data_2KWI
# 
_entry.id   2KWI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KWI         pdb_00002kwi 10.2210/pdb2kwi/pdb 
RCSB  RCSB101660   ?            ?                   
WWPDB D_1000101660 ?            ?                   
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 15525 BMRB . 
unspecified 15803 BMRB . 
unspecified 2kwh  PDB  . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KWI 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-12 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fenwick, R.B.'   1 
'Campbell, L.J.'  2 
'Rajasekar, K.'   3 
'Prasannan, S.'   4 
'Nietlispach, D.' 5 
'Camonis, J.'     6 
'Owen, D.'        7 
'Mott, H.R.'      8 
# 
_citation.id                        primary 
_citation.title                     'The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            18 
_citation.page_first                985 
_citation.page_last                 995 
_citation.year                      2010 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20696399 
_citation.pdbx_database_id_DOI      10.1016/j.str.2010.05.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fenwick, R.B.'   1 ? 
primary 'Campbell, L.J.'  2 ? 
primary 'Rajasekar, K.'   3 ? 
primary 'Prasannan, S.'   4 ? 
primary 'Nietlispach, D.' 5 ? 
primary 'Camonis, J.'     6 ? 
primary 'Owen, D.'        7 ? 
primary 'Mott, H.R.'      8 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein Ral-B'                   20265.801 1 ? Q72L  'UNP residues 8-185'   ? 
2 polymer     man 'RalA-binding protein 1'                      6600.567  1 ? C411S 'UNP residues 393-446' ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   1 ? ?     ?                      ? 
4 non-polymer syn 'MAGNESIUM ION'                               24.305    1 ? ?     ?                      ? 
5 water       nat water                                         18.015    2 ? ?     ?                      ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
'RalBP1, Ral-interacting protein 1, 76 kDa Ral-interacting protein, Dinitrophenyl S-glutathione ATPase, DNP-SG ATPase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGE
GFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDK
VFFDLMREIRTKKMSENK
;
;GQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGE
GFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDK
VFFDLMREIRTKKMSENK
;
A ? 
2 'polypeptide(L)' no no GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA 
GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLN n 
1 3   SER n 
1 4   SER n 
1 5   LEU n 
1 6   ALA n 
1 7   LEU n 
1 8   HIS n 
1 9   LYS n 
1 10  VAL n 
1 11  ILE n 
1 12  MET n 
1 13  VAL n 
1 14  GLY n 
1 15  SER n 
1 16  GLY n 
1 17  GLY n 
1 18  VAL n 
1 19  GLY n 
1 20  LYS n 
1 21  SER n 
1 22  ALA n 
1 23  LEU n 
1 24  THR n 
1 25  LEU n 
1 26  GLN n 
1 27  PHE n 
1 28  MET n 
1 29  TYR n 
1 30  ASP n 
1 31  GLU n 
1 32  PHE n 
1 33  VAL n 
1 34  GLU n 
1 35  ASP n 
1 36  TYR n 
1 37  GLU n 
1 38  PRO n 
1 39  THR n 
1 40  LYS n 
1 41  ALA n 
1 42  ASP n 
1 43  SER n 
1 44  TYR n 
1 45  ARG n 
1 46  LYS n 
1 47  LYS n 
1 48  VAL n 
1 49  VAL n 
1 50  LEU n 
1 51  ASP n 
1 52  GLY n 
1 53  GLU n 
1 54  GLU n 
1 55  VAL n 
1 56  GLN n 
1 57  ILE n 
1 58  ASP n 
1 59  ILE n 
1 60  LEU n 
1 61  ASP n 
1 62  THR n 
1 63  ALA n 
1 64  GLY n 
1 65  LEU n 
1 66  GLU n 
1 67  ASP n 
1 68  TYR n 
1 69  ALA n 
1 70  ALA n 
1 71  ILE n 
1 72  ARG n 
1 73  ASP n 
1 74  ASN n 
1 75  TYR n 
1 76  PHE n 
1 77  ARG n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  GLY n 
1 82  PHE n 
1 83  LEU n 
1 84  LEU n 
1 85  VAL n 
1 86  PHE n 
1 87  SER n 
1 88  ILE n 
1 89  THR n 
1 90  GLU n 
1 91  HIS n 
1 92  GLU n 
1 93  SER n 
1 94  PHE n 
1 95  THR n 
1 96  ALA n 
1 97  THR n 
1 98  ALA n 
1 99  GLU n 
1 100 PHE n 
1 101 ARG n 
1 102 GLU n 
1 103 GLN n 
1 104 ILE n 
1 105 LEU n 
1 106 ARG n 
1 107 VAL n 
1 108 LYS n 
1 109 ALA n 
1 110 GLU n 
1 111 GLU n 
1 112 ASP n 
1 113 LYS n 
1 114 ILE n 
1 115 PRO n 
1 116 LEU n 
1 117 LEU n 
1 118 VAL n 
1 119 VAL n 
1 120 GLY n 
1 121 ASN n 
1 122 LYS n 
1 123 SER n 
1 124 ASP n 
1 125 LEU n 
1 126 GLU n 
1 127 GLU n 
1 128 ARG n 
1 129 ARG n 
1 130 GLN n 
1 131 VAL n 
1 132 PRO n 
1 133 VAL n 
1 134 GLU n 
1 135 GLU n 
1 136 ALA n 
1 137 ARG n 
1 138 SER n 
1 139 LYS n 
1 140 ALA n 
1 141 GLU n 
1 142 GLU n 
1 143 TRP n 
1 144 GLY n 
1 145 VAL n 
1 146 GLN n 
1 147 TYR n 
1 148 VAL n 
1 149 GLU n 
1 150 THR n 
1 151 SER n 
1 152 ALA n 
1 153 LYS n 
1 154 THR n 
1 155 ARG n 
1 156 ALA n 
1 157 ASN n 
1 158 VAL n 
1 159 ASP n 
1 160 LYS n 
1 161 VAL n 
1 162 PHE n 
1 163 PHE n 
1 164 ASP n 
1 165 LEU n 
1 166 MET n 
1 167 ARG n 
1 168 GLU n 
1 169 ILE n 
1 170 ARG n 
1 171 THR n 
1 172 LYS n 
1 173 LYS n 
1 174 MET n 
1 175 SER n 
1 176 GLU n 
1 177 ASN n 
1 178 LYS n 
2 1   GLY n 
2 2   SER n 
2 3   GLU n 
2 4   THR n 
2 5   GLN n 
2 6   ALA n 
2 7   GLY n 
2 8   ILE n 
2 9   LYS n 
2 10  GLU n 
2 11  GLU n 
2 12  ILE n 
2 13  ARG n 
2 14  ARG n 
2 15  GLN n 
2 16  GLU n 
2 17  PHE n 
2 18  LEU n 
2 19  LEU n 
2 20  ASN n 
2 21  SER n 
2 22  LEU n 
2 23  HIS n 
2 24  ARG n 
2 25  ASP n 
2 26  LEU n 
2 27  GLN n 
2 28  GLY n 
2 29  GLY n 
2 30  ILE n 
2 31  LYS n 
2 32  ASP n 
2 33  LEU n 
2 34  SER n 
2 35  LYS n 
2 36  GLU n 
2 37  GLU n 
2 38  ARG n 
2 39  LEU n 
2 40  TRP n 
2 41  GLU n 
2 42  VAL n 
2 43  GLN n 
2 44  ARG n 
2 45  ILE n 
2 46  LEU n 
2 47  THR n 
2 48  ALA n 
2 49  LEU n 
2 50  LYS n 
2 51  ARG n 
2 52  LYS n 
2 53  LEU n 
2 54  ARG n 
2 55  GLU n 
2 56  ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? RALB                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? pET16b ? ? ? ? ? 
2 1 sample ? ? ? human ? 'RALBP1, RLIP1, RLIP76' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? pGEX2t ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RALB_HUMAN P11234 1 
;GQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGE
GFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDK
VFFDLMREIRTKKMSENK
;
8   ? 
2 UNP RBP1_HUMAN Q15311 2 ETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA 393 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KWI A 1 ? 178 ? P11234 8   ? 185 ? 8   185 
2 2 2KWI B 3 ? 56  ? Q15311 393 ? 446 ? 393 446 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KWI LEU A 65 ? UNP P11234 GLN 72  'engineered mutation' 72  1 
2 2KWI GLY B 1  ? UNP Q15311 ?   ?   'expression tag'      391 2 
2 2KWI SER B 2  ? UNP Q15311 ?   ?   'expression tag'      392 3 
2 2KWI SER B 21 ? UNP Q15311 CYS 411 'engineered mutation' 411 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ? 'C10 H17 N6 O13 P3' 522.196 
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '3D HNCA'         
1 3  1 '3D HNCO'         
1 4  1 '3D HN(CO)CA'     
1 5  1 '3D HNCACB'       
1 6  1 '3D CBCA(CO)NH'   
1 7  1 '3D H(CCO)NH'     
1 8  1 '2D 1H-13C HSQC'  
1 9  1 '3D HCCH-TOCSY'   
1 10 2 '3D 1H-15N NOESY' 
1 11 1 '3D 1H-13C NOESY' 
1 12 4 '2D 1H-15N HSQC'  
1 13 4 '3D HNCA'         
1 14 4 '3D HNCO'         
1 15 4 '3D HN(CO)CA'     
1 16 4 '3D HNCACB'       
1 17 4 '3D CBCA(CO)NH'   
1 18 4 '3D H(CCO)NH'     
1 19 4 '2D 1H-13C HSQC'  
1 20 4 '3D HCCH-TOCSY'   
1 21 4 '3D HBHA(CO)NH'   
1 22 3 '3D 1H-15N NOESY' 
1 23 4 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.15 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;50 mM sodium phosphate-1, 100 mM potassium chloride-2, 1 mM Magnesium chloride-3, 0.05 % sodium azide-4, 0.8 mM [U-99% 13C; U-99% 15N] RalB-5, 0.8 mM RLIP76-6, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;50 mM sodium phosphate-7, 100 mM potassium chloride-8, 1 mM Magnesium chloride-9, 0.05 % sodium azide-10, 0.8 mM [U-99% 15N] RalB-11, 0.8 mM RLIP76-12, 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
;50 mM sodium phosphate-13, 100 mM potassium chloride-14, 1 mM Magnesium chloride-15, 0.05 % sodium azide-16, 0.8 mM [U-99% 13C; U-99% 15N] RLIP76-17, 0.8 mM RalB-18, 90% H2O/10% D2O
;
3 '90% H2O/10% D2O' 
;50 mM sodium phosphate-19, 100 mM potassium chloride-20, 1 mM Magnesium chloride-21, 0.05 % sodium azide-22, 0.8 mM [U-99% 15N] RLIP76-23, 0.8 mM RalB-24, 90% H2O/10% D2O
;
4 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker DRX 1 'Bruker DRX' 
800 Bruker DRX 2 'Bruker DRX' 
# 
_pdbx_nmr_refine.entry_id           2KWI 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             51 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KWI 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KWI 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Boucher                                        processing                  Azara    ? 1 
CCPN                                           'chemical shift assignment' Analysis ? 2 
;Linge, O'Donoghue and Nilges
;
'data analysis'             ARIA     ? 3 
'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution'        CNS      ? 4 
'Brunger, Adams, Clore, Gros, Nilges and Read' refinement                  CNS      ? 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KWI 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KWI 
_struct.title                     'RalB-RLIP76 (RalBP1) complex' 
_struct.pdbx_model_details        'closest to the average, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KWI 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN, PROTEIN BINDING' 
_struct_keywords.text            'TRANSPORT PROTEIN, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 21  ? ASP A 30  ? SER A 28  ASP A 37  1 ? 10 
HELX_P HELX_P2 2 TYR A 68  ? ASP A 73  ? TYR A 75  ASP A 80  1 ? 6  
HELX_P HELX_P3 3 GLU A 90  ? LYS A 108 ? GLU A 97  LYS A 115 1 ? 19 
HELX_P HELX_P4 4 PRO A 132 ? GLY A 144 ? PRO A 139 GLY A 151 1 ? 13 
HELX_P HELX_P5 5 ASN A 157 ? SER A 175 ? ASN A 164 SER A 182 1 ? 19 
HELX_P HELX_P6 6 SER B 2   ? GLY B 28  ? SER B 392 GLY B 418 1 ? 27 
HELX_P HELX_P7 7 ASP B 32  ? ALA B 56  ? ASP B 422 ALA B 446 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 45  ? LEU A 50  ? ARG A 52  LEU A 57  
A 2 GLU A 53  ? ASP A 61  ? GLU A 60  ASP A 68  
A 3 LEU A 7   ? VAL A 13  ? LEU A 14  VAL A 20  
A 4 GLY A 81  ? SER A 87  ? GLY A 88  SER A 94  
A 5 LEU A 116 ? ASN A 121 ? LEU A 123 ASN A 128 
A 6 TYR A 147 ? GLU A 149 ? TYR A 154 GLU A 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 48  ? N VAL A 55  O VAL A 55  ? O VAL A 62  
A 2 3 O ASP A 58  ? O ASP A 65  N HIS A 8   ? N HIS A 15  
A 3 4 N ILE A 11  ? N ILE A 18  O LEU A 83  ? O LEU A 90  
A 4 5 N LEU A 84  ? N LEU A 91  O VAL A 119 ? O VAL A 126 
A 5 6 N GLY A 120 ? N GLY A 127 O VAL A 148 ? O VAL A 155 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GNP 500 ? 16 'BINDING SITE FOR RESIDUE GNP A 500' 
AC2 Software A MG  501 ? 6  'BINDING SITE FOR RESIDUE MG A 501'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 GLY A 17  ? GLY A 24  . ? 1_555 ? 
2  AC1 16 GLY A 19  ? GLY A 26  . ? 1_555 ? 
3  AC1 16 SER A 21  ? SER A 28  . ? 1_555 ? 
4  AC1 16 ALA A 22  ? ALA A 29  . ? 1_555 ? 
5  AC1 16 PHE A 32  ? PHE A 39  . ? 1_555 ? 
6  AC1 16 GLU A 37  ? GLU A 44  . ? 1_555 ? 
7  AC1 16 PRO A 38  ? PRO A 45  . ? 1_555 ? 
8  AC1 16 THR A 39  ? THR A 46  . ? 1_555 ? 
9  AC1 16 ASN A 121 ? ASN A 128 . ? 1_555 ? 
10 AC1 16 LYS A 122 ? LYS A 129 . ? 1_555 ? 
11 AC1 16 ASP A 124 ? ASP A 131 . ? 1_555 ? 
12 AC1 16 SER A 151 ? SER A 158 . ? 1_555 ? 
13 AC1 16 ALA A 152 ? ALA A 159 . ? 1_555 ? 
14 AC1 16 LYS A 153 ? LYS A 160 . ? 1_555 ? 
15 AC1 16 MG  D .   ? MG  A 501 . ? 1_555 ? 
16 AC1 16 HOH E .   ? HOH A 503 . ? 1_555 ? 
17 AC2 6  SER A 21  ? SER A 28  . ? 1_555 ? 
18 AC2 6  THR A 39  ? THR A 46  . ? 1_555 ? 
19 AC2 6  ASP A 61  ? ASP A 68  . ? 1_555 ? 
20 AC2 6  GNP C .   ? GNP A 500 . ? 1_555 ? 
21 AC2 6  HOH E .   ? HOH A 502 . ? 1_555 ? 
22 AC2 6  HOH E .   ? HOH A 503 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KWI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N  N      . GLY A 1 1   ? 5.371   17.248  -19.432 1.00 0.00 ? 8   GLY A N      1  
ATOM   2      C  CA     . GLY A 1 1   ? 6.078   16.132  -18.765 1.00 0.00 ? 8   GLY A CA     1  
ATOM   3      C  C      . GLY A 1 1   ? 5.122   15.054  -18.313 1.00 0.00 ? 8   GLY A C      1  
ATOM   4      O  O      . GLY A 1 1   ? 4.001   15.349  -17.900 1.00 0.00 ? 8   GLY A O      1  
ATOM   5      H  H1     . GLY A 1 1   ? 4.861   16.898  -20.273 1.00 0.00 ? 8   GLY A H1     1  
ATOM   6      H  H2     . GLY A 1 1   ? 6.050   17.980  -19.728 1.00 0.00 ? 8   GLY A H2     1  
ATOM   7      H  H3     . GLY A 1 1   ? 4.683   17.675  -18.775 1.00 0.00 ? 8   GLY A H3     1  
ATOM   8      H  HA2    . GLY A 1 1   ? 6.791   15.705  -19.455 1.00 0.00 ? 8   GLY A HA2    1  
ATOM   9      H  HA3    . GLY A 1 1   ? 6.608   16.518  -17.905 1.00 0.00 ? 8   GLY A HA3    1  
ATOM   10     N  N      . GLN A 1 2   ? 5.547   13.801  -18.403 1.00 0.00 ? 9   GLN A N      1  
ATOM   11     C  CA     . GLN A 1 2   ? 4.715   12.688  -17.969 1.00 0.00 ? 9   GLN A CA     1  
ATOM   12     C  C      . GLN A 1 2   ? 5.481   11.773  -17.021 1.00 0.00 ? 9   GLN A C      1  
ATOM   13     O  O      . GLN A 1 2   ? 5.011   10.691  -16.672 1.00 0.00 ? 9   GLN A O      1  
ATOM   14     C  CB     . GLN A 1 2   ? 4.207   11.888  -19.172 1.00 0.00 ? 9   GLN A CB     1  
ATOM   15     C  CG     . GLN A 1 2   ? 3.307   12.685  -20.104 1.00 0.00 ? 9   GLN A CG     1  
ATOM   16     C  CD     . GLN A 1 2   ? 2.714   11.834  -21.206 1.00 0.00 ? 9   GLN A CD     1  
ATOM   17     O  OE1    . GLN A 1 2   ? 3.296   11.695  -22.279 1.00 0.00 ? 9   GLN A OE1    1  
ATOM   18     N  NE2    . GLN A 1 2   ? 1.550   11.263  -20.948 1.00 0.00 ? 9   GLN A NE2    1  
ATOM   19     H  H      . GLN A 1 2   ? 6.444   13.620  -18.777 1.00 0.00 ? 9   GLN A H      1  
ATOM   20     H  HA     . GLN A 1 2   ? 3.868   13.099  -17.440 1.00 0.00 ? 9   GLN A HA     1  
ATOM   21     H  HB2    . GLN A 1 2   ? 5.057   11.538  -19.739 1.00 0.00 ? 9   GLN A HB2    1  
ATOM   22     H  HB3    . GLN A 1 2   ? 3.651   11.037  -18.811 1.00 0.00 ? 9   GLN A HB3    1  
ATOM   23     H  HG2    . GLN A 1 2   ? 2.500   13.115  -19.528 1.00 0.00 ? 9   GLN A HG2    1  
ATOM   24     H  HG3    . GLN A 1 2   ? 3.888   13.477  -20.554 1.00 0.00 ? 9   GLN A HG3    1  
ATOM   25     H  HE21   . GLN A 1 2   ? 1.143   11.423  -20.074 1.00 0.00 ? 9   GLN A HE21   1  
ATOM   26     H  HE22   . GLN A 1 2   ? 1.145   10.691  -21.645 1.00 0.00 ? 9   GLN A HE22   1  
ATOM   27     N  N      . SER A 1 3   ? 6.652   12.220  -16.586 1.00 0.00 ? 10  SER A N      1  
ATOM   28     C  CA     . SER A 1 3   ? 7.481   11.429  -15.686 1.00 0.00 ? 10  SER A CA     1  
ATOM   29     C  C      . SER A 1 3   ? 6.824   11.284  -14.316 1.00 0.00 ? 10  SER A C      1  
ATOM   30     O  O      . SER A 1 3   ? 7.102   10.338  -13.580 1.00 0.00 ? 10  SER A O      1  
ATOM   31     C  CB     . SER A 1 3   ? 8.864   12.062  -15.553 1.00 0.00 ? 10  SER A CB     1  
ATOM   32     O  OG     . SER A 1 3   ? 9.492   12.163  -16.819 1.00 0.00 ? 10  SER A OG     1  
ATOM   33     H  H      . SER A 1 3   ? 6.969   13.102  -16.880 1.00 0.00 ? 10  SER A H      1  
ATOM   34     H  HA     . SER A 1 3   ? 7.590   10.446  -16.121 1.00 0.00 ? 10  SER A HA     1  
ATOM   35     H  HB2    . SER A 1 3   ? 8.767   13.052  -15.133 1.00 0.00 ? 10  SER A HB2    1  
ATOM   36     H  HB3    . SER A 1 3   ? 9.478   11.455  -14.905 1.00 0.00 ? 10  SER A HB3    1  
ATOM   37     H  HG     . SER A 1 3   ? 9.197   11.433  -17.382 1.00 0.00 ? 10  SER A HG     1  
ATOM   38     N  N      . SER A 1 4   ? 5.933   12.213  -13.990 1.00 0.00 ? 11  SER A N      1  
ATOM   39     C  CA     . SER A 1 4   ? 5.205   12.155  -12.733 1.00 0.00 ? 11  SER A CA     1  
ATOM   40     C  C      . SER A 1 4   ? 3.932   11.333  -12.886 1.00 0.00 ? 11  SER A C      1  
ATOM   41     O  O      . SER A 1 4   ? 3.142   11.195  -11.955 1.00 0.00 ? 11  SER A O      1  
ATOM   42     C  CB     . SER A 1 4   ? 4.880   13.569  -12.251 1.00 0.00 ? 11  SER A CB     1  
ATOM   43     O  OG     . SER A 1 4   ? 6.055   14.361  -12.179 1.00 0.00 ? 11  SER A OG     1  
ATOM   44     H  H      . SER A 1 4   ? 5.769   12.957  -14.602 1.00 0.00 ? 11  SER A H      1  
ATOM   45     H  HA     . SER A 1 4   ? 5.839   11.671  -12.014 1.00 0.00 ? 11  SER A HA     1  
ATOM   46     H  HB2    . SER A 1 4   ? 4.188   14.033  -12.938 1.00 0.00 ? 11  SER A HB2    1  
ATOM   47     H  HB3    . SER A 1 4   ? 4.434   13.519  -11.268 1.00 0.00 ? 11  SER A HB3    1  
ATOM   48     H  HG     . SER A 1 4   ? 5.842   15.273  -12.436 1.00 0.00 ? 11  SER A HG     1  
ATOM   49     N  N      . LEU A 1 5   ? 3.755   10.774  -14.070 1.00 0.00 ? 12  LEU A N      1  
ATOM   50     C  CA     . LEU A 1 5   ? 2.587   9.958   -14.369 1.00 0.00 ? 12  LEU A CA     1  
ATOM   51     C  C      . LEU A 1 5   ? 2.976   8.495   -14.482 1.00 0.00 ? 12  LEU A C      1  
ATOM   52     O  O      . LEU A 1 5   ? 2.153   7.606   -14.258 1.00 0.00 ? 12  LEU A O      1  
ATOM   53     C  CB     . LEU A 1 5   ? 1.926   10.417  -15.665 1.00 0.00 ? 12  LEU A CB     1  
ATOM   54     C  CG     . LEU A 1 5   ? 1.424   11.860  -15.659 1.00 0.00 ? 12  LEU A CG     1  
ATOM   55     C  CD1    . LEU A 1 5   ? 0.829   12.218  -17.007 1.00 0.00 ? 12  LEU A CD1    1  
ATOM   56     C  CD2    . LEU A 1 5   ? 0.394   12.061  -14.560 1.00 0.00 ? 12  LEU A CD2    1  
ATOM   57     H  H      . LEU A 1 5   ? 4.436   10.912  -14.758 1.00 0.00 ? 12  LEU A H      1  
ATOM   58     H  HA     . LEU A 1 5   ? 1.885   10.071  -13.558 1.00 0.00 ? 12  LEU A HA     1  
ATOM   59     H  HB2    . LEU A 1 5   ? 2.643   10.309  -16.467 1.00 0.00 ? 12  LEU A HB2    1  
ATOM   60     H  HB3    . LEU A 1 5   ? 1.086   9.769   -15.866 1.00 0.00 ? 12  LEU A HB3    1  
ATOM   61     H  HG     . LEU A 1 5   ? 2.254   12.526  -15.470 1.00 0.00 ? 12  LEU A HG     1  
ATOM   62     H  HD11   . LEU A 1 5   ? 0.015   11.546  -17.230 1.00 0.00 ? 12  LEU A HD11   1  
ATOM   63     H  HD12   . LEU A 1 5   ? 1.588   12.132  -17.772 1.00 0.00 ? 12  LEU A HD12   1  
ATOM   64     H  HD13   . LEU A 1 5   ? 0.459   13.232  -16.978 1.00 0.00 ? 12  LEU A HD13   1  
ATOM   65     H  HD21   . LEU A 1 5   ? -0.435  11.386  -14.715 1.00 0.00 ? 12  LEU A HD21   1  
ATOM   66     H  HD22   . LEU A 1 5   ? 0.037   13.081  -14.584 1.00 0.00 ? 12  LEU A HD22   1  
ATOM   67     H  HD23   . LEU A 1 5   ? 0.846   11.860  -13.601 1.00 0.00 ? 12  LEU A HD23   1  
ATOM   68     N  N      . ALA A 1 6   ? 4.239   8.250   -14.813 1.00 0.00 ? 13  ALA A N      1  
ATOM   69     C  CA     . ALA A 1 6   ? 4.735   6.891   -14.965 1.00 0.00 ? 13  ALA A CA     1  
ATOM   70     C  C      . ALA A 1 6   ? 5.155   6.321   -13.621 1.00 0.00 ? 13  ALA A C      1  
ATOM   71     O  O      . ALA A 1 6   ? 5.620   5.184   -13.522 1.00 0.00 ? 13  ALA A O      1  
ATOM   72     C  CB     . ALA A 1 6   ? 5.887   6.845   -15.959 1.00 0.00 ? 13  ALA A CB     1  
ATOM   73     H  H      . ALA A 1 6   ? 4.850   9.001   -14.962 1.00 0.00 ? 13  ALA A H      1  
ATOM   74     H  HA     . ALA A 1 6   ? 3.928   6.295   -15.351 1.00 0.00 ? 13  ALA A HA     1  
ATOM   75     H  HB1    . ALA A 1 6   ? 6.721   7.411   -15.569 1.00 0.00 ? 13  ALA A HB1    1  
ATOM   76     H  HB2    . ALA A 1 6   ? 5.570   7.270   -16.898 1.00 0.00 ? 13  ALA A HB2    1  
ATOM   77     H  HB3    . ALA A 1 6   ? 6.187   5.819   -16.111 1.00 0.00 ? 13  ALA A HB3    1  
ATOM   78     N  N      . LEU A 1 7   ? 4.951   7.113   -12.589 1.00 0.00 ? 14  LEU A N      1  
ATOM   79     C  CA     . LEU A 1 7   ? 5.297   6.724   -11.235 1.00 0.00 ? 14  LEU A CA     1  
ATOM   80     C  C      . LEU A 1 7   ? 4.067   6.852   -10.347 1.00 0.00 ? 14  LEU A C      1  
ATOM   81     O  O      . LEU A 1 7   ? 3.438   7.909   -10.293 1.00 0.00 ? 14  LEU A O      1  
ATOM   82     C  CB     . LEU A 1 7   ? 6.443   7.594   -10.704 1.00 0.00 ? 14  LEU A CB     1  
ATOM   83     C  CG     . LEU A 1 7   ? 6.983   7.192   -9.329  1.00 0.00 ? 14  LEU A CG     1  
ATOM   84     C  CD1    . LEU A 1 7   ? 7.549   5.779   -9.366  1.00 0.00 ? 14  LEU A CD1    1  
ATOM   85     C  CD2    . LEU A 1 7   ? 8.045   8.176   -8.863  1.00 0.00 ? 14  LEU A CD2    1  
ATOM   86     H  H      . LEU A 1 7   ? 4.532   7.982   -12.745 1.00 0.00 ? 14  LEU A H      1  
ATOM   87     H  HA     . LEU A 1 7   ? 5.613   5.691   -11.253 1.00 0.00 ? 14  LEU A HA     1  
ATOM   88     H  HB2    . LEU A 1 7   ? 7.258   7.551   -11.413 1.00 0.00 ? 14  LEU A HB2    1  
ATOM   89     H  HB3    . LEU A 1 7   ? 6.096   8.614   -10.644 1.00 0.00 ? 14  LEU A HB3    1  
ATOM   90     H  HG     . LEU A 1 7   ? 6.175   7.207   -8.615  1.00 0.00 ? 14  LEU A HG     1  
ATOM   91     H  HD11   . LEU A 1 7   ? 7.925   5.516   -8.389  1.00 0.00 ? 14  LEU A HD11   1  
ATOM   92     H  HD12   . LEU A 1 7   ? 8.354   5.731   -10.084 1.00 0.00 ? 14  LEU A HD12   1  
ATOM   93     H  HD13   . LEU A 1 7   ? 6.770   5.087   -9.652  1.00 0.00 ? 14  LEU A HD13   1  
ATOM   94     H  HD21   . LEU A 1 7   ? 8.871   8.172   -9.558  1.00 0.00 ? 14  LEU A HD21   1  
ATOM   95     H  HD22   . LEU A 1 7   ? 8.398   7.886   -7.884  1.00 0.00 ? 14  LEU A HD22   1  
ATOM   96     H  HD23   . LEU A 1 7   ? 7.621   9.168   -8.814  1.00 0.00 ? 14  LEU A HD23   1  
ATOM   97     N  N      . HIS A 1 8   ? 3.701   5.771   -9.678  1.00 0.00 ? 15  HIS A N      1  
ATOM   98     C  CA     . HIS A 1 8   ? 2.514   5.775   -8.835  1.00 0.00 ? 15  HIS A CA     1  
ATOM   99     C  C      . HIS A 1 8   ? 2.865   5.366   -7.411  1.00 0.00 ? 15  HIS A C      1  
ATOM   100    O  O      . HIS A 1 8   ? 3.661   4.457   -7.205  1.00 0.00 ? 15  HIS A O      1  
ATOM   101    C  CB     . HIS A 1 8   ? 1.447   4.831   -9.403  1.00 0.00 ? 15  HIS A CB     1  
ATOM   102    C  CG     . HIS A 1 8   ? 1.019   5.166   -10.802 1.00 0.00 ? 15  HIS A CG     1  
ATOM   103    N  ND1    . HIS A 1 8   ? 0.292   6.294   -11.125 1.00 0.00 ? 15  HIS A ND1    1  
ATOM   104    C  CD2    . HIS A 1 8   ? 1.225   4.510   -11.970 1.00 0.00 ? 15  HIS A CD2    1  
ATOM   105    C  CE1    . HIS A 1 8   ? 0.071   6.315   -12.426 1.00 0.00 ? 15  HIS A CE1    1  
ATOM   106    N  NE2    . HIS A 1 8   ? 0.625   5.245   -12.960 1.00 0.00 ? 15  HIS A NE2    1  
ATOM   107    H  H      . HIS A 1 8   ? 4.242   4.952   -9.748  1.00 0.00 ? 15  HIS A H      1  
ATOM   108    H  HA     . HIS A 1 8   ? 2.120   6.781   -8.822  1.00 0.00 ? 15  HIS A HA     1  
ATOM   109    H  HB2    . HIS A 1 8   ? 1.837   3.825   -9.410  1.00 0.00 ? 15  HIS A HB2    1  
ATOM   110    H  HB3    . HIS A 1 8   ? 0.571   4.867   -8.769  1.00 0.00 ? 15  HIS A HB3    1  
ATOM   111    H  HD1    . HIS A 1 8   ? -0.011  6.983   -10.495 1.00 0.00 ? 15  HIS A HD1    1  
ATOM   112    H  HD2    . HIS A 1 8   ? 1.759   3.580   -12.096 1.00 0.00 ? 15  HIS A HD2    1  
ATOM   113    H  HE1    . HIS A 1 8   ? -0.470  7.080   -12.964 1.00 0.00 ? 15  HIS A HE1    1  
ATOM   114    H  HE2    . HIS A 1 8   ? 0.686   5.063   -13.930 1.00 0.00 ? 15  HIS A HE2    1  
ATOM   115    N  N      . LYS A 1 9   ? 2.276   6.053   -6.439  1.00 0.00 ? 16  LYS A N      1  
ATOM   116    C  CA     . LYS A 1 9   ? 2.500   5.747   -5.029  1.00 0.00 ? 16  LYS A CA     1  
ATOM   117    C  C      . LYS A 1 9   ? 1.189   5.333   -4.373  1.00 0.00 ? 16  LYS A C      1  
ATOM   118    O  O      . LYS A 1 9   ? 0.252   6.131   -4.299  1.00 0.00 ? 16  LYS A O      1  
ATOM   119    C  CB     . LYS A 1 9   ? 3.077   6.969   -4.313  1.00 0.00 ? 16  LYS A CB     1  
ATOM   120    C  CG     . LYS A 1 9   ? 4.337   7.506   -4.966  1.00 0.00 ? 16  LYS A CG     1  
ATOM   121    C  CD     . LYS A 1 9   ? 5.522   6.576   -4.764  1.00 0.00 ? 16  LYS A CD     1  
ATOM   122    C  CE     . LYS A 1 9   ? 6.667   6.925   -5.701  1.00 0.00 ? 16  LYS A CE     1  
ATOM   123    N  NZ     . LYS A 1 9   ? 7.939   6.271   -5.302  1.00 0.00 ? 16  LYS A NZ     1  
ATOM   124    H  H      . LYS A 1 9   ? 1.676   6.791   -6.672  1.00 0.00 ? 16  LYS A H      1  
ATOM   125    H  HA     . LYS A 1 9   ? 3.202   4.930   -4.966  1.00 0.00 ? 16  LYS A HA     1  
ATOM   126    H  HB2    . LYS A 1 9   ? 2.335   7.754   -4.310  1.00 0.00 ? 16  LYS A HB2    1  
ATOM   127    H  HB3    . LYS A 1 9   ? 3.311   6.702   -3.293  1.00 0.00 ? 16  LYS A HB3    1  
ATOM   128    H  HG2    . LYS A 1 9   ? 4.159   7.613   -6.025  1.00 0.00 ? 16  LYS A HG2    1  
ATOM   129    H  HG3    . LYS A 1 9   ? 4.569   8.471   -4.540  1.00 0.00 ? 16  LYS A HG3    1  
ATOM   130    H  HD2    . LYS A 1 9   ? 5.863   6.658   -3.742  1.00 0.00 ? 16  LYS A HD2    1  
ATOM   131    H  HD3    . LYS A 1 9   ? 5.205   5.561   -4.960  1.00 0.00 ? 16  LYS A HD3    1  
ATOM   132    H  HE2    . LYS A 1 9   ? 6.409   6.600   -6.697  1.00 0.00 ? 16  LYS A HE2    1  
ATOM   133    H  HE3    . LYS A 1 9   ? 6.806   7.997   -5.698  1.00 0.00 ? 16  LYS A HE3    1  
ATOM   134    H  HZ1    . LYS A 1 9   ? 7.750   5.320   -4.908  1.00 0.00 ? 16  LYS A HZ1    1  
ATOM   135    H  HZ2    . LYS A 1 9   ? 8.423   6.843   -4.581  1.00 0.00 ? 16  LYS A HZ2    1  
ATOM   136    H  HZ3    . LYS A 1 9   ? 8.570   6.175   -6.126  1.00 0.00 ? 16  LYS A HZ3    1  
ATOM   137    N  N      . VAL A 1 10  ? 1.121   4.092   -3.910  1.00 0.00 ? 17  VAL A N      1  
ATOM   138    C  CA     . VAL A 1 10  ? -0.107  3.558   -3.336  1.00 0.00 ? 17  VAL A CA     1  
ATOM   139    C  C      . VAL A 1 10  ? 0.153   2.915   -1.977  1.00 0.00 ? 17  VAL A C      1  
ATOM   140    O  O      . VAL A 1 10  ? 0.959   1.991   -1.855  1.00 0.00 ? 17  VAL A O      1  
ATOM   141    C  CB     . VAL A 1 10  ? -0.764  2.517   -4.272  1.00 0.00 ? 17  VAL A CB     1  
ATOM   142    C  CG1    . VAL A 1 10  ? -2.023  1.936   -3.647  1.00 0.00 ? 17  VAL A CG1    1  
ATOM   143    C  CG2    . VAL A 1 10  ? -1.081  3.135   -5.627  1.00 0.00 ? 17  VAL A CG2    1  
ATOM   144    H  H      . VAL A 1 10  ? 1.923   3.519   -3.945  1.00 0.00 ? 17  VAL A H      1  
ATOM   145    H  HA     . VAL A 1 10  ? -0.797  4.377   -3.206  1.00 0.00 ? 17  VAL A HA     1  
ATOM   146    H  HB     . VAL A 1 10  ? -0.063  1.710   -4.426  1.00 0.00 ? 17  VAL A HB     1  
ATOM   147    H  HG11   . VAL A 1 10  ? -1.773  1.452   -2.715  1.00 0.00 ? 17  VAL A HG11   1  
ATOM   148    H  HG12   . VAL A 1 10  ? -2.459  1.214   -4.321  1.00 0.00 ? 17  VAL A HG12   1  
ATOM   149    H  HG13   . VAL A 1 10  ? -2.732  2.728   -3.461  1.00 0.00 ? 17  VAL A HG13   1  
ATOM   150    H  HG21   . VAL A 1 10  ? -0.166  3.481   -6.086  1.00 0.00 ? 17  VAL A HG21   1  
ATOM   151    H  HG22   . VAL A 1 10  ? -1.756  3.968   -5.495  1.00 0.00 ? 17  VAL A HG22   1  
ATOM   152    H  HG23   . VAL A 1 10  ? -1.545  2.393   -6.261  1.00 0.00 ? 17  VAL A HG23   1  
ATOM   153    N  N      . ILE A 1 11  ? -0.533  3.412   -0.958  1.00 0.00 ? 18  ILE A N      1  
ATOM   154    C  CA     . ILE A 1 11  ? -0.423  2.857   0.384   1.00 0.00 ? 18  ILE A CA     1  
ATOM   155    C  C      . ILE A 1 11  ? -1.668  2.040   0.717   1.00 0.00 ? 18  ILE A C      1  
ATOM   156    O  O      . ILE A 1 11  ? -2.794  2.496   0.503   1.00 0.00 ? 18  ILE A O      1  
ATOM   157    C  CB     . ILE A 1 11  ? -0.240  3.967   1.442   1.00 0.00 ? 18  ILE A CB     1  
ATOM   158    C  CG1    . ILE A 1 11  ? 0.954   4.855   1.077   1.00 0.00 ? 18  ILE A CG1    1  
ATOM   159    C  CG2    . ILE A 1 11  ? -0.049  3.358   2.827   1.00 0.00 ? 18  ILE A CG2    1  
ATOM   160    C  CD1    . ILE A 1 11  ? 1.166   6.014   2.028   1.00 0.00 ? 18  ILE A CD1    1  
ATOM   161    H  H      . ILE A 1 11  ? -1.135  4.173   -1.114  1.00 0.00 ? 18  ILE A H      1  
ATOM   162    H  HA     . ILE A 1 11  ? 0.442   2.210   0.409   1.00 0.00 ? 18  ILE A HA     1  
ATOM   163    H  HB     . ILE A 1 11  ? -1.136  4.568   1.459   1.00 0.00 ? 18  ILE A HB     1  
ATOM   164    H  HG12   . ILE A 1 11  ? 1.852   4.256   1.081   1.00 0.00 ? 18  ILE A HG12   1  
ATOM   165    H  HG13   . ILE A 1 11  ? 0.801   5.260   0.088   1.00 0.00 ? 18  ILE A HG13   1  
ATOM   166    H  HG21   . ILE A 1 11  ? -0.929  2.791   3.095   1.00 0.00 ? 18  ILE A HG21   1  
ATOM   167    H  HG22   . ILE A 1 11  ? 0.105   4.147   3.549   1.00 0.00 ? 18  ILE A HG22   1  
ATOM   168    H  HG23   . ILE A 1 11  ? 0.811   2.705   2.817   1.00 0.00 ? 18  ILE A HG23   1  
ATOM   169    H  HD11   . ILE A 1 11  ? 0.276   6.627   2.051   1.00 0.00 ? 18  ILE A HD11   1  
ATOM   170    H  HD12   . ILE A 1 11  ? 2.000   6.609   1.691   1.00 0.00 ? 18  ILE A HD12   1  
ATOM   171    H  HD13   . ILE A 1 11  ? 1.368   5.636   3.018   1.00 0.00 ? 18  ILE A HD13   1  
ATOM   172    N  N      . MET A 1 12  ? -1.470  0.833   1.227   1.00 0.00 ? 19  MET A N      1  
ATOM   173    C  CA     . MET A 1 12  ? -2.585  -0.042  1.557   1.00 0.00 ? 19  MET A CA     1  
ATOM   174    C  C      . MET A 1 12  ? -2.703  -0.209  3.072   1.00 0.00 ? 19  MET A C      1  
ATOM   175    O  O      . MET A 1 12  ? -1.782  -0.705  3.729   1.00 0.00 ? 19  MET A O      1  
ATOM   176    C  CB     . MET A 1 12  ? -2.406  -1.403  0.881   1.00 0.00 ? 19  MET A CB     1  
ATOM   177    C  CG     . MET A 1 12  ? -3.634  -2.292  0.970   1.00 0.00 ? 19  MET A CG     1  
ATOM   178    S  SD     . MET A 1 12  ? -3.445  -3.858  0.090   1.00 0.00 ? 19  MET A SD     1  
ATOM   179    C  CE     . MET A 1 12  ? -3.110  -3.296  -1.577  1.00 0.00 ? 19  MET A CE     1  
ATOM   180    H  H      . MET A 1 12  ? -0.553  0.521   1.387   1.00 0.00 ? 19  MET A H      1  
ATOM   181    H  HA     . MET A 1 12  ? -3.489  0.419   1.187   1.00 0.00 ? 19  MET A HA     1  
ATOM   182    H  HB2    . MET A 1 12  ? -2.176  -1.245  -0.163  1.00 0.00 ? 19  MET A HB2    1  
ATOM   183    H  HB3    . MET A 1 12  ? -1.580  -1.917  1.350   1.00 0.00 ? 19  MET A HB3    1  
ATOM   184    H  HG2    . MET A 1 12  ? -3.825  -2.507  2.010   1.00 0.00 ? 19  MET A HG2    1  
ATOM   185    H  HG3    . MET A 1 12  ? -4.477  -1.759  0.555   1.00 0.00 ? 19  MET A HG3    1  
ATOM   186    H  HE1    . MET A 1 12  ? -2.235  -2.664  -1.574  1.00 0.00 ? 19  MET A HE1    1  
ATOM   187    H  HE2    . MET A 1 12  ? -3.958  -2.738  -1.948  1.00 0.00 ? 19  MET A HE2    1  
ATOM   188    H  HE3    . MET A 1 12  ? -2.935  -4.149  -2.216  1.00 0.00 ? 19  MET A HE3    1  
ATOM   189    N  N      . VAL A 1 13  ? -3.833  0.210   3.622   1.00 0.00 ? 20  VAL A N      1  
ATOM   190    C  CA     . VAL A 1 13  ? -4.040  0.176   5.064   1.00 0.00 ? 20  VAL A CA     1  
ATOM   191    C  C      . VAL A 1 13  ? -5.205  -0.735  5.432   1.00 0.00 ? 20  VAL A C      1  
ATOM   192    O  O      . VAL A 1 13  ? -6.029  -1.082  4.582   1.00 0.00 ? 20  VAL A O      1  
ATOM   193    C  CB     . VAL A 1 13  ? -4.297  1.590   5.631   1.00 0.00 ? 20  VAL A CB     1  
ATOM   194    C  CG1    . VAL A 1 13  ? -3.109  2.496   5.357   1.00 0.00 ? 20  VAL A CG1    1  
ATOM   195    C  CG2    . VAL A 1 13  ? -5.569  2.188   5.047   1.00 0.00 ? 20  VAL A CG2    1  
ATOM   196    H  H      . VAL A 1 13  ? -4.558  0.539   3.043   1.00 0.00 ? 20  VAL A H      1  
ATOM   197    H  HA     . VAL A 1 13  ? -3.139  -0.211  5.520   1.00 0.00 ? 20  VAL A HA     1  
ATOM   198    H  HB     . VAL A 1 13  ? -4.420  1.509   6.701   1.00 0.00 ? 20  VAL A HB     1  
ATOM   199    H  HG11   . VAL A 1 13  ? -3.317  3.487   5.735   1.00 0.00 ? 20  VAL A HG11   1  
ATOM   200    H  HG12   . VAL A 1 13  ? -2.935  2.547   4.293   1.00 0.00 ? 20  VAL A HG12   1  
ATOM   201    H  HG13   . VAL A 1 13  ? -2.231  2.100   5.846   1.00 0.00 ? 20  VAL A HG13   1  
ATOM   202    H  HG21   . VAL A 1 13  ? -5.467  2.277   3.976   1.00 0.00 ? 20  VAL A HG21   1  
ATOM   203    H  HG22   . VAL A 1 13  ? -5.736  3.166   5.474   1.00 0.00 ? 20  VAL A HG22   1  
ATOM   204    H  HG23   . VAL A 1 13  ? -6.408  1.547   5.276   1.00 0.00 ? 20  VAL A HG23   1  
ATOM   205    N  N      . GLY A 1 14  ? -5.261  -1.121  6.698   1.00 0.00 ? 21  GLY A N      1  
ATOM   206    C  CA     . GLY A 1 14  ? -6.327  -1.972  7.179   1.00 0.00 ? 21  GLY A CA     1  
ATOM   207    C  C      . GLY A 1 14  ? -6.418  -1.949  8.691   1.00 0.00 ? 21  GLY A C      1  
ATOM   208    O  O      . GLY A 1 14  ? -5.803  -1.099  9.335   1.00 0.00 ? 21  GLY A O      1  
ATOM   209    H  H      . GLY A 1 14  ? -4.564  -0.815  7.323   1.00 0.00 ? 21  GLY A H      1  
ATOM   210    H  HA2    . GLY A 1 14  ? -7.265  -1.631  6.764   1.00 0.00 ? 21  GLY A HA2    1  
ATOM   211    H  HA3    . GLY A 1 14  ? -6.143  -2.984  6.854   1.00 0.00 ? 21  GLY A HA3    1  
ATOM   212    N  N      . SER A 1 15  ? -7.150  -2.896  9.262   1.00 0.00 ? 22  SER A N      1  
ATOM   213    C  CA     . SER A 1 15  ? -7.349  -2.946  10.709  1.00 0.00 ? 22  SER A CA     1  
ATOM   214    C  C      . SER A 1 15  ? -6.294  -3.847  11.344  1.00 0.00 ? 22  SER A C      1  
ATOM   215    O  O      . SER A 1 15  ? -6.309  -4.111  12.545  1.00 0.00 ? 22  SER A O      1  
ATOM   216    C  CB     . SER A 1 15  ? -8.759  -3.464  11.020  1.00 0.00 ? 22  SER A CB     1  
ATOM   217    O  OG     . SER A 1 15  ? -9.079  -3.359  12.400  1.00 0.00 ? 22  SER A OG     1  
ATOM   218    H  H      . SER A 1 15  ? -7.557  -3.591  8.702   1.00 0.00 ? 22  SER A H      1  
ATOM   219    H  HA     . SER A 1 15  ? -7.243  -1.943  11.099  1.00 0.00 ? 22  SER A HA     1  
ATOM   220    H  HB2    . SER A 1 15  ? -9.479  -2.889  10.457  1.00 0.00 ? 22  SER A HB2    1  
ATOM   221    H  HB3    . SER A 1 15  ? -8.827  -4.502  10.727  1.00 0.00 ? 22  SER A HB3    1  
ATOM   222    H  HG     . SER A 1 15  ? -8.369  -2.889  12.866  1.00 0.00 ? 22  SER A HG     1  
ATOM   223    N  N      . GLY A 1 16  ? -5.375  -4.307  10.515  1.00 0.00 ? 23  GLY A N      1  
ATOM   224    C  CA     . GLY A 1 16  ? -4.341  -5.201  10.967  1.00 0.00 ? 23  GLY A CA     1  
ATOM   225    C  C      . GLY A 1 16  ? -4.027  -6.240  9.920   1.00 0.00 ? 23  GLY A C      1  
ATOM   226    O  O      . GLY A 1 16  ? -2.933  -6.253  9.356   1.00 0.00 ? 23  GLY A O      1  
ATOM   227    H  H      . GLY A 1 16  ? -5.404  -4.037  9.576   1.00 0.00 ? 23  GLY A H      1  
ATOM   228    H  HA2    . GLY A 1 16  ? -3.447  -4.628  11.180  1.00 0.00 ? 23  GLY A HA2    1  
ATOM   229    H  HA3    . GLY A 1 16  ? -4.671  -5.698  11.869  1.00 0.00 ? 23  GLY A HA3    1  
ATOM   230    N  N      . GLY A 1 17  ? -4.998  -7.089  9.634   1.00 0.00 ? 24  GLY A N      1  
ATOM   231    C  CA     . GLY A 1 17  ? -4.810  -8.107  8.628   1.00 0.00 ? 24  GLY A CA     1  
ATOM   232    C  C      . GLY A 1 17  ? -5.720  -7.906  7.439   1.00 0.00 ? 24  GLY A C      1  
ATOM   233    O  O      . GLY A 1 17  ? -5.355  -7.210  6.485   1.00 0.00 ? 24  GLY A O      1  
ATOM   234    H  H      . GLY A 1 17  ? -5.859  -7.021  10.111  1.00 0.00 ? 24  GLY A H      1  
ATOM   235    H  HA2    . GLY A 1 17  ? -3.787  -8.076  8.291   1.00 0.00 ? 24  GLY A HA2    1  
ATOM   236    H  HA3    . GLY A 1 17  ? -5.011  -9.075  9.064   1.00 0.00 ? 24  GLY A HA3    1  
ATOM   237    N  N      . VAL A 1 18  ? -6.899  -8.525  7.499   1.00 0.00 ? 25  VAL A N      1  
ATOM   238    C  CA     . VAL A 1 18  ? -7.906  -8.447  6.438   1.00 0.00 ? 25  VAL A CA     1  
ATOM   239    C  C      . VAL A 1 18  ? -7.474  -9.230  5.199   1.00 0.00 ? 25  VAL A C      1  
ATOM   240    O  O      . VAL A 1 18  ? -8.216  -10.063 4.686   1.00 0.00 ? 25  VAL A O      1  
ATOM   241    C  CB     . VAL A 1 18  ? -8.223  -6.989  6.036   1.00 0.00 ? 25  VAL A CB     1  
ATOM   242    C  CG1    . VAL A 1 18  ? -9.208  -6.966  4.881   1.00 0.00 ? 25  VAL A CG1    1  
ATOM   243    C  CG2    . VAL A 1 18  ? -8.770  -6.209  7.224   1.00 0.00 ? 25  VAL A CG2    1  
ATOM   244    H  H      . VAL A 1 18  ? -7.102  -9.068  8.294   1.00 0.00 ? 25  VAL A H      1  
ATOM   245    H  HA     . VAL A 1 18  ? -8.815  -8.891  6.820   1.00 0.00 ? 25  VAL A HA     1  
ATOM   246    H  HB     . VAL A 1 18  ? -7.307  -6.518  5.711   1.00 0.00 ? 25  VAL A HB     1  
ATOM   247    H  HG11   . VAL A 1 18  ? -8.786  -7.495  4.037   1.00 0.00 ? 25  VAL A HG11   1  
ATOM   248    H  HG12   . VAL A 1 18  ? -9.412  -5.944  4.600   1.00 0.00 ? 25  VAL A HG12   1  
ATOM   249    H  HG13   . VAL A 1 18  ? -10.128 -7.445  5.184   1.00 0.00 ? 25  VAL A HG13   1  
ATOM   250    H  HG21   . VAL A 1 18  ? -8.937  -5.182  6.932   1.00 0.00 ? 25  VAL A HG21   1  
ATOM   251    H  HG22   . VAL A 1 18  ? -8.056  -6.241  8.036   1.00 0.00 ? 25  VAL A HG22   1  
ATOM   252    H  HG23   . VAL A 1 18  ? -9.702  -6.648  7.546   1.00 0.00 ? 25  VAL A HG23   1  
ATOM   253    N  N      . GLY A 1 19  ? -6.271  -8.953  4.730   1.00 0.00 ? 26  GLY A N      1  
ATOM   254    C  CA     . GLY A 1 19  ? -5.756  -9.612  3.551   1.00 0.00 ? 26  GLY A CA     1  
ATOM   255    C  C      . GLY A 1 19  ? -5.009  -8.664  2.635   1.00 0.00 ? 26  GLY A C      1  
ATOM   256    O  O      . GLY A 1 19  ? -4.873  -8.923  1.440   1.00 0.00 ? 26  GLY A O      1  
ATOM   257    H  H      . GLY A 1 19  ? -5.726  -8.290  5.204   1.00 0.00 ? 26  GLY A H      1  
ATOM   258    H  HA2    . GLY A 1 19  ? -5.084  -10.400 3.854   1.00 0.00 ? 26  GLY A HA2    1  
ATOM   259    H  HA3    . GLY A 1 19  ? -6.582  -10.048 3.009   1.00 0.00 ? 26  GLY A HA3    1  
ATOM   260    N  N      . LYS A 1 20  ? -4.495  -7.575  3.202   1.00 0.00 ? 27  LYS A N      1  
ATOM   261    C  CA     . LYS A 1 20  ? -3.845  -6.534  2.408   1.00 0.00 ? 27  LYS A CA     1  
ATOM   262    C  C      . LYS A 1 20  ? -2.395  -6.896  2.062   1.00 0.00 ? 27  LYS A C      1  
ATOM   263    O  O      . LYS A 1 20  ? -1.633  -6.059  1.589   1.00 0.00 ? 27  LYS A O      1  
ATOM   264    C  CB     . LYS A 1 20  ? -3.918  -5.188  3.143   1.00 0.00 ? 27  LYS A CB     1  
ATOM   265    C  CG     . LYS A 1 20  ? -3.014  -5.063  4.361   1.00 0.00 ? 27  LYS A CG     1  
ATOM   266    C  CD     . LYS A 1 20  ? -3.345  -3.800  5.142   1.00 0.00 ? 27  LYS A CD     1  
ATOM   267    C  CE     . LYS A 1 20  ? -2.281  -3.460  6.169   1.00 0.00 ? 27  LYS A CE     1  
ATOM   268    N  NZ     . LYS A 1 20  ? -1.076  -2.864  5.540   1.00 0.00 ? 27  LYS A NZ     1  
ATOM   269    H  H      . LYS A 1 20  ? -4.573  -7.456  4.171   1.00 0.00 ? 27  LYS A H      1  
ATOM   270    H  HA     . LYS A 1 20  ? -4.397  -6.445  1.484   1.00 0.00 ? 27  LYS A HA     1  
ATOM   271    H  HB2    . LYS A 1 20  ? -3.651  -4.406  2.450   1.00 0.00 ? 27  LYS A HB2    1  
ATOM   272    H  HB3    . LYS A 1 20  ? -4.936  -5.029  3.464   1.00 0.00 ? 27  LYS A HB3    1  
ATOM   273    H  HG2    . LYS A 1 20  ? -3.161  -5.923  5.000   1.00 0.00 ? 27  LYS A HG2    1  
ATOM   274    H  HG3    . LYS A 1 20  ? -1.985  -5.020  4.036   1.00 0.00 ? 27  LYS A HG3    1  
ATOM   275    H  HD2    . LYS A 1 20  ? -3.433  -2.976  4.449   1.00 0.00 ? 27  LYS A HD2    1  
ATOM   276    H  HD3    . LYS A 1 20  ? -4.288  -3.943  5.649   1.00 0.00 ? 27  LYS A HD3    1  
ATOM   277    H  HE2    . LYS A 1 20  ? -2.692  -2.757  6.878   1.00 0.00 ? 27  LYS A HE2    1  
ATOM   278    H  HE3    . LYS A 1 20  ? -1.995  -4.366  6.686   1.00 0.00 ? 27  LYS A HE3    1  
ATOM   279    H  HZ1    . LYS A 1 20  ? -1.343  -2.036  4.967   1.00 0.00 ? 27  LYS A HZ1    1  
ATOM   280    H  HZ2    . LYS A 1 20  ? -0.612  -3.565  4.916   1.00 0.00 ? 27  LYS A HZ2    1  
ATOM   281    H  HZ3    . LYS A 1 20  ? -0.396  -2.566  6.271   1.00 0.00 ? 27  LYS A HZ3    1  
ATOM   282    N  N      . SER A 1 21  ? -2.024  -8.149  2.292   1.00 0.00 ? 28  SER A N      1  
ATOM   283    C  CA     . SER A 1 21  ? -0.717  -8.641  1.877   1.00 0.00 ? 28  SER A CA     1  
ATOM   284    C  C      . SER A 1 21  ? -0.864  -9.572  0.670   1.00 0.00 ? 28  SER A C      1  
ATOM   285    O  O      . SER A 1 21  ? 0.001   -9.619  -0.204  1.00 0.00 ? 28  SER A O      1  
ATOM   286    C  CB     . SER A 1 21  ? -0.029  -9.392  3.023   1.00 0.00 ? 28  SER A CB     1  
ATOM   287    O  OG     . SER A 1 21  ? 0.210   -8.554  4.154   1.00 0.00 ? 28  SER A OG     1  
ATOM   288    H  H      . SER A 1 21  ? -2.643  -8.752  2.743   1.00 0.00 ? 28  SER A H      1  
ATOM   289    H  HA     . SER A 1 21  ? -0.112  -7.793  1.591   1.00 0.00 ? 28  SER A HA     1  
ATOM   290    H  HB2    . SER A 1 21  ? -0.654  -10.216 3.332   1.00 0.00 ? 28  SER A HB2    1  
ATOM   291    H  HB3    . SER A 1 21  ? 0.920   -9.775  2.674   1.00 0.00 ? 28  SER A HB3    1  
ATOM   292    H  HG     . SER A 1 21  ? 0.524   -7.672  3.837   1.00 0.00 ? 28  SER A HG     1  
ATOM   293    N  N      . ALA A 1 22  ? -1.974  -10.305 0.627   1.00 0.00 ? 29  ALA A N      1  
ATOM   294    C  CA     . ALA A 1 22  ? -2.198  -11.292 -0.424  1.00 0.00 ? 29  ALA A CA     1  
ATOM   295    C  C      . ALA A 1 22  ? -2.479  -10.620 -1.757  1.00 0.00 ? 29  ALA A C      1  
ATOM   296    O  O      . ALA A 1 22  ? -1.976  -11.052 -2.791  1.00 0.00 ? 29  ALA A O      1  
ATOM   297    C  CB     . ALA A 1 22  ? -3.341  -12.222 -0.054  1.00 0.00 ? 29  ALA A CB     1  
ATOM   298    H  H      . ALA A 1 22  ? -2.664  -10.167 1.308   1.00 0.00 ? 29  ALA A H      1  
ATOM   299    H  HA     . ALA A 1 22  ? -1.301  -11.885 -0.516  1.00 0.00 ? 29  ALA A HA     1  
ATOM   300    H  HB1    . ALA A 1 22  ? -3.107  -12.732 0.869   1.00 0.00 ? 29  ALA A HB1    1  
ATOM   301    H  HB2    . ALA A 1 22  ? -3.482  -12.948 -0.841  1.00 0.00 ? 29  ALA A HB2    1  
ATOM   302    H  HB3    . ALA A 1 22  ? -4.246  -11.648 0.073   1.00 0.00 ? 29  ALA A HB3    1  
ATOM   303    N  N      . LEU A 1 23  ? -3.272  -9.555  -1.719  1.00 0.00 ? 30  LEU A N      1  
ATOM   304    C  CA     . LEU A 1 23  ? -3.648  -8.829  -2.930  1.00 0.00 ? 30  LEU A CA     1  
ATOM   305    C  C      . LEU A 1 23  ? -2.412  -8.327  -3.662  1.00 0.00 ? 30  LEU A C      1  
ATOM   306    O  O      . LEU A 1 23  ? -2.334  -8.378  -4.891  1.00 0.00 ? 30  LEU A O      1  
ATOM   307    C  CB     . LEU A 1 23  ? -4.549  -7.645  -2.581  1.00 0.00 ? 30  LEU A CB     1  
ATOM   308    C  CG     . LEU A 1 23  ? -5.839  -8.010  -1.839  1.00 0.00 ? 30  LEU A CG     1  
ATOM   309    C  CD1    . LEU A 1 23  ? -6.611  -6.757  -1.467  1.00 0.00 ? 30  LEU A CD1    1  
ATOM   310    C  CD2    . LEU A 1 23  ? -6.703  -8.926  -2.688  1.00 0.00 ? 30  LEU A CD2    1  
ATOM   311    H  H      . LEU A 1 23  ? -3.616  -9.246  -0.853  1.00 0.00 ? 30  LEU A H      1  
ATOM   312    H  HA     . LEU A 1 23  ? -4.190  -9.506  -3.572  1.00 0.00 ? 30  LEU A HA     1  
ATOM   313    H  HB2    . LEU A 1 23  ? -3.981  -6.955  -1.969  1.00 0.00 ? 30  LEU A HB2    1  
ATOM   314    H  HB3    . LEU A 1 23  ? -4.820  -7.145  -3.499  1.00 0.00 ? 30  LEU A HB3    1  
ATOM   315    H  HG     . LEU A 1 23  ? -5.590  -8.534  -0.928  1.00 0.00 ? 30  LEU A HG     1  
ATOM   316    H  HD11   . LEU A 1 23  ? -6.847  -6.205  -2.364  1.00 0.00 ? 30  LEU A HD11   1  
ATOM   317    H  HD12   . LEU A 1 23  ? -6.011  -6.143  -0.813  1.00 0.00 ? 30  LEU A HD12   1  
ATOM   318    H  HD13   . LEU A 1 23  ? -7.525  -7.035  -0.964  1.00 0.00 ? 30  LEU A HD13   1  
ATOM   319    H  HD21   . LEU A 1 23  ? -6.910  -8.448  -3.633  1.00 0.00 ? 30  LEU A HD21   1  
ATOM   320    H  HD22   . LEU A 1 23  ? -7.632  -9.123  -2.172  1.00 0.00 ? 30  LEU A HD22   1  
ATOM   321    H  HD23   . LEU A 1 23  ? -6.182  -9.856  -2.860  1.00 0.00 ? 30  LEU A HD23   1  
ATOM   322    N  N      . THR A 1 24  ? -1.442  -7.860  -2.893  1.00 0.00 ? 31  THR A N      1  
ATOM   323    C  CA     . THR A 1 24  ? -0.221  -7.318  -3.442  1.00 0.00 ? 31  THR A CA     1  
ATOM   324    C  C      . THR A 1 24  ? 0.591   -8.397  -4.160  1.00 0.00 ? 31  THR A C      1  
ATOM   325    O  O      . THR A 1 24  ? 1.002   -8.211  -5.304  1.00 0.00 ? 31  THR A O      1  
ATOM   326    C  CB     . THR A 1 24  ? 0.614   -6.688  -2.323  1.00 0.00 ? 31  THR A CB     1  
ATOM   327    O  OG1    . THR A 1 24  ? -0.247  -6.350  -1.227  1.00 0.00 ? 31  THR A OG1    1  
ATOM   328    C  CG2    . THR A 1 24  ? 1.317   -5.439  -2.821  1.00 0.00 ? 31  THR A CG2    1  
ATOM   329    H  H      . THR A 1 24  ? -1.557  -7.870  -1.918  1.00 0.00 ? 31  THR A H      1  
ATOM   330    H  HA     . THR A 1 24  ? -0.484  -6.544  -4.150  1.00 0.00 ? 31  THR A HA     1  
ATOM   331    H  HB     . THR A 1 24  ? 1.355   -7.399  -1.993  1.00 0.00 ? 31  THR A HB     1  
ATOM   332    H  HG1    . THR A 1 24  ? 0.058   -5.536  -0.815  1.00 0.00 ? 31  THR A HG1    1  
ATOM   333    H  HG21   . THR A 1 24  ? 0.579   -4.733  -3.174  1.00 0.00 ? 31  THR A HG21   1  
ATOM   334    H  HG22   . THR A 1 24  ? 1.985   -5.699  -3.629  1.00 0.00 ? 31  THR A HG22   1  
ATOM   335    H  HG23   . THR A 1 24  ? 1.880   -4.997  -2.014  1.00 0.00 ? 31  THR A HG23   1  
ATOM   336    N  N      . LEU A 1 25  ? 0.808   -9.532  -3.494  1.00 0.00 ? 32  LEU A N      1  
ATOM   337    C  CA     . LEU A 1 25  ? 1.544   -10.638 -4.100  1.00 0.00 ? 32  LEU A CA     1  
ATOM   338    C  C      . LEU A 1 25  ? 0.818   -11.176 -5.330  1.00 0.00 ? 32  LEU A C      1  
ATOM   339    O  O      . LEU A 1 25  ? 1.455   -11.574 -6.303  1.00 0.00 ? 32  LEU A O      1  
ATOM   340    C  CB     . LEU A 1 25  ? 1.791   -11.762 -3.088  1.00 0.00 ? 32  LEU A CB     1  
ATOM   341    C  CG     . LEU A 1 25  ? 3.056   -11.608 -2.234  1.00 0.00 ? 32  LEU A CG     1  
ATOM   342    C  CD1    . LEU A 1 25  ? 2.957   -10.398 -1.318  1.00 0.00 ? 32  LEU A CD1    1  
ATOM   343    C  CD2    . LEU A 1 25  ? 3.314   -12.872 -1.429  1.00 0.00 ? 32  LEU A CD2    1  
ATOM   344    H  H      . LEU A 1 25  ? 0.474   -9.623  -2.573  1.00 0.00 ? 32  LEU A H      1  
ATOM   345    H  HA     . LEU A 1 25  ? 2.500   -10.249 -4.419  1.00 0.00 ? 32  LEU A HA     1  
ATOM   346    H  HB2    . LEU A 1 25  ? 0.940   -11.814 -2.425  1.00 0.00 ? 32  LEU A HB2    1  
ATOM   347    H  HB3    . LEU A 1 25  ? 1.862   -12.695 -3.628  1.00 0.00 ? 32  LEU A HB3    1  
ATOM   348    H  HG     . LEU A 1 25  ? 3.903   -11.454 -2.888  1.00 0.00 ? 32  LEU A HG     1  
ATOM   349    H  HD11   . LEU A 1 25  ? 2.119   -10.520 -0.648  1.00 0.00 ? 32  LEU A HD11   1  
ATOM   350    H  HD12   . LEU A 1 25  ? 2.814   -9.509  -1.915  1.00 0.00 ? 32  LEU A HD12   1  
ATOM   351    H  HD13   . LEU A 1 25  ? 3.866   -10.306 -0.745  1.00 0.00 ? 32  LEU A HD13   1  
ATOM   352    H  HD21   . LEU A 1 25  ? 3.439   -13.708 -2.102  1.00 0.00 ? 32  LEU A HD21   1  
ATOM   353    H  HD22   . LEU A 1 25  ? 2.476   -13.061 -0.773  1.00 0.00 ? 32  LEU A HD22   1  
ATOM   354    H  HD23   . LEU A 1 25  ? 4.211   -12.748 -0.839  1.00 0.00 ? 32  LEU A HD23   1  
ATOM   355    N  N      . GLN A 1 26  ? -0.512  -11.171 -5.288  1.00 0.00 ? 33  GLN A N      1  
ATOM   356    C  CA     . GLN A 1 26  ? -1.316  -11.571 -6.440  1.00 0.00 ? 33  GLN A CA     1  
ATOM   357    C  C      . GLN A 1 26  ? -1.019  -10.674 -7.640  1.00 0.00 ? 33  GLN A C      1  
ATOM   358    O  O      . GLN A 1 26  ? -0.741  -11.155 -8.734  1.00 0.00 ? 33  GLN A O      1  
ATOM   359    C  CB     . GLN A 1 26  ? -2.810  -11.504 -6.109  1.00 0.00 ? 33  GLN A CB     1  
ATOM   360    C  CG     . GLN A 1 26  ? -3.304  -12.636 -5.223  1.00 0.00 ? 33  GLN A CG     1  
ATOM   361    C  CD     . GLN A 1 26  ? -3.277  -13.979 -5.926  1.00 0.00 ? 33  GLN A CD     1  
ATOM   362    O  OE1    . GLN A 1 26  ? -3.407  -14.055 -7.144  1.00 0.00 ? 33  GLN A OE1    1  
ATOM   363    N  NE2    . GLN A 1 26  ? -3.129  -15.047 -5.164  1.00 0.00 ? 33  GLN A NE2    1  
ATOM   364    H  H      . GLN A 1 26  ? -0.965  -10.895 -4.460  1.00 0.00 ? 33  GLN A H      1  
ATOM   365    H  HA     . GLN A 1 26  ? -1.054  -12.588 -6.690  1.00 0.00 ? 33  GLN A HA     1  
ATOM   366    H  HB2    . GLN A 1 26  ? -3.013  -10.570 -5.605  1.00 0.00 ? 33  GLN A HB2    1  
ATOM   367    H  HB3    . GLN A 1 26  ? -3.371  -11.531 -7.032  1.00 0.00 ? 33  GLN A HB3    1  
ATOM   368    H  HG2    . GLN A 1 26  ? -2.673  -12.692 -4.347  1.00 0.00 ? 33  GLN A HG2    1  
ATOM   369    H  HG3    . GLN A 1 26  ? -4.318  -12.423 -4.922  1.00 0.00 ? 33  GLN A HG3    1  
ATOM   370    H  HE21   . GLN A 1 26  ? -3.040  -14.918 -4.200  1.00 0.00 ? 33  GLN A HE21   1  
ATOM   371    H  HE22   . GLN A 1 26  ? -3.110  -15.930 -5.602  1.00 0.00 ? 33  GLN A HE22   1  
ATOM   372    N  N      . PHE A 1 27  ? -1.040  -9.368  -7.407  1.00 0.00 ? 34  PHE A N      1  
ATOM   373    C  CA     . PHE A 1 27  ? -0.857  -8.384  -8.471  1.00 0.00 ? 34  PHE A CA     1  
ATOM   374    C  C      . PHE A 1 27  ? 0.592   -8.362  -8.974  1.00 0.00 ? 34  PHE A C      1  
ATOM   375    O  O      . PHE A 1 27  ? 0.883   -7.808  -10.033 1.00 0.00 ? 34  PHE A O      1  
ATOM   376    C  CB     . PHE A 1 27  ? -1.270  -6.996  -7.963  1.00 0.00 ? 34  PHE A CB     1  
ATOM   377    C  CG     . PHE A 1 27  ? -1.201  -5.910  -9.001  1.00 0.00 ? 34  PHE A CG     1  
ATOM   378    C  CD1    . PHE A 1 27  ? -2.055  -5.923  -10.091 1.00 0.00 ? 34  PHE A CD1    1  
ATOM   379    C  CD2    . PHE A 1 27  ? -0.282  -4.876  -8.887  1.00 0.00 ? 34  PHE A CD2    1  
ATOM   380    C  CE1    . PHE A 1 27  ? -1.995  -4.928  -11.049 1.00 0.00 ? 34  PHE A CE1    1  
ATOM   381    C  CE2    . PHE A 1 27  ? -0.218  -3.879  -9.841  1.00 0.00 ? 34  PHE A CE2    1  
ATOM   382    C  CZ     . PHE A 1 27  ? -1.076  -3.905  -10.923 1.00 0.00 ? 34  PHE A CZ     1  
ATOM   383    H  H      . PHE A 1 27  ? -1.195  -9.053  -6.490  1.00 0.00 ? 34  PHE A H      1  
ATOM   384    H  HA     . PHE A 1 27  ? -1.502  -8.662  -9.291  1.00 0.00 ? 34  PHE A HA     1  
ATOM   385    H  HB2    . PHE A 1 27  ? -2.287  -7.046  -7.607  1.00 0.00 ? 34  PHE A HB2    1  
ATOM   386    H  HB3    . PHE A 1 27  ? -0.623  -6.716  -7.145  1.00 0.00 ? 34  PHE A HB3    1  
ATOM   387    H  HD1    . PHE A 1 27  ? -2.772  -6.722  -10.191 1.00 0.00 ? 34  PHE A HD1    1  
ATOM   388    H  HD2    . PHE A 1 27  ? 0.391   -4.853  -8.040  1.00 0.00 ? 34  PHE A HD2    1  
ATOM   389    H  HE1    . PHE A 1 27  ? -2.667  -4.951  -11.892 1.00 0.00 ? 34  PHE A HE1    1  
ATOM   390    H  HE2    . PHE A 1 27  ? 0.501   -3.079  -9.741  1.00 0.00 ? 34  PHE A HE2    1  
ATOM   391    H  HZ     . PHE A 1 27  ? -1.030  -3.126  -11.671 1.00 0.00 ? 34  PHE A HZ     1  
ATOM   392    N  N      . MET A 1 28  ? 1.499   -8.971  -8.222  1.00 0.00 ? 35  MET A N      1  
ATOM   393    C  CA     . MET A 1 28  ? 2.909   -8.942  -8.586  1.00 0.00 ? 35  MET A CA     1  
ATOM   394    C  C      . MET A 1 28  ? 3.402   -10.282 -9.130  1.00 0.00 ? 35  MET A C      1  
ATOM   395    O  O      . MET A 1 28  ? 4.071   -10.325 -10.164 1.00 0.00 ? 35  MET A O      1  
ATOM   396    C  CB     . MET A 1 28  ? 3.776   -8.523  -7.393  1.00 0.00 ? 35  MET A CB     1  
ATOM   397    C  CG     . MET A 1 28  ? 3.536   -7.097  -6.920  1.00 0.00 ? 35  MET A CG     1  
ATOM   398    S  SD     . MET A 1 28  ? 4.688   -6.590  -5.625  1.00 0.00 ? 35  MET A SD     1  
ATOM   399    C  CE     . MET A 1 28  ? 4.308   -7.770  -4.333  1.00 0.00 ? 35  MET A CE     1  
ATOM   400    H  H      . MET A 1 28  ? 1.214   -9.442  -7.411  1.00 0.00 ? 35  MET A H      1  
ATOM   401    H  HA     . MET A 1 28  ? 3.018   -8.205  -9.363  1.00 0.00 ? 35  MET A HA     1  
ATOM   402    H  HB2    . MET A 1 28  ? 3.577   -9.190  -6.569  1.00 0.00 ? 35  MET A HB2    1  
ATOM   403    H  HB3    . MET A 1 28  ? 4.816   -8.615  -7.674  1.00 0.00 ? 35  MET A HB3    1  
ATOM   404    H  HG2    . MET A 1 28  ? 3.644   -6.428  -7.761  1.00 0.00 ? 35  MET A HG2    1  
ATOM   405    H  HG3    . MET A 1 28  ? 2.528   -7.027  -6.534  1.00 0.00 ? 35  MET A HG3    1  
ATOM   406    H  HE1    . MET A 1 28  ? 4.954   -7.596  -3.485  1.00 0.00 ? 35  MET A HE1    1  
ATOM   407    H  HE2    . MET A 1 28  ? 4.463   -8.772  -4.706  1.00 0.00 ? 35  MET A HE2    1  
ATOM   408    H  HE3    . MET A 1 28  ? 3.279   -7.652  -4.031  1.00 0.00 ? 35  MET A HE3    1  
ATOM   409    N  N      . TYR A 1 29  ? 3.077   -11.367 -8.435  1.00 0.00 ? 36  TYR A N      1  
ATOM   410    C  CA     . TYR A 1 29  ? 3.620   -12.685 -8.765  1.00 0.00 ? 36  TYR A CA     1  
ATOM   411    C  C      . TYR A 1 29  ? 2.552   -13.625 -9.324  1.00 0.00 ? 36  TYR A C      1  
ATOM   412    O  O      . TYR A 1 29  ? 2.883   -14.680 -9.867  1.00 0.00 ? 36  TYR A O      1  
ATOM   413    C  CB     . TYR A 1 29  ? 4.234   -13.332 -7.518  1.00 0.00 ? 36  TYR A CB     1  
ATOM   414    C  CG     . TYR A 1 29  ? 5.465   -12.632 -6.971  1.00 0.00 ? 36  TYR A CG     1  
ATOM   415    C  CD1    . TYR A 1 29  ? 5.352   -11.574 -6.078  1.00 0.00 ? 36  TYR A CD1    1  
ATOM   416    C  CD2    . TYR A 1 29  ? 6.743   -13.045 -7.336  1.00 0.00 ? 36  TYR A CD2    1  
ATOM   417    C  CE1    . TYR A 1 29  ? 6.475   -10.946 -5.568  1.00 0.00 ? 36  TYR A CE1    1  
ATOM   418    C  CE2    . TYR A 1 29  ? 7.869   -12.425 -6.824  1.00 0.00 ? 36  TYR A CE2    1  
ATOM   419    C  CZ     . TYR A 1 29  ? 7.731   -11.378 -5.941  1.00 0.00 ? 36  TYR A CZ     1  
ATOM   420    O  OH     . TYR A 1 29  ? 8.850   -10.760 -5.429  1.00 0.00 ? 36  TYR A OH     1  
ATOM   421    H  H      . TYR A 1 29  ? 2.455   -11.285 -7.680  1.00 0.00 ? 36  TYR A H      1  
ATOM   422    H  HA     . TYR A 1 29  ? 4.393   -12.554 -9.505  1.00 0.00 ? 36  TYR A HA     1  
ATOM   423    H  HB2    . TYR A 1 29  ? 3.494   -13.347 -6.734  1.00 0.00 ? 36  TYR A HB2    1  
ATOM   424    H  HB3    . TYR A 1 29  ? 4.511   -14.351 -7.758  1.00 0.00 ? 36  TYR A HB3    1  
ATOM   425    H  HD1    . TYR A 1 29  ? 4.369   -11.236 -5.785  1.00 0.00 ? 36  TYR A HD1    1  
ATOM   426    H  HD2    . TYR A 1 29  ? 6.853   -13.868 -8.028  1.00 0.00 ? 36  TYR A HD2    1  
ATOM   427    H  HE1    . TYR A 1 29  ? 6.365   -10.124 -4.875  1.00 0.00 ? 36  TYR A HE1    1  
ATOM   428    H  HE2    . TYR A 1 29  ? 8.852   -12.762 -7.122  1.00 0.00 ? 36  TYR A HE2    1  
ATOM   429    H  HH     . TYR A 1 29  ? 9.589   -10.866 -6.046  1.00 0.00 ? 36  TYR A HH     1  
ATOM   430    N  N      . ASP A 1 30  ? 1.281   -13.242 -9.182  1.00 0.00 ? 37  ASP A N      1  
ATOM   431    C  CA     . ASP A 1 30  ? 0.148   -14.120 -9.520  1.00 0.00 ? 37  ASP A CA     1  
ATOM   432    C  C      . ASP A 1 30  ? 0.140   -15.356 -8.626  1.00 0.00 ? 37  ASP A C      1  
ATOM   433    O  O      . ASP A 1 30  ? -0.439  -16.388 -8.977  1.00 0.00 ? 37  ASP A O      1  
ATOM   434    C  CB     . ASP A 1 30  ? 0.166   -14.559 -10.994 1.00 0.00 ? 37  ASP A CB     1  
ATOM   435    C  CG     . ASP A 1 30  ? -0.390  -13.510 -11.936 1.00 0.00 ? 37  ASP A CG     1  
ATOM   436    O  OD1    . ASP A 1 30  ? -1.628  -13.349 -11.988 1.00 0.00 ? 37  ASP A OD1    1  
ATOM   437    O  OD2    . ASP A 1 30  ? 0.405   -12.873 -12.650 1.00 0.00 ? 37  ASP A OD2    1  
ATOM   438    H  H      . ASP A 1 30  ? 1.093   -12.340 -8.851  1.00 0.00 ? 37  ASP A H      1  
ATOM   439    H  HA     . ASP A 1 30  ? -0.760  -13.563 -9.337  1.00 0.00 ? 37  ASP A HA     1  
ATOM   440    H  HB2    . ASP A 1 30  ? 1.184   -14.767 -11.287 1.00 0.00 ? 37  ASP A HB2    1  
ATOM   441    H  HB3    . ASP A 1 30  ? -0.421  -15.459 -11.101 1.00 0.00 ? 37  ASP A HB3    1  
ATOM   442    N  N      . GLU A 1 31  ? 0.767   -15.242 -7.461  1.00 0.00 ? 38  GLU A N      1  
ATOM   443    C  CA     . GLU A 1 31  ? 0.886   -16.365 -6.540  1.00 0.00 ? 38  GLU A CA     1  
ATOM   444    C  C      . GLU A 1 31  ? 0.145   -16.076 -5.242  1.00 0.00 ? 38  GLU A C      1  
ATOM   445    O  O      . GLU A 1 31  ? 0.099   -14.934 -4.783  1.00 0.00 ? 38  GLU A O      1  
ATOM   446    C  CB     . GLU A 1 31  ? 2.359   -16.655 -6.239  1.00 0.00 ? 38  GLU A CB     1  
ATOM   447    C  CG     . GLU A 1 31  ? 3.200   -16.880 -7.484  1.00 0.00 ? 38  GLU A CG     1  
ATOM   448    C  CD     . GLU A 1 31  ? 4.629   -17.271 -7.168  1.00 0.00 ? 38  GLU A CD     1  
ATOM   449    O  OE1    . GLU A 1 31  ? 5.419   -16.389 -6.778  1.00 0.00 ? 38  GLU A OE1    1  
ATOM   450    O  OE2    . GLU A 1 31  ? 4.964   -18.464 -7.315  1.00 0.00 ? 38  GLU A OE2    1  
ATOM   451    H  H      . GLU A 1 31  ? 1.152   -14.379 -7.209  1.00 0.00 ? 38  GLU A H      1  
ATOM   452    H  HA     . GLU A 1 31  ? 0.448   -17.231 -7.011  1.00 0.00 ? 38  GLU A HA     1  
ATOM   453    H  HB2    . GLU A 1 31  ? 2.775   -15.819 -5.696  1.00 0.00 ? 38  GLU A HB2    1  
ATOM   454    H  HB3    . GLU A 1 31  ? 2.423   -17.539 -5.621  1.00 0.00 ? 38  GLU A HB3    1  
ATOM   455    H  HG2    . GLU A 1 31  ? 2.747   -17.668 -8.068  1.00 0.00 ? 38  GLU A HG2    1  
ATOM   456    H  HG3    . GLU A 1 31  ? 3.211   -15.968 -8.063  1.00 0.00 ? 38  GLU A HG3    1  
ATOM   457    N  N      . PHE A 1 32  ? -0.441  -17.113 -4.662  1.00 0.00 ? 39  PHE A N      1  
ATOM   458    C  CA     . PHE A 1 32  ? -1.135  -16.985 -3.393  1.00 0.00 ? 39  PHE A CA     1  
ATOM   459    C  C      . PHE A 1 32  ? -0.139  -17.108 -2.250  1.00 0.00 ? 39  PHE A C      1  
ATOM   460    O  O      . PHE A 1 32  ? 0.810   -17.887 -2.327  1.00 0.00 ? 39  PHE A O      1  
ATOM   461    C  CB     . PHE A 1 32  ? -2.220  -18.058 -3.272  1.00 0.00 ? 39  PHE A CB     1  
ATOM   462    C  CG     . PHE A 1 32  ? -3.117  -17.891 -2.078  1.00 0.00 ? 39  PHE A CG     1  
ATOM   463    C  CD1    . PHE A 1 32  ? -4.105  -16.919 -2.067  1.00 0.00 ? 39  PHE A CD1    1  
ATOM   464    C  CD2    . PHE A 1 32  ? -2.977  -18.709 -0.967  1.00 0.00 ? 39  PHE A CD2    1  
ATOM   465    C  CE1    . PHE A 1 32  ? -4.935  -16.767 -0.974  1.00 0.00 ? 39  PHE A CE1    1  
ATOM   466    C  CE2    . PHE A 1 32  ? -3.805  -18.559 0.129   1.00 0.00 ? 39  PHE A CE2    1  
ATOM   467    C  CZ     . PHE A 1 32  ? -4.784  -17.587 0.125   1.00 0.00 ? 39  PHE A CZ     1  
ATOM   468    H  H      . PHE A 1 32  ? -0.398  -17.994 -5.100  1.00 0.00 ? 39  PHE A H      1  
ATOM   469    H  HA     . PHE A 1 32  ? -1.592  -16.009 -3.356  1.00 0.00 ? 39  PHE A HA     1  
ATOM   470    H  HB2    . PHE A 1 32  ? -2.841  -18.032 -4.156  1.00 0.00 ? 39  PHE A HB2    1  
ATOM   471    H  HB3    . PHE A 1 32  ? -1.747  -19.026 -3.201  1.00 0.00 ? 39  PHE A HB3    1  
ATOM   472    H  HD1    . PHE A 1 32  ? -4.223  -16.277 -2.925  1.00 0.00 ? 39  PHE A HD1    1  
ATOM   473    H  HD2    . PHE A 1 32  ? -2.210  -19.470 -0.963  1.00 0.00 ? 39  PHE A HD2    1  
ATOM   474    H  HE1    . PHE A 1 32  ? -5.701  -16.005 -0.980  1.00 0.00 ? 39  PHE A HE1    1  
ATOM   475    H  HE2    . PHE A 1 32  ? -3.684  -19.201 0.989   1.00 0.00 ? 39  PHE A HE2    1  
ATOM   476    H  HZ     . PHE A 1 32  ? -5.433  -17.469 0.980   1.00 0.00 ? 39  PHE A HZ     1  
ATOM   477    N  N      . VAL A 1 33  ? -0.355  -16.336 -1.196  1.00 0.00 ? 40  VAL A N      1  
ATOM   478    C  CA     . VAL A 1 33  ? 0.556   -16.325 -0.065  1.00 0.00 ? 40  VAL A CA     1  
ATOM   479    C  C      . VAL A 1 33  ? 0.508   -17.651 0.683   1.00 0.00 ? 40  VAL A C      1  
ATOM   480    O  O      . VAL A 1 33  ? -0.417  -17.906 1.454   1.00 0.00 ? 40  VAL A O      1  
ATOM   481    C  CB     . VAL A 1 33  ? 0.227   -15.173 0.910   1.00 0.00 ? 40  VAL A CB     1  
ATOM   482    C  CG1    . VAL A 1 33  ? 1.237   -15.113 2.046   1.00 0.00 ? 40  VAL A CG1    1  
ATOM   483    C  CG2    . VAL A 1 33  ? 0.174   -13.849 0.168   1.00 0.00 ? 40  VAL A CG2    1  
ATOM   484    H  H      . VAL A 1 33  ? -1.150  -15.769 -1.173  1.00 0.00 ? 40  VAL A H      1  
ATOM   485    H  HA     . VAL A 1 33  ? 1.556   -16.174 -0.441  1.00 0.00 ? 40  VAL A HA     1  
ATOM   486    H  HB     . VAL A 1 33  ? -0.747  -15.360 1.337   1.00 0.00 ? 40  VAL A HB     1  
ATOM   487    H  HG11   . VAL A 1 33  ? 2.223   -14.937 1.642   1.00 0.00 ? 40  VAL A HG11   1  
ATOM   488    H  HG12   . VAL A 1 33  ? 1.229   -16.050 2.582   1.00 0.00 ? 40  VAL A HG12   1  
ATOM   489    H  HG13   . VAL A 1 33  ? 0.975   -14.310 2.720   1.00 0.00 ? 40  VAL A HG13   1  
ATOM   490    H  HG21   . VAL A 1 33  ? -0.591  -13.894 -0.595  1.00 0.00 ? 40  VAL A HG21   1  
ATOM   491    H  HG22   . VAL A 1 33  ? 1.132   -13.658 -0.295  1.00 0.00 ? 40  VAL A HG22   1  
ATOM   492    H  HG23   . VAL A 1 33  ? -0.056  -13.053 0.861   1.00 0.00 ? 40  VAL A HG23   1  
ATOM   493    N  N      . GLU A 1 34  ? 1.491   -18.502 0.423   1.00 0.00 ? 41  GLU A N      1  
ATOM   494    C  CA     . GLU A 1 34  ? 1.624   -19.756 1.146   1.00 0.00 ? 41  GLU A CA     1  
ATOM   495    C  C      . GLU A 1 34  ? 2.090   -19.479 2.565   1.00 0.00 ? 41  GLU A C      1  
ATOM   496    O  O      . GLU A 1 34  ? 1.413   -19.817 3.536   1.00 0.00 ? 41  GLU A O      1  
ATOM   497    C  CB     . GLU A 1 34  ? 2.624   -20.671 0.449   1.00 0.00 ? 41  GLU A CB     1  
ATOM   498    C  CG     . GLU A 1 34  ? 2.250   -21.020 -0.978  1.00 0.00 ? 41  GLU A CG     1  
ATOM   499    C  CD     . GLU A 1 34  ? 3.297   -21.885 -1.641  1.00 0.00 ? 41  GLU A CD     1  
ATOM   500    O  OE1    . GLU A 1 34  ? 3.213   -23.123 -1.518  1.00 0.00 ? 41  GLU A OE1    1  
ATOM   501    O  OE2    . GLU A 1 34  ? 4.213   -21.329 -2.277  1.00 0.00 ? 41  GLU A OE2    1  
ATOM   502    H  H      . GLU A 1 34  ? 2.136   -18.286 -0.283  1.00 0.00 ? 41  GLU A H      1  
ATOM   503    H  HA     . GLU A 1 34  ? 0.657   -20.233 1.172   1.00 0.00 ? 41  GLU A HA     1  
ATOM   504    H  HB2    . GLU A 1 34  ? 3.586   -20.184 0.433   1.00 0.00 ? 41  GLU A HB2    1  
ATOM   505    H  HB3    . GLU A 1 34  ? 2.704   -21.590 1.012   1.00 0.00 ? 41  GLU A HB3    1  
ATOM   506    H  HG2    . GLU A 1 34  ? 1.311   -21.553 -0.973  1.00 0.00 ? 41  GLU A HG2    1  
ATOM   507    H  HG3    . GLU A 1 34  ? 2.145   -20.107 -1.544  1.00 0.00 ? 41  GLU A HG3    1  
ATOM   508    N  N      . ASP A 1 35  ? 3.259   -18.861 2.663   1.00 0.00 ? 42  ASP A N      1  
ATOM   509    C  CA     . ASP A 1 35  ? 3.804   -18.422 3.938   1.00 0.00 ? 42  ASP A CA     1  
ATOM   510    C  C      . ASP A 1 35  ? 4.747   -17.253 3.705   1.00 0.00 ? 42  ASP A C      1  
ATOM   511    O  O      . ASP A 1 35  ? 5.867   -17.424 3.224   1.00 0.00 ? 42  ASP A O      1  
ATOM   512    C  CB     . ASP A 1 35  ? 4.538   -19.558 4.659   1.00 0.00 ? 42  ASP A CB     1  
ATOM   513    C  CG     . ASP A 1 35  ? 5.010   -19.159 6.047   1.00 0.00 ? 42  ASP A CG     1  
ATOM   514    O  OD1    . ASP A 1 35  ? 4.170   -19.109 6.973   1.00 0.00 ? 42  ASP A OD1    1  
ATOM   515    O  OD2    . ASP A 1 35  ? 6.220   -18.905 6.215   1.00 0.00 ? 42  ASP A OD2    1  
ATOM   516    H  H      . ASP A 1 35  ? 3.775   -18.695 1.849   1.00 0.00 ? 42  ASP A H      1  
ATOM   517    H  HA     . ASP A 1 35  ? 2.980   -18.086 4.552   1.00 0.00 ? 42  ASP A HA     1  
ATOM   518    H  HB2    . ASP A 1 35  ? 3.872   -20.401 4.756   1.00 0.00 ? 42  ASP A HB2    1  
ATOM   519    H  HB3    . ASP A 1 35  ? 5.399   -19.849 4.074   1.00 0.00 ? 42  ASP A HB3    1  
ATOM   520    N  N      . TYR A 1 36  ? 4.260   -16.062 3.999   1.00 0.00 ? 43  TYR A N      1  
ATOM   521    C  CA     . TYR A 1 36  ? 5.043   -14.846 3.850   1.00 0.00 ? 43  TYR A CA     1  
ATOM   522    C  C      . TYR A 1 36  ? 4.681   -13.899 4.981   1.00 0.00 ? 43  TYR A C      1  
ATOM   523    O  O      . TYR A 1 36  ? 3.704   -13.154 4.896   1.00 0.00 ? 43  TYR A O      1  
ATOM   524    C  CB     . TYR A 1 36  ? 4.781   -14.196 2.481   1.00 0.00 ? 43  TYR A CB     1  
ATOM   525    C  CG     . TYR A 1 36  ? 5.813   -13.162 2.074   1.00 0.00 ? 43  TYR A CG     1  
ATOM   526    C  CD1    . TYR A 1 36  ? 7.160   -13.493 2.019   1.00 0.00 ? 43  TYR A CD1    1  
ATOM   527    C  CD2    . TYR A 1 36  ? 5.442   -11.865 1.726   1.00 0.00 ? 43  TYR A CD2    1  
ATOM   528    C  CE1    . TYR A 1 36  ? 8.109   -12.568 1.634   1.00 0.00 ? 43  TYR A CE1    1  
ATOM   529    C  CE2    . TYR A 1 36  ? 6.390   -10.932 1.342   1.00 0.00 ? 43  TYR A CE2    1  
ATOM   530    C  CZ     . TYR A 1 36  ? 7.723   -11.292 1.299   1.00 0.00 ? 43  TYR A CZ     1  
ATOM   531    O  OH     . TYR A 1 36  ? 8.675   -10.380 0.906   1.00 0.00 ? 43  TYR A OH     1  
ATOM   532    H  H      . TYR A 1 36  ? 3.342   -15.997 4.348   1.00 0.00 ? 43  TYR A H      1  
ATOM   533    H  HA     . TYR A 1 36  ? 6.088   -15.105 3.931   1.00 0.00 ? 43  TYR A HA     1  
ATOM   534    H  HB2    . TYR A 1 36  ? 4.768   -14.966 1.725   1.00 0.00 ? 43  TYR A HB2    1  
ATOM   535    H  HB3    . TYR A 1 36  ? 3.816   -13.709 2.501   1.00 0.00 ? 43  TYR A HB3    1  
ATOM   536    H  HD1    . TYR A 1 36  ? 7.464   -14.495 2.285   1.00 0.00 ? 43  TYR A HD1    1  
ATOM   537    H  HD2    . TYR A 1 36  ? 4.394   -11.588 1.757   1.00 0.00 ? 43  TYR A HD2    1  
ATOM   538    H  HE1    . TYR A 1 36  ? 9.151   -12.849 1.601   1.00 0.00 ? 43  TYR A HE1    1  
ATOM   539    H  HE2    . TYR A 1 36  ? 6.086   -9.930  1.079   1.00 0.00 ? 43  TYR A HE2    1  
ATOM   540    H  HH     . TYR A 1 36  ? 8.573   -9.554  1.411   1.00 0.00 ? 43  TYR A HH     1  
ATOM   541    N  N      . GLU A 1 37  ? 5.449   -13.964 6.054   1.00 0.00 ? 44  GLU A N      1  
ATOM   542    C  CA     . GLU A 1 37  ? 5.131   -13.230 7.270   1.00 0.00 ? 44  GLU A CA     1  
ATOM   543    C  C      . GLU A 1 37  ? 5.435   -11.730 7.145   1.00 0.00 ? 44  GLU A C      1  
ATOM   544    O  O      . GLU A 1 37  ? 4.495   -10.933 7.161   1.00 0.00 ? 44  GLU A O      1  
ATOM   545    C  CB     . GLU A 1 37  ? 5.867   -13.836 8.471   1.00 0.00 ? 44  GLU A CB     1  
ATOM   546    C  CG     . GLU A 1 37  ? 5.629   -13.093 9.773   1.00 0.00 ? 44  GLU A CG     1  
ATOM   547    C  CD     . GLU A 1 37  ? 6.417   -13.672 10.928  1.00 0.00 ? 44  GLU A CD     1  
ATOM   548    O  OE1    . GLU A 1 37  ? 7.626   -13.380 11.030  1.00 0.00 ? 44  GLU A OE1    1  
ATOM   549    O  OE2    . GLU A 1 37  ? 5.830   -14.421 11.734  1.00 0.00 ? 44  GLU A OE2    1  
ATOM   550    H  H      . GLU A 1 37  ? 6.259   -14.521 6.028   1.00 0.00 ? 44  GLU A H      1  
ATOM   551    H  HA     . GLU A 1 37  ? 4.070   -13.339 7.437   1.00 0.00 ? 44  GLU A HA     1  
ATOM   552    H  HB2    . GLU A 1 37  ? 5.541   -14.857 8.599   1.00 0.00 ? 44  GLU A HB2    1  
ATOM   553    H  HB3    . GLU A 1 37  ? 6.929   -13.830 8.267   1.00 0.00 ? 44  GLU A HB3    1  
ATOM   554    H  HG2    . GLU A 1 37  ? 5.922   -12.062 9.640   1.00 0.00 ? 44  GLU A HG2    1  
ATOM   555    H  HG3    . GLU A 1 37  ? 4.576   -13.139 10.012  1.00 0.00 ? 44  GLU A HG3    1  
ATOM   556    N  N      . PRO A 1 38  ? 6.736   -11.343 6.964   1.00 0.00 ? 45  PRO A N      1  
ATOM   557    C  CA     . PRO A 1 38  ? 7.232   -9.962  7.095   1.00 0.00 ? 45  PRO A CA     1  
ATOM   558    C  C      . PRO A 1 38  ? 6.209   -8.858  6.805   1.00 0.00 ? 45  PRO A C      1  
ATOM   559    O  O      . PRO A 1 38  ? 5.340   -8.578  7.634   1.00 0.00 ? 45  PRO A O      1  
ATOM   560    C  CB     . PRO A 1 38  ? 8.364   -9.932  6.075   1.00 0.00 ? 45  PRO A CB     1  
ATOM   561    C  CG     . PRO A 1 38  ? 8.945   -11.306 6.114   1.00 0.00 ? 45  PRO A CG     1  
ATOM   562    C  CD     . PRO A 1 38  ? 7.850   -12.240 6.580   1.00 0.00 ? 45  PRO A CD     1  
ATOM   563    H  HA     . PRO A 1 38  ? 7.646   -9.797  8.078   1.00 0.00 ? 45  PRO A HA     1  
ATOM   564    H  HB2    . PRO A 1 38  ? 7.964   -9.698  5.098   1.00 0.00 ? 45  PRO A HB2    1  
ATOM   565    H  HB3    . PRO A 1 38  ? 9.092   -9.189  6.359   1.00 0.00 ? 45  PRO A HB3    1  
ATOM   566    H  HG2    . PRO A 1 38  ? 9.280   -11.588 5.127   1.00 0.00 ? 45  PRO A HG2    1  
ATOM   567    H  HG3    . PRO A 1 38  ? 9.773   -11.329 6.808   1.00 0.00 ? 45  PRO A HG3    1  
ATOM   568    H  HD2    . PRO A 1 38  ? 7.553   -12.896 5.775   1.00 0.00 ? 45  PRO A HD2    1  
ATOM   569    H  HD3    . PRO A 1 38  ? 8.188   -12.818 7.428   1.00 0.00 ? 45  PRO A HD3    1  
ATOM   570    N  N      . THR A 1 39  ? 6.330   -8.229  5.635   1.00 0.00 ? 46  THR A N      1  
ATOM   571    C  CA     . THR A 1 39  ? 5.456   -7.121  5.225   1.00 0.00 ? 46  THR A CA     1  
ATOM   572    C  C      . THR A 1 39  ? 5.219   -6.118  6.357   1.00 0.00 ? 46  THR A C      1  
ATOM   573    O  O      . THR A 1 39  ? 4.120   -5.593  6.509   1.00 0.00 ? 46  THR A O      1  
ATOM   574    C  CB     . THR A 1 39  ? 4.094   -7.631  4.700   1.00 0.00 ? 46  THR A CB     1  
ATOM   575    O  OG1    . THR A 1 39  ? 3.454   -8.457  5.685   1.00 0.00 ? 46  THR A OG1    1  
ATOM   576    C  CG2    . THR A 1 39  ? 4.273   -8.418  3.412   1.00 0.00 ? 46  THR A CG2    1  
ATOM   577    H  H      . THR A 1 39  ? 7.036   -8.517  5.019   1.00 0.00 ? 46  THR A H      1  
ATOM   578    H  HA     . THR A 1 39  ? 5.950   -6.606  4.415   1.00 0.00 ? 46  THR A HA     1  
ATOM   579    H  HB     . THR A 1 39  ? 3.461   -6.778  4.496   1.00 0.00 ? 46  THR A HB     1  
ATOM   580    H  HG1    . THR A 1 39  ? 4.110   -8.686  6.369   1.00 0.00 ? 46  THR A HG1    1  
ATOM   581    H  HG21   . THR A 1 39  ? 4.709   -7.781  2.657   1.00 0.00 ? 46  THR A HG21   1  
ATOM   582    H  HG22   . THR A 1 39  ? 3.312   -8.774  3.073   1.00 0.00 ? 46  THR A HG22   1  
ATOM   583    H  HG23   . THR A 1 39  ? 4.926   -9.259  3.595   1.00 0.00 ? 46  THR A HG23   1  
ATOM   584    N  N      . LYS A 1 40  ? 6.245   -5.869  7.163   1.00 0.00 ? 47  LYS A N      1  
ATOM   585    C  CA     . LYS A 1 40  ? 6.147   -4.868  8.213   1.00 0.00 ? 47  LYS A CA     1  
ATOM   586    C  C      . LYS A 1 40  ? 6.463   -3.520  7.593   1.00 0.00 ? 47  LYS A C      1  
ATOM   587    O  O      . LYS A 1 40  ? 5.701   -2.564  7.703   1.00 0.00 ? 47  LYS A O      1  
ATOM   588    C  CB     . LYS A 1 40  ? 7.130   -5.168  9.352   1.00 0.00 ? 47  LYS A CB     1  
ATOM   589    C  CG     . LYS A 1 40  ? 7.196   -6.640  9.745   1.00 0.00 ? 47  LYS A CG     1  
ATOM   590    C  CD     . LYS A 1 40  ? 8.198   -6.877  10.867  1.00 0.00 ? 47  LYS A CD     1  
ATOM   591    C  CE     . LYS A 1 40  ? 7.617   -6.532  12.228  1.00 0.00 ? 47  LYS A CE     1  
ATOM   592    N  NZ     . LYS A 1 40  ? 6.617   -7.538  12.667  1.00 0.00 ? 47  LYS A NZ     1  
ATOM   593    H  H      . LYS A 1 40  ? 7.080   -6.363  7.045   1.00 0.00 ? 47  LYS A H      1  
ATOM   594    H  HA     . LYS A 1 40  ? 5.135   -4.863  8.592   1.00 0.00 ? 47  LYS A HA     1  
ATOM   595    H  HB2    . LYS A 1 40  ? 8.119   -4.857  9.045   1.00 0.00 ? 47  LYS A HB2    1  
ATOM   596    H  HB3    . LYS A 1 40  ? 6.837   -4.599  10.222  1.00 0.00 ? 47  LYS A HB3    1  
ATOM   597    H  HG2    . LYS A 1 40  ? 6.219   -6.959  10.076  1.00 0.00 ? 47  LYS A HG2    1  
ATOM   598    H  HG3    . LYS A 1 40  ? 7.493   -7.217  8.882   1.00 0.00 ? 47  LYS A HG3    1  
ATOM   599    H  HD2    . LYS A 1 40  ? 8.481   -7.919  10.866  1.00 0.00 ? 47  LYS A HD2    1  
ATOM   600    H  HD3    . LYS A 1 40  ? 9.072   -6.267  10.691  1.00 0.00 ? 47  LYS A HD3    1  
ATOM   601    H  HE2    . LYS A 1 40  ? 8.420   -6.495  12.949  1.00 0.00 ? 47  LYS A HE2    1  
ATOM   602    H  HE3    . LYS A 1 40  ? 7.142   -5.563  12.167  1.00 0.00 ? 47  LYS A HE3    1  
ATOM   603    H  HZ1    . LYS A 1 40  ? 7.060   -8.484  12.718  1.00 0.00 ? 47  LYS A HZ1    1  
ATOM   604    H  HZ2    . LYS A 1 40  ? 5.822   -7.577  11.993  1.00 0.00 ? 47  LYS A HZ2    1  
ATOM   605    H  HZ3    . LYS A 1 40  ? 6.244   -7.294  13.609  1.00 0.00 ? 47  LYS A HZ3    1  
ATOM   606    N  N      . ALA A 1 41  ? 7.629   -3.469  6.969   1.00 0.00 ? 48  ALA A N      1  
ATOM   607    C  CA     . ALA A 1 41  ? 8.011   -2.369  6.102   1.00 0.00 ? 48  ALA A CA     1  
ATOM   608    C  C      . ALA A 1 41  ? 8.407   -2.929  4.745   1.00 0.00 ? 48  ALA A C      1  
ATOM   609    O  O      . ALA A 1 41  ? 8.596   -2.196  3.777   1.00 0.00 ? 48  ALA A O      1  
ATOM   610    C  CB     . ALA A 1 41  ? 9.158   -1.584  6.717   1.00 0.00 ? 48  ALA A CB     1  
ATOM   611    H  H      . ALA A 1 41  ? 8.260   -4.210  7.091   1.00 0.00 ? 48  ALA A H      1  
ATOM   612    H  HA     . ALA A 1 41  ? 7.160   -1.711  5.986   1.00 0.00 ? 48  ALA A HA     1  
ATOM   613    H  HB1    . ALA A 1 41  ? 9.443   -0.781  6.055   1.00 0.00 ? 48  ALA A HB1    1  
ATOM   614    H  HB2    . ALA A 1 41  ? 10.002  -2.240  6.873   1.00 0.00 ? 48  ALA A HB2    1  
ATOM   615    H  HB3    . ALA A 1 41  ? 8.843   -1.174  7.665   1.00 0.00 ? 48  ALA A HB3    1  
ATOM   616    N  N      . ASP A 1 42  ? 8.526   -4.250  4.698   1.00 0.00 ? 49  ASP A N      1  
ATOM   617    C  CA     . ASP A 1 42  ? 8.976   -4.947  3.504   1.00 0.00 ? 49  ASP A CA     1  
ATOM   618    C  C      . ASP A 1 42  ? 7.905   -4.922  2.425   1.00 0.00 ? 49  ASP A C      1  
ATOM   619    O  O      . ASP A 1 42  ? 6.792   -5.414  2.622   1.00 0.00 ? 49  ASP A O      1  
ATOM   620    C  CB     . ASP A 1 42  ? 9.349   -6.393  3.845   1.00 0.00 ? 49  ASP A CB     1  
ATOM   621    C  CG     . ASP A 1 42  ? 9.775   -7.190  2.629   1.00 0.00 ? 49  ASP A CG     1  
ATOM   622    O  OD1    . ASP A 1 42  ? 10.847  -6.884  2.062   1.00 0.00 ? 49  ASP A OD1    1  
ATOM   623    O  OD2    . ASP A 1 42  ? 9.043   -8.126  2.245   1.00 0.00 ? 49  ASP A OD2    1  
ATOM   624    H  H      . ASP A 1 42  ? 8.295   -4.773  5.491   1.00 0.00 ? 49  ASP A H      1  
ATOM   625    H  HA     . ASP A 1 42  ? 9.852   -4.436  3.135   1.00 0.00 ? 49  ASP A HA     1  
ATOM   626    H  HB2    . ASP A 1 42  ? 10.166  -6.389  4.551   1.00 0.00 ? 49  ASP A HB2    1  
ATOM   627    H  HB3    . ASP A 1 42  ? 8.495   -6.882  4.292   1.00 0.00 ? 49  ASP A HB3    1  
ATOM   628    N  N      . SER A 1 43  ? 8.241   -4.324  1.297   1.00 0.00 ? 50  SER A N      1  
ATOM   629    C  CA     . SER A 1 43  ? 7.332   -4.233  0.173   1.00 0.00 ? 50  SER A CA     1  
ATOM   630    C  C      . SER A 1 43  ? 8.123   -4.124  -1.126  1.00 0.00 ? 50  SER A C      1  
ATOM   631    O  O      . SER A 1 43  ? 9.286   -3.704  -1.125  1.00 0.00 ? 50  SER A O      1  
ATOM   632    C  CB     . SER A 1 43  ? 6.399   -3.027  0.336   1.00 0.00 ? 50  SER A CB     1  
ATOM   633    O  OG     . SER A 1 43  ? 5.574   -3.167  1.483   1.00 0.00 ? 50  SER A OG     1  
ATOM   634    H  H      . SER A 1 43  ? 9.137   -3.937  1.212   1.00 0.00 ? 50  SER A H      1  
ATOM   635    H  HA     . SER A 1 43  ? 6.742   -5.137  0.148   1.00 0.00 ? 50  SER A HA     1  
ATOM   636    H  HB2    . SER A 1 43  ? 6.989   -2.130  0.445   1.00 0.00 ? 50  SER A HB2    1  
ATOM   637    H  HB3    . SER A 1 43  ? 5.769   -2.940  -0.536  1.00 0.00 ? 50  SER A HB3    1  
ATOM   638    H  HG     . SER A 1 43  ? 5.921   -3.878  2.041   1.00 0.00 ? 50  SER A HG     1  
ATOM   639    N  N      . TYR A 1 44  ? 7.502   -4.514  -2.226  1.00 0.00 ? 51  TYR A N      1  
ATOM   640    C  CA     . TYR A 1 44  ? 8.158   -4.490  -3.524  1.00 0.00 ? 51  TYR A CA     1  
ATOM   641    C  C      . TYR A 1 44  ? 7.354   -3.663  -4.519  1.00 0.00 ? 51  TYR A C      1  
ATOM   642    O  O      . TYR A 1 44  ? 6.177   -3.380  -4.298  1.00 0.00 ? 51  TYR A O      1  
ATOM   643    C  CB     . TYR A 1 44  ? 8.347   -5.916  -4.053  1.00 0.00 ? 51  TYR A CB     1  
ATOM   644    C  CG     . TYR A 1 44  ? 9.398   -6.715  -3.309  1.00 0.00 ? 51  TYR A CG     1  
ATOM   645    C  CD1    . TYR A 1 44  ? 9.080   -7.421  -2.153  1.00 0.00 ? 51  TYR A CD1    1  
ATOM   646    C  CD2    . TYR A 1 44  ? 10.709  -6.763  -3.765  1.00 0.00 ? 51  TYR A CD2    1  
ATOM   647    C  CE1    . TYR A 1 44  ? 10.041  -8.148  -1.475  1.00 0.00 ? 51  TYR A CE1    1  
ATOM   648    C  CE2    . TYR A 1 44  ? 11.673  -7.489  -3.093  1.00 0.00 ? 51  TYR A CE2    1  
ATOM   649    C  CZ     . TYR A 1 44  ? 11.334  -8.180  -1.951  1.00 0.00 ? 51  TYR A CZ     1  
ATOM   650    O  OH     . TYR A 1 44  ? 12.294  -8.905  -1.284  1.00 0.00 ? 51  TYR A OH     1  
ATOM   651    H  H      . TYR A 1 44  ? 6.572   -4.816  -2.170  1.00 0.00 ? 51  TYR A H      1  
ATOM   652    H  HA     . TYR A 1 44  ? 9.128   -4.032  -3.396  1.00 0.00 ? 51  TYR A HA     1  
ATOM   653    H  HB2    . TYR A 1 44  ? 7.411   -6.446  -3.969  1.00 0.00 ? 51  TYR A HB2    1  
ATOM   654    H  HB3    . TYR A 1 44  ? 8.636   -5.870  -5.092  1.00 0.00 ? 51  TYR A HB3    1  
ATOM   655    H  HD1    . TYR A 1 44  ? 8.066   -7.397  -1.785  1.00 0.00 ? 51  TYR A HD1    1  
ATOM   656    H  HD2    . TYR A 1 44  ? 10.973  -6.222  -4.661  1.00 0.00 ? 51  TYR A HD2    1  
ATOM   657    H  HE1    . TYR A 1 44  ? 9.777   -8.689  -0.579  1.00 0.00 ? 51  TYR A HE1    1  
ATOM   658    H  HE2    . TYR A 1 44  ? 12.687  -7.512  -3.464  1.00 0.00 ? 51  TYR A HE2    1  
ATOM   659    H  HH     . TYR A 1 44  ? 11.929  -9.769  -1.042  1.00 0.00 ? 51  TYR A HH     1  
ATOM   660    N  N      . ARG A 1 45  ? 8.001   -3.277  -5.607  1.00 0.00 ? 52  ARG A N      1  
ATOM   661    C  CA     . ARG A 1 45  ? 7.357   -2.481  -6.642  1.00 0.00 ? 52  ARG A CA     1  
ATOM   662    C  C      . ARG A 1 45  ? 7.037   -3.350  -7.851  1.00 0.00 ? 52  ARG A C      1  
ATOM   663    O  O      . ARG A 1 45  ? 7.799   -4.254  -8.194  1.00 0.00 ? 52  ARG A O      1  
ATOM   664    C  CB     . ARG A 1 45  ? 8.259   -1.318  -7.055  1.00 0.00 ? 52  ARG A CB     1  
ATOM   665    C  CG     . ARG A 1 45  ? 8.620   -0.397  -5.905  1.00 0.00 ? 52  ARG A CG     1  
ATOM   666    C  CD     . ARG A 1 45  ? 9.516   0.739   -6.363  1.00 0.00 ? 52  ARG A CD     1  
ATOM   667    N  NE     . ARG A 1 45  ? 10.782  0.260   -6.923  1.00 0.00 ? 52  ARG A NE     1  
ATOM   668    C  CZ     . ARG A 1 45  ? 11.935  0.914   -6.816  1.00 0.00 ? 52  ARG A CZ     1  
ATOM   669    N  NH1    . ARG A 1 45  ? 11.984  2.071   -6.170  1.00 0.00 ? 52  ARG A NH1    1  
ATOM   670    N  NH2    . ARG A 1 45  ? 13.041  0.415   -7.352  1.00 0.00 ? 52  ARG A NH2    1  
ATOM   671    H  H      . ARG A 1 45  ? 8.935   -3.538  -5.723  1.00 0.00 ? 52  ARG A H      1  
ATOM   672    H  HA     . ARG A 1 45  ? 6.436   -2.088  -6.237  1.00 0.00 ? 52  ARG A HA     1  
ATOM   673    H  HB2    . ARG A 1 45  ? 9.173   -1.717  -7.472  1.00 0.00 ? 52  ARG A HB2    1  
ATOM   674    H  HB3    . ARG A 1 45  ? 7.753   -0.735  -7.810  1.00 0.00 ? 52  ARG A HB3    1  
ATOM   675    H  HG2    . ARG A 1 45  ? 7.713   0.019   -5.493  1.00 0.00 ? 52  ARG A HG2    1  
ATOM   676    H  HG3    . ARG A 1 45  ? 9.133   -0.969  -5.146  1.00 0.00 ? 52  ARG A HG3    1  
ATOM   677    H  HD2    . ARG A 1 45  ? 8.994   1.307   -7.118  1.00 0.00 ? 52  ARG A HD2    1  
ATOM   678    H  HD3    . ARG A 1 45  ? 9.726   1.377   -5.516  1.00 0.00 ? 52  ARG A HD3    1  
ATOM   679    H  HE     . ARG A 1 45  ? 10.766  -0.599  -7.414  1.00 0.00 ? 52  ARG A HE     1  
ATOM   680    H  HH11   . ARG A 1 45  ? 11.156  2.452   -5.759  1.00 0.00 ? 52  ARG A HH11   1  
ATOM   681    H  HH12   . ARG A 1 45  ? 12.859  2.571   -6.091  1.00 0.00 ? 52  ARG A HH12   1  
ATOM   682    H  HH21   . ARG A 1 45  ? 13.018  -0.465  -7.845  1.00 0.00 ? 52  ARG A HH21   1  
ATOM   683    H  HH22   . ARG A 1 45  ? 13.909  0.909   -7.269  1.00 0.00 ? 52  ARG A HH22   1  
ATOM   684    N  N      . LYS A 1 46  ? 5.918   -3.068  -8.496  1.00 0.00 ? 53  LYS A N      1  
ATOM   685    C  CA     . LYS A 1 46  ? 5.471   -3.866  -9.625  1.00 0.00 ? 53  LYS A CA     1  
ATOM   686    C  C      . LYS A 1 46  ? 5.676   -3.120  -10.941 1.00 0.00 ? 53  LYS A C      1  
ATOM   687    O  O      . LYS A 1 46  ? 5.285   -1.959  -11.079 1.00 0.00 ? 53  LYS A O      1  
ATOM   688    C  CB     . LYS A 1 46  ? 3.996   -4.251  -9.446  1.00 0.00 ? 53  LYS A CB     1  
ATOM   689    C  CG     . LYS A 1 46  ? 3.398   -5.003  -10.626 1.00 0.00 ? 53  LYS A CG     1  
ATOM   690    C  CD     . LYS A 1 46  ? 4.177   -6.272  -10.947 1.00 0.00 ? 53  LYS A CD     1  
ATOM   691    C  CE     . LYS A 1 46  ? 3.534   -7.048  -12.088 1.00 0.00 ? 53  LYS A CE     1  
ATOM   692    N  NZ     . LYS A 1 46  ? 4.215   -8.346  -12.339 1.00 0.00 ? 53  LYS A NZ     1  
ATOM   693    H  H      . LYS A 1 46  ? 5.382   -2.295  -8.213  1.00 0.00 ? 53  LYS A H      1  
ATOM   694    H  HA     . LYS A 1 46  ? 6.064   -4.767  -9.646  1.00 0.00 ? 53  LYS A HA     1  
ATOM   695    H  HB2    . LYS A 1 46  ? 3.906   -4.877  -8.570  1.00 0.00 ? 53  LYS A HB2    1  
ATOM   696    H  HB3    . LYS A 1 46  ? 3.420   -3.352  -9.292  1.00 0.00 ? 53  LYS A HB3    1  
ATOM   697    H  HG2    . LYS A 1 46  ? 2.378   -5.270  -10.389 1.00 0.00 ? 53  LYS A HG2    1  
ATOM   698    H  HG3    . LYS A 1 46  ? 3.409   -4.357  -11.491 1.00 0.00 ? 53  LYS A HG3    1  
ATOM   699    H  HD2    . LYS A 1 46  ? 5.181   -6.000  -11.236 1.00 0.00 ? 53  LYS A HD2    1  
ATOM   700    H  HD3    . LYS A 1 46  ? 4.214   -6.896  -10.071 1.00 0.00 ? 53  LYS A HD3    1  
ATOM   701    H  HE2    . LYS A 1 46  ? 2.501   -7.238  -11.838 1.00 0.00 ? 53  LYS A HE2    1  
ATOM   702    H  HE3    . LYS A 1 46  ? 3.582   -6.446  -12.985 1.00 0.00 ? 53  LYS A HE3    1  
ATOM   703    H  HZ1    . LYS A 1 46  ? 5.251   -8.226  -12.315 1.00 0.00 ? 53  LYS A HZ1    1  
ATOM   704    H  HZ2    . LYS A 1 46  ? 3.945   -8.714  -13.278 1.00 0.00 ? 53  LYS A HZ2    1  
ATOM   705    H  HZ3    . LYS A 1 46  ? 3.939   -9.045  -11.618 1.00 0.00 ? 53  LYS A HZ3    1  
ATOM   706    N  N      . LYS A 1 47  ? 6.319   -3.790  -11.889 1.00 0.00 ? 54  LYS A N      1  
ATOM   707    C  CA     . LYS A 1 47  ? 6.473   -3.262  -13.235 1.00 0.00 ? 54  LYS A CA     1  
ATOM   708    C  C      . LYS A 1 47  ? 5.279   -3.668  -14.089 1.00 0.00 ? 54  LYS A C      1  
ATOM   709    O  O      . LYS A 1 47  ? 5.045   -4.854  -14.324 1.00 0.00 ? 54  LYS A O      1  
ATOM   710    C  CB     . LYS A 1 47  ? 7.766   -3.776  -13.876 1.00 0.00 ? 54  LYS A CB     1  
ATOM   711    C  CG     . LYS A 1 47  ? 7.874   -3.449  -15.359 1.00 0.00 ? 54  LYS A CG     1  
ATOM   712    C  CD     . LYS A 1 47  ? 9.040   -4.168  -16.019 1.00 0.00 ? 54  LYS A CD     1  
ATOM   713    C  CE     . LYS A 1 47  ? 10.375  -3.514  -15.709 1.00 0.00 ? 54  LYS A CE     1  
ATOM   714    N  NZ     . LYS A 1 47  ? 10.519  -2.201  -16.395 1.00 0.00 ? 54  LYS A NZ     1  
ATOM   715    H  H      . LYS A 1 47  ? 6.697   -4.668  -11.678 1.00 0.00 ? 54  LYS A H      1  
ATOM   716    H  HA     . LYS A 1 47  ? 6.511   -2.184  -13.172 1.00 0.00 ? 54  LYS A HA     1  
ATOM   717    H  HB2    . LYS A 1 47  ? 8.610   -3.330  -13.368 1.00 0.00 ? 54  LYS A HB2    1  
ATOM   718    H  HB3    . LYS A 1 47  ? 7.812   -4.849  -13.760 1.00 0.00 ? 54  LYS A HB3    1  
ATOM   719    H  HG2    . LYS A 1 47  ? 6.960   -3.749  -15.848 1.00 0.00 ? 54  LYS A HG2    1  
ATOM   720    H  HG3    . LYS A 1 47  ? 8.011   -2.382  -15.470 1.00 0.00 ? 54  LYS A HG3    1  
ATOM   721    H  HD2    . LYS A 1 47  ? 9.062   -5.187  -15.665 1.00 0.00 ? 54  LYS A HD2    1  
ATOM   722    H  HD3    . LYS A 1 47  ? 8.889   -4.163  -17.088 1.00 0.00 ? 54  LYS A HD3    1  
ATOM   723    H  HE2    . LYS A 1 47  ? 10.449  -3.363  -14.641 1.00 0.00 ? 54  LYS A HE2    1  
ATOM   724    H  HE3    . LYS A 1 47  ? 11.168  -4.171  -16.036 1.00 0.00 ? 54  LYS A HE3    1  
ATOM   725    H  HZ1    . LYS A 1 47  ? 10.322  -2.307  -17.420 1.00 0.00 ? 54  LYS A HZ1    1  
ATOM   726    H  HZ2    . LYS A 1 47  ? 11.491  -1.841  -16.280 1.00 0.00 ? 54  LYS A HZ2    1  
ATOM   727    H  HZ3    . LYS A 1 47  ? 9.853   -1.505  -15.996 1.00 0.00 ? 54  LYS A HZ3    1  
ATOM   728    N  N      . VAL A 1 48  ? 4.517   -2.684  -14.530 1.00 0.00 ? 55  VAL A N      1  
ATOM   729    C  CA     . VAL A 1 48  ? 3.396   -2.927  -15.423 1.00 0.00 ? 55  VAL A CA     1  
ATOM   730    C  C      . VAL A 1 48  ? 3.524   -2.041  -16.648 1.00 0.00 ? 55  VAL A C      1  
ATOM   731    O  O      . VAL A 1 48  ? 4.031   -0.932  -16.558 1.00 0.00 ? 55  VAL A O      1  
ATOM   732    C  CB     . VAL A 1 48  ? 2.034   -2.662  -14.736 1.00 0.00 ? 55  VAL A CB     1  
ATOM   733    C  CG1    . VAL A 1 48  ? 1.736   -3.729  -13.696 1.00 0.00 ? 55  VAL A CG1    1  
ATOM   734    C  CG2    . VAL A 1 48  ? 2.004   -1.279  -14.101 1.00 0.00 ? 55  VAL A CG2    1  
ATOM   735    H  H      . VAL A 1 48  ? 4.716   -1.760  -14.254 1.00 0.00 ? 55  VAL A H      1  
ATOM   736    H  HA     . VAL A 1 48  ? 3.429   -3.962  -15.732 1.00 0.00 ? 55  VAL A HA     1  
ATOM   737    H  HB     . VAL A 1 48  ? 1.261   -2.702  -15.491 1.00 0.00 ? 55  VAL A HB     1  
ATOM   738    H  HG11   . VAL A 1 48  ? 0.793   -3.508  -13.214 1.00 0.00 ? 55  VAL A HG11   1  
ATOM   739    H  HG12   . VAL A 1 48  ? 2.523   -3.743  -12.956 1.00 0.00 ? 55  VAL A HG12   1  
ATOM   740    H  HG13   . VAL A 1 48  ? 1.677   -4.694  -14.176 1.00 0.00 ? 55  VAL A HG13   1  
ATOM   741    H  HG21   . VAL A 1 48  ? 2.146   -0.530  -14.866 1.00 0.00 ? 55  VAL A HG21   1  
ATOM   742    H  HG22   . VAL A 1 48  ? 2.795   -1.200  -13.369 1.00 0.00 ? 55  VAL A HG22   1  
ATOM   743    H  HG23   . VAL A 1 48  ? 1.050   -1.123  -13.620 1.00 0.00 ? 55  VAL A HG23   1  
ATOM   744    N  N      . VAL A 1 49  ? 3.093   -2.524  -17.792 1.00 0.00 ? 56  VAL A N      1  
ATOM   745    C  CA     . VAL A 1 49  ? 3.163   -1.728  -19.003 1.00 0.00 ? 56  VAL A CA     1  
ATOM   746    C  C      . VAL A 1 49  ? 1.764   -1.510  -19.566 1.00 0.00 ? 56  VAL A C      1  
ATOM   747    O  O      . VAL A 1 49  ? 1.078   -2.453  -19.958 1.00 0.00 ? 56  VAL A O      1  
ATOM   748    C  CB     . VAL A 1 49  ? 4.112   -2.346  -20.065 1.00 0.00 ? 56  VAL A CB     1  
ATOM   749    C  CG1    . VAL A 1 49  ? 3.714   -3.764  -20.423 1.00 0.00 ? 56  VAL A CG1    1  
ATOM   750    C  CG2    . VAL A 1 49  ? 4.164   -1.481  -21.313 1.00 0.00 ? 56  VAL A CG2    1  
ATOM   751    H  H      . VAL A 1 49  ? 2.698   -3.425  -17.822 1.00 0.00 ? 56  VAL A H      1  
ATOM   752    H  HA     . VAL A 1 49  ? 3.564   -0.762  -18.724 1.00 0.00 ? 56  VAL A HA     1  
ATOM   753    H  HB     . VAL A 1 49  ? 5.106   -2.377  -19.644 1.00 0.00 ? 56  VAL A HB     1  
ATOM   754    H  HG11   . VAL A 1 49  ? 3.731   -4.378  -19.536 1.00 0.00 ? 56  VAL A HG11   1  
ATOM   755    H  HG12   . VAL A 1 49  ? 4.410   -4.156  -21.148 1.00 0.00 ? 56  VAL A HG12   1  
ATOM   756    H  HG13   . VAL A 1 49  ? 2.718   -3.760  -20.843 1.00 0.00 ? 56  VAL A HG13   1  
ATOM   757    H  HG21   . VAL A 1 49  ? 3.173   -1.399  -21.736 1.00 0.00 ? 56  VAL A HG21   1  
ATOM   758    H  HG22   . VAL A 1 49  ? 4.828   -1.931  -22.036 1.00 0.00 ? 56  VAL A HG22   1  
ATOM   759    H  HG23   . VAL A 1 49  ? 4.529   -0.498  -21.056 1.00 0.00 ? 56  VAL A HG23   1  
ATOM   760    N  N      . LEU A 1 50  ? 1.330   -0.261  -19.561 1.00 0.00 ? 57  LEU A N      1  
ATOM   761    C  CA     . LEU A 1 50  ? -0.003  0.081   -20.021 1.00 0.00 ? 57  LEU A CA     1  
ATOM   762    C  C      . LEU A 1 50  ? 0.052   0.684   -21.413 1.00 0.00 ? 57  LEU A C      1  
ATOM   763    O  O      . LEU A 1 50  ? 0.427   1.846   -21.586 1.00 0.00 ? 57  LEU A O      1  
ATOM   764    C  CB     . LEU A 1 50  ? -0.700  1.047   -19.050 1.00 0.00 ? 57  LEU A CB     1  
ATOM   765    C  CG     . LEU A 1 50  ? -1.248  0.416   -17.762 1.00 0.00 ? 57  LEU A CG     1  
ATOM   766    C  CD1    . LEU A 1 50  ? -0.125  -0.012  -16.830 1.00 0.00 ? 57  LEU A CD1    1  
ATOM   767    C  CD2    . LEU A 1 50  ? -2.183  1.385   -17.058 1.00 0.00 ? 57  LEU A CD2    1  
ATOM   768    H  H      . LEU A 1 50  ? 1.927   0.452   -19.244 1.00 0.00 ? 57  LEU A H      1  
ATOM   769    H  HA     . LEU A 1 50  ? -0.575  -0.832  -20.069 1.00 0.00 ? 57  LEU A HA     1  
ATOM   770    H  HB2    . LEU A 1 50  ? 0.006   1.817   -18.774 1.00 0.00 ? 57  LEU A HB2    1  
ATOM   771    H  HB3    . LEU A 1 50  ? -1.525  1.511   -19.572 1.00 0.00 ? 57  LEU A HB3    1  
ATOM   772    H  HG     . LEU A 1 50  ? -1.817  -0.465  -18.020 1.00 0.00 ? 57  LEU A HG     1  
ATOM   773    H  HD11   . LEU A 1 50  ? -0.545  -0.471  -15.946 1.00 0.00 ? 57  LEU A HD11   1  
ATOM   774    H  HD12   . LEU A 1 50  ? 0.456   0.851   -16.544 1.00 0.00 ? 57  LEU A HD12   1  
ATOM   775    H  HD13   . LEU A 1 50  ? 0.511   -0.722  -17.337 1.00 0.00 ? 57  LEU A HD13   1  
ATOM   776    H  HD21   . LEU A 1 50  ? -3.010  1.626   -17.710 1.00 0.00 ? 57  LEU A HD21   1  
ATOM   777    H  HD22   . LEU A 1 50  ? -1.646  2.287   -16.808 1.00 0.00 ? 57  LEU A HD22   1  
ATOM   778    H  HD23   . LEU A 1 50  ? -2.557  0.929   -16.154 1.00 0.00 ? 57  LEU A HD23   1  
ATOM   779    N  N      . ASP A 1 51  ? -0.264  -0.143  -22.401 1.00 0.00 ? 58  ASP A N      1  
ATOM   780    C  CA     . ASP A 1 51  ? -0.404  0.291   -23.789 1.00 0.00 ? 58  ASP A CA     1  
ATOM   781    C  C      . ASP A 1 51  ? 0.895   0.833   -24.373 1.00 0.00 ? 58  ASP A C      1  
ATOM   782    O  O      . ASP A 1 51  ? 0.879   1.507   -25.403 1.00 0.00 ? 58  ASP A O      1  
ATOM   783    C  CB     . ASP A 1 51  ? -1.513  1.338   -23.922 1.00 0.00 ? 58  ASP A CB     1  
ATOM   784    C  CG     . ASP A 1 51  ? -2.894  0.727   -23.838 1.00 0.00 ? 58  ASP A CG     1  
ATOM   785    O  OD1    . ASP A 1 51  ? -3.402  0.263   -24.881 1.00 0.00 ? 58  ASP A OD1    1  
ATOM   786    O  OD2    . ASP A 1 51  ? -3.477  0.713   -22.734 1.00 0.00 ? 58  ASP A OD2    1  
ATOM   787    H  H      . ASP A 1 51  ? -0.408  -1.097  -22.192 1.00 0.00 ? 58  ASP A H      1  
ATOM   788    H  HA     . ASP A 1 51  ? -0.692  -0.577  -24.364 1.00 0.00 ? 58  ASP A HA     1  
ATOM   789    H  HB2    . ASP A 1 51  ? -1.413  2.064   -23.128 1.00 0.00 ? 58  ASP A HB2    1  
ATOM   790    H  HB3    . ASP A 1 51  ? -1.416  1.835   -24.875 1.00 0.00 ? 58  ASP A HB3    1  
ATOM   791    N  N      . GLY A 1 52  ? 2.021   0.541   -23.734 1.00 0.00 ? 59  GLY A N      1  
ATOM   792    C  CA     . GLY A 1 52  ? 3.290   0.926   -24.310 1.00 0.00 ? 59  GLY A CA     1  
ATOM   793    C  C      . GLY A 1 52  ? 4.282   1.478   -23.309 1.00 0.00 ? 59  GLY A C      1  
ATOM   794    O  O      . GLY A 1 52  ? 5.487   1.323   -23.492 1.00 0.00 ? 59  GLY A O      1  
ATOM   795    H  H      . GLY A 1 52  ? 1.987   0.069   -22.877 1.00 0.00 ? 59  GLY A H      1  
ATOM   796    H  HA2    . GLY A 1 52  ? 3.729   0.061   -24.783 1.00 0.00 ? 59  GLY A HA2    1  
ATOM   797    H  HA3    . GLY A 1 52  ? 3.109   1.673   -25.064 1.00 0.00 ? 59  GLY A HA3    1  
ATOM   798    N  N      . GLU A 1 53  ? 3.802   2.129   -22.255 1.00 0.00 ? 60  GLU A N      1  
ATOM   799    C  CA     . GLU A 1 53  ? 4.703   2.708   -21.277 1.00 0.00 ? 60  GLU A CA     1  
ATOM   800    C  C      . GLU A 1 53  ? 4.896   1.759   -20.107 1.00 0.00 ? 60  GLU A C      1  
ATOM   801    O  O      . GLU A 1 53  ? 3.925   1.242   -19.548 1.00 0.00 ? 60  GLU A O      1  
ATOM   802    C  CB     . GLU A 1 53  ? 4.177   4.064   -20.793 1.00 0.00 ? 60  GLU A CB     1  
ATOM   803    C  CG     . GLU A 1 53  ? 2.735   4.036   -20.315 1.00 0.00 ? 60  GLU A CG     1  
ATOM   804    C  CD     . GLU A 1 53  ? 2.254   5.391   -19.833 1.00 0.00 ? 60  GLU A CD     1  
ATOM   805    O  OE1    . GLU A 1 53  ? 1.944   6.253   -20.685 1.00 0.00 ? 60  GLU A OE1    1  
ATOM   806    O  OE2    . GLU A 1 53  ? 2.183   5.598   -18.603 1.00 0.00 ? 60  GLU A OE2    1  
ATOM   807    H  H      . GLU A 1 53  ? 2.832   2.212   -22.119 1.00 0.00 ? 60  GLU A H      1  
ATOM   808    H  HA     . GLU A 1 53  ? 5.657   2.857   -21.760 1.00 0.00 ? 60  GLU A HA     1  
ATOM   809    H  HB2    . GLU A 1 53  ? 4.796   4.403   -19.976 1.00 0.00 ? 60  GLU A HB2    1  
ATOM   810    H  HB3    . GLU A 1 53  ? 4.251   4.774   -21.604 1.00 0.00 ? 60  GLU A HB3    1  
ATOM   811    H  HG2    . GLU A 1 53  ? 2.103   3.719   -21.129 1.00 0.00 ? 60  GLU A HG2    1  
ATOM   812    H  HG3    . GLU A 1 53  ? 2.654   3.330   -19.504 1.00 0.00 ? 60  GLU A HG3    1  
ATOM   813    N  N      . GLU A 1 54  ? 6.150   1.499   -19.763 1.00 0.00 ? 61  GLU A N      1  
ATOM   814    C  CA     . GLU A 1 54  ? 6.461   0.707   -18.591 1.00 0.00 ? 61  GLU A CA     1  
ATOM   815    C  C      . GLU A 1 54  ? 6.344   1.581   -17.356 1.00 0.00 ? 61  GLU A C      1  
ATOM   816    O  O      . GLU A 1 54  ? 7.162   2.471   -17.117 1.00 0.00 ? 61  GLU A O      1  
ATOM   817    C  CB     . GLU A 1 54  ? 7.855   0.087   -18.693 1.00 0.00 ? 61  GLU A CB     1  
ATOM   818    C  CG     . GLU A 1 54  ? 7.943   -1.060  -19.691 1.00 0.00 ? 61  GLU A CG     1  
ATOM   819    C  CD     . GLU A 1 54  ? 9.341   -1.640  -19.784 1.00 0.00 ? 61  GLU A CD     1  
ATOM   820    O  OE1    . GLU A 1 54  ? 9.724   -2.424  -18.887 1.00 0.00 ? 61  GLU A OE1    1  
ATOM   821    O  OE2    . GLU A 1 54  ? 10.059  -1.312  -20.747 1.00 0.00 ? 61  GLU A OE2    1  
ATOM   822    H  H      . GLU A 1 54  ? 6.885   1.871   -20.301 1.00 0.00 ? 61  GLU A H      1  
ATOM   823    H  HA     . GLU A 1 54  ? 5.730   -0.084  -18.522 1.00 0.00 ? 61  GLU A HA     1  
ATOM   824    H  HB2    . GLU A 1 54  ? 8.555   0.851   -18.995 1.00 0.00 ? 61  GLU A HB2    1  
ATOM   825    H  HB3    . GLU A 1 54  ? 8.139   -0.287  -17.722 1.00 0.00 ? 61  GLU A HB3    1  
ATOM   826    H  HG2    . GLU A 1 54  ? 7.264   -1.844  -19.383 1.00 0.00 ? 61  GLU A HG2    1  
ATOM   827    H  HG3    . GLU A 1 54  ? 7.652   -0.698  -20.664 1.00 0.00 ? 61  GLU A HG3    1  
ATOM   828    N  N      . VAL A 1 55  ? 5.320   1.308   -16.580 1.00 0.00 ? 62  VAL A N      1  
ATOM   829    C  CA     . VAL A 1 55  ? 4.946   2.142   -15.462 1.00 0.00 ? 62  VAL A CA     1  
ATOM   830    C  C      . VAL A 1 55  ? 5.326   1.449   -14.161 1.00 0.00 ? 62  VAL A C      1  
ATOM   831    O  O      . VAL A 1 55  ? 5.224   0.224   -14.051 1.00 0.00 ? 62  VAL A O      1  
ATOM   832    C  CB     . VAL A 1 55  ? 3.424   2.414   -15.464 1.00 0.00 ? 62  VAL A CB     1  
ATOM   833    C  CG1    . VAL A 1 55  ? 3.126   3.807   -14.960 1.00 0.00 ? 62  VAL A CG1    1  
ATOM   834    C  CG2    . VAL A 1 55  ? 2.822   2.217   -16.849 1.00 0.00 ? 62  VAL A CG2    1  
ATOM   835    H  H      . VAL A 1 55  ? 4.790   0.498   -16.760 1.00 0.00 ? 62  VAL A H      1  
ATOM   836    H  HA     . VAL A 1 55  ? 5.471   3.083   -15.540 1.00 0.00 ? 62  VAL A HA     1  
ATOM   837    H  HB     . VAL A 1 55  ? 2.957   1.708   -14.792 1.00 0.00 ? 62  VAL A HB     1  
ATOM   838    H  HG11   . VAL A 1 55  ? 2.057   3.949   -14.909 1.00 0.00 ? 62  VAL A HG11   1  
ATOM   839    H  HG12   . VAL A 1 55  ? 3.553   4.527   -15.644 1.00 0.00 ? 62  VAL A HG12   1  
ATOM   840    H  HG13   . VAL A 1 55  ? 3.558   3.938   -13.979 1.00 0.00 ? 62  VAL A HG13   1  
ATOM   841    H  HG21   . VAL A 1 55  ? 2.996   1.202   -17.175 1.00 0.00 ? 62  VAL A HG21   1  
ATOM   842    H  HG22   . VAL A 1 55  ? 3.284   2.902   -17.545 1.00 0.00 ? 62  VAL A HG22   1  
ATOM   843    H  HG23   . VAL A 1 55  ? 1.759   2.405   -16.809 1.00 0.00 ? 62  VAL A HG23   1  
ATOM   844    N  N      . GLN A 1 56  ? 5.772   2.220   -13.183 1.00 0.00 ? 63  GLN A N      1  
ATOM   845    C  CA     . GLN A 1 56  ? 6.180   1.656   -11.906 1.00 0.00 ? 63  GLN A CA     1  
ATOM   846    C  C      . GLN A 1 56  ? 5.250   2.097   -10.792 1.00 0.00 ? 63  GLN A C      1  
ATOM   847    O  O      . GLN A 1 56  ? 5.039   3.294   -10.568 1.00 0.00 ? 63  GLN A O      1  
ATOM   848    C  CB     . GLN A 1 56  ? 7.619   2.052   -11.570 1.00 0.00 ? 63  GLN A CB     1  
ATOM   849    C  CG     . GLN A 1 56  ? 8.659   1.181   -12.258 1.00 0.00 ? 63  GLN A CG     1  
ATOM   850    C  CD     . GLN A 1 56  ? 10.090  1.593   -11.955 1.00 0.00 ? 63  GLN A CD     1  
ATOM   851    O  OE1    . GLN A 1 56  ? 10.981  0.747   -11.869 1.00 0.00 ? 63  GLN A OE1    1  
ATOM   852    N  NE2    . GLN A 1 56  ? 10.334  2.889   -11.843 1.00 0.00 ? 63  GLN A NE2    1  
ATOM   853    H  H      . GLN A 1 56  ? 5.830   3.193   -13.321 1.00 0.00 ? 63  GLN A H      1  
ATOM   854    H  HA     . GLN A 1 56  ? 6.128   0.579   -11.991 1.00 0.00 ? 63  GLN A HA     1  
ATOM   855    H  HB2    . GLN A 1 56  ? 7.776   3.077   -11.872 1.00 0.00 ? 63  GLN A HB2    1  
ATOM   856    H  HB3    . GLN A 1 56  ? 7.762   1.974   -10.501 1.00 0.00 ? 63  GLN A HB3    1  
ATOM   857    H  HG2    . GLN A 1 56  ? 8.525   0.160   -11.937 1.00 0.00 ? 63  GLN A HG2    1  
ATOM   858    H  HG3    . GLN A 1 56  ? 8.503   1.242   -13.326 1.00 0.00 ? 63  GLN A HG3    1  
ATOM   859    H  HE21   . GLN A 1 56  ? 9.589   3.516   -11.968 1.00 0.00 ? 63  GLN A HE21   1  
ATOM   860    H  HE22   . GLN A 1 56  ? 11.250  3.170   -11.648 1.00 0.00 ? 63  GLN A HE22   1  
ATOM   861    N  N      . ILE A 1 57  ? 4.680   1.126   -10.102 1.00 0.00 ? 64  ILE A N      1  
ATOM   862    C  CA     . ILE A 1 57  ? 3.827   1.414   -8.969  1.00 0.00 ? 64  ILE A CA     1  
ATOM   863    C  C      . ILE A 1 57  ? 4.533   1.022   -7.669  1.00 0.00 ? 64  ILE A C      1  
ATOM   864    O  O      . ILE A 1 57  ? 4.949   -0.124  -7.480  1.00 0.00 ? 64  ILE A O      1  
ATOM   865    C  CB     . ILE A 1 57  ? 2.445   0.724   -9.105  1.00 0.00 ? 64  ILE A CB     1  
ATOM   866    C  CG1    . ILE A 1 57  ? 1.517   1.142   -7.958  1.00 0.00 ? 64  ILE A CG1    1  
ATOM   867    C  CG2    . ILE A 1 57  ? 2.592   -0.791  -9.169  1.00 0.00 ? 64  ILE A CG2    1  
ATOM   868    C  CD1    . ILE A 1 57  ? 0.088   0.667   -8.130  1.00 0.00 ? 64  ILE A CD1    1  
ATOM   869    H  H      . ILE A 1 57  ? 4.842   0.190   -10.360 1.00 0.00 ? 64  ILE A H      1  
ATOM   870    H  HA     . ILE A 1 57  ? 3.665   2.483   -8.955  1.00 0.00 ? 64  ILE A HA     1  
ATOM   871    H  HB     . ILE A 1 57  ? 2.008   1.047   -10.036 1.00 0.00 ? 64  ILE A HB     1  
ATOM   872    H  HG12   . ILE A 1 57  ? 1.892   0.734   -7.031  1.00 0.00 ? 64  ILE A HG12   1  
ATOM   873    H  HG13   . ILE A 1 57  ? 1.503   2.220   -7.892  1.00 0.00 ? 64  ILE A HG13   1  
ATOM   874    H  HG21   . ILE A 1 57  ? 1.616   -1.245  -9.248  1.00 0.00 ? 64  ILE A HG21   1  
ATOM   875    H  HG22   . ILE A 1 57  ? 3.082   -1.144  -8.275  1.00 0.00 ? 64  ILE A HG22   1  
ATOM   876    H  HG23   . ILE A 1 57  ? 3.186   -1.058  -10.033 1.00 0.00 ? 64  ILE A HG23   1  
ATOM   877    H  HD11   . ILE A 1 57  ? -0.318  1.071   -9.047  1.00 0.00 ? 64  ILE A HD11   1  
ATOM   878    H  HD12   . ILE A 1 57  ? -0.507  1.006   -7.293  1.00 0.00 ? 64  ILE A HD12   1  
ATOM   879    H  HD13   . ILE A 1 57  ? 0.068   -0.412  -8.172  1.00 0.00 ? 64  ILE A HD13   1  
ATOM   880    N  N      . ASP A 1 58  ? 4.701   2.006   -6.804  1.00 0.00 ? 65  ASP A N      1  
ATOM   881    C  CA     . ASP A 1 58  ? 5.437   1.844   -5.557  1.00 0.00 ? 65  ASP A CA     1  
ATOM   882    C  C      . ASP A 1 58  ? 4.458   1.545   -4.423  1.00 0.00 ? 65  ASP A C      1  
ATOM   883    O  O      . ASP A 1 58  ? 3.654   2.401   -4.044  1.00 0.00 ? 65  ASP A O      1  
ATOM   884    C  CB     . ASP A 1 58  ? 6.236   3.130   -5.301  1.00 0.00 ? 65  ASP A CB     1  
ATOM   885    C  CG     . ASP A 1 58  ? 7.247   3.034   -4.176  1.00 0.00 ? 65  ASP A CG     1  
ATOM   886    O  OD1    . ASP A 1 58  ? 7.618   1.912   -3.795  1.00 0.00 ? 65  ASP A OD1    1  
ATOM   887    O  OD2    . ASP A 1 58  ? 7.716   4.107   -3.717  1.00 0.00 ? 65  ASP A OD2    1  
ATOM   888    H  H      . ASP A 1 58  ? 4.308   2.885   -7.003  1.00 0.00 ? 65  ASP A H      1  
ATOM   889    H  HA     . ASP A 1 58  ? 6.119   1.013   -5.670  1.00 0.00 ? 65  ASP A HA     1  
ATOM   890    H  HB2    . ASP A 1 58  ? 6.775   3.383   -6.201  1.00 0.00 ? 65  ASP A HB2    1  
ATOM   891    H  HB3    . ASP A 1 58  ? 5.546   3.929   -5.070  1.00 0.00 ? 65  ASP A HB3    1  
ATOM   892    N  N      . ILE A 1 59  ? 4.506   0.314   -3.916  1.00 0.00 ? 66  ILE A N      1  
ATOM   893    C  CA     . ILE A 1 59  ? 3.526   -0.166  -2.945  1.00 0.00 ? 66  ILE A CA     1  
ATOM   894    C  C      . ILE A 1 59  ? 4.157   -0.341  -1.568  1.00 0.00 ? 66  ILE A C      1  
ATOM   895    O  O      . ILE A 1 59  ? 5.305   -0.763  -1.456  1.00 0.00 ? 66  ILE A O      1  
ATOM   896    C  CB     . ILE A 1 59  ? 2.933   -1.533  -3.372  1.00 0.00 ? 66  ILE A CB     1  
ATOM   897    C  CG1    . ILE A 1 59  ? 2.335   -1.468  -4.782  1.00 0.00 ? 66  ILE A CG1    1  
ATOM   898    C  CG2    . ILE A 1 59  ? 1.877   -1.998  -2.378  1.00 0.00 ? 66  ILE A CG2    1  
ATOM   899    C  CD1    . ILE A 1 59  ? 1.094   -0.609  -4.888  1.00 0.00 ? 66  ILE A CD1    1  
ATOM   900    H  H      . ILE A 1 59  ? 5.232   -0.283  -4.189  1.00 0.00 ? 66  ILE A H      1  
ATOM   901    H  HA     . ILE A 1 59  ? 2.723   0.555   -2.884  1.00 0.00 ? 66  ILE A HA     1  
ATOM   902    H  HB     . ILE A 1 59  ? 3.735   -2.257  -3.366  1.00 0.00 ? 66  ILE A HB     1  
ATOM   903    H  HG12   . ILE A 1 59  ? 3.073   -1.066  -5.459  1.00 0.00 ? 66  ILE A HG12   1  
ATOM   904    H  HG13   . ILE A 1 59  ? 2.073   -2.469  -5.096  1.00 0.00 ? 66  ILE A HG13   1  
ATOM   905    H  HG21   . ILE A 1 59  ? 1.485   -2.956  -2.689  1.00 0.00 ? 66  ILE A HG21   1  
ATOM   906    H  HG22   . ILE A 1 59  ? 1.074   -1.276  -2.341  1.00 0.00 ? 66  ILE A HG22   1  
ATOM   907    H  HG23   . ILE A 1 59  ? 2.321   -2.093  -1.398  1.00 0.00 ? 66  ILE A HG23   1  
ATOM   908    H  HD11   . ILE A 1 59  ? 0.731   -0.630  -5.906  1.00 0.00 ? 66  ILE A HD11   1  
ATOM   909    H  HD12   . ILE A 1 59  ? 1.333   0.407   -4.609  1.00 0.00 ? 66  ILE A HD12   1  
ATOM   910    H  HD13   . ILE A 1 59  ? 0.332   -0.994  -4.227  1.00 0.00 ? 66  ILE A HD13   1  
ATOM   911    N  N      . LEU A 1 60  ? 3.398   -0.020  -0.528  1.00 0.00 ? 67  LEU A N      1  
ATOM   912    C  CA     . LEU A 1 60  ? 3.824   -0.286  0.839   1.00 0.00 ? 67  LEU A CA     1  
ATOM   913    C  C      . LEU A 1 60  ? 2.729   -0.978  1.640   1.00 0.00 ? 67  LEU A C      1  
ATOM   914    O  O      . LEU A 1 60  ? 1.640   -0.427  1.834   1.00 0.00 ? 67  LEU A O      1  
ATOM   915    C  CB     . LEU A 1 60  ? 4.240   1.007   1.538   1.00 0.00 ? 67  LEU A CB     1  
ATOM   916    C  CG     . LEU A 1 60  ? 5.716   1.381   1.380   1.00 0.00 ? 67  LEU A CG     1  
ATOM   917    C  CD1    . LEU A 1 60  ? 5.982   2.768   1.938   1.00 0.00 ? 67  LEU A CD1    1  
ATOM   918    C  CD2    . LEU A 1 60  ? 6.599   0.355   2.078   1.00 0.00 ? 67  LEU A CD2    1  
ATOM   919    H  H      . LEU A 1 60  ? 2.533   0.412   -0.684  1.00 0.00 ? 67  LEU A H      1  
ATOM   920    H  HA     . LEU A 1 60  ? 4.679   -0.942  0.791   1.00 0.00 ? 67  LEU A HA     1  
ATOM   921    H  HB2    . LEU A 1 60  ? 3.640   1.812   1.140   1.00 0.00 ? 67  LEU A HB2    1  
ATOM   922    H  HB3    . LEU A 1 60  ? 4.027   0.907   2.591   1.00 0.00 ? 67  LEU A HB3    1  
ATOM   923    H  HG     . LEU A 1 60  ? 5.971   1.386   0.330   1.00 0.00 ? 67  LEU A HG     1  
ATOM   924    H  HD11   . LEU A 1 60  ? 7.017   3.027   1.775   1.00 0.00 ? 67  LEU A HD11   1  
ATOM   925    H  HD12   . LEU A 1 60  ? 5.775   2.778   2.998   1.00 0.00 ? 67  LEU A HD12   1  
ATOM   926    H  HD13   . LEU A 1 60  ? 5.347   3.486   1.440   1.00 0.00 ? 67  LEU A HD13   1  
ATOM   927    H  HD21   . LEU A 1 60  ? 6.334   0.303   3.125   1.00 0.00 ? 67  LEU A HD21   1  
ATOM   928    H  HD22   . LEU A 1 60  ? 7.633   0.650   1.985   1.00 0.00 ? 67  LEU A HD22   1  
ATOM   929    H  HD23   . LEU A 1 60  ? 6.457   -0.613  1.623   1.00 0.00 ? 67  LEU A HD23   1  
ATOM   930    N  N      . ASP A 1 61  ? 3.022   -2.192  2.089   1.00 0.00 ? 68  ASP A N      1  
ATOM   931    C  CA     . ASP A 1 61  ? 2.153   -2.893  3.024   1.00 0.00 ? 68  ASP A CA     1  
ATOM   932    C  C      . ASP A 1 61  ? 2.619   -2.557  4.430   1.00 0.00 ? 68  ASP A C      1  
ATOM   933    O  O      . ASP A 1 61  ? 3.522   -3.191  4.970   1.00 0.00 ? 68  ASP A O      1  
ATOM   934    C  CB     . ASP A 1 61  ? 2.175   -4.411  2.784   1.00 0.00 ? 68  ASP A CB     1  
ATOM   935    C  CG     . ASP A 1 61  ? 1.232   -5.170  3.710   1.00 0.00 ? 68  ASP A CG     1  
ATOM   936    O  OD1    . ASP A 1 61  ? 0.249   -4.572  4.188   1.00 0.00 ? 68  ASP A OD1    1  
ATOM   937    O  OD2    . ASP A 1 61  ? 1.469   -6.374  3.967   1.00 0.00 ? 68  ASP A OD2    1  
ATOM   938    H  H      . ASP A 1 61  ? 3.861   -2.621  1.800   1.00 0.00 ? 68  ASP A H      1  
ATOM   939    H  HA     . ASP A 1 61  ? 1.147   -2.521  2.889   1.00 0.00 ? 68  ASP A HA     1  
ATOM   940    H  HB2    . ASP A 1 61  ? 1.883   -4.610  1.765   1.00 0.00 ? 68  ASP A HB2    1  
ATOM   941    H  HB3    . ASP A 1 61  ? 3.178   -4.780  2.945   1.00 0.00 ? 68  ASP A HB3    1  
ATOM   942    N  N      . THR A 1 62  ? 2.037   -1.509  4.985   1.00 0.00 ? 69  THR A N      1  
ATOM   943    C  CA     . THR A 1 62  ? 2.531   -0.925  6.220   1.00 0.00 ? 69  THR A CA     1  
ATOM   944    C  C      . THR A 1 62  ? 1.928   -1.574  7.465   1.00 0.00 ? 69  THR A C      1  
ATOM   945    O  O      . THR A 1 62  ? 0.760   -1.986  7.466   1.00 0.00 ? 69  THR A O      1  
ATOM   946    C  CB     . THR A 1 62  ? 2.239   0.588   6.237   1.00 0.00 ? 69  THR A CB     1  
ATOM   947    O  OG1    . THR A 1 62  ? 0.845   0.823   5.984   1.00 0.00 ? 69  THR A OG1    1  
ATOM   948    C  CG2    . THR A 1 62  ? 3.068   1.308   5.184   1.00 0.00 ? 69  THR A CG2    1  
ATOM   949    H  H      . THR A 1 62  ? 1.258   -1.109  4.549   1.00 0.00 ? 69  THR A H      1  
ATOM   950    H  HA     . THR A 1 62  ? 3.602   -1.057  6.243   1.00 0.00 ? 69  THR A HA     1  
ATOM   951    H  HB     . THR A 1 62  ? 2.497   0.981   7.211   1.00 0.00 ? 69  THR A HB     1  
ATOM   952    H  HG1    . THR A 1 62  ? 0.744   1.670   5.542   1.00 0.00 ? 69  THR A HG1    1  
ATOM   953    H  HG21   . THR A 1 62  ? 2.850   2.366   5.215   1.00 0.00 ? 69  THR A HG21   1  
ATOM   954    H  HG22   . THR A 1 62  ? 2.825   0.920   4.206   1.00 0.00 ? 69  THR A HG22   1  
ATOM   955    H  HG23   . THR A 1 62  ? 4.119   1.151   5.382   1.00 0.00 ? 69  THR A HG23   1  
ATOM   956    N  N      . ALA A 1 63  ? 2.744   -1.684  8.513   1.00 0.00 ? 70  ALA A N      1  
ATOM   957    C  CA     . ALA A 1 63  ? 2.268   -2.105  9.825   1.00 0.00 ? 70  ALA A CA     1  
ATOM   958    C  C      . ALA A 1 63  ? 1.389   -1.020  10.433  1.00 0.00 ? 70  ALA A C      1  
ATOM   959    O  O      . ALA A 1 63  ? 1.768   0.151   10.472  1.00 0.00 ? 70  ALA A O      1  
ATOM   960    C  CB     . ALA A 1 63  ? 3.436   -2.406  10.758  1.00 0.00 ? 70  ALA A CB     1  
ATOM   961    H  H      . ALA A 1 63  ? 3.699   -1.490  8.393   1.00 0.00 ? 70  ALA A H      1  
ATOM   962    H  HA     . ALA A 1 63  ? 1.686   -3.006  9.701   1.00 0.00 ? 70  ALA A HA     1  
ATOM   963    H  HB1    . ALA A 1 63  ? 3.058   -2.737  11.716  1.00 0.00 ? 70  ALA A HB1    1  
ATOM   964    H  HB2    . ALA A 1 63  ? 4.026   -1.511  10.900  1.00 0.00 ? 70  ALA A HB2    1  
ATOM   965    H  HB3    . ALA A 1 63  ? 4.054   -3.178  10.326  1.00 0.00 ? 70  ALA A HB3    1  
ATOM   966    N  N      . GLY A 1 64  ? 0.223   -1.415  10.910  1.00 0.00 ? 71  GLY A N      1  
ATOM   967    C  CA     . GLY A 1 64  ? -0.697  -0.469  11.499  1.00 0.00 ? 71  GLY A CA     1  
ATOM   968    C  C      . GLY A 1 64  ? -1.376  -1.039  12.721  1.00 0.00 ? 71  GLY A C      1  
ATOM   969    O  O      . GLY A 1 64  ? -2.356  -1.771  12.608  1.00 0.00 ? 71  GLY A O      1  
ATOM   970    H  H      . GLY A 1 64  ? -0.014  -2.373  10.873  1.00 0.00 ? 71  GLY A H      1  
ATOM   971    H  HA2    . GLY A 1 64  ? -0.156  0.423   11.781  1.00 0.00 ? 71  GLY A HA2    1  
ATOM   972    H  HA3    . GLY A 1 64  ? -1.448  -0.210  10.769  1.00 0.00 ? 71  GLY A HA3    1  
ATOM   973    N  N      . LEU A 1 65  ? -0.854  -0.705  13.887  1.00 0.00 ? 72  LEU A N      1  
ATOM   974    C  CA     . LEU A 1 65  ? -1.386  -1.238  15.129  1.00 0.00 ? 72  LEU A CA     1  
ATOM   975    C  C      . LEU A 1 65  ? -1.368  -0.180  16.224  1.00 0.00 ? 72  LEU A C      1  
ATOM   976    O  O      . LEU A 1 65  ? -2.409  0.170   16.778  1.00 0.00 ? 72  LEU A O      1  
ATOM   977    C  CB     . LEU A 1 65  ? -0.620  -2.506  15.572  1.00 0.00 ? 72  LEU A CB     1  
ATOM   978    C  CG     . LEU A 1 65  ? 0.855   -2.339  15.994  1.00 0.00 ? 72  LEU A CG     1  
ATOM   979    C  CD1    . LEU A 1 65  ? 1.342   -3.600  16.689  1.00 0.00 ? 72  LEU A CD1    1  
ATOM   980    C  CD2    . LEU A 1 65  ? 1.760   -2.026  14.802  1.00 0.00 ? 72  LEU A CD2    1  
ATOM   981    H  H      . LEU A 1 65  ? -0.113  -0.069  13.914  1.00 0.00 ? 72  LEU A H      1  
ATOM   982    H  HA     . LEU A 1 65  ? -2.407  -1.504  14.947  1.00 0.00 ? 72  LEU A HA     1  
ATOM   983    H  HB2    . LEU A 1 65  ? -1.151  -2.935  16.407  1.00 0.00 ? 72  LEU A HB2    1  
ATOM   984    H  HB3    . LEU A 1 65  ? -0.653  -3.214  14.755  1.00 0.00 ? 72  LEU A HB3    1  
ATOM   985    H  HG     . LEU A 1 65  ? 0.930   -1.522  16.698  1.00 0.00 ? 72  LEU A HG     1  
ATOM   986    H  HD11   . LEU A 1 65  ? 0.720   -3.799  17.549  1.00 0.00 ? 72  LEU A HD11   1  
ATOM   987    H  HD12   . LEU A 1 65  ? 2.364   -3.463  17.008  1.00 0.00 ? 72  LEU A HD12   1  
ATOM   988    H  HD13   . LEU A 1 65  ? 1.287   -4.434  16.005  1.00 0.00 ? 72  LEU A HD13   1  
ATOM   989    H  HD21   . LEU A 1 65  ? 2.795   -2.049  15.120  1.00 0.00 ? 72  LEU A HD21   1  
ATOM   990    H  HD22   . LEU A 1 65  ? 1.528   -1.045  14.419  1.00 0.00 ? 72  LEU A HD22   1  
ATOM   991    H  HD23   . LEU A 1 65  ? 1.606   -2.762  14.026  1.00 0.00 ? 72  LEU A HD23   1  
ATOM   992    N  N      . GLU A 1 66  ? -0.179  0.328   16.499  1.00 0.00 ? 73  GLU A N      1  
ATOM   993    C  CA     . GLU A 1 66  ? 0.044   1.336   17.531  1.00 0.00 ? 73  GLU A CA     1  
ATOM   994    C  C      . GLU A 1 66  ? 1.537   1.613   17.635  1.00 0.00 ? 73  GLU A C      1  
ATOM   995    O  O      . GLU A 1 66  ? 1.991   2.751   17.524  1.00 0.00 ? 73  GLU A O      1  
ATOM   996    C  CB     . GLU A 1 66  ? -0.489  0.853   18.888  1.00 0.00 ? 73  GLU A CB     1  
ATOM   997    C  CG     . GLU A 1 66  ? -0.319  1.864   20.013  1.00 0.00 ? 73  GLU A CG     1  
ATOM   998    C  CD     . GLU A 1 66  ? -1.120  3.130   19.787  1.00 0.00 ? 73  GLU A CD     1  
ATOM   999    O  OE1    . GLU A 1 66  ? -0.602  4.056   19.131  1.00 0.00 ? 73  GLU A OE1    1  
ATOM   1000   O  OE2    . GLU A 1 66  ? -2.266  3.205   20.274  1.00 0.00 ? 73  GLU A OE2    1  
ATOM   1001   H  H      . GLU A 1 66  ? 0.585   0.003   15.990  1.00 0.00 ? 73  GLU A H      1  
ATOM   1002   H  HA     . GLU A 1 66  ? -0.468  2.242   17.239  1.00 0.00 ? 73  GLU A HA     1  
ATOM   1003   H  HB2    . GLU A 1 66  ? -1.542  0.633   18.789  1.00 0.00 ? 73  GLU A HB2    1  
ATOM   1004   H  HB3    . GLU A 1 66  ? 0.034   -0.052  19.165  1.00 0.00 ? 73  GLU A HB3    1  
ATOM   1005   H  HG2    . GLU A 1 66  ? -0.645  1.412   20.938  1.00 0.00 ? 73  GLU A HG2    1  
ATOM   1006   H  HG3    . GLU A 1 66  ? 0.728   2.124   20.089  1.00 0.00 ? 73  GLU A HG3    1  
ATOM   1007   N  N      . ASP A 1 67  ? 2.292   0.537   17.829  1.00 0.00 ? 74  ASP A N      1  
ATOM   1008   C  CA     . ASP A 1 67  ? 3.745   0.599   17.952  1.00 0.00 ? 74  ASP A CA     1  
ATOM   1009   C  C      . ASP A 1 67  ? 4.385   1.245   16.737  1.00 0.00 ? 74  ASP A C      1  
ATOM   1010   O  O      . ASP A 1 67  ? 4.858   2.380   16.795  1.00 0.00 ? 74  ASP A O      1  
ATOM   1011   C  CB     . ASP A 1 67  ? 4.313   -0.807  18.111  1.00 0.00 ? 74  ASP A CB     1  
ATOM   1012   C  CG     . ASP A 1 67  ? 3.919   -1.445  19.423  1.00 0.00 ? 74  ASP A CG     1  
ATOM   1013   O  OD1    . ASP A 1 67  ? 4.621   -1.222  20.430  1.00 0.00 ? 74  ASP A OD1    1  
ATOM   1014   O  OD2    . ASP A 1 67  ? 2.899   -2.164  19.446  1.00 0.00 ? 74  ASP A OD2    1  
ATOM   1015   H  H      . ASP A 1 67  ? 1.853   -0.335  17.920  1.00 0.00 ? 74  ASP A H      1  
ATOM   1016   H  HA     . ASP A 1 67  ? 3.986   1.175   18.830  1.00 0.00 ? 74  ASP A HA     1  
ATOM   1017   H  HB2    . ASP A 1 67  ? 3.941   -1.424  17.307  1.00 0.00 ? 74  ASP A HB2    1  
ATOM   1018   H  HB3    . ASP A 1 67  ? 5.388   -0.765  18.048  1.00 0.00 ? 74  ASP A HB3    1  
ATOM   1019   N  N      . TYR A 1 68  ? 4.380   0.519   15.632  1.00 0.00 ? 75  TYR A N      1  
ATOM   1020   C  CA     . TYR A 1 68  ? 5.073   0.947   14.427  1.00 0.00 ? 75  TYR A CA     1  
ATOM   1021   C  C      . TYR A 1 68  ? 4.261   1.971   13.645  1.00 0.00 ? 75  TYR A C      1  
ATOM   1022   O  O      . TYR A 1 68  ? 4.028   1.822   12.446  1.00 0.00 ? 75  TYR A O      1  
ATOM   1023   C  CB     . TYR A 1 68  ? 5.403   -0.266  13.558  1.00 0.00 ? 75  TYR A CB     1  
ATOM   1024   C  CG     . TYR A 1 68  ? 6.388   -1.210  14.214  1.00 0.00 ? 75  TYR A CG     1  
ATOM   1025   C  CD1    . TYR A 1 68  ? 5.953   -2.220  15.063  1.00 0.00 ? 75  TYR A CD1    1  
ATOM   1026   C  CD2    . TYR A 1 68  ? 7.755   -1.079  13.997  1.00 0.00 ? 75  TYR A CD2    1  
ATOM   1027   C  CE1    . TYR A 1 68  ? 6.850   -3.070  15.678  1.00 0.00 ? 75  TYR A CE1    1  
ATOM   1028   C  CE2    . TYR A 1 68  ? 8.658   -1.929  14.604  1.00 0.00 ? 75  TYR A CE2    1  
ATOM   1029   C  CZ     . TYR A 1 68  ? 8.202   -2.919  15.445  1.00 0.00 ? 75  TYR A CZ     1  
ATOM   1030   O  OH     . TYR A 1 68  ? 9.104   -3.759  16.055  1.00 0.00 ? 75  TYR A OH     1  
ATOM   1031   H  H      . TYR A 1 68  ? 3.903   -0.334  15.627  1.00 0.00 ? 75  TYR A H      1  
ATOM   1032   H  HA     . TYR A 1 68  ? 5.999   1.409   14.735  1.00 0.00 ? 75  TYR A HA     1  
ATOM   1033   H  HB2    . TYR A 1 68  ? 4.494   -0.816  13.354  1.00 0.00 ? 75  TYR A HB2    1  
ATOM   1034   H  HB3    . TYR A 1 68  ? 5.831   0.073   12.627  1.00 0.00 ? 75  TYR A HB3    1  
ATOM   1035   H  HD1    . TYR A 1 68  ? 4.897   -2.334  15.243  1.00 0.00 ? 75  TYR A HD1    1  
ATOM   1036   H  HD2    . TYR A 1 68  ? 8.109   -0.303  13.339  1.00 0.00 ? 75  TYR A HD2    1  
ATOM   1037   H  HE1    . TYR A 1 68  ? 6.491   -3.849  16.334  1.00 0.00 ? 75  TYR A HE1    1  
ATOM   1038   H  HE2    . TYR A 1 68  ? 9.717   -1.812  14.423  1.00 0.00 ? 75  TYR A HE2    1  
ATOM   1039   H  HH     . TYR A 1 68  ? 8.702   -4.633  16.180  1.00 0.00 ? 75  TYR A HH     1  
ATOM   1040   N  N      . ALA A 1 69  ? 3.858   3.031   14.333  1.00 0.00 ? 76  ALA A N      1  
ATOM   1041   C  CA     . ALA A 1 69  ? 3.141   4.135   13.711  1.00 0.00 ? 76  ALA A CA     1  
ATOM   1042   C  C      . ALA A 1 69  ? 4.043   4.866   12.727  1.00 0.00 ? 76  ALA A C      1  
ATOM   1043   O  O      . ALA A 1 69  ? 3.578   5.578   11.839  1.00 0.00 ? 76  ALA A O      1  
ATOM   1044   C  CB     . ALA A 1 69  ? 2.635   5.091   14.774  1.00 0.00 ? 76  ALA A CB     1  
ATOM   1045   H  H      . ALA A 1 69  ? 4.049   3.071   15.300  1.00 0.00 ? 76  ALA A H      1  
ATOM   1046   H  HA     . ALA A 1 69  ? 2.289   3.732   13.182  1.00 0.00 ? 76  ALA A HA     1  
ATOM   1047   H  HB1    . ALA A 1 69  ? 1.962   4.568   15.436  1.00 0.00 ? 76  ALA A HB1    1  
ATOM   1048   H  HB2    . ALA A 1 69  ? 2.118   5.909   14.301  1.00 0.00 ? 76  ALA A HB2    1  
ATOM   1049   H  HB3    . ALA A 1 69  ? 3.475   5.470   15.339  1.00 0.00 ? 76  ALA A HB3    1  
ATOM   1050   N  N      . ALA A 1 70  ? 5.345   4.664   12.886  1.00 0.00 ? 77  ALA A N      1  
ATOM   1051   C  CA     . ALA A 1 70  ? 6.330   5.266   12.004  1.00 0.00 ? 77  ALA A CA     1  
ATOM   1052   C  C      . ALA A 1 70  ? 6.312   4.622   10.628  1.00 0.00 ? 77  ALA A C      1  
ATOM   1053   O  O      . ALA A 1 70  ? 6.948   5.111   9.704   1.00 0.00 ? 77  ALA A O      1  
ATOM   1054   C  CB     . ALA A 1 70  ? 7.722   5.165   12.603  1.00 0.00 ? 77  ALA A CB     1  
ATOM   1055   H  H      . ALA A 1 70  ? 5.649   4.096   13.623  1.00 0.00 ? 77  ALA A H      1  
ATOM   1056   H  HA     . ALA A 1 70  ? 6.087   6.313   11.902  1.00 0.00 ? 77  ALA A HA     1  
ATOM   1057   H  HB1    . ALA A 1 70  ? 8.424   5.690   11.972  1.00 0.00 ? 77  ALA A HB1    1  
ATOM   1058   H  HB2    . ALA A 1 70  ? 8.008   4.126   12.671  1.00 0.00 ? 77  ALA A HB2    1  
ATOM   1059   H  HB3    . ALA A 1 70  ? 7.723   5.606   13.588  1.00 0.00 ? 77  ALA A HB3    1  
ATOM   1060   N  N      . ILE A 1 71  ? 5.594   3.516   10.504  1.00 0.00 ? 78  ILE A N      1  
ATOM   1061   C  CA     . ILE A 1 71  ? 5.466   2.839   9.226   1.00 0.00 ? 78  ILE A CA     1  
ATOM   1062   C  C      . ILE A 1 71  ? 4.122   3.175   8.588   1.00 0.00 ? 78  ILE A C      1  
ATOM   1063   O  O      . ILE A 1 71  ? 4.016   3.296   7.372   1.00 0.00 ? 78  ILE A O      1  
ATOM   1064   C  CB     . ILE A 1 71  ? 5.605   1.310   9.375   1.00 0.00 ? 78  ILE A CB     1  
ATOM   1065   C  CG1    . ILE A 1 71  ? 6.888   0.966   10.136  1.00 0.00 ? 78  ILE A CG1    1  
ATOM   1066   C  CG2    . ILE A 1 71  ? 5.608   0.642   8.003   1.00 0.00 ? 78  ILE A CG2    1  
ATOM   1067   C  CD1    . ILE A 1 71  ? 7.050   -0.511  10.413  1.00 0.00 ? 78  ILE A CD1    1  
ATOM   1068   H  H      . ILE A 1 71  ? 5.137   3.148   11.288  1.00 0.00 ? 78  ILE A H      1  
ATOM   1069   H  HA     . ILE A 1 71  ? 6.259   3.191   8.581   1.00 0.00 ? 78  ILE A HA     1  
ATOM   1070   H  HB     . ILE A 1 71  ? 4.755   0.942   9.928   1.00 0.00 ? 78  ILE A HB     1  
ATOM   1071   H  HG12   . ILE A 1 71  ? 7.742   1.288   9.558   1.00 0.00 ? 78  ILE A HG12   1  
ATOM   1072   H  HG13   . ILE A 1 71  ? 6.885   1.484   11.084  1.00 0.00 ? 78  ILE A HG13   1  
ATOM   1073   H  HG21   . ILE A 1 71  ? 4.673   0.844   7.503   1.00 0.00 ? 78  ILE A HG21   1  
ATOM   1074   H  HG22   . ILE A 1 71  ? 5.730   -0.424  8.122   1.00 0.00 ? 78  ILE A HG22   1  
ATOM   1075   H  HG23   . ILE A 1 71  ? 6.423   1.034   7.412   1.00 0.00 ? 78  ILE A HG23   1  
ATOM   1076   H  HD11   . ILE A 1 71  ? 7.966   -0.676  10.961  1.00 0.00 ? 78  ILE A HD11   1  
ATOM   1077   H  HD12   . ILE A 1 71  ? 7.085   -1.051  9.479   1.00 0.00 ? 78  ILE A HD12   1  
ATOM   1078   H  HD13   . ILE A 1 71  ? 6.212   -0.858  10.999  1.00 0.00 ? 78  ILE A HD13   1  
ATOM   1079   N  N      . ARG A 1 72  ? 3.098   3.344   9.414   1.00 0.00 ? 79  ARG A N      1  
ATOM   1080   C  CA     . ARG A 1 72  ? 1.765   3.651   8.911   1.00 0.00 ? 79  ARG A CA     1  
ATOM   1081   C  C      . ARG A 1 72  ? 1.579   5.155   8.725   1.00 0.00 ? 79  ARG A C      1  
ATOM   1082   O  O      . ARG A 1 72  ? 1.457   5.639   7.605   1.00 0.00 ? 79  ARG A O      1  
ATOM   1083   C  CB     . ARG A 1 72  ? 0.702   3.124   9.878   1.00 0.00 ? 79  ARG A CB     1  
ATOM   1084   C  CG     . ARG A 1 72  ? -0.724  3.336   9.394   1.00 0.00 ? 79  ARG A CG     1  
ATOM   1085   C  CD     . ARG A 1 72  ? -1.736  3.066   10.496  1.00 0.00 ? 79  ARG A CD     1  
ATOM   1086   N  NE     . ARG A 1 72  ? -1.567  3.978   11.627  1.00 0.00 ? 79  ARG A NE     1  
ATOM   1087   C  CZ     . ARG A 1 72  ? -2.336  3.988   12.712  1.00 0.00 ? 79  ARG A CZ     1  
ATOM   1088   N  NH1    . ARG A 1 72  ? -3.358  3.146   12.827  1.00 0.00 ? 79  ARG A NH1    1  
ATOM   1089   N  NH2    . ARG A 1 72  ? -2.076  4.857   13.674  1.00 0.00 ? 79  ARG A NH2    1  
ATOM   1090   H  H      . ARG A 1 72  ? 3.241   3.259   10.377  1.00 0.00 ? 79  ARG A H      1  
ATOM   1091   H  HA     . ARG A 1 72  ? 1.648   3.161   7.959   1.00 0.00 ? 79  ARG A HA     1  
ATOM   1092   H  HB2    . ARG A 1 72  ? 0.855   2.065   10.022  1.00 0.00 ? 79  ARG A HB2    1  
ATOM   1093   H  HB3    . ARG A 1 72  ? 0.816   3.627   10.827  1.00 0.00 ? 79  ARG A HB3    1  
ATOM   1094   H  HG2    . ARG A 1 72  ? -0.833  4.357   9.062   1.00 0.00 ? 79  ARG A HG2    1  
ATOM   1095   H  HG3    . ARG A 1 72  ? -0.916  2.665   8.570   1.00 0.00 ? 79  ARG A HG3    1  
ATOM   1096   H  HD2    . ARG A 1 72  ? -2.730  3.187   10.093  1.00 0.00 ? 79  ARG A HD2    1  
ATOM   1097   H  HD3    . ARG A 1 72  ? -1.609  2.051   10.843  1.00 0.00 ? 79  ARG A HD3    1  
ATOM   1098   H  HE     . ARG A 1 72  ? -0.824  4.636   11.578  1.00 0.00 ? 79  ARG A HE     1  
ATOM   1099   H  HH11   . ARG A 1 72  ? -3.559  2.493   12.097  1.00 0.00 ? 79  ARG A HH11   1  
ATOM   1100   H  HH12   . ARG A 1 72  ? -3.951  3.179   13.644  1.00 0.00 ? 79  ARG A HH12   1  
ATOM   1101   H  HH21   . ARG A 1 72  ? -1.307  5.504   13.569  1.00 0.00 ? 79  ARG A HH21   1  
ATOM   1102   H  HH22   . ARG A 1 72  ? -2.627  4.870   14.519  1.00 0.00 ? 79  ARG A HH22   1  
ATOM   1103   N  N      . ASP A 1 73  ? 1.606   5.886   9.829   1.00 0.00 ? 80  ASP A N      1  
ATOM   1104   C  CA     . ASP A 1 73  ? 1.270   7.305   9.825   1.00 0.00 ? 80  ASP A CA     1  
ATOM   1105   C  C      . ASP A 1 73  ? 2.390   8.125   9.215   1.00 0.00 ? 80  ASP A C      1  
ATOM   1106   O  O      . ASP A 1 73  ? 2.157   8.978   8.360   1.00 0.00 ? 80  ASP A O      1  
ATOM   1107   C  CB     . ASP A 1 73  ? 0.998   7.796   11.251  1.00 0.00 ? 80  ASP A CB     1  
ATOM   1108   C  CG     . ASP A 1 73  ? -0.082  6.997   11.950  1.00 0.00 ? 80  ASP A CG     1  
ATOM   1109   O  OD1    . ASP A 1 73  ? 0.206   5.862   12.391  1.00 0.00 ? 80  ASP A OD1    1  
ATOM   1110   O  OD2    . ASP A 1 73  ? -1.214  7.498   12.077  1.00 0.00 ? 80  ASP A OD2    1  
ATOM   1111   H  H      . ASP A 1 73  ? 1.862   5.461   10.678  1.00 0.00 ? 80  ASP A H      1  
ATOM   1112   H  HA     . ASP A 1 73  ? 0.378   7.436   9.233   1.00 0.00 ? 80  ASP A HA     1  
ATOM   1113   H  HB2    . ASP A 1 73  ? 1.905   7.719   11.830  1.00 0.00 ? 80  ASP A HB2    1  
ATOM   1114   H  HB3    . ASP A 1 73  ? 0.688   8.830   11.215  1.00 0.00 ? 80  ASP A HB3    1  
ATOM   1115   N  N      . ASN A 1 74  ? 3.608   7.844   9.640   1.00 0.00 ? 81  ASN A N      1  
ATOM   1116   C  CA     . ASN A 1 74  ? 4.766   8.629   9.226   1.00 0.00 ? 81  ASN A CA     1  
ATOM   1117   C  C      . ASN A 1 74  ? 5.108   8.407   7.749   1.00 0.00 ? 81  ASN A C      1  
ATOM   1118   O  O      . ASN A 1 74  ? 5.846   9.188   7.155   1.00 0.00 ? 81  ASN A O      1  
ATOM   1119   C  CB     . ASN A 1 74  ? 5.964   8.342   10.143  1.00 0.00 ? 81  ASN A CB     1  
ATOM   1120   C  CG     . ASN A 1 74  ? 5.769   8.959   11.523  1.00 0.00 ? 81  ASN A CG     1  
ATOM   1121   O  OD1    . ASN A 1 74  ? 5.145   10.010  11.653  1.00 0.00 ? 81  ASN A OD1    1  
ATOM   1122   N  ND2    . ASN A 1 74  ? 6.280   8.313   12.572  1.00 0.00 ? 81  ASN A ND2    1  
ATOM   1123   H  H      . ASN A 1 74  ? 3.736   7.090   10.254  1.00 0.00 ? 81  ASN A H      1  
ATOM   1124   H  HA     . ASN A 1 74  ? 4.495   9.667   9.345   1.00 0.00 ? 81  ASN A HA     1  
ATOM   1125   H  HB2    . ASN A 1 74  ? 6.083   7.273   10.252  1.00 0.00 ? 81  ASN A HB2    1  
ATOM   1126   H  HB3    . ASN A 1 74  ? 6.858   8.761   9.704   1.00 0.00 ? 81  ASN A HB3    1  
ATOM   1127   H  HD21   . ASN A 1 74  ? 6.763   7.475   12.424  1.00 0.00 ? 81  ASN A HD21   1  
ATOM   1128   H  HD22   . ASN A 1 74  ? 6.133   8.702   13.464  1.00 0.00 ? 81  ASN A HD22   1  
ATOM   1129   N  N      . TYR A 1 75  ? 4.567   7.346   7.156   1.00 0.00 ? 82  TYR A N      1  
ATOM   1130   C  CA     . TYR A 1 75  ? 4.772   7.082   5.733   1.00 0.00 ? 82  TYR A CA     1  
ATOM   1131   C  C      . TYR A 1 75  ? 3.653   7.670   4.869   1.00 0.00 ? 82  TYR A C      1  
ATOM   1132   O  O      . TYR A 1 75  ? 3.766   7.700   3.646   1.00 0.00 ? 82  TYR A O      1  
ATOM   1133   C  CB     . TYR A 1 75  ? 4.865   5.581   5.463   1.00 0.00 ? 82  TYR A CB     1  
ATOM   1134   C  CG     . TYR A 1 75  ? 6.261   5.012   5.568   1.00 0.00 ? 82  TYR A CG     1  
ATOM   1135   C  CD1    . TYR A 1 75  ? 6.801   4.662   6.793   1.00 0.00 ? 82  TYR A CD1    1  
ATOM   1136   C  CD2    . TYR A 1 75  ? 7.035   4.811   4.430   1.00 0.00 ? 82  TYR A CD2    1  
ATOM   1137   C  CE1    . TYR A 1 75  ? 8.068   4.125   6.888   1.00 0.00 ? 82  TYR A CE1    1  
ATOM   1138   C  CE2    . TYR A 1 75  ? 8.303   4.276   4.518   1.00 0.00 ? 82  TYR A CE2    1  
ATOM   1139   C  CZ     . TYR A 1 75  ? 8.815   3.939   5.750   1.00 0.00 ? 82  TYR A CZ     1  
ATOM   1140   O  OH     . TYR A 1 75  ? 10.074  3.399   5.845   1.00 0.00 ? 82  TYR A OH     1  
ATOM   1141   H  H      . TYR A 1 75  ? 4.016   6.730   7.684   1.00 0.00 ? 82  TYR A H      1  
ATOM   1142   H  HA     . TYR A 1 75  ? 5.705   7.542   5.446   1.00 0.00 ? 82  TYR A HA     1  
ATOM   1143   H  HB2    . TYR A 1 75  ? 4.245   5.056   6.175   1.00 0.00 ? 82  TYR A HB2    1  
ATOM   1144   H  HB3    . TYR A 1 75  ? 4.501   5.380   4.466   1.00 0.00 ? 82  TYR A HB3    1  
ATOM   1145   H  HD1    . TYR A 1 75  ? 6.215   4.809   7.686   1.00 0.00 ? 82  TYR A HD1    1  
ATOM   1146   H  HD2    . TYR A 1 75  ? 6.632   5.077   3.465   1.00 0.00 ? 82  TYR A HD2    1  
ATOM   1147   H  HE1    . TYR A 1 75  ? 8.470   3.860   7.852   1.00 0.00 ? 82  TYR A HE1    1  
ATOM   1148   H  HE2    . TYR A 1 75  ? 8.889   4.131   3.625   1.00 0.00 ? 82  TYR A HE2    1  
ATOM   1149   H  HH     . TYR A 1 75  ? 10.641  3.799   5.173   1.00 0.00 ? 82  TYR A HH     1  
ATOM   1150   N  N      . PHE A 1 76  ? 2.585   8.144   5.500   1.00 0.00 ? 83  PHE A N      1  
ATOM   1151   C  CA     . PHE A 1 76  ? 1.410   8.628   4.764   1.00 0.00 ? 83  PHE A CA     1  
ATOM   1152   C  C      . PHE A 1 76  ? 1.726   9.842   3.887   1.00 0.00 ? 83  PHE A C      1  
ATOM   1153   O  O      . PHE A 1 76  ? 1.014   10.108  2.918   1.00 0.00 ? 83  PHE A O      1  
ATOM   1154   C  CB     . PHE A 1 76  ? 0.275   8.995   5.724   1.00 0.00 ? 83  PHE A CB     1  
ATOM   1155   C  CG     . PHE A 1 76  ? -0.529  7.829   6.230   1.00 0.00 ? 83  PHE A CG     1  
ATOM   1156   C  CD1    . PHE A 1 76  ? -0.635  6.663   5.490   1.00 0.00 ? 83  PHE A CD1    1  
ATOM   1157   C  CD2    . PHE A 1 76  ? -1.192  7.908   7.448   1.00 0.00 ? 83  PHE A CD2    1  
ATOM   1158   C  CE1    . PHE A 1 76  ? -1.382  5.598   5.955   1.00 0.00 ? 83  PHE A CE1    1  
ATOM   1159   C  CE2    . PHE A 1 76  ? -1.942  6.847   7.915   1.00 0.00 ? 83  PHE A CE2    1  
ATOM   1160   C  CZ     . PHE A 1 76  ? -2.037  5.691   7.166   1.00 0.00 ? 83  PHE A CZ     1  
ATOM   1161   H  H      . PHE A 1 76  ? 2.581   8.175   6.482   1.00 0.00 ? 83  PHE A H      1  
ATOM   1162   H  HA     . PHE A 1 76  ? 1.075   7.825   4.127   1.00 0.00 ? 83  PHE A HA     1  
ATOM   1163   H  HB2    . PHE A 1 76  ? 0.695   9.497   6.583   1.00 0.00 ? 83  PHE A HB2    1  
ATOM   1164   H  HB3    . PHE A 1 76  ? -0.400  9.669   5.220   1.00 0.00 ? 83  PHE A HB3    1  
ATOM   1165   H  HD1    . PHE A 1 76  ? -0.123  6.588   4.544   1.00 0.00 ? 83  PHE A HD1    1  
ATOM   1166   H  HD2    . PHE A 1 76  ? -1.119  8.812   8.034   1.00 0.00 ? 83  PHE A HD2    1  
ATOM   1167   H  HE1    . PHE A 1 76  ? -1.454  4.693   5.367   1.00 0.00 ? 83  PHE A HE1    1  
ATOM   1168   H  HE2    . PHE A 1 76  ? -2.452  6.920   8.864   1.00 0.00 ? 83  PHE A HE2    1  
ATOM   1169   H  HZ     . PHE A 1 76  ? -2.621  4.859   7.529   1.00 0.00 ? 83  PHE A HZ     1  
ATOM   1170   N  N      . ARG A 1 77  ? 2.784   10.567  4.228   1.00 0.00 ? 84  ARG A N      1  
ATOM   1171   C  CA     . ARG A 1 77  ? 3.113   11.818  3.550   1.00 0.00 ? 84  ARG A CA     1  
ATOM   1172   C  C      . ARG A 1 77  ? 3.334   11.610  2.048   1.00 0.00 ? 84  ARG A C      1  
ATOM   1173   O  O      . ARG A 1 77  ? 2.690   12.255  1.221   1.00 0.00 ? 84  ARG A O      1  
ATOM   1174   C  CB     . ARG A 1 77  ? 4.360   12.449  4.193   1.00 0.00 ? 84  ARG A CB     1  
ATOM   1175   C  CG     . ARG A 1 77  ? 4.588   13.901  3.793   1.00 0.00 ? 84  ARG A CG     1  
ATOM   1176   C  CD     . ARG A 1 77  ? 5.202   14.034  2.408   1.00 0.00 ? 84  ARG A CD     1  
ATOM   1177   N  NE     . ARG A 1 77  ? 4.792   15.275  1.757   1.00 0.00 ? 84  ARG A NE     1  
ATOM   1178   C  CZ     . ARG A 1 77  ? 5.292   15.725  0.609   1.00 0.00 ? 84  ARG A CZ     1  
ATOM   1179   N  NH1    . ARG A 1 77  ? 6.277   15.074  -0.002  1.00 0.00 ? 84  ARG A NH1    1  
ATOM   1180   N  NH2    . ARG A 1 77  ? 4.809   16.842  0.080   1.00 0.00 ? 84  ARG A NH2    1  
ATOM   1181   H  H      . ARG A 1 77  ? 3.360   10.254  4.955   1.00 0.00 ? 84  ARG A H      1  
ATOM   1182   H  HA     . ARG A 1 77  ? 2.280   12.492  3.685   1.00 0.00 ? 84  ARG A HA     1  
ATOM   1183   H  HB2    . ARG A 1 77  ? 4.255   12.406  5.266   1.00 0.00 ? 84  ARG A HB2    1  
ATOM   1184   H  HB3    . ARG A 1 77  ? 5.229   11.877  3.903   1.00 0.00 ? 84  ARG A HB3    1  
ATOM   1185   H  HG2    . ARG A 1 77  ? 3.638   14.413  3.798   1.00 0.00 ? 84  ARG A HG2    1  
ATOM   1186   H  HG3    . ARG A 1 77  ? 5.247   14.364  4.516   1.00 0.00 ? 84  ARG A HG3    1  
ATOM   1187   H  HD2    . ARG A 1 77  ? 6.279   14.021  2.500   1.00 0.00 ? 84  ARG A HD2    1  
ATOM   1188   H  HD3    . ARG A 1 77  ? 4.882   13.197  1.804   1.00 0.00 ? 84  ARG A HD3    1  
ATOM   1189   H  HE     . ARG A 1 77  ? 4.071   15.792  2.193   1.00 0.00 ? 84  ARG A HE     1  
ATOM   1190   H  HH11   . ARG A 1 77  ? 6.663   14.227  0.399   1.00 0.00 ? 84  ARG A HH11   1  
ATOM   1191   H  HH12   . ARG A 1 77  ? 6.645   15.418  -0.879  1.00 0.00 ? 84  ARG A HH12   1  
ATOM   1192   H  HH21   . ARG A 1 77  ? 4.071   17.336  0.543   1.00 0.00 ? 84  ARG A HH21   1  
ATOM   1193   H  HH22   . ARG A 1 77  ? 5.177   17.197  -0.790  1.00 0.00 ? 84  ARG A HH22   1  
ATOM   1194   N  N      . SER A 1 78  ? 4.229   10.702  1.705   1.00 0.00 ? 85  SER A N      1  
ATOM   1195   C  CA     . SER A 1 78  ? 4.693   10.557  0.331   1.00 0.00 ? 85  SER A CA     1  
ATOM   1196   C  C      . SER A 1 78  ? 3.854   9.544   -0.452  1.00 0.00 ? 85  SER A C      1  
ATOM   1197   O  O      . SER A 1 78  ? 4.377   8.793   -1.282  1.00 0.00 ? 85  SER A O      1  
ATOM   1198   C  CB     . SER A 1 78  ? 6.150   10.121  0.363   1.00 0.00 ? 85  SER A CB     1  
ATOM   1199   O  OG     . SER A 1 78  ? 6.860   10.819  1.374   1.00 0.00 ? 85  SER A OG     1  
ATOM   1200   H  H      . SER A 1 78  ? 4.592   10.108  2.391   1.00 0.00 ? 85  SER A H      1  
ATOM   1201   H  HA     . SER A 1 78  ? 4.626   11.521  -0.152  1.00 0.00 ? 85  SER A HA     1  
ATOM   1202   H  HB2    . SER A 1 78  ? 6.203   9.062   0.569   1.00 0.00 ? 85  SER A HB2    1  
ATOM   1203   H  HB3    . SER A 1 78  ? 6.609   10.329  -0.591  1.00 0.00 ? 85  SER A HB3    1  
ATOM   1204   H  HG     . SER A 1 78  ? 7.244   11.634  1.003   1.00 0.00 ? 85  SER A HG     1  
ATOM   1205   N  N      . GLY A 1 79  ? 2.552   9.540   -0.204  1.00 0.00 ? 86  GLY A N      1  
ATOM   1206   C  CA     . GLY A 1 79  ? 1.674   8.615   -0.890  1.00 0.00 ? 86  GLY A CA     1  
ATOM   1207   C  C      . GLY A 1 79  ? 0.513   9.313   -1.572  1.00 0.00 ? 86  GLY A C      1  
ATOM   1208   O  O      . GLY A 1 79  ? -0.252  10.017  -0.921  1.00 0.00 ? 86  GLY A O      1  
ATOM   1209   H  H      . GLY A 1 79  ? 2.182   10.177  0.444   1.00 0.00 ? 86  GLY A H      1  
ATOM   1210   H  HA2    . GLY A 1 79  ? 2.246   8.076   -1.631  1.00 0.00 ? 86  GLY A HA2    1  
ATOM   1211   H  HA3    . GLY A 1 79  ? 1.283   7.909   -0.171  1.00 0.00 ? 86  GLY A HA3    1  
ATOM   1212   N  N      . GLU A 1 80  ? 0.398   9.125   -2.883  1.00 0.00 ? 87  GLU A N      1  
ATOM   1213   C  CA     . GLU A 1 80  ? -0.708  9.679   -3.666  1.00 0.00 ? 87  GLU A CA     1  
ATOM   1214   C  C      . GLU A 1 80  ? -2.035  9.054   -3.245  1.00 0.00 ? 87  GLU A C      1  
ATOM   1215   O  O      . GLU A 1 80  ? -2.836  9.677   -2.545  1.00 0.00 ? 87  GLU A O      1  
ATOM   1216   C  CB     . GLU A 1 80  ? -0.480  9.389   -5.153  1.00 0.00 ? 87  GLU A CB     1  
ATOM   1217   C  CG     . GLU A 1 80  ? 0.805   9.966   -5.708  1.00 0.00 ? 87  GLU A CG     1  
ATOM   1218   C  CD     . GLU A 1 80  ? 0.751   11.470  -5.826  1.00 0.00 ? 87  GLU A CD     1  
ATOM   1219   O  OE1    . GLU A 1 80  ? 0.016   11.973  -6.701  1.00 0.00 ? 87  GLU A OE1    1  
ATOM   1220   O  OE2    . GLU A 1 80  ? 1.451   12.157  -5.059  1.00 0.00 ? 87  GLU A OE2    1  
ATOM   1221   H  H      . GLU A 1 80  ? 1.082   8.600   -3.343  1.00 0.00 ? 87  GLU A H      1  
ATOM   1222   H  HA     . GLU A 1 80  ? -0.751  10.758  -3.515  1.00 0.00 ? 87  GLU A HA     1  
ATOM   1223   H  HB2    . GLU A 1 80  ? -0.458  8.320   -5.302  1.00 0.00 ? 87  GLU A HB2    1  
ATOM   1224   H  HB3    . GLU A 1 80  ? -1.305  9.802   -5.714  1.00 0.00 ? 87  GLU A HB3    1  
ATOM   1225   H  HG2    . GLU A 1 80  ? 1.622   9.699   -5.052  1.00 0.00 ? 87  GLU A HG2    1  
ATOM   1226   H  HG3    . GLU A 1 80  ? 0.981   9.549   -6.688  1.00 0.00 ? 87  GLU A HG3    1  
ATOM   1227   N  N      . GLY A 1 81  ? -2.240  7.807   -3.658  1.00 0.00 ? 88  GLY A N      1  
ATOM   1228   C  CA     . GLY A 1 81  ? -3.509  7.147   -3.447  1.00 0.00 ? 88  GLY A CA     1  
ATOM   1229   C  C      . GLY A 1 81  ? -3.472  6.170   -2.294  1.00 0.00 ? 88  GLY A C      1  
ATOM   1230   O  O      . GLY A 1 81  ? -2.407  5.665   -1.930  1.00 0.00 ? 88  GLY A O      1  
ATOM   1231   H  H      . GLY A 1 81  ? -1.507  7.319   -4.091  1.00 0.00 ? 88  GLY A H      1  
ATOM   1232   H  HA2    . GLY A 1 81  ? -4.263  7.895   -3.246  1.00 0.00 ? 88  GLY A HA2    1  
ATOM   1233   H  HA3    . GLY A 1 81  ? -3.780  6.611   -4.345  1.00 0.00 ? 88  GLY A HA3    1  
ATOM   1234   N  N      . PHE A 1 82  ? -4.635  5.905   -1.720  1.00 0.00 ? 89  PHE A N      1  
ATOM   1235   C  CA     . PHE A 1 82  ? -4.736  5.015   -0.577  1.00 0.00 ? 89  PHE A CA     1  
ATOM   1236   C  C      . PHE A 1 82  ? -5.815  3.966   -0.794  1.00 0.00 ? 89  PHE A C      1  
ATOM   1237   O  O      . PHE A 1 82  ? -6.914  4.273   -1.267  1.00 0.00 ? 89  PHE A O      1  
ATOM   1238   C  CB     . PHE A 1 82  ? -5.040  5.811   0.690   1.00 0.00 ? 89  PHE A CB     1  
ATOM   1239   C  CG     . PHE A 1 82  ? -3.941  6.748   1.084   1.00 0.00 ? 89  PHE A CG     1  
ATOM   1240   C  CD1    . PHE A 1 82  ? -3.871  8.017   0.539   1.00 0.00 ? 89  PHE A CD1    1  
ATOM   1241   C  CD2    . PHE A 1 82  ? -2.977  6.359   1.999   1.00 0.00 ? 89  PHE A CD2    1  
ATOM   1242   C  CE1    . PHE A 1 82  ? -2.861  8.883   0.897   1.00 0.00 ? 89  PHE A CE1    1  
ATOM   1243   C  CE2    . PHE A 1 82  ? -1.965  7.223   2.363   1.00 0.00 ? 89  PHE A CE2    1  
ATOM   1244   C  CZ     . PHE A 1 82  ? -1.905  8.487   1.812   1.00 0.00 ? 89  PHE A CZ     1  
ATOM   1245   H  H      . PHE A 1 82  ? -5.452  6.324   -2.074  1.00 0.00 ? 89  PHE A H      1  
ATOM   1246   H  HA     . PHE A 1 82  ? -3.786  4.517   -0.459  1.00 0.00 ? 89  PHE A HA     1  
ATOM   1247   H  HB2    . PHE A 1 82  ? -5.931  6.398   0.531   1.00 0.00 ? 89  PHE A HB2    1  
ATOM   1248   H  HB3    . PHE A 1 82  ? -5.207  5.128   1.510   1.00 0.00 ? 89  PHE A HB3    1  
ATOM   1249   H  HD1    . PHE A 1 82  ? -4.617  8.327   -0.178  1.00 0.00 ? 89  PHE A HD1    1  
ATOM   1250   H  HD2    . PHE A 1 82  ? -3.021  5.369   2.428   1.00 0.00 ? 89  PHE A HD2    1  
ATOM   1251   H  HE1    . PHE A 1 82  ? -2.818  9.871   0.463   1.00 0.00 ? 89  PHE A HE1    1  
ATOM   1252   H  HE2    . PHE A 1 82  ? -1.221  6.911   3.076   1.00 0.00 ? 89  PHE A HE2    1  
ATOM   1253   H  HZ     . PHE A 1 82  ? -1.115  9.166   2.096   1.00 0.00 ? 89  PHE A HZ     1  
ATOM   1254   N  N      . LEU A 1 83  ? -5.492  2.730   -0.452  1.00 0.00 ? 90  LEU A N      1  
ATOM   1255   C  CA     . LEU A 1 83  ? -6.452  1.644   -0.519  1.00 0.00 ? 90  LEU A CA     1  
ATOM   1256   C  C      . LEU A 1 83  ? -6.885  1.247   0.885   1.00 0.00 ? 90  LEU A C      1  
ATOM   1257   O  O      . LEU A 1 83  ? -6.082  0.744   1.675   1.00 0.00 ? 90  LEU A O      1  
ATOM   1258   C  CB     . LEU A 1 83  ? -5.861  0.432   -1.247  1.00 0.00 ? 90  LEU A CB     1  
ATOM   1259   C  CG     . LEU A 1 83  ? -5.565  0.640   -2.732  1.00 0.00 ? 90  LEU A CG     1  
ATOM   1260   C  CD1    . LEU A 1 83  ? -4.861  -0.574  -3.310  1.00 0.00 ? 90  LEU A CD1    1  
ATOM   1261   C  CD2    . LEU A 1 83  ? -6.851  0.908   -3.494  1.00 0.00 ? 90  LEU A CD2    1  
ATOM   1262   H  H      . LEU A 1 83  ? -4.578  2.546   -0.135  1.00 0.00 ? 90  LEU A H      1  
ATOM   1263   H  HA     . LEU A 1 83  ? -7.313  1.999   -1.064  1.00 0.00 ? 90  LEU A HA     1  
ATOM   1264   H  HB2    . LEU A 1 83  ? -4.940  0.152   -0.755  1.00 0.00 ? 90  LEU A HB2    1  
ATOM   1265   H  HB3    . LEU A 1 83  ? -6.559  -0.388  -1.159  1.00 0.00 ? 90  LEU A HB3    1  
ATOM   1266   H  HG     . LEU A 1 83  ? -4.917  1.496   -2.852  1.00 0.00 ? 90  LEU A HG     1  
ATOM   1267   H  HD11   . LEU A 1 83  ? -4.663  -0.410  -4.359  1.00 0.00 ? 90  LEU A HD11   1  
ATOM   1268   H  HD12   . LEU A 1 83  ? -5.492  -1.444  -3.194  1.00 0.00 ? 90  LEU A HD12   1  
ATOM   1269   H  HD13   . LEU A 1 83  ? -3.929  -0.732  -2.788  1.00 0.00 ? 90  LEU A HD13   1  
ATOM   1270   H  HD21   . LEU A 1 83  ? -6.624  1.065   -4.538  1.00 0.00 ? 90  LEU A HD21   1  
ATOM   1271   H  HD22   . LEU A 1 83  ? -7.329  1.791   -3.093  1.00 0.00 ? 90  LEU A HD22   1  
ATOM   1272   H  HD23   . LEU A 1 83  ? -7.512  0.061   -3.395  1.00 0.00 ? 90  LEU A HD23   1  
ATOM   1273   N  N      . LEU A 1 84  ? -8.148  1.498   1.196   1.00 0.00 ? 91  LEU A N      1  
ATOM   1274   C  CA     . LEU A 1 84  ? -8.705  1.124   2.487   1.00 0.00 ? 91  LEU A CA     1  
ATOM   1275   C  C      . LEU A 1 84  ? -9.266  -0.283  2.388   1.00 0.00 ? 91  LEU A C      1  
ATOM   1276   O  O      . LEU A 1 84  ? -10.309 -0.495  1.777   1.00 0.00 ? 91  LEU A O      1  
ATOM   1277   C  CB     . LEU A 1 84  ? -9.815  2.102   2.894   1.00 0.00 ? 91  LEU A CB     1  
ATOM   1278   C  CG     . LEU A 1 84  ? -9.428  3.586   2.876   1.00 0.00 ? 91  LEU A CG     1  
ATOM   1279   C  CD1    . LEU A 1 84  ? -10.648 4.456   3.135   1.00 0.00 ? 91  LEU A CD1    1  
ATOM   1280   C  CD2    . LEU A 1 84  ? -8.349  3.880   3.906   1.00 0.00 ? 91  LEU A CD2    1  
ATOM   1281   H  H      . LEU A 1 84  ? -8.727  1.932   0.530   1.00 0.00 ? 91  LEU A H      1  
ATOM   1282   H  HA     . LEU A 1 84  ? -7.915  1.145   3.221   1.00 0.00 ? 91  LEU A HA     1  
ATOM   1283   H  HB2    . LEU A 1 84  ? -10.650 1.964   2.221   1.00 0.00 ? 91  LEU A HB2    1  
ATOM   1284   H  HB3    . LEU A 1 84  ? -10.137 1.851   3.893   1.00 0.00 ? 91  LEU A HB3    1  
ATOM   1285   H  HG     . LEU A 1 84  ? -9.040  3.840   1.900   1.00 0.00 ? 91  LEU A HG     1  
ATOM   1286   H  HD11   . LEU A 1 84  ? -11.083 4.188   4.085   1.00 0.00 ? 91  LEU A HD11   1  
ATOM   1287   H  HD12   . LEU A 1 84  ? -11.374 4.300   2.350   1.00 0.00 ? 91  LEU A HD12   1  
ATOM   1288   H  HD13   . LEU A 1 84  ? -10.353 5.494   3.152   1.00 0.00 ? 91  LEU A HD13   1  
ATOM   1289   H  HD21   . LEU A 1 84  ? -8.104  4.932   3.881   1.00 0.00 ? 91  LEU A HD21   1  
ATOM   1290   H  HD22   . LEU A 1 84  ? -7.466  3.301   3.678   1.00 0.00 ? 91  LEU A HD22   1  
ATOM   1291   H  HD23   . LEU A 1 84  ? -8.708  3.615   4.889   1.00 0.00 ? 91  LEU A HD23   1  
ATOM   1292   N  N      . VAL A 1 85  ? -8.577  -1.242  2.979   1.00 0.00 ? 92  VAL A N      1  
ATOM   1293   C  CA     . VAL A 1 85  ? -8.956  -2.637  2.832   1.00 0.00 ? 92  VAL A CA     1  
ATOM   1294   C  C      . VAL A 1 85  ? -9.499  -3.203  4.136   1.00 0.00 ? 92  VAL A C      1  
ATOM   1295   O  O      . VAL A 1 85  ? -8.790  -3.269  5.142   1.00 0.00 ? 92  VAL A O      1  
ATOM   1296   C  CB     . VAL A 1 85  ? -7.766  -3.499  2.355   1.00 0.00 ? 92  VAL A CB     1  
ATOM   1297   C  CG1    . VAL A 1 85  ? -8.202  -4.935  2.117   1.00 0.00 ? 92  VAL A CG1    1  
ATOM   1298   C  CG2    . VAL A 1 85  ? -7.158  -2.914  1.090   1.00 0.00 ? 92  VAL A CG2    1  
ATOM   1299   H  H      . VAL A 1 85  ? -7.796  -1.010  3.528   1.00 0.00 ? 92  VAL A H      1  
ATOM   1300   H  HA     . VAL A 1 85  ? -9.731  -2.691  2.082   1.00 0.00 ? 92  VAL A HA     1  
ATOM   1301   H  HB     . VAL A 1 85  ? -7.010  -3.497  3.128   1.00 0.00 ? 92  VAL A HB     1  
ATOM   1302   H  HG11   . VAL A 1 85  ? -7.362  -5.515  1.766   1.00 0.00 ? 92  VAL A HG11   1  
ATOM   1303   H  HG12   . VAL A 1 85  ? -8.988  -4.954  1.375   1.00 0.00 ? 92  VAL A HG12   1  
ATOM   1304   H  HG13   . VAL A 1 85  ? -8.568  -5.356  3.040   1.00 0.00 ? 92  VAL A HG13   1  
ATOM   1305   H  HG21   . VAL A 1 85  ? -7.899  -2.913  0.304   1.00 0.00 ? 92  VAL A HG21   1  
ATOM   1306   H  HG22   . VAL A 1 85  ? -6.311  -3.511  0.787   1.00 0.00 ? 92  VAL A HG22   1  
ATOM   1307   H  HG23   . VAL A 1 85  ? -6.836  -1.902  1.282   1.00 0.00 ? 92  VAL A HG23   1  
ATOM   1308   N  N      . PHE A 1 86  ? -10.759 -3.605  4.105   1.00 0.00 ? 93  PHE A N      1  
ATOM   1309   C  CA     . PHE A 1 86  ? -11.396 -4.233  5.251   1.00 0.00 ? 93  PHE A CA     1  
ATOM   1310   C  C      . PHE A 1 86  ? -12.248 -5.404  4.776   1.00 0.00 ? 93  PHE A C      1  
ATOM   1311   O  O      . PHE A 1 86  ? -12.406 -5.613  3.571   1.00 0.00 ? 93  PHE A O      1  
ATOM   1312   C  CB     . PHE A 1 86  ? -12.250 -3.222  6.034   1.00 0.00 ? 93  PHE A CB     1  
ATOM   1313   C  CG     . PHE A 1 86  ? -13.557 -2.858  5.373   1.00 0.00 ? 93  PHE A CG     1  
ATOM   1314   C  CD1    . PHE A 1 86  ? -13.595 -1.974  4.309   1.00 0.00 ? 93  PHE A CD1    1  
ATOM   1315   C  CD2    . PHE A 1 86  ? -14.749 -3.406  5.826   1.00 0.00 ? 93  PHE A CD2    1  
ATOM   1316   C  CE1    . PHE A 1 86  ? -14.795 -1.644  3.707   1.00 0.00 ? 93  PHE A CE1    1  
ATOM   1317   C  CE2    . PHE A 1 86  ? -15.950 -3.079  5.229   1.00 0.00 ? 93  PHE A CE2    1  
ATOM   1318   C  CZ     . PHE A 1 86  ? -15.974 -2.197  4.167   1.00 0.00 ? 93  PHE A CZ     1  
ATOM   1319   H  H      . PHE A 1 86  ? -11.276 -3.490  3.275   1.00 0.00 ? 93  PHE A H      1  
ATOM   1320   H  HA     . PHE A 1 86  ? -10.616 -4.611  5.896   1.00 0.00 ? 93  PHE A HA     1  
ATOM   1321   H  HB2    . PHE A 1 86  ? -12.477 -3.633  7.005   1.00 0.00 ? 93  PHE A HB2    1  
ATOM   1322   H  HB3    . PHE A 1 86  ? -11.681 -2.312  6.163   1.00 0.00 ? 93  PHE A HB3    1  
ATOM   1323   H  HD1    . PHE A 1 86  ? -12.674 -1.539  3.947   1.00 0.00 ? 93  PHE A HD1    1  
ATOM   1324   H  HD2    . PHE A 1 86  ? -14.732 -4.098  6.657   1.00 0.00 ? 93  PHE A HD2    1  
ATOM   1325   H  HE1    . PHE A 1 86  ? -14.811 -0.950  2.879   1.00 0.00 ? 93  PHE A HE1    1  
ATOM   1326   H  HE2    . PHE A 1 86  ? -16.871 -3.516  5.591   1.00 0.00 ? 93  PHE A HE2    1  
ATOM   1327   H  HZ     . PHE A 1 86  ? -16.912 -1.939  3.697   1.00 0.00 ? 93  PHE A HZ     1  
ATOM   1328   N  N      . SER A 1 87  ? -12.782 -6.173  5.708   1.00 0.00 ? 94  SER A N      1  
ATOM   1329   C  CA     . SER A 1 87  ? -13.615 -7.306  5.358   1.00 0.00 ? 94  SER A CA     1  
ATOM   1330   C  C      . SER A 1 87  ? -14.995 -7.144  5.980   1.00 0.00 ? 94  SER A C      1  
ATOM   1331   O  O      . SER A 1 87  ? -15.132 -6.594  7.072   1.00 0.00 ? 94  SER A O      1  
ATOM   1332   C  CB     . SER A 1 87  ? -12.959 -8.609  5.817   1.00 0.00 ? 94  SER A CB     1  
ATOM   1333   O  OG     . SER A 1 87  ? -13.569 -9.726  5.194   1.00 0.00 ? 94  SER A OG     1  
ATOM   1334   H  H      . SER A 1 87  ? -12.620 -5.971  6.654   1.00 0.00 ? 94  SER A H      1  
ATOM   1335   H  HA     . SER A 1 87  ? -13.723 -7.324  4.284   1.00 0.00 ? 94  SER A HA     1  
ATOM   1336   H  HB2    . SER A 1 87  ? -11.910 -8.593  5.557   1.00 0.00 ? 94  SER A HB2    1  
ATOM   1337   H  HB3    . SER A 1 87  ? -13.064 -8.706  6.888   1.00 0.00 ? 94  SER A HB3    1  
ATOM   1338   H  HG     . SER A 1 87  ? -13.515 -9.623  4.235   1.00 0.00 ? 94  SER A HG     1  
ATOM   1339   N  N      . ILE A 1 88  ? -16.014 -7.628  5.281   1.00 0.00 ? 95  ILE A N      1  
ATOM   1340   C  CA     . ILE A 1 88  ? -17.397 -7.426  5.707   1.00 0.00 ? 95  ILE A CA     1  
ATOM   1341   C  C      . ILE A 1 88  ? -17.781 -8.325  6.886   1.00 0.00 ? 95  ILE A C      1  
ATOM   1342   O  O      . ILE A 1 88  ? -18.938 -8.345  7.304   1.00 0.00 ? 95  ILE A O      1  
ATOM   1343   C  CB     . ILE A 1 88  ? -18.417 -7.608  4.551   1.00 0.00 ? 95  ILE A CB     1  
ATOM   1344   C  CG1    . ILE A 1 88  ? -18.498 -9.065  4.068   1.00 0.00 ? 95  ILE A CG1    1  
ATOM   1345   C  CG2    . ILE A 1 88  ? -18.071 -6.677  3.396   1.00 0.00 ? 95  ILE A CG2    1  
ATOM   1346   C  CD1    . ILE A 1 88  ? -17.274 -9.559  3.329   1.00 0.00 ? 95  ILE A CD1    1  
ATOM   1347   H  H      . ILE A 1 88  ? -15.832 -8.126  4.457   1.00 0.00 ? 95  ILE A H      1  
ATOM   1348   H  HA     . ILE A 1 88  ? -17.470 -6.400  6.040   1.00 0.00 ? 95  ILE A HA     1  
ATOM   1349   H  HB     . ILE A 1 88  ? -19.387 -7.312  4.923   1.00 0.00 ? 95  ILE A HB     1  
ATOM   1350   H  HG12   . ILE A 1 88  ? -18.642 -9.709  4.923   1.00 0.00 ? 95  ILE A HG12   1  
ATOM   1351   H  HG13   . ILE A 1 88  ? -19.347 -9.167  3.405   1.00 0.00 ? 95  ILE A HG13   1  
ATOM   1352   H  HG21   . ILE A 1 88  ? -17.075 -6.900  3.040   1.00 0.00 ? 95  ILE A HG21   1  
ATOM   1353   H  HG22   . ILE A 1 88  ? -18.112 -5.653  3.735   1.00 0.00 ? 95  ILE A HG22   1  
ATOM   1354   H  HG23   . ILE A 1 88  ? -18.779 -6.818  2.593   1.00 0.00 ? 95  ILE A HG23   1  
ATOM   1355   H  HD11   . ILE A 1 88  ? -16.427 -9.561  4.002   1.00 0.00 ? 95  ILE A HD11   1  
ATOM   1356   H  HD12   . ILE A 1 88  ? -17.069 -8.907  2.493   1.00 0.00 ? 95  ILE A HD12   1  
ATOM   1357   H  HD13   . ILE A 1 88  ? -17.450 -10.562 2.971   1.00 0.00 ? 95  ILE A HD13   1  
ATOM   1358   N  N      . THR A 1 89  ? -16.815 -9.055  7.426   1.00 0.00 ? 96  THR A N      1  
ATOM   1359   C  CA     . THR A 1 89  ? -17.029 -9.816  8.648   1.00 0.00 ? 96  THR A CA     1  
ATOM   1360   C  C      . THR A 1 89  ? -16.698 -8.953  9.855   1.00 0.00 ? 96  THR A C      1  
ATOM   1361   O  O      . THR A 1 89  ? -17.108 -9.237  10.980  1.00 0.00 ? 96  THR A O      1  
ATOM   1362   C  CB     . THR A 1 89  ? -16.164 -11.089 8.681   1.00 0.00 ? 96  THR A CB     1  
ATOM   1363   O  OG1    . THR A 1 89  ? -14.846 -10.793 8.207   1.00 0.00 ? 96  THR A OG1    1  
ATOM   1364   C  CG2    . THR A 1 89  ? -16.777 -12.188 7.835   1.00 0.00 ? 96  THR A CG2    1  
ATOM   1365   H  H      . THR A 1 89  ? -15.930 -9.075  7.004   1.00 0.00 ? 96  THR A H      1  
ATOM   1366   H  HA     . THR A 1 89  ? -18.071 -10.105 8.691   1.00 0.00 ? 96  THR A HA     1  
ATOM   1367   H  HB     . THR A 1 89  ? -16.098 -11.436 9.703   1.00 0.00 ? 96  THR A HB     1  
ATOM   1368   H  HG1    . THR A 1 89  ? -14.194 -11.128 8.842   1.00 0.00 ? 96  THR A HG1    1  
ATOM   1369   H  HG21   . THR A 1 89  ? -16.140 -13.061 7.856   1.00 0.00 ? 96  THR A HG21   1  
ATOM   1370   H  HG22   . THR A 1 89  ? -16.873 -11.841 6.812   1.00 0.00 ? 96  THR A HG22   1  
ATOM   1371   H  HG23   . THR A 1 89  ? -17.751 -12.442 8.222   1.00 0.00 ? 96  THR A HG23   1  
ATOM   1372   N  N      . GLU A 1 90  ? -15.963 -7.880  9.600   1.00 0.00 ? 97  GLU A N      1  
ATOM   1373   C  CA     . GLU A 1 90  ? -15.542 -6.977  10.650  1.00 0.00 ? 97  GLU A CA     1  
ATOM   1374   C  C      . GLU A 1 90  ? -16.270 -5.650  10.519  1.00 0.00 ? 97  GLU A C      1  
ATOM   1375   O  O      . GLU A 1 90  ? -15.988 -4.859  9.621   1.00 0.00 ? 97  GLU A O      1  
ATOM   1376   C  CB     . GLU A 1 90  ? -14.038 -6.731  10.579  1.00 0.00 ? 97  GLU A CB     1  
ATOM   1377   C  CG     . GLU A 1 90  ? -13.197 -7.988  10.457  1.00 0.00 ? 97  GLU A CG     1  
ATOM   1378   C  CD     . GLU A 1 90  ? -11.722 -7.672  10.331  1.00 0.00 ? 97  GLU A CD     1  
ATOM   1379   O  OE1    . GLU A 1 90  ? -11.378 -6.720  9.595   1.00 0.00 ? 97  GLU A OE1    1  
ATOM   1380   O  OE2    . GLU A 1 90  ? -10.906 -8.370  10.970  1.00 0.00 ? 97  GLU A OE2    1  
ATOM   1381   H  H      . GLU A 1 90  ? -15.703 -7.685  8.672   1.00 0.00 ? 97  GLU A H      1  
ATOM   1382   H  HA     . GLU A 1 90  ? -15.787 -7.426  11.602  1.00 0.00 ? 97  GLU A HA     1  
ATOM   1383   H  HB2    . GLU A 1 90  ? -13.834 -6.110  9.721   1.00 0.00 ? 97  GLU A HB2    1  
ATOM   1384   H  HB3    . GLU A 1 90  ? -13.731 -6.206  11.473  1.00 0.00 ? 97  GLU A HB3    1  
ATOM   1385   H  HG2    . GLU A 1 90  ? -13.348 -8.598  11.335  1.00 0.00 ? 97  GLU A HG2    1  
ATOM   1386   H  HG3    . GLU A 1 90  ? -13.512 -8.533  9.578   1.00 0.00 ? 97  GLU A HG3    1  
ATOM   1387   N  N      . HIS A 1 91  ? -17.214 -5.411  11.408  1.00 0.00 ? 98  HIS A N      1  
ATOM   1388   C  CA     . HIS A 1 91  ? -17.906 -4.132  11.440  1.00 0.00 ? 98  HIS A CA     1  
ATOM   1389   C  C      . HIS A 1 91  ? -16.975 -3.070  12.019  1.00 0.00 ? 98  HIS A C      1  
ATOM   1390   O  O      . HIS A 1 91  ? -17.116 -1.881  11.743  1.00 0.00 ? 98  HIS A O      1  
ATOM   1391   C  CB     . HIS A 1 91  ? -19.193 -4.237  12.266  1.00 0.00 ? 98  HIS A CB     1  
ATOM   1392   C  CG     . HIS A 1 91  ? -19.993 -2.968  12.306  1.00 0.00 ? 98  HIS A CG     1  
ATOM   1393   N  ND1    . HIS A 1 91  ? -19.966 -2.098  13.371  1.00 0.00 ? 98  HIS A ND1    1  
ATOM   1394   C  CD2    . HIS A 1 91  ? -20.849 -2.430  11.405  1.00 0.00 ? 98  HIS A CD2    1  
ATOM   1395   C  CE1    . HIS A 1 91  ? -20.769 -1.084  13.129  1.00 0.00 ? 98  HIS A CE1    1  
ATOM   1396   N  NE2    . HIS A 1 91  ? -21.318 -1.260  11.942  1.00 0.00 ? 98  HIS A NE2    1  
ATOM   1397   H  H      . HIS A 1 91  ? -17.448 -6.109  12.060  1.00 0.00 ? 98  HIS A H      1  
ATOM   1398   H  HA     . HIS A 1 91  ? -18.155 -3.862  10.423  1.00 0.00 ? 98  HIS A HA     1  
ATOM   1399   H  HB2    . HIS A 1 91  ? -19.820 -5.008  11.845  1.00 0.00 ? 98  HIS A HB2    1  
ATOM   1400   H  HB3    . HIS A 1 91  ? -18.941 -4.502  13.282  1.00 0.00 ? 98  HIS A HB3    1  
ATOM   1401   H  HD1    . HIS A 1 91  ? -19.424 -2.205  14.192  1.00 0.00 ? 98  HIS A HD1    1  
ATOM   1402   H  HD2    . HIS A 1 91  ? -21.115 -2.847  10.445  1.00 0.00 ? 98  HIS A HD2    1  
ATOM   1403   H  HE1    . HIS A 1 91  ? -20.949 -0.248  13.791  1.00 0.00 ? 98  HIS A HE1    1  
ATOM   1404   H  HE2    . HIS A 1 91  ? -21.858 -0.583  11.463  1.00 0.00 ? 98  HIS A HE2    1  
ATOM   1405   N  N      . GLU A 1 92  ? -16.004 -3.527  12.802  1.00 0.00 ? 99  GLU A N      1  
ATOM   1406   C  CA     . GLU A 1 92  ? -15.038 -2.640  13.434  1.00 0.00 ? 99  GLU A CA     1  
ATOM   1407   C  C      . GLU A 1 92  ? -14.151 -1.949  12.411  1.00 0.00 ? 99  GLU A C      1  
ATOM   1408   O  O      . GLU A 1 92  ? -13.972 -0.734  12.463  1.00 0.00 ? 99  GLU A O      1  
ATOM   1409   C  CB     . GLU A 1 92  ? -14.178 -3.414  14.424  1.00 0.00 ? 99  GLU A CB     1  
ATOM   1410   C  CG     . GLU A 1 92  ? -14.953 -3.891  15.633  1.00 0.00 ? 99  GLU A CG     1  
ATOM   1411   C  CD     . GLU A 1 92  ? -14.087 -4.642  16.615  1.00 0.00 ? 99  GLU A CD     1  
ATOM   1412   O  OE1    . GLU A 1 92  ? -13.158 -4.028  17.176  1.00 0.00 ? 99  GLU A OE1    1  
ATOM   1413   O  OE2    . GLU A 1 92  ? -14.326 -5.848  16.820  1.00 0.00 ? 99  GLU A OE2    1  
ATOM   1414   H  H      . GLU A 1 92  ? -15.941 -4.491  12.966  1.00 0.00 ? 99  GLU A H      1  
ATOM   1415   H  HA     . GLU A 1 92  ? -15.592 -1.887  13.973  1.00 0.00 ? 99  GLU A HA     1  
ATOM   1416   H  HB2    . GLU A 1 92  ? -13.759 -4.276  13.928  1.00 0.00 ? 99  GLU A HB2    1  
ATOM   1417   H  HB3    . GLU A 1 92  ? -13.375 -2.776  14.764  1.00 0.00 ? 99  GLU A HB3    1  
ATOM   1418   H  HG2    . GLU A 1 92  ? -15.375 -3.033  16.131  1.00 0.00 ? 99  GLU A HG2    1  
ATOM   1419   H  HG3    . GLU A 1 92  ? -15.747 -4.543  15.300  1.00 0.00 ? 99  GLU A HG3    1  
ATOM   1420   N  N      . SER A 1 93  ? -13.600 -2.712  11.476  1.00 0.00 ? 100 SER A N      1  
ATOM   1421   C  CA     . SER A 1 93  ? -12.718 -2.134  10.480  1.00 0.00 ? 100 SER A CA     1  
ATOM   1422   C  C      . SER A 1 93  ? -13.511 -1.268  9.504   1.00 0.00 ? 100 SER A C      1  
ATOM   1423   O  O      . SER A 1 93  ? -12.967 -0.348  8.894   1.00 0.00 ? 100 SER A O      1  
ATOM   1424   C  CB     . SER A 1 93  ? -11.929 -3.224  9.750   1.00 0.00 ? 100 SER A CB     1  
ATOM   1425   O  OG     . SER A 1 93  ? -12.770 -4.273  9.316   1.00 0.00 ? 100 SER A OG     1  
ATOM   1426   H  H      . SER A 1 93  ? -13.790 -3.673  11.453  1.00 0.00 ? 100 SER A H      1  
ATOM   1427   H  HA     . SER A 1 93  ? -12.024 -1.498  11.008  1.00 0.00 ? 100 SER A HA     1  
ATOM   1428   H  HB2    . SER A 1 93  ? -11.441 -2.793  8.890   1.00 0.00 ? 100 SER A HB2    1  
ATOM   1429   H  HB3    . SER A 1 93  ? -11.181 -3.631  10.418  1.00 0.00 ? 100 SER A HB3    1  
ATOM   1430   H  HG     . SER A 1 93  ? -12.284 -5.115  9.369   1.00 0.00 ? 100 SER A HG     1  
ATOM   1431   N  N      . PHE A 1 94  ? -14.803 -1.561  9.379   1.00 0.00 ? 101 PHE A N      1  
ATOM   1432   C  CA     . PHE A 1 94  ? -15.705 -0.723  8.603   1.00 0.00 ? 101 PHE A CA     1  
ATOM   1433   C  C      . PHE A 1 94  ? -15.806 0.666   9.230   1.00 0.00 ? 101 PHE A C      1  
ATOM   1434   O  O      . PHE A 1 94  ? -15.679 1.675   8.543   1.00 0.00 ? 101 PHE A O      1  
ATOM   1435   C  CB     . PHE A 1 94  ? -17.094 -1.358  8.514   1.00 0.00 ? 101 PHE A CB     1  
ATOM   1436   C  CG     . PHE A 1 94  ? -18.113 -0.468  7.859   1.00 0.00 ? 101 PHE A CG     1  
ATOM   1437   C  CD1    . PHE A 1 94  ? -18.108 -0.270  6.487   1.00 0.00 ? 101 PHE A CD1    1  
ATOM   1438   C  CD2    . PHE A 1 94  ? -19.075 0.175   8.622   1.00 0.00 ? 101 PHE A CD2    1  
ATOM   1439   C  CE1    . PHE A 1 94  ? -19.043 0.555   5.891   1.00 0.00 ? 101 PHE A CE1    1  
ATOM   1440   C  CE2    . PHE A 1 94  ? -20.010 0.999   8.030   1.00 0.00 ? 101 PHE A CE2    1  
ATOM   1441   C  CZ     . PHE A 1 94  ? -19.995 1.190   6.663   1.00 0.00 ? 101 PHE A CZ     1  
ATOM   1442   H  H      . PHE A 1 94  ? -15.152 -2.369  9.811   1.00 0.00 ? 101 PHE A H      1  
ATOM   1443   H  HA     . PHE A 1 94  ? -15.295 -0.627  7.609   1.00 0.00 ? 101 PHE A HA     1  
ATOM   1444   H  HB2    . PHE A 1 94  ? -17.030 -2.272  7.942   1.00 0.00 ? 101 PHE A HB2    1  
ATOM   1445   H  HB3    . PHE A 1 94  ? -17.441 -1.586  9.511   1.00 0.00 ? 101 PHE A HB3    1  
ATOM   1446   H  HD1    . PHE A 1 94  ? -17.364 -0.766  5.882   1.00 0.00 ? 101 PHE A HD1    1  
ATOM   1447   H  HD2    . PHE A 1 94  ? -19.088 0.027   9.693   1.00 0.00 ? 101 PHE A HD2    1  
ATOM   1448   H  HE1    . PHE A 1 94  ? -19.029 0.705   4.821   1.00 0.00 ? 101 PHE A HE1    1  
ATOM   1449   H  HE2    . PHE A 1 94  ? -20.754 1.494   8.638   1.00 0.00 ? 101 PHE A HE2    1  
ATOM   1450   H  HZ     . PHE A 1 94  ? -20.724 1.835   6.199   1.00 0.00 ? 101 PHE A HZ     1  
ATOM   1451   N  N      . THR A 1 95  ? -16.035 0.706   10.535  1.00 0.00 ? 102 THR A N      1  
ATOM   1452   C  CA     . THR A 1 95  ? -16.101 1.965   11.264  1.00 0.00 ? 102 THR A CA     1  
ATOM   1453   C  C      . THR A 1 95  ? -14.739 2.666   11.255  1.00 0.00 ? 102 THR A C      1  
ATOM   1454   O  O      . THR A 1 95  ? -14.651 3.895   11.221  1.00 0.00 ? 102 THR A O      1  
ATOM   1455   C  CB     . THR A 1 95  ? -16.550 1.724   12.721  1.00 0.00 ? 102 THR A CB     1  
ATOM   1456   O  OG1    . THR A 1 95  ? -17.756 0.946   12.735  1.00 0.00 ? 102 THR A OG1    1  
ATOM   1457   C  CG2    . THR A 1 95  ? -16.785 3.038   13.456  1.00 0.00 ? 102 THR A CG2    1  
ATOM   1458   H  H      . THR A 1 95  ? -16.178 -0.136  11.022  1.00 0.00 ? 102 THR A H      1  
ATOM   1459   H  HA     . THR A 1 95  ? -16.830 2.598   10.780  1.00 0.00 ? 102 THR A HA     1  
ATOM   1460   H  HB     . THR A 1 95  ? -15.771 1.175   13.234  1.00 0.00 ? 102 THR A HB     1  
ATOM   1461   H  HG1    . THR A 1 95  ? -18.503 1.503   12.463  1.00 0.00 ? 102 THR A HG1    1  
ATOM   1462   H  HG21   . THR A 1 95  ? -17.109 2.832   14.465  1.00 0.00 ? 102 THR A HG21   1  
ATOM   1463   H  HG22   . THR A 1 95  ? -17.545 3.608   12.943  1.00 0.00 ? 102 THR A HG22   1  
ATOM   1464   H  HG23   . THR A 1 95  ? -15.866 3.605   13.480  1.00 0.00 ? 102 THR A HG23   1  
ATOM   1465   N  N      . ALA A 1 96  ? -13.682 1.865   11.249  1.00 0.00 ? 103 ALA A N      1  
ATOM   1466   C  CA     . ALA A 1 96  ? -12.321 2.377   11.318  1.00 0.00 ? 103 ALA A CA     1  
ATOM   1467   C  C      . ALA A 1 96  ? -11.887 3.065   10.024  1.00 0.00 ? 103 ALA A C      1  
ATOM   1468   O  O      . ALA A 1 96  ? -10.896 3.792   10.018  1.00 0.00 ? 103 ALA A O      1  
ATOM   1469   C  CB     . ALA A 1 96  ? -11.357 1.255   11.670  1.00 0.00 ? 103 ALA A CB     1  
ATOM   1470   H  H      . ALA A 1 96  ? -13.824 0.894   11.208  1.00 0.00 ? 103 ALA A H      1  
ATOM   1471   H  HA     . ALA A 1 96  ? -12.286 3.103   12.118  1.00 0.00 ? 103 ALA A HA     1  
ATOM   1472   H  HB1    . ALA A 1 96  ? -11.367 0.512   10.885  1.00 0.00 ? 103 ALA A HB1    1  
ATOM   1473   H  HB2    . ALA A 1 96  ? -11.660 0.798   12.600  1.00 0.00 ? 103 ALA A HB2    1  
ATOM   1474   H  HB3    . ALA A 1 96  ? -10.359 1.657   11.773  1.00 0.00 ? 103 ALA A HB3    1  
ATOM   1475   N  N      . THR A 1 97  ? -12.626 2.848   8.935   1.00 0.00 ? 104 THR A N      1  
ATOM   1476   C  CA     . THR A 1 97  ? -12.278 3.447   7.646   1.00 0.00 ? 104 THR A CA     1  
ATOM   1477   C  C      . THR A 1 97  ? -12.231 4.972   7.744   1.00 0.00 ? 104 THR A C      1  
ATOM   1478   O  O      . THR A 1 97  ? -11.351 5.615   7.172   1.00 0.00 ? 104 THR A O      1  
ATOM   1479   C  CB     . THR A 1 97  ? -13.270 3.045   6.535   1.00 0.00 ? 104 THR A CB     1  
ATOM   1480   O  OG1    . THR A 1 97  ? -14.606 3.394   6.917   1.00 0.00 ? 104 THR A OG1    1  
ATOM   1481   C  CG2    . THR A 1 97  ? -13.195 1.553   6.238   1.00 0.00 ? 104 THR A CG2    1  
ATOM   1482   H  H      . THR A 1 97  ? -13.420 2.277   9.000   1.00 0.00 ? 104 THR A H      1  
ATOM   1483   H  HA     . THR A 1 97  ? -11.297 3.088   7.369   1.00 0.00 ? 104 THR A HA     1  
ATOM   1484   H  HB     . THR A 1 97  ? -13.011 3.584   5.634   1.00 0.00 ? 104 THR A HB     1  
ATOM   1485   H  HG1    . THR A 1 97  ? -15.016 2.649   7.378   1.00 0.00 ? 104 THR A HG1    1  
ATOM   1486   H  HG21   . THR A 1 97  ? -13.898 1.306   5.457   1.00 0.00 ? 104 THR A HG21   1  
ATOM   1487   H  HG22   . THR A 1 97  ? -13.438 0.995   7.132   1.00 0.00 ? 104 THR A HG22   1  
ATOM   1488   H  HG23   . THR A 1 97  ? -12.195 1.299   5.918   1.00 0.00 ? 104 THR A HG23   1  
ATOM   1489   N  N      . ALA A 1 98  ? -13.174 5.536   8.493   1.00 0.00 ? 105 ALA A N      1  
ATOM   1490   C  CA     . ALA A 1 98  ? -13.234 6.978   8.701   1.00 0.00 ? 105 ALA A CA     1  
ATOM   1491   C  C      . ALA A 1 98  ? -12.026 7.454   9.500   1.00 0.00 ? 105 ALA A C      1  
ATOM   1492   O  O      . ALA A 1 98  ? -11.490 8.534   9.251   1.00 0.00 ? 105 ALA A O      1  
ATOM   1493   C  CB     . ALA A 1 98  ? -14.526 7.354   9.412   1.00 0.00 ? 105 ALA A CB     1  
ATOM   1494   H  H      . ALA A 1 98  ? -13.849 4.965   8.914   1.00 0.00 ? 105 ALA A H      1  
ATOM   1495   H  HA     . ALA A 1 98  ? -13.227 7.458   7.733   1.00 0.00 ? 105 ALA A HA     1  
ATOM   1496   H  HB1    . ALA A 1 98  ? -14.570 8.427   9.535   1.00 0.00 ? 105 ALA A HB1    1  
ATOM   1497   H  HB2    . ALA A 1 98  ? -14.557 6.879   10.380  1.00 0.00 ? 105 ALA A HB2    1  
ATOM   1498   H  HB3    . ALA A 1 98  ? -15.371 7.024   8.823   1.00 0.00 ? 105 ALA A HB3    1  
ATOM   1499   N  N      . GLU A 1 99  ? -11.591 6.624   10.440  1.00 0.00 ? 106 GLU A N      1  
ATOM   1500   C  CA     . GLU A 1 99  ? -10.434 6.934   11.269  1.00 0.00 ? 106 GLU A CA     1  
ATOM   1501   C  C      . GLU A 1 99  ? -9.175  6.978   10.405  1.00 0.00 ? 106 GLU A C      1  
ATOM   1502   O  O      . GLU A 1 99  ? -8.383  7.915   10.495  1.00 0.00 ? 106 GLU A O      1  
ATOM   1503   C  CB     . GLU A 1 99  ? -10.283 5.884   12.376  1.00 0.00 ? 106 GLU A CB     1  
ATOM   1504   C  CG     . GLU A 1 99  ? -9.397  6.322   13.529  1.00 0.00 ? 106 GLU A CG     1  
ATOM   1505   C  CD     . GLU A 1 99  ? -10.036 7.414   14.363  1.00 0.00 ? 106 GLU A CD     1  
ATOM   1506   O  OE1    . GLU A 1 99  ? -11.002 7.113   15.098  1.00 0.00 ? 106 GLU A OE1    1  
ATOM   1507   O  OE2    . GLU A 1 99  ? -9.581  8.570   14.287  1.00 0.00 ? 106 GLU A OE2    1  
ATOM   1508   H  H      . GLU A 1 99  ? -12.059 5.775   10.575  1.00 0.00 ? 106 GLU A H      1  
ATOM   1509   H  HA     . GLU A 1 99  ? -10.591 7.904   11.716  1.00 0.00 ? 106 GLU A HA     1  
ATOM   1510   H  HB2    . GLU A 1 99  ? -11.261 5.656   12.772  1.00 0.00 ? 106 GLU A HB2    1  
ATOM   1511   H  HB3    . GLU A 1 99  ? -9.862  4.986   11.948  1.00 0.00 ? 106 GLU A HB3    1  
ATOM   1512   H  HG2    . GLU A 1 99  ? -9.206  5.469   14.164  1.00 0.00 ? 106 GLU A HG2    1  
ATOM   1513   H  HG3    . GLU A 1 99  ? -8.463  6.690   13.131  1.00 0.00 ? 106 GLU A HG3    1  
ATOM   1514   N  N      . PHE A 1 100 ? -9.010  5.967   9.548   1.00 0.00 ? 107 PHE A N      1  
ATOM   1515   C  CA     . PHE A 1 100 ? -7.880  5.922   8.619   1.00 0.00 ? 107 PHE A CA     1  
ATOM   1516   C  C      . PHE A 1 100 ? -7.897  7.149   7.717   1.00 0.00 ? 107 PHE A C      1  
ATOM   1517   O  O      . PHE A 1 100 ? -6.869  7.781   7.481   1.00 0.00 ? 107 PHE A O      1  
ATOM   1518   C  CB     . PHE A 1 100 ? -7.923  4.668   7.734   1.00 0.00 ? 107 PHE A CB     1  
ATOM   1519   C  CG     . PHE A 1 100 ? -8.040  3.364   8.473   1.00 0.00 ? 107 PHE A CG     1  
ATOM   1520   C  CD1    . PHE A 1 100 ? -7.316  3.126   9.630   1.00 0.00 ? 107 PHE A CD1    1  
ATOM   1521   C  CD2    . PHE A 1 100 ? -8.880  2.368   7.997   1.00 0.00 ? 107 PHE A CD2    1  
ATOM   1522   C  CE1    . PHE A 1 100 ? -7.427  1.920   10.297  1.00 0.00 ? 107 PHE A CE1    1  
ATOM   1523   C  CE2    . PHE A 1 100 ? -8.995  1.161   8.658   1.00 0.00 ? 107 PHE A CE2    1  
ATOM   1524   C  CZ     . PHE A 1 100 ? -8.269  0.937   9.811   1.00 0.00 ? 107 PHE A CZ     1  
ATOM   1525   H  H      . PHE A 1 100 ? -9.662  5.229   9.549   1.00 0.00 ? 107 PHE A H      1  
ATOM   1526   H  HA     . PHE A 1 100 ? -6.968  5.921   9.198   1.00 0.00 ? 107 PHE A HA     1  
ATOM   1527   H  HB2    . PHE A 1 100 ? -8.769  4.742   7.069   1.00 0.00 ? 107 PHE A HB2    1  
ATOM   1528   H  HB3    . PHE A 1 100 ? -7.019  4.631   7.144   1.00 0.00 ? 107 PHE A HB3    1  
ATOM   1529   H  HD1    . PHE A 1 100 ? -6.657  3.894   10.011  1.00 0.00 ? 107 PHE A HD1    1  
ATOM   1530   H  HD2    . PHE A 1 100 ? -9.449  2.541   7.095   1.00 0.00 ? 107 PHE A HD2    1  
ATOM   1531   H  HE1    . PHE A 1 100 ? -6.857  1.747   11.200  1.00 0.00 ? 107 PHE A HE1    1  
ATOM   1532   H  HE2    . PHE A 1 100 ? -9.654  0.394   8.272   1.00 0.00 ? 107 PHE A HE2    1  
ATOM   1533   H  HZ     . PHE A 1 100 ? -8.356  -0.008  10.330  1.00 0.00 ? 107 PHE A HZ     1  
ATOM   1534   N  N      . ARG A 1 101 ? -9.086  7.472   7.219   1.00 0.00 ? 108 ARG A N      1  
ATOM   1535   C  CA     . ARG A 1 101 ? -9.278  8.609   6.334   1.00 0.00 ? 108 ARG A CA     1  
ATOM   1536   C  C      . ARG A 1 101 ? -8.772  9.891   6.986   1.00 0.00 ? 108 ARG A C      1  
ATOM   1537   O  O      . ARG A 1 101 ? -7.972  10.622  6.403   1.00 0.00 ? 108 ARG A O      1  
ATOM   1538   C  CB     . ARG A 1 101 ? -10.761 8.744   5.988   1.00 0.00 ? 108 ARG A CB     1  
ATOM   1539   C  CG     . ARG A 1 101 ? -11.059 9.772   4.911   1.00 0.00 ? 108 ARG A CG     1  
ATOM   1540   C  CD     . ARG A 1 101 ? -12.555 9.898   4.683   1.00 0.00 ? 108 ARG A CD     1  
ATOM   1541   N  NE     . ARG A 1 101 ? -12.876 10.771  3.557   1.00 0.00 ? 108 ARG A NE     1  
ATOM   1542   C  CZ     . ARG A 1 101 ? -14.036 11.416  3.428   1.00 0.00 ? 108 ARG A CZ     1  
ATOM   1543   N  NH1    . ARG A 1 101 ? -14.938 11.364  4.401   1.00 0.00 ? 108 ARG A NH1    1  
ATOM   1544   N  NH2    . ARG A 1 101 ? -14.277 12.132  2.337   1.00 0.00 ? 108 ARG A NH2    1  
ATOM   1545   H  H      . ARG A 1 101 ? -9.864  6.919   7.456   1.00 0.00 ? 108 ARG A H      1  
ATOM   1546   H  HA     . ARG A 1 101 ? -8.718  8.430   5.428   1.00 0.00 ? 108 ARG A HA     1  
ATOM   1547   H  HB2    . ARG A 1 101 ? -11.126 7.786   5.649   1.00 0.00 ? 108 ARG A HB2    1  
ATOM   1548   H  HB3    . ARG A 1 101 ? -11.299 9.028   6.881   1.00 0.00 ? 108 ARG A HB3    1  
ATOM   1549   H  HG2    . ARG A 1 101 ? -10.668 10.728  5.221   1.00 0.00 ? 108 ARG A HG2    1  
ATOM   1550   H  HG3    . ARG A 1 101 ? -10.586 9.466   3.989   1.00 0.00 ? 108 ARG A HG3    1  
ATOM   1551   H  HD2    . ARG A 1 101 ? -12.961 8.916   4.490   1.00 0.00 ? 108 ARG A HD2    1  
ATOM   1552   H  HD3    . ARG A 1 101 ? -13.007 10.301  5.576   1.00 0.00 ? 108 ARG A HD3    1  
ATOM   1553   H  HE     . ARG A 1 101 ? -12.204 10.858  2.848   1.00 0.00 ? 108 ARG A HE     1  
ATOM   1554   H  HH11   . ARG A 1 101 ? -14.749 10.844  5.241   1.00 0.00 ? 108 ARG A HH11   1  
ATOM   1555   H  HH12   . ARG A 1 101 ? -15.822 11.841  4.298   1.00 0.00 ? 108 ARG A HH12   1  
ATOM   1556   H  HH21   . ARG A 1 101 ? -13.586 12.191  1.604   1.00 0.00 ? 108 ARG A HH21   1  
ATOM   1557   H  HH22   . ARG A 1 101 ? -15.155 12.618  2.228   1.00 0.00 ? 108 ARG A HH22   1  
ATOM   1558   N  N      . GLU A 1 102 ? -9.217  10.145  8.210   1.00 0.00 ? 109 GLU A N      1  
ATOM   1559   C  CA     . GLU A 1 102 ? -8.828  11.354  8.922   1.00 0.00 ? 109 GLU A CA     1  
ATOM   1560   C  C      . GLU A 1 102 ? -7.357  11.330  9.318   1.00 0.00 ? 109 GLU A C      1  
ATOM   1561   O  O      . GLU A 1 102 ? -6.713  12.375  9.359   1.00 0.00 ? 109 GLU A O      1  
ATOM   1562   C  CB     . GLU A 1 102 ? -9.713  11.566  10.147  1.00 0.00 ? 109 GLU A CB     1  
ATOM   1563   C  CG     . GLU A 1 102 ? -11.097 12.079  9.790   1.00 0.00 ? 109 GLU A CG     1  
ATOM   1564   C  CD     . GLU A 1 102 ? -11.898 12.502  10.998  1.00 0.00 ? 109 GLU A CD     1  
ATOM   1565   O  OE1    . GLU A 1 102 ? -11.456 13.425  11.710  1.00 0.00 ? 109 GLU A OE1    1  
ATOM   1566   O  OE2    . GLU A 1 102 ? -12.985 11.931  11.223  1.00 0.00 ? 109 GLU A OE2    1  
ATOM   1567   H  H      . GLU A 1 102 ? -9.821  9.502   8.647   1.00 0.00 ? 109 GLU A H      1  
ATOM   1568   H  HA     . GLU A 1 102 ? -8.980  12.184  8.244   1.00 0.00 ? 109 GLU A HA     1  
ATOM   1569   H  HB2    . GLU A 1 102 ? -9.820  10.625  10.667  1.00 0.00 ? 109 GLU A HB2    1  
ATOM   1570   H  HB3    . GLU A 1 102 ? -9.239  12.281  10.806  1.00 0.00 ? 109 GLU A HB3    1  
ATOM   1571   H  HG2    . GLU A 1 102 ? -10.992 12.930  9.136   1.00 0.00 ? 109 GLU A HG2    1  
ATOM   1572   H  HG3    . GLU A 1 102 ? -11.636 11.295  9.277   1.00 0.00 ? 109 GLU A HG3    1  
ATOM   1573   N  N      . GLN A 1 103 ? -6.824  10.144  9.600   1.00 0.00 ? 110 GLN A N      1  
ATOM   1574   C  CA     . GLN A 1 103 ? -5.396  9.994   9.868   1.00 0.00 ? 110 GLN A CA     1  
ATOM   1575   C  C      . GLN A 1 103 ? -4.585  10.506  8.684   1.00 0.00 ? 110 GLN A C      1  
ATOM   1576   O  O      . GLN A 1 103 ? -3.582  11.199  8.850   1.00 0.00 ? 110 GLN A O      1  
ATOM   1577   C  CB     . GLN A 1 103 ? -5.050  8.527   10.150  1.00 0.00 ? 110 GLN A CB     1  
ATOM   1578   C  CG     . GLN A 1 103 ? -4.494  8.295   11.544  1.00 0.00 ? 110 GLN A CG     1  
ATOM   1579   C  CD     . GLN A 1 103 ? -5.408  8.840   12.621  1.00 0.00 ? 110 GLN A CD     1  
ATOM   1580   O  OE1    . GLN A 1 103 ? -6.273  8.135   13.136  1.00 0.00 ? 110 GLN A OE1    1  
ATOM   1581   N  NE2    . GLN A 1 103 ? -5.217  10.100  12.972  1.00 0.00 ? 110 GLN A NE2    1  
ATOM   1582   H  H      . GLN A 1 103 ? -7.408  9.353   9.644   1.00 0.00 ? 110 GLN A H      1  
ATOM   1583   H  HA     . GLN A 1 103 ? -5.157  10.589  10.739  1.00 0.00 ? 110 GLN A HA     1  
ATOM   1584   H  HB2    . GLN A 1 103 ? -5.943  7.929   10.036  1.00 0.00 ? 110 GLN A HB2    1  
ATOM   1585   H  HB3    . GLN A 1 103 ? -4.313  8.198   9.432   1.00 0.00 ? 110 GLN A HB3    1  
ATOM   1586   H  HG2    . GLN A 1 103 ? -4.372  7.233   11.699  1.00 0.00 ? 110 GLN A HG2    1  
ATOM   1587   H  HG3    . GLN A 1 103 ? -3.535  8.784   11.623  1.00 0.00 ? 110 GLN A HG3    1  
ATOM   1588   H  HE21   . GLN A 1 103 ? -4.493  10.602  12.528  1.00 0.00 ? 110 GLN A HE21   1  
ATOM   1589   H  HE22   . GLN A 1 103 ? -5.823  10.494  13.637  1.00 0.00 ? 110 GLN A HE22   1  
ATOM   1590   N  N      . ILE A 1 104 ? -5.050  10.179  7.490   1.00 0.00 ? 111 ILE A N      1  
ATOM   1591   C  CA     . ILE A 1 104 ? -4.420  10.639  6.265   1.00 0.00 ? 111 ILE A CA     1  
ATOM   1592   C  C      . ILE A 1 104 ? -4.610  12.148  6.090   1.00 0.00 ? 111 ILE A C      1  
ATOM   1593   O  O      . ILE A 1 104 ? -3.687  12.858  5.700   1.00 0.00 ? 111 ILE A O      1  
ATOM   1594   C  CB     . ILE A 1 104 ? -5.002  9.890   5.048   1.00 0.00 ? 111 ILE A CB     1  
ATOM   1595   C  CG1    . ILE A 1 104 ? -4.771  8.384   5.209   1.00 0.00 ? 111 ILE A CG1    1  
ATOM   1596   C  CG2    . ILE A 1 104 ? -4.384  10.397  3.751   1.00 0.00 ? 111 ILE A CG2    1  
ATOM   1597   C  CD1    . ILE A 1 104 ? -5.520  7.537   4.202   1.00 0.00 ? 111 ILE A CD1    1  
ATOM   1598   H  H      . ILE A 1 104 ? -5.841  9.598   7.433   1.00 0.00 ? 111 ILE A H      1  
ATOM   1599   H  HA     . ILE A 1 104 ? -3.365  10.421  6.329   1.00 0.00 ? 111 ILE A HA     1  
ATOM   1600   H  HB     . ILE A 1 104 ? -6.064  10.080  5.011   1.00 0.00 ? 111 ILE A HB     1  
ATOM   1601   H  HG12   . ILE A 1 104 ? -3.719  8.174   5.099   1.00 0.00 ? 111 ILE A HG12   1  
ATOM   1602   H  HG13   . ILE A 1 104 ? -5.090  8.084   6.197   1.00 0.00 ? 111 ILE A HG13   1  
ATOM   1603   H  HG21   . ILE A 1 104 ? -4.791  9.843   2.918   1.00 0.00 ? 111 ILE A HG21   1  
ATOM   1604   H  HG22   . ILE A 1 104 ? -3.313  10.259  3.785   1.00 0.00 ? 111 ILE A HG22   1  
ATOM   1605   H  HG23   . ILE A 1 104 ? -4.609  11.446  3.631   1.00 0.00 ? 111 ILE A HG23   1  
ATOM   1606   H  HD11   . ILE A 1 104 ? -5.213  7.808   3.202   1.00 0.00 ? 111 ILE A HD11   1  
ATOM   1607   H  HD12   . ILE A 1 104 ? -6.581  7.702   4.310   1.00 0.00 ? 111 ILE A HD12   1  
ATOM   1608   H  HD13   . ILE A 1 104 ? -5.299  6.492   4.376   1.00 0.00 ? 111 ILE A HD13   1  
ATOM   1609   N  N      . LEU A 1 105 ? -5.809  12.633  6.397   1.00 0.00 ? 112 LEU A N      1  
ATOM   1610   C  CA     . LEU A 1 105 ? -6.117  14.058  6.302   1.00 0.00 ? 112 LEU A CA     1  
ATOM   1611   C  C      . LEU A 1 105 ? -5.249  14.894  7.241   1.00 0.00 ? 112 LEU A C      1  
ATOM   1612   O  O      . LEU A 1 105 ? -4.894  16.029  6.925   1.00 0.00 ? 112 LEU A O      1  
ATOM   1613   C  CB     . LEU A 1 105 ? -7.590  14.291  6.609   1.00 0.00 ? 112 LEU A CB     1  
ATOM   1614   C  CG     . LEU A 1 105 ? -8.506  14.301  5.390   1.00 0.00 ? 112 LEU A CG     1  
ATOM   1615   C  CD1    . LEU A 1 105 ? -8.251  15.536  4.556   1.00 0.00 ? 112 LEU A CD1    1  
ATOM   1616   C  CD2    . LEU A 1 105 ? -8.329  13.051  4.545   1.00 0.00 ? 112 LEU A CD2    1  
ATOM   1617   H  H      . LEU A 1 105 ? -6.517  12.013  6.681   1.00 0.00 ? 112 LEU A H      1  
ATOM   1618   H  HA     . LEU A 1 105 ? -5.936  14.366  5.285   1.00 0.00 ? 112 LEU A HA     1  
ATOM   1619   H  HB2    . LEU A 1 105 ? -7.924  13.513  7.273   1.00 0.00 ? 112 LEU A HB2    1  
ATOM   1620   H  HB3    . LEU A 1 105 ? -7.688  15.240  7.114   1.00 0.00 ? 112 LEU A HB3    1  
ATOM   1621   H  HG     . LEU A 1 105 ? -9.519  14.332  5.728   1.00 0.00 ? 112 LEU A HG     1  
ATOM   1622   H  HD11   . LEU A 1 105 ? -8.882  15.517  3.681   1.00 0.00 ? 112 LEU A HD11   1  
ATOM   1623   H  HD12   . LEU A 1 105 ? -7.216  15.555  4.257   1.00 0.00 ? 112 LEU A HD12   1  
ATOM   1624   H  HD13   . LEU A 1 105 ? -8.473  16.414  5.143   1.00 0.00 ? 112 LEU A HD13   1  
ATOM   1625   H  HD21   . LEU A 1 105 ? -8.985  13.101  3.688   1.00 0.00 ? 112 LEU A HD21   1  
ATOM   1626   H  HD22   . LEU A 1 105 ? -8.572  12.179  5.134   1.00 0.00 ? 112 LEU A HD22   1  
ATOM   1627   H  HD23   . LEU A 1 105 ? -7.304  12.986  4.210   1.00 0.00 ? 112 LEU A HD23   1  
ATOM   1628   N  N      . ARG A 1 106 ? -4.902  14.325  8.391   1.00 0.00 ? 113 ARG A N      1  
ATOM   1629   C  CA     . ARG A 1 106 ? -4.113  15.038  9.394   1.00 0.00 ? 113 ARG A CA     1  
ATOM   1630   C  C      . ARG A 1 106 ? -2.674  15.244  8.930   1.00 0.00 ? 113 ARG A C      1  
ATOM   1631   O  O      . ARG A 1 106 ? -1.981  16.138  9.416   1.00 0.00 ? 113 ARG A O      1  
ATOM   1632   C  CB     . ARG A 1 106 ? -4.128  14.293  10.733  1.00 0.00 ? 113 ARG A CB     1  
ATOM   1633   C  CG     . ARG A 1 106 ? -5.500  14.239  11.379  1.00 0.00 ? 113 ARG A CG     1  
ATOM   1634   C  CD     . ARG A 1 106 ? -5.465  13.537  12.725  1.00 0.00 ? 113 ARG A CD     1  
ATOM   1635   N  NE     . ARG A 1 106 ? -4.681  14.276  13.716  1.00 0.00 ? 113 ARG A NE     1  
ATOM   1636   C  CZ     . ARG A 1 106 ? -4.769  14.073  15.032  1.00 0.00 ? 113 ARG A CZ     1  
ATOM   1637   N  NH1    . ARG A 1 106 ? -5.614  13.169  15.508  1.00 0.00 ? 113 ARG A NH1    1  
ATOM   1638   N  NH2    . ARG A 1 106 ? -4.014  14.773  15.869  1.00 0.00 ? 113 ARG A NH2    1  
ATOM   1639   H  H      . ARG A 1 106 ? -5.189  13.403  8.574   1.00 0.00 ? 113 ARG A H      1  
ATOM   1640   H  HA     . ARG A 1 106 ? -4.566  16.007  9.535   1.00 0.00 ? 113 ARG A HA     1  
ATOM   1641   H  HB2    . ARG A 1 106 ? -3.788  13.281  10.573  1.00 0.00 ? 113 ARG A HB2    1  
ATOM   1642   H  HB3    . ARG A 1 106 ? -3.453  14.787  11.417  1.00 0.00 ? 113 ARG A HB3    1  
ATOM   1643   H  HG2    . ARG A 1 106 ? -5.861  15.246  11.522  1.00 0.00 ? 113 ARG A HG2    1  
ATOM   1644   H  HG3    . ARG A 1 106 ? -6.170  13.704  10.723  1.00 0.00 ? 113 ARG A HG3    1  
ATOM   1645   H  HD2    . ARG A 1 106 ? -6.477  13.432  13.087  1.00 0.00 ? 113 ARG A HD2    1  
ATOM   1646   H  HD3    . ARG A 1 106 ? -5.030  12.556  12.593  1.00 0.00 ? 113 ARG A HD3    1  
ATOM   1647   H  HE     . ARG A 1 106 ? -4.057  14.964  13.380  1.00 0.00 ? 113 ARG A HE     1  
ATOM   1648   H  HH11   . ARG A 1 106 ? -6.194  12.635  14.882  1.00 0.00 ? 113 ARG A HH11   1  
ATOM   1649   H  HH12   . ARG A 1 106 ? -5.676  13.005  16.503  1.00 0.00 ? 113 ARG A HH12   1  
ATOM   1650   H  HH21   . ARG A 1 106 ? -3.365  15.461  15.518  1.00 0.00 ? 113 ARG A HH21   1  
ATOM   1651   H  HH22   . ARG A 1 106 ? -4.097  14.632  16.866  1.00 0.00 ? 113 ARG A HH22   1  
ATOM   1652   N  N      . VAL A 1 107 ? -2.225  14.423  7.993   1.00 0.00 ? 114 VAL A N      1  
ATOM   1653   C  CA     . VAL A 1 107 ? -0.857  14.520  7.511   1.00 0.00 ? 114 VAL A CA     1  
ATOM   1654   C  C      . VAL A 1 107 ? -0.806  15.043  6.077   1.00 0.00 ? 114 VAL A C      1  
ATOM   1655   O  O      . VAL A 1 107 ? 0.242   15.483  5.606   1.00 0.00 ? 114 VAL A O      1  
ATOM   1656   C  CB     . VAL A 1 107 ? -0.120  13.164  7.602   1.00 0.00 ? 114 VAL A CB     1  
ATOM   1657   C  CG1    . VAL A 1 107 ? -0.040  12.691  9.048   1.00 0.00 ? 114 VAL A CG1    1  
ATOM   1658   C  CG2    . VAL A 1 107 ? -0.802  12.117  6.741   1.00 0.00 ? 114 VAL A CG2    1  
ATOM   1659   H  H      . VAL A 1 107 ? -2.824  13.745  7.613   1.00 0.00 ? 114 VAL A H      1  
ATOM   1660   H  HA     . VAL A 1 107 ? -0.339  15.224  8.149   1.00 0.00 ? 114 VAL A HA     1  
ATOM   1661   H  HB     . VAL A 1 107 ? 0.889   13.301  7.235   1.00 0.00 ? 114 VAL A HB     1  
ATOM   1662   H  HG11   . VAL A 1 107 ? 0.507   13.415  9.634   1.00 0.00 ? 114 VAL A HG11   1  
ATOM   1663   H  HG12   . VAL A 1 107 ? 0.467   11.740  9.087   1.00 0.00 ? 114 VAL A HG12   1  
ATOM   1664   H  HG13   . VAL A 1 107 ? -1.039  12.585  9.449   1.00 0.00 ? 114 VAL A HG13   1  
ATOM   1665   H  HG21   . VAL A 1 107 ? -0.268  11.181  6.823   1.00 0.00 ? 114 VAL A HG21   1  
ATOM   1666   H  HG22   . VAL A 1 107 ? -0.802  12.444  5.711   1.00 0.00 ? 114 VAL A HG22   1  
ATOM   1667   H  HG23   . VAL A 1 107 ? -1.820  11.982  7.078   1.00 0.00 ? 114 VAL A HG23   1  
ATOM   1668   N  N      . LYS A 1 108 ? -1.938  14.992  5.382   1.00 0.00 ? 115 LYS A N      1  
ATOM   1669   C  CA     . LYS A 1 108 ? -2.016  15.496  4.016   1.00 0.00 ? 115 LYS A CA     1  
ATOM   1670   C  C      . LYS A 1 108 ? -3.288  16.302  3.812   1.00 0.00 ? 115 LYS A C      1  
ATOM   1671   O  O      . LYS A 1 108 ? -4.390  15.770  3.930   1.00 0.00 ? 115 LYS A O      1  
ATOM   1672   C  CB     . LYS A 1 108 ? -2.003  14.360  2.997   1.00 0.00 ? 115 LYS A CB     1  
ATOM   1673   C  CG     . LYS A 1 108 ? -0.828  13.403  3.114   1.00 0.00 ? 115 LYS A CG     1  
ATOM   1674   C  CD     . LYS A 1 108 ? -0.613  12.661  1.806   1.00 0.00 ? 115 LYS A CD     1  
ATOM   1675   C  CE     . LYS A 1 108 ? -1.922  12.122  1.257   1.00 0.00 ? 115 LYS A CE     1  
ATOM   1676   N  NZ     . LYS A 1 108 ? -1.878  11.943  -0.218  1.00 0.00 ? 115 LYS A NZ     1  
ATOM   1677   H  H      . LYS A 1 108 ? -2.741  14.611  5.796   1.00 0.00 ? 115 LYS A H      1  
ATOM   1678   H  HA     . LYS A 1 108 ? -1.162  16.133  3.846   1.00 0.00 ? 115 LYS A HA     1  
ATOM   1679   H  HB2    . LYS A 1 108 ? -2.912  13.788  3.113   1.00 0.00 ? 115 LYS A HB2    1  
ATOM   1680   H  HB3    . LYS A 1 108 ? -1.991  14.789  2.007   1.00 0.00 ? 115 LYS A HB3    1  
ATOM   1681   H  HG2    . LYS A 1 108 ? 0.063   13.963  3.355   1.00 0.00 ? 115 LYS A HG2    1  
ATOM   1682   H  HG3    . LYS A 1 108 ? -1.033  12.686  3.896   1.00 0.00 ? 115 LYS A HG3    1  
ATOM   1683   H  HD2    . LYS A 1 108 ? -0.181  13.340  1.084   1.00 0.00 ? 115 LYS A HD2    1  
ATOM   1684   H  HD3    . LYS A 1 108 ? 0.063   11.835  1.978   1.00 0.00 ? 115 LYS A HD3    1  
ATOM   1685   H  HE2    . LYS A 1 108 ? -2.126  11.167  1.717   1.00 0.00 ? 115 LYS A HE2    1  
ATOM   1686   H  HE3    . LYS A 1 108 ? -2.712  12.815  1.505   1.00 0.00 ? 115 LYS A HE3    1  
ATOM   1687   H  HZ1    . LYS A 1 108 ? -1.746  12.872  -0.690  1.00 0.00 ? 115 LYS A HZ1    1  
ATOM   1688   H  HZ2    . LYS A 1 108 ? -2.762  11.519  -0.556  1.00 0.00 ? 115 LYS A HZ2    1  
ATOM   1689   H  HZ3    . LYS A 1 108 ? -1.087  11.320  -0.481  1.00 0.00 ? 115 LYS A HZ3    1  
ATOM   1690   N  N      . ALA A 1 109 ? -3.136  17.577  3.489   1.00 0.00 ? 116 ALA A N      1  
ATOM   1691   C  CA     . ALA A 1 109 ? -4.292  18.428  3.229   1.00 0.00 ? 116 ALA A CA     1  
ATOM   1692   C  C      . ALA A 1 109 ? -3.980  19.560  2.246   1.00 0.00 ? 116 ALA A C      1  
ATOM   1693   O  O      . ALA A 1 109 ? -4.853  19.986  1.491   1.00 0.00 ? 116 ALA A O      1  
ATOM   1694   C  CB     . ALA A 1 109 ? -4.831  18.999  4.535   1.00 0.00 ? 116 ALA A CB     1  
ATOM   1695   H  H      . ALA A 1 109 ? -2.229  17.953  3.443   1.00 0.00 ? 116 ALA A H      1  
ATOM   1696   H  HA     . ALA A 1 109 ? -5.063  17.800  2.800   1.00 0.00 ? 116 ALA A HA     1  
ATOM   1697   H  HB1    . ALA A 1 109 ? -4.102  19.673  4.962   1.00 0.00 ? 116 ALA A HB1    1  
ATOM   1698   H  HB2    . ALA A 1 109 ? -5.025  18.192  5.228   1.00 0.00 ? 116 ALA A HB2    1  
ATOM   1699   H  HB3    . ALA A 1 109 ? -5.747  19.536  4.341   1.00 0.00 ? 116 ALA A HB3    1  
ATOM   1700   N  N      . GLU A 1 110 ? -2.742  20.049  2.249   1.00 0.00 ? 117 GLU A N      1  
ATOM   1701   C  CA     . GLU A 1 110 ? -2.374  21.205  1.434   1.00 0.00 ? 117 GLU A CA     1  
ATOM   1702   C  C      . GLU A 1 110 ? -1.885  20.797  0.045   1.00 0.00 ? 117 GLU A C      1  
ATOM   1703   O  O      . GLU A 1 110 ? -1.460  21.645  -0.742  1.00 0.00 ? 117 GLU A O      1  
ATOM   1704   C  CB     . GLU A 1 110 ? -1.295  22.024  2.142   1.00 0.00 ? 117 GLU A CB     1  
ATOM   1705   C  CG     . GLU A 1 110 ? -1.727  22.556  3.500   1.00 0.00 ? 117 GLU A CG     1  
ATOM   1706   C  CD     . GLU A 1 110 ? -0.618  23.301  4.212   1.00 0.00 ? 117 GLU A CD     1  
ATOM   1707   O  OE1    . GLU A 1 110 ? -0.506  24.528  4.017   1.00 0.00 ? 117 GLU A OE1    1  
ATOM   1708   O  OE2    . GLU A 1 110 ? 0.142   22.661  4.965   1.00 0.00 ? 117 GLU A OE2    1  
ATOM   1709   H  H      . GLU A 1 110 ? -2.060  19.636  2.823   1.00 0.00 ? 117 GLU A H      1  
ATOM   1710   H  HA     . GLU A 1 110 ? -3.254  21.818  1.321   1.00 0.00 ? 117 GLU A HA     1  
ATOM   1711   H  HB2    . GLU A 1 110 ? -0.424  21.403  2.281   1.00 0.00 ? 117 GLU A HB2    1  
ATOM   1712   H  HB3    . GLU A 1 110 ? -1.032  22.865  1.519   1.00 0.00 ? 117 GLU A HB3    1  
ATOM   1713   H  HG2    . GLU A 1 110 ? -2.560  23.229  3.361   1.00 0.00 ? 117 GLU A HG2    1  
ATOM   1714   H  HG3    . GLU A 1 110 ? -2.036  21.724  4.118   1.00 0.00 ? 117 GLU A HG3    1  
ATOM   1715   N  N      . GLU A 1 111 ? -1.954  19.510  -0.258  1.00 0.00 ? 118 GLU A N      1  
ATOM   1716   C  CA     . GLU A 1 111 ? -1.531  19.013  -1.563  1.00 0.00 ? 118 GLU A CA     1  
ATOM   1717   C  C      . GLU A 1 111 ? -2.679  19.095  -2.566  1.00 0.00 ? 118 GLU A C      1  
ATOM   1718   O  O      . GLU A 1 111 ? -3.702  19.721  -2.287  1.00 0.00 ? 118 GLU A O      1  
ATOM   1719   C  CB     . GLU A 1 111 ? -1.018  17.578  -1.443  1.00 0.00 ? 118 GLU A CB     1  
ATOM   1720   C  CG     . GLU A 1 111 ? -2.014  16.617  -0.824  1.00 0.00 ? 118 GLU A CG     1  
ATOM   1721   C  CD     . GLU A 1 111 ? -1.452  15.222  -0.700  1.00 0.00 ? 118 GLU A CD     1  
ATOM   1722   O  OE1    . GLU A 1 111 ? -0.458  15.048  0.024   1.00 0.00 ? 118 GLU A OE1    1  
ATOM   1723   O  OE2    . GLU A 1 111 ? -1.999  14.295  -1.331  1.00 0.00 ? 118 GLU A OE2    1  
ATOM   1724   H  H      . GLU A 1 111 ? -2.309  18.882  0.402   1.00 0.00 ? 118 GLU A H      1  
ATOM   1725   H  HA     . GLU A 1 111 ? -0.727  19.643  -1.908  1.00 0.00 ? 118 GLU A HA     1  
ATOM   1726   H  HB2    . GLU A 1 111 ? -0.765  17.215  -2.427  1.00 0.00 ? 118 GLU A HB2    1  
ATOM   1727   H  HB3    . GLU A 1 111 ? -0.126  17.580  -0.831  1.00 0.00 ? 118 GLU A HB3    1  
ATOM   1728   H  HG2    . GLU A 1 111 ? -2.281  16.976  0.161   1.00 0.00 ? 118 GLU A HG2    1  
ATOM   1729   H  HG3    . GLU A 1 111 ? -2.897  16.582  -1.447  1.00 0.00 ? 118 GLU A HG3    1  
ATOM   1730   N  N      . ASP A 1 112 ? -2.501  18.476  -3.731  1.00 0.00 ? 119 ASP A N      1  
ATOM   1731   C  CA     . ASP A 1 112 ? -3.516  18.512  -4.778  1.00 0.00 ? 119 ASP A CA     1  
ATOM   1732   C  C      . ASP A 1 112 ? -4.778  17.774  -4.354  1.00 0.00 ? 119 ASP A C      1  
ATOM   1733   O  O      . ASP A 1 112 ? -5.723  18.399  -3.872  1.00 0.00 ? 119 ASP A O      1  
ATOM   1734   C  CB     . ASP A 1 112 ? -2.978  17.941  -6.097  1.00 0.00 ? 119 ASP A CB     1  
ATOM   1735   C  CG     . ASP A 1 112 ? -2.178  18.957  -6.888  1.00 0.00 ? 119 ASP A CG     1  
ATOM   1736   O  OD1    . ASP A 1 112 ? -1.011  19.216  -6.523  1.00 0.00 ? 119 ASP A OD1    1  
ATOM   1737   O  OD2    . ASP A 1 112 ? -2.713  19.497  -7.879  1.00 0.00 ? 119 ASP A OD2    1  
ATOM   1738   H  H      . ASP A 1 112 ? -1.672  17.982  -3.889  1.00 0.00 ? 119 ASP A H      1  
ATOM   1739   H  HA     . ASP A 1 112 ? -3.771  19.550  -4.935  1.00 0.00 ? 119 ASP A HA     1  
ATOM   1740   H  HB2    . ASP A 1 112 ? -2.337  17.100  -5.882  1.00 0.00 ? 119 ASP A HB2    1  
ATOM   1741   H  HB3    . ASP A 1 112 ? -3.808  17.609  -6.705  1.00 0.00 ? 119 ASP A HB3    1  
ATOM   1742   N  N      . LYS A 1 113 ? -4.799  16.448  -4.501  1.00 0.00 ? 120 LYS A N      1  
ATOM   1743   C  CA     . LYS A 1 113 ? -6.005  15.679  -4.199  1.00 0.00 ? 120 LYS A CA     1  
ATOM   1744   C  C      . LYS A 1 113 ? -5.637  14.288  -3.716  1.00 0.00 ? 120 LYS A C      1  
ATOM   1745   O  O      . LYS A 1 113 ? -4.688  13.680  -4.207  1.00 0.00 ? 120 LYS A O      1  
ATOM   1746   C  CB     . LYS A 1 113 ? -6.938  15.576  -5.420  1.00 0.00 ? 120 LYS A CB     1  
ATOM   1747   C  CG     . LYS A 1 113 ? -7.562  16.900  -5.848  1.00 0.00 ? 120 LYS A CG     1  
ATOM   1748   C  CD     . LYS A 1 113 ? -8.453  17.486  -4.755  1.00 0.00 ? 120 LYS A CD     1  
ATOM   1749   C  CE     . LYS A 1 113 ? -9.788  16.766  -4.658  1.00 0.00 ? 120 LYS A CE     1  
ATOM   1750   N  NZ     . LYS A 1 113 ? -10.685 17.102  -5.797  1.00 0.00 ? 120 LYS A NZ     1  
ATOM   1751   H  H      . LYS A 1 113 ? -3.977  15.968  -4.778  1.00 0.00 ? 120 LYS A H      1  
ATOM   1752   H  HA     . LYS A 1 113 ? -6.528  16.191  -3.405  1.00 0.00 ? 120 LYS A HA     1  
ATOM   1753   H  HB2    . LYS A 1 113 ? -6.375  15.182  -6.252  1.00 0.00 ? 120 LYS A HB2    1  
ATOM   1754   H  HB3    . LYS A 1 113 ? -7.737  14.889  -5.185  1.00 0.00 ? 120 LYS A HB3    1  
ATOM   1755   H  HG2    . LYS A 1 113 ? -6.771  17.603  -6.070  1.00 0.00 ? 120 LYS A HG2    1  
ATOM   1756   H  HG3    . LYS A 1 113 ? -8.156  16.734  -6.733  1.00 0.00 ? 120 LYS A HG3    1  
ATOM   1757   H  HD2    . LYS A 1 113 ? -7.943  17.402  -3.807  1.00 0.00 ? 120 LYS A HD2    1  
ATOM   1758   H  HD3    . LYS A 1 113 ? -8.631  18.529  -4.976  1.00 0.00 ? 120 LYS A HD3    1  
ATOM   1759   H  HE2    . LYS A 1 113 ? -9.608  15.701  -4.656  1.00 0.00 ? 120 LYS A HE2    1  
ATOM   1760   H  HE3    . LYS A 1 113 ? -10.271 17.050  -3.734  1.00 0.00 ? 120 LYS A HE3    1  
ATOM   1761   H  HZ1    . LYS A 1 113 ? -11.587 16.582  -5.707  1.00 0.00 ? 120 LYS A HZ1    1  
ATOM   1762   H  HZ2    . LYS A 1 113 ? -10.238 16.844  -6.698  1.00 0.00 ? 120 LYS A HZ2    1  
ATOM   1763   H  HZ3    . LYS A 1 113 ? -10.890 18.123  -5.803  1.00 0.00 ? 120 LYS A HZ3    1  
ATOM   1764   N  N      . ILE A 1 114 ? -6.400  13.789  -2.760  1.00 0.00 ? 121 ILE A N      1  
ATOM   1765   C  CA     . ILE A 1 114 ? -6.133  12.492  -2.162  1.00 0.00 ? 121 ILE A CA     1  
ATOM   1766   C  C      . ILE A 1 114 ? -7.086  11.432  -2.717  1.00 0.00 ? 121 ILE A C      1  
ATOM   1767   O  O      . ILE A 1 114 ? -8.268  11.406  -2.368  1.00 0.00 ? 121 ILE A O      1  
ATOM   1768   C  CB     . ILE A 1 114 ? -6.274  12.559  -0.626  1.00 0.00 ? 121 ILE A CB     1  
ATOM   1769   C  CG1    . ILE A 1 114 ? -5.421  13.704  -0.070  1.00 0.00 ? 121 ILE A CG1    1  
ATOM   1770   C  CG2    . ILE A 1 114 ? -5.870  11.237  0.012   1.00 0.00 ? 121 ILE A CG2    1  
ATOM   1771   C  CD1    . ILE A 1 114 ? -5.554  13.897  1.426   1.00 0.00 ? 121 ILE A CD1    1  
ATOM   1772   H  H      . ILE A 1 114 ? -7.174  14.310  -2.442  1.00 0.00 ? 121 ILE A H      1  
ATOM   1773   H  HA     . ILE A 1 114 ? -5.115  12.214  -2.401  1.00 0.00 ? 121 ILE A HA     1  
ATOM   1774   H  HB     . ILE A 1 114 ? -7.310  12.744  -0.388  1.00 0.00 ? 121 ILE A HB     1  
ATOM   1775   H  HG12   . ILE A 1 114 ? -4.383  13.506  -0.284  1.00 0.00 ? 121 ILE A HG12   1  
ATOM   1776   H  HG13   . ILE A 1 114 ? -5.714  14.626  -0.549  1.00 0.00 ? 121 ILE A HG13   1  
ATOM   1777   H  HG21   . ILE A 1 114 ? -4.835  11.033  -0.212  1.00 0.00 ? 121 ILE A HG21   1  
ATOM   1778   H  HG22   . ILE A 1 114 ? -6.489  10.444  -0.381  1.00 0.00 ? 121 ILE A HG22   1  
ATOM   1779   H  HG23   . ILE A 1 114 ? -6.001  11.303  1.083   1.00 0.00 ? 121 ILE A HG23   1  
ATOM   1780   H  HD11   . ILE A 1 114 ? -6.581  14.125  1.672   1.00 0.00 ? 121 ILE A HD11   1  
ATOM   1781   H  HD12   . ILE A 1 114 ? -4.919  14.712  1.741   1.00 0.00 ? 121 ILE A HD12   1  
ATOM   1782   H  HD13   . ILE A 1 114 ? -5.254  12.992  1.933   1.00 0.00 ? 121 ILE A HD13   1  
ATOM   1783   N  N      . PRO A 1 115 ? -6.592  10.567  -3.617  1.00 0.00 ? 122 PRO A N      1  
ATOM   1784   C  CA     . PRO A 1 115 ? -7.378  9.474   -4.193  1.00 0.00 ? 122 PRO A CA     1  
ATOM   1785   C  C      . PRO A 1 115 ? -7.613  8.349   -3.187  1.00 0.00 ? 122 PRO A C      1  
ATOM   1786   O  O      . PRO A 1 115 ? -6.666  7.751   -2.672  1.00 0.00 ? 122 PRO A O      1  
ATOM   1787   C  CB     . PRO A 1 115 ? -6.518  8.971   -5.367  1.00 0.00 ? 122 PRO A CB     1  
ATOM   1788   C  CG     . PRO A 1 115 ? -5.391  9.943   -5.497  1.00 0.00 ? 122 PRO A CG     1  
ATOM   1789   C  CD     . PRO A 1 115 ? -5.228  10.582  -4.150  1.00 0.00 ? 122 PRO A CD     1  
ATOM   1790   H  HA     . PRO A 1 115 ? -8.330  9.826   -4.564  1.00 0.00 ? 122 PRO A HA     1  
ATOM   1791   H  HB2    . PRO A 1 115 ? -6.154  7.979   -5.146  1.00 0.00 ? 122 PRO A HB2    1  
ATOM   1792   H  HB3    . PRO A 1 115 ? -7.118  8.944   -6.265  1.00 0.00 ? 122 PRO A HB3    1  
ATOM   1793   H  HG2    . PRO A 1 115 ? -4.488  9.419   -5.775  1.00 0.00 ? 122 PRO A HG2    1  
ATOM   1794   H  HG3    . PRO A 1 115 ? -5.635  10.690  -6.239  1.00 0.00 ? 122 PRO A HG3    1  
ATOM   1795   H  HD2    . PRO A 1 115 ? -4.563  9.997   -3.530  1.00 0.00 ? 122 PRO A HD2    1  
ATOM   1796   H  HD3    . PRO A 1 115 ? -4.862  11.592  -4.250  1.00 0.00 ? 122 PRO A HD3    1  
ATOM   1797   N  N      . LEU A 1 116 ? -8.878  8.067   -2.910  1.00 0.00 ? 123 LEU A N      1  
ATOM   1798   C  CA     . LEU A 1 116 ? -9.242  7.033   -1.950  1.00 0.00 ? 123 LEU A CA     1  
ATOM   1799   C  C      . LEU A 1 116 ? -10.069 5.942   -2.612  1.00 0.00 ? 123 LEU A C      1  
ATOM   1800   O  O      . LEU A 1 116 ? -11.048 6.227   -3.296  1.00 0.00 ? 123 LEU A O      1  
ATOM   1801   C  CB     . LEU A 1 116 ? -10.036 7.644   -0.794  1.00 0.00 ? 123 LEU A CB     1  
ATOM   1802   C  CG     . LEU A 1 116 ? -9.232  8.542   0.144   1.00 0.00 ? 123 LEU A CG     1  
ATOM   1803   C  CD1    . LEU A 1 116 ? -10.164 9.331   1.049   1.00 0.00 ? 123 LEU A CD1    1  
ATOM   1804   C  CD2    . LEU A 1 116 ? -8.269  7.709   0.972   1.00 0.00 ? 123 LEU A CD2    1  
ATOM   1805   H  H      . LEU A 1 116 ? -9.588  8.561   -3.369  1.00 0.00 ? 123 LEU A H      1  
ATOM   1806   H  HA     . LEU A 1 116 ? -8.332  6.598   -1.562  1.00 0.00 ? 123 LEU A HA     1  
ATOM   1807   H  HB2    . LEU A 1 116 ? -10.845 8.227   -1.211  1.00 0.00 ? 123 LEU A HB2    1  
ATOM   1808   H  HB3    . LEU A 1 116 ? -10.458 6.840   -0.212  1.00 0.00 ? 123 LEU A HB3    1  
ATOM   1809   H  HG     . LEU A 1 116 ? -8.653  9.240   -0.440  1.00 0.00 ? 123 LEU A HG     1  
ATOM   1810   H  HD11   . LEU A 1 116 ? -10.750 8.647   1.645   1.00 0.00 ? 123 LEU A HD11   1  
ATOM   1811   H  HD12   . LEU A 1 116 ? -10.821 9.939   0.445   1.00 0.00 ? 123 LEU A HD12   1  
ATOM   1812   H  HD13   . LEU A 1 116 ? -9.582  9.968   1.697   1.00 0.00 ? 123 LEU A HD13   1  
ATOM   1813   H  HD21   . LEU A 1 116 ? -7.643  8.361   1.563   1.00 0.00 ? 123 LEU A HD21   1  
ATOM   1814   H  HD22   . LEU A 1 116 ? -7.653  7.115   0.315   1.00 0.00 ? 123 LEU A HD22   1  
ATOM   1815   H  HD23   . LEU A 1 116 ? -8.828  7.055   1.627   1.00 0.00 ? 123 LEU A HD23   1  
ATOM   1816   N  N      . LEU A 1 117 ? -9.663  4.700   -2.415  1.00 0.00 ? 124 LEU A N      1  
ATOM   1817   C  CA     . LEU A 1 117 ? -10.420 3.564   -2.908  1.00 0.00 ? 124 LEU A CA     1  
ATOM   1818   C  C      . LEU A 1 117 ? -10.604 2.543   -1.795  1.00 0.00 ? 124 LEU A C      1  
ATOM   1819   O  O      . LEU A 1 117 ? -9.632  2.036   -1.231  1.00 0.00 ? 124 LEU A O      1  
ATOM   1820   C  CB     . LEU A 1 117 ? -9.722  2.947   -4.131  1.00 0.00 ? 124 LEU A CB     1  
ATOM   1821   C  CG     . LEU A 1 117 ? -10.323 1.642   -4.673  1.00 0.00 ? 124 LEU A CG     1  
ATOM   1822   C  CD1    . LEU A 1 117 ? -11.830 1.720   -4.731  1.00 0.00 ? 124 LEU A CD1    1  
ATOM   1823   C  CD2    . LEU A 1 117 ? -9.784  1.351   -6.060  1.00 0.00 ? 124 LEU A CD2    1  
ATOM   1824   H  H      . LEU A 1 117 ? -8.827  4.539   -1.925  1.00 0.00 ? 124 LEU A H      1  
ATOM   1825   H  HA     . LEU A 1 117 ? -11.394 3.924   -3.206  1.00 0.00 ? 124 LEU A HA     1  
ATOM   1826   H  HB2    . LEU A 1 117 ? -9.738  3.677   -4.926  1.00 0.00 ? 124 LEU A HB2    1  
ATOM   1827   H  HB3    . LEU A 1 117 ? -8.692  2.757   -3.867  1.00 0.00 ? 124 LEU A HB3    1  
ATOM   1828   H  HG     . LEU A 1 117 ? -10.054 0.826   -4.024  1.00 0.00 ? 124 LEU A HG     1  
ATOM   1829   H  HD11   . LEU A 1 117 ? -12.219 0.831   -5.207  1.00 0.00 ? 124 LEU A HD11   1  
ATOM   1830   H  HD12   . LEU A 1 117 ? -12.115 2.589   -5.295  1.00 0.00 ? 124 LEU A HD12   1  
ATOM   1831   H  HD13   . LEU A 1 117 ? -12.225 1.794   -3.728  1.00 0.00 ? 124 LEU A HD13   1  
ATOM   1832   H  HD21   . LEU A 1 117 ? -8.705  1.392   -6.046  1.00 0.00 ? 124 LEU A HD21   1  
ATOM   1833   H  HD22   . LEU A 1 117 ? -10.169 2.087   -6.753  1.00 0.00 ? 124 LEU A HD22   1  
ATOM   1834   H  HD23   . LEU A 1 117 ? -10.105 0.367   -6.370  1.00 0.00 ? 124 LEU A HD23   1  
ATOM   1835   N  N      . VAL A 1 118 ? -11.858 2.272   -1.462  1.00 0.00 ? 125 VAL A N      1  
ATOM   1836   C  CA     . VAL A 1 118 ? -12.178 1.322   -0.414  1.00 0.00 ? 125 VAL A CA     1  
ATOM   1837   C  C      . VAL A 1 118 ? -12.327 -0.071  -1.012  1.00 0.00 ? 125 VAL A C      1  
ATOM   1838   O  O      . VAL A 1 118 ? -13.151 -0.295  -1.901  1.00 0.00 ? 125 VAL A O      1  
ATOM   1839   C  CB     . VAL A 1 118 ? -13.472 1.702   0.339   1.00 0.00 ? 125 VAL A CB     1  
ATOM   1840   C  CG1    . VAL A 1 118 ? -13.627 0.858   1.596   1.00 0.00 ? 125 VAL A CG1    1  
ATOM   1841   C  CG2    . VAL A 1 118 ? -13.485 3.182   0.682   1.00 0.00 ? 125 VAL A CG2    1  
ATOM   1842   H  H      . VAL A 1 118 ? -12.587 2.712   -1.948  1.00 0.00 ? 125 VAL A H      1  
ATOM   1843   H  HA     . VAL A 1 118 ? -11.359 1.317   0.293   1.00 0.00 ? 125 VAL A HA     1  
ATOM   1844   H  HB     . VAL A 1 118 ? -14.313 1.498   -0.309  1.00 0.00 ? 125 VAL A HB     1  
ATOM   1845   H  HG11   . VAL A 1 118 ? -12.792 1.041   2.259   1.00 0.00 ? 125 VAL A HG11   1  
ATOM   1846   H  HG12   . VAL A 1 118 ? -13.649 -0.188  1.325   1.00 0.00 ? 125 VAL A HG12   1  
ATOM   1847   H  HG13   . VAL A 1 118 ? -14.548 1.121   2.096   1.00 0.00 ? 125 VAL A HG13   1  
ATOM   1848   H  HG21   . VAL A 1 118 ? -14.384 3.416   1.232   1.00 0.00 ? 125 VAL A HG21   1  
ATOM   1849   H  HG22   . VAL A 1 118 ? -13.457 3.763   -0.228  1.00 0.00 ? 125 VAL A HG22   1  
ATOM   1850   H  HG23   . VAL A 1 118 ? -12.621 3.420   1.286   1.00 0.00 ? 125 VAL A HG23   1  
ATOM   1851   N  N      . VAL A 1 119 ? -11.519 -0.996  -0.526  1.00 0.00 ? 126 VAL A N      1  
ATOM   1852   C  CA     . VAL A 1 119 ? -11.484 -2.344  -1.057  1.00 0.00 ? 126 VAL A CA     1  
ATOM   1853   C  C      . VAL A 1 119 ? -12.067 -3.328  -0.052  1.00 0.00 ? 126 VAL A C      1  
ATOM   1854   O  O      . VAL A 1 119 ? -11.585 -3.438  1.078   1.00 0.00 ? 126 VAL A O      1  
ATOM   1855   C  CB     . VAL A 1 119 ? -10.040 -2.765  -1.408  1.00 0.00 ? 126 VAL A CB     1  
ATOM   1856   C  CG1    . VAL A 1 119 ? -10.015 -4.149  -2.033  1.00 0.00 ? 126 VAL A CG1    1  
ATOM   1857   C  CG2    . VAL A 1 119 ? -9.391  -1.749  -2.334  1.00 0.00 ? 126 VAL A CG2    1  
ATOM   1858   H  H      . VAL A 1 119 ? -10.935 -0.771  0.234   1.00 0.00 ? 126 VAL A H      1  
ATOM   1859   H  HA     . VAL A 1 119 ? -12.079 -2.368  -1.961  1.00 0.00 ? 126 VAL A HA     1  
ATOM   1860   H  HB     . VAL A 1 119 ? -9.468  -2.802  -0.492  1.00 0.00 ? 126 VAL A HB     1  
ATOM   1861   H  HG11   . VAL A 1 119 ? -8.997  -4.415  -2.280  1.00 0.00 ? 126 VAL A HG11   1  
ATOM   1862   H  HG12   . VAL A 1 119 ? -10.615 -4.149  -2.932  1.00 0.00 ? 126 VAL A HG12   1  
ATOM   1863   H  HG13   . VAL A 1 119 ? -10.416 -4.868  -1.333  1.00 0.00 ? 126 VAL A HG13   1  
ATOM   1864   H  HG21   . VAL A 1 119 ? -9.944  -1.702  -3.261  1.00 0.00 ? 126 VAL A HG21   1  
ATOM   1865   H  HG22   . VAL A 1 119 ? -8.373  -2.045  -2.535  1.00 0.00 ? 126 VAL A HG22   1  
ATOM   1866   H  HG23   . VAL A 1 119 ? -9.398  -0.778  -1.860  1.00 0.00 ? 126 VAL A HG23   1  
ATOM   1867   N  N      . GLY A 1 120 ? -13.111 -4.026  -0.464  1.00 0.00 ? 127 GLY A N      1  
ATOM   1868   C  CA     . GLY A 1 120 ? -13.702 -5.037  0.380   1.00 0.00 ? 127 GLY A CA     1  
ATOM   1869   C  C      . GLY A 1 120 ? -13.152 -6.404  0.049   1.00 0.00 ? 127 GLY A C      1  
ATOM   1870   O  O      . GLY A 1 120 ? -13.326 -6.890  -1.066  1.00 0.00 ? 127 GLY A O      1  
ATOM   1871   H  H      . GLY A 1 120 ? -13.480 -3.863  -1.360  1.00 0.00 ? 127 GLY A H      1  
ATOM   1872   H  HA2    . GLY A 1 120 ? -13.488 -4.806  1.415   1.00 0.00 ? 127 GLY A HA2    1  
ATOM   1873   H  HA3    . GLY A 1 120 ? -14.772 -5.043  0.232   1.00 0.00 ? 127 GLY A HA3    1  
ATOM   1874   N  N      . ASN A 1 121 ? -12.459 -7.010  0.995   1.00 0.00 ? 128 ASN A N      1  
ATOM   1875   C  CA     . ASN A 1 121 ? -11.859 -8.319  0.771   1.00 0.00 ? 128 ASN A CA     1  
ATOM   1876   C  C      . ASN A 1 121 ? -12.710 -9.405  1.417   1.00 0.00 ? 128 ASN A C      1  
ATOM   1877   O  O      . ASN A 1 121 ? -13.459 -9.130  2.362   1.00 0.00 ? 128 ASN A O      1  
ATOM   1878   C  CB     . ASN A 1 121 ? -10.435 -8.361  1.341   1.00 0.00 ? 128 ASN A CB     1  
ATOM   1879   C  CG     . ASN A 1 121 ? -9.708  -9.666  1.041   1.00 0.00 ? 128 ASN A CG     1  
ATOM   1880   O  OD1    . ASN A 1 121 ? -9.909  -10.289 -0.003  1.00 0.00 ? 128 ASN A OD1    1  
ATOM   1881   N  ND2    . ASN A 1 121 ? -8.871  -10.099 1.969   1.00 0.00 ? 128 ASN A ND2    1  
ATOM   1882   H  H      . ASN A 1 121 ? -12.353 -6.572  1.871   1.00 0.00 ? 128 ASN A H      1  
ATOM   1883   H  HA     . ASN A 1 121 ? -11.821 -8.489  -0.295  1.00 0.00 ? 128 ASN A HA     1  
ATOM   1884   H  HB2    . ASN A 1 121 ? -9.862  -7.551  0.917   1.00 0.00 ? 128 ASN A HB2    1  
ATOM   1885   H  HB3    . ASN A 1 121 ? -10.483 -8.237  2.412   1.00 0.00 ? 128 ASN A HB3    1  
ATOM   1886   H  HD21   . ASN A 1 121 ? -8.768  -9.562  2.789   1.00 0.00 ? 128 ASN A HD21   1  
ATOM   1887   H  HD22   . ASN A 1 121 ? -8.387  -10.936 1.804   1.00 0.00 ? 128 ASN A HD22   1  
ATOM   1888   N  N      . LYS A 1 122 ? -12.588 -10.625 0.892   1.00 0.00 ? 129 LYS A N      1  
ATOM   1889   C  CA     . LYS A 1 122 ? -13.273 -11.802 1.433   1.00 0.00 ? 129 LYS A CA     1  
ATOM   1890   C  C      . LYS A 1 122 ? -14.748 -11.841 1.048   1.00 0.00 ? 129 LYS A C      1  
ATOM   1891   O  O      . LYS A 1 122 ? -15.592 -12.215 1.854   1.00 0.00 ? 129 LYS A O      1  
ATOM   1892   C  CB     . LYS A 1 122 ? -13.127 -11.885 2.959   1.00 0.00 ? 129 LYS A CB     1  
ATOM   1893   C  CG     . LYS A 1 122 ? -11.794 -12.440 3.429   1.00 0.00 ? 129 LYS A CG     1  
ATOM   1894   C  CD     . LYS A 1 122 ? -11.711 -13.942 3.203   1.00 0.00 ? 129 LYS A CD     1  
ATOM   1895   C  CE     . LYS A 1 122 ? -12.771 -14.691 3.999   1.00 0.00 ? 129 LYS A CE     1  
ATOM   1896   N  NZ     . LYS A 1 122 ? -12.711 -16.154 3.757   1.00 0.00 ? 129 LYS A NZ     1  
ATOM   1897   H  H      . LYS A 1 122 ? -12.010 -10.738 0.105   1.00 0.00 ? 129 LYS A H      1  
ATOM   1898   H  HA     . LYS A 1 122 ? -12.793 -12.669 1.003   1.00 0.00 ? 129 LYS A HA     1  
ATOM   1899   H  HB2    . LYS A 1 122 ? -13.243 -10.895 3.371   1.00 0.00 ? 129 LYS A HB2    1  
ATOM   1900   H  HB3    . LYS A 1 122 ? -13.913 -12.518 3.346   1.00 0.00 ? 129 LYS A HB3    1  
ATOM   1901   H  HG2    . LYS A 1 122 ? -11.000 -11.958 2.878   1.00 0.00 ? 129 LYS A HG2    1  
ATOM   1902   H  HG3    . LYS A 1 122 ? -11.679 -12.237 4.484   1.00 0.00 ? 129 LYS A HG3    1  
ATOM   1903   H  HD2    . LYS A 1 122 ? -11.855 -14.147 2.152   1.00 0.00 ? 129 LYS A HD2    1  
ATOM   1904   H  HD3    . LYS A 1 122 ? -10.735 -14.286 3.507   1.00 0.00 ? 129 LYS A HD3    1  
ATOM   1905   H  HE2    . LYS A 1 122 ? -12.612 -14.503 5.050   1.00 0.00 ? 129 LYS A HE2    1  
ATOM   1906   H  HE3    . LYS A 1 122 ? -13.746 -14.325 3.711   1.00 0.00 ? 129 LYS A HE3    1  
ATOM   1907   H  HZ1    . LYS A 1 122 ? -12.838 -16.354 2.736   1.00 0.00 ? 129 LYS A HZ1    1  
ATOM   1908   H  HZ2    . LYS A 1 122 ? -13.464 -16.638 4.289   1.00 0.00 ? 129 LYS A HZ2    1  
ATOM   1909   H  HZ3    . LYS A 1 122 ? -11.789 -16.532 4.065   1.00 0.00 ? 129 LYS A HZ3    1  
ATOM   1910   N  N      . SER A 1 123 ? -15.061 -11.513 -0.200  1.00 0.00 ? 130 SER A N      1  
ATOM   1911   C  CA     . SER A 1 123 ? -16.425 -11.674 -0.714  1.00 0.00 ? 130 SER A CA     1  
ATOM   1912   C  C      . SER A 1 123 ? -16.769 -13.160 -0.897  1.00 0.00 ? 130 SER A C      1  
ATOM   1913   O  O      . SER A 1 123 ? -17.743 -13.513 -1.563  1.00 0.00 ? 130 SER A O      1  
ATOM   1914   C  CB     . SER A 1 123 ? -16.583 -10.930 -2.042  1.00 0.00 ? 130 SER A CB     1  
ATOM   1915   O  OG     . SER A 1 123 ? -16.369 -9.540  -1.876  1.00 0.00 ? 130 SER A OG     1  
ATOM   1916   H  H      . SER A 1 123 ? -14.370 -11.138 -0.787  1.00 0.00 ? 130 SER A H      1  
ATOM   1917   H  HA     . SER A 1 123 ? -17.104 -11.249 0.011   1.00 0.00 ? 130 SER A HA     1  
ATOM   1918   H  HB2    . SER A 1 123 ? -15.863 -11.311 -2.751  1.00 0.00 ? 130 SER A HB2    1  
ATOM   1919   H  HB3    . SER A 1 123 ? -17.581 -11.086 -2.424  1.00 0.00 ? 130 SER A HB3    1  
ATOM   1920   H  HG     . SER A 1 123 ? -17.226 -9.082  -1.878  1.00 0.00 ? 130 SER A HG     1  
ATOM   1921   N  N      . ASP A 1 124 ? -15.958 -14.024 -0.295  1.00 0.00 ? 131 ASP A N      1  
ATOM   1922   C  CA     . ASP A 1 124 ? -16.155 -15.462 -0.365  1.00 0.00 ? 131 ASP A CA     1  
ATOM   1923   C  C      . ASP A 1 124 ? -16.747 -16.010 0.936   1.00 0.00 ? 131 ASP A C      1  
ATOM   1924   O  O      . ASP A 1 124 ? -17.011 -17.206 1.044   1.00 0.00 ? 131 ASP A O      1  
ATOM   1925   C  CB     . ASP A 1 124 ? -14.826 -16.164 -0.685  1.00 0.00 ? 131 ASP A CB     1  
ATOM   1926   C  CG     . ASP A 1 124 ? -13.687 -15.731 0.223   1.00 0.00 ? 131 ASP A CG     1  
ATOM   1927   O  OD1    . ASP A 1 124 ? -13.039 -14.703 -0.080  1.00 0.00 ? 131 ASP A OD1    1  
ATOM   1928   O  OD2    . ASP A 1 124 ? -13.426 -16.415 1.234   1.00 0.00 ? 131 ASP A OD2    1  
ATOM   1929   H  H      . ASP A 1 124 ? -15.189 -13.679 0.208   1.00 0.00 ? 131 ASP A H      1  
ATOM   1930   H  HA     . ASP A 1 124 ? -16.851 -15.655 -1.167  1.00 0.00 ? 131 ASP A HA     1  
ATOM   1931   H  HB2    . ASP A 1 124 ? -14.957 -17.231 -0.578  1.00 0.00 ? 131 ASP A HB2    1  
ATOM   1932   H  HB3    . ASP A 1 124 ? -14.550 -15.944 -1.707  1.00 0.00 ? 131 ASP A HB3    1  
ATOM   1933   N  N      . LEU A 1 125 ? -16.961 -15.136 1.921   1.00 0.00 ? 132 LEU A N      1  
ATOM   1934   C  CA     . LEU A 1 125 ? -17.596 -15.547 3.177   1.00 0.00 ? 132 LEU A CA     1  
ATOM   1935   C  C      . LEU A 1 125 ? -19.120 -15.535 3.031   1.00 0.00 ? 132 LEU A C      1  
ATOM   1936   O  O      . LEU A 1 125 ? -19.797 -16.478 3.438   1.00 0.00 ? 132 LEU A O      1  
ATOM   1937   C  CB     . LEU A 1 125 ? -17.148 -14.649 4.353   1.00 0.00 ? 132 LEU A CB     1  
ATOM   1938   C  CG     . LEU A 1 125 ? -17.308 -13.142 4.148   1.00 0.00 ? 132 LEU A CG     1  
ATOM   1939   C  CD1    . LEU A 1 125 ? -18.622 -12.642 4.725   1.00 0.00 ? 132 LEU A CD1    1  
ATOM   1940   C  CD2    . LEU A 1 125 ? -16.137 -12.401 4.766   1.00 0.00 ? 132 LEU A CD2    1  
ATOM   1941   H  H      . LEU A 1 125 ? -16.686 -14.202 1.800   1.00 0.00 ? 132 LEU A H      1  
ATOM   1942   H  HA     . LEU A 1 125 ? -17.283 -16.563 3.380   1.00 0.00 ? 132 LEU A HA     1  
ATOM   1943   H  HB2    . LEU A 1 125 ? -17.726 -14.929 5.222   1.00 0.00 ? 132 LEU A HB2    1  
ATOM   1944   H  HB3    . LEU A 1 125 ? -16.109 -14.848 4.565   1.00 0.00 ? 132 LEU A HB3    1  
ATOM   1945   H  HG     . LEU A 1 125 ? -17.311 -12.931 3.088   1.00 0.00 ? 132 LEU A HG     1  
ATOM   1946   H  HD11   . LEU A 1 125 ? -19.444 -13.136 4.230   1.00 0.00 ? 132 LEU A HD11   1  
ATOM   1947   H  HD12   . LEU A 1 125 ? -18.699 -11.575 4.573   1.00 0.00 ? 132 LEU A HD12   1  
ATOM   1948   H  HD13   . LEU A 1 125 ? -18.655 -12.858 5.783   1.00 0.00 ? 132 LEU A HD13   1  
ATOM   1949   H  HD21   . LEU A 1 125 ? -16.282 -11.337 4.643   1.00 0.00 ? 132 LEU A HD21   1  
ATOM   1950   H  HD22   . LEU A 1 125 ? -15.221 -12.701 4.277   1.00 0.00 ? 132 LEU A HD22   1  
ATOM   1951   H  HD23   . LEU A 1 125 ? -16.079 -12.634 5.818   1.00 0.00 ? 132 LEU A HD23   1  
ATOM   1952   N  N      . GLU A 1 126 ? -19.634 -14.454 2.436   1.00 0.00 ? 133 GLU A N      1  
ATOM   1953   C  CA     . GLU A 1 126 ? -21.065 -14.273 2.167   1.00 0.00 ? 133 GLU A CA     1  
ATOM   1954   C  C      . GLU A 1 126 ? -21.908 -14.240 3.445   1.00 0.00 ? 133 GLU A C      1  
ATOM   1955   O  O      . GLU A 1 126 ? -22.291 -13.168 3.909   1.00 0.00 ? 133 GLU A O      1  
ATOM   1956   C  CB     . GLU A 1 126 ? -21.577 -15.351 1.204   1.00 0.00 ? 133 GLU A CB     1  
ATOM   1957   C  CG     . GLU A 1 126 ? -23.048 -15.203 0.847   1.00 0.00 ? 133 GLU A CG     1  
ATOM   1958   C  CD     . GLU A 1 126 ? -23.486 -16.179 -0.221  1.00 0.00 ? 133 GLU A CD     1  
ATOM   1959   O  OE1    . GLU A 1 126 ? -23.824 -17.330 0.123   1.00 0.00 ? 133 GLU A OE1    1  
ATOM   1960   O  OE2    . GLU A 1 126 ? -23.491 -15.796 -1.408  1.00 0.00 ? 133 GLU A OE2    1  
ATOM   1961   H  H      . GLU A 1 126 ? -19.022 -13.742 2.166   1.00 0.00 ? 133 GLU A H      1  
ATOM   1962   H  HA     . GLU A 1 126 ? -21.172 -13.313 1.684   1.00 0.00 ? 133 GLU A HA     1  
ATOM   1963   H  HB2    . GLU A 1 126 ? -21.001 -15.304 0.293   1.00 0.00 ? 133 GLU A HB2    1  
ATOM   1964   H  HB3    . GLU A 1 126 ? -21.436 -16.320 1.660   1.00 0.00 ? 133 GLU A HB3    1  
ATOM   1965   H  HG2    . GLU A 1 126 ? -23.638 -15.377 1.733   1.00 0.00 ? 133 GLU A HG2    1  
ATOM   1966   H  HG3    . GLU A 1 126 ? -23.220 -14.198 0.490   1.00 0.00 ? 133 GLU A HG3    1  
ATOM   1967   N  N      . GLU A 1 127 ? -22.163 -15.404 4.025   1.00 0.00 ? 134 GLU A N      1  
ATOM   1968   C  CA     . GLU A 1 127 ? -23.105 -15.525 5.134   1.00 0.00 ? 134 GLU A CA     1  
ATOM   1969   C  C      . GLU A 1 127 ? -22.508 -15.017 6.445   1.00 0.00 ? 134 GLU A C      1  
ATOM   1970   O  O      . GLU A 1 127 ? -23.231 -14.757 7.405   1.00 0.00 ? 134 GLU A O      1  
ATOM   1971   C  CB     . GLU A 1 127 ? -23.549 -16.977 5.295   1.00 0.00 ? 134 GLU A CB     1  
ATOM   1972   C  CG     . GLU A 1 127 ? -22.419 -17.933 5.638   1.00 0.00 ? 134 GLU A CG     1  
ATOM   1973   C  CD     . GLU A 1 127 ? -22.915 -19.336 5.899   1.00 0.00 ? 134 GLU A CD     1  
ATOM   1974   O  OE1    . GLU A 1 127 ? -23.278 -19.632 7.054   1.00 0.00 ? 134 GLU A OE1    1  
ATOM   1975   O  OE2    . GLU A 1 127 ? -22.948 -20.142 4.947   1.00 0.00 ? 134 GLU A OE2    1  
ATOM   1976   H  H      . GLU A 1 127 ? -21.691 -16.205 3.704   1.00 0.00 ? 134 GLU A H      1  
ATOM   1977   H  HA     . GLU A 1 127 ? -23.970 -14.925 4.893   1.00 0.00 ? 134 GLU A HA     1  
ATOM   1978   H  HB2    . GLU A 1 127 ? -24.285 -17.029 6.083   1.00 0.00 ? 134 GLU A HB2    1  
ATOM   1979   H  HB3    . GLU A 1 127 ? -24.001 -17.307 4.371   1.00 0.00 ? 134 GLU A HB3    1  
ATOM   1980   H  HG2    . GLU A 1 127 ? -21.722 -17.959 4.815   1.00 0.00 ? 134 GLU A HG2    1  
ATOM   1981   H  HG3    . GLU A 1 127 ? -21.916 -17.573 6.525   1.00 0.00 ? 134 GLU A HG3    1  
ATOM   1982   N  N      . ARG A 1 128 ? -21.189 -14.874 6.480   1.00 0.00 ? 135 ARG A N      1  
ATOM   1983   C  CA     . ARG A 1 128 ? -20.499 -14.392 7.676   1.00 0.00 ? 135 ARG A CA     1  
ATOM   1984   C  C      . ARG A 1 128 ? -20.534 -12.865 7.740   1.00 0.00 ? 135 ARG A C      1  
ATOM   1985   O  O      . ARG A 1 128 ? -19.900 -12.253 8.600   1.00 0.00 ? 135 ARG A O      1  
ATOM   1986   C  CB     . ARG A 1 128 ? -19.046 -14.875 7.688   1.00 0.00 ? 135 ARG A CB     1  
ATOM   1987   C  CG     . ARG A 1 128 ? -18.890 -16.387 7.704   1.00 0.00 ? 135 ARG A CG     1  
ATOM   1988   C  CD     . ARG A 1 128 ? -17.423 -16.782 7.774   1.00 0.00 ? 135 ARG A CD     1  
ATOM   1989   N  NE     . ARG A 1 128 ? -17.237 -18.232 7.841   1.00 0.00 ? 135 ARG A NE     1  
ATOM   1990   C  CZ     . ARG A 1 128 ? -16.250 -18.826 8.517   1.00 0.00 ? 135 ARG A CZ     1  
ATOM   1991   N  NH1    . ARG A 1 128 ? -15.370 -18.095 9.189   1.00 0.00 ? 135 ARG A NH1    1  
ATOM   1992   N  NH2    . ARG A 1 128 ? -16.154 -20.148 8.523   1.00 0.00 ? 135 ARG A NH2    1  
ATOM   1993   H  H      . ARG A 1 128 ? -20.666 -15.101 5.684   1.00 0.00 ? 135 ARG A H      1  
ATOM   1994   H  HA     . ARG A 1 128 ? -21.010 -14.790 8.538   1.00 0.00 ? 135 ARG A HA     1  
ATOM   1995   H  HB2    . ARG A 1 128 ? -18.551 -14.498 6.806   1.00 0.00 ? 135 ARG A HB2    1  
ATOM   1996   H  HB3    . ARG A 1 128 ? -18.554 -14.477 8.564   1.00 0.00 ? 135 ARG A HB3    1  
ATOM   1997   H  HG2    . ARG A 1 128 ? -19.403 -16.786 8.566   1.00 0.00 ? 135 ARG A HG2    1  
ATOM   1998   H  HG3    . ARG A 1 128 ? -19.324 -16.795 6.802   1.00 0.00 ? 135 ARG A HG3    1  
ATOM   1999   H  HD2    . ARG A 1 128 ? -16.923 -16.407 6.895   1.00 0.00 ? 135 ARG A HD2    1  
ATOM   2000   H  HD3    . ARG A 1 128 ? -16.986 -16.333 8.654   1.00 0.00 ? 135 ARG A HD3    1  
ATOM   2001   H  HE     . ARG A 1 128 ? -17.881 -18.795 7.346   1.00 0.00 ? 135 ARG A HE     1  
ATOM   2002   H  HH11   . ARG A 1 128 ? -15.443 -17.088 9.194   1.00 0.00 ? 135 ARG A HH11   1  
ATOM   2003   H  HH12   . ARG A 1 128 ? -14.624 -18.542 9.703   1.00 0.00 ? 135 ARG A HH12   1  
ATOM   2004   H  HH21   . ARG A 1 128 ? -16.826 -20.705 8.022   1.00 0.00 ? 135 ARG A HH21   1  
ATOM   2005   H  HH22   . ARG A 1 128 ? -15.413 -20.604 9.032   1.00 0.00 ? 135 ARG A HH22   1  
ATOM   2006   N  N      . ARG A 1 129 ? -21.283 -12.264 6.823   1.00 0.00 ? 136 ARG A N      1  
ATOM   2007   C  CA     . ARG A 1 129 ? -21.356 -10.815 6.701   1.00 0.00 ? 136 ARG A CA     1  
ATOM   2008   C  C      . ARG A 1 129 ? -21.888 -10.177 7.981   1.00 0.00 ? 136 ARG A C      1  
ATOM   2009   O  O      . ARG A 1 129 ? -23.004 -10.458 8.410   1.00 0.00 ? 136 ARG A O      1  
ATOM   2010   C  CB     . ARG A 1 129 ? -22.250 -10.430 5.522   1.00 0.00 ? 136 ARG A CB     1  
ATOM   2011   C  CG     . ARG A 1 129 ? -22.254 -8.940  5.229   1.00 0.00 ? 136 ARG A CG     1  
ATOM   2012   C  CD     . ARG A 1 129 ? -23.247 -8.586  4.135   1.00 0.00 ? 136 ARG A CD     1  
ATOM   2013   N  NE     . ARG A 1 129 ? -24.631 -8.766  4.567   1.00 0.00 ? 136 ARG A NE     1  
ATOM   2014   C  CZ     . ARG A 1 129 ? -25.583 -9.313  3.815   1.00 0.00 ? 136 ARG A CZ     1  
ATOM   2015   N  NH1    . ARG A 1 129 ? -25.287 -9.842  2.632   1.00 0.00 ? 136 ARG A NH1    1  
ATOM   2016   N  NH2    . ARG A 1 129 ? -26.831 -9.351  4.252   1.00 0.00 ? 136 ARG A NH2    1  
ATOM   2017   H  H      . ARG A 1 129 ? -21.810 -12.818 6.210   1.00 0.00 ? 136 ARG A H      1  
ATOM   2018   H  HA     . ARG A 1 129 ? -20.357 -10.449 6.517   1.00 0.00 ? 136 ARG A HA     1  
ATOM   2019   H  HB2    . ARG A 1 129 ? -21.908 -10.952 4.638   1.00 0.00 ? 136 ARG A HB2    1  
ATOM   2020   H  HB3    . ARG A 1 129 ? -23.262 -10.736 5.739   1.00 0.00 ? 136 ARG A HB3    1  
ATOM   2021   H  HG2    . ARG A 1 129 ? -22.520 -8.407  6.128   1.00 0.00 ? 136 ARG A HG2    1  
ATOM   2022   H  HG3    . ARG A 1 129 ? -21.263 -8.644  4.912   1.00 0.00 ? 136 ARG A HG3    1  
ATOM   2023   H  HD2    . ARG A 1 129 ? -23.102 -7.552  3.856   1.00 0.00 ? 136 ARG A HD2    1  
ATOM   2024   H  HD3    . ARG A 1 129 ? -23.062 -9.219  3.279   1.00 0.00 ? 136 ARG A HD3    1  
ATOM   2025   H  HE     . ARG A 1 129 ? -24.869 -8.431  5.471   1.00 0.00 ? 136 ARG A HE     1  
ATOM   2026   H  HH11   . ARG A 1 129 ? -24.335 -9.835  2.294   1.00 0.00 ? 136 ARG A HH11   1  
ATOM   2027   H  HH12   . ARG A 1 129 ? -26.009 -10.250 2.068   1.00 0.00 ? 136 ARG A HH12   1  
ATOM   2028   H  HH21   . ARG A 1 129 ? -27.069 -8.962  5.152   1.00 0.00 ? 136 ARG A HH21   1  
ATOM   2029   H  HH22   . ARG A 1 129 ? -27.554 -9.764  3.683   1.00 0.00 ? 136 ARG A HH22   1  
ATOM   2030   N  N      . GLN A 1 130 ? -21.078 -9.325  8.590   1.00 0.00 ? 137 GLN A N      1  
ATOM   2031   C  CA     . GLN A 1 130 ? -21.482 -8.611  9.790   1.00 0.00 ? 137 GLN A CA     1  
ATOM   2032   C  C      . GLN A 1 130 ? -21.762 -7.148  9.476   1.00 0.00 ? 137 GLN A C      1  
ATOM   2033   O  O      . GLN A 1 130 ? -22.398 -6.446  10.262  1.00 0.00 ? 137 GLN A O      1  
ATOM   2034   C  CB     . GLN A 1 130 ? -20.412 -8.730  10.877  1.00 0.00 ? 137 GLN A CB     1  
ATOM   2035   C  CG     . GLN A 1 130 ? -20.269 -10.140 11.430  1.00 0.00 ? 137 GLN A CG     1  
ATOM   2036   C  CD     . GLN A 1 130 ? -21.553 -10.656 12.055  1.00 0.00 ? 137 GLN A CD     1  
ATOM   2037   O  OE1    . GLN A 1 130 ? -21.786 -10.486 13.250  1.00 0.00 ? 137 GLN A OE1    1  
ATOM   2038   N  NE2    . GLN A 1 130 ? -22.398 -11.280 11.248  1.00 0.00 ? 137 GLN A NE2    1  
ATOM   2039   H  H      . GLN A 1 130 ? -20.178 -9.172  8.222   1.00 0.00 ? 137 GLN A H      1  
ATOM   2040   H  HA     . GLN A 1 130 ? -22.395 -9.067  10.149  1.00 0.00 ? 137 GLN A HA     1  
ATOM   2041   H  HB2    . GLN A 1 130 ? -19.459 -8.429  10.463  1.00 0.00 ? 137 GLN A HB2    1  
ATOM   2042   H  HB3    . GLN A 1 130 ? -20.665 -8.071  11.692  1.00 0.00 ? 137 GLN A HB3    1  
ATOM   2043   H  HG2    . GLN A 1 130 ? -19.988 -10.802 10.626  1.00 0.00 ? 137 GLN A HG2    1  
ATOM   2044   H  HG3    . GLN A 1 130 ? -19.494 -10.142 12.183  1.00 0.00 ? 137 GLN A HG3    1  
ATOM   2045   H  HE21   . GLN A 1 130 ? -22.151 -11.371 10.302  1.00 0.00 ? 137 GLN A HE21   1  
ATOM   2046   H  HE22   . GLN A 1 130 ? -23.239 -11.631 11.628  1.00 0.00 ? 137 GLN A HE22   1  
ATOM   2047   N  N      . VAL A 1 131 ? -21.283 -6.691  8.329   1.00 0.00 ? 138 VAL A N      1  
ATOM   2048   C  CA     . VAL A 1 131 ? -21.575 -5.343  7.872   1.00 0.00 ? 138 VAL A CA     1  
ATOM   2049   C  C      . VAL A 1 131 ? -22.095 -5.383  6.439   1.00 0.00 ? 138 VAL A C      1  
ATOM   2050   O  O      . VAL A 1 131 ? -21.437 -5.911  5.540   1.00 0.00 ? 138 VAL A O      1  
ATOM   2051   C  CB     . VAL A 1 131 ? -20.346 -4.399  7.988   1.00 0.00 ? 138 VAL A CB     1  
ATOM   2052   C  CG1    . VAL A 1 131 ? -19.132 -4.970  7.273   1.00 0.00 ? 138 VAL A CG1    1  
ATOM   2053   C  CG2    . VAL A 1 131 ? -20.678 -3.013  7.451   1.00 0.00 ? 138 VAL A CG2    1  
ATOM   2054   H  H      . VAL A 1 131 ? -20.730 -7.279  7.765   1.00 0.00 ? 138 VAL A H      1  
ATOM   2055   H  HA     . VAL A 1 131 ? -22.359 -4.950  8.506   1.00 0.00 ? 138 VAL A HA     1  
ATOM   2056   H  HB     . VAL A 1 131 ? -20.099 -4.300  9.035   1.00 0.00 ? 138 VAL A HB     1  
ATOM   2057   H  HG11   . VAL A 1 131 ? -18.850 -5.905  7.733   1.00 0.00 ? 138 VAL A HG11   1  
ATOM   2058   H  HG12   . VAL A 1 131 ? -18.310 -4.273  7.345   1.00 0.00 ? 138 VAL A HG12   1  
ATOM   2059   H  HG13   . VAL A 1 131 ? -19.371 -5.139  6.234   1.00 0.00 ? 138 VAL A HG13   1  
ATOM   2060   H  HG21   . VAL A 1 131 ? -20.938 -3.085  6.406   1.00 0.00 ? 138 VAL A HG21   1  
ATOM   2061   H  HG22   . VAL A 1 131 ? -19.820 -2.367  7.564   1.00 0.00 ? 138 VAL A HG22   1  
ATOM   2062   H  HG23   . VAL A 1 131 ? -21.512 -2.603  8.002   1.00 0.00 ? 138 VAL A HG23   1  
ATOM   2063   N  N      . PRO A 1 132 ? -23.311 -4.868  6.224   1.00 0.00 ? 139 PRO A N      1  
ATOM   2064   C  CA     . PRO A 1 132 ? -23.957 -4.876  4.911   1.00 0.00 ? 139 PRO A CA     1  
ATOM   2065   C  C      . PRO A 1 132 ? -23.188 -4.055  3.884   1.00 0.00 ? 139 PRO A C      1  
ATOM   2066   O  O      . PRO A 1 132 ? -22.795 -2.915  4.144   1.00 0.00 ? 139 PRO A O      1  
ATOM   2067   C  CB     . PRO A 1 132 ? -25.332 -4.247  5.173   1.00 0.00 ? 139 PRO A CB     1  
ATOM   2068   C  CG     . PRO A 1 132 ? -25.527 -4.324  6.650   1.00 0.00 ? 139 PRO A CG     1  
ATOM   2069   C  CD     . PRO A 1 132 ? -24.157 -4.234  7.247   1.00 0.00 ? 139 PRO A CD     1  
ATOM   2070   H  HA     . PRO A 1 132 ? -24.084 -5.883  4.542   1.00 0.00 ? 139 PRO A HA     1  
ATOM   2071   H  HB2    . PRO A 1 132 ? -25.330 -3.224  4.830   1.00 0.00 ? 139 PRO A HB2    1  
ATOM   2072   H  HB3    . PRO A 1 132 ? -26.091 -4.806  4.648   1.00 0.00 ? 139 PRO A HB3    1  
ATOM   2073   H  HG2    . PRO A 1 132 ? -26.138 -3.498  6.984   1.00 0.00 ? 139 PRO A HG2    1  
ATOM   2074   H  HG3    . PRO A 1 132 ? -25.989 -5.264  6.912   1.00 0.00 ? 139 PRO A HG3    1  
ATOM   2075   H  HD2    . PRO A 1 132 ? -23.873 -3.202  7.399   1.00 0.00 ? 139 PRO A HD2    1  
ATOM   2076   H  HD3    . PRO A 1 132 ? -24.113 -4.781  8.178   1.00 0.00 ? 139 PRO A HD3    1  
ATOM   2077   N  N      . VAL A 1 133 ? -22.988 -4.635  2.705   1.00 0.00 ? 140 VAL A N      1  
ATOM   2078   C  CA     . VAL A 1 133 ? -22.326 -3.935  1.611   1.00 0.00 ? 140 VAL A CA     1  
ATOM   2079   C  C      . VAL A 1 133 ? -23.162 -2.734  1.192   1.00 0.00 ? 140 VAL A C      1  
ATOM   2080   O  O      . VAL A 1 133 ? -22.650 -1.771  0.634   1.00 0.00 ? 140 VAL A O      1  
ATOM   2081   C  CB     . VAL A 1 133 ? -22.115 -4.843  0.377   1.00 0.00 ? 140 VAL A CB     1  
ATOM   2082   C  CG1    . VAL A 1 133 ? -21.227 -4.164  -0.651  1.00 0.00 ? 140 VAL A CG1    1  
ATOM   2083   C  CG2    . VAL A 1 133 ? -21.525 -6.181  0.769   1.00 0.00 ? 140 VAL A CG2    1  
ATOM   2084   H  H      . VAL A 1 133 ? -23.300 -5.557  2.567   1.00 0.00 ? 140 VAL A H      1  
ATOM   2085   H  HA     . VAL A 1 133 ? -21.362 -3.594  1.963   1.00 0.00 ? 140 VAL A HA     1  
ATOM   2086   H  HB     . VAL A 1 133 ? -23.078 -5.020  -0.077  1.00 0.00 ? 140 VAL A HB     1  
ATOM   2087   H  HG11   . VAL A 1 133 ? -21.090 -4.819  -1.500  1.00 0.00 ? 140 VAL A HG11   1  
ATOM   2088   H  HG12   . VAL A 1 133 ? -20.266 -3.944  -0.209  1.00 0.00 ? 140 VAL A HG12   1  
ATOM   2089   H  HG13   . VAL A 1 133 ? -21.691 -3.245  -0.977  1.00 0.00 ? 140 VAL A HG13   1  
ATOM   2090   H  HG21   . VAL A 1 133 ? -20.566 -6.026  1.236   1.00 0.00 ? 140 VAL A HG21   1  
ATOM   2091   H  HG22   . VAL A 1 133 ? -21.401 -6.782  -0.119  1.00 0.00 ? 140 VAL A HG22   1  
ATOM   2092   H  HG23   . VAL A 1 133 ? -22.189 -6.682  1.457   1.00 0.00 ? 140 VAL A HG23   1  
ATOM   2093   N  N      . GLU A 1 134 ? -24.452 -2.796  1.503   1.00 0.00 ? 141 GLU A N      1  
ATOM   2094   C  CA     . GLU A 1 134 ? -25.388 -1.738  1.154   1.00 0.00 ? 141 GLU A CA     1  
ATOM   2095   C  C      . GLU A 1 134 ? -24.919 -0.387  1.701   1.00 0.00 ? 141 GLU A C      1  
ATOM   2096   O  O      . GLU A 1 134 ? -24.881 0.606   0.973   1.00 0.00 ? 141 GLU A O      1  
ATOM   2097   C  CB     . GLU A 1 134 ? -26.775 -2.078  1.701   1.00 0.00 ? 141 GLU A CB     1  
ATOM   2098   C  CG     . GLU A 1 134 ? -27.845 -1.064  1.340   1.00 0.00 ? 141 GLU A CG     1  
ATOM   2099   C  CD     . GLU A 1 134 ? -29.201 -1.430  1.902   1.00 0.00 ? 141 GLU A CD     1  
ATOM   2100   O  OE1    . GLU A 1 134 ? -29.492 -1.039  3.050   1.00 0.00 ? 141 GLU A OE1    1  
ATOM   2101   O  OE2    . GLU A 1 134 ? -29.975 -2.112  1.199   1.00 0.00 ? 141 GLU A OE2    1  
ATOM   2102   H  H      . GLU A 1 134 ? -24.785 -3.586  1.976   1.00 0.00 ? 141 GLU A H      1  
ATOM   2103   H  HA     . GLU A 1 134 ? -25.438 -1.682  0.077   1.00 0.00 ? 141 GLU A HA     1  
ATOM   2104   H  HB2    . GLU A 1 134 ? -27.074 -3.039  1.311   1.00 0.00 ? 141 GLU A HB2    1  
ATOM   2105   H  HB3    . GLU A 1 134 ? -26.719 -2.141  2.778   1.00 0.00 ? 141 GLU A HB3    1  
ATOM   2106   H  HG2    . GLU A 1 134 ? -27.557 -0.100  1.731   1.00 0.00 ? 141 GLU A HG2    1  
ATOM   2107   H  HG3    . GLU A 1 134 ? -27.920 -1.007  0.262   1.00 0.00 ? 141 GLU A HG3    1  
ATOM   2108   N  N      . GLU A 1 135 ? -24.527 -0.357  2.970   1.00 0.00 ? 142 GLU A N      1  
ATOM   2109   C  CA     . GLU A 1 135 ? -24.062 0.882   3.583   1.00 0.00 ? 142 GLU A CA     1  
ATOM   2110   C  C      . GLU A 1 135 ? -22.602 1.136   3.222   1.00 0.00 ? 142 GLU A C      1  
ATOM   2111   O  O      . GLU A 1 135 ? -22.161 2.283   3.157   1.00 0.00 ? 142 GLU A O      1  
ATOM   2112   C  CB     . GLU A 1 135 ? -24.250 0.849   5.104   1.00 0.00 ? 142 GLU A CB     1  
ATOM   2113   C  CG     . GLU A 1 135 ? -23.390 -0.179  5.823   1.00 0.00 ? 142 GLU A CG     1  
ATOM   2114   C  CD     . GLU A 1 135 ? -23.532 -0.087  7.326   1.00 0.00 ? 142 GLU A CD     1  
ATOM   2115   O  OE1    . GLU A 1 135 ? -23.371 1.025   7.868   1.00 0.00 ? 142 GLU A OE1    1  
ATOM   2116   O  OE2    . GLU A 1 135 ? -23.832 -1.115  7.962   1.00 0.00 ? 142 GLU A OE2    1  
ATOM   2117   H  H      . GLU A 1 135 ? -24.546 -1.180  3.502   1.00 0.00 ? 142 GLU A H      1  
ATOM   2118   H  HA     . GLU A 1 135 ? -24.658 1.687   3.177   1.00 0.00 ? 142 GLU A HA     1  
ATOM   2119   H  HB2    . GLU A 1 135 ? -24.012 1.824   5.504   1.00 0.00 ? 142 GLU A HB2    1  
ATOM   2120   H  HB3    . GLU A 1 135 ? -25.286 0.628   5.318   1.00 0.00 ? 142 GLU A HB3    1  
ATOM   2121   H  HG2    . GLU A 1 135 ? -23.689 -1.167  5.505   1.00 0.00 ? 142 GLU A HG2    1  
ATOM   2122   H  HG3    . GLU A 1 135 ? -22.355 -0.012  5.562   1.00 0.00 ? 142 GLU A HG3    1  
ATOM   2123   N  N      . ALA A 1 136 ? -21.861 0.064   2.963   1.00 0.00 ? 143 ALA A N      1  
ATOM   2124   C  CA     . ALA A 1 136 ? -20.469 0.183   2.546   1.00 0.00 ? 143 ALA A CA     1  
ATOM   2125   C  C      . ALA A 1 136 ? -20.376 0.886   1.193   1.00 0.00 ? 143 ALA A C      1  
ATOM   2126   O  O      . ALA A 1 136 ? -19.536 1.762   0.988   1.00 0.00 ? 143 ALA A O      1  
ATOM   2127   C  CB     . ALA A 1 136 ? -19.806 -1.186  2.493   1.00 0.00 ? 143 ALA A CB     1  
ATOM   2128   H  H      . ALA A 1 136 ? -22.257 -0.827  3.067   1.00 0.00 ? 143 ALA A H      1  
ATOM   2129   H  HA     . ALA A 1 136 ? -19.954 0.779   3.285   1.00 0.00 ? 143 ALA A HA     1  
ATOM   2130   H  HB1    . ALA A 1 136 ? -18.766 -1.073  2.223   1.00 0.00 ? 143 ALA A HB1    1  
ATOM   2131   H  HB2    . ALA A 1 136 ? -20.305 -1.800  1.758   1.00 0.00 ? 143 ALA A HB2    1  
ATOM   2132   H  HB3    . ALA A 1 136 ? -19.876 -1.658  3.462   1.00 0.00 ? 143 ALA A HB3    1  
ATOM   2133   N  N      . ARG A 1 137 ? -21.263 0.505   0.284   1.00 0.00 ? 144 ARG A N      1  
ATOM   2134   C  CA     . ARG A 1 137 ? -21.352 1.135   -1.028  1.00 0.00 ? 144 ARG A CA     1  
ATOM   2135   C  C      . ARG A 1 137 ? -21.905 2.547   -0.892  1.00 0.00 ? 144 ARG A C      1  
ATOM   2136   O  O      . ARG A 1 137 ? -21.543 3.448   -1.647  1.00 0.00 ? 144 ARG A O      1  
ATOM   2137   C  CB     . ARG A 1 137 ? -22.247 0.301   -1.943  1.00 0.00 ? 144 ARG A CB     1  
ATOM   2138   C  CG     . ARG A 1 137 ? -21.729 -1.108  -2.165  1.00 0.00 ? 144 ARG A CG     1  
ATOM   2139   C  CD     . ARG A 1 137 ? -22.765 -1.986  -2.841  1.00 0.00 ? 144 ARG A CD     1  
ATOM   2140   N  NE     . ARG A 1 137 ? -23.042 -1.542  -4.209  1.00 0.00 ? 144 ARG A NE     1  
ATOM   2141   C  CZ     . ARG A 1 137 ? -23.530 -2.323  -5.172  1.00 0.00 ? 144 ARG A CZ     1  
ATOM   2142   N  NH1    . ARG A 1 137 ? -23.791 -3.601  -4.935  1.00 0.00 ? 144 ARG A NH1    1  
ATOM   2143   N  NH2    . ARG A 1 137 ? -23.761 -1.813  -6.376  1.00 0.00 ? 144 ARG A NH2    1  
ATOM   2144   H  H      . ARG A 1 137 ? -21.880 -0.231  0.502   1.00 0.00 ? 144 ARG A H      1  
ATOM   2145   H  HA     . ARG A 1 137 ? -20.359 1.183   -1.450  1.00 0.00 ? 144 ARG A HA     1  
ATOM   2146   H  HB2    . ARG A 1 137 ? -23.231 0.235   -1.505  1.00 0.00 ? 144 ARG A HB2    1  
ATOM   2147   H  HB3    . ARG A 1 137 ? -22.321 0.789   -2.904  1.00 0.00 ? 144 ARG A HB3    1  
ATOM   2148   H  HG2    . ARG A 1 137 ? -20.849 -1.064  -2.789  1.00 0.00 ? 144 ARG A HG2    1  
ATOM   2149   H  HG3    . ARG A 1 137 ? -21.474 -1.540  -1.208  1.00 0.00 ? 144 ARG A HG3    1  
ATOM   2150   H  HD2    . ARG A 1 137 ? -22.398 -3.005  -2.855  1.00 0.00 ? 144 ARG A HD2    1  
ATOM   2151   H  HD3    . ARG A 1 137 ? -23.680 -1.946  -2.268  1.00 0.00 ? 144 ARG A HD3    1  
ATOM   2152   H  HE     . ARG A 1 137 ? -22.856 -0.591  -4.418  1.00 0.00 ? 144 ARG A HE     1  
ATOM   2153   H  HH11   . ARG A 1 137 ? -23.622 -3.993  -4.022  1.00 0.00 ? 144 ARG A HH11   1  
ATOM   2154   H  HH12   . ARG A 1 137 ? -24.163 -4.190  -5.664  1.00 0.00 ? 144 ARG A HH12   1  
ATOM   2155   H  HH21   . ARG A 1 137 ? -23.576 -0.841  -6.559  1.00 0.00 ? 144 ARG A HH21   1  
ATOM   2156   H  HH22   . ARG A 1 137 ? -24.115 -2.398  -7.118  1.00 0.00 ? 144 ARG A HH22   1  
ATOM   2157   N  N      . SER A 1 138 ? -22.783 2.727   0.087   1.00 0.00 ? 145 SER A N      1  
ATOM   2158   C  CA     . SER A 1 138 ? -23.317 4.045   0.409   1.00 0.00 ? 145 SER A CA     1  
ATOM   2159   C  C      . SER A 1 138 ? -22.198 4.973   0.884   1.00 0.00 ? 145 SER A C      1  
ATOM   2160   O  O      . SER A 1 138 ? -22.211 6.168   0.600   1.00 0.00 ? 145 SER A O      1  
ATOM   2161   C  CB     . SER A 1 138 ? -24.409 3.928   1.480   1.00 0.00 ? 145 SER A CB     1  
ATOM   2162   O  OG     . SER A 1 138 ? -25.107 5.150   1.648   1.00 0.00 ? 145 SER A OG     1  
ATOM   2163   H  H      . SER A 1 138 ? -23.093 1.947   0.592   1.00 0.00 ? 145 SER A H      1  
ATOM   2164   H  HA     . SER A 1 138 ? -23.749 4.455   -0.490  1.00 0.00 ? 145 SER A HA     1  
ATOM   2165   H  HB2    . SER A 1 138 ? -25.114 3.165   1.189   1.00 0.00 ? 145 SER A HB2    1  
ATOM   2166   H  HB3    . SER A 1 138 ? -23.954 3.658   2.421   1.00 0.00 ? 145 SER A HB3    1  
ATOM   2167   H  HG     . SER A 1 138 ? -24.702 5.659   2.371   1.00 0.00 ? 145 SER A HG     1  
ATOM   2168   N  N      . LYS A 1 139 ? -21.225 4.414   1.606   1.00 0.00 ? 146 LYS A N      1  
ATOM   2169   C  CA     . LYS A 1 139 ? -20.056 5.177   2.041   1.00 0.00 ? 146 LYS A CA     1  
ATOM   2170   C  C      . LYS A 1 139 ? -19.221 5.618   0.847   1.00 0.00 ? 146 LYS A C      1  
ATOM   2171   O  O      . LYS A 1 139 ? -18.672 6.718   0.840   1.00 0.00 ? 146 LYS A O      1  
ATOM   2172   C  CB     . LYS A 1 139 ? -19.200 4.365   3.015   1.00 0.00 ? 146 LYS A CB     1  
ATOM   2173   C  CG     . LYS A 1 139 ? -19.776 4.310   4.420   1.00 0.00 ? 146 LYS A CG     1  
ATOM   2174   C  CD     . LYS A 1 139 ? -19.846 5.699   5.033   1.00 0.00 ? 146 LYS A CD     1  
ATOM   2175   C  CE     . LYS A 1 139 ? -20.519 5.680   6.391   1.00 0.00 ? 146 LYS A CE     1  
ATOM   2176   N  NZ     . LYS A 1 139 ? -20.670 7.048   6.949   1.00 0.00 ? 146 LYS A NZ     1  
ATOM   2177   H  H      . LYS A 1 139 ? -21.304 3.469   1.867   1.00 0.00 ? 146 LYS A H      1  
ATOM   2178   H  HA     . LYS A 1 139 ? -20.416 6.059   2.551   1.00 0.00 ? 146 LYS A HA     1  
ATOM   2179   H  HB2    . LYS A 1 139 ? -19.109 3.357   2.642   1.00 0.00 ? 146 LYS A HB2    1  
ATOM   2180   H  HB3    . LYS A 1 139 ? -18.219 4.810   3.069   1.00 0.00 ? 146 LYS A HB3    1  
ATOM   2181   H  HG2    . LYS A 1 139 ? -20.772 3.894   4.376   1.00 0.00 ? 146 LYS A HG2    1  
ATOM   2182   H  HG3    . LYS A 1 139 ? -19.146 3.683   5.036   1.00 0.00 ? 146 LYS A HG3    1  
ATOM   2183   H  HD2    . LYS A 1 139 ? -18.843 6.082   5.147   1.00 0.00 ? 146 LYS A HD2    1  
ATOM   2184   H  HD3    . LYS A 1 139 ? -20.408 6.345   4.373   1.00 0.00 ? 146 LYS A HD3    1  
ATOM   2185   H  HE2    . LYS A 1 139 ? -21.496 5.230   6.288   1.00 0.00 ? 146 LYS A HE2    1  
ATOM   2186   H  HE3    . LYS A 1 139 ? -19.918 5.088   7.067   1.00 0.00 ? 146 LYS A HE3    1  
ATOM   2187   H  HZ1    . LYS A 1 139 ? -21.121 7.679   6.246   1.00 0.00 ? 146 LYS A HZ1    1  
ATOM   2188   H  HZ2    . LYS A 1 139 ? -19.736 7.436   7.197   1.00 0.00 ? 146 LYS A HZ2    1  
ATOM   2189   H  HZ3    . LYS A 1 139 ? -21.259 7.022   7.809   1.00 0.00 ? 146 LYS A HZ3    1  
ATOM   2190   N  N      . ALA A 1 140 ? -19.132 4.761   -0.164  1.00 0.00 ? 147 ALA A N      1  
ATOM   2191   C  CA     . ALA A 1 140 ? -18.461 5.121   -1.402  1.00 0.00 ? 147 ALA A CA     1  
ATOM   2192   C  C      . ALA A 1 140 ? -19.130 6.344   -2.022  1.00 0.00 ? 147 ALA A C      1  
ATOM   2193   O  O      . ALA A 1 140 ? -18.462 7.293   -2.424  1.00 0.00 ? 147 ALA A O      1  
ATOM   2194   C  CB     . ALA A 1 140 ? -18.465 3.951   -2.373  1.00 0.00 ? 147 ALA A CB     1  
ATOM   2195   H  H      . ALA A 1 140 ? -19.518 3.867   -0.071  1.00 0.00 ? 147 ALA A H      1  
ATOM   2196   H  HA     . ALA A 1 140 ? -17.435 5.364   -1.167  1.00 0.00 ? 147 ALA A HA     1  
ATOM   2197   H  HB1    . ALA A 1 140 ? -18.009 3.091   -1.904  1.00 0.00 ? 147 ALA A HB1    1  
ATOM   2198   H  HB2    . ALA A 1 140 ? -17.906 4.218   -3.258  1.00 0.00 ? 147 ALA A HB2    1  
ATOM   2199   H  HB3    . ALA A 1 140 ? -19.482 3.712   -2.647  1.00 0.00 ? 147 ALA A HB3    1  
ATOM   2200   N  N      . GLU A 1 141 ? -20.456 6.327   -2.060  1.00 0.00 ? 148 GLU A N      1  
ATOM   2201   C  CA     . GLU A 1 141 ? -21.227 7.456   -2.568  1.00 0.00 ? 148 GLU A CA     1  
ATOM   2202   C  C      . GLU A 1 141 ? -21.049 8.676   -1.665  1.00 0.00 ? 148 GLU A C      1  
ATOM   2203   O  O      . GLU A 1 141 ? -20.963 9.807   -2.141  1.00 0.00 ? 148 GLU A O      1  
ATOM   2204   C  CB     . GLU A 1 141 ? -22.706 7.077   -2.655  1.00 0.00 ? 148 GLU A CB     1  
ATOM   2205   C  CG     . GLU A 1 141 ? -23.588 8.171   -3.230  1.00 0.00 ? 148 GLU A CG     1  
ATOM   2206   C  CD     . GLU A 1 141 ? -25.048 7.776   -3.264  1.00 0.00 ? 148 GLU A CD     1  
ATOM   2207   O  OE1    . GLU A 1 141 ? -25.476 7.166   -4.264  1.00 0.00 ? 148 GLU A OE1    1  
ATOM   2208   O  OE2    . GLU A 1 141 ? -25.770 8.081   -2.293  1.00 0.00 ? 148 GLU A OE2    1  
ATOM   2209   H  H      . GLU A 1 141 ? -20.929 5.530   -1.740  1.00 0.00 ? 148 GLU A H      1  
ATOM   2210   H  HA     . GLU A 1 141 ? -20.863 7.694   -3.555  1.00 0.00 ? 148 GLU A HA     1  
ATOM   2211   H  HB2    . GLU A 1 141 ? -22.804 6.200   -3.277  1.00 0.00 ? 148 GLU A HB2    1  
ATOM   2212   H  HB3    . GLU A 1 141 ? -23.061 6.843   -1.662  1.00 0.00 ? 148 GLU A HB3    1  
ATOM   2213   H  HG2    . GLU A 1 141 ? -23.485 9.057   -2.621  1.00 0.00 ? 148 GLU A HG2    1  
ATOM   2214   H  HG3    . GLU A 1 141 ? -23.263 8.388   -4.237  1.00 0.00 ? 148 GLU A HG3    1  
ATOM   2215   N  N      . GLU A 1 142 ? -20.978 8.428   -0.363  1.00 0.00 ? 149 GLU A N      1  
ATOM   2216   C  CA     . GLU A 1 142 ? -20.812 9.482   0.633   1.00 0.00 ? 149 GLU A CA     1  
ATOM   2217   C  C      . GLU A 1 142 ? -19.508 10.250  0.410   1.00 0.00 ? 149 GLU A C      1  
ATOM   2218   O  O      . GLU A 1 142 ? -19.458 11.471  0.558   1.00 0.00 ? 149 GLU A O      1  
ATOM   2219   C  CB     . GLU A 1 142 ? -20.827 8.863   2.037   1.00 0.00 ? 149 GLU A CB     1  
ATOM   2220   C  CG     . GLU A 1 142 ? -20.724 9.874   3.167   1.00 0.00 ? 149 GLU A CG     1  
ATOM   2221   C  CD     . GLU A 1 142 ? -20.635 9.214   4.533   1.00 0.00 ? 149 GLU A CD     1  
ATOM   2222   O  OE1    . GLU A 1 142 ? -21.656 8.671   5.004   1.00 0.00 ? 149 GLU A OE1    1  
ATOM   2223   O  OE2    . GLU A 1 142 ? -19.543 9.224   5.137   1.00 0.00 ? 149 GLU A OE2    1  
ATOM   2224   H  H      . GLU A 1 142 ? -21.046 7.497   -0.055  1.00 0.00 ? 149 GLU A H      1  
ATOM   2225   H  HA     . GLU A 1 142 ? -21.643 10.164  0.542   1.00 0.00 ? 149 GLU A HA     1  
ATOM   2226   H  HB2    . GLU A 1 142 ? -21.747 8.313   2.163   1.00 0.00 ? 149 GLU A HB2    1  
ATOM   2227   H  HB3    . GLU A 1 142 ? -19.996 8.177   2.121   1.00 0.00 ? 149 GLU A HB3    1  
ATOM   2228   H  HG2    . GLU A 1 142 ? -19.839 10.475  3.014   1.00 0.00 ? 149 GLU A HG2    1  
ATOM   2229   H  HG3    . GLU A 1 142 ? -21.598 10.508  3.144   1.00 0.00 ? 149 GLU A HG3    1  
ATOM   2230   N  N      . TRP A 1 143 ? -18.455 9.526   0.044   1.00 0.00 ? 150 TRP A N      1  
ATOM   2231   C  CA     . TRP A 1 143 ? -17.132 10.129  -0.117  1.00 0.00 ? 150 TRP A CA     1  
ATOM   2232   C  C      . TRP A 1 143 ? -16.851 10.457  -1.581  1.00 0.00 ? 150 TRP A C      1  
ATOM   2233   O  O      . TRP A 1 143 ? -15.834 11.067  -1.909  1.00 0.00 ? 150 TRP A O      1  
ATOM   2234   C  CB     . TRP A 1 143 ? -16.043 9.195   0.430   1.00 0.00 ? 150 TRP A CB     1  
ATOM   2235   C  CG     . TRP A 1 143 ? -16.242 8.812   1.870   1.00 0.00 ? 150 TRP A CG     1  
ATOM   2236   C  CD1    . TRP A 1 143 ? -17.192 9.291   2.721   1.00 0.00 ? 150 TRP A CD1    1  
ATOM   2237   C  CD2    . TRP A 1 143 ? -15.466 7.872   2.630   1.00 0.00 ? 150 TRP A CD2    1  
ATOM   2238   N  NE1    . TRP A 1 143 ? -17.072 8.700   3.954   1.00 0.00 ? 150 TRP A NE1    1  
ATOM   2239   C  CE2    . TRP A 1 143 ? -16.016 7.829   3.927   1.00 0.00 ? 150 TRP A CE2    1  
ATOM   2240   C  CE3    . TRP A 1 143 ? -14.363 7.063   2.341   1.00 0.00 ? 150 TRP A CE3    1  
ATOM   2241   C  CZ2    . TRP A 1 143 ? -15.503 7.006   4.928   1.00 0.00 ? 150 TRP A CZ2    1  
ATOM   2242   C  CZ3    . TRP A 1 143 ? -13.855 6.248   3.336   1.00 0.00 ? 150 TRP A CZ3    1  
ATOM   2243   C  CH2    . TRP A 1 143 ? -14.424 6.226   4.616   1.00 0.00 ? 150 TRP A CH2    1  
ATOM   2244   H  H      . TRP A 1 143 ? -18.566 8.562   -0.109  1.00 0.00 ? 150 TRP A H      1  
ATOM   2245   H  HA     . TRP A 1 143 ? -17.122 11.047  0.449   1.00 0.00 ? 150 TRP A HA     1  
ATOM   2246   H  HB2    . TRP A 1 143 ? -16.029 8.286   -0.156  1.00 0.00 ? 150 TRP A HB2    1  
ATOM   2247   H  HB3    . TRP A 1 143 ? -15.084 9.685   0.343   1.00 0.00 ? 150 TRP A HB3    1  
ATOM   2248   H  HD1    . TRP A 1 143 ? -17.935 10.024  2.448   1.00 0.00 ? 150 TRP A HD1    1  
ATOM   2249   H  HE1    . TRP A 1 143 ? -17.658 8.879   4.728   1.00 0.00 ? 150 TRP A HE1    1  
ATOM   2250   H  HE3    . TRP A 1 143 ? -13.909 7.064   1.359   1.00 0.00 ? 150 TRP A HE3    1  
ATOM   2251   H  HZ2    . TRP A 1 143 ? -15.933 6.977   5.919   1.00 0.00 ? 150 TRP A HZ2    1  
ATOM   2252   H  HZ3    . TRP A 1 143 ? -13.003 5.619   3.131   1.00 0.00 ? 150 TRP A HZ3    1  
ATOM   2253   H  HH2    . TRP A 1 143 ? -13.992 5.577   5.362   1.00 0.00 ? 150 TRP A HH2    1  
ATOM   2254   N  N      . GLY A 1 144 ? -17.762 10.048  -2.455  1.00 0.00 ? 151 GLY A N      1  
ATOM   2255   C  CA     . GLY A 1 144 ? -17.607 10.300  -3.877  1.00 0.00 ? 151 GLY A CA     1  
ATOM   2256   C  C      . GLY A 1 144 ? -16.563 9.399   -4.507  1.00 0.00 ? 151 GLY A C      1  
ATOM   2257   O  O      . GLY A 1 144 ? -15.908 9.771   -5.477  1.00 0.00 ? 151 GLY A O      1  
ATOM   2258   H  H      . GLY A 1 144 ? -18.550 9.565   -2.130  1.00 0.00 ? 151 GLY A H      1  
ATOM   2259   H  HA2    . GLY A 1 144 ? -18.553 10.132  -4.364  1.00 0.00 ? 151 GLY A HA2    1  
ATOM   2260   H  HA3    . GLY A 1 144 ? -17.315 11.330  -4.020  1.00 0.00 ? 151 GLY A HA3    1  
ATOM   2261   N  N      . VAL A 1 145 ? -16.420 8.205   -3.955  1.00 0.00 ? 152 VAL A N      1  
ATOM   2262   C  CA     . VAL A 1 145 ? -15.420 7.253   -4.414  1.00 0.00 ? 152 VAL A CA     1  
ATOM   2263   C  C      . VAL A 1 145 ? -16.078 5.972   -4.883  1.00 0.00 ? 152 VAL A C      1  
ATOM   2264   O  O      . VAL A 1 145 ? -17.302 5.906   -5.014  1.00 0.00 ? 152 VAL A O      1  
ATOM   2265   C  CB     . VAL A 1 145 ? -14.405 6.916   -3.303  1.00 0.00 ? 152 VAL A CB     1  
ATOM   2266   C  CG1    . VAL A 1 145 ? -13.588 8.141   -2.955  1.00 0.00 ? 152 VAL A CG1    1  
ATOM   2267   C  CG2    . VAL A 1 145 ? -15.105 6.365   -2.064  1.00 0.00 ? 152 VAL A CG2    1  
ATOM   2268   H  H      . VAL A 1 145 ? -17.024 7.944   -3.223  1.00 0.00 ? 152 VAL A H      1  
ATOM   2269   H  HA     . VAL A 1 145 ? -14.886 7.699   -5.239  1.00 0.00 ? 152 VAL A HA     1  
ATOM   2270   H  HB     . VAL A 1 145 ? -13.731 6.159   -3.677  1.00 0.00 ? 152 VAL A HB     1  
ATOM   2271   H  HG11   . VAL A 1 145 ? -12.882 7.893   -2.178  1.00 0.00 ? 152 VAL A HG11   1  
ATOM   2272   H  HG12   . VAL A 1 145 ? -14.245 8.924   -2.612  1.00 0.00 ? 152 VAL A HG12   1  
ATOM   2273   H  HG13   . VAL A 1 145 ? -13.058 8.474   -3.833  1.00 0.00 ? 152 VAL A HG13   1  
ATOM   2274   H  HG21   . VAL A 1 145 ? -14.374 6.172   -1.291  1.00 0.00 ? 152 VAL A HG21   1  
ATOM   2275   H  HG22   . VAL A 1 145 ? -15.613 5.445   -2.314  1.00 0.00 ? 152 VAL A HG22   1  
ATOM   2276   H  HG23   . VAL A 1 145 ? -15.827 7.085   -1.707  1.00 0.00 ? 152 VAL A HG23   1  
ATOM   2277   N  N      . GLN A 1 146 ? -15.273 4.953   -5.137  1.00 0.00 ? 153 GLN A N      1  
ATOM   2278   C  CA     . GLN A 1 146 ? -15.818 3.682   -5.544  1.00 0.00 ? 153 GLN A CA     1  
ATOM   2279   C  C      . GLN A 1 146 ? -15.548 2.604   -4.500  1.00 0.00 ? 153 GLN A C      1  
ATOM   2280   O  O      . GLN A 1 146 ? -14.573 2.675   -3.751  1.00 0.00 ? 153 GLN A O      1  
ATOM   2281   C  CB     . GLN A 1 146 ? -15.303 3.240   -6.927  1.00 0.00 ? 153 GLN A CB     1  
ATOM   2282   C  CG     . GLN A 1 146 ? -13.804 3.404   -7.158  1.00 0.00 ? 153 GLN A CG     1  
ATOM   2283   C  CD     . GLN A 1 146 ? -13.407 4.822   -7.533  1.00 0.00 ? 153 GLN A CD     1  
ATOM   2284   O  OE1    . GLN A 1 146 ? -14.199 5.567   -8.112  1.00 0.00 ? 153 GLN A OE1    1  
ATOM   2285   N  NE2    . GLN A 1 146 ? -12.174 5.193   -7.224  1.00 0.00 ? 153 GLN A NE2    1  
ATOM   2286   H  H      . GLN A 1 146 ? -14.300 5.059   -5.043  1.00 0.00 ? 153 GLN A H      1  
ATOM   2287   H  HA     . GLN A 1 146 ? -16.881 3.826   -5.605  1.00 0.00 ? 153 GLN A HA     1  
ATOM   2288   H  HB2    . GLN A 1 146 ? -15.537 2.195   -7.060  1.00 0.00 ? 153 GLN A HB2    1  
ATOM   2289   H  HB3    . GLN A 1 146 ? -15.821 3.810   -7.685  1.00 0.00 ? 153 GLN A HB3    1  
ATOM   2290   H  HG2    . GLN A 1 146 ? -13.286 3.133   -6.254  1.00 0.00 ? 153 GLN A HG2    1  
ATOM   2291   H  HG3    . GLN A 1 146 ? -13.503 2.740   -7.953  1.00 0.00 ? 153 GLN A HG3    1  
ATOM   2292   H  HE21   . GLN A 1 146 ? -11.596 4.549   -6.771  1.00 0.00 ? 153 GLN A HE21   1  
ATOM   2293   H  HE22   . GLN A 1 146 ? -11.874 6.099   -7.491  1.00 0.00 ? 153 GLN A HE22   1  
ATOM   2294   N  N      . TYR A 1 147 ? -16.446 1.632   -4.436  1.00 0.00 ? 154 TYR A N      1  
ATOM   2295   C  CA     . TYR A 1 147 ? -16.282 0.479   -3.563  1.00 0.00 ? 154 TYR A CA     1  
ATOM   2296   C  C      . TYR A 1 147 ? -16.289 -0.794  -4.396  1.00 0.00 ? 154 TYR A C      1  
ATOM   2297   O  O      . TYR A 1 147 ? -17.227 -1.045  -5.155  1.00 0.00 ? 154 TYR A O      1  
ATOM   2298   C  CB     . TYR A 1 147 ? -17.396 0.434   -2.511  1.00 0.00 ? 154 TYR A CB     1  
ATOM   2299   C  CG     . TYR A 1 147 ? -17.268 -0.706  -1.520  1.00 0.00 ? 154 TYR A CG     1  
ATOM   2300   C  CD1    . TYR A 1 147 ? -16.322 -0.662  -0.505  1.00 0.00 ? 154 TYR A CD1    1  
ATOM   2301   C  CD2    . TYR A 1 147 ? -18.097 -1.818  -1.596  1.00 0.00 ? 154 TYR A CD2    1  
ATOM   2302   C  CE1    . TYR A 1 147 ? -16.206 -1.690  0.408   1.00 0.00 ? 154 TYR A CE1    1  
ATOM   2303   C  CE2    . TYR A 1 147 ? -17.986 -2.853  -0.686  1.00 0.00 ? 154 TYR A CE2    1  
ATOM   2304   C  CZ     . TYR A 1 147 ? -17.039 -2.785  0.313   1.00 0.00 ? 154 TYR A CZ     1  
ATOM   2305   O  OH     . TYR A 1 147 ? -16.929 -3.809  1.226   1.00 0.00 ? 154 TYR A OH     1  
ATOM   2306   H  H      . TYR A 1 147 ? -17.257 1.695   -4.996  1.00 0.00 ? 154 TYR A H      1  
ATOM   2307   H  HA     . TYR A 1 147 ? -15.327 0.568   -3.068  1.00 0.00 ? 154 TYR A HA     1  
ATOM   2308   H  HB2    . TYR A 1 147 ? -17.387 1.356   -1.951  1.00 0.00 ? 154 TYR A HB2    1  
ATOM   2309   H  HB3    . TYR A 1 147 ? -18.350 0.334   -3.011  1.00 0.00 ? 154 TYR A HB3    1  
ATOM   2310   H  HD1    . TYR A 1 147 ? -15.671 0.196   -0.434  1.00 0.00 ? 154 TYR A HD1    1  
ATOM   2311   H  HD2    . TYR A 1 147 ? -18.838 -1.868  -2.381  1.00 0.00 ? 154 TYR A HD2    1  
ATOM   2312   H  HE1    . TYR A 1 147 ? -15.463 -1.636  1.190   1.00 0.00 ? 154 TYR A HE1    1  
ATOM   2313   H  HE2    . TYR A 1 147 ? -18.643 -3.711  -0.761  1.00 0.00 ? 154 TYR A HE2    1  
ATOM   2314   H  HH     . TYR A 1 147 ? -16.858 -3.445  2.114   1.00 0.00 ? 154 TYR A HH     1  
ATOM   2315   N  N      . VAL A 1 148 ? -15.239 -1.586  -4.268  1.00 0.00 ? 155 VAL A N      1  
ATOM   2316   C  CA     . VAL A 1 148 ? -15.096 -2.788  -5.075  1.00 0.00 ? 155 VAL A CA     1  
ATOM   2317   C  C      . VAL A 1 148 ? -14.952 -4.026  -4.197  1.00 0.00 ? 155 VAL A C      1  
ATOM   2318   O  O      . VAL A 1 148 ? -14.199 -4.015  -3.219  1.00 0.00 ? 155 VAL A O      1  
ATOM   2319   C  CB     . VAL A 1 148 ? -13.875 -2.690  -6.016  1.00 0.00 ? 155 VAL A CB     1  
ATOM   2320   C  CG1    . VAL A 1 148 ? -13.856 -3.854  -6.996  1.00 0.00 ? 155 VAL A CG1    1  
ATOM   2321   C  CG2    . VAL A 1 148 ? -13.867 -1.359  -6.756  1.00 0.00 ? 155 VAL A CG2    1  
ATOM   2322   H  H      . VAL A 1 148 ? -14.542 -1.359  -3.613  1.00 0.00 ? 155 VAL A H      1  
ATOM   2323   H  HA     . VAL A 1 148 ? -15.984 -2.888  -5.682  1.00 0.00 ? 155 VAL A HA     1  
ATOM   2324   H  HB     . VAL A 1 148 ? -12.979 -2.748  -5.413  1.00 0.00 ? 155 VAL A HB     1  
ATOM   2325   H  HG11   . VAL A 1 148 ? -14.745 -3.823  -7.608  1.00 0.00 ? 155 VAL A HG11   1  
ATOM   2326   H  HG12   . VAL A 1 148 ? -13.829 -4.785  -6.449  1.00 0.00 ? 155 VAL A HG12   1  
ATOM   2327   H  HG13   . VAL A 1 148 ? -12.981 -3.782  -7.625  1.00 0.00 ? 155 VAL A HG13   1  
ATOM   2328   H  HG21   . VAL A 1 148 ? -12.983 -1.296  -7.374  1.00 0.00 ? 155 VAL A HG21   1  
ATOM   2329   H  HG22   . VAL A 1 148 ? -13.865 -0.550  -6.042  1.00 0.00 ? 155 VAL A HG22   1  
ATOM   2330   H  HG23   . VAL A 1 148 ? -14.749 -1.286  -7.376  1.00 0.00 ? 155 VAL A HG23   1  
ATOM   2331   N  N      . GLU A 1 149 ? -15.686 -5.079  -4.537  1.00 0.00 ? 156 GLU A N      1  
ATOM   2332   C  CA     . GLU A 1 149 ? -15.559 -6.354  -3.846  1.00 0.00 ? 156 GLU A CA     1  
ATOM   2333   C  C      . GLU A 1 149 ? -14.441 -7.175  -4.469  1.00 0.00 ? 156 GLU A C      1  
ATOM   2334   O  O      . GLU A 1 149 ? -14.386 -7.342  -5.690  1.00 0.00 ? 156 GLU A O      1  
ATOM   2335   C  CB     . GLU A 1 149 ? -16.867 -7.143  -3.896  1.00 0.00 ? 156 GLU A CB     1  
ATOM   2336   C  CG     . GLU A 1 149 ? -17.966 -6.579  -3.015  1.00 0.00 ? 156 GLU A CG     1  
ATOM   2337   C  CD     . GLU A 1 149 ? -19.161 -7.503  -2.936  1.00 0.00 ? 156 GLU A CD     1  
ATOM   2338   O  OE1    . GLU A 1 149 ? -19.055 -8.560  -2.274  1.00 0.00 ? 156 GLU A OE1    1  
ATOM   2339   O  OE2    . GLU A 1 149 ? -20.201 -7.190  -3.553  1.00 0.00 ? 156 GLU A OE2    1  
ATOM   2340   H  H      . GLU A 1 149 ? -16.326 -4.999  -5.282  1.00 0.00 ? 156 GLU A H      1  
ATOM   2341   H  HA     . GLU A 1 149 ? -15.309 -6.146  -2.815  1.00 0.00 ? 156 GLU A HA     1  
ATOM   2342   H  HB2    . GLU A 1 149 ? -17.226 -7.152  -4.914  1.00 0.00 ? 156 GLU A HB2    1  
ATOM   2343   H  HB3    . GLU A 1 149 ? -16.673 -8.160  -3.584  1.00 0.00 ? 156 GLU A HB3    1  
ATOM   2344   H  HG2    . GLU A 1 149 ? -17.575 -6.432  -2.020  1.00 0.00 ? 156 GLU A HG2    1  
ATOM   2345   H  HG3    . GLU A 1 149 ? -18.288 -5.630  -3.419  1.00 0.00 ? 156 GLU A HG3    1  
ATOM   2346   N  N      . THR A 1 150 ? -13.555 -7.683  -3.631  1.00 0.00 ? 157 THR A N      1  
ATOM   2347   C  CA     . THR A 1 150 ? -12.402 -8.428  -4.098  1.00 0.00 ? 157 THR A CA     1  
ATOM   2348   C  C      . THR A 1 150 ? -12.167 -9.660  -3.235  1.00 0.00 ? 157 THR A C      1  
ATOM   2349   O  O      . THR A 1 150 ? -12.830 -9.859  -2.213  1.00 0.00 ? 157 THR A O      1  
ATOM   2350   C  CB     . THR A 1 150 ? -11.123 -7.565  -4.066  1.00 0.00 ? 157 THR A CB     1  
ATOM   2351   O  OG1    . THR A 1 150 ? -10.904 -7.079  -2.737  1.00 0.00 ? 157 THR A OG1    1  
ATOM   2352   C  CG2    . THR A 1 150 ? -11.216 -6.393  -5.029  1.00 0.00 ? 157 THR A CG2    1  
ATOM   2353   H  H      . THR A 1 150 ? -13.686 -7.564  -2.662  1.00 0.00 ? 157 THR A H      1  
ATOM   2354   H  HA     . THR A 1 150 ? -12.584 -8.737  -5.117  1.00 0.00 ? 157 THR A HA     1  
ATOM   2355   H  HB     . THR A 1 150 ? -10.284 -8.185  -4.355  1.00 0.00 ? 157 THR A HB     1  
ATOM   2356   H  HG1    . THR A 1 150 ? -11.754 -6.892  -2.319  1.00 0.00 ? 157 THR A HG1    1  
ATOM   2357   H  HG21   . THR A 1 150 ? -12.043 -5.759  -4.745  1.00 0.00 ? 157 THR A HG21   1  
ATOM   2358   H  HG22   . THR A 1 150 ? -11.370 -6.761  -6.032  1.00 0.00 ? 157 THR A HG22   1  
ATOM   2359   H  HG23   . THR A 1 150 ? -10.298 -5.825  -4.991  1.00 0.00 ? 157 THR A HG23   1  
ATOM   2360   N  N      . SER A 1 151 ? -11.223 -10.480 -3.656  1.00 0.00 ? 158 SER A N      1  
ATOM   2361   C  CA     . SER A 1 151 ? -10.781 -11.613 -2.869  1.00 0.00 ? 158 SER A CA     1  
ATOM   2362   C  C      . SER A 1 151 ? -9.533  -12.203 -3.496  1.00 0.00 ? 158 SER A C      1  
ATOM   2363   O  O      . SER A 1 151 ? -9.457  -12.352 -4.715  1.00 0.00 ? 158 SER A O      1  
ATOM   2364   C  CB     . SER A 1 151 ? -11.875 -12.681 -2.769  1.00 0.00 ? 158 SER A CB     1  
ATOM   2365   O  OG     . SER A 1 151 ? -11.448 -13.771 -1.963  1.00 0.00 ? 158 SER A OG     1  
ATOM   2366   H  H      . SER A 1 151 ? -10.810 -10.321 -4.530  1.00 0.00 ? 158 SER A H      1  
ATOM   2367   H  HA     . SER A 1 151 ? -10.540 -11.257 -1.878  1.00 0.00 ? 158 SER A HA     1  
ATOM   2368   H  HB2    . SER A 1 151 ? -12.761 -12.247 -2.329  1.00 0.00 ? 158 SER A HB2    1  
ATOM   2369   H  HB3    . SER A 1 151 ? -12.106 -13.050 -3.758  1.00 0.00 ? 158 SER A HB3    1  
ATOM   2370   H  HG     . SER A 1 151 ? -12.193 -14.081 -1.415  1.00 0.00 ? 158 SER A HG     1  
ATOM   2371   N  N      . ALA A 1 152 ? -8.554  -12.520 -2.667  1.00 0.00 ? 159 ALA A N      1  
ATOM   2372   C  CA     . ALA A 1 152 ? -7.339  -13.160 -3.137  1.00 0.00 ? 159 ALA A CA     1  
ATOM   2373   C  C      . ALA A 1 152 ? -7.538  -14.666 -3.185  1.00 0.00 ? 159 ALA A C      1  
ATOM   2374   O  O      . ALA A 1 152 ? -6.688  -15.407 -3.671  1.00 0.00 ? 159 ALA A O      1  
ATOM   2375   C  CB     . ALA A 1 152 ? -6.169  -12.797 -2.239  1.00 0.00 ? 159 ALA A CB     1  
ATOM   2376   H  H      . ALA A 1 152 ? -8.653  -12.321 -1.712  1.00 0.00 ? 159 ALA A H      1  
ATOM   2377   H  HA     . ALA A 1 152 ? -7.131  -12.799 -4.135  1.00 0.00 ? 159 ALA A HA     1  
ATOM   2378   H  HB1    . ALA A 1 152 ? -6.347  -13.183 -1.246  1.00 0.00 ? 159 ALA A HB1    1  
ATOM   2379   H  HB2    . ALA A 1 152 ? -6.069  -11.720 -2.197  1.00 0.00 ? 159 ALA A HB2    1  
ATOM   2380   H  HB3    . ALA A 1 152 ? -5.261  -13.226 -2.636  1.00 0.00 ? 159 ALA A HB3    1  
ATOM   2381   N  N      . LYS A 1 153 ? -8.678  -15.105 -2.670  1.00 0.00 ? 160 LYS A N      1  
ATOM   2382   C  CA     . LYS A 1 153 ? -9.041  -16.508 -2.681  1.00 0.00 ? 160 LYS A CA     1  
ATOM   2383   C  C      . LYS A 1 153 ? -9.538  -16.894 -4.068  1.00 0.00 ? 160 LYS A C      1  
ATOM   2384   O  O      . LYS A 1 153 ? -9.057  -17.847 -4.677  1.00 0.00 ? 160 LYS A O      1  
ATOM   2385   C  CB     . LYS A 1 153 ? -10.129 -16.757 -1.635  1.00 0.00 ? 160 LYS A CB     1  
ATOM   2386   C  CG     . LYS A 1 153 ? -10.507 -18.215 -1.454  1.00 0.00 ? 160 LYS A CG     1  
ATOM   2387   C  CD     . LYS A 1 153 ? -9.318  -19.054 -1.018  1.00 0.00 ? 160 LYS A CD     1  
ATOM   2388   C  CE     . LYS A 1 153 ? -9.762  -20.416 -0.506  1.00 0.00 ? 160 LYS A CE     1  
ATOM   2389   N  NZ     . LYS A 1 153 ? -10.585 -21.155 -1.501  1.00 0.00 ? 160 LYS A NZ     1  
ATOM   2390   H  H      . LYS A 1 153 ? -9.299  -14.458 -2.276  1.00 0.00 ? 160 LYS A H      1  
ATOM   2391   H  HA     . LYS A 1 153 ? -8.165  -17.091 -2.437  1.00 0.00 ? 160 LYS A HA     1  
ATOM   2392   H  HB2    . LYS A 1 153 ? -9.788  -16.380 -0.684  1.00 0.00 ? 160 LYS A HB2    1  
ATOM   2393   H  HB3    . LYS A 1 153 ? -11.016 -16.215 -1.928  1.00 0.00 ? 160 LYS A HB3    1  
ATOM   2394   H  HG2    . LYS A 1 153 ? -11.279 -18.286 -0.701  1.00 0.00 ? 160 LYS A HG2    1  
ATOM   2395   H  HG3    . LYS A 1 153 ? -10.880 -18.597 -2.393  1.00 0.00 ? 160 LYS A HG3    1  
ATOM   2396   H  HD2    . LYS A 1 153 ? -8.661  -19.195 -1.863  1.00 0.00 ? 160 LYS A HD2    1  
ATOM   2397   H  HD3    . LYS A 1 153 ? -8.790  -18.531 -0.232  1.00 0.00 ? 160 LYS A HD3    1  
ATOM   2398   H  HE2    . LYS A 1 153 ? -8.884  -21.001 -0.276  1.00 0.00 ? 160 LYS A HE2    1  
ATOM   2399   H  HE3    . LYS A 1 153 ? -10.342 -20.273 0.393   1.00 0.00 ? 160 LYS A HE3    1  
ATOM   2400   H  HZ1    . LYS A 1 153 ? -10.870 -22.080 -1.114  1.00 0.00 ? 160 LYS A HZ1    1  
ATOM   2401   H  HZ2    . LYS A 1 153 ? -10.041 -21.311 -2.378  1.00 0.00 ? 160 LYS A HZ2    1  
ATOM   2402   H  HZ3    . LYS A 1 153 ? -11.445 -20.612 -1.736  1.00 0.00 ? 160 LYS A HZ3    1  
ATOM   2403   N  N      . THR A 1 154 ? -10.489 -16.118 -4.567  1.00 0.00 ? 161 THR A N      1  
ATOM   2404   C  CA     . THR A 1 154 ? -11.050 -16.339 -5.887  1.00 0.00 ? 161 THR A CA     1  
ATOM   2405   C  C      . THR A 1 154 ? -10.268 -15.571 -6.945  1.00 0.00 ? 161 THR A C      1  
ATOM   2406   O  O      . THR A 1 154 ? -10.350 -15.878 -8.135  1.00 0.00 ? 161 THR A O      1  
ATOM   2407   C  CB     . THR A 1 154 ? -12.524 -15.908 -5.916  1.00 0.00 ? 161 THR A CB     1  
ATOM   2408   O  OG1    . THR A 1 154 ? -12.658 -14.602 -5.338  1.00 0.00 ? 161 THR A OG1    1  
ATOM   2409   C  CG2    . THR A 1 154 ? -13.381 -16.896 -5.144  1.00 0.00 ? 161 THR A CG2    1  
ATOM   2410   H  H      . THR A 1 154 ? -10.833 -15.375 -4.028  1.00 0.00 ? 161 THR A H      1  
ATOM   2411   H  HA     . THR A 1 154 ? -10.997 -17.395 -6.107  1.00 0.00 ? 161 THR A HA     1  
ATOM   2412   H  HB     . THR A 1 154 ? -12.862 -15.881 -6.944  1.00 0.00 ? 161 THR A HB     1  
ATOM   2413   H  HG1    . THR A 1 154 ? -13.546 -14.512 -4.953  1.00 0.00 ? 161 THR A HG1    1  
ATOM   2414   H  HG21   . THR A 1 154 ? -13.323 -17.866 -5.615  1.00 0.00 ? 161 THR A HG21   1  
ATOM   2415   H  HG22   . THR A 1 154 ? -14.408 -16.557 -5.139  1.00 0.00 ? 161 THR A HG22   1  
ATOM   2416   H  HG23   . THR A 1 154 ? -13.021 -16.970 -4.129  1.00 0.00 ? 161 THR A HG23   1  
ATOM   2417   N  N      . ARG A 1 155 ? -9.496  -14.583 -6.486  1.00 0.00 ? 162 ARG A N      1  
ATOM   2418   C  CA     . ARG A 1 155 ? -8.699  -13.728 -7.361  1.00 0.00 ? 162 ARG A CA     1  
ATOM   2419   C  C      . ARG A 1 155 ? -9.596  -12.960 -8.323  1.00 0.00 ? 162 ARG A C      1  
ATOM   2420   O  O      . ARG A 1 155 ? -9.575  -13.182 -9.535  1.00 0.00 ? 162 ARG A O      1  
ATOM   2421   C  CB     . ARG A 1 155 ? -7.648  -14.544 -8.116  1.00 0.00 ? 162 ARG A CB     1  
ATOM   2422   C  CG     . ARG A 1 155 ? -6.563  -15.114 -7.213  1.00 0.00 ? 162 ARG A CG     1  
ATOM   2423   C  CD     . ARG A 1 155 ? -6.318  -16.588 -7.493  1.00 0.00 ? 162 ARG A CD     1  
ATOM   2424   N  NE     . ARG A 1 155 ? -5.899  -16.829 -8.874  1.00 0.00 ? 162 ARG A NE     1  
ATOM   2425   C  CZ     . ARG A 1 155 ? -6.494  -17.696 -9.692  1.00 0.00 ? 162 ARG A CZ     1  
ATOM   2426   N  NH1    . ARG A 1 155 ? -7.585  -18.346 -9.304  1.00 0.00 ? 162 ARG A NH1    1  
ATOM   2427   N  NH2    . ARG A 1 155 ? -6.000  -17.912 -10.903 1.00 0.00 ? 162 ARG A NH2    1  
ATOM   2428   H  H      . ARG A 1 155 ? -9.470  -14.419 -5.522  1.00 0.00 ? 162 ARG A H      1  
ATOM   2429   H  HA     . ARG A 1 155 ? -8.192  -13.011 -6.730  1.00 0.00 ? 162 ARG A HA     1  
ATOM   2430   H  HB2    . ARG A 1 155 ? -8.136  -15.364 -8.619  1.00 0.00 ? 162 ARG A HB2    1  
ATOM   2431   H  HB3    . ARG A 1 155 ? -7.177  -13.909 -8.853  1.00 0.00 ? 162 ARG A HB3    1  
ATOM   2432   H  HG2    . ARG A 1 155 ? -5.647  -14.571 -7.383  1.00 0.00 ? 162 ARG A HG2    1  
ATOM   2433   H  HG3    . ARG A 1 155 ? -6.868  -14.997 -6.183  1.00 0.00 ? 162 ARG A HG3    1  
ATOM   2434   H  HD2    . ARG A 1 155 ? -5.540  -16.938 -6.830  1.00 0.00 ? 162 ARG A HD2    1  
ATOM   2435   H  HD3    . ARG A 1 155 ? -7.228  -17.137 -7.299  1.00 0.00 ? 162 ARG A HD3    1  
ATOM   2436   H  HE     . ARG A 1 155 ? -5.112  -16.326 -9.202  1.00 0.00 ? 162 ARG A HE     1  
ATOM   2437   H  HH11   . ARG A 1 155 ? -7.965  -18.195 -8.390  1.00 0.00 ? 162 ARG A HH11   1  
ATOM   2438   H  HH12   . ARG A 1 155 ? -8.043  -18.984 -9.930  1.00 0.00 ? 162 ARG A HH12   1  
ATOM   2439   H  HH21   . ARG A 1 155 ? -5.173  -17.427 -11.208 1.00 0.00 ? 162 ARG A HH21   1  
ATOM   2440   H  HH22   . ARG A 1 155 ? -6.445  -18.575 -11.520 1.00 0.00 ? 162 ARG A HH22   1  
ATOM   2441   N  N      . ALA A 1 156 ? -10.396 -12.064 -7.766  1.00 0.00 ? 163 ALA A N      1  
ATOM   2442   C  CA     . ALA A 1 156 ? -11.331 -11.283 -8.558  1.00 0.00 ? 163 ALA A CA     1  
ATOM   2443   C  C      . ALA A 1 156 ? -11.227 -9.800  -8.233  1.00 0.00 ? 163 ALA A C      1  
ATOM   2444   O  O      . ALA A 1 156 ? -11.195 -9.413  -7.062  1.00 0.00 ? 163 ALA A O      1  
ATOM   2445   C  CB     . ALA A 1 156 ? -12.752 -11.773 -8.336  1.00 0.00 ? 163 ALA A CB     1  
ATOM   2446   H  H      . ALA A 1 156 ? -10.352 -11.922 -6.797  1.00 0.00 ? 163 ALA A H      1  
ATOM   2447   H  HA     . ALA A 1 156 ? -11.085 -11.430 -9.598  1.00 0.00 ? 163 ALA A HA     1  
ATOM   2448   H  HB1    . ALA A 1 156 ? -13.029 -11.616 -7.304  1.00 0.00 ? 163 ALA A HB1    1  
ATOM   2449   H  HB2    . ALA A 1 156 ? -12.810 -12.824 -8.569  1.00 0.00 ? 163 ALA A HB2    1  
ATOM   2450   H  HB3    . ALA A 1 156 ? -13.425 -11.223 -8.978  1.00 0.00 ? 163 ALA A HB3    1  
ATOM   2451   N  N      . ASN A 1 157 ? -11.161 -8.990  -9.290  1.00 0.00 ? 164 ASN A N      1  
ATOM   2452   C  CA     . ASN A 1 157 ? -11.120 -7.528  -9.191  1.00 0.00 ? 164 ASN A CA     1  
ATOM   2453   C  C      . ASN A 1 157 ? -9.840  -7.030  -8.528  1.00 0.00 ? 164 ASN A C      1  
ATOM   2454   O  O      . ASN A 1 157 ? -9.757  -5.867  -8.127  1.00 0.00 ? 164 ASN A O      1  
ATOM   2455   C  CB     . ASN A 1 157 ? -12.343 -6.989  -8.441  1.00 0.00 ? 164 ASN A CB     1  
ATOM   2456   C  CG     . ASN A 1 157 ? -13.623 -7.092  -9.247  1.00 0.00 ? 164 ASN A CG     1  
ATOM   2457   O  OD1    . ASN A 1 157 ? -13.605 -7.050  -10.478 1.00 0.00 ? 164 ASN A OD1    1  
ATOM   2458   N  ND2    . ASN A 1 157 ? -14.748 -7.215  -8.559  1.00 0.00 ? 164 ASN A ND2    1  
ATOM   2459   H  H      . ASN A 1 157 ? -11.143 -9.396  -10.187 1.00 0.00 ? 164 ASN A H      1  
ATOM   2460   H  HA     . ASN A 1 157 ? -11.144 -7.142  -10.200 1.00 0.00 ? 164 ASN A HA     1  
ATOM   2461   H  HB2    . ASN A 1 157 ? -12.474 -7.552  -7.529  1.00 0.00 ? 164 ASN A HB2    1  
ATOM   2462   H  HB3    . ASN A 1 157 ? -12.178 -5.950  -8.195  1.00 0.00 ? 164 ASN A HB3    1  
ATOM   2463   H  HD21   . ASN A 1 157 ? -14.691 -7.229  -7.576  1.00 0.00 ? 164 ASN A HD21   1  
ATOM   2464   H  HD22   . ASN A 1 157 ? -15.592 -7.286  -9.059  1.00 0.00 ? 164 ASN A HD22   1  
ATOM   2465   N  N      . VAL A 1 158 ? -8.835  -7.894  -8.441  1.00 0.00 ? 165 VAL A N      1  
ATOM   2466   C  CA     . VAL A 1 158 ? -7.560  -7.510  -7.852  1.00 0.00 ? 165 VAL A CA     1  
ATOM   2467   C  C      . VAL A 1 158 ? -6.827  -6.553  -8.785  1.00 0.00 ? 165 VAL A C      1  
ATOM   2468   O  O      . VAL A 1 158 ? -6.272  -5.548  -8.348  1.00 0.00 ? 165 VAL A O      1  
ATOM   2469   C  CB     . VAL A 1 158 ? -6.666  -8.739  -7.552  1.00 0.00 ? 165 VAL A CB     1  
ATOM   2470   C  CG1    . VAL A 1 158 ? -5.318  -8.312  -6.984  1.00 0.00 ? 165 VAL A CG1    1  
ATOM   2471   C  CG2    . VAL A 1 158 ? -7.363  -9.693  -6.590  1.00 0.00 ? 165 VAL A CG2    1  
ATOM   2472   H  H      . VAL A 1 158 ? -8.949  -8.804  -8.796  1.00 0.00 ? 165 VAL A H      1  
ATOM   2473   H  HA     . VAL A 1 158 ? -7.765  -7.002  -6.920  1.00 0.00 ? 165 VAL A HA     1  
ATOM   2474   H  HB     . VAL A 1 158 ? -6.492  -9.263  -8.478  1.00 0.00 ? 165 VAL A HB     1  
ATOM   2475   H  HG11   . VAL A 1 158 ? -4.805  -7.692  -7.705  1.00 0.00 ? 165 VAL A HG11   1  
ATOM   2476   H  HG12   . VAL A 1 158 ? -4.723  -9.190  -6.775  1.00 0.00 ? 165 VAL A HG12   1  
ATOM   2477   H  HG13   . VAL A 1 158 ? -5.469  -7.755  -6.071  1.00 0.00 ? 165 VAL A HG13   1  
ATOM   2478   H  HG21   . VAL A 1 158 ? -6.705  -10.521 -6.366  1.00 0.00 ? 165 VAL A HG21   1  
ATOM   2479   H  HG22   . VAL A 1 158 ? -8.269  -10.066 -7.045  1.00 0.00 ? 165 VAL A HG22   1  
ATOM   2480   H  HG23   . VAL A 1 158 ? -7.607  -9.171  -5.677  1.00 0.00 ? 165 VAL A HG23   1  
ATOM   2481   N  N      . ASP A 1 159 ? -6.848  -6.857  -10.078 1.00 0.00 ? 166 ASP A N      1  
ATOM   2482   C  CA     . ASP A 1 159 ? -6.240  -5.978  -11.075 1.00 0.00 ? 166 ASP A CA     1  
ATOM   2483   C  C      . ASP A 1 159 ? -6.936  -4.626  -11.072 1.00 0.00 ? 166 ASP A C      1  
ATOM   2484   O  O      . ASP A 1 159 ? -6.287  -3.577  -11.086 1.00 0.00 ? 166 ASP A O      1  
ATOM   2485   C  CB     . ASP A 1 159 ? -6.338  -6.577  -12.481 1.00 0.00 ? 166 ASP A CB     1  
ATOM   2486   C  CG     . ASP A 1 159 ? -5.728  -7.958  -12.589 1.00 0.00 ? 166 ASP A CG     1  
ATOM   2487   O  OD1    . ASP A 1 159 ? -6.447  -8.944  -12.326 1.00 0.00 ? 166 ASP A OD1    1  
ATOM   2488   O  OD2    . ASP A 1 159 ? -4.539  -8.060  -12.952 1.00 0.00 ? 166 ASP A OD2    1  
ATOM   2489   H  H      . ASP A 1 159 ? -7.271  -7.694  -10.370 1.00 0.00 ? 166 ASP A H      1  
ATOM   2490   H  HA     . ASP A 1 159 ? -5.200  -5.842  -10.816 1.00 0.00 ? 166 ASP A HA     1  
ATOM   2491   H  HB2    . ASP A 1 159 ? -7.379  -6.646  -12.759 1.00 0.00 ? 166 ASP A HB2    1  
ATOM   2492   H  HB3    . ASP A 1 159 ? -5.830  -5.923  -13.176 1.00 0.00 ? 166 ASP A HB3    1  
ATOM   2493   N  N      . LYS A 1 160 ? -8.266  -4.670  -11.045 1.00 0.00 ? 167 LYS A N      1  
ATOM   2494   C  CA     . LYS A 1 160 ? -9.096  -3.473  -11.117 1.00 0.00 ? 167 LYS A CA     1  
ATOM   2495   C  C      . LYS A 1 160 ? -8.687  -2.444  -10.068 1.00 0.00 ? 167 LYS A C      1  
ATOM   2496   O  O      . LYS A 1 160 ? -8.328  -1.327  -10.416 1.00 0.00 ? 167 LYS A O      1  
ATOM   2497   C  CB     . LYS A 1 160 ? -10.578 -3.860  -10.965 1.00 0.00 ? 167 LYS A CB     1  
ATOM   2498   C  CG     . LYS A 1 160 ? -11.578 -2.742  -11.252 1.00 0.00 ? 167 LYS A CG     1  
ATOM   2499   C  CD     . LYS A 1 160 ? -11.861 -1.896  -10.020 1.00 0.00 ? 167 LYS A CD     1  
ATOM   2500   C  CE     . LYS A 1 160 ? -13.097 -1.023  -10.210 1.00 0.00 ? 167 LYS A CE     1  
ATOM   2501   N  NZ     . LYS A 1 160 ? -12.873 0.080   -11.180 1.00 0.00 ? 167 LYS A NZ     1  
ATOM   2502   H  H      . LYS A 1 160 ? -8.707  -5.548  -10.989 1.00 0.00 ? 167 LYS A H      1  
ATOM   2503   H  HA     . LYS A 1 160 ? -8.952  -3.037  -12.095 1.00 0.00 ? 167 LYS A HA     1  
ATOM   2504   H  HB2    . LYS A 1 160 ? -10.790 -4.674  -11.640 1.00 0.00 ? 167 LYS A HB2    1  
ATOM   2505   H  HB3    . LYS A 1 160 ? -10.743 -4.201  -9.952  1.00 0.00 ? 167 LYS A HB3    1  
ATOM   2506   H  HG2    . LYS A 1 160 ? -11.180 -2.106  -12.029 1.00 0.00 ? 167 LYS A HG2    1  
ATOM   2507   H  HG3    . LYS A 1 160 ? -12.503 -3.184  -11.591 1.00 0.00 ? 167 LYS A HG3    1  
ATOM   2508   H  HD2    . LYS A 1 160 ? -12.018 -2.549  -9.175  1.00 0.00 ? 167 LYS A HD2    1  
ATOM   2509   H  HD3    . LYS A 1 160 ? -11.008 -1.259  -9.830  1.00 0.00 ? 167 LYS A HD3    1  
ATOM   2510   H  HE2    . LYS A 1 160 ? -13.903 -1.643  -10.571 1.00 0.00 ? 167 LYS A HE2    1  
ATOM   2511   H  HE3    . LYS A 1 160 ? -13.374 -0.600  -9.255  1.00 0.00 ? 167 LYS A HE3    1  
ATOM   2512   H  HZ1    . LYS A 1 160 ? -12.343 0.861   -10.725 1.00 0.00 ? 167 LYS A HZ1    1  
ATOM   2513   H  HZ2    . LYS A 1 160 ? -13.786 0.448   -11.522 1.00 0.00 ? 167 LYS A HZ2    1  
ATOM   2514   H  HZ3    . LYS A 1 160 ? -12.327 -0.263  -11.998 1.00 0.00 ? 167 LYS A HZ3    1  
ATOM   2515   N  N      . VAL A 1 161 ? -8.708  -2.827  -8.793  1.00 0.00 ? 168 VAL A N      1  
ATOM   2516   C  CA     . VAL A 1 161 ? -8.442  -1.881  -7.710  1.00 0.00 ? 168 VAL A CA     1  
ATOM   2517   C  C      . VAL A 1 161 ? -7.057  -1.237  -7.820  1.00 0.00 ? 168 VAL A C      1  
ATOM   2518   O  O      . VAL A 1 161 ? -6.888  -0.070  -7.468  1.00 0.00 ? 168 VAL A O      1  
ATOM   2519   C  CB     . VAL A 1 161 ? -8.608  -2.531  -6.317  1.00 0.00 ? 168 VAL A CB     1  
ATOM   2520   C  CG1    . VAL A 1 161 ? -10.054 -2.939  -6.095  1.00 0.00 ? 168 VAL A CG1    1  
ATOM   2521   C  CG2    . VAL A 1 161 ? -7.688  -3.732  -6.153  1.00 0.00 ? 168 VAL A CG2    1  
ATOM   2522   H  H      . VAL A 1 161 ? -8.907  -3.763  -8.575  1.00 0.00 ? 168 VAL A H      1  
ATOM   2523   H  HA     . VAL A 1 161 ? -9.181  -1.095  -7.791  1.00 0.00 ? 168 VAL A HA     1  
ATOM   2524   H  HB     . VAL A 1 161 ? -8.349  -1.799  -5.568  1.00 0.00 ? 168 VAL A HB     1  
ATOM   2525   H  HG11   . VAL A 1 161 ? -10.342 -3.661  -6.846  1.00 0.00 ? 168 VAL A HG11   1  
ATOM   2526   H  HG12   . VAL A 1 161 ? -10.689 -2.069  -6.170  1.00 0.00 ? 168 VAL A HG12   1  
ATOM   2527   H  HG13   . VAL A 1 161 ? -10.160 -3.379  -5.114  1.00 0.00 ? 168 VAL A HG13   1  
ATOM   2528   H  HG21   . VAL A 1 161 ? -7.842  -4.173  -5.180  1.00 0.00 ? 168 VAL A HG21   1  
ATOM   2529   H  HG22   . VAL A 1 161 ? -6.660  -3.412  -6.246  1.00 0.00 ? 168 VAL A HG22   1  
ATOM   2530   H  HG23   . VAL A 1 161 ? -7.907  -4.461  -6.920  1.00 0.00 ? 168 VAL A HG23   1  
ATOM   2531   N  N      . PHE A 1 162 ? -6.075  -1.981  -8.317  1.00 0.00 ? 169 PHE A N      1  
ATOM   2532   C  CA     . PHE A 1 162 ? -4.724  -1.445  -8.462  1.00 0.00 ? 169 PHE A CA     1  
ATOM   2533   C  C      . PHE A 1 162 ? -4.632  -0.481  -9.644  1.00 0.00 ? 169 PHE A C      1  
ATOM   2534   O  O      . PHE A 1 162 ? -4.149  0.645   -9.502  1.00 0.00 ? 169 PHE A O      1  
ATOM   2535   C  CB     . PHE A 1 162 ? -3.697  -2.570  -8.621  1.00 0.00 ? 169 PHE A CB     1  
ATOM   2536   C  CG     . PHE A 1 162 ? -3.325  -3.249  -7.330  1.00 0.00 ? 169 PHE A CG     1  
ATOM   2537   C  CD1    . PHE A 1 162 ? -4.026  -4.353  -6.877  1.00 0.00 ? 169 PHE A CD1    1  
ATOM   2538   C  CD2    . PHE A 1 162 ? -2.263  -2.783  -6.573  1.00 0.00 ? 169 PHE A CD2    1  
ATOM   2539   C  CE1    . PHE A 1 162 ? -3.678  -4.977  -5.695  1.00 0.00 ? 169 PHE A CE1    1  
ATOM   2540   C  CE2    . PHE A 1 162 ? -1.908  -3.403  -5.390  1.00 0.00 ? 169 PHE A CE2    1  
ATOM   2541   C  CZ     . PHE A 1 162 ? -2.618  -4.502  -4.950  1.00 0.00 ? 169 PHE A CZ     1  
ATOM   2542   H  H      . PHE A 1 162 ? -6.261  -2.903  -8.598  1.00 0.00 ? 169 PHE A H      1  
ATOM   2543   H  HA     . PHE A 1 162 ? -4.499  -0.897  -7.559  1.00 0.00 ? 169 PHE A HA     1  
ATOM   2544   H  HB2    . PHE A 1 162 ? -4.096  -3.320  -9.286  1.00 0.00 ? 169 PHE A HB2    1  
ATOM   2545   H  HB3    . PHE A 1 162 ? -2.793  -2.162  -9.053  1.00 0.00 ? 169 PHE A HB3    1  
ATOM   2546   H  HD1    . PHE A 1 162 ? -4.858  -4.727  -7.457  1.00 0.00 ? 169 PHE A HD1    1  
ATOM   2547   H  HD2    . PHE A 1 162 ? -1.708  -1.922  -6.915  1.00 0.00 ? 169 PHE A HD2    1  
ATOM   2548   H  HE1    . PHE A 1 162 ? -4.234  -5.838  -5.353  1.00 0.00 ? 169 PHE A HE1    1  
ATOM   2549   H  HE2    . PHE A 1 162 ? -1.075  -3.030  -4.811  1.00 0.00 ? 169 PHE A HE2    1  
ATOM   2550   H  HZ     . PHE A 1 162 ? -2.343  -4.989  -4.026  1.00 0.00 ? 169 PHE A HZ     1  
ATOM   2551   N  N      . PHE A 1 163 ? -5.099  -0.922  -10.810 1.00 0.00 ? 170 PHE A N      1  
ATOM   2552   C  CA     . PHE A 1 163 ? -5.041  -0.095  -12.012 1.00 0.00 ? 170 PHE A CA     1  
ATOM   2553   C  C      . PHE A 1 163 ? -5.940  1.131   -11.882 1.00 0.00 ? 170 PHE A C      1  
ATOM   2554   O  O      . PHE A 1 163 ? -5.537  2.241   -12.221 1.00 0.00 ? 170 PHE A O      1  
ATOM   2555   C  CB     . PHE A 1 163 ? -5.440  -0.893  -13.257 1.00 0.00 ? 170 PHE A CB     1  
ATOM   2556   C  CG     . PHE A 1 163 ? -4.403  -1.882  -13.714 1.00 0.00 ? 170 PHE A CG     1  
ATOM   2557   C  CD1    . PHE A 1 163 ? -3.174  -1.443  -14.181 1.00 0.00 ? 170 PHE A CD1    1  
ATOM   2558   C  CD2    . PHE A 1 163 ? -4.660  -3.242  -13.698 1.00 0.00 ? 170 PHE A CD2    1  
ATOM   2559   C  CE1    . PHE A 1 163 ? -2.221  -2.344  -14.617 1.00 0.00 ? 170 PHE A CE1    1  
ATOM   2560   C  CE2    . PHE A 1 163 ? -3.710  -4.147  -14.130 1.00 0.00 ? 170 PHE A CE2    1  
ATOM   2561   C  CZ     . PHE A 1 163 ? -2.489  -3.696  -14.592 1.00 0.00 ? 170 PHE A CZ     1  
ATOM   2562   H  H      . PHE A 1 163 ? -5.496  -1.822  -10.862 1.00 0.00 ? 170 PHE A H      1  
ATOM   2563   H  HA     . PHE A 1 163 ? -4.022  0.242   -12.128 1.00 0.00 ? 170 PHE A HA     1  
ATOM   2564   H  HB2    . PHE A 1 163 ? -6.347  -1.439  -13.049 1.00 0.00 ? 170 PHE A HB2    1  
ATOM   2565   H  HB3    . PHE A 1 163 ? -5.622  -0.205  -14.070 1.00 0.00 ? 170 PHE A HB3    1  
ATOM   2566   H  HD1    . PHE A 1 163 ? -2.959  -0.384  -14.199 1.00 0.00 ? 170 PHE A HD1    1  
ATOM   2567   H  HD2    . PHE A 1 163 ? -5.614  -3.597  -13.338 1.00 0.00 ? 170 PHE A HD2    1  
ATOM   2568   H  HE1    . PHE A 1 163 ? -1.267  -1.990  -14.978 1.00 0.00 ? 170 PHE A HE1    1  
ATOM   2569   H  HE2    . PHE A 1 163 ? -3.923  -5.206  -14.111 1.00 0.00 ? 170 PHE A HE2    1  
ATOM   2570   H  HZ     . PHE A 1 163 ? -1.747  -4.403  -14.934 1.00 0.00 ? 170 PHE A HZ     1  
ATOM   2571   N  N      . ASP A 1 164 ? -7.144  0.917   -11.369 1.00 0.00 ? 171 ASP A N      1  
ATOM   2572   C  CA     . ASP A 1 164 ? -8.150  1.974   -11.267 1.00 0.00 ? 171 ASP A CA     1  
ATOM   2573   C  C      . ASP A 1 164 ? -7.620  3.148   -10.452 1.00 0.00 ? 171 ASP A C      1  
ATOM   2574   O  O      . ASP A 1 164 ? -7.673  4.298   -10.894 1.00 0.00 ? 171 ASP A O      1  
ATOM   2575   C  CB     . ASP A 1 164 ? -9.419  1.408   -10.621 1.00 0.00 ? 171 ASP A CB     1  
ATOM   2576   C  CG     . ASP A 1 164 ? -10.655 2.251   -10.858 1.00 0.00 ? 171 ASP A CG     1  
ATOM   2577   O  OD1    . ASP A 1 164 ? -10.705 2.978   -11.868 1.00 0.00 ? 171 ASP A OD1    1  
ATOM   2578   O  OD2    . ASP A 1 164 ? -11.612 2.129   -10.062 1.00 0.00 ? 171 ASP A OD2    1  
ATOM   2579   H  H      . ASP A 1 164 ? -7.371  0.017   -11.043 1.00 0.00 ? 171 ASP A H      1  
ATOM   2580   H  HA     . ASP A 1 164 ? -8.382  2.316   -12.264 1.00 0.00 ? 171 ASP A HA     1  
ATOM   2581   H  HB2    . ASP A 1 164 ? -9.602  0.425   -11.023 1.00 0.00 ? 171 ASP A HB2    1  
ATOM   2582   H  HB3    . ASP A 1 164 ? -9.261  1.326   -9.556  1.00 0.00 ? 171 ASP A HB3    1  
ATOM   2583   N  N      . LEU A 1 165 ? -7.063  2.847   -9.283  1.00 0.00 ? 172 LEU A N      1  
ATOM   2584   C  CA     . LEU A 1 165 ? -6.559  3.886   -8.395  1.00 0.00 ? 172 LEU A CA     1  
ATOM   2585   C  C      . LEU A 1 165 ? -5.346  4.589   -9.004  1.00 0.00 ? 172 LEU A C      1  
ATOM   2586   O  O      . LEU A 1 165 ? -5.206  5.809   -8.892  1.00 0.00 ? 172 LEU A O      1  
ATOM   2587   C  CB     . LEU A 1 165 ? -6.183  3.306   -7.028  1.00 0.00 ? 172 LEU A CB     1  
ATOM   2588   C  CG     . LEU A 1 165 ? -5.720  4.340   -5.998  1.00 0.00 ? 172 LEU A CG     1  
ATOM   2589   C  CD1    . LEU A 1 165 ? -6.866  5.260   -5.605  1.00 0.00 ? 172 LEU A CD1    1  
ATOM   2590   C  CD2    . LEU A 1 165 ? -5.136  3.655   -4.774  1.00 0.00 ? 172 LEU A CD2    1  
ATOM   2591   H  H      . LEU A 1 165 ? -6.991  1.906   -9.013  1.00 0.00 ? 172 LEU A H      1  
ATOM   2592   H  HA     . LEU A 1 165 ? -7.347  4.611   -8.260  1.00 0.00 ? 172 LEU A HA     1  
ATOM   2593   H  HB2    . LEU A 1 165 ? -7.044  2.789   -6.629  1.00 0.00 ? 172 LEU A HB2    1  
ATOM   2594   H  HB3    . LEU A 1 165 ? -5.388  2.589   -7.167  1.00 0.00 ? 172 LEU A HB3    1  
ATOM   2595   H  HG     . LEU A 1 165 ? -4.944  4.950   -6.439  1.00 0.00 ? 172 LEU A HG     1  
ATOM   2596   H  HD11   . LEU A 1 165 ? -6.517  5.989   -4.889  1.00 0.00 ? 172 LEU A HD11   1  
ATOM   2597   H  HD12   . LEU A 1 165 ? -7.664  4.678   -5.165  1.00 0.00 ? 172 LEU A HD12   1  
ATOM   2598   H  HD13   . LEU A 1 165 ? -7.237  5.768   -6.483  1.00 0.00 ? 172 LEU A HD13   1  
ATOM   2599   H  HD21   . LEU A 1 165 ? -4.816  4.400   -4.062  1.00 0.00 ? 172 LEU A HD21   1  
ATOM   2600   H  HD22   . LEU A 1 165 ? -4.290  3.051   -5.069  1.00 0.00 ? 172 LEU A HD22   1  
ATOM   2601   H  HD23   . LEU A 1 165 ? -5.887  3.024   -4.321  1.00 0.00 ? 172 LEU A HD23   1  
ATOM   2602   N  N      . MET A 1 166 ? -4.470  3.826   -9.656  1.00 0.00 ? 173 MET A N      1  
ATOM   2603   C  CA     . MET A 1 166 ? -3.255  4.402   -10.220 1.00 0.00 ? 173 MET A CA     1  
ATOM   2604   C  C      . MET A 1 166 ? -3.589  5.351   -11.368 1.00 0.00 ? 173 MET A C      1  
ATOM   2605   O  O      . MET A 1 166 ? -2.860  6.310   -11.623 1.00 0.00 ? 173 MET A O      1  
ATOM   2606   C  CB     . MET A 1 166 ? -2.259  3.330   -10.679 1.00 0.00 ? 173 MET A CB     1  
ATOM   2607   C  CG     . MET A 1 166 ? -2.587  2.719   -12.021 1.00 0.00 ? 173 MET A CG     1  
ATOM   2608   S  SD     . MET A 1 166 ? -1.294  1.625   -12.638 1.00 0.00 ? 173 MET A SD     1  
ATOM   2609   C  CE     . MET A 1 166 ? -1.358  0.287   -11.448 1.00 0.00 ? 173 MET A CE     1  
ATOM   2610   H  H      . MET A 1 166 ? -4.645  2.865   -9.756  1.00 0.00 ? 173 MET A H      1  
ATOM   2611   H  HA     . MET A 1 166 ? -2.792  4.976   -9.443  1.00 0.00 ? 173 MET A HA     1  
ATOM   2612   H  HB2    . MET A 1 166 ? -1.278  3.774   -10.741 1.00 0.00 ? 173 MET A HB2    1  
ATOM   2613   H  HB3    . MET A 1 166 ? -2.241  2.539   -9.944  1.00 0.00 ? 173 MET A HB3    1  
ATOM   2614   H  HG2    . MET A 1 166 ? -3.499  2.162   -11.919 1.00 0.00 ? 173 MET A HG2    1  
ATOM   2615   H  HG3    . MET A 1 166 ? -2.734  3.516   -12.734 1.00 0.00 ? 173 MET A HG3    1  
ATOM   2616   H  HE1    . MET A 1 166 ? -2.342  -0.155  -11.460 1.00 0.00 ? 173 MET A HE1    1  
ATOM   2617   H  HE2    . MET A 1 166 ? -1.147  0.672   -10.462 1.00 0.00 ? 173 MET A HE2    1  
ATOM   2618   H  HE3    . MET A 1 166 ? -0.623  -0.462  -11.706 1.00 0.00 ? 173 MET A HE3    1  
ATOM   2619   N  N      . ARG A 1 167 ? -4.690  5.081   -12.061 1.00 0.00 ? 174 ARG A N      1  
ATOM   2620   C  CA     . ARG A 1 167 ? -5.125  5.936   -13.157 1.00 0.00 ? 174 ARG A CA     1  
ATOM   2621   C  C      . ARG A 1 167 ? -5.604  7.279   -12.621 1.00 0.00 ? 174 ARG A C      1  
ATOM   2622   O  O      . ARG A 1 167 ? -5.324  8.320   -13.213 1.00 0.00 ? 174 ARG A O      1  
ATOM   2623   C  CB     . ARG A 1 167 ? -6.230  5.264   -13.974 1.00 0.00 ? 174 ARG A CB     1  
ATOM   2624   C  CG     . ARG A 1 167 ? -5.805  3.946   -14.605 1.00 0.00 ? 174 ARG A CG     1  
ATOM   2625   C  CD     . ARG A 1 167 ? -4.722  4.141   -15.657 1.00 0.00 ? 174 ARG A CD     1  
ATOM   2626   N  NE     . ARG A 1 167 ? -5.279  4.485   -16.965 1.00 0.00 ? 174 ARG A NE     1  
ATOM   2627   C  CZ     . ARG A 1 167 ? -4.554  4.621   -18.073 1.00 0.00 ? 174 ARG A CZ     1  
ATOM   2628   N  NH1    . ARG A 1 167 ? -3.231  4.506   -18.027 1.00 0.00 ? 174 ARG A NH1    1  
ATOM   2629   N  NH2    . ARG A 1 167 ? -5.156  4.879   -19.225 1.00 0.00 ? 174 ARG A NH2    1  
ATOM   2630   H  H      . ARG A 1 167 ? -5.227  4.292   -11.822 1.00 0.00 ? 174 ARG A H      1  
ATOM   2631   H  HA     . ARG A 1 167 ? -4.271  6.106   -13.798 1.00 0.00 ? 174 ARG A HA     1  
ATOM   2632   H  HB2    . ARG A 1 167 ? -7.073  5.076   -13.326 1.00 0.00 ? 174 ARG A HB2    1  
ATOM   2633   H  HB3    . ARG A 1 167 ? -6.536  5.933   -14.763 1.00 0.00 ? 174 ARG A HB3    1  
ATOM   2634   H  HG2    . ARG A 1 167 ? -5.424  3.298   -13.831 1.00 0.00 ? 174 ARG A HG2    1  
ATOM   2635   H  HG3    . ARG A 1 167 ? -6.666  3.488   -15.068 1.00 0.00 ? 174 ARG A HG3    1  
ATOM   2636   H  HD2    . ARG A 1 167 ? -4.067  4.938   -15.337 1.00 0.00 ? 174 ARG A HD2    1  
ATOM   2637   H  HD3    . ARG A 1 167 ? -4.154  3.228   -15.745 1.00 0.00 ? 174 ARG A HD3    1  
ATOM   2638   H  HE     . ARG A 1 167 ? -6.258  4.595   -17.027 1.00 0.00 ? 174 ARG A HE     1  
ATOM   2639   H  HH11   . ARG A 1 167 ? -2.772  4.314   -17.161 1.00 0.00 ? 174 ARG A HH11   1  
ATOM   2640   H  HH12   . ARG A 1 167 ? -2.678  4.618   -18.868 1.00 0.00 ? 174 ARG A HH12   1  
ATOM   2641   H  HH21   . ARG A 1 167 ? -6.156  4.975   -19.258 1.00 0.00 ? 174 ARG A HH21   1  
ATOM   2642   H  HH22   . ARG A 1 167 ? -4.617  4.964   -20.078 1.00 0.00 ? 174 ARG A HH22   1  
ATOM   2643   N  N      . GLU A 1 168 ? -6.304  7.251   -11.484 1.00 0.00 ? 175 GLU A N      1  
ATOM   2644   C  CA     . GLU A 1 168 ? -6.746  8.481   -10.821 1.00 0.00 ? 175 GLU A CA     1  
ATOM   2645   C  C      . GLU A 1 168 ? -5.556  9.357   -10.451 1.00 0.00 ? 175 GLU A C      1  
ATOM   2646   O  O      . GLU A 1 168 ? -5.640  10.583  -10.496 1.00 0.00 ? 175 GLU A O      1  
ATOM   2647   C  CB     . GLU A 1 168 ? -7.538  8.177   -9.549  1.00 0.00 ? 175 GLU A CB     1  
ATOM   2648   C  CG     . GLU A 1 168 ? -9.011  7.874   -9.765  1.00 0.00 ? 175 GLU A CG     1  
ATOM   2649   C  CD     . GLU A 1 168 ? -9.800  8.029   -8.479  1.00 0.00 ? 175 GLU A CD     1  
ATOM   2650   O  OE1    . GLU A 1 168 ? -9.438  8.918   -7.675  1.00 0.00 ? 175 GLU A OE1    1  
ATOM   2651   O  OE2    . GLU A 1 168 ? -10.770 7.276   -8.267  1.00 0.00 ? 175 GLU A OE2    1  
ATOM   2652   H  H      . GLU A 1 168 ? -6.532  6.383   -11.083 1.00 0.00 ? 175 GLU A H      1  
ATOM   2653   H  HA     . GLU A 1 168 ? -7.378  9.019   -11.510 1.00 0.00 ? 175 GLU A HA     1  
ATOM   2654   H  HB2    . GLU A 1 168 ? -7.094  7.323   -9.063  1.00 0.00 ? 175 GLU A HB2    1  
ATOM   2655   H  HB3    . GLU A 1 168 ? -7.466  9.028   -8.889  1.00 0.00 ? 175 GLU A HB3    1  
ATOM   2656   H  HG2    . GLU A 1 168 ? -9.408  8.558   -10.503 1.00 0.00 ? 175 GLU A HG2    1  
ATOM   2657   H  HG3    . GLU A 1 168 ? -9.115  6.859   -10.116 1.00 0.00 ? 175 GLU A HG3    1  
ATOM   2658   N  N      . ILE A 1 169 ? -4.452  8.714   -10.077 1.00 0.00 ? 176 ILE A N      1  
ATOM   2659   C  CA     . ILE A 1 169 ? -3.228  9.421   -9.703  1.00 0.00 ? 176 ILE A CA     1  
ATOM   2660   C  C      . ILE A 1 169 ? -2.766  10.347  -10.830 1.00 0.00 ? 176 ILE A C      1  
ATOM   2661   O  O      . ILE A 1 169 ? -2.228  11.424  -10.579 1.00 0.00 ? 176 ILE A O      1  
ATOM   2662   C  CB     . ILE A 1 169 ? -2.099  8.426   -9.341  1.00 0.00 ? 176 ILE A CB     1  
ATOM   2663   C  CG1    . ILE A 1 169 ? -2.516  7.581   -8.132  1.00 0.00 ? 176 ILE A CG1    1  
ATOM   2664   C  CG2    . ILE A 1 169 ? -0.792  9.159   -9.059  1.00 0.00 ? 176 ILE A CG2    1  
ATOM   2665   C  CD1    . ILE A 1 169 ? -1.487  6.551   -7.713  1.00 0.00 ? 176 ILE A CD1    1  
ATOM   2666   H  H      . ILE A 1 169 ? -4.464  7.734   -10.046 1.00 0.00 ? 176 ILE A H      1  
ATOM   2667   H  HA     . ILE A 1 169 ? -3.446  10.018  -8.829  1.00 0.00 ? 176 ILE A HA     1  
ATOM   2668   H  HB     . ILE A 1 169 ? -1.941  7.775   -10.187 1.00 0.00 ? 176 ILE A HB     1  
ATOM   2669   H  HG12   . ILE A 1 169 ? -2.691  8.234   -7.290  1.00 0.00 ? 176 ILE A HG12   1  
ATOM   2670   H  HG13   . ILE A 1 169 ? -3.432  7.059   -8.369  1.00 0.00 ? 176 ILE A HG13   1  
ATOM   2671   H  HG21   . ILE A 1 169 ? -0.931  9.846   -8.238  1.00 0.00 ? 176 ILE A HG21   1  
ATOM   2672   H  HG22   . ILE A 1 169 ? -0.491  9.708   -9.939  1.00 0.00 ? 176 ILE A HG22   1  
ATOM   2673   H  HG23   . ILE A 1 169 ? -0.026  8.442   -8.803  1.00 0.00 ? 176 ILE A HG23   1  
ATOM   2674   H  HD11   . ILE A 1 169 ? -1.311  5.864   -8.528  1.00 0.00 ? 176 ILE A HD11   1  
ATOM   2675   H  HD12   . ILE A 1 169 ? -1.852  6.007   -6.854  1.00 0.00 ? 176 ILE A HD12   1  
ATOM   2676   H  HD13   . ILE A 1 169 ? -0.564  7.050   -7.456  1.00 0.00 ? 176 ILE A HD13   1  
ATOM   2677   N  N      . ARG A 1 170 ? -3.013  9.939   -12.069 1.00 0.00 ? 177 ARG A N      1  
ATOM   2678   C  CA     . ARG A 1 170 ? -2.638  10.750  -13.220 1.00 0.00 ? 177 ARG A CA     1  
ATOM   2679   C  C      . ARG A 1 170 ? -3.439  12.040  -13.236 1.00 0.00 ? 177 ARG A C      1  
ATOM   2680   O  O      . ARG A 1 170 ? -2.895  13.116  -13.471 1.00 0.00 ? 177 ARG A O      1  
ATOM   2681   C  CB     . ARG A 1 170 ? -2.865  9.994   -14.528 1.00 0.00 ? 177 ARG A CB     1  
ATOM   2682   C  CG     . ARG A 1 170 ? -2.174  8.643   -14.587 1.00 0.00 ? 177 ARG A CG     1  
ATOM   2683   C  CD     . ARG A 1 170 ? -2.338  7.998   -15.952 1.00 0.00 ? 177 ARG A CD     1  
ATOM   2684   N  NE     . ARG A 1 170 ? -3.737  7.981   -16.381 1.00 0.00 ? 177 ARG A NE     1  
ATOM   2685   C  CZ     . ARG A 1 170 ? -4.127  8.037   -17.655 1.00 0.00 ? 177 ARG A CZ     1  
ATOM   2686   N  NH1    . ARG A 1 170 ? -3.226  8.123   -18.629 1.00 0.00 ? 177 ARG A NH1    1  
ATOM   2687   N  NH2    . ARG A 1 170 ? -5.422  8.019   -17.947 1.00 0.00 ? 177 ARG A NH2    1  
ATOM   2688   H  H      . ARG A 1 170 ? -3.471  9.083   -12.210 1.00 0.00 ? 177 ARG A H      1  
ATOM   2689   H  HA     . ARG A 1 170 ? -1.590  10.990  -13.130 1.00 0.00 ? 177 ARG A HA     1  
ATOM   2690   H  HB2    . ARG A 1 170 ? -3.926  9.836   -14.659 1.00 0.00 ? 177 ARG A HB2    1  
ATOM   2691   H  HB3    . ARG A 1 170 ? -2.498  10.599  -15.346 1.00 0.00 ? 177 ARG A HB3    1  
ATOM   2692   H  HG2    . ARG A 1 170 ? -1.122  8.780   -14.384 1.00 0.00 ? 177 ARG A HG2    1  
ATOM   2693   H  HG3    . ARG A 1 170 ? -2.605  7.994   -13.837 1.00 0.00 ? 177 ARG A HG3    1  
ATOM   2694   H  HD2    . ARG A 1 170 ? -1.755  8.553   -16.673 1.00 0.00 ? 177 ARG A HD2    1  
ATOM   2695   H  HD3    . ARG A 1 170 ? -1.974  6.981   -15.903 1.00 0.00 ? 177 ARG A HD3    1  
ATOM   2696   H  HE     . ARG A 1 170 ? -4.423  7.928   -15.680 1.00 0.00 ? 177 ARG A HE     1  
ATOM   2697   H  HH11   . ARG A 1 170 ? -2.241  8.144   -18.413 1.00 0.00 ? 177 ARG A HH11   1  
ATOM   2698   H  HH12   . ARG A 1 170 ? -3.523  8.173   -19.595 1.00 0.00 ? 177 ARG A HH12   1  
ATOM   2699   H  HH21   . ARG A 1 170 ? -6.108  7.967   -17.207 1.00 0.00 ? 177 ARG A HH21   1  
ATOM   2700   H  HH22   . ARG A 1 170 ? -5.728  8.048   -18.908 1.00 0.00 ? 177 ARG A HH22   1  
ATOM   2701   N  N      . THR A 1 171 ? -4.732  11.926  -12.965 1.00 0.00 ? 178 THR A N      1  
ATOM   2702   C  CA     . THR A 1 171 ? -5.614  13.081  -12.926 1.00 0.00 ? 178 THR A CA     1  
ATOM   2703   C  C      . THR A 1 171 ? -5.189  14.044  -11.819 1.00 0.00 ? 178 THR A C      1  
ATOM   2704   O  O      . THR A 1 171 ? -5.235  15.263  -11.985 1.00 0.00 ? 178 THR A O      1  
ATOM   2705   C  CB     . THR A 1 171 ? -7.073  12.641  -12.703 1.00 0.00 ? 178 THR A CB     1  
ATOM   2706   O  OG1    . THR A 1 171 ? -7.393  11.560  -13.591 1.00 0.00 ? 178 THR A OG1    1  
ATOM   2707   C  CG2    . THR A 1 171 ? -8.035  13.794  -12.944 1.00 0.00 ? 178 THR A CG2    1  
ATOM   2708   H  H      . THR A 1 171 ? -5.108  11.037  -12.788 1.00 0.00 ? 178 THR A H      1  
ATOM   2709   H  HA     . THR A 1 171 ? -5.549  13.588  -13.878 1.00 0.00 ? 178 THR A HA     1  
ATOM   2710   H  HB     . THR A 1 171 ? -7.184  12.303  -11.681 1.00 0.00 ? 178 THR A HB     1  
ATOM   2711   H  HG1    . THR A 1 171 ? -7.158  11.810  -14.502 1.00 0.00 ? 178 THR A HG1    1  
ATOM   2712   H  HG21   . THR A 1 171 ? -7.933  14.141  -13.961 1.00 0.00 ? 178 THR A HG21   1  
ATOM   2713   H  HG22   . THR A 1 171 ? -7.807  14.599  -12.263 1.00 0.00 ? 178 THR A HG22   1  
ATOM   2714   H  HG23   . THR A 1 171 ? -9.047  13.457  -12.778 1.00 0.00 ? 178 THR A HG23   1  
ATOM   2715   N  N      . LYS A 1 172 ? -4.753  13.484  -10.697 1.00 0.00 ? 179 LYS A N      1  
ATOM   2716   C  CA     . LYS A 1 172 ? -4.272  14.286  -9.582  1.00 0.00 ? 179 LYS A CA     1  
ATOM   2717   C  C      . LYS A 1 172 ? -2.955  14.983  -9.933  1.00 0.00 ? 179 LYS A C      1  
ATOM   2718   O  O      . LYS A 1 172 ? -2.740  16.140  -9.577  1.00 0.00 ? 179 LYS A O      1  
ATOM   2719   C  CB     . LYS A 1 172 ? -4.090  13.417  -8.334  1.00 0.00 ? 179 LYS A CB     1  
ATOM   2720   C  CG     . LYS A 1 172 ? -5.345  13.260  -7.476  1.00 0.00 ? 179 LYS A CG     1  
ATOM   2721   C  CD     . LYS A 1 172 ? -6.434  12.435  -8.157  1.00 0.00 ? 179 LYS A CD     1  
ATOM   2722   C  CE     . LYS A 1 172 ? -7.658  12.296  -7.260  1.00 0.00 ? 179 LYS A CE     1  
ATOM   2723   N  NZ     . LYS A 1 172 ? -8.721  11.436  -7.857  1.00 0.00 ? 179 LYS A NZ     1  
ATOM   2724   H  H      . LYS A 1 172 ? -4.761  12.504  -10.615 1.00 0.00 ? 179 LYS A H      1  
ATOM   2725   H  HA     . LYS A 1 172 ? -5.016  15.040  -9.377  1.00 0.00 ? 179 LYS A HA     1  
ATOM   2726   H  HB2    . LYS A 1 172 ? -3.775  12.432  -8.644  1.00 0.00 ? 179 LYS A HB2    1  
ATOM   2727   H  HB3    . LYS A 1 172 ? -3.316  13.853  -7.722  1.00 0.00 ? 179 LYS A HB3    1  
ATOM   2728   H  HG2    . LYS A 1 172 ? -5.069  12.772  -6.555  1.00 0.00 ? 179 LYS A HG2    1  
ATOM   2729   H  HG3    . LYS A 1 172 ? -5.737  14.243  -7.255  1.00 0.00 ? 179 LYS A HG3    1  
ATOM   2730   H  HD2    . LYS A 1 172 ? -6.723  12.924  -9.075  1.00 0.00 ? 179 LYS A HD2    1  
ATOM   2731   H  HD3    . LYS A 1 172 ? -6.044  11.452  -8.378  1.00 0.00 ? 179 LYS A HD3    1  
ATOM   2732   H  HE2    . LYS A 1 172 ? -7.350  11.860  -6.321  1.00 0.00 ? 179 LYS A HE2    1  
ATOM   2733   H  HE3    . LYS A 1 172 ? -8.065  13.280  -7.080  1.00 0.00 ? 179 LYS A HE3    1  
ATOM   2734   H  HZ1    . LYS A 1 172 ? -8.980  11.779  -8.807  1.00 0.00 ? 179 LYS A HZ1    1  
ATOM   2735   H  HZ2    . LYS A 1 172 ? -9.574  11.456  -7.254  1.00 0.00 ? 179 LYS A HZ2    1  
ATOM   2736   H  HZ3    . LYS A 1 172 ? -8.399  10.447  -7.929  1.00 0.00 ? 179 LYS A HZ3    1  
ATOM   2737   N  N      . LYS A 1 173 ? -2.081  14.278  -10.642 1.00 0.00 ? 180 LYS A N      1  
ATOM   2738   C  CA     . LYS A 1 173 ? -0.786  14.829  -11.035 1.00 0.00 ? 180 LYS A CA     1  
ATOM   2739   C  C      . LYS A 1 173 ? -0.921  15.851  -12.162 1.00 0.00 ? 180 LYS A C      1  
ATOM   2740   O  O      . LYS A 1 173 ? -0.061  16.714  -12.327 1.00 0.00 ? 180 LYS A O      1  
ATOM   2741   C  CB     . LYS A 1 173 ? 0.169   13.704  -11.444 1.00 0.00 ? 180 LYS A CB     1  
ATOM   2742   C  CG     . LYS A 1 173 ? 0.946   13.121  -10.273 1.00 0.00 ? 180 LYS A CG     1  
ATOM   2743   C  CD     . LYS A 1 173 ? 2.036   14.076  -9.816  1.00 0.00 ? 180 LYS A CD     1  
ATOM   2744   C  CE     . LYS A 1 173 ? 2.646   13.650  -8.490  1.00 0.00 ? 180 LYS A CE     1  
ATOM   2745   N  NZ     . LYS A 1 173 ? 1.708   13.869  -7.356  1.00 0.00 ? 180 LYS A NZ     1  
ATOM   2746   H  H      . LYS A 1 173 ? -2.307  13.357  -10.901 1.00 0.00 ? 180 LYS A H      1  
ATOM   2747   H  HA     . LYS A 1 173 ? -0.376  15.330  -10.171 1.00 0.00 ? 180 LYS A HA     1  
ATOM   2748   H  HB2    . LYS A 1 173 ? -0.400  12.908  -11.903 1.00 0.00 ? 180 LYS A HB2    1  
ATOM   2749   H  HB3    . LYS A 1 173 ? 0.876   14.089  -12.163 1.00 0.00 ? 180 LYS A HB3    1  
ATOM   2750   H  HG2    . LYS A 1 173 ? 0.268   12.943  -9.452  1.00 0.00 ? 180 LYS A HG2    1  
ATOM   2751   H  HG3    . LYS A 1 173 ? 1.401   12.190  -10.580 1.00 0.00 ? 180 LYS A HG3    1  
ATOM   2752   H  HD2    . LYS A 1 173 ? 2.814   14.104  -10.564 1.00 0.00 ? 180 LYS A HD2    1  
ATOM   2753   H  HD3    . LYS A 1 173 ? 1.611   15.062  -9.702  1.00 0.00 ? 180 LYS A HD3    1  
ATOM   2754   H  HE2    . LYS A 1 173 ? 2.893   12.600  -8.544  1.00 0.00 ? 180 LYS A HE2    1  
ATOM   2755   H  HE3    . LYS A 1 173 ? 3.545   14.225  -8.322  1.00 0.00 ? 180 LYS A HE3    1  
ATOM   2756   H  HZ1    . LYS A 1 173 ? 2.212   13.781  -6.449  1.00 0.00 ? 180 LYS A HZ1    1  
ATOM   2757   H  HZ2    . LYS A 1 173 ? 0.938   13.158  -7.375  1.00 0.00 ? 180 LYS A HZ2    1  
ATOM   2758   H  HZ3    . LYS A 1 173 ? 1.287   14.821  -7.417  1.00 0.00 ? 180 LYS A HZ3    1  
ATOM   2759   N  N      . MET A 1 174 ? -1.993  15.753  -12.936 1.00 0.00 ? 181 MET A N      1  
ATOM   2760   C  CA     . MET A 1 174 ? -2.259  16.732  -13.983 1.00 0.00 ? 181 MET A CA     1  
ATOM   2761   C  C      . MET A 1 174 ? -2.911  17.974  -13.390 1.00 0.00 ? 181 MET A C      1  
ATOM   2762   O  O      . MET A 1 174 ? -2.856  19.057  -13.980 1.00 0.00 ? 181 MET A O      1  
ATOM   2763   C  CB     . MET A 1 174 ? -3.159  16.144  -15.077 1.00 0.00 ? 181 MET A CB     1  
ATOM   2764   C  CG     . MET A 1 174 ? -2.488  15.077  -15.930 1.00 0.00 ? 181 MET A CG     1  
ATOM   2765   S  SD     . MET A 1 174 ? -3.562  14.488  -17.253 1.00 0.00 ? 181 MET A SD     1  
ATOM   2766   C  CE     . MET A 1 174 ? -2.484  13.318  -18.072 1.00 0.00 ? 181 MET A CE     1  
ATOM   2767   H  H      . MET A 1 174 ? -2.616  15.005  -12.806 1.00 0.00 ? 181 MET A H      1  
ATOM   2768   H  HA     . MET A 1 174 ? -1.312  17.013  -14.420 1.00 0.00 ? 181 MET A HA     1  
ATOM   2769   H  HB2    . MET A 1 174 ? -4.028  15.702  -14.613 1.00 0.00 ? 181 MET A HB2    1  
ATOM   2770   H  HB3    . MET A 1 174 ? -3.480  16.942  -15.730 1.00 0.00 ? 181 MET A HB3    1  
ATOM   2771   H  HG2    . MET A 1 174 ? -1.596  15.493  -16.370 1.00 0.00 ? 181 MET A HG2    1  
ATOM   2772   H  HG3    . MET A 1 174 ? -2.224  14.241  -15.299 1.00 0.00 ? 181 MET A HG3    1  
ATOM   2773   H  HE1    . MET A 1 174 ? -2.208  12.537  -17.378 1.00 0.00 ? 181 MET A HE1    1  
ATOM   2774   H  HE2    . MET A 1 174 ? -1.596  13.828  -18.414 1.00 0.00 ? 181 MET A HE2    1  
ATOM   2775   H  HE3    . MET A 1 174 ? -2.999  12.885  -18.916 1.00 0.00 ? 181 MET A HE3    1  
ATOM   2776   N  N      . SER A 1 175 ? -3.515  17.800  -12.213 1.00 0.00 ? 182 SER A N      1  
ATOM   2777   C  CA     . SER A 1 175 ? -4.219  18.869  -11.512 1.00 0.00 ? 182 SER A CA     1  
ATOM   2778   C  C      . SER A 1 175 ? -5.442  19.344  -12.297 1.00 0.00 ? 182 SER A C      1  
ATOM   2779   O  O      . SER A 1 175 ? -5.691  18.910  -13.424 1.00 0.00 ? 182 SER A O      1  
ATOM   2780   C  CB     . SER A 1 175 ? -3.275  20.040  -11.238 1.00 0.00 ? 182 SER A CB     1  
ATOM   2781   O  OG     . SER A 1 175 ? -2.154  19.626  -10.472 1.00 0.00 ? 182 SER A OG     1  
ATOM   2782   H  H      . SER A 1 175 ? -3.480  16.918  -11.797 1.00 0.00 ? 182 SER A H      1  
ATOM   2783   H  HA     . SER A 1 175 ? -4.556  18.471  -10.566 1.00 0.00 ? 182 SER A HA     1  
ATOM   2784   H  HB2    . SER A 1 175 ? -2.923  20.440  -12.177 1.00 0.00 ? 182 SER A HB2    1  
ATOM   2785   H  HB3    . SER A 1 175 ? -3.805  20.807  -10.695 1.00 0.00 ? 182 SER A HB3    1  
ATOM   2786   H  HG     . SER A 1 175 ? -2.419  19.519  -9.539  1.00 0.00 ? 182 SER A HG     1  
ATOM   2787   N  N      . GLU A 1 176 ? -6.216  20.224  -11.685 1.00 0.00 ? 183 GLU A N      1  
ATOM   2788   C  CA     . GLU A 1 176 ? -7.403  20.765  -12.319 1.00 0.00 ? 183 GLU A CA     1  
ATOM   2789   C  C      . GLU A 1 176 ? -7.168  22.215  -12.715 1.00 0.00 ? 183 GLU A C      1  
ATOM   2790   O  O      . GLU A 1 176 ? -6.975  22.512  -13.895 1.00 0.00 ? 183 GLU A O      1  
ATOM   2791   C  CB     . GLU A 1 176 ? -8.605  20.629  -11.379 1.00 0.00 ? 183 GLU A CB     1  
ATOM   2792   C  CG     . GLU A 1 176 ? -9.915  21.119  -11.968 1.00 0.00 ? 183 GLU A CG     1  
ATOM   2793   C  CD     . GLU A 1 176 ? -11.095 20.801  -11.075 1.00 0.00 ? 183 GLU A CD     1  
ATOM   2794   O  OE1    . GLU A 1 176 ? -11.269 21.486  -10.048 1.00 0.00 ? 183 GLU A OE1    1  
ATOM   2795   O  OE2    . GLU A 1 176 ? -11.845 19.855  -11.393 1.00 0.00 ? 183 GLU A OE2    1  
ATOM   2796   H  H      . GLU A 1 176 ? -5.979  20.523  -10.773 1.00 0.00 ? 183 GLU A H      1  
ATOM   2797   H  HA     . GLU A 1 176 ? -7.592  20.193  -13.214 1.00 0.00 ? 183 GLU A HA     1  
ATOM   2798   H  HB2    . GLU A 1 176 ? -8.725  19.588  -11.121 1.00 0.00 ? 183 GLU A HB2    1  
ATOM   2799   H  HB3    . GLU A 1 176 ? -8.408  21.189  -10.478 1.00 0.00 ? 183 GLU A HB3    1  
ATOM   2800   H  HG2    . GLU A 1 176 ? -9.860  22.189  -12.100 1.00 0.00 ? 183 GLU A HG2    1  
ATOM   2801   H  HG3    . GLU A 1 176 ? -10.068 20.643  -12.925 1.00 0.00 ? 183 GLU A HG3    1  
ATOM   2802   N  N      . ASN A 1 177 ? -7.155  23.099  -11.719 1.00 0.00 ? 184 ASN A N      1  
ATOM   2803   C  CA     . ASN A 1 177 ? -6.939  24.532  -11.928 1.00 0.00 ? 184 ASN A CA     1  
ATOM   2804   C  C      . ASN A 1 177 ? -7.876  25.054  -13.017 1.00 0.00 ? 184 ASN A C      1  
ATOM   2805   O  O      . ASN A 1 177 ? -7.449  25.667  -13.996 1.00 0.00 ? 184 ASN A O      1  
ATOM   2806   C  CB     . ASN A 1 177 ? -5.469  24.812  -12.284 1.00 0.00 ? 184 ASN A CB     1  
ATOM   2807   C  CG     . ASN A 1 177 ? -5.063  26.262  -12.064 1.00 0.00 ? 184 ASN A CG     1  
ATOM   2808   O  OD1    . ASN A 1 177 ? -5.874  27.180  -12.171 1.00 0.00 ? 184 ASN A OD1    1  
ATOM   2809   N  ND2    . ASN A 1 177 ? -3.798  26.476  -11.740 1.00 0.00 ? 184 ASN A ND2    1  
ATOM   2810   H  H      . ASN A 1 177 ? -7.309  22.779  -10.804 1.00 0.00 ? 184 ASN A H      1  
ATOM   2811   H  HA     . ASN A 1 177 ? -7.176  25.035  -11.004 1.00 0.00 ? 184 ASN A HA     1  
ATOM   2812   H  HB2    . ASN A 1 177 ? -4.836  24.190  -11.670 1.00 0.00 ? 184 ASN A HB2    1  
ATOM   2813   H  HB3    . ASN A 1 177 ? -5.305  24.567  -13.323 1.00 0.00 ? 184 ASN A HB3    1  
ATOM   2814   H  HD21   . ASN A 1 177 ? -3.199  25.697  -11.658 1.00 0.00 ? 184 ASN A HD21   1  
ATOM   2815   H  HD22   . ASN A 1 177 ? -3.507  27.400  -11.592 1.00 0.00 ? 184 ASN A HD22   1  
ATOM   2816   N  N      . LYS A 1 178 ? -9.158  24.778  -12.844 1.00 0.00 ? 185 LYS A N      1  
ATOM   2817   C  CA     . LYS A 1 178 ? -10.165 25.194  -13.800 1.00 0.00 ? 185 LYS A CA     1  
ATOM   2818   C  C      . LYS A 1 178 ? -11.216 26.037  -13.096 1.00 0.00 ? 185 LYS A C      1  
ATOM   2819   O  O      . LYS A 1 178 ? -11.094 27.276  -13.113 1.00 0.00 ? 185 LYS A O      1  
ATOM   2820   C  CB     . LYS A 1 178 ? -10.820 23.972  -14.458 1.00 0.00 ? 185 LYS A CB     1  
ATOM   2821   C  CG     . LYS A 1 178 ? -9.870  23.134  -15.298 1.00 0.00 ? 185 LYS A CG     1  
ATOM   2822   C  CD     . LYS A 1 178 ? -9.338  23.912  -16.490 1.00 0.00 ? 185 LYS A CD     1  
ATOM   2823   C  CE     . LYS A 1 178 ? -8.355  23.083  -17.299 1.00 0.00 ? 185 LYS A CE     1  
ATOM   2824   N  NZ     . LYS A 1 178 ? -7.835  23.827  -18.476 1.00 0.00 ? 185 LYS A NZ     1  
ATOM   2825   O  OXT    . LYS A 1 178 ? -12.149 25.450  -12.518 1.00 0.00 ? 185 LYS A OXT    1  
ATOM   2826   H  H      . LYS A 1 178 ? -9.440  24.287  -12.044 1.00 0.00 ? 185 LYS A H      1  
ATOM   2827   H  HA     . LYS A 1 178 ? -9.683  25.791  -14.559 1.00 0.00 ? 185 LYS A HA     1  
ATOM   2828   H  HB2    . LYS A 1 178 ? -11.229 23.341  -13.686 1.00 0.00 ? 185 LYS A HB2    1  
ATOM   2829   H  HB3    . LYS A 1 178 ? -11.621 24.308  -15.094 1.00 0.00 ? 185 LYS A HB3    1  
ATOM   2830   H  HG2    . LYS A 1 178 ? -9.039  22.824  -14.682 1.00 0.00 ? 185 LYS A HG2    1  
ATOM   2831   H  HG3    . LYS A 1 178 ? -10.398 22.263  -15.654 1.00 0.00 ? 185 LYS A HG3    1  
ATOM   2832   H  HD2    . LYS A 1 178 ? -10.166 24.188  -17.125 1.00 0.00 ? 185 LYS A HD2    1  
ATOM   2833   H  HD3    . LYS A 1 178 ? -8.839  24.803  -16.136 1.00 0.00 ? 185 LYS A HD3    1  
ATOM   2834   H  HE2    . LYS A 1 178 ? -7.527  22.805  -16.664 1.00 0.00 ? 185 LYS A HE2    1  
ATOM   2835   H  HE3    . LYS A 1 178 ? -8.859  22.191  -17.643 1.00 0.00 ? 185 LYS A HE3    1  
ATOM   2836   H  HZ1    . LYS A 1 178 ? -7.047  23.298  -18.914 1.00 0.00 ? 185 LYS A HZ1    1  
ATOM   2837   H  HZ2    . LYS A 1 178 ? -7.488  24.768  -18.186 1.00 0.00 ? 185 LYS A HZ2    1  
ATOM   2838   H  HZ3    . LYS A 1 178 ? -8.590  23.952  -19.187 1.00 0.00 ? 185 LYS A HZ3    1  
ATOM   2839   N  N      . GLY B 2 1   ? 30.841  -19.702 -3.176  1.00 0.00 ? 391 GLY B N      1  
ATOM   2840   C  CA     . GLY B 2 1   ? 31.354  -18.316 -3.094  1.00 0.00 ? 391 GLY B CA     1  
ATOM   2841   C  C      . GLY B 2 1   ? 30.271  -17.335 -2.710  1.00 0.00 ? 391 GLY B C      1  
ATOM   2842   O  O      . GLY B 2 1   ? 29.092  -17.696 -2.637  1.00 0.00 ? 391 GLY B O      1  
ATOM   2843   H  H1     . GLY B 2 1   ? 31.614  -20.361 -3.410  1.00 0.00 ? 391 GLY B H1     1  
ATOM   2844   H  H2     . GLY B 2 1   ? 30.107  -19.766 -3.914  1.00 0.00 ? 391 GLY B H2     1  
ATOM   2845   H  H3     . GLY B 2 1   ? 30.421  -19.982 -2.266  1.00 0.00 ? 391 GLY B H3     1  
ATOM   2846   H  HA2    . GLY B 2 1   ? 32.141  -18.276 -2.355  1.00 0.00 ? 391 GLY B HA2    1  
ATOM   2847   H  HA3    . GLY B 2 1   ? 31.759  -18.035 -4.056  1.00 0.00 ? 391 GLY B HA3    1  
ATOM   2848   N  N      . SER B 2 2   ? 30.667  -16.096 -2.467  1.00 0.00 ? 392 SER B N      1  
ATOM   2849   C  CA     . SER B 2 2   ? 29.735  -15.046 -2.080  1.00 0.00 ? 392 SER B CA     1  
ATOM   2850   C  C      . SER B 2 2   ? 30.340  -13.689 -2.410  1.00 0.00 ? 392 SER B C      1  
ATOM   2851   O  O      . SER B 2 2   ? 30.011  -12.675 -1.793  1.00 0.00 ? 392 SER B O      1  
ATOM   2852   C  CB     . SER B 2 2   ? 29.431  -15.150 -0.582  1.00 0.00 ? 392 SER B CB     1  
ATOM   2853   O  OG     . SER B 2 2   ? 30.628  -15.204 0.180   1.00 0.00 ? 392 SER B OG     1  
ATOM   2854   H  H      . SER B 2 2   ? 31.627  -15.874 -2.549  1.00 0.00 ? 392 SER B H      1  
ATOM   2855   H  HA     . SER B 2 2   ? 28.824  -15.176 -2.643  1.00 0.00 ? 392 SER B HA     1  
ATOM   2856   H  HB2    . SER B 2 2   ? 28.861  -14.287 -0.271  1.00 0.00 ? 392 SER B HB2    1  
ATOM   2857   H  HB3    . SER B 2 2   ? 28.859  -16.046 -0.395  1.00 0.00 ? 392 SER B HB3    1  
ATOM   2858   H  HG     . SER B 2 2   ? 30.553  -15.904 0.845   1.00 0.00 ? 392 SER B HG     1  
ATOM   2859   N  N      . GLU B 2 3   ? 31.193  -13.694 -3.430  1.00 0.00 ? 393 GLU B N      1  
ATOM   2860   C  CA     . GLU B 2 3   ? 32.066  -12.567 -3.758  1.00 0.00 ? 393 GLU B CA     1  
ATOM   2861   C  C      . GLU B 2 3   ? 31.304  -11.249 -3.869  1.00 0.00 ? 393 GLU B C      1  
ATOM   2862   O  O      . GLU B 2 3   ? 31.577  -10.299 -3.136  1.00 0.00 ? 393 GLU B O      1  
ATOM   2863   C  CB     . GLU B 2 3   ? 32.799  -12.841 -5.075  1.00 0.00 ? 393 GLU B CB     1  
ATOM   2864   C  CG     . GLU B 2 3   ? 33.280  -14.277 -5.224  1.00 0.00 ? 393 GLU B CG     1  
ATOM   2865   C  CD     . GLU B 2 3   ? 34.021  -14.780 -4.001  1.00 0.00 ? 393 GLU B CD     1  
ATOM   2866   O  OE1    . GLU B 2 3   ? 35.191  -14.395 -3.817  1.00 0.00 ? 393 GLU B OE1    1  
ATOM   2867   O  OE2    . GLU B 2 3   ? 33.426  -15.558 -3.222  1.00 0.00 ? 393 GLU B OE2    1  
ATOM   2868   H  H      . GLU B 2 3   ? 31.242  -14.498 -3.989  1.00 0.00 ? 393 GLU B H      1  
ATOM   2869   H  HA     . GLU B 2 3   ? 32.796  -12.479 -2.970  1.00 0.00 ? 393 GLU B HA     1  
ATOM   2870   H  HB2    . GLU B 2 3   ? 32.135  -12.619 -5.897  1.00 0.00 ? 393 GLU B HB2    1  
ATOM   2871   H  HB3    . GLU B 2 3   ? 33.661  -12.190 -5.136  1.00 0.00 ? 393 GLU B HB3    1  
ATOM   2872   H  HG2    . GLU B 2 3   ? 32.424  -14.914 -5.391  1.00 0.00 ? 393 GLU B HG2    1  
ATOM   2873   H  HG3    . GLU B 2 3   ? 33.942  -14.336 -6.076  1.00 0.00 ? 393 GLU B HG3    1  
ATOM   2874   N  N      . THR B 2 4   ? 30.351  -11.196 -4.782  1.00 0.00 ? 394 THR B N      1  
ATOM   2875   C  CA     . THR B 2 4   ? 29.625  -9.969  -5.051  1.00 0.00 ? 394 THR B CA     1  
ATOM   2876   C  C      . THR B 2 4   ? 28.459  -9.803  -4.080  1.00 0.00 ? 394 THR B C      1  
ATOM   2877   O  O      . THR B 2 4   ? 28.121  -8.685  -3.683  1.00 0.00 ? 394 THR B O      1  
ATOM   2878   C  CB     . THR B 2 4   ? 29.106  -9.949  -6.503  1.00 0.00 ? 394 THR B CB     1  
ATOM   2879   O  OG1    . THR B 2 4   ? 30.175  -10.290 -7.397  1.00 0.00 ? 394 THR B OG1    1  
ATOM   2880   C  CG2    . THR B 2 4   ? 28.553  -8.577  -6.871  1.00 0.00 ? 394 THR B CG2    1  
ATOM   2881   H  H      . THR B 2 4   ? 30.120  -12.009 -5.285  1.00 0.00 ? 394 THR B H      1  
ATOM   2882   H  HA     . THR B 2 4   ? 30.309  -9.142  -4.921  1.00 0.00 ? 394 THR B HA     1  
ATOM   2883   H  HB     . THR B 2 4   ? 28.316  -10.680 -6.595  1.00 0.00 ? 394 THR B HB     1  
ATOM   2884   H  HG1    . THR B 2 4   ? 31.018  -10.002 -7.013  1.00 0.00 ? 394 THR B HG1    1  
ATOM   2885   H  HG21   . THR B 2 4   ? 27.720  -8.341  -6.227  1.00 0.00 ? 394 THR B HG21   1  
ATOM   2886   H  HG22   . THR B 2 4   ? 28.223  -8.584  -7.899  1.00 0.00 ? 394 THR B HG22   1  
ATOM   2887   H  HG23   . THR B 2 4   ? 29.328  -7.832  -6.747  1.00 0.00 ? 394 THR B HG23   1  
ATOM   2888   N  N      . GLN B 2 5   ? 27.863  -10.922 -3.675  1.00 0.00 ? 395 GLN B N      1  
ATOM   2889   C  CA     . GLN B 2 5   ? 26.722  -10.890 -2.765  1.00 0.00 ? 395 GLN B CA     1  
ATOM   2890   C  C      . GLN B 2 5   ? 27.119  -10.329 -1.404  1.00 0.00 ? 395 GLN B C      1  
ATOM   2891   O  O      . GLN B 2 5   ? 26.290  -9.757  -0.700  1.00 0.00 ? 395 GLN B O      1  
ATOM   2892   C  CB     . GLN B 2 5   ? 26.111  -12.279 -2.587  1.00 0.00 ? 395 GLN B CB     1  
ATOM   2893   C  CG     . GLN B 2 5   ? 25.583  -12.882 -3.875  1.00 0.00 ? 395 GLN B CG     1  
ATOM   2894   C  CD     . GLN B 2 5   ? 24.679  -14.070 -3.627  1.00 0.00 ? 395 GLN B CD     1  
ATOM   2895   O  OE1    . GLN B 2 5   ? 25.141  -15.204 -3.515  1.00 0.00 ? 395 GLN B OE1    1  
ATOM   2896   N  NE2    . GLN B 2 5   ? 23.382  -13.821 -3.560  1.00 0.00 ? 395 GLN B NE2    1  
ATOM   2897   H  H      . GLN B 2 5   ? 28.194  -11.787 -4.003  1.00 0.00 ? 395 GLN B H      1  
ATOM   2898   H  HA     . GLN B 2 5   ? 25.977  -10.238 -3.200  1.00 0.00 ? 395 GLN B HA     1  
ATOM   2899   H  HB2    . GLN B 2 5   ? 26.862  -12.941 -2.186  1.00 0.00 ? 395 GLN B HB2    1  
ATOM   2900   H  HB3    . GLN B 2 5   ? 25.293  -12.212 -1.885  1.00 0.00 ? 395 GLN B HB3    1  
ATOM   2901   H  HG2    . GLN B 2 5   ? 25.024  -12.127 -4.408  1.00 0.00 ? 395 GLN B HG2    1  
ATOM   2902   H  HG3    . GLN B 2 5   ? 26.420  -13.202 -4.476  1.00 0.00 ? 395 GLN B HG3    1  
ATOM   2903   H  HE21   . GLN B 2 5   ? 23.082  -12.893 -3.676  1.00 0.00 ? 395 GLN B HE21   1  
ATOM   2904   H  HE22   . GLN B 2 5   ? 22.769  -14.574 -3.405  1.00 0.00 ? 395 GLN B HE22   1  
ATOM   2905   N  N      . ALA B 2 6   ? 28.385  -10.503 -1.039  1.00 0.00 ? 396 ALA B N      1  
ATOM   2906   C  CA     . ALA B 2 6   ? 28.905  -9.982  0.221   1.00 0.00 ? 396 ALA B CA     1  
ATOM   2907   C  C      . ALA B 2 6   ? 28.648  -8.481  0.343   1.00 0.00 ? 396 ALA B C      1  
ATOM   2908   O  O      . ALA B 2 6   ? 28.038  -8.021  1.311   1.00 0.00 ? 396 ALA B O      1  
ATOM   2909   C  CB     . ALA B 2 6   ? 30.394  -10.270 0.328   1.00 0.00 ? 396 ALA B CB     1  
ATOM   2910   H  H      . ALA B 2 6   ? 28.989  -11.007 -1.631  1.00 0.00 ? 396 ALA B H      1  
ATOM   2911   H  HA     . ALA B 2 6   ? 28.403  -10.493 1.028   1.00 0.00 ? 396 ALA B HA     1  
ATOM   2912   H  HB1    . ALA B 2 6   ? 30.560  -11.336 0.270   1.00 0.00 ? 396 ALA B HB1    1  
ATOM   2913   H  HB2    . ALA B 2 6   ? 30.766  -9.896  1.269   1.00 0.00 ? 396 ALA B HB2    1  
ATOM   2914   H  HB3    . ALA B 2 6   ? 30.911  -9.781  -0.485  1.00 0.00 ? 396 ALA B HB3    1  
ATOM   2915   N  N      . GLY B 2 7   ? 29.097  -7.732  -0.662  1.00 0.00 ? 397 GLY B N      1  
ATOM   2916   C  CA     . GLY B 2 7   ? 28.901  -6.295  -0.667  1.00 0.00 ? 397 GLY B CA     1  
ATOM   2917   C  C      . GLY B 2 7   ? 27.433  -5.921  -0.698  1.00 0.00 ? 397 GLY B C      1  
ATOM   2918   O  O      . GLY B 2 7   ? 27.025  -4.928  -0.095  1.00 0.00 ? 397 GLY B O      1  
ATOM   2919   H  H      . GLY B 2 7   ? 29.566  -8.162  -1.406  1.00 0.00 ? 397 GLY B H      1  
ATOM   2920   H  HA2    . GLY B 2 7   ? 29.353  -5.876  0.220   1.00 0.00 ? 397 GLY B HA2    1  
ATOM   2921   H  HA3    . GLY B 2 7   ? 29.385  -5.880  -1.538  1.00 0.00 ? 397 GLY B HA3    1  
ATOM   2922   N  N      . ILE B 2 8   ? 26.640  -6.724  -1.400  1.00 0.00 ? 398 ILE B N      1  
ATOM   2923   C  CA     . ILE B 2 8   ? 25.202  -6.504  -1.476  1.00 0.00 ? 398 ILE B CA     1  
ATOM   2924   C  C      . ILE B 2 8   ? 24.551  -6.686  -0.106  1.00 0.00 ? 398 ILE B C      1  
ATOM   2925   O  O      . ILE B 2 8   ? 23.786  -5.835  0.338   1.00 0.00 ? 398 ILE B O      1  
ATOM   2926   C  CB     . ILE B 2 8   ? 24.530  -7.458  -2.491  1.00 0.00 ? 398 ILE B CB     1  
ATOM   2927   C  CG1    . ILE B 2 8   ? 25.059  -7.206  -3.907  1.00 0.00 ? 398 ILE B CG1    1  
ATOM   2928   C  CG2    . ILE B 2 8   ? 23.021  -7.289  -2.456  1.00 0.00 ? 398 ILE B CG2    1  
ATOM   2929   C  CD1    . ILE B 2 8   ? 24.735  -5.826  -4.447  1.00 0.00 ? 398 ILE B CD1    1  
ATOM   2930   H  H      . ILE B 2 8   ? 27.034  -7.481  -1.879  1.00 0.00 ? 398 ILE B H      1  
ATOM   2931   H  HA     . ILE B 2 8   ? 25.037  -5.488  -1.808  1.00 0.00 ? 398 ILE B HA     1  
ATOM   2932   H  HB     . ILE B 2 8   ? 24.760  -8.475  -2.204  1.00 0.00 ? 398 ILE B HB     1  
ATOM   2933   H  HG12   . ILE B 2 8   ? 26.131  -7.318  -3.910  1.00 0.00 ? 398 ILE B HG12   1  
ATOM   2934   H  HG13   . ILE B 2 8   ? 24.624  -7.934  -4.579  1.00 0.00 ? 398 ILE B HG13   1  
ATOM   2935   H  HG21   . ILE B 2 8   ? 22.569  -7.956  -3.173  1.00 0.00 ? 398 ILE B HG21   1  
ATOM   2936   H  HG22   . ILE B 2 8   ? 22.769  -6.268  -2.702  1.00 0.00 ? 398 ILE B HG22   1  
ATOM   2937   H  HG23   . ILE B 2 8   ? 22.655  -7.521  -1.467  1.00 0.00 ? 398 ILE B HG23   1  
ATOM   2938   H  HD11   . ILE B 2 8   ? 23.662  -5.689  -4.470  1.00 0.00 ? 398 ILE B HD11   1  
ATOM   2939   H  HD12   . ILE B 2 8   ? 25.130  -5.731  -5.449  1.00 0.00 ? 398 ILE B HD12   1  
ATOM   2940   H  HD13   . ILE B 2 8   ? 25.180  -5.075  -3.812  1.00 0.00 ? 398 ILE B HD13   1  
ATOM   2941   N  N      . LYS B 2 9   ? 24.875  -7.788  0.564   1.00 0.00 ? 399 LYS B N      1  
ATOM   2942   C  CA     . LYS B 2 9   ? 24.306  -8.086  1.877   1.00 0.00 ? 399 LYS B CA     1  
ATOM   2943   C  C      . LYS B 2 9   ? 24.638  -6.991  2.879   1.00 0.00 ? 399 LYS B C      1  
ATOM   2944   O  O      . LYS B 2 9   ? 23.781  -6.576  3.661   1.00 0.00 ? 399 LYS B O      1  
ATOM   2945   C  CB     . LYS B 2 9   ? 24.812  -9.432  2.400   1.00 0.00 ? 399 LYS B CB     1  
ATOM   2946   C  CG     . LYS B 2 9   ? 24.312  -10.623 1.605   1.00 0.00 ? 399 LYS B CG     1  
ATOM   2947   C  CD     . LYS B 2 9   ? 24.832  -11.930 2.177   1.00 0.00 ? 399 LYS B CD     1  
ATOM   2948   C  CE     . LYS B 2 9   ? 24.364  -13.117 1.353   1.00 0.00 ? 399 LYS B CE     1  
ATOM   2949   N  NZ     . LYS B 2 9   ? 24.810  -14.413 1.929   1.00 0.00 ? 399 LYS B NZ     1  
ATOM   2950   H  H      . LYS B 2 9   ? 25.514  -8.419  0.165   1.00 0.00 ? 399 LYS B H      1  
ATOM   2951   H  HA     . LYS B 2 9   ? 23.233  -8.136  1.766   1.00 0.00 ? 399 LYS B HA     1  
ATOM   2952   H  HB2    . LYS B 2 9   ? 25.890  -9.435  2.369   1.00 0.00 ? 399 LYS B HB2    1  
ATOM   2953   H  HB3    . LYS B 2 9   ? 24.488  -9.550  3.424   1.00 0.00 ? 399 LYS B HB3    1  
ATOM   2954   H  HG2    . LYS B 2 9   ? 23.233  -10.634 1.631   1.00 0.00 ? 399 LYS B HG2    1  
ATOM   2955   H  HG3    . LYS B 2 9   ? 24.648  -10.529 0.581   1.00 0.00 ? 399 LYS B HG3    1  
ATOM   2956   H  HD2    . LYS B 2 9   ? 25.912  -11.906 2.176   1.00 0.00 ? 399 LYS B HD2    1  
ATOM   2957   H  HD3    . LYS B 2 9   ? 24.473  -12.039 3.191   1.00 0.00 ? 399 LYS B HD3    1  
ATOM   2958   H  HE2    . LYS B 2 9   ? 23.285  -13.106 1.311   1.00 0.00 ? 399 LYS B HE2    1  
ATOM   2959   H  HE3    . LYS B 2 9   ? 24.763  -13.022 0.354   1.00 0.00 ? 399 LYS B HE3    1  
ATOM   2960   H  HZ1    . LYS B 2 9   ? 24.533  -15.198 1.301   1.00 0.00 ? 399 LYS B HZ1    1  
ATOM   2961   H  HZ2    . LYS B 2 9   ? 24.368  -14.561 2.864   1.00 0.00 ? 399 LYS B HZ2    1  
ATOM   2962   H  HZ3    . LYS B 2 9   ? 25.846  -14.422 2.045   1.00 0.00 ? 399 LYS B HZ3    1  
ATOM   2963   N  N      . GLU B 2 10  ? 25.878  -6.519  2.850   1.00 0.00 ? 400 GLU B N      1  
ATOM   2964   C  CA     . GLU B 2 10  ? 26.298  -5.444  3.738   1.00 0.00 ? 400 GLU B CA     1  
ATOM   2965   C  C      . GLU B 2 10  ? 25.577  -4.145  3.392   1.00 0.00 ? 400 GLU B C      1  
ATOM   2966   O  O      . GLU B 2 10  ? 25.245  -3.356  4.276   1.00 0.00 ? 400 GLU B O      1  
ATOM   2967   C  CB     . GLU B 2 10  ? 27.813  -5.251  3.676   1.00 0.00 ? 400 GLU B CB     1  
ATOM   2968   C  CG     . GLU B 2 10  ? 28.586  -6.422  4.251   1.00 0.00 ? 400 GLU B CG     1  
ATOM   2969   C  CD     . GLU B 2 10  ? 30.083  -6.206  4.222   1.00 0.00 ? 400 GLU B CD     1  
ATOM   2970   O  OE1    . GLU B 2 10  ? 30.576  -5.357  4.989   1.00 0.00 ? 400 GLU B OE1    1  
ATOM   2971   O  OE2    . GLU B 2 10  ? 30.766  -6.896  3.442   1.00 0.00 ? 400 GLU B OE2    1  
ATOM   2972   H  H      . GLU B 2 10  ? 26.527  -6.907  2.220   1.00 0.00 ? 400 GLU B H      1  
ATOM   2973   H  HA     . GLU B 2 10  ? 26.025  -5.729  4.743   1.00 0.00 ? 400 GLU B HA     1  
ATOM   2974   H  HB2    . GLU B 2 10  ? 28.107  -5.123  2.646   1.00 0.00 ? 400 GLU B HB2    1  
ATOM   2975   H  HB3    . GLU B 2 10  ? 28.079  -4.364  4.231   1.00 0.00 ? 400 GLU B HB3    1  
ATOM   2976   H  HG2    . GLU B 2 10  ? 28.277  -6.573  5.275   1.00 0.00 ? 400 GLU B HG2    1  
ATOM   2977   H  HG3    . GLU B 2 10  ? 28.353  -7.306  3.673   1.00 0.00 ? 400 GLU B HG3    1  
ATOM   2978   N  N      . GLU B 2 11  ? 25.324  -3.930  2.107   1.00 0.00 ? 401 GLU B N      1  
ATOM   2979   C  CA     . GLU B 2 11  ? 24.582  -2.755  1.670   1.00 0.00 ? 401 GLU B CA     1  
ATOM   2980   C  C      . GLU B 2 11  ? 23.124  -2.860  2.118   1.00 0.00 ? 401 GLU B C      1  
ATOM   2981   O  O      . GLU B 2 11  ? 22.544  -1.882  2.583   1.00 0.00 ? 401 GLU B O      1  
ATOM   2982   C  CB     . GLU B 2 11  ? 24.657  -2.597  0.150   1.00 0.00 ? 401 GLU B CB     1  
ATOM   2983   C  CG     . GLU B 2 11  ? 24.156  -1.250  -0.350  1.00 0.00 ? 401 GLU B CG     1  
ATOM   2984   C  CD     . GLU B 2 11  ? 25.113  -0.120  -0.035  1.00 0.00 ? 401 GLU B CD     1  
ATOM   2985   O  OE1    . GLU B 2 11  ? 26.093  0.052   -0.783  1.00 0.00 ? 401 GLU B OE1    1  
ATOM   2986   O  OE2    . GLU B 2 11  ? 24.887  0.597   0.960   1.00 0.00 ? 401 GLU B OE2    1  
ATOM   2987   H  H      . GLU B 2 11  ? 25.648  -4.573  1.437   1.00 0.00 ? 401 GLU B H      1  
ATOM   2988   H  HA     . GLU B 2 11  ? 25.029  -1.890  2.137   1.00 0.00 ? 401 GLU B HA     1  
ATOM   2989   H  HB2    . GLU B 2 11  ? 25.686  -2.712  -0.159  1.00 0.00 ? 401 GLU B HB2    1  
ATOM   2990   H  HB3    . GLU B 2 11  ? 24.065  -3.374  -0.310  1.00 0.00 ? 401 GLU B HB3    1  
ATOM   2991   H  HG2    . GLU B 2 11  ? 24.023  -1.303  -1.419  1.00 0.00 ? 401 GLU B HG2    1  
ATOM   2992   H  HG3    . GLU B 2 11  ? 23.207  -1.038  0.122   1.00 0.00 ? 401 GLU B HG3    1  
ATOM   2993   N  N      . ILE B 2 12  ? 22.546  -4.058  1.984   1.00 0.00 ? 402 ILE B N      1  
ATOM   2994   C  CA     . ILE B 2 12  ? 21.189  -4.321  2.465   1.00 0.00 ? 402 ILE B CA     1  
ATOM   2995   C  C      . ILE B 2 12  ? 21.085  -3.981  3.944   1.00 0.00 ? 402 ILE B C      1  
ATOM   2996   O  O      . ILE B 2 12  ? 20.186  -3.257  4.358   1.00 0.00 ? 402 ILE B O      1  
ATOM   2997   C  CB     . ILE B 2 12  ? 20.769  -5.799  2.262   1.00 0.00 ? 402 ILE B CB     1  
ATOM   2998   C  CG1    . ILE B 2 12  ? 20.717  -6.157  0.774   1.00 0.00 ? 402 ILE B CG1    1  
ATOM   2999   C  CG2    . ILE B 2 12  ? 19.412  -6.062  2.904   1.00 0.00 ? 402 ILE B CG2    1  
ATOM   3000   C  CD1    . ILE B 2 12  ? 20.569  -7.639  0.520   1.00 0.00 ? 402 ILE B CD1    1  
ATOM   3001   H  H      . ILE B 2 12  ? 23.046  -4.781  1.545   1.00 0.00 ? 402 ILE B H      1  
ATOM   3002   H  HA     . ILE B 2 12  ? 20.508  -3.692  1.908   1.00 0.00 ? 402 ILE B HA     1  
ATOM   3003   H  HB     . ILE B 2 12  ? 21.498  -6.429  2.750   1.00 0.00 ? 402 ILE B HB     1  
ATOM   3004   H  HG12   . ILE B 2 12  ? 19.870  -5.663  0.318   1.00 0.00 ? 402 ILE B HG12   1  
ATOM   3005   H  HG13   . ILE B 2 12  ? 21.627  -5.824  0.296   1.00 0.00 ? 402 ILE B HG13   1  
ATOM   3006   H  HG21   . ILE B 2 12  ? 18.669  -5.422  2.451   1.00 0.00 ? 402 ILE B HG21   1  
ATOM   3007   H  HG22   . ILE B 2 12  ? 19.469  -5.854  3.962   1.00 0.00 ? 402 ILE B HG22   1  
ATOM   3008   H  HG23   . ILE B 2 12  ? 19.137  -7.095  2.755   1.00 0.00 ? 402 ILE B HG23   1  
ATOM   3009   H  HD11   . ILE B 2 12  ? 20.516  -7.817  -0.544  1.00 0.00 ? 402 ILE B HD11   1  
ATOM   3010   H  HD12   . ILE B 2 12  ? 19.666  -7.998  0.990   1.00 0.00 ? 402 ILE B HD12   1  
ATOM   3011   H  HD13   . ILE B 2 12  ? 21.421  -8.161  0.930   1.00 0.00 ? 402 ILE B HD13   1  
ATOM   3012   N  N      . ARG B 2 13  ? 22.033  -4.491  4.727   1.00 0.00 ? 403 ARG B N      1  
ATOM   3013   C  CA     . ARG B 2 13  ? 22.078  -4.227  6.162   1.00 0.00 ? 403 ARG B CA     1  
ATOM   3014   C  C      . ARG B 2 13  ? 22.166  -2.730  6.445   1.00 0.00 ? 403 ARG B C      1  
ATOM   3015   O  O      . ARG B 2 13  ? 21.561  -2.235  7.392   1.00 0.00 ? 403 ARG B O      1  
ATOM   3016   C  CB     . ARG B 2 13  ? 23.268  -4.943  6.797   1.00 0.00 ? 403 ARG B CB     1  
ATOM   3017   C  CG     . ARG B 2 13  ? 23.131  -6.453  6.816   1.00 0.00 ? 403 ARG B CG     1  
ATOM   3018   C  CD     . ARG B 2 13  ? 24.424  -7.118  7.252   1.00 0.00 ? 403 ARG B CD     1  
ATOM   3019   N  NE     . ARG B 2 13  ? 24.856  -6.674  8.577   1.00 0.00 ? 403 ARG B NE     1  
ATOM   3020   C  CZ     . ARG B 2 13  ? 25.690  -7.361  9.353   1.00 0.00 ? 403 ARG B CZ     1  
ATOM   3021   N  NH1    . ARG B 2 13  ? 26.165  -8.533  8.949   1.00 0.00 ? 403 ARG B NH1    1  
ATOM   3022   N  NH2    . ARG B 2 13  ? 26.050  -6.874  10.531  1.00 0.00 ? 403 ARG B NH2    1  
ATOM   3023   H  H      . ARG B 2 13  ? 22.721  -5.068  4.325   1.00 0.00 ? 403 ARG B H      1  
ATOM   3024   H  HA     . ARG B 2 13  ? 21.167  -4.611  6.597   1.00 0.00 ? 403 ARG B HA     1  
ATOM   3025   H  HB2    . ARG B 2 13  ? 24.161  -4.694  6.244   1.00 0.00 ? 403 ARG B HB2    1  
ATOM   3026   H  HB3    . ARG B 2 13  ? 23.379  -4.601  7.816   1.00 0.00 ? 403 ARG B HB3    1  
ATOM   3027   H  HG2    . ARG B 2 13  ? 22.348  -6.725  7.507   1.00 0.00 ? 403 ARG B HG2    1  
ATOM   3028   H  HG3    . ARG B 2 13  ? 22.876  -6.794  5.824   1.00 0.00 ? 403 ARG B HG3    1  
ATOM   3029   H  HD2    . ARG B 2 13  ? 24.274  -8.188  7.273   1.00 0.00 ? 403 ARG B HD2    1  
ATOM   3030   H  HD3    . ARG B 2 13  ? 25.195  -6.878  6.534   1.00 0.00 ? 403 ARG B HD3    1  
ATOM   3031   H  HE     . ARG B 2 13  ? 24.505  -5.807  8.905   1.00 0.00 ? 403 ARG B HE     1  
ATOM   3032   H  HH11   . ARG B 2 13  ? 25.901  -8.906  8.049   1.00 0.00 ? 403 ARG B HH11   1  
ATOM   3033   H  HH12   . ARG B 2 13  ? 26.774  -9.065  9.544   1.00 0.00 ? 403 ARG B HH12   1  
ATOM   3034   H  HH21   . ARG B 2 13  ? 25.697  -5.984  10.842  1.00 0.00 ? 403 ARG B HH21   1  
ATOM   3035   H  HH22   . ARG B 2 13  ? 26.688  -7.389  11.121  1.00 0.00 ? 403 ARG B HH22   1  
ATOM   3036   N  N      . ARG B 2 14  ? 22.919  -2.017  5.613   1.00 0.00 ? 404 ARG B N      1  
ATOM   3037   C  CA     . ARG B 2 14  ? 23.044  -0.569  5.734   1.00 0.00 ? 404 ARG B CA     1  
ATOM   3038   C  C      . ARG B 2 14  ? 21.696  0.107   5.492   1.00 0.00 ? 404 ARG B C      1  
ATOM   3039   O  O      . ARG B 2 14  ? 21.307  1.019   6.224   1.00 0.00 ? 404 ARG B O      1  
ATOM   3040   C  CB     . ARG B 2 14  ? 24.091  -0.039  4.746   1.00 0.00 ? 404 ARG B CB     1  
ATOM   3041   C  CG     . ARG B 2 14  ? 24.134  1.479   4.655   1.00 0.00 ? 404 ARG B CG     1  
ATOM   3042   C  CD     . ARG B 2 14  ? 25.188  1.951   3.673   1.00 0.00 ? 404 ARG B CD     1  
ATOM   3043   N  NE     . ARG B 2 14  ? 26.544  1.673   4.139   1.00 0.00 ? 404 ARG B NE     1  
ATOM   3044   C  CZ     . ARG B 2 14  ? 27.548  1.314   3.341   1.00 0.00 ? 404 ARG B CZ     1  
ATOM   3045   N  NH1    . ARG B 2 14  ? 27.328  1.067   2.056   1.00 0.00 ? 404 ARG B NH1    1  
ATOM   3046   N  NH2    . ARG B 2 14  ? 28.768  1.166   3.844   1.00 0.00 ? 404 ARG B NH2    1  
ATOM   3047   H  H      . ARG B 2 14  ? 23.405  -2.480  4.896   1.00 0.00 ? 404 ARG B H      1  
ATOM   3048   H  HA     . ARG B 2 14  ? 23.370  -0.349  6.740   1.00 0.00 ? 404 ARG B HA     1  
ATOM   3049   H  HB2    . ARG B 2 14  ? 25.067  -0.386  5.055   1.00 0.00 ? 404 ARG B HB2    1  
ATOM   3050   H  HB3    . ARG B 2 14  ? 23.874  -0.432  3.764   1.00 0.00 ? 404 ARG B HB3    1  
ATOM   3051   H  HG2    . ARG B 2 14  ? 23.169  1.839   4.331   1.00 0.00 ? 404 ARG B HG2    1  
ATOM   3052   H  HG3    . ARG B 2 14  ? 24.360  1.880   5.629   1.00 0.00 ? 404 ARG B HG3    1  
ATOM   3053   H  HD2    . ARG B 2 14  ? 25.033  1.449   2.728   1.00 0.00 ? 404 ARG B HD2    1  
ATOM   3054   H  HD3    . ARG B 2 14  ? 25.078  3.017   3.533   1.00 0.00 ? 404 ARG B HD3    1  
ATOM   3055   H  HE     . ARG B 2 14  ? 26.723  1.789   5.101   1.00 0.00 ? 404 ARG B HE     1  
ATOM   3056   H  HH11   . ARG B 2 14  ? 26.392  1.142   1.672   1.00 0.00 ? 404 ARG B HH11   1  
ATOM   3057   H  HH12   . ARG B 2 14  ? 28.087  0.799   1.457   1.00 0.00 ? 404 ARG B HH12   1  
ATOM   3058   H  HH21   . ARG B 2 14  ? 28.930  1.318   4.828   1.00 0.00 ? 404 ARG B HH21   1  
ATOM   3059   H  HH22   . ARG B 2 14  ? 29.535  0.906   3.251   1.00 0.00 ? 404 ARG B HH22   1  
ATOM   3060   N  N      . GLN B 2 15  ? 20.978  -0.362  4.478   1.00 0.00 ? 405 GLN B N      1  
ATOM   3061   C  CA     . GLN B 2 15  ? 19.678  0.203   4.136   1.00 0.00 ? 405 GLN B CA     1  
ATOM   3062   C  C      . GLN B 2 15  ? 18.648  -0.172  5.195   1.00 0.00 ? 405 GLN B C      1  
ATOM   3063   O  O      . GLN B 2 15  ? 17.790  0.637   5.559   1.00 0.00 ? 405 GLN B O      1  
ATOM   3064   C  CB     . GLN B 2 15  ? 19.223  -0.287  2.758   1.00 0.00 ? 405 GLN B CB     1  
ATOM   3065   C  CG     . GLN B 2 15  ? 20.262  -0.086  1.665   1.00 0.00 ? 405 GLN B CG     1  
ATOM   3066   C  CD     . GLN B 2 15  ? 20.664  1.366   1.493   1.00 0.00 ? 405 GLN B CD     1  
ATOM   3067   O  OE1    . GLN B 2 15  ? 19.858  2.276   1.685   1.00 0.00 ? 405 GLN B OE1    1  
ATOM   3068   N  NE2    . GLN B 2 15  ? 21.923  1.594   1.154   1.00 0.00 ? 405 GLN B NE2    1  
ATOM   3069   H  H      . GLN B 2 15  ? 21.331  -1.112  3.947   1.00 0.00 ? 405 GLN B H      1  
ATOM   3070   H  HA     . GLN B 2 15  ? 19.781  1.279   4.112   1.00 0.00 ? 405 GLN B HA     1  
ATOM   3071   H  HB2    . GLN B 2 15  ? 18.999  -1.342  2.820   1.00 0.00 ? 405 GLN B HB2    1  
ATOM   3072   H  HB3    . GLN B 2 15  ? 18.330  0.247   2.476   1.00 0.00 ? 405 GLN B HB3    1  
ATOM   3073   H  HG2    . GLN B 2 15  ? 21.144  -0.657  1.914   1.00 0.00 ? 405 GLN B HG2    1  
ATOM   3074   H  HG3    . GLN B 2 15  ? 19.856  -0.445  0.731   1.00 0.00 ? 405 GLN B HG3    1  
ATOM   3075   H  HE21   . GLN B 2 15  ? 22.523  0.825   1.037   1.00 0.00 ? 405 GLN B HE21   1  
ATOM   3076   H  HE22   . GLN B 2 15  ? 22.207  2.528   1.028   1.00 0.00 ? 405 GLN B HE22   1  
ATOM   3077   N  N      . GLU B 2 16  ? 18.743  -1.402  5.692   1.00 0.00 ? 406 GLU B N      1  
ATOM   3078   C  CA     . GLU B 2 16  ? 17.902  -1.849  6.795   1.00 0.00 ? 406 GLU B CA     1  
ATOM   3079   C  C      . GLU B 2 16  ? 18.156  -0.992  8.026   1.00 0.00 ? 406 GLU B C      1  
ATOM   3080   O  O      . GLU B 2 16  ? 17.224  -0.613  8.725   1.00 0.00 ? 406 GLU B O      1  
ATOM   3081   C  CB     . GLU B 2 16  ? 18.159  -3.324  7.125   1.00 0.00 ? 406 GLU B CB     1  
ATOM   3082   C  CG     . GLU B 2 16  ? 17.675  -4.288  6.052   1.00 0.00 ? 406 GLU B CG     1  
ATOM   3083   C  CD     . GLU B 2 16  ? 17.829  -5.743  6.452   1.00 0.00 ? 406 GLU B CD     1  
ATOM   3084   O  OE1    . GLU B 2 16  ? 18.934  -6.295  6.284   1.00 0.00 ? 406 GLU B OE1    1  
ATOM   3085   O  OE2    . GLU B 2 16  ? 16.838  -6.339  6.924   1.00 0.00 ? 406 GLU B OE2    1  
ATOM   3086   H  H      . GLU B 2 16  ? 19.390  -2.031  5.296   1.00 0.00 ? 406 GLU B H      1  
ATOM   3087   H  HA     . GLU B 2 16  ? 16.871  -1.730  6.495   1.00 0.00 ? 406 GLU B HA     1  
ATOM   3088   H  HB2    . GLU B 2 16  ? 19.221  -3.470  7.255   1.00 0.00 ? 406 GLU B HB2    1  
ATOM   3089   H  HB3    . GLU B 2 16  ? 17.657  -3.566  8.047   1.00 0.00 ? 406 GLU B HB3    1  
ATOM   3090   H  HG2    . GLU B 2 16  ? 16.630  -4.096  5.858   1.00 0.00 ? 406 GLU B HG2    1  
ATOM   3091   H  HG3    . GLU B 2 16  ? 18.243  -4.114  5.149   1.00 0.00 ? 406 GLU B HG3    1  
ATOM   3092   N  N      . PHE B 2 17  ? 19.423  -0.680  8.270   1.00 0.00 ? 407 PHE B N      1  
ATOM   3093   C  CA     . PHE B 2 17  ? 19.816  0.184   9.377   1.00 0.00 ? 407 PHE B CA     1  
ATOM   3094   C  C      . PHE B 2 17  ? 19.203  1.570   9.226   1.00 0.00 ? 407 PHE B C      1  
ATOM   3095   O  O      . PHE B 2 17  ? 18.619  2.106   10.170  1.00 0.00 ? 407 PHE B O      1  
ATOM   3096   C  CB     . PHE B 2 17  ? 21.342  0.285   9.444   1.00 0.00 ? 407 PHE B CB     1  
ATOM   3097   C  CG     . PHE B 2 17  ? 21.845  1.320   10.410  1.00 0.00 ? 407 PHE B CG     1  
ATOM   3098   C  CD1    . PHE B 2 17  ? 21.800  1.093   11.775  1.00 0.00 ? 407 PHE B CD1    1  
ATOM   3099   C  CD2    . PHE B 2 17  ? 22.355  2.524   9.950   1.00 0.00 ? 407 PHE B CD2    1  
ATOM   3100   C  CE1    . PHE B 2 17  ? 22.254  2.046   12.664  1.00 0.00 ? 407 PHE B CE1    1  
ATOM   3101   C  CE2    . PHE B 2 17  ? 22.809  3.481   10.833  1.00 0.00 ? 407 PHE B CE2    1  
ATOM   3102   C  CZ     . PHE B 2 17  ? 22.761  3.243   12.193  1.00 0.00 ? 407 PHE B CZ     1  
ATOM   3103   H  H      . PHE B 2 17  ? 20.123  -1.052  7.686   1.00 0.00 ? 407 PHE B H      1  
ATOM   3104   H  HA     . PHE B 2 17  ? 19.451  -0.260  10.292  1.00 0.00 ? 407 PHE B HA     1  
ATOM   3105   H  HB2    . PHE B 2 17  ? 21.737  -0.669  9.745   1.00 0.00 ? 407 PHE B HB2    1  
ATOM   3106   H  HB3    . PHE B 2 17  ? 21.720  0.532   8.463   1.00 0.00 ? 407 PHE B HB3    1  
ATOM   3107   H  HD1    . PHE B 2 17  ? 21.406  0.158   12.143  1.00 0.00 ? 407 PHE B HD1    1  
ATOM   3108   H  HD2    . PHE B 2 17  ? 22.395  2.712   8.887   1.00 0.00 ? 407 PHE B HD2    1  
ATOM   3109   H  HE1    . PHE B 2 17  ? 22.213  1.858   13.727  1.00 0.00 ? 407 PHE B HE1    1  
ATOM   3110   H  HE2    . PHE B 2 17  ? 23.202  4.414   10.461  1.00 0.00 ? 407 PHE B HE2    1  
ATOM   3111   H  HZ     . PHE B 2 17  ? 23.116  3.990   12.885  1.00 0.00 ? 407 PHE B HZ     1  
ATOM   3112   N  N      . LEU B 2 18  ? 19.334  2.139   8.032   1.00 0.00 ? 408 LEU B N      1  
ATOM   3113   C  CA     . LEU B 2 18  ? 18.762  3.448   7.737   1.00 0.00 ? 408 LEU B CA     1  
ATOM   3114   C  C      . LEU B 2 18  ? 17.265  3.446   7.996   1.00 0.00 ? 408 LEU B C      1  
ATOM   3115   O  O      . LEU B 2 18  ? 16.733  4.344   8.651   1.00 0.00 ? 408 LEU B O      1  
ATOM   3116   C  CB     . LEU B 2 18  ? 19.026  3.829   6.278   1.00 0.00 ? 408 LEU B CB     1  
ATOM   3117   C  CG     . LEU B 2 18  ? 20.480  4.152   5.940   1.00 0.00 ? 408 LEU B CG     1  
ATOM   3118   C  CD1    . LEU B 2 18  ? 20.616  4.523   4.473   1.00 0.00 ? 408 LEU B CD1    1  
ATOM   3119   C  CD2    . LEU B 2 18  ? 20.993  5.276   6.821   1.00 0.00 ? 408 LEU B CD2    1  
ATOM   3120   H  H      . LEU B 2 18  ? 19.834  1.667   7.330   1.00 0.00 ? 408 LEU B H      1  
ATOM   3121   H  HA     . LEU B 2 18  ? 19.232  4.172   8.386   1.00 0.00 ? 408 LEU B HA     1  
ATOM   3122   H  HB2    . LEU B 2 18  ? 18.717  3.000   5.659   1.00 0.00 ? 408 LEU B HB2    1  
ATOM   3123   H  HB3    . LEU B 2 18  ? 18.413  4.686   6.028   1.00 0.00 ? 408 LEU B HB3    1  
ATOM   3124   H  HG     . LEU B 2 18  ? 21.089  3.278   6.123   1.00 0.00 ? 408 LEU B HG     1  
ATOM   3125   H  HD11   . LEU B 2 18  ? 20.284  3.696   3.860   1.00 0.00 ? 408 LEU B HD11   1  
ATOM   3126   H  HD12   . LEU B 2 18  ? 21.651  4.741   4.252   1.00 0.00 ? 408 LEU B HD12   1  
ATOM   3127   H  HD13   . LEU B 2 18  ? 20.012  5.393   4.263   1.00 0.00 ? 408 LEU B HD13   1  
ATOM   3128   H  HD21   . LEU B 2 18  ? 22.026  5.476   6.582   1.00 0.00 ? 408 LEU B HD21   1  
ATOM   3129   H  HD22   . LEU B 2 18  ? 20.911  4.985   7.858   1.00 0.00 ? 408 LEU B HD22   1  
ATOM   3130   H  HD23   . LEU B 2 18  ? 20.404  6.164   6.646   1.00 0.00 ? 408 LEU B HD23   1  
ATOM   3131   N  N      . LEU B 2 19  ? 16.600  2.415   7.498   1.00 0.00 ? 409 LEU B N      1  
ATOM   3132   C  CA     . LEU B 2 19  ? 15.158  2.294   7.645   1.00 0.00 ? 409 LEU B CA     1  
ATOM   3133   C  C      . LEU B 2 19  ? 14.794  2.054   9.104   1.00 0.00 ? 409 LEU B C      1  
ATOM   3134   O  O      . LEU B 2 19  ? 13.887  2.685   9.643   1.00 0.00 ? 409 LEU B O      1  
ATOM   3135   C  CB     . LEU B 2 19  ? 14.631  1.139   6.794   1.00 0.00 ? 409 LEU B CB     1  
ATOM   3136   C  CG     . LEU B 2 19  ? 13.145  1.229   6.443   1.00 0.00 ? 409 LEU B CG     1  
ATOM   3137   C  CD1    . LEU B 2 19  ? 12.891  2.394   5.502   1.00 0.00 ? 409 LEU B CD1    1  
ATOM   3138   C  CD2    . LEU B 2 19  ? 12.651  -0.072  5.832   1.00 0.00 ? 409 LEU B CD2    1  
ATOM   3139   H  H      . LEU B 2 19  ? 17.097  1.712   7.015   1.00 0.00 ? 409 LEU B H      1  
ATOM   3140   H  HA     . LEU B 2 19  ? 14.705  3.216   7.314   1.00 0.00 ? 409 LEU B HA     1  
ATOM   3141   H  HB2    . LEU B 2 19  ? 15.202  1.102   5.880   1.00 0.00 ? 409 LEU B HB2    1  
ATOM   3142   H  HB3    . LEU B 2 19  ? 14.793  0.219   7.337   1.00 0.00 ? 409 LEU B HB3    1  
ATOM   3143   H  HG     . LEU B 2 19  ? 12.581  1.407   7.348   1.00 0.00 ? 409 LEU B HG     1  
ATOM   3144   H  HD11   . LEU B 2 19  ? 13.226  3.311   5.965   1.00 0.00 ? 409 LEU B HD11   1  
ATOM   3145   H  HD12   . LEU B 2 19  ? 11.833  2.465   5.292   1.00 0.00 ? 409 LEU B HD12   1  
ATOM   3146   H  HD13   . LEU B 2 19  ? 13.432  2.239   4.580   1.00 0.00 ? 409 LEU B HD13   1  
ATOM   3147   H  HD21   . LEU B 2 19  ? 13.237  -0.303  4.955   1.00 0.00 ? 409 LEU B HD21   1  
ATOM   3148   H  HD22   . LEU B 2 19  ? 11.612  0.034   5.552   1.00 0.00 ? 409 LEU B HD22   1  
ATOM   3149   H  HD23   . LEU B 2 19  ? 12.750  -0.870  6.554   1.00 0.00 ? 409 LEU B HD23   1  
ATOM   3150   N  N      . ASN B 2 20  ? 15.513  1.133   9.725   1.00 0.00 ? 410 ASN B N      1  
ATOM   3151   C  CA     . ASN B 2 20  ? 15.282  0.757   11.120  1.00 0.00 ? 410 ASN B CA     1  
ATOM   3152   C  C      . ASN B 2 20  ? 15.418  1.958   12.051  1.00 0.00 ? 410 ASN B C      1  
ATOM   3153   O  O      . ASN B 2 20  ? 14.543  2.200   12.881  1.00 0.00 ? 410 ASN B O      1  
ATOM   3154   C  CB     . ASN B 2 20  ? 16.257  -0.346  11.544  1.00 0.00 ? 410 ASN B CB     1  
ATOM   3155   C  CG     . ASN B 2 20  ? 15.990  -0.865  12.943  1.00 0.00 ? 410 ASN B CG     1  
ATOM   3156   O  OD1    . ASN B 2 20  ? 14.852  -0.866  13.416  1.00 0.00 ? 410 ASN B OD1    1  
ATOM   3157   N  ND2    . ASN B 2 20  ? 17.041  -1.318  13.607  1.00 0.00 ? 410 ASN B ND2    1  
ATOM   3158   H  H      . ASN B 2 20  ? 16.224  0.674   9.220   1.00 0.00 ? 410 ASN B H      1  
ATOM   3159   H  HA     . ASN B 2 20  ? 14.274  0.377   11.194  1.00 0.00 ? 410 ASN B HA     1  
ATOM   3160   H  HB2    . ASN B 2 20  ? 16.173  -1.173  10.854  1.00 0.00 ? 410 ASN B HB2    1  
ATOM   3161   H  HB3    . ASN B 2 20  ? 17.265  0.041   11.508  1.00 0.00 ? 410 ASN B HB3    1  
ATOM   3162   H  HD21   . ASN B 2 20  ? 17.920  -1.290  13.161  1.00 0.00 ? 410 ASN B HD21   1  
ATOM   3163   H  HD22   . ASN B 2 20  ? 16.906  -1.669  14.512  1.00 0.00 ? 410 ASN B HD22   1  
ATOM   3164   N  N      . SER B 2 21  ? 16.499  2.714   11.903  1.00 0.00 ? 411 SER B N      1  
ATOM   3165   C  CA     . SER B 2 21  ? 16.715  3.896   12.731  1.00 0.00 ? 411 SER B CA     1  
ATOM   3166   C  C      . SER B 2 21  ? 15.576  4.891   12.538  1.00 0.00 ? 411 SER B C      1  
ATOM   3167   O  O      . SER B 2 21  ? 14.945  5.308   13.504  1.00 0.00 ? 411 SER B O      1  
ATOM   3168   C  CB     . SER B 2 21  ? 18.054  4.558   12.395  1.00 0.00 ? 411 SER B CB     1  
ATOM   3169   O  OG     . SER B 2 21  ? 18.350  5.623   13.292  1.00 0.00 ? 411 SER B OG     1  
ATOM   3170   H  H      . SER B 2 21  ? 17.170  2.470   11.226  1.00 0.00 ? 411 SER B H      1  
ATOM   3171   H  HA     . SER B 2 21  ? 16.728  3.577   13.763  1.00 0.00 ? 411 SER B HA     1  
ATOM   3172   H  HB2    . SER B 2 21  ? 18.842  3.824   12.456  1.00 0.00 ? 411 SER B HB2    1  
ATOM   3173   H  HB3    . SER B 2 21  ? 18.010  4.954   11.390  1.00 0.00 ? 411 SER B HB3    1  
ATOM   3174   H  HG     . SER B 2 21  ? 17.547  5.882   13.774  1.00 0.00 ? 411 SER B HG     1  
ATOM   3175   N  N      . LEU B 2 22  ? 15.302  5.242   11.283  1.00 0.00 ? 412 LEU B N      1  
ATOM   3176   C  CA     . LEU B 2 22  ? 14.210  6.159   10.961  1.00 0.00 ? 412 LEU B CA     1  
ATOM   3177   C  C      . LEU B 2 22  ? 12.881  5.648   11.518  1.00 0.00 ? 412 LEU B C      1  
ATOM   3178   O  O      . LEU B 2 22  ? 12.005  6.428   11.880  1.00 0.00 ? 412 LEU B O      1  
ATOM   3179   C  CB     . LEU B 2 22  ? 14.108  6.353   9.446   1.00 0.00 ? 412 LEU B CB     1  
ATOM   3180   C  CG     . LEU B 2 22  ? 15.131  7.313   8.827   1.00 0.00 ? 412 LEU B CG     1  
ATOM   3181   C  CD1    . LEU B 2 22  ? 15.184  7.133   7.319   1.00 0.00 ? 412 LEU B CD1    1  
ATOM   3182   C  CD2    . LEU B 2 22  ? 14.777  8.753   9.167   1.00 0.00 ? 412 LEU B CD2    1  
ATOM   3183   H  H      . LEU B 2 22  ? 15.847  4.875   10.553  1.00 0.00 ? 412 LEU B H      1  
ATOM   3184   H  HA     . LEU B 2 22  ? 14.435  7.112   11.420  1.00 0.00 ? 412 LEU B HA     1  
ATOM   3185   H  HB2    . LEU B 2 22  ? 14.223  5.387   8.974   1.00 0.00 ? 412 LEU B HB2    1  
ATOM   3186   H  HB3    . LEU B 2 22  ? 13.120  6.726   9.222   1.00 0.00 ? 412 LEU B HB3    1  
ATOM   3187   H  HG     . LEU B 2 22  ? 16.111  7.100   9.227   1.00 0.00 ? 412 LEU B HG     1  
ATOM   3188   H  HD11   . LEU B 2 22  ? 14.203  7.298   6.902   1.00 0.00 ? 412 LEU B HD11   1  
ATOM   3189   H  HD12   . LEU B 2 22  ? 15.511  6.131   7.087   1.00 0.00 ? 412 LEU B HD12   1  
ATOM   3190   H  HD13   . LEU B 2 22  ? 15.880  7.845   6.896   1.00 0.00 ? 412 LEU B HD13   1  
ATOM   3191   H  HD21   . LEU B 2 22  ? 13.816  8.999   8.736   1.00 0.00 ? 412 LEU B HD21   1  
ATOM   3192   H  HD22   . LEU B 2 22  ? 15.531  9.415   8.767   1.00 0.00 ? 412 LEU B HD22   1  
ATOM   3193   H  HD23   . LEU B 2 22  ? 14.731  8.868   10.241  1.00 0.00 ? 412 LEU B HD23   1  
ATOM   3194   N  N      . HIS B 2 23  ? 12.732  4.335   11.594  1.00 0.00 ? 413 HIS B N      1  
ATOM   3195   C  CA     . HIS B 2 23  ? 11.520  3.749   12.151  1.00 0.00 ? 413 HIS B CA     1  
ATOM   3196   C  C      . HIS B 2 23  ? 11.467  3.925   13.662  1.00 0.00 ? 413 HIS B C      1  
ATOM   3197   O  O      . HIS B 2 23  ? 10.458  4.367   14.204  1.00 0.00 ? 413 HIS B O      1  
ATOM   3198   C  CB     . HIS B 2 23  ? 11.419  2.265   11.797  1.00 0.00 ? 413 HIS B CB     1  
ATOM   3199   C  CG     . HIS B 2 23  ? 11.005  2.017   10.381  1.00 0.00 ? 413 HIS B CG     1  
ATOM   3200   N  ND1    . HIS B 2 23  ? 10.635  0.776   9.913   1.00 0.00 ? 413 HIS B ND1    1  
ATOM   3201   C  CD2    . HIS B 2 23  ? 10.888  2.862   9.330   1.00 0.00 ? 413 HIS B CD2    1  
ATOM   3202   C  CE1    . HIS B 2 23  ? 10.304  0.871   8.638   1.00 0.00 ? 413 HIS B CE1    1  
ATOM   3203   N  NE2    . HIS B 2 23  ? 10.449  2.125   8.264   1.00 0.00 ? 413 HIS B NE2    1  
ATOM   3204   H  H      . HIS B 2 23  ? 13.451  3.748   11.269  1.00 0.00 ? 413 HIS B H      1  
ATOM   3205   H  HA     . HIS B 2 23  ? 10.678  4.268   11.715  1.00 0.00 ? 413 HIS B HA     1  
ATOM   3206   H  HB2    . HIS B 2 23  ? 12.381  1.800   11.946  1.00 0.00 ? 413 HIS B HB2    1  
ATOM   3207   H  HB3    . HIS B 2 23  ? 10.692  1.795   12.444  1.00 0.00 ? 413 HIS B HB3    1  
ATOM   3208   H  HD1    . HIS B 2 23  ? 10.648  -0.064  10.434  1.00 0.00 ? 413 HIS B HD1    1  
ATOM   3209   H  HD2    . HIS B 2 23  ? 11.130  3.916   9.325   1.00 0.00 ? 413 HIS B HD2    1  
ATOM   3210   H  HE1    . HIS B 2 23  ? 9.971   0.059   8.010   1.00 0.00 ? 413 HIS B HE1    1  
ATOM   3211   H  HE2    . HIS B 2 23  ? 10.285  2.474   7.351   1.00 0.00 ? 413 HIS B HE2    1  
ATOM   3212   N  N      . ARG B 2 24  ? 12.557  3.589   14.338  1.00 0.00 ? 414 ARG B N      1  
ATOM   3213   C  CA     . ARG B 2 24  ? 12.600  3.642   15.797  1.00 0.00 ? 414 ARG B CA     1  
ATOM   3214   C  C      . ARG B 2 24  ? 12.552  5.083   16.294  1.00 0.00 ? 414 ARG B C      1  
ATOM   3215   O  O      . ARG B 2 24  ? 11.831  5.397   17.240  1.00 0.00 ? 414 ARG B O      1  
ATOM   3216   C  CB     . ARG B 2 24  ? 13.854  2.939   16.324  1.00 0.00 ? 414 ARG B CB     1  
ATOM   3217   C  CG     . ARG B 2 24  ? 13.908  1.461   15.978  1.00 0.00 ? 414 ARG B CG     1  
ATOM   3218   C  CD     . ARG B 2 24  ? 15.119  0.786   16.595  1.00 0.00 ? 414 ARG B CD     1  
ATOM   3219   N  NE     . ARG B 2 24  ? 15.190  -0.634  16.245  1.00 0.00 ? 414 ARG B NE     1  
ATOM   3220   C  CZ     . ARG B 2 24  ? 15.980  -1.516  16.853  1.00 0.00 ? 414 ARG B CZ     1  
ATOM   3221   N  NH1    . ARG B 2 24  ? 16.762  -1.126  17.851  1.00 0.00 ? 414 ARG B NH1    1  
ATOM   3222   N  NH2    . ARG B 2 24  ? 15.989  -2.786  16.462  1.00 0.00 ? 414 ARG B NH2    1  
ATOM   3223   H  H      . ARG B 2 24  ? 13.359  3.302   13.844  1.00 0.00 ? 414 ARG B H      1  
ATOM   3224   H  HA     . ARG B 2 24  ? 11.728  3.123   16.166  1.00 0.00 ? 414 ARG B HA     1  
ATOM   3225   H  HB2    . ARG B 2 24  ? 14.728  3.419   15.902  1.00 0.00 ? 414 ARG B HB2    1  
ATOM   3226   H  HB3    . ARG B 2 24  ? 13.883  3.037   17.398  1.00 0.00 ? 414 ARG B HB3    1  
ATOM   3227   H  HG2    . ARG B 2 24  ? 13.015  0.981   16.348  1.00 0.00 ? 414 ARG B HG2    1  
ATOM   3228   H  HG3    . ARG B 2 24  ? 13.957  1.354   14.904  1.00 0.00 ? 414 ARG B HG3    1  
ATOM   3229   H  HD2    . ARG B 2 24  ? 16.012  1.281   16.241  1.00 0.00 ? 414 ARG B HD2    1  
ATOM   3230   H  HD3    . ARG B 2 24  ? 15.060  0.881   17.669  1.00 0.00 ? 414 ARG B HD3    1  
ATOM   3231   H  HE     . ARG B 2 24  ? 14.617  -0.941  15.505  1.00 0.00 ? 414 ARG B HE     1  
ATOM   3232   H  HH11   . ARG B 2 24  ? 16.756  -0.173  18.153  1.00 0.00 ? 414 ARG B HH11   1  
ATOM   3233   H  HH12   . ARG B 2 24  ? 17.368  -1.791  18.311  1.00 0.00 ? 414 ARG B HH12   1  
ATOM   3234   H  HH21   . ARG B 2 24  ? 15.396  -3.090  15.703  1.00 0.00 ? 414 ARG B HH21   1  
ATOM   3235   H  HH22   . ARG B 2 24  ? 16.585  -3.457  16.921  1.00 0.00 ? 414 ARG B HH22   1  
ATOM   3236   N  N      . ASP B 2 25  ? 13.308  5.952   15.638  1.00 0.00 ? 415 ASP B N      1  
ATOM   3237   C  CA     . ASP B 2 25  ? 13.361  7.366   15.999  1.00 0.00 ? 415 ASP B CA     1  
ATOM   3238   C  C      . ASP B 2 25  ? 11.992  8.029   15.864  1.00 0.00 ? 415 ASP B C      1  
ATOM   3239   O  O      . ASP B 2 25  ? 11.558  8.766   16.751  1.00 0.00 ? 415 ASP B O      1  
ATOM   3240   C  CB     . ASP B 2 25  ? 14.378  8.111   15.125  1.00 0.00 ? 415 ASP B CB     1  
ATOM   3241   C  CG     . ASP B 2 25  ? 15.817  7.894   15.560  1.00 0.00 ? 415 ASP B CG     1  
ATOM   3242   O  OD1    . ASP B 2 25  ? 16.437  6.897   15.131  1.00 0.00 ? 415 ASP B OD1    1  
ATOM   3243   O  OD2    . ASP B 2 25  ? 16.337  8.730   16.325  1.00 0.00 ? 415 ASP B OD2    1  
ATOM   3244   H  H      . ASP B 2 25  ? 13.859  5.632   14.885  1.00 0.00 ? 415 ASP B H      1  
ATOM   3245   H  HA     . ASP B 2 25  ? 13.675  7.430   17.030  1.00 0.00 ? 415 ASP B HA     1  
ATOM   3246   H  HB2    . ASP B 2 25  ? 14.280  7.773   14.105  1.00 0.00 ? 415 ASP B HB2    1  
ATOM   3247   H  HB3    . ASP B 2 25  ? 14.165  9.170   15.168  1.00 0.00 ? 415 ASP B HB3    1  
ATOM   3248   N  N      . LEU B 2 26  ? 11.304  7.749   14.764  1.00 0.00 ? 416 LEU B N      1  
ATOM   3249   C  CA     . LEU B 2 26  ? 10.036  8.411   14.472  1.00 0.00 ? 416 LEU B CA     1  
ATOM   3250   C  C      . LEU B 2 26  ? 8.884   7.874   15.321  1.00 0.00 ? 416 LEU B C      1  
ATOM   3251   O  O      . LEU B 2 26  ? 7.925   8.599   15.583  1.00 0.00 ? 416 LEU B O      1  
ATOM   3252   C  CB     . LEU B 2 26  ? 9.686   8.308   12.985  1.00 0.00 ? 416 LEU B CB     1  
ATOM   3253   C  CG     . LEU B 2 26  ? 10.235  9.435   12.097  1.00 0.00 ? 416 LEU B CG     1  
ATOM   3254   C  CD1    . LEU B 2 26  ? 11.753  9.411   12.036  1.00 0.00 ? 416 LEU B CD1    1  
ATOM   3255   C  CD2    . LEU B 2 26  ? 9.642   9.349   10.703  1.00 0.00 ? 416 LEU B CD2    1  
ATOM   3256   H  H      . LEU B 2 26  ? 11.657  7.086   14.132  1.00 0.00 ? 416 LEU B H      1  
ATOM   3257   H  HA     . LEU B 2 26  ? 10.167  9.459   14.717  1.00 0.00 ? 416 LEU B HA     1  
ATOM   3258   H  HB2    . LEU B 2 26  ? 10.066  7.368   12.613  1.00 0.00 ? 416 LEU B HB2    1  
ATOM   3259   H  HB3    . LEU B 2 26  ? 8.611   8.302   12.891  1.00 0.00 ? 416 LEU B HB3    1  
ATOM   3260   H  HG     . LEU B 2 26  ? 9.941   10.384  12.521  1.00 0.00 ? 416 LEU B HG     1  
ATOM   3261   H  HD11   . LEU B 2 26  ? 12.159  9.649   13.008  1.00 0.00 ? 416 LEU B HD11   1  
ATOM   3262   H  HD12   . LEU B 2 26  ? 12.093  10.136  11.313  1.00 0.00 ? 416 LEU B HD12   1  
ATOM   3263   H  HD13   . LEU B 2 26  ? 12.085  8.426   11.739  1.00 0.00 ? 416 LEU B HD13   1  
ATOM   3264   H  HD21   . LEU B 2 26  ? 9.903   8.400   10.256  1.00 0.00 ? 416 LEU B HD21   1  
ATOM   3265   H  HD22   . LEU B 2 26  ? 10.033  10.152  10.094  1.00 0.00 ? 416 LEU B HD22   1  
ATOM   3266   H  HD23   . LEU B 2 26  ? 8.568   9.434   10.763  1.00 0.00 ? 416 LEU B HD23   1  
ATOM   3267   N  N      . GLN B 2 27  ? 8.963   6.613   15.753  1.00 0.00 ? 417 GLN B N      1  
ATOM   3268   C  CA     . GLN B 2 27  ? 7.922   6.053   16.624  1.00 0.00 ? 417 GLN B CA     1  
ATOM   3269   C  C      . GLN B 2 27  ? 7.889   6.792   17.961  1.00 0.00 ? 417 GLN B C      1  
ATOM   3270   O  O      . GLN B 2 27  ? 6.878   6.785   18.662  1.00 0.00 ? 417 GLN B O      1  
ATOM   3271   C  CB     . GLN B 2 27  ? 8.135   4.559   16.890  1.00 0.00 ? 417 GLN B CB     1  
ATOM   3272   C  CG     . GLN B 2 27  ? 7.892   3.639   15.703  1.00 0.00 ? 417 GLN B CG     1  
ATOM   3273   C  CD     . GLN B 2 27  ? 8.394   2.230   15.964  1.00 0.00 ? 417 GLN B CD     1  
ATOM   3274   O  OE1    . GLN B 2 27  ? 7.657   1.373   16.444  1.00 0.00 ? 417 GLN B OE1    1  
ATOM   3275   N  NE2    . GLN B 2 27  ? 9.656   1.986   15.655  1.00 0.00 ? 417 GLN B NE2    1  
ATOM   3276   H  H      . GLN B 2 27  ? 9.726   6.057   15.487  1.00 0.00 ? 417 GLN B H      1  
ATOM   3277   H  HA     . GLN B 2 27  ? 6.973   6.191   16.132  1.00 0.00 ? 417 GLN B HA     1  
ATOM   3278   H  HB2    . GLN B 2 27  ? 9.146   4.409   17.227  1.00 0.00 ? 417 GLN B HB2    1  
ATOM   3279   H  HB3    . GLN B 2 27  ? 7.460   4.266   17.675  1.00 0.00 ? 417 GLN B HB3    1  
ATOM   3280   H  HG2    . GLN B 2 27  ? 6.826   3.590   15.507  1.00 0.00 ? 417 GLN B HG2    1  
ATOM   3281   H  HG3    . GLN B 2 27  ? 8.403   4.036   14.838  1.00 0.00 ? 417 GLN B HG3    1  
ATOM   3282   H  HE21   . GLN B 2 27  ? 10.187  2.717   15.275  1.00 0.00 ? 417 GLN B HE21   1  
ATOM   3283   H  HE22   . GLN B 2 27  ? 10.017  1.087   15.841  1.00 0.00 ? 417 GLN B HE22   1  
ATOM   3284   N  N      . GLY B 2 28  ? 9.001   7.436   18.303  1.00 0.00 ? 418 GLY B N      1  
ATOM   3285   C  CA     . GLY B 2 28  ? 9.080   8.178   19.544  1.00 0.00 ? 418 GLY B CA     1  
ATOM   3286   C  C      . GLY B 2 28  ? 8.356   9.509   19.473  1.00 0.00 ? 418 GLY B C      1  
ATOM   3287   O  O      . GLY B 2 28  ? 8.298   10.244  20.456  1.00 0.00 ? 418 GLY B O      1  
ATOM   3288   H  H      . GLY B 2 28  ? 9.778   7.404   17.704  1.00 0.00 ? 418 GLY B H      1  
ATOM   3289   H  HA2    . GLY B 2 28  ? 8.643   7.585   20.333  1.00 0.00 ? 418 GLY B HA2    1  
ATOM   3290   H  HA3    . GLY B 2 28  ? 10.120  8.359   19.778  1.00 0.00 ? 418 GLY B HA3    1  
ATOM   3291   N  N      . GLY B 2 29  ? 7.810   9.822   18.307  1.00 0.00 ? 419 GLY B N      1  
ATOM   3292   C  CA     . GLY B 2 29  ? 7.057   11.048  18.146  1.00 0.00 ? 419 GLY B CA     1  
ATOM   3293   C  C      . GLY B 2 29  ? 7.837   12.116  17.416  1.00 0.00 ? 419 GLY B C      1  
ATOM   3294   O  O      . GLY B 2 29  ? 7.291   13.165  17.087  1.00 0.00 ? 419 GLY B O      1  
ATOM   3295   H  H      . GLY B 2 29  ? 7.913   9.211   17.545  1.00 0.00 ? 419 GLY B H      1  
ATOM   3296   H  HA2    . GLY B 2 29  ? 6.159   10.832  17.588  1.00 0.00 ? 419 GLY B HA2    1  
ATOM   3297   H  HA3    . GLY B 2 29  ? 6.782   11.419  19.121  1.00 0.00 ? 419 GLY B HA3    1  
ATOM   3298   N  N      . ILE B 2 30  ? 9.111   11.860  17.161  1.00 0.00 ? 420 ILE B N      1  
ATOM   3299   C  CA     . ILE B 2 30  ? 9.933   12.815  16.438  1.00 0.00 ? 420 ILE B CA     1  
ATOM   3300   C  C      . ILE B 2 30  ? 9.926   12.486  14.961  1.00 0.00 ? 420 ILE B C      1  
ATOM   3301   O  O      . ILE B 2 30  ? 10.430  11.444  14.551  1.00 0.00 ? 420 ILE B O      1  
ATOM   3302   C  CB     . ILE B 2 30  ? 11.397  12.815  16.921  1.00 0.00 ? 420 ILE B CB     1  
ATOM   3303   C  CG1    . ILE B 2 30  ? 11.461  12.982  18.442  1.00 0.00 ? 420 ILE B CG1    1  
ATOM   3304   C  CG2    . ILE B 2 30  ? 12.180  13.925  16.223  1.00 0.00 ? 420 ILE B CG2    1  
ATOM   3305   C  CD1    . ILE B 2 30  ? 12.863  12.885  19.006  1.00 0.00 ? 420 ILE B CD1    1  
ATOM   3306   H  H      . ILE B 2 30  ? 9.500   11.011  17.452  1.00 0.00 ? 420 ILE B H      1  
ATOM   3307   H  HA     . ILE B 2 30  ? 9.521   13.801  16.587  1.00 0.00 ? 420 ILE B HA     1  
ATOM   3308   H  HB     . ILE B 2 30  ? 11.840  11.869  16.650  1.00 0.00 ? 420 ILE B HB     1  
ATOM   3309   H  HG12   . ILE B 2 30  ? 11.061  13.947  18.706  1.00 0.00 ? 420 ILE B HG12   1  
ATOM   3310   H  HG13   . ILE B 2 30  ? 10.863  12.210  18.904  1.00 0.00 ? 420 ILE B HG13   1  
ATOM   3311   H  HG21   . ILE B 2 30  ? 12.114  13.795  15.150  1.00 0.00 ? 420 ILE B HG21   1  
ATOM   3312   H  HG22   . ILE B 2 30  ? 13.216  13.880  16.526  1.00 0.00 ? 420 ILE B HG22   1  
ATOM   3313   H  HG23   . ILE B 2 30  ? 11.769  14.887  16.492  1.00 0.00 ? 420 ILE B HG23   1  
ATOM   3314   H  HD11   . ILE B 2 30  ? 12.834  13.039  20.074  1.00 0.00 ? 420 ILE B HD11   1  
ATOM   3315   H  HD12   . ILE B 2 30  ? 13.486  13.641  18.551  1.00 0.00 ? 420 ILE B HD12   1  
ATOM   3316   H  HD13   . ILE B 2 30  ? 13.271  11.908  18.795  1.00 0.00 ? 420 ILE B HD13   1  
ATOM   3317   N  N      . LYS B 2 31  ? 9.377   13.373  14.159  1.00 0.00 ? 421 LYS B N      1  
ATOM   3318   C  CA     . LYS B 2 31  ? 9.385   13.174  12.730  1.00 0.00 ? 421 LYS B CA     1  
ATOM   3319   C  C      . LYS B 2 31  ? 9.496   14.515  12.025  1.00 0.00 ? 421 LYS B C      1  
ATOM   3320   O  O      . LYS B 2 31  ? 9.125   15.552  12.570  1.00 0.00 ? 421 LYS B O      1  
ATOM   3321   C  CB     . LYS B 2 31  ? 8.144   12.383  12.275  1.00 0.00 ? 421 LYS B CB     1  
ATOM   3322   C  CG     . LYS B 2 31  ? 6.850   13.177  12.207  1.00 0.00 ? 421 LYS B CG     1  
ATOM   3323   C  CD     . LYS B 2 31  ? 6.675   13.824  10.846  1.00 0.00 ? 421 LYS B CD     1  
ATOM   3324   C  CE     . LYS B 2 31  ? 5.315   14.485  10.714  1.00 0.00 ? 421 LYS B CE     1  
ATOM   3325   N  NZ     . LYS B 2 31  ? 5.147   15.138  9.393   1.00 0.00 ? 421 LYS B NZ     1  
ATOM   3326   H  H      . LYS B 2 31  ? 8.965   14.187  14.537  1.00 0.00 ? 421 LYS B H      1  
ATOM   3327   H  HA     . LYS B 2 31  ? 10.267  12.595  12.493  1.00 0.00 ? 421 LYS B HA     1  
ATOM   3328   H  HB2    . LYS B 2 31  ? 8.336   11.986  11.291  1.00 0.00 ? 421 LYS B HB2    1  
ATOM   3329   H  HB3    . LYS B 2 31  ? 7.996   11.558  12.956  1.00 0.00 ? 421 LYS B HB3    1  
ATOM   3330   H  HG2    . LYS B 2 31  ? 6.019   12.510  12.387  1.00 0.00 ? 421 LYS B HG2    1  
ATOM   3331   H  HG3    . LYS B 2 31  ? 6.870   13.947  12.963  1.00 0.00 ? 421 LYS B HG3    1  
ATOM   3332   H  HD2    . LYS B 2 31  ? 7.447   14.570  10.710  1.00 0.00 ? 421 LYS B HD2    1  
ATOM   3333   H  HD3    . LYS B 2 31  ? 6.774   13.064  10.083  1.00 0.00 ? 421 LYS B HD3    1  
ATOM   3334   H  HE2    . LYS B 2 31  ? 4.550   13.731  10.835  1.00 0.00 ? 421 LYS B HE2    1  
ATOM   3335   H  HE3    . LYS B 2 31  ? 5.213   15.229  11.491  1.00 0.00 ? 421 LYS B HE3    1  
ATOM   3336   H  HZ1    . LYS B 2 31  ? 5.852   15.893  9.275   1.00 0.00 ? 421 LYS B HZ1    1  
ATOM   3337   H  HZ2    . LYS B 2 31  ? 4.194   15.554  9.316   1.00 0.00 ? 421 LYS B HZ2    1  
ATOM   3338   H  HZ3    . LYS B 2 31  ? 5.275   14.435  8.627   1.00 0.00 ? 421 LYS B HZ3    1  
ATOM   3339   N  N      . ASP B 2 32  ? 10.027  14.478  10.823  1.00 0.00 ? 422 ASP B N      1  
ATOM   3340   C  CA     . ASP B 2 32  ? 10.258  15.673  10.036  1.00 0.00 ? 422 ASP B CA     1  
ATOM   3341   C  C      . ASP B 2 32  ? 10.089  15.317  8.571   1.00 0.00 ? 422 ASP B C      1  
ATOM   3342   O  O      . ASP B 2 32  ? 10.200  14.144  8.211   1.00 0.00 ? 422 ASP B O      1  
ATOM   3343   C  CB     . ASP B 2 32  ? 11.667  16.213  10.304  1.00 0.00 ? 422 ASP B CB     1  
ATOM   3344   C  CG     . ASP B 2 32  ? 11.970  17.473  9.519   1.00 0.00 ? 422 ASP B CG     1  
ATOM   3345   O  OD1    . ASP B 2 32  ? 11.669  18.571  10.015  1.00 0.00 ? 422 ASP B OD1    1  
ATOM   3346   O  OD2    . ASP B 2 32  ? 12.510  17.359  8.394   1.00 0.00 ? 422 ASP B OD2    1  
ATOM   3347   H  H      . ASP B 2 32  ? 10.258  13.609  10.432  1.00 0.00 ? 422 ASP B H      1  
ATOM   3348   H  HA     . ASP B 2 32  ? 9.525   16.417  10.314  1.00 0.00 ? 422 ASP B HA     1  
ATOM   3349   H  HB2    . ASP B 2 32  ? 11.770  16.429  11.362  1.00 0.00 ? 422 ASP B HB2    1  
ATOM   3350   H  HB3    . ASP B 2 32  ? 12.390  15.459  10.027  1.00 0.00 ? 422 ASP B HB3    1  
ATOM   3351   N  N      . LEU B 2 33  ? 9.828   16.302  7.731   1.00 0.00 ? 423 LEU B N      1  
ATOM   3352   C  CA     . LEU B 2 33  ? 9.579   16.039  6.323   1.00 0.00 ? 423 LEU B CA     1  
ATOM   3353   C  C      . LEU B 2 33  ? 10.809  15.453  5.642   1.00 0.00 ? 423 LEU B C      1  
ATOM   3354   O  O      . LEU B 2 33  ? 10.694  14.721  4.659   1.00 0.00 ? 423 LEU B O      1  
ATOM   3355   C  CB     . LEU B 2 33  ? 9.117   17.306  5.588   1.00 0.00 ? 423 LEU B CB     1  
ATOM   3356   C  CG     . LEU B 2 33  ? 7.673   17.754  5.859   1.00 0.00 ? 423 LEU B CG     1  
ATOM   3357   C  CD1    . LEU B 2 33  ? 7.505   18.250  7.287   1.00 0.00 ? 423 LEU B CD1    1  
ATOM   3358   C  CD2    . LEU B 2 33  ? 7.256   18.836  4.871   1.00 0.00 ? 423 LEU B CD2    1  
ATOM   3359   H  H      . LEU B 2 33  ? 9.800   17.225  8.062   1.00 0.00 ? 423 LEU B H      1  
ATOM   3360   H  HA     . LEU B 2 33  ? 8.796   15.302  6.278   1.00 0.00 ? 423 LEU B HA     1  
ATOM   3361   H  HB2    . LEU B 2 33  ? 9.778   18.113  5.868   1.00 0.00 ? 423 LEU B HB2    1  
ATOM   3362   H  HB3    . LEU B 2 33  ? 9.222   17.133  4.527   1.00 0.00 ? 423 LEU B HB3    1  
ATOM   3363   H  HG     . LEU B 2 33  ? 7.013   16.910  5.722   1.00 0.00 ? 423 LEU B HG     1  
ATOM   3364   H  HD11   . LEU B 2 33  ? 6.492   18.594  7.432   1.00 0.00 ? 423 LEU B HD11   1  
ATOM   3365   H  HD12   . LEU B 2 33  ? 8.191   19.064  7.468   1.00 0.00 ? 423 LEU B HD12   1  
ATOM   3366   H  HD13   . LEU B 2 33  ? 7.714   17.444  7.975   1.00 0.00 ? 423 LEU B HD13   1  
ATOM   3367   H  HD21   . LEU B 2 33  ? 7.343   18.458  3.864   1.00 0.00 ? 423 LEU B HD21   1  
ATOM   3368   H  HD22   . LEU B 2 33  ? 7.897   19.697  4.988   1.00 0.00 ? 423 LEU B HD22   1  
ATOM   3369   H  HD23   . LEU B 2 33  ? 6.231   19.122  5.062   1.00 0.00 ? 423 LEU B HD23   1  
ATOM   3370   N  N      . SER B 2 34  ? 11.985  15.764  6.170   1.00 0.00 ? 424 SER B N      1  
ATOM   3371   C  CA     . SER B 2 34  ? 13.217  15.191  5.656   1.00 0.00 ? 424 SER B CA     1  
ATOM   3372   C  C      . SER B 2 34  ? 13.221  13.685  5.911   1.00 0.00 ? 424 SER B C      1  
ATOM   3373   O  O      . SER B 2 34  ? 13.687  12.895  5.090   1.00 0.00 ? 424 SER B O      1  
ATOM   3374   C  CB     . SER B 2 34  ? 14.419  15.842  6.342   1.00 0.00 ? 424 SER B CB     1  
ATOM   3375   O  OG     . SER B 2 34  ? 14.269  17.252  6.404   1.00 0.00 ? 424 SER B OG     1  
ATOM   3376   H  H      . SER B 2 34  ? 12.026  16.395  6.929   1.00 0.00 ? 424 SER B H      1  
ATOM   3377   H  HA     . SER B 2 34  ? 13.261  15.375  4.593   1.00 0.00 ? 424 SER B HA     1  
ATOM   3378   H  HB2    . SER B 2 34  ? 14.506  15.458  7.347   1.00 0.00 ? 424 SER B HB2    1  
ATOM   3379   H  HB3    . SER B 2 34  ? 15.318  15.610  5.789   1.00 0.00 ? 424 SER B HB3    1  
ATOM   3380   H  HG     . SER B 2 34  ? 13.686  17.479  7.151   1.00 0.00 ? 424 SER B HG     1  
ATOM   3381   N  N      . LYS B 2 35  ? 12.663  13.302  7.055   1.00 0.00 ? 425 LYS B N      1  
ATOM   3382   C  CA     . LYS B 2 35  ? 12.637  11.911  7.484   1.00 0.00 ? 425 LYS B CA     1  
ATOM   3383   C  C      . LYS B 2 35  ? 11.623  11.120  6.670   1.00 0.00 ? 425 LYS B C      1  
ATOM   3384   O  O      . LYS B 2 35  ? 11.912  10.024  6.205   1.00 0.00 ? 425 LYS B O      1  
ATOM   3385   C  CB     . LYS B 2 35  ? 12.288  11.816  8.973   1.00 0.00 ? 425 LYS B CB     1  
ATOM   3386   C  CG     . LYS B 2 35  ? 12.851  12.958  9.795   1.00 0.00 ? 425 LYS B CG     1  
ATOM   3387   C  CD     . LYS B 2 35  ? 12.694  12.709  11.287  1.00 0.00 ? 425 LYS B CD     1  
ATOM   3388   C  CE     . LYS B 2 35  ? 13.385  13.781  12.115  1.00 0.00 ? 425 LYS B CE     1  
ATOM   3389   N  NZ     . LYS B 2 35  ? 14.865  13.642  12.098  1.00 0.00 ? 425 LYS B NZ     1  
ATOM   3390   H  H      . LYS B 2 35  ? 12.234  13.981  7.621   1.00 0.00 ? 425 LYS B H      1  
ATOM   3391   H  HA     . LYS B 2 35  ? 13.619  11.492  7.324   1.00 0.00 ? 425 LYS B HA     1  
ATOM   3392   H  HB2    . LYS B 2 35  ? 11.214  11.819  9.080   1.00 0.00 ? 425 LYS B HB2    1  
ATOM   3393   H  HB3    . LYS B 2 35  ? 12.680  10.889  9.366   1.00 0.00 ? 425 LYS B HB3    1  
ATOM   3394   H  HG2    . LYS B 2 35  ? 13.892  13.080  9.565   1.00 0.00 ? 425 LYS B HG2    1  
ATOM   3395   H  HG3    . LYS B 2 35  ? 12.310  13.863  9.530   1.00 0.00 ? 425 LYS B HG3    1  
ATOM   3396   H  HD2    . LYS B 2 35  ? 11.642  12.706  11.531  1.00 0.00 ? 425 LYS B HD2    1  
ATOM   3397   H  HD3    . LYS B 2 35  ? 13.123  11.748  11.528  1.00 0.00 ? 425 LYS B HD3    1  
ATOM   3398   H  HE2    . LYS B 2 35  ? 13.122  14.750  11.715  1.00 0.00 ? 425 LYS B HE2    1  
ATOM   3399   H  HE3    . LYS B 2 35  ? 13.037  13.709  13.134  1.00 0.00 ? 425 LYS B HE3    1  
ATOM   3400   H  HZ1    . LYS B 2 35  ? 15.216  13.575  11.119  1.00 0.00 ? 425 LYS B HZ1    1  
ATOM   3401   H  HZ2    . LYS B 2 35  ? 15.152  12.783  12.618  1.00 0.00 ? 425 LYS B HZ2    1  
ATOM   3402   H  HZ3    . LYS B 2 35  ? 15.306  14.471  12.557  1.00 0.00 ? 425 LYS B HZ3    1  
ATOM   3403   N  N      . GLU B 2 36  ? 10.440  11.703  6.500   1.00 0.00 ? 426 GLU B N      1  
ATOM   3404   C  CA     . GLU B 2 36  ? 9.335   11.049  5.799   1.00 0.00 ? 426 GLU B CA     1  
ATOM   3405   C  C      . GLU B 2 36  ? 9.719   10.721  4.354   1.00 0.00 ? 426 GLU B C      1  
ATOM   3406   O  O      . GLU B 2 36  ? 9.490   9.607   3.873   1.00 0.00 ? 426 GLU B O      1  
ATOM   3407   C  CB     . GLU B 2 36  ? 8.096   11.956  5.834   1.00 0.00 ? 426 GLU B CB     1  
ATOM   3408   C  CG     . GLU B 2 36  ? 7.667   12.322  7.250   1.00 0.00 ? 426 GLU B CG     1  
ATOM   3409   C  CD     . GLU B 2 36  ? 6.606   13.405  7.300   1.00 0.00 ? 426 GLU B CD     1  
ATOM   3410   O  OE1    . GLU B 2 36  ? 6.941   14.582  7.072   1.00 0.00 ? 426 GLU B OE1    1  
ATOM   3411   O  OE2    . GLU B 2 36  ? 5.437   13.092  7.601   1.00 0.00 ? 426 GLU B OE2    1  
ATOM   3412   H  H      . GLU B 2 36  ? 10.300  12.606  6.861   1.00 0.00 ? 426 GLU B H      1  
ATOM   3413   H  HA     . GLU B 2 36  ? 9.111   10.129  6.319   1.00 0.00 ? 426 GLU B HA     1  
ATOM   3414   H  HB2    . GLU B 2 36  ? 8.311   12.867  5.293   1.00 0.00 ? 426 GLU B HB2    1  
ATOM   3415   H  HB3    . GLU B 2 36  ? 7.275   11.444  5.351   1.00 0.00 ? 426 GLU B HB3    1  
ATOM   3416   H  HG2    . GLU B 2 36  ? 7.274   11.439  7.730   1.00 0.00 ? 426 GLU B HG2    1  
ATOM   3417   H  HG3    . GLU B 2 36  ? 8.536   12.665  7.795   1.00 0.00 ? 426 GLU B HG3    1  
ATOM   3418   N  N      . GLU B 2 37  ? 10.331  11.686  3.680   1.00 0.00 ? 427 GLU B N      1  
ATOM   3419   C  CA     . GLU B 2 37  ? 10.748  11.504  2.294   1.00 0.00 ? 427 GLU B CA     1  
ATOM   3420   C  C      . GLU B 2 37  ? 11.880  10.487  2.207   1.00 0.00 ? 427 GLU B C      1  
ATOM   3421   O  O      . GLU B 2 37  ? 11.896  9.623   1.327   1.00 0.00 ? 427 GLU B O      1  
ATOM   3422   C  CB     . GLU B 2 37  ? 11.190  12.838  1.689   1.00 0.00 ? 427 GLU B CB     1  
ATOM   3423   C  CG     . GLU B 2 37  ? 10.054  13.833  1.487   1.00 0.00 ? 427 GLU B CG     1  
ATOM   3424   C  CD     . GLU B 2 37  ? 9.084   13.418  0.398   1.00 0.00 ? 427 GLU B CD     1  
ATOM   3425   O  OE1    . GLU B 2 37  ? 9.483   13.409  -0.784  1.00 0.00 ? 427 GLU B OE1    1  
ATOM   3426   O  OE2    . GLU B 2 37  ? 7.914   13.110  0.717   1.00 0.00 ? 427 GLU B OE2    1  
ATOM   3427   H  H      . GLU B 2 37  ? 10.516  12.537  4.132   1.00 0.00 ? 427 GLU B H      1  
ATOM   3428   H  HA     . GLU B 2 37  ? 9.901   11.129  1.739   1.00 0.00 ? 427 GLU B HA     1  
ATOM   3429   H  HB2    . GLU B 2 37  ? 11.921  13.291  2.342   1.00 0.00 ? 427 GLU B HB2    1  
ATOM   3430   H  HB3    . GLU B 2 37  ? 11.647  12.650  0.729   1.00 0.00 ? 427 GLU B HB3    1  
ATOM   3431   H  HG2    . GLU B 2 37  ? 9.508   13.924  2.414   1.00 0.00 ? 427 GLU B HG2    1  
ATOM   3432   H  HG3    . GLU B 2 37  ? 10.477  14.793  1.226   1.00 0.00 ? 427 GLU B HG3    1  
ATOM   3433   N  N      . ARG B 2 38  ? 12.818  10.586  3.144   1.00 0.00 ? 428 ARG B N      1  
ATOM   3434   C  CA     . ARG B 2 38  ? 13.946  9.669   3.203   1.00 0.00 ? 428 ARG B CA     1  
ATOM   3435   C  C      . ARG B 2 38  ? 13.463  8.261   3.544   1.00 0.00 ? 428 ARG B C      1  
ATOM   3436   O  O      . ARG B 2 38  ? 14.028  7.279   3.072   1.00 0.00 ? 428 ARG B O      1  
ATOM   3437   C  CB     . ARG B 2 38  ? 14.971  10.155  4.236   1.00 0.00 ? 428 ARG B CB     1  
ATOM   3438   C  CG     . ARG B 2 38  ? 16.232  9.305   4.325   1.00 0.00 ? 428 ARG B CG     1  
ATOM   3439   C  CD     . ARG B 2 38  ? 17.020  9.308   3.022   1.00 0.00 ? 428 ARG B CD     1  
ATOM   3440   N  NE     . ARG B 2 38  ? 18.331  8.678   3.186   1.00 0.00 ? 428 ARG B NE     1  
ATOM   3441   C  CZ     . ARG B 2 38  ? 19.159  8.376   2.183   1.00 0.00 ? 428 ARG B CZ     1  
ATOM   3442   N  NH1    . ARG B 2 38  ? 18.830  8.650   0.926   1.00 0.00 ? 428 ARG B NH1    1  
ATOM   3443   N  NH2    . ARG B 2 38  ? 20.325  7.803   2.450   1.00 0.00 ? 428 ARG B NH2    1  
ATOM   3444   H  H      . ARG B 2 38  ? 12.742  11.296  3.818   1.00 0.00 ? 428 ARG B H      1  
ATOM   3445   H  HA     . ARG B 2 38  ? 14.410  9.652   2.226   1.00 0.00 ? 428 ARG B HA     1  
ATOM   3446   H  HB2    . ARG B 2 38  ? 15.265  11.164  3.984   1.00 0.00 ? 428 ARG B HB2    1  
ATOM   3447   H  HB3    . ARG B 2 38  ? 14.503  10.162  5.209   1.00 0.00 ? 428 ARG B HB3    1  
ATOM   3448   H  HG2    . ARG B 2 38  ? 16.862  9.696   5.111   1.00 0.00 ? 428 ARG B HG2    1  
ATOM   3449   H  HG3    . ARG B 2 38  ? 15.951  8.290   4.560   1.00 0.00 ? 428 ARG B HG3    1  
ATOM   3450   H  HD2    . ARG B 2 38  ? 16.459  8.765   2.275   1.00 0.00 ? 428 ARG B HD2    1  
ATOM   3451   H  HD3    . ARG B 2 38  ? 17.159  10.328  2.697   1.00 0.00 ? 428 ARG B HD3    1  
ATOM   3452   H  HE     . ARG B 2 38  ? 18.615  8.470   4.109   1.00 0.00 ? 428 ARG B HE     1  
ATOM   3453   H  HH11   . ARG B 2 38  ? 17.945  9.098   0.713   1.00 0.00 ? 428 ARG B HH11   1  
ATOM   3454   H  HH12   . ARG B 2 38  ? 19.453  8.404   0.171   1.00 0.00 ? 428 ARG B HH12   1  
ATOM   3455   H  HH21   . ARG B 2 38  ? 20.576  7.595   3.396   1.00 0.00 ? 428 ARG B HH21   1  
ATOM   3456   H  HH22   . ARG B 2 38  ? 20.973  7.589   1.705   1.00 0.00 ? 428 ARG B HH22   1  
ATOM   3457   N  N      . LEU B 2 39  ? 12.401  8.178   4.348   1.00 0.00 ? 429 LEU B N      1  
ATOM   3458   C  CA     . LEU B 2 39  ? 11.797  6.900   4.715   1.00 0.00 ? 429 LEU B CA     1  
ATOM   3459   C  C      . LEU B 2 39  ? 11.398  6.118   3.484   1.00 0.00 ? 429 LEU B C      1  
ATOM   3460   O  O      . LEU B 2 39  ? 11.770  4.957   3.325   1.00 0.00 ? 429 LEU B O      1  
ATOM   3461   C  CB     . LEU B 2 39  ? 10.566  7.112   5.596   1.00 0.00 ? 429 LEU B CB     1  
ATOM   3462   C  CG     . LEU B 2 39  ? 10.836  7.163   7.092   1.00 0.00 ? 429 LEU B CG     1  
ATOM   3463   C  CD1    . LEU B 2 39  ? 9.541   7.401   7.848   1.00 0.00 ? 429 LEU B CD1    1  
ATOM   3464   C  CD2    . LEU B 2 39  ? 11.493  5.869   7.539   1.00 0.00 ? 429 LEU B CD2    1  
ATOM   3465   H  H      . LEU B 2 39  ? 12.012  9.007   4.709   1.00 0.00 ? 429 LEU B H      1  
ATOM   3466   H  HA     . LEU B 2 39  ? 12.530  6.331   5.266   1.00 0.00 ? 429 LEU B HA     1  
ATOM   3467   H  HB2    . LEU B 2 39  ? 10.100  8.041   5.308   1.00 0.00 ? 429 LEU B HB2    1  
ATOM   3468   H  HB3    . LEU B 2 39  ? 9.872   6.306   5.408   1.00 0.00 ? 429 LEU B HB3    1  
ATOM   3469   H  HG     . LEU B 2 39  ? 11.510  7.979   7.310   1.00 0.00 ? 429 LEU B HG     1  
ATOM   3470   H  HD11   . LEU B 2 39  ? 8.850   6.596   7.643   1.00 0.00 ? 429 LEU B HD11   1  
ATOM   3471   H  HD12   . LEU B 2 39  ? 9.108   8.336   7.529   1.00 0.00 ? 429 LEU B HD12   1  
ATOM   3472   H  HD13   . LEU B 2 39  ? 9.743   7.441   8.909   1.00 0.00 ? 429 LEU B HD13   1  
ATOM   3473   H  HD21   . LEU B 2 39  ? 11.700  5.916   8.597   1.00 0.00 ? 429 LEU B HD21   1  
ATOM   3474   H  HD22   . LEU B 2 39  ? 12.417  5.731   6.994   1.00 0.00 ? 429 LEU B HD22   1  
ATOM   3475   H  HD23   . LEU B 2 39  ? 10.829  5.039   7.338   1.00 0.00 ? 429 LEU B HD23   1  
ATOM   3476   N  N      . TRP B 2 40  ? 10.634  6.759   2.619   1.00 0.00 ? 430 TRP B N      1  
ATOM   3477   C  CA     . TRP B 2 40  ? 10.245  6.143   1.365   1.00 0.00 ? 430 TRP B CA     1  
ATOM   3478   C  C      . TRP B 2 40  ? 11.468  5.867   0.501   1.00 0.00 ? 430 TRP B C      1  
ATOM   3479   O  O      . TRP B 2 40  ? 11.613  4.779   -0.049  1.00 0.00 ? 430 TRP B O      1  
ATOM   3480   C  CB     . TRP B 2 40  ? 9.283   7.046   0.604   1.00 0.00 ? 430 TRP B CB     1  
ATOM   3481   C  CG     . TRP B 2 40  ? 7.852   6.905   1.015   1.00 0.00 ? 430 TRP B CG     1  
ATOM   3482   C  CD1    . TRP B 2 40  ? 7.249   7.458   2.106   1.00 0.00 ? 430 TRP B CD1    1  
ATOM   3483   C  CD2    . TRP B 2 40  ? 6.834   6.170   0.323   1.00 0.00 ? 430 TRP B CD2    1  
ATOM   3484   N  NE1    . TRP B 2 40  ? 5.920   7.111   2.133   1.00 0.00 ? 430 TRP B NE1    1  
ATOM   3485   C  CE2    . TRP B 2 40  ? 5.643   6.322   1.051   1.00 0.00 ? 430 TRP B CE2    1  
ATOM   3486   C  CE3    . TRP B 2 40  ? 6.814   5.402   -0.845  1.00 0.00 ? 430 TRP B CE3    1  
ATOM   3487   C  CZ2    . TRP B 2 40  ? 4.449   5.731   0.656   1.00 0.00 ? 430 TRP B CZ2    1  
ATOM   3488   C  CZ3    . TRP B 2 40  ? 5.627   4.815   -1.237  1.00 0.00 ? 430 TRP B CZ3    1  
ATOM   3489   C  CH2    . TRP B 2 40  ? 4.456   4.986   -0.490  1.00 0.00 ? 430 TRP B CH2    1  
ATOM   3490   H  H      . TRP B 2 40  ? 10.322  7.670   2.831   1.00 0.00 ? 430 TRP B H      1  
ATOM   3491   H  HA     . TRP B 2 40  ? 9.754   5.211   1.590   1.00 0.00 ? 430 TRP B HA     1  
ATOM   3492   H  HB2    . TRP B 2 40  ? 9.571   8.074   0.759   1.00 0.00 ? 430 TRP B HB2    1  
ATOM   3493   H  HB3    . TRP B 2 40  ? 9.351   6.816   -0.450  1.00 0.00 ? 430 TRP B HB3    1  
ATOM   3494   H  HD1    . TRP B 2 40  ? 7.753   8.076   2.833   1.00 0.00 ? 430 TRP B HD1    1  
ATOM   3495   H  HE1    . TRP B 2 40  ? 5.270   7.386   2.821   1.00 0.00 ? 430 TRP B HE1    1  
ATOM   3496   H  HE3    . TRP B 2 40  ? 7.708   5.262   -1.435  1.00 0.00 ? 430 TRP B HE3    1  
ATOM   3497   H  HZ2    . TRP B 2 40  ? 3.539   5.851   1.221   1.00 0.00 ? 430 TRP B HZ2    1  
ATOM   3498   H  HZ3    . TRP B 2 40  ? 5.595   4.218   -2.137  1.00 0.00 ? 430 TRP B HZ3    1  
ATOM   3499   H  HH2    . TRP B 2 40  ? 3.550   4.510   -0.832  1.00 0.00 ? 430 TRP B HH2    1  
ATOM   3500   N  N      . GLU B 2 41  ? 12.349  6.854   0.411   1.00 0.00 ? 431 GLU B N      1  
ATOM   3501   C  CA     . GLU B 2 41  ? 13.511  6.780   -0.457  1.00 0.00 ? 431 GLU B CA     1  
ATOM   3502   C  C      . GLU B 2 41  ? 14.392  5.571   -0.125  1.00 0.00 ? 431 GLU B C      1  
ATOM   3503   O  O      . GLU B 2 41  ? 14.655  4.739   -0.995  1.00 0.00 ? 431 GLU B O      1  
ATOM   3504   C  CB     . GLU B 2 41  ? 14.303  8.081   -0.338  1.00 0.00 ? 431 GLU B CB     1  
ATOM   3505   C  CG     . GLU B 2 41  ? 15.566  8.112   -1.167  1.00 0.00 ? 431 GLU B CG     1  
ATOM   3506   C  CD     . GLU B 2 41  ? 16.192  9.487   -1.204  1.00 0.00 ? 431 GLU B CD     1  
ATOM   3507   O  OE1    . GLU B 2 41  ? 16.817  9.886   -0.197  1.00 0.00 ? 431 GLU B OE1    1  
ATOM   3508   O  OE2    . GLU B 2 41  ? 16.051  10.174  -2.233  1.00 0.00 ? 431 GLU B OE2    1  
ATOM   3509   H  H      . GLU B 2 41  ? 12.214  7.666   0.946   1.00 0.00 ? 431 GLU B H      1  
ATOM   3510   H  HA     . GLU B 2 41  ? 13.159  6.679   -1.473  1.00 0.00 ? 431 GLU B HA     1  
ATOM   3511   H  HB2    . GLU B 2 41  ? 13.673  8.901   -0.649  1.00 0.00 ? 431 GLU B HB2    1  
ATOM   3512   H  HB3    . GLU B 2 41  ? 14.576  8.225   0.697   1.00 0.00 ? 431 GLU B HB3    1  
ATOM   3513   H  HG2    . GLU B 2 41  ? 16.273  7.420   -0.738  1.00 0.00 ? 431 GLU B HG2    1  
ATOM   3514   H  HG3    . GLU B 2 41  ? 15.331  7.808   -2.176  1.00 0.00 ? 431 GLU B HG3    1  
ATOM   3515   N  N      . VAL B 2 42  ? 14.810  5.456   1.133   1.00 0.00 ? 432 VAL B N      1  
ATOM   3516   C  CA     . VAL B 2 42  ? 15.664  4.346   1.554   1.00 0.00 ? 432 VAL B CA     1  
ATOM   3517   C  C      . VAL B 2 42  ? 14.927  3.015   1.423   1.00 0.00 ? 432 VAL B C      1  
ATOM   3518   O  O      . VAL B 2 42  ? 15.523  1.994   1.095   1.00 0.00 ? 432 VAL B O      1  
ATOM   3519   C  CB     . VAL B 2 42  ? 16.202  4.535   2.991   1.00 0.00 ? 432 VAL B CB     1  
ATOM   3520   C  CG1    . VAL B 2 42  ? 15.075  4.608   4.003   1.00 0.00 ? 432 VAL B CG1    1  
ATOM   3521   C  CG2    . VAL B 2 42  ? 17.175  3.422   3.346   1.00 0.00 ? 432 VAL B CG2    1  
ATOM   3522   H  H      . VAL B 2 42  ? 14.540  6.132   1.797   1.00 0.00 ? 432 VAL B H      1  
ATOM   3523   H  HA     . VAL B 2 42  ? 16.509  4.323   0.887   1.00 0.00 ? 432 VAL B HA     1  
ATOM   3524   H  HB     . VAL B 2 42  ? 16.741  5.471   3.026   1.00 0.00 ? 432 VAL B HB     1  
ATOM   3525   H  HG11   . VAL B 2 42  ? 15.489  4.768   4.991   1.00 0.00 ? 432 VAL B HG11   1  
ATOM   3526   H  HG12   . VAL B 2 42  ? 14.518  3.683   3.987   1.00 0.00 ? 432 VAL B HG12   1  
ATOM   3527   H  HG13   . VAL B 2 42  ? 14.416  5.427   3.746   1.00 0.00 ? 432 VAL B HG13   1  
ATOM   3528   H  HG21   . VAL B 2 42  ? 17.551  3.579   4.345   1.00 0.00 ? 432 VAL B HG21   1  
ATOM   3529   H  HG22   . VAL B 2 42  ? 17.997  3.427   2.644   1.00 0.00 ? 432 VAL B HG22   1  
ATOM   3530   H  HG23   . VAL B 2 42  ? 16.665  2.472   3.298   1.00 0.00 ? 432 VAL B HG23   1  
ATOM   3531   N  N      . GLN B 2 43  ? 13.626  3.044   1.665   1.00 0.00 ? 433 GLN B N      1  
ATOM   3532   C  CA     . GLN B 2 43  ? 12.775  1.882   1.464   1.00 0.00 ? 433 GLN B CA     1  
ATOM   3533   C  C      . GLN B 2 43  ? 12.893  1.367   0.029   1.00 0.00 ? 433 GLN B C      1  
ATOM   3534   O  O      . GLN B 2 43  ? 13.080  0.172   -0.206  1.00 0.00 ? 433 GLN B O      1  
ATOM   3535   C  CB     . GLN B 2 43  ? 11.330  2.267   1.772   1.00 0.00 ? 433 GLN B CB     1  
ATOM   3536   C  CG     . GLN B 2 43  ? 10.289  1.323   1.191   1.00 0.00 ? 433 GLN B CG     1  
ATOM   3537   C  CD     . GLN B 2 43  ? 10.486  -0.115  1.623   1.00 0.00 ? 433 GLN B CD     1  
ATOM   3538   O  OE1    . GLN B 2 43  ? 10.952  -0.389  2.729   1.00 0.00 ? 433 GLN B OE1    1  
ATOM   3539   N  NE2    . GLN B 2 43  ? 10.171  -1.037  0.731   1.00 0.00 ? 433 GLN B NE2    1  
ATOM   3540   H  H      . GLN B 2 43  ? 13.223  3.875   1.998   1.00 0.00 ? 433 GLN B H      1  
ATOM   3541   H  HA     . GLN B 2 43  ? 13.091  1.108   2.146   1.00 0.00 ? 433 GLN B HA     1  
ATOM   3542   H  HB2    . GLN B 2 43  ? 11.199  2.295   2.844   1.00 0.00 ? 433 GLN B HB2    1  
ATOM   3543   H  HB3    . GLN B 2 43  ? 11.158  3.255   1.370   1.00 0.00 ? 433 GLN B HB3    1  
ATOM   3544   H  HG2    . GLN B 2 43  ? 9.312   1.644   1.510   1.00 0.00 ? 433 GLN B HG2    1  
ATOM   3545   H  HG3    . GLN B 2 43  ? 10.346  1.369   0.112   1.00 0.00 ? 433 GLN B HG3    1  
ATOM   3546   H  HE21   . GLN B 2 43  ? 9.836   -0.739  -0.144  1.00 0.00 ? 433 GLN B HE21   1  
ATOM   3547   H  HE22   . GLN B 2 43  ? 10.286  -1.974  0.978   1.00 0.00 ? 433 GLN B HE22   1  
ATOM   3548   N  N      . ARG B 2 44  ? 12.799  2.278   -0.927  1.00 0.00 ? 434 ARG B N      1  
ATOM   3549   C  CA     . ARG B 2 44  ? 12.885  1.917   -2.333  1.00 0.00 ? 434 ARG B CA     1  
ATOM   3550   C  C      . ARG B 2 44  ? 14.277  1.389   -2.666  1.00 0.00 ? 434 ARG B C      1  
ATOM   3551   O  O      . ARG B 2 44  ? 14.448  0.575   -3.570  1.00 0.00 ? 434 ARG B O      1  
ATOM   3552   C  CB     . ARG B 2 44  ? 12.554  3.119   -3.208  1.00 0.00 ? 434 ARG B CB     1  
ATOM   3553   C  CG     . ARG B 2 44  ? 11.165  3.680   -2.966  1.00 0.00 ? 434 ARG B CG     1  
ATOM   3554   C  CD     . ARG B 2 44  ? 11.176  5.199   -2.964  1.00 0.00 ? 434 ARG B CD     1  
ATOM   3555   N  NE     . ARG B 2 44  ? 9.831   5.762   -2.832  1.00 0.00 ? 434 ARG B NE     1  
ATOM   3556   C  CZ     . ARG B 2 44  ? 9.590   7.065   -2.696  1.00 0.00 ? 434 ARG B CZ     1  
ATOM   3557   N  NH1    . ARG B 2 44  ? 10.586  7.937   -2.750  1.00 0.00 ? 434 ARG B NH1    1  
ATOM   3558   N  NH2    . ARG B 2 44  ? 8.349   7.505   -2.522  1.00 0.00 ? 434 ARG B NH2    1  
ATOM   3559   H  H      . ARG B 2 44  ? 12.670  3.221   -0.678  1.00 0.00 ? 434 ARG B H      1  
ATOM   3560   H  HA     . ARG B 2 44  ? 12.162  1.135   -2.518  1.00 0.00 ? 434 ARG B HA     1  
ATOM   3561   H  HB2    . ARG B 2 44  ? 13.277  3.898   -3.026  1.00 0.00 ? 434 ARG B HB2    1  
ATOM   3562   H  HB3    . ARG B 2 44  ? 12.616  2.816   -4.240  1.00 0.00 ? 434 ARG B HB3    1  
ATOM   3563   H  HG2    . ARG B 2 44  ? 10.504  3.334   -3.747  1.00 0.00 ? 434 ARG B HG2    1  
ATOM   3564   H  HG3    . ARG B 2 44  ? 10.809  3.329   -2.007  1.00 0.00 ? 434 ARG B HG3    1  
ATOM   3565   H  HD2    . ARG B 2 44  ? 11.777  5.535   -2.123  1.00 0.00 ? 434 ARG B HD2    1  
ATOM   3566   H  HD3    . ARG B 2 44  ? 11.619  5.547   -3.884  1.00 0.00 ? 434 ARG B HD3    1  
ATOM   3567   H  HE     . ARG B 2 44  ? 9.069   5.123   -2.827  1.00 0.00 ? 434 ARG B HE     1  
ATOM   3568   H  HH11   . ARG B 2 44  ? 11.530  7.622   -2.902  1.00 0.00 ? 434 ARG B HH11   1  
ATOM   3569   H  HH12   . ARG B 2 44  ? 10.405  8.922   -2.636  1.00 0.00 ? 434 ARG B HH12   1  
ATOM   3570   H  HH21   . ARG B 2 44  ? 7.580   6.862   -2.491  1.00 0.00 ? 434 ARG B HH21   1  
ATOM   3571   H  HH22   . ARG B 2 44  ? 8.181   8.497   -2.403  1.00 0.00 ? 434 ARG B HH22   1  
ATOM   3572   N  N      . ILE B 2 45  ? 15.269  1.856   -1.923  1.00 0.00 ? 435 ILE B N      1  
ATOM   3573   C  CA     . ILE B 2 45  ? 16.632  1.379   -2.087  1.00 0.00 ? 435 ILE B CA     1  
ATOM   3574   C  C      . ILE B 2 45  ? 16.781  -0.007  -1.462  1.00 0.00 ? 435 ILE B C      1  
ATOM   3575   O  O      . ILE B 2 45  ? 17.444  -0.877  -2.016  1.00 0.00 ? 435 ILE B O      1  
ATOM   3576   C  CB     . ILE B 2 45  ? 17.637  2.361   -1.453  1.00 0.00 ? 435 ILE B CB     1  
ATOM   3577   C  CG1    . ILE B 2 45  ? 17.470  3.744   -2.077  1.00 0.00 ? 435 ILE B CG1    1  
ATOM   3578   C  CG2    . ILE B 2 45  ? 19.067  1.868   -1.640  1.00 0.00 ? 435 ILE B CG2    1  
ATOM   3579   C  CD1    . ILE B 2 45  ? 18.038  4.860   -1.232  1.00 0.00 ? 435 ILE B CD1    1  
ATOM   3580   H  H      . ILE B 2 45  ? 15.080  2.544   -1.249  1.00 0.00 ? 435 ILE B H      1  
ATOM   3581   H  HA     . ILE B 2 45  ? 16.838  1.314   -3.145  1.00 0.00 ? 435 ILE B HA     1  
ATOM   3582   H  HB     . ILE B 2 45  ? 17.435  2.422   -0.395  1.00 0.00 ? 435 ILE B HB     1  
ATOM   3583   H  HG12   . ILE B 2 45  ? 17.971  3.764   -3.033  1.00 0.00 ? 435 ILE B HG12   1  
ATOM   3584   H  HG13   . ILE B 2 45  ? 16.418  3.942   -2.224  1.00 0.00 ? 435 ILE B HG13   1  
ATOM   3585   H  HG21   . ILE B 2 45  ? 19.184  0.912   -1.154  1.00 0.00 ? 435 ILE B HG21   1  
ATOM   3586   H  HG22   . ILE B 2 45  ? 19.752  2.580   -1.202  1.00 0.00 ? 435 ILE B HG22   1  
ATOM   3587   H  HG23   . ILE B 2 45  ? 19.280  1.764   -2.695  1.00 0.00 ? 435 ILE B HG23   1  
ATOM   3588   H  HD11   . ILE B 2 45  ? 19.023  4.586   -0.886  1.00 0.00 ? 435 ILE B HD11   1  
ATOM   3589   H  HD12   . ILE B 2 45  ? 17.390  5.033   -0.387  1.00 0.00 ? 435 ILE B HD12   1  
ATOM   3590   H  HD13   . ILE B 2 45  ? 18.101  5.760   -1.823  1.00 0.00 ? 435 ILE B HD13   1  
ATOM   3591   N  N      . LEU B 2 46  ? 16.139  -0.205  -0.315  1.00 0.00 ? 436 LEU B N      1  
ATOM   3592   C  CA     . LEU B 2 46  ? 16.114  -1.504  0.350   1.00 0.00 ? 436 LEU B CA     1  
ATOM   3593   C  C      . LEU B 2 46  ? 15.515  -2.564  -0.576  1.00 0.00 ? 436 LEU B C      1  
ATOM   3594   O  O      . LEU B 2 46  ? 16.062  -3.659  -0.719  1.00 0.00 ? 436 LEU B O      1  
ATOM   3595   C  CB     . LEU B 2 46  ? 15.303  -1.394  1.656   1.00 0.00 ? 436 LEU B CB     1  
ATOM   3596   C  CG     . LEU B 2 46  ? 15.342  -2.605  2.608   1.00 0.00 ? 436 LEU B CG     1  
ATOM   3597   C  CD1    . LEU B 2 46  ? 14.459  -3.746  2.120   1.00 0.00 ? 436 LEU B CD1    1  
ATOM   3598   C  CD2    . LEU B 2 46  ? 16.771  -3.087  2.796   1.00 0.00 ? 436 LEU B CD2    1  
ATOM   3599   H  H      . LEU B 2 46  ? 15.686  0.557   0.117   1.00 0.00 ? 436 LEU B H      1  
ATOM   3600   H  HA     . LEU B 2 46  ? 17.132  -1.779  0.587   1.00 0.00 ? 436 LEU B HA     1  
ATOM   3601   H  HB2    . LEU B 2 46  ? 15.669  -0.536  2.201   1.00 0.00 ? 436 LEU B HB2    1  
ATOM   3602   H  HB3    . LEU B 2 46  ? 14.273  -1.211  1.393   1.00 0.00 ? 436 LEU B HB3    1  
ATOM   3603   H  HG     . LEU B 2 46  ? 14.968  -2.300  3.574   1.00 0.00 ? 436 LEU B HG     1  
ATOM   3604   H  HD11   . LEU B 2 46  ? 14.504  -4.562  2.827   1.00 0.00 ? 436 LEU B HD11   1  
ATOM   3605   H  HD12   . LEU B 2 46  ? 14.809  -4.087  1.157   1.00 0.00 ? 436 LEU B HD12   1  
ATOM   3606   H  HD13   . LEU B 2 46  ? 13.439  -3.403  2.032   1.00 0.00 ? 436 LEU B HD13   1  
ATOM   3607   H  HD21   . LEU B 2 46  ? 17.186  -3.360  1.839   1.00 0.00 ? 436 LEU B HD21   1  
ATOM   3608   H  HD22   . LEU B 2 46  ? 16.778  -3.945  3.450   1.00 0.00 ? 436 LEU B HD22   1  
ATOM   3609   H  HD23   . LEU B 2 46  ? 17.362  -2.294  3.233   1.00 0.00 ? 436 LEU B HD23   1  
ATOM   3610   N  N      . THR B 2 47  ? 14.403  -2.233  -1.214  1.00 0.00 ? 437 THR B N      1  
ATOM   3611   C  CA     . THR B 2 47  ? 13.722  -3.177  -2.093  1.00 0.00 ? 437 THR B CA     1  
ATOM   3612   C  C      . THR B 2 47  ? 14.546  -3.404  -3.372  1.00 0.00 ? 437 THR B C      1  
ATOM   3613   O  O      . THR B 2 47  ? 14.581  -4.511  -3.921  1.00 0.00 ? 437 THR B O      1  
ATOM   3614   C  CB     . THR B 2 47  ? 12.271  -2.710  -2.418  1.00 0.00 ? 437 THR B CB     1  
ATOM   3615   O  OG1    . THR B 2 47  ? 11.500  -3.800  -2.934  1.00 0.00 ? 437 THR B OG1    1  
ATOM   3616   C  CG2    . THR B 2 47  ? 12.242  -1.564  -3.422  1.00 0.00 ? 437 THR B CG2    1  
ATOM   3617   H  H      . THR B 2 47  ? 14.032  -1.335  -1.088  1.00 0.00 ? 437 THR B H      1  
ATOM   3618   H  HA     . THR B 2 47  ? 13.657  -4.118  -1.563  1.00 0.00 ? 437 THR B HA     1  
ATOM   3619   H  HB     . THR B 2 47  ? 11.814  -2.370  -1.500  1.00 0.00 ? 437 THR B HB     1  
ATOM   3620   H  HG1    . THR B 2 47  ? 10.747  -3.964  -2.348  1.00 0.00 ? 437 THR B HG1    1  
ATOM   3621   H  HG21   . THR B 2 47  ? 11.221  -1.231  -3.563  1.00 0.00 ? 437 THR B HG21   1  
ATOM   3622   H  HG22   . THR B 2 47  ? 12.642  -1.901  -4.365  1.00 0.00 ? 437 THR B HG22   1  
ATOM   3623   H  HG23   . THR B 2 47  ? 12.838  -0.744  -3.050  1.00 0.00 ? 437 THR B HG23   1  
ATOM   3624   N  N      . ALA B 2 48  ? 15.254  -2.365  -3.810  1.00 0.00 ? 438 ALA B N      1  
ATOM   3625   C  CA     . ALA B 2 48  ? 16.156  -2.482  -4.948  1.00 0.00 ? 438 ALA B CA     1  
ATOM   3626   C  C      . ALA B 2 48  ? 17.365  -3.338  -4.577  1.00 0.00 ? 438 ALA B C      1  
ATOM   3627   O  O      . ALA B 2 48  ? 17.864  -4.115  -5.391  1.00 0.00 ? 438 ALA B O      1  
ATOM   3628   C  CB     . ALA B 2 48  ? 16.596  -1.103  -5.419  1.00 0.00 ? 438 ALA B CB     1  
ATOM   3629   H  H      . ALA B 2 48  ? 15.161  -1.498  -3.360  1.00 0.00 ? 438 ALA B H      1  
ATOM   3630   H  HA     . ALA B 2 48  ? 15.619  -2.962  -5.753  1.00 0.00 ? 438 ALA B HA     1  
ATOM   3631   H  HB1    . ALA B 2 48  ? 17.224  -1.203  -6.292  1.00 0.00 ? 438 ALA B HB1    1  
ATOM   3632   H  HB2    . ALA B 2 48  ? 17.149  -0.612  -4.631  1.00 0.00 ? 438 ALA B HB2    1  
ATOM   3633   H  HB3    . ALA B 2 48  ? 15.725  -0.515  -5.668  1.00 0.00 ? 438 ALA B HB3    1  
ATOM   3634   N  N      . LEU B 2 49  ? 17.819  -3.191  -3.335  1.00 0.00 ? 439 LEU B N      1  
ATOM   3635   C  CA     . LEU B 2 49  ? 18.906  -4.001  -2.793  1.00 0.00 ? 439 LEU B CA     1  
ATOM   3636   C  C      . LEU B 2 49  ? 18.510  -5.472  -2.724  1.00 0.00 ? 439 LEU B C      1  
ATOM   3637   O  O      . LEU B 2 49  ? 19.340  -6.353  -2.938  1.00 0.00 ? 439 LEU B O      1  
ATOM   3638   C  CB     . LEU B 2 49  ? 19.295  -3.500  -1.400  1.00 0.00 ? 439 LEU B CB     1  
ATOM   3639   C  CG     . LEU B 2 49  ? 20.628  -2.749  -1.321  1.00 0.00 ? 439 LEU B CG     1  
ATOM   3640   C  CD1    . LEU B 2 49  ? 21.774  -3.664  -1.715  1.00 0.00 ? 439 LEU B CD1    1  
ATOM   3641   C  CD2    . LEU B 2 49  ? 20.615  -1.516  -2.208  1.00 0.00 ? 439 LEU B CD2    1  
ATOM   3642   H  H      . LEU B 2 49  ? 17.417  -2.496  -2.762  1.00 0.00 ? 439 LEU B H      1  
ATOM   3643   H  HA     . LEU B 2 49  ? 19.759  -3.901  -3.452  1.00 0.00 ? 439 LEU B HA     1  
ATOM   3644   H  HB2    . LEU B 2 49  ? 18.509  -2.842  -1.050  1.00 0.00 ? 439 LEU B HB2    1  
ATOM   3645   H  HB3    . LEU B 2 49  ? 19.348  -4.353  -0.741  1.00 0.00 ? 439 LEU B HB3    1  
ATOM   3646   H  HG     . LEU B 2 49  ? 20.791  -2.427  -0.301  1.00 0.00 ? 439 LEU B HG     1  
ATOM   3647   H  HD11   . LEU B 2 49  ? 22.704  -3.119  -1.651  1.00 0.00 ? 439 LEU B HD11   1  
ATOM   3648   H  HD12   . LEU B 2 49  ? 21.626  -4.013  -2.726  1.00 0.00 ? 439 LEU B HD12   1  
ATOM   3649   H  HD13   . LEU B 2 49  ? 21.805  -4.508  -1.042  1.00 0.00 ? 439 LEU B HD13   1  
ATOM   3650   H  HD21   . LEU B 2 49  ? 19.836  -0.844  -1.880  1.00 0.00 ? 439 LEU B HD21   1  
ATOM   3651   H  HD22   . LEU B 2 49  ? 20.429  -1.811  -3.230  1.00 0.00 ? 439 LEU B HD22   1  
ATOM   3652   H  HD23   . LEU B 2 49  ? 21.572  -1.020  -2.145  1.00 0.00 ? 439 LEU B HD23   1  
ATOM   3653   N  N      . LYS B 2 50  ? 17.240  -5.730  -2.418  1.00 0.00 ? 440 LYS B N      1  
ATOM   3654   C  CA     . LYS B 2 50  ? 16.715  -7.090  -2.439  1.00 0.00 ? 440 LYS B CA     1  
ATOM   3655   C  C      . LYS B 2 50  ? 16.914  -7.698  -3.824  1.00 0.00 ? 440 LYS B C      1  
ATOM   3656   O  O      . LYS B 2 50  ? 17.327  -8.852  -3.967  1.00 0.00 ? 440 LYS B O      1  
ATOM   3657   C  CB     . LYS B 2 50  ? 15.224  -7.104  -2.084  1.00 0.00 ? 440 LYS B CB     1  
ATOM   3658   C  CG     . LYS B 2 50  ? 14.912  -6.737  -0.641  1.00 0.00 ? 440 LYS B CG     1  
ATOM   3659   C  CD     . LYS B 2 50  ? 15.382  -7.811  0.329   1.00 0.00 ? 440 LYS B CD     1  
ATOM   3660   C  CE     . LYS B 2 50  ? 14.933  -7.517  1.754   1.00 0.00 ? 440 LYS B CE     1  
ATOM   3661   N  NZ     . LYS B 2 50  ? 13.452  -7.581  1.907   1.00 0.00 ? 440 LYS B NZ     1  
ATOM   3662   H  H      . LYS B 2 50  ? 16.649  -4.988  -2.165  1.00 0.00 ? 440 LYS B H      1  
ATOM   3663   H  HA     . LYS B 2 50  ? 17.265  -7.670  -1.711  1.00 0.00 ? 440 LYS B HA     1  
ATOM   3664   H  HB2    . LYS B 2 50  ? 14.712  -6.403  -2.726  1.00 0.00 ? 440 LYS B HB2    1  
ATOM   3665   H  HB3    . LYS B 2 50  ? 14.834  -8.095  -2.271  1.00 0.00 ? 440 LYS B HB3    1  
ATOM   3666   H  HG2    . LYS B 2 50  ? 15.412  -5.810  -0.402  1.00 0.00 ? 440 LYS B HG2    1  
ATOM   3667   H  HG3    . LYS B 2 50  ? 13.846  -6.609  -0.536  1.00 0.00 ? 440 LYS B HG3    1  
ATOM   3668   H  HD2    . LYS B 2 50  ? 14.973  -8.763  0.022   1.00 0.00 ? 440 LYS B HD2    1  
ATOM   3669   H  HD3    . LYS B 2 50  ? 16.461  -7.857  0.303   1.00 0.00 ? 440 LYS B HD3    1  
ATOM   3670   H  HE2    . LYS B 2 50  ? 15.384  -8.242  2.416   1.00 0.00 ? 440 LYS B HE2    1  
ATOM   3671   H  HE3    . LYS B 2 50  ? 15.271  -6.527  2.025   1.00 0.00 ? 440 LYS B HE3    1  
ATOM   3672   H  HZ1    . LYS B 2 50  ? 13.176  -7.277  2.864   1.00 0.00 ? 440 LYS B HZ1    1  
ATOM   3673   H  HZ2    . LYS B 2 50  ? 13.115  -8.558  1.763   1.00 0.00 ? 440 LYS B HZ2    1  
ATOM   3674   H  HZ3    . LYS B 2 50  ? 12.984  -6.964  1.214   1.00 0.00 ? 440 LYS B HZ3    1  
ATOM   3675   N  N      . ARG B 2 51  ? 16.634  -6.891  -4.842  1.00 0.00 ? 441 ARG B N      1  
ATOM   3676   C  CA     . ARG B 2 51  ? 16.808  -7.304  -6.225  1.00 0.00 ? 441 ARG B CA     1  
ATOM   3677   C  C      . ARG B 2 51  ? 18.283  -7.548  -6.499  1.00 0.00 ? 441 ARG B C      1  
ATOM   3678   O  O      . ARG B 2 51  ? 18.654  -8.545  -7.112  1.00 0.00 ? 441 ARG B O      1  
ATOM   3679   C  CB     . ARG B 2 51  ? 16.254  -6.221  -7.162  1.00 0.00 ? 441 ARG B CB     1  
ATOM   3680   C  CG     . ARG B 2 51  ? 16.289  -6.575  -8.645  1.00 0.00 ? 441 ARG B CG     1  
ATOM   3681   C  CD     . ARG B 2 51  ? 17.625  -6.228  -9.293  1.00 0.00 ? 441 ARG B CD     1  
ATOM   3682   N  NE     . ARG B 2 51  ? 17.967  -4.812  -9.126  1.00 0.00 ? 441 ARG B NE     1  
ATOM   3683   C  CZ     . ARG B 2 51  ? 18.268  -3.990  -10.136 1.00 0.00 ? 441 ARG B CZ     1  
ATOM   3684   N  NH1    . ARG B 2 51  ? 18.286  -4.442  -11.385 1.00 0.00 ? 441 ARG B NH1    1  
ATOM   3685   N  NH2    . ARG B 2 51  ? 18.565  -2.718  -9.895  1.00 0.00 ? 441 ARG B NH2    1  
ATOM   3686   H  H      . ARG B 2 51  ? 16.310  -5.982  -4.653  1.00 0.00 ? 441 ARG B H      1  
ATOM   3687   H  HA     . ARG B 2 51  ? 16.260  -8.223  -6.375  1.00 0.00 ? 441 ARG B HA     1  
ATOM   3688   H  HB2    . ARG B 2 51  ? 15.231  -6.019  -6.889  1.00 0.00 ? 441 ARG B HB2    1  
ATOM   3689   H  HB3    . ARG B 2 51  ? 16.834  -5.320  -7.018  1.00 0.00 ? 441 ARG B HB3    1  
ATOM   3690   H  HG2    . ARG B 2 51  ? 16.118  -7.635  -8.752  1.00 0.00 ? 441 ARG B HG2    1  
ATOM   3691   H  HG3    . ARG B 2 51  ? 15.502  -6.032  -9.150  1.00 0.00 ? 441 ARG B HG3    1  
ATOM   3692   H  HD2    . ARG B 2 51  ? 18.398  -6.831  -8.837  1.00 0.00 ? 441 ARG B HD2    1  
ATOM   3693   H  HD3    . ARG B 2 51  ? 17.569  -6.454  -10.348 1.00 0.00 ? 441 ARG B HD3    1  
ATOM   3694   H  HE     . ARG B 2 51  ? 17.975  -4.458  -8.210  1.00 0.00 ? 441 ARG B HE     1  
ATOM   3695   H  HH11   . ARG B 2 51  ? 18.077  -5.409  -11.582 1.00 0.00 ? 441 ARG B HH11   1  
ATOM   3696   H  HH12   . ARG B 2 51  ? 18.514  -3.821  -12.147 1.00 0.00 ? 441 ARG B HH12   1  
ATOM   3697   H  HH21   . ARG B 2 51  ? 18.572  -2.361  -8.952  1.00 0.00 ? 441 ARG B HH21   1  
ATOM   3698   H  HH22   . ARG B 2 51  ? 18.781  -2.092  -10.659 1.00 0.00 ? 441 ARG B HH22   1  
ATOM   3699   N  N      . LYS B 2 52  ? 19.111  -6.627  -6.023  1.00 0.00 ? 442 LYS B N      1  
ATOM   3700   C  CA     . LYS B 2 52  ? 20.559  -6.712  -6.183  1.00 0.00 ? 442 LYS B CA     1  
ATOM   3701   C  C      . LYS B 2 52  ? 21.116  -7.993  -5.565  1.00 0.00 ? 442 LYS B C      1  
ATOM   3702   O  O      . LYS B 2 52  ? 22.061  -8.582  -6.087  1.00 0.00 ? 442 LYS B O      1  
ATOM   3703   C  CB     . LYS B 2 52  ? 21.233  -5.494  -5.547  1.00 0.00 ? 442 LYS B CB     1  
ATOM   3704   C  CG     . LYS B 2 52  ? 20.874  -4.173  -6.212  1.00 0.00 ? 442 LYS B CG     1  
ATOM   3705   C  CD     . LYS B 2 52  ? 21.295  -4.145  -7.672  1.00 0.00 ? 442 LYS B CD     1  
ATOM   3706   C  CE     . LYS B 2 52  ? 22.809  -4.152  -7.823  1.00 0.00 ? 442 LYS B CE     1  
ATOM   3707   N  NZ     . LYS B 2 52  ? 23.224  -4.176  -9.247  1.00 0.00 ? 442 LYS B NZ     1  
ATOM   3708   H  H      . LYS B 2 52  ? 18.731  -5.854  -5.551  1.00 0.00 ? 442 LYS B H      1  
ATOM   3709   H  HA     . LYS B 2 52  ? 20.773  -6.717  -7.242  1.00 0.00 ? 442 LYS B HA     1  
ATOM   3710   H  HB2    . LYS B 2 52  ? 20.942  -5.438  -4.509  1.00 0.00 ? 442 LYS B HB2    1  
ATOM   3711   H  HB3    . LYS B 2 52  ? 22.301  -5.620  -5.604  1.00 0.00 ? 442 LYS B HB3    1  
ATOM   3712   H  HG2    . LYS B 2 52  ? 19.805  -4.034  -6.157  1.00 0.00 ? 442 LYS B HG2    1  
ATOM   3713   H  HG3    . LYS B 2 52  ? 21.372  -3.371  -5.686  1.00 0.00 ? 442 LYS B HG3    1  
ATOM   3714   H  HD2    . LYS B 2 52  ? 20.889  -5.014  -8.167  1.00 0.00 ? 442 LYS B HD2    1  
ATOM   3715   H  HD3    . LYS B 2 52  ? 20.900  -3.250  -8.133  1.00 0.00 ? 442 LYS B HD3    1  
ATOM   3716   H  HE2    . LYS B 2 52  ? 23.210  -3.264  -7.355  1.00 0.00 ? 442 LYS B HE2    1  
ATOM   3717   H  HE3    . LYS B 2 52  ? 23.204  -5.027  -7.327  1.00 0.00 ? 442 LYS B HE3    1  
ATOM   3718   H  HZ1    . LYS B 2 52  ? 24.244  -3.972  -9.329  1.00 0.00 ? 442 LYS B HZ1    1  
ATOM   3719   H  HZ2    . LYS B 2 52  ? 22.692  -3.465  -9.793  1.00 0.00 ? 442 LYS B HZ2    1  
ATOM   3720   H  HZ3    . LYS B 2 52  ? 23.038  -5.121  -9.659  1.00 0.00 ? 442 LYS B HZ3    1  
ATOM   3721   N  N      . LEU B 2 53  ? 20.527  -8.417  -4.453  1.00 0.00 ? 443 LEU B N      1  
ATOM   3722   C  CA     . LEU B 2 53  ? 20.949  -9.639  -3.774  1.00 0.00 ? 443 LEU B CA     1  
ATOM   3723   C  C      . LEU B 2 53  ? 20.713  -10.862 -4.652  1.00 0.00 ? 443 LEU B C      1  
ATOM   3724   O  O      . LEU B 2 53  ? 21.589  -11.712 -4.797  1.00 0.00 ? 443 LEU B O      1  
ATOM   3725   C  CB     . LEU B 2 53  ? 20.200  -9.799  -2.450  1.00 0.00 ? 443 LEU B CB     1  
ATOM   3726   C  CG     . LEU B 2 53  ? 20.544  -11.060 -1.656  1.00 0.00 ? 443 LEU B CG     1  
ATOM   3727   C  CD1    . LEU B 2 53  ? 22.027  -11.102 -1.325  1.00 0.00 ? 443 LEU B CD1    1  
ATOM   3728   C  CD2    . LEU B 2 53  ? 19.716  -11.118 -0.388  1.00 0.00 ? 443 LEU B CD2    1  
ATOM   3729   H  H      . LEU B 2 53  ? 19.796  -7.883  -4.068  1.00 0.00 ? 443 LEU B H      1  
ATOM   3730   H  HA     . LEU B 2 53  ? 22.007  -9.556  -3.571  1.00 0.00 ? 443 LEU B HA     1  
ATOM   3731   H  HB2    . LEU B 2 53  ? 20.412  -8.941  -1.830  1.00 0.00 ? 443 LEU B HB2    1  
ATOM   3732   H  HB3    . LEU B 2 53  ? 19.143  -9.814  -2.663  1.00 0.00 ? 443 LEU B HB3    1  
ATOM   3733   H  HG     . LEU B 2 53  ? 20.308  -11.929 -2.252  1.00 0.00 ? 443 LEU B HG     1  
ATOM   3734   H  HD11   . LEU B 2 53  ? 22.599  -11.112 -2.240  1.00 0.00 ? 443 LEU B HD11   1  
ATOM   3735   H  HD12   . LEU B 2 53  ? 22.241  -11.995 -0.756  1.00 0.00 ? 443 LEU B HD12   1  
ATOM   3736   H  HD13   . LEU B 2 53  ? 22.293  -10.232 -0.743  1.00 0.00 ? 443 LEU B HD13   1  
ATOM   3737   H  HD21   . LEU B 2 53  ? 18.671  -11.209 -0.643  1.00 0.00 ? 443 LEU B HD21   1  
ATOM   3738   H  HD22   . LEU B 2 53  ? 19.869  -10.211 0.179   1.00 0.00 ? 443 LEU B HD22   1  
ATOM   3739   H  HD23   . LEU B 2 53  ? 20.021  -11.969 0.202   1.00 0.00 ? 443 LEU B HD23   1  
ATOM   3740   N  N      . ARG B 2 54  ? 19.522  -10.947 -5.227  1.00 0.00 ? 444 ARG B N      1  
ATOM   3741   C  CA     . ARG B 2 54  ? 19.168  -12.064 -6.094  1.00 0.00 ? 444 ARG B CA     1  
ATOM   3742   C  C      . ARG B 2 54  ? 19.698  -11.849 -7.511  1.00 0.00 ? 444 ARG B C      1  
ATOM   3743   O  O      . ARG B 2 54  ? 19.527  -12.697 -8.388  1.00 0.00 ? 444 ARG B O      1  
ATOM   3744   C  CB     . ARG B 2 54  ? 17.651  -12.261 -6.106  1.00 0.00 ? 444 ARG B CB     1  
ATOM   3745   C  CG     . ARG B 2 54  ? 17.092  -12.694 -4.760  1.00 0.00 ? 444 ARG B CG     1  
ATOM   3746   C  CD     . ARG B 2 54  ? 15.592  -12.943 -4.814  1.00 0.00 ? 444 ARG B CD     1  
ATOM   3747   N  NE     . ARG B 2 54  ? 14.829  -11.718 -5.046  1.00 0.00 ? 444 ARG B NE     1  
ATOM   3748   C  CZ     . ARG B 2 54  ? 13.911  -11.248 -4.201  1.00 0.00 ? 444 ARG B CZ     1  
ATOM   3749   N  NH1    . ARG B 2 54  ? 13.701  -11.853 -3.039  1.00 0.00 ? 444 ARG B NH1    1  
ATOM   3750   N  NH2    . ARG B 2 54  ? 13.215  -10.161 -4.509  1.00 0.00 ? 444 ARG B NH2    1  
ATOM   3751   H  H      . ARG B 2 54  ? 18.859  -10.236 -5.061  1.00 0.00 ? 444 ARG B H      1  
ATOM   3752   H  HA     . ARG B 2 54  ? 19.629  -12.950 -5.687  1.00 0.00 ? 444 ARG B HA     1  
ATOM   3753   H  HB2    . ARG B 2 54  ? 17.180  -11.330 -6.387  1.00 0.00 ? 444 ARG B HB2    1  
ATOM   3754   H  HB3    . ARG B 2 54  ? 17.402  -13.016 -6.837  1.00 0.00 ? 444 ARG B HB3    1  
ATOM   3755   H  HG2    . ARG B 2 54  ? 17.585  -13.606 -4.454  1.00 0.00 ? 444 ARG B HG2    1  
ATOM   3756   H  HG3    . ARG B 2 54  ? 17.291  -11.917 -4.035  1.00 0.00 ? 444 ARG B HG3    1  
ATOM   3757   H  HD2    . ARG B 2 54  ? 15.387  -13.637 -5.618  1.00 0.00 ? 444 ARG B HD2    1  
ATOM   3758   H  HD3    . ARG B 2 54  ? 15.279  -13.379 -3.877  1.00 0.00 ? 444 ARG B HD3    1  
ATOM   3759   H  HE     . ARG B 2 54  ? 14.995  -11.234 -5.895  1.00 0.00 ? 444 ARG B HE     1  
ATOM   3760   H  HH11   . ARG B 2 54  ? 14.243  -12.665 -2.786  1.00 0.00 ? 444 ARG B HH11   1  
ATOM   3761   H  HH12   . ARG B 2 54  ? 12.992  -11.514 -2.409  1.00 0.00 ? 444 ARG B HH12   1  
ATOM   3762   H  HH21   . ARG B 2 54  ? 13.375  -9.686  -5.384  1.00 0.00 ? 444 ARG B HH21   1  
ATOM   3763   H  HH22   . ARG B 2 54  ? 12.531  -9.805  -3.874  1.00 0.00 ? 444 ARG B HH22   1  
ATOM   3764   N  N      . GLU B 2 55  ? 20.332  -10.708 -7.724  1.00 0.00 ? 445 GLU B N      1  
ATOM   3765   C  CA     . GLU B 2 55  ? 20.901  -10.364 -9.020  1.00 0.00 ? 445 GLU B CA     1  
ATOM   3766   C  C      . GLU B 2 55  ? 22.266  -11.018 -9.209  1.00 0.00 ? 445 GLU B C      1  
ATOM   3767   O  O      . GLU B 2 55  ? 22.578  -11.523 -10.288 1.00 0.00 ? 445 GLU B O      1  
ATOM   3768   C  CB     . GLU B 2 55  ? 21.040  -8.847  -9.140  1.00 0.00 ? 445 GLU B CB     1  
ATOM   3769   C  CG     . GLU B 2 55  ? 21.596  -8.370  -10.471 1.00 0.00 ? 445 GLU B CG     1  
ATOM   3770   C  CD     . GLU B 2 55  ? 21.970  -6.906  -10.436 1.00 0.00 ? 445 GLU B CD     1  
ATOM   3771   O  OE1    . GLU B 2 55  ? 21.080  -6.052  -10.611 1.00 0.00 ? 445 GLU B OE1    1  
ATOM   3772   O  OE2    . GLU B 2 55  ? 23.158  -6.601  -10.219 1.00 0.00 ? 445 GLU B OE2    1  
ATOM   3773   H  H      . GLU B 2 55  ? 20.414  -10.069 -6.985  1.00 0.00 ? 445 GLU B H      1  
ATOM   3774   H  HA     . GLU B 2 55  ? 20.232  -10.721 -9.787  1.00 0.00 ? 445 GLU B HA     1  
ATOM   3775   H  HB2    . GLU B 2 55  ? 20.066  -8.401  -9.006  1.00 0.00 ? 445 GLU B HB2    1  
ATOM   3776   H  HB3    . GLU B 2 55  ? 21.695  -8.498  -8.356  1.00 0.00 ? 445 GLU B HB3    1  
ATOM   3777   H  HG2    . GLU B 2 55  ? 22.477  -8.947  -10.711 1.00 0.00 ? 445 GLU B HG2    1  
ATOM   3778   H  HG3    . GLU B 2 55  ? 20.847  -8.519  -11.235 1.00 0.00 ? 445 GLU B HG3    1  
ATOM   3779   N  N      . ALA B 2 56  ? 23.070  -10.996 -8.156  1.00 0.00 ? 446 ALA B N      1  
ATOM   3780   C  CA     . ALA B 2 56  ? 24.430  -11.510 -8.220  1.00 0.00 ? 446 ALA B CA     1  
ATOM   3781   C  C      . ALA B 2 56  ? 24.452  -13.032 -8.102  1.00 0.00 ? 446 ALA B C      1  
ATOM   3782   O  O      . ALA B 2 56  ? 24.466  -13.708 -9.150  1.00 0.00 ? 446 ALA B O      1  
ATOM   3783   C  CB     . ALA B 2 56  ? 25.285  -10.876 -7.131  1.00 0.00 ? 446 ALA B CB     1  
ATOM   3784   O  OXT    . ALA B 2 56  ? 24.456  -13.540 -6.964  1.00 0.00 ? 446 ALA B OXT    1  
ATOM   3785   H  H      . ALA B 2 56  ? 22.740  -10.633 -7.309  1.00 0.00 ? 446 ALA B H      1  
ATOM   3786   H  HA     . ALA B 2 56  ? 24.844  -11.227 -9.177  1.00 0.00 ? 446 ALA B HA     1  
ATOM   3787   H  HB1    . ALA B 2 56  ? 24.920  -11.182 -6.161  1.00 0.00 ? 446 ALA B HB1    1  
ATOM   3788   H  HB2    . ALA B 2 56  ? 25.232  -9.800  -7.212  1.00 0.00 ? 446 ALA B HB2    1  
ATOM   3789   H  HB3    . ALA B 2 56  ? 26.309  -11.196 -7.245  1.00 0.00 ? 446 ALA B HB3    1  
HETATM 3790   P  PG     . GNP C 3 .   ? 1.909   -10.544 9.277   1.00 0.00 ? 500 GNP A PG     1  
HETATM 3791   O  O1G    . GNP C 3 .   ? 3.126   -11.286 9.694   1.00 0.00 ? 500 GNP A O1G    1  
HETATM 3792   O  O2G    . GNP C 3 .   ? 2.282   -9.326  8.320   1.00 0.00 ? 500 GNP A O2G    1  
HETATM 3793   O  O3G    . GNP C 3 .   ? 1.069   -10.077 10.550  1.00 0.00 ? 500 GNP A O3G    1  
HETATM 3794   N  N3B    . GNP C 3 .   ? 0.890   -11.526 8.376   1.00 0.00 ? 500 GNP A N3B    1  
HETATM 3795   P  PB     . GNP C 3 .   ? -0.665  -10.902 8.251   1.00 0.00 ? 500 GNP A PB     1  
HETATM 3796   O  O1B    . GNP C 3 .   ? -1.224  -10.699 9.613   1.00 0.00 ? 500 GNP A O1B    1  
HETATM 3797   O  O2B    . GNP C 3 .   ? -0.666  -9.768  7.284   1.00 0.00 ? 500 GNP A O2B    1  
HETATM 3798   O  O3A    . GNP C 3 .   ? -1.437  -12.126 7.571   1.00 0.00 ? 500 GNP A O3A    1  
HETATM 3799   P  PA     . GNP C 3 .   ? -2.991  -12.373 7.836   1.00 0.00 ? 500 GNP A PA     1  
HETATM 3800   O  O1A    . GNP C 3 .   ? -3.149  -13.596 8.662   1.00 0.00 ? 500 GNP A O1A    1  
HETATM 3801   O  O2A    . GNP C 3 .   ? -3.614  -11.106 8.294   1.00 0.00 ? 500 GNP A O2A    1  
HETATM 3802   O  "O5'"  . GNP C 3 .   ? -3.532  -12.684 6.370   1.00 0.00 ? 500 GNP A "O5'"  1  
HETATM 3803   C  "C5'"  . GNP C 3 .   ? -3.142  -13.863 5.669   1.00 0.00 ? 500 GNP A "C5'"  1  
HETATM 3804   C  "C4'"  . GNP C 3 .   ? -3.441  -13.708 4.196   1.00 0.00 ? 500 GNP A "C4'"  1  
HETATM 3805   O  "O4'"  . GNP C 3 .   ? -4.212  -14.856 3.758   1.00 0.00 ? 500 GNP A "O4'"  1  
HETATM 3806   C  "C3'"  . GNP C 3 .   ? -4.270  -12.479 3.829   1.00 0.00 ? 500 GNP A "C3'"  1  
HETATM 3807   O  "O3'"  . GNP C 3 .   ? -3.568  -11.641 2.921   1.00 0.00 ? 500 GNP A "O3'"  1  
HETATM 3808   C  "C2'"  . GNP C 3 .   ? -5.557  -13.023 3.205   1.00 0.00 ? 500 GNP A "C2'"  1  
HETATM 3809   O  "O2'"  . GNP C 3 .   ? -5.929  -12.292 2.053   1.00 0.00 ? 500 GNP A "O2'"  1  
HETATM 3810   C  "C1'"  . GNP C 3 .   ? -5.140  -14.428 2.788   1.00 0.00 ? 500 GNP A "C1'"  1  
HETATM 3811   N  N9     . GNP C 3 .   ? -6.247  -15.384 2.738   1.00 0.00 ? 500 GNP A N9     1  
HETATM 3812   C  C8     . GNP C 3 .   ? -6.274  -16.642 3.287   1.00 0.00 ? 500 GNP A C8     1  
HETATM 3813   N  N7     . GNP C 3 .   ? -7.395  -17.274 3.079   1.00 0.00 ? 500 GNP A N7     1  
HETATM 3814   C  C5     . GNP C 3 .   ? -8.163  -16.375 2.349   1.00 0.00 ? 500 GNP A C5     1  
HETATM 3815   C  C6     . GNP C 3 .   ? -9.478  -16.504 1.835   1.00 0.00 ? 500 GNP A C6     1  
HETATM 3816   O  O6     . GNP C 3 .   ? -10.251 -17.464 1.934   1.00 0.00 ? 500 GNP A O6     1  
HETATM 3817   N  N1     . GNP C 3 .   ? -9.883  -15.360 1.153   1.00 0.00 ? 500 GNP A N1     1  
HETATM 3818   C  C2     . GNP C 3 .   ? -9.108  -14.236 0.992   1.00 0.00 ? 500 GNP A C2     1  
HETATM 3819   N  N2     . GNP C 3 .   ? -9.678  -13.216 0.330   1.00 0.00 ? 500 GNP A N2     1  
HETATM 3820   N  N3     . GNP C 3 .   ? -7.879  -14.102 1.462   1.00 0.00 ? 500 GNP A N3     1  
HETATM 3821   C  C4     . GNP C 3 .   ? -7.470  -15.204 2.129   1.00 0.00 ? 500 GNP A C4     1  
HETATM 3822   H  HNB3   . GNP C 3 .   ? 0.851   -12.418 8.792   1.00 0.00 ? 500 GNP A HNB3   1  
HETATM 3823   H  "H5'2" . GNP C 3 .   ? -3.690  -14.721 6.056   1.00 0.00 ? 500 GNP A "H5'2" 1  
HETATM 3824   H  "H5'1" . GNP C 3 .   ? -2.075  -14.036 5.798   1.00 0.00 ? 500 GNP A "H5'1" 1  
HETATM 3825   H  "H4'"  . GNP C 3 .   ? -2.486  -13.603 3.680   1.00 0.00 ? 500 GNP A "H4'"  1  
HETATM 3826   H  "H3'"  . GNP C 3 .   ? -4.468  -11.858 4.702   1.00 0.00 ? 500 GNP A "H3'"  1  
HETATM 3827   H  "HO3'" . GNP C 3 .   ? -4.124  -11.551 2.145   1.00 0.00 ? 500 GNP A "HO3'" 1  
HETATM 3828   H  "H2'"  . GNP C 3 .   ? -6.353  -13.053 3.951   1.00 0.00 ? 500 GNP A "H2'"  1  
HETATM 3829   H  "HO2'" . GNP C 3 .   ? -6.448  -12.879 1.503   1.00 0.00 ? 500 GNP A "HO2'" 1  
HETATM 3830   H  "H1'"  . GNP C 3 .   ? -4.628  -14.445 1.825   1.00 0.00 ? 500 GNP A "H1'"  1  
HETATM 3831   H  H8     . GNP C 3 .   ? -5.446  -17.069 3.837   1.00 0.00 ? 500 GNP A H8     1  
HETATM 3832   H  HN1    . GNP C 3 .   ? -10.811 -15.360 0.749   1.00 0.00 ? 500 GNP A HN1    1  
HETATM 3833   H  HN21   . GNP C 3 .   ? -9.172  -12.352 0.197   1.00 0.00 ? 500 GNP A HN21   1  
HETATM 3834   H  HN22   . GNP C 3 .   ? -10.617 -13.313 -0.032  1.00 0.00 ? 500 GNP A HN22   1  
HETATM 3835   MG MG     . MG  D 4 .   ? 1.230   -8.886  6.328   1.00 0.00 ? 501 MG  A MG     1  
HETATM 3836   O  O      . HOH E 5 .   ? 0.675   -6.771  7.062   1.00 0.00 ? 502 HOH A O      1  
HETATM 3837   H  H1     . HOH E 5 .   ? -0.005  -6.482  6.456   1.00 0.00 ? 502 HOH A H1     1  
HETATM 3838   H  H2     . HOH E 5 .   ? 1.435   -6.232  6.828   1.00 0.00 ? 502 HOH A H2     1  
HETATM 3839   O  O      . HOH E 5 .   ? 1.798   -10.986 5.564   1.00 0.00 ? 503 HOH A O      1  
HETATM 3840   H  H1     . HOH E 5 .   ? 2.377   -10.813 4.819   1.00 0.00 ? 503 HOH A H1     1  
HETATM 3841   H  H2     . HOH E 5 .   ? 1.000   -11.324 5.171   1.00 0.00 ? 503 HOH A H2     1  
ATOM   3842   N  N      . GLY A 1 1   ? 8.019   16.241  -19.487 1.00 0.00 ? 8   GLY A N      2  
ATOM   3843   C  CA     . GLY A 1 1   ? 7.566   15.882  -18.124 1.00 0.00 ? 8   GLY A CA     2  
ATOM   3844   C  C      . GLY A 1 1   ? 6.354   16.678  -17.701 1.00 0.00 ? 8   GLY A C      2  
ATOM   3845   O  O      . GLY A 1 1   ? 5.874   17.531  -18.449 1.00 0.00 ? 8   GLY A O      2  
ATOM   3846   H  H1     . GLY A 1 1   ? 8.299   17.245  -19.520 1.00 0.00 ? 8   GLY A H1     2  
ATOM   3847   H  H2     . GLY A 1 1   ? 7.249   16.087  -20.172 1.00 0.00 ? 8   GLY A H2     2  
ATOM   3848   H  H3     . GLY A 1 1   ? 8.834   15.655  -19.759 1.00 0.00 ? 8   GLY A H3     2  
ATOM   3849   H  HA2    . GLY A 1 1   ? 7.321   14.830  -18.102 1.00 0.00 ? 8   GLY A HA2    2  
ATOM   3850   H  HA3    . GLY A 1 1   ? 8.370   16.068  -17.428 1.00 0.00 ? 8   GLY A HA3    2  
ATOM   3851   N  N      . GLN A 1 2   ? 5.856   16.399  -16.505 1.00 0.00 ? 9   GLN A N      2  
ATOM   3852   C  CA     . GLN A 1 2   ? 4.694   17.095  -15.976 1.00 0.00 ? 9   GLN A CA     2  
ATOM   3853   C  C      . GLN A 1 2   ? 4.613   16.915  -14.463 1.00 0.00 ? 9   GLN A C      2  
ATOM   3854   O  O      . GLN A 1 2   ? 4.828   17.860  -13.701 1.00 0.00 ? 9   GLN A O      2  
ATOM   3855   C  CB     . GLN A 1 2   ? 3.413   16.572  -16.634 1.00 0.00 ? 9   GLN A CB     2  
ATOM   3856   C  CG     . GLN A 1 2   ? 2.149   17.266  -16.156 1.00 0.00 ? 9   GLN A CG     2  
ATOM   3857   C  CD     . GLN A 1 2   ? 0.895   16.559  -16.620 1.00 0.00 ? 9   GLN A CD     2  
ATOM   3858   O  OE1    . GLN A 1 2   ? 0.359   16.852  -17.687 1.00 0.00 ? 9   GLN A OE1    2  
ATOM   3859   N  NE2    . GLN A 1 2   ? 0.417   15.621  -15.817 1.00 0.00 ? 9   GLN A NE2    2  
ATOM   3860   H  H      . GLN A 1 2   ? 6.288   15.703  -15.959 1.00 0.00 ? 9   GLN A H      2  
ATOM   3861   H  HA     . GLN A 1 2   ? 4.804   18.146  -16.199 1.00 0.00 ? 9   GLN A HA     2  
ATOM   3862   H  HB2    . GLN A 1 2   ? 3.488   16.705  -17.704 1.00 0.00 ? 9   GLN A HB2    2  
ATOM   3863   H  HB3    . GLN A 1 2   ? 3.319   15.518  -16.420 1.00 0.00 ? 9   GLN A HB3    2  
ATOM   3864   H  HG2    . GLN A 1 2   ? 2.152   17.291  -15.076 1.00 0.00 ? 9   GLN A HG2    2  
ATOM   3865   H  HG3    . GLN A 1 2   ? 2.138   18.276  -16.539 1.00 0.00 ? 9   GLN A HG3    2  
ATOM   3866   H  HE21   . GLN A 1 2   ? 0.895   15.442  -14.975 1.00 0.00 ? 9   GLN A HE21   2  
ATOM   3867   H  HE22   . GLN A 1 2   ? -0.390  15.146  -16.093 1.00 0.00 ? 9   GLN A HE22   2  
ATOM   3868   N  N      . SER A 1 3   ? 4.317   15.693  -14.035 1.00 0.00 ? 10  SER A N      2  
ATOM   3869   C  CA     . SER A 1 3   ? 4.167   15.394  -12.614 1.00 0.00 ? 10  SER A CA     2  
ATOM   3870   C  C      . SER A 1 3   ? 4.444   13.920  -12.308 1.00 0.00 ? 10  SER A C      2  
ATOM   3871   O  O      . SER A 1 3   ? 4.112   13.435  -11.220 1.00 0.00 ? 10  SER A O      2  
ATOM   3872   C  CB     . SER A 1 3   ? 2.759   15.780  -12.144 1.00 0.00 ? 10  SER A CB     2  
ATOM   3873   O  OG     . SER A 1 3   ? 1.823   15.728  -13.213 1.00 0.00 ? 10  SER A OG     2  
ATOM   3874   H  H      . SER A 1 3   ? 4.191   14.973  -14.692 1.00 0.00 ? 10  SER A H      2  
ATOM   3875   H  HA     . SER A 1 3   ? 4.886   15.995  -12.079 1.00 0.00 ? 10  SER A HA     2  
ATOM   3876   H  HB2    . SER A 1 3   ? 2.440   15.094  -11.374 1.00 0.00 ? 10  SER A HB2    2  
ATOM   3877   H  HB3    . SER A 1 3   ? 2.778   16.784  -11.745 1.00 0.00 ? 10  SER A HB3    2  
ATOM   3878   H  HG     . SER A 1 3   ? 1.474   16.622  -13.366 1.00 0.00 ? 10  SER A HG     2  
ATOM   3879   N  N      . SER A 1 4   ? 5.064   13.228  -13.265 1.00 0.00 ? 11  SER A N      2  
ATOM   3880   C  CA     . SER A 1 4   ? 5.422   11.817  -13.119 1.00 0.00 ? 11  SER A CA     2  
ATOM   3881   C  C      . SER A 1 4   ? 4.180   10.926  -13.055 1.00 0.00 ? 11  SER A C      2  
ATOM   3882   O  O      . SER A 1 4   ? 3.603   10.696  -11.991 1.00 0.00 ? 11  SER A O      2  
ATOM   3883   C  CB     . SER A 1 4   ? 6.313   11.608  -11.890 1.00 0.00 ? 11  SER A CB     2  
ATOM   3884   O  OG     . SER A 1 4   ? 7.499   12.379  -11.997 1.00 0.00 ? 11  SER A OG     2  
ATOM   3885   H  H      . SER A 1 4   ? 5.293   13.681  -14.102 1.00 0.00 ? 11  SER A H      2  
ATOM   3886   H  HA     . SER A 1 4   ? 5.984   11.540  -13.999 1.00 0.00 ? 11  SER A HA     2  
ATOM   3887   H  HB2    . SER A 1 4   ? 5.778   11.910  -11.002 1.00 0.00 ? 11  SER A HB2    2  
ATOM   3888   H  HB3    . SER A 1 4   ? 6.580   10.565  -11.815 1.00 0.00 ? 11  SER A HB3    2  
ATOM   3889   H  HG     . SER A 1 4   ? 7.680   12.815  -11.157 1.00 0.00 ? 11  SER A HG     2  
ATOM   3890   N  N      . LEU A 1 5   ? 3.770   10.431  -14.217 1.00 0.00 ? 12  LEU A N      2  
ATOM   3891   C  CA     . LEU A 1 5   ? 2.620   9.545   -14.316 1.00 0.00 ? 12  LEU A CA     2  
ATOM   3892   C  C      . LEU A 1 5   ? 3.070   8.091   -14.334 1.00 0.00 ? 12  LEU A C      2  
ATOM   3893   O  O      . LEU A 1 5   ? 2.252   7.172   -14.221 1.00 0.00 ? 12  LEU A O      2  
ATOM   3894   C  CB     . LEU A 1 5   ? 1.809   9.855   -15.576 1.00 0.00 ? 12  LEU A CB     2  
ATOM   3895   C  CG     . LEU A 1 5   ? 1.139   11.230  -15.601 1.00 0.00 ? 12  LEU A CG     2  
ATOM   3896   C  CD1    . LEU A 1 5   ? 0.517   11.499  -16.961 1.00 0.00 ? 12  LEU A CD1    2  
ATOM   3897   C  CD2    . LEU A 1 5   ? 0.083   11.322  -14.512 1.00 0.00 ? 12  LEU A CD2    2  
ATOM   3898   H  H      . LEU A 1 5   ? 4.266   10.666  -15.036 1.00 0.00 ? 12  LEU A H      2  
ATOM   3899   H  HA     . LEU A 1 5   ? 1.999   9.709   -13.449 1.00 0.00 ? 12  LEU A HA     2  
ATOM   3900   H  HB2    . LEU A 1 5   ? 2.470   9.785   -16.429 1.00 0.00 ? 12  LEU A HB2    2  
ATOM   3901   H  HB3    . LEU A 1 5   ? 1.041   9.104   -15.676 1.00 0.00 ? 12  LEU A HB3    2  
ATOM   3902   H  HG     . LEU A 1 5   ? 1.881   11.992  -15.415 1.00 0.00 ? 12  LEU A HG     2  
ATOM   3903   H  HD11   . LEU A 1 5   ? 1.286   11.479  -17.720 1.00 0.00 ? 12  LEU A HD11   2  
ATOM   3904   H  HD12   . LEU A 1 5   ? 0.042   12.470  -16.954 1.00 0.00 ? 12  LEU A HD12   2  
ATOM   3905   H  HD13   . LEU A 1 5   ? -0.221  10.740  -17.175 1.00 0.00 ? 12  LEU A HD13   2  
ATOM   3906   H  HD21   . LEU A 1 5   ? 0.549   11.193  -13.545 1.00 0.00 ? 12  LEU A HD21   2  
ATOM   3907   H  HD22   . LEU A 1 5   ? -0.656  10.548  -14.661 1.00 0.00 ? 12  LEU A HD22   2  
ATOM   3908   H  HD23   . LEU A 1 5   ? -0.394  12.289  -14.553 1.00 0.00 ? 12  LEU A HD23   2  
ATOM   3909   N  N      . ALA A 1 6   ? 4.375   7.889   -14.474 1.00 0.00 ? 13  ALA A N      2  
ATOM   3910   C  CA     . ALA A 1 6   ? 4.944   6.549   -14.526 1.00 0.00 ? 13  ALA A CA     2  
ATOM   3911   C  C      . ALA A 1 6   ? 5.403   6.084   -13.151 1.00 0.00 ? 13  ALA A C      2  
ATOM   3912   O  O      . ALA A 1 6   ? 6.020   5.029   -13.012 1.00 0.00 ? 13  ALA A O      2  
ATOM   3913   C  CB     . ALA A 1 6   ? 6.092   6.505   -15.522 1.00 0.00 ? 13  ALA A CB     2  
ATOM   3914   H  H      . ALA A 1 6   ? 4.970   8.665   -14.564 1.00 0.00 ? 13  ALA A H      2  
ATOM   3915   H  HA     . ALA A 1 6   ? 4.174   5.883   -14.870 1.00 0.00 ? 13  ALA A HA     2  
ATOM   3916   H  HB1    . ALA A 1 6   ? 5.740   6.824   -16.493 1.00 0.00 ? 13  ALA A HB1    2  
ATOM   3917   H  HB2    . ALA A 1 6   ? 6.469   5.496   -15.591 1.00 0.00 ? 13  ALA A HB2    2  
ATOM   3918   H  HB3    . ALA A 1 6   ? 6.880   7.164   -15.191 1.00 0.00 ? 13  ALA A HB3    2  
ATOM   3919   N  N      . LEU A 1 7   ? 5.081   6.870   -12.143 1.00 0.00 ? 14  LEU A N      2  
ATOM   3920   C  CA     . LEU A 1 7   ? 5.410   6.538   -10.763 1.00 0.00 ? 14  LEU A CA     2  
ATOM   3921   C  C      . LEU A 1 7   ? 4.151   6.591   -9.913  1.00 0.00 ? 14  LEU A C      2  
ATOM   3922   O  O      . LEU A 1 7   ? 3.438   7.591   -9.922  1.00 0.00 ? 14  LEU A O      2  
ATOM   3923   C  CB     . LEU A 1 7   ? 6.465   7.501   -10.189 1.00 0.00 ? 14  LEU A CB     2  
ATOM   3924   C  CG     . LEU A 1 7   ? 7.920   7.259   -10.622 1.00 0.00 ? 14  LEU A CG     2  
ATOM   3925   C  CD1    . LEU A 1 7   ? 8.308   5.806   -10.414 1.00 0.00 ? 14  LEU A CD1    2  
ATOM   3926   C  CD2    . LEU A 1 7   ? 8.143   7.672   -12.069 1.00 0.00 ? 14  LEU A CD2    2  
ATOM   3927   H  H      . LEU A 1 7   ? 4.593   7.695   -12.331 1.00 0.00 ? 14  LEU A H      2  
ATOM   3928   H  HA     . LEU A 1 7   ? 5.800   5.532   -10.745 1.00 0.00 ? 14  LEU A HA     2  
ATOM   3929   H  HB2    . LEU A 1 7   ? 6.192   8.505   -10.483 1.00 0.00 ? 14  LEU A HB2    2  
ATOM   3930   H  HB3    . LEU A 1 7   ? 6.421   7.440   -9.113  1.00 0.00 ? 14  LEU A HB3    2  
ATOM   3931   H  HG     . LEU A 1 7   ? 8.571   7.862   -10.003 1.00 0.00 ? 14  LEU A HG     2  
ATOM   3932   H  HD11   . LEU A 1 7   ? 9.345   5.667   -10.676 1.00 0.00 ? 14  LEU A HD11   2  
ATOM   3933   H  HD12   . LEU A 1 7   ? 7.691   5.177   -11.039 1.00 0.00 ? 14  LEU A HD12   2  
ATOM   3934   H  HD13   . LEU A 1 7   ? 8.158   5.538   -9.378  1.00 0.00 ? 14  LEU A HD13   2  
ATOM   3935   H  HD21   . LEU A 1 7   ? 7.472   7.117   -12.708 1.00 0.00 ? 14  LEU A HD21   2  
ATOM   3936   H  HD22   . LEU A 1 7   ? 9.164   7.463   -12.351 1.00 0.00 ? 14  LEU A HD22   2  
ATOM   3937   H  HD23   . LEU A 1 7   ? 7.948   8.730   -12.175 1.00 0.00 ? 14  LEU A HD23   2  
ATOM   3938   N  N      . HIS A 1 8   ? 3.855   5.508   -9.210  1.00 0.00 ? 15  HIS A N      2  
ATOM   3939   C  CA     . HIS A 1 8   ? 2.670   5.459   -8.356  1.00 0.00 ? 15  HIS A CA     2  
ATOM   3940   C  C      . HIS A 1 8   ? 3.003   4.841   -7.007  1.00 0.00 ? 15  HIS A C      2  
ATOM   3941   O  O      . HIS A 1 8   ? 3.539   3.735   -6.937  1.00 0.00 ? 15  HIS A O      2  
ATOM   3942   C  CB     . HIS A 1 8   ? 1.536   4.662   -9.017  1.00 0.00 ? 15  HIS A CB     2  
ATOM   3943   C  CG     . HIS A 1 8   ? 1.019   5.263   -10.289 1.00 0.00 ? 15  HIS A CG     2  
ATOM   3944   N  ND1    . HIS A 1 8   ? -0.129  6.023   -10.356 1.00 0.00 ? 15  HIS A ND1    2  
ATOM   3945   C  CD2    . HIS A 1 8   ? 1.495   5.201   -11.552 1.00 0.00 ? 15  HIS A CD2    2  
ATOM   3946   C  CE1    . HIS A 1 8   ? -0.335  6.397   -11.607 1.00 0.00 ? 15  HIS A CE1    2  
ATOM   3947   N  NE2    . HIS A 1 8   ? 0.638   5.913   -12.353 1.00 0.00 ? 15  HIS A NE2    2  
ATOM   3948   H  H      . HIS A 1 8   ? 4.445   4.723   -9.261  1.00 0.00 ? 15  HIS A H      2  
ATOM   3949   H  HA     . HIS A 1 8   ? 2.337   6.475   -8.198  1.00 0.00 ? 15  HIS A HA     2  
ATOM   3950   H  HB2    . HIS A 1 8   ? 1.893   3.668   -9.245  1.00 0.00 ? 15  HIS A HB2    2  
ATOM   3951   H  HB3    . HIS A 1 8   ? 0.710   4.588   -8.325  1.00 0.00 ? 15  HIS A HB3    2  
ATOM   3952   H  HD1    . HIS A 1 8   ? -0.703  6.262   -9.598  1.00 0.00 ? 15  HIS A HD1    2  
ATOM   3953   H  HD2    . HIS A 1 8   ? 2.386   4.681   -11.873 1.00 0.00 ? 15  HIS A HD2    2  
ATOM   3954   H  HE1    . HIS A 1 8   ? -1.170  6.985   -11.963 1.00 0.00 ? 15  HIS A HE1    2  
ATOM   3955   H  HE2    . HIS A 1 8   ? 0.853   6.224   -13.264 1.00 0.00 ? 15  HIS A HE2    2  
ATOM   3956   N  N      . LYS A 1 9   ? 2.691   5.569   -5.943  1.00 0.00 ? 16  LYS A N      2  
ATOM   3957   C  CA     . LYS A 1 9   ? 2.889   5.076   -4.586  1.00 0.00 ? 16  LYS A CA     2  
ATOM   3958   C  C      . LYS A 1 9   ? 1.544   4.853   -3.907  1.00 0.00 ? 16  LYS A C      2  
ATOM   3959   O  O      . LYS A 1 9   ? 0.794   5.804   -3.672  1.00 0.00 ? 16  LYS A O      2  
ATOM   3960   C  CB     . LYS A 1 9   ? 3.733   6.048   -3.755  1.00 0.00 ? 16  LYS A CB     2  
ATOM   3961   C  CG     . LYS A 1 9   ? 5.208   6.081   -4.136  1.00 0.00 ? 16  LYS A CG     2  
ATOM   3962   C  CD     . LYS A 1 9   ? 5.616   7.417   -4.745  1.00 0.00 ? 16  LYS A CD     2  
ATOM   3963   C  CE     . LYS A 1 9   ? 5.003   7.619   -6.121  1.00 0.00 ? 16  LYS A CE     2  
ATOM   3964   N  NZ     . LYS A 1 9   ? 5.338   8.948   -6.702  1.00 0.00 ? 16  LYS A NZ     2  
ATOM   3965   H  H      . LYS A 1 9   ? 2.308   6.472   -6.076  1.00 0.00 ? 16  LYS A H      2  
ATOM   3966   H  HA     . LYS A 1 9   ? 3.406   4.129   -4.653  1.00 0.00 ? 16  LYS A HA     2  
ATOM   3967   H  HB2    . LYS A 1 9   ? 3.332   7.046   -3.871  1.00 0.00 ? 16  LYS A HB2    2  
ATOM   3968   H  HB3    . LYS A 1 9   ? 3.661   5.764   -2.714  1.00 0.00 ? 16  LYS A HB3    2  
ATOM   3969   H  HG2    . LYS A 1 9   ? 5.796   5.910   -3.248  1.00 0.00 ? 16  LYS A HG2    2  
ATOM   3970   H  HG3    . LYS A 1 9   ? 5.401   5.295   -4.852  1.00 0.00 ? 16  LYS A HG3    2  
ATOM   3971   H  HD2    . LYS A 1 9   ? 5.286   8.215   -4.096  1.00 0.00 ? 16  LYS A HD2    2  
ATOM   3972   H  HD3    . LYS A 1 9   ? 6.692   7.445   -4.831  1.00 0.00 ? 16  LYS A HD3    2  
ATOM   3973   H  HE2    . LYS A 1 9   ? 5.371   6.843   -6.778  1.00 0.00 ? 16  LYS A HE2    2  
ATOM   3974   H  HE3    . LYS A 1 9   ? 3.929   7.534   -6.036  1.00 0.00 ? 16  LYS A HE3    2  
ATOM   3975   H  HZ1    . LYS A 1 9   ? 6.358   9.003   -6.909  1.00 0.00 ? 16  LYS A HZ1    2  
ATOM   3976   H  HZ2    . LYS A 1 9   ? 5.094   9.708   -6.028  1.00 0.00 ? 16  LYS A HZ2    2  
ATOM   3977   H  HZ3    . LYS A 1 9   ? 4.805   9.103   -7.580  1.00 0.00 ? 16  LYS A HZ3    2  
ATOM   3978   N  N      . VAL A 1 10  ? 1.242   3.602   -3.598  1.00 0.00 ? 17  VAL A N      2  
ATOM   3979   C  CA     . VAL A 1 10  ? -0.042  3.247   -3.014  1.00 0.00 ? 17  VAL A CA     2  
ATOM   3980   C  C      . VAL A 1 10  ? 0.135   2.699   -1.600  1.00 0.00 ? 17  VAL A C      2  
ATOM   3981   O  O      . VAL A 1 10  ? 0.953   1.810   -1.362  1.00 0.00 ? 17  VAL A O      2  
ATOM   3982   C  CB     . VAL A 1 10  ? -0.782  2.205   -3.882  1.00 0.00 ? 17  VAL A CB     2  
ATOM   3983   C  CG1    . VAL A 1 10  ? -2.104  1.805   -3.246  1.00 0.00 ? 17  VAL A CG1    2  
ATOM   3984   C  CG2    . VAL A 1 10  ? -1.007  2.740   -5.290  1.00 0.00 ? 17  VAL A CG2    2  
ATOM   3985   H  H      . VAL A 1 10  ? 1.912   2.892   -3.754  1.00 0.00 ? 17  VAL A H      2  
ATOM   3986   H  HA     . VAL A 1 10  ? -0.646  4.143   -2.968  1.00 0.00 ? 17  VAL A HA     2  
ATOM   3987   H  HB     . VAL A 1 10  ? -0.164  1.324   -3.953  1.00 0.00 ? 17  VAL A HB     2  
ATOM   3988   H  HG11   . VAL A 1 10  ? -1.919  1.393   -2.265  1.00 0.00 ? 17  VAL A HG11   2  
ATOM   3989   H  HG12   . VAL A 1 10  ? -2.590  1.066   -3.863  1.00 0.00 ? 17  VAL A HG12   2  
ATOM   3990   H  HG13   . VAL A 1 10  ? -2.738  2.675   -3.157  1.00 0.00 ? 17  VAL A HG13   2  
ATOM   3991   H  HG21   . VAL A 1 10  ? -1.521  1.997   -5.882  1.00 0.00 ? 17  VAL A HG21   2  
ATOM   3992   H  HG22   . VAL A 1 10  ? -0.054  2.968   -5.745  1.00 0.00 ? 17  VAL A HG22   2  
ATOM   3993   H  HG23   . VAL A 1 10  ? -1.605  3.638   -5.242  1.00 0.00 ? 17  VAL A HG23   2  
ATOM   3994   N  N      . ILE A 1 11  ? -0.625  3.242   -0.662  1.00 0.00 ? 18  ILE A N      2  
ATOM   3995   C  CA     . ILE A 1 11  ? -0.567  2.793   0.719   1.00 0.00 ? 18  ILE A CA     2  
ATOM   3996   C  C      . ILE A 1 11  ? -1.866  2.087   1.103   1.00 0.00 ? 18  ILE A C      2  
ATOM   3997   O  O      . ILE A 1 11  ? -2.957  2.636   0.935   1.00 0.00 ? 18  ILE A O      2  
ATOM   3998   C  CB     . ILE A 1 11  ? -0.314  3.974   1.684   1.00 0.00 ? 18  ILE A CB     2  
ATOM   3999   C  CG1    . ILE A 1 11  ? 0.990   4.693   1.314   1.00 0.00 ? 18  ILE A CG1    2  
ATOM   4000   C  CG2    . ILE A 1 11  ? -0.273  3.490   3.129   1.00 0.00 ? 18  ILE A CG2    2  
ATOM   4001   C  CD1    . ILE A 1 11  ? 1.306   5.890   2.191   1.00 0.00 ? 18  ILE A CD1    2  
ATOM   4002   H  H      . ILE A 1 11  ? -1.248  3.966   -0.906  1.00 0.00 ? 18  ILE A H      2  
ATOM   4003   H  HA     . ILE A 1 11  ? 0.254   2.095   0.810   1.00 0.00 ? 18  ILE A HA     2  
ATOM   4004   H  HB     . ILE A 1 11  ? -1.135  4.667   1.590   1.00 0.00 ? 18  ILE A HB     2  
ATOM   4005   H  HG12   . ILE A 1 11  ? 1.813   3.998   1.396   1.00 0.00 ? 18  ILE A HG12   2  
ATOM   4006   H  HG13   . ILE A 1 11  ? 0.920   5.040   0.294   1.00 0.00 ? 18  ILE A HG13   2  
ATOM   4007   H  HG21   . ILE A 1 11  ? -0.051  4.319   3.782   1.00 0.00 ? 18  ILE A HG21   2  
ATOM   4008   H  HG22   . ILE A 1 11  ? 0.490   2.734   3.234   1.00 0.00 ? 18  ILE A HG22   2  
ATOM   4009   H  HG23   . ILE A 1 11  ? -1.234  3.070   3.395   1.00 0.00 ? 18  ILE A HG23   2  
ATOM   4010   H  HD11   . ILE A 1 11  ? 2.237   6.334   1.873   1.00 0.00 ? 18  ILE A HD11   2  
ATOM   4011   H  HD12   . ILE A 1 11  ? 1.392   5.569   3.219   1.00 0.00 ? 18  ILE A HD12   2  
ATOM   4012   H  HD13   . ILE A 1 11  ? 0.512   6.619   2.108   1.00 0.00 ? 18  ILE A HD13   2  
ATOM   4013   N  N      . MET A 1 12  ? -1.746  0.860   1.596   1.00 0.00 ? 19  MET A N      2  
ATOM   4014   C  CA     . MET A 1 12  ? -2.908  0.106   2.050   1.00 0.00 ? 19  MET A CA     2  
ATOM   4015   C  C      . MET A 1 12  ? -3.066  0.212   3.557   1.00 0.00 ? 19  MET A C      2  
ATOM   4016   O  O      . MET A 1 12  ? -2.208  -0.250  4.310   1.00 0.00 ? 19  MET A O      2  
ATOM   4017   C  CB     . MET A 1 12  ? -2.802  -1.372  1.666   1.00 0.00 ? 19  MET A CB     2  
ATOM   4018   C  CG     . MET A 1 12  ? -3.242  -1.684  0.247   1.00 0.00 ? 19  MET A CG     2  
ATOM   4019   S  SD     . MET A 1 12  ? -3.381  -3.459  -0.036  1.00 0.00 ? 19  MET A SD     2  
ATOM   4020   C  CE     . MET A 1 12  ? -4.126  -3.495  -1.663  1.00 0.00 ? 19  MET A CE     2  
ATOM   4021   H  H      . MET A 1 12  ? -0.852  0.456   1.664   1.00 0.00 ? 19  MET A H      2  
ATOM   4022   H  HA     . MET A 1 12  ? -3.784  0.529   1.578   1.00 0.00 ? 19  MET A HA     2  
ATOM   4023   H  HB2    . MET A 1 12  ? -1.776  -1.689  1.777   1.00 0.00 ? 19  MET A HB2    2  
ATOM   4024   H  HB3    . MET A 1 12  ? -3.419  -1.948  2.340   1.00 0.00 ? 19  MET A HB3    2  
ATOM   4025   H  HG2    . MET A 1 12  ? -4.202  -1.224  0.070   1.00 0.00 ? 19  MET A HG2    2  
ATOM   4026   H  HG3    . MET A 1 12  ? -2.515  -1.278  -0.441  1.00 0.00 ? 19  MET A HG3    2  
ATOM   4027   H  HE1    . MET A 1 12  ? -5.085  -2.998  -1.630  1.00 0.00 ? 19  MET A HE1    2  
ATOM   4028   H  HE2    . MET A 1 12  ? -4.262  -4.521  -1.976  1.00 0.00 ? 19  MET A HE2    2  
ATOM   4029   H  HE3    . MET A 1 12  ? -3.480  -2.988  -2.367  1.00 0.00 ? 19  MET A HE3    2  
ATOM   4030   N  N      . VAL A 1 13  ? -4.172  0.793   3.990   1.00 0.00 ? 20  VAL A N      2  
ATOM   4031   C  CA     . VAL A 1 13  ? -4.472  0.917   5.414   1.00 0.00 ? 20  VAL A CA     2  
ATOM   4032   C  C      . VAL A 1 13  ? -5.371  -0.231  5.867   1.00 0.00 ? 20  VAL A C      2  
ATOM   4033   O  O      . VAL A 1 13  ? -5.760  -1.072  5.053   1.00 0.00 ? 20  VAL A O      2  
ATOM   4034   C  CB     . VAL A 1 13  ? -5.154  2.266   5.732   1.00 0.00 ? 20  VAL A CB     2  
ATOM   4035   C  CG1    . VAL A 1 13  ? -4.205  3.425   5.453   1.00 0.00 ? 20  VAL A CG1    2  
ATOM   4036   C  CG2    . VAL A 1 13  ? -6.438  2.424   4.932   1.00 0.00 ? 20  VAL A CG2    2  
ATOM   4037   H  H      . VAL A 1 13  ? -4.816  1.146   3.334   1.00 0.00 ? 20  VAL A H      2  
ATOM   4038   H  HA     . VAL A 1 13  ? -3.539  0.868   5.958   1.00 0.00 ? 20  VAL A HA     2  
ATOM   4039   H  HB     . VAL A 1 13  ? -5.404  2.282   6.783   1.00 0.00 ? 20  VAL A HB     2  
ATOM   4040   H  HG11   . VAL A 1 13  ? -3.918  3.411   4.413   1.00 0.00 ? 20  VAL A HG11   2  
ATOM   4041   H  HG12   . VAL A 1 13  ? -3.325  3.326   6.073   1.00 0.00 ? 20  VAL A HG12   2  
ATOM   4042   H  HG13   . VAL A 1 13  ? -4.701  4.358   5.677   1.00 0.00 ? 20  VAL A HG13   2  
ATOM   4043   H  HG21   . VAL A 1 13  ? -6.908  3.363   5.185   1.00 0.00 ? 20  VAL A HG21   2  
ATOM   4044   H  HG22   . VAL A 1 13  ? -7.109  1.611   5.165   1.00 0.00 ? 20  VAL A HG22   2  
ATOM   4045   H  HG23   . VAL A 1 13  ? -6.208  2.409   3.876   1.00 0.00 ? 20  VAL A HG23   2  
ATOM   4046   N  N      . GLY A 1 14  ? -5.664  -0.300  7.157   1.00 0.00 ? 21  GLY A N      2  
ATOM   4047   C  CA     . GLY A 1 14  ? -6.578  -1.317  7.648   1.00 0.00 ? 21  GLY A CA     2  
ATOM   4048   C  C      . GLY A 1 14  ? -6.352  -1.657  9.106   1.00 0.00 ? 21  GLY A C      2  
ATOM   4049   O  O      . GLY A 1 14  ? -5.715  -0.896  9.835   1.00 0.00 ? 21  GLY A O      2  
ATOM   4050   H  H      . GLY A 1 14  ? -5.248  0.334   7.789   1.00 0.00 ? 21  GLY A H      2  
ATOM   4051   H  HA2    . GLY A 1 14  ? -7.590  -0.962  7.527   1.00 0.00 ? 21  GLY A HA2    2  
ATOM   4052   H  HA3    . GLY A 1 14  ? -6.451  -2.212  7.056   1.00 0.00 ? 21  GLY A HA3    2  
ATOM   4053   N  N      . SER A 1 15  ? -6.867  -2.806  9.528   1.00 0.00 ? 22  SER A N      2  
ATOM   4054   C  CA     . SER A 1 15  ? -6.723  -3.258  10.907  1.00 0.00 ? 22  SER A CA     2  
ATOM   4055   C  C      . SER A 1 15  ? -5.394  -3.982  11.094  1.00 0.00 ? 22  SER A C      2  
ATOM   4056   O  O      . SER A 1 15  ? -4.989  -4.300  12.212  1.00 0.00 ? 22  SER A O      2  
ATOM   4057   C  CB     . SER A 1 15  ? -7.879  -4.194  11.253  1.00 0.00 ? 22  SER A CB     2  
ATOM   4058   O  OG     . SER A 1 15  ? -7.970  -5.240  10.300  1.00 0.00 ? 22  SER A OG     2  
ATOM   4059   H  H      . SER A 1 15  ? -7.363  -3.372  8.898   1.00 0.00 ? 22  SER A H      2  
ATOM   4060   H  HA     . SER A 1 15  ? -6.754  -2.396  11.553  1.00 0.00 ? 22  SER A HA     2  
ATOM   4061   H  HB2    . SER A 1 15  ? -7.714  -4.623  12.230  1.00 0.00 ? 22  SER A HB2    2  
ATOM   4062   H  HB3    . SER A 1 15  ? -8.805  -3.638  11.251  1.00 0.00 ? 22  SER A HB3    2  
ATOM   4063   H  HG     . SER A 1 15  ? -8.905  -5.502  10.192  1.00 0.00 ? 22  SER A HG     2  
ATOM   4064   N  N      . GLY A 1 16  ? -4.729  -4.242  9.979   1.00 0.00 ? 23  GLY A N      2  
ATOM   4065   C  CA     . GLY A 1 16  ? -3.484  -4.979  9.998   1.00 0.00 ? 23  GLY A CA     2  
ATOM   4066   C  C      . GLY A 1 16  ? -3.557  -6.201  9.112   1.00 0.00 ? 23  GLY A C      2  
ATOM   4067   O  O      . GLY A 1 16  ? -2.676  -6.437  8.285   1.00 0.00 ? 23  GLY A O      2  
ATOM   4068   H  H      . GLY A 1 16  ? -5.093  -3.929  9.129   1.00 0.00 ? 23  GLY A H      2  
ATOM   4069   H  HA2    . GLY A 1 16  ? -2.687  -4.334  9.648   1.00 0.00 ? 23  GLY A HA2    2  
ATOM   4070   H  HA3    . GLY A 1 16  ? -3.272  -5.291  11.012  1.00 0.00 ? 23  GLY A HA3    2  
ATOM   4071   N  N      . GLY A 1 17  ? -4.617  -6.974  9.286   1.00 0.00 ? 24  GLY A N      2  
ATOM   4072   C  CA     . GLY A 1 17  ? -4.851  -8.120  8.437   1.00 0.00 ? 24  GLY A CA     2  
ATOM   4073   C  C      . GLY A 1 17  ? -5.662  -7.757  7.211   1.00 0.00 ? 24  GLY A C      2  
ATOM   4074   O  O      . GLY A 1 17  ? -5.131  -7.168  6.265   1.00 0.00 ? 24  GLY A O      2  
ATOM   4075   H  H      . GLY A 1 17  ? -5.248  -6.771  10.015  1.00 0.00 ? 24  GLY A H      2  
ATOM   4076   H  HA2    . GLY A 1 17  ? -3.901  -8.527  8.122   1.00 0.00 ? 24  GLY A HA2    2  
ATOM   4077   H  HA3    . GLY A 1 17  ? -5.388  -8.867  9.001   1.00 0.00 ? 24  GLY A HA3    2  
ATOM   4078   N  N      . VAL A 1 18  ? -6.952  -8.101  7.241   1.00 0.00 ? 25  VAL A N      2  
ATOM   4079   C  CA     . VAL A 1 18  ? -7.893  -7.816  6.148   1.00 0.00 ? 25  VAL A CA     2  
ATOM   4080   C  C      . VAL A 1 18  ? -7.607  -8.667  4.907   1.00 0.00 ? 25  VAL A C      2  
ATOM   4081   O  O      . VAL A 1 18  ? -8.494  -9.341  4.385   1.00 0.00 ? 25  VAL A O      2  
ATOM   4082   C  CB     . VAL A 1 18  ? -7.885  -6.321  5.752   1.00 0.00 ? 25  VAL A CB     2  
ATOM   4083   C  CG1    . VAL A 1 18  ? -8.790  -6.083  4.553   1.00 0.00 ? 25  VAL A CG1    2  
ATOM   4084   C  CG2    . VAL A 1 18  ? -8.310  -5.452  6.930   1.00 0.00 ? 25  VAL A CG2    2  
ATOM   4085   H  H      . VAL A 1 18  ? -7.291  -8.556  8.036   1.00 0.00 ? 25  VAL A H      2  
ATOM   4086   H  HA     . VAL A 1 18  ? -8.882  -8.057  6.506   1.00 0.00 ? 25  VAL A HA     2  
ATOM   4087   H  HB     . VAL A 1 18  ? -6.877  -6.048  5.476   1.00 0.00 ? 25  VAL A HB     2  
ATOM   4088   H  HG11   . VAL A 1 18  ? -9.805  -6.350  4.808   1.00 0.00 ? 25  VAL A HG11   2  
ATOM   4089   H  HG12   . VAL A 1 18  ? -8.456  -6.688  3.724   1.00 0.00 ? 25  VAL A HG12   2  
ATOM   4090   H  HG13   . VAL A 1 18  ? -8.754  -5.040  4.274   1.00 0.00 ? 25  VAL A HG13   2  
ATOM   4091   H  HG21   . VAL A 1 18  ? -8.258  -4.411  6.649   1.00 0.00 ? 25  VAL A HG21   2  
ATOM   4092   H  HG22   . VAL A 1 18  ? -7.653  -5.631  7.767   1.00 0.00 ? 25  VAL A HG22   2  
ATOM   4093   H  HG23   . VAL A 1 18  ? -9.326  -5.697  7.212   1.00 0.00 ? 25  VAL A HG23   2  
ATOM   4094   N  N      . GLY A 1 19  ? -6.363  -8.642  4.464   1.00 0.00 ? 26  GLY A N      2  
ATOM   4095   C  CA     . GLY A 1 19  ? -5.972  -9.321  3.246   1.00 0.00 ? 26  GLY A CA     2  
ATOM   4096   C  C      . GLY A 1 19  ? -5.085  -8.450  2.379   1.00 0.00 ? 26  GLY A C      2  
ATOM   4097   O  O      . GLY A 1 19  ? -4.910  -8.714  1.189   1.00 0.00 ? 26  GLY A O      2  
ATOM   4098   H  H      . GLY A 1 19  ? -5.692  -8.156  4.989   1.00 0.00 ? 26  GLY A H      2  
ATOM   4099   H  HA2    . GLY A 1 19  ? -5.435  -10.222 3.505   1.00 0.00 ? 26  GLY A HA2    2  
ATOM   4100   H  HA3    . GLY A 1 19  ? -6.859  -9.587  2.688   1.00 0.00 ? 26  GLY A HA3    2  
ATOM   4101   N  N      . LYS A 1 20  ? -4.520  -7.409  2.988   1.00 0.00 ? 27  LYS A N      2  
ATOM   4102   C  CA     . LYS A 1 20  ? -3.662  -6.461  2.280   1.00 0.00 ? 27  LYS A CA     2  
ATOM   4103   C  C      . LYS A 1 20  ? -2.435  -7.149  1.679   1.00 0.00 ? 27  LYS A C      2  
ATOM   4104   O  O      . LYS A 1 20  ? -2.109  -6.940  0.511   1.00 0.00 ? 27  LYS A O      2  
ATOM   4105   C  CB     . LYS A 1 20  ? -3.228  -5.331  3.224   1.00 0.00 ? 27  LYS A CB     2  
ATOM   4106   C  CG     . LYS A 1 20  ? -2.714  -5.819  4.576   1.00 0.00 ? 27  LYS A CG     2  
ATOM   4107   C  CD     . LYS A 1 20  ? -2.144  -4.692  5.433   1.00 0.00 ? 27  LYS A CD     2  
ATOM   4108   C  CE     . LYS A 1 20  ? -3.209  -3.691  5.857   1.00 0.00 ? 27  LYS A CE     2  
ATOM   4109   N  NZ     . LYS A 1 20  ? -3.534  -2.725  4.776   1.00 0.00 ? 27  LYS A NZ     2  
ATOM   4110   H  H      . LYS A 1 20  ? -4.693  -7.268  3.939   1.00 0.00 ? 27  LYS A H      2  
ATOM   4111   H  HA     . LYS A 1 20  ? -4.242  -6.035  1.474   1.00 0.00 ? 27  LYS A HA     2  
ATOM   4112   H  HB2    . LYS A 1 20  ? -2.443  -4.764  2.748   1.00 0.00 ? 27  LYS A HB2    2  
ATOM   4113   H  HB3    . LYS A 1 20  ? -4.074  -4.681  3.398   1.00 0.00 ? 27  LYS A HB3    2  
ATOM   4114   H  HG2    . LYS A 1 20  ? -3.531  -6.279  5.111   1.00 0.00 ? 27  LYS A HG2    2  
ATOM   4115   H  HG3    . LYS A 1 20  ? -1.941  -6.555  4.407   1.00 0.00 ? 27  LYS A HG3    2  
ATOM   4116   H  HD2    . LYS A 1 20  ? -1.698  -5.120  6.320   1.00 0.00 ? 27  LYS A HD2    2  
ATOM   4117   H  HD3    . LYS A 1 20  ? -1.383  -4.174  4.866   1.00 0.00 ? 27  LYS A HD3    2  
ATOM   4118   H  HE2    . LYS A 1 20  ? -4.105  -4.231  6.125   1.00 0.00 ? 27  LYS A HE2    2  
ATOM   4119   H  HE3    . LYS A 1 20  ? -2.849  -3.145  6.718   1.00 0.00 ? 27  LYS A HE3    2  
ATOM   4120   H  HZ1    . LYS A 1 20  ? -2.756  -2.040  4.662   1.00 0.00 ? 27  LYS A HZ1    2  
ATOM   4121   H  HZ2    . LYS A 1 20  ? -4.406  -2.204  5.008   1.00 0.00 ? 27  LYS A HZ2    2  
ATOM   4122   H  HZ3    . LYS A 1 20  ? -3.672  -3.228  3.878   1.00 0.00 ? 27  LYS A HZ3    2  
ATOM   4123   N  N      . SER A 1 21  ? -1.768  -7.978  2.475   1.00 0.00 ? 28  SER A N      2  
ATOM   4124   C  CA     . SER A 1 21  ? -0.560  -8.657  2.028   1.00 0.00 ? 28  SER A CA     2  
ATOM   4125   C  C      . SER A 1 21  ? -0.877  -9.692  0.948   1.00 0.00 ? 28  SER A C      2  
ATOM   4126   O  O      . SER A 1 21  ? -0.023  -10.041 0.135   1.00 0.00 ? 28  SER A O      2  
ATOM   4127   C  CB     . SER A 1 21  ? 0.137   -9.323  3.217   1.00 0.00 ? 28  SER A CB     2  
ATOM   4128   O  OG     . SER A 1 21  ? 0.514   -8.365  4.205   1.00 0.00 ? 28  SER A OG     2  
ATOM   4129   H  H      . SER A 1 21  ? -2.091  -8.129  3.384   1.00 0.00 ? 28  SER A H      2  
ATOM   4130   H  HA     . SER A 1 21  ? 0.100   -7.913  1.608   1.00 0.00 ? 28  SER A HA     2  
ATOM   4131   H  HB2    . SER A 1 21  ? -0.533  -10.038 3.669   1.00 0.00 ? 28  SER A HB2    2  
ATOM   4132   H  HB3    . SER A 1 21  ? 1.025   -9.831  2.871   1.00 0.00 ? 28  SER A HB3    2  
ATOM   4133   H  HG     . SER A 1 21  ? 0.340   -7.461  3.858   1.00 0.00 ? 28  SER A HG     2  
ATOM   4134   N  N      . ALA A 1 22  ? -2.108  -10.185 0.950   1.00 0.00 ? 29  ALA A N      2  
ATOM   4135   C  CA     . ALA A 1 22  ? -2.538  -11.135 -0.059  1.00 0.00 ? 29  ALA A CA     2  
ATOM   4136   C  C      . ALA A 1 22  ? -2.704  -10.444 -1.408  1.00 0.00 ? 29  ALA A C      2  
ATOM   4137   O  O      . ALA A 1 22  ? -2.170  -10.900 -2.418  1.00 0.00 ? 29  ALA A O      2  
ATOM   4138   C  CB     . ALA A 1 22  ? -3.835  -11.811 0.361   1.00 0.00 ? 29  ALA A CB     2  
ATOM   4139   H  H      . ALA A 1 22  ? -2.741  -9.897  1.640   1.00 0.00 ? 29  ALA A H      2  
ATOM   4140   H  HA     . ALA A 1 22  ? -1.776  -11.895 -0.148  1.00 0.00 ? 29  ALA A HA     2  
ATOM   4141   H  HB1    . ALA A 1 22  ? -3.697  -12.285 1.322   1.00 0.00 ? 29  ALA A HB1    2  
ATOM   4142   H  HB2    . ALA A 1 22  ? -4.106  -12.558 -0.372  1.00 0.00 ? 29  ALA A HB2    2  
ATOM   4143   H  HB3    . ALA A 1 22  ? -4.620  -11.073 0.432   1.00 0.00 ? 29  ALA A HB3    2  
ATOM   4144   N  N      . LEU A 1 23  ? -3.426  -9.330  -1.408  1.00 0.00 ? 30  LEU A N      2  
ATOM   4145   C  CA     . LEU A 1 23  ? -3.723  -8.597  -2.638  1.00 0.00 ? 30  LEU A CA     2  
ATOM   4146   C  C      . LEU A 1 23  ? -2.451  -8.095  -3.314  1.00 0.00 ? 30  LEU A C      2  
ATOM   4147   O  O      . LEU A 1 23  ? -2.298  -8.210  -4.530  1.00 0.00 ? 30  LEU A O      2  
ATOM   4148   C  CB     . LEU A 1 23  ? -4.655  -7.419  -2.344  1.00 0.00 ? 30  LEU A CB     2  
ATOM   4149   C  CG     . LEU A 1 23  ? -6.056  -7.807  -1.870  1.00 0.00 ? 30  LEU A CG     2  
ATOM   4150   C  CD1    . LEU A 1 23  ? -6.884  -6.566  -1.586  1.00 0.00 ? 30  LEU A CD1    2  
ATOM   4151   C  CD2    . LEU A 1 23  ? -6.745  -8.676  -2.912  1.00 0.00 ? 30  LEU A CD2    2  
ATOM   4152   H  H      . LEU A 1 23  ? -3.768  -8.984  -0.554  1.00 0.00 ? 30  LEU A H      2  
ATOM   4153   H  HA     . LEU A 1 23  ? -4.226  -9.276  -3.312  1.00 0.00 ? 30  LEU A HA     2  
ATOM   4154   H  HB2    . LEU A 1 23  ? -4.197  -6.805  -1.583  1.00 0.00 ? 30  LEU A HB2    2  
ATOM   4155   H  HB3    . LEU A 1 23  ? -4.756  -6.833  -3.246  1.00 0.00 ? 30  LEU A HB3    2  
ATOM   4156   H  HG     . LEU A 1 23  ? -5.978  -8.376  -0.955  1.00 0.00 ? 30  LEU A HG     2  
ATOM   4157   H  HD11   . LEU A 1 23  ? -6.977  -5.985  -2.492  1.00 0.00 ? 30  LEU A HD11   2  
ATOM   4158   H  HD12   . LEU A 1 23  ? -6.397  -5.974  -0.825  1.00 0.00 ? 30  LEU A HD12   2  
ATOM   4159   H  HD13   . LEU A 1 23  ? -7.866  -6.859  -1.243  1.00 0.00 ? 30  LEU A HD13   2  
ATOM   4160   H  HD21   . LEU A 1 23  ? -7.728  -8.947  -2.559  1.00 0.00 ? 30  LEU A HD21   2  
ATOM   4161   H  HD22   . LEU A 1 23  ? -6.162  -9.570  -3.078  1.00 0.00 ? 30  LEU A HD22   2  
ATOM   4162   H  HD23   . LEU A 1 23  ? -6.833  -8.126  -3.837  1.00 0.00 ? 30  LEU A HD23   2  
ATOM   4163   N  N      . THR A 1 24  ? -1.535  -7.555  -2.522  1.00 0.00 ? 31  THR A N      2  
ATOM   4164   C  CA     . THR A 1 24  ? -0.305  -6.991  -3.055  1.00 0.00 ? 31  THR A CA     2  
ATOM   4165   C  C      . THR A 1 24  ? 0.588   -8.066  -3.672  1.00 0.00 ? 31  THR A C      2  
ATOM   4166   O  O      . THR A 1 24  ? 1.245   -7.828  -4.687  1.00 0.00 ? 31  THR A O      2  
ATOM   4167   C  CB     . THR A 1 24  ? 0.464   -6.225  -1.965  1.00 0.00 ? 31  THR A CB     2  
ATOM   4168   O  OG1    . THR A 1 24  ? 0.555   -7.014  -0.776  1.00 0.00 ? 31  THR A OG1    2  
ATOM   4169   C  CG2    . THR A 1 24  ? -0.235  -4.917  -1.643  1.00 0.00 ? 31  THR A CG2    2  
ATOM   4170   H  H      . THR A 1 24  ? -1.688  -7.533  -1.551  1.00 0.00 ? 31  THR A H      2  
ATOM   4171   H  HA     . THR A 1 24  ? -0.577  -6.287  -3.828  1.00 0.00 ? 31  THR A HA     2  
ATOM   4172   H  HB     . THR A 1 24  ? 1.459   -6.007  -2.326  1.00 0.00 ? 31  THR A HB     2  
ATOM   4173   H  HG1    . THR A 1 24  ? 0.223   -6.500  -0.033  1.00 0.00 ? 31  THR A HG1    2  
ATOM   4174   H  HG21   . THR A 1 24  ? -0.276  -4.302  -2.529  1.00 0.00 ? 31  THR A HG21   2  
ATOM   4175   H  HG22   . THR A 1 24  ? 0.314   -4.396  -0.871  1.00 0.00 ? 31  THR A HG22   2  
ATOM   4176   H  HG23   . THR A 1 24  ? -1.237  -5.121  -1.297  1.00 0.00 ? 31  THR A HG23   2  
ATOM   4177   N  N      . LEU A 1 25  ? 0.596   -9.251  -3.071  1.00 0.00 ? 32  LEU A N      2  
ATOM   4178   C  CA     . LEU A 1 25  ? 1.407   -10.347 -3.582  1.00 0.00 ? 32  LEU A CA     2  
ATOM   4179   C  C      . LEU A 1 25  ? 0.764   -10.963 -4.824  1.00 0.00 ? 32  LEU A C      2  
ATOM   4180   O  O      . LEU A 1 25  ? 1.461   -11.440 -5.720  1.00 0.00 ? 32  LEU A O      2  
ATOM   4181   C  CB     . LEU A 1 25  ? 1.626   -11.420 -2.511  1.00 0.00 ? 32  LEU A CB     2  
ATOM   4182   C  CG     . LEU A 1 25  ? 2.708   -12.450 -2.850  1.00 0.00 ? 32  LEU A CG     2  
ATOM   4183   C  CD1    . LEU A 1 25  ? 4.061   -11.768 -2.986  1.00 0.00 ? 32  LEU A CD1    2  
ATOM   4184   C  CD2    . LEU A 1 25  ? 2.770   -13.537 -1.792  1.00 0.00 ? 32  LEU A CD2    2  
ATOM   4185   H  H      . LEU A 1 25  ? 0.057   -9.383  -2.261  1.00 0.00 ? 32  LEU A H      2  
ATOM   4186   H  HA     . LEU A 1 25  ? 2.366   -9.936  -3.861  1.00 0.00 ? 32  LEU A HA     2  
ATOM   4187   H  HB2    . LEU A 1 25  ? 1.899   -10.927 -1.588  1.00 0.00 ? 32  LEU A HB2    2  
ATOM   4188   H  HB3    . LEU A 1 25  ? 0.694   -11.944 -2.358  1.00 0.00 ? 32  LEU A HB3    2  
ATOM   4189   H  HG     . LEU A 1 25  ? 2.471   -12.914 -3.797  1.00 0.00 ? 32  LEU A HG     2  
ATOM   4190   H  HD11   . LEU A 1 25  ? 4.016   -11.029 -3.771  1.00 0.00 ? 32  LEU A HD11   2  
ATOM   4191   H  HD12   . LEU A 1 25  ? 4.816   -12.504 -3.227  1.00 0.00 ? 32  LEU A HD12   2  
ATOM   4192   H  HD13   . LEU A 1 25  ? 4.315   -11.287 -2.052  1.00 0.00 ? 32  LEU A HD13   2  
ATOM   4193   H  HD21   . LEU A 1 25  ? 3.540   -14.248 -2.051  1.00 0.00 ? 32  LEU A HD21   2  
ATOM   4194   H  HD22   . LEU A 1 25  ? 1.817   -14.044 -1.736  1.00 0.00 ? 32  LEU A HD22   2  
ATOM   4195   H  HD23   . LEU A 1 25  ? 2.999   -13.095 -0.834  1.00 0.00 ? 32  LEU A HD23   2  
ATOM   4196   N  N      . GLN A 1 26  ? -0.567  -10.943 -4.884  1.00 0.00 ? 33  GLN A N      2  
ATOM   4197   C  CA     . GLN A 1 26  ? -1.281  -11.432 -6.061  1.00 0.00 ? 33  GLN A CA     2  
ATOM   4198   C  C      . GLN A 1 26  ? -1.054  -10.501 -7.239  1.00 0.00 ? 33  GLN A C      2  
ATOM   4199   O  O      . GLN A 1 26  ? -0.926  -10.941 -8.380  1.00 0.00 ? 33  GLN A O      2  
ATOM   4200   C  CB     . GLN A 1 26  ? -2.779  -11.574 -5.784  1.00 0.00 ? 33  GLN A CB     2  
ATOM   4201   C  CG     . GLN A 1 26  ? -3.089  -12.626 -4.740  1.00 0.00 ? 33  GLN A CG     2  
ATOM   4202   C  CD     . GLN A 1 26  ? -2.502  -13.972 -5.098  1.00 0.00 ? 33  GLN A CD     2  
ATOM   4203   O  OE1    . GLN A 1 26  ? -2.415  -14.338 -6.269  1.00 0.00 ? 33  GLN A OE1    2  
ATOM   4204   N  NE2    . GLN A 1 26  ? -2.057  -14.704 -4.093  1.00 0.00 ? 33  GLN A NE2    2  
ATOM   4205   H  H      . GLN A 1 26  ? -1.078  -10.601 -4.117  1.00 0.00 ? 33  GLN A H      2  
ATOM   4206   H  HA     . GLN A 1 26  ? -0.879  -12.401 -6.309  1.00 0.00 ? 33  GLN A HA     2  
ATOM   4207   H  HB2    . GLN A 1 26  ? -3.164  -10.625 -5.438  1.00 0.00 ? 33  GLN A HB2    2  
ATOM   4208   H  HB3    . GLN A 1 26  ? -3.282  -11.845 -6.701  1.00 0.00 ? 33  GLN A HB3    2  
ATOM   4209   H  HG2    . GLN A 1 26  ? -2.680  -12.309 -3.792  1.00 0.00 ? 33  GLN A HG2    2  
ATOM   4210   H  HG3    . GLN A 1 26  ? -4.162  -12.727 -4.656  1.00 0.00 ? 33  GLN A HG3    2  
ATOM   4211   H  HE21   . GLN A 1 26  ? -2.134  -14.340 -3.187  1.00 0.00 ? 33  GLN A HE21   2  
ATOM   4212   H  HE22   . GLN A 1 26  ? -1.651  -15.573 -4.303  1.00 0.00 ? 33  GLN A HE22   2  
ATOM   4213   N  N      . PHE A 1 27  ? -0.991  -9.209  -6.951  1.00 0.00 ? 34  PHE A N      2  
ATOM   4214   C  CA     . PHE A 1 27  ? -0.686  -8.208  -7.965  1.00 0.00 ? 34  PHE A CA     2  
ATOM   4215   C  C      . PHE A 1 27  ? 0.799   -8.269  -8.343  1.00 0.00 ? 34  PHE A C      2  
ATOM   4216   O  O      . PHE A 1 27  ? 1.267   -7.537  -9.216  1.00 0.00 ? 34  PHE A O      2  
ATOM   4217   C  CB     . PHE A 1 27  ? -1.059  -6.815  -7.445  1.00 0.00 ? 34  PHE A CB     2  
ATOM   4218   C  CG     . PHE A 1 27  ? -0.970  -5.725  -8.478  1.00 0.00 ? 34  PHE A CG     2  
ATOM   4219   C  CD1    . PHE A 1 27  ? -1.870  -5.678  -9.530  1.00 0.00 ? 34  PHE A CD1    2  
ATOM   4220   C  CD2    . PHE A 1 27  ? 0.011   -4.747  -8.396  1.00 0.00 ? 34  PHE A CD2    2  
ATOM   4221   C  CE1    . PHE A 1 27  ? -1.795  -4.678  -10.480 1.00 0.00 ? 34  PHE A CE1    2  
ATOM   4222   C  CE2    . PHE A 1 27  ? 0.090   -3.743  -9.343  1.00 0.00 ? 34  PHE A CE2    2  
ATOM   4223   C  CZ     . PHE A 1 27  ? -0.813  -3.708  -10.387 1.00 0.00 ? 34  PHE A CZ     2  
ATOM   4224   H  H      . PHE A 1 27  ? -1.164  -8.918  -6.029  1.00 0.00 ? 34  PHE A H      2  
ATOM   4225   H  HA     . PHE A 1 27  ? -1.281  -8.429  -8.840  1.00 0.00 ? 34  PHE A HA     2  
ATOM   4226   H  HB2    . PHE A 1 27  ? -2.075  -6.838  -7.081  1.00 0.00 ? 34  PHE A HB2    2  
ATOM   4227   H  HB3    . PHE A 1 27  ? -0.398  -6.557  -6.631  1.00 0.00 ? 34  PHE A HB3    2  
ATOM   4228   H  HD1    . PHE A 1 27  ? -2.637  -6.435  -9.606  1.00 0.00 ? 34  PHE A HD1    2  
ATOM   4229   H  HD2    . PHE A 1 27  ? 0.720   -4.774  -7.580  1.00 0.00 ? 34  PHE A HD2    2  
ATOM   4230   H  HE1    . PHE A 1 27  ? -2.503  -4.654  -11.296 1.00 0.00 ? 34  PHE A HE1    2  
ATOM   4231   H  HE2    . PHE A 1 27  ? 0.859   -2.988  -9.266  1.00 0.00 ? 34  PHE A HE2    2  
ATOM   4232   H  HZ     . PHE A 1 27  ? -0.755  -2.923  -11.128 1.00 0.00 ? 34  PHE A HZ     2  
ATOM   4233   N  N      . MET A 1 28  ? 1.537   -9.151  -7.679  1.00 0.00 ? 35  MET A N      2  
ATOM   4234   C  CA     . MET A 1 28  ? 2.961   -9.301  -7.931  1.00 0.00 ? 35  MET A CA     2  
ATOM   4235   C  C      . MET A 1 28  ? 3.241   -10.586 -8.706  1.00 0.00 ? 35  MET A C      2  
ATOM   4236   O  O      . MET A 1 28  ? 3.817   -10.553 -9.791  1.00 0.00 ? 35  MET A O      2  
ATOM   4237   C  CB     . MET A 1 28  ? 3.743   -9.324  -6.616  1.00 0.00 ? 35  MET A CB     2  
ATOM   4238   C  CG     . MET A 1 28  ? 5.240   -9.143  -6.805  1.00 0.00 ? 35  MET A CG     2  
ATOM   4239   S  SD     . MET A 1 28  ? 5.676   -7.425  -7.123  1.00 0.00 ? 35  MET A SD     2  
ATOM   4240   C  CE     . MET A 1 28  ? 5.240   -6.683  -5.549  1.00 0.00 ? 35  MET A CE     2  
ATOM   4241   H  H      . MET A 1 28  ? 1.106   -9.721  -7.006  1.00 0.00 ? 35  MET A H      2  
ATOM   4242   H  HA     . MET A 1 28  ? 3.288   -8.456  -8.521  1.00 0.00 ? 35  MET A HA     2  
ATOM   4243   H  HB2    . MET A 1 28  ? 3.382   -8.528  -5.982  1.00 0.00 ? 35  MET A HB2    2  
ATOM   4244   H  HB3    . MET A 1 28  ? 3.574   -10.270 -6.124  1.00 0.00 ? 35  MET A HB3    2  
ATOM   4245   H  HG2    . MET A 1 28  ? 5.750   -9.474  -5.912  1.00 0.00 ? 35  MET A HG2    2  
ATOM   4246   H  HG3    . MET A 1 28  ? 5.558   -9.741  -7.647  1.00 0.00 ? 35  MET A HG3    2  
ATOM   4247   H  HE1    . MET A 1 28  ? 5.809   -7.152  -4.760  1.00 0.00 ? 35  MET A HE1    2  
ATOM   4248   H  HE2    . MET A 1 28  ? 4.185   -6.825  -5.364  1.00 0.00 ? 35  MET A HE2    2  
ATOM   4249   H  HE3    . MET A 1 28  ? 5.462   -5.626  -5.574  1.00 0.00 ? 35  MET A HE3    2  
ATOM   4250   N  N      . TYR A 1 29  ? 2.827   -11.714 -8.141  1.00 0.00 ? 36  TYR A N      2  
ATOM   4251   C  CA     . TYR A 1 29  ? 3.113   -13.016 -8.730  1.00 0.00 ? 36  TYR A CA     2  
ATOM   4252   C  C      . TYR A 1 29  ? 1.947   -13.514 -9.577  1.00 0.00 ? 36  TYR A C      2  
ATOM   4253   O  O      . TYR A 1 29  ? 1.710   -13.011 -10.678 1.00 0.00 ? 36  TYR A O      2  
ATOM   4254   C  CB     . TYR A 1 29  ? 3.449   -14.042 -7.641  1.00 0.00 ? 36  TYR A CB     2  
ATOM   4255   C  CG     . TYR A 1 29  ? 4.828   -13.886 -7.035  1.00 0.00 ? 36  TYR A CG     2  
ATOM   4256   C  CD1    . TYR A 1 29  ? 5.159   -12.770 -6.275  1.00 0.00 ? 36  TYR A CD1    2  
ATOM   4257   C  CD2    . TYR A 1 29  ? 5.797   -14.865 -7.218  1.00 0.00 ? 36  TYR A CD2    2  
ATOM   4258   C  CE1    . TYR A 1 29  ? 6.418   -12.633 -5.717  1.00 0.00 ? 36  TYR A CE1    2  
ATOM   4259   C  CE2    . TYR A 1 29  ? 7.056   -14.734 -6.663  1.00 0.00 ? 36  TYR A CE2    2  
ATOM   4260   C  CZ     . TYR A 1 29  ? 7.361   -13.617 -5.916  1.00 0.00 ? 36  TYR A CZ     2  
ATOM   4261   O  OH     . TYR A 1 29  ? 8.614   -13.489 -5.362  1.00 0.00 ? 36  TYR A OH     2  
ATOM   4262   H  H      . TYR A 1 29  ? 2.302   -11.671 -7.312  1.00 0.00 ? 36  TYR A H      2  
ATOM   4263   H  HA     . TYR A 1 29  ? 3.974   -12.899 -9.371  1.00 0.00 ? 36  TYR A HA     2  
ATOM   4264   H  HB2    . TYR A 1 29  ? 2.728   -13.953 -6.841  1.00 0.00 ? 36  TYR A HB2    2  
ATOM   4265   H  HB3    . TYR A 1 29  ? 3.384   -15.034 -8.064  1.00 0.00 ? 36  TYR A HB3    2  
ATOM   4266   H  HD1    . TYR A 1 29  ? 4.420   -11.999 -6.122  1.00 0.00 ? 36  TYR A HD1    2  
ATOM   4267   H  HD2    . TYR A 1 29  ? 5.557   -15.739 -7.803  1.00 0.00 ? 36  TYR A HD2    2  
ATOM   4268   H  HE1    . TYR A 1 29  ? 6.658   -11.756 -5.129  1.00 0.00 ? 36  TYR A HE1    2  
ATOM   4269   H  HE2    . TYR A 1 29  ? 7.797   -15.506 -6.818  1.00 0.00 ? 36  TYR A HE2    2  
ATOM   4270   H  HH     . TYR A 1 29  ? 9.274   -13.860 -5.971  1.00 0.00 ? 36  TYR A HH     2  
ATOM   4271   N  N      . ASP A 1 30  ? 1.209   -14.486 -9.042  1.00 0.00 ? 37  ASP A N      2  
ATOM   4272   C  CA     . ASP A 1 30  ? 0.130   -15.146 -9.780  1.00 0.00 ? 37  ASP A CA     2  
ATOM   4273   C  C      . ASP A 1 30  ? -0.508  -16.254 -8.944  1.00 0.00 ? 37  ASP A C      2  
ATOM   4274   O  O      . ASP A 1 30  ? -1.700  -16.533 -9.081  1.00 0.00 ? 37  ASP A O      2  
ATOM   4275   C  CB     . ASP A 1 30  ? 0.643   -15.736 -11.107 1.00 0.00 ? 37  ASP A CB     2  
ATOM   4276   C  CG     . ASP A 1 30  ? 1.524   -16.961 -10.928 1.00 0.00 ? 37  ASP A CG     2  
ATOM   4277   O  OD1    . ASP A 1 30  ? 2.562   -16.861 -10.241 1.00 0.00 ? 37  ASP A OD1    2  
ATOM   4278   O  OD2    . ASP A 1 30  ? 1.180   -18.024 -11.481 1.00 0.00 ? 37  ASP A OD2    2  
ATOM   4279   H  H      . ASP A 1 30  ? 1.384   -14.758 -8.119  1.00 0.00 ? 37  ASP A H      2  
ATOM   4280   H  HA     . ASP A 1 30  ? -0.620  -14.401 -9.999  1.00 0.00 ? 37  ASP A HA     2  
ATOM   4281   H  HB2    . ASP A 1 30  ? -0.203  -16.018 -11.712 1.00 0.00 ? 37  ASP A HB2    2  
ATOM   4282   H  HB3    . ASP A 1 30  ? 1.213   -14.980 -11.628 1.00 0.00 ? 37  ASP A HB3    2  
ATOM   4283   N  N      . GLU A 1 31  ? 0.283   -16.881 -8.077  1.00 0.00 ? 38  GLU A N      2  
ATOM   4284   C  CA     . GLU A 1 31  ? -0.210  -17.969 -7.238  1.00 0.00 ? 38  GLU A CA     2  
ATOM   4285   C  C      . GLU A 1 31  ? -0.591  -17.463 -5.853  1.00 0.00 ? 38  GLU A C      2  
ATOM   4286   O  O      . GLU A 1 31  ? -0.223  -16.353 -5.459  1.00 0.00 ? 38  GLU A O      2  
ATOM   4287   C  CB     . GLU A 1 31  ? 0.841   -19.076 -7.116  1.00 0.00 ? 38  GLU A CB     2  
ATOM   4288   C  CG     . GLU A 1 31  ? 2.171   -18.600 -6.556  1.00 0.00 ? 38  GLU A CG     2  
ATOM   4289   C  CD     . GLU A 1 31  ? 3.140   -19.738 -6.320  1.00 0.00 ? 38  GLU A CD     2  
ATOM   4290   O  OE1    . GLU A 1 31  ? 3.627   -20.322 -7.309  1.00 0.00 ? 38  GLU A OE1    2  
ATOM   4291   O  OE2    . GLU A 1 31  ? 3.412   -20.059 -5.144  1.00 0.00 ? 38  GLU A OE2    2  
ATOM   4292   H  H      . GLU A 1 31  ? 1.224   -16.625 -8.018  1.00 0.00 ? 38  GLU A H      2  
ATOM   4293   H  HA     . GLU A 1 31  ? -1.091  -18.376 -7.711  1.00 0.00 ? 38  GLU A HA     2  
ATOM   4294   H  HB2    . GLU A 1 31  ? 0.459   -19.849 -6.465  1.00 0.00 ? 38  GLU A HB2    2  
ATOM   4295   H  HB3    . GLU A 1 31  ? 1.020   -19.499 -8.094  1.00 0.00 ? 38  GLU A HB3    2  
ATOM   4296   H  HG2    . GLU A 1 31  ? 2.614   -17.908 -7.257  1.00 0.00 ? 38  GLU A HG2    2  
ATOM   4297   H  HG3    . GLU A 1 31  ? 1.991   -18.097 -5.616  1.00 0.00 ? 38  GLU A HG3    2  
ATOM   4298   N  N      . PHE A 1 32  ? -1.320  -18.287 -5.113  1.00 0.00 ? 39  PHE A N      2  
ATOM   4299   C  CA     . PHE A 1 32  ? -1.850  -17.891 -3.817  1.00 0.00 ? 39  PHE A CA     2  
ATOM   4300   C  C      . PHE A 1 32  ? -0.755  -17.911 -2.751  1.00 0.00 ? 39  PHE A C      2  
ATOM   4301   O  O      . PHE A 1 32  ? 0.111   -18.785 -2.749  1.00 0.00 ? 39  PHE A O      2  
ATOM   4302   C  CB     . PHE A 1 32  ? -3.012  -18.807 -3.418  1.00 0.00 ? 39  PHE A CB     2  
ATOM   4303   C  CG     . PHE A 1 32  ? -3.735  -18.367 -2.175  1.00 0.00 ? 39  PHE A CG     2  
ATOM   4304   C  CD1    . PHE A 1 32  ? -4.498  -17.210 -2.173  1.00 0.00 ? 39  PHE A CD1    2  
ATOM   4305   C  CD2    . PHE A 1 32  ? -3.650  -19.111 -1.010  1.00 0.00 ? 39  PHE A CD2    2  
ATOM   4306   C  CE1    . PHE A 1 32  ? -5.161  -16.802 -1.033  1.00 0.00 ? 39  PHE A CE1    2  
ATOM   4307   C  CE2    . PHE A 1 32  ? -4.313  -18.707 0.135   1.00 0.00 ? 39  PHE A CE2    2  
ATOM   4308   C  CZ     . PHE A 1 32  ? -5.069  -17.552 0.123   1.00 0.00 ? 39  PHE A CZ     2  
ATOM   4309   H  H      . PHE A 1 32  ? -1.494  -19.199 -5.444  1.00 0.00 ? 39  PHE A H      2  
ATOM   4310   H  HA     . PHE A 1 32  ? -2.219  -16.881 -3.911  1.00 0.00 ? 39  PHE A HA     2  
ATOM   4311   H  HB2    . PHE A 1 32  ? -3.729  -18.836 -4.224  1.00 0.00 ? 39  PHE A HB2    2  
ATOM   4312   H  HB3    . PHE A 1 32  ? -2.631  -19.804 -3.246  1.00 0.00 ? 39  PHE A HB3    2  
ATOM   4313   H  HD1    . PHE A 1 32  ? -4.571  -16.623 -3.075  1.00 0.00 ? 39  PHE A HD1    2  
ATOM   4314   H  HD2    . PHE A 1 32  ? -3.057  -20.013 -0.999  1.00 0.00 ? 39  PHE A HD2    2  
ATOM   4315   H  HE1    . PHE A 1 32  ? -5.752  -15.895 -1.044  1.00 0.00 ? 39  PHE A HE1    2  
ATOM   4316   H  HE2    . PHE A 1 32  ? -4.241  -19.298 1.037   1.00 0.00 ? 39  PHE A HE2    2  
ATOM   4317   H  HZ     . PHE A 1 32  ? -5.586  -17.237 1.016   1.00 0.00 ? 39  PHE A HZ     2  
ATOM   4318   N  N      . VAL A 1 33  ? -0.809  -16.940 -1.845  1.00 0.00 ? 40  VAL A N      2  
ATOM   4319   C  CA     . VAL A 1 33  ? 0.208   -16.790 -0.809  1.00 0.00 ? 40  VAL A CA     2  
ATOM   4320   C  C      . VAL A 1 33  ? 0.044   -17.835 0.293   1.00 0.00 ? 40  VAL A C      2  
ATOM   4321   O  O      . VAL A 1 33  ? -1.061  -18.092 0.772   1.00 0.00 ? 40  VAL A O      2  
ATOM   4322   C  CB     . VAL A 1 33  ? 0.183   -15.367 -0.192  1.00 0.00 ? 40  VAL A CB     2  
ATOM   4323   C  CG1    . VAL A 1 33  ? -1.200  -15.022 0.337   1.00 0.00 ? 40  VAL A CG1    2  
ATOM   4324   C  CG2    . VAL A 1 33  ? 1.227   -15.228 0.910   1.00 0.00 ? 40  VAL A CG2    2  
ATOM   4325   H  H      . VAL A 1 33  ? -1.559  -16.315 -1.866  1.00 0.00 ? 40  VAL A H      2  
ATOM   4326   H  HA     . VAL A 1 33  ? 1.171   -16.934 -1.277  1.00 0.00 ? 40  VAL A HA     2  
ATOM   4327   H  HB     . VAL A 1 33  ? 0.426   -14.660 -0.973  1.00 0.00 ? 40  VAL A HB     2  
ATOM   4328   H  HG11   . VAL A 1 33  ? -1.473  -15.723 1.112   1.00 0.00 ? 40  VAL A HG11   2  
ATOM   4329   H  HG12   . VAL A 1 33  ? -1.917  -15.079 -0.468  1.00 0.00 ? 40  VAL A HG12   2  
ATOM   4330   H  HG13   . VAL A 1 33  ? -1.191  -14.020 0.742   1.00 0.00 ? 40  VAL A HG13   2  
ATOM   4331   H  HG21   . VAL A 1 33  ? 1.193   -14.226 1.315   1.00 0.00 ? 40  VAL A HG21   2  
ATOM   4332   H  HG22   . VAL A 1 33  ? 2.209   -15.419 0.501   1.00 0.00 ? 40  VAL A HG22   2  
ATOM   4333   H  HG23   . VAL A 1 33  ? 1.018   -15.940 1.695   1.00 0.00 ? 40  VAL A HG23   2  
ATOM   4334   N  N      . GLU A 1 34  ? 1.153   -18.448 0.672   1.00 0.00 ? 41  GLU A N      2  
ATOM   4335   C  CA     . GLU A 1 34  ? 1.163   -19.414 1.756   1.00 0.00 ? 41  GLU A CA     2  
ATOM   4336   C  C      . GLU A 1 34  ? 2.213   -19.029 2.796   1.00 0.00 ? 41  GLU A C      2  
ATOM   4337   O  O      . GLU A 1 34  ? 2.033   -19.254 3.993   1.00 0.00 ? 41  GLU A O      2  
ATOM   4338   C  CB     . GLU A 1 34  ? 1.441   -20.818 1.211   1.00 0.00 ? 41  GLU A CB     2  
ATOM   4339   C  CG     . GLU A 1 34  ? 1.416   -21.900 2.275   1.00 0.00 ? 41  GLU A CG     2  
ATOM   4340   C  CD     . GLU A 1 34  ? 1.629   -23.281 1.702   1.00 0.00 ? 41  GLU A CD     2  
ATOM   4341   O  OE1    . GLU A 1 34  ? 2.769   -23.593 1.308   1.00 0.00 ? 41  GLU A OE1    2  
ATOM   4342   O  OE2    . GLU A 1 34  ? 0.657   -24.063 1.657   1.00 0.00 ? 41  GLU A OE2    2  
ATOM   4343   H  H      . GLU A 1 34  ? 1.994   -18.246 0.202   1.00 0.00 ? 41  GLU A H      2  
ATOM   4344   H  HA     . GLU A 1 34  ? 0.189   -19.402 2.223   1.00 0.00 ? 41  GLU A HA     2  
ATOM   4345   H  HB2    . GLU A 1 34  ? 0.694   -21.057 0.468   1.00 0.00 ? 41  GLU A HB2    2  
ATOM   4346   H  HB3    . GLU A 1 34  ? 2.415   -20.825 0.744   1.00 0.00 ? 41  GLU A HB3    2  
ATOM   4347   H  HG2    . GLU A 1 34  ? 2.199   -21.699 2.993   1.00 0.00 ? 41  GLU A HG2    2  
ATOM   4348   H  HG3    . GLU A 1 34  ? 0.458   -21.874 2.775   1.00 0.00 ? 41  GLU A HG3    2  
ATOM   4349   N  N      . ASP A 1 35  ? 3.304   -18.430 2.332   1.00 0.00 ? 42  ASP A N      2  
ATOM   4350   C  CA     . ASP A 1 35  ? 4.383   -18.016 3.223   1.00 0.00 ? 42  ASP A CA     2  
ATOM   4351   C  C      . ASP A 1 35  ? 5.021   -16.716 2.734   1.00 0.00 ? 42  ASP A C      2  
ATOM   4352   O  O      . ASP A 1 35  ? 5.694   -16.697 1.701   1.00 0.00 ? 42  ASP A O      2  
ATOM   4353   C  CB     . ASP A 1 35  ? 5.440   -19.120 3.323   1.00 0.00 ? 42  ASP A CB     2  
ATOM   4354   C  CG     . ASP A 1 35  ? 6.569   -18.773 4.276   1.00 0.00 ? 42  ASP A CG     2  
ATOM   4355   O  OD1    . ASP A 1 35  ? 6.369   -18.879 5.505   1.00 0.00 ? 42  ASP A OD1    2  
ATOM   4356   O  OD2    . ASP A 1 35  ? 7.662   -18.411 3.797   1.00 0.00 ? 42  ASP A OD2    2  
ATOM   4357   H  H      . ASP A 1 35  ? 3.390   -18.266 1.369   1.00 0.00 ? 42  ASP A H      2  
ATOM   4358   H  HA     . ASP A 1 35  ? 3.958   -17.847 4.202   1.00 0.00 ? 42  ASP A HA     2  
ATOM   4359   H  HB2    . ASP A 1 35  ? 4.971   -20.029 3.669   1.00 0.00 ? 42  ASP A HB2    2  
ATOM   4360   H  HB3    . ASP A 1 35  ? 5.863   -19.291 2.344   1.00 0.00 ? 42  ASP A HB3    2  
ATOM   4361   N  N      . TYR A 1 36  ? 4.782   -15.633 3.468   1.00 0.00 ? 43  TYR A N      2  
ATOM   4362   C  CA     . TYR A 1 36  ? 5.354   -14.327 3.146   1.00 0.00 ? 43  TYR A CA     2  
ATOM   4363   C  C      . TYR A 1 36  ? 5.168   -13.376 4.330   1.00 0.00 ? 43  TYR A C      2  
ATOM   4364   O  O      . TYR A 1 36  ? 4.081   -12.829 4.536   1.00 0.00 ? 43  TYR A O      2  
ATOM   4365   C  CB     . TYR A 1 36  ? 4.706   -13.748 1.886   1.00 0.00 ? 43  TYR A CB     2  
ATOM   4366   C  CG     . TYR A 1 36  ? 5.419   -12.532 1.340   1.00 0.00 ? 43  TYR A CG     2  
ATOM   4367   C  CD1    . TYR A 1 36  ? 6.717   -12.627 0.853   1.00 0.00 ? 43  TYR A CD1    2  
ATOM   4368   C  CD2    . TYR A 1 36  ? 4.794   -11.294 1.303   1.00 0.00 ? 43  TYR A CD2    2  
ATOM   4369   C  CE1    . TYR A 1 36  ? 7.371   -11.520 0.344   1.00 0.00 ? 43  TYR A CE1    2  
ATOM   4370   C  CE2    . TYR A 1 36  ? 5.443   -10.185 0.797   1.00 0.00 ? 43  TYR A CE2    2  
ATOM   4371   C  CZ     . TYR A 1 36  ? 6.729   -10.302 0.320   1.00 0.00 ? 43  TYR A CZ     2  
ATOM   4372   O  OH     . TYR A 1 36  ? 7.376   -9.196  -0.182  1.00 0.00 ? 43  TYR A OH     2  
ATOM   4373   H  H      . TYR A 1 36  ? 4.206   -15.713 4.260   1.00 0.00 ? 43  TYR A H      2  
ATOM   4374   H  HA     . TYR A 1 36  ? 6.412   -14.463 2.970   1.00 0.00 ? 43  TYR A HA     2  
ATOM   4375   H  HB2    . TYR A 1 36  ? 4.699   -14.503 1.115   1.00 0.00 ? 43  TYR A HB2    2  
ATOM   4376   H  HB3    . TYR A 1 36  ? 3.689   -13.463 2.112   1.00 0.00 ? 43  TYR A HB3    2  
ATOM   4377   H  HD1    . TYR A 1 36  ? 7.217   -13.585 0.874   1.00 0.00 ? 43  TYR A HD1    2  
ATOM   4378   H  HD2    . TYR A 1 36  ? 3.785   -11.203 1.678   1.00 0.00 ? 43  TYR A HD2    2  
ATOM   4379   H  HE1    . TYR A 1 36  ? 8.381   -11.615 -0.029  1.00 0.00 ? 43  TYR A HE1    2  
ATOM   4380   H  HE2    . TYR A 1 36  ? 4.939   -9.230  0.779   1.00 0.00 ? 43  TYR A HE2    2  
ATOM   4381   H  HH     . TYR A 1 36  ? 7.324   -8.478  0.458   1.00 0.00 ? 43  TYR A HH     2  
ATOM   4382   N  N      . GLU A 1 37  ? 6.228   -13.194 5.107   1.00 0.00 ? 44  GLU A N      2  
ATOM   4383   C  CA     . GLU A 1 37  ? 6.150   -12.450 6.364   1.00 0.00 ? 44  GLU A CA     2  
ATOM   4384   C  C      . GLU A 1 37  ? 6.446   -10.944 6.207   1.00 0.00 ? 44  GLU A C      2  
ATOM   4385   O  O      . GLU A 1 37  ? 5.586   -10.112 6.515   1.00 0.00 ? 44  GLU A O      2  
ATOM   4386   C  CB     . GLU A 1 37  ? 7.111   -13.063 7.387   1.00 0.00 ? 44  GLU A CB     2  
ATOM   4387   C  CG     . GLU A 1 37  ? 6.864   -14.541 7.647   1.00 0.00 ? 44  GLU A CG     2  
ATOM   4388   C  CD     . GLU A 1 37  ? 7.977   -15.190 8.438   1.00 0.00 ? 44  GLU A CD     2  
ATOM   4389   O  OE1    . GLU A 1 37  ? 8.961   -15.647 7.818   1.00 0.00 ? 44  GLU A OE1    2  
ATOM   4390   O  OE2    . GLU A 1 37  ? 7.873   -15.249 9.678   1.00 0.00 ? 44  GLU A OE2    2  
ATOM   4391   H  H      . GLU A 1 37  ? 7.092   -13.584 4.834   1.00 0.00 ? 44  GLU A H      2  
ATOM   4392   H  HA     . GLU A 1 37  ? 5.144   -12.559 6.739   1.00 0.00 ? 44  GLU A HA     2  
ATOM   4393   H  HB2    . GLU A 1 37  ? 8.124   -12.947 7.028   1.00 0.00 ? 44  GLU A HB2    2  
ATOM   4394   H  HB3    . GLU A 1 37  ? 7.009   -12.533 8.322   1.00 0.00 ? 44  GLU A HB3    2  
ATOM   4395   H  HG2    . GLU A 1 37  ? 5.942   -14.647 8.200   1.00 0.00 ? 44  GLU A HG2    2  
ATOM   4396   H  HG3    . GLU A 1 37  ? 6.774   -15.048 6.697   1.00 0.00 ? 44  GLU A HG3    2  
ATOM   4397   N  N      . PRO A 1 38  ? 7.653   -10.563 5.726   1.00 0.00 ? 45  PRO A N      2  
ATOM   4398   C  CA     . PRO A 1 38  ? 8.132   -9.173  5.803   1.00 0.00 ? 45  PRO A CA     2  
ATOM   4399   C  C      . PRO A 1 38  ? 7.473   -8.217  4.805   1.00 0.00 ? 45  PRO A C      2  
ATOM   4400   O  O      . PRO A 1 38  ? 7.691   -8.312  3.598   1.00 0.00 ? 45  PRO A O      2  
ATOM   4401   C  CB     . PRO A 1 38  ? 9.626   -9.306  5.502   1.00 0.00 ? 45  PRO A CB     2  
ATOM   4402   C  CG     . PRO A 1 38  ? 9.730   -10.500 4.619   1.00 0.00 ? 45  PRO A CG     2  
ATOM   4403   C  CD     . PRO A 1 38  ? 8.636   -11.440 5.051   1.00 0.00 ? 45  PRO A CD     2  
ATOM   4404   H  HA     . PRO A 1 38  ? 8.008   -8.773  6.799   1.00 0.00 ? 45  PRO A HA     2  
ATOM   4405   H  HB2    . PRO A 1 38  ? 9.978   -8.414  5.005   1.00 0.00 ? 45  PRO A HB2    2  
ATOM   4406   H  HB3    . PRO A 1 38  ? 10.170  -9.451  6.424   1.00 0.00 ? 45  PRO A HB3    2  
ATOM   4407   H  HG2    . PRO A 1 38  ? 9.585   -10.207 3.590   1.00 0.00 ? 45  PRO A HG2    2  
ATOM   4408   H  HG3    . PRO A 1 38  ? 10.696  -10.967 4.745   1.00 0.00 ? 45  PRO A HG3    2  
ATOM   4409   H  HD2    . PRO A 1 38  ? 8.193   -11.917 4.190   1.00 0.00 ? 45  PRO A HD2    2  
ATOM   4410   H  HD3    . PRO A 1 38  ? 9.023   -12.180 5.735   1.00 0.00 ? 45  PRO A HD3    2  
ATOM   4411   N  N      . THR A 1 39  ? 6.652   -7.306  5.326   1.00 0.00 ? 46  THR A N      2  
ATOM   4412   C  CA     . THR A 1 39  ? 6.111   -6.203  4.532   1.00 0.00 ? 46  THR A CA     2  
ATOM   4413   C  C      . THR A 1 39  ? 5.958   -4.950  5.389   1.00 0.00 ? 46  THR A C      2  
ATOM   4414   O  O      . THR A 1 39  ? 5.410   -3.947  4.939   1.00 0.00 ? 46  THR A O      2  
ATOM   4415   C  CB     . THR A 1 39  ? 4.738   -6.533  3.906   1.00 0.00 ? 46  THR A CB     2  
ATOM   4416   O  OG1    . THR A 1 39  ? 3.803   -6.954  4.914   1.00 0.00 ? 46  THR A OG1    2  
ATOM   4417   C  CG2    . THR A 1 39  ? 4.853   -7.595  2.826   1.00 0.00 ? 46  THR A CG2    2  
ATOM   4418   H  H      . THR A 1 39  ? 6.396   -7.383  6.264   1.00 0.00 ? 46  THR A H      2  
ATOM   4419   H  HA     . THR A 1 39  ? 6.807   -5.997  3.732   1.00 0.00 ? 46  THR A HA     2  
ATOM   4420   H  HB     . THR A 1 39  ? 4.359   -5.629  3.449   1.00 0.00 ? 46  THR A HB     2  
ATOM   4421   H  HG1    . THR A 1 39  ? 3.090   -6.287  4.952   1.00 0.00 ? 46  THR A HG1    2  
ATOM   4422   H  HG21   . THR A 1 39  ? 5.539   -7.258  2.065   1.00 0.00 ? 46  THR A HG21   2  
ATOM   4423   H  HG22   . THR A 1 39  ? 3.882   -7.769  2.383   1.00 0.00 ? 46  THR A HG22   2  
ATOM   4424   H  HG23   . THR A 1 39  ? 5.220   -8.512  3.260   1.00 0.00 ? 46  THR A HG23   2  
ATOM   4425   N  N      . LYS A 1 40  ? 6.460   -5.011  6.623   1.00 0.00 ? 47  LYS A N      2  
ATOM   4426   C  CA     . LYS A 1 40  ? 6.289   -3.917  7.581   1.00 0.00 ? 47  LYS A CA     2  
ATOM   4427   C  C      . LYS A 1 40  ? 7.000   -2.655  7.107   1.00 0.00 ? 47  LYS A C      2  
ATOM   4428   O  O      . LYS A 1 40  ? 6.397   -1.593  6.992   1.00 0.00 ? 47  LYS A O      2  
ATOM   4429   C  CB     . LYS A 1 40  ? 6.835   -4.320  8.953   1.00 0.00 ? 47  LYS A CB     2  
ATOM   4430   C  CG     . LYS A 1 40  ? 5.956   -5.303  9.705   1.00 0.00 ? 47  LYS A CG     2  
ATOM   4431   C  CD     . LYS A 1 40  ? 6.667   -5.847  10.936  1.00 0.00 ? 47  LYS A CD     2  
ATOM   4432   C  CE     . LYS A 1 40  ? 5.731   -6.668  11.806  1.00 0.00 ? 47  LYS A CE     2  
ATOM   4433   N  NZ     . LYS A 1 40  ? 6.462   -7.410  12.866  1.00 0.00 ? 47  LYS A NZ     2  
ATOM   4434   H  H      . LYS A 1 40  ? 6.981   -5.799  6.887   1.00 0.00 ? 47  LYS A H      2  
ATOM   4435   H  HA     . LYS A 1 40  ? 5.233   -3.714  7.668   1.00 0.00 ? 47  LYS A HA     2  
ATOM   4436   H  HB2    . LYS A 1 40  ? 7.806   -4.773  8.820   1.00 0.00 ? 47  LYS A HB2    2  
ATOM   4437   H  HB3    . LYS A 1 40  ? 6.942   -3.431  9.558   1.00 0.00 ? 47  LYS A HB3    2  
ATOM   4438   H  HG2    . LYS A 1 40  ? 5.054   -4.799  10.017  1.00 0.00 ? 47  LYS A HG2    2  
ATOM   4439   H  HG3    . LYS A 1 40  ? 5.706   -6.126  9.051   1.00 0.00 ? 47  LYS A HG3    2  
ATOM   4440   H  HD2    . LYS A 1 40  ? 7.488   -6.473  10.617  1.00 0.00 ? 47  LYS A HD2    2  
ATOM   4441   H  HD3    . LYS A 1 40  ? 7.048   -5.019  11.514  1.00 0.00 ? 47  LYS A HD3    2  
ATOM   4442   H  HE2    . LYS A 1 40  ? 5.024   -5.997  12.275  1.00 0.00 ? 47  LYS A HE2    2  
ATOM   4443   H  HE3    . LYS A 1 40  ? 5.201   -7.372  11.182  1.00 0.00 ? 47  LYS A HE3    2  
ATOM   4444   H  HZ1    . LYS A 1 40  ? 7.035   -6.752  13.437  1.00 0.00 ? 47  LYS A HZ1    2  
ATOM   4445   H  HZ2    . LYS A 1 40  ? 7.095   -8.121  12.439  1.00 0.00 ? 47  LYS A HZ2    2  
ATOM   4446   H  HZ3    . LYS A 1 40  ? 5.788   -7.899  13.497  1.00 0.00 ? 47  LYS A HZ3    2  
ATOM   4447   N  N      . ALA A 1 41  ? 8.291   -2.782  6.863   1.00 0.00 ? 48  ALA A N      2  
ATOM   4448   C  CA     . ALA A 1 41  ? 9.080   -1.692  6.316   1.00 0.00 ? 48  ALA A CA     2  
ATOM   4449   C  C      . ALA A 1 41  ? 9.776   -2.165  5.054   1.00 0.00 ? 48  ALA A C      2  
ATOM   4450   O  O      . ALA A 1 41  ? 10.830  -1.658  4.678   1.00 0.00 ? 48  ALA A O      2  
ATOM   4451   C  CB     . ALA A 1 41  ? 10.090  -1.195  7.337   1.00 0.00 ? 48  ALA A CB     2  
ATOM   4452   H  H      . ALA A 1 41  ? 8.726   -3.642  7.043   1.00 0.00 ? 48  ALA A H      2  
ATOM   4453   H  HA     . ALA A 1 41  ? 8.411   -0.881  6.069   1.00 0.00 ? 48  ALA A HA     2  
ATOM   4454   H  HB1    . ALA A 1 41  ? 10.784  -1.987  7.571   1.00 0.00 ? 48  ALA A HB1    2  
ATOM   4455   H  HB2    . ALA A 1 41  ? 9.575   -0.889  8.235   1.00 0.00 ? 48  ALA A HB2    2  
ATOM   4456   H  HB3    . ALA A 1 41  ? 10.629  -0.353  6.926   1.00 0.00 ? 48  ALA A HB3    2  
ATOM   4457   N  N      . ASP A 1 42  ? 9.169   -3.144  4.404   1.00 0.00 ? 49  ASP A N      2  
ATOM   4458   C  CA     . ASP A 1 42  ? 9.776   -3.782  3.250   1.00 0.00 ? 49  ASP A CA     2  
ATOM   4459   C  C      . ASP A 1 42  ? 8.755   -3.963  2.137   1.00 0.00 ? 49  ASP A C      2  
ATOM   4460   O  O      . ASP A 1 42  ? 7.910   -4.857  2.192   1.00 0.00 ? 49  ASP A O      2  
ATOM   4461   C  CB     . ASP A 1 42  ? 10.361  -5.138  3.650   1.00 0.00 ? 49  ASP A CB     2  
ATOM   4462   C  CG     . ASP A 1 42  ? 11.236  -5.742  2.572   1.00 0.00 ? 49  ASP A CG     2  
ATOM   4463   O  OD1    . ASP A 1 42  ? 12.420  -5.366  2.489   1.00 0.00 ? 49  ASP A OD1    2  
ATOM   4464   O  OD2    . ASP A 1 42  ? 10.757  -6.619  1.827   1.00 0.00 ? 49  ASP A OD2    2  
ATOM   4465   H  H      . ASP A 1 42  ? 8.279   -3.433  4.695   1.00 0.00 ? 49  ASP A H      2  
ATOM   4466   H  HA     . ASP A 1 42  ? 10.569  -3.146  2.897   1.00 0.00 ? 49  ASP A HA     2  
ATOM   4467   H  HB2    . ASP A 1 42  ? 10.960  -5.014  4.541   1.00 0.00 ? 49  ASP A HB2    2  
ATOM   4468   H  HB3    . ASP A 1 42  ? 9.552   -5.823  3.857   1.00 0.00 ? 49  ASP A HB3    2  
ATOM   4469   N  N      . SER A 1 43  ? 8.809   -3.082  1.154   1.00 0.00 ? 50  SER A N      2  
ATOM   4470   C  CA     . SER A 1 43  ? 7.940   -3.177  -0.003  1.00 0.00 ? 50  SER A CA     2  
ATOM   4471   C  C      . SER A 1 43  ? 8.749   -3.593  -1.225  1.00 0.00 ? 50  SER A C      2  
ATOM   4472   O  O      . SER A 1 43  ? 9.980   -3.586  -1.192  1.00 0.00 ? 50  SER A O      2  
ATOM   4473   C  CB     . SER A 1 43  ? 7.254   -1.835  -0.259  1.00 0.00 ? 50  SER A CB     2  
ATOM   4474   O  OG     . SER A 1 43  ? 8.200   -0.817  -0.544  1.00 0.00 ? 50  SER A OG     2  
ATOM   4475   H  H      . SER A 1 43  ? 9.448   -2.344  1.205   1.00 0.00 ? 50  SER A H      2  
ATOM   4476   H  HA     . SER A 1 43  ? 7.192   -3.928  0.199   1.00 0.00 ? 50  SER A HA     2  
ATOM   4477   H  HB2    . SER A 1 43  ? 6.588   -1.933  -1.103  1.00 0.00 ? 50  SER A HB2    2  
ATOM   4478   H  HB3    . SER A 1 43  ? 6.689   -1.548  0.614   1.00 0.00 ? 50  SER A HB3    2  
ATOM   4479   H  HG     . SER A 1 43  ? 7.888   -0.299  -1.307  1.00 0.00 ? 50  SER A HG     2  
ATOM   4480   N  N      . TYR A 1 44  ? 8.067   -3.959  -2.297  1.00 0.00 ? 51  TYR A N      2  
ATOM   4481   C  CA     . TYR A 1 44  ? 8.750   -4.302  -3.530  1.00 0.00 ? 51  TYR A CA     2  
ATOM   4482   C  C      . TYR A 1 44  ? 8.104   -3.585  -4.705  1.00 0.00 ? 51  TYR A C      2  
ATOM   4483   O  O      . TYR A 1 44  ? 7.017   -3.952  -5.152  1.00 0.00 ? 51  TYR A O      2  
ATOM   4484   C  CB     . TYR A 1 44  ? 8.740   -5.818  -3.759  1.00 0.00 ? 51  TYR A CB     2  
ATOM   4485   C  CG     . TYR A 1 44  ? 9.640   -6.258  -4.894  1.00 0.00 ? 51  TYR A CG     2  
ATOM   4486   C  CD1    . TYR A 1 44  ? 11.012  -6.385  -4.703  1.00 0.00 ? 51  TYR A CD1    2  
ATOM   4487   C  CD2    . TYR A 1 44  ? 9.126   -6.529  -6.155  1.00 0.00 ? 51  TYR A CD2    2  
ATOM   4488   C  CE1    . TYR A 1 44  ? 11.842  -6.775  -5.735  1.00 0.00 ? 51  TYR A CE1    2  
ATOM   4489   C  CE2    . TYR A 1 44  ? 9.950   -6.918  -7.193  1.00 0.00 ? 51  TYR A CE2    2  
ATOM   4490   C  CZ     . TYR A 1 44  ? 11.308  -7.037  -6.977  1.00 0.00 ? 51  TYR A CZ     2  
ATOM   4491   O  OH     . TYR A 1 44  ? 12.135  -7.419  -8.009  1.00 0.00 ? 51  TYR A OH     2  
ATOM   4492   H  H      . TYR A 1 44  ? 7.088   -3.989  -2.262  1.00 0.00 ? 51  TYR A H      2  
ATOM   4493   H  HA     . TYR A 1 44  ? 9.773   -3.967  -3.442  1.00 0.00 ? 51  TYR A HA     2  
ATOM   4494   H  HB2    . TYR A 1 44  ? 9.071   -6.313  -2.859  1.00 0.00 ? 51  TYR A HB2    2  
ATOM   4495   H  HB3    . TYR A 1 44  ? 7.734   -6.132  -3.991  1.00 0.00 ? 51  TYR A HB3    2  
ATOM   4496   H  HD1    . TYR A 1 44  ? 11.426  -6.179  -3.727  1.00 0.00 ? 51  TYR A HD1    2  
ATOM   4497   H  HD2    . TYR A 1 44  ? 8.062   -6.435  -6.320  1.00 0.00 ? 51  TYR A HD2    2  
ATOM   4498   H  HE1    . TYR A 1 44  ? 12.904  -6.868  -5.567  1.00 0.00 ? 51  TYR A HE1    2  
ATOM   4499   H  HE2    . TYR A 1 44  ? 9.532   -7.124  -8.166  1.00 0.00 ? 51  TYR A HE2    2  
ATOM   4500   H  HH     . TYR A 1 44  ? 11.953  -6.862  -8.785  1.00 0.00 ? 51  TYR A HH     2  
ATOM   4501   N  N      . ARG A 1 45  ? 8.773   -2.553  -5.186  1.00 0.00 ? 52  ARG A N      2  
ATOM   4502   C  CA     . ARG A 1 45  ? 8.293   -1.797  -6.330  1.00 0.00 ? 52  ARG A CA     2  
ATOM   4503   C  C      . ARG A 1 45  ? 8.722   -2.471  -7.627  1.00 0.00 ? 52  ARG A C      2  
ATOM   4504   O  O      . ARG A 1 45  ? 9.876   -2.872  -7.780  1.00 0.00 ? 52  ARG A O      2  
ATOM   4505   C  CB     . ARG A 1 45  ? 8.812   -0.358  -6.276  1.00 0.00 ? 52  ARG A CB     2  
ATOM   4506   C  CG     . ARG A 1 45  ? 10.316  -0.253  -6.108  1.00 0.00 ? 52  ARG A CG     2  
ATOM   4507   C  CD     . ARG A 1 45  ? 10.776  1.195   -6.108  1.00 0.00 ? 52  ARG A CD     2  
ATOM   4508   N  NE     . ARG A 1 45  ? 10.139  1.979   -5.051  1.00 0.00 ? 52  ARG A NE     2  
ATOM   4509   C  CZ     . ARG A 1 45  ? 10.332  3.286   -4.869  1.00 0.00 ? 52  ARG A CZ     2  
ATOM   4510   N  NH1    . ARG A 1 45  ? 11.187  3.951   -5.641  1.00 0.00 ? 52  ARG A NH1    2  
ATOM   4511   N  NH2    . ARG A 1 45  ? 9.671   3.915   -3.906  1.00 0.00 ? 52  ARG A NH2    2  
ATOM   4512   H  H      . ARG A 1 45  ? 9.618   -2.293  -4.761  1.00 0.00 ? 52  ARG A H      2  
ATOM   4513   H  HA     . ARG A 1 45  ? 7.214   -1.784  -6.289  1.00 0.00 ? 52  ARG A HA     2  
ATOM   4514   H  HB2    . ARG A 1 45  ? 8.540   0.145   -7.191  1.00 0.00 ? 52  ARG A HB2    2  
ATOM   4515   H  HB3    . ARG A 1 45  ? 8.344   0.149   -5.446  1.00 0.00 ? 52  ARG A HB3    2  
ATOM   4516   H  HG2    . ARG A 1 45  ? 10.596  -0.711  -5.172  1.00 0.00 ? 52  ARG A HG2    2  
ATOM   4517   H  HG3    . ARG A 1 45  ? 10.794  -0.774  -6.924  1.00 0.00 ? 52  ARG A HG3    2  
ATOM   4518   H  HD2    . ARG A 1 45  ? 11.847  1.220   -5.963  1.00 0.00 ? 52  ARG A HD2    2  
ATOM   4519   H  HD3    . ARG A 1 45  ? 10.534  1.634   -7.063  1.00 0.00 ? 52  ARG A HD3    2  
ATOM   4520   H  HE     . ARG A 1 45  ? 9.514   1.506   -4.446  1.00 0.00 ? 52  ARG A HE     2  
ATOM   4521   H  HH11   . ARG A 1 45  ? 11.699  3.471   -6.363  1.00 0.00 ? 52  ARG A HH11   2  
ATOM   4522   H  HH12   . ARG A 1 45  ? 11.323  4.943   -5.513  1.00 0.00 ? 52  ARG A HH12   2  
ATOM   4523   H  HH21   . ARG A 1 45  ? 9.025   3.396   -3.320  1.00 0.00 ? 52  ARG A HH21   2  
ATOM   4524   H  HH22   . ARG A 1 45  ? 9.811   4.902   -3.746  1.00 0.00 ? 52  ARG A HH22   2  
ATOM   4525   N  N      . LYS A 1 46  ? 7.789   -2.602  -8.554  1.00 0.00 ? 53  LYS A N      2  
ATOM   4526   C  CA     . LYS A 1 46  ? 8.069   -3.267  -9.815  1.00 0.00 ? 53  LYS A CA     2  
ATOM   4527   C  C      . LYS A 1 46  ? 7.457   -2.495  -10.974 1.00 0.00 ? 53  LYS A C      2  
ATOM   4528   O  O      . LYS A 1 46  ? 6.774   -1.486  -10.767 1.00 0.00 ? 53  LYS A O      2  
ATOM   4529   C  CB     . LYS A 1 46  ? 7.560   -4.715  -9.807  1.00 0.00 ? 53  LYS A CB     2  
ATOM   4530   C  CG     . LYS A 1 46  ? 6.053   -4.877  -9.973  1.00 0.00 ? 53  LYS A CG     2  
ATOM   4531   C  CD     . LYS A 1 46  ? 5.275   -4.446  -8.755  1.00 0.00 ? 53  LYS A CD     2  
ATOM   4532   C  CE     . LYS A 1 46  ? 3.823   -4.850  -8.907  1.00 0.00 ? 53  LYS A CE     2  
ATOM   4533   N  NZ     . LYS A 1 46  ? 3.694   -6.300  -9.217  1.00 0.00 ? 53  LYS A NZ     2  
ATOM   4534   H  H      . LYS A 1 46  ? 6.898   -2.229  -8.392  1.00 0.00 ? 53  LYS A H      2  
ATOM   4535   H  HA     . LYS A 1 46  ? 9.142   -3.278  -9.943  1.00 0.00 ? 53  LYS A HA     2  
ATOM   4536   H  HB2    . LYS A 1 46  ? 8.040   -5.250  -10.612 1.00 0.00 ? 53  LYS A HB2    2  
ATOM   4537   H  HB3    . LYS A 1 46  ? 7.847   -5.173  -8.869  1.00 0.00 ? 53  LYS A HB3    2  
ATOM   4538   H  HG2    . LYS A 1 46  ? 5.722   -4.282  -10.807 1.00 0.00 ? 53  LYS A HG2    2  
ATOM   4539   H  HG3    . LYS A 1 46  ? 5.832   -5.919  -10.164 1.00 0.00 ? 53  LYS A HG3    2  
ATOM   4540   H  HD2    . LYS A 1 46  ? 5.688   -4.926  -7.881  1.00 0.00 ? 53  LYS A HD2    2  
ATOM   4541   H  HD3    . LYS A 1 46  ? 5.336   -3.374  -8.651  1.00 0.00 ? 53  LYS A HD3    2  
ATOM   4542   H  HE2    . LYS A 1 46  ? 3.312   -4.641  -7.990  1.00 0.00 ? 53  LYS A HE2    2  
ATOM   4543   H  HE3    . LYS A 1 46  ? 3.380   -4.275  -9.709  1.00 0.00 ? 53  LYS A HE3    2  
ATOM   4544   H  HZ1    . LYS A 1 46  ? 2.697   -6.598  -9.153  1.00 0.00 ? 53  LYS A HZ1    2  
ATOM   4545   H  HZ2    . LYS A 1 46  ? 4.258   -6.860  -8.547  1.00 0.00 ? 53  LYS A HZ2    2  
ATOM   4546   H  HZ3    . LYS A 1 46  ? 4.037   -6.494  -10.187 1.00 0.00 ? 53  LYS A HZ3    2  
ATOM   4547   N  N      . LYS A 1 47  ? 7.694   -2.977  -12.183 1.00 0.00 ? 54  LYS A N      2  
ATOM   4548   C  CA     . LYS A 1 47  ? 7.256   -2.292  -13.383 1.00 0.00 ? 54  LYS A CA     2  
ATOM   4549   C  C      . LYS A 1 47  ? 6.068   -3.000  -14.037 1.00 0.00 ? 54  LYS A C      2  
ATOM   4550   O  O      . LYS A 1 47  ? 6.109   -4.203  -14.294 1.00 0.00 ? 54  LYS A O      2  
ATOM   4551   C  CB     . LYS A 1 47  ? 8.416   -2.204  -14.369 1.00 0.00 ? 54  LYS A CB     2  
ATOM   4552   C  CG     . LYS A 1 47  ? 8.035   -1.594  -15.702 1.00 0.00 ? 54  LYS A CG     2  
ATOM   4553   C  CD     . LYS A 1 47  ? 9.181   -1.667  -16.691 1.00 0.00 ? 54  LYS A CD     2  
ATOM   4554   C  CE     . LYS A 1 47  ? 10.323  -0.744  -16.307 1.00 0.00 ? 54  LYS A CE     2  
ATOM   4555   N  NZ     . LYS A 1 47  ? 11.448  -0.838  -17.273 1.00 0.00 ? 54  LYS A NZ     2  
ATOM   4556   H  H      . LYS A 1 47  ? 8.181   -3.831  -12.272 1.00 0.00 ? 54  LYS A H      2  
ATOM   4557   H  HA     . LYS A 1 47  ? 6.958   -1.294  -13.104 1.00 0.00 ? 54  LYS A HA     2  
ATOM   4558   H  HB2    . LYS A 1 47  ? 9.201   -1.604  -13.932 1.00 0.00 ? 54  LYS A HB2    2  
ATOM   4559   H  HB3    . LYS A 1 47  ? 8.793   -3.199  -14.549 1.00 0.00 ? 54  LYS A HB3    2  
ATOM   4560   H  HG2    . LYS A 1 47  ? 7.190   -2.132  -16.104 1.00 0.00 ? 54  LYS A HG2    2  
ATOM   4561   H  HG3    . LYS A 1 47  ? 7.767   -0.559  -15.549 1.00 0.00 ? 54  LYS A HG3    2  
ATOM   4562   H  HD2    . LYS A 1 47  ? 9.550   -2.682  -16.725 1.00 0.00 ? 54  LYS A HD2    2  
ATOM   4563   H  HD3    . LYS A 1 47  ? 8.816   -1.385  -17.668 1.00 0.00 ? 54  LYS A HD3    2  
ATOM   4564   H  HE2    . LYS A 1 47  ? 9.958   0.272   -16.289 1.00 0.00 ? 54  LYS A HE2    2  
ATOM   4565   H  HE3    . LYS A 1 47  ? 10.677  -1.017  -15.324 1.00 0.00 ? 54  LYS A HE3    2  
ATOM   4566   H  HZ1    . LYS A 1 47  ? 11.887  -1.782  -17.219 1.00 0.00 ? 54  LYS A HZ1    2  
ATOM   4567   H  HZ2    . LYS A 1 47  ? 12.170  -0.118  -17.058 1.00 0.00 ? 54  LYS A HZ2    2  
ATOM   4568   H  HZ3    . LYS A 1 47  ? 11.100  -0.686  -18.244 1.00 0.00 ? 54  LYS A HZ3    2  
ATOM   4569   N  N      . VAL A 1 48  ? 5.016   -2.236  -14.296 1.00 0.00 ? 55  VAL A N      2  
ATOM   4570   C  CA     . VAL A 1 48  ? 3.840   -2.719  -15.009 1.00 0.00 ? 55  VAL A CA     2  
ATOM   4571   C  C      . VAL A 1 48  ? 3.397   -1.667  -16.021 1.00 0.00 ? 55  VAL A C      2  
ATOM   4572   O  O      . VAL A 1 48  ? 3.549   -0.472  -15.784 1.00 0.00 ? 55  VAL A O      2  
ATOM   4573   C  CB     . VAL A 1 48  ? 2.663   -3.027  -14.053 1.00 0.00 ? 55  VAL A CB     2  
ATOM   4574   C  CG1    . VAL A 1 48  ? 2.985   -4.223  -13.172 1.00 0.00 ? 55  VAL A CG1    2  
ATOM   4575   C  CG2    . VAL A 1 48  ? 2.321   -1.811  -13.201 1.00 0.00 ? 55  VAL A CG2    2  
ATOM   4576   H  H      . VAL A 1 48  ? 5.037   -1.293  -14.011 1.00 0.00 ? 55  VAL A H      2  
ATOM   4577   H  HA     . VAL A 1 48  ? 4.108   -3.626  -15.532 1.00 0.00 ? 55  VAL A HA     2  
ATOM   4578   H  HB     . VAL A 1 48  ? 1.798   -3.273  -14.652 1.00 0.00 ? 55  VAL A HB     2  
ATOM   4579   H  HG11   . VAL A 1 48  ? 3.879   -4.018  -12.601 1.00 0.00 ? 55  VAL A HG11   2  
ATOM   4580   H  HG12   . VAL A 1 48  ? 3.144   -5.092  -13.792 1.00 0.00 ? 55  VAL A HG12   2  
ATOM   4581   H  HG13   . VAL A 1 48  ? 2.161   -4.406  -12.498 1.00 0.00 ? 55  VAL A HG13   2  
ATOM   4582   H  HG21   . VAL A 1 48  ? 3.191   -1.512  -12.634 1.00 0.00 ? 55  VAL A HG21   2  
ATOM   4583   H  HG22   . VAL A 1 48  ? 1.517   -2.059  -12.522 1.00 0.00 ? 55  VAL A HG22   2  
ATOM   4584   H  HG23   . VAL A 1 48  ? 2.015   -0.998  -13.841 1.00 0.00 ? 55  VAL A HG23   2  
ATOM   4585   N  N      . VAL A 1 49  ? 2.861   -2.088  -17.152 1.00 0.00 ? 56  VAL A N      2  
ATOM   4586   C  CA     . VAL A 1 49  ? 2.421   -1.125  -18.149 1.00 0.00 ? 56  VAL A CA     2  
ATOM   4587   C  C      . VAL A 1 49  ? 0.908   -1.145  -18.295 1.00 0.00 ? 56  VAL A C      2  
ATOM   4588   O  O      . VAL A 1 49  ? 0.324   -2.062  -18.875 1.00 0.00 ? 56  VAL A O      2  
ATOM   4589   C  CB     . VAL A 1 49  ? 3.121   -1.308  -19.525 1.00 0.00 ? 56  VAL A CB     2  
ATOM   4590   C  CG1    . VAL A 1 49  ? 3.119   -2.751  -19.980 1.00 0.00 ? 56  VAL A CG1    2  
ATOM   4591   C  CG2    . VAL A 1 49  ? 2.473   -0.430  -20.585 1.00 0.00 ? 56  VAL A CG2    2  
ATOM   4592   H  H      . VAL A 1 49  ? 2.734   -3.053  -17.307 1.00 0.00 ? 56  VAL A H      2  
ATOM   4593   H  HA     . VAL A 1 49  ? 2.696   -0.149  -17.775 1.00 0.00 ? 56  VAL A HA     2  
ATOM   4594   H  HB     . VAL A 1 49  ? 4.149   -0.996  -19.420 1.00 0.00 ? 56  VAL A HB     2  
ATOM   4595   H  HG11   . VAL A 1 49  ? 3.628   -3.361  -19.250 1.00 0.00 ? 56  VAL A HG11   2  
ATOM   4596   H  HG12   . VAL A 1 49  ? 3.632   -2.820  -20.929 1.00 0.00 ? 56  VAL A HG12   2  
ATOM   4597   H  HG13   . VAL A 1 49  ? 2.100   -3.090  -20.094 1.00 0.00 ? 56  VAL A HG13   2  
ATOM   4598   H  HG21   . VAL A 1 49  ? 2.960   -0.597  -21.536 1.00 0.00 ? 56  VAL A HG21   2  
ATOM   4599   H  HG22   . VAL A 1 49  ? 2.576   0.609   -20.307 1.00 0.00 ? 56  VAL A HG22   2  
ATOM   4600   H  HG23   . VAL A 1 49  ? 1.426   -0.678  -20.670 1.00 0.00 ? 56  VAL A HG23   2  
ATOM   4601   N  N      . LEU A 1 50  ? 0.274   -0.134  -17.721 1.00 0.00 ? 57  LEU A N      2  
ATOM   4602   C  CA     . LEU A 1 50  ? -1.159  0.033   -17.849 1.00 0.00 ? 57  LEU A CA     2  
ATOM   4603   C  C      . LEU A 1 50  ? -1.441  0.779   -19.143 1.00 0.00 ? 57  LEU A C      2  
ATOM   4604   O  O      . LEU A 1 50  ? -1.334  2.004   -19.180 1.00 0.00 ? 57  LEU A O      2  
ATOM   4605   C  CB     . LEU A 1 50  ? -1.710  0.812   -16.642 1.00 0.00 ? 57  LEU A CB     2  
ATOM   4606   C  CG     . LEU A 1 50  ? -3.232  0.750   -16.413 1.00 0.00 ? 57  LEU A CG     2  
ATOM   4607   C  CD1    . LEU A 1 50  ? -3.587  1.436   -15.105 1.00 0.00 ? 57  LEU A CD1    2  
ATOM   4608   C  CD2    . LEU A 1 50  ? -4.003  1.400   -17.551 1.00 0.00 ? 57  LEU A CD2    2  
ATOM   4609   H  H      . LEU A 1 50  ? 0.788   0.520   -17.207 1.00 0.00 ? 57  LEU A H      2  
ATOM   4610   H  HA     . LEU A 1 50  ? -1.615  -0.945  -17.890 1.00 0.00 ? 57  LEU A HA     2  
ATOM   4611   H  HB2    . LEU A 1 50  ? -1.221  0.439   -15.753 1.00 0.00 ? 57  LEU A HB2    2  
ATOM   4612   H  HB3    . LEU A 1 50  ? -1.435  1.849   -16.764 1.00 0.00 ? 57  LEU A HB3    2  
ATOM   4613   H  HG     . LEU A 1 50  ? -3.539  -0.285  -16.344 1.00 0.00 ? 57  LEU A HG     2  
ATOM   4614   H  HD11   . LEU A 1 50  ? -4.655  1.383   -14.950 1.00 0.00 ? 57  LEU A HD11   2  
ATOM   4615   H  HD12   . LEU A 1 50  ? -3.280  2.470   -15.148 1.00 0.00 ? 57  LEU A HD12   2  
ATOM   4616   H  HD13   . LEU A 1 50  ? -3.080  0.942   -14.288 1.00 0.00 ? 57  LEU A HD13   2  
ATOM   4617   H  HD21   . LEU A 1 50  ? -3.791  0.880   -18.474 1.00 0.00 ? 57  LEU A HD21   2  
ATOM   4618   H  HD22   . LEU A 1 50  ? -3.704  2.433   -17.642 1.00 0.00 ? 57  LEU A HD22   2  
ATOM   4619   H  HD23   . LEU A 1 50  ? -5.062  1.349   -17.344 1.00 0.00 ? 57  LEU A HD23   2  
ATOM   4620   N  N      . ASP A 1 51  ? -1.775  0.012   -20.183 1.00 0.00 ? 58  ASP A N      2  
ATOM   4621   C  CA     . ASP A 1 51  ? -2.113  0.535   -21.514 1.00 0.00 ? 58  ASP A CA     2  
ATOM   4622   C  C      . ASP A 1 51  ? -1.269  1.750   -21.901 1.00 0.00 ? 58  ASP A C      2  
ATOM   4623   O  O      . ASP A 1 51  ? -1.700  2.898   -21.754 1.00 0.00 ? 58  ASP A O      2  
ATOM   4624   C  CB     . ASP A 1 51  ? -3.605  0.871   -21.590 1.00 0.00 ? 58  ASP A CB     2  
ATOM   4625   C  CG     . ASP A 1 51  ? -4.030  1.354   -22.964 1.00 0.00 ? 58  ASP A CG     2  
ATOM   4626   O  OD1    . ASP A 1 51  ? -3.903  0.581   -23.934 1.00 0.00 ? 58  ASP A OD1    2  
ATOM   4627   O  OD2    . ASP A 1 51  ? -4.508  2.502   -23.072 1.00 0.00 ? 58  ASP A OD2    2  
ATOM   4628   H  H      . ASP A 1 51  ? -1.799  -0.962  -20.048 1.00 0.00 ? 58  ASP A H      2  
ATOM   4629   H  HA     . ASP A 1 51  ? -1.907  -0.253  -22.226 1.00 0.00 ? 58  ASP A HA     2  
ATOM   4630   H  HB2    . ASP A 1 51  ? -4.177  -0.011  -21.348 1.00 0.00 ? 58  ASP A HB2    2  
ATOM   4631   H  HB3    . ASP A 1 51  ? -3.828  1.647   -20.872 1.00 0.00 ? 58  ASP A HB3    2  
ATOM   4632   N  N      . GLY A 1 52  ? -0.056  1.505   -22.375 1.00 0.00 ? 59  GLY A N      2  
ATOM   4633   C  CA     . GLY A 1 52  ? 0.788   2.602   -22.784 1.00 0.00 ? 59  GLY A CA     2  
ATOM   4634   C  C      . GLY A 1 52  ? 2.262   2.348   -22.582 1.00 0.00 ? 59  GLY A C      2  
ATOM   4635   O  O      . GLY A 1 52  ? 2.899   1.679   -23.393 1.00 0.00 ? 59  GLY A O      2  
ATOM   4636   H  H      . GLY A 1 52  ? 0.259   0.576   -22.458 1.00 0.00 ? 59  GLY A H      2  
ATOM   4637   H  HA2    . GLY A 1 52  ? 0.617   2.794   -23.830 1.00 0.00 ? 59  GLY A HA2    2  
ATOM   4638   H  HA3    . GLY A 1 52  ? 0.509   3.475   -22.219 1.00 0.00 ? 59  GLY A HA3    2  
ATOM   4639   N  N      . GLU A 1 53  ? 2.807   2.884   -21.501 1.00 0.00 ? 60  GLU A N      2  
ATOM   4640   C  CA     . GLU A 1 53  ? 4.240   2.838   -21.278 1.00 0.00 ? 60  GLU A CA     2  
ATOM   4641   C  C      . GLU A 1 53  ? 4.566   2.176   -19.946 1.00 0.00 ? 60  GLU A C      2  
ATOM   4642   O  O      . GLU A 1 53  ? 3.692   2.017   -19.093 1.00 0.00 ? 60  GLU A O      2  
ATOM   4643   C  CB     . GLU A 1 53  ? 4.819   4.253   -21.337 1.00 0.00 ? 60  GLU A CB     2  
ATOM   4644   C  CG     . GLU A 1 53  ? 4.070   5.251   -20.471 1.00 0.00 ? 60  GLU A CG     2  
ATOM   4645   C  CD     . GLU A 1 53  ? 4.553   6.669   -20.675 1.00 0.00 ? 60  GLU A CD     2  
ATOM   4646   O  OE1    . GLU A 1 53  ? 4.110   7.314   -21.649 1.00 0.00 ? 60  GLU A OE1    2  
ATOM   4647   O  OE2    . GLU A 1 53  ? 5.372   7.140   -19.864 1.00 0.00 ? 60  GLU A OE2    2  
ATOM   4648   H  H      . GLU A 1 53  ? 2.231   3.306   -20.826 1.00 0.00 ? 60  GLU A H      2  
ATOM   4649   H  HA     . GLU A 1 53  ? 4.678   2.251   -22.072 1.00 0.00 ? 60  GLU A HA     2  
ATOM   4650   H  HB2    . GLU A 1 53  ? 5.847   4.225   -21.007 1.00 0.00 ? 60  GLU A HB2    2  
ATOM   4651   H  HB3    . GLU A 1 53  ? 4.789   4.603   -22.358 1.00 0.00 ? 60  GLU A HB3    2  
ATOM   4652   H  HG2    . GLU A 1 53  ? 3.020   5.205   -20.718 1.00 0.00 ? 60  GLU A HG2    2  
ATOM   4653   H  HG3    . GLU A 1 53  ? 4.208   4.984   -19.434 1.00 0.00 ? 60  GLU A HG3    2  
ATOM   4654   N  N      . GLU A 1 54  ? 5.821   1.785   -19.790 1.00 0.00 ? 61  GLU A N      2  
ATOM   4655   C  CA     . GLU A 1 54  ? 6.284   1.084   -18.601 1.00 0.00 ? 61  GLU A CA     2  
ATOM   4656   C  C      . GLU A 1 54  ? 6.195   1.964   -17.356 1.00 0.00 ? 61  GLU A C      2  
ATOM   4657   O  O      . GLU A 1 54  ? 6.934   2.938   -17.209 1.00 0.00 ? 61  GLU A O      2  
ATOM   4658   C  CB     . GLU A 1 54  ? 7.715   0.613   -18.822 1.00 0.00 ? 61  GLU A CB     2  
ATOM   4659   C  CG     . GLU A 1 54  ? 7.850   -0.347  -19.992 1.00 0.00 ? 61  GLU A CG     2  
ATOM   4660   C  CD     . GLU A 1 54  ? 9.296   -0.622  -20.347 1.00 0.00 ? 61  GLU A CD     2  
ATOM   4661   O  OE1    . GLU A 1 54  ? 9.964   -1.367  -19.602 1.00 0.00 ? 61  GLU A OE1    2  
ATOM   4662   O  OE2    . GLU A 1 54  ? 9.772   -0.078  -21.362 1.00 0.00 ? 61  GLU A OE2    2  
ATOM   4663   H  H      . GLU A 1 54  ? 6.463   1.970   -20.507 1.00 0.00 ? 61  GLU A H      2  
ATOM   4664   H  HA     . GLU A 1 54  ? 5.651   0.220   -18.461 1.00 0.00 ? 61  GLU A HA     2  
ATOM   4665   H  HB2    . GLU A 1 54  ? 8.343   1.471   -19.013 1.00 0.00 ? 61  GLU A HB2    2  
ATOM   4666   H  HB3    . GLU A 1 54  ? 8.062   0.112   -17.931 1.00 0.00 ? 61  GLU A HB3    2  
ATOM   4667   H  HG2    . GLU A 1 54  ? 7.367   -1.283  -19.733 1.00 0.00 ? 61  GLU A HG2    2  
ATOM   4668   H  HG3    . GLU A 1 54  ? 7.356   0.083   -20.851 1.00 0.00 ? 61  GLU A HG3    2  
ATOM   4669   N  N      . VAL A 1 55  ? 5.284   1.603   -16.467 1.00 0.00 ? 62  VAL A N      2  
ATOM   4670   C  CA     . VAL A 1 55  ? 5.029   2.360   -15.254 1.00 0.00 ? 62  VAL A CA     2  
ATOM   4671   C  C      . VAL A 1 55  ? 5.540   1.582   -14.040 1.00 0.00 ? 62  VAL A C      2  
ATOM   4672   O  O      . VAL A 1 55  ? 5.497   0.358   -14.023 1.00 0.00 ? 62  VAL A O      2  
ATOM   4673   C  CB     . VAL A 1 55  ? 3.511   2.637   -15.108 1.00 0.00 ? 62  VAL A CB     2  
ATOM   4674   C  CG1    . VAL A 1 55  ? 3.209   3.428   -13.851 1.00 0.00 ? 62  VAL A CG1    2  
ATOM   4675   C  CG2    . VAL A 1 55  ? 2.978   3.370   -16.330 1.00 0.00 ? 62  VAL A CG2    2  
ATOM   4676   H  H      . VAL A 1 55  ? 4.764   0.785   -16.627 1.00 0.00 ? 62  VAL A H      2  
ATOM   4677   H  HA     . VAL A 1 55  ? 5.550   3.303   -15.323 1.00 0.00 ? 62  VAL A HA     2  
ATOM   4678   H  HB     . VAL A 1 55  ? 2.999   1.687   -15.037 1.00 0.00 ? 62  VAL A HB     2  
ATOM   4679   H  HG11   . VAL A 1 55  ? 2.146   3.614   -13.794 1.00 0.00 ? 62  VAL A HG11   2  
ATOM   4680   H  HG12   . VAL A 1 55  ? 3.737   4.369   -13.885 1.00 0.00 ? 62  VAL A HG12   2  
ATOM   4681   H  HG13   . VAL A 1 55  ? 3.525   2.865   -12.987 1.00 0.00 ? 62  VAL A HG13   2  
ATOM   4682   H  HG21   . VAL A 1 55  ? 3.501   4.308   -16.445 1.00 0.00 ? 62  VAL A HG21   2  
ATOM   4683   H  HG22   . VAL A 1 55  ? 1.920   3.560   -16.206 1.00 0.00 ? 62  VAL A HG22   2  
ATOM   4684   H  HG23   . VAL A 1 55  ? 3.132   2.763   -17.211 1.00 0.00 ? 62  VAL A HG23   2  
ATOM   4685   N  N      . GLN A 1 56  ? 6.042   2.281   -13.035 1.00 0.00 ? 63  GLN A N      2  
ATOM   4686   C  CA     . GLN A 1 56  ? 6.534   1.615   -11.838 1.00 0.00 ? 63  GLN A CA     2  
ATOM   4687   C  C      . GLN A 1 56  ? 5.686   1.980   -10.627 1.00 0.00 ? 63  GLN A C      2  
ATOM   4688   O  O      . GLN A 1 56  ? 5.345   3.148   -10.412 1.00 0.00 ? 63  GLN A O      2  
ATOM   4689   C  CB     . GLN A 1 56  ? 8.004   1.951   -11.602 1.00 0.00 ? 63  GLN A CB     2  
ATOM   4690   C  CG     . GLN A 1 56  ? 8.922   1.346   -12.656 1.00 0.00 ? 63  GLN A CG     2  
ATOM   4691   C  CD     . GLN A 1 56  ? 10.386  1.649   -12.417 1.00 0.00 ? 63  GLN A CD     2  
ATOM   4692   O  OE1    . GLN A 1 56  ? 11.177  1.716   -13.357 1.00 0.00 ? 63  GLN A OE1    2  
ATOM   4693   N  NE2    . GLN A 1 56  ? 10.761  1.828   -11.162 1.00 0.00 ? 63  GLN A NE2    2  
ATOM   4694   H  H      . GLN A 1 56  ? 6.072   3.262   -13.091 1.00 0.00 ? 63  GLN A H      2  
ATOM   4695   H  HA     . GLN A 1 56  ? 6.447   0.551   -12.004 1.00 0.00 ? 63  GLN A HA     2  
ATOM   4696   H  HB2    . GLN A 1 56  ? 8.125   3.025   -11.616 1.00 0.00 ? 63  GLN A HB2    2  
ATOM   4697   H  HB3    . GLN A 1 56  ? 8.299   1.573   -10.633 1.00 0.00 ? 63  GLN A HB3    2  
ATOM   4698   H  HG2    . GLN A 1 56  ? 8.790   0.273   -12.657 1.00 0.00 ? 63  GLN A HG2    2  
ATOM   4699   H  HG3    . GLN A 1 56  ? 8.644   1.740   -13.623 1.00 0.00 ? 63  GLN A HG3    2  
ATOM   4700   H  HE21   . GLN A 1 56  ? 10.082  1.760   -10.462 1.00 0.00 ? 63  GLN A HE21   2  
ATOM   4701   H  HE22   . GLN A 1 56  ? 11.716  2.014   -10.986 1.00 0.00 ? 63  GLN A HE22   2  
ATOM   4702   N  N      . ILE A 1 57  ? 5.342   0.970   -9.841  1.00 0.00 ? 64  ILE A N      2  
ATOM   4703   C  CA     . ILE A 1 57  ? 4.423   1.139   -8.730  1.00 0.00 ? 64  ILE A CA     2  
ATOM   4704   C  C      . ILE A 1 57  ? 5.001   0.546   -7.442  1.00 0.00 ? 64  ILE A C      2  
ATOM   4705   O  O      . ILE A 1 57  ? 5.671   -0.490  -7.471  1.00 0.00 ? 64  ILE A O      2  
ATOM   4706   C  CB     . ILE A 1 57  ? 3.055   0.491   -9.061  1.00 0.00 ? 64  ILE A CB     2  
ATOM   4707   C  CG1    . ILE A 1 57  ? 2.023   0.813   -7.977  1.00 0.00 ? 64  ILE A CG1    2  
ATOM   4708   C  CG2    . ILE A 1 57  ? 3.194   -1.021  -9.244  1.00 0.00 ? 64  ILE A CG2    2  
ATOM   4709   C  CD1    . ILE A 1 57  ? 0.632   0.319   -8.306  1.00 0.00 ? 64  ILE A CD1    2  
ATOM   4710   H  H      . ILE A 1 57  ? 5.726   0.079   -10.012 1.00 0.00 ? 64  ILE A H      2  
ATOM   4711   H  HA     . ILE A 1 57  ? 4.269   2.200   -8.585  1.00 0.00 ? 64  ILE A HA     2  
ATOM   4712   H  HB     . ILE A 1 57  ? 2.713   0.905   -10.000 1.00 0.00 ? 64  ILE A HB     2  
ATOM   4713   H  HG12   . ILE A 1 57  ? 2.329   0.351   -7.048  1.00 0.00 ? 64  ILE A HG12   2  
ATOM   4714   H  HG13   . ILE A 1 57  ? 1.973   1.883   -7.843  1.00 0.00 ? 64  ILE A HG13   2  
ATOM   4715   H  HG21   . ILE A 1 57  ? 3.549   -1.464  -8.326  1.00 0.00 ? 64  ILE A HG21   2  
ATOM   4716   H  HG22   . ILE A 1 57  ? 3.900   -1.226  -10.037 1.00 0.00 ? 64  ILE A HG22   2  
ATOM   4717   H  HG23   . ILE A 1 57  ? 2.233   -1.445  -9.499  1.00 0.00 ? 64  ILE A HG23   2  
ATOM   4718   H  HD11   . ILE A 1 57  ? 0.332   0.699   -9.276  1.00 0.00 ? 64  ILE A HD11   2  
ATOM   4719   H  HD12   . ILE A 1 57  ? -0.062  0.668   -7.555  1.00 0.00 ? 64  ILE A HD12   2  
ATOM   4720   H  HD13   . ILE A 1 57  ? 0.629   -0.759  -8.329  1.00 0.00 ? 64  ILE A HD13   2  
ATOM   4721   N  N      . ASP A 1 58  ? 4.757   1.224   -6.325  1.00 0.00 ? 65  ASP A N      2  
ATOM   4722   C  CA     . ASP A 1 58  ? 5.262   0.796   -5.022  1.00 0.00 ? 65  ASP A CA     2  
ATOM   4723   C  C      . ASP A 1 58  ? 4.118   0.772   -4.008  1.00 0.00 ? 65  ASP A C      2  
ATOM   4724   O  O      . ASP A 1 58  ? 3.279   1.676   -3.995  1.00 0.00 ? 65  ASP A O      2  
ATOM   4725   C  CB     . ASP A 1 58  ? 6.368   1.754   -4.564  1.00 0.00 ? 65  ASP A CB     2  
ATOM   4726   C  CG     . ASP A 1 58  ? 7.184   1.225   -3.393  1.00 0.00 ? 65  ASP A CG     2  
ATOM   4727   O  OD1    . ASP A 1 58  ? 6.894   0.116   -2.900  1.00 0.00 ? 65  ASP A OD1    2  
ATOM   4728   O  OD2    . ASP A 1 58  ? 8.144   1.916   -2.985  1.00 0.00 ? 65  ASP A OD2    2  
ATOM   4729   H  H      . ASP A 1 58  ? 4.218   2.046   -6.375  1.00 0.00 ? 65  ASP A H      2  
ATOM   4730   H  HA     . ASP A 1 58  ? 5.667   -0.199  -5.125  1.00 0.00 ? 65  ASP A HA     2  
ATOM   4731   H  HB2    . ASP A 1 58  ? 7.042   1.926   -5.390  1.00 0.00 ? 65  ASP A HB2    2  
ATOM   4732   H  HB3    . ASP A 1 58  ? 5.920   2.696   -4.275  1.00 0.00 ? 65  ASP A HB3    2  
ATOM   4733   N  N      . ILE A 1 59  ? 4.079   -0.258  -3.166  1.00 0.00 ? 66  ILE A N      2  
ATOM   4734   C  CA     . ILE A 1 59  ? 2.959   -0.451  -2.243  1.00 0.00 ? 66  ILE A CA     2  
ATOM   4735   C  C      . ILE A 1 59  ? 3.453   -0.622  -0.809  1.00 0.00 ? 66  ILE A C      2  
ATOM   4736   O  O      . ILE A 1 59  ? 4.289   -1.478  -0.538  1.00 0.00 ? 66  ILE A O      2  
ATOM   4737   C  CB     . ILE A 1 59  ? 2.119   -1.709  -2.581  1.00 0.00 ? 66  ILE A CB     2  
ATOM   4738   C  CG1    . ILE A 1 59  ? 1.829   -1.832  -4.083  1.00 0.00 ? 66  ILE A CG1    2  
ATOM   4739   C  CG2    . ILE A 1 59  ? 0.814   -1.683  -1.798  1.00 0.00 ? 66  ILE A CG2    2  
ATOM   4740   C  CD1    . ILE A 1 59  ? 0.966   -0.723  -4.642  1.00 0.00 ? 66  ILE A CD1    2  
ATOM   4741   H  H      . ILE A 1 59  ? 4.839   -0.878  -3.136  1.00 0.00 ? 66  ILE A H      2  
ATOM   4742   H  HA     . ILE A 1 59  ? 2.319   0.416   -2.299  1.00 0.00 ? 66  ILE A HA     2  
ATOM   4743   H  HB     . ILE A 1 59  ? 2.677   -2.576  -2.260  1.00 0.00 ? 66  ILE A HB     2  
ATOM   4744   H  HG12   . ILE A 1 59  ? 2.765   -1.824  -4.620  1.00 0.00 ? 66  ILE A HG12   2  
ATOM   4745   H  HG13   . ILE A 1 59  ? 1.324   -2.774  -4.263  1.00 0.00 ? 66  ILE A HG13   2  
ATOM   4746   H  HG21   . ILE A 1 59  ? 0.260   -0.790  -2.051  1.00 0.00 ? 66  ILE A HG21   2  
ATOM   4747   H  HG22   . ILE A 1 59  ? 1.031   -1.684  -0.741  1.00 0.00 ? 66  ILE A HG22   2  
ATOM   4748   H  HG23   . ILE A 1 59  ? 0.227   -2.555  -2.046  1.00 0.00 ? 66  ILE A HG23   2  
ATOM   4749   H  HD11   . ILE A 1 59  ? 0.832   -0.871  -5.703  1.00 0.00 ? 66  ILE A HD11   2  
ATOM   4750   H  HD12   . ILE A 1 59  ? 1.445   0.229   -4.468  1.00 0.00 ? 66  ILE A HD12   2  
ATOM   4751   H  HD13   . ILE A 1 59  ? 0.003   -0.735  -4.153  1.00 0.00 ? 66  ILE A HD13   2  
ATOM   4752   N  N      . LEU A 1 60  ? 2.918   0.173   0.110   1.00 0.00 ? 67  LEU A N      2  
ATOM   4753   C  CA     . LEU A 1 60  ? 3.214   -0.003  1.529   1.00 0.00 ? 67  LEU A CA     2  
ATOM   4754   C  C      . LEU A 1 60  ? 2.159   -0.880  2.202   1.00 0.00 ? 67  LEU A C      2  
ATOM   4755   O  O      . LEU A 1 60  ? 0.983   -0.503  2.289   1.00 0.00 ? 67  LEU A O      2  
ATOM   4756   C  CB     . LEU A 1 60  ? 3.298   1.346   2.246   1.00 0.00 ? 67  LEU A CB     2  
ATOM   4757   C  CG     . LEU A 1 60  ? 4.574   2.154   1.986   1.00 0.00 ? 67  LEU A CG     2  
ATOM   4758   C  CD1    . LEU A 1 60  ? 4.496   3.495   2.691   1.00 0.00 ? 67  LEU A CD1    2  
ATOM   4759   C  CD2    . LEU A 1 60  ? 5.808   1.389   2.457   1.00 0.00 ? 67  LEU A CD2    2  
ATOM   4760   H  H      . LEU A 1 60  ? 2.313   0.894   -0.173  1.00 0.00 ? 67  LEU A H      2  
ATOM   4761   H  HA     . LEU A 1 60  ? 4.170   -0.498  1.605   1.00 0.00 ? 67  LEU A HA     2  
ATOM   4762   H  HB2    . LEU A 1 60  ? 2.451   1.943   1.940   1.00 0.00 ? 67  LEU A HB2    2  
ATOM   4763   H  HB3    . LEU A 1 60  ? 3.224   1.170   3.309   1.00 0.00 ? 67  LEU A HB3    2  
ATOM   4764   H  HG     . LEU A 1 60  ? 4.672   2.336   0.925   1.00 0.00 ? 67  LEU A HG     2  
ATOM   4765   H  HD11   . LEU A 1 60  ? 3.643   4.047   2.325   1.00 0.00 ? 67  LEU A HD11   2  
ATOM   4766   H  HD12   . LEU A 1 60  ? 5.398   4.056   2.494   1.00 0.00 ? 67  LEU A HD12   2  
ATOM   4767   H  HD13   . LEU A 1 60  ? 4.395   3.335   3.754   1.00 0.00 ? 67  LEU A HD13   2  
ATOM   4768   H  HD21   . LEU A 1 60  ? 6.689   1.997   2.292   1.00 0.00 ? 67  LEU A HD21   2  
ATOM   4769   H  HD22   . LEU A 1 60  ? 5.899   0.469   1.901   1.00 0.00 ? 67  LEU A HD22   2  
ATOM   4770   H  HD23   . LEU A 1 60  ? 5.717   1.168   3.512   1.00 0.00 ? 67  LEU A HD23   2  
ATOM   4771   N  N      . ASP A 1 61  ? 2.586   -2.044  2.671   1.00 0.00 ? 68  ASP A N      2  
ATOM   4772   C  CA     . ASP A 1 61  ? 1.707   -2.961  3.396   1.00 0.00 ? 68  ASP A CA     2  
ATOM   4773   C  C      . ASP A 1 61  ? 1.819   -2.691  4.898   1.00 0.00 ? 68  ASP A C      2  
ATOM   4774   O  O      . ASP A 1 61  ? 2.587   -3.341  5.611   1.00 0.00 ? 68  ASP A O      2  
ATOM   4775   C  CB     . ASP A 1 61  ? 2.079   -4.412  3.063   1.00 0.00 ? 68  ASP A CB     2  
ATOM   4776   C  CG     . ASP A 1 61  ? 1.157   -5.438  3.695   1.00 0.00 ? 68  ASP A CG     2  
ATOM   4777   O  OD1    . ASP A 1 61  ? 0.067   -5.687  3.154   1.00 0.00 ? 68  ASP A OD1    2  
ATOM   4778   O  OD2    . ASP A 1 61  ? 1.541   -6.047  4.718   1.00 0.00 ? 68  ASP A OD2    2  
ATOM   4779   H  H      . ASP A 1 61  ? 3.524   -2.298  2.532   1.00 0.00 ? 68  ASP A H      2  
ATOM   4780   H  HA     . ASP A 1 61  ? 0.692   -2.769  3.080   1.00 0.00 ? 68  ASP A HA     2  
ATOM   4781   H  HB2    . ASP A 1 61  ? 2.045   -4.546  1.991   1.00 0.00 ? 68  ASP A HB2    2  
ATOM   4782   H  HB3    . ASP A 1 61  ? 3.086   -4.601  3.407   1.00 0.00 ? 68  ASP A HB3    2  
ATOM   4783   N  N      . THR A 1 62  ? 1.061   -1.704  5.360   1.00 0.00 ? 69  THR A N      2  
ATOM   4784   C  CA     . THR A 1 62  ? 1.219   -1.177  6.711   1.00 0.00 ? 69  THR A CA     2  
ATOM   4785   C  C      . THR A 1 62  ? 0.542   -2.051  7.769   1.00 0.00 ? 69  THR A C      2  
ATOM   4786   O  O      . THR A 1 62  ? -0.379  -2.819  7.472   1.00 0.00 ? 69  THR A O      2  
ATOM   4787   C  CB     . THR A 1 62  ? 0.663   0.261   6.813   1.00 0.00 ? 69  THR A CB     2  
ATOM   4788   O  OG1    . THR A 1 62  ? -0.738  0.278   6.501   1.00 0.00 ? 69  THR A OG1    2  
ATOM   4789   C  CG2    . THR A 1 62  ? 1.399   1.198   5.867   1.00 0.00 ? 69  THR A CG2    2  
ATOM   4790   H  H      . THR A 1 62  ? 0.381   -1.318  4.776   1.00 0.00 ? 69  THR A H      2  
ATOM   4791   H  HA     . THR A 1 62  ? 2.278   -1.139  6.925   1.00 0.00 ? 69  THR A HA     2  
ATOM   4792   H  HB     . THR A 1 62  ? 0.802   0.614   7.825   1.00 0.00 ? 69  THR A HB     2  
ATOM   4793   H  HG1    . THR A 1 62  ? -0.857  0.259   5.544   1.00 0.00 ? 69  THR A HG1    2  
ATOM   4794   H  HG21   . THR A 1 62  ? 1.267   0.860   4.850   1.00 0.00 ? 69  THR A HG21   2  
ATOM   4795   H  HG22   . THR A 1 62  ? 2.451   1.202   6.112   1.00 0.00 ? 69  THR A HG22   2  
ATOM   4796   H  HG23   . THR A 1 62  ? 1.003   2.198   5.969   1.00 0.00 ? 69  THR A HG23   2  
ATOM   4797   N  N      . ALA A 1 63  ? 1.019   -1.926  9.004   1.00 0.00 ? 70  ALA A N      2  
ATOM   4798   C  CA     . ALA A 1 63  ? 0.430   -2.622  10.140  1.00 0.00 ? 70  ALA A CA     2  
ATOM   4799   C  C      . ALA A 1 63  ? -0.686  -1.779  10.747  1.00 0.00 ? 70  ALA A C      2  
ATOM   4800   O  O      . ALA A 1 63  ? -0.650  -0.548  10.679  1.00 0.00 ? 70  ALA A O      2  
ATOM   4801   C  CB     . ALA A 1 63  ? 1.496   -2.926  11.188  1.00 0.00 ? 70  ALA A CB     2  
ATOM   4802   H  H      . ALA A 1 63  ? 1.787   -1.342  9.155   1.00 0.00 ? 70  ALA A H      2  
ATOM   4803   H  HA     . ALA A 1 63  ? 0.018   -3.558  9.789   1.00 0.00 ? 70  ALA A HA     2  
ATOM   4804   H  HB1    . ALA A 1 63  ? 1.057   -3.495  11.995  1.00 0.00 ? 70  ALA A HB1    2  
ATOM   4805   H  HB2    . ALA A 1 63  ? 1.893   -1.999  11.579  1.00 0.00 ? 70  ALA A HB2    2  
ATOM   4806   H  HB3    . ALA A 1 63  ? 2.295   -3.497  10.737  1.00 0.00 ? 70  ALA A HB3    2  
ATOM   4807   N  N      . GLY A 1 64  ? -1.664  -2.437  11.347  1.00 0.00 ? 71  GLY A N      2  
ATOM   4808   C  CA     . GLY A 1 64  ? -2.797  -1.732  11.912  1.00 0.00 ? 71  GLY A CA     2  
ATOM   4809   C  C      . GLY A 1 64  ? -2.657  -1.535  13.404  1.00 0.00 ? 71  GLY A C      2  
ATOM   4810   O  O      . GLY A 1 64  ? -3.464  -2.031  14.188  1.00 0.00 ? 71  GLY A O      2  
ATOM   4811   H  H      . GLY A 1 64  ? -1.612  -3.417  11.423  1.00 0.00 ? 71  GLY A H      2  
ATOM   4812   H  HA2    . GLY A 1 64  ? -2.877  -0.766  11.435  1.00 0.00 ? 71  GLY A HA2    2  
ATOM   4813   H  HA3    . GLY A 1 64  ? -3.694  -2.298  11.715  1.00 0.00 ? 71  GLY A HA3    2  
ATOM   4814   N  N      . LEU A 1 65  ? -1.626  -0.808  13.794  1.00 0.00 ? 72  LEU A N      2  
ATOM   4815   C  CA     . LEU A 1 65  ? -1.338  -0.563  15.197  1.00 0.00 ? 72  LEU A CA     2  
ATOM   4816   C  C      . LEU A 1 65  ? -0.671  0.797   15.378  1.00 0.00 ? 72  LEU A C      2  
ATOM   4817   O  O      . LEU A 1 65  ? 0.000   1.288   14.470  1.00 0.00 ? 72  LEU A O      2  
ATOM   4818   C  CB     . LEU A 1 65  ? -0.460  -1.690  15.769  1.00 0.00 ? 72  LEU A CB     2  
ATOM   4819   C  CG     . LEU A 1 65  ? 0.558   -2.320  14.803  1.00 0.00 ? 72  LEU A CG     2  
ATOM   4820   C  CD1    . LEU A 1 65  ? 1.625   -1.322  14.376  1.00 0.00 ? 72  LEU A CD1    2  
ATOM   4821   C  CD2    . LEU A 1 65  ? 1.200   -3.543  15.440  1.00 0.00 ? 72  LEU A CD2    2  
ATOM   4822   H  H      . LEU A 1 65  ? -1.042  -0.414  13.114  1.00 0.00 ? 72  LEU A H      2  
ATOM   4823   H  HA     . LEU A 1 65  ? -2.279  -0.555  15.724  1.00 0.00 ? 72  LEU A HA     2  
ATOM   4824   H  HB2    . LEU A 1 65  ? 0.082   -1.294  16.615  1.00 0.00 ? 72  LEU A HB2    2  
ATOM   4825   H  HB3    . LEU A 1 65  ? -1.114  -2.473  16.123  1.00 0.00 ? 72  LEU A HB3    2  
ATOM   4826   H  HG     . LEU A 1 65  ? 0.037   -2.646  13.915  1.00 0.00 ? 72  LEU A HG     2  
ATOM   4827   H  HD11   . LEU A 1 65  ? 2.358   -1.820  13.761  1.00 0.00 ? 72  LEU A HD11   2  
ATOM   4828   H  HD12   . LEU A 1 65  ? 2.105   -0.910  15.248  1.00 0.00 ? 72  LEU A HD12   2  
ATOM   4829   H  HD13   . LEU A 1 65  ? 1.165   -0.525  13.810  1.00 0.00 ? 72  LEU A HD13   2  
ATOM   4830   H  HD21   . LEU A 1 65  ? 1.690   -3.255  16.357  1.00 0.00 ? 72  LEU A HD21   2  
ATOM   4831   H  HD22   . LEU A 1 65  ? 1.924   -3.964  14.760  1.00 0.00 ? 72  LEU A HD22   2  
ATOM   4832   H  HD23   . LEU A 1 65  ? 0.437   -4.277  15.653  1.00 0.00 ? 72  LEU A HD23   2  
ATOM   4833   N  N      . GLU A 1 66  ? -0.871  1.406   16.541  1.00 0.00 ? 73  GLU A N      2  
ATOM   4834   C  CA     . GLU A 1 66  ? -0.281  2.711   16.829  1.00 0.00 ? 73  GLU A CA     2  
ATOM   4835   C  C      . GLU A 1 66  ? 1.194   2.553   17.171  1.00 0.00 ? 73  GLU A C      2  
ATOM   4836   O  O      . GLU A 1 66  ? 1.950   3.524   17.159  1.00 0.00 ? 73  GLU A O      2  
ATOM   4837   C  CB     . GLU A 1 66  ? -0.992  3.417   17.992  1.00 0.00 ? 73  GLU A CB     2  
ATOM   4838   C  CG     . GLU A 1 66  ? -2.453  3.043   18.166  1.00 0.00 ? 73  GLU A CG     2  
ATOM   4839   C  CD     . GLU A 1 66  ? -2.627  1.776   18.981  1.00 0.00 ? 73  GLU A CD     2  
ATOM   4840   O  OE1    . GLU A 1 66  ? -2.679  1.875   20.223  1.00 0.00 ? 73  GLU A OE1    2  
ATOM   4841   O  OE2    . GLU A 1 66  ? -2.704  0.686   18.378  1.00 0.00 ? 73  GLU A OE2    2  
ATOM   4842   H  H      . GLU A 1 66  ? -1.444  0.973   17.224  1.00 0.00 ? 73  GLU A H      2  
ATOM   4843   H  HA     . GLU A 1 66  ? -0.369  3.319   15.940  1.00 0.00 ? 73  GLU A HA     2  
ATOM   4844   H  HB2    . GLU A 1 66  ? -0.477  3.174   18.911  1.00 0.00 ? 73  GLU A HB2    2  
ATOM   4845   H  HB3    . GLU A 1 66  ? -0.934  4.484   17.836  1.00 0.00 ? 73  GLU A HB3    2  
ATOM   4846   H  HG2    . GLU A 1 66  ? -2.964  3.851   18.665  1.00 0.00 ? 73  GLU A HG2    2  
ATOM   4847   H  HG3    . GLU A 1 66  ? -2.889  2.889   17.190  1.00 0.00 ? 73  GLU A HG3    2  
ATOM   4848   N  N      . ASP A 1 67  ? 1.583   1.317   17.479  1.00 0.00 ? 74  ASP A N      2  
ATOM   4849   C  CA     . ASP A 1 67  ? 2.960   0.983   17.839  1.00 0.00 ? 74  ASP A CA     2  
ATOM   4850   C  C      . ASP A 1 67  ? 3.944   1.551   16.837  1.00 0.00 ? 74  ASP A C      2  
ATOM   4851   O  O      . ASP A 1 67  ? 4.773   2.401   17.162  1.00 0.00 ? 74  ASP A O      2  
ATOM   4852   C  CB     . ASP A 1 67  ? 3.139   -0.532  17.882  1.00 0.00 ? 74  ASP A CB     2  
ATOM   4853   C  CG     . ASP A 1 67  ? 2.280   -1.196  18.933  1.00 0.00 ? 74  ASP A CG     2  
ATOM   4854   O  OD1    . ASP A 1 67  ? 1.099   -1.474  18.644  1.00 0.00 ? 74  ASP A OD1    2  
ATOM   4855   O  OD2    . ASP A 1 67  ? 2.786   -1.445  20.045  1.00 0.00 ? 74  ASP A OD2    2  
ATOM   4856   H  H      . ASP A 1 67  ? 0.911   0.600   17.477  1.00 0.00 ? 74  ASP A H      2  
ATOM   4857   H  HA     . ASP A 1 67  ? 3.166   1.393   18.816  1.00 0.00 ? 74  ASP A HA     2  
ATOM   4858   H  HB2    . ASP A 1 67  ? 2.876   -0.940  16.921  1.00 0.00 ? 74  ASP A HB2    2  
ATOM   4859   H  HB3    . ASP A 1 67  ? 4.170   -0.761  18.085  1.00 0.00 ? 74  ASP A HB3    2  
ATOM   4860   N  N      . TYR A 1 68  ? 3.836   1.082   15.611  1.00 0.00 ? 75  TYR A N      2  
ATOM   4861   C  CA     . TYR A 1 68  ? 4.754   1.482   14.572  1.00 0.00 ? 75  TYR A CA     2  
ATOM   4862   C  C      . TYR A 1 68  ? 4.202   2.645   13.774  1.00 0.00 ? 75  TYR A C      2  
ATOM   4863   O  O      . TYR A 1 68  ? 3.744   2.486   12.640  1.00 0.00 ? 75  TYR A O      2  
ATOM   4864   C  CB     . TYR A 1 68  ? 5.086   0.308   13.657  1.00 0.00 ? 75  TYR A CB     2  
ATOM   4865   C  CG     . TYR A 1 68  ? 5.984   -0.713  14.309  1.00 0.00 ? 75  TYR A CG     2  
ATOM   4866   C  CD1    . TYR A 1 68  ? 7.364   -0.573  14.261  1.00 0.00 ? 75  TYR A CD1    2  
ATOM   4867   C  CD2    . TYR A 1 68  ? 5.456   -1.804  14.988  1.00 0.00 ? 75  TYR A CD2    2  
ATOM   4868   C  CE1    . TYR A 1 68  ? 8.195   -1.489  14.876  1.00 0.00 ? 75  TYR A CE1    2  
ATOM   4869   C  CE2    . TYR A 1 68  ? 6.281   -2.726  15.600  1.00 0.00 ? 75  TYR A CE2    2  
ATOM   4870   C  CZ     . TYR A 1 68  ? 7.648   -2.564  15.541  1.00 0.00 ? 75  TYR A CZ     2  
ATOM   4871   O  OH     . TYR A 1 68  ? 8.473   -3.468  16.165  1.00 0.00 ? 75  TYR A OH     2  
ATOM   4872   H  H      . TYR A 1 68  ? 3.108   0.460   15.398  1.00 0.00 ? 75  TYR A H      2  
ATOM   4873   H  HA     . TYR A 1 68  ? 5.665   1.806   15.055  1.00 0.00 ? 75  TYR A HA     2  
ATOM   4874   H  HB2    . TYR A 1 68  ? 4.170   -0.188  13.373  1.00 0.00 ? 75  TYR A HB2    2  
ATOM   4875   H  HB3    . TYR A 1 68  ? 5.583   0.676   12.772  1.00 0.00 ? 75  TYR A HB3    2  
ATOM   4876   H  HD1    . TYR A 1 68  ? 7.787   0.269   13.735  1.00 0.00 ? 75  TYR A HD1    2  
ATOM   4877   H  HD2    . TYR A 1 68  ? 4.386   -1.928  15.029  1.00 0.00 ? 75  TYR A HD2    2  
ATOM   4878   H  HE1    . TYR A 1 68  ? 9.267   -1.362  14.828  1.00 0.00 ? 75  TYR A HE1    2  
ATOM   4879   H  HE2    . TYR A 1 68  ? 5.853   -3.572  16.118  1.00 0.00 ? 75  TYR A HE2    2  
ATOM   4880   H  HH     . TYR A 1 68  ? 9.144   -2.987  16.679  1.00 0.00 ? 75  TYR A HH     2  
ATOM   4881   N  N      . ALA A 1 69  ? 4.243   3.815   14.386  1.00 0.00 ? 76  ALA A N      2  
ATOM   4882   C  CA     . ALA A 1 69  ? 3.855   5.047   13.718  1.00 0.00 ? 76  ALA A CA     2  
ATOM   4883   C  C      . ALA A 1 69  ? 4.781   5.326   12.541  1.00 0.00 ? 76  ALA A C      2  
ATOM   4884   O  O      . ALA A 1 69  ? 4.429   6.042   11.609  1.00 0.00 ? 76  ALA A O      2  
ATOM   4885   C  CB     . ALA A 1 69  ? 3.883   6.203   14.700  1.00 0.00 ? 76  ALA A CB     2  
ATOM   4886   H  H      . ALA A 1 69  ? 4.522   3.849   15.328  1.00 0.00 ? 76  ALA A H      2  
ATOM   4887   H  HA     . ALA A 1 69  ? 2.843   4.931   13.356  1.00 0.00 ? 76  ALA A HA     2  
ATOM   4888   H  HB1    . ALA A 1 69  ? 4.894   6.356   15.045  1.00 0.00 ? 76  ALA A HB1    2  
ATOM   4889   H  HB2    . ALA A 1 69  ? 3.245   5.973   15.542  1.00 0.00 ? 76  ALA A HB2    2  
ATOM   4890   H  HB3    . ALA A 1 69  ? 3.527   7.098   14.214  1.00 0.00 ? 76  ALA A HB3    2  
ATOM   4891   N  N      . ALA A 1 70  ? 5.966   4.726   12.589  1.00 0.00 ? 77  ALA A N      2  
ATOM   4892   C  CA     . ALA A 1 70  ? 6.961   4.883   11.538  1.00 0.00 ? 77  ALA A CA     2  
ATOM   4893   C  C      . ALA A 1 70  ? 6.553   4.151   10.267  1.00 0.00 ? 77  ALA A C      2  
ATOM   4894   O  O      . ALA A 1 70  ? 7.221   4.256   9.244   1.00 0.00 ? 77  ALA A O      2  
ATOM   4895   C  CB     . ALA A 1 70  ? 8.316   4.388   12.020  1.00 0.00 ? 77  ALA A CB     2  
ATOM   4896   H  H      . ALA A 1 70  ? 6.173   4.162   13.361  1.00 0.00 ? 77  ALA A H      2  
ATOM   4897   H  HA     . ALA A 1 70  ? 7.048   5.937   11.320  1.00 0.00 ? 77  ALA A HA     2  
ATOM   4898   H  HB1    . ALA A 1 70  ? 9.058   4.567   11.254  1.00 0.00 ? 77  ALA A HB1    2  
ATOM   4899   H  HB2    . ALA A 1 70  ? 8.258   3.329   12.225  1.00 0.00 ? 77  ALA A HB2    2  
ATOM   4900   H  HB3    . ALA A 1 70  ? 8.595   4.914   12.921  1.00 0.00 ? 77  ALA A HB3    2  
ATOM   4901   N  N      . ILE A 1 71  ? 5.468   3.392   10.341  1.00 0.00 ? 78  ILE A N      2  
ATOM   4902   C  CA     . ILE A 1 71  ? 4.981   2.658   9.185   1.00 0.00 ? 78  ILE A CA     2  
ATOM   4903   C  C      . ILE A 1 71  ? 3.722   3.305   8.614   1.00 0.00 ? 78  ILE A C      2  
ATOM   4904   O  O      . ILE A 1 71  ? 3.539   3.346   7.402   1.00 0.00 ? 78  ILE A O      2  
ATOM   4905   C  CB     . ILE A 1 71  ? 4.700   1.182   9.534   1.00 0.00 ? 78  ILE A CB     2  
ATOM   4906   C  CG1    . ILE A 1 71  ? 5.969   0.532   10.085  1.00 0.00 ? 78  ILE A CG1    2  
ATOM   4907   C  CG2    . ILE A 1 71  ? 4.210   0.425   8.306   1.00 0.00 ? 78  ILE A CG2    2  
ATOM   4908   C  CD1    . ILE A 1 71  ? 5.766   -0.871  10.613  1.00 0.00 ? 78  ILE A CD1    2  
ATOM   4909   H  H      . ILE A 1 71  ? 4.985   3.324   11.191  1.00 0.00 ? 78  ILE A H      2  
ATOM   4910   H  HA     . ILE A 1 71  ? 5.756   2.683   8.429   1.00 0.00 ? 78  ILE A HA     2  
ATOM   4911   H  HB     . ILE A 1 71  ? 3.927   1.152   10.287  1.00 0.00 ? 78  ILE A HB     2  
ATOM   4912   H  HG12   . ILE A 1 71  ? 6.708   0.482   9.300   1.00 0.00 ? 78  ILE A HG12   2  
ATOM   4913   H  HG13   . ILE A 1 71  ? 6.351   1.138   10.892  1.00 0.00 ? 78  ILE A HG13   2  
ATOM   4914   H  HG21   . ILE A 1 71  ? 4.082   -0.618  8.557   1.00 0.00 ? 78  ILE A HG21   2  
ATOM   4915   H  HG22   . ILE A 1 71  ? 4.937   0.518   7.510   1.00 0.00 ? 78  ILE A HG22   2  
ATOM   4916   H  HG23   . ILE A 1 71  ? 3.265   0.836   7.980   1.00 0.00 ? 78  ILE A HG23   2  
ATOM   4917   H  HD11   . ILE A 1 71  ? 5.030   -0.854  11.404  1.00 0.00 ? 78  ILE A HD11   2  
ATOM   4918   H  HD12   . ILE A 1 71  ? 6.703   -1.244  11.000  1.00 0.00 ? 78  ILE A HD12   2  
ATOM   4919   H  HD13   . ILE A 1 71  ? 5.426   -1.514  9.816   1.00 0.00 ? 78  ILE A HD13   2  
ATOM   4920   N  N      . ARG A 1 72  ? 2.851   3.808   9.480   1.00 0.00 ? 79  ARG A N      2  
ATOM   4921   C  CA     . ARG A 1 72  ? 1.635   4.459   9.004   1.00 0.00 ? 79  ARG A CA     2  
ATOM   4922   C  C      . ARG A 1 72  ? 1.857   5.955   8.847   1.00 0.00 ? 79  ARG A C      2  
ATOM   4923   O  O      . ARG A 1 72  ? 1.853   6.487   7.744   1.00 0.00 ? 79  ARG A O      2  
ATOM   4924   C  CB     . ARG A 1 72  ? 0.465   4.263   9.973   1.00 0.00 ? 79  ARG A CB     2  
ATOM   4925   C  CG     . ARG A 1 72  ? 0.616   3.117   10.955  1.00 0.00 ? 79  ARG A CG     2  
ATOM   4926   C  CD     . ARG A 1 72  ? -0.467  3.193   12.024  1.00 0.00 ? 79  ARG A CD     2  
ATOM   4927   N  NE     . ARG A 1 72  ? -0.545  4.535   12.610  1.00 0.00 ? 79  ARG A NE     2  
ATOM   4928   C  CZ     . ARG A 1 72  ? -1.579  4.995   13.313  1.00 0.00 ? 79  ARG A CZ     2  
ATOM   4929   N  NH1    . ARG A 1 72  ? -2.616  4.212   13.593  1.00 0.00 ? 79  ARG A NH1    2  
ATOM   4930   N  NH2    . ARG A 1 72  ? -1.572  6.257   13.729  1.00 0.00 ? 79  ARG A NH2    2  
ATOM   4931   H  H      . ARG A 1 72  ? 3.027   3.746   10.440  1.00 0.00 ? 79  ARG A H      2  
ATOM   4932   H  HA     . ARG A 1 72  ? 1.378   4.035   8.045   1.00 0.00 ? 79  ARG A HA     2  
ATOM   4933   H  HB2    . ARG A 1 72  ? 0.339   5.171   10.542  1.00 0.00 ? 79  ARG A HB2    2  
ATOM   4934   H  HB3    . ARG A 1 72  ? -0.431  4.091   9.394   1.00 0.00 ? 79  ARG A HB3    2  
ATOM   4935   H  HG2    . ARG A 1 72  ? 0.527   2.181   10.423  1.00 0.00 ? 79  ARG A HG2    2  
ATOM   4936   H  HG3    . ARG A 1 72  ? 1.586   3.180   11.427  1.00 0.00 ? 79  ARG A HG3    2  
ATOM   4937   H  HD2    . ARG A 1 72  ? -1.418  2.948   11.576  1.00 0.00 ? 79  ARG A HD2    2  
ATOM   4938   H  HD3    . ARG A 1 72  ? -0.240  2.481   12.804  1.00 0.00 ? 79  ARG A HD3    2  
ATOM   4939   H  HE     . ARG A 1 72  ? 0.219   5.148   12.444  1.00 0.00 ? 79  ARG A HE     2  
ATOM   4940   H  HH11   . ARG A 1 72  ? -2.633  3.258   13.278  1.00 0.00 ? 79  ARG A HH11   2  
ATOM   4941   H  HH12   . ARG A 1 72  ? -3.399  4.578   14.116  1.00 0.00 ? 79  ARG A HH12   2  
ATOM   4942   H  HH21   . ARG A 1 72  ? -0.790  6.862   13.502  1.00 0.00 ? 79  ARG A HH21   2  
ATOM   4943   H  HH22   . ARG A 1 72  ? -2.336  6.619   14.274  1.00 0.00 ? 79  ARG A HH22   2  
ATOM   4944   N  N      . ASP A 1 73  ? 2.090   6.609   9.976   1.00 0.00 ? 80  ASP A N      2  
ATOM   4945   C  CA     . ASP A 1 73  ? 2.100   8.063   10.055  1.00 0.00 ? 80  ASP A CA     2  
ATOM   4946   C  C      . ASP A 1 73  ? 3.338   8.641   9.389   1.00 0.00 ? 80  ASP A C      2  
ATOM   4947   O  O      . ASP A 1 73  ? 3.255   9.594   8.616   1.00 0.00 ? 80  ASP A O      2  
ATOM   4948   C  CB     . ASP A 1 73  ? 2.062   8.509   11.522  1.00 0.00 ? 80  ASP A CB     2  
ATOM   4949   C  CG     . ASP A 1 73  ? 1.058   7.732   12.354  1.00 0.00 ? 80  ASP A CG     2  
ATOM   4950   O  OD1    . ASP A 1 73  ? 1.267   6.513   12.560  1.00 0.00 ? 80  ASP A OD1    2  
ATOM   4951   O  OD2    . ASP A 1 73  ? 0.062   8.327   12.808  1.00 0.00 ? 80  ASP A OD2    2  
ATOM   4952   H  H      . ASP A 1 73  ? 2.253   6.095   10.797  1.00 0.00 ? 80  ASP A H      2  
ATOM   4953   H  HA     . ASP A 1 73  ? 1.223   8.433   9.551   1.00 0.00 ? 80  ASP A HA     2  
ATOM   4954   H  HB2    . ASP A 1 73  ? 3.040   8.374   11.957  1.00 0.00 ? 80  ASP A HB2    2  
ATOM   4955   H  HB3    . ASP A 1 73  ? 1.799   9.557   11.562  1.00 0.00 ? 80  ASP A HB3    2  
ATOM   4956   N  N      . ASN A 1 74  ? 4.483   8.054   9.696   1.00 0.00 ? 81  ASN A N      2  
ATOM   4957   C  CA     . ASN A 1 74  ? 5.764   8.555   9.212   1.00 0.00 ? 81  ASN A CA     2  
ATOM   4958   C  C      . ASN A 1 74  ? 6.005   8.181   7.753   1.00 0.00 ? 81  ASN A C      2  
ATOM   4959   O  O      . ASN A 1 74  ? 6.884   8.741   7.104   1.00 0.00 ? 81  ASN A O      2  
ATOM   4960   C  CB     . ASN A 1 74  ? 6.901   8.044   10.099  1.00 0.00 ? 81  ASN A CB     2  
ATOM   4961   C  CG     . ASN A 1 74  ? 6.805   8.595   11.510  1.00 0.00 ? 81  ASN A CG     2  
ATOM   4962   O  OD1    . ASN A 1 74  ? 6.283   9.683   11.728  1.00 0.00 ? 81  ASN A OD1    2  
ATOM   4963   N  ND2    . ASN A 1 74  ? 7.303   7.849   12.483  1.00 0.00 ? 81  ASN A ND2    2  
ATOM   4964   H  H      . ASN A 1 74  ? 4.469   7.262   10.282  1.00 0.00 ? 81  ASN A H      2  
ATOM   4965   H  HA     . ASN A 1 74  ? 5.735   9.633   9.284   1.00 0.00 ? 81  ASN A HA     2  
ATOM   4966   H  HB2    . ASN A 1 74  ? 6.855   6.963   10.147  1.00 0.00 ? 81  ASN A HB2    2  
ATOM   4967   H  HB3    . ASN A 1 74  ? 7.846   8.343   9.674   1.00 0.00 ? 81  ASN A HB3    2  
ATOM   4968   H  HD21   . ASN A 1 74  ? 7.703   6.989   12.248  1.00 0.00 ? 81  ASN A HD21   2  
ATOM   4969   H  HD22   . ASN A 1 74  ? 7.255   8.194   13.401  1.00 0.00 ? 81  ASN A HD22   2  
ATOM   4970   N  N      . TYR A 1 75  ? 5.242   7.223   7.246   1.00 0.00 ? 82  TYR A N      2  
ATOM   4971   C  CA     . TYR A 1 75  ? 5.346   6.837   5.842   1.00 0.00 ? 82  TYR A CA     2  
ATOM   4972   C  C      . TYR A 1 75  ? 4.329   7.591   4.985   1.00 0.00 ? 82  TYR A C      2  
ATOM   4973   O  O      . TYR A 1 75  ? 4.186   7.319   3.793   1.00 0.00 ? 82  TYR A O      2  
ATOM   4974   C  CB     . TYR A 1 75  ? 5.148   5.332   5.661   1.00 0.00 ? 82  TYR A CB     2  
ATOM   4975   C  CG     . TYR A 1 75  ? 6.430   4.524   5.589   1.00 0.00 ? 82  TYR A CG     2  
ATOM   4976   C  CD1    . TYR A 1 75  ? 7.536   4.982   4.878   1.00 0.00 ? 82  TYR A CD1    2  
ATOM   4977   C  CD2    . TYR A 1 75  ? 6.527   3.289   6.219   1.00 0.00 ? 82  TYR A CD2    2  
ATOM   4978   C  CE1    . TYR A 1 75  ? 8.698   4.233   4.807   1.00 0.00 ? 82  TYR A CE1    2  
ATOM   4979   C  CE2    . TYR A 1 75  ? 7.682   2.537   6.149   1.00 0.00 ? 82  TYR A CE2    2  
ATOM   4980   C  CZ     . TYR A 1 75  ? 8.763   3.010   5.440   1.00 0.00 ? 82  TYR A CZ     2  
ATOM   4981   O  OH     . TYR A 1 75  ? 9.912   2.259   5.368   1.00 0.00 ? 82  TYR A OH     2  
ATOM   4982   H  H      . TYR A 1 75  ? 4.588   6.776   7.819   1.00 0.00 ? 82  TYR A H      2  
ATOM   4983   H  HA     . TYR A 1 75  ? 6.337   7.101   5.505   1.00 0.00 ? 82  TYR A HA     2  
ATOM   4984   H  HB2    . TYR A 1 75  ? 4.572   4.953   6.492   1.00 0.00 ? 82  TYR A HB2    2  
ATOM   4985   H  HB3    . TYR A 1 75  ? 4.597   5.161   4.747   1.00 0.00 ? 82  TYR A HB3    2  
ATOM   4986   H  HD1    . TYR A 1 75  ? 7.483   5.940   4.382   1.00 0.00 ? 82  TYR A HD1    2  
ATOM   4987   H  HD2    . TYR A 1 75  ? 5.679   2.920   6.775   1.00 0.00 ? 82  TYR A HD2    2  
ATOM   4988   H  HE1    . TYR A 1 75  ? 9.548   4.607   4.253   1.00 0.00 ? 82  TYR A HE1    2  
ATOM   4989   H  HE2    . TYR A 1 75  ? 7.733   1.581   6.647   1.00 0.00 ? 82  TYR A HE2    2  
ATOM   4990   H  HH     . TYR A 1 75  ? 9.727   1.442   4.886   1.00 0.00 ? 82  TYR A HH     2  
ATOM   4991   N  N      . PHE A 1 76  ? 3.626   8.539   5.587   1.00 0.00 ? 83  PHE A N      2  
ATOM   4992   C  CA     . PHE A 1 76  ? 2.673   9.358   4.850   1.00 0.00 ? 83  PHE A CA     2  
ATOM   4993   C  C      . PHE A 1 76  ? 3.394   10.468  4.087   1.00 0.00 ? 83  PHE A C      2  
ATOM   4994   O  O      . PHE A 1 76  ? 4.589   10.363  3.815   1.00 0.00 ? 83  PHE A O      2  
ATOM   4995   C  CB     . PHE A 1 76  ? 1.632   9.958   5.792   1.00 0.00 ? 83  PHE A CB     2  
ATOM   4996   C  CG     . PHE A 1 76  ? 0.553   9.001   6.216   1.00 0.00 ? 83  PHE A CG     2  
ATOM   4997   C  CD1    . PHE A 1 76  ? 0.144   7.973   5.379   1.00 0.00 ? 83  PHE A CD1    2  
ATOM   4998   C  CD2    . PHE A 1 76  ? -0.062  9.140   7.449   1.00 0.00 ? 83  PHE A CD2    2  
ATOM   4999   C  CE1    . PHE A 1 76  ? -0.859  7.102   5.769   1.00 0.00 ? 83  PHE A CE1    2  
ATOM   5000   C  CE2    . PHE A 1 76  ? -1.065  8.277   7.842   1.00 0.00 ? 83  PHE A CE2    2  
ATOM   5001   C  CZ     . PHE A 1 76  ? -1.464  7.256   7.000   1.00 0.00 ? 83  PHE A CZ     2  
ATOM   5002   H  H      . PHE A 1 76  ? 3.758   8.701   6.546   1.00 0.00 ? 83  PHE A H      2  
ATOM   5003   H  HA     . PHE A 1 76  ? 2.173   8.718   4.138   1.00 0.00 ? 83  PHE A HA     2  
ATOM   5004   H  HB2    . PHE A 1 76  ? 2.127   10.308  6.684   1.00 0.00 ? 83  PHE A HB2    2  
ATOM   5005   H  HB3    . PHE A 1 76  ? 1.156   10.796  5.302   1.00 0.00 ? 83  PHE A HB3    2  
ATOM   5006   H  HD1    . PHE A 1 76  ? 0.618   7.853   4.417   1.00 0.00 ? 83  PHE A HD1    2  
ATOM   5007   H  HD2    . PHE A 1 76  ? 0.248   9.937   8.106   1.00 0.00 ? 83  PHE A HD2    2  
ATOM   5008   H  HE1    . PHE A 1 76  ? -1.169  6.305   5.109   1.00 0.00 ? 83  PHE A HE1    2  
ATOM   5009   H  HE2    . PHE A 1 76  ? -1.538  8.399   8.806   1.00 0.00 ? 83  PHE A HE2    2  
ATOM   5010   H  HZ     . PHE A 1 76  ? -2.248  6.581   7.305   1.00 0.00 ? 83  PHE A HZ     2  
ATOM   5011   N  N      . ARG A 1 77  ? 2.648   11.520  3.728   1.00 0.00 ? 84  ARG A N      2  
ATOM   5012   C  CA     . ARG A 1 77  ? 3.184   12.664  2.976   1.00 0.00 ? 84  ARG A CA     2  
ATOM   5013   C  C      . ARG A 1 77  ? 3.536   12.283  1.536   1.00 0.00 ? 84  ARG A C      2  
ATOM   5014   O  O      . ARG A 1 77  ? 2.865   12.703  0.595   1.00 0.00 ? 84  ARG A O      2  
ATOM   5015   C  CB     . ARG A 1 77  ? 4.416   13.267  3.668   1.00 0.00 ? 84  ARG A CB     2  
ATOM   5016   C  CG     . ARG A 1 77  ? 4.132   13.893  5.024   1.00 0.00 ? 84  ARG A CG     2  
ATOM   5017   C  CD     . ARG A 1 77  ? 3.185   15.076  4.910   1.00 0.00 ? 84  ARG A CD     2  
ATOM   5018   N  NE     . ARG A 1 77  ? 3.697   16.123  4.023   1.00 0.00 ? 84  ARG A NE     2  
ATOM   5019   C  CZ     . ARG A 1 77  ? 2.957   17.132  3.555   1.00 0.00 ? 84  ARG A CZ     2  
ATOM   5020   N  NH1    . ARG A 1 77  ? 1.694   17.268  3.938   1.00 0.00 ? 84  ARG A NH1    2  
ATOM   5021   N  NH2    . ARG A 1 77  ? 3.488   18.025  2.732   1.00 0.00 ? 84  ARG A NH2    2  
ATOM   5022   H  H      . ARG A 1 77  ? 1.705   11.531  3.985   1.00 0.00 ? 84  ARG A H      2  
ATOM   5023   H  HA     . ARG A 1 77  ? 2.410   13.417  2.944   1.00 0.00 ? 84  ARG A HA     2  
ATOM   5024   H  HB2    . ARG A 1 77  ? 5.150   12.487  3.806   1.00 0.00 ? 84  ARG A HB2    2  
ATOM   5025   H  HB3    . ARG A 1 77  ? 4.834   14.027  3.027   1.00 0.00 ? 84  ARG A HB3    2  
ATOM   5026   H  HG2    . ARG A 1 77  ? 3.686   13.150  5.666   1.00 0.00 ? 84  ARG A HG2    2  
ATOM   5027   H  HG3    . ARG A 1 77  ? 5.064   14.230  5.454   1.00 0.00 ? 84  ARG A HG3    2  
ATOM   5028   H  HD2    . ARG A 1 77  ? 2.238   14.727  4.526   1.00 0.00 ? 84  ARG A HD2    2  
ATOM   5029   H  HD3    . ARG A 1 77  ? 3.037   15.497  5.895   1.00 0.00 ? 84  ARG A HD3    2  
ATOM   5030   H  HE     . ARG A 1 77  ? 4.645   16.066  3.756   1.00 0.00 ? 84  ARG A HE     2  
ATOM   5031   H  HH11   . ARG A 1 77  ? 1.285   16.616  4.586   1.00 0.00 ? 84  ARG A HH11   2  
ATOM   5032   H  HH12   . ARG A 1 77  ? 1.138   18.031  3.577   1.00 0.00 ? 84  ARG A HH12   2  
ATOM   5033   H  HH21   . ARG A 1 77  ? 4.459   17.955  2.459   1.00 0.00 ? 84  ARG A HH21   2  
ATOM   5034   H  HH22   . ARG A 1 77  ? 2.923   18.770  2.366   1.00 0.00 ? 84  ARG A HH22   2  
ATOM   5035   N  N      . SER A 1 78  ? 4.573   11.477  1.372   1.00 0.00 ? 85  SER A N      2  
ATOM   5036   C  CA     . SER A 1 78  ? 5.084   11.128  0.054   1.00 0.00 ? 85  SER A CA     2  
ATOM   5037   C  C      . SER A 1 78  ? 4.163   10.139  -0.669  1.00 0.00 ? 85  SER A C      2  
ATOM   5038   O  O      . SER A 1 78  ? 4.289   9.930   -1.876  1.00 0.00 ? 85  SER A O      2  
ATOM   5039   C  CB     . SER A 1 78  ? 6.483   10.541  0.209   1.00 0.00 ? 85  SER A CB     2  
ATOM   5040   O  OG     . SER A 1 78  ? 7.231   11.287  1.155   1.00 0.00 ? 85  SER A OG     2  
ATOM   5041   H  H      . SER A 1 78  ? 5.023   11.110  2.169   1.00 0.00 ? 85  SER A H      2  
ATOM   5042   H  HA     . SER A 1 78  ? 5.148   12.034  -0.527  1.00 0.00 ? 85  SER A HA     2  
ATOM   5043   H  HB2    . SER A 1 78  ? 6.409   9.518   0.549   1.00 0.00 ? 85  SER A HB2    2  
ATOM   5044   H  HB3    . SER A 1 78  ? 6.992   10.571  -0.741  1.00 0.00 ? 85  SER A HB3    2  
ATOM   5045   H  HG     . SER A 1 78  ? 8.016   11.676  0.723   1.00 0.00 ? 85  SER A HG     2  
ATOM   5046   N  N      . GLY A 1 79  ? 3.245   9.529   0.076   1.00 0.00 ? 86  GLY A N      2  
ATOM   5047   C  CA     . GLY A 1 79  ? 2.279   8.624   -0.526  1.00 0.00 ? 86  GLY A CA     2  
ATOM   5048   C  C      . GLY A 1 79  ? 1.217   9.370   -1.312  1.00 0.00 ? 86  GLY A C      2  
ATOM   5049   O  O      . GLY A 1 79  ? 0.837   10.483  -0.944  1.00 0.00 ? 86  GLY A O      2  
ATOM   5050   H  H      . GLY A 1 79  ? 3.226   9.693   1.040   1.00 0.00 ? 86  GLY A H      2  
ATOM   5051   H  HA2    . GLY A 1 79  ? 2.797   7.949   -1.191  1.00 0.00 ? 86  GLY A HA2    2  
ATOM   5052   H  HA3    . GLY A 1 79  ? 1.801   8.052   0.254   1.00 0.00 ? 86  GLY A HA3    2  
ATOM   5053   N  N      . GLU A 1 80  ? 0.744   8.758   -2.387  1.00 0.00 ? 87  GLU A N      2  
ATOM   5054   C  CA     . GLU A 1 80  ? -0.247  9.378   -3.259  1.00 0.00 ? 87  GLU A CA     2  
ATOM   5055   C  C      . GLU A 1 80  ? -1.617  8.746   -3.036  1.00 0.00 ? 87  GLU A C      2  
ATOM   5056   O  O      . GLU A 1 80  ? -2.502  9.351   -2.435  1.00 0.00 ? 87  GLU A O      2  
ATOM   5057   C  CB     . GLU A 1 80  ? 0.168   9.204   -4.723  1.00 0.00 ? 87  GLU A CB     2  
ATOM   5058   C  CG     . GLU A 1 80  ? 1.596   9.638   -5.006  1.00 0.00 ? 87  GLU A CG     2  
ATOM   5059   C  CD     . GLU A 1 80  ? 2.058   9.250   -6.395  1.00 0.00 ? 87  GLU A CD     2  
ATOM   5060   O  OE1    . GLU A 1 80  ? 1.928   8.058   -6.751  1.00 0.00 ? 87  GLU A OE1    2  
ATOM   5061   O  OE2    . GLU A 1 80  ? 2.588   10.124  -7.120  1.00 0.00 ? 87  GLU A OE2    2  
ATOM   5062   H  H      . GLU A 1 80  ? 1.065   7.858   -2.602  1.00 0.00 ? 87  GLU A H      2  
ATOM   5063   H  HA     . GLU A 1 80  ? -0.301  10.435  -3.027  1.00 0.00 ? 87  GLU A HA     2  
ATOM   5064   H  HB2    . GLU A 1 80  ? 0.074   8.160   -4.987  1.00 0.00 ? 87  GLU A HB2    2  
ATOM   5065   H  HB3    . GLU A 1 80  ? -0.495  9.785   -5.345  1.00 0.00 ? 87  GLU A HB3    2  
ATOM   5066   H  HG2    . GLU A 1 80  ? 1.659   10.710  -4.908  1.00 0.00 ? 87  GLU A HG2    2  
ATOM   5067   H  HG3    . GLU A 1 80  ? 2.249   9.171   -4.283  1.00 0.00 ? 87  GLU A HG3    2  
ATOM   5068   N  N      . GLY A 1 81  ? -1.773  7.508   -3.495  1.00 0.00 ? 88  GLY A N      2  
ATOM   5069   C  CA     . GLY A 1 81  ? -3.063  6.852   -3.433  1.00 0.00 ? 88  GLY A CA     2  
ATOM   5070   C  C      . GLY A 1 81  ? -3.221  5.988   -2.199  1.00 0.00 ? 88  GLY A C      2  
ATOM   5071   O  O      . GLY A 1 81  ? -2.256  5.379   -1.730  1.00 0.00 ? 88  GLY A O      2  
ATOM   5072   H  H      . GLY A 1 81  ? -0.997  7.030   -3.863  1.00 0.00 ? 88  GLY A H      2  
ATOM   5073   H  HA2    . GLY A 1 81  ? -3.833  7.608   -3.428  1.00 0.00 ? 88  GLY A HA2    2  
ATOM   5074   H  HA3    . GLY A 1 81  ? -3.184  6.235   -4.311  1.00 0.00 ? 88  GLY A HA3    2  
ATOM   5075   N  N      . PHE A 1 82  ? -4.438  5.929   -1.674  1.00 0.00 ? 89  PHE A N      2  
ATOM   5076   C  CA     . PHE A 1 82  ? -4.709  5.150   -0.476  1.00 0.00 ? 89  PHE A CA     2  
ATOM   5077   C  C      . PHE A 1 82  ? -5.851  4.173   -0.706  1.00 0.00 ? 89  PHE A C      2  
ATOM   5078   O  O      . PHE A 1 82  ? -6.924  4.548   -1.184  1.00 0.00 ? 89  PHE A O      2  
ATOM   5079   C  CB     . PHE A 1 82  ? -5.035  6.075   0.701   1.00 0.00 ? 89  PHE A CB     2  
ATOM   5080   C  CG     . PHE A 1 82  ? -3.889  6.958   1.101   1.00 0.00 ? 89  PHE A CG     2  
ATOM   5081   C  CD1    . PHE A 1 82  ? -3.724  8.205   0.522   1.00 0.00 ? 89  PHE A CD1    2  
ATOM   5082   C  CD2    . PHE A 1 82  ? -2.975  6.539   2.053   1.00 0.00 ? 89  PHE A CD2    2  
ATOM   5083   C  CE1    . PHE A 1 82  ? -2.667  9.018   0.882   1.00 0.00 ? 89  PHE A CE1    2  
ATOM   5084   C  CE2    . PHE A 1 82  ? -1.918  7.347   2.417   1.00 0.00 ? 89  PHE A CE2    2  
ATOM   5085   C  CZ     . PHE A 1 82  ? -1.763  8.588   1.832   1.00 0.00 ? 89  PHE A CZ     2  
ATOM   5086   H  H      . PHE A 1 82  ? -5.176  6.419   -2.104  1.00 0.00 ? 89  PHE A H      2  
ATOM   5087   H  HA     . PHE A 1 82  ? -3.818  4.588   -0.240  1.00 0.00 ? 89  PHE A HA     2  
ATOM   5088   H  HB2    . PHE A 1 82  ? -5.866  6.710   0.430   1.00 0.00 ? 89  PHE A HB2    2  
ATOM   5089   H  HB3    . PHE A 1 82  ? -5.311  5.474   1.556   1.00 0.00 ? 89  PHE A HB3    2  
ATOM   5090   H  HD1    . PHE A 1 82  ? -4.433  8.541   -0.219  1.00 0.00 ? 89  PHE A HD1    2  
ATOM   5091   H  HD2    . PHE A 1 82  ? -3.096  5.568   2.511   1.00 0.00 ? 89  PHE A HD2    2  
ATOM   5092   H  HE1    . PHE A 1 82  ? -2.547  9.987   0.421   1.00 0.00 ? 89  PHE A HE1    2  
ATOM   5093   H  HE2    . PHE A 1 82  ? -1.212  7.009   3.162   1.00 0.00 ? 89  PHE A HE2    2  
ATOM   5094   H  HZ     . PHE A 1 82  ? -0.935  9.219   2.116   1.00 0.00 ? 89  PHE A HZ     2  
ATOM   5095   N  N      . LEU A 1 83  ? -5.611  2.916   -0.375  1.00 0.00 ? 90  LEU A N      2  
ATOM   5096   C  CA     . LEU A 1 83  ? -6.628  1.889   -0.510  1.00 0.00 ? 90  LEU A CA     2  
ATOM   5097   C  C      . LEU A 1 83  ? -7.193  1.518   0.851   1.00 0.00 ? 90  LEU A C      2  
ATOM   5098   O  O      . LEU A 1 83  ? -6.485  0.972   1.705   1.00 0.00 ? 90  LEU A O      2  
ATOM   5099   C  CB     . LEU A 1 83  ? -6.060  0.643   -1.198  1.00 0.00 ? 90  LEU A CB     2  
ATOM   5100   C  CG     . LEU A 1 83  ? -5.753  0.800   -2.688  1.00 0.00 ? 90  LEU A CG     2  
ATOM   5101   C  CD1    . LEU A 1 83  ? -5.074  -0.448  -3.232  1.00 0.00 ? 90  LEU A CD1    2  
ATOM   5102   C  CD2    . LEU A 1 83  ? -7.029  1.074   -3.463  1.00 0.00 ? 90  LEU A CD2    2  
ATOM   5103   H  H      . LEU A 1 83  ? -4.726  2.673   -0.023  1.00 0.00 ? 90  LEU A H      2  
ATOM   5104   H  HA     . LEU A 1 83  ? -7.425  2.291   -1.115  1.00 0.00 ? 90  LEU A HA     2  
ATOM   5105   H  HB2    . LEU A 1 83  ? -5.149  0.364   -0.692  1.00 0.00 ? 90  LEU A HB2    2  
ATOM   5106   H  HB3    . LEU A 1 83  ? -6.775  -0.158  -1.087  1.00 0.00 ? 90  LEU A HB3    2  
ATOM   5107   H  HG     . LEU A 1 83  ? -5.084  1.637   -2.829  1.00 0.00 ? 90  LEU A HG     2  
ATOM   5108   H  HD11   . LEU A 1 83  ? -4.843  -0.306  -4.276  1.00 0.00 ? 90  LEU A HD11   2  
ATOM   5109   H  HD12   . LEU A 1 83  ? -5.737  -1.293  -3.123  1.00 0.00 ? 90  LEU A HD12   2  
ATOM   5110   H  HD13   . LEU A 1 83  ? -4.163  -0.634  -2.682  1.00 0.00 ? 90  LEU A HD13   2  
ATOM   5111   H  HD21   . LEU A 1 83  ? -7.707  0.243   -3.340  1.00 0.00 ? 90  LEU A HD21   2  
ATOM   5112   H  HD22   . LEU A 1 83  ? -6.796  1.198   -4.509  1.00 0.00 ? 90  LEU A HD22   2  
ATOM   5113   H  HD23   . LEU A 1 83  ? -7.491  1.975   -3.088  1.00 0.00 ? 90  LEU A HD23   2  
ATOM   5114   N  N      . LEU A 1 84  ? -8.459  1.836   1.059   1.00 0.00 ? 91  LEU A N      2  
ATOM   5115   C  CA     . LEU A 1 84  ? -9.150  1.444   2.274   1.00 0.00 ? 91  LEU A CA     2  
ATOM   5116   C  C      . LEU A 1 84  ? -9.718  0.049   2.092   1.00 0.00 ? 91  LEU A C      2  
ATOM   5117   O  O      . LEU A 1 84  ? -10.698 -0.139  1.376   1.00 0.00 ? 91  LEU A O      2  
ATOM   5118   C  CB     . LEU A 1 84  ? -10.280 2.429   2.607   1.00 0.00 ? 91  LEU A CB     2  
ATOM   5119   C  CG     . LEU A 1 84  ? -9.876  3.674   3.410   1.00 0.00 ? 91  LEU A CG     2  
ATOM   5120   C  CD1    . LEU A 1 84  ? -8.840  4.504   2.676   1.00 0.00 ? 91  LEU A CD1    2  
ATOM   5121   C  CD2    . LEU A 1 84  ? -11.096 4.526   3.714   1.00 0.00 ? 91  LEU A CD2    2  
ATOM   5122   H  H      . LEU A 1 84  ? -8.949  2.331   0.367   1.00 0.00 ? 91  LEU A H      2  
ATOM   5123   H  HA     . LEU A 1 84  ? -8.435  1.433   3.082   1.00 0.00 ? 91  LEU A HA     2  
ATOM   5124   H  HB2    . LEU A 1 84  ? -10.721 2.757   1.677   1.00 0.00 ? 91  LEU A HB2    2  
ATOM   5125   H  HB3    . LEU A 1 84  ? -11.033 1.896   3.169   1.00 0.00 ? 91  LEU A HB3    2  
ATOM   5126   H  HG     . LEU A 1 84  ? -9.446  3.362   4.350   1.00 0.00 ? 91  LEU A HG     2  
ATOM   5127   H  HD11   . LEU A 1 84  ? -9.253  4.847   1.740   1.00 0.00 ? 91  LEU A HD11   2  
ATOM   5128   H  HD12   . LEU A 1 84  ? -7.965  3.902   2.487   1.00 0.00 ? 91  LEU A HD12   2  
ATOM   5129   H  HD13   . LEU A 1 84  ? -8.570  5.354   3.283   1.00 0.00 ? 91  LEU A HD13   2  
ATOM   5130   H  HD21   . LEU A 1 84  ? -11.813 3.943   4.271   1.00 0.00 ? 91  LEU A HD21   2  
ATOM   5131   H  HD22   . LEU A 1 84  ? -11.542 4.858   2.788   1.00 0.00 ? 91  LEU A HD22   2  
ATOM   5132   H  HD23   . LEU A 1 84  ? -10.798 5.385   4.297   1.00 0.00 ? 91  LEU A HD23   2  
ATOM   5133   N  N      . VAL A 1 85  ? -9.100  -0.925  2.733   1.00 0.00 ? 92  VAL A N      2  
ATOM   5134   C  CA     . VAL A 1 85  ? -9.509  -2.305  2.572   1.00 0.00 ? 92  VAL A CA     2  
ATOM   5135   C  C      . VAL A 1 85  ? -10.023 -2.880  3.882   1.00 0.00 ? 92  VAL A C      2  
ATOM   5136   O  O      . VAL A 1 85  ? -9.419  -2.689  4.939   1.00 0.00 ? 92  VAL A O      2  
ATOM   5137   C  CB     . VAL A 1 85  ? -8.356  -3.181  2.031   1.00 0.00 ? 92  VAL A CB     2  
ATOM   5138   C  CG1    . VAL A 1 85  ? -7.997  -2.764  0.613   1.00 0.00 ? 92  VAL A CG1    2  
ATOM   5139   C  CG2    . VAL A 1 85  ? -7.130  -3.104  2.937   1.00 0.00 ? 92  VAL A CG2    2  
ATOM   5140   H  H      . VAL A 1 85  ? -8.355  -0.713  3.330   1.00 0.00 ? 92  VAL A H      2  
ATOM   5141   H  HA     . VAL A 1 85  ? -10.310 -2.325  1.849   1.00 0.00 ? 92  VAL A HA     2  
ATOM   5142   H  HB     . VAL A 1 85  ? -8.694  -4.208  2.005   1.00 0.00 ? 92  VAL A HB     2  
ATOM   5143   H  HG11   . VAL A 1 85  ? -8.861  -2.880  -0.026  1.00 0.00 ? 92  VAL A HG11   2  
ATOM   5144   H  HG12   . VAL A 1 85  ? -7.192  -3.384  0.246   1.00 0.00 ? 92  VAL A HG12   2  
ATOM   5145   H  HG13   . VAL A 1 85  ? -7.685  -1.729  0.610   1.00 0.00 ? 92  VAL A HG13   2  
ATOM   5146   H  HG21   . VAL A 1 85  ? -7.385  -3.482  3.918   1.00 0.00 ? 92  VAL A HG21   2  
ATOM   5147   H  HG22   . VAL A 1 85  ? -6.808  -2.077  3.021   1.00 0.00 ? 92  VAL A HG22   2  
ATOM   5148   H  HG23   . VAL A 1 85  ? -6.332  -3.699  2.518   1.00 0.00 ? 92  VAL A HG23   2  
ATOM   5149   N  N      . PHE A 1 86  ? -11.150 -3.566  3.803   1.00 0.00 ? 93  PHE A N      2  
ATOM   5150   C  CA     . PHE A 1 86  ? -11.733 -4.224  4.959   1.00 0.00 ? 93  PHE A CA     2  
ATOM   5151   C  C      . PHE A 1 86  ? -12.456 -5.484  4.516   1.00 0.00 ? 93  PHE A C      2  
ATOM   5152   O  O      . PHE A 1 86  ? -12.875 -5.594  3.362   1.00 0.00 ? 93  PHE A O      2  
ATOM   5153   C  CB     . PHE A 1 86  ? -12.709 -3.289  5.693   1.00 0.00 ? 93  PHE A CB     2  
ATOM   5154   C  CG     . PHE A 1 86  ? -13.942 -2.925  4.903   1.00 0.00 ? 93  PHE A CG     2  
ATOM   5155   C  CD1    . PHE A 1 86  ? -13.937 -1.837  4.044   1.00 0.00 ? 93  PHE A CD1    2  
ATOM   5156   C  CD2    . PHE A 1 86  ? -15.111 -3.666  5.028   1.00 0.00 ? 93  PHE A CD2    2  
ATOM   5157   C  CE1    . PHE A 1 86  ? -15.067 -1.498  3.325   1.00 0.00 ? 93  PHE A CE1    2  
ATOM   5158   C  CE2    . PHE A 1 86  ? -16.243 -3.330  4.307   1.00 0.00 ? 93  PHE A CE2    2  
ATOM   5159   C  CZ     . PHE A 1 86  ? -16.220 -2.246  3.457   1.00 0.00 ? 93  PHE A CZ     2  
ATOM   5160   H  H      . PHE A 1 86  ? -11.610 -3.636  2.935   1.00 0.00 ? 93  PHE A H      2  
ATOM   5161   H  HA     . PHE A 1 86  ? -10.930 -4.497  5.628   1.00 0.00 ? 93  PHE A HA     2  
ATOM   5162   H  HB2    . PHE A 1 86  ? -13.034 -3.769  6.604   1.00 0.00 ? 93  PHE A HB2    2  
ATOM   5163   H  HB3    . PHE A 1 86  ? -12.193 -2.373  5.943   1.00 0.00 ? 93  PHE A HB3    2  
ATOM   5164   H  HD1    . PHE A 1 86  ? -13.038 -1.250  3.935   1.00 0.00 ? 93  PHE A HD1    2  
ATOM   5165   H  HD2    . PHE A 1 86  ? -15.130 -4.516  5.693   1.00 0.00 ? 93  PHE A HD2    2  
ATOM   5166   H  HE1    . PHE A 1 86  ? -15.049 -0.648  2.660   1.00 0.00 ? 93  PHE A HE1    2  
ATOM   5167   H  HE2    . PHE A 1 86  ? -17.145 -3.916  4.408   1.00 0.00 ? 93  PHE A HE2    2  
ATOM   5168   H  HZ     . PHE A 1 86  ? -17.104 -1.984  2.895   1.00 0.00 ? 93  PHE A HZ     2  
ATOM   5169   N  N      . SER A 1 87  ? -12.579 -6.441  5.410   1.00 0.00 ? 94  SER A N      2  
ATOM   5170   C  CA     . SER A 1 87  ? -13.402 -7.599  5.142   1.00 0.00 ? 94  SER A CA     2  
ATOM   5171   C  C      . SER A 1 87  ? -14.795 -7.346  5.687   1.00 0.00 ? 94  SER A C      2  
ATOM   5172   O  O      . SER A 1 87  ? -14.970 -6.582  6.639   1.00 0.00 ? 94  SER A O      2  
ATOM   5173   C  CB     . SER A 1 87  ? -12.785 -8.852  5.764   1.00 0.00 ? 94  SER A CB     2  
ATOM   5174   O  OG     . SER A 1 87  ? -12.749 -8.766  7.176   1.00 0.00 ? 94  SER A OG     2  
ATOM   5175   H  H      . SER A 1 87  ? -12.106 -6.373  6.270   1.00 0.00 ? 94  SER A H      2  
ATOM   5176   H  HA     . SER A 1 87  ? -13.470 -7.728  4.070   1.00 0.00 ? 94  SER A HA     2  
ATOM   5177   H  HB2    . SER A 1 87  ? -13.371 -9.717  5.484   1.00 0.00 ? 94  SER A HB2    2  
ATOM   5178   H  HB3    . SER A 1 87  ? -11.775 -8.969  5.398   1.00 0.00 ? 94  SER A HB3    2  
ATOM   5179   H  HG     . SER A 1 87  ? -12.075 -8.110  7.445   1.00 0.00 ? 94  SER A HG     2  
ATOM   5180   N  N      . ILE A 1 88  ? -15.789 -7.968  5.083   1.00 0.00 ? 95  ILE A N      2  
ATOM   5181   C  CA     . ILE A 1 88  ? -17.166 -7.798  5.535   1.00 0.00 ? 95  ILE A CA     2  
ATOM   5182   C  C      . ILE A 1 88  ? -17.381 -8.450  6.903   1.00 0.00 ? 95  ILE A C      2  
ATOM   5183   O  O      . ILE A 1 88  ? -18.455 -8.343  7.492   1.00 0.00 ? 95  ILE A O      2  
ATOM   5184   C  CB     . ILE A 1 88  ? -18.203 -8.341  4.519   1.00 0.00 ? 95  ILE A CB     2  
ATOM   5185   C  CG1    . ILE A 1 88  ? -18.136 -9.871  4.378   1.00 0.00 ? 95  ILE A CG1    2  
ATOM   5186   C  CG2    . ILE A 1 88  ? -18.012 -7.673  3.167   1.00 0.00 ? 95  ILE A CG2    2  
ATOM   5187   C  CD1    . ILE A 1 88  ? -16.881 -10.401 3.715   1.00 0.00 ? 95  ILE A CD1    2  
ATOM   5188   H  H      . ILE A 1 88  ? -15.598 -8.539  4.309   1.00 0.00 ? 95  ILE A H      2  
ATOM   5189   H  HA     . ILE A 1 88  ? -17.337 -6.735  5.642   1.00 0.00 ? 95  ILE A HA     2  
ATOM   5190   H  HB     . ILE A 1 88  ? -19.185 -8.069  4.879   1.00 0.00 ? 95  ILE A HB     2  
ATOM   5191   H  HG12   . ILE A 1 88  ? -18.197 -10.316 5.360   1.00 0.00 ? 95  ILE A HG12   2  
ATOM   5192   H  HG13   . ILE A 1 88  ? -18.982 -10.199 3.793   1.00 0.00 ? 95  ILE A HG13   2  
ATOM   5193   H  HG21   . ILE A 1 88  ? -18.739 -8.060  2.469   1.00 0.00 ? 95  ILE A HG21   2  
ATOM   5194   H  HG22   . ILE A 1 88  ? -17.016 -7.878  2.800   1.00 0.00 ? 95  ILE A HG22   2  
ATOM   5195   H  HG23   . ILE A 1 88  ? -18.144 -6.605  3.271   1.00 0.00 ? 95  ILE A HG23   2  
ATOM   5196   H  HD11   . ILE A 1 88  ? -16.943 -11.477 3.634   1.00 0.00 ? 95  ILE A HD11   2  
ATOM   5197   H  HD12   . ILE A 1 88  ? -16.020 -10.138 4.313   1.00 0.00 ? 95  ILE A HD12   2  
ATOM   5198   H  HD13   . ILE A 1 88  ? -16.781 -9.972  2.727   1.00 0.00 ? 95  ILE A HD13   2  
ATOM   5199   N  N      . THR A 1 89  ? -16.344 -9.115  7.400   1.00 0.00 ? 96  THR A N      2  
ATOM   5200   C  CA     . THR A 1 89  ? -16.352 -9.688  8.735   1.00 0.00 ? 96  THR A CA     2  
ATOM   5201   C  C      . THR A 1 89  ? -15.789 -8.698  9.754   1.00 0.00 ? 96  THR A C      2  
ATOM   5202   O  O      . THR A 1 89  ? -15.632 -9.020  10.932  1.00 0.00 ? 96  THR A O      2  
ATOM   5203   C  CB     . THR A 1 89  ? -15.526 -10.987 8.771   1.00 0.00 ? 96  THR A CB     2  
ATOM   5204   O  OG1    . THR A 1 89  ? -14.457 -10.909 7.813   1.00 0.00 ? 96  THR A OG1    2  
ATOM   5205   C  CG2    . THR A 1 89  ? -16.400 -12.193 8.471   1.00 0.00 ? 96  THR A CG2    2  
ATOM   5206   H  H      . THR A 1 89  ? -15.544 -9.230  6.845   1.00 0.00 ? 96  THR A H      2  
ATOM   5207   H  HA     . THR A 1 89  ? -17.373 -9.925  8.996   1.00 0.00 ? 96  THR A HA     2  
ATOM   5208   H  HB     . THR A 1 89  ? -15.105 -11.100 9.758   1.00 0.00 ? 96  THR A HB     2  
ATOM   5209   H  HG1    . THR A 1 89  ? -13.903 -10.139 8.006   1.00 0.00 ? 96  THR A HG1    2  
ATOM   5210   H  HG21   . THR A 1 89  ? -15.813 -13.099 8.549   1.00 0.00 ? 96  THR A HG21   2  
ATOM   5211   H  HG22   . THR A 1 89  ? -16.794 -12.109 7.464   1.00 0.00 ? 96  THR A HG22   2  
ATOM   5212   H  HG23   . THR A 1 89  ? -17.217 -12.232 9.175   1.00 0.00 ? 96  THR A HG23   2  
ATOM   5213   N  N      . GLU A 1 90  ? -15.480 -7.494  9.288   1.00 0.00 ? 97  GLU A N      2  
ATOM   5214   C  CA     . GLU A 1 90  ? -14.951 -6.450  10.151  1.00 0.00 ? 97  GLU A CA     2  
ATOM   5215   C  C      . GLU A 1 90  ? -15.856 -5.229  10.144  1.00 0.00 ? 97  GLU A C      2  
ATOM   5216   O  O      . GLU A 1 90  ? -15.731 -4.353  9.287   1.00 0.00 ? 97  GLU A O      2  
ATOM   5217   C  CB     . GLU A 1 90  ? -13.552 -6.039  9.706   1.00 0.00 ? 97  GLU A CB     2  
ATOM   5218   C  CG     . GLU A 1 90  ? -12.518 -7.141  9.800   1.00 0.00 ? 97  GLU A CG     2  
ATOM   5219   C  CD     . GLU A 1 90  ? -11.206 -6.734  9.167   1.00 0.00 ? 97  GLU A CD     2  
ATOM   5220   O  OE1    . GLU A 1 90  ? -10.385 -6.096  9.855   1.00 0.00 ? 97  GLU A OE1    2  
ATOM   5221   O  OE2    . GLU A 1 90  ? -11.002 -7.041  7.972   1.00 0.00 ? 97  GLU A OE2    2  
ATOM   5222   H  H      . GLU A 1 90  ? -15.605 -7.304  8.332   1.00 0.00 ? 97  GLU A H      2  
ATOM   5223   H  HA     . GLU A 1 90  ? -14.899 -6.841  11.157  1.00 0.00 ? 97  GLU A HA     2  
ATOM   5224   H  HB2    . GLU A 1 90  ? -13.597 -5.712  8.679   1.00 0.00 ? 97  GLU A HB2    2  
ATOM   5225   H  HB3    . GLU A 1 90  ? -13.219 -5.212  10.319  1.00 0.00 ? 97  GLU A HB3    2  
ATOM   5226   H  HG2    . GLU A 1 90  ? -12.345 -7.369  10.841  1.00 0.00 ? 97  GLU A HG2    2  
ATOM   5227   H  HG3    . GLU A 1 90  ? -12.892 -8.018  9.294   1.00 0.00 ? 97  GLU A HG3    2  
ATOM   5228   N  N      . HIS A 1 91  ? -16.772 -5.174  11.094  1.00 0.00 ? 98  HIS A N      2  
ATOM   5229   C  CA     . HIS A 1 91  ? -17.633 -4.011  11.236  1.00 0.00 ? 98  HIS A CA     2  
ATOM   5230   C  C      . HIS A 1 91  ? -16.827 -2.832  11.780  1.00 0.00 ? 98  HIS A C      2  
ATOM   5231   O  O      . HIS A 1 91  ? -17.124 -1.675  11.482  1.00 0.00 ? 98  HIS A O      2  
ATOM   5232   C  CB     . HIS A 1 91  ? -18.828 -4.318  12.148  1.00 0.00 ? 98  HIS A CB     2  
ATOM   5233   C  CG     . HIS A 1 91  ? -19.813 -3.188  12.241  1.00 0.00 ? 98  HIS A CG     2  
ATOM   5234   N  ND1    . HIS A 1 91  ? -19.958 -2.400  13.361  1.00 0.00 ? 98  HIS A ND1    2  
ATOM   5235   C  CD2    . HIS A 1 91  ? -20.692 -2.704  11.330  1.00 0.00 ? 98  HIS A CD2    2  
ATOM   5236   C  CE1    . HIS A 1 91  ? -20.880 -1.481  13.134  1.00 0.00 ? 98  HIS A CE1    2  
ATOM   5237   N  NE2    . HIS A 1 91  ? -21.335 -1.643  11.908  1.00 0.00 ? 98  HIS A NE2    2  
ATOM   5238   H  H      . HIS A 1 91  ? -16.877 -5.937  11.709  1.00 0.00 ? 98  HIS A H      2  
ATOM   5239   H  HA     . HIS A 1 91  ? -17.999 -3.751  10.252  1.00 0.00 ? 98  HIS A HA     2  
ATOM   5240   H  HB2    . HIS A 1 91  ? -19.349 -5.184  11.766  1.00 0.00 ? 98  HIS A HB2    2  
ATOM   5241   H  HB3    . HIS A 1 91  ? -18.467 -4.532  13.145  1.00 0.00 ? 98  HIS A HB3    2  
ATOM   5242   H  HD1    . HIS A 1 91  ? -19.467 -2.510  14.211  1.00 0.00 ? 98  HIS A HD1    2  
ATOM   5243   H  HD2    . HIS A 1 91  ? -20.859 -3.089  10.335  1.00 0.00 ? 98  HIS A HD2    2  
ATOM   5244   H  HE1    . HIS A 1 91  ? -21.200 -0.720  13.832  1.00 0.00 ? 98  HIS A HE1    2  
ATOM   5245   H  HE2    . HIS A 1 91  ? -22.115 -1.170  11.522  1.00 0.00 ? 98  HIS A HE2    2  
ATOM   5246   N  N      . GLU A 1 92  ? -15.793 -3.136  12.561  1.00 0.00 ? 99  GLU A N      2  
ATOM   5247   C  CA     . GLU A 1 92  ? -14.920 -2.112  13.114  1.00 0.00 ? 99  GLU A CA     2  
ATOM   5248   C  C      . GLU A 1 92  ? -14.136 -1.410  12.005  1.00 0.00 ? 99  GLU A C      2  
ATOM   5249   O  O      . GLU A 1 92  ? -14.177 -0.185  11.889  1.00 0.00 ? 99  GLU A O      2  
ATOM   5250   C  CB     . GLU A 1 92  ? -13.952 -2.724  14.129  1.00 0.00 ? 99  GLU A CB     2  
ATOM   5251   C  CG     . GLU A 1 92  ? -13.067 -1.699  14.813  1.00 0.00 ? 99  GLU A CG     2  
ATOM   5252   C  CD     . GLU A 1 92  ? -12.110 -2.330  15.799  1.00 0.00 ? 99  GLU A CD     2  
ATOM   5253   O  OE1    . GLU A 1 92  ? -12.566 -2.760  16.876  1.00 0.00 ? 99  GLU A OE1    2  
ATOM   5254   O  OE2    . GLU A 1 92  ? -10.902 -2.409  15.494  1.00 0.00 ? 99  GLU A OE2    2  
ATOM   5255   H  H      . GLU A 1 92  ? -15.621 -4.081  12.781  1.00 0.00 ? 99  GLU A H      2  
ATOM   5256   H  HA     . GLU A 1 92  ? -15.540 -1.381  13.618  1.00 0.00 ? 99  GLU A HA     2  
ATOM   5257   H  HB2    . GLU A 1 92  ? -14.521 -3.242  14.887  1.00 0.00 ? 99  GLU A HB2    2  
ATOM   5258   H  HB3    . GLU A 1 92  ? -13.316 -3.434  13.620  1.00 0.00 ? 99  GLU A HB3    2  
ATOM   5259   H  HG2    . GLU A 1 92  ? -12.494 -1.179  14.061  1.00 0.00 ? 99  GLU A HG2    2  
ATOM   5260   H  HG3    . GLU A 1 92  ? -13.696 -0.996  15.340  1.00 0.00 ? 99  GLU A HG3    2  
ATOM   5261   N  N      . SER A 1 93  ? -13.440 -2.191  11.183  1.00 0.00 ? 100 SER A N      2  
ATOM   5262   C  CA     . SER A 1 93  ? -12.642 -1.647  10.092  1.00 0.00 ? 100 SER A CA     2  
ATOM   5263   C  C      . SER A 1 93  ? -13.509 -0.872  9.098   1.00 0.00 ? 100 SER A C      2  
ATOM   5264   O  O      . SER A 1 93  ? -13.036 0.052   8.434   1.00 0.00 ? 100 SER A O      2  
ATOM   5265   C  CB     . SER A 1 93  ? -11.898 -2.782  9.392   1.00 0.00 ? 100 SER A CB     2  
ATOM   5266   O  OG     . SER A 1 93  ? -11.190 -3.564  10.340  1.00 0.00 ? 100 SER A OG     2  
ATOM   5267   H  H      . SER A 1 93  ? -13.447 -3.161  11.320  1.00 0.00 ? 100 SER A H      2  
ATOM   5268   H  HA     . SER A 1 93  ? -11.919 -0.969  10.520  1.00 0.00 ? 100 SER A HA     2  
ATOM   5269   H  HB2    . SER A 1 93  ? -12.606 -3.414  8.875   1.00 0.00 ? 100 SER A HB2    2  
ATOM   5270   H  HB3    . SER A 1 93  ? -11.196 -2.370  8.680   1.00 0.00 ? 100 SER A HB3    2  
ATOM   5271   H  HG     . SER A 1 93  ? -10.958 -4.424  9.954   1.00 0.00 ? 100 SER A HG     2  
ATOM   5272   N  N      . PHE A 1 94  ? -14.782 -1.247  9.010   1.00 0.00 ? 101 PHE A N      2  
ATOM   5273   C  CA     . PHE A 1 94  ? -15.735 -0.531  8.171   1.00 0.00 ? 101 PHE A CA     2  
ATOM   5274   C  C      . PHE A 1 94  ? -15.911 0.904   8.666   1.00 0.00 ? 101 PHE A C      2  
ATOM   5275   O  O      . PHE A 1 94  ? -15.818 1.852   7.888   1.00 0.00 ? 101 PHE A O      2  
ATOM   5276   C  CB     . PHE A 1 94  ? -17.088 -1.250  8.158   1.00 0.00 ? 101 PHE A CB     2  
ATOM   5277   C  CG     . PHE A 1 94  ? -18.175 -0.466  7.481   1.00 0.00 ? 101 PHE A CG     2  
ATOM   5278   C  CD1    . PHE A 1 94  ? -18.216 -0.355  6.100   1.00 0.00 ? 101 PHE A CD1    2  
ATOM   5279   C  CD2    . PHE A 1 94  ? -19.153 0.168   8.230   1.00 0.00 ? 101 PHE A CD2    2  
ATOM   5280   C  CE1    . PHE A 1 94  ? -19.215 0.372   5.480   1.00 0.00 ? 101 PHE A CE1    2  
ATOM   5281   C  CE2    . PHE A 1 94  ? -20.152 0.897   7.617   1.00 0.00 ? 101 PHE A CE2    2  
ATOM   5282   C  CZ     . PHE A 1 94  ? -20.184 0.999   6.241   1.00 0.00 ? 101 PHE A CZ     2  
ATOM   5283   H  H      . PHE A 1 94  ? -15.085 -2.028  9.520   1.00 0.00 ? 101 PHE A H      2  
ATOM   5284   H  HA     . PHE A 1 94  ? -15.339 -0.507  7.167   1.00 0.00 ? 101 PHE A HA     2  
ATOM   5285   H  HB2    . PHE A 1 94  ? -16.985 -2.191  7.638   1.00 0.00 ? 101 PHE A HB2    2  
ATOM   5286   H  HB3    . PHE A 1 94  ? -17.399 -1.439  9.177   1.00 0.00 ? 101 PHE A HB3    2  
ATOM   5287   H  HD1    . PHE A 1 94  ? -17.460 -0.845  5.505   1.00 0.00 ? 101 PHE A HD1    2  
ATOM   5288   H  HD2    . PHE A 1 94  ? -19.128 0.088   9.307   1.00 0.00 ? 101 PHE A HD2    2  
ATOM   5289   H  HE1    . PHE A 1 94  ? -19.238 0.451   4.403   1.00 0.00 ? 101 PHE A HE1    2  
ATOM   5290   H  HE2    . PHE A 1 94  ? -20.907 1.385   8.212   1.00 0.00 ? 101 PHE A HE2    2  
ATOM   5291   H  HZ     . PHE A 1 94  ? -20.965 1.569   5.759   1.00 0.00 ? 101 PHE A HZ     2  
ATOM   5292   N  N      . THR A 1 95  ? -16.156 1.053   9.961   1.00 0.00 ? 102 THR A N      2  
ATOM   5293   C  CA     . THR A 1 95  ? -16.319 2.367   10.567  1.00 0.00 ? 102 THR A CA     2  
ATOM   5294   C  C      . THR A 1 95  ? -14.994 3.128   10.555  1.00 0.00 ? 102 THR A C      2  
ATOM   5295   O  O      . THR A 1 95  ? -14.963 4.359   10.485  1.00 0.00 ? 102 THR A O      2  
ATOM   5296   C  CB     . THR A 1 95  ? -16.821 2.234   12.017  1.00 0.00 ? 102 THR A CB     2  
ATOM   5297   O  OG1    . THR A 1 95  ? -17.877 1.265   12.077  1.00 0.00 ? 102 THR A OG1    2  
ATOM   5298   C  CG2    . THR A 1 95  ? -17.330 3.568   12.544  1.00 0.00 ? 102 THR A CG2    2  
ATOM   5299   H  H      . THR A 1 95  ? -16.241 0.256   10.528  1.00 0.00 ? 102 THR A H      2  
ATOM   5300   H  HA     . THR A 1 95  ? -17.054 2.917   9.997   1.00 0.00 ? 102 THR A HA     2  
ATOM   5301   H  HB     . THR A 1 95  ? -16.000 1.905   12.640  1.00 0.00 ? 102 THR A HB     2  
ATOM   5302   H  HG1    . THR A 1 95  ? -17.755 0.706   12.862  1.00 0.00 ? 102 THR A HG1    2  
ATOM   5303   H  HG21   . THR A 1 95  ? -16.531 4.293   12.519  1.00 0.00 ? 102 THR A HG21   2  
ATOM   5304   H  HG22   . THR A 1 95  ? -17.674 3.445   13.560  1.00 0.00 ? 102 THR A HG22   2  
ATOM   5305   H  HG23   . THR A 1 95  ? -18.147 3.910   11.927  1.00 0.00 ? 102 THR A HG23   2  
ATOM   5306   N  N      . ALA A 1 96  ? -13.903 2.373   10.587  1.00 0.00 ? 103 ALA A N      2  
ATOM   5307   C  CA     . ALA A 1 96  ? -12.560 2.939   10.632  1.00 0.00 ? 103 ALA A CA     2  
ATOM   5308   C  C      . ALA A 1 96  ? -12.194 3.657   9.333   1.00 0.00 ? 103 ALA A C      2  
ATOM   5309   O  O      . ALA A 1 96  ? -11.222 4.407   9.296   1.00 0.00 ? 103 ALA A O      2  
ATOM   5310   C  CB     . ALA A 1 96  ? -11.543 1.849   10.935  1.00 0.00 ? 103 ALA A CB     2  
ATOM   5311   H  H      . ALA A 1 96  ? -14.003 1.398   10.589  1.00 0.00 ? 103 ALA A H      2  
ATOM   5312   H  HA     . ALA A 1 96  ? -12.531 3.654   11.442  1.00 0.00 ? 103 ALA A HA     2  
ATOM   5313   H  HB1    . ALA A 1 96  ? -11.812 1.345   11.851  1.00 0.00 ? 103 ALA A HB1    2  
ATOM   5314   H  HB2    . ALA A 1 96  ? -10.566 2.292   11.041  1.00 0.00 ? 103 ALA A HB2    2  
ATOM   5315   H  HB3    . ALA A 1 96  ? -11.530 1.136   10.124  1.00 0.00 ? 103 ALA A HB3    2  
ATOM   5316   N  N      . THR A 1 97  ? -12.960 3.423   8.268   1.00 0.00 ? 104 THR A N      2  
ATOM   5317   C  CA     . THR A 1 97  ? -12.707 4.074   6.979   1.00 0.00 ? 104 THR A CA     2  
ATOM   5318   C  C      . THR A 1 97  ? -12.699 5.595   7.125   1.00 0.00 ? 104 THR A C      2  
ATOM   5319   O  O      . THR A 1 97  ? -11.901 6.295   6.494   1.00 0.00 ? 104 THR A O      2  
ATOM   5320   C  CB     . THR A 1 97  ? -13.760 3.674   5.925   1.00 0.00 ? 104 THR A CB     2  
ATOM   5321   O  OG1    . THR A 1 97  ? -15.080 3.916   6.427   1.00 0.00 ? 104 THR A OG1    2  
ATOM   5322   C  CG2    . THR A 1 97  ? -13.616 2.210   5.544   1.00 0.00 ? 104 THR A CG2    2  
ATOM   5323   H  H      . THR A 1 97  ? -13.713 2.801   8.349   1.00 0.00 ? 104 THR A H      2  
ATOM   5324   H  HA     . THR A 1 97  ? -11.735 3.752   6.626   1.00 0.00 ? 104 THR A HA     2  
ATOM   5325   H  HB     . THR A 1 97  ? -13.608 4.275   5.040   1.00 0.00 ? 104 THR A HB     2  
ATOM   5326   H  HG1    . THR A 1 97  ? -15.424 3.105   6.831   1.00 0.00 ? 104 THR A HG1    2  
ATOM   5327   H  HG21   . THR A 1 97  ? -12.620 2.031   5.170   1.00 0.00 ? 104 THR A HG21   2  
ATOM   5328   H  HG22   . THR A 1 97  ? -14.338 1.963   4.781   1.00 0.00 ? 104 THR A HG22   2  
ATOM   5329   H  HG23   . THR A 1 97  ? -13.789 1.595   6.415   1.00 0.00 ? 104 THR A HG23   2  
ATOM   5330   N  N      . ALA A 1 98  ? -13.580 6.096   7.984   1.00 0.00 ? 105 ALA A N      2  
ATOM   5331   C  CA     . ALA A 1 98  ? -13.672 7.522   8.242   1.00 0.00 ? 105 ALA A CA     2  
ATOM   5332   C  C      . ALA A 1 98  ? -12.451 8.001   9.013   1.00 0.00 ? 105 ALA A C      2  
ATOM   5333   O  O      . ALA A 1 98  ? -11.954 9.106   8.790   1.00 0.00 ? 105 ALA A O      2  
ATOM   5334   C  CB     . ALA A 1 98  ? -14.945 7.835   9.005   1.00 0.00 ? 105 ALA A CB     2  
ATOM   5335   H  H      . ALA A 1 98  ? -14.184 5.485   8.456   1.00 0.00 ? 105 ALA A H      2  
ATOM   5336   H  HA     . ALA A 1 98  ? -13.711 8.033   7.290   1.00 0.00 ? 105 ALA A HA     2  
ATOM   5337   H  HB1    . ALA A 1 98  ? -15.023 8.902   9.148   1.00 0.00 ? 105 ALA A HB1    2  
ATOM   5338   H  HB2    . ALA A 1 98  ? -14.920 7.343   9.966   1.00 0.00 ? 105 ALA A HB2    2  
ATOM   5339   H  HB3    . ALA A 1 98  ? -15.797 7.484   8.440   1.00 0.00 ? 105 ALA A HB3    2  
ATOM   5340   N  N      . GLU A 1 99  ? -11.957 7.156   9.908   1.00 0.00 ? 106 GLU A N      2  
ATOM   5341   C  CA     . GLU A 1 99  ? -10.765 7.454   10.662  1.00 0.00 ? 106 GLU A CA     2  
ATOM   5342   C  C      . GLU A 1 99  ? -9.547  7.453   9.751   1.00 0.00 ? 106 GLU A C      2  
ATOM   5343   O  O      . GLU A 1 99  ? -8.663  8.297   9.881   1.00 0.00 ? 106 GLU A O      2  
ATOM   5344   C  CB     . GLU A 1 99  ? -10.594 6.420   11.764  1.00 0.00 ? 106 GLU A CB     2  
ATOM   5345   C  CG     . GLU A 1 99  ? -11.731 6.408   12.767  1.00 0.00 ? 106 GLU A CG     2  
ATOM   5346   C  CD     . GLU A 1 99  ? -11.573 5.323   13.809  1.00 0.00 ? 106 GLU A CD     2  
ATOM   5347   O  OE1    . GLU A 1 99  ? -12.066 4.201   13.579  1.00 0.00 ? 106 GLU A OE1    2  
ATOM   5348   O  OE2    . GLU A 1 99  ? -10.963 5.594   14.862  1.00 0.00 ? 106 GLU A OE2    2  
ATOM   5349   H  H      . GLU A 1 99  ? -12.406 6.305   10.068  1.00 0.00 ? 106 GLU A H      2  
ATOM   5350   H  HA     . GLU A 1 99  ? -10.878 8.431   11.105  1.00 0.00 ? 106 GLU A HA     2  
ATOM   5351   H  HB2    . GLU A 1 99  ? -10.526 5.439   11.318  1.00 0.00 ? 106 GLU A HB2    2  
ATOM   5352   H  HB3    . GLU A 1 99  ? -9.686  6.626   12.288  1.00 0.00 ? 106 GLU A HB3    2  
ATOM   5353   H  HG2    . GLU A 1 99  ? -11.761 7.364   13.267  1.00 0.00 ? 106 GLU A HG2    2  
ATOM   5354   H  HG3    . GLU A 1 99  ? -12.659 6.249   12.239  1.00 0.00 ? 106 GLU A HG3    2  
ATOM   5355   N  N      . PHE A 1 100 ? -9.515  6.508   8.816   1.00 0.00 ? 107 PHE A N      2  
ATOM   5356   C  CA     . PHE A 1 100 ? -8.403  6.388   7.883   1.00 0.00 ? 107 PHE A CA     2  
ATOM   5357   C  C      . PHE A 1 100 ? -8.215  7.678   7.092   1.00 0.00 ? 107 PHE A C      2  
ATOM   5358   O  O      . PHE A 1 100 ? -7.113  8.218   7.029   1.00 0.00 ? 107 PHE A O      2  
ATOM   5359   C  CB     . PHE A 1 100 ? -8.612  5.220   6.911   1.00 0.00 ? 107 PHE A CB     2  
ATOM   5360   C  CG     . PHE A 1 100 ? -8.607  3.862   7.563   1.00 0.00 ? 107 PHE A CG     2  
ATOM   5361   C  CD1    . PHE A 1 100 ? -7.720  3.569   8.587   1.00 0.00 ? 107 PHE A CD1    2  
ATOM   5362   C  CD2    . PHE A 1 100 ? -9.482  2.876   7.136   1.00 0.00 ? 107 PHE A CD2    2  
ATOM   5363   C  CE1    . PHE A 1 100 ? -7.709  2.320   9.176   1.00 0.00 ? 107 PHE A CE1    2  
ATOM   5364   C  CE2    . PHE A 1 100 ? -9.478  1.625   7.723   1.00 0.00 ? 107 PHE A CE2    2  
ATOM   5365   C  CZ     . PHE A 1 100 ? -8.590  1.347   8.744   1.00 0.00 ? 107 PHE A CZ     2  
ATOM   5366   H  H      . PHE A 1 100 ? -10.258 5.862   8.763   1.00 0.00 ? 107 PHE A H      2  
ATOM   5367   H  HA     . PHE A 1 100 ? -7.509  6.205   8.462   1.00 0.00 ? 107 PHE A HA     2  
ATOM   5368   H  HB2    . PHE A 1 100 ? -9.562  5.341   6.415   1.00 0.00 ? 107 PHE A HB2    2  
ATOM   5369   H  HB3    . PHE A 1 100 ? -7.825  5.234   6.172   1.00 0.00 ? 107 PHE A HB3    2  
ATOM   5370   H  HD1    . PHE A 1 100 ? -7.034  4.331   8.927   1.00 0.00 ? 107 PHE A HD1    2  
ATOM   5371   H  HD2    . PHE A 1 100 ? -10.175 3.092   6.338   1.00 0.00 ? 107 PHE A HD2    2  
ATOM   5372   H  HE1    . PHE A 1 100 ? -7.013  2.104   9.972   1.00 0.00 ? 107 PHE A HE1    2  
ATOM   5373   H  HE2    . PHE A 1 100 ? -10.167 0.867   7.385   1.00 0.00 ? 107 PHE A HE2    2  
ATOM   5374   H  HZ     . PHE A 1 100 ? -8.585  0.371   9.204   1.00 0.00 ? 107 PHE A HZ     2  
ATOM   5375   N  N      . ARG A 1 101 ? -9.297  8.186   6.511   1.00 0.00 ? 108 ARG A N      2  
ATOM   5376   C  CA     . ARG A 1 101 ? -9.214  9.386   5.687   1.00 0.00 ? 108 ARG A CA     2  
ATOM   5377   C  C      . ARG A 1 101 ? -8.779  10.592  6.515   1.00 0.00 ? 108 ARG A C      2  
ATOM   5378   O  O      . ARG A 1 101 ? -7.990  11.413  6.054   1.00 0.00 ? 108 ARG A O      2  
ATOM   5379   C  CB     . ARG A 1 101 ? -10.540 9.666   4.967   1.00 0.00 ? 108 ARG A CB     2  
ATOM   5380   C  CG     . ARG A 1 101 ? -11.724 9.919   5.886   1.00 0.00 ? 108 ARG A CG     2  
ATOM   5381   C  CD     . ARG A 1 101 ? -12.969 10.291  5.095   1.00 0.00 ? 108 ARG A CD     2  
ATOM   5382   N  NE     . ARG A 1 101 ? -12.795 11.537  4.350   1.00 0.00 ? 108 ARG A NE     2  
ATOM   5383   C  CZ     . ARG A 1 101 ? -13.134 11.695  3.070   1.00 0.00 ? 108 ARG A CZ     2  
ATOM   5384   N  NH1    . ARG A 1 101 ? -13.664 10.690  2.388   1.00 0.00 ? 108 ARG A NH1    2  
ATOM   5385   N  NH2    . ARG A 1 101 ? -12.947 12.864  2.468   1.00 0.00 ? 108 ARG A NH2    2  
ATOM   5386   H  H      . ARG A 1 101 ? -10.165 7.744   6.636   1.00 0.00 ? 108 ARG A H      2  
ATOM   5387   H  HA     . ARG A 1 101 ? -8.454  9.204   4.941   1.00 0.00 ? 108 ARG A HA     2  
ATOM   5388   H  HB2    . ARG A 1 101 ? -10.413 10.538  4.342   1.00 0.00 ? 108 ARG A HB2    2  
ATOM   5389   H  HB3    . ARG A 1 101 ? -10.775 8.819   4.340   1.00 0.00 ? 108 ARG A HB3    2  
ATOM   5390   H  HG2    . ARG A 1 101 ? -11.927 9.023   6.457   1.00 0.00 ? 108 ARG A HG2    2  
ATOM   5391   H  HG3    . ARG A 1 101 ? -11.480 10.729  6.559   1.00 0.00 ? 108 ARG A HG3    2  
ATOM   5392   H  HD2    . ARG A 1 101 ? -13.188 9.496   4.400   1.00 0.00 ? 108 ARG A HD2    2  
ATOM   5393   H  HD3    . ARG A 1 101 ? -13.796 10.406  5.782   1.00 0.00 ? 108 ARG A HD3    2  
ATOM   5394   H  HE     . ARG A 1 101 ? -12.408 12.306  4.841   1.00 0.00 ? 108 ARG A HE     2  
ATOM   5395   H  HH11   . ARG A 1 101 ? -13.822 9.806   2.827   1.00 0.00 ? 108 ARG A HH11   2  
ATOM   5396   H  HH12   . ARG A 1 101 ? -13.907 10.818  1.418   1.00 0.00 ? 108 ARG A HH12   2  
ATOM   5397   H  HH21   . ARG A 1 101 ? -12.549 13.643  2.973   1.00 0.00 ? 108 ARG A HH21   2  
ATOM   5398   H  HH22   . ARG A 1 101 ? -13.210 12.979  1.507   1.00 0.00 ? 108 ARG A HH22   2  
ATOM   5399   N  N      . GLU A 1 102 ? -9.267  10.683  7.746   1.00 0.00 ? 109 GLU A N      2  
ATOM   5400   C  CA     . GLU A 1 102 ? -8.881  11.771  8.631   1.00 0.00 ? 109 GLU A CA     2  
ATOM   5401   C  C      . GLU A 1 102 ? -7.417  11.657  9.012   1.00 0.00 ? 109 GLU A C      2  
ATOM   5402   O  O      . GLU A 1 102 ? -6.713  12.658  9.121   1.00 0.00 ? 109 GLU A O      2  
ATOM   5403   C  CB     . GLU A 1 102 ? -9.746  11.782  9.886   1.00 0.00 ? 109 GLU A CB     2  
ATOM   5404   C  CG     . GLU A 1 102 ? -11.154 12.286  9.637   1.00 0.00 ? 109 GLU A CG     2  
ATOM   5405   C  CD     . GLU A 1 102 ? -11.891 12.599  10.922  1.00 0.00 ? 109 GLU A CD     2  
ATOM   5406   O  OE1    . GLU A 1 102 ? -12.549 11.693  11.471  1.00 0.00 ? 109 GLU A OE1    2  
ATOM   5407   O  OE2    . GLU A 1 102 ? -11.815 13.756  11.383  1.00 0.00 ? 109 GLU A OE2    2  
ATOM   5408   H  H      . GLU A 1 102 ? -9.897  10.001  8.069   1.00 0.00 ? 109 GLU A H      2  
ATOM   5409   H  HA     . GLU A 1 102 ? -9.028  12.697  8.095   1.00 0.00 ? 109 GLU A HA     2  
ATOM   5410   H  HB2    . GLU A 1 102 ? -9.810  10.774  10.270  1.00 0.00 ? 109 GLU A HB2    2  
ATOM   5411   H  HB3    . GLU A 1 102 ? -9.279  12.412  10.629  1.00 0.00 ? 109 GLU A HB3    2  
ATOM   5412   H  HG2    . GLU A 1 102 ? -11.102 13.183  9.035   1.00 0.00 ? 109 GLU A HG2    2  
ATOM   5413   H  HG3    . GLU A 1 102 ? -11.703 11.526  9.100   1.00 0.00 ? 109 GLU A HG3    2  
ATOM   5414   N  N      . GLN A 1 103 ? -6.961  10.430  9.203   1.00 0.00 ? 110 GLN A N      2  
ATOM   5415   C  CA     . GLN A 1 103 ? -5.572  10.176  9.533   1.00 0.00 ? 110 GLN A CA     2  
ATOM   5416   C  C      . GLN A 1 103 ? -4.679  10.616  8.377   1.00 0.00 ? 110 GLN A C      2  
ATOM   5417   O  O      . GLN A 1 103 ? -3.576  11.128  8.578   1.00 0.00 ? 110 GLN A O      2  
ATOM   5418   C  CB     . GLN A 1 103 ? -5.372  8.691   9.831   1.00 0.00 ? 110 GLN A CB     2  
ATOM   5419   C  CG     . GLN A 1 103 ? -4.136  8.403   10.660  1.00 0.00 ? 110 GLN A CG     2  
ATOM   5420   C  CD     . GLN A 1 103 ? -4.168  9.098   12.010  1.00 0.00 ? 110 GLN A CD     2  
ATOM   5421   O  OE1    . GLN A 1 103 ? -3.127  9.436   12.563  1.00 0.00 ? 110 GLN A OE1    2  
ATOM   5422   N  NE2    . GLN A 1 103 ? -5.362  9.339   12.541  1.00 0.00 ? 110 GLN A NE2    2  
ATOM   5423   H  H      . GLN A 1 103 ? -7.581  9.670   9.125   1.00 0.00 ? 110 GLN A H      2  
ATOM   5424   H  HA     . GLN A 1 103 ? -5.326  10.754  10.411  1.00 0.00 ? 110 GLN A HA     2  
ATOM   5425   H  HB2    . GLN A 1 103 ? -6.237  8.322   10.365  1.00 0.00 ? 110 GLN A HB2    2  
ATOM   5426   H  HB3    . GLN A 1 103 ? -5.285  8.157   8.896   1.00 0.00 ? 110 GLN A HB3    2  
ATOM   5427   H  HG2    . GLN A 1 103 ? -4.064  7.337   10.821  1.00 0.00 ? 110 GLN A HG2    2  
ATOM   5428   H  HG3    . GLN A 1 103 ? -3.268  8.744   10.117  1.00 0.00 ? 110 GLN A HG3    2  
ATOM   5429   H  HE21   . GLN A 1 103 ? -6.165  9.068   12.040  1.00 0.00 ? 110 GLN A HE21   2  
ATOM   5430   H  HE22   . GLN A 1 103 ? -5.397  9.772   13.424  1.00 0.00 ? 110 GLN A HE22   2  
ATOM   5431   N  N      . ILE A 1 104 ? -5.185  10.425  7.166   1.00 0.00 ? 111 ILE A N      2  
ATOM   5432   C  CA     . ILE A 1 104 ? -4.494  10.860  5.964   1.00 0.00 ? 111 ILE A CA     2  
ATOM   5433   C  C      . ILE A 1 104 ? -4.418  12.385  5.911   1.00 0.00 ? 111 ILE A C      2  
ATOM   5434   O  O      . ILE A 1 104 ? -3.343  12.956  5.733   1.00 0.00 ? 111 ILE A O      2  
ATOM   5435   C  CB     . ILE A 1 104 ? -5.203  10.343  4.694   1.00 0.00 ? 111 ILE A CB     2  
ATOM   5436   C  CG1    . ILE A 1 104 ? -5.250  8.813   4.691   1.00 0.00 ? 111 ILE A CG1    2  
ATOM   5437   C  CG2    . ILE A 1 104 ? -4.500  10.852  3.443   1.00 0.00 ? 111 ILE A CG2    2  
ATOM   5438   C  CD1    . ILE A 1 104 ? -6.114  8.231   3.591   1.00 0.00 ? 111 ILE A CD1    2  
ATOM   5439   H  H      . ILE A 1 104 ? -6.047  9.964   7.079   1.00 0.00 ? 111 ILE A H      2  
ATOM   5440   H  HA     . ILE A 1 104 ? -3.493  10.457  5.987   1.00 0.00 ? 111 ILE A HA     2  
ATOM   5441   H  HB     . ILE A 1 104 ? -6.211  10.726  4.692   1.00 0.00 ? 111 ILE A HB     2  
ATOM   5442   H  HG12   . ILE A 1 104 ? -4.250  8.429   4.563   1.00 0.00 ? 111 ILE A HG12   2  
ATOM   5443   H  HG13   . ILE A 1 104 ? -5.643  8.470   5.639   1.00 0.00 ? 111 ILE A HG13   2  
ATOM   5444   H  HG21   . ILE A 1 104 ? -4.511  11.931  3.433   1.00 0.00 ? 111 ILE A HG21   2  
ATOM   5445   H  HG22   . ILE A 1 104 ? -5.008  10.479  2.567   1.00 0.00 ? 111 ILE A HG22   2  
ATOM   5446   H  HG23   . ILE A 1 104 ? -3.479  10.502  3.440   1.00 0.00 ? 111 ILE A HG23   2  
ATOM   5447   H  HD11   . ILE A 1 104 ? -5.760  8.582   2.631   1.00 0.00 ? 111 ILE A HD11   2  
ATOM   5448   H  HD12   . ILE A 1 104 ? -7.137  8.541   3.733   1.00 0.00 ? 111 ILE A HD12   2  
ATOM   5449   H  HD13   . ILE A 1 104 ? -6.056  7.151   3.622   1.00 0.00 ? 111 ILE A HD13   2  
ATOM   5450   N  N      . LEU A 1 105 ? -5.560  13.041  6.084   1.00 0.00 ? 112 LEU A N      2  
ATOM   5451   C  CA     . LEU A 1 105 ? -5.626  14.495  6.006   1.00 0.00 ? 112 LEU A CA     2  
ATOM   5452   C  C      . LEU A 1 105 ? -4.927  15.164  7.187   1.00 0.00 ? 112 LEU A C      2  
ATOM   5453   O  O      . LEU A 1 105 ? -4.535  16.323  7.096   1.00 0.00 ? 112 LEU A O      2  
ATOM   5454   C  CB     . LEU A 1 105 ? -7.077  14.978  5.915   1.00 0.00 ? 112 LEU A CB     2  
ATOM   5455   C  CG     . LEU A 1 105 ? -7.671  15.004  4.503   1.00 0.00 ? 112 LEU A CG     2  
ATOM   5456   C  CD1    . LEU A 1 105 ? -7.960  13.603  3.998   1.00 0.00 ? 112 LEU A CD1    2  
ATOM   5457   C  CD2    . LEU A 1 105 ? -8.931  15.851  4.477   1.00 0.00 ? 112 LEU A CD2    2  
ATOM   5458   H  H      . LEU A 1 105 ? -6.384  12.533  6.258   1.00 0.00 ? 112 LEU A H      2  
ATOM   5459   H  HA     . LEU A 1 105 ? -5.114  14.789  5.098   1.00 0.00 ? 112 LEU A HA     2  
ATOM   5460   H  HB2    . LEU A 1 105 ? -7.688  14.326  6.526   1.00 0.00 ? 112 LEU A HB2    2  
ATOM   5461   H  HB3    . LEU A 1 105 ? -7.131  15.976  6.322   1.00 0.00 ? 112 LEU A HB3    2  
ATOM   5462   H  HG     . LEU A 1 105 ? -6.955  15.454  3.833   1.00 0.00 ? 112 LEU A HG     2  
ATOM   5463   H  HD11   . LEU A 1 105 ? -7.036  13.048  3.934   1.00 0.00 ? 112 LEU A HD11   2  
ATOM   5464   H  HD12   . LEU A 1 105 ? -8.415  13.659  3.018   1.00 0.00 ? 112 LEU A HD12   2  
ATOM   5465   H  HD13   . LEU A 1 105 ? -8.635  13.106  4.685   1.00 0.00 ? 112 LEU A HD13   2  
ATOM   5466   H  HD21   . LEU A 1 105 ? -9.367  15.818  3.490   1.00 0.00 ? 112 LEU A HD21   2  
ATOM   5467   H  HD22   . LEU A 1 105 ? -8.682  16.870  4.728   1.00 0.00 ? 112 LEU A HD22   2  
ATOM   5468   H  HD23   . LEU A 1 105 ? -9.640  15.465  5.196   1.00 0.00 ? 112 LEU A HD23   2  
ATOM   5469   N  N      . ARG A 1 106 ? -4.752  14.434  8.285   1.00 0.00 ? 113 ARG A N      2  
ATOM   5470   C  CA     . ARG A 1 106 ? -4.057  14.976  9.454   1.00 0.00 ? 113 ARG A CA     2  
ATOM   5471   C  C      . ARG A 1 106 ? -2.621  15.341  9.097   1.00 0.00 ? 113 ARG A C      2  
ATOM   5472   O  O      . ARG A 1 106 ? -2.064  16.313  9.607   1.00 0.00 ? 113 ARG A O      2  
ATOM   5473   C  CB     . ARG A 1 106 ? -4.061  13.975  10.617  1.00 0.00 ? 113 ARG A CB     2  
ATOM   5474   C  CG     . ARG A 1 106 ? -3.395  14.523  11.873  1.00 0.00 ? 113 ARG A CG     2  
ATOM   5475   C  CD     . ARG A 1 106 ? -3.527  13.581  13.060  1.00 0.00 ? 113 ARG A CD     2  
ATOM   5476   N  NE     . ARG A 1 106 ? -2.712  12.368  12.922  1.00 0.00 ? 113 ARG A NE     2  
ATOM   5477   C  CZ     . ARG A 1 106 ? -1.677  12.072  13.717  1.00 0.00 ? 113 ARG A CZ     2  
ATOM   5478   N  NH1    . ARG A 1 106 ? -1.267  12.939  14.636  1.00 0.00 ? 113 ARG A NH1    2  
ATOM   5479   N  NH2    . ARG A 1 106 ? -1.045  10.914  13.591  1.00 0.00 ? 113 ARG A NH2    2  
ATOM   5480   H  H      . ARG A 1 106 ? -5.109  13.518  8.319   1.00 0.00 ? 113 ARG A H      2  
ATOM   5481   H  HA     . ARG A 1 106 ? -4.575  15.872  9.760   1.00 0.00 ? 113 ARG A HA     2  
ATOM   5482   H  HB2    . ARG A 1 106 ? -5.082  13.716  10.857  1.00 0.00 ? 113 ARG A HB2    2  
ATOM   5483   H  HB3    . ARG A 1 106 ? -3.533  13.083  10.314  1.00 0.00 ? 113 ARG A HB3    2  
ATOM   5484   H  HG2    . ARG A 1 106 ? -2.346  14.678  11.669  1.00 0.00 ? 113 ARG A HG2    2  
ATOM   5485   H  HG3    . ARG A 1 106 ? -3.855  15.469  12.121  1.00 0.00 ? 113 ARG A HG3    2  
ATOM   5486   H  HD2    . ARG A 1 106 ? -3.219  14.106  13.952  1.00 0.00 ? 113 ARG A HD2    2  
ATOM   5487   H  HD3    . ARG A 1 106 ? -4.565  13.295  13.155  1.00 0.00 ? 113 ARG A HD3    2  
ATOM   5488   H  HE     . ARG A 1 106 ? -2.976  11.720  12.229  1.00 0.00 ? 113 ARG A HE     2  
ATOM   5489   H  HH11   . ARG A 1 106 ? -1.730  13.826  14.744  1.00 0.00 ? 113 ARG A HH11   2  
ATOM   5490   H  HH12   . ARG A 1 106 ? -0.490  12.711  15.230  1.00 0.00 ? 113 ARG A HH12   2  
ATOM   5491   H  HH21   . ARG A 1 106 ? -1.339  10.243  12.897  1.00 0.00 ? 113 ARG A HH21   2  
ATOM   5492   H  HH22   . ARG A 1 106 ? -0.272  10.692  14.193  1.00 0.00 ? 113 ARG A HH22   2  
ATOM   5493   N  N      . VAL A 1 107 ? -2.027  14.552  8.217   1.00 0.00 ? 114 VAL A N      2  
ATOM   5494   C  CA     . VAL A 1 107 ? -0.656  14.785  7.796   1.00 0.00 ? 114 VAL A CA     2  
ATOM   5495   C  C      . VAL A 1 107 ? -0.610  15.399  6.398   1.00 0.00 ? 114 VAL A C      2  
ATOM   5496   O  O      . VAL A 1 107 ? 0.439   15.841  5.937   1.00 0.00 ? 114 VAL A O      2  
ATOM   5497   C  CB     . VAL A 1 107 ? 0.159   13.475  7.803   1.00 0.00 ? 114 VAL A CB     2  
ATOM   5498   C  CG1    . VAL A 1 107 ? 0.114   12.826  9.179   1.00 0.00 ? 114 VAL A CG1    2  
ATOM   5499   C  CG2    . VAL A 1 107 ? -0.354  12.516  6.742   1.00 0.00 ? 114 VAL A CG2    2  
ATOM   5500   H  H      . VAL A 1 107 ? -2.521  13.791  7.848   1.00 0.00 ? 114 VAL A H      2  
ATOM   5501   H  HA     . VAL A 1 107 ? -0.203  15.471  8.497   1.00 0.00 ? 114 VAL A HA     2  
ATOM   5502   H  HB     . VAL A 1 107 ? 1.189   13.715  7.576   1.00 0.00 ? 114 VAL A HB     2  
ATOM   5503   H  HG11   . VAL A 1 107 ? 0.708   11.925  9.173   1.00 0.00 ? 114 VAL A HG11   2  
ATOM   5504   H  HG12   . VAL A 1 107 ? -0.909  12.580  9.427   1.00 0.00 ? 114 VAL A HG12   2  
ATOM   5505   H  HG13   . VAL A 1 107 ? 0.507   13.511  9.914   1.00 0.00 ? 114 VAL A HG13   2  
ATOM   5506   H  HG21   . VAL A 1 107 ? -1.395  12.297  6.927   1.00 0.00 ? 114 VAL A HG21   2  
ATOM   5507   H  HG22   . VAL A 1 107 ? 0.218   11.600  6.776   1.00 0.00 ? 114 VAL A HG22   2  
ATOM   5508   H  HG23   . VAL A 1 107 ? -0.248  12.970  5.767   1.00 0.00 ? 114 VAL A HG23   2  
ATOM   5509   N  N      . LYS A 1 108 ? -1.755  15.425  5.729   1.00 0.00 ? 115 LYS A N      2  
ATOM   5510   C  CA     . LYS A 1 108 ? -1.831  15.903  4.358   1.00 0.00 ? 115 LYS A CA     2  
ATOM   5511   C  C      . LYS A 1 108 ? -2.799  17.076  4.213   1.00 0.00 ? 115 LYS A C      2  
ATOM   5512   O  O      . LYS A 1 108 ? -2.392  18.234  4.304   1.00 0.00 ? 115 LYS A O      2  
ATOM   5513   C  CB     . LYS A 1 108 ? -2.245  14.765  3.423   1.00 0.00 ? 115 LYS A CB     2  
ATOM   5514   C  CG     . LYS A 1 108 ? -1.119  13.801  3.085   1.00 0.00 ? 115 LYS A CG     2  
ATOM   5515   C  CD     . LYS A 1 108 ? -1.595  12.720  2.126   1.00 0.00 ? 115 LYS A CD     2  
ATOM   5516   C  CE     . LYS A 1 108 ? -0.444  12.019  1.428   1.00 0.00 ? 115 LYS A CE     2  
ATOM   5517   N  NZ     . LYS A 1 108 ? 0.120   12.828  0.311   1.00 0.00 ? 115 LYS A NZ     2  
ATOM   5518   H  H      . LYS A 1 108 ? -2.571  15.116  6.170   1.00 0.00 ? 115 LYS A H      2  
ATOM   5519   H  HA     . LYS A 1 108 ? -0.843  16.238  4.073   1.00 0.00 ? 115 LYS A HA     2  
ATOM   5520   H  HB2    . LYS A 1 108 ? -3.041  14.202  3.890   1.00 0.00 ? 115 LYS A HB2    2  
ATOM   5521   H  HB3    . LYS A 1 108 ? -2.613  15.191  2.501   1.00 0.00 ? 115 LYS A HB3    2  
ATOM   5522   H  HG2    . LYS A 1 108 ? -0.311  14.351  2.631   1.00 0.00 ? 115 LYS A HG2    2  
ATOM   5523   H  HG3    . LYS A 1 108 ? -0.771  13.334  3.995   1.00 0.00 ? 115 LYS A HG3    2  
ATOM   5524   H  HD2    . LYS A 1 108 ? -2.159  11.988  2.681   1.00 0.00 ? 115 LYS A HD2    2  
ATOM   5525   H  HD3    . LYS A 1 108 ? -2.229  13.174  1.381   1.00 0.00 ? 115 LYS A HD3    2  
ATOM   5526   H  HE2    . LYS A 1 108 ? 0.332   11.836  2.151   1.00 0.00 ? 115 LYS A HE2    2  
ATOM   5527   H  HE3    . LYS A 1 108 ? -0.797  11.076  1.036   1.00 0.00 ? 115 LYS A HE3    2  
ATOM   5528   H  HZ1    . LYS A 1 108 ? 0.894   12.303  -0.156  1.00 0.00 ? 115 LYS A HZ1    2  
ATOM   5529   H  HZ2    . LYS A 1 108 ? 0.502   13.736  0.669   1.00 0.00 ? 115 LYS A HZ2    2  
ATOM   5530   H  HZ3    . LYS A 1 108 ? -0.614  13.032  -0.393  1.00 0.00 ? 115 LYS A HZ3    2  
ATOM   5531   N  N      . ALA A 1 109 ? -4.077  16.753  3.986   1.00 0.00 ? 116 ALA A N      2  
ATOM   5532   C  CA     . ALA A 1 109 ? -5.134  17.743  3.766   1.00 0.00 ? 116 ALA A CA     2  
ATOM   5533   C  C      . ALA A 1 109 ? -4.931  18.523  2.462   1.00 0.00 ? 116 ALA A C      2  
ATOM   5534   O  O      . ALA A 1 109 ? -5.608  18.266  1.467   1.00 0.00 ? 116 ALA A O      2  
ATOM   5535   C  CB     . ALA A 1 109 ? -5.255  18.683  4.958   1.00 0.00 ? 116 ALA A CB     2  
ATOM   5536   H  H      . ALA A 1 109 ? -4.322  15.809  3.976   1.00 0.00 ? 116 ALA A H      2  
ATOM   5537   H  HA     . ALA A 1 109 ? -6.066  17.198  3.689   1.00 0.00 ? 116 ALA A HA     2  
ATOM   5538   H  HB1    . ALA A 1 109 ? -5.386  18.101  5.858   1.00 0.00 ? 116 ALA A HB1    2  
ATOM   5539   H  HB2    . ALA A 1 109 ? -6.107  19.334  4.822   1.00 0.00 ? 116 ALA A HB2    2  
ATOM   5540   H  HB3    . ALA A 1 109 ? -4.357  19.276  5.041   1.00 0.00 ? 116 ALA A HB3    2  
ATOM   5541   N  N      . GLU A 1 110 ? -3.974  19.442  2.457   1.00 0.00 ? 117 GLU A N      2  
ATOM   5542   C  CA     . GLU A 1 110 ? -3.762  20.343  1.323   1.00 0.00 ? 117 GLU A CA     2  
ATOM   5543   C  C      . GLU A 1 110 ? -2.872  19.700  0.257   1.00 0.00 ? 117 GLU A C      2  
ATOM   5544   O  O      . GLU A 1 110 ? -2.006  20.358  -0.319  1.00 0.00 ? 117 GLU A O      2  
ATOM   5545   C  CB     . GLU A 1 110 ? -3.121  21.638  1.813   1.00 0.00 ? 117 GLU A CB     2  
ATOM   5546   C  CG     . GLU A 1 110 ? -3.947  22.373  2.849   1.00 0.00 ? 117 GLU A CG     2  
ATOM   5547   C  CD     . GLU A 1 110 ? -3.231  23.583  3.402   1.00 0.00 ? 117 GLU A CD     2  
ATOM   5548   O  OE1    . GLU A 1 110 ? -3.183  24.617  2.708   1.00 0.00 ? 117 GLU A OE1    2  
ATOM   5549   O  OE2    . GLU A 1 110 ? -2.707  23.497  4.531   1.00 0.00 ? 117 GLU A OE2    2  
ATOM   5550   H  H      . GLU A 1 110 ? -3.376  19.507  3.236   1.00 0.00 ? 117 GLU A H      2  
ATOM   5551   H  HA     . GLU A 1 110 ? -4.724  20.567  0.890   1.00 0.00 ? 117 GLU A HA     2  
ATOM   5552   H  HB2    . GLU A 1 110 ? -2.159  21.410  2.247   1.00 0.00 ? 117 GLU A HB2    2  
ATOM   5553   H  HB3    . GLU A 1 110 ? -2.978  22.295  0.969   1.00 0.00 ? 117 GLU A HB3    2  
ATOM   5554   H  HG2    . GLU A 1 110 ? -4.872  22.696  2.394   1.00 0.00 ? 117 GLU A HG2    2  
ATOM   5555   H  HG3    . GLU A 1 110 ? -4.165  21.697  3.662   1.00 0.00 ? 117 GLU A HG3    2  
ATOM   5556   N  N      . GLU A 1 111 ? -3.114  18.428  -0.021  1.00 0.00 ? 118 GLU A N      2  
ATOM   5557   C  CA     . GLU A 1 111 ? -2.279  17.677  -0.946  1.00 0.00 ? 118 GLU A CA     2  
ATOM   5558   C  C      . GLU A 1 111 ? -2.944  17.530  -2.308  1.00 0.00 ? 118 GLU A C      2  
ATOM   5559   O  O      . GLU A 1 111 ? -2.257  17.486  -3.326  1.00 0.00 ? 118 GLU A O      2  
ATOM   5560   C  CB     . GLU A 1 111 ? -1.973  16.301  -0.363  1.00 0.00 ? 118 GLU A CB     2  
ATOM   5561   C  CG     . GLU A 1 111 ? -1.101  16.356  0.872   1.00 0.00 ? 118 GLU A CG     2  
ATOM   5562   C  CD     . GLU A 1 111 ? 0.376   16.297  0.553   1.00 0.00 ? 118 GLU A CD     2  
ATOM   5563   O  OE1    . GLU A 1 111 ? 0.923   17.296  0.051   1.00 0.00 ? 118 GLU A OE1    2  
ATOM   5564   O  OE2    . GLU A 1 111 ? 0.990   15.238  0.816   1.00 0.00 ? 118 GLU A OE2    2  
ATOM   5565   H  H      . GLU A 1 111 ? -3.879  17.986  0.405   1.00 0.00 ? 118 GLU A H      2  
ATOM   5566   H  HA     . GLU A 1 111 ? -1.354  18.216  -1.071  1.00 0.00 ? 118 GLU A HA     2  
ATOM   5567   H  HB2    . GLU A 1 111 ? -2.904  15.818  -0.102  1.00 0.00 ? 118 GLU A HB2    2  
ATOM   5568   H  HB3    . GLU A 1 111 ? -1.467  15.707  -1.110  1.00 0.00 ? 118 GLU A HB3    2  
ATOM   5569   H  HG2    . GLU A 1 111 ? -1.303  17.276  1.400   1.00 0.00 ? 118 GLU A HG2    2  
ATOM   5570   H  HG3    . GLU A 1 111 ? -1.352  15.519  1.506   1.00 0.00 ? 118 GLU A HG3    2  
ATOM   5571   N  N      . ASP A 1 112 ? -4.278  17.435  -2.309  1.00 0.00 ? 119 ASP A N      2  
ATOM   5572   C  CA     . ASP A 1 112 ? -5.081  17.305  -3.539  1.00 0.00 ? 119 ASP A CA     2  
ATOM   5573   C  C      . ASP A 1 112 ? -4.990  15.901  -4.128  1.00 0.00 ? 119 ASP A C      2  
ATOM   5574   O  O      . ASP A 1 112 ? -6.011  15.281  -4.427  1.00 0.00 ? 119 ASP A O      2  
ATOM   5575   C  CB     . ASP A 1 112 ? -4.672  18.331  -4.602  1.00 0.00 ? 119 ASP A CB     2  
ATOM   5576   C  CG     . ASP A 1 112 ? -5.519  18.245  -5.855  1.00 0.00 ? 119 ASP A CG     2  
ATOM   5577   O  OD1    . ASP A 1 112 ? -6.675  18.715  -5.830  1.00 0.00 ? 119 ASP A OD1    2  
ATOM   5578   O  OD2    . ASP A 1 112 ? -5.024  17.713  -6.872  1.00 0.00 ? 119 ASP A OD2    2  
ATOM   5579   H  H      . ASP A 1 112 ? -4.748  17.445  -1.448  1.00 0.00 ? 119 ASP A H      2  
ATOM   5580   H  HA     . ASP A 1 112 ? -6.110  17.489  -3.266  1.00 0.00 ? 119 ASP A HA     2  
ATOM   5581   H  HB2    . ASP A 1 112 ? -4.763  19.326  -4.195  1.00 0.00 ? 119 ASP A HB2    2  
ATOM   5582   H  HB3    . ASP A 1 112 ? -3.642  18.150  -4.881  1.00 0.00 ? 119 ASP A HB3    2  
ATOM   5583   N  N      . LYS A 1 113 ? -3.774  15.383  -4.260  1.00 0.00 ? 120 LYS A N      2  
ATOM   5584   C  CA     . LYS A 1 113 ? -3.554  14.115  -4.935  1.00 0.00 ? 120 LYS A CA     2  
ATOM   5585   C  C      . LYS A 1 113 ? -3.774  12.950  -3.977  1.00 0.00 ? 120 LYS A C      2  
ATOM   5586   O  O      . LYS A 1 113 ? -2.938  12.055  -3.869  1.00 0.00 ? 120 LYS A O      2  
ATOM   5587   C  CB     . LYS A 1 113 ? -2.144  14.048  -5.548  1.00 0.00 ? 120 LYS A CB     2  
ATOM   5588   C  CG     . LYS A 1 113 ? -1.894  15.049  -6.676  1.00 0.00 ? 120 LYS A CG     2  
ATOM   5589   C  CD     . LYS A 1 113 ? -1.701  16.459  -6.146  1.00 0.00 ? 120 LYS A CD     2  
ATOM   5590   C  CE     . LYS A 1 113 ? -1.464  17.467  -7.259  1.00 0.00 ? 120 LYS A CE     2  
ATOM   5591   N  NZ     . LYS A 1 113 ? -2.694  17.741  -8.048  1.00 0.00 ? 120 LYS A NZ     2  
ATOM   5592   H  H      . LYS A 1 113 ? -3.005  15.861  -3.880  1.00 0.00 ? 120 LYS A H      2  
ATOM   5593   H  HA     . LYS A 1 113 ? -4.278  14.048  -5.733  1.00 0.00 ? 120 LYS A HA     2  
ATOM   5594   H  HB2    . LYS A 1 113 ? -1.419  14.233  -4.771  1.00 0.00 ? 120 LYS A HB2    2  
ATOM   5595   H  HB3    . LYS A 1 113 ? -1.987  13.053  -5.941  1.00 0.00 ? 120 LYS A HB3    2  
ATOM   5596   H  HG2    . LYS A 1 113 ? -1.007  14.757  -7.214  1.00 0.00 ? 120 LYS A HG2    2  
ATOM   5597   H  HG3    . LYS A 1 113 ? -2.743  15.039  -7.345  1.00 0.00 ? 120 LYS A HG3    2  
ATOM   5598   H  HD2    . LYS A 1 113 ? -2.590  16.744  -5.606  1.00 0.00 ? 120 LYS A HD2    2  
ATOM   5599   H  HD3    . LYS A 1 113 ? -0.853  16.468  -5.476  1.00 0.00 ? 120 LYS A HD3    2  
ATOM   5600   H  HE2    . LYS A 1 113 ? -1.119  18.390  -6.819  1.00 0.00 ? 120 LYS A HE2    2  
ATOM   5601   H  HE3    . LYS A 1 113 ? -0.702  17.081  -7.920  1.00 0.00 ? 120 LYS A HE3    2  
ATOM   5602   H  HZ1    . LYS A 1 113 ? -3.502  17.934  -7.409  1.00 0.00 ? 120 LYS A HZ1    2  
ATOM   5603   H  HZ2    . LYS A 1 113 ? -2.931  16.924  -8.647  1.00 0.00 ? 120 LYS A HZ2    2  
ATOM   5604   H  HZ3    . LYS A 1 113 ? -2.548  18.571  -8.662  1.00 0.00 ? 120 LYS A HZ3    2  
ATOM   5605   N  N      . ILE A 1 114 ? -4.910  12.968  -3.288  1.00 0.00 ? 121 ILE A N      2  
ATOM   5606   C  CA     . ILE A 1 114 ? -5.270  11.894  -2.371  1.00 0.00 ? 121 ILE A CA     2  
ATOM   5607   C  C      . ILE A 1 114 ? -6.513  11.163  -2.874  1.00 0.00 ? 121 ILE A C      2  
ATOM   5608   O  O      . ILE A 1 114 ? -7.639  11.571  -2.587  1.00 0.00 ? 121 ILE A O      2  
ATOM   5609   C  CB     . ILE A 1 114 ? -5.536  12.417  -0.936  1.00 0.00 ? 121 ILE A CB     2  
ATOM   5610   C  CG1    . ILE A 1 114 ? -4.355  13.257  -0.444  1.00 0.00 ? 121 ILE A CG1    2  
ATOM   5611   C  CG2    . ILE A 1 114 ? -5.788  11.253  0.015   1.00 0.00 ? 121 ILE A CG2    2  
ATOM   5612   C  CD1    . ILE A 1 114 ? -4.568  13.853  0.932   1.00 0.00 ? 121 ILE A CD1    2  
ATOM   5613   H  H      . ILE A 1 114 ? -5.527  13.721  -3.409  1.00 0.00 ? 121 ILE A H      2  
ATOM   5614   H  HA     . ILE A 1 114 ? -4.447  11.197  -2.333  1.00 0.00 ? 121 ILE A HA     2  
ATOM   5615   H  HB     . ILE A 1 114 ? -6.424  13.032  -0.951  1.00 0.00 ? 121 ILE A HB     2  
ATOM   5616   H  HG12   . ILE A 1 114 ? -3.474  12.634  -0.404  1.00 0.00 ? 121 ILE A HG12   2  
ATOM   5617   H  HG13   . ILE A 1 114 ? -4.186  14.067  -1.138  1.00 0.00 ? 121 ILE A HG13   2  
ATOM   5618   H  HG21   . ILE A 1 114 ? -6.668  10.713  -0.303  1.00 0.00 ? 121 ILE A HG21   2  
ATOM   5619   H  HG22   . ILE A 1 114 ? -5.939  11.631  1.015   1.00 0.00 ? 121 ILE A HG22   2  
ATOM   5620   H  HG23   . ILE A 1 114 ? -4.937  10.590  0.006   1.00 0.00 ? 121 ILE A HG23   2  
ATOM   5621   H  HD11   . ILE A 1 114 ? -4.663  13.057  1.657   1.00 0.00 ? 121 ILE A HD11   2  
ATOM   5622   H  HD12   . ILE A 1 114 ? -5.469  14.449  0.932   1.00 0.00 ? 121 ILE A HD12   2  
ATOM   5623   H  HD13   . ILE A 1 114 ? -3.722  14.474  1.191   1.00 0.00 ? 121 ILE A HD13   2  
ATOM   5624   N  N      . PRO A 1 115 ? -6.322  10.114  -3.685  1.00 0.00 ? 122 PRO A N      2  
ATOM   5625   C  CA     . PRO A 1 115 ? -7.404  9.259   -4.149  1.00 0.00 ? 122 PRO A CA     2  
ATOM   5626   C  C      . PRO A 1 115 ? -7.689  8.127   -3.168  1.00 0.00 ? 122 PRO A C      2  
ATOM   5627   O  O      . PRO A 1 115 ? -6.768  7.441   -2.714  1.00 0.00 ? 122 PRO A O      2  
ATOM   5628   C  CB     . PRO A 1 115 ? -6.870  8.696   -5.477  1.00 0.00 ? 122 PRO A CB     2  
ATOM   5629   C  CG     . PRO A 1 115 ? -5.449  9.168   -5.599  1.00 0.00 ? 122 PRO A CG     2  
ATOM   5630   C  CD     . PRO A 1 115 ? -5.044  9.682   -4.245  1.00 0.00 ? 122 PRO A CD     2  
ATOM   5631   H  HA     . PRO A 1 115 ? -8.309  9.822   -4.328  1.00 0.00 ? 122 PRO A HA     2  
ATOM   5632   H  HB2    . PRO A 1 115 ? -6.923  7.617   -5.455  1.00 0.00 ? 122 PRO A HB2    2  
ATOM   5633   H  HB3    . PRO A 1 115 ? -7.475  9.069   -6.290  1.00 0.00 ? 122 PRO A HB3    2  
ATOM   5634   H  HG2    . PRO A 1 115 ? -4.815  8.344   -5.888  1.00 0.00 ? 122 PRO A HG2    2  
ATOM   5635   H  HG3    . PRO A 1 115 ? -5.392  9.959   -6.331  1.00 0.00 ? 122 PRO A HG3    2  
ATOM   5636   H  HD2    . PRO A 1 115 ? -4.607  8.891   -3.653  1.00 0.00 ? 122 PRO A HD2    2  
ATOM   5637   H  HD3    . PRO A 1 115 ? -4.360  10.512  -4.342  1.00 0.00 ? 122 PRO A HD3    2  
ATOM   5638   N  N      . LEU A 1 116 ? -8.957  7.932   -2.839  1.00 0.00 ? 123 LEU A N      2  
ATOM   5639   C  CA     . LEU A 1 116 ? -9.343  6.887   -1.904  1.00 0.00 ? 123 LEU A CA     2  
ATOM   5640   C  C      . LEU A 1 116 ? -10.242 5.865   -2.583  1.00 0.00 ? 123 LEU A C      2  
ATOM   5641   O  O      . LEU A 1 116 ? -11.291 6.209   -3.121  1.00 0.00 ? 123 LEU A O      2  
ATOM   5642   C  CB     . LEU A 1 116 ? -10.072 7.461   -0.680  1.00 0.00 ? 123 LEU A CB     2  
ATOM   5643   C  CG     . LEU A 1 116 ? -9.258  8.406   0.210   1.00 0.00 ? 123 LEU A CG     2  
ATOM   5644   C  CD1    . LEU A 1 116 ? -9.228  9.811   -0.370  1.00 0.00 ? 123 LEU A CD1    2  
ATOM   5645   C  CD2    . LEU A 1 116 ? -9.829  8.417   1.617   1.00 0.00 ? 123 LEU A CD2    2  
ATOM   5646   H  H      . LEU A 1 116 ? -9.652  8.494   -3.242  1.00 0.00 ? 123 LEU A H      2  
ATOM   5647   H  HA     . LEU A 1 116 ? -8.442  6.391   -1.573  1.00 0.00 ? 123 LEU A HA     2  
ATOM   5648   H  HB2    . LEU A 1 116 ? -10.944 7.996   -1.029  1.00 0.00 ? 123 LEU A HB2    2  
ATOM   5649   H  HB3    . LEU A 1 116 ? -10.405 6.633   -0.071  1.00 0.00 ? 123 LEU A HB3    2  
ATOM   5650   H  HG     . LEU A 1 116 ? -8.241  8.048   0.266   1.00 0.00 ? 123 LEU A HG     2  
ATOM   5651   H  HD11   . LEU A 1 116 ? -10.236 10.187  -0.452  1.00 0.00 ? 123 LEU A HD11   2  
ATOM   5652   H  HD12   . LEU A 1 116 ? -8.772  9.785   -1.349  1.00 0.00 ? 123 LEU A HD12   2  
ATOM   5653   H  HD13   . LEU A 1 116 ? -8.653  10.456  0.279   1.00 0.00 ? 123 LEU A HD13   2  
ATOM   5654   H  HD21   . LEU A 1 116 ? -10.861 8.732   1.584   1.00 0.00 ? 123 LEU A HD21   2  
ATOM   5655   H  HD22   . LEU A 1 116 ? -9.262  9.100   2.231   1.00 0.00 ? 123 LEU A HD22   2  
ATOM   5656   H  HD23   . LEU A 1 116 ? -9.770  7.423   2.036   1.00 0.00 ? 123 LEU A HD23   2  
ATOM   5657   N  N      . LEU A 1 117 ? -9.829  4.614   -2.557  1.00 0.00 ? 124 LEU A N      2  
ATOM   5658   C  CA     . LEU A 1 117 ? -10.637 3.539   -3.096  1.00 0.00 ? 124 LEU A CA     2  
ATOM   5659   C  C      . LEU A 1 117 ? -10.971 2.542   -1.995  1.00 0.00 ? 124 LEU A C      2  
ATOM   5660   O  O      . LEU A 1 117 ? -10.080 2.006   -1.336  1.00 0.00 ? 124 LEU A O      2  
ATOM   5661   C  CB     . LEU A 1 117 ? -9.911  2.864   -4.266  1.00 0.00 ? 124 LEU A CB     2  
ATOM   5662   C  CG     . LEU A 1 117 ? -10.543 1.571   -4.797  1.00 0.00 ? 124 LEU A CG     2  
ATOM   5663   C  CD1    . LEU A 1 117 ? -12.034 1.728   -4.999  1.00 0.00 ? 124 LEU A CD1    2  
ATOM   5664   C  CD2    . LEU A 1 117 ? -9.894  1.164   -6.105  1.00 0.00 ? 124 LEU A CD2    2  
ATOM   5665   H  H      . LEU A 1 117 ? -8.957  4.403   -2.164  1.00 0.00 ? 124 LEU A H      2  
ATOM   5666   H  HA     . LEU A 1 117 ? -11.556 3.972   -3.460  1.00 0.00 ? 124 LEU A HA     2  
ATOM   5667   H  HB2    . LEU A 1 117 ? -9.858  3.571   -5.081  1.00 0.00 ? 124 LEU A HB2    2  
ATOM   5668   H  HB3    . LEU A 1 117 ? -8.904  2.638   -3.949  1.00 0.00 ? 124 LEU A HB3    2  
ATOM   5669   H  HG     . LEU A 1 117 ? -10.386 0.781   -4.083  1.00 0.00 ? 124 LEU A HG     2  
ATOM   5670   H  HD11   . LEU A 1 117 ? -12.517 1.835   -4.037  1.00 0.00 ? 124 LEU A HD11   2  
ATOM   5671   H  HD12   . LEU A 1 117 ? -12.423 0.857   -5.506  1.00 0.00 ? 124 LEU A HD12   2  
ATOM   5672   H  HD13   . LEU A 1 117 ? -12.219 2.608   -5.591  1.00 0.00 ? 124 LEU A HD13   2  
ATOM   5673   H  HD21   . LEU A 1 117 ? -10.098 1.916   -6.854  1.00 0.00 ? 124 LEU A HD21   2  
ATOM   5674   H  HD22   . LEU A 1 117 ? -10.300 0.216   -6.427  1.00 0.00 ? 124 LEU A HD22   2  
ATOM   5675   H  HD23   . LEU A 1 117 ? -8.827  1.074   -5.966  1.00 0.00 ? 124 LEU A HD23   2  
ATOM   5676   N  N      . VAL A 1 118 ? -12.263 2.329   -1.790  1.00 0.00 ? 125 VAL A N      2  
ATOM   5677   C  CA     . VAL A 1 118 ? -12.735 1.412   -0.770  1.00 0.00 ? 125 VAL A CA     2  
ATOM   5678   C  C      . VAL A 1 118 ? -12.841 0.010   -1.356  1.00 0.00 ? 125 VAL A C      2  
ATOM   5679   O  O      . VAL A 1 118 ? -13.462 -0.192  -2.402  1.00 0.00 ? 125 VAL A O      2  
ATOM   5680   C  CB     . VAL A 1 118 ? -14.105 1.848   -0.205  1.00 0.00 ? 125 VAL A CB     2  
ATOM   5681   C  CG1    . VAL A 1 118 ? -14.477 1.002   0.999   1.00 0.00 ? 125 VAL A CG1    2  
ATOM   5682   C  CG2    . VAL A 1 118 ? -14.094 3.325   0.163   1.00 0.00 ? 125 VAL A CG2    2  
ATOM   5683   H  H      . VAL A 1 118 ? -12.919 2.791   -2.355  1.00 0.00 ? 125 VAL A H      2  
ATOM   5684   H  HA     . VAL A 1 118 ? -12.016 1.404   0.038   1.00 0.00 ? 125 VAL A HA     2  
ATOM   5685   H  HB     . VAL A 1 118 ? -14.853 1.694   -0.969  1.00 0.00 ? 125 VAL A HB     2  
ATOM   5686   H  HG11   . VAL A 1 118 ? -15.430 1.328   1.391   1.00 0.00 ? 125 VAL A HG11   2  
ATOM   5687   H  HG12   . VAL A 1 118 ? -13.719 1.110   1.762   1.00 0.00 ? 125 VAL A HG12   2  
ATOM   5688   H  HG13   . VAL A 1 118 ? -14.543 -0.034  0.703   1.00 0.00 ? 125 VAL A HG13   2  
ATOM   5689   H  HG21   . VAL A 1 118 ? -15.063 3.606   0.552   1.00 0.00 ? 125 VAL A HG21   2  
ATOM   5690   H  HG22   . VAL A 1 118 ? -13.874 3.912   -0.715  1.00 0.00 ? 125 VAL A HG22   2  
ATOM   5691   H  HG23   . VAL A 1 118 ? -13.340 3.503   0.916   1.00 0.00 ? 125 VAL A HG23   2  
ATOM   5692   N  N      . VAL A 1 119 ? -12.211 -0.947  -0.692  1.00 0.00 ? 126 VAL A N      2  
ATOM   5693   C  CA     . VAL A 1 119 ? -12.138 -2.309  -1.196  1.00 0.00 ? 126 VAL A CA     2  
ATOM   5694   C  C      . VAL A 1 119 ? -12.611 -3.312  -0.145  1.00 0.00 ? 126 VAL A C      2  
ATOM   5695   O  O      . VAL A 1 119 ? -12.166 -3.280  1.004   1.00 0.00 ? 126 VAL A O      2  
ATOM   5696   C  CB     . VAL A 1 119 ? -10.693 -2.667  -1.618  1.00 0.00 ? 126 VAL A CB     2  
ATOM   5697   C  CG1    . VAL A 1 119 ? -10.637 -4.052  -2.241  1.00 0.00 ? 126 VAL A CG1    2  
ATOM   5698   C  CG2    . VAL A 1 119 ? -10.130 -1.626  -2.577  1.00 0.00 ? 126 VAL A CG2    2  
ATOM   5699   H  H      . VAL A 1 119 ? -11.778 -0.732  0.166   1.00 0.00 ? 126 VAL A H      2  
ATOM   5700   H  HA     . VAL A 1 119 ? -12.775 -2.383  -2.065  1.00 0.00 ? 126 VAL A HA     2  
ATOM   5701   H  HB     . VAL A 1 119 ? -10.077 -2.674  -0.731  1.00 0.00 ? 126 VAL A HB     2  
ATOM   5702   H  HG11   . VAL A 1 119 ? -11.279 -4.083  -3.110  1.00 0.00 ? 126 VAL A HG11   2  
ATOM   5703   H  HG12   . VAL A 1 119 ? -10.969 -4.785  -1.521  1.00 0.00 ? 126 VAL A HG12   2  
ATOM   5704   H  HG13   . VAL A 1 119 ? -9.622  -4.271  -2.537  1.00 0.00 ? 126 VAL A HG13   2  
ATOM   5705   H  HG21   . VAL A 1 119 ? -10.139 -0.657  -2.102  1.00 0.00 ? 126 VAL A HG21   2  
ATOM   5706   H  HG22   . VAL A 1 119 ? -10.736 -1.594  -3.470  1.00 0.00 ? 126 VAL A HG22   2  
ATOM   5707   H  HG23   . VAL A 1 119 ? -9.116  -1.890  -2.839  1.00 0.00 ? 126 VAL A HG23   2  
ATOM   5708   N  N      . GLY A 1 120 ? -13.514 -4.194  -0.547  1.00 0.00 ? 127 GLY A N      2  
ATOM   5709   C  CA     . GLY A 1 120 ? -13.953 -5.259  0.328   1.00 0.00 ? 127 GLY A CA     2  
ATOM   5710   C  C      . GLY A 1 120 ? -13.273 -6.568  -0.020  1.00 0.00 ? 127 GLY A C      2  
ATOM   5711   O  O      . GLY A 1 120 ? -13.105 -6.885  -1.200  1.00 0.00 ? 127 GLY A O      2  
ATOM   5712   H  H      . GLY A 1 120 ? -13.885 -4.124  -1.452  1.00 0.00 ? 127 GLY A H      2  
ATOM   5713   H  HA2    . GLY A 1 120 ? -13.719 -4.995  1.349   1.00 0.00 ? 127 GLY A HA2    2  
ATOM   5714   H  HA3    . GLY A 1 120 ? -15.021 -5.380  0.229   1.00 0.00 ? 127 GLY A HA3    2  
ATOM   5715   N  N      . ASN A 1 121 ? -12.863 -7.328  0.987   1.00 0.00 ? 128 ASN A N      2  
ATOM   5716   C  CA     . ASN A 1 121 ? -12.143 -8.575  0.745   1.00 0.00 ? 128 ASN A CA     2  
ATOM   5717   C  C      . ASN A 1 121 ? -12.671 -9.689  1.651   1.00 0.00 ? 128 ASN A C      2  
ATOM   5718   O  O      . ASN A 1 121 ? -13.569 -9.454  2.464   1.00 0.00 ? 128 ASN A O      2  
ATOM   5719   C  CB     . ASN A 1 121 ? -10.641 -8.361  0.970   1.00 0.00 ? 128 ASN A CB     2  
ATOM   5720   C  CG     . ASN A 1 121 ? -9.782  -9.417  0.294   1.00 0.00 ? 128 ASN A CG     2  
ATOM   5721   O  OD1    . ASN A 1 121 ? -9.452  -10.447 0.882   1.00 0.00 ? 128 ASN A OD1    2  
ATOM   5722   N  ND2    . ASN A 1 121 ? -9.424  -9.177  -0.955  1.00 0.00 ? 128 ASN A ND2    2  
ATOM   5723   H  H      . ASN A 1 121 ? -13.049 -7.048  1.911   1.00 0.00 ? 128 ASN A H      2  
ATOM   5724   H  HA     . ASN A 1 121 ? -12.308 -8.855  -0.285  1.00 0.00 ? 128 ASN A HA     2  
ATOM   5725   H  HB2    . ASN A 1 121 ? -10.362 -7.394  0.580   1.00 0.00 ? 128 ASN A HB2    2  
ATOM   5726   H  HB3    . ASN A 1 121 ? -10.441 -8.387  2.031   1.00 0.00 ? 128 ASN A HB3    2  
ATOM   5727   H  HD21   . ASN A 1 121 ? -9.736  -8.336  -1.376  1.00 0.00 ? 128 ASN A HD21   2  
ATOM   5728   H  HD22   . ASN A 1 121 ? -8.863  -9.836  -1.410  1.00 0.00 ? 128 ASN A HD22   2  
ATOM   5729   N  N      . LYS A 1 122 ? -12.091 -10.888 1.512   1.00 0.00 ? 129 LYS A N      2  
ATOM   5730   C  CA     . LYS A 1 122 ? -12.514 -12.079 2.251   1.00 0.00 ? 129 LYS A CA     2  
ATOM   5731   C  C      . LYS A 1 122 ? -13.946 -12.467 1.897   1.00 0.00 ? 129 LYS A C      2  
ATOM   5732   O  O      . LYS A 1 122 ? -14.835 -12.451 2.741   1.00 0.00 ? 129 LYS A O      2  
ATOM   5733   C  CB     . LYS A 1 122 ? -12.377 -11.878 3.765   1.00 0.00 ? 129 LYS A CB     2  
ATOM   5734   C  CG     . LYS A 1 122 ? -10.955 -11.591 4.225   1.00 0.00 ? 129 LYS A CG     2  
ATOM   5735   C  CD     . LYS A 1 122 ? -10.007 -12.727 3.871   1.00 0.00 ? 129 LYS A CD     2  
ATOM   5736   C  CE     . LYS A 1 122 ? -8.599  -12.463 4.384   1.00 0.00 ? 129 LYS A CE     2  
ATOM   5737   N  NZ     . LYS A 1 122 ? -8.559  -12.364 5.866   1.00 0.00 ? 129 LYS A NZ     2  
ATOM   5738   H  H      . LYS A 1 122 ? -11.333 -10.970 0.895   1.00 0.00 ? 129 LYS A H      2  
ATOM   5739   H  HA     . LYS A 1 122 ? -11.864 -12.889 1.953   1.00 0.00 ? 129 LYS A HA     2  
ATOM   5740   H  HB2    . LYS A 1 122 ? -13.001 -11.049 4.063   1.00 0.00 ? 129 LYS A HB2    2  
ATOM   5741   H  HB3    . LYS A 1 122 ? -12.721 -12.772 4.267   1.00 0.00 ? 129 LYS A HB3    2  
ATOM   5742   H  HG2    . LYS A 1 122 ? -10.609 -10.687 3.747   1.00 0.00 ? 129 LYS A HG2    2  
ATOM   5743   H  HG3    . LYS A 1 122 ? -10.955 -11.455 5.298   1.00 0.00 ? 129 LYS A HG3    2  
ATOM   5744   H  HD2    . LYS A 1 122 ? -10.374 -13.640 4.314   1.00 0.00 ? 129 LYS A HD2    2  
ATOM   5745   H  HD3    . LYS A 1 122 ? -9.974  -12.836 2.797   1.00 0.00 ? 129 LYS A HD3    2  
ATOM   5746   H  HE2    . LYS A 1 122 ? -7.958  -13.273 4.068   1.00 0.00 ? 129 LYS A HE2    2  
ATOM   5747   H  HE3    . LYS A 1 122 ? -8.242  -11.536 3.958   1.00 0.00 ? 129 LYS A HE3    2  
ATOM   5748   H  HZ1    . LYS A 1 122 ? -7.574  -12.262 6.194   1.00 0.00 ? 129 LYS A HZ1    2  
ATOM   5749   H  HZ2    . LYS A 1 122 ? -8.967  -13.223 6.296   1.00 0.00 ? 129 LYS A HZ2    2  
ATOM   5750   H  HZ3    . LYS A 1 122 ? -9.106  -11.538 6.191   1.00 0.00 ? 129 LYS A HZ3    2  
ATOM   5751   N  N      . SER A 1 123 ? -14.161 -12.829 0.641   1.00 0.00 ? 130 SER A N      2  
ATOM   5752   C  CA     . SER A 1 123 ? -15.489 -13.204 0.169   1.00 0.00 ? 130 SER A CA     2  
ATOM   5753   C  C      . SER A 1 123 ? -15.797 -14.667 0.505   1.00 0.00 ? 130 SER A C      2  
ATOM   5754   O  O      . SER A 1 123 ? -16.829 -15.199 0.109   1.00 0.00 ? 130 SER A O      2  
ATOM   5755   C  CB     . SER A 1 123 ? -15.568 -12.998 -1.346  1.00 0.00 ? 130 SER A CB     2  
ATOM   5756   O  OG     . SER A 1 123 ? -14.864 -11.831 -1.744  1.00 0.00 ? 130 SER A OG     2  
ATOM   5757   H  H      . SER A 1 123 ? -13.414 -12.832 0.010   1.00 0.00 ? 130 SER A H      2  
ATOM   5758   H  HA     . SER A 1 123 ? -16.214 -12.565 0.657   1.00 0.00 ? 130 SER A HA     2  
ATOM   5759   H  HB2    . SER A 1 123 ? -15.134 -13.851 -1.847  1.00 0.00 ? 130 SER A HB2    2  
ATOM   5760   H  HB3    . SER A 1 123 ? -16.605 -12.896 -1.638  1.00 0.00 ? 130 SER A HB3    2  
ATOM   5761   H  HG     . SER A 1 123 ? -15.124 -11.087 -1.175  1.00 0.00 ? 130 SER A HG     2  
ATOM   5762   N  N      . ASP A 1 124 ? -14.892 -15.304 1.242   1.00 0.00 ? 131 ASP A N      2  
ATOM   5763   C  CA     . ASP A 1 124 ? -14.996 -16.733 1.541   1.00 0.00 ? 131 ASP A CA     2  
ATOM   5764   C  C      . ASP A 1 124 ? -16.177 -17.042 2.452   1.00 0.00 ? 131 ASP A C      2  
ATOM   5765   O  O      . ASP A 1 124 ? -16.757 -18.122 2.392   1.00 0.00 ? 131 ASP A O      2  
ATOM   5766   C  CB     . ASP A 1 124 ? -13.709 -17.233 2.200   1.00 0.00 ? 131 ASP A CB     2  
ATOM   5767   C  CG     . ASP A 1 124 ? -12.483 -16.981 1.353   1.00 0.00 ? 131 ASP A CG     2  
ATOM   5768   O  OD1    . ASP A 1 124 ? -11.908 -15.872 1.445   1.00 0.00 ? 131 ASP A OD1    2  
ATOM   5769   O  OD2    . ASP A 1 124 ? -12.085 -17.887 0.600   1.00 0.00 ? 131 ASP A OD2    2  
ATOM   5770   H  H      . ASP A 1 124 ? -14.124 -14.803 1.587   1.00 0.00 ? 131 ASP A H      2  
ATOM   5771   H  HA     . ASP A 1 124 ? -15.138 -17.251 0.612   1.00 0.00 ? 131 ASP A HA     2  
ATOM   5772   H  HB2    . ASP A 1 124 ? -13.579 -16.732 3.147   1.00 0.00 ? 131 ASP A HB2    2  
ATOM   5773   H  HB3    . ASP A 1 124 ? -13.792 -18.297 2.369   1.00 0.00 ? 131 ASP A HB3    2  
ATOM   5774   N  N      . LEU A 1 125 ? -16.514 -16.089 3.294   1.00 0.00 ? 132 LEU A N      2  
ATOM   5775   C  CA     . LEU A 1 125 ? -17.576 -16.269 4.280   1.00 0.00 ? 132 LEU A CA     2  
ATOM   5776   C  C      . LEU A 1 125 ? -18.956 -16.004 3.675   1.00 0.00 ? 132 LEU A C      2  
ATOM   5777   O  O      . LEU A 1 125 ? -19.824 -16.878 3.699   1.00 0.00 ? 132 LEU A O      2  
ATOM   5778   C  CB     . LEU A 1 125 ? -17.344 -15.342 5.478   1.00 0.00 ? 132 LEU A CB     2  
ATOM   5779   C  CG     . LEU A 1 125 ? -17.071 -13.890 5.117   1.00 0.00 ? 132 LEU A CG     2  
ATOM   5780   C  CD1    . LEU A 1 125 ? -18.091 -12.990 5.786   1.00 0.00 ? 132 LEU A CD1    2  
ATOM   5781   C  CD2    . LEU A 1 125 ? -15.654 -13.505 5.512   1.00 0.00 ? 132 LEU A CD2    2  
ATOM   5782   H  H      . LEU A 1 125 ? -16.037 -15.238 3.250   1.00 0.00 ? 132 LEU A H      2  
ATOM   5783   H  HA     . LEU A 1 125 ? -17.538 -17.292 4.621   1.00 0.00 ? 132 LEU A HA     2  
ATOM   5784   H  HB2    . LEU A 1 125 ? -18.221 -15.373 6.106   1.00 0.00 ? 132 LEU A HB2    2  
ATOM   5785   H  HB3    . LEU A 1 125 ? -16.502 -15.706 6.047   1.00 0.00 ? 132 LEU A HB3    2  
ATOM   5786   H  HG     . LEU A 1 125 ? -17.167 -13.767 4.047   1.00 0.00 ? 132 LEU A HG     2  
ATOM   5787   H  HD11   . LEU A 1 125 ? -18.069 -13.154 6.854   1.00 0.00 ? 132 LEU A HD11   2  
ATOM   5788   H  HD12   . LEU A 1 125 ? -19.075 -13.216 5.406   1.00 0.00 ? 132 LEU A HD12   2  
ATOM   5789   H  HD13   . LEU A 1 125 ? -17.851 -11.958 5.577   1.00 0.00 ? 132 LEU A HD13   2  
ATOM   5790   H  HD21   . LEU A 1 125 ? -14.948 -14.096 4.945   1.00 0.00 ? 132 LEU A HD21   2  
ATOM   5791   H  HD22   . LEU A 1 125 ? -15.511 -13.690 6.566   1.00 0.00 ? 132 LEU A HD22   2  
ATOM   5792   H  HD23   . LEU A 1 125 ? -15.493 -12.457 5.306   1.00 0.00 ? 132 LEU A HD23   2  
ATOM   5793   N  N      . GLU A 1 126 ? -19.142 -14.789 3.148   1.00 0.00 ? 133 GLU A N      2  
ATOM   5794   C  CA     . GLU A 1 126 ? -20.412 -14.340 2.567   1.00 0.00 ? 133 GLU A CA     2  
ATOM   5795   C  C      . GLU A 1 126 ? -21.504 -14.197 3.634   1.00 0.00 ? 133 GLU A C      2  
ATOM   5796   O  O      . GLU A 1 126 ? -21.935 -13.086 3.943   1.00 0.00 ? 133 GLU A O      2  
ATOM   5797   C  CB     . GLU A 1 126 ? -20.872 -15.282 1.449   1.00 0.00 ? 133 GLU A CB     2  
ATOM   5798   C  CG     . GLU A 1 126 ? -22.124 -14.806 0.728   1.00 0.00 ? 133 GLU A CG     2  
ATOM   5799   C  CD     . GLU A 1 126 ? -22.527 -15.723 -0.407  1.00 0.00 ? 133 GLU A CD     2  
ATOM   5800   O  OE1    . GLU A 1 126 ? -23.284 -16.684 -0.162  1.00 0.00 ? 133 GLU A OE1    2  
ATOM   5801   O  OE2    . GLU A 1 126 ? -22.090 -15.479 -1.550  1.00 0.00 ? 133 GLU A OE2    2  
ATOM   5802   H  H      . GLU A 1 126 ? -18.389 -14.165 3.147   1.00 0.00 ? 133 GLU A H      2  
ATOM   5803   H  HA     . GLU A 1 126 ? -20.237 -13.364 2.141   1.00 0.00 ? 133 GLU A HA     2  
ATOM   5804   H  HB2    . GLU A 1 126 ? -20.080 -15.371 0.720   1.00 0.00 ? 133 GLU A HB2    2  
ATOM   5805   H  HB3    . GLU A 1 126 ? -21.075 -16.257 1.872   1.00 0.00 ? 133 GLU A HB3    2  
ATOM   5806   H  HG2    . GLU A 1 126 ? -22.937 -14.757 1.437   1.00 0.00 ? 133 GLU A HG2    2  
ATOM   5807   H  HG3    . GLU A 1 126 ? -21.937 -13.819 0.327   1.00 0.00 ? 133 GLU A HG3    2  
ATOM   5808   N  N      . GLU A 1 127 ? -21.925 -15.319 4.203   1.00 0.00 ? 134 GLU A N      2  
ATOM   5809   C  CA     . GLU A 1 127 ? -23.031 -15.346 5.158   1.00 0.00 ? 134 GLU A CA     2  
ATOM   5810   C  C      . GLU A 1 127 ? -22.708 -14.583 6.441   1.00 0.00 ? 134 GLU A C      2  
ATOM   5811   O  O      . GLU A 1 127 ? -23.583 -13.959 7.037   1.00 0.00 ? 134 GLU A O      2  
ATOM   5812   C  CB     . GLU A 1 127 ? -23.387 -16.792 5.501   1.00 0.00 ? 134 GLU A CB     2  
ATOM   5813   C  CG     . GLU A 1 127 ? -22.208 -17.610 6.002   1.00 0.00 ? 134 GLU A CG     2  
ATOM   5814   C  CD     . GLU A 1 127 ? -22.619 -18.970 6.512   1.00 0.00 ? 134 GLU A CD     2  
ATOM   5815   O  OE1    . GLU A 1 127 ? -22.812 -19.882 5.682   1.00 0.00 ? 134 GLU A OE1    2  
ATOM   5816   O  OE2    . GLU A 1 127 ? -22.747 -19.132 7.744   1.00 0.00 ? 134 GLU A OE2    2  
ATOM   5817   H  H      . GLU A 1 127 ? -21.476 -16.164 3.971   1.00 0.00 ? 134 GLU A H      2  
ATOM   5818   H  HA     . GLU A 1 127 ? -23.883 -14.882 4.686   1.00 0.00 ? 134 GLU A HA     2  
ATOM   5819   H  HB2    . GLU A 1 127 ? -24.147 -16.789 6.268   1.00 0.00 ? 134 GLU A HB2    2  
ATOM   5820   H  HB3    . GLU A 1 127 ? -23.781 -17.272 4.618   1.00 0.00 ? 134 GLU A HB3    2  
ATOM   5821   H  HG2    . GLU A 1 127 ? -21.509 -17.742 5.190   1.00 0.00 ? 134 GLU A HG2    2  
ATOM   5822   H  HG3    . GLU A 1 127 ? -21.724 -17.070 6.804   1.00 0.00 ? 134 GLU A HG3    2  
ATOM   5823   N  N      . ARG A 1 128 ? -21.450 -14.623 6.856   1.00 0.00 ? 135 ARG A N      2  
ATOM   5824   C  CA     . ARG A 1 128 ? -21.035 -14.034 8.107   1.00 0.00 ? 135 ARG A CA     2  
ATOM   5825   C  C      . ARG A 1 128 ? -20.706 -12.546 7.926   1.00 0.00 ? 135 ARG A C      2  
ATOM   5826   O  O      . ARG A 1 128 ? -19.925 -11.961 8.677   1.00 0.00 ? 135 ARG A O      2  
ATOM   5827   C  CB     . ARG A 1 128 ? -19.837 -14.823 8.630   1.00 0.00 ? 135 ARG A CB     2  
ATOM   5828   C  CG     . ARG A 1 128 ? -19.443 -14.462 10.037  1.00 0.00 ? 135 ARG A CG     2  
ATOM   5829   C  CD     . ARG A 1 128 ? -18.467 -15.467 10.617  1.00 0.00 ? 135 ARG A CD     2  
ATOM   5830   N  NE     . ARG A 1 128 ? -19.098 -16.770 10.842  1.00 0.00 ? 135 ARG A NE     2  
ATOM   5831   C  CZ     . ARG A 1 128 ? -18.427 -17.882 11.139  1.00 0.00 ? 135 ARG A CZ     2  
ATOM   5832   N  NH1    . ARG A 1 128 ? -17.100 -17.868 11.195  1.00 0.00 ? 135 ARG A NH1    2  
ATOM   5833   N  NH2    . ARG A 1 128 ? -19.086 -19.015 11.362  1.00 0.00 ? 135 ARG A NH2    2  
ATOM   5834   H  H      . ARG A 1 128 ? -20.780 -15.070 6.312   1.00 0.00 ? 135 ARG A H      2  
ATOM   5835   H  HA     . ARG A 1 128 ? -21.851 -14.129 8.809   1.00 0.00 ? 135 ARG A HA     2  
ATOM   5836   H  HB2    . ARG A 1 128 ? -20.078 -15.876 8.605   1.00 0.00 ? 135 ARG A HB2    2  
ATOM   5837   H  HB3    . ARG A 1 128 ? -18.992 -14.641 7.983   1.00 0.00 ? 135 ARG A HB3    2  
ATOM   5838   H  HG2    . ARG A 1 128 ? -18.981 -13.489 10.022  1.00 0.00 ? 135 ARG A HG2    2  
ATOM   5839   H  HG3    . ARG A 1 128 ? -20.331 -14.436 10.645  1.00 0.00 ? 135 ARG A HG3    2  
ATOM   5840   H  HD2    . ARG A 1 128 ? -17.647 -15.588 9.925   1.00 0.00 ? 135 ARG A HD2    2  
ATOM   5841   H  HD3    . ARG A 1 128 ? -18.093 -15.088 11.556  1.00 0.00 ? 135 ARG A HD3    2  
ATOM   5842   H  HE     . ARG A 1 128 ? -20.087 -16.808 10.785  1.00 0.00 ? 135 ARG A HE     2  
ATOM   5843   H  HH11   . ARG A 1 128 ? -16.593 -17.019 11.008  1.00 0.00 ? 135 ARG A HH11   2  
ATOM   5844   H  HH12   . ARG A 1 128 ? -16.593 -18.706 11.441  1.00 0.00 ? 135 ARG A HH12   2  
ATOM   5845   H  HH21   . ARG A 1 128 ? -20.092 -19.040 11.314  1.00 0.00 ? 135 ARG A HH21   2  
ATOM   5846   H  HH22   . ARG A 1 128 ? -18.577 -19.865 11.572  1.00 0.00 ? 135 ARG A HH22   2  
ATOM   5847   N  N      . ARG A 1 129 ? -21.329 -11.938 6.926   1.00 0.00 ? 136 ARG A N      2  
ATOM   5848   C  CA     . ARG A 1 129 ? -21.166 -10.520 6.664   1.00 0.00 ? 136 ARG A CA     2  
ATOM   5849   C  C      . ARG A 1 129 ? -21.755 -9.702  7.814   1.00 0.00 ? 136 ARG A C      2  
ATOM   5850   O  O      . ARG A 1 129 ? -22.964 -9.720  8.047   1.00 0.00 ? 136 ARG A O      2  
ATOM   5851   C  CB     . ARG A 1 129 ? -21.850 -10.165 5.342   1.00 0.00 ? 136 ARG A CB     2  
ATOM   5852   C  CG     . ARG A 1 129 ? -21.694 -8.713  4.935   1.00 0.00 ? 136 ARG A CG     2  
ATOM   5853   C  CD     . ARG A 1 129 ? -22.361 -8.439  3.596   1.00 0.00 ? 136 ARG A CD     2  
ATOM   5854   N  NE     . ARG A 1 129 ? -21.718 -9.169  2.499   1.00 0.00 ? 136 ARG A NE     2  
ATOM   5855   C  CZ     . ARG A 1 129 ? -22.377 -9.906  1.604   1.00 0.00 ? 136 ARG A CZ     2  
ATOM   5856   N  NH1    . ARG A 1 129 ? -23.687 -10.082 1.711   1.00 0.00 ? 136 ARG A NH1    2  
ATOM   5857   N  NH2    . ARG A 1 129 ? -21.719 -10.499 0.616   1.00 0.00 ? 136 ARG A NH2    2  
ATOM   5858   H  H      . ARG A 1 129 ? -21.923 -12.459 6.350   1.00 0.00 ? 136 ARG A H      2  
ATOM   5859   H  HA     . ARG A 1 129 ? -20.111 -10.309 6.587   1.00 0.00 ? 136 ARG A HA     2  
ATOM   5860   H  HB2    . ARG A 1 129 ? -21.434 -10.780 4.559   1.00 0.00 ? 136 ARG A HB2    2  
ATOM   5861   H  HB3    . ARG A 1 129 ? -22.906 -10.378 5.430   1.00 0.00 ? 136 ARG A HB3    2  
ATOM   5862   H  HG2    . ARG A 1 129 ? -22.147 -8.087  5.688   1.00 0.00 ? 136 ARG A HG2    2  
ATOM   5863   H  HG3    . ARG A 1 129 ? -20.641 -8.484  4.855   1.00 0.00 ? 136 ARG A HG3    2  
ATOM   5864   H  HD2    . ARG A 1 129 ? -23.397 -8.741  3.658   1.00 0.00 ? 136 ARG A HD2    2  
ATOM   5865   H  HD3    . ARG A 1 129 ? -22.309 -7.380  3.391   1.00 0.00 ? 136 ARG A HD3    2  
ATOM   5866   H  HE     . ARG A 1 129 ? -20.742 -9.088  2.417   1.00 0.00 ? 136 ARG A HE     2  
ATOM   5867   H  HH11   . ARG A 1 129 ? -24.198 -9.666  2.476   1.00 0.00 ? 136 ARG A HH11   2  
ATOM   5868   H  HH12   . ARG A 1 129 ? -24.178 -10.637 1.028   1.00 0.00 ? 136 ARG A HH12   2  
ATOM   5869   H  HH21   . ARG A 1 129 ? -20.714 -10.401 0.539   1.00 0.00 ? 136 ARG A HH21   2  
ATOM   5870   H  HH22   . ARG A 1 129 ? -22.215 -11.039 -0.068  1.00 0.00 ? 136 ARG A HH22   2  
ATOM   5871   N  N      . GLN A 1 130 ? -20.890 -9.001  8.539   1.00 0.00 ? 137 GLN A N      2  
ATOM   5872   C  CA     . GLN A 1 130 ? -21.321 -8.188  9.667   1.00 0.00 ? 137 GLN A CA     2  
ATOM   5873   C  C      . GLN A 1 130 ? -21.926 -6.882  9.191   1.00 0.00 ? 137 GLN A C      2  
ATOM   5874   O  O      . GLN A 1 130 ? -22.927 -6.409  9.728   1.00 0.00 ? 137 GLN A O      2  
ATOM   5875   C  CB     . GLN A 1 130 ? -20.150 -7.872  10.596  1.00 0.00 ? 137 GLN A CB     2  
ATOM   5876   C  CG     . GLN A 1 130 ? -19.542 -9.090  11.259  1.00 0.00 ? 137 GLN A CG     2  
ATOM   5877   C  CD     . GLN A 1 130 ? -18.609 -8.717  12.394  1.00 0.00 ? 137 GLN A CD     2  
ATOM   5878   O  OE1    . GLN A 1 130 ? -17.964 -7.667  12.369  1.00 0.00 ? 137 GLN A OE1    2  
ATOM   5879   N  NE2    . GLN A 1 130 ? -18.558 -9.560  13.409  1.00 0.00 ? 137 GLN A NE2    2  
ATOM   5880   H  H      . GLN A 1 130 ? -19.933 -9.038  8.313   1.00 0.00 ? 137 GLN A H      2  
ATOM   5881   H  HA     . GLN A 1 130 ? -22.067 -8.745  10.215  1.00 0.00 ? 137 GLN A HA     2  
ATOM   5882   H  HB2    . GLN A 1 130 ? -19.378 -7.379  10.024  1.00 0.00 ? 137 GLN A HB2    2  
ATOM   5883   H  HB3    . GLN A 1 130 ? -20.494 -7.202  11.370  1.00 0.00 ? 137 GLN A HB3    2  
ATOM   5884   H  HG2    . GLN A 1 130 ? -20.339 -9.706  11.653  1.00 0.00 ? 137 GLN A HG2    2  
ATOM   5885   H  HG3    . GLN A 1 130 ? -18.986 -9.647  10.521  1.00 0.00 ? 137 GLN A HG3    2  
ATOM   5886   H  HE21   . GLN A 1 130 ? -19.122 -10.368 13.366  1.00 0.00 ? 137 GLN A HE21   2  
ATOM   5887   H  HE22   . GLN A 1 130 ? -17.975 -9.342  14.172  1.00 0.00 ? 137 GLN A HE22   2  
ATOM   5888   N  N      . VAL A 1 131 ? -21.303 -6.297  8.186   1.00 0.00 ? 138 VAL A N      2  
ATOM   5889   C  CA     . VAL A 1 131 ? -21.727 -5.004  7.685   1.00 0.00 ? 138 VAL A CA     2  
ATOM   5890   C  C      . VAL A 1 131 ? -22.382 -5.138  6.316   1.00 0.00 ? 138 VAL A C      2  
ATOM   5891   O  O      . VAL A 1 131 ? -21.800 -5.707  5.394   1.00 0.00 ? 138 VAL A O      2  
ATOM   5892   C  CB     . VAL A 1 131 ? -20.543 -4.006  7.610   1.00 0.00 ? 138 VAL A CB     2  
ATOM   5893   C  CG1    . VAL A 1 131 ? -19.387 -4.576  6.798   1.00 0.00 ? 138 VAL A CG1    2  
ATOM   5894   C  CG2    . VAL A 1 131 ? -21.004 -2.679  7.028   1.00 0.00 ? 138 VAL A CG2    2  
ATOM   5895   H  H      . VAL A 1 131 ? -20.547 -6.755  7.760   1.00 0.00 ? 138 VAL A H      2  
ATOM   5896   H  HA     . VAL A 1 131 ? -22.456 -4.609  8.378   1.00 0.00 ? 138 VAL A HA     2  
ATOM   5897   H  HB     . VAL A 1 131 ? -20.189 -3.826  8.613   1.00 0.00 ? 138 VAL A HB     2  
ATOM   5898   H  HG11   . VAL A 1 131 ? -19.012 -5.469  7.278   1.00 0.00 ? 138 VAL A HG11   2  
ATOM   5899   H  HG12   . VAL A 1 131 ? -18.596 -3.844  6.733   1.00 0.00 ? 138 VAL A HG12   2  
ATOM   5900   H  HG13   . VAL A 1 131 ? -19.732 -4.820  5.804   1.00 0.00 ? 138 VAL A HG13   2  
ATOM   5901   H  HG21   . VAL A 1 131 ? -21.412 -2.842  6.043   1.00 0.00 ? 138 VAL A HG21   2  
ATOM   5902   H  HG22   . VAL A 1 131 ? -20.162 -2.004  6.962   1.00 0.00 ? 138 VAL A HG22   2  
ATOM   5903   H  HG23   . VAL A 1 131 ? -21.764 -2.249  7.666   1.00 0.00 ? 138 VAL A HG23   2  
ATOM   5904   N  N      . PRO A 1 132 ? -23.619 -4.640  6.178   1.00 0.00 ? 139 PRO A N      2  
ATOM   5905   C  CA     . PRO A 1 132 ? -24.310 -4.611  4.893   1.00 0.00 ? 139 PRO A CA     2  
ATOM   5906   C  C      . PRO A 1 132 ? -23.485 -3.864  3.853   1.00 0.00 ? 139 PRO A C      2  
ATOM   5907   O  O      . PRO A 1 132 ? -23.262 -2.659  3.971   1.00 0.00 ? 139 PRO A O      2  
ATOM   5908   C  CB     . PRO A 1 132 ? -25.614 -3.860  5.193   1.00 0.00 ? 139 PRO A CB     2  
ATOM   5909   C  CG     . PRO A 1 132 ? -25.816 -4.019  6.659   1.00 0.00 ? 139 PRO A CG     2  
ATOM   5910   C  CD     . PRO A 1 132 ? -24.438 -4.068  7.260   1.00 0.00 ? 139 PRO A CD     2  
ATOM   5911   H  HA     . PRO A 1 132 ? -24.532 -5.607  4.536   1.00 0.00 ? 139 PRO A HA     2  
ATOM   5912   H  HB2    . PRO A 1 132 ? -25.505 -2.822  4.918   1.00 0.00 ? 139 PRO A HB2    2  
ATOM   5913   H  HB3    . PRO A 1 132 ? -26.426 -4.304  4.633   1.00 0.00 ? 139 PRO A HB3    2  
ATOM   5914   H  HG2    . PRO A 1 132 ? -26.367 -3.176  7.047   1.00 0.00 ? 139 PRO A HG2    2  
ATOM   5915   H  HG3    . PRO A 1 132 ? -26.343 -4.939  6.860   1.00 0.00 ? 139 PRO A HG3    2  
ATOM   5916   H  HD2    . PRO A 1 132 ? -24.104 -3.072  7.513   1.00 0.00 ? 139 PRO A HD2    2  
ATOM   5917   H  HD3    . PRO A 1 132 ? -24.427 -4.704  8.132   1.00 0.00 ? 139 PRO A HD3    2  
ATOM   5918   N  N      . VAL A 1 133 ? -23.033 -4.583  2.836   1.00 0.00 ? 140 VAL A N      2  
ATOM   5919   C  CA     . VAL A 1 133 ? -22.134 -4.014  1.843   1.00 0.00 ? 140 VAL A CA     2  
ATOM   5920   C  C      . VAL A 1 133 ? -22.875 -2.994  0.983   1.00 0.00 ? 140 VAL A C      2  
ATOM   5921   O  O      . VAL A 1 133 ? -22.266 -2.206  0.260   1.00 0.00 ? 140 VAL A O      2  
ATOM   5922   C  CB     . VAL A 1 133 ? -21.488 -5.112  0.960   1.00 0.00 ? 140 VAL A CB     2  
ATOM   5923   C  CG1    . VAL A 1 133 ? -22.324 -5.432  -0.271  1.00 0.00 ? 140 VAL A CG1    2  
ATOM   5924   C  CG2    . VAL A 1 133 ? -20.082 -4.713  0.563   1.00 0.00 ? 140 VAL A CG2    2  
ATOM   5925   H  H      . VAL A 1 133 ? -23.321 -5.517  2.747   1.00 0.00 ? 140 VAL A H      2  
ATOM   5926   H  HA     . VAL A 1 133 ? -21.345 -3.504  2.374   1.00 0.00 ? 140 VAL A HA     2  
ATOM   5927   H  HB     . VAL A 1 133 ? -21.420 -6.011  1.552   1.00 0.00 ? 140 VAL A HB     2  
ATOM   5928   H  HG11   . VAL A 1 133 ? -23.322 -5.709  0.032   1.00 0.00 ? 140 VAL A HG11   2  
ATOM   5929   H  HG12   . VAL A 1 133 ? -21.869 -6.252  -0.808  1.00 0.00 ? 140 VAL A HG12   2  
ATOM   5930   H  HG13   . VAL A 1 133 ? -22.367 -4.563  -0.913  1.00 0.00 ? 140 VAL A HG13   2  
ATOM   5931   H  HG21   . VAL A 1 133 ? -20.108 -3.768  0.039   1.00 0.00 ? 140 VAL A HG21   2  
ATOM   5932   H  HG22   . VAL A 1 133 ? -19.662 -5.470  -0.081  1.00 0.00 ? 140 VAL A HG22   2  
ATOM   5933   H  HG23   . VAL A 1 133 ? -19.471 -4.616  1.449   1.00 0.00 ? 140 VAL A HG23   2  
ATOM   5934   N  N      . GLU A 1 134 ? -24.197 -3.003  1.099   1.00 0.00 ? 141 GLU A N      2  
ATOM   5935   C  CA     . GLU A 1 134 ? -25.048 -2.045  0.410   1.00 0.00 ? 141 GLU A CA     2  
ATOM   5936   C  C      . GLU A 1 134 ? -24.708 -0.618  0.835   1.00 0.00 ? 141 GLU A C      2  
ATOM   5937   O  O      . GLU A 1 134 ? -24.521 0.262   -0.003  1.00 0.00 ? 141 GLU A O      2  
ATOM   5938   C  CB     . GLU A 1 134 ? -26.516 -2.345  0.710   1.00 0.00 ? 141 GLU A CB     2  
ATOM   5939   C  CG     . GLU A 1 134 ? -26.938 -3.748  0.311   1.00 0.00 ? 141 GLU A CG     2  
ATOM   5940   C  CD     . GLU A 1 134 ? -28.361 -4.060  0.713   1.00 0.00 ? 141 GLU A CD     2  
ATOM   5941   O  OE1    . GLU A 1 134 ? -29.288 -3.595  0.021   1.00 0.00 ? 141 GLU A OE1    2  
ATOM   5942   O  OE2    . GLU A 1 134 ? -28.553 -4.775  1.719   1.00 0.00 ? 141 GLU A OE2    2  
ATOM   5943   H  H      . GLU A 1 134 ? -24.615 -3.684  1.667   1.00 0.00 ? 141 GLU A H      2  
ATOM   5944   H  HA     . GLU A 1 134 ? -24.876 -2.147  -0.651  1.00 0.00 ? 141 GLU A HA     2  
ATOM   5945   H  HB2    . GLU A 1 134 ? -26.687 -2.228  1.771   1.00 0.00 ? 141 GLU A HB2    2  
ATOM   5946   H  HB3    . GLU A 1 134 ? -27.134 -1.640  0.174   1.00 0.00 ? 141 GLU A HB3    2  
ATOM   5947   H  HG2    . GLU A 1 134 ? -26.854 -3.844  -0.761  1.00 0.00 ? 141 GLU A HG2    2  
ATOM   5948   H  HG3    . GLU A 1 134 ? -26.280 -4.459  0.788   1.00 0.00 ? 141 GLU A HG3    2  
ATOM   5949   N  N      . GLU A 1 135 ? -24.604 -0.399  2.141   1.00 0.00 ? 142 GLU A N      2  
ATOM   5950   C  CA     . GLU A 1 135 ? -24.286 0.925   2.656   1.00 0.00 ? 142 GLU A CA     2  
ATOM   5951   C  C      . GLU A 1 135 ? -22.795 1.216   2.500   1.00 0.00 ? 142 GLU A C      2  
ATOM   5952   O  O      . GLU A 1 135 ? -22.374 2.372   2.508   1.00 0.00 ? 142 GLU A O      2  
ATOM   5953   C  CB     . GLU A 1 135 ? -24.731 1.072   4.116   1.00 0.00 ? 142 GLU A CB     2  
ATOM   5954   C  CG     . GLU A 1 135 ? -24.126 0.051   5.065   1.00 0.00 ? 142 GLU A CG     2  
ATOM   5955   C  CD     . GLU A 1 135 ? -24.680 0.171   6.467   1.00 0.00 ? 142 GLU A CD     2  
ATOM   5956   O  OE1    . GLU A 1 135 ? -24.192 1.028   7.228   1.00 0.00 ? 142 GLU A OE1    2  
ATOM   5957   O  OE2    . GLU A 1 135 ? -25.615 -0.583  6.806   1.00 0.00 ? 142 GLU A OE2    2  
ATOM   5958   H  H      . GLU A 1 135 ? -24.738 -1.141  2.769   1.00 0.00 ? 142 GLU A H      2  
ATOM   5959   H  HA     . GLU A 1 135 ? -24.831 1.639   2.057   1.00 0.00 ? 142 GLU A HA     2  
ATOM   5960   H  HB2    . GLU A 1 135 ? -24.455 2.057   4.463   1.00 0.00 ? 142 GLU A HB2    2  
ATOM   5961   H  HB3    . GLU A 1 135 ? -25.809 0.976   4.159   1.00 0.00 ? 142 GLU A HB3    2  
ATOM   5962   H  HG2    . GLU A 1 135 ? -24.340 -0.940  4.694   1.00 0.00 ? 142 GLU A HG2    2  
ATOM   5963   H  HG3    . GLU A 1 135 ? -23.057 0.201   5.100   1.00 0.00 ? 142 GLU A HG3    2  
ATOM   5964   N  N      . ALA A 1 136 ? -22.002 0.163   2.333   1.00 0.00 ? 143 ALA A N      2  
ATOM   5965   C  CA     . ALA A 1 136 ? -20.586 0.320   2.030   1.00 0.00 ? 143 ALA A CA     2  
ATOM   5966   C  C      . ALA A 1 136 ? -20.423 0.898   0.627   1.00 0.00 ? 143 ALA A C      2  
ATOM   5967   O  O      . ALA A 1 136 ? -19.602 1.786   0.397   1.00 0.00 ? 143 ALA A O      2  
ATOM   5968   C  CB     . ALA A 1 136 ? -19.861 -1.011  2.156   1.00 0.00 ? 143 ALA A CB     2  
ATOM   5969   H  H      . ALA A 1 136 ? -22.378 -0.738  2.419   1.00 0.00 ? 143 ALA A H      2  
ATOM   5970   H  HA     . ALA A 1 136 ? -20.162 1.010   2.749   1.00 0.00 ? 143 ALA A HA     2  
ATOM   5971   H  HB1    . ALA A 1 136 ? -20.282 -1.716  1.453   1.00 0.00 ? 143 ALA A HB1    2  
ATOM   5972   H  HB2    . ALA A 1 136 ? -19.976 -1.391  3.161   1.00 0.00 ? 143 ALA A HB2    2  
ATOM   5973   H  HB3    . ALA A 1 136 ? -18.811 -0.873  1.942   1.00 0.00 ? 143 ALA A HB3    2  
ATOM   5974   N  N      . ARG A 1 137 ? -21.230 0.394   -0.303  1.00 0.00 ? 144 ARG A N      2  
ATOM   5975   C  CA     . ARG A 1 137 ? -21.282 0.934   -1.659  1.00 0.00 ? 144 ARG A CA     2  
ATOM   5976   C  C      . ARG A 1 137 ? -21.824 2.355   -1.628  1.00 0.00 ? 144 ARG A C      2  
ATOM   5977   O  O      . ARG A 1 137 ? -21.412 3.212   -2.409  1.00 0.00 ? 144 ARG A O      2  
ATOM   5978   C  CB     . ARG A 1 137 ? -22.174 0.065   -2.549  1.00 0.00 ? 144 ARG A CB     2  
ATOM   5979   C  CG     . ARG A 1 137 ? -21.730 -1.383  -2.628  1.00 0.00 ? 144 ARG A CG     2  
ATOM   5980   C  CD     . ARG A 1 137 ? -22.687 -2.222  -3.456  1.00 0.00 ? 144 ARG A CD     2  
ATOM   5981   N  NE     . ARG A 1 137 ? -22.704 -1.822  -4.863  1.00 0.00 ? 144 ARG A NE     2  
ATOM   5982   C  CZ     . ARG A 1 137 ? -23.552 -2.311  -5.765  1.00 0.00 ? 144 ARG A CZ     2  
ATOM   5983   N  NH1    . ARG A 1 137 ? -24.451 -3.223  -5.412  1.00 0.00 ? 144 ARG A NH1    2  
ATOM   5984   N  NH2    . ARG A 1 137 ? -23.500 -1.894  -7.024  1.00 0.00 ? 144 ARG A NH2    2  
ATOM   5985   H  H      . ARG A 1 137 ? -21.804 -0.369  -0.070  1.00 0.00 ? 144 ARG A H      2  
ATOM   5986   H  HA     . ARG A 1 137 ? -20.279 0.944   -2.059  1.00 0.00 ? 144 ARG A HA     2  
ATOM   5987   H  HB2    . ARG A 1 137 ? -23.182 0.089   -2.162  1.00 0.00 ? 144 ARG A HB2    2  
ATOM   5988   H  HB3    . ARG A 1 137 ? -22.173 0.474   -3.549  1.00 0.00 ? 144 ARG A HB3    2  
ATOM   5989   H  HG2    . ARG A 1 137 ? -20.752 -1.424  -3.080  1.00 0.00 ? 144 ARG A HG2    2  
ATOM   5990   H  HG3    . ARG A 1 137 ? -21.685 -1.789  -1.628  1.00 0.00 ? 144 ARG A HG3    2  
ATOM   5991   H  HD2    . ARG A 1 137 ? -22.382 -3.253  -3.389  1.00 0.00 ? 144 ARG A HD2    2  
ATOM   5992   H  HD3    . ARG A 1 137 ? -23.682 -2.117  -3.049  1.00 0.00 ? 144 ARG A HD3    2  
ATOM   5993   H  HE     . ARG A 1 137 ? -22.037 -1.150  -5.149  1.00 0.00 ? 144 ARG A HE     2  
ATOM   5994   H  HH11   . ARG A 1 137 ? -24.494 -3.551  -4.459  1.00 0.00 ? 144 ARG A HH11   2  
ATOM   5995   H  HH12   . ARG A 1 137 ? -25.101 -3.587  -6.089  1.00 0.00 ? 144 ARG A HH12   2  
ATOM   5996   H  HH21   . ARG A 1 137 ? -22.823 -1.201  -7.305  1.00 0.00 ? 144 ARG A HH21   2  
ATOM   5997   H  HH22   . ARG A 1 137 ? -24.135 -2.276  -7.710  1.00 0.00 ? 144 ARG A HH22   2  
ATOM   5998   N  N      . SER A 1 138 ? -22.754 2.586   -0.712  1.00 0.00 ? 145 SER A N      2  
ATOM   5999   C  CA     . SER A 1 138 ? -23.344 3.902   -0.518  1.00 0.00 ? 145 SER A CA     2  
ATOM   6000   C  C      . SER A 1 138 ? -22.287 4.916   -0.066  1.00 0.00 ? 145 SER A C      2  
ATOM   6001   O  O      . SER A 1 138 ? -22.352 6.093   -0.420  1.00 0.00 ? 145 SER A O      2  
ATOM   6002   C  CB     . SER A 1 138 ? -24.479 3.808   0.506   1.00 0.00 ? 145 SER A CB     2  
ATOM   6003   O  OG     . SER A 1 138 ? -25.202 5.023   0.609   1.00 0.00 ? 145 SER A OG     2  
ATOM   6004   H  H      . SER A 1 138 ? -23.070 1.835   -0.162  1.00 0.00 ? 145 SER A H      2  
ATOM   6005   H  HA     . SER A 1 138 ? -23.752 4.224   -1.465  1.00 0.00 ? 145 SER A HA     2  
ATOM   6006   H  HB2    . SER A 1 138 ? -25.161 3.026   0.207   1.00 0.00 ? 145 SER A HB2    2  
ATOM   6007   H  HB3    . SER A 1 138 ? -24.065 3.571   1.475   1.00 0.00 ? 145 SER A HB3    2  
ATOM   6008   H  HG     . SER A 1 138 ? -25.884 4.926   1.291   1.00 0.00 ? 145 SER A HG     2  
ATOM   6009   N  N      . LYS A 1 139 ? -21.308 4.456   0.709   1.00 0.00 ? 146 LYS A N      2  
ATOM   6010   C  CA     . LYS A 1 139 ? -20.210 5.316   1.144   1.00 0.00 ? 146 LYS A CA     2  
ATOM   6011   C  C      . LYS A 1 139 ? -19.348 5.749   -0.035  1.00 0.00 ? 146 LYS A C      2  
ATOM   6012   O  O      . LYS A 1 139 ? -18.856 6.877   -0.073  1.00 0.00 ? 146 LYS A O      2  
ATOM   6013   C  CB     . LYS A 1 139 ? -19.357 4.620   2.207   1.00 0.00 ? 146 LYS A CB     2  
ATOM   6014   C  CG     . LYS A 1 139 ? -19.947 4.726   3.602   1.00 0.00 ? 146 LYS A CG     2  
ATOM   6015   C  CD     . LYS A 1 139 ? -20.044 6.182   4.027   1.00 0.00 ? 146 LYS A CD     2  
ATOM   6016   C  CE     . LYS A 1 139 ? -20.720 6.338   5.376   1.00 0.00 ? 146 LYS A CE     2  
ATOM   6017   N  NZ     . LYS A 1 139 ? -20.817 7.763   5.780   1.00 0.00 ? 146 LYS A NZ     2  
ATOM   6018   H  H      . LYS A 1 139 ? -21.330 3.522   1.007   1.00 0.00 ? 146 LYS A H      2  
ATOM   6019   H  HA     . LYS A 1 139 ? -20.650 6.200   1.582   1.00 0.00 ? 146 LYS A HA     2  
ATOM   6020   H  HB2    . LYS A 1 139 ? -19.262 3.575   1.953   1.00 0.00 ? 146 LYS A HB2    2  
ATOM   6021   H  HB3    . LYS A 1 139 ? -18.377 5.072   2.219   1.00 0.00 ? 146 LYS A HB3    2  
ATOM   6022   H  HG2    . LYS A 1 139 ? -20.935 4.289   3.601   1.00 0.00 ? 146 LYS A HG2    2  
ATOM   6023   H  HG3    . LYS A 1 139 ? -19.312 4.196   4.299   1.00 0.00 ? 146 LYS A HG3    2  
ATOM   6024   H  HD2    . LYS A 1 139 ? -19.047 6.594   4.087   1.00 0.00 ? 146 LYS A HD2    2  
ATOM   6025   H  HD3    . LYS A 1 139 ? -20.614 6.723   3.284   1.00 0.00 ? 146 LYS A HD3    2  
ATOM   6026   H  HE2    . LYS A 1 139 ? -21.716 5.921   5.315   1.00 0.00 ? 146 LYS A HE2    2  
ATOM   6027   H  HE3    . LYS A 1 139 ? -20.147 5.798   6.117   1.00 0.00 ? 146 LYS A HE3    2  
ATOM   6028   H  HZ1    . LYS A 1 139 ? -19.865 8.158   5.934   1.00 0.00 ? 146 LYS A HZ1    2  
ATOM   6029   H  HZ2    . LYS A 1 139 ? -21.364 7.850   6.662   1.00 0.00 ? 146 LYS A HZ2    2  
ATOM   6030   H  HZ3    . LYS A 1 139 ? -21.293 8.320   5.031   1.00 0.00 ? 146 LYS A HZ3    2  
ATOM   6031   N  N      . ALA A 1 140 ? -19.177 4.857   -1.002  1.00 0.00 ? 147 ALA A N      2  
ATOM   6032   C  CA     . ALA A 1 140 ? -18.478 5.204   -2.228  1.00 0.00 ? 147 ALA A CA     2  
ATOM   6033   C  C      . ALA A 1 140 ? -19.219 6.326   -2.944  1.00 0.00 ? 147 ALA A C      2  
ATOM   6034   O  O      . ALA A 1 140 ? -18.611 7.278   -3.433  1.00 0.00 ? 147 ALA A O      2  
ATOM   6035   C  CB     . ALA A 1 140 ? -18.348 3.987   -3.129  1.00 0.00 ? 147 ALA A CB     2  
ATOM   6036   H  H      . ALA A 1 140 ? -19.525 3.949   -0.887  1.00 0.00 ? 147 ALA A H      2  
ATOM   6037   H  HA     . ALA A 1 140 ? -17.487 5.546   -1.966  1.00 0.00 ? 147 ALA A HA     2  
ATOM   6038   H  HB1    . ALA A 1 140 ? -19.333 3.628   -3.392  1.00 0.00 ? 147 ALA A HB1    2  
ATOM   6039   H  HB2    . ALA A 1 140 ? -17.808 3.210   -2.609  1.00 0.00 ? 147 ALA A HB2    2  
ATOM   6040   H  HB3    . ALA A 1 140 ? -17.814 4.261   -4.026  1.00 0.00 ? 147 ALA A HB3    2  
ATOM   6041   N  N      . GLU A 1 141 ? -20.542 6.212   -2.974  1.00 0.00 ? 148 GLU A N      2  
ATOM   6042   C  CA     . GLU A 1 141 ? -21.396 7.235   -3.560  1.00 0.00 ? 148 GLU A CA     2  
ATOM   6043   C  C      . GLU A 1 141 ? -21.251 8.545   -2.782  1.00 0.00 ? 148 GLU A C      2  
ATOM   6044   O  O      . GLU A 1 141 ? -21.096 9.614   -3.370  1.00 0.00 ? 148 GLU A O      2  
ATOM   6045   C  CB     . GLU A 1 141 ? -22.854 6.762   -3.540  1.00 0.00 ? 148 GLU A CB     2  
ATOM   6046   C  CG     . GLU A 1 141 ? -23.840 7.733   -4.166  1.00 0.00 ? 148 GLU A CG     2  
ATOM   6047   C  CD     . GLU A 1 141 ? -23.595 7.940   -5.643  1.00 0.00 ? 148 GLU A CD     2  
ATOM   6048   O  OE1    . GLU A 1 141 ? -23.858 7.006   -6.426  1.00 0.00 ? 148 GLU A OE1    2  
ATOM   6049   O  OE2    . GLU A 1 141 ? -23.154 9.040   -6.026  1.00 0.00 ? 148 GLU A OE2    2  
ATOM   6050   H  H      . GLU A 1 141 ? -20.957 5.411   -2.588  1.00 0.00 ? 148 GLU A H      2  
ATOM   6051   H  HA     . GLU A 1 141 ? -21.083 7.390   -4.582  1.00 0.00 ? 148 GLU A HA     2  
ATOM   6052   H  HB2    . GLU A 1 141 ? -22.920 5.827   -4.074  1.00 0.00 ? 148 GLU A HB2    2  
ATOM   6053   H  HB3    . GLU A 1 141 ? -23.148 6.597   -2.515  1.00 0.00 ? 148 GLU A HB3    2  
ATOM   6054   H  HG2    . GLU A 1 141 ? -24.839 7.346   -4.035  1.00 0.00 ? 148 GLU A HG2    2  
ATOM   6055   H  HG3    . GLU A 1 141 ? -23.755 8.686   -3.664  1.00 0.00 ? 148 GLU A HG3    2  
ATOM   6056   N  N      . GLU A 1 142 ? -21.267 8.431   -1.456  1.00 0.00 ? 149 GLU A N      2  
ATOM   6057   C  CA     . GLU A 1 142 ? -21.181 9.584   -0.562  1.00 0.00 ? 149 GLU A CA     2  
ATOM   6058   C  C      . GLU A 1 142 ? -19.900 10.381  -0.802  1.00 0.00 ? 149 GLU A C      2  
ATOM   6059   O  O      . GLU A 1 142 ? -19.915 11.613  -0.815  1.00 0.00 ? 149 GLU A O      2  
ATOM   6060   C  CB     . GLU A 1 142 ? -21.237 9.111   0.902   1.00 0.00 ? 149 GLU A CB     2  
ATOM   6061   C  CG     . GLU A 1 142 ? -21.257 10.242  1.925   1.00 0.00 ? 149 GLU A CG     2  
ATOM   6062   C  CD     . GLU A 1 142 ? -21.099 9.753   3.353   1.00 0.00 ? 149 GLU A CD     2  
ATOM   6063   O  OE1    . GLU A 1 142 ? -22.072 9.214   3.918   1.00 0.00 ? 149 GLU A OE1    2  
ATOM   6064   O  OE2    . GLU A 1 142 ? -20.002 9.913   3.927   1.00 0.00 ? 149 GLU A OE2    2  
ATOM   6065   H  H      . GLU A 1 142 ? -21.348 7.535   -1.061  1.00 0.00 ? 149 GLU A H      2  
ATOM   6066   H  HA     . GLU A 1 142 ? -22.031 10.220  -0.759  1.00 0.00 ? 149 GLU A HA     2  
ATOM   6067   H  HB2    . GLU A 1 142 ? -22.131 8.520   1.040   1.00 0.00 ? 149 GLU A HB2    2  
ATOM   6068   H  HB3    . GLU A 1 142 ? -20.375 8.489   1.101   1.00 0.00 ? 149 GLU A HB3    2  
ATOM   6069   H  HG2    . GLU A 1 142 ? -20.448 10.922  1.706   1.00 0.00 ? 149 GLU A HG2    2  
ATOM   6070   H  HG3    . GLU A 1 142 ? -22.197 10.766  1.842   1.00 0.00 ? 149 GLU A HG3    2  
ATOM   6071   N  N      . TRP A 1 143 ? -18.794 9.675   -1.003  1.00 0.00 ? 150 TRP A N      2  
ATOM   6072   C  CA     . TRP A 1 143 ? -17.490 10.321  -1.129  1.00 0.00 ? 150 TRP A CA     2  
ATOM   6073   C  C      . TRP A 1 143 ? -17.161 10.644  -2.585  1.00 0.00 ? 150 TRP A C      2  
ATOM   6074   O  O      . TRP A 1 143 ? -16.235 11.405  -2.864  1.00 0.00 ? 150 TRP A O      2  
ATOM   6075   C  CB     . TRP A 1 143 ? -16.397 9.433   -0.525  1.00 0.00 ? 150 TRP A CB     2  
ATOM   6076   C  CG     . TRP A 1 143 ? -16.629 9.104   0.925   1.00 0.00 ? 150 TRP A CG     2  
ATOM   6077   C  CD1    . TRP A 1 143 ? -17.609 9.608   1.726   1.00 0.00 ? 150 TRP A CD1    2  
ATOM   6078   C  CD2    . TRP A 1 143 ? -15.869 8.204   1.743   1.00 0.00 ? 150 TRP A CD2    2  
ATOM   6079   N  NE1    . TRP A 1 143 ? -17.520 9.071   2.983   1.00 0.00 ? 150 TRP A NE1    2  
ATOM   6080   C  CE2    . TRP A 1 143 ? -16.457 8.209   3.025   1.00 0.00 ? 150 TRP A CE2    2  
ATOM   6081   C  CE3    . TRP A 1 143 ? -14.753 7.392   1.518   1.00 0.00 ? 150 TRP A CE3    2  
ATOM   6082   C  CZ2    . TRP A 1 143 ? -15.967 7.431   4.074   1.00 0.00 ? 150 TRP A CZ2    2  
ATOM   6083   C  CZ3    . TRP A 1 143 ? -14.265 6.624   2.559   1.00 0.00 ? 150 TRP A CZ3    2  
ATOM   6084   C  CH2    . TRP A 1 143 ? -14.872 6.648   3.823   1.00 0.00 ? 150 TRP A CH2    2  
ATOM   6085   H  H      . TRP A 1 143 ? -18.852 8.696   -1.046  1.00 0.00 ? 150 TRP A H      2  
ATOM   6086   H  HA     . TRP A 1 143 ? -17.531 11.246  -0.574  1.00 0.00 ? 150 TRP A HA     2  
ATOM   6087   H  HB2    . TRP A 1 143 ? -16.353 8.505   -1.074  1.00 0.00 ? 150 TRP A HB2    2  
ATOM   6088   H  HB3    . TRP A 1 143 ? -15.448 9.941   -0.606  1.00 0.00 ? 150 TRP A HB3    2  
ATOM   6089   H  HD1    . TRP A 1 143 ? -18.350 10.321  1.397   1.00 0.00 ? 150 TRP A HD1    2  
ATOM   6090   H  HE1    . TRP A 1 143 ? -18.129 9.275   3.733   1.00 0.00 ? 150 TRP A HE1    2  
ATOM   6091   H  HE3    . TRP A 1 143 ? -14.270 7.361   0.554   1.00 0.00 ? 150 TRP A HE3    2  
ATOM   6092   H  HZ2    . TRP A 1 143 ? -16.421 7.438   5.055   1.00 0.00 ? 150 TRP A HZ2    2  
ATOM   6093   H  HZ3    . TRP A 1 143 ? -13.402 5.993   2.402   1.00 0.00 ? 150 TRP A HZ3    2  
ATOM   6094   H  HH2    . TRP A 1 143 ? -14.454 6.030   4.606   1.00 0.00 ? 150 TRP A HH2    2  
ATOM   6095   N  N      . GLY A 1 144 ? -17.918 10.064  -3.503  1.00 0.00 ? 151 GLY A N      2  
ATOM   6096   C  CA     . GLY A 1 144 ? -17.691 10.309  -4.915  1.00 0.00 ? 151 GLY A CA     2  
ATOM   6097   C  C      . GLY A 1 144 ? -16.603 9.419   -5.486  1.00 0.00 ? 151 GLY A C      2  
ATOM   6098   O  O      . GLY A 1 144 ? -15.851 9.833   -6.368  1.00 0.00 ? 151 GLY A O      2  
ATOM   6099   H  H      . GLY A 1 144 ? -18.641 9.462   -3.221  1.00 0.00 ? 151 GLY A H      2  
ATOM   6100   H  HA2    . GLY A 1 144 ? -18.611 10.131  -5.453  1.00 0.00 ? 151 GLY A HA2    2  
ATOM   6101   H  HA3    . GLY A 1 144 ? -17.404 11.342  -5.048  1.00 0.00 ? 151 GLY A HA3    2  
ATOM   6102   N  N      . VAL A 1 145 ? -16.524 8.195   -4.978  1.00 0.00 ? 152 VAL A N      2  
ATOM   6103   C  CA     . VAL A 1 145 ? -15.508 7.238   -5.407  1.00 0.00 ? 152 VAL A CA     2  
ATOM   6104   C  C      . VAL A 1 145 ? -16.143 5.934   -5.850  1.00 0.00 ? 152 VAL A C      2  
ATOM   6105   O  O      . VAL A 1 145 ? -17.360 5.854   -6.014  1.00 0.00 ? 152 VAL A O      2  
ATOM   6106   C  CB     . VAL A 1 145 ? -14.493 6.938   -4.286  1.00 0.00 ? 152 VAL A CB     2  
ATOM   6107   C  CG1    . VAL A 1 145 ? -13.610 8.141   -4.048  1.00 0.00 ? 152 VAL A CG1    2  
ATOM   6108   C  CG2    . VAL A 1 145 ? -15.198 6.526   -2.999  1.00 0.00 ? 152 VAL A CG2    2  
ATOM   6109   H  H      . VAL A 1 145 ? -17.180 7.918   -4.300  1.00 0.00 ? 152 VAL A H      2  
ATOM   6110   H  HA     . VAL A 1 145 ? -14.973 7.669   -6.241  1.00 0.00 ? 152 VAL A HA     2  
ATOM   6111   H  HB     . VAL A 1 145 ? -13.867 6.119   -4.606  1.00 0.00 ? 152 VAL A HB     2  
ATOM   6112   H  HG11   . VAL A 1 145 ? -12.919 7.923   -3.251  1.00 0.00 ? 152 VAL A HG11   2  
ATOM   6113   H  HG12   . VAL A 1 145 ? -14.222 8.987   -3.779  1.00 0.00 ? 152 VAL A HG12   2  
ATOM   6114   H  HG13   . VAL A 1 145 ? -13.062 8.363   -4.950  1.00 0.00 ? 152 VAL A HG13   2  
ATOM   6115   H  HG21   . VAL A 1 145 ? -14.461 6.341   -2.230  1.00 0.00 ? 152 VAL A HG21   2  
ATOM   6116   H  HG22   . VAL A 1 145 ? -15.772 5.625   -3.170  1.00 0.00 ? 152 VAL A HG22   2  
ATOM   6117   H  HG23   . VAL A 1 145 ? -15.860 7.317   -2.678  1.00 0.00 ? 152 VAL A HG23   2  
ATOM   6118   N  N      . GLN A 1 146 ? -15.325 4.909   -6.038  1.00 0.00 ? 153 GLN A N      2  
ATOM   6119   C  CA     . GLN A 1 146 ? -15.832 3.622   -6.444  1.00 0.00 ? 153 GLN A CA     2  
ATOM   6120   C  C      . GLN A 1 146 ? -15.652 2.603   -5.331  1.00 0.00 ? 153 GLN A C      2  
ATOM   6121   O  O      . GLN A 1 146 ? -14.818 2.784   -4.442  1.00 0.00 ? 153 GLN A O      2  
ATOM   6122   C  CB     . GLN A 1 146 ? -15.163 3.122   -7.739  1.00 0.00 ? 153 GLN A CB     2  
ATOM   6123   C  CG     . GLN A 1 146 ? -13.643 3.166   -7.731  1.00 0.00 ? 153 GLN A CG     2  
ATOM   6124   C  CD     . GLN A 1 146 ? -13.092 4.567   -7.905  1.00 0.00 ? 153 GLN A CD     2  
ATOM   6125   O  OE1    . GLN A 1 146 ? -13.707 5.410   -8.554  1.00 0.00 ? 153 GLN A OE1    2  
ATOM   6126   N  NE2    . GLN A 1 146 ? -11.932 4.821   -7.328  1.00 0.00 ? 153 GLN A NE2    2  
ATOM   6127   H  H      . GLN A 1 146 ? -14.360 5.019   -5.884  1.00 0.00 ? 153 GLN A H      2  
ATOM   6128   H  HA     . GLN A 1 146 ? -16.884 3.753   -6.621  1.00 0.00 ? 153 GLN A HA     2  
ATOM   6129   H  HB2    . GLN A 1 146 ? -15.462 2.097   -7.906  1.00 0.00 ? 153 GLN A HB2    2  
ATOM   6130   H  HB3    . GLN A 1 146 ? -15.512 3.725   -8.562  1.00 0.00 ? 153 GLN A HB3    2  
ATOM   6131   H  HG2    . GLN A 1 146 ? -13.295 2.778   -6.789  1.00 0.00 ? 153 GLN A HG2    2  
ATOM   6132   H  HG3    . GLN A 1 146 ? -13.271 2.546   -8.532  1.00 0.00 ? 153 GLN A HG3    2  
ATOM   6133   H  HE21   . GLN A 1 146 ? -11.493 4.103   -6.832  1.00 0.00 ? 153 GLN A HE21   2  
ATOM   6134   H  HE22   . GLN A 1 146 ? -11.559 5.740   -7.410  1.00 0.00 ? 153 GLN A HE22   2  
ATOM   6135   N  N      . TYR A 1 147 ? -16.455 1.552   -5.365  1.00 0.00 ? 154 TYR A N      2  
ATOM   6136   C  CA     . TYR A 1 147 ? -16.314 0.451   -4.427  1.00 0.00 ? 154 TYR A CA     2  
ATOM   6137   C  C      . TYR A 1 147 ? -16.148 -0.846  -5.195  1.00 0.00 ? 154 TYR A C      2  
ATOM   6138   O  O      . TYR A 1 147 ? -16.967 -1.174  -6.052  1.00 0.00 ? 154 TYR A O      2  
ATOM   6139   C  CB     . TYR A 1 147 ? -17.530 0.360   -3.501  1.00 0.00 ? 154 TYR A CB     2  
ATOM   6140   C  CG     . TYR A 1 147 ? -17.432 -0.760  -2.494  1.00 0.00 ? 154 TYR A CG     2  
ATOM   6141   C  CD1    . TYR A 1 147 ? -16.514 -0.700  -1.458  1.00 0.00 ? 154 TYR A CD1    2  
ATOM   6142   C  CD2    . TYR A 1 147 ? -18.249 -1.882  -2.585  1.00 0.00 ? 154 TYR A CD2    2  
ATOM   6143   C  CE1    . TYR A 1 147 ? -16.408 -1.721  -0.538  1.00 0.00 ? 154 TYR A CE1    2  
ATOM   6144   C  CE2    . TYR A 1 147 ? -18.148 -2.909  -1.669  1.00 0.00 ? 154 TYR A CE2    2  
ATOM   6145   C  CZ     . TYR A 1 147 ? -17.223 -2.822  -0.648  1.00 0.00 ? 154 TYR A CZ     2  
ATOM   6146   O  OH     . TYR A 1 147 ? -17.111 -3.842  0.262   1.00 0.00 ? 154 TYR A OH     2  
ATOM   6147   H  H      . TYR A 1 147 ? -17.165 1.513   -6.044  1.00 0.00 ? 154 TYR A H      2  
ATOM   6148   H  HA     . TYR A 1 147 ? -15.427 0.625   -3.835  1.00 0.00 ? 154 TYR A HA     2  
ATOM   6149   H  HB2    . TYR A 1 147 ? -17.632 1.287   -2.958  1.00 0.00 ? 154 TYR A HB2    2  
ATOM   6150   H  HB3    . TYR A 1 147 ? -18.416 0.195   -4.097  1.00 0.00 ? 154 TYR A HB3    2  
ATOM   6151   H  HD1    . TYR A 1 147 ? -15.874 0.165   -1.375  1.00 0.00 ? 154 TYR A HD1    2  
ATOM   6152   H  HD2    . TYR A 1 147 ? -18.969 -1.944  -3.387  1.00 0.00 ? 154 TYR A HD2    2  
ATOM   6153   H  HE1    . TYR A 1 147 ? -15.684 -1.654  0.260   1.00 0.00 ? 154 TYR A HE1    2  
ATOM   6154   H  HE2    . TYR A 1 147 ? -18.794 -3.774  -1.750  1.00 0.00 ? 154 TYR A HE2    2  
ATOM   6155   H  HH     . TYR A 1 147 ? -17.003 -4.685  -0.217  1.00 0.00 ? 154 TYR A HH     2  
ATOM   6156   N  N      . VAL A 1 148 ? -15.085 -1.575  -4.902  1.00 0.00 ? 155 VAL A N      2  
ATOM   6157   C  CA     . VAL A 1 148 ? -14.787 -2.798  -5.627  1.00 0.00 ? 155 VAL A CA     2  
ATOM   6158   C  C      . VAL A 1 148 ? -14.626 -3.970  -4.665  1.00 0.00 ? 155 VAL A C      2  
ATOM   6159   O  O      . VAL A 1 148 ? -13.877 -3.889  -3.690  1.00 0.00 ? 155 VAL A O      2  
ATOM   6160   C  CB     . VAL A 1 148 ? -13.504 -2.653  -6.483  1.00 0.00 ? 155 VAL A CB     2  
ATOM   6161   C  CG1    . VAL A 1 148 ? -13.265 -3.910  -7.311  1.00 0.00 ? 155 VAL A CG1    2  
ATOM   6162   C  CG2    . VAL A 1 148 ? -13.588 -1.427  -7.387  1.00 0.00 ? 155 VAL A CG2    2  
ATOM   6163   H  H      . VAL A 1 148 ? -14.494 -1.294  -4.170  1.00 0.00 ? 155 VAL A H      2  
ATOM   6164   H  HA     . VAL A 1 148 ? -15.614 -3.001  -6.291  1.00 0.00 ? 155 VAL A HA     2  
ATOM   6165   H  HB     . VAL A 1 148 ? -12.662 -2.526  -5.817  1.00 0.00 ? 155 VAL A HB     2  
ATOM   6166   H  HG11   . VAL A 1 148 ? -14.100 -4.064  -7.978  1.00 0.00 ? 155 VAL A HG11   2  
ATOM   6167   H  HG12   . VAL A 1 148 ? -13.169 -4.762  -6.655  1.00 0.00 ? 155 VAL A HG12   2  
ATOM   6168   H  HG13   . VAL A 1 148 ? -12.360 -3.793  -7.888  1.00 0.00 ? 155 VAL A HG13   2  
ATOM   6169   H  HG21   . VAL A 1 148 ? -13.738 -0.542  -6.784  1.00 0.00 ? 155 VAL A HG21   2  
ATOM   6170   H  HG22   . VAL A 1 148 ? -14.416 -1.540  -8.072  1.00 0.00 ? 155 VAL A HG22   2  
ATOM   6171   H  HG23   . VAL A 1 148 ? -12.672 -1.329  -7.948  1.00 0.00 ? 155 VAL A HG23   2  
ATOM   6172   N  N      . GLU A 1 149 ? -15.343 -5.047  -4.944  1.00 0.00 ? 156 GLU A N      2  
ATOM   6173   C  CA     . GLU A 1 149 ? -15.235 -6.269  -4.164  1.00 0.00 ? 156 GLU A CA     2  
ATOM   6174   C  C      . GLU A 1 149 ? -14.094 -7.119  -4.704  1.00 0.00 ? 156 GLU A C      2  
ATOM   6175   O  O      . GLU A 1 149 ? -13.961 -7.282  -5.916  1.00 0.00 ? 156 GLU A O      2  
ATOM   6176   C  CB     . GLU A 1 149 ? -16.546 -7.060  -4.226  1.00 0.00 ? 156 GLU A CB     2  
ATOM   6177   C  CG     . GLU A 1 149 ? -17.693 -6.419  -3.462  1.00 0.00 ? 156 GLU A CG     2  
ATOM   6178   C  CD     . GLU A 1 149 ? -17.560 -6.590  -1.962  1.00 0.00 ? 156 GLU A CD     2  
ATOM   6179   O  OE1    . GLU A 1 149 ? -16.726 -5.893  -1.352  1.00 0.00 ? 156 GLU A OE1    2  
ATOM   6180   O  OE2    . GLU A 1 149 ? -18.288 -7.430  -1.396  1.00 0.00 ? 156 GLU A OE2    2  
ATOM   6181   H  H      . GLU A 1 149 ? -15.958 -5.024  -5.712  1.00 0.00 ? 156 GLU A H      2  
ATOM   6182   H  HA     . GLU A 1 149 ? -15.026 -6.001  -3.140  1.00 0.00 ? 156 GLU A HA     2  
ATOM   6183   H  HB2    . GLU A 1 149 ? -16.842 -7.158  -5.260  1.00 0.00 ? 156 GLU A HB2    2  
ATOM   6184   H  HB3    . GLU A 1 149 ? -16.377 -8.046  -3.818  1.00 0.00 ? 156 GLU A HB3    2  
ATOM   6185   H  HG2    . GLU A 1 149 ? -17.714 -5.364  -3.686  1.00 0.00 ? 156 GLU A HG2    2  
ATOM   6186   H  HG3    . GLU A 1 149 ? -18.620 -6.873  -3.780  1.00 0.00 ? 156 GLU A HG3    2  
ATOM   6187   N  N      . THR A 1 150 ? -13.269 -7.649  -3.816  1.00 0.00 ? 157 THR A N      2  
ATOM   6188   C  CA     . THR A 1 150 ? -12.136 -8.463  -4.229  1.00 0.00 ? 157 THR A CA     2  
ATOM   6189   C  C      . THR A 1 150 ? -12.140 -9.817  -3.533  1.00 0.00 ? 157 THR A C      2  
ATOM   6190   O  O      . THR A 1 150 ? -12.359 -9.914  -2.325  1.00 0.00 ? 157 THR A O      2  
ATOM   6191   C  CB     . THR A 1 150 ? -10.791 -7.754  -3.956  1.00 0.00 ? 157 THR A CB     2  
ATOM   6192   O  OG1    . THR A 1 150 ? -10.727 -7.316  -2.593  1.00 0.00 ? 157 THR A OG1    2  
ATOM   6193   C  CG2    . THR A 1 150 ? -10.599 -6.566  -4.885  1.00 0.00 ? 157 THR A CG2    2  
ATOM   6194   H  H      . THR A 1 150 ? -13.425 -7.491  -2.857  1.00 0.00 ? 157 THR A H      2  
ATOM   6195   H  HA     . THR A 1 150 ? -12.219 -8.627  -5.295  1.00 0.00 ? 157 THR A HA     2  
ATOM   6196   H  HB     . THR A 1 150 ? -9.991  -8.458  -4.133  1.00 0.00 ? 157 THR A HB     2  
ATOM   6197   H  HG1    . THR A 1 150 ? -11.619 -7.109  -2.279  1.00 0.00 ? 157 THR A HG1    2  
ATOM   6198   H  HG21   . THR A 1 150 ? -9.662  -6.080  -4.659  1.00 0.00 ? 157 THR A HG21   2  
ATOM   6199   H  HG22   . THR A 1 150 ? -11.410 -5.867  -4.747  1.00 0.00 ? 157 THR A HG22   2  
ATOM   6200   H  HG23   . THR A 1 150 ? -10.589 -6.908  -5.910  1.00 0.00 ? 157 THR A HG23   2  
ATOM   6201   N  N      . SER A 1 151 ? -11.898 -10.859 -4.306  1.00 0.00 ? 158 SER A N      2  
ATOM   6202   C  CA     . SER A 1 151 ? -11.823 -12.202 -3.775  1.00 0.00 ? 158 SER A CA     2  
ATOM   6203   C  C      . SER A 1 151 ? -10.394 -12.718 -3.907  1.00 0.00 ? 158 SER A C      2  
ATOM   6204   O  O      . SER A 1 151 ? -9.985  -13.167 -4.974  1.00 0.00 ? 158 SER A O      2  
ATOM   6205   C  CB     . SER A 1 151 ? -12.805 -13.103 -4.522  1.00 0.00 ? 158 SER A CB     2  
ATOM   6206   O  OG     . SER A 1 151 ? -14.115 -12.559 -4.483  1.00 0.00 ? 158 SER A OG     2  
ATOM   6207   H  H      . SER A 1 151 ? -11.761 -10.719 -5.270  1.00 0.00 ? 158 SER A H      2  
ATOM   6208   H  HA     . SER A 1 151 ? -12.093 -12.168 -2.729  1.00 0.00 ? 158 SER A HA     2  
ATOM   6209   H  HB2    . SER A 1 151 ? -12.493 -13.196 -5.551  1.00 0.00 ? 158 SER A HB2    2  
ATOM   6210   H  HB3    . SER A 1 151 ? -12.820 -14.078 -4.058  1.00 0.00 ? 158 SER A HB3    2  
ATOM   6211   H  HG     . SER A 1 151 ? -14.274 -12.171 -3.610  1.00 0.00 ? 158 SER A HG     2  
ATOM   6212   N  N      . ALA A 1 152 ? -9.628  -12.620 -2.827  1.00 0.00 ? 159 ALA A N      2  
ATOM   6213   C  CA     . ALA A 1 152 ? -8.209  -12.959 -2.865  1.00 0.00 ? 159 ALA A CA     2  
ATOM   6214   C  C      . ALA A 1 152 ? -7.983  -14.465 -2.942  1.00 0.00 ? 159 ALA A C      2  
ATOM   6215   O  O      . ALA A 1 152 ? -6.982  -14.917 -3.494  1.00 0.00 ? 159 ALA A O      2  
ATOM   6216   C  CB     . ALA A 1 152 ? -7.497  -12.375 -1.654  1.00 0.00 ? 159 ALA A CB     2  
ATOM   6217   H  H      . ALA A 1 152 ? -10.026 -12.311 -1.986  1.00 0.00 ? 159 ALA A H      2  
ATOM   6218   H  HA     . ALA A 1 152 ? -7.787  -12.502 -3.747  1.00 0.00 ? 159 ALA A HA     2  
ATOM   6219   H  HB1    . ALA A 1 152 ? -7.660  -11.308 -1.622  1.00 0.00 ? 159 ALA A HB1    2  
ATOM   6220   H  HB2    . ALA A 1 152 ? -6.438  -12.577 -1.728  1.00 0.00 ? 159 ALA A HB2    2  
ATOM   6221   H  HB3    . ALA A 1 152 ? -7.888  -12.827 -0.754  1.00 0.00 ? 159 ALA A HB3    2  
ATOM   6222   N  N      . LYS A 1 153 ? -8.917  -15.239 -2.401  1.00 0.00 ? 160 LYS A N      2  
ATOM   6223   C  CA     . LYS A 1 153 ? -8.796  -16.694 -2.407  1.00 0.00 ? 160 LYS A CA     2  
ATOM   6224   C  C      . LYS A 1 153 ? -8.885  -17.229 -3.831  1.00 0.00 ? 160 LYS A C      2  
ATOM   6225   O  O      . LYS A 1 153 ? -8.084  -18.067 -4.243  1.00 0.00 ? 160 LYS A O      2  
ATOM   6226   C  CB     . LYS A 1 153 ? -9.886  -17.327 -1.542  1.00 0.00 ? 160 LYS A CB     2  
ATOM   6227   C  CG     . LYS A 1 153 ? -9.805  -18.846 -1.453  1.00 0.00 ? 160 LYS A CG     2  
ATOM   6228   C  CD     . LYS A 1 153 ? -8.652  -19.299 -0.569  1.00 0.00 ? 160 LYS A CD     2  
ATOM   6229   C  CE     . LYS A 1 153 ? -8.869  -18.882 0.880   1.00 0.00 ? 160 LYS A CE     2  
ATOM   6230   N  NZ     . LYS A 1 153 ? -10.133 -19.434 1.438   1.00 0.00 ? 160 LYS A NZ     2  
ATOM   6231   H  H      . LYS A 1 153 ? -9.709  -14.826 -1.996  1.00 0.00 ? 160 LYS A H      2  
ATOM   6232   H  HA     . LYS A 1 153 ? -7.827  -16.948 -1.999  1.00 0.00 ? 160 LYS A HA     2  
ATOM   6233   H  HB2    . LYS A 1 153 ? -9.808  -16.929 -0.541  1.00 0.00 ? 160 LYS A HB2    2  
ATOM   6234   H  HB3    . LYS A 1 153 ? -10.852 -17.062 -1.949  1.00 0.00 ? 160 LYS A HB3    2  
ATOM   6235   H  HG2    . LYS A 1 153 ? -10.728 -19.223 -1.041  1.00 0.00 ? 160 LYS A HG2    2  
ATOM   6236   H  HG3    . LYS A 1 153 ? -9.663  -19.246 -2.447  1.00 0.00 ? 160 LYS A HG3    2  
ATOM   6237   H  HD2    . LYS A 1 153 ? -8.572  -20.376 -0.616  1.00 0.00 ? 160 LYS A HD2    2  
ATOM   6238   H  HD3    . LYS A 1 153 ? -7.737  -18.852 -0.932  1.00 0.00 ? 160 LYS A HD3    2  
ATOM   6239   H  HE2    . LYS A 1 153 ? -8.039  -19.234 1.472   1.00 0.00 ? 160 LYS A HE2    2  
ATOM   6240   H  HE3    . LYS A 1 153 ? -8.911  -17.804 0.926   1.00 0.00 ? 160 LYS A HE3    2  
ATOM   6241   H  HZ1    . LYS A 1 153 ? -10.191 -19.248 2.461   1.00 0.00 ? 160 LYS A HZ1    2  
ATOM   6242   H  HZ2    . LYS A 1 153 ? -10.181 -20.463 1.284   1.00 0.00 ? 160 LYS A HZ2    2  
ATOM   6243   H  HZ3    . LYS A 1 153 ? -10.957 -18.986 0.972   1.00 0.00 ? 160 LYS A HZ3    2  
ATOM   6244   N  N      . THR A 1 154 ? -9.852  -16.723 -4.584  1.00 0.00 ? 161 THR A N      2  
ATOM   6245   C  CA     . THR A 1 154 ? -10.048 -17.144 -5.962  1.00 0.00 ? 161 THR A CA     2  
ATOM   6246   C  C      . THR A 1 154 ? -9.202  -16.295 -6.905  1.00 0.00 ? 161 THR A C      2  
ATOM   6247   O  O      . THR A 1 154 ? -9.164  -16.539 -8.114  1.00 0.00 ? 161 THR A O      2  
ATOM   6248   C  CB     . THR A 1 154 ? -11.533 -17.049 -6.356  1.00 0.00 ? 161 THR A CB     2  
ATOM   6249   O  OG1    . THR A 1 154 ? -12.047 -15.754 -6.017  1.00 0.00 ? 161 THR A OG1    2  
ATOM   6250   C  CG2    . THR A 1 154 ? -12.347 -18.122 -5.649  1.00 0.00 ? 161 THR A CG2    2  
ATOM   6251   H  H      . THR A 1 154 ? -10.448 -16.042 -4.207  1.00 0.00 ? 161 THR A H      2  
ATOM   6252   H  HA     . THR A 1 154 ? -9.739  -18.178 -6.044  1.00 0.00 ? 161 THR A HA     2  
ATOM   6253   H  HB     . THR A 1 154 ? -11.620 -17.195 -7.423  1.00 0.00 ? 161 THR A HB     2  
ATOM   6254   H  HG1    . THR A 1 154 ? -12.989 -15.724 -6.209  1.00 0.00 ? 161 THR A HG1    2  
ATOM   6255   H  HG21   . THR A 1 154 ? -12.241 -18.008 -4.579  1.00 0.00 ? 161 THR A HG21   2  
ATOM   6256   H  HG22   . THR A 1 154 ? -11.988 -19.098 -5.944  1.00 0.00 ? 161 THR A HG22   2  
ATOM   6257   H  HG23   . THR A 1 154 ? -13.388 -18.023 -5.921  1.00 0.00 ? 161 THR A HG23   2  
ATOM   6258   N  N      . ARG A 1 155 ? -8.519  -15.305 -6.326  1.00 0.00 ? 162 ARG A N      2  
ATOM   6259   C  CA     . ARG A 1 155 ? -7.645  -14.396 -7.067  1.00 0.00 ? 162 ARG A CA     2  
ATOM   6260   C  C      . ARG A 1 155 ? -8.430  -13.603 -8.113  1.00 0.00 ? 162 ARG A C      2  
ATOM   6261   O  O      . ARG A 1 155 ? -8.026  -13.499 -9.272  1.00 0.00 ? 162 ARG A O      2  
ATOM   6262   C  CB     . ARG A 1 155 ? -6.495  -15.173 -7.721  1.00 0.00 ? 162 ARG A CB     2  
ATOM   6263   C  CG     . ARG A 1 155 ? -5.490  -15.730 -6.723  1.00 0.00 ? 162 ARG A CG     2  
ATOM   6264   C  CD     . ARG A 1 155 ? -4.490  -16.666 -7.387  1.00 0.00 ? 162 ARG A CD     2  
ATOM   6265   N  NE     . ARG A 1 155 ? -5.078  -17.967 -7.712  1.00 0.00 ? 162 ARG A NE     2  
ATOM   6266   C  CZ     . ARG A 1 155 ? -4.494  -18.883 -8.489  1.00 0.00 ? 162 ARG A CZ     2  
ATOM   6267   N  NH1    . ARG A 1 155 ? -3.339  -18.622 -9.083  1.00 0.00 ? 162 ARG A NH1    2  
ATOM   6268   N  NH2    . ARG A 1 155 ? -5.076  -20.061 -8.673  1.00 0.00 ? 162 ARG A NH2    2  
ATOM   6269   H  H      . ARG A 1 155 ? -8.609  -15.184 -5.358  1.00 0.00 ? 162 ARG A H      2  
ATOM   6270   H  HA     . ARG A 1 155 ? -7.228  -13.699 -6.353  1.00 0.00 ? 162 ARG A HA     2  
ATOM   6271   H  HB2    . ARG A 1 155 ? -6.906  -15.999 -8.282  1.00 0.00 ? 162 ARG A HB2    2  
ATOM   6272   H  HB3    . ARG A 1 155 ? -5.971  -14.513 -8.396  1.00 0.00 ? 162 ARG A HB3    2  
ATOM   6273   H  HG2    . ARG A 1 155 ? -4.952  -14.907 -6.276  1.00 0.00 ? 162 ARG A HG2    2  
ATOM   6274   H  HG3    . ARG A 1 155 ? -6.026  -16.272 -5.956  1.00 0.00 ? 162 ARG A HG3    2  
ATOM   6275   H  HD2    . ARG A 1 155 ? -4.133  -16.206 -8.296  1.00 0.00 ? 162 ARG A HD2    2  
ATOM   6276   H  HD3    . ARG A 1 155 ? -3.659  -16.818 -6.713  1.00 0.00 ? 162 ARG A HD3    2  
ATOM   6277   H  HE     . ARG A 1 155 ? -5.952  -18.181 -7.305  1.00 0.00 ? 162 ARG A HE     2  
ATOM   6278   H  HH11   . ARG A 1 155 ? -2.890  -17.729 -8.952  1.00 0.00 ? 162 ARG A HH11   2  
ATOM   6279   H  HH12   . ARG A 1 155 ? -2.907  -19.309 -9.681  1.00 0.00 ? 162 ARG A HH12   2  
ATOM   6280   H  HH21   . ARG A 1 155 ? -5.959  -20.262 -8.232  1.00 0.00 ? 162 ARG A HH21   2  
ATOM   6281   H  HH22   . ARG A 1 155 ? -4.633  -20.766 -9.245  1.00 0.00 ? 162 ARG A HH22   2  
ATOM   6282   N  N      . ALA A 1 156 ? -9.543  -13.020 -7.682  1.00 0.00 ? 163 ALA A N      2  
ATOM   6283   C  CA     . ALA A 1 156 ? -10.418 -12.273 -8.575  1.00 0.00 ? 163 ALA A CA     2  
ATOM   6284   C  C      . ALA A 1 156 ? -10.505 -10.807 -8.176  1.00 0.00 ? 163 ALA A C      2  
ATOM   6285   O  O      . ALA A 1 156 ? -10.562 -10.484 -6.983  1.00 0.00 ? 163 ALA A O      2  
ATOM   6286   C  CB     . ALA A 1 156 ? -11.810 -12.884 -8.579  1.00 0.00 ? 163 ALA A CB     2  
ATOM   6287   H  H      . ALA A 1 156 ? -9.779  -13.085 -6.729  1.00 0.00 ? 163 ALA A H      2  
ATOM   6288   H  HA     . ALA A 1 156 ? -10.017 -12.344 -9.577  1.00 0.00 ? 163 ALA A HA     2  
ATOM   6289   H  HB1    . ALA A 1 156 ? -12.413 -12.397 -9.333  1.00 0.00 ? 163 ALA A HB1    2  
ATOM   6290   H  HB2    . ALA A 1 156 ? -12.265 -12.740 -7.608  1.00 0.00 ? 163 ALA A HB2    2  
ATOM   6291   H  HB3    . ALA A 1 156 ? -11.742 -13.939 -8.796  1.00 0.00 ? 163 ALA A HB3    2  
ATOM   6292   N  N      . ASN A 1 157 ? -10.494 -9.932  -9.183  1.00 0.00 ? 164 ASN A N      2  
ATOM   6293   C  CA     . ASN A 1 157 ? -10.697 -8.489  -8.998  1.00 0.00 ? 164 ASN A CA     2  
ATOM   6294   C  C      . ASN A 1 157 ? -9.513  -7.833  -8.297  1.00 0.00 ? 164 ASN A C      2  
ATOM   6295   O  O      . ASN A 1 157 ? -9.577  -6.661  -7.926  1.00 0.00 ? 164 ASN A O      2  
ATOM   6296   C  CB     . ASN A 1 157 ? -11.986 -8.211  -8.210  1.00 0.00 ? 164 ASN A CB     2  
ATOM   6297   C  CG     . ASN A 1 157 ? -13.248 -8.506  -9.001  1.00 0.00 ? 164 ASN A CG     2  
ATOM   6298   O  OD1    . ASN A 1 157 ? -13.252 -9.325  -9.918  1.00 0.00 ? 164 ASN A OD1    2  
ATOM   6299   N  ND2    . ASN A 1 157 ? -14.339 -7.861  -8.627  1.00 0.00 ? 164 ASN A ND2    2  
ATOM   6300   H  H      . ASN A 1 157 ? -10.340 -10.270 -10.098 1.00 0.00 ? 164 ASN A H      2  
ATOM   6301   H  HA     . ASN A 1 157 ? -10.796 -8.050  -9.980  1.00 0.00 ? 164 ASN A HA     2  
ATOM   6302   H  HB2    . ASN A 1 157 ? -11.994 -8.823  -7.321  1.00 0.00 ? 164 ASN A HB2    2  
ATOM   6303   H  HB3    . ASN A 1 157 ? -12.002 -7.169  -7.922  1.00 0.00 ? 164 ASN A HB3    2  
ATOM   6304   H  HD21   . ASN A 1 157 ? -14.274 -7.241  -7.868  1.00 0.00 ? 164 ASN A HD21   2  
ATOM   6305   H  HD22   . ASN A 1 157 ? -15.176 -8.035  -9.119  1.00 0.00 ? 164 ASN A HD22   2  
ATOM   6306   N  N      . VAL A 1 158 ? -8.420  -8.575  -8.152  1.00 0.00 ? 165 VAL A N      2  
ATOM   6307   C  CA     . VAL A 1 158 ? -7.260  -8.095  -7.408  1.00 0.00 ? 165 VAL A CA     2  
ATOM   6308   C  C      . VAL A 1 158 ? -6.586  -6.930  -8.127  1.00 0.00 ? 165 VAL A C      2  
ATOM   6309   O  O      . VAL A 1 158 ? -6.297  -5.901  -7.522  1.00 0.00 ? 165 VAL A O      2  
ATOM   6310   C  CB     . VAL A 1 158 ? -6.225  -9.219  -7.185  1.00 0.00 ? 165 VAL A CB     2  
ATOM   6311   C  CG1    . VAL A 1 158 ? -5.034  -8.708  -6.384  1.00 0.00 ? 165 VAL A CG1    2  
ATOM   6312   C  CG2    . VAL A 1 158 ? -6.868  -10.408 -6.487  1.00 0.00 ? 165 VAL A CG2    2  
ATOM   6313   H  H      . VAL A 1 158 ? -8.391  -9.463  -8.563  1.00 0.00 ? 165 VAL A H      2  
ATOM   6314   H  HA     . VAL A 1 158 ? -7.607  -7.756  -6.443  1.00 0.00 ? 165 VAL A HA     2  
ATOM   6315   H  HB     . VAL A 1 158 ? -5.866  -9.547  -8.148  1.00 0.00 ? 165 VAL A HB     2  
ATOM   6316   H  HG11   . VAL A 1 158 ? -4.586  -7.870  -6.898  1.00 0.00 ? 165 VAL A HG11   2  
ATOM   6317   H  HG12   . VAL A 1 158 ? -4.304  -9.497  -6.280  1.00 0.00 ? 165 VAL A HG12   2  
ATOM   6318   H  HG13   . VAL A 1 158 ? -5.365  -8.394  -5.404  1.00 0.00 ? 165 VAL A HG13   2  
ATOM   6319   H  HG21   . VAL A 1 158 ? -6.140  -11.199 -6.374  1.00 0.00 ? 165 VAL A HG21   2  
ATOM   6320   H  HG22   . VAL A 1 158 ? -7.699  -10.764 -7.077  1.00 0.00 ? 165 VAL A HG22   2  
ATOM   6321   H  HG23   . VAL A 1 158 ? -7.223  -10.105 -5.513  1.00 0.00 ? 165 VAL A HG23   2  
ATOM   6322   N  N      . ASP A 1 159 ? -6.361  -7.092  -9.422  1.00 0.00 ? 166 ASP A N      2  
ATOM   6323   C  CA     . ASP A 1 159 ? -5.632  -6.099  -10.207 1.00 0.00 ? 166 ASP A CA     2  
ATOM   6324   C  C      . ASP A 1 159 ? -6.424  -4.803  -10.360 1.00 0.00 ? 166 ASP A C      2  
ATOM   6325   O  O      . ASP A 1 159 ? -5.841  -3.721  -10.481 1.00 0.00 ? 166 ASP A O      2  
ATOM   6326   C  CB     . ASP A 1 159 ? -5.308  -6.660  -11.594 1.00 0.00 ? 166 ASP A CB     2  
ATOM   6327   C  CG     . ASP A 1 159 ? -6.555  -6.970  -12.400 1.00 0.00 ? 166 ASP A CG     2  
ATOM   6328   O  OD1    . ASP A 1 159 ? -7.153  -8.044  -12.179 1.00 0.00 ? 166 ASP A OD1    2  
ATOM   6329   O  OD2    . ASP A 1 159 ? -6.944  -6.141  -13.248 1.00 0.00 ? 166 ASP A OD2    2  
ATOM   6330   H  H      . ASP A 1 159 ? -6.694  -7.900  -9.870  1.00 0.00 ? 166 ASP A H      2  
ATOM   6331   H  HA     . ASP A 1 159 ? -4.711  -5.884  -9.693  1.00 0.00 ? 166 ASP A HA     2  
ATOM   6332   H  HB2    . ASP A 1 159 ? -4.722  -5.934  -12.138 1.00 0.00 ? 166 ASP A HB2    2  
ATOM   6333   H  HB3    . ASP A 1 159 ? -4.735  -7.569  -11.484 1.00 0.00 ? 166 ASP A HB3    2  
ATOM   6334   N  N      . LYS A 1 160 ? -7.745  -4.916  -10.333 1.00 0.00 ? 167 LYS A N      2  
ATOM   6335   C  CA     . LYS A 1 160 ? -8.620  -3.788  -10.622 1.00 0.00 ? 167 LYS A CA     2  
ATOM   6336   C  C      . LYS A 1 160 ? -8.402  -2.635  -9.648  1.00 0.00 ? 167 LYS A C      2  
ATOM   6337   O  O      . LYS A 1 160 ? -8.165  -1.500  -10.063 1.00 0.00 ? 167 LYS A O      2  
ATOM   6338   C  CB     . LYS A 1 160 ? -10.083 -4.227  -10.580 1.00 0.00 ? 167 LYS A CB     2  
ATOM   6339   C  CG     . LYS A 1 160 ? -11.046 -3.147  -11.041 1.00 0.00 ? 167 LYS A CG     2  
ATOM   6340   C  CD     . LYS A 1 160 ? -12.482 -3.639  -11.047 1.00 0.00 ? 167 LYS A CD     2  
ATOM   6341   C  CE     . LYS A 1 160 ? -13.408 -2.610  -11.673 1.00 0.00 ? 167 LYS A CE     2  
ATOM   6342   N  NZ     . LYS A 1 160 ? -14.809 -3.101  -11.776 1.00 0.00 ? 167 LYS A NZ     2  
ATOM   6343   H  H      . LYS A 1 160 ? -8.140  -5.785  -10.118 1.00 0.00 ? 167 LYS A H      2  
ATOM   6344   H  HA     . LYS A 1 160 ? -8.390  -3.444  -11.618 1.00 0.00 ? 167 LYS A HA     2  
ATOM   6345   H  HB2    . LYS A 1 160 ? -10.206 -5.090  -11.218 1.00 0.00 ? 167 LYS A HB2    2  
ATOM   6346   H  HB3    . LYS A 1 160 ? -10.337 -4.500  -9.567  1.00 0.00 ? 167 LYS A HB3    2  
ATOM   6347   H  HG2    . LYS A 1 160 ? -10.971 -2.302  -10.373 1.00 0.00 ? 167 LYS A HG2    2  
ATOM   6348   H  HG3    . LYS A 1 160 ? -10.775 -2.840  -12.041 1.00 0.00 ? 167 LYS A HG3    2  
ATOM   6349   H  HD2    . LYS A 1 160 ? -12.537 -4.555  -11.614 1.00 0.00 ? 167 LYS A HD2    2  
ATOM   6350   H  HD3    . LYS A 1 160 ? -12.793 -3.822  -10.030 1.00 0.00 ? 167 LYS A HD3    2  
ATOM   6351   H  HE2    . LYS A 1 160 ? -13.395 -1.716  -11.067 1.00 0.00 ? 167 LYS A HE2    2  
ATOM   6352   H  HE3    . LYS A 1 160 ? -13.043 -2.378  -12.660 1.00 0.00 ? 167 LYS A HE3    2  
ATOM   6353   H  HZ1    . LYS A 1 160 ? -15.334 -2.536  -12.478 1.00 0.00 ? 167 LYS A HZ1    2  
ATOM   6354   H  HZ2    . LYS A 1 160 ? -15.292 -3.012  -10.858 1.00 0.00 ? 167 LYS A HZ2    2  
ATOM   6355   H  HZ3    . LYS A 1 160 ? -14.823 -4.102  -12.071 1.00 0.00 ? 167 LYS A HZ3    2  
ATOM   6356   N  N      . VAL A 1 161 ? -8.464  -2.935  -8.355  1.00 0.00 ? 168 VAL A N      2  
ATOM   6357   C  CA     . VAL A 1 161 ? -8.366  -1.908  -7.324  1.00 0.00 ? 168 VAL A CA     2  
ATOM   6358   C  C      . VAL A 1 161 ? -7.046  -1.146  -7.401  1.00 0.00 ? 168 VAL A C      2  
ATOM   6359   O  O      . VAL A 1 161 ? -6.976  0.023   -7.024  1.00 0.00 ? 168 VAL A O      2  
ATOM   6360   C  CB     . VAL A 1 161 ? -8.545  -2.504  -5.913  1.00 0.00 ? 168 VAL A CB     2  
ATOM   6361   C  CG1    . VAL A 1 161 ? -9.921  -3.132  -5.786  1.00 0.00 ? 168 VAL A CG1    2  
ATOM   6362   C  CG2    . VAL A 1 161 ? -7.463  -3.528  -5.599  1.00 0.00 ? 168 VAL A CG2    2  
ATOM   6363   H  H      . VAL A 1 161 ? -8.582  -3.868  -8.088  1.00 0.00 ? 168 VAL A H      2  
ATOM   6364   H  HA     . VAL A 1 161 ? -9.170  -1.207  -7.492  1.00 0.00 ? 168 VAL A HA     2  
ATOM   6365   H  HB     . VAL A 1 161 ? -8.474  -1.701  -5.192  1.00 0.00 ? 168 VAL A HB     2  
ATOM   6366   H  HG11   . VAL A 1 161 ? -10.678 -2.375  -5.925  1.00 0.00 ? 168 VAL A HG11   2  
ATOM   6367   H  HG12   . VAL A 1 161 ? -10.026 -3.569  -4.803  1.00 0.00 ? 168 VAL A HG12   2  
ATOM   6368   H  HG13   . VAL A 1 161 ? -10.036 -3.899  -6.536  1.00 0.00 ? 168 VAL A HG13   2  
ATOM   6369   H  HG21   . VAL A 1 161 ? -7.587  -3.882  -4.586  1.00 0.00 ? 168 VAL A HG21   2  
ATOM   6370   H  HG22   . VAL A 1 161 ? -6.489  -3.069  -5.704  1.00 0.00 ? 168 VAL A HG22   2  
ATOM   6371   H  HG23   . VAL A 1 161 ? -7.545  -4.360  -6.283  1.00 0.00 ? 168 VAL A HG23   2  
ATOM   6372   N  N      . PHE A 1 162 ? -6.004  -1.801  -7.898  1.00 0.00 ? 169 PHE A N      2  
ATOM   6373   C  CA     . PHE A 1 162 ? -4.722  -1.139  -8.068  1.00 0.00 ? 169 PHE A CA     2  
ATOM   6374   C  C      . PHE A 1 162 ? -4.763  -0.203  -9.267  1.00 0.00 ? 169 PHE A C      2  
ATOM   6375   O  O      . PHE A 1 162 ? -4.550  1.001   -9.130  1.00 0.00 ? 169 PHE A O      2  
ATOM   6376   C  CB     . PHE A 1 162 ? -3.597  -2.162  -8.256  1.00 0.00 ? 169 PHE A CB     2  
ATOM   6377   C  CG     . PHE A 1 162 ? -3.269  -2.947  -7.017  1.00 0.00 ? 169 PHE A CG     2  
ATOM   6378   C  CD1    . PHE A 1 162 ? -2.316  -2.484  -6.127  1.00 0.00 ? 169 PHE A CD1    2  
ATOM   6379   C  CD2    . PHE A 1 162 ? -3.904  -4.149  -6.748  1.00 0.00 ? 169 PHE A CD2    2  
ATOM   6380   C  CE1    . PHE A 1 162 ? -2.002  -3.203  -4.991  1.00 0.00 ? 169 PHE A CE1    2  
ATOM   6381   C  CE2    . PHE A 1 162 ? -3.595  -4.872  -5.612  1.00 0.00 ? 169 PHE A CE2    2  
ATOM   6382   C  CZ     . PHE A 1 162 ? -2.642  -4.398  -4.734  1.00 0.00 ? 169 PHE A CZ     2  
ATOM   6383   H  H      . PHE A 1 162 ? -6.105  -2.739  -8.164  1.00 0.00 ? 169 PHE A H      2  
ATOM   6384   H  HA     . PHE A 1 162 ? -4.527  -0.559  -7.180  1.00 0.00 ? 169 PHE A HA     2  
ATOM   6385   H  HB2    . PHE A 1 162 ? -3.883  -2.863  -9.025  1.00 0.00 ? 169 PHE A HB2    2  
ATOM   6386   H  HB3    . PHE A 1 162 ? -2.702  -1.643  -8.566  1.00 0.00 ? 169 PHE A HB3    2  
ATOM   6387   H  HD1    . PHE A 1 162 ? -1.815  -1.547  -6.326  1.00 0.00 ? 169 PHE A HD1    2  
ATOM   6388   H  HD2    . PHE A 1 162 ? -4.649  -4.520  -7.437  1.00 0.00 ? 169 PHE A HD2    2  
ATOM   6389   H  HE1    . PHE A 1 162 ? -1.256  -2.832  -4.306  1.00 0.00 ? 169 PHE A HE1    2  
ATOM   6390   H  HE2    . PHE A 1 162 ? -4.095  -5.807  -5.413  1.00 0.00 ? 169 PHE A HE2    2  
ATOM   6391   H  HZ     . PHE A 1 162 ? -2.398  -4.963  -3.847  1.00 0.00 ? 169 PHE A HZ     2  
ATOM   6392   N  N      . PHE A 1 163 ? -5.099  -0.754  -10.430 1.00 0.00 ? 170 PHE A N      2  
ATOM   6393   C  CA     . PHE A 1 163 ? -5.055  -0.001  -11.679 1.00 0.00 ? 170 PHE A CA     2  
ATOM   6394   C  C      . PHE A 1 163 ? -6.027  1.178   -11.657 1.00 0.00 ? 170 PHE A C      2  
ATOM   6395   O  O      . PHE A 1 163 ? -5.689  2.270   -12.116 1.00 0.00 ? 170 PHE A O      2  
ATOM   6396   C  CB     . PHE A 1 163 ? -5.359  -0.908  -12.878 1.00 0.00 ? 170 PHE A CB     2  
ATOM   6397   C  CG     . PHE A 1 163 ? -4.263  -1.886  -13.205 1.00 0.00 ? 170 PHE A CG     2  
ATOM   6398   C  CD1    . PHE A 1 163 ? -2.948  -1.461  -13.314 1.00 0.00 ? 170 PHE A CD1    2  
ATOM   6399   C  CD2    . PHE A 1 163 ? -4.547  -3.226  -13.420 1.00 0.00 ? 170 PHE A CD2    2  
ATOM   6400   C  CE1    . PHE A 1 163 ? -1.939  -2.348  -13.631 1.00 0.00 ? 170 PHE A CE1    2  
ATOM   6401   C  CE2    . PHE A 1 163 ? -3.539  -4.120  -13.735 1.00 0.00 ? 170 PHE A CE2    2  
ATOM   6402   C  CZ     . PHE A 1 163 ? -2.233  -3.680  -13.840 1.00 0.00 ? 170 PHE A CZ     2  
ATOM   6403   H  H      . PHE A 1 163 ? -5.388  -1.694  -10.446 1.00 0.00 ? 170 PHE A H      2  
ATOM   6404   H  HA     . PHE A 1 163 ? -4.046  0.389   -11.789 1.00 0.00 ? 170 PHE A HA     2  
ATOM   6405   H  HB2    . PHE A 1 163 ? -6.254  -1.474  -12.670 1.00 0.00 ? 170 PHE A HB2    2  
ATOM   6406   H  HB3    . PHE A 1 163 ? -5.526  -0.291  -13.749 1.00 0.00 ? 170 PHE A HB3    2  
ATOM   6407   H  HD1    . PHE A 1 163 ? -2.715  -0.420  -13.147 1.00 0.00 ? 170 PHE A HD1    2  
ATOM   6408   H  HD2    . PHE A 1 163 ? -5.568  -3.571  -13.338 1.00 0.00 ? 170 PHE A HD2    2  
ATOM   6409   H  HE1    . PHE A 1 163 ? -0.920  -2.001  -13.712 1.00 0.00 ? 170 PHE A HE1    2  
ATOM   6410   H  HE2    . PHE A 1 163 ? -3.774  -5.162  -13.897 1.00 0.00 ? 170 PHE A HE2    2  
ATOM   6411   H  HZ     . PHE A 1 163 ? -1.443  -4.376  -14.088 1.00 0.00 ? 170 PHE A HZ     2  
ATOM   6412   N  N      . ASP A 1 164 ? -7.223  0.963   -11.116 1.00 0.00 ? 171 ASP A N      2  
ATOM   6413   C  CA     . ASP A 1 164 ? -8.230  2.022   -11.043 1.00 0.00 ? 171 ASP A CA     2  
ATOM   6414   C  C      . ASP A 1 164 ? -7.767  3.169   -10.153 1.00 0.00 ? 171 ASP A C      2  
ATOM   6415   O  O      . ASP A 1 164 ? -7.951  4.338   -10.494 1.00 0.00 ? 171 ASP A O      2  
ATOM   6416   C  CB     . ASP A 1 164 ? -9.573  1.481   -10.546 1.00 0.00 ? 171 ASP A CB     2  
ATOM   6417   C  CG     . ASP A 1 164 ? -10.435 0.945   -11.672 1.00 0.00 ? 171 ASP A CG     2  
ATOM   6418   O  OD1    . ASP A 1 164 ? -10.302 -0.245  -12.016 1.00 0.00 ? 171 ASP A OD1    2  
ATOM   6419   O  OD2    . ASP A 1 164 ? -11.256 1.718   -12.213 1.00 0.00 ? 171 ASP A OD2    2  
ATOM   6420   H  H      . ASP A 1 164 ? -7.439  0.069   -10.761 1.00 0.00 ? 171 ASP A H      2  
ATOM   6421   H  HA     . ASP A 1 164 ? -8.366  2.406   -12.046 1.00 0.00 ? 171 ASP A HA     2  
ATOM   6422   H  HB2    . ASP A 1 164 ? -9.393  0.682   -9.843  1.00 0.00 ? 171 ASP A HB2    2  
ATOM   6423   H  HB3    . ASP A 1 164 ? -10.112 2.275   -10.052 1.00 0.00 ? 171 ASP A HB3    2  
ATOM   6424   N  N      . LEU A 1 165 ? -7.150  2.842   -9.020  1.00 0.00 ? 172 LEU A N      2  
ATOM   6425   C  CA     . LEU A 1 165 ? -6.621  3.870   -8.131  1.00 0.00 ? 172 LEU A CA     2  
ATOM   6426   C  C      . LEU A 1 165 ? -5.481  4.609   -8.819  1.00 0.00 ? 172 LEU A C      2  
ATOM   6427   O  O      . LEU A 1 165 ? -5.346  5.830   -8.707  1.00 0.00 ? 172 LEU A O      2  
ATOM   6428   C  CB     . LEU A 1 165 ? -6.122  3.265   -6.818  1.00 0.00 ? 172 LEU A CB     2  
ATOM   6429   C  CG     . LEU A 1 165 ? -5.652  4.290   -5.783  1.00 0.00 ? 172 LEU A CG     2  
ATOM   6430   C  CD1    . LEU A 1 165 ? -6.836  5.073   -5.239  1.00 0.00 ? 172 LEU A CD1    2  
ATOM   6431   C  CD2    . LEU A 1 165 ? -4.887  3.610   -4.658  1.00 0.00 ? 172 LEU A CD2    2  
ATOM   6432   H  H      . LEU A 1 165 ? -7.045  1.896   -8.783  1.00 0.00 ? 172 LEU A H      2  
ATOM   6433   H  HA     . LEU A 1 165 ? -7.417  4.571   -7.920  1.00 0.00 ? 172 LEU A HA     2  
ATOM   6434   H  HB2    . LEU A 1 165 ? -6.927  2.686   -6.384  1.00 0.00 ? 172 LEU A HB2    2  
ATOM   6435   H  HB3    . LEU A 1 165 ? -5.300  2.600   -7.039  1.00 0.00 ? 172 LEU A HB3    2  
ATOM   6436   H  HG     . LEU A 1 165 ? -4.984  4.992   -6.262  1.00 0.00 ? 172 LEU A HG     2  
ATOM   6437   H  HD11   . LEU A 1 165 ? -7.529  4.393   -4.765  1.00 0.00 ? 172 LEU A HD11   2  
ATOM   6438   H  HD12   . LEU A 1 165 ? -7.332  5.582   -6.052  1.00 0.00 ? 172 LEU A HD12   2  
ATOM   6439   H  HD13   . LEU A 1 165 ? -6.490  5.798   -4.517  1.00 0.00 ? 172 LEU A HD13   2  
ATOM   6440   H  HD21   . LEU A 1 165 ? -4.571  4.351   -3.937  1.00 0.00 ? 172 LEU A HD21   2  
ATOM   6441   H  HD22   . LEU A 1 165 ? -4.020  3.110   -5.062  1.00 0.00 ? 172 LEU A HD22   2  
ATOM   6442   H  HD23   . LEU A 1 165 ? -5.526  2.887   -4.172  1.00 0.00 ? 172 LEU A HD23   2  
ATOM   6443   N  N      . MET A 1 166 ? -4.672  3.851   -9.550  1.00 0.00 ? 173 MET A N      2  
ATOM   6444   C  CA     . MET A 1 166 ? -3.555  4.405   -10.307 1.00 0.00 ? 173 MET A CA     2  
ATOM   6445   C  C      . MET A 1 166 ? -4.052  5.398   -11.353 1.00 0.00 ? 173 MET A C      2  
ATOM   6446   O  O      . MET A 1 166 ? -3.362  6.363   -11.686 1.00 0.00 ? 173 MET A O      2  
ATOM   6447   C  CB     . MET A 1 166 ? -2.765  3.275   -10.969 1.00 0.00 ? 173 MET A CB     2  
ATOM   6448   C  CG     . MET A 1 166 ? -2.046  2.377   -9.973  1.00 0.00 ? 173 MET A CG     2  
ATOM   6449   S  SD     . MET A 1 166 ? -1.751  0.717   -10.609 1.00 0.00 ? 173 MET A SD     2  
ATOM   6450   C  CE     . MET A 1 166 ? -0.727  1.057   -12.028 1.00 0.00 ? 173 MET A CE     2  
ATOM   6451   H  H      . MET A 1 166 ? -4.833  2.878   -9.580  1.00 0.00 ? 173 MET A H      2  
ATOM   6452   H  HA     . MET A 1 166 ? -2.910  4.923   -9.613  1.00 0.00 ? 173 MET A HA     2  
ATOM   6453   H  HB2    . MET A 1 166 ? -3.445  2.663   -11.546 1.00 0.00 ? 173 MET A HB2    2  
ATOM   6454   H  HB3    . MET A 1 166 ? -2.029  3.701   -11.631 1.00 0.00 ? 173 MET A HB3    2  
ATOM   6455   H  HG2    . MET A 1 166 ? -1.095  2.825   -9.729  1.00 0.00 ? 173 MET A HG2    2  
ATOM   6456   H  HG3    . MET A 1 166 ? -2.647  2.302   -9.079  1.00 0.00 ? 173 MET A HG3    2  
ATOM   6457   H  HE1    . MET A 1 166 ? 0.174   1.556   -11.703 1.00 0.00 ? 173 MET A HE1    2  
ATOM   6458   H  HE2    . MET A 1 166 ? -1.270  1.687   -12.716 1.00 0.00 ? 173 MET A HE2    2  
ATOM   6459   H  HE3    . MET A 1 166 ? -0.472  0.130   -12.518 1.00 0.00 ? 173 MET A HE3    2  
ATOM   6460   N  N      . ARG A 1 167 ? -5.253  5.156   -11.863 1.00 0.00 ? 174 ARG A N      2  
ATOM   6461   C  CA     . ARG A 1 167 ? -5.880  6.061   -12.819 1.00 0.00 ? 174 ARG A CA     2  
ATOM   6462   C  C      . ARG A 1 167 ? -6.260  7.373   -12.146 1.00 0.00 ? 174 ARG A C      2  
ATOM   6463   O  O      . ARG A 1 167 ? -6.005  8.448   -12.686 1.00 0.00 ? 174 ARG A O      2  
ATOM   6464   C  CB     . ARG A 1 167 ? -7.118  5.418   -13.442 1.00 0.00 ? 174 ARG A CB     2  
ATOM   6465   C  CG     . ARG A 1 167 ? -6.806  4.238   -14.343 1.00 0.00 ? 174 ARG A CG     2  
ATOM   6466   C  CD     . ARG A 1 167 ? -5.968  4.655   -15.538 1.00 0.00 ? 174 ARG A CD     2  
ATOM   6467   N  NE     . ARG A 1 167 ? -6.548  4.172   -16.790 1.00 0.00 ? 174 ARG A NE     2  
ATOM   6468   C  CZ     . ARG A 1 167 ? -7.064  4.963   -17.732 1.00 0.00 ? 174 ARG A CZ     2  
ATOM   6469   N  NH1    . ARG A 1 167 ? -7.055  6.282   -17.578 1.00 0.00 ? 174 ARG A NH1    2  
ATOM   6470   N  NH2    . ARG A 1 167 ? -7.587  4.436   -18.829 1.00 0.00 ? 174 ARG A NH2    2  
ATOM   6471   H  H      . ARG A 1 167 ? -5.736  4.346   -11.584 1.00 0.00 ? 174 ARG A H      2  
ATOM   6472   H  HA     . ARG A 1 167 ? -5.161  6.266   -13.599 1.00 0.00 ? 174 ARG A HA     2  
ATOM   6473   H  HB2    . ARG A 1 167 ? -7.771  5.077   -12.652 1.00 0.00 ? 174 ARG A HB2    2  
ATOM   6474   H  HB3    . ARG A 1 167 ? -7.637  6.163   -14.028 1.00 0.00 ? 174 ARG A HB3    2  
ATOM   6475   H  HG2    . ARG A 1 167 ? -6.262  3.498   -13.775 1.00 0.00 ? 174 ARG A HG2    2  
ATOM   6476   H  HG3    . ARG A 1 167 ? -7.734  3.811   -14.695 1.00 0.00 ? 174 ARG A HG3    2  
ATOM   6477   H  HD2    . ARG A 1 167 ? -5.901  5.733   -15.564 1.00 0.00 ? 174 ARG A HD2    2  
ATOM   6478   H  HD3    . ARG A 1 167 ? -4.978  4.238   -15.428 1.00 0.00 ? 174 ARG A HD3    2  
ATOM   6479   H  HE     . ARG A 1 167 ? -6.567  3.192   -16.927 1.00 0.00 ? 174 ARG A HE     2  
ATOM   6480   H  HH11   . ARG A 1 167 ? -6.659  6.695   -16.750 1.00 0.00 ? 174 ARG A HH11   2  
ATOM   6481   H  HH12   . ARG A 1 167 ? -7.448  6.881   -18.287 1.00 0.00 ? 174 ARG A HH12   2  
ATOM   6482   H  HH21   . ARG A 1 167 ? -7.588  3.438   -18.963 1.00 0.00 ? 174 ARG A HH21   2  
ATOM   6483   H  HH22   . ARG A 1 167 ? -8.009  5.031   -19.524 1.00 0.00 ? 174 ARG A HH22   2  
ATOM   6484   N  N      . GLU A 1 168 ? -6.859  7.284   -10.962 1.00 0.00 ? 175 GLU A N      2  
ATOM   6485   C  CA     . GLU A 1 168 ? -7.209  8.478   -10.200 1.00 0.00 ? 175 GLU A CA     2  
ATOM   6486   C  C      . GLU A 1 168 ? -5.983  9.329   -9.912  1.00 0.00 ? 175 GLU A C      2  
ATOM   6487   O  O      . GLU A 1 168 ? -6.045  10.556  -9.975  1.00 0.00 ? 175 GLU A O      2  
ATOM   6488   C  CB     . GLU A 1 168 ? -7.885  8.121   -8.888  1.00 0.00 ? 175 GLU A CB     2  
ATOM   6489   C  CG     . GLU A 1 168 ? -9.381  7.935   -8.998  1.00 0.00 ? 175 GLU A CG     2  
ATOM   6490   C  CD     . GLU A 1 168 ? -10.051 8.071   -7.652  1.00 0.00 ? 175 GLU A CD     2  
ATOM   6491   O  OE1    . GLU A 1 168 ? -9.761  9.065   -6.951  1.00 0.00 ? 175 GLU A OE1    2  
ATOM   6492   O  OE2    . GLU A 1 168 ? -10.866 7.202   -7.299  1.00 0.00 ? 175 GLU A OE2    2  
ATOM   6493   H  H      . GLU A 1 168 ? -7.077  6.399   -10.596 1.00 0.00 ? 175 GLU A H      2  
ATOM   6494   H  HA     . GLU A 1 168 ? -7.896  9.058   -10.798 1.00 0.00 ? 175 GLU A HA     2  
ATOM   6495   H  HB2    . GLU A 1 168 ? -7.459  7.201   -8.516  1.00 0.00 ? 175 GLU A HB2    2  
ATOM   6496   H  HB3    . GLU A 1 168 ? -7.696  8.908   -8.173  1.00 0.00 ? 175 GLU A HB3    2  
ATOM   6497   H  HG2    . GLU A 1 168 ? -9.782  8.683   -9.667  1.00 0.00 ? 175 GLU A HG2    2  
ATOM   6498   H  HG3    . GLU A 1 168 ? -9.582  6.949   -9.391  1.00 0.00 ? 175 GLU A HG3    2  
ATOM   6499   N  N      . ILE A 1 169 ? -4.870  8.676   -9.595  1.00 0.00 ? 176 ILE A N      2  
ATOM   6500   C  CA     . ILE A 1 169 ? -3.619  9.382   -9.355  1.00 0.00 ? 176 ILE A CA     2  
ATOM   6501   C  C      . ILE A 1 169 ? -3.265  10.231  -10.573 1.00 0.00 ? 176 ILE A C      2  
ATOM   6502   O  O      . ILE A 1 169 ? -2.869  11.386  -10.438 1.00 0.00 ? 176 ILE A O      2  
ATOM   6503   C  CB     . ILE A 1 169 ? -2.462  8.406   -9.033  1.00 0.00 ? 176 ILE A CB     2  
ATOM   6504   C  CG1    . ILE A 1 169 ? -2.796  7.598   -7.769  1.00 0.00 ? 176 ILE A CG1    2  
ATOM   6505   C  CG2    . ILE A 1 169 ? -1.150  9.167   -8.859  1.00 0.00 ? 176 ILE A CG2    2  
ATOM   6506   C  CD1    . ILE A 1 169 ? -1.748  6.567   -7.399  1.00 0.00 ? 176 ILE A CD1    2  
ATOM   6507   H  H      . ILE A 1 169 ? -4.897  7.696   -9.514  1.00 0.00 ? 176 ILE A H      2  
ATOM   6508   H  HA     . ILE A 1 169 ? -3.762  10.035  -8.505  1.00 0.00 ? 176 ILE A HA     2  
ATOM   6509   H  HB     . ILE A 1 169 ? -2.349  7.728   -9.866  1.00 0.00 ? 176 ILE A HB     2  
ATOM   6510   H  HG12   . ILE A 1 169 ? -2.901  8.274   -6.934  1.00 0.00 ? 176 ILE A HG12   2  
ATOM   6511   H  HG13   . ILE A 1 169 ? -3.731  7.078   -7.923  1.00 0.00 ? 176 ILE A HG13   2  
ATOM   6512   H  HG21   . ILE A 1 169 ? -0.909  9.685   -9.777  1.00 0.00 ? 176 ILE A HG21   2  
ATOM   6513   H  HG22   . ILE A 1 169 ? -0.357  8.472   -8.620  1.00 0.00 ? 176 ILE A HG22   2  
ATOM   6514   H  HG23   . ILE A 1 169 ? -1.253  9.884   -8.058  1.00 0.00 ? 176 ILE A HG23   2  
ATOM   6515   H  HD11   . ILE A 1 169 ? -2.051  6.053   -6.498  1.00 0.00 ? 176 ILE A HD11   2  
ATOM   6516   H  HD12   . ILE A 1 169 ? -0.803  7.058   -7.231  1.00 0.00 ? 176 ILE A HD12   2  
ATOM   6517   H  HD13   . ILE A 1 169 ? -1.646  5.853   -8.202  1.00 0.00 ? 176 ILE A HD13   2  
ATOM   6518   N  N      . ARG A 1 170 ? -3.479  9.663   -11.759 1.00 0.00 ? 177 ARG A N      2  
ATOM   6519   C  CA     . ARG A 1 170 ? -3.223  10.366  -13.015 1.00 0.00 ? 177 ARG A CA     2  
ATOM   6520   C  C      . ARG A 1 170 ? -4.101  11.604  -13.125 1.00 0.00 ? 177 ARG A C      2  
ATOM   6521   O  O      . ARG A 1 170 ? -3.634  12.678  -13.504 1.00 0.00 ? 177 ARG A O      2  
ATOM   6522   C  CB     . ARG A 1 170 ? -3.499  9.469   -14.225 1.00 0.00 ? 177 ARG A CB     2  
ATOM   6523   C  CG     . ARG A 1 170 ? -2.417  8.449   -14.530 1.00 0.00 ? 177 ARG A CG     2  
ATOM   6524   C  CD     . ARG A 1 170 ? -2.727  7.708   -15.824 1.00 0.00 ? 177 ARG A CD     2  
ATOM   6525   N  NE     . ARG A 1 170 ? -1.591  6.916   -16.294 1.00 0.00 ? 177 ARG A NE     2  
ATOM   6526   C  CZ     . ARG A 1 170 ? -1.082  7.005   -17.524 1.00 0.00 ? 177 ARG A CZ     2  
ATOM   6527   N  NH1    . ARG A 1 170 ? -1.629  7.826   -18.411 1.00 0.00 ? 177 ARG A NH1    2  
ATOM   6528   N  NH2    . ARG A 1 170 ? -0.037  6.264   -17.869 1.00 0.00 ? 177 ARG A NH2    2  
ATOM   6529   H  H      . ARG A 1 170 ? -3.850  8.759   -11.785 1.00 0.00 ? 177 ARG A H      2  
ATOM   6530   H  HA     . ARG A 1 170 ? -2.185  10.667  -13.027 1.00 0.00 ? 177 ARG A HA     2  
ATOM   6531   H  HB2    . ARG A 1 170 ? -4.420  8.933   -14.053 1.00 0.00 ? 177 ARG A HB2    2  
ATOM   6532   H  HB3    . ARG A 1 170 ? -3.621  10.097  -15.096 1.00 0.00 ? 177 ARG A HB3    2  
ATOM   6533   H  HG2    . ARG A 1 170 ? -1.471  8.957   -14.634 1.00 0.00 ? 177 ARG A HG2    2  
ATOM   6534   H  HG3    . ARG A 1 170 ? -2.364  7.737   -13.720 1.00 0.00 ? 177 ARG A HG3    2  
ATOM   6535   H  HD2    . ARG A 1 170 ? -3.565  7.048   -15.654 1.00 0.00 ? 177 ARG A HD2    2  
ATOM   6536   H  HD3    . ARG A 1 170 ? -2.990  8.430   -16.583 1.00 0.00 ? 177 ARG A HD3    2  
ATOM   6537   H  HE     . ARG A 1 170 ? -1.189  6.282   -15.657 1.00 0.00 ? 177 ARG A HE     2  
ATOM   6538   H  HH11   . ARG A 1 170 ? -2.432  8.376   -18.166 1.00 0.00 ? 177 ARG A HH11   2  
ATOM   6539   H  HH12   . ARG A 1 170 ? -1.232  7.914   -19.334 1.00 0.00 ? 177 ARG A HH12   2  
ATOM   6540   H  HH21   . ARG A 1 170 ? 0.375   5.639   -17.209 1.00 0.00 ? 177 ARG A HH21   2  
ATOM   6541   H  HH22   . ARG A 1 170 ? 0.336   6.319   -18.806 1.00 0.00 ? 177 ARG A HH22   2  
ATOM   6542   N  N      . THR A 1 171 ? -5.374  11.439  -12.794 1.00 0.00 ? 178 THR A N      2  
ATOM   6543   C  CA     . THR A 1 171 ? -6.336  12.524  -12.869 1.00 0.00 ? 178 THR A CA     2  
ATOM   6544   C  C      . THR A 1 171 ? -5.964  13.669  -11.927 1.00 0.00 ? 178 THR A C      2  
ATOM   6545   O  O      . THR A 1 171 ? -6.095  14.839  -12.283 1.00 0.00 ? 178 THR A O      2  
ATOM   6546   C  CB     . THR A 1 171 ? -7.754  12.022  -12.547 1.00 0.00 ? 178 THR A CB     2  
ATOM   6547   O  OG1    . THR A 1 171 ? -8.060  10.891  -13.374 1.00 0.00 ? 178 THR A OG1    2  
ATOM   6548   C  CG2    . THR A 1 171 ? -8.783  13.117  -12.781 1.00 0.00 ? 178 THR A CG2    2  
ATOM   6549   H  H      . THR A 1 171 ? -5.680  10.553  -12.502 1.00 0.00 ? 178 THR A H      2  
ATOM   6550   H  HA     . THR A 1 171 ? -6.334  12.897  -13.884 1.00 0.00 ? 178 THR A HA     2  
ATOM   6551   H  HB     . THR A 1 171 ? -7.791  11.725  -11.509 1.00 0.00 ? 178 THR A HB     2  
ATOM   6552   H  HG1    . THR A 1 171 ? -8.007  11.152  -14.307 1.00 0.00 ? 178 THR A HG1    2  
ATOM   6553   H  HG21   . THR A 1 171 ? -8.741  13.437  -13.812 1.00 0.00 ? 178 THR A HG21   2  
ATOM   6554   H  HG22   . THR A 1 171 ? -8.569  13.956  -12.135 1.00 0.00 ? 178 THR A HG22   2  
ATOM   6555   H  HG23   . THR A 1 171 ? -9.770  12.737  -12.561 1.00 0.00 ? 178 THR A HG23   2  
ATOM   6556   N  N      . LYS A 1 172 ? -5.482  13.341  -10.733 1.00 0.00 ? 179 LYS A N      2  
ATOM   6557   C  CA     . LYS A 1 172 ? -5.040  14.375  -9.803  1.00 0.00 ? 179 LYS A CA     2  
ATOM   6558   C  C      . LYS A 1 172 ? -3.758  15.042  -10.302 1.00 0.00 ? 179 LYS A C      2  
ATOM   6559   O  O      . LYS A 1 172 ? -3.535  16.222  -10.055 1.00 0.00 ? 179 LYS A O      2  
ATOM   6560   C  CB     . LYS A 1 172 ? -4.831  13.822  -8.386  1.00 0.00 ? 179 LYS A CB     2  
ATOM   6561   C  CG     . LYS A 1 172 ? -6.098  13.726  -7.542  1.00 0.00 ? 179 LYS A CG     2  
ATOM   6562   C  CD     . LYS A 1 172 ? -7.087  12.689  -8.056  1.00 0.00 ? 179 LYS A CD     2  
ATOM   6563   C  CE     . LYS A 1 172 ? -8.286  12.585  -7.120  1.00 0.00 ? 179 LYS A CE     2  
ATOM   6564   N  NZ     . LYS A 1 172 ? -9.307  11.606  -7.588  1.00 0.00 ? 179 LYS A NZ     2  
ATOM   6565   H  H      . LYS A 1 172 ? -5.427  12.394  -10.473 1.00 0.00 ? 179 LYS A H      2  
ATOM   6566   H  HA     . LYS A 1 172 ? -5.817  15.124  -9.769  1.00 0.00 ? 179 LYS A HA     2  
ATOM   6567   H  HB2    . LYS A 1 172 ? -4.400  12.841  -8.452  1.00 0.00 ? 179 LYS A HB2    2  
ATOM   6568   H  HB3    . LYS A 1 172 ? -4.137  14.468  -7.868  1.00 0.00 ? 179 LYS A HB3    2  
ATOM   6569   H  HG2    . LYS A 1 172 ? -5.821  13.462  -6.534  1.00 0.00 ? 179 LYS A HG2    2  
ATOM   6570   H  HG3    . LYS A 1 172 ? -6.582  14.693  -7.536  1.00 0.00 ? 179 LYS A HG3    2  
ATOM   6571   H  HD2    . LYS A 1 172 ? -7.427  12.982  -9.039  1.00 0.00 ? 179 LYS A HD2    2  
ATOM   6572   H  HD3    . LYS A 1 172 ? -6.593  11.729  -8.114  1.00 0.00 ? 179 LYS A HD3    2  
ATOM   6573   H  HE2    . LYS A 1 172 ? -7.935  12.281  -6.144  1.00 0.00 ? 179 LYS A HE2    2  
ATOM   6574   H  HE3    . LYS A 1 172 ? -8.745  13.560  -7.043  1.00 0.00 ? 179 LYS A HE3    2  
ATOM   6575   H  HZ1    . LYS A 1 172 ? -10.160 11.663  -6.989  1.00 0.00 ? 179 LYS A HZ1    2  
ATOM   6576   H  HZ2    . LYS A 1 172 ? -8.936  10.632  -7.533  1.00 0.00 ? 179 LYS A HZ2    2  
ATOM   6577   H  HZ3    . LYS A 1 172 ? -9.579  11.809  -8.574  1.00 0.00 ? 179 LYS A HZ3    2  
ATOM   6578   N  N      . LYS A 1 173 ? -2.916  14.285  -11.001 1.00 0.00 ? 180 LYS A N      2  
ATOM   6579   C  CA     . LYS A 1 173 ? -1.687  14.838  -11.573 1.00 0.00 ? 180 LYS A CA     2  
ATOM   6580   C  C      . LYS A 1 173 ? -2.020  15.851  -12.665 1.00 0.00 ? 180 LYS A C      2  
ATOM   6581   O  O      . LYS A 1 173 ? -1.534  16.979  -12.648 1.00 0.00 ? 180 LYS A O      2  
ATOM   6582   C  CB     . LYS A 1 173 ? -0.813  13.733  -12.176 1.00 0.00 ? 180 LYS A CB     2  
ATOM   6583   C  CG     . LYS A 1 173 ? -0.359  12.664  -11.197 1.00 0.00 ? 180 LYS A CG     2  
ATOM   6584   C  CD     . LYS A 1 173 ? 0.775   13.135  -10.305 1.00 0.00 ? 180 LYS A CD     2  
ATOM   6585   C  CE     . LYS A 1 173 ? 1.313   11.980  -9.471  1.00 0.00 ? 180 LYS A CE     2  
ATOM   6586   N  NZ     . LYS A 1 173 ? 2.525   12.348  -8.697  1.00 0.00 ? 180 LYS A NZ     2  
ATOM   6587   H  H      . LYS A 1 173 ? -3.123  13.333  -11.136 1.00 0.00 ? 180 LYS A H      2  
ATOM   6588   H  HA     . LYS A 1 173 ? -1.142  15.333  -10.783 1.00 0.00 ? 180 LYS A HA     2  
ATOM   6589   H  HB2    . LYS A 1 173 ? -1.367  13.246  -12.962 1.00 0.00 ? 180 LYS A HB2    2  
ATOM   6590   H  HB3    . LYS A 1 173 ? 0.068   14.190  -12.604 1.00 0.00 ? 180 LYS A HB3    2  
ATOM   6591   H  HG2    . LYS A 1 173 ? -1.196  12.387  -10.573 1.00 0.00 ? 180 LYS A HG2    2  
ATOM   6592   H  HG3    . LYS A 1 173 ? -0.027  11.800  -11.756 1.00 0.00 ? 180 LYS A HG3    2  
ATOM   6593   H  HD2    . LYS A 1 173 ? 1.573   13.528  -10.922 1.00 0.00 ? 180 LYS A HD2    2  
ATOM   6594   H  HD3    . LYS A 1 173 ? 0.405   13.905  -9.645  1.00 0.00 ? 180 LYS A HD3    2  
ATOM   6595   H  HE2    . LYS A 1 173 ? 0.543   11.668  -8.781  1.00 0.00 ? 180 LYS A HE2    2  
ATOM   6596   H  HE3    . LYS A 1 173 ? 1.554   11.159  -10.133 1.00 0.00 ? 180 LYS A HE3    2  
ATOM   6597   H  HZ1    . LYS A 1 173 ? 2.860   11.520  -8.153  1.00 0.00 ? 180 LYS A HZ1    2  
ATOM   6598   H  HZ2    . LYS A 1 173 ? 2.306   13.117  -8.028  1.00 0.00 ? 180 LYS A HZ2    2  
ATOM   6599   H  HZ3    . LYS A 1 173 ? 3.282   12.659  -9.339  1.00 0.00 ? 180 LYS A HZ3    2  
ATOM   6600   N  N      . MET A 1 174 ? -2.859  15.432  -13.608 1.00 0.00 ? 181 MET A N      2  
ATOM   6601   C  CA     . MET A 1 174 ? -3.218  16.265  -14.756 1.00 0.00 ? 181 MET A CA     2  
ATOM   6602   C  C      . MET A 1 174 ? -4.109  17.432  -14.338 1.00 0.00 ? 181 MET A C      2  
ATOM   6603   O  O      . MET A 1 174 ? -3.983  18.540  -14.866 1.00 0.00 ? 181 MET A O      2  
ATOM   6604   C  CB     . MET A 1 174 ? -3.951  15.432  -15.814 1.00 0.00 ? 181 MET A CB     2  
ATOM   6605   C  CG     . MET A 1 174 ? -3.120  14.307  -16.406 1.00 0.00 ? 181 MET A CG     2  
ATOM   6606   S  SD     . MET A 1 174 ? -4.064  13.295  -17.561 1.00 0.00 ? 181 MET A SD     2  
ATOM   6607   C  CE     . MET A 1 174 ? -2.812  12.139  -18.111 1.00 0.00 ? 181 MET A CE     2  
ATOM   6608   H  H      . MET A 1 174 ? -3.253  14.534  -13.530 1.00 0.00 ? 181 MET A H      2  
ATOM   6609   H  HA     . MET A 1 174 ? -2.306  16.652  -15.185 1.00 0.00 ? 181 MET A HA     2  
ATOM   6610   H  HB2    . MET A 1 174 ? -4.829  14.998  -15.362 1.00 0.00 ? 181 MET A HB2    2  
ATOM   6611   H  HB3    . MET A 1 174 ? -4.258  16.084  -16.619 1.00 0.00 ? 181 MET A HB3    2  
ATOM   6612   H  HG2    . MET A 1 174 ? -2.275  14.734  -16.927 1.00 0.00 ? 181 MET A HG2    2  
ATOM   6613   H  HG3    . MET A 1 174 ? -2.766  13.678  -15.602 1.00 0.00 ? 181 MET A HG3    2  
ATOM   6614   H  HE1    . MET A 1 174 ? -2.017  12.677  -18.607 1.00 0.00 ? 181 MET A HE1    2  
ATOM   6615   H  HE2    . MET A 1 174 ? -3.254  11.434  -18.798 1.00 0.00 ? 181 MET A HE2    2  
ATOM   6616   H  HE3    . MET A 1 174 ? -2.412  11.609  -17.258 1.00 0.00 ? 181 MET A HE3    2  
ATOM   6617   N  N      . SER A 1 175 ? -5.006  17.158  -13.386 1.00 0.00 ? 182 SER A N      2  
ATOM   6618   C  CA     . SER A 1 175 ? -6.020  18.113  -12.937 1.00 0.00 ? 182 SER A CA     2  
ATOM   6619   C  C      . SER A 1 175 ? -7.071  18.314  -14.028 1.00 0.00 ? 182 SER A C      2  
ATOM   6620   O  O      . SER A 1 175 ? -6.880  17.898  -15.173 1.00 0.00 ? 182 SER A O      2  
ATOM   6621   C  CB     . SER A 1 175 ? -5.387  19.458  -12.556 1.00 0.00 ? 182 SER A CB     2  
ATOM   6622   O  OG     . SER A 1 175 ? -6.285  20.268  -11.821 1.00 0.00 ? 182 SER A OG     2  
ATOM   6623   H  H      . SER A 1 175 ? -4.988  16.269  -12.971 1.00 0.00 ? 182 SER A H      2  
ATOM   6624   H  HA     . SER A 1 175 ? -6.503  17.694  -12.065 1.00 0.00 ? 182 SER A HA     2  
ATOM   6625   H  HB2    . SER A 1 175 ? -4.507  19.286  -11.959 1.00 0.00 ? 182 SER A HB2    2  
ATOM   6626   H  HB3    . SER A 1 175 ? -5.113  19.983  -13.458 1.00 0.00 ? 182 SER A HB3    2  
ATOM   6627   H  HG     . SER A 1 175 ? -6.552  19.795  -11.014 1.00 0.00 ? 182 SER A HG     2  
ATOM   6628   N  N      . GLU A 1 176 ? -8.184  18.938  -13.679 1.00 0.00 ? 183 GLU A N      2  
ATOM   6629   C  CA     . GLU A 1 176 ? -9.212  19.222  -14.662 1.00 0.00 ? 183 GLU A CA     2  
ATOM   6630   C  C      . GLU A 1 176 ? -8.808  20.428  -15.499 1.00 0.00 ? 183 GLU A C      2  
ATOM   6631   O  O      . GLU A 1 176 ? -8.975  21.578  -15.091 1.00 0.00 ? 183 GLU A O      2  
ATOM   6632   C  CB     . GLU A 1 176 ? -10.560 19.466  -13.992 1.00 0.00 ? 183 GLU A CB     2  
ATOM   6633   C  CG     . GLU A 1 176 ? -11.708 19.528  -14.983 1.00 0.00 ? 183 GLU A CG     2  
ATOM   6634   C  CD     . GLU A 1 176 ? -11.757 18.298  -15.869 1.00 0.00 ? 183 GLU A CD     2  
ATOM   6635   O  OE1    . GLU A 1 176 ? -10.987 18.241  -16.853 1.00 0.00 ? 183 GLU A OE1    2  
ATOM   6636   O  OE2    . GLU A 1 176 ? -12.550 17.381  -15.576 1.00 0.00 ? 183 GLU A OE2    2  
ATOM   6637   H  H      . GLU A 1 176 ? -8.314  19.220  -12.743 1.00 0.00 ? 183 GLU A H      2  
ATOM   6638   H  HA     . GLU A 1 176 ? -9.297  18.364  -15.316 1.00 0.00 ? 183 GLU A HA     2  
ATOM   6639   H  HB2    . GLU A 1 176 ? -10.754 18.664  -13.294 1.00 0.00 ? 183 GLU A HB2    2  
ATOM   6640   H  HB3    . GLU A 1 176 ? -10.515 20.401  -13.454 1.00 0.00 ? 183 GLU A HB3    2  
ATOM   6641   H  HG2    . GLU A 1 176 ? -12.638 19.601  -14.439 1.00 0.00 ? 183 GLU A HG2    2  
ATOM   6642   H  HG3    . GLU A 1 176 ? -11.586 20.400  -15.606 1.00 0.00 ? 183 GLU A HG3    2  
ATOM   6643   N  N      . ASN A 1 177 ? -8.236  20.146  -16.656 1.00 0.00 ? 184 ASN A N      2  
ATOM   6644   C  CA     . ASN A 1 177 ? -7.779  21.184  -17.567 1.00 0.00 ? 184 ASN A CA     2  
ATOM   6645   C  C      . ASN A 1 177 ? -8.670  21.226  -18.798 1.00 0.00 ? 184 ASN A C      2  
ATOM   6646   O  O      . ASN A 1 177 ? -8.359  21.895  -19.781 1.00 0.00 ? 184 ASN A O      2  
ATOM   6647   C  CB     . ASN A 1 177 ? -6.317  20.940  -17.968 1.00 0.00 ? 184 ASN A CB     2  
ATOM   6648   C  CG     . ASN A 1 177 ? -6.102  19.608  -18.671 1.00 0.00 ? 184 ASN A CG     2  
ATOM   6649   O  OD1    . ASN A 1 177 ? -6.198  19.515  -19.892 1.00 0.00 ? 184 ASN A OD1    2  
ATOM   6650   N  ND2    . ASN A 1 177 ? -5.805  18.565  -17.906 1.00 0.00 ? 184 ASN A ND2    2  
ATOM   6651   H  H      . ASN A 1 177 ? -8.118  19.206  -16.910 1.00 0.00 ? 184 ASN A H      2  
ATOM   6652   H  HA     . ASN A 1 177 ? -7.851  22.131  -17.051 1.00 0.00 ? 184 ASN A HA     2  
ATOM   6653   H  HB2    . ASN A 1 177 ? -5.998  21.728  -18.635 1.00 0.00 ? 184 ASN A HB2    2  
ATOM   6654   H  HB3    . ASN A 1 177 ? -5.704  20.960  -17.080 1.00 0.00 ? 184 ASN A HB3    2  
ATOM   6655   H  HD21   . ASN A 1 177 ? -5.743  18.698  -16.933 1.00 0.00 ? 184 ASN A HD21   2  
ATOM   6656   H  HD22   . ASN A 1 177 ? -5.643  17.703  -18.344 1.00 0.00 ? 184 ASN A HD22   2  
ATOM   6657   N  N      . LYS A 1 178 ? -9.780  20.506  -18.730 1.00 0.00 ? 185 LYS A N      2  
ATOM   6658   C  CA     . LYS A 1 178 ? -10.732 20.455  -19.825 1.00 0.00 ? 185 LYS A CA     2  
ATOM   6659   C  C      . LYS A 1 178 ? -11.795 21.534  -19.650 1.00 0.00 ? 185 LYS A C      2  
ATOM   6660   O  O      . LYS A 1 178 ? -11.625 22.632  -20.217 1.00 0.00 ? 185 LYS A O      2  
ATOM   6661   C  CB     . LYS A 1 178 ? -11.380 19.070  -19.889 1.00 0.00 ? 185 LYS A CB     2  
ATOM   6662   C  CG     . LYS A 1 178 ? -10.385 17.946  -20.133 1.00 0.00 ? 185 LYS A CG     2  
ATOM   6663   C  CD     . LYS A 1 178 ? -11.058 16.581  -20.112 1.00 0.00 ? 185 LYS A CD     2  
ATOM   6664   C  CE     . LYS A 1 178 ? -10.053 15.452  -20.284 1.00 0.00 ? 185 LYS A CE     2  
ATOM   6665   N  NZ     . LYS A 1 178 ? -9.438  15.443  -21.640 1.00 0.00 ? 185 LYS A NZ     2  
ATOM   6666   O  OXT    . LYS A 1 178 ? -12.785 21.285  -18.933 1.00 0.00 ? 185 LYS A OXT    2  
ATOM   6667   H  H      . LYS A 1 178 ? -9.970  19.995  -17.914 1.00 0.00 ? 185 LYS A H      2  
ATOM   6668   H  HA     . LYS A 1 178 ? -10.195 20.637  -20.744 1.00 0.00 ? 185 LYS A HA     2  
ATOM   6669   H  HB2    . LYS A 1 178 ? -11.883 18.877  -18.953 1.00 0.00 ? 185 LYS A HB2    2  
ATOM   6670   H  HB3    . LYS A 1 178 ? -12.104 19.058  -20.683 1.00 0.00 ? 185 LYS A HB3    2  
ATOM   6671   H  HG2    . LYS A 1 178 ? -9.924  18.094  -21.098 1.00 0.00 ? 185 LYS A HG2    2  
ATOM   6672   H  HG3    . LYS A 1 178 ? -9.629  17.977  -19.363 1.00 0.00 ? 185 LYS A HG3    2  
ATOM   6673   H  HD2    . LYS A 1 178 ? -11.564 16.454  -19.167 1.00 0.00 ? 185 LYS A HD2    2  
ATOM   6674   H  HD3    . LYS A 1 178 ? -11.780 16.534  -20.914 1.00 0.00 ? 185 LYS A HD3    2  
ATOM   6675   H  HE2    . LYS A 1 178 ? -9.274  15.566  -19.546 1.00 0.00 ? 185 LYS A HE2    2  
ATOM   6676   H  HE3    . LYS A 1 178 ? -10.560 14.511  -20.125 1.00 0.00 ? 185 LYS A HE3    2  
ATOM   6677   H  HZ1    . LYS A 1 178 ? -8.693  14.713  -21.690 1.00 0.00 ? 185 LYS A HZ1    2  
ATOM   6678   H  HZ2    . LYS A 1 178 ? -9.013  16.370  -21.856 1.00 0.00 ? 185 LYS A HZ2    2  
ATOM   6679   H  HZ3    . LYS A 1 178 ? -10.160 15.226  -22.361 1.00 0.00 ? 185 LYS A HZ3    2  
ATOM   6680   N  N      . GLY B 2 1   ? 30.770  -18.966 -2.234  1.00 0.00 ? 391 GLY B N      2  
ATOM   6681   C  CA     . GLY B 2 1   ? 30.543  -18.757 -3.682  1.00 0.00 ? 391 GLY B CA     2  
ATOM   6682   C  C      . GLY B 2 1   ? 29.647  -17.571 -3.955  1.00 0.00 ? 391 GLY B C      2  
ATOM   6683   O  O      . GLY B 2 1   ? 28.588  -17.711 -4.570  1.00 0.00 ? 391 GLY B O      2  
ATOM   6684   H  H1     . GLY B 2 1   ? 31.400  -19.782 -2.084  1.00 0.00 ? 391 GLY B H1     2  
ATOM   6685   H  H2     . GLY B 2 1   ? 29.862  -19.148 -1.753  1.00 0.00 ? 391 GLY B H2     2  
ATOM   6686   H  H3     . GLY B 2 1   ? 31.206  -18.120 -1.810  1.00 0.00 ? 391 GLY B H3     2  
ATOM   6687   H  HA2    . GLY B 2 1   ? 31.494  -18.597 -4.167  1.00 0.00 ? 391 GLY B HA2    2  
ATOM   6688   H  HA3    . GLY B 2 1   ? 30.085  -19.643 -4.097  1.00 0.00 ? 391 GLY B HA3    2  
ATOM   6689   N  N      . SER B 2 2   ? 30.061  -16.399 -3.498  1.00 0.00 ? 392 SER B N      2  
ATOM   6690   C  CA     . SER B 2 2   ? 29.293  -15.181 -3.697  1.00 0.00 ? 392 SER B CA     2  
ATOM   6691   C  C      . SER B 2 2   ? 30.204  -13.963 -3.621  1.00 0.00 ? 392 SER B C      2  
ATOM   6692   O  O      . SER B 2 2   ? 30.476  -13.450 -2.540  1.00 0.00 ? 392 SER B O      2  
ATOM   6693   C  CB     . SER B 2 2   ? 28.183  -15.075 -2.643  1.00 0.00 ? 392 SER B CB     2  
ATOM   6694   O  OG     . SER B 2 2   ? 27.279  -16.162 -2.742  1.00 0.00 ? 392 SER B OG     2  
ATOM   6695   H  H      . SER B 2 2   ? 30.920  -16.347 -3.018  1.00 0.00 ? 392 SER B H      2  
ATOM   6696   H  HA     . SER B 2 2   ? 28.844  -15.225 -4.679  1.00 0.00 ? 392 SER B HA     2  
ATOM   6697   H  HB2    . SER B 2 2   ? 28.624  -15.082 -1.659  1.00 0.00 ? 392 SER B HB2    2  
ATOM   6698   H  HB3    . SER B 2 2   ? 27.640  -14.152 -2.787  1.00 0.00 ? 392 SER B HB3    2  
ATOM   6699   H  HG     . SER B 2 2   ? 27.479  -16.673 -3.538  1.00 0.00 ? 392 SER B HG     2  
ATOM   6700   N  N      . GLU B 2 3   ? 30.702  -13.526 -4.769  1.00 0.00 ? 393 GLU B N      2  
ATOM   6701   C  CA     . GLU B 2 3   ? 31.567  -12.355 -4.832  1.00 0.00 ? 393 GLU B CA     2  
ATOM   6702   C  C      . GLU B 2 3   ? 30.759  -11.073 -4.644  1.00 0.00 ? 393 GLU B C      2  
ATOM   6703   O  O      . GLU B 2 3   ? 30.826  -10.421 -3.600  1.00 0.00 ? 393 GLU B O      2  
ATOM   6704   C  CB     . GLU B 2 3   ? 32.296  -12.308 -6.175  1.00 0.00 ? 393 GLU B CB     2  
ATOM   6705   C  CG     . GLU B 2 3   ? 33.185  -11.089 -6.345  1.00 0.00 ? 393 GLU B CG     2  
ATOM   6706   C  CD     . GLU B 2 3   ? 33.523  -10.820 -7.794  1.00 0.00 ? 393 GLU B CD     2  
ATOM   6707   O  OE1    . GLU B 2 3   ? 32.734  -10.124 -8.466  1.00 0.00 ? 393 GLU B OE1    2  
ATOM   6708   O  OE2    . GLU B 2 3   ? 34.574  -11.301 -8.261  1.00 0.00 ? 393 GLU B OE2    2  
ATOM   6709   H  H      . GLU B 2 3   ? 30.497  -14.015 -5.600  1.00 0.00 ? 393 GLU B H      2  
ATOM   6710   H  HA     . GLU B 2 3   ? 32.295  -12.433 -4.036  1.00 0.00 ? 393 GLU B HA     2  
ATOM   6711   H  HB2    . GLU B 2 3   ? 32.915  -13.189 -6.266  1.00 0.00 ? 393 GLU B HB2    2  
ATOM   6712   H  HB3    . GLU B 2 3   ? 31.565  -12.308 -6.969  1.00 0.00 ? 393 GLU B HB3    2  
ATOM   6713   H  HG2    . GLU B 2 3   ? 32.675  -10.226 -5.944  1.00 0.00 ? 393 GLU B HG2    2  
ATOM   6714   H  HG3    . GLU B 2 3   ? 34.104  -11.249 -5.799  1.00 0.00 ? 393 GLU B HG3    2  
ATOM   6715   N  N      . THR B 2 4   ? 29.978  -10.738 -5.659  1.00 0.00 ? 394 THR B N      2  
ATOM   6716   C  CA     . THR B 2 4   ? 29.199  -9.512  -5.667  1.00 0.00 ? 394 THR B CA     2  
ATOM   6717   C  C      . THR B 2 4   ? 28.000  -9.646  -4.738  1.00 0.00 ? 394 THR B C      2  
ATOM   6718   O  O      . THR B 2 4   ? 27.587  -8.687  -4.083  1.00 0.00 ? 394 THR B O      2  
ATOM   6719   C  CB     . THR B 2 4   ? 28.709  -9.202  -7.092  1.00 0.00 ? 394 THR B CB     2  
ATOM   6720   O  OG1    . THR B 2 4   ? 29.775  -9.421  -8.029  1.00 0.00 ? 394 THR B OG1    2  
ATOM   6721   C  CG2    . THR B 2 4   ? 28.218  -7.766  -7.209  1.00 0.00 ? 394 THR B CG2    2  
ATOM   6722   H  H      . THR B 2 4   ? 29.915  -11.346 -6.433  1.00 0.00 ? 394 THR B H      2  
ATOM   6723   H  HA     . THR B 2 4   ? 29.825  -8.702  -5.327  1.00 0.00 ? 394 THR B HA     2  
ATOM   6724   H  HB     . THR B 2 4   ? 27.891  -9.867  -7.325  1.00 0.00 ? 394 THR B HB     2  
ATOM   6725   H  HG1    . THR B 2 4   ? 30.623  -9.420  -7.566  1.00 0.00 ? 394 THR B HG1    2  
ATOM   6726   H  HG21   . THR B 2 4   ? 27.869  -7.587  -8.215  1.00 0.00 ? 394 THR B HG21   2  
ATOM   6727   H  HG22   . THR B 2 4   ? 29.029  -7.087  -6.984  1.00 0.00 ? 394 THR B HG22   2  
ATOM   6728   H  HG23   . THR B 2 4   ? 27.408  -7.603  -6.512  1.00 0.00 ? 394 THR B HG23   2  
ATOM   6729   N  N      . GLN B 2 5   ? 27.459  -10.857 -4.678  1.00 0.00 ? 395 GLN B N      2  
ATOM   6730   C  CA     . GLN B 2 5   ? 26.316  -11.154 -3.823  1.00 0.00 ? 395 GLN B CA     2  
ATOM   6731   C  C      . GLN B 2 5   ? 26.631  -10.828 -2.368  1.00 0.00 ? 395 GLN B C      2  
ATOM   6732   O  O      . GLN B 2 5   ? 25.768  -10.361 -1.630  1.00 0.00 ? 395 GLN B O      2  
ATOM   6733   C  CB     . GLN B 2 5   ? 25.937  -12.628 -3.947  1.00 0.00 ? 395 GLN B CB     2  
ATOM   6734   C  CG     . GLN B 2 5   ? 25.609  -13.051 -5.366  1.00 0.00 ? 395 GLN B CG     2  
ATOM   6735   C  CD     . GLN B 2 5   ? 25.579  -14.556 -5.521  1.00 0.00 ? 395 GLN B CD     2  
ATOM   6736   O  OE1    . GLN B 2 5   ? 26.603  -15.186 -5.784  1.00 0.00 ? 395 GLN B OE1    2  
ATOM   6737   N  NE2    . GLN B 2 5   ? 24.403  -15.139 -5.386  1.00 0.00 ? 395 GLN B NE2    2  
ATOM   6738   H  H      . GLN B 2 5   ? 27.835  -11.572 -5.234  1.00 0.00 ? 395 GLN B H      2  
ATOM   6739   H  HA     . GLN B 2 5   ? 25.485  -10.546 -4.150  1.00 0.00 ? 395 GLN B HA     2  
ATOM   6740   H  HB2    . GLN B 2 5   ? 26.765  -13.229 -3.597  1.00 0.00 ? 395 GLN B HB2    2  
ATOM   6741   H  HB3    . GLN B 2 5   ? 25.075  -12.822 -3.327  1.00 0.00 ? 395 GLN B HB3    2  
ATOM   6742   H  HG2    . GLN B 2 5   ? 24.634  -12.657 -5.628  1.00 0.00 ? 395 GLN B HG2    2  
ATOM   6743   H  HG3    . GLN B 2 5   ? 26.354  -12.644 -6.033  1.00 0.00 ? 395 GLN B HG3    2  
ATOM   6744   H  HE21   . GLN B 2 5   ? 23.625  -14.573 -5.200  1.00 0.00 ? 395 GLN B HE21   2  
ATOM   6745   H  HE22   . GLN B 2 5   ? 24.359  -16.116 -5.472  1.00 0.00 ? 395 GLN B HE22   2  
ATOM   6746   N  N      . ALA B 2 6   ? 27.878  -11.062 -1.971  1.00 0.00 ? 396 ALA B N      2  
ATOM   6747   C  CA     . ALA B 2 6   ? 28.316  -10.793 -0.609  1.00 0.00 ? 396 ALA B CA     2  
ATOM   6748   C  C      . ALA B 2 6   ? 28.136  -9.321  -0.271  1.00 0.00 ? 396 ALA B C      2  
ATOM   6749   O  O      . ALA B 2 6   ? 27.585  -8.975  0.775   1.00 0.00 ? 396 ALA B O      2  
ATOM   6750   C  CB     . ALA B 2 6   ? 29.769  -11.200 -0.438  1.00 0.00 ? 396 ALA B CB     2  
ATOM   6751   H  H      . ALA B 2 6   ? 28.525  -11.417 -2.616  1.00 0.00 ? 396 ALA B H      2  
ATOM   6752   H  HA     . ALA B 2 6   ? 27.714  -11.387 0.066   1.00 0.00 ? 396 ALA B HA     2  
ATOM   6753   H  HB1    . ALA B 2 6   ? 29.879  -12.250 -0.668  1.00 0.00 ? 396 ALA B HB1    2  
ATOM   6754   H  HB2    . ALA B 2 6   ? 30.077  -11.020 0.581   1.00 0.00 ? 396 ALA B HB2    2  
ATOM   6755   H  HB3    . ALA B 2 6   ? 30.383  -10.618 -1.110  1.00 0.00 ? 396 ALA B HB3    2  
ATOM   6756   N  N      . GLY B 2 7   ? 28.590  -8.458  -1.176  1.00 0.00 ? 397 GLY B N      2  
ATOM   6757   C  CA     . GLY B 2 7   ? 28.441  -7.031  -0.983  1.00 0.00 ? 397 GLY B CA     2  
ATOM   6758   C  C      . GLY B 2 7   ? 26.985  -6.622  -0.933  1.00 0.00 ? 397 GLY B C      2  
ATOM   6759   O  O      . GLY B 2 7   ? 26.585  -5.841  -0.074  1.00 0.00 ? 397 GLY B O      2  
ATOM   6760   H  H      . GLY B 2 7   ? 29.025  -8.796  -1.986  1.00 0.00 ? 397 GLY B H      2  
ATOM   6761   H  HA2    . GLY B 2 7   ? 28.918  -6.751  -0.055  1.00 0.00 ? 397 GLY B HA2    2  
ATOM   6762   H  HA3    . GLY B 2 7   ? 28.924  -6.512  -1.798  1.00 0.00 ? 397 GLY B HA3    2  
ATOM   6763   N  N      . ILE B 2 8   ? 26.191  -7.173  -1.849  1.00 0.00 ? 398 ILE B N      2  
ATOM   6764   C  CA     . ILE B 2 8   ? 24.757  -6.898  -1.899  1.00 0.00 ? 398 ILE B CA     2  
ATOM   6765   C  C      . ILE B 2 8   ? 24.088  -7.234  -0.565  1.00 0.00 ? 398 ILE B C      2  
ATOM   6766   O  O      . ILE B 2 8   ? 23.388  -6.405  0.015   1.00 0.00 ? 398 ILE B O      2  
ATOM   6767   C  CB     . ILE B 2 8   ? 24.063  -7.713  -3.017  1.00 0.00 ? 398 ILE B CB     2  
ATOM   6768   C  CG1    . ILE B 2 8   ? 24.665  -7.400  -4.393  1.00 0.00 ? 398 ILE B CG1    2  
ATOM   6769   C  CG2    . ILE B 2 8   ? 22.567  -7.436  -3.026  1.00 0.00 ? 398 ILE B CG2    2  
ATOM   6770   C  CD1    . ILE B 2 8   ? 24.326  -6.022  -4.928  1.00 0.00 ? 398 ILE B CD1    2  
ATOM   6771   H  H      . ILE B 2 8   ? 26.584  -7.778  -2.515  1.00 0.00 ? 398 ILE B H      2  
ATOM   6772   H  HA     . ILE B 2 8   ? 24.621  -5.848  -2.107  1.00 0.00 ? 398 ILE B HA     2  
ATOM   6773   H  HB     . ILE B 2 8   ? 24.205  -8.762  -2.804  1.00 0.00 ? 398 ILE B HB     2  
ATOM   6774   H  HG12   . ILE B 2 8   ? 25.740  -7.471  -4.329  1.00 0.00 ? 398 ILE B HG12   2  
ATOM   6775   H  HG13   . ILE B 2 8   ? 24.305  -8.129  -5.105  1.00 0.00 ? 398 ILE B HG13   2  
ATOM   6776   H  HG21   . ILE B 2 8   ? 22.396  -6.386  -3.209  1.00 0.00 ? 398 ILE B HG21   2  
ATOM   6777   H  HG22   . ILE B 2 8   ? 22.144  -7.711  -2.071  1.00 0.00 ? 398 ILE B HG22   2  
ATOM   6778   H  HG23   . ILE B 2 8   ? 22.100  -8.019  -3.808  1.00 0.00 ? 398 ILE B HG23   2  
ATOM   6779   H  HD11   . ILE B 2 8   ? 23.253  -5.892  -4.935  1.00 0.00 ? 398 ILE B HD11   2  
ATOM   6780   H  HD12   . ILE B 2 8   ? 24.704  -5.926  -5.937  1.00 0.00 ? 398 ILE B HD12   2  
ATOM   6781   H  HD13   . ILE B 2 8   ? 24.777  -5.269  -4.298  1.00 0.00 ? 398 ILE B HD13   2  
ATOM   6782   N  N      . LYS B 2 9   ? 24.324  -8.451  -0.079  1.00 0.00 ? 399 LYS B N      2  
ATOM   6783   C  CA     . LYS B 2 9   ? 23.692  -8.932  1.147   1.00 0.00 ? 399 LYS B CA     2  
ATOM   6784   C  C      . LYS B 2 9   ? 24.092  -8.080  2.346   1.00 0.00 ? 399 LYS B C      2  
ATOM   6785   O  O      . LYS B 2 9   ? 23.259  -7.769  3.204   1.00 0.00 ? 399 LYS B O      2  
ATOM   6786   C  CB     . LYS B 2 9   ? 24.049  -10.402 1.386   1.00 0.00 ? 399 LYS B CB     2  
ATOM   6787   C  CG     . LYS B 2 9   ? 23.559  -11.315 0.275   1.00 0.00 ? 399 LYS B CG     2  
ATOM   6788   C  CD     . LYS B 2 9   ? 23.949  -12.772 0.489   1.00 0.00 ? 399 LYS B CD     2  
ATOM   6789   C  CE     . LYS B 2 9   ? 22.985  -13.502 1.416   1.00 0.00 ? 399 LYS B CE     2  
ATOM   6790   N  NZ     . LYS B 2 9   ? 23.147  -13.111 2.842   1.00 0.00 ? 399 LYS B NZ     2  
ATOM   6791   H  H      . LYS B 2 9   ? 24.945  -9.042  -0.559  1.00 0.00 ? 399 LYS B H      2  
ATOM   6792   H  HA     . LYS B 2 9   ? 22.623  -8.851  1.015   1.00 0.00 ? 399 LYS B HA     2  
ATOM   6793   H  HB2    . LYS B 2 9   ? 25.123  -10.496 1.458   1.00 0.00 ? 399 LYS B HB2    2  
ATOM   6794   H  HB3    . LYS B 2 9   ? 23.603  -10.726 2.314   1.00 0.00 ? 399 LYS B HB3    2  
ATOM   6795   H  HG2    . LYS B 2 9   ? 22.482  -11.251 0.225   1.00 0.00 ? 399 LYS B HG2    2  
ATOM   6796   H  HG3    . LYS B 2 9   ? 23.980  -10.977 -0.662  1.00 0.00 ? 399 LYS B HG3    2  
ATOM   6797   H  HD2    . LYS B 2 9   ? 23.952  -13.273 -0.467  1.00 0.00 ? 399 LYS B HD2    2  
ATOM   6798   H  HD3    . LYS B 2 9   ? 24.939  -12.809 0.915   1.00 0.00 ? 399 LYS B HD3    2  
ATOM   6799   H  HE2    . LYS B 2 9   ? 21.976  -13.278 1.106   1.00 0.00 ? 399 LYS B HE2    2  
ATOM   6800   H  HE3    . LYS B 2 9   ? 23.159  -14.563 1.323   1.00 0.00 ? 399 LYS B HE3    2  
ATOM   6801   H  HZ1    . LYS B 2 9   ? 24.122  -13.307 3.159   1.00 0.00 ? 399 LYS B HZ1    2  
ATOM   6802   H  HZ2    . LYS B 2 9   ? 22.490  -13.659 3.439   1.00 0.00 ? 399 LYS B HZ2    2  
ATOM   6803   H  HZ3    . LYS B 2 9   ? 22.947  -12.096 2.971   1.00 0.00 ? 399 LYS B HZ3    2  
ATOM   6804   N  N      . GLU B 2 10  ? 25.360  -7.695  2.400   1.00 0.00 ? 400 GLU B N      2  
ATOM   6805   C  CA     . GLU B 2 10  ? 25.843  -6.838  3.474   1.00 0.00 ? 400 GLU B CA     2  
ATOM   6806   C  C      . GLU B 2 10  ? 25.182  -5.466  3.407   1.00 0.00 ? 400 GLU B C      2  
ATOM   6807   O  O      . GLU B 2 10  ? 24.780  -4.908  4.429   1.00 0.00 ? 400 GLU B O      2  
ATOM   6808   C  CB     . GLU B 2 10  ? 27.365  -6.695  3.410   1.00 0.00 ? 400 GLU B CB     2  
ATOM   6809   C  CG     . GLU B 2 10  ? 28.108  -7.976  3.748   1.00 0.00 ? 400 GLU B CG     2  
ATOM   6810   C  CD     . GLU B 2 10  ? 27.760  -8.500  5.125   1.00 0.00 ? 400 GLU B CD     2  
ATOM   6811   O  OE1    . GLU B 2 10  ? 28.335  -8.002  6.114   1.00 0.00 ? 400 GLU B OE1    2  
ATOM   6812   O  OE2    . GLU B 2 10  ? 26.916  -9.412  5.223   1.00 0.00 ? 400 GLU B OE2    2  
ATOM   6813   H  H      . GLU B 2 10  ? 25.986  -7.998  1.706   1.00 0.00 ? 400 GLU B H      2  
ATOM   6814   H  HA     . GLU B 2 10  ? 25.577  -7.306  4.410   1.00 0.00 ? 400 GLU B HA     2  
ATOM   6815   H  HB2    . GLU B 2 10  ? 27.646  -6.394  2.411   1.00 0.00 ? 400 GLU B HB2    2  
ATOM   6816   H  HB3    . GLU B 2 10  ? 27.674  -5.930  4.106   1.00 0.00 ? 400 GLU B HB3    2  
ATOM   6817   H  HG2    . GLU B 2 10  ? 27.856  -8.730  3.018   1.00 0.00 ? 400 GLU B HG2    2  
ATOM   6818   H  HG3    . GLU B 2 10  ? 29.171  -7.781  3.710   1.00 0.00 ? 400 GLU B HG3    2  
ATOM   6819   N  N      . GLU B 2 11  ? 25.061  -4.933  2.198   1.00 0.00 ? 401 GLU B N      2  
ATOM   6820   C  CA     . GLU B 2 11  ? 24.418  -3.646  1.991   1.00 0.00 ? 401 GLU B CA     2  
ATOM   6821   C  C      . GLU B 2 11  ? 22.939  -3.708  2.350   1.00 0.00 ? 401 GLU B C      2  
ATOM   6822   O  O      . GLU B 2 11  ? 22.363  -2.712  2.782   1.00 0.00 ? 401 GLU B O      2  
ATOM   6823   C  CB     . GLU B 2 11  ? 24.595  -3.185  0.546   1.00 0.00 ? 401 GLU B CB     2  
ATOM   6824   C  CG     . GLU B 2 11  ? 26.032  -2.836  0.207   1.00 0.00 ? 401 GLU B CG     2  
ATOM   6825   C  CD     . GLU B 2 11  ? 26.204  -1.381  -0.155  1.00 0.00 ? 401 GLU B CD     2  
ATOM   6826   O  OE1    . GLU B 2 11  ? 26.231  -0.541  0.765   1.00 0.00 ? 401 GLU B OE1    2  
ATOM   6827   O  OE2    . GLU B 2 11  ? 26.314  -1.073  -1.357  1.00 0.00 ? 401 GLU B OE2    2  
ATOM   6828   H  H      . GLU B 2 11  ? 25.415  -5.420  1.422   1.00 0.00 ? 401 GLU B H      2  
ATOM   6829   H  HA     . GLU B 2 11  ? 24.900  -2.934  2.644   1.00 0.00 ? 401 GLU B HA     2  
ATOM   6830   H  HB2    . GLU B 2 11  ? 24.267  -3.974  -0.117  1.00 0.00 ? 401 GLU B HB2    2  
ATOM   6831   H  HB3    . GLU B 2 11  ? 23.985  -2.310  0.381   1.00 0.00 ? 401 GLU B HB3    2  
ATOM   6832   H  HG2    . GLU B 2 11  ? 26.650  -3.050  1.065   1.00 0.00 ? 401 GLU B HG2    2  
ATOM   6833   H  HG3    . GLU B 2 11  ? 26.351  -3.440  -0.627  1.00 0.00 ? 401 GLU B HG3    2  
ATOM   6834   N  N      . ILE B 2 12  ? 22.328  -4.875  2.172   1.00 0.00 ? 402 ILE B N      2  
ATOM   6835   C  CA     . ILE B 2 12  ? 20.943  -5.073  2.579   1.00 0.00 ? 402 ILE B CA     2  
ATOM   6836   C  C      . ILE B 2 12  ? 20.803  -4.796  4.070   1.00 0.00 ? 402 ILE B C      2  
ATOM   6837   O  O      . ILE B 2 12  ? 19.959  -4.005  4.485   1.00 0.00 ? 402 ILE B O      2  
ATOM   6838   C  CB     . ILE B 2 12  ? 20.439  -6.499  2.257   1.00 0.00 ? 402 ILE B CB     2  
ATOM   6839   C  CG1    . ILE B 2 12  ? 20.423  -6.725  0.742   1.00 0.00 ? 402 ILE B CG1    2  
ATOM   6840   C  CG2    . ILE B 2 12  ? 19.050  -6.719  2.840   1.00 0.00 ? 402 ILE B CG2    2  
ATOM   6841   C  CD1    . ILE B 2 12  ? 20.037  -8.132  0.340   1.00 0.00 ? 402 ILE B CD1    2  
ATOM   6842   H  H      . ILE B 2 12  ? 22.817  -5.615  1.750   1.00 0.00 ? 402 ILE B H      2  
ATOM   6843   H  HA     . ILE B 2 12  ? 20.332  -4.365  2.037   1.00 0.00 ? 402 ILE B HA     2  
ATOM   6844   H  HB     . ILE B 2 12  ? 21.114  -7.209  2.714   1.00 0.00 ? 402 ILE B HB     2  
ATOM   6845   H  HG12   . ILE B 2 12  ? 19.712  -6.048  0.291   1.00 0.00 ? 402 ILE B HG12   2  
ATOM   6846   H  HG13   . ILE B 2 12  ? 21.408  -6.523  0.344   1.00 0.00 ? 402 ILE B HG13   2  
ATOM   6847   H  HG21   . ILE B 2 12  ? 18.358  -6.021  2.392   1.00 0.00 ? 402 ILE B HG21   2  
ATOM   6848   H  HG22   . ILE B 2 12  ? 19.079  -6.560  3.909   1.00 0.00 ? 402 ILE B HG22   2  
ATOM   6849   H  HG23   . ILE B 2 12  ? 18.726  -7.729  2.635   1.00 0.00 ? 402 ILE B HG23   2  
ATOM   6850   H  HD11   . ILE B 2 12  ? 20.739  -8.833  0.769   1.00 0.00 ? 402 ILE B HD11   2  
ATOM   6851   H  HD12   . ILE B 2 12  ? 20.055  -8.217  -0.737  1.00 0.00 ? 402 ILE B HD12   2  
ATOM   6852   H  HD13   . ILE B 2 12  ? 19.044  -8.349  0.704   1.00 0.00 ? 402 ILE B HD13   2  
ATOM   6853   N  N      . ARG B 2 13  ? 21.672  -5.413  4.864   1.00 0.00 ? 403 ARG B N      2  
ATOM   6854   C  CA     . ARG B 2 13  ? 21.677  -5.187  6.306   1.00 0.00 ? 403 ARG B CA     2  
ATOM   6855   C  C      . ARG B 2 13  ? 22.006  -3.730  6.618   1.00 0.00 ? 403 ARG B C      2  
ATOM   6856   O  O      . ARG B 2 13  ? 21.509  -3.163  7.591   1.00 0.00 ? 403 ARG B O      2  
ATOM   6857   C  CB     . ARG B 2 13  ? 22.683  -6.109  6.999   1.00 0.00 ? 403 ARG B CB     2  
ATOM   6858   C  CG     . ARG B 2 13  ? 22.336  -7.590  6.910   1.00 0.00 ? 403 ARG B CG     2  
ATOM   6859   C  CD     . ARG B 2 13  ? 20.992  -7.897  7.549   1.00 0.00 ? 403 ARG B CD     2  
ATOM   6860   N  NE     . ARG B 2 13  ? 20.755  -9.338  7.657   1.00 0.00 ? 403 ARG B NE     2  
ATOM   6861   C  CZ     . ARG B 2 13  ? 19.577  -9.928  7.452   1.00 0.00 ? 403 ARG B CZ     2  
ATOM   6862   N  NH1    . ARG B 2 13  ? 18.528  -9.218  7.063   1.00 0.00 ? 403 ARG B NH1    2  
ATOM   6863   N  NH2    . ARG B 2 13  ? 19.455  -11.237 7.628   1.00 0.00 ? 403 ARG B NH2    2  
ATOM   6864   H  H      . ARG B 2 13  ? 22.324  -6.034  4.470   1.00 0.00 ? 403 ARG B H      2  
ATOM   6865   H  HA     . ARG B 2 13  ? 20.687  -5.406  6.679   1.00 0.00 ? 403 ARG B HA     2  
ATOM   6866   H  HB2    . ARG B 2 13  ? 23.653  -5.966  6.547   1.00 0.00 ? 403 ARG B HB2    2  
ATOM   6867   H  HB3    . ARG B 2 13  ? 22.742  -5.837  8.043   1.00 0.00 ? 403 ARG B HB3    2  
ATOM   6868   H  HG2    . ARG B 2 13  ? 22.301  -7.877  5.871   1.00 0.00 ? 403 ARG B HG2    2  
ATOM   6869   H  HG3    . ARG B 2 13  ? 23.103  -8.158  7.418   1.00 0.00 ? 403 ARG B HG3    2  
ATOM   6870   H  HD2    . ARG B 2 13  ? 20.971  -7.465  8.538   1.00 0.00 ? 403 ARG B HD2    2  
ATOM   6871   H  HD3    . ARG B 2 13  ? 20.211  -7.457  6.946   1.00 0.00 ? 403 ARG B HD3    2  
ATOM   6872   H  HE     . ARG B 2 13  ? 21.524  -9.901  7.917   1.00 0.00 ? 403 ARG B HE     2  
ATOM   6873   H  HH11   . ARG B 2 13  ? 18.610  -8.216  6.919   1.00 0.00 ? 403 ARG B HH11   2  
ATOM   6874   H  HH12   . ARG B 2 13  ? 17.649  -9.669  6.892   1.00 0.00 ? 403 ARG B HH12   2  
ATOM   6875   H  HH21   . ARG B 2 13  ? 20.249  -11.784 7.916   1.00 0.00 ? 403 ARG B HH21   2  
ATOM   6876   H  HH22   . ARG B 2 13  ? 18.564  -11.691 7.480   1.00 0.00 ? 403 ARG B HH22   2  
ATOM   6877   N  N      . ARG B 2 14  ? 22.842  -3.129  5.780   1.00 0.00 ? 404 ARG B N      2  
ATOM   6878   C  CA     . ARG B 2 14  ? 23.195  -1.720  5.914   1.00 0.00 ? 404 ARG B CA     2  
ATOM   6879   C  C      . ARG B 2 14  ? 21.951  -0.842  5.793   1.00 0.00 ? 404 ARG B C      2  
ATOM   6880   O  O      . ARG B 2 14  ? 21.686  0.000   6.654   1.00 0.00 ? 404 ARG B O      2  
ATOM   6881   C  CB     . ARG B 2 14  ? 24.221  -1.330  4.843   1.00 0.00 ? 404 ARG B CB     2  
ATOM   6882   C  CG     . ARG B 2 14  ? 24.646  0.131   4.891   1.00 0.00 ? 404 ARG B CG     2  
ATOM   6883   C  CD     . ARG B 2 14  ? 25.546  0.476   3.715   1.00 0.00 ? 404 ARG B CD     2  
ATOM   6884   N  NE     . ARG B 2 14  ? 26.014  1.859   3.759   1.00 0.00 ? 404 ARG B NE     2  
ATOM   6885   C  CZ     . ARG B 2 14  ? 26.565  2.499   2.726   1.00 0.00 ? 404 ARG B CZ     2  
ATOM   6886   N  NH1    . ARG B 2 14  ? 26.707  1.898   1.550   1.00 0.00 ? 404 ARG B NH1    2  
ATOM   6887   N  NH2    . ARG B 2 14  ? 26.980  3.748   2.871   1.00 0.00 ? 404 ARG B NH2    2  
ATOM   6888   H  H      . ARG B 2 14  ? 23.238  -3.652  5.050   1.00 0.00 ? 404 ARG B H      2  
ATOM   6889   H  HA     . ARG B 2 14  ? 23.631  -1.576  6.890   1.00 0.00 ? 404 ARG B HA     2  
ATOM   6890   H  HB2    . ARG B 2 14  ? 25.101  -1.940  4.971   1.00 0.00 ? 404 ARG B HB2    2  
ATOM   6891   H  HB3    . ARG B 2 14  ? 23.797  -1.527  3.869   1.00 0.00 ? 404 ARG B HB3    2  
ATOM   6892   H  HG2    . ARG B 2 14  ? 23.767  0.756   4.856   1.00 0.00 ? 404 ARG B HG2    2  
ATOM   6893   H  HG3    . ARG B 2 14  ? 25.183  0.310   5.811   1.00 0.00 ? 404 ARG B HG3    2  
ATOM   6894   H  HD2    . ARG B 2 14  ? 26.402  -0.181  3.730   1.00 0.00 ? 404 ARG B HD2    2  
ATOM   6895   H  HD3    . ARG B 2 14  ? 24.994  0.324   2.799   1.00 0.00 ? 404 ARG B HD3    2  
ATOM   6896   H  HE     . ARG B 2 14  ? 25.922  2.341   4.619   1.00 0.00 ? 404 ARG B HE     2  
ATOM   6897   H  HH11   . ARG B 2 14  ? 26.399  0.937   1.419   1.00 0.00 ? 404 ARG B HH11   2  
ATOM   6898   H  HH12   . ARG B 2 14  ? 27.124  2.391   0.781   1.00 0.00 ? 404 ARG B HH12   2  
ATOM   6899   H  HH21   . ARG B 2 14  ? 26.882  4.213   3.758   1.00 0.00 ? 404 ARG B HH21   2  
ATOM   6900   H  HH22   . ARG B 2 14  ? 27.400  4.232   2.101   1.00 0.00 ? 404 ARG B HH22   2  
ATOM   6901   N  N      . GLN B 2 15  ? 21.177  -1.065  4.736   1.00 0.00 ? 405 GLN B N      2  
ATOM   6902   C  CA     . GLN B 2 15  ? 19.982  -0.273  4.481   1.00 0.00 ? 405 GLN B CA     2  
ATOM   6903   C  C      . GLN B 2 15  ? 18.907  -0.578  5.512   1.00 0.00 ? 405 GLN B C      2  
ATOM   6904   O  O      . GLN B 2 15  ? 18.171  0.314   5.935   1.00 0.00 ? 405 GLN B O      2  
ATOM   6905   C  CB     . GLN B 2 15  ? 19.448  -0.538  3.071   1.00 0.00 ? 405 GLN B CB     2  
ATOM   6906   C  CG     . GLN B 2 15  ? 20.462  -0.252  1.975   1.00 0.00 ? 405 GLN B CG     2  
ATOM   6907   C  CD     . GLN B 2 15  ? 21.059  1.138   2.074   1.00 0.00 ? 405 GLN B CD     2  
ATOM   6908   O  OE1    . GLN B 2 15  ? 20.414  2.075   2.542   1.00 0.00 ? 405 GLN B OE1    2  
ATOM   6909   N  NE2    . GLN B 2 15  ? 22.297  1.278   1.630   1.00 0.00 ? 405 GLN B NE2    2  
ATOM   6910   H  H      . GLN B 2 15  ? 21.413  -1.788  4.115   1.00 0.00 ? 405 GLN B H      2  
ATOM   6911   H  HA     . GLN B 2 15  ? 20.253  0.769   4.561   1.00 0.00 ? 405 GLN B HA     2  
ATOM   6912   H  HB2    . GLN B 2 15  ? 19.156  -1.575  3.000   1.00 0.00 ? 405 GLN B HB2    2  
ATOM   6913   H  HB3    . GLN B 2 15  ? 18.580  0.083   2.905   1.00 0.00 ? 405 GLN B HB3    2  
ATOM   6914   H  HG2    . GLN B 2 15  ? 21.260  -0.975  2.043   1.00 0.00 ? 405 GLN B HG2    2  
ATOM   6915   H  HG3    . GLN B 2 15  ? 19.971  -0.349  1.016   1.00 0.00 ? 405 GLN B HG3    2  
ATOM   6916   H  HE21   . GLN B 2 15  ? 22.749  0.491   1.263   1.00 0.00 ? 405 GLN B HE21   2  
ATOM   6917   H  HE22   . GLN B 2 15  ? 22.713  2.171   1.682   1.00 0.00 ? 405 GLN B HE22   2  
ATOM   6918   N  N      . GLU B 2 16  ? 18.826  -1.841  5.923   1.00 0.00 ? 406 GLU B N      2  
ATOM   6919   C  CA     . GLU B 2 16  ? 17.897  -2.238  6.971   1.00 0.00 ? 406 GLU B CA     2  
ATOM   6920   C  C      . GLU B 2 16  ? 18.200  -1.478  8.252   1.00 0.00 ? 406 GLU B C      2  
ATOM   6921   O  O      . GLU B 2 16  ? 17.294  -0.969  8.900   1.00 0.00 ? 406 GLU B O      2  
ATOM   6922   C  CB     . GLU B 2 16  ? 17.971  -3.742  7.232   1.00 0.00 ? 406 GLU B CB     2  
ATOM   6923   C  CG     . GLU B 2 16  ? 17.409  -4.596  6.109   1.00 0.00 ? 406 GLU B CG     2  
ATOM   6924   C  CD     . GLU B 2 16  ? 17.435  -6.070  6.446   1.00 0.00 ? 406 GLU B CD     2  
ATOM   6925   O  OE1    . GLU B 2 16  ? 18.495  -6.704  6.270   1.00 0.00 ? 406 GLU B OE1    2  
ATOM   6926   O  OE2    . GLU B 2 16  ? 16.401  -6.602  6.896   1.00 0.00 ? 406 GLU B OE2    2  
ATOM   6927   H  H      . GLU B 2 16  ? 19.400  -2.523  5.506   1.00 0.00 ? 406 GLU B H      2  
ATOM   6928   H  HA     . GLU B 2 16  ? 16.899  -1.986  6.644   1.00 0.00 ? 406 GLU B HA     2  
ATOM   6929   H  HB2    . GLU B 2 16  ? 19.004  -4.018  7.377   1.00 0.00 ? 406 GLU B HB2    2  
ATOM   6930   H  HB3    . GLU B 2 16  ? 17.423  -3.964  8.131   1.00 0.00 ? 406 GLU B HB3    2  
ATOM   6931   H  HG2    . GLU B 2 16  ? 16.387  -4.300  5.923   1.00 0.00 ? 406 GLU B HG2    2  
ATOM   6932   H  HG3    . GLU B 2 16  ? 17.999  -4.433  5.220   1.00 0.00 ? 406 GLU B HG3    2  
ATOM   6933   N  N      . PHE B 2 17  ? 19.481  -1.389  8.594   1.00 0.00 ? 407 PHE B N      2  
ATOM   6934   C  CA     . PHE B 2 17  ? 19.913  -0.656  9.779   1.00 0.00 ? 407 PHE B CA     2  
ATOM   6935   C  C      . PHE B 2 17  ? 19.565  0.825   9.668   1.00 0.00 ? 407 PHE B C      2  
ATOM   6936   O  O      . PHE B 2 17  ? 19.065  1.417   10.622  1.00 0.00 ? 407 PHE B O      2  
ATOM   6937   C  CB     . PHE B 2 17  ? 21.418  -0.822  9.990   1.00 0.00 ? 407 PHE B CB     2  
ATOM   6938   C  CG     . PHE B 2 17  ? 21.986  0.091   11.042  1.00 0.00 ? 407 PHE B CG     2  
ATOM   6939   C  CD1    . PHE B 2 17  ? 21.769  -0.157  12.388  1.00 0.00 ? 407 PHE B CD1    2  
ATOM   6940   C  CD2    . PHE B 2 17  ? 22.724  1.207   10.680  1.00 0.00 ? 407 PHE B CD2    2  
ATOM   6941   C  CE1    . PHE B 2 17  ? 22.282  0.691   13.354  1.00 0.00 ? 407 PHE B CE1    2  
ATOM   6942   C  CE2    . PHE B 2 17  ? 23.235  2.060   11.638  1.00 0.00 ? 407 PHE B CE2    2  
ATOM   6943   C  CZ     . PHE B 2 17  ? 23.014  1.802   12.979  1.00 0.00 ? 407 PHE B CZ     2  
ATOM   6944   H  H      . PHE B 2 17  ? 20.156  -1.833  8.036   1.00 0.00 ? 407 PHE B H      2  
ATOM   6945   H  HA     . PHE B 2 17  ? 19.394  -1.072  10.628  1.00 0.00 ? 407 PHE B HA     2  
ATOM   6946   H  HB2    . PHE B 2 17  ? 21.623  -1.838  10.287  1.00 0.00 ? 407 PHE B HB2    2  
ATOM   6947   H  HB3    . PHE B 2 17  ? 21.925  -0.617  9.060   1.00 0.00 ? 407 PHE B HB3    2  
ATOM   6948   H  HD1    . PHE B 2 17  ? 21.197  -1.024  12.683  1.00 0.00 ? 407 PHE B HD1    2  
ATOM   6949   H  HD2    . PHE B 2 17  ? 22.898  1.410   9.633   1.00 0.00 ? 407 PHE B HD2    2  
ATOM   6950   H  HE1    . PHE B 2 17  ? 22.106  0.487   14.400  1.00 0.00 ? 407 PHE B HE1    2  
ATOM   6951   H  HE2    . PHE B 2 17  ? 23.805  2.927   11.339  1.00 0.00 ? 407 PHE B HE2    2  
ATOM   6952   H  HZ     . PHE B 2 17  ? 23.413  2.468   13.732  1.00 0.00 ? 407 PHE B HZ     2  
ATOM   6953   N  N      . LEU B 2 18  ? 19.841  1.422   8.512   1.00 0.00 ? 408 LEU B N      2  
ATOM   6954   C  CA     . LEU B 2 18  ? 19.538  2.834   8.287   1.00 0.00 ? 408 LEU B CA     2  
ATOM   6955   C  C      . LEU B 2 18  ? 18.048  3.101   8.480   1.00 0.00 ? 408 LEU B C      2  
ATOM   6956   O  O      . LEU B 2 18  ? 17.649  3.997   9.240   1.00 0.00 ? 408 LEU B O      2  
ATOM   6957   C  CB     . LEU B 2 18  ? 19.969  3.257   6.878   1.00 0.00 ? 408 LEU B CB     2  
ATOM   6958   C  CG     . LEU B 2 18  ? 21.463  3.112   6.582   1.00 0.00 ? 408 LEU B CG     2  
ATOM   6959   C  CD1    . LEU B 2 18  ? 21.795  3.679   5.212   1.00 0.00 ? 408 LEU B CD1    2  
ATOM   6960   C  CD2    . LEU B 2 18  ? 22.292  3.787   7.663   1.00 0.00 ? 408 LEU B CD2    2  
ATOM   6961   H  H      . LEU B 2 18  ? 20.266  0.901   7.794   1.00 0.00 ? 408 LEU B H      2  
ATOM   6962   H  HA     . LEU B 2 18  ? 20.094  3.411   9.012   1.00 0.00 ? 408 LEU B HA     2  
ATOM   6963   H  HB2    . LEU B 2 18  ? 19.425  2.653   6.166   1.00 0.00 ? 408 LEU B HB2    2  
ATOM   6964   H  HB3    . LEU B 2 18  ? 19.691  4.292   6.730   1.00 0.00 ? 408 LEU B HB3    2  
ATOM   6965   H  HG     . LEU B 2 18  ? 21.717  2.063   6.573   1.00 0.00 ? 408 LEU B HG     2  
ATOM   6966   H  HD11   . LEU B 2 18  ? 21.225  3.152   4.460   1.00 0.00 ? 408 LEU B HD11   2  
ATOM   6967   H  HD12   . LEU B 2 18  ? 22.851  3.554   5.018   1.00 0.00 ? 408 LEU B HD12   2  
ATOM   6968   H  HD13   . LEU B 2 18  ? 21.546  4.728   5.185   1.00 0.00 ? 408 LEU B HD13   2  
ATOM   6969   H  HD21   . LEU B 2 18  ? 23.340  3.715   7.411   1.00 0.00 ? 408 LEU B HD21   2  
ATOM   6970   H  HD22   . LEU B 2 18  ? 22.114  3.291   8.608   1.00 0.00 ? 408 LEU B HD22   2  
ATOM   6971   H  HD23   . LEU B 2 18  ? 22.007  4.825   7.743   1.00 0.00 ? 408 LEU B HD23   2  
ATOM   6972   N  N      . LEU B 2 19  ? 17.235  2.301   7.802   1.00 0.00 ? 409 LEU B N      2  
ATOM   6973   C  CA     . LEU B 2 19  ? 15.787  2.399   7.916   1.00 0.00 ? 409 LEU B CA     2  
ATOM   6974   C  C      . LEU B 2 19  ? 15.369  2.185   9.363   1.00 0.00 ? 409 LEU B C      2  
ATOM   6975   O  O      . LEU B 2 19  ? 14.610  2.970   9.924   1.00 0.00 ? 409 LEU B O      2  
ATOM   6976   C  CB     . LEU B 2 19  ? 15.122  1.348   7.025   1.00 0.00 ? 409 LEU B CB     2  
ATOM   6977   C  CG     . LEU B 2 19  ? 13.613  1.517   6.836   1.00 0.00 ? 409 LEU B CG     2  
ATOM   6978   C  CD1    . LEU B 2 19  ? 13.290  2.883   6.248   1.00 0.00 ? 409 LEU B CD1    2  
ATOM   6979   C  CD2    . LEU B 2 19  ? 13.070  0.415   5.943   1.00 0.00 ? 409 LEU B CD2    2  
ATOM   6980   H  H      . LEU B 2 19  ? 17.622  1.626   7.200   1.00 0.00 ? 409 LEU B H      2  
ATOM   6981   H  HA     . LEU B 2 19  ? 15.484  3.383   7.596   1.00 0.00 ? 409 LEU B HA     2  
ATOM   6982   H  HB2    . LEU B 2 19  ? 15.597  1.373   6.058   1.00 0.00 ? 409 LEU B HB2    2  
ATOM   6983   H  HB3    . LEU B 2 19  ? 15.296  0.377   7.464   1.00 0.00 ? 409 LEU B HB3    2  
ATOM   6984   H  HG     . LEU B 2 19  ? 13.123  1.442   7.796   1.00 0.00 ? 409 LEU B HG     2  
ATOM   6985   H  HD11   . LEU B 2 19  ? 12.219  2.990   6.156   1.00 0.00 ? 409 LEU B HD11   2  
ATOM   6986   H  HD12   . LEU B 2 19  ? 13.746  2.973   5.274   1.00 0.00 ? 409 LEU B HD12   2  
ATOM   6987   H  HD13   . LEU B 2 19  ? 13.673  3.656   6.898   1.00 0.00 ? 409 LEU B HD13   2  
ATOM   6988   H  HD21   . LEU B 2 19  ? 13.566  0.453   4.984   1.00 0.00 ? 409 LEU B HD21   2  
ATOM   6989   H  HD22   . LEU B 2 19  ? 12.008  0.556   5.804   1.00 0.00 ? 409 LEU B HD22   2  
ATOM   6990   H  HD23   . LEU B 2 19  ? 13.248  -0.545  6.405   1.00 0.00 ? 409 LEU B HD23   2  
ATOM   6991   N  N      . ASN B 2 20  ? 15.907  1.122   9.948   1.00 0.00 ? 410 ASN B N      2  
ATOM   6992   C  CA     . ASN B 2 20  ? 15.656  0.758   11.347  1.00 0.00 ? 410 ASN B CA     2  
ATOM   6993   C  C      . ASN B 2 20  ? 16.001  1.901   12.299  1.00 0.00 ? 410 ASN B C      2  
ATOM   6994   O  O      . ASN B 2 20  ? 15.279  2.151   13.265  1.00 0.00 ? 410 ASN B O      2  
ATOM   6995   C  CB     . ASN B 2 20  ? 16.483  -0.477  11.725  1.00 0.00 ? 410 ASN B CB     2  
ATOM   6996   C  CG     . ASN B 2 20  ? 16.239  -0.941  13.148  1.00 0.00 ? 410 ASN B CG     2  
ATOM   6997   O  OD1    . ASN B 2 20  ? 15.135  -0.819  13.678  1.00 0.00 ? 410 ASN B OD1    2  
ATOM   6998   N  ND2    . ASN B 2 20  ? 17.272  -1.487  13.770  1.00 0.00 ? 410 ASN B ND2    2  
ATOM   6999   H  H      . ASN B 2 20  ? 16.490  0.542   9.405   1.00 0.00 ? 410 ASN B H      2  
ATOM   7000   H  HA     . ASN B 2 20  ? 14.607  0.521   11.451  1.00 0.00 ? 410 ASN B HA     2  
ATOM   7001   H  HB2    . ASN B 2 20  ? 16.240  -1.290  11.055  1.00 0.00 ? 410 ASN B HB2    2  
ATOM   7002   H  HB3    . ASN B 2 20  ? 17.531  -0.241  11.624  1.00 0.00 ? 410 ASN B HB3    2  
ATOM   7003   H  HD21   . ASN B 2 20  ? 18.119  -1.567  13.276  1.00 0.00 ? 410 ASN B HD21   2  
ATOM   7004   H  HD22   . ASN B 2 20  ? 17.160  -1.773  14.703  1.00 0.00 ? 410 ASN B HD22   2  
ATOM   7005   N  N      . SER B 2 21  ? 17.093  2.599   12.014  1.00 0.00 ? 411 SER B N      2  
ATOM   7006   C  CA     . SER B 2 21  ? 17.560  3.680   12.870  1.00 0.00 ? 411 SER B CA     2  
ATOM   7007   C  C      . SER B 2 21  ? 16.487  4.753   13.004  1.00 0.00 ? 411 SER B C      2  
ATOM   7008   O  O      . SER B 2 21  ? 16.083  5.104   14.116  1.00 0.00 ? 411 SER B O      2  
ATOM   7009   C  CB     . SER B 2 21  ? 18.859  4.272   12.308  1.00 0.00 ? 411 SER B CB     2  
ATOM   7010   O  OG     . SER B 2 21  ? 19.386  5.284   13.153  1.00 0.00 ? 411 SER B OG     2  
ATOM   7011   H  H      . SER B 2 21  ? 17.609  2.372   11.208  1.00 0.00 ? 411 SER B H      2  
ATOM   7012   H  HA     . SER B 2 21  ? 17.757  3.265   13.847  1.00 0.00 ? 411 SER B HA     2  
ATOM   7013   H  HB2    . SER B 2 21  ? 19.594  3.488   12.213  1.00 0.00 ? 411 SER B HB2    2  
ATOM   7014   H  HB3    . SER B 2 21  ? 18.663  4.699   11.335  1.00 0.00 ? 411 SER B HB3    2  
ATOM   7015   H  HG     . SER B 2 21  ? 18.940  5.260   14.013  1.00 0.00 ? 411 SER B HG     2  
ATOM   7016   N  N      . LEU B 2 22  ? 15.991  5.253   11.879  1.00 0.00 ? 412 LEU B N      2  
ATOM   7017   C  CA     . LEU B 2 22  ? 14.918  6.239   11.932  1.00 0.00 ? 412 LEU B CA     2  
ATOM   7018   C  C      . LEU B 2 22  ? 13.601  5.576   12.329  1.00 0.00 ? 412 LEU B C      2  
ATOM   7019   O  O      . LEU B 2 22  ? 12.759  6.185   12.981  1.00 0.00 ? 412 LEU B O      2  
ATOM   7020   C  CB     . LEU B 2 22  ? 14.753  6.978   10.599  1.00 0.00 ? 412 LEU B CB     2  
ATOM   7021   C  CG     . LEU B 2 22  ? 15.889  7.939   10.221  1.00 0.00 ? 412 LEU B CG     2  
ATOM   7022   C  CD1    . LEU B 2 22  ? 16.984  7.212   9.457   1.00 0.00 ? 412 LEU B CD1    2  
ATOM   7023   C  CD2    . LEU B 2 22  ? 15.350  9.107   9.405   1.00 0.00 ? 412 LEU B CD2    2  
ATOM   7024   H  H      . LEU B 2 22  ? 16.352  4.959   11.009  1.00 0.00 ? 412 LEU B H      2  
ATOM   7025   H  HA     . LEU B 2 22  ? 15.178  6.955   12.697  1.00 0.00 ? 412 LEU B HA     2  
ATOM   7026   H  HB2    . LEU B 2 22  ? 14.663  6.239   9.815   1.00 0.00 ? 412 LEU B HB2    2  
ATOM   7027   H  HB3    . LEU B 2 22  ? 13.834  7.542   10.642  1.00 0.00 ? 412 LEU B HB3    2  
ATOM   7028   H  HG     . LEU B 2 22  ? 16.326  8.337   11.127  1.00 0.00 ? 412 LEU B HG     2  
ATOM   7029   H  HD11   . LEU B 2 22  ? 17.380  6.412   10.064  1.00 0.00 ? 412 LEU B HD11   2  
ATOM   7030   H  HD12   . LEU B 2 22  ? 17.775  7.905   9.213   1.00 0.00 ? 412 LEU B HD12   2  
ATOM   7031   H  HD13   . LEU B 2 22  ? 16.574  6.801   8.543   1.00 0.00 ? 412 LEU B HD13   2  
ATOM   7032   H  HD21   . LEU B 2 22  ? 14.889  8.732   8.503   1.00 0.00 ? 412 LEU B HD21   2  
ATOM   7033   H  HD22   . LEU B 2 22  ? 16.162  9.771   9.146   1.00 0.00 ? 412 LEU B HD22   2  
ATOM   7034   H  HD23   . LEU B 2 22  ? 14.616  9.644   9.987   1.00 0.00 ? 412 LEU B HD23   2  
ATOM   7035   N  N      . HIS B 2 23  ? 13.446  4.314   11.950  1.00 0.00 ? 413 HIS B N      2  
ATOM   7036   C  CA     . HIS B 2 23  ? 12.235  3.555   12.243  1.00 0.00 ? 413 HIS B CA     2  
ATOM   7037   C  C      . HIS B 2 23  ? 11.974  3.505   13.744  1.00 0.00 ? 413 HIS B C      2  
ATOM   7038   O  O      . HIS B 2 23  ? 10.844  3.682   14.190  1.00 0.00 ? 413 HIS B O      2  
ATOM   7039   C  CB     . HIS B 2 23  ? 12.368  2.135   11.693  1.00 0.00 ? 413 HIS B CB     2  
ATOM   7040   C  CG     . HIS B 2 23  ? 11.132  1.636   11.023  1.00 0.00 ? 413 HIS B CG     2  
ATOM   7041   N  ND1    . HIS B 2 23  ? 10.361  0.613   11.526  1.00 0.00 ? 413 HIS B ND1    2  
ATOM   7042   C  CD2    . HIS B 2 23  ? 10.545  2.018   9.866   1.00 0.00 ? 413 HIS B CD2    2  
ATOM   7043   C  CE1    . HIS B 2 23  ? 9.350   0.388   10.707  1.00 0.00 ? 413 HIS B CE1    2  
ATOM   7044   N  NE2    . HIS B 2 23  ? 9.435   1.230   9.692   1.00 0.00 ? 413 HIS B NE2    2  
ATOM   7045   H  H      . HIS B 2 23  ? 14.168  3.879   11.444  1.00 0.00 ? 413 HIS B H      2  
ATOM   7046   H  HA     . HIS B 2 23  ? 11.403  4.042   11.756  1.00 0.00 ? 413 HIS B HA     2  
ATOM   7047   H  HB2    . HIS B 2 23  ? 13.168  2.112   10.966  1.00 0.00 ? 413 HIS B HB2    2  
ATOM   7048   H  HB3    . HIS B 2 23  ? 12.605  1.461   12.504  1.00 0.00 ? 413 HIS B HB3    2  
ATOM   7049   H  HD1    . HIS B 2 23  ? 10.544  0.106   12.356  1.00 0.00 ? 413 HIS B HD1    2  
ATOM   7050   H  HD2    . HIS B 2 23  ? 10.893  2.794   9.199   1.00 0.00 ? 413 HIS B HD2    2  
ATOM   7051   H  HE1    . HIS B 2 23  ? 8.584   -0.364  10.842  1.00 0.00 ? 413 HIS B HE1    2  
ATOM   7052   H  HE2    . HIS B 2 23  ? 8.928   1.151   8.854   1.00 0.00 ? 413 HIS B HE2    2  
ATOM   7053   N  N      . ARG B 2 24  ? 13.025  3.262   14.516  1.00 0.00 ? 414 ARG B N      2  
ATOM   7054   C  CA     . ARG B 2 24  ? 12.909  3.184   15.968  1.00 0.00 ? 414 ARG B CA     2  
ATOM   7055   C  C      . ARG B 2 24  ? 12.788  4.569   16.598  1.00 0.00 ? 414 ARG B C      2  
ATOM   7056   O  O      . ARG B 2 24  ? 12.013  4.767   17.531  1.00 0.00 ? 414 ARG B O      2  
ATOM   7057   C  CB     . ARG B 2 24  ? 14.116  2.452   16.554  1.00 0.00 ? 414 ARG B CB     2  
ATOM   7058   C  CG     . ARG B 2 24  ? 14.165  0.978   16.193  1.00 0.00 ? 414 ARG B CG     2  
ATOM   7059   C  CD     . ARG B 2 24  ? 15.370  0.292   16.817  1.00 0.00 ? 414 ARG B CD     2  
ATOM   7060   N  NE     . ARG B 2 24  ? 15.327  0.331   18.277  1.00 0.00 ? 414 ARG B NE     2  
ATOM   7061   C  CZ     . ARG B 2 24  ? 16.382  0.591   19.052  1.00 0.00 ? 414 ARG B CZ     2  
ATOM   7062   N  NH1    . ARG B 2 24  ? 17.567  0.854   18.511  1.00 0.00 ? 414 ARG B NH1    2  
ATOM   7063   N  NH2    . ARG B 2 24  ? 16.249  0.594   20.370  1.00 0.00 ? 414 ARG B NH2    2  
ATOM   7064   H  H      . ARG B 2 24  ? 13.907  3.124   14.097  1.00 0.00 ? 414 ARG B H      2  
ATOM   7065   H  HA     . ARG B 2 24  ? 12.016  2.622   16.198  1.00 0.00 ? 414 ARG B HA     2  
ATOM   7066   H  HB2    . ARG B 2 24  ? 15.019  2.922   16.187  1.00 0.00 ? 414 ARG B HB2    2  
ATOM   7067   H  HB3    . ARG B 2 24  ? 14.089  2.536   17.629  1.00 0.00 ? 414 ARG B HB3    2  
ATOM   7068   H  HG2    . ARG B 2 24  ? 13.264  0.501   16.551  1.00 0.00 ? 414 ARG B HG2    2  
ATOM   7069   H  HG3    . ARG B 2 24  ? 14.222  0.882   15.118  1.00 0.00 ? 414 ARG B HG3    2  
ATOM   7070   H  HD2    . ARG B 2 24  ? 15.387  -0.738  16.496  1.00 0.00 ? 414 ARG B HD2    2  
ATOM   7071   H  HD3    . ARG B 2 24  ? 16.267  0.789   16.478  1.00 0.00 ? 414 ARG B HD3    2  
ATOM   7072   H  HE     . ARG B 2 24  ? 14.461  0.151   18.706  1.00 0.00 ? 414 ARG B HE     2  
ATOM   7073   H  HH11   . ARG B 2 24  ? 17.681  0.865   17.513  1.00 0.00 ? 414 ARG B HH11   2  
ATOM   7074   H  HH12   . ARG B 2 24  ? 18.364  1.039   19.103  1.00 0.00 ? 414 ARG B HH12   2  
ATOM   7075   H  HH21   . ARG B 2 24  ? 15.354  0.392   20.791  1.00 0.00 ? 414 ARG B HH21   2  
ATOM   7076   H  HH22   . ARG B 2 24  ? 17.034  0.817   20.958  1.00 0.00 ? 414 ARG B HH22   2  
ATOM   7077   N  N      . ASP B 2 25  ? 13.550  5.520   16.077  1.00 0.00 ? 415 ASP B N      2  
ATOM   7078   C  CA     . ASP B 2 25  ? 13.593  6.869   16.637  1.00 0.00 ? 415 ASP B CA     2  
ATOM   7079   C  C      . ASP B 2 25  ? 12.260  7.591   16.454  1.00 0.00 ? 415 ASP B C      2  
ATOM   7080   O  O      . ASP B 2 25  ? 11.690  8.123   17.407  1.00 0.00 ? 415 ASP B O      2  
ATOM   7081   C  CB     . ASP B 2 25  ? 14.713  7.672   15.982  1.00 0.00 ? 415 ASP B CB     2  
ATOM   7082   C  CG     . ASP B 2 25  ? 14.875  9.048   16.593  1.00 0.00 ? 415 ASP B CG     2  
ATOM   7083   O  OD1    . ASP B 2 25  ? 15.446  9.142   17.700  1.00 0.00 ? 415 ASP B OD1    2  
ATOM   7084   O  OD2    . ASP B 2 25  ? 14.455  10.034  15.959  1.00 0.00 ? 415 ASP B OD2    2  
ATOM   7085   H  H      . ASP B 2 25  ? 14.105  5.313   15.293  1.00 0.00 ? 415 ASP B H      2  
ATOM   7086   H  HA     . ASP B 2 25  ? 13.799  6.781   17.693  1.00 0.00 ? 415 ASP B HA     2  
ATOM   7087   H  HB2    . ASP B 2 25  ? 15.643  7.138   16.093  1.00 0.00 ? 415 ASP B HB2    2  
ATOM   7088   H  HB3    . ASP B 2 25  ? 14.494  7.790   14.930  1.00 0.00 ? 415 ASP B HB3    2  
ATOM   7089   N  N      . LEU B 2 26  ? 11.753  7.571   15.227  1.00 0.00 ? 416 LEU B N      2  
ATOM   7090   C  CA     . LEU B 2 26  ? 10.515  8.264   14.881  1.00 0.00 ? 416 LEU B CA     2  
ATOM   7091   C  C      . LEU B 2 26  ? 9.319   7.698   15.653  1.00 0.00 ? 416 LEU B C      2  
ATOM   7092   O  O      . LEU B 2 26  ? 8.310   8.380   15.835  1.00 0.00 ? 416 LEU B O      2  
ATOM   7093   C  CB     . LEU B 2 26  ? 10.252  8.186   13.373  1.00 0.00 ? 416 LEU B CB     2  
ATOM   7094   C  CG     . LEU B 2 26  ? 11.365  8.741   12.471  1.00 0.00 ? 416 LEU B CG     2  
ATOM   7095   C  CD1    . LEU B 2 26  ? 10.937  8.698   11.013  1.00 0.00 ? 416 LEU B CD1    2  
ATOM   7096   C  CD2    . LEU B 2 26  ? 11.739  10.160  12.870  1.00 0.00 ? 416 LEU B CD2    2  
ATOM   7097   H  H      . LEU B 2 26  ? 12.232  7.078   14.524  1.00 0.00 ? 416 LEU B H      2  
ATOM   7098   H  HA     . LEU B 2 26  ? 10.637  9.303   15.157  1.00 0.00 ? 416 LEU B HA     2  
ATOM   7099   H  HB2    . LEU B 2 26  ? 10.093  7.149   13.113  1.00 0.00 ? 416 LEU B HB2    2  
ATOM   7100   H  HB3    . LEU B 2 26  ? 9.346   8.733   13.162  1.00 0.00 ? 416 LEU B HB3    2  
ATOM   7101   H  HG     . LEU B 2 26  ? 12.245  8.120   12.574  1.00 0.00 ? 416 LEU B HG     2  
ATOM   7102   H  HD11   . LEU B 2 26  ? 10.721  7.678   10.730  1.00 0.00 ? 416 LEU B HD11   2  
ATOM   7103   H  HD12   . LEU B 2 26  ? 11.732  9.084   10.392  1.00 0.00 ? 416 LEU B HD12   2  
ATOM   7104   H  HD13   . LEU B 2 26  ? 10.051  9.302   10.881  1.00 0.00 ? 416 LEU B HD13   2  
ATOM   7105   H  HD21   . LEU B 2 26  ? 12.093  10.167  13.890  1.00 0.00 ? 416 LEU B HD21   2  
ATOM   7106   H  HD22   . LEU B 2 26  ? 10.871  10.797  12.784  1.00 0.00 ? 416 LEU B HD22   2  
ATOM   7107   H  HD23   . LEU B 2 26  ? 12.517  10.523  12.215  1.00 0.00 ? 416 LEU B HD23   2  
ATOM   7108   N  N      . GLN B 2 27  ? 9.425   6.438   16.083  1.00 0.00 ? 417 GLN B N      2  
ATOM   7109   C  CA     . GLN B 2 27  ? 8.376   5.794   16.869  1.00 0.00 ? 417 GLN B CA     2  
ATOM   7110   C  C      . GLN B 2 27  ? 8.149   6.520   18.199  1.00 0.00 ? 417 GLN B C      2  
ATOM   7111   O  O      . GLN B 2 27  ? 7.117   6.339   18.846  1.00 0.00 ? 417 GLN B O      2  
ATOM   7112   C  CB     . GLN B 2 27  ? 8.738   4.331   17.129  1.00 0.00 ? 417 GLN B CB     2  
ATOM   7113   C  CG     . GLN B 2 27  ? 8.198   3.358   16.091  1.00 0.00 ? 417 GLN B CG     2  
ATOM   7114   C  CD     . GLN B 2 27  ? 8.680   1.939   16.330  1.00 0.00 ? 417 GLN B CD     2  
ATOM   7115   O  OE1    . GLN B 2 27  ? 8.032   1.161   17.022  1.00 0.00 ? 417 GLN B OE1    2  
ATOM   7116   N  NE2    . GLN B 2 27  ? 9.825   1.596   15.762  1.00 0.00 ? 417 GLN B NE2    2  
ATOM   7117   H  H      . GLN B 2 27  ? 10.239  5.931   15.886  1.00 0.00 ? 417 GLN B H      2  
ATOM   7118   H  HA     . GLN B 2 27  ? 7.463   5.831   16.294  1.00 0.00 ? 417 GLN B HA     2  
ATOM   7119   H  HB2    . GLN B 2 27  ? 9.814   4.240   17.143  1.00 0.00 ? 417 GLN B HB2    2  
ATOM   7120   H  HB3    . GLN B 2 27  ? 8.356   4.049   18.092  1.00 0.00 ? 417 GLN B HB3    2  
ATOM   7121   H  HG2    . GLN B 2 27  ? 7.116   3.360   16.137  1.00 0.00 ? 417 GLN B HG2    2  
ATOM   7122   H  HG3    . GLN B 2 27  ? 8.521   3.675   15.110  1.00 0.00 ? 417 GLN B HG3    2  
ATOM   7123   H  HE21   . GLN B 2 27  ? 10.296  2.271   15.223  1.00 0.00 ? 417 GLN B HE21   2  
ATOM   7124   H  HE22   . GLN B 2 27  ? 10.159  0.686   15.909  1.00 0.00 ? 417 GLN B HE22   2  
ATOM   7125   N  N      . GLY B 2 28  ? 9.113   7.345   18.595  1.00 0.00 ? 418 GLY B N      2  
ATOM   7126   C  CA     . GLY B 2 28  ? 8.987   8.102   19.827  1.00 0.00 ? 418 GLY B CA     2  
ATOM   7127   C  C      . GLY B 2 28  ? 8.083   9.315   19.679  1.00 0.00 ? 418 GLY B C      2  
ATOM   7128   O  O      . GLY B 2 28  ? 7.840   10.037  20.645  1.00 0.00 ? 418 GLY B O      2  
ATOM   7129   H  H      . GLY B 2 28  ? 9.926   7.435   18.048  1.00 0.00 ? 418 GLY B H      2  
ATOM   7130   H  HA2    . GLY B 2 28  ? 8.580   7.457   20.592  1.00 0.00 ? 418 GLY B HA2    2  
ATOM   7131   H  HA3    . GLY B 2 28  ? 9.968   8.433   20.135  1.00 0.00 ? 418 GLY B HA3    2  
ATOM   7132   N  N      . GLY B 2 29  ? 7.596   9.547   18.468  1.00 0.00 ? 419 GLY B N      2  
ATOM   7133   C  CA     . GLY B 2 29  ? 6.692   10.656  18.227  1.00 0.00 ? 419 GLY B CA     2  
ATOM   7134   C  C      . GLY B 2 29  ? 7.353   11.771  17.454  1.00 0.00 ? 419 GLY B C      2  
ATOM   7135   O  O      . GLY B 2 29  ? 6.680   12.622  16.874  1.00 0.00 ? 419 GLY B O      2  
ATOM   7136   H  H      . GLY B 2 29  ? 7.854   8.959   17.724  1.00 0.00 ? 419 GLY B H      2  
ATOM   7137   H  HA2    . GLY B 2 29  ? 5.842   10.296  17.665  1.00 0.00 ? 419 GLY B HA2    2  
ATOM   7138   H  HA3    . GLY B 2 29  ? 6.347   11.044  19.171  1.00 0.00 ? 419 GLY B HA3    2  
ATOM   7139   N  N      . ILE B 2 30  ? 8.674   11.769  17.454  1.00 0.00 ? 420 ILE B N      2  
ATOM   7140   C  CA     . ILE B 2 30  ? 9.435   12.762  16.715  1.00 0.00 ? 420 ILE B CA     2  
ATOM   7141   C  C      . ILE B 2 30  ? 9.394   12.447  15.230  1.00 0.00 ? 420 ILE B C      2  
ATOM   7142   O  O      . ILE B 2 30  ? 9.709   11.333  14.823  1.00 0.00 ? 420 ILE B O      2  
ATOM   7143   C  CB     . ILE B 2 30  ? 10.912  12.806  17.167  1.00 0.00 ? 420 ILE B CB     2  
ATOM   7144   C  CG1    . ILE B 2 30  ? 11.001  13.085  18.669  1.00 0.00 ? 420 ILE B CG1    2  
ATOM   7145   C  CG2    . ILE B 2 30  ? 11.685  13.856  16.370  1.00 0.00 ? 420 ILE B CG2    2  
ATOM   7146   C  CD1    . ILE B 2 30  ? 12.416  13.065  19.211  1.00 0.00 ? 420 ILE B CD1    2  
ATOM   7147   H  H      . ILE B 2 30  ? 9.152   11.078  17.956  1.00 0.00 ? 420 ILE B H      2  
ATOM   7148   H  HA     . ILE B 2 30  ? 8.989   13.730  16.888  1.00 0.00 ? 420 ILE B HA     2  
ATOM   7149   H  HB     . ILE B 2 30  ? 11.351  11.843  16.962  1.00 0.00 ? 420 ILE B HB     2  
ATOM   7150   H  HG12   . ILE B 2 30  ? 10.581  14.057  18.872  1.00 0.00 ? 420 ILE B HG12   2  
ATOM   7151   H  HG13   . ILE B 2 30  ? 10.432  12.336  19.201  1.00 0.00 ? 420 ILE B HG13   2  
ATOM   7152   H  HG21   . ILE B 2 30  ? 11.236  14.827  16.518  1.00 0.00 ? 420 ILE B HG21   2  
ATOM   7153   H  HG22   . ILE B 2 30  ? 11.657  13.605  15.319  1.00 0.00 ? 420 ILE B HG22   2  
ATOM   7154   H  HG23   . ILE B 2 30  ? 12.711  13.878  16.706  1.00 0.00 ? 420 ILE B HG23   2  
ATOM   7155   H  HD11   . ILE B 2 30  ? 13.000  13.830  18.722  1.00 0.00 ? 420 ILE B HD11   2  
ATOM   7156   H  HD12   . ILE B 2 30  ? 12.859  12.097  19.024  1.00 0.00 ? 420 ILE B HD12   2  
ATOM   7157   H  HD13   . ILE B 2 30  ? 12.398  13.253  20.276  1.00 0.00 ? 420 ILE B HD13   2  
ATOM   7158   N  N      . LYS B 2 31  ? 8.992   13.415  14.427  1.00 0.00 ? 421 LYS B N      2  
ATOM   7159   C  CA     . LYS B 2 31  ? 9.047   13.261  12.988  1.00 0.00 ? 421 LYS B CA     2  
ATOM   7160   C  C      . LYS B 2 31  ? 9.162   14.618  12.316  1.00 0.00 ? 421 LYS B C      2  
ATOM   7161   O  O      . LYS B 2 31  ? 8.749   15.642  12.861  1.00 0.00 ? 421 LYS B O      2  
ATOM   7162   C  CB     . LYS B 2 31  ? 7.834   12.499  12.442  1.00 0.00 ? 421 LYS B CB     2  
ATOM   7163   C  CG     . LYS B 2 31  ? 6.562   13.324  12.344  1.00 0.00 ? 421 LYS B CG     2  
ATOM   7164   C  CD     . LYS B 2 31  ? 5.590   12.688  11.363  1.00 0.00 ? 421 LYS B CD     2  
ATOM   7165   C  CE     . LYS B 2 31  ? 4.453   13.627  10.996  1.00 0.00 ? 421 LYS B CE     2  
ATOM   7166   N  NZ     . LYS B 2 31  ? 3.697   13.146  9.807   1.00 0.00 ? 421 LYS B NZ     2  
ATOM   7167   H  H      . LYS B 2 31  ? 8.661   14.255  14.810  1.00 0.00 ? 421 LYS B H      2  
ATOM   7168   H  HA     . LYS B 2 31  ? 9.941   12.696  12.759  1.00 0.00 ? 421 LYS B HA     2  
ATOM   7169   H  HB2    . LYS B 2 31  ? 8.072   12.133  11.456  1.00 0.00 ? 421 LYS B HB2    2  
ATOM   7170   H  HB3    . LYS B 2 31  ? 7.640   11.655  13.088  1.00 0.00 ? 421 LYS B HB3    2  
ATOM   7171   H  HG2    . LYS B 2 31  ? 6.101   13.376  13.320  1.00 0.00 ? 421 LYS B HG2    2  
ATOM   7172   H  HG3    . LYS B 2 31  ? 6.814   14.317  12.002  1.00 0.00 ? 421 LYS B HG3    2  
ATOM   7173   H  HD2    . LYS B 2 31  ? 6.125   12.421  10.464  1.00 0.00 ? 421 LYS B HD2    2  
ATOM   7174   H  HD3    . LYS B 2 31  ? 5.175   11.798  11.812  1.00 0.00 ? 421 LYS B HD3    2  
ATOM   7175   H  HE2    . LYS B 2 31  ? 3.777   13.697  11.838  1.00 0.00 ? 421 LYS B HE2    2  
ATOM   7176   H  HE3    . LYS B 2 31  ? 4.862   14.603  10.783  1.00 0.00 ? 421 LYS B HE3    2  
ATOM   7177   H  HZ1    . LYS B 2 31  ? 4.355   12.961  9.009   1.00 0.00 ? 421 LYS B HZ1    2  
ATOM   7178   H  HZ2    . LYS B 2 31  ? 3.009   13.870  9.506   1.00 0.00 ? 421 LYS B HZ2    2  
ATOM   7179   H  HZ3    . LYS B 2 31  ? 3.188   12.271  10.031  1.00 0.00 ? 421 LYS B HZ3    2  
ATOM   7180   N  N      . ASP B 2 32  ? 9.736   14.606  11.135  1.00 0.00 ? 422 ASP B N      2  
ATOM   7181   C  CA     . ASP B 2 32  ? 9.958   15.807  10.356  1.00 0.00 ? 422 ASP B CA     2  
ATOM   7182   C  C      . ASP B 2 32  ? 9.863   15.441  8.886   1.00 0.00 ? 422 ASP B C      2  
ATOM   7183   O  O      . ASP B 2 32  ? 9.963   14.260  8.547   1.00 0.00 ? 422 ASP B O      2  
ATOM   7184   C  CB     . ASP B 2 32  ? 11.336  16.393  10.682  1.00 0.00 ? 422 ASP B CB     2  
ATOM   7185   C  CG     . ASP B 2 32  ? 11.663  17.635  9.876   1.00 0.00 ? 422 ASP B CG     2  
ATOM   7186   O  OD1    . ASP B 2 32  ? 11.261  18.737  10.288  1.00 0.00 ? 422 ASP B OD1    2  
ATOM   7187   O  OD2    . ASP B 2 32  ? 12.314  17.502  8.817   1.00 0.00 ? 422 ASP B OD2    2  
ATOM   7188   H  H      . ASP B 2 32  ? 10.011  13.747  10.754  1.00 0.00 ? 422 ASP B H      2  
ATOM   7189   H  HA     . ASP B 2 32  ? 9.187   16.524  10.601  1.00 0.00 ? 422 ASP B HA     2  
ATOM   7190   H  HB2    . ASP B 2 32  ? 11.374  16.644  11.736  1.00 0.00 ? 422 ASP B HB2    2  
ATOM   7191   H  HB3    . ASP B 2 32  ? 12.089  15.646  10.475  1.00 0.00 ? 422 ASP B HB3    2  
ATOM   7192   N  N      . LEU B 2 33  ? 9.690   16.426  8.018   1.00 0.00 ? 423 LEU B N      2  
ATOM   7193   C  CA     . LEU B 2 33  ? 9.557   16.156  6.591   1.00 0.00 ? 423 LEU B CA     2  
ATOM   7194   C  C      . LEU B 2 33  ? 10.809  15.478  6.054   1.00 0.00 ? 423 LEU B C      2  
ATOM   7195   O  O      . LEU B 2 33  ? 10.738  14.631  5.167   1.00 0.00 ? 423 LEU B O      2  
ATOM   7196   C  CB     . LEU B 2 33  ? 9.287   17.437  5.788   1.00 0.00 ? 423 LEU B CB     2  
ATOM   7197   C  CG     . LEU B 2 33  ? 7.883   18.048  5.918   1.00 0.00 ? 423 LEU B CG     2  
ATOM   7198   C  CD1    . LEU B 2 33  ? 6.811   17.000  5.671   1.00 0.00 ? 423 LEU B CD1    2  
ATOM   7199   C  CD2    . LEU B 2 33  ? 7.682   18.707  7.275   1.00 0.00 ? 423 LEU B CD2    2  
ATOM   7200   H  H      . LEU B 2 33  ? 9.663   17.352  8.339   1.00 0.00 ? 423 LEU B H      2  
ATOM   7201   H  HA     . LEU B 2 33  ? 8.730   15.480  6.471   1.00 0.00 ? 423 LEU B HA     2  
ATOM   7202   H  HB2    . LEU B 2 33  ? 10.005  18.182  6.096   1.00 0.00 ? 423 LEU B HB2    2  
ATOM   7203   H  HB3    . LEU B 2 33  ? 9.457   17.217  4.744   1.00 0.00 ? 423 LEU B HB3    2  
ATOM   7204   H  HG     . LEU B 2 33  ? 7.771   18.811  5.159   1.00 0.00 ? 423 LEU B HG     2  
ATOM   7205   H  HD11   . LEU B 2 33  ? 6.943   16.574  4.688   1.00 0.00 ? 423 LEU B HD11   2  
ATOM   7206   H  HD12   . LEU B 2 33  ? 5.836   17.460  5.736   1.00 0.00 ? 423 LEU B HD12   2  
ATOM   7207   H  HD13   . LEU B 2 33  ? 6.891   16.222  6.414   1.00 0.00 ? 423 LEU B HD13   2  
ATOM   7208   H  HD21   . LEU B 2 33  ? 7.698   17.953  8.047   1.00 0.00 ? 423 LEU B HD21   2  
ATOM   7209   H  HD22   . LEU B 2 33  ? 6.730   19.217  7.291   1.00 0.00 ? 423 LEU B HD22   2  
ATOM   7210   H  HD23   . LEU B 2 33  ? 8.474   19.419  7.451   1.00 0.00 ? 423 LEU B HD23   2  
ATOM   7211   N  N      . SER B 2 34  ? 11.955  15.842  6.613   1.00 0.00 ? 424 SER B N      2  
ATOM   7212   C  CA     . SER B 2 34  ? 13.220  15.264  6.199   1.00 0.00 ? 424 SER B CA     2  
ATOM   7213   C  C      . SER B 2 34  ? 13.270  13.783  6.563   1.00 0.00 ? 424 SER B C      2  
ATOM   7214   O  O      . SER B 2 34  ? 13.882  12.980  5.862   1.00 0.00 ? 424 SER B O      2  
ATOM   7215   C  CB     . SER B 2 34  ? 14.368  16.011  6.870   1.00 0.00 ? 424 SER B CB     2  
ATOM   7216   O  OG     . SER B 2 34  ? 14.128  17.410  6.868   1.00 0.00 ? 424 SER B OG     2  
ATOM   7217   H  H      . SER B 2 34  ? 11.951  16.525  7.327   1.00 0.00 ? 424 SER B H      2  
ATOM   7218   H  HA     . SER B 2 34  ? 13.305  15.369  5.127   1.00 0.00 ? 424 SER B HA     2  
ATOM   7219   H  HB2    . SER B 2 34  ? 14.465  15.676  7.891   1.00 0.00 ? 424 SER B HB2    2  
ATOM   7220   H  HB3    . SER B 2 34  ? 15.285  15.814  6.334   1.00 0.00 ? 424 SER B HB3    2  
ATOM   7221   H  HG     . SER B 2 34  ? 13.583  17.639  7.640   1.00 0.00 ? 424 SER B HG     2  
ATOM   7222   N  N      . LYS B 2 35  ? 12.613  13.431  7.664   1.00 0.00 ? 425 LYS B N      2  
ATOM   7223   C  CA     . LYS B 2 35  ? 12.603  12.056  8.149   1.00 0.00 ? 425 LYS B CA     2  
ATOM   7224   C  C      . LYS B 2 35  ? 11.710  11.195  7.270   1.00 0.00 ? 425 LYS B C      2  
ATOM   7225   O  O      . LYS B 2 35  ? 12.106  10.118  6.829   1.00 0.00 ? 425 LYS B O      2  
ATOM   7226   C  CB     . LYS B 2 35  ? 12.098  11.987  9.591   1.00 0.00 ? 425 LYS B CB     2  
ATOM   7227   C  CG     . LYS B 2 35  ? 12.433  13.207  10.433  1.00 0.00 ? 425 LYS B CG     2  
ATOM   7228   C  CD     . LYS B 2 35  ? 13.930  13.407  10.600  1.00 0.00 ? 425 LYS B CD     2  
ATOM   7229   C  CE     . LYS B 2 35  ? 14.221  14.496  11.616  1.00 0.00 ? 425 LYS B CE     2  
ATOM   7230   N  NZ     . LYS B 2 35  ? 15.672  14.799  11.715  1.00 0.00 ? 425 LYS B NZ     2  
ATOM   7231   H  H      . LYS B 2 35  ? 12.103  14.112  8.152   1.00 0.00 ? 425 LYS B H      2  
ATOM   7232   H  HA     . LYS B 2 35  ? 13.611  11.676  8.108   1.00 0.00 ? 425 LYS B HA     2  
ATOM   7233   H  HB2    . LYS B 2 35  ? 11.024  11.873  9.578   1.00 0.00 ? 425 LYS B HB2    2  
ATOM   7234   H  HB3    . LYS B 2 35  ? 12.532  11.120  10.068  1.00 0.00 ? 425 LYS B HB3    2  
ATOM   7235   H  HG2    . LYS B 2 35  ? 12.015  14.082  9.945   1.00 0.00 ? 425 LYS B HG2    2  
ATOM   7236   H  HG3    . LYS B 2 35  ? 11.982  13.092  11.409  1.00 0.00 ? 425 LYS B HG3    2  
ATOM   7237   H  HD2    . LYS B 2 35  ? 14.372  12.482  10.939  1.00 0.00 ? 425 LYS B HD2    2  
ATOM   7238   H  HD3    . LYS B 2 35  ? 14.356  13.689  9.650   1.00 0.00 ? 425 LYS B HD3    2  
ATOM   7239   H  HE2    . LYS B 2 35  ? 13.694  15.395  11.325  1.00 0.00 ? 425 LYS B HE2    2  
ATOM   7240   H  HE3    . LYS B 2 35  ? 13.862  14.171  12.583  1.00 0.00 ? 425 LYS B HE3    2  
ATOM   7241   H  HZ1    . LYS B 2 35  ? 15.859  15.383  12.560  1.00 0.00 ? 425 LYS B HZ1    2  
ATOM   7242   H  HZ2    . LYS B 2 35  ? 15.985  15.329  10.873  1.00 0.00 ? 425 LYS B HZ2    2  
ATOM   7243   H  HZ3    . LYS B 2 35  ? 16.226  13.917  11.784  1.00 0.00 ? 425 LYS B HZ3    2  
ATOM   7244   N  N      . GLU B 2 36  ? 10.500  11.684  7.030   1.00 0.00 ? 426 GLU B N      2  
ATOM   7245   C  CA     . GLU B 2 36  ? 9.519   10.969  6.223   1.00 0.00 ? 426 GLU B CA     2  
ATOM   7246   C  C      . GLU B 2 36  ? 10.070  10.715  4.820   1.00 0.00 ? 426 GLU B C      2  
ATOM   7247   O  O      . GLU B 2 36  ? 9.954   9.608   4.285   1.00 0.00 ? 426 GLU B O      2  
ATOM   7248   C  CB     . GLU B 2 36  ? 8.218   11.778  6.173   1.00 0.00 ? 426 GLU B CB     2  
ATOM   7249   C  CG     . GLU B 2 36  ? 7.641   12.053  7.557   1.00 0.00 ? 426 GLU B CG     2  
ATOM   7250   C  CD     . GLU B 2 36  ? 6.443   12.982  7.536   1.00 0.00 ? 426 GLU B CD     2  
ATOM   7251   O  OE1    . GLU B 2 36  ? 6.627   14.182  7.257   1.00 0.00 ? 426 GLU B OE1    2  
ATOM   7252   O  OE2    . GLU B 2 36  ? 5.315   12.520  7.824   1.00 0.00 ? 426 GLU B OE2    2  
ATOM   7253   H  H      . GLU B 2 36  ? 10.256  12.557  7.406   1.00 0.00 ? 426 GLU B H      2  
ATOM   7254   H  HA     . GLU B 2 36  ? 9.327   10.019  6.700   1.00 0.00 ? 426 GLU B HA     2  
ATOM   7255   H  HB2    . GLU B 2 36  ? 8.412   12.723  5.688   1.00 0.00 ? 426 GLU B HB2    2  
ATOM   7256   H  HB3    . GLU B 2 36  ? 7.485   11.230  5.601   1.00 0.00 ? 426 GLU B HB3    2  
ATOM   7257   H  HG2    . GLU B 2 36  ? 7.336   11.116  7.998   1.00 0.00 ? 426 GLU B HG2    2  
ATOM   7258   H  HG3    . GLU B 2 36  ? 8.413   12.498  8.170   1.00 0.00 ? 426 GLU B HG3    2  
ATOM   7259   N  N      . GLU B 2 37  ? 10.712  11.733  4.249   1.00 0.00 ? 427 GLU B N      2  
ATOM   7260   C  CA     . GLU B 2 37  ? 11.373  11.599  2.955   1.00 0.00 ? 427 GLU B CA     2  
ATOM   7261   C  C      . GLU B 2 37  ? 12.536  10.612  3.036   1.00 0.00 ? 427 GLU B C      2  
ATOM   7262   O  O      . GLU B 2 37  ? 12.810  9.881   2.085   1.00 0.00 ? 427 GLU B O      2  
ATOM   7263   C  CB     . GLU B 2 37  ? 11.883  12.958  2.473   1.00 0.00 ? 427 GLU B CB     2  
ATOM   7264   C  CG     . GLU B 2 37  ? 10.825  13.811  1.795   1.00 0.00 ? 427 GLU B CG     2  
ATOM   7265   C  CD     . GLU B 2 37  ? 10.397  13.237  0.458   1.00 0.00 ? 427 GLU B CD     2  
ATOM   7266   O  OE1    . GLU B 2 37  ? 11.095  13.488  -0.546  1.00 0.00 ? 427 GLU B OE1    2  
ATOM   7267   O  OE2    . GLU B 2 37  ? 9.371   12.535  0.409   1.00 0.00 ? 427 GLU B OE2    2  
ATOM   7268   H  H      . GLU B 2 37  ? 10.738  12.600  4.710   1.00 0.00 ? 427 GLU B H      2  
ATOM   7269   H  HA     . GLU B 2 37  ? 10.646  11.224  2.248   1.00 0.00 ? 427 GLU B HA     2  
ATOM   7270   H  HB2    . GLU B 2 37  ? 12.263  13.508  3.322   1.00 0.00 ? 427 GLU B HB2    2  
ATOM   7271   H  HB3    . GLU B 2 37  ? 12.689  12.800  1.770   1.00 0.00 ? 427 GLU B HB3    2  
ATOM   7272   H  HG2    . GLU B 2 37  ? 9.958   13.876  2.441   1.00 0.00 ? 427 GLU B HG2    2  
ATOM   7273   H  HG3    . GLU B 2 37  ? 11.226  14.800  1.635   1.00 0.00 ? 427 GLU B HG3    2  
ATOM   7274   N  N      . ARG B 2 38  ? 13.215  10.598  4.179   1.00 0.00 ? 428 ARG B N      2  
ATOM   7275   C  CA     . ARG B 2 38  ? 14.366  9.729   4.372   1.00 0.00 ? 428 ARG B CA     2  
ATOM   7276   C  C      . ARG B 2 38  ? 13.944  8.264   4.347   1.00 0.00 ? 428 ARG B C      2  
ATOM   7277   O  O      . ARG B 2 38  ? 14.574  7.452   3.683   1.00 0.00 ? 428 ARG B O      2  
ATOM   7278   C  CB     . ARG B 2 38  ? 15.076  10.050  5.690   1.00 0.00 ? 428 ARG B CB     2  
ATOM   7279   C  CG     . ARG B 2 38  ? 16.431  9.375   5.829   1.00 0.00 ? 428 ARG B CG     2  
ATOM   7280   C  CD     . ARG B 2 38  ? 17.369  9.802   4.714   1.00 0.00 ? 428 ARG B CD     2  
ATOM   7281   N  NE     . ARG B 2 38  ? 18.679  9.171   4.820   1.00 0.00 ? 428 ARG B NE     2  
ATOM   7282   C  CZ     . ARG B 2 38  ? 19.585  9.181   3.847   1.00 0.00 ? 428 ARG B CZ     2  
ATOM   7283   N  NH1    . ARG B 2 38  ? 19.304  9.752   2.679   1.00 0.00 ? 428 ARG B NH1    2  
ATOM   7284   N  NH2    . ARG B 2 38  ? 20.774  8.624   4.046   1.00 0.00 ? 428 ARG B NH2    2  
ATOM   7285   H  H      . ARG B 2 38  ? 12.936  11.188  4.909   1.00 0.00 ? 428 ARG B H      2  
ATOM   7286   H  HA     . ARG B 2 38  ? 15.050  9.904   3.554   1.00 0.00 ? 428 ARG B HA     2  
ATOM   7287   H  HB2    . ARG B 2 38  ? 15.222  11.119  5.754   1.00 0.00 ? 428 ARG B HB2    2  
ATOM   7288   H  HB3    . ARG B 2 38  ? 14.453  9.731   6.512   1.00 0.00 ? 428 ARG B HB3    2  
ATOM   7289   H  HG2    . ARG B 2 38  ? 16.865  9.649   6.779   1.00 0.00 ? 428 ARG B HG2    2  
ATOM   7290   H  HG3    . ARG B 2 38  ? 16.299  8.303   5.787   1.00 0.00 ? 428 ARG B HG3    2  
ATOM   7291   H  HD2    . ARG B 2 38  ? 16.928  9.532   3.766   1.00 0.00 ? 428 ARG B HD2    2  
ATOM   7292   H  HD3    . ARG B 2 38  ? 17.492  10.874  4.759   1.00 0.00 ? 428 ARG B HD3    2  
ATOM   7293   H  HE     . ARG B 2 38  ? 18.900  8.722   5.674   1.00 0.00 ? 428 ARG B HE     2  
ATOM   7294   H  HH11   . ARG B 2 38  ? 18.407  10.187  2.529   1.00 0.00 ? 428 ARG B HH11   2  
ATOM   7295   H  HH12   . ARG B 2 38  ? 19.982  9.742   1.930   1.00 0.00 ? 428 ARG B HH12   2  
ATOM   7296   H  HH21   . ARG B 2 38  ? 20.991  8.196   4.932   1.00 0.00 ? 428 ARG B HH21   2  
ATOM   7297   H  HH22   . ARG B 2 38  ? 21.472  8.633   3.316   1.00 0.00 ? 428 ARG B HH22   2  
ATOM   7298   N  N      . LEU B 2 39  ? 12.887  7.928   5.080   1.00 0.00 ? 429 LEU B N      2  
ATOM   7299   C  CA     . LEU B 2 39  ? 12.364  6.574   5.098   1.00 0.00 ? 429 LEU B CA     2  
ATOM   7300   C  C      . LEU B 2 39  ? 12.009  6.087   3.706   1.00 0.00 ? 429 LEU B C      2  
ATOM   7301   O  O      . LEU B 2 39  ? 12.434  5.009   3.313   1.00 0.00 ? 429 LEU B O      2  
ATOM   7302   C  CB     . LEU B 2 39  ? 11.160  6.492   6.026   1.00 0.00 ? 429 LEU B CB     2  
ATOM   7303   C  CG     . LEU B 2 39  ? 11.514  6.238   7.485   1.00 0.00 ? 429 LEU B CG     2  
ATOM   7304   C  CD1    . LEU B 2 39  ? 12.553  7.229   7.977   1.00 0.00 ? 429 LEU B CD1    2  
ATOM   7305   C  CD2    . LEU B 2 39  ? 10.265  6.280   8.355   1.00 0.00 ? 429 LEU B CD2    2  
ATOM   7306   H  H      . LEU B 2 39  ? 12.464  8.600   5.655   1.00 0.00 ? 429 LEU B H      2  
ATOM   7307   H  HA     . LEU B 2 39  ? 13.140  5.934   5.489   1.00 0.00 ? 429 LEU B HA     2  
ATOM   7308   H  HB2    . LEU B 2 39  ? 10.614  7.422   5.960   1.00 0.00 ? 429 LEU B HB2    2  
ATOM   7309   H  HB3    . LEU B 2 39  ? 10.521  5.692   5.686   1.00 0.00 ? 429 LEU B HB3    2  
ATOM   7310   H  HG     . LEU B 2 39  ? 11.945  5.262   7.562   1.00 0.00 ? 429 LEU B HG     2  
ATOM   7311   H  HD11   . LEU B 2 39  ? 13.448  7.143   7.363   1.00 0.00 ? 429 LEU B HD11   2  
ATOM   7312   H  HD12   . LEU B 2 39  ? 12.799  7.014   9.006   1.00 0.00 ? 429 LEU B HD12   2  
ATOM   7313   H  HD13   . LEU B 2 39  ? 12.160  8.231   7.900   1.00 0.00 ? 429 LEU B HD13   2  
ATOM   7314   H  HD21   . LEU B 2 39  ? 9.566   5.527   8.021   1.00 0.00 ? 429 LEU B HD21   2  
ATOM   7315   H  HD22   . LEU B 2 39  ? 9.807   7.254   8.276   1.00 0.00 ? 429 LEU B HD22   2  
ATOM   7316   H  HD23   . LEU B 2 39  ? 10.535  6.091   9.384   1.00 0.00 ? 429 LEU B HD23   2  
ATOM   7317   N  N      . TRP B 2 40  ? 11.256  6.884   2.951   1.00 0.00 ? 430 TRP B N      2  
ATOM   7318   C  CA     . TRP B 2 40  ? 10.946  6.538   1.564   1.00 0.00 ? 430 TRP B CA     2  
ATOM   7319   C  C      . TRP B 2 40  ? 12.219  6.347   0.756   1.00 0.00 ? 430 TRP B C      2  
ATOM   7320   O  O      . TRP B 2 40  ? 12.255  5.526   -0.150  1.00 0.00 ? 430 TRP B O      2  
ATOM   7321   C  CB     . TRP B 2 40  ? 10.062  7.599   0.907   1.00 0.00 ? 430 TRP B CB     2  
ATOM   7322   C  CG     . TRP B 2 40  ? 8.613   7.470   1.261   1.00 0.00 ? 430 TRP B CG     2  
ATOM   7323   C  CD1    . TRP B 2 40  ? 7.961   8.055   2.307   1.00 0.00 ? 430 TRP B CD1    2  
ATOM   7324   C  CD2    . TRP B 2 40  ? 7.633   6.702   0.554   1.00 0.00 ? 430 TRP B CD2    2  
ATOM   7325   N  NE1    . TRP B 2 40  ? 6.634   7.700   2.291   1.00 0.00 ? 430 TRP B NE1    2  
ATOM   7326   C  CE2    . TRP B 2 40  ? 6.408   6.870   1.224   1.00 0.00 ? 430 TRP B CE2    2  
ATOM   7327   C  CE3    . TRP B 2 40  ? 7.672   5.891   -0.584  1.00 0.00 ? 430 TRP B CE3    2  
ATOM   7328   C  CZ2    . TRP B 2 40  ? 5.234   6.257   0.796   1.00 0.00 ? 430 TRP B CZ2    2  
ATOM   7329   C  CZ3    . TRP B 2 40  ? 6.508   5.280   -1.007  1.00 0.00 ? 430 TRP B CZ3    2  
ATOM   7330   C  CH2    . TRP B 2 40  ? 5.300   5.468   -0.320  1.00 0.00 ? 430 TRP B CH2    2  
ATOM   7331   H  H      . TRP B 2 40  ? 10.899  7.717   3.335   1.00 0.00 ? 430 TRP B H      2  
ATOM   7332   H  HA     . TRP B 2 40  ? 10.416  5.597   1.567   1.00 0.00 ? 430 TRP B HA     2  
ATOM   7333   H  HB2    . TRP B 2 40  ? 10.394  8.581   1.214   1.00 0.00 ? 430 TRP B HB2    2  
ATOM   7334   H  HB3    . TRP B 2 40  ? 10.149  7.512   -0.165  1.00 0.00 ? 430 TRP B HB3    2  
ATOM   7335   H  HD1    . TRP B 2 40  ? 8.433   8.703   3.033   1.00 0.00 ? 430 TRP B HD1    2  
ATOM   7336   H  HE1    . TRP B 2 40  ? 5.956   7.993   2.943   1.00 0.00 ? 430 TRP B HE1    2  
ATOM   7337   H  HE3    . TRP B 2 40  ? 8.594   5.736   -1.127  1.00 0.00 ? 430 TRP B HE3    2  
ATOM   7338   H  HZ2    . TRP B 2 40  ? 4.296   6.394   1.315   1.00 0.00 ? 430 TRP B HZ2    2  
ATOM   7339   H  HZ3    . TRP B 2 40  ? 6.520   4.649   -1.884  1.00 0.00 ? 430 TRP B HZ3    2  
ATOM   7340   H  HH2    . TRP B 2 40  ? 4.414   4.972   -0.686  1.00 0.00 ? 430 TRP B HH2    2  
ATOM   7341   N  N      . GLU B 2 41  ? 13.258  7.088   1.104   1.00 0.00 ? 431 GLU B N      2  
ATOM   7342   C  CA     . GLU B 2 41  ? 14.543  6.975   0.436   1.00 0.00 ? 431 GLU B CA     2  
ATOM   7343   C  C      . GLU B 2 41  ? 15.207  5.635   0.754   1.00 0.00 ? 431 GLU B C      2  
ATOM   7344   O  O      . GLU B 2 41  ? 15.553  4.879   -0.148  1.00 0.00 ? 431 GLU B O      2  
ATOM   7345   C  CB     . GLU B 2 41  ? 15.448  8.134   0.871   1.00 0.00 ? 431 GLU B CB     2  
ATOM   7346   C  CG     . GLU B 2 41  ? 16.842  8.097   0.276   1.00 0.00 ? 431 GLU B CG     2  
ATOM   7347   C  CD     . GLU B 2 41  ? 16.848  8.373   -1.209  1.00 0.00 ? 431 GLU B CD     2  
ATOM   7348   O  OE1    . GLU B 2 41  ? 16.865  9.557   -1.595  1.00 0.00 ? 431 GLU B OE1    2  
ATOM   7349   O  OE2    . GLU B 2 41  ? 16.831  7.410   -1.995  1.00 0.00 ? 431 GLU B OE2    2  
ATOM   7350   H  H      . GLU B 2 41  ? 13.160  7.734   1.835   1.00 0.00 ? 431 GLU B H      2  
ATOM   7351   H  HA     . GLU B 2 41  ? 14.368  7.033   -0.626  1.00 0.00 ? 431 GLU B HA     2  
ATOM   7352   H  HB2    . GLU B 2 41  ? 14.985  9.064   0.579   1.00 0.00 ? 431 GLU B HB2    2  
ATOM   7353   H  HB3    . GLU B 2 41  ? 15.541  8.113   1.946   1.00 0.00 ? 431 GLU B HB3    2  
ATOM   7354   H  HG2    . GLU B 2 41  ? 17.449  8.840   0.768   1.00 0.00 ? 431 GLU B HG2    2  
ATOM   7355   H  HG3    . GLU B 2 41  ? 17.259  7.118   0.448   1.00 0.00 ? 431 GLU B HG3    2  
ATOM   7356   N  N      . VAL B 2 42  ? 15.355  5.337   2.038   1.00 0.00 ? 432 VAL B N      2  
ATOM   7357   C  CA     . VAL B 2 42  ? 16.013  4.104   2.472   1.00 0.00 ? 432 VAL B CA     2  
ATOM   7358   C  C      . VAL B 2 42  ? 15.198  2.893   2.064   1.00 0.00 ? 432 VAL B C      2  
ATOM   7359   O  O      . VAL B 2 42  ? 15.737  1.867   1.653   1.00 0.00 ? 432 VAL B O      2  
ATOM   7360   C  CB     . VAL B 2 42  ? 16.211  4.085   3.994   1.00 0.00 ? 432 VAL B CB     2  
ATOM   7361   C  CG1    . VAL B 2 42  ? 17.229  3.031   4.392   1.00 0.00 ? 432 VAL B CG1    2  
ATOM   7362   C  CG2    . VAL B 2 42  ? 16.622  5.460   4.473   1.00 0.00 ? 432 VAL B CG2    2  
ATOM   7363   H  H      . VAL B 2 42  ? 15.015  5.963   2.714   1.00 0.00 ? 432 VAL B H      2  
ATOM   7364   H  HA     . VAL B 2 42  ? 16.982  4.051   2.000   1.00 0.00 ? 432 VAL B HA     2  
ATOM   7365   H  HB     . VAL B 2 42  ? 15.266  3.834   4.456   1.00 0.00 ? 432 VAL B HB     2  
ATOM   7366   H  HG11   . VAL B 2 42  ? 18.187  3.273   3.954   1.00 0.00 ? 432 VAL B HG11   2  
ATOM   7367   H  HG12   . VAL B 2 42  ? 16.904  2.065   4.036   1.00 0.00 ? 432 VAL B HG12   2  
ATOM   7368   H  HG13   . VAL B 2 42  ? 17.321  3.007   5.468   1.00 0.00 ? 432 VAL B HG13   2  
ATOM   7369   H  HG21   . VAL B 2 42  ? 17.501  5.379   5.096   1.00 0.00 ? 432 VAL B HG21   2  
ATOM   7370   H  HG22   . VAL B 2 42  ? 15.808  5.900   5.042   1.00 0.00 ? 432 VAL B HG22   2  
ATOM   7371   H  HG23   . VAL B 2 42  ? 16.838  6.080   3.609   1.00 0.00 ? 432 VAL B HG23   2  
ATOM   7372   N  N      . GLN B 2 43  ? 13.892  3.042   2.170   1.00 0.00 ? 433 GLN B N      2  
ATOM   7373   C  CA     . GLN B 2 43  ? 12.949  2.032   1.731   1.00 0.00 ? 433 GLN B CA     2  
ATOM   7374   C  C      . GLN B 2 43  ? 13.188  1.718   0.262   1.00 0.00 ? 433 GLN B C      2  
ATOM   7375   O  O      . GLN B 2 43  ? 13.307  0.564   -0.156  1.00 0.00 ? 433 GLN B O      2  
ATOM   7376   C  CB     . GLN B 2 43  ? 11.541  2.592   1.910   1.00 0.00 ? 433 GLN B CB     2  
ATOM   7377   C  CG     . GLN B 2 43  ? 10.439  1.721   1.351   1.00 0.00 ? 433 GLN B CG     2  
ATOM   7378   C  CD     . GLN B 2 43  ? 10.302  0.428   2.123   1.00 0.00 ? 433 GLN B CD     2  
ATOM   7379   O  OE1    . GLN B 2 43  ? 9.547   0.349   3.093   1.00 0.00 ? 433 GLN B OE1    2  
ATOM   7380   N  NE2    . GLN B 2 43  ? 11.041  -0.588  1.706   1.00 0.00 ? 433 GLN B NE2    2  
ATOM   7381   H  H      . GLN B 2 43  ? 13.542  3.878   2.554   1.00 0.00 ? 433 GLN B H      2  
ATOM   7382   H  HA     . GLN B 2 43  ? 13.079  1.149   2.333   1.00 0.00 ? 433 GLN B HA     2  
ATOM   7383   H  HB2    . GLN B 2 43  ? 11.357  2.732   2.965   1.00 0.00 ? 433 GLN B HB2    2  
ATOM   7384   H  HB3    . GLN B 2 43  ? 11.501  3.554   1.417   1.00 0.00 ? 433 GLN B HB3    2  
ATOM   7385   H  HG2    . GLN B 2 43  ? 9.507   2.262   1.402   1.00 0.00 ? 433 GLN B HG2    2  
ATOM   7386   H  HG3    . GLN B 2 43  ? 10.668  1.493   0.320   1.00 0.00 ? 433 GLN B HG3    2  
ATOM   7387   H  HE21   . GLN B 2 43  ? 11.620  -0.447  0.925   1.00 0.00 ? 433 GLN B HE21   2  
ATOM   7388   H  HE22   . GLN B 2 43  ? 10.993  -1.430  2.204   1.00 0.00 ? 433 GLN B HE22   2  
ATOM   7389   N  N      . ARG B 2 44  ? 13.257  2.794   -0.490  1.00 0.00 ? 434 ARG B N      2  
ATOM   7390   C  CA     . ARG B 2 44  ? 13.526  2.784   -1.908  1.00 0.00 ? 434 ARG B CA     2  
ATOM   7391   C  C      . ARG B 2 44  ? 14.843  2.081   -2.227  1.00 0.00 ? 434 ARG B C      2  
ATOM   7392   O  O      . ARG B 2 44  ? 14.917  1.259   -3.140  1.00 0.00 ? 434 ARG B O      2  
ATOM   7393   C  CB     . ARG B 2 44  ? 13.571  4.241   -2.329  1.00 0.00 ? 434 ARG B CB     2  
ATOM   7394   C  CG     . ARG B 2 44  ? 14.164  4.510   -3.677  1.00 0.00 ? 434 ARG B CG     2  
ATOM   7395   C  CD     . ARG B 2 44  ? 14.947  5.813   -3.654  1.00 0.00 ? 434 ARG B CD     2  
ATOM   7396   N  NE     . ARG B 2 44  ? 15.274  6.275   -5.006  1.00 0.00 ? 434 ARG B NE     2  
ATOM   7397   C  CZ     . ARG B 2 44  ? 15.671  7.515   -5.299  1.00 0.00 ? 434 ARG B CZ     2  
ATOM   7398   N  NH1    . ARG B 2 44  ? 16.009  8.357   -4.331  1.00 0.00 ? 434 ARG B NH1    2  
ATOM   7399   N  NH2    . ARG B 2 44  ? 15.796  7.889   -6.565  1.00 0.00 ? 434 ARG B NH2    2  
ATOM   7400   H  H      . ARG B 2 44  ? 13.118  3.666   -0.061  1.00 0.00 ? 434 ARG B H      2  
ATOM   7401   H  HA     . ARG B 2 44  ? 12.715  2.290   -2.414  1.00 0.00 ? 434 ARG B HA     2  
ATOM   7402   H  HB2    . ARG B 2 44  ? 12.562  4.618   -2.328  1.00 0.00 ? 434 ARG B HB2    2  
ATOM   7403   H  HB3    . ARG B 2 44  ? 14.144  4.788   -1.594  1.00 0.00 ? 434 ARG B HB3    2  
ATOM   7404   H  HG2    . ARG B 2 44  ? 14.820  3.697   -3.938  1.00 0.00 ? 434 ARG B HG2    2  
ATOM   7405   H  HG3    . ARG B 2 44  ? 13.364  4.589   -4.393  1.00 0.00 ? 434 ARG B HG3    2  
ATOM   7406   H  HD2    . ARG B 2 44  ? 14.353  6.565   -3.152  1.00 0.00 ? 434 ARG B HD2    2  
ATOM   7407   H  HD3    . ARG B 2 44  ? 15.864  5.657   -3.094  1.00 0.00 ? 434 ARG B HD3    2  
ATOM   7408   H  HE     . ARG B 2 44  ? 15.138  5.638   -5.742  1.00 0.00 ? 434 ARG B HE     2  
ATOM   7409   H  HH11   . ARG B 2 44  ? 15.984  8.059   -3.362  1.00 0.00 ? 434 ARG B HH11   2  
ATOM   7410   H  HH12   . ARG B 2 44  ? 16.282  9.295   -4.549  1.00 0.00 ? 434 ARG B HH12   2  
ATOM   7411   H  HH21   . ARG B 2 44  ? 15.595  7.238   -7.309  1.00 0.00 ? 434 ARG B HH21   2  
ATOM   7412   H  HH22   . ARG B 2 44  ? 16.085  8.829   -6.791  1.00 0.00 ? 434 ARG B HH22   2  
ATOM   7413   N  N      . ILE B 2 45  ? 15.876  2.408   -1.469  1.00 0.00 ? 435 ILE B N      2  
ATOM   7414   C  CA     . ILE B 2 45  ? 17.185  1.808   -1.669  1.00 0.00 ? 435 ILE B CA     2  
ATOM   7415   C  C      . ILE B 2 45  ? 17.149  0.311   -1.369  1.00 0.00 ? 435 ILE B C      2  
ATOM   7416   O  O      . ILE B 2 45  ? 17.594  -0.496  -2.182  1.00 0.00 ? 435 ILE B O      2  
ATOM   7417   C  CB     . ILE B 2 45  ? 18.249  2.492   -0.788  1.00 0.00 ? 435 ILE B CB     2  
ATOM   7418   C  CG1    . ILE B 2 45  ? 18.297  3.987   -1.097  1.00 0.00 ? 435 ILE B CG1    2  
ATOM   7419   C  CG2    . ILE B 2 45  ? 19.615  1.864   -1.018  1.00 0.00 ? 435 ILE B CG2    2  
ATOM   7420   C  CD1    . ILE B 2 45  ? 18.808  4.824   0.052   1.00 0.00 ? 435 ILE B CD1    2  
ATOM   7421   H  H      . ILE B 2 45  ? 15.759  3.081   -0.760  1.00 0.00 ? 435 ILE B H      2  
ATOM   7422   H  HA     . ILE B 2 45  ? 17.459  1.949   -2.704  1.00 0.00 ? 435 ILE B HA     2  
ATOM   7423   H  HB     . ILE B 2 45  ? 17.980  2.351   0.247   1.00 0.00 ? 435 ILE B HB     2  
ATOM   7424   H  HG12   . ILE B 2 45  ? 18.944  4.158   -1.944  1.00 0.00 ? 435 ILE B HG12   2  
ATOM   7425   H  HG13   . ILE B 2 45  ? 17.298  4.329   -1.338  1.00 0.00 ? 435 ILE B HG13   2  
ATOM   7426   H  HG21   . ILE B 2 45  ? 19.905  1.998   -2.049  1.00 0.00 ? 435 ILE B HG21   2  
ATOM   7427   H  HG22   . ILE B 2 45  ? 19.569  0.808   -0.791  1.00 0.00 ? 435 ILE B HG22   2  
ATOM   7428   H  HG23   . ILE B 2 45  ? 20.340  2.338   -0.373  1.00 0.00 ? 435 ILE B HG23   2  
ATOM   7429   H  HD11   . ILE B 2 45  ? 19.766  4.447   0.377   1.00 0.00 ? 435 ILE B HD11   2  
ATOM   7430   H  HD12   . ILE B 2 45  ? 18.101  4.774   0.867   1.00 0.00 ? 435 ILE B HD12   2  
ATOM   7431   H  HD13   . ILE B 2 45  ? 18.912  5.848   -0.270  1.00 0.00 ? 435 ILE B HD13   2  
ATOM   7432   N  N      . LEU B 2 46  ? 16.589  -0.049  -0.214  1.00 0.00 ? 436 LEU B N      2  
ATOM   7433   C  CA     . LEU B 2 46  ? 16.537  -1.444  0.221   1.00 0.00 ? 436 LEU B CA     2  
ATOM   7434   C  C      . LEU B 2 46  ? 15.804  -2.335  -0.786  1.00 0.00 ? 436 LEU B C      2  
ATOM   7435   O  O      . LEU B 2 46  ? 16.252  -3.440  -1.085  1.00 0.00 ? 436 LEU B O      2  
ATOM   7436   C  CB     . LEU B 2 46  ? 15.861  -1.545  1.584   1.00 0.00 ? 436 LEU B CB     2  
ATOM   7437   C  CG     . LEU B 2 46  ? 15.801  -2.954  2.171   1.00 0.00 ? 436 LEU B CG     2  
ATOM   7438   C  CD1    . LEU B 2 46  ? 17.189  -3.575  2.244   1.00 0.00 ? 436 LEU B CD1    2  
ATOM   7439   C  CD2    . LEU B 2 46  ? 15.176  -2.911  3.545   1.00 0.00 ? 436 LEU B CD2    2  
ATOM   7440   H  H      . LEU B 2 46  ? 16.206  0.646   0.373   1.00 0.00 ? 436 LEU B H      2  
ATOM   7441   H  HA     . LEU B 2 46  ? 17.551  -1.798  0.319   1.00 0.00 ? 436 LEU B HA     2  
ATOM   7442   H  HB2    . LEU B 2 46  ? 16.395  -0.911  2.278   1.00 0.00 ? 436 LEU B HB2    2  
ATOM   7443   H  HB3    . LEU B 2 46  ? 14.851  -1.175  1.490   1.00 0.00 ? 436 LEU B HB3    2  
ATOM   7444   H  HG     . LEU B 2 46  ? 15.185  -3.578  1.539   1.00 0.00 ? 436 LEU B HG     2  
ATOM   7445   H  HD11   . LEU B 2 46  ? 17.614  -3.627  1.253   1.00 0.00 ? 436 LEU B HD11   2  
ATOM   7446   H  HD12   . LEU B 2 46  ? 17.115  -4.570  2.657   1.00 0.00 ? 436 LEU B HD12   2  
ATOM   7447   H  HD13   . LEU B 2 46  ? 17.822  -2.969  2.877   1.00 0.00 ? 436 LEU B HD13   2  
ATOM   7448   H  HD21   . LEU B 2 46  ? 15.765  -2.272  4.182   1.00 0.00 ? 436 LEU B HD21   2  
ATOM   7449   H  HD22   . LEU B 2 46  ? 15.149  -3.908  3.958   1.00 0.00 ? 436 LEU B HD22   2  
ATOM   7450   H  HD23   . LEU B 2 46  ? 14.172  -2.521  3.470   1.00 0.00 ? 436 LEU B HD23   2  
ATOM   7451   N  N      . THR B 2 47  ? 14.691  -1.849  -1.319  1.00 0.00 ? 437 THR B N      2  
ATOM   7452   C  CA     . THR B 2 47  ? 13.870  -2.651  -2.220  1.00 0.00 ? 437 THR B CA     2  
ATOM   7453   C  C      . THR B 2 47  ? 14.575  -2.860  -3.568  1.00 0.00 ? 437 THR B C      2  
ATOM   7454   O  O      . THR B 2 47  ? 14.588  -3.971  -4.110  1.00 0.00 ? 437 THR B O      2  
ATOM   7455   C  CB     . THR B 2 47  ? 12.460  -2.033  -2.421  1.00 0.00 ? 437 THR B CB     2  
ATOM   7456   O  OG1    . THR B 2 47  ? 11.639  -2.909  -3.197  1.00 0.00 ? 437 THR B OG1    2  
ATOM   7457   C  CG2    . THR B 2 47  ? 12.515  -0.672  -3.095  1.00 0.00 ? 437 THR B CG2    2  
ATOM   7458   H  H      . THR B 2 47  ? 14.418  -0.935  -1.100  1.00 0.00 ? 437 THR B H      2  
ATOM   7459   H  HA     . THR B 2 47  ? 13.743  -3.620  -1.756  1.00 0.00 ? 437 THR B HA     2  
ATOM   7460   H  HB     . THR B 2 47  ? 12.006  -1.911  -1.446  1.00 0.00 ? 437 THR B HB     2  
ATOM   7461   H  HG1    . THR B 2 47  ? 11.012  -3.353  -2.607  1.00 0.00 ? 437 THR B HG1    2  
ATOM   7462   H  HG21   . THR B 2 47  ? 11.511  -0.296  -3.227  1.00 0.00 ? 437 THR B HG21   2  
ATOM   7463   H  HG22   . THR B 2 47  ? 12.993  -0.765  -4.059  1.00 0.00 ? 437 THR B HG22   2  
ATOM   7464   H  HG23   . THR B 2 47  ? 13.078  0.011   -2.478  1.00 0.00 ? 437 THR B HG23   2  
ATOM   7465   N  N      . ALA B 2 48  ? 15.191  -1.804  -4.089  1.00 0.00 ? 438 ALA B N      2  
ATOM   7466   C  CA     . ALA B 2 48  ? 15.949  -1.904  -5.327  1.00 0.00 ? 438 ALA B CA     2  
ATOM   7467   C  C      . ALA B 2 48  ? 17.163  -2.798  -5.120  1.00 0.00 ? 438 ALA B C      2  
ATOM   7468   O  O      . ALA B 2 48  ? 17.556  -3.558  -6.002  1.00 0.00 ? 438 ALA B O      2  
ATOM   7469   C  CB     . ALA B 2 48  ? 16.375  -0.524  -5.807  1.00 0.00 ? 438 ALA B CB     2  
ATOM   7470   H  H      . ALA B 2 48  ? 15.129  -0.937  -3.632  1.00 0.00 ? 438 ALA B H      2  
ATOM   7471   H  HA     . ALA B 2 48  ? 15.310  -2.345  -6.080  1.00 0.00 ? 438 ALA B HA     2  
ATOM   7472   H  HB1    . ALA B 2 48  ? 15.499  0.091   -5.957  1.00 0.00 ? 438 ALA B HB1    2  
ATOM   7473   H  HB2    . ALA B 2 48  ? 16.911  -0.618  -6.739  1.00 0.00 ? 438 ALA B HB2    2  
ATOM   7474   H  HB3    . ALA B 2 48  ? 17.014  -0.066  -5.068  1.00 0.00 ? 438 ALA B HB3    2  
ATOM   7475   N  N      . LEU B 2 49  ? 17.729  -2.712  -3.925  1.00 0.00 ? 439 LEU B N      2  
ATOM   7476   C  CA     . LEU B 2 49  ? 18.882  -3.507  -3.543  1.00 0.00 ? 439 LEU B CA     2  
ATOM   7477   C  C      . LEU B 2 49  ? 18.521  -4.989  -3.450  1.00 0.00 ? 439 LEU B C      2  
ATOM   7478   O  O      . LEU B 2 49  ? 19.346  -5.857  -3.740  1.00 0.00 ? 439 LEU B O      2  
ATOM   7479   C  CB     . LEU B 2 49  ? 19.415  -2.998  -2.208  1.00 0.00 ? 439 LEU B CB     2  
ATOM   7480   C  CG     . LEU B 2 49  ? 20.663  -3.701  -1.681  1.00 0.00 ? 439 LEU B CG     2  
ATOM   7481   C  CD1    . LEU B 2 49  ? 21.813  -3.567  -2.669  1.00 0.00 ? 439 LEU B CD1    2  
ATOM   7482   C  CD2    . LEU B 2 49  ? 21.054  -3.117  -0.340  1.00 0.00 ? 439 LEU B CD2    2  
ATOM   7483   H  H      . LEU B 2 49  ? 17.355  -2.081  -3.269  1.00 0.00 ? 439 LEU B H      2  
ATOM   7484   H  HA     . LEU B 2 49  ? 19.644  -3.379  -4.298  1.00 0.00 ? 439 LEU B HA     2  
ATOM   7485   H  HB2    . LEU B 2 49  ? 19.646  -1.947  -2.319  1.00 0.00 ? 439 LEU B HB2    2  
ATOM   7486   H  HB3    . LEU B 2 49  ? 18.629  -3.098  -1.470  1.00 0.00 ? 439 LEU B HB3    2  
ATOM   7487   H  HG     . LEU B 2 49  ? 20.452  -4.751  -1.545  1.00 0.00 ? 439 LEU B HG     2  
ATOM   7488   H  HD11   . LEU B 2 49  ? 21.512  -3.968  -3.626  1.00 0.00 ? 439 LEU B HD11   2  
ATOM   7489   H  HD12   . LEU B 2 49  ? 22.670  -4.115  -2.303  1.00 0.00 ? 439 LEU B HD12   2  
ATOM   7490   H  HD13   . LEU B 2 49  ? 22.073  -2.525  -2.780  1.00 0.00 ? 439 LEU B HD13   2  
ATOM   7491   H  HD21   . LEU B 2 49  ? 20.241  -3.245  0.359   1.00 0.00 ? 439 LEU B HD21   2  
ATOM   7492   H  HD22   . LEU B 2 49  ? 21.268  -2.065  -0.453  1.00 0.00 ? 439 LEU B HD22   2  
ATOM   7493   H  HD23   . LEU B 2 49  ? 21.932  -3.625  0.032   1.00 0.00 ? 439 LEU B HD23   2  
ATOM   7494   N  N      . LYS B 2 50  ? 17.285  -5.280  -3.051  1.00 0.00 ? 440 LYS B N      2  
ATOM   7495   C  CA     . LYS B 2 50  ? 16.808  -6.657  -3.025  1.00 0.00 ? 440 LYS B CA     2  
ATOM   7496   C  C      . LYS B 2 50  ? 16.749  -7.221  -4.436  1.00 0.00 ? 440 LYS B C      2  
ATOM   7497   O  O      . LYS B 2 50  ? 17.054  -8.395  -4.664  1.00 0.00 ? 440 LYS B O      2  
ATOM   7498   C  CB     . LYS B 2 50  ? 15.435  -6.767  -2.365  1.00 0.00 ? 440 LYS B CB     2  
ATOM   7499   C  CG     . LYS B 2 50  ? 15.493  -6.804  -0.849  1.00 0.00 ? 440 LYS B CG     2  
ATOM   7500   C  CD     . LYS B 2 50  ? 14.163  -7.232  -0.262  1.00 0.00 ? 440 LYS B CD     2  
ATOM   7501   C  CE     . LYS B 2 50  ? 14.270  -7.507  1.225   1.00 0.00 ? 440 LYS B CE     2  
ATOM   7502   N  NZ     . LYS B 2 50  ? 13.009  -8.068  1.759   1.00 0.00 ? 440 LYS B NZ     2  
ATOM   7503   H  H      . LYS B 2 50  ? 16.690  -4.554  -2.759  1.00 0.00 ? 440 LYS B H      2  
ATOM   7504   H  HA     . LYS B 2 50  ? 17.519  -7.236  -2.453  1.00 0.00 ? 440 LYS B HA     2  
ATOM   7505   H  HB2    . LYS B 2 50  ? 14.836  -5.917  -2.658  1.00 0.00 ? 440 LYS B HB2    2  
ATOM   7506   H  HB3    . LYS B 2 50  ? 14.956  -7.670  -2.709  1.00 0.00 ? 440 LYS B HB3    2  
ATOM   7507   H  HG2    . LYS B 2 50  ? 16.253  -7.507  -0.544  1.00 0.00 ? 440 LYS B HG2    2  
ATOM   7508   H  HG3    . LYS B 2 50  ? 15.739  -5.819  -0.483  1.00 0.00 ? 440 LYS B HG3    2  
ATOM   7509   H  HD2    . LYS B 2 50  ? 13.440  -6.446  -0.421  1.00 0.00 ? 440 LYS B HD2    2  
ATOM   7510   H  HD3    . LYS B 2 50  ? 13.832  -8.131  -0.759  1.00 0.00 ? 440 LYS B HD3    2  
ATOM   7511   H  HE2    . LYS B 2 50  ? 15.072  -8.210  1.394   1.00 0.00 ? 440 LYS B HE2    2  
ATOM   7512   H  HE3    . LYS B 2 50  ? 14.488  -6.582  1.737   1.00 0.00 ? 440 LYS B HE3    2  
ATOM   7513   H  HZ1    . LYS B 2 50  ? 12.731  -8.910  1.213   1.00 0.00 ? 440 LYS B HZ1    2  
ATOM   7514   H  HZ2    . LYS B 2 50  ? 12.242  -7.357  1.696   1.00 0.00 ? 440 LYS B HZ2    2  
ATOM   7515   H  HZ3    . LYS B 2 50  ? 13.132  -8.339  2.758   1.00 0.00 ? 440 LYS B HZ3    2  
ATOM   7516   N  N      . ARG B 2 51  ? 16.376  -6.374  -5.389  1.00 0.00 ? 441 ARG B N      2  
ATOM   7517   C  CA     . ARG B 2 51  ? 16.342  -6.778  -6.784  1.00 0.00 ? 441 ARG B CA     2  
ATOM   7518   C  C      . ARG B 2 51  ? 17.768  -7.039  -7.249  1.00 0.00 ? 441 ARG B C      2  
ATOM   7519   O  O      . ARG B 2 51  ? 18.033  -7.994  -7.976  1.00 0.00 ? 441 ARG B O      2  
ATOM   7520   C  CB     . ARG B 2 51  ? 15.684  -5.688  -7.639  1.00 0.00 ? 441 ARG B CB     2  
ATOM   7521   C  CG     . ARG B 2 51  ? 15.264  -6.160  -9.027  1.00 0.00 ? 441 ARG B CG     2  
ATOM   7522   C  CD     . ARG B 2 51  ? 16.444  -6.232  -9.982  1.00 0.00 ? 441 ARG B CD     2  
ATOM   7523   N  NE     . ARG B 2 51  ? 16.260  -7.238  -11.022 1.00 0.00 ? 441 ARG B NE     2  
ATOM   7524   C  CZ     . ARG B 2 51  ? 16.985  -7.284  -12.132 1.00 0.00 ? 441 ARG B CZ     2  
ATOM   7525   N  NH1    . ARG B 2 51  ? 17.772  -6.271  -12.455 1.00 0.00 ? 441 ARG B NH1    2  
ATOM   7526   N  NH2    . ARG B 2 51  ? 16.896  -8.323  -12.945 1.00 0.00 ? 441 ARG B NH2    2  
ATOM   7527   H  H      . ARG B 2 51  ? 16.129  -5.453  -5.146  1.00 0.00 ? 441 ARG B H      2  
ATOM   7528   H  HA     . ARG B 2 51  ? 15.771  -7.691  -6.859  1.00 0.00 ? 441 ARG B HA     2  
ATOM   7529   H  HB2    . ARG B 2 51  ? 14.808  -5.322  -7.125  1.00 0.00 ? 441 ARG B HB2    2  
ATOM   7530   H  HB3    . ARG B 2 51  ? 16.391  -4.877  -7.754  1.00 0.00 ? 441 ARG B HB3    2  
ATOM   7531   H  HG2    . ARG B 2 51  ? 14.822  -7.140  -8.944  1.00 0.00 ? 441 ARG B HG2    2  
ATOM   7532   H  HG3    . ARG B 2 51  ? 14.534  -5.468  -9.425  1.00 0.00 ? 441 ARG B HG3    2  
ATOM   7533   H  HD2    . ARG B 2 51  ? 16.570  -5.269  -10.450 1.00 0.00 ? 441 ARG B HD2    2  
ATOM   7534   H  HD3    . ARG B 2 51  ? 17.334  -6.476  -9.417  1.00 0.00 ? 441 ARG B HD3    2  
ATOM   7535   H  HE     . ARG B 2 51  ? 15.603  -7.958  -10.847 1.00 0.00 ? 441 ARG B HE     2  
ATOM   7536   H  HH11   . ARG B 2 51  ? 17.814  -5.451  -11.872 1.00 0.00 ? 441 ARG B HH11   2  
ATOM   7537   H  HH12   . ARG B 2 51  ? 18.367  -6.337  -13.267 1.00 0.00 ? 441 ARG B HH12   2  
ATOM   7538   H  HH21   . ARG B 2 51  ? 16.281  -9.088  -12.729 1.00 0.00 ? 441 ARG B HH21   2  
ATOM   7539   H  HH22   . ARG B 2 51  ? 17.453  -8.355  -13.778 1.00 0.00 ? 441 ARG B HH22   2  
ATOM   7540   N  N      . LYS B 2 52  ? 18.676  -6.181  -6.801  1.00 0.00 ? 442 LYS B N      2  
ATOM   7541   C  CA     . LYS B 2 52  ? 20.105  -6.330  -7.081  1.00 0.00 ? 442 LYS B CA     2  
ATOM   7542   C  C      . LYS B 2 52  ? 20.626  -7.682  -6.590  1.00 0.00 ? 442 LYS B C      2  
ATOM   7543   O  O      . LYS B 2 52  ? 21.492  -8.287  -7.220  1.00 0.00 ? 442 LYS B O      2  
ATOM   7544   C  CB     . LYS B 2 52  ? 20.899  -5.209  -6.405  1.00 0.00 ? 442 LYS B CB     2  
ATOM   7545   C  CG     . LYS B 2 52  ? 20.531  -3.816  -6.886  1.00 0.00 ? 442 LYS B CG     2  
ATOM   7546   C  CD     . LYS B 2 52  ? 20.942  -3.596  -8.330  1.00 0.00 ? 442 LYS B CD     2  
ATOM   7547   C  CE     . LYS B 2 52  ? 22.455  -3.688  -8.491  1.00 0.00 ? 442 LYS B CE     2  
ATOM   7548   N  NZ     . LYS B 2 52  ? 22.900  -3.316  -9.860  1.00 0.00 ? 442 LYS B NZ     2  
ATOM   7549   H  H      . LYS B 2 52  ? 18.370  -5.406  -6.277  1.00 0.00 ? 442 LYS B H      2  
ATOM   7550   H  HA     . LYS B 2 52  ? 20.243  -6.266  -8.149  1.00 0.00 ? 442 LYS B HA     2  
ATOM   7551   H  HB2    . LYS B 2 52  ? 20.726  -5.253  -5.340  1.00 0.00 ? 442 LYS B HB2    2  
ATOM   7552   H  HB3    . LYS B 2 52  ? 21.951  -5.363  -6.595  1.00 0.00 ? 442 LYS B HB3    2  
ATOM   7553   H  HG2    . LYS B 2 52  ? 19.462  -3.688  -6.806  1.00 0.00 ? 442 LYS B HG2    2  
ATOM   7554   H  HG3    . LYS B 2 52  ? 21.030  -3.088  -6.265  1.00 0.00 ? 442 LYS B HG3    2  
ATOM   7555   H  HD2    . LYS B 2 52  ? 20.475  -4.355  -8.940  1.00 0.00 ? 442 LYS B HD2    2  
ATOM   7556   H  HD3    . LYS B 2 52  ? 20.610  -2.618  -8.648  1.00 0.00 ? 442 LYS B HD3    2  
ATOM   7557   H  HE2    . LYS B 2 52  ? 22.921  -3.020  -7.781  1.00 0.00 ? 442 LYS B HE2    2  
ATOM   7558   H  HE3    . LYS B 2 52  ? 22.764  -4.702  -8.283  1.00 0.00 ? 442 LYS B HE3    2  
ATOM   7559   H  HZ1    . LYS B 2 52  ? 22.686  -2.312  -10.048 1.00 0.00 ? 442 LYS B HZ1    2  
ATOM   7560   H  HZ2    . LYS B 2 52  ? 22.411  -3.899  -10.573 1.00 0.00 ? 442 LYS B HZ2    2  
ATOM   7561   H  HZ3    . LYS B 2 52  ? 23.929  -3.463  -9.955  1.00 0.00 ? 442 LYS B HZ3    2  
ATOM   7562   N  N      . LEU B 2 53  ? 20.089  -8.150  -5.469  1.00 0.00 ? 443 LEU B N      2  
ATOM   7563   C  CA     . LEU B 2 53  ? 20.472  -9.443  -4.914  1.00 0.00 ? 443 LEU B CA     2  
ATOM   7564   C  C      . LEU B 2 53  ? 20.099  -10.564 -5.877  1.00 0.00 ? 443 LEU B C      2  
ATOM   7565   O  O      . LEU B 2 53  ? 20.925  -11.412 -6.204  1.00 0.00 ? 443 LEU B O      2  
ATOM   7566   C  CB     . LEU B 2 53  ? 19.795  -9.650  -3.555  1.00 0.00 ? 443 LEU B CB     2  
ATOM   7567   C  CG     . LEU B 2 53  ? 20.322  -10.811 -2.693  1.00 0.00 ? 443 LEU B CG     2  
ATOM   7568   C  CD1    . LEU B 2 53  ? 19.672  -12.131 -3.082  1.00 0.00 ? 443 LEU B CD1    2  
ATOM   7569   C  CD2    . LEU B 2 53  ? 21.836  -10.918 -2.799  1.00 0.00 ? 443 LEU B CD2    2  
ATOM   7570   H  H      . LEU B 2 53  ? 19.426  -7.603  -4.994  1.00 0.00 ? 443 LEU B H      2  
ATOM   7571   H  HA     . LEU B 2 53  ? 21.535  -9.444  -4.773  1.00 0.00 ? 443 LEU B HA     2  
ATOM   7572   H  HB2    . LEU B 2 53  ? 19.895  -8.738  -2.989  1.00 0.00 ? 443 LEU B HB2    2  
ATOM   7573   H  HB3    . LEU B 2 53  ? 18.753  -9.820  -3.739  1.00 0.00 ? 443 LEU B HB3    2  
ATOM   7574   H  HG     . LEU B 2 53  ? 20.076  -10.615 -1.660  1.00 0.00 ? 443 LEU B HG     2  
ATOM   7575   H  HD11   . LEU B 2 53  ? 20.067  -12.923 -2.462  1.00 0.00 ? 443 LEU B HD11   2  
ATOM   7576   H  HD12   . LEU B 2 53  ? 19.883  -12.346 -4.119  1.00 0.00 ? 443 LEU B HD12   2  
ATOM   7577   H  HD13   . LEU B 2 53  ? 18.603  -12.062 -2.939  1.00 0.00 ? 443 LEU B HD13   2  
ATOM   7578   H  HD21   . LEU B 2 53  ? 22.113  -11.106 -3.827  1.00 0.00 ? 443 LEU B HD21   2  
ATOM   7579   H  HD22   . LEU B 2 53  ? 22.183  -11.732 -2.178  1.00 0.00 ? 443 LEU B HD22   2  
ATOM   7580   H  HD23   . LEU B 2 53  ? 22.285  -9.994  -2.466  1.00 0.00 ? 443 LEU B HD23   2  
ATOM   7581   N  N      . ARG B 2 54  ? 18.854  -10.559 -6.334  1.00 0.00 ? 444 ARG B N      2  
ATOM   7582   C  CA     . ARG B 2 54  ? 18.372  -11.581 -7.257  1.00 0.00 ? 444 ARG B CA     2  
ATOM   7583   C  C      . ARG B 2 54  ? 18.917  -11.371 -8.668  1.00 0.00 ? 444 ARG B C      2  
ATOM   7584   O  O      . ARG B 2 54  ? 18.798  -12.248 -9.525  1.00 0.00 ? 444 ARG B O      2  
ATOM   7585   C  CB     . ARG B 2 54  ? 16.851  -11.575 -7.264  1.00 0.00 ? 444 ARG B CB     2  
ATOM   7586   C  CG     . ARG B 2 54  ? 16.267  -11.752 -5.876  1.00 0.00 ? 444 ARG B CG     2  
ATOM   7587   C  CD     . ARG B 2 54  ? 16.562  -13.139 -5.325  1.00 0.00 ? 444 ARG B CD     2  
ATOM   7588   N  NE     . ARG B 2 54  ? 16.017  -14.198 -6.176  1.00 0.00 ? 444 ARG B NE     2  
ATOM   7589   C  CZ     . ARG B 2 54  ? 16.583  -15.396 -6.339  1.00 0.00 ? 444 ARG B CZ     2  
ATOM   7590   N  NH1    . ARG B 2 54  ? 17.703  -15.701 -5.696  1.00 0.00 ? 444 ARG B NH1    2  
ATOM   7591   N  NH2    . ARG B 2 54  ? 16.021  -16.300 -7.133  1.00 0.00 ? 444 ARG B NH2    2  
ATOM   7592   H  H      . ARG B 2 54  ? 18.231  -9.862  -6.027  1.00 0.00 ? 444 ARG B H      2  
ATOM   7593   H  HA     . ARG B 2 54  ? 18.715  -12.538 -6.894  1.00 0.00 ? 444 ARG B HA     2  
ATOM   7594   H  HB2    . ARG B 2 54  ? 16.500  -10.637 -7.670  1.00 0.00 ? 444 ARG B HB2    2  
ATOM   7595   H  HB3    . ARG B 2 54  ? 16.499  -12.385 -7.886  1.00 0.00 ? 444 ARG B HB3    2  
ATOM   7596   H  HG2    . ARG B 2 54  ? 16.707  -11.017 -5.220  1.00 0.00 ? 444 ARG B HG2    2  
ATOM   7597   H  HG3    . ARG B 2 54  ? 15.206  -11.602 -5.920  1.00 0.00 ? 444 ARG B HG3    2  
ATOM   7598   H  HD2    . ARG B 2 54  ? 17.633  -13.261 -5.257  1.00 0.00 ? 444 ARG B HD2    2  
ATOM   7599   H  HD3    . ARG B 2 54  ? 16.128  -13.222 -4.339  1.00 0.00 ? 444 ARG B HD3    2  
ATOM   7600   H  HE     . ARG B 2 54  ? 15.169  -14.001 -6.650  1.00 0.00 ? 444 ARG B HE     2  
ATOM   7601   H  HH11   . ARG B 2 54  ? 18.134  -15.038 -5.083  1.00 0.00 ? 444 ARG B HH11   2  
ATOM   7602   H  HH12   . ARG B 2 54  ? 18.119  -16.609 -5.815  1.00 0.00 ? 444 ARG B HH12   2  
ATOM   7603   H  HH21   . ARG B 2 54  ? 15.160  -16.092 -7.617  1.00 0.00 ? 444 ARG B HH21   2  
ATOM   7604   H  HH22   . ARG B 2 54  ? 16.461  -17.197 -7.263  1.00 0.00 ? 444 ARG B HH22   2  
ATOM   7605   N  N      . GLU B 2 55  ? 19.502  -10.207 -8.902  1.00 0.00 ? 445 GLU B N      2  
ATOM   7606   C  CA     . GLU B 2 55  ? 20.160  -9.911  -10.168 1.00 0.00 ? 445 GLU B CA     2  
ATOM   7607   C  C      . GLU B 2 55  ? 21.553  -10.549 -10.187 1.00 0.00 ? 445 GLU B C      2  
ATOM   7608   O  O      . GLU B 2 55  ? 22.171  -10.708 -11.241 1.00 0.00 ? 445 GLU B O      2  
ATOM   7609   C  CB     . GLU B 2 55  ? 20.254  -8.391  -10.366 1.00 0.00 ? 445 GLU B CB     2  
ATOM   7610   C  CG     . GLU B 2 55  ? 20.989  -7.964  -11.633 1.00 0.00 ? 445 GLU B CG     2  
ATOM   7611   C  CD     . GLU B 2 55  ? 20.270  -8.350  -12.916 1.00 0.00 ? 445 GLU B CD     2  
ATOM   7612   O  OE1    . GLU B 2 55  ? 20.170  -9.557  -13.217 1.00 0.00 ? 445 GLU B OE1    2  
ATOM   7613   O  OE2    . GLU B 2 55  ? 19.804  -7.439  -13.633 1.00 0.00 ? 445 GLU B OE2    2  
ATOM   7614   H  H      . GLU B 2 55  ? 19.487  -9.520  -8.203  1.00 0.00 ? 445 GLU B H      2  
ATOM   7615   H  HA     . GLU B 2 55  ? 19.566  -10.339 -10.960 1.00 0.00 ? 445 GLU B HA     2  
ATOM   7616   H  HB2    . GLU B 2 55  ? 19.253  -7.981  -10.400 1.00 0.00 ? 445 GLU B HB2    2  
ATOM   7617   H  HB3    . GLU B 2 55  ? 20.772  -7.966  -9.518  1.00 0.00 ? 445 GLU B HB3    2  
ATOM   7618   H  HG2    . GLU B 2 55  ? 21.102  -6.889  -11.617 1.00 0.00 ? 445 GLU B HG2    2  
ATOM   7619   H  HG3    . GLU B 2 55  ? 21.968  -8.422  -11.629 1.00 0.00 ? 445 GLU B HG3    2  
ATOM   7620   N  N      . ALA B 2 56  ? 22.036  -10.921 -9.010  1.00 0.00 ? 446 ALA B N      2  
ATOM   7621   C  CA     . ALA B 2 56  ? 23.335  -11.557 -8.880  1.00 0.00 ? 446 ALA B CA     2  
ATOM   7622   C  C      . ALA B 2 56  ? 23.176  -13.069 -8.726  1.00 0.00 ? 446 ALA B C      2  
ATOM   7623   O  O      . ALA B 2 56  ? 23.305  -13.786 -9.741  1.00 0.00 ? 446 ALA B O      2  
ATOM   7624   C  CB     . ALA B 2 56  ? 24.096  -10.967 -7.702  1.00 0.00 ? 446 ALA B CB     2  
ATOM   7625   O  OXT    . ALA B 2 56  ? 22.910  -13.531 -7.597  1.00 0.00 ? 446 ALA B OXT    2  
ATOM   7626   H  H      . ALA B 2 56  ? 21.498  -10.776 -8.205  1.00 0.00 ? 446 ALA B H      2  
ATOM   7627   H  HA     . ALA B 2 56  ? 23.898  -11.354 -9.779  1.00 0.00 ? 446 ALA B HA     2  
ATOM   7628   H  HB1    . ALA B 2 56  ? 24.209  -9.902  -7.845  1.00 0.00 ? 446 ALA B HB1    2  
ATOM   7629   H  HB2    . ALA B 2 56  ? 25.071  -11.427 -7.634  1.00 0.00 ? 446 ALA B HB2    2  
ATOM   7630   H  HB3    . ALA B 2 56  ? 23.546  -11.151 -6.791  1.00 0.00 ? 446 ALA B HB3    2  
HETATM 7631   P  PG     . GNP C 3 .   ? 3.667   -8.911  8.968   1.00 0.00 ? 500 GNP A PG     2  
HETATM 7632   O  O1G    . GNP C 3 .   ? 5.104   -9.227  9.187   1.00 0.00 ? 500 GNP A O1G    2  
HETATM 7633   O  O2G    . GNP C 3 .   ? 3.496   -7.834  7.807   1.00 0.00 ? 500 GNP A O2G    2  
HETATM 7634   O  O3G    . GNP C 3 .   ? 2.989   -8.424  10.324  1.00 0.00 ? 500 GNP A O3G    2  
HETATM 7635   N  N3B    . GNP C 3 .   ? 2.806   -10.267 8.469   1.00 0.00 ? 500 GNP A N3B    2  
HETATM 7636   P  PB     . GNP C 3 .   ? 1.143   -10.079 8.647   1.00 0.00 ? 500 GNP A PB     2  
HETATM 7637   O  O1B    . GNP C 3 .   ? 0.829   -9.798  10.074  1.00 0.00 ? 500 GNP A O1B    2  
HETATM 7638   O  O2B    . GNP C 3 .   ? 0.632   -9.155  7.597   1.00 0.00 ? 500 GNP A O2B    2  
HETATM 7639   O  O3A    . GNP C 3 .   ? 0.605   -11.543 8.311   1.00 0.00 ? 500 GNP A O3A    2  
HETATM 7640   P  PA     . GNP C 3 .   ? -0.952  -11.881 8.400   1.00 0.00 ? 500 GNP A PA     2  
HETATM 7641   O  O1A    . GNP C 3 .   ? -1.229  -12.505 9.718   1.00 0.00 ? 500 GNP A O1A    2  
HETATM 7642   O  O2A    . GNP C 3 .   ? -1.731  -10.682 7.996   1.00 0.00 ? 500 GNP A O2A    2  
HETATM 7643   O  "O5'"  . GNP C 3 .   ? -1.114  -12.990 7.266   1.00 0.00 ? 500 GNP A "O5'"  2  
HETATM 7644   C  "C5'"  . GNP C 3 .   ? -2.397  -13.501 6.912   1.00 0.00 ? 500 GNP A "C5'"  2  
HETATM 7645   C  "C4'"  . GNP C 3 .   ? -2.502  -13.639 5.411   1.00 0.00 ? 500 GNP A "C4'"  2  
HETATM 7646   O  "O4'"  . GNP C 3 .   ? -3.383  -14.756 5.109   1.00 0.00 ? 500 GNP A "O4'"  2  
HETATM 7647   C  "C3'"  . GNP C 3 .   ? -3.091  -12.437 4.684   1.00 0.00 ? 500 GNP A "C3'"  2  
HETATM 7648   O  "O3'"  . GNP C 3 .   ? -2.429  -12.218 3.444   1.00 0.00 ? 500 GNP A "O3'"  2  
HETATM 7649   C  "C2'"  . GNP C 3 .   ? -4.557  -12.805 4.485   1.00 0.00 ? 500 GNP A "C2'"  2  
HETATM 7650   O  "O2'"  . GNP C 3 .   ? -5.100  -12.244 3.307   1.00 0.00 ? 500 GNP A "O2'"  2  
HETATM 7651   C  "C1'"  . GNP C 3 .   ? -4.465  -14.320 4.315   1.00 0.00 ? 500 GNP A "C1'"  2  
HETATM 7652   N  N9     . GNP C 3 .   ? -5.674  -15.015 4.747   1.00 0.00 ? 500 GNP A N9     2  
HETATM 7653   C  C8     . GNP C 3 .   ? -5.926  -15.538 5.991   1.00 0.00 ? 500 GNP A C8     2  
HETATM 7654   N  N7     . GNP C 3 .   ? -7.108  -16.086 6.090   1.00 0.00 ? 500 GNP A N7     2  
HETATM 7655   C  C5     . GNP C 3 .   ? -7.669  -15.915 4.834   1.00 0.00 ? 500 GNP A C5     2  
HETATM 7656   C  C6     . GNP C 3 .   ? -8.940  -16.307 4.338   1.00 0.00 ? 500 GNP A C6     2  
HETATM 7657   O  O6     . GNP C 3 .   ? -9.850  -16.889 4.937   1.00 0.00 ? 500 GNP A O6     2  
HETATM 7658   N  N1     . GNP C 3 .   ? -9.111  -15.940 3.007   1.00 0.00 ? 500 GNP A N1     2  
HETATM 7659   C  C2     . GNP C 3 .   ? -8.170  -15.284 2.253   1.00 0.00 ? 500 GNP A C2     2  
HETATM 7660   N  N2     . GNP C 3 .   ? -8.515  -15.012 0.985   1.00 0.00 ? 500 GNP A N2     2  
HETATM 7661   N  N3     . GNP C 3 .   ? -6.981  -14.909 2.701   1.00 0.00 ? 500 GNP A N3     2  
HETATM 7662   C  C4     . GNP C 3 .   ? -6.799  -15.259 3.992   1.00 0.00 ? 500 GNP A C4     2  
HETATM 7663   H  HNB3   . GNP C 3 .   ? 3.102   -11.051 8.987   1.00 0.00 ? 500 GNP A HNB3   2  
HETATM 7664   H  "H5'2" . GNP C 3 .   ? -3.176  -12.826 7.266   1.00 0.00 ? 500 GNP A "H5'2" 2  
HETATM 7665   H  "H5'1" . GNP C 3 .   ? -2.542  -14.480 7.367   1.00 0.00 ? 500 GNP A "H5'1" 2  
HETATM 7666   H  "H4'"  . GNP C 3 .   ? -1.490  -13.769 5.026   1.00 0.00 ? 500 GNP A "H4'"  2  
HETATM 7667   H  "H3'"  . GNP C 3 .   ? -2.965  -11.517 5.255   1.00 0.00 ? 500 GNP A "H3'"  2  
HETATM 7668   H  "HO3'" . GNP C 3 .   ? -2.469  -13.040 2.955   1.00 0.00 ? 500 GNP A "HO3'" 2  
HETATM 7669   H  "H2'"  . GNP C 3 .   ? -5.134  -12.545 5.375   1.00 0.00 ? 500 GNP A "H2'"  2  
HETATM 7670   H  "HO2'" . GNP C 3 .   ? -5.357  -12.970 2.735   1.00 0.00 ? 500 GNP A "HO2'" 2  
HETATM 7671   H  "H1'"  . GNP C 3 .   ? -4.252  -14.612 3.285   1.00 0.00 ? 500 GNP A "H1'"  2  
HETATM 7672   H  H8     . GNP C 3 .   ? -5.223  -15.494 6.808   1.00 0.00 ? 500 GNP A H8     2  
HETATM 7673   H  HN1    . GNP C 3 .   ? -9.992  -16.172 2.569   1.00 0.00 ? 500 GNP A HN1    2  
HETATM 7674   H  HN21   . GNP C 3 .   ? -7.872  -14.526 0.379   1.00 0.00 ? 500 GNP A HN21   2  
HETATM 7675   H  HN22   . GNP C 3 .   ? -9.418  -15.302 0.634   1.00 0.00 ? 500 GNP A HN22   2  
HETATM 7676   MG MG     . MG  D 4 .   ? 1.948   -7.992  6.119   1.00 0.00 ? 501 MG  A MG     2  
HETATM 7677   O  O      . HOH E 5 .   ? 0.976   -6.016  6.792   1.00 0.00 ? 502 HOH A O      2  
HETATM 7678   H  H1     . HOH E 5 .   ? 1.541   -5.690  7.486   1.00 0.00 ? 502 HOH A H1     2  
HETATM 7679   H  H2     . HOH E 5 .   ? 0.175   -6.281  7.232   1.00 0.00 ? 502 HOH A H2     2  
HETATM 7680   O  O      . HOH E 5 .   ? 2.907   -9.971  5.425   1.00 0.00 ? 503 HOH A O      2  
HETATM 7681   H  H1     . HOH E 5 .   ? 3.270   -9.768  4.564   1.00 0.00 ? 503 HOH A H1     2  
HETATM 7682   H  H2     . HOH E 5 .   ? 2.167   -10.545 5.240   1.00 0.00 ? 503 HOH A H2     2  
ATOM   7683   N  N      . GLY A 1 1   ? 1.177   19.363  -17.583 1.00 0.00 ? 8   GLY A N      3  
ATOM   7684   C  CA     . GLY A 1 1   ? 1.218   18.792  -16.215 1.00 0.00 ? 8   GLY A CA     3  
ATOM   7685   C  C      . GLY A 1 1   ? 2.608   18.848  -15.624 1.00 0.00 ? 8   GLY A C      3  
ATOM   7686   O  O      . GLY A 1 1   ? 3.122   19.926  -15.330 1.00 0.00 ? 8   GLY A O      3  
ATOM   7687   H  H1     . GLY A 1 1   ? 1.436   20.373  -17.557 1.00 0.00 ? 8   GLY A H1     3  
ATOM   7688   H  H2     . GLY A 1 1   ? 0.220   19.269  -17.984 1.00 0.00 ? 8   GLY A H2     3  
ATOM   7689   H  H3     . GLY A 1 1   ? 1.853   18.860  -18.199 1.00 0.00 ? 8   GLY A H3     3  
ATOM   7690   H  HA2    . GLY A 1 1   ? 0.547   19.353  -15.581 1.00 0.00 ? 8   GLY A HA2    3  
ATOM   7691   H  HA3    . GLY A 1 1   ? 0.890   17.762  -16.254 1.00 0.00 ? 8   GLY A HA3    3  
ATOM   7692   N  N      . GLN A 1 2   ? 3.226   17.688  -15.473 1.00 0.00 ? 9   GLN A N      3  
ATOM   7693   C  CA     . GLN A 1 2   ? 4.570   17.595  -14.921 1.00 0.00 ? 9   GLN A CA     3  
ATOM   7694   C  C      . GLN A 1 2   ? 5.359   16.513  -15.656 1.00 0.00 ? 9   GLN A C      3  
ATOM   7695   O  O      . GLN A 1 2   ? 5.087   16.233  -16.825 1.00 0.00 ? 9   GLN A O      3  
ATOM   7696   C  CB     . GLN A 1 2   ? 4.507   17.292  -13.416 1.00 0.00 ? 9   GLN A CB     3  
ATOM   7697   C  CG     . GLN A 1 2   ? 3.858   15.956  -13.078 1.00 0.00 ? 9   GLN A CG     3  
ATOM   7698   C  CD     . GLN A 1 2   ? 3.953   15.616  -11.601 1.00 0.00 ? 9   GLN A CD     3  
ATOM   7699   O  OE1    . GLN A 1 2   ? 3.931   16.494  -10.741 1.00 0.00 ? 9   GLN A OE1    3  
ATOM   7700   N  NE2    . GLN A 1 2   ? 4.093   14.338  -11.301 1.00 0.00 ? 9   GLN A NE2    3  
ATOM   7701   H  H      . GLN A 1 2   ? 2.771   16.865  -15.755 1.00 0.00 ? 9   GLN A H      3  
ATOM   7702   H  HA     . GLN A 1 2   ? 5.060   18.546  -15.071 1.00 0.00 ? 9   GLN A HA     3  
ATOM   7703   H  HB2    . GLN A 1 2   ? 5.512   17.287  -13.023 1.00 0.00 ? 9   GLN A HB2    3  
ATOM   7704   H  HB3    . GLN A 1 2   ? 3.945   18.074  -12.928 1.00 0.00 ? 9   GLN A HB3    3  
ATOM   7705   H  HG2    . GLN A 1 2   ? 2.816   15.997  -13.354 1.00 0.00 ? 9   GLN A HG2    3  
ATOM   7706   H  HG3    . GLN A 1 2   ? 4.350   15.178  -13.644 1.00 0.00 ? 9   GLN A HG3    3  
ATOM   7707   H  HE21   . GLN A 1 2   ? 4.131   13.691  -12.037 1.00 0.00 ? 9   GLN A HE21   3  
ATOM   7708   H  HE22   . GLN A 1 2   ? 4.165   14.090  -10.357 1.00 0.00 ? 9   GLN A HE22   3  
ATOM   7709   N  N      . SER A 1 3   ? 6.337   15.925  -14.977 1.00 0.00 ? 10  SER A N      3  
ATOM   7710   C  CA     . SER A 1 3   ? 7.111   14.815  -15.523 1.00 0.00 ? 10  SER A CA     3  
ATOM   7711   C  C      . SER A 1 3   ? 6.209   13.621  -15.856 1.00 0.00 ? 10  SER A C      3  
ATOM   7712   O  O      . SER A 1 3   ? 5.029   13.613  -15.500 1.00 0.00 ? 10  SER A O      3  
ATOM   7713   C  CB     . SER A 1 3   ? 8.157   14.391  -14.497 1.00 0.00 ? 10  SER A CB     3  
ATOM   7714   O  OG     . SER A 1 3   ? 8.845   15.518  -13.979 1.00 0.00 ? 10  SER A OG     3  
ATOM   7715   H  H      . SER A 1 3   ? 6.554   16.249  -14.079 1.00 0.00 ? 10  SER A H      3  
ATOM   7716   H  HA     . SER A 1 3   ? 7.606   15.153  -16.420 1.00 0.00 ? 10  SER A HA     3  
ATOM   7717   H  HB2    . SER A 1 3   ? 7.669   13.871  -13.683 1.00 0.00 ? 10  SER A HB2    3  
ATOM   7718   H  HB3    . SER A 1 3   ? 8.873   13.732  -14.967 1.00 0.00 ? 10  SER A HB3    3  
ATOM   7719   H  HG     . SER A 1 3   ? 9.799   15.346  -13.998 1.00 0.00 ? 10  SER A HG     3  
ATOM   7720   N  N      . SER A 1 4   ? 6.771   12.619  -16.526 1.00 0.00 ? 11  SER A N      3  
ATOM   7721   C  CA     . SER A 1 4   ? 6.033   11.406  -16.857 1.00 0.00 ? 11  SER A CA     3  
ATOM   7722   C  C      . SER A 1 4   ? 5.427   10.787  -15.600 1.00 0.00 ? 11  SER A C      3  
ATOM   7723   O  O      . SER A 1 4   ? 6.122   10.561  -14.601 1.00 0.00 ? 11  SER A O      3  
ATOM   7724   C  CB     . SER A 1 4   ? 6.949   10.406  -17.557 1.00 0.00 ? 11  SER A CB     3  
ATOM   7725   O  OG     . SER A 1 4   ? 7.468   10.954  -18.760 1.00 0.00 ? 11  SER A OG     3  
ATOM   7726   H  H      . SER A 1 4   ? 7.715   12.695  -16.805 1.00 0.00 ? 11  SER A H      3  
ATOM   7727   H  HA     . SER A 1 4   ? 5.233   11.681  -17.530 1.00 0.00 ? 11  SER A HA     3  
ATOM   7728   H  HB2    . SER A 1 4   ? 7.772   10.156  -16.904 1.00 0.00 ? 11  SER A HB2    3  
ATOM   7729   H  HB3    . SER A 1 4   ? 6.391   9.513   -17.794 1.00 0.00 ? 11  SER A HB3    3  
ATOM   7730   H  HG     . SER A 1 4   ? 8.003   10.291  -19.206 1.00 0.00 ? 11  SER A HG     3  
ATOM   7731   N  N      . LEU A 1 5   ? 4.133   10.506  -15.661 1.00 0.00 ? 12  LEU A N      3  
ATOM   7732   C  CA     . LEU A 1 5   ? 3.376   10.070  -14.493 1.00 0.00 ? 12  LEU A CA     3  
ATOM   7733   C  C      . LEU A 1 5   ? 3.502   8.562   -14.300 1.00 0.00 ? 12  LEU A C      3  
ATOM   7734   O  O      . LEU A 1 5   ? 2.521   7.876   -13.991 1.00 0.00 ? 12  LEU A O      3  
ATOM   7735   C  CB     . LEU A 1 5   ? 1.897   10.439  -14.650 1.00 0.00 ? 12  LEU A CB     3  
ATOM   7736   C  CG     . LEU A 1 5   ? 1.574   11.453  -15.756 1.00 0.00 ? 12  LEU A CG     3  
ATOM   7737   C  CD1    . LEU A 1 5   ? 0.094   11.417  -16.082 1.00 0.00 ? 12  LEU A CD1    3  
ATOM   7738   C  CD2    . LEU A 1 5   ? 1.983   12.860  -15.344 1.00 0.00 ? 12  LEU A CD2    3  
ATOM   7739   H  H      . LEU A 1 5   ? 3.674   10.584  -16.522 1.00 0.00 ? 12  LEU A H      3  
ATOM   7740   H  HA     . LEU A 1 5   ? 3.777   10.570  -13.625 1.00 0.00 ? 12  LEU A HA     3  
ATOM   7741   H  HB2    . LEU A 1 5   ? 1.340   9.535   -14.846 1.00 0.00 ? 12  LEU A HB2    3  
ATOM   7742   H  HB3    . LEU A 1 5   ? 1.558   10.852  -13.711 1.00 0.00 ? 12  LEU A HB3    3  
ATOM   7743   H  HG     . LEU A 1 5   ? 2.121   11.190  -16.649 1.00 0.00 ? 12  LEU A HG     3  
ATOM   7744   H  HD11   . LEU A 1 5   ? -0.184  10.416  -16.376 1.00 0.00 ? 12  LEU A HD11   3  
ATOM   7745   H  HD12   . LEU A 1 5   ? -0.113  12.100  -16.893 1.00 0.00 ? 12  LEU A HD12   3  
ATOM   7746   H  HD13   . LEU A 1 5   ? -0.475  11.709  -15.210 1.00 0.00 ? 12  LEU A HD13   3  
ATOM   7747   H  HD21   . LEU A 1 5   ? 3.047   12.888  -15.164 1.00 0.00 ? 12  LEU A HD21   3  
ATOM   7748   H  HD22   . LEU A 1 5   ? 1.458   13.140  -14.443 1.00 0.00 ? 12  LEU A HD22   3  
ATOM   7749   H  HD23   . LEU A 1 5   ? 1.735   13.552  -16.137 1.00 0.00 ? 12  LEU A HD23   3  
ATOM   7750   N  N      . ALA A 1 6   ? 4.713   8.056   -14.450 1.00 0.00 ? 13  ALA A N      3  
ATOM   7751   C  CA     . ALA A 1 6   ? 4.967   6.628   -14.349 1.00 0.00 ? 13  ALA A CA     3  
ATOM   7752   C  C      . ALA A 1 6   ? 5.388   6.243   -12.941 1.00 0.00 ? 13  ALA A C      3  
ATOM   7753   O  O      . ALA A 1 6   ? 5.876   5.143   -12.704 1.00 0.00 ? 13  ALA A O      3  
ATOM   7754   C  CB     . ALA A 1 6   ? 6.023   6.208   -15.358 1.00 0.00 ? 13  ALA A CB     3  
ATOM   7755   H  H      . ALA A 1 6   ? 5.464   8.664   -14.637 1.00 0.00 ? 13  ALA A H      3  
ATOM   7756   H  HA     . ALA A 1 6   ? 4.050   6.116   -14.587 1.00 0.00 ? 13  ALA A HA     3  
ATOM   7757   H  HB1    . ALA A 1 6   ? 6.952   6.717   -15.141 1.00 0.00 ? 13  ALA A HB1    3  
ATOM   7758   H  HB2    . ALA A 1 6   ? 5.695   6.468   -16.355 1.00 0.00 ? 13  ALA A HB2    3  
ATOM   7759   H  HB3    . ALA A 1 6   ? 6.176   5.141   -15.297 1.00 0.00 ? 13  ALA A HB3    3  
ATOM   7760   N  N      . LEU A 1 7   ? 5.181   7.149   -12.006 1.00 0.00 ? 14  LEU A N      3  
ATOM   7761   C  CA     . LEU A 1 7   ? 5.492   6.887   -10.610 1.00 0.00 ? 14  LEU A CA     3  
ATOM   7762   C  C      . LEU A 1 7   ? 4.222   7.003   -9.775  1.00 0.00 ? 14  LEU A C      3  
ATOM   7763   O  O      . LEU A 1 7   ? 3.614   8.070   -9.698  1.00 0.00 ? 14  LEU A O      3  
ATOM   7764   C  CB     . LEU A 1 7   ? 6.563   7.860   -10.113 1.00 0.00 ? 14  LEU A CB     3  
ATOM   7765   C  CG     . LEU A 1 7   ? 7.103   7.576   -8.708  1.00 0.00 ? 14  LEU A CG     3  
ATOM   7766   C  CD1    . LEU A 1 7   ? 7.680   6.170   -8.626  1.00 0.00 ? 14  LEU A CD1    3  
ATOM   7767   C  CD2    . LEU A 1 7   ? 8.157   8.603   -8.329  1.00 0.00 ? 14  LEU A CD2    3  
ATOM   7768   H  H      . LEU A 1 7   ? 4.803   8.015   -12.261 1.00 0.00 ? 14  LEU A H      3  
ATOM   7769   H  HA     . LEU A 1 7   ? 5.867   5.876   -10.538 1.00 0.00 ? 14  LEU A HA     3  
ATOM   7770   H  HB2    . LEU A 1 7   ? 7.391   7.836   -10.806 1.00 0.00 ? 14  LEU A HB2    3  
ATOM   7771   H  HB3    . LEU A 1 7   ? 6.142   8.854   -10.116 1.00 0.00 ? 14  LEU A HB3    3  
ATOM   7772   H  HG     . LEU A 1 7   ? 6.292   7.647   -7.996  1.00 0.00 ? 14  LEU A HG     3  
ATOM   7773   H  HD11   . LEU A 1 7   ? 8.500   6.077   -9.322  1.00 0.00 ? 14  LEU A HD11   3  
ATOM   7774   H  HD12   . LEU A 1 7   ? 6.913   5.452   -8.873  1.00 0.00 ? 14  LEU A HD12   3  
ATOM   7775   H  HD13   . LEU A 1 7   ? 8.037   5.987   -7.623  1.00 0.00 ? 14  LEU A HD13   3  
ATOM   7776   H  HD21   . LEU A 1 7   ? 7.728   9.592   -8.369  1.00 0.00 ? 14  LEU A HD21   3  
ATOM   7777   H  HD22   . LEU A 1 7   ? 8.984   8.541   -9.022  1.00 0.00 ? 14  LEU A HD22   3  
ATOM   7778   H  HD23   . LEU A 1 7   ? 8.511   8.403   -7.328  1.00 0.00 ? 14  LEU A HD23   3  
ATOM   7779   N  N      . HIS A 1 8   ? 3.802   5.890   -9.186  1.00 0.00 ? 15  HIS A N      3  
ATOM   7780   C  CA     . HIS A 1 8   ? 2.540   5.840   -8.453  1.00 0.00 ? 15  HIS A CA     3  
ATOM   7781   C  C      . HIS A 1 8   ? 2.758   5.323   -7.036  1.00 0.00 ? 15  HIS A C      3  
ATOM   7782   O  O      . HIS A 1 8   ? 3.579   4.434   -6.810  1.00 0.00 ? 15  HIS A O      3  
ATOM   7783   C  CB     . HIS A 1 8   ? 1.537   4.937   -9.179  1.00 0.00 ? 15  HIS A CB     3  
ATOM   7784   C  CG     . HIS A 1 8   ? 1.139   5.416   -10.548 1.00 0.00 ? 15  HIS A CG     3  
ATOM   7785   N  ND1    . HIS A 1 8   ? -0.171  5.608   -10.938 1.00 0.00 ? 15  HIS A ND1    3  
ATOM   7786   C  CD2    . HIS A 1 8   ? 1.889   5.708   -11.633 1.00 0.00 ? 15  HIS A CD2    3  
ATOM   7787   C  CE1    . HIS A 1 8   ? -0.203  5.993   -12.203 1.00 0.00 ? 15  HIS A CE1    3  
ATOM   7788   N  NE2    . HIS A 1 8   ? 1.037   6.067   -12.646 1.00 0.00 ? 15  HIS A NE2    3  
ATOM   7789   H  H      . HIS A 1 8   ? 4.358   5.076   -9.241  1.00 0.00 ? 15  HIS A H      3  
ATOM   7790   H  HA     . HIS A 1 8   ? 2.143   6.842   -8.401  1.00 0.00 ? 15  HIS A HA     3  
ATOM   7791   H  HB2    . HIS A 1 8   ? 1.980   3.960   -9.291  1.00 0.00 ? 15  HIS A HB2    3  
ATOM   7792   H  HB3    . HIS A 1 8   ? 0.642   4.852   -8.582  1.00 0.00 ? 15  HIS A HB3    3  
ATOM   7793   H  HD1    . HIS A 1 8   ? -0.962  5.489   -10.370 1.00 0.00 ? 15  HIS A HD1    3  
ATOM   7794   H  HD2    . HIS A 1 8   ? 2.968   5.661   -11.694 1.00 0.00 ? 15  HIS A HD2    3  
ATOM   7795   H  HE1    . HIS A 1 8   ? -1.099  6.182   -12.788 1.00 0.00 ? 15  HIS A HE1    3  
ATOM   7796   H  HE2    . HIS A 1 8   ? 1.314   6.568   -13.451 1.00 0.00 ? 15  HIS A HE2    3  
ATOM   7797   N  N      . LYS A 1 9   ? 2.019   5.883   -6.088  1.00 0.00 ? 16  LYS A N      3  
ATOM   7798   C  CA     . LYS A 1 9   ? 2.130   5.482   -4.690  1.00 0.00 ? 16  LYS A CA     3  
ATOM   7799   C  C      . LYS A 1 9   ? 0.799   4.941   -4.194  1.00 0.00 ? 16  LYS A C      3  
ATOM   7800   O  O      . LYS A 1 9   ? -0.193  5.668   -4.158  1.00 0.00 ? 16  LYS A O      3  
ATOM   7801   C  CB     . LYS A 1 9   ? 2.542   6.676   -3.827  1.00 0.00 ? 16  LYS A CB     3  
ATOM   7802   C  CG     . LYS A 1 9   ? 3.719   7.458   -4.384  1.00 0.00 ? 16  LYS A CG     3  
ATOM   7803   C  CD     . LYS A 1 9   ? 4.990   6.627   -4.422  1.00 0.00 ? 16  LYS A CD     3  
ATOM   7804   C  CE     . LYS A 1 9   ? 6.113   7.367   -5.130  1.00 0.00 ? 16  LYS A CE     3  
ATOM   7805   N  NZ     . LYS A 1 9   ? 6.391   8.695   -4.511  1.00 0.00 ? 16  LYS A NZ     3  
ATOM   7806   H  H      . LYS A 1 9   ? 1.381   6.589   -6.329  1.00 0.00 ? 16  LYS A H      3  
ATOM   7807   H  HA     . LYS A 1 9   ? 2.877   4.709   -4.613  1.00 0.00 ? 16  LYS A HA     3  
ATOM   7808   H  HB2    . LYS A 1 9   ? 1.702   7.347   -3.739  1.00 0.00 ? 16  LYS A HB2    3  
ATOM   7809   H  HB3    . LYS A 1 9   ? 2.807   6.319   -2.844  1.00 0.00 ? 16  LYS A HB3    3  
ATOM   7810   H  HG2    . LYS A 1 9   ? 3.484   7.774   -5.388  1.00 0.00 ? 16  LYS A HG2    3  
ATOM   7811   H  HG3    . LYS A 1 9   ? 3.886   8.326   -3.763  1.00 0.00 ? 16  LYS A HG3    3  
ATOM   7812   H  HD2    . LYS A 1 9   ? 5.296   6.407   -3.410  1.00 0.00 ? 16  LYS A HD2    3  
ATOM   7813   H  HD3    . LYS A 1 9   ? 4.789   5.706   -4.947  1.00 0.00 ? 16  LYS A HD3    3  
ATOM   7814   H  HE2    . LYS A 1 9   ? 7.007   6.765   -5.083  1.00 0.00 ? 16  LYS A HE2    3  
ATOM   7815   H  HE3    . LYS A 1 9   ? 5.829   7.511   -6.164  1.00 0.00 ? 16  LYS A HE3    3  
ATOM   7816   H  HZ1    . LYS A 1 9   ? 7.260   9.107   -4.912  1.00 0.00 ? 16  LYS A HZ1    3  
ATOM   7817   H  HZ2    . LYS A 1 9   ? 6.517   8.596   -3.484  1.00 0.00 ? 16  LYS A HZ2    3  
ATOM   7818   H  HZ3    . LYS A 1 9   ? 5.598   9.352   -4.687  1.00 0.00 ? 16  LYS A HZ3    3  
ATOM   7819   N  N      . VAL A 1 10  ? 0.775   3.672   -3.825  1.00 0.00 ? 17  VAL A N      3  
ATOM   7820   C  CA     . VAL A 1 10  ? -0.442  3.059   -3.314  1.00 0.00 ? 17  VAL A CA     3  
ATOM   7821   C  C      . VAL A 1 10  ? -0.199  2.467   -1.929  1.00 0.00 ? 17  VAL A C      3  
ATOM   7822   O  O      . VAL A 1 10  ? 0.559   1.507   -1.769  1.00 0.00 ? 17  VAL A O      3  
ATOM   7823   C  CB     . VAL A 1 10  ? -0.976  1.963   -4.259  1.00 0.00 ? 17  VAL A CB     3  
ATOM   7824   C  CG1    . VAL A 1 10  ? -2.253  1.352   -3.704  1.00 0.00 ? 17  VAL A CG1    3  
ATOM   7825   C  CG2    . VAL A 1 10  ? -1.216  2.523   -5.652  1.00 0.00 ? 17  VAL A CG2    3  
ATOM   7826   H  H      . VAL A 1 10  ? 1.597   3.131   -3.890  1.00 0.00 ? 17  VAL A H      3  
ATOM   7827   H  HA     . VAL A 1 10  ? -1.192  3.835   -3.234  1.00 0.00 ? 17  VAL A HA     3  
ATOM   7828   H  HB     . VAL A 1 10  ? -0.232  1.184   -4.330  1.00 0.00 ? 17  VAL A HB     3  
ATOM   7829   H  HG11   . VAL A 1 10  ? -2.054  0.932   -2.728  1.00 0.00 ? 17  VAL A HG11   3  
ATOM   7830   H  HG12   . VAL A 1 10  ? -2.599  0.575   -4.367  1.00 0.00 ? 17  VAL A HG12   3  
ATOM   7831   H  HG13   . VAL A 1 10  ? -3.011  2.118   -3.619  1.00 0.00 ? 17  VAL A HG13   3  
ATOM   7832   H  HG21   . VAL A 1 10  ? -1.926  3.335   -5.596  1.00 0.00 ? 17  VAL A HG21   3  
ATOM   7833   H  HG22   . VAL A 1 10  ? -1.609  1.746   -6.291  1.00 0.00 ? 17  VAL A HG22   3  
ATOM   7834   H  HG23   . VAL A 1 10  ? -0.283  2.887   -6.057  1.00 0.00 ? 17  VAL A HG23   3  
ATOM   7835   N  N      . ILE A 1 11  ? -0.837  3.053   -0.930  1.00 0.00 ? 18  ILE A N      3  
ATOM   7836   C  CA     . ILE A 1 11  ? -0.676  2.612   0.445   1.00 0.00 ? 18  ILE A CA     3  
ATOM   7837   C  C      . ILE A 1 11  ? -1.867  1.763   0.885   1.00 0.00 ? 18  ILE A C      3  
ATOM   7838   O  O      . ILE A 1 11  ? -3.019  2.176   0.752   1.00 0.00 ? 18  ILE A O      3  
ATOM   7839   C  CB     . ILE A 1 11  ? -0.521  3.817   1.398   1.00 0.00 ? 18  ILE A CB     3  
ATOM   7840   C  CG1    . ILE A 1 11  ? 0.631   4.709   0.924   1.00 0.00 ? 18  ILE A CG1    3  
ATOM   7841   C  CG2    . ILE A 1 11  ? -0.285  3.345   2.828   1.00 0.00 ? 18  ILE A CG2    3  
ATOM   7842   C  CD1    . ILE A 1 11  ? 0.834   5.949   1.766   1.00 0.00 ? 18  ILE A CD1    3  
ATOM   7843   H  H      . ILE A 1 11  ? -1.440  3.809   -1.123  1.00 0.00 ? 18  ILE A H      3  
ATOM   7844   H  HA     . ILE A 1 11  ? 0.224   2.013   0.500   1.00 0.00 ? 18  ILE A HA     3  
ATOM   7845   H  HB     . ILE A 1 11  ? -1.439  4.385   1.378   1.00 0.00 ? 18  ILE A HB     3  
ATOM   7846   H  HG12   . ILE A 1 11  ? 1.548   4.143   0.948   1.00 0.00 ? 18  ILE A HG12   3  
ATOM   7847   H  HG13   . ILE A 1 11  ? 0.436   5.025   -0.090  1.00 0.00 ? 18  ILE A HG13   3  
ATOM   7848   H  HG21   . ILE A 1 11  ? -1.118  2.736   3.147   1.00 0.00 ? 18  ILE A HG21   3  
ATOM   7849   H  HG22   . ILE A 1 11  ? -0.197  4.203   3.478   1.00 0.00 ? 18  ILE A HG22   3  
ATOM   7850   H  HG23   . ILE A 1 11  ? 0.625   2.766   2.872   1.00 0.00 ? 18  ILE A HG23   3  
ATOM   7851   H  HD11   . ILE A 1 11  ? 1.018   5.660   2.791   1.00 0.00 ? 18  ILE A HD11   3  
ATOM   7852   H  HD12   . ILE A 1 11  ? -0.054  6.562   1.718   1.00 0.00 ? 18  ILE A HD12   3  
ATOM   7853   H  HD13   . ILE A 1 11  ? 1.679   6.506   1.392   1.00 0.00 ? 18  ILE A HD13   3  
ATOM   7854   N  N      . MET A 1 12  ? -1.588  0.577   1.403   1.00 0.00 ? 19  MET A N      3  
ATOM   7855   C  CA     . MET A 1 12  ? -2.634  -0.309  1.884   1.00 0.00 ? 19  MET A CA     3  
ATOM   7856   C  C      . MET A 1 12  ? -2.818  -0.147  3.382   1.00 0.00 ? 19  MET A C      3  
ATOM   7857   O  O      . MET A 1 12  ? -1.959  -0.553  4.170   1.00 0.00 ? 19  MET A O      3  
ATOM   7858   C  CB     . MET A 1 12  ? -2.301  -1.762  1.562   1.00 0.00 ? 19  MET A CB     3  
ATOM   7859   C  CG     . MET A 1 12  ? -2.620  -2.162  0.135   1.00 0.00 ? 19  MET A CG     3  
ATOM   7860   S  SD     . MET A 1 12  ? -2.226  -3.888  -0.195  1.00 0.00 ? 19  MET A SD     3  
ATOM   7861   C  CE     . MET A 1 12  ? -3.093  -4.137  -1.739  1.00 0.00 ? 19  MET A CE     3  
ATOM   7862   H  H      . MET A 1 12  ? -0.651  0.292   1.478   1.00 0.00 ? 19  MET A H      3  
ATOM   7863   H  HA     . MET A 1 12  ? -3.555  -0.038  1.388   1.00 0.00 ? 19  MET A HA     3  
ATOM   7864   H  HB2    . MET A 1 12  ? -1.246  -1.922  1.730   1.00 0.00 ? 19  MET A HB2    3  
ATOM   7865   H  HB3    . MET A 1 12  ? -2.864  -2.402  2.226   1.00 0.00 ? 19  MET A HB3    3  
ATOM   7866   H  HG2    . MET A 1 12  ? -3.674  -2.006  -0.042  1.00 0.00 ? 19  MET A HG2    3  
ATOM   7867   H  HG3    . MET A 1 12  ? -2.046  -1.541  -0.537  1.00 0.00 ? 19  MET A HG3    3  
ATOM   7868   H  HE1    . MET A 1 12  ? -2.936  -5.149  -2.082  1.00 0.00 ? 19  MET A HE1    3  
ATOM   7869   H  HE2    . MET A 1 12  ? -2.719  -3.444  -2.478  1.00 0.00 ? 19  MET A HE2    3  
ATOM   7870   H  HE3    . MET A 1 12  ? -4.150  -3.966  -1.587  1.00 0.00 ? 19  MET A HE3    3  
ATOM   7871   N  N      . VAL A 1 13  ? -3.942  0.432   3.773   1.00 0.00 ? 20  VAL A N      3  
ATOM   7872   C  CA     . VAL A 1 13  ? -4.226  0.667   5.180   1.00 0.00 ? 20  VAL A CA     3  
ATOM   7873   C  C      . VAL A 1 13  ? -5.072  -0.464  5.754   1.00 0.00 ? 20  VAL A C      3  
ATOM   7874   O  O      . VAL A 1 13  ? -5.900  -1.052  5.058   1.00 0.00 ? 20  VAL A O      3  
ATOM   7875   C  CB     . VAL A 1 13  ? -4.938  2.018   5.402   1.00 0.00 ? 20  VAL A CB     3  
ATOM   7876   C  CG1    . VAL A 1 13  ? -4.016  3.170   5.038   1.00 0.00 ? 20  VAL A CG1    3  
ATOM   7877   C  CG2    . VAL A 1 13  ? -6.223  2.097   4.597   1.00 0.00 ? 20  VAL A CG2    3  
ATOM   7878   H  H      . VAL A 1 13  ? -4.607  0.696   3.099   1.00 0.00 ? 20  VAL A H      3  
ATOM   7879   H  HA     . VAL A 1 13  ? -3.282  0.692   5.706   1.00 0.00 ? 20  VAL A HA     3  
ATOM   7880   H  HB     . VAL A 1 13  ? -5.189  2.104   6.450   1.00 0.00 ? 20  VAL A HB     3  
ATOM   7881   H  HG11   . VAL A 1 13  ? -3.742  3.096   3.996   1.00 0.00 ? 20  VAL A HG11   3  
ATOM   7882   H  HG12   . VAL A 1 13  ? -3.127  3.125   5.648   1.00 0.00 ? 20  VAL A HG12   3  
ATOM   7883   H  HG13   . VAL A 1 13  ? -4.526  4.106   5.210   1.00 0.00 ? 20  VAL A HG13   3  
ATOM   7884   H  HG21   . VAL A 1 13  ? -5.993  2.025   3.545   1.00 0.00 ? 20  VAL A HG21   3  
ATOM   7885   H  HG22   . VAL A 1 13  ? -6.716  3.037   4.797   1.00 0.00 ? 20  VAL A HG22   3  
ATOM   7886   H  HG23   . VAL A 1 13  ? -6.873  1.282   4.879   1.00 0.00 ? 20  VAL A HG23   3  
ATOM   7887   N  N      . GLY A 1 14  ? -4.837  -0.776  7.020   1.00 0.00 ? 21  GLY A N      3  
ATOM   7888   C  CA     . GLY A 1 14  ? -5.540  -1.857  7.677   1.00 0.00 ? 21  GLY A CA     3  
ATOM   7889   C  C      . GLY A 1 14  ? -4.834  -2.265  8.947   1.00 0.00 ? 21  GLY A C      3  
ATOM   7890   O  O      . GLY A 1 14  ? -3.897  -1.592  9.374   1.00 0.00 ? 21  GLY A O      3  
ATOM   7891   H  H      . GLY A 1 14  ? -4.171  -0.262  7.525   1.00 0.00 ? 21  GLY A H      3  
ATOM   7892   H  HA2    . GLY A 1 14  ? -6.545  -1.537  7.916   1.00 0.00 ? 21  GLY A HA2    3  
ATOM   7893   H  HA3    . GLY A 1 14  ? -5.588  -2.707  7.012   1.00 0.00 ? 21  GLY A HA3    3  
ATOM   7894   N  N      . SER A 1 15  ? -5.263  -3.365  9.545   1.00 0.00 ? 22  SER A N      3  
ATOM   7895   C  CA     . SER A 1 15  ? -4.649  -3.854  10.767  1.00 0.00 ? 22  SER A CA     3  
ATOM   7896   C  C      . SER A 1 15  ? -3.427  -4.702  10.438  1.00 0.00 ? 22  SER A C      3  
ATOM   7897   O  O      . SER A 1 15  ? -2.502  -4.836  11.238  1.00 0.00 ? 22  SER A O      3  
ATOM   7898   C  CB     . SER A 1 15  ? -5.678  -4.666  11.547  1.00 0.00 ? 22  SER A CB     3  
ATOM   7899   O  OG     . SER A 1 15  ? -6.429  -5.489  10.668  1.00 0.00 ? 22  SER A OG     3  
ATOM   7900   H  H      . SER A 1 15  ? -6.010  -3.873  9.156   1.00 0.00 ? 22  SER A H      3  
ATOM   7901   H  HA     . SER A 1 15  ? -4.344  -3.002  11.356  1.00 0.00 ? 22  SER A HA     3  
ATOM   7902   H  HB2    . SER A 1 15  ? -5.171  -5.291  12.265  1.00 0.00 ? 22  SER A HB2    3  
ATOM   7903   H  HB3    . SER A 1 15  ? -6.352  -3.996  12.059  1.00 0.00 ? 22  SER A HB3    3  
ATOM   7904   H  HG     . SER A 1 15  ? -6.263  -6.421  10.880  1.00 0.00 ? 22  SER A HG     3  
ATOM   7905   N  N      . GLY A 1 16  ? -3.431  -5.248  9.235   1.00 0.00 ? 23  GLY A N      3  
ATOM   7906   C  CA     . GLY A 1 16  ? -2.352  -6.097  8.791   1.00 0.00 ? 23  GLY A CA     3  
ATOM   7907   C  C      . GLY A 1 16  ? -2.882  -7.293  8.038   1.00 0.00 ? 23  GLY A C      3  
ATOM   7908   O  O      . GLY A 1 16  ? -2.341  -7.677  6.998   1.00 0.00 ? 23  GLY A O      3  
ATOM   7909   H  H      . GLY A 1 16  ? -4.189  -5.074  8.640   1.00 0.00 ? 23  GLY A H      3  
ATOM   7910   H  HA2    . GLY A 1 16  ? -1.700  -5.529  8.142   1.00 0.00 ? 23  GLY A HA2    3  
ATOM   7911   H  HA3    . GLY A 1 16  ? -1.791  -6.438  9.650   1.00 0.00 ? 23  GLY A HA3    3  
ATOM   7912   N  N      . GLY A 1 17  ? -3.960  -7.865  8.554   1.00 0.00 ? 24  GLY A N      3  
ATOM   7913   C  CA     . GLY A 1 17  ? -4.592  -8.983  7.910   1.00 0.00 ? 24  GLY A CA     3  
ATOM   7914   C  C      . GLY A 1 17  ? -5.803  -8.553  7.121   1.00 0.00 ? 24  GLY A C      3  
ATOM   7915   O  O      . GLY A 1 17  ? -5.699  -7.692  6.243   1.00 0.00 ? 24  GLY A O      3  
ATOM   7916   H  H      . GLY A 1 17  ? -4.340  -7.521  9.392   1.00 0.00 ? 24  GLY A H      3  
ATOM   7917   H  HA2    . GLY A 1 17  ? -3.884  -9.459  7.246   1.00 0.00 ? 24  GLY A HA2    3  
ATOM   7918   H  HA3    . GLY A 1 17  ? -4.900  -9.685  8.664   1.00 0.00 ? 24  GLY A HA3    3  
ATOM   7919   N  N      . VAL A 1 18  ? -6.946  -9.146  7.458   1.00 0.00 ? 25  VAL A N      3  
ATOM   7920   C  CA     . VAL A 1 18  ? -8.233  -8.877  6.800   1.00 0.00 ? 25  VAL A CA     3  
ATOM   7921   C  C      . VAL A 1 18  ? -8.246  -9.392  5.360   1.00 0.00 ? 25  VAL A C      3  
ATOM   7922   O  O      . VAL A 1 18  ? -9.143  -10.127 4.952   1.00 0.00 ? 25  VAL A O      3  
ATOM   7923   C  CB     . VAL A 1 18  ? -8.595  -7.371  6.812   1.00 0.00 ? 25  VAL A CB     3  
ATOM   7924   C  CG1    . VAL A 1 18  ? -9.933  -7.138  6.126   1.00 0.00 ? 25  VAL A CG1    3  
ATOM   7925   C  CG2    . VAL A 1 18  ? -8.631  -6.842  8.236   1.00 0.00 ? 25  VAL A CG2    3  
ATOM   7926   H  H      . VAL A 1 18  ? -6.923  -9.801  8.188   1.00 0.00 ? 25  VAL A H      3  
ATOM   7927   H  HA     . VAL A 1 18  ? -8.997  -9.405  7.354   1.00 0.00 ? 25  VAL A HA     3  
ATOM   7928   H  HB     . VAL A 1 18  ? -7.837  -6.828  6.264   1.00 0.00 ? 25  VAL A HB     3  
ATOM   7929   H  HG11   . VAL A 1 18  ? -10.151 -6.080  6.116   1.00 0.00 ? 25  VAL A HG11   3  
ATOM   7930   H  HG12   . VAL A 1 18  ? -10.709 -7.659  6.665   1.00 0.00 ? 25  VAL A HG12   3  
ATOM   7931   H  HG13   . VAL A 1 18  ? -9.887  -7.509  5.113   1.00 0.00 ? 25  VAL A HG13   3  
ATOM   7932   H  HG21   . VAL A 1 18  ? -9.402  -7.355  8.791   1.00 0.00 ? 25  VAL A HG21   3  
ATOM   7933   H  HG22   . VAL A 1 18  ? -8.839  -5.782  8.221   1.00 0.00 ? 25  VAL A HG22   3  
ATOM   7934   H  HG23   . VAL A 1 18  ? -7.674  -7.014  8.706   1.00 0.00 ? 25  VAL A HG23   3  
ATOM   7935   N  N      . GLY A 1 19  ? -7.243  -8.996  4.611   1.00 0.00 ? 26  GLY A N      3  
ATOM   7936   C  CA     . GLY A 1 19  ? -7.119  -9.395  3.229   1.00 0.00 ? 26  GLY A CA     3  
ATOM   7937   C  C      . GLY A 1 19  ? -6.231  -8.438  2.472   1.00 0.00 ? 26  GLY A C      3  
ATOM   7938   O  O      . GLY A 1 19  ? -6.420  -8.215  1.279   1.00 0.00 ? 26  GLY A O      3  
ATOM   7939   H  H      . GLY A 1 19  ? -6.566  -8.409  5.014   1.00 0.00 ? 26  GLY A H      3  
ATOM   7940   H  HA2    . GLY A 1 19  ? -6.694  -10.387 3.185   1.00 0.00 ? 26  GLY A HA2    3  
ATOM   7941   H  HA3    . GLY A 1 19  ? -8.098  -9.407  2.775   1.00 0.00 ? 26  GLY A HA3    3  
ATOM   7942   N  N      . LYS A 1 20  ? -5.249  -7.885  3.176   1.00 0.00 ? 27  LYS A N      3  
ATOM   7943   C  CA     . LYS A 1 20  ? -4.421  -6.820  2.633   1.00 0.00 ? 27  LYS A CA     3  
ATOM   7944   C  C      . LYS A 1 20  ? -3.238  -7.385  1.847   1.00 0.00 ? 27  LYS A C      3  
ATOM   7945   O  O      . LYS A 1 20  ? -3.157  -7.213  0.631   1.00 0.00 ? 27  LYS A O      3  
ATOM   7946   C  CB     . LYS A 1 20  ? -3.946  -5.916  3.777   1.00 0.00 ? 27  LYS A CB     3  
ATOM   7947   C  CG     . LYS A 1 20  ? -3.425  -4.565  3.320   1.00 0.00 ? 27  LYS A CG     3  
ATOM   7948   C  CD     . LYS A 1 20  ? -3.621  -3.506  4.393   1.00 0.00 ? 27  LYS A CD     3  
ATOM   7949   C  CE     . LYS A 1 20  ? -2.639  -3.655  5.542   1.00 0.00 ? 27  LYS A CE     3  
ATOM   7950   N  NZ     . LYS A 1 20  ? -1.277  -3.195  5.167   1.00 0.00 ? 27  LYS A NZ     3  
ATOM   7951   H  H      . LYS A 1 20  ? -5.079  -8.201  4.088   1.00 0.00 ? 27  LYS A H      3  
ATOM   7952   H  HA     . LYS A 1 20  ? -5.035  -6.238  1.963   1.00 0.00 ? 27  LYS A HA     3  
ATOM   7953   H  HB2    . LYS A 1 20  ? -4.770  -5.746  4.454   1.00 0.00 ? 27  LYS A HB2    3  
ATOM   7954   H  HB3    . LYS A 1 20  ? -3.153  -6.418  4.312   1.00 0.00 ? 27  LYS A HB3    3  
ATOM   7955   H  HG2    . LYS A 1 20  ? -2.370  -4.652  3.101   1.00 0.00 ? 27  LYS A HG2    3  
ATOM   7956   H  HG3    . LYS A 1 20  ? -3.955  -4.266  2.428   1.00 0.00 ? 27  LYS A HG3    3  
ATOM   7957   H  HD2    . LYS A 1 20  ? -3.487  -2.531  3.949   1.00 0.00 ? 27  LYS A HD2    3  
ATOM   7958   H  HD3    . LYS A 1 20  ? -4.625  -3.589  4.780   1.00 0.00 ? 27  LYS A HD3    3  
ATOM   7959   H  HE2    . LYS A 1 20  ? -2.990  -3.068  6.379   1.00 0.00 ? 27  LYS A HE2    3  
ATOM   7960   H  HE3    . LYS A 1 20  ? -2.593  -4.696  5.827   1.00 0.00 ? 27  LYS A HE3    3  
ATOM   7961   H  HZ1    . LYS A 1 20  ? -1.325  -2.240  4.752   1.00 0.00 ? 27  LYS A HZ1    3  
ATOM   7962   H  HZ2    . LYS A 1 20  ? -0.852  -3.850  4.468   1.00 0.00 ? 27  LYS A HZ2    3  
ATOM   7963   H  HZ3    . LYS A 1 20  ? -0.665  -3.163  6.011   1.00 0.00 ? 27  LYS A HZ3    3  
ATOM   7964   N  N      . SER A 1 21  ? -2.349  -8.098  2.541   1.00 0.00 ? 28  SER A N      3  
ATOM   7965   C  CA     . SER A 1 21  ? -1.137  -8.640  1.924   1.00 0.00 ? 28  SER A CA     3  
ATOM   7966   C  C      . SER A 1 21  ? -1.460  -9.689  0.854   1.00 0.00 ? 28  SER A C      3  
ATOM   7967   O  O      . SER A 1 21  ? -0.607  -10.038 0.037   1.00 0.00 ? 28  SER A O      3  
ATOM   7968   C  CB     . SER A 1 21  ? -0.236  -9.269  2.992   1.00 0.00 ? 28  SER A CB     3  
ATOM   7969   O  OG     . SER A 1 21  ? 0.156   -8.327  3.991   1.00 0.00 ? 28  SER A OG     3  
ATOM   7970   H  H      . SER A 1 21  ? -2.513  -8.260  3.492   1.00 0.00 ? 28  SER A H      3  
ATOM   7971   H  HA     . SER A 1 21  ? -0.608  -7.822  1.459   1.00 0.00 ? 28  SER A HA     3  
ATOM   7972   H  HB2    . SER A 1 21  ? -0.768  -10.077 3.472   1.00 0.00 ? 28  SER A HB2    3  
ATOM   7973   H  HB3    . SER A 1 21  ? 0.652   -9.661  2.519   1.00 0.00 ? 28  SER A HB3    3  
ATOM   7974   H  HG     . SER A 1 21  ? 0.316   -7.456  3.573   1.00 0.00 ? 28  SER A HG     3  
ATOM   7975   N  N      . ALA A 1 22  ? -2.686  -10.198 0.873   1.00 0.00 ? 29  ALA A N      3  
ATOM   7976   C  CA     . ALA A 1 22  ? -3.109  -11.207 -0.090  1.00 0.00 ? 29  ALA A CA     3  
ATOM   7977   C  C      . ALA A 1 22  ? -3.253  -10.604 -1.481  1.00 0.00 ? 29  ALA A C      3  
ATOM   7978   O  O      . ALA A 1 22  ? -2.891  -11.225 -2.479  1.00 0.00 ? 29  ALA A O      3  
ATOM   7979   C  CB     . ALA A 1 22  ? -4.417  -11.839 0.348   1.00 0.00 ? 29  ALA A CB     3  
ATOM   7980   H  H      . ALA A 1 22  ? -3.325  -9.879  1.543   1.00 0.00 ? 29  ALA A H      3  
ATOM   7981   H  HA     . ALA A 1 22  ? -2.353  -11.980 -0.121  1.00 0.00 ? 29  ALA A HA     3  
ATOM   7982   H  HB1    . ALA A 1 22  ? -5.187  -11.083 0.385   1.00 0.00 ? 29  ALA A HB1    3  
ATOM   7983   H  HB2    . ALA A 1 22  ? -4.294  -12.279 1.327   1.00 0.00 ? 29  ALA A HB2    3  
ATOM   7984   H  HB3    . ALA A 1 22  ? -4.703  -12.605 -0.357  1.00 0.00 ? 29  ALA A HB3    3  
ATOM   7985   N  N      . LEU A 1 23  ? -3.775  -9.384  -1.535  1.00 0.00 ? 30  LEU A N      3  
ATOM   7986   C  CA     . LEU A 1 23  ? -3.964  -8.690  -2.801  1.00 0.00 ? 30  LEU A CA     3  
ATOM   7987   C  C      . LEU A 1 23  ? -2.620  -8.300  -3.386  1.00 0.00 ? 30  LEU A C      3  
ATOM   7988   O  O      . LEU A 1 23  ? -2.407  -8.359  -4.596  1.00 0.00 ? 30  LEU A O      3  
ATOM   7989   C  CB     . LEU A 1 23  ? -4.809  -7.432  -2.602  1.00 0.00 ? 30  LEU A CB     3  
ATOM   7990   C  CG     . LEU A 1 23  ? -6.194  -7.667  -1.999  1.00 0.00 ? 30  LEU A CG     3  
ATOM   7991   C  CD1    . LEU A 1 23  ? -6.922  -6.347  -1.810  1.00 0.00 ? 30  LEU A CD1    3  
ATOM   7992   C  CD2    . LEU A 1 23  ? -7.008  -8.596  -2.884  1.00 0.00 ? 30  LEU A CD2    3  
ATOM   7993   H  H      . LEU A 1 23  ? -4.026  -8.931  -0.700  1.00 0.00 ? 30  LEU A H      3  
ATOM   7994   H  HA     . LEU A 1 23  ? -4.471  -9.355  -3.483  1.00 0.00 ? 30  LEU A HA     3  
ATOM   7995   H  HB2    . LEU A 1 23  ? -4.262  -6.757  -1.956  1.00 0.00 ? 30  LEU A HB2    3  
ATOM   7996   H  HB3    . LEU A 1 23  ? -4.938  -6.957  -3.561  1.00 0.00 ? 30  LEU A HB3    3  
ATOM   7997   H  HG     . LEU A 1 23  ? -6.087  -8.134  -1.032  1.00 0.00 ? 30  LEU A HG     3  
ATOM   7998   H  HD11   . LEU A 1 23  ? -6.364  -5.724  -1.125  1.00 0.00 ? 30  LEU A HD11   3  
ATOM   7999   H  HD12   . LEU A 1 23  ? -7.907  -6.534  -1.408  1.00 0.00 ? 30  LEU A HD12   3  
ATOM   8000   H  HD13   . LEU A 1 23  ? -7.010  -5.847  -2.762  1.00 0.00 ? 30  LEU A HD13   3  
ATOM   8001   H  HD21   . LEU A 1 23  ? -6.493  -9.539  -2.984  1.00 0.00 ? 30  LEU A HD21   3  
ATOM   8002   H  HD22   . LEU A 1 23  ? -7.133  -8.146  -3.858  1.00 0.00 ? 30  LEU A HD22   3  
ATOM   8003   H  HD23   . LEU A 1 23  ? -7.977  -8.762  -2.437  1.00 0.00 ? 30  LEU A HD23   3  
ATOM   8004   N  N      . THR A 1 24  ? -1.716  -7.916  -2.501  1.00 0.00 ? 31  THR A N      3  
ATOM   8005   C  CA     . THR A 1 24  ? -0.407  -7.434  -2.888  1.00 0.00 ? 31  THR A CA     3  
ATOM   8006   C  C      . THR A 1 24  ? 0.385   -8.504  -3.636  1.00 0.00 ? 31  THR A C      3  
ATOM   8007   O  O      . THR A 1 24  ? 0.847   -8.270  -4.752  1.00 0.00 ? 31  THR A O      3  
ATOM   8008   C  CB     . THR A 1 24  ? 0.382   -6.988  -1.651  1.00 0.00 ? 31  THR A CB     3  
ATOM   8009   O  OG1    . THR A 1 24  ? -0.528  -6.633  -0.602  1.00 0.00 ? 31  THR A OG1    3  
ATOM   8010   C  CG2    . THR A 1 24  ? 1.258   -5.793  -1.983  1.00 0.00 ? 31  THR A CG2    3  
ATOM   8011   H  H      . THR A 1 24  ? -1.941  -7.949  -1.546  1.00 0.00 ? 31  THR A H      3  
ATOM   8012   H  HA     . THR A 1 24  ? -0.540  -6.579  -3.535  1.00 0.00 ? 31  THR A HA     3  
ATOM   8013   H  HB     . THR A 1 24  ? 1.008   -7.800  -1.324  1.00 0.00 ? 31  THR A HB     3  
ATOM   8014   H  HG1    . THR A 1 24  ? -0.798  -5.713  -0.703  1.00 0.00 ? 31  THR A HG1    3  
ATOM   8015   H  HG21   . THR A 1 24  ? 0.633   -4.970  -2.297  1.00 0.00 ? 31  THR A HG21   3  
ATOM   8016   H  HG22   . THR A 1 24  ? 1.937   -6.055  -2.782  1.00 0.00 ? 31  THR A HG22   3  
ATOM   8017   H  HG23   . THR A 1 24  ? 1.822   -5.505  -1.110  1.00 0.00 ? 31  THR A HG23   3  
ATOM   8018   N  N      . LEU A 1 25  ? 0.524   -9.684  -3.033  1.00 0.00 ? 32  LEU A N      3  
ATOM   8019   C  CA     . LEU A 1 25  ? 1.325   -10.754 -3.629  1.00 0.00 ? 32  LEU A CA     3  
ATOM   8020   C  C      . LEU A 1 25  ? 0.749   -11.191 -4.976  1.00 0.00 ? 32  LEU A C      3  
ATOM   8021   O  O      . LEU A 1 25  ? 1.493   -11.582 -5.878  1.00 0.00 ? 32  LEU A O      3  
ATOM   8022   C  CB     . LEU A 1 25  ? 1.429   -11.952 -2.682  1.00 0.00 ? 32  LEU A CB     3  
ATOM   8023   C  CG     . LEU A 1 25  ? 2.487   -12.990 -3.071  1.00 0.00 ? 32  LEU A CG     3  
ATOM   8024   C  CD1    . LEU A 1 25  ? 3.865   -12.351 -3.117  1.00 0.00 ? 32  LEU A CD1    3  
ATOM   8025   C  CD2    . LEU A 1 25  ? 2.485   -14.155 -2.093  1.00 0.00 ? 32  LEU A CD2    3  
ATOM   8026   H  H      . LEU A 1 25  ? 0.090   -9.835  -2.162  1.00 0.00 ? 32  LEU A H      3  
ATOM   8027   H  HA     . LEU A 1 25  ? 2.315   -10.360 -3.796  1.00 0.00 ? 32  LEU A HA     3  
ATOM   8028   H  HB2    . LEU A 1 25  ? 1.661   -11.585 -1.692  1.00 0.00 ? 32  LEU A HB2    3  
ATOM   8029   H  HB3    . LEU A 1 25  ? 0.469   -12.443 -2.651  1.00 0.00 ? 32  LEU A HB3    3  
ATOM   8030   H  HG     . LEU A 1 25  ? 2.262   -13.378 -4.054  1.00 0.00 ? 32  LEU A HG     3  
ATOM   8031   H  HD11   . LEU A 1 25  ? 3.866   -11.553 -3.844  1.00 0.00 ? 32  LEU A HD11   3  
ATOM   8032   H  HD12   . LEU A 1 25  ? 4.597   -13.094 -3.396  1.00 0.00 ? 32  LEU A HD12   3  
ATOM   8033   H  HD13   . LEU A 1 25  ? 4.108   -11.954 -2.143  1.00 0.00 ? 32  LEU A HD13   3  
ATOM   8034   H  HD21   . LEU A 1 25  ? 2.717   -13.792 -1.103  1.00 0.00 ? 32  LEU A HD21   3  
ATOM   8035   H  HD22   . LEU A 1 25  ? 3.227   -14.880 -2.394  1.00 0.00 ? 32  LEU A HD22   3  
ATOM   8036   H  HD23   . LEU A 1 25  ? 1.509   -14.618 -2.086  1.00 0.00 ? 32  LEU A HD23   3  
ATOM   8037   N  N      . GLN A 1 26  ? -0.570  -11.100 -5.118  1.00 0.00 ? 33  GLN A N      3  
ATOM   8038   C  CA     . GLN A 1 26  ? -1.226  -11.425 -6.381  1.00 0.00 ? 33  GLN A CA     3  
ATOM   8039   C  C      . GLN A 1 26  ? -0.808  -10.442 -7.471  1.00 0.00 ? 33  GLN A C      3  
ATOM   8040   O  O      . GLN A 1 26  ? -0.596  -10.822 -8.617  1.00 0.00 ? 33  GLN A O      3  
ATOM   8041   C  CB     . GLN A 1 26  ? -2.747  -11.417 -6.221  1.00 0.00 ? 33  GLN A CB     3  
ATOM   8042   C  CG     . GLN A 1 26  ? -3.300  -12.675 -5.568  1.00 0.00 ? 33  GLN A CG     3  
ATOM   8043   C  CD     . GLN A 1 26  ? -3.202  -13.894 -6.470  1.00 0.00 ? 33  GLN A CD     3  
ATOM   8044   O  OE1    . GLN A 1 26  ? -3.274  -13.787 -7.696  1.00 0.00 ? 33  GLN A OE1    3  
ATOM   8045   N  NE2    . GLN A 1 26  ? -3.040  -15.063 -5.874  1.00 0.00 ? 33  GLN A NE2    3  
ATOM   8046   H  H      . GLN A 1 26  ? -1.115  -10.806 -4.357  1.00 0.00 ? 33  GLN A H      3  
ATOM   8047   H  HA     . GLN A 1 26  ? -0.909  -12.416 -6.671  1.00 0.00 ? 33  GLN A HA     3  
ATOM   8048   H  HB2    . GLN A 1 26  ? -3.028  -10.568 -5.614  1.00 0.00 ? 33  GLN A HB2    3  
ATOM   8049   H  HB3    . GLN A 1 26  ? -3.199  -11.314 -7.195  1.00 0.00 ? 33  GLN A HB3    3  
ATOM   8050   H  HG2    . GLN A 1 26  ? -2.744  -12.869 -4.663  1.00 0.00 ? 33  GLN A HG2    3  
ATOM   8051   H  HG3    . GLN A 1 26  ? -4.339  -12.510 -5.322  1.00 0.00 ? 33  GLN A HG3    3  
ATOM   8052   H  HE21   . GLN A 1 26  ? -2.994  -15.082 -4.896  1.00 0.00 ? 33  GLN A HE21   3  
ATOM   8053   H  HE22   . GLN A 1 26  ? -2.967  -15.861 -6.437  1.00 0.00 ? 33  GLN A HE22   3  
ATOM   8054   N  N      . PHE A 1 27  ? -0.684  -9.178  -7.107  1.00 0.00 ? 34  PHE A N      3  
ATOM   8055   C  CA     . PHE A 1 27  ? -0.243  -8.162  -8.047  1.00 0.00 ? 34  PHE A CA     3  
ATOM   8056   C  C      . PHE A 1 27  ? 1.254   -8.302  -8.318  1.00 0.00 ? 34  PHE A C      3  
ATOM   8057   O  O      . PHE A 1 27  ? 1.730   -8.043  -9.424  1.00 0.00 ? 34  PHE A O      3  
ATOM   8058   C  CB     . PHE A 1 27  ? -0.556  -6.772  -7.495  1.00 0.00 ? 34  PHE A CB     3  
ATOM   8059   C  CG     . PHE A 1 27  ? -0.281  -5.660  -8.463  1.00 0.00 ? 34  PHE A CG     3  
ATOM   8060   C  CD1    . PHE A 1 27  ? -1.095  -5.469  -9.569  1.00 0.00 ? 34  PHE A CD1    3  
ATOM   8061   C  CD2    . PHE A 1 27  ? 0.782   -4.800  -8.261  1.00 0.00 ? 34  PHE A CD2    3  
ATOM   8062   C  CE1    . PHE A 1 27  ? -0.848  -4.438  -10.456 1.00 0.00 ? 34  PHE A CE1    3  
ATOM   8063   C  CE2    . PHE A 1 27  ? 1.033   -3.771  -9.144  1.00 0.00 ? 34  PHE A CE2    3  
ATOM   8064   C  CZ     . PHE A 1 27  ? 0.216   -3.589  -10.242 1.00 0.00 ? 34  PHE A CZ     3  
ATOM   8065   H  H      . PHE A 1 27  ? -0.893  -8.920  -6.181  1.00 0.00 ? 34  PHE A H      3  
ATOM   8066   H  HA     . PHE A 1 27  ? -0.784  -8.306  -8.971  1.00 0.00 ? 34  PHE A HA     3  
ATOM   8067   H  HB2    . PHE A 1 27  ? -1.600  -6.727  -7.226  1.00 0.00 ? 34  PHE A HB2    3  
ATOM   8068   H  HB3    . PHE A 1 27  ? 0.046   -6.602  -6.612  1.00 0.00 ? 34  PHE A HB3    3  
ATOM   8069   H  HD1    . PHE A 1 27  ? -1.930  -6.133  -9.736  1.00 0.00 ? 34  PHE A HD1    3  
ATOM   8070   H  HD2    . PHE A 1 27  ? 1.422   -4.939  -7.402  1.00 0.00 ? 34  PHE A HD2    3  
ATOM   8071   H  HE1    . PHE A 1 27  ? -1.487  -4.298  -11.316 1.00 0.00 ? 34  PHE A HE1    3  
ATOM   8072   H  HE2    . PHE A 1 27  ? 1.868   -3.108  -8.977  1.00 0.00 ? 34  PHE A HE2    3  
ATOM   8073   H  HZ     . PHE A 1 27  ? 0.412   -2.781  -10.932 1.00 0.00 ? 34  PHE A HZ     3  
ATOM   8074   N  N      . MET A 1 28  ? 1.986   -8.730  -7.299  1.00 0.00 ? 35  MET A N      3  
ATOM   8075   C  CA     . MET A 1 28  ? 3.438   -8.833  -7.374  1.00 0.00 ? 35  MET A CA     3  
ATOM   8076   C  C      . MET A 1 28  ? 3.884   -10.046 -8.186  1.00 0.00 ? 35  MET A C      3  
ATOM   8077   O  O      . MET A 1 28  ? 4.534   -9.897  -9.222  1.00 0.00 ? 35  MET A O      3  
ATOM   8078   C  CB     . MET A 1 28  ? 4.033   -8.903  -5.965  1.00 0.00 ? 35  MET A CB     3  
ATOM   8079   C  CG     . MET A 1 28  ? 3.873   -7.619  -5.170  1.00 0.00 ? 35  MET A CG     3  
ATOM   8080   S  SD     . MET A 1 28  ? 4.318   -7.813  -3.431  1.00 0.00 ? 35  MET A SD     3  
ATOM   8081   C  CE     . MET A 1 28  ? 6.015   -8.360  -3.582  1.00 0.00 ? 35  MET A CE     3  
ATOM   8082   H  H      . MET A 1 28  ? 1.533   -8.979  -6.463  1.00 0.00 ? 35  MET A H      3  
ATOM   8083   H  HA     . MET A 1 28  ? 3.804   -7.941  -7.857  1.00 0.00 ? 35  MET A HA     3  
ATOM   8084   H  HB2    . MET A 1 28  ? 3.549   -9.702  -5.420  1.00 0.00 ? 35  MET A HB2    3  
ATOM   8085   H  HB3    . MET A 1 28  ? 5.089   -9.122  -6.045  1.00 0.00 ? 35  MET A HB3    3  
ATOM   8086   H  HG2    . MET A 1 28  ? 4.507   -6.862  -5.608  1.00 0.00 ? 35  MET A HG2    3  
ATOM   8087   H  HG3    . MET A 1 28  ? 2.843   -7.301  -5.233  1.00 0.00 ? 35  MET A HG3    3  
ATOM   8088   H  HE1    . MET A 1 28  ? 6.044   -9.298  -4.117  1.00 0.00 ? 35  MET A HE1    3  
ATOM   8089   H  HE2    . MET A 1 28  ? 6.441   -8.490  -2.599  1.00 0.00 ? 35  MET A HE2    3  
ATOM   8090   H  HE3    . MET A 1 28  ? 6.583   -7.617  -4.122  1.00 0.00 ? 35  MET A HE3    3  
ATOM   8091   N  N      . TYR A 1 29  ? 3.537   -11.242 -7.720  1.00 0.00 ? 36  TYR A N      3  
ATOM   8092   C  CA     . TYR A 1 29  ? 4.007   -12.472 -8.354  1.00 0.00 ? 36  TYR A CA     3  
ATOM   8093   C  C      . TYR A 1 29  ? 2.849   -13.321 -8.864  1.00 0.00 ? 36  TYR A C      3  
ATOM   8094   O  O      . TYR A 1 29  ? 3.070   -14.373 -9.458  1.00 0.00 ? 36  TYR A O      3  
ATOM   8095   C  CB     . TYR A 1 29  ? 4.855   -13.290 -7.376  1.00 0.00 ? 36  TYR A CB     3  
ATOM   8096   C  CG     . TYR A 1 29  ? 6.148   -12.616 -6.975  1.00 0.00 ? 36  TYR A CG     3  
ATOM   8097   C  CD1    . TYR A 1 29  ? 7.270   -12.675 -7.792  1.00 0.00 ? 36  TYR A CD1    3  
ATOM   8098   C  CD2    . TYR A 1 29  ? 6.246   -11.917 -5.779  1.00 0.00 ? 36  TYR A CD2    3  
ATOM   8099   C  CE1    . TYR A 1 29  ? 8.453   -12.060 -7.426  1.00 0.00 ? 36  TYR A CE1    3  
ATOM   8100   C  CE2    . TYR A 1 29  ? 7.422   -11.299 -5.407  1.00 0.00 ? 36  TYR A CE2    3  
ATOM   8101   C  CZ     . TYR A 1 29  ? 8.523   -11.371 -6.234  1.00 0.00 ? 36  TYR A CZ     3  
ATOM   8102   O  OH     . TYR A 1 29  ? 9.696   -10.753 -5.867  1.00 0.00 ? 36  TYR A OH     3  
ATOM   8103   H  H      . TYR A 1 29  ? 2.947   -11.300 -6.934  1.00 0.00 ? 36  TYR A H      3  
ATOM   8104   H  HA     . TYR A 1 29  ? 4.624   -12.192 -9.196  1.00 0.00 ? 36  TYR A HA     3  
ATOM   8105   H  HB2    . TYR A 1 29  ? 4.282   -13.466 -6.477  1.00 0.00 ? 36  TYR A HB2    3  
ATOM   8106   H  HB3    . TYR A 1 29  ? 5.100   -14.239 -7.832  1.00 0.00 ? 36  TYR A HB3    3  
ATOM   8107   H  HD1    . TYR A 1 29  ? 7.212   -13.214 -8.724  1.00 0.00 ? 36  TYR A HD1    3  
ATOM   8108   H  HD2    . TYR A 1 29  ? 5.383   -11.862 -5.133  1.00 0.00 ? 36  TYR A HD2    3  
ATOM   8109   H  HE1    . TYR A 1 29  ? 9.314   -12.118 -8.076  1.00 0.00 ? 36  TYR A HE1    3  
ATOM   8110   H  HE2    . TYR A 1 29  ? 7.477   -10.762 -4.471  1.00 0.00 ? 36  TYR A HE2    3  
ATOM   8111   H  HH     . TYR A 1 29  ? 9.849   -10.892 -4.918  1.00 0.00 ? 36  TYR A HH     3  
ATOM   8112   N  N      . ASP A 1 30  ? 1.621   -12.860 -8.615  1.00 0.00 ? 37  ASP A N      3  
ATOM   8113   C  CA     . ASP A 1 30  ? 0.406   -13.549 -9.079  1.00 0.00 ? 37  ASP A CA     3  
ATOM   8114   C  C      . ASP A 1 30  ? 0.199   -14.865 -8.319  1.00 0.00 ? 37  ASP A C      3  
ATOM   8115   O  O      . ASP A 1 30  ? -0.581  -15.727 -8.721  1.00 0.00 ? 37  ASP A O      3  
ATOM   8116   C  CB     . ASP A 1 30  ? 0.471   -13.782 -10.598 1.00 0.00 ? 37  ASP A CB     3  
ATOM   8117   C  CG     . ASP A 1 30  ? -0.828  -14.291 -11.193 1.00 0.00 ? 37  ASP A CG     3  
ATOM   8118   O  OD1    . ASP A 1 30  ? -1.867  -13.606 -11.056 1.00 0.00 ? 37  ASP A OD1    3  
ATOM   8119   O  OD2    . ASP A 1 30  ? -0.809  -15.374 -11.819 1.00 0.00 ? 37  ASP A OD2    3  
ATOM   8120   H  H      . ASP A 1 30  ? 1.525   -12.031 -8.104  1.00 0.00 ? 37  ASP A H      3  
ATOM   8121   H  HA     . ASP A 1 30  ? -0.433  -12.900 -8.864  1.00 0.00 ? 37  ASP A HA     3  
ATOM   8122   H  HB2    . ASP A 1 30  ? 0.721   -12.850 -11.082 1.00 0.00 ? 37  ASP A HB2    3  
ATOM   8123   H  HB3    . ASP A 1 30  ? 1.247   -14.504 -10.806 1.00 0.00 ? 37  ASP A HB3    3  
ATOM   8124   N  N      . GLU A 1 31  ? 0.886   -15.000 -7.194  1.00 0.00 ? 38  GLU A N      3  
ATOM   8125   C  CA     . GLU A 1 31  ? 0.784   -16.198 -6.374  1.00 0.00 ? 38  GLU A CA     3  
ATOM   8126   C  C      . GLU A 1 31  ? 0.063   -15.896 -5.064  1.00 0.00 ? 38  GLU A C      3  
ATOM   8127   O  O      . GLU A 1 31  ? 0.178   -14.797 -4.518  1.00 0.00 ? 38  GLU A O      3  
ATOM   8128   C  CB     . GLU A 1 31  ? 2.176   -16.776 -6.106  1.00 0.00 ? 38  GLU A CB     3  
ATOM   8129   C  CG     . GLU A 1 31  ? 2.896   -17.212 -7.373  1.00 0.00 ? 38  GLU A CG     3  
ATOM   8130   C  CD     . GLU A 1 31  ? 4.273   -17.777 -7.104  1.00 0.00 ? 38  GLU A CD     3  
ATOM   8131   O  OE1    . GLU A 1 31  ? 4.370   -18.978 -6.777  1.00 0.00 ? 38  GLU A OE1    3  
ATOM   8132   O  OE2    . GLU A 1 31  ? 5.263   -17.027 -7.225  1.00 0.00 ? 38  GLU A OE2    3  
ATOM   8133   H  H      . GLU A 1 31  ? 1.473   -14.275 -6.905  1.00 0.00 ? 38  GLU A H      3  
ATOM   8134   H  HA     . GLU A 1 31  ? 0.203   -16.924 -6.925  1.00 0.00 ? 38  GLU A HA     3  
ATOM   8135   H  HB2    . GLU A 1 31  ? 2.777   -16.027 -5.612  1.00 0.00 ? 38  GLU A HB2    3  
ATOM   8136   H  HB3    . GLU A 1 31  ? 2.080   -17.634 -5.458  1.00 0.00 ? 38  GLU A HB3    3  
ATOM   8137   H  HG2    . GLU A 1 31  ? 2.304   -17.971 -7.861  1.00 0.00 ? 38  GLU A HG2    3  
ATOM   8138   H  HG3    . GLU A 1 31  ? 2.994   -16.357 -8.027  1.00 0.00 ? 38  GLU A HG3    3  
ATOM   8139   N  N      . PHE A 1 32  ? -0.697  -16.867 -4.578  1.00 0.00 ? 39  PHE A N      3  
ATOM   8140   C  CA     . PHE A 1 32  ? -1.451  -16.713 -3.343  1.00 0.00 ? 39  PHE A CA     3  
ATOM   8141   C  C      . PHE A 1 32  ? -0.533  -16.872 -2.137  1.00 0.00 ? 39  PHE A C      3  
ATOM   8142   O  O      . PHE A 1 32  ? 0.450   -17.612 -2.185  1.00 0.00 ? 39  PHE A O      3  
ATOM   8143   C  CB     . PHE A 1 32  ? -2.594  -17.738 -3.289  1.00 0.00 ? 39  PHE A CB     3  
ATOM   8144   C  CG     . PHE A 1 32  ? -3.546  -17.543 -2.137  1.00 0.00 ? 39  PHE A CG     3  
ATOM   8145   C  CD1    . PHE A 1 32  ? -4.457  -16.499 -2.144  1.00 0.00 ? 39  PHE A CD1    3  
ATOM   8146   C  CD2    . PHE A 1 32  ? -3.529  -18.404 -1.050  1.00 0.00 ? 39  PHE A CD2    3  
ATOM   8147   C  CE1    . PHE A 1 32  ? -5.333  -16.316 -1.090  1.00 0.00 ? 39  PHE A CE1    3  
ATOM   8148   C  CE2    . PHE A 1 32  ? -4.402  -18.226 0.007   1.00 0.00 ? 39  PHE A CE2    3  
ATOM   8149   C  CZ     . PHE A 1 32  ? -5.305  -17.181 -0.013  1.00 0.00 ? 39  PHE A CZ     3  
ATOM   8150   H  H      . PHE A 1 32  ? -0.751  -17.719 -5.067  1.00 0.00 ? 39  PHE A H      3  
ATOM   8151   H  HA     . PHE A 1 32  ? -1.871  -15.718 -3.332  1.00 0.00 ? 39  PHE A HA     3  
ATOM   8152   H  HB2    . PHE A 1 32  ? -3.166  -17.675 -4.202  1.00 0.00 ? 39  PHE A HB2    3  
ATOM   8153   H  HB3    . PHE A 1 32  ? -2.171  -18.728 -3.205  1.00 0.00 ? 39  PHE A HB3    3  
ATOM   8154   H  HD1    . PHE A 1 32  ? -4.480  -15.820 -2.985  1.00 0.00 ? 39  PHE A HD1    3  
ATOM   8155   H  HD2    . PHE A 1 32  ? -2.824  -19.222 -1.033  1.00 0.00 ? 39  PHE A HD2    3  
ATOM   8156   H  HE1    . PHE A 1 32  ? -6.038  -15.497 -1.108  1.00 0.00 ? 39  PHE A HE1    3  
ATOM   8157   H  HE2    . PHE A 1 32  ? -4.380  -18.904 0.847   1.00 0.00 ? 39  PHE A HE2    3  
ATOM   8158   H  HZ     . PHE A 1 32  ? -5.987  -17.040 0.811   1.00 0.00 ? 39  PHE A HZ     3  
ATOM   8159   N  N      . VAL A 1 33  ? -0.857  -16.168 -1.060  1.00 0.00 ? 40  VAL A N      3  
ATOM   8160   C  CA     . VAL A 1 33  ? -0.052  -16.203 0.151   1.00 0.00 ? 40  VAL A CA     3  
ATOM   8161   C  C      . VAL A 1 33  ? -0.291  -17.492 0.928   1.00 0.00 ? 40  VAL A C      3  
ATOM   8162   O  O      . VAL A 1 33  ? -1.337  -17.670 1.553   1.00 0.00 ? 40  VAL A O      3  
ATOM   8163   C  CB     . VAL A 1 33  ? -0.356  -15.007 1.079   1.00 0.00 ? 40  VAL A CB     3  
ATOM   8164   C  CG1    . VAL A 1 33  ? 0.582   -15.006 2.281   1.00 0.00 ? 40  VAL A CG1    3  
ATOM   8165   C  CG2    . VAL A 1 33  ? -0.257  -13.693 0.320   1.00 0.00 ? 40  VAL A CG2    3  
ATOM   8166   H  H      . VAL A 1 33  ? -1.665  -15.617 -1.079  1.00 0.00 ? 40  VAL A H      3  
ATOM   8167   H  HA     . VAL A 1 33  ? 0.988   -16.155 -0.137  1.00 0.00 ? 40  VAL A HA     3  
ATOM   8168   H  HB     . VAL A 1 33  ? -1.367  -15.111 1.443   1.00 0.00 ? 40  VAL A HB     3  
ATOM   8169   H  HG11   . VAL A 1 33  ? 0.324   -14.193 2.940   1.00 0.00 ? 40  VAL A HG11   3  
ATOM   8170   H  HG12   . VAL A 1 33  ? 1.599   -14.884 1.941   1.00 0.00 ? 40  VAL A HG12   3  
ATOM   8171   H  HG13   . VAL A 1 33  ? 0.491   -15.945 2.810   1.00 0.00 ? 40  VAL A HG13   3  
ATOM   8172   H  HG21   . VAL A 1 33  ? 0.737   -13.585 -0.086  1.00 0.00 ? 40  VAL A HG21   3  
ATOM   8173   H  HG22   . VAL A 1 33  ? -0.463  -12.874 0.993   1.00 0.00 ? 40  VAL A HG22   3  
ATOM   8174   H  HG23   . VAL A 1 33  ? -0.978  -13.688 -0.485  1.00 0.00 ? 40  VAL A HG23   3  
ATOM   8175   N  N      . GLU A 1 34  ? 0.678   -18.392 0.869   1.00 0.00 ? 41  GLU A N      3  
ATOM   8176   C  CA     . GLU A 1 34  ? 0.635   -19.611 1.661   1.00 0.00 ? 41  GLU A CA     3  
ATOM   8177   C  C      . GLU A 1 34  ? 1.445   -19.411 2.931   1.00 0.00 ? 41  GLU A C      3  
ATOM   8178   O  O      . GLU A 1 34  ? 1.042   -19.835 4.014   1.00 0.00 ? 41  GLU A O      3  
ATOM   8179   C  CB     . GLU A 1 34  ? 1.189   -20.798 0.870   1.00 0.00 ? 41  GLU A CB     3  
ATOM   8180   C  CG     . GLU A 1 34  ? 0.474   -21.046 -0.447  1.00 0.00 ? 41  GLU A CG     3  
ATOM   8181   C  CD     . GLU A 1 34  ? 1.086   -22.187 -1.232  1.00 0.00 ? 41  GLU A CD     3  
ATOM   8182   O  OE1    . GLU A 1 34  ? 2.273   -22.083 -1.601  1.00 0.00 ? 41  GLU A OE1    3  
ATOM   8183   O  OE2    . GLU A 1 34  ? 0.384   -23.191 -1.472  1.00 0.00 ? 41  GLU A OE2    3  
ATOM   8184   H  H      . GLU A 1 34  ? 1.447   -18.231 0.277   1.00 0.00 ? 41  GLU A H      3  
ATOM   8185   H  HA     . GLU A 1 34  ? -0.394  -19.806 1.926   1.00 0.00 ? 41  GLU A HA     3  
ATOM   8186   H  HB2    . GLU A 1 34  ? 2.233   -20.622 0.660   1.00 0.00 ? 41  GLU A HB2    3  
ATOM   8187   H  HB3    . GLU A 1 34  ? 1.099   -21.688 1.475   1.00 0.00 ? 41  GLU A HB3    3  
ATOM   8188   H  HG2    . GLU A 1 34  ? -0.560  -21.283 -0.243  1.00 0.00 ? 41  GLU A HG2    3  
ATOM   8189   H  HG3    . GLU A 1 34  ? 0.526   -20.149 -1.046  1.00 0.00 ? 41  GLU A HG3    3  
ATOM   8190   N  N      . ASP A 1 35  ? 2.585   -18.744 2.784   1.00 0.00 ? 42  ASP A N      3  
ATOM   8191   C  CA     . ASP A 1 35  ? 3.447   -18.426 3.914   1.00 0.00 ? 42  ASP A CA     3  
ATOM   8192   C  C      . ASP A 1 35  ? 4.389   -17.286 3.554   1.00 0.00 ? 42  ASP A C      3  
ATOM   8193   O  O      . ASP A 1 35  ? 5.369   -17.477 2.832   1.00 0.00 ? 42  ASP A O      3  
ATOM   8194   C  CB     . ASP A 1 35  ? 4.248   -19.657 4.358   1.00 0.00 ? 42  ASP A CB     3  
ATOM   8195   C  CG     . ASP A 1 35  ? 5.177   -19.359 5.524   1.00 0.00 ? 42  ASP A CG     3  
ATOM   8196   O  OD1    . ASP A 1 35  ? 4.686   -19.226 6.664   1.00 0.00 ? 42  ASP A OD1    3  
ATOM   8197   O  OD2    . ASP A 1 35  ? 6.404   -19.270 5.303   1.00 0.00 ? 42  ASP A OD2    3  
ATOM   8198   H  H      . ASP A 1 35  ? 2.857   -18.454 1.885   1.00 0.00 ? 42  ASP A H      3  
ATOM   8199   H  HA     . ASP A 1 35  ? 2.815   -18.107 4.731   1.00 0.00 ? 42  ASP A HA     3  
ATOM   8200   H  HB2    . ASP A 1 35  ? 3.561   -20.433 4.660   1.00 0.00 ? 42  ASP A HB2    3  
ATOM   8201   H  HB3    . ASP A 1 35  ? 4.841   -20.012 3.529   1.00 0.00 ? 42  ASP A HB3    3  
ATOM   8202   N  N      . TYR A 1 36  ? 4.059   -16.094 4.022   1.00 0.00 ? 43  TYR A N      3  
ATOM   8203   C  CA     . TYR A 1 36  ? 4.892   -14.923 3.803   1.00 0.00 ? 43  TYR A CA     3  
ATOM   8204   C  C      . TYR A 1 36  ? 4.627   -13.894 4.890   1.00 0.00 ? 43  TYR A C      3  
ATOM   8205   O  O      . TYR A 1 36  ? 3.522   -13.364 4.996   1.00 0.00 ? 43  TYR A O      3  
ATOM   8206   C  CB     . TYR A 1 36  ? 4.635   -14.313 2.419   1.00 0.00 ? 43  TYR A CB     3  
ATOM   8207   C  CG     . TYR A 1 36  ? 5.494   -13.100 2.127   1.00 0.00 ? 43  TYR A CG     3  
ATOM   8208   C  CD1    . TYR A 1 36  ? 6.862   -13.225 1.919   1.00 0.00 ? 43  TYR A CD1    3  
ATOM   8209   C  CD2    . TYR A 1 36  ? 4.940   -11.825 2.088   1.00 0.00 ? 43  TYR A CD2    3  
ATOM   8210   C  CE1    . TYR A 1 36  ? 7.652   -12.118 1.670   1.00 0.00 ? 43  TYR A CE1    3  
ATOM   8211   C  CE2    . TYR A 1 36  ? 5.725   -10.714 1.845   1.00 0.00 ? 43  TYR A CE2    3  
ATOM   8212   C  CZ     . TYR A 1 36  ? 7.079   -10.865 1.640   1.00 0.00 ? 43  TYR A CZ     3  
ATOM   8213   O  OH     . TYR A 1 36  ? 7.863   -9.755  1.413   1.00 0.00 ? 43  TYR A OH     3  
ATOM   8214   H  H      . TYR A 1 36  ? 3.228   -15.997 4.531   1.00 0.00 ? 43  TYR A H      3  
ATOM   8215   H  HA     . TYR A 1 36  ? 5.923   -15.236 3.865   1.00 0.00 ? 43  TYR A HA     3  
ATOM   8216   H  HB2    . TYR A 1 36  ? 4.840   -15.053 1.661   1.00 0.00 ? 43  TYR A HB2    3  
ATOM   8217   H  HB3    . TYR A 1 36  ? 3.601   -14.011 2.351   1.00 0.00 ? 43  TYR A HB3    3  
ATOM   8218   H  HD1    . TYR A 1 36  ? 7.309   -14.207 1.943   1.00 0.00 ? 43  TYR A HD1    3  
ATOM   8219   H  HD2    . TYR A 1 36  ? 3.878   -11.706 2.247   1.00 0.00 ? 43  TYR A HD2    3  
ATOM   8220   H  HE1    . TYR A 1 36  ? 8.713   -12.237 1.509   1.00 0.00 ? 43  TYR A HE1    3  
ATOM   8221   H  HE2    . TYR A 1 36  ? 5.276   -9.732  1.818   1.00 0.00 ? 43  TYR A HE2    3  
ATOM   8222   H  HH     . TYR A 1 36  ? 7.688   -9.101  2.107   1.00 0.00 ? 43  TYR A HH     3  
ATOM   8223   N  N      . GLU A 1 37  ? 5.633   -13.632 5.708   1.00 0.00 ? 44  GLU A N      3  
ATOM   8224   C  CA     . GLU A 1 37  ? 5.491   -12.711 6.825   1.00 0.00 ? 44  GLU A CA     3  
ATOM   8225   C  C      . GLU A 1 37  ? 5.982   -11.291 6.496   1.00 0.00 ? 44  GLU A C      3  
ATOM   8226   O  O      . GLU A 1 37  ? 5.189   -10.349 6.554   1.00 0.00 ? 44  GLU A O      3  
ATOM   8227   C  CB     . GLU A 1 37  ? 6.233   -13.250 8.050   1.00 0.00 ? 44  GLU A CB     3  
ATOM   8228   C  CG     . GLU A 1 37  ? 6.097   -12.374 9.282   1.00 0.00 ? 44  GLU A CG     3  
ATOM   8229   C  CD     . GLU A 1 37  ? 7.011   -12.810 10.404  1.00 0.00 ? 44  GLU A CD     3  
ATOM   8230   O  OE1    . GLU A 1 37  ? 6.632   -13.722 11.164  1.00 0.00 ? 44  GLU A OE1    3  
ATOM   8231   O  OE2    . GLU A 1 37  ? 8.113   -12.239 10.528  1.00 0.00 ? 44  GLU A OE2    3  
ATOM   8232   H  H      . GLU A 1 37  ? 6.492   -14.090 5.570   1.00 0.00 ? 44  GLU A H      3  
ATOM   8233   H  HA     . GLU A 1 37  ? 4.440   -12.656 7.064   1.00 0.00 ? 44  GLU A HA     3  
ATOM   8234   H  HB2    . GLU A 1 37  ? 5.845   -14.232 8.286   1.00 0.00 ? 44  GLU A HB2    3  
ATOM   8235   H  HB3    . GLU A 1 37  ? 7.282   -13.336 7.809   1.00 0.00 ? 44  GLU A HB3    3  
ATOM   8236   H  HG2    . GLU A 1 37  ? 6.340   -11.357 9.015   1.00 0.00 ? 44  GLU A HG2    3  
ATOM   8237   H  HG3    . GLU A 1 37  ? 5.075   -12.420 9.632   1.00 0.00 ? 44  GLU A HG3    3  
ATOM   8238   N  N      . PRO A 1 38  ? 7.276   -11.116 6.126   1.00 0.00 ? 45  PRO A N      3  
ATOM   8239   C  CA     . PRO A 1 38  ? 7.930   -9.792  6.075   1.00 0.00 ? 45  PRO A CA     3  
ATOM   8240   C  C      . PRO A 1 38  ? 7.179   -8.735  5.260   1.00 0.00 ? 45  PRO A C      3  
ATOM   8241   O  O      . PRO A 1 38  ? 7.288   -8.681  4.034   1.00 0.00 ? 45  PRO A O      3  
ATOM   8242   C  CB     . PRO A 1 38  ? 9.299   -10.074 5.437   1.00 0.00 ? 45  PRO A CB     3  
ATOM   8243   C  CG     . PRO A 1 38  ? 9.188   -11.437 4.845   1.00 0.00 ? 45  PRO A CG     3  
ATOM   8244   C  CD     . PRO A 1 38  ? 8.208   -12.177 5.704   1.00 0.00 ? 45  PRO A CD     3  
ATOM   8245   H  HA     . PRO A 1 38  ? 8.086   -9.408  7.073   1.00 0.00 ? 45  PRO A HA     3  
ATOM   8246   H  HB2    . PRO A 1 38  ? 9.502   -9.331  4.680   1.00 0.00 ? 45  PRO A HB2    3  
ATOM   8247   H  HB3    . PRO A 1 38  ? 10.065  -10.038 6.197   1.00 0.00 ? 45  PRO A HB3    3  
ATOM   8248   H  HG2    . PRO A 1 38  ? 8.821   -11.370 3.830   1.00 0.00 ? 45  PRO A HG2    3  
ATOM   8249   H  HG3    . PRO A 1 38  ? 10.151  -11.926 4.866   1.00 0.00 ? 45  PRO A HG3    3  
ATOM   8250   H  HD2    . PRO A 1 38  ? 7.696   -12.934 5.127   1.00 0.00 ? 45  PRO A HD2    3  
ATOM   8251   H  HD3    . PRO A 1 38  ? 8.705   -12.617 6.555   1.00 0.00 ? 45  PRO A HD3    3  
ATOM   8252   N  N      . THR A 1 39  ? 6.402   -7.916  5.965   1.00 0.00 ? 46  THR A N      3  
ATOM   8253   C  CA     . THR A 1 39  ? 5.765   -6.732  5.393   1.00 0.00 ? 46  THR A CA     3  
ATOM   8254   C  C      . THR A 1 39  ? 5.516   -5.708  6.497   1.00 0.00 ? 46  THR A C      3  
ATOM   8255   O  O      . THR A 1 39  ? 4.372   -5.443  6.862   1.00 0.00 ? 46  THR A O      3  
ATOM   8256   C  CB     . THR A 1 39  ? 4.421   -7.057  4.694   1.00 0.00 ? 46  THR A CB     3  
ATOM   8257   O  OG1    . THR A 1 39  ? 3.713   -8.071  5.428   1.00 0.00 ? 46  THR A OG1    3  
ATOM   8258   C  CG2    . THR A 1 39  ? 4.635   -7.510  3.258   1.00 0.00 ? 46  THR A CG2    3  
ATOM   8259   H  H      . THR A 1 39  ? 6.247   -8.117  6.914   1.00 0.00 ? 46  THR A H      3  
ATOM   8260   H  HA     . THR A 1 39  ? 6.439   -6.306  4.661   1.00 0.00 ? 46  THR A HA     3  
ATOM   8261   H  HB     . THR A 1 39  ? 3.821   -6.157  4.681   1.00 0.00 ? 46  THR A HB     3  
ATOM   8262   H  HG1    . THR A 1 39  ? 4.363   -8.580  5.949   1.00 0.00 ? 46  THR A HG1    3  
ATOM   8263   H  HG21   . THR A 1 39  ? 5.111   -6.719  2.698   1.00 0.00 ? 46  THR A HG21   3  
ATOM   8264   H  HG22   . THR A 1 39  ? 3.682   -7.746  2.810   1.00 0.00 ? 46  THR A HG22   3  
ATOM   8265   H  HG23   . THR A 1 39  ? 5.264   -8.388  3.249   1.00 0.00 ? 46  THR A HG23   3  
ATOM   8266   N  N      . LYS A 1 40  ? 6.593   -5.188  7.077   1.00 0.00 ? 47  LYS A N      3  
ATOM   8267   C  CA     . LYS A 1 40  ? 6.468   -4.221  8.166   1.00 0.00 ? 47  LYS A CA     3  
ATOM   8268   C  C      . LYS A 1 40  ? 6.328   -2.817  7.593   1.00 0.00 ? 47  LYS A C      3  
ATOM   8269   O  O      . LYS A 1 40  ? 5.343   -2.118  7.834   1.00 0.00 ? 47  LYS A O      3  
ATOM   8270   C  CB     . LYS A 1 40  ? 7.697   -4.291  9.085   1.00 0.00 ? 47  LYS A CB     3  
ATOM   8271   C  CG     . LYS A 1 40  ? 8.015   -5.697  9.586   1.00 0.00 ? 47  LYS A CG     3  
ATOM   8272   C  CD     . LYS A 1 40  ? 6.902   -6.252  10.456  1.00 0.00 ? 47  LYS A CD     3  
ATOM   8273   C  CE     . LYS A 1 40  ? 6.865   -5.597  11.828  1.00 0.00 ? 47  LYS A CE     3  
ATOM   8274   N  NZ     . LYS A 1 40  ? 8.004   -6.027  12.683  1.00 0.00 ? 47  LYS A NZ     3  
ATOM   8275   H  H      . LYS A 1 40  ? 7.489   -5.444  6.750   1.00 0.00 ? 47  LYS A H      3  
ATOM   8276   H  HA     . LYS A 1 40  ? 5.582   -4.461  8.733   1.00 0.00 ? 47  LYS A HA     3  
ATOM   8277   H  HB2    . LYS A 1 40  ? 8.558   -3.926  8.544   1.00 0.00 ? 47  LYS A HB2    3  
ATOM   8278   H  HB3    . LYS A 1 40  ? 7.528   -3.657  9.944   1.00 0.00 ? 47  LYS A HB3    3  
ATOM   8279   H  HG2    . LYS A 1 40  ? 8.150   -6.348  8.737   1.00 0.00 ? 47  LYS A HG2    3  
ATOM   8280   H  HG3    . LYS A 1 40  ? 8.927   -5.667  10.164  1.00 0.00 ? 47  LYS A HG3    3  
ATOM   8281   H  HD2    . LYS A 1 40  ? 5.959   -6.077  9.965   1.00 0.00 ? 47  LYS A HD2    3  
ATOM   8282   H  HD3    . LYS A 1 40  ? 7.052   -7.316  10.580  1.00 0.00 ? 47  LYS A HD3    3  
ATOM   8283   H  HE2    . LYS A 1 40  ? 6.909   -4.527  11.701  1.00 0.00 ? 47  LYS A HE2    3  
ATOM   8284   H  HE3    . LYS A 1 40  ? 5.938   -5.863  12.316  1.00 0.00 ? 47  LYS A HE3    3  
ATOM   8285   H  HZ1    . LYS A 1 40  ? 8.903   -5.645  12.315  1.00 0.00 ? 47  LYS A HZ1    3  
ATOM   8286   H  HZ2    . LYS A 1 40  ? 8.065   -7.070  12.699  1.00 0.00 ? 47  LYS A HZ2    3  
ATOM   8287   H  HZ3    . LYS A 1 40  ? 7.867   -5.689  13.662  1.00 0.00 ? 47  LYS A HZ3    3  
ATOM   8288   N  N      . ALA A 1 41  ? 7.341   -2.417  6.843   1.00 0.00 ? 48  ALA A N      3  
ATOM   8289   C  CA     . ALA A 1 41  ? 7.298   -1.197  6.054   1.00 0.00 ? 48  ALA A CA     3  
ATOM   8290   C  C      . ALA A 1 41  ? 7.664   -1.527  4.620   1.00 0.00 ? 48  ALA A C      3  
ATOM   8291   O  O      . ALA A 1 41  ? 7.820   -0.644  3.777   1.00 0.00 ? 48  ALA A O      3  
ATOM   8292   C  CB     . ALA A 1 41  ? 8.247   -0.157  6.630   1.00 0.00 ? 48  ALA A CB     3  
ATOM   8293   H  H      . ALA A 1 41  ? 8.150   -2.969  6.810   1.00 0.00 ? 48  ALA A H      3  
ATOM   8294   H  HA     . ALA A 1 41  ? 6.293   -0.805  6.086   1.00 0.00 ? 48  ALA A HA     3  
ATOM   8295   H  HB1    . ALA A 1 41  ? 8.154   0.763   6.071   1.00 0.00 ? 48  ALA A HB1    3  
ATOM   8296   H  HB2    . ALA A 1 41  ? 9.260   -0.519  6.562   1.00 0.00 ? 48  ALA A HB2    3  
ATOM   8297   H  HB3    . ALA A 1 41  ? 7.997   0.024   7.666   1.00 0.00 ? 48  ALA A HB3    3  
ATOM   8298   N  N      . ASP A 1 42  ? 7.791   -2.825  4.370   1.00 0.00 ? 49  ASP A N      3  
ATOM   8299   C  CA     . ASP A 1 42  ? 8.313   -3.343  3.118   1.00 0.00 ? 49  ASP A CA     3  
ATOM   8300   C  C      . ASP A 1 42  ? 7.484   -2.892  1.926   1.00 0.00 ? 49  ASP A C      3  
ATOM   8301   O  O      . ASP A 1 42  ? 6.320   -3.263  1.777   1.00 0.00 ? 49  ASP A O      3  
ATOM   8302   C  CB     . ASP A 1 42  ? 8.377   -4.871  3.169   1.00 0.00 ? 49  ASP A CB     3  
ATOM   8303   C  CG     . ASP A 1 42  ? 9.278   -5.376  4.283   1.00 0.00 ? 49  ASP A CG     3  
ATOM   8304   O  OD1    . ASP A 1 42  ? 8.823   -5.416  5.452   1.00 0.00 ? 49  ASP A OD1    3  
ATOM   8305   O  OD2    . ASP A 1 42  ? 10.444  -5.727  3.992   1.00 0.00 ? 49  ASP A OD2    3  
ATOM   8306   H  H      . ASP A 1 42  ? 7.516   -3.464  5.060   1.00 0.00 ? 49  ASP A H      3  
ATOM   8307   H  HA     . ASP A 1 42  ? 9.314   -2.962  3.000   1.00 0.00 ? 49  ASP A HA     3  
ATOM   8308   H  HB2    . ASP A 1 42  ? 7.383   -5.262  3.332   1.00 0.00 ? 49  ASP A HB2    3  
ATOM   8309   H  HB3    . ASP A 1 42  ? 8.755   -5.237  2.229   1.00 0.00 ? 49  ASP A HB3    3  
ATOM   8310   N  N      . SER A 1 43  ? 8.095   -2.064  1.097   1.00 0.00 ? 50  SER A N      3  
ATOM   8311   C  CA     . SER A 1 43  ? 7.483   -1.611  -0.134  1.00 0.00 ? 50  SER A CA     3  
ATOM   8312   C  C      . SER A 1 43  ? 8.121   -2.349  -1.301  1.00 0.00 ? 50  SER A C      3  
ATOM   8313   O  O      . SER A 1 43  ? 9.297   -2.728  -1.233  1.00 0.00 ? 50  SER A O      3  
ATOM   8314   C  CB     . SER A 1 43  ? 7.691   -0.107  -0.281  1.00 0.00 ? 50  SER A CB     3  
ATOM   8315   O  OG     . SER A 1 43  ? 7.620   0.529   0.986   1.00 0.00 ? 50  SER A OG     3  
ATOM   8316   H  H      . SER A 1 43  ? 8.991   -1.743  1.316   1.00 0.00 ? 50  SER A H      3  
ATOM   8317   H  HA     . SER A 1 43  ? 6.428   -1.833  -0.098  1.00 0.00 ? 50  SER A HA     3  
ATOM   8318   H  HB2    . SER A 1 43  ? 8.663   0.082   -0.714  1.00 0.00 ? 50  SER A HB2    3  
ATOM   8319   H  HB3    . SER A 1 43  ? 6.925   0.302   -0.922  1.00 0.00 ? 50  SER A HB3    3  
ATOM   8320   H  HG     . SER A 1 43  ? 7.506   -0.136  1.673   1.00 0.00 ? 50  SER A HG     3  
ATOM   8321   N  N      . TYR A 1 44  ? 7.364   -2.575  -2.355  1.00 0.00 ? 51  TYR A N      3  
ATOM   8322   C  CA     . TYR A 1 44  ? 7.868   -3.328  -3.486  1.00 0.00 ? 51  TYR A CA     3  
ATOM   8323   C  C      . TYR A 1 44  ? 7.491   -2.661  -4.798  1.00 0.00 ? 51  TYR A C      3  
ATOM   8324   O  O      . TYR A 1 44  ? 6.320   -2.603  -5.173  1.00 0.00 ? 51  TYR A O      3  
ATOM   8325   C  CB     . TYR A 1 44  ? 7.368   -4.771  -3.429  1.00 0.00 ? 51  TYR A CB     3  
ATOM   8326   C  CG     . TYR A 1 44  ? 8.046   -5.591  -2.354  1.00 0.00 ? 51  TYR A CG     3  
ATOM   8327   C  CD1    . TYR A 1 44  ? 9.334   -6.076  -2.538  1.00 0.00 ? 51  TYR A CD1    3  
ATOM   8328   C  CD2    . TYR A 1 44  ? 7.414   -5.856  -1.144  1.00 0.00 ? 51  TYR A CD2    3  
ATOM   8329   C  CE1    . TYR A 1 44  ? 9.968   -6.809  -1.557  1.00 0.00 ? 51  TYR A CE1    3  
ATOM   8330   C  CE2    . TYR A 1 44  ? 8.041   -6.592  -0.157  1.00 0.00 ? 51  TYR A CE2    3  
ATOM   8331   C  CZ     . TYR A 1 44  ? 9.322   -7.060  -0.366  1.00 0.00 ? 51  TYR A CZ     3  
ATOM   8332   O  OH     . TYR A 1 44  ? 9.956   -7.785  0.616   1.00 0.00 ? 51  TYR A OH     3  
ATOM   8333   H  H      . TYR A 1 44  ? 6.453   -2.212  -2.382  1.00 0.00 ? 51  TYR A H      3  
ATOM   8334   H  HA     . TYR A 1 44  ? 8.946   -3.336  -3.412  1.00 0.00 ? 51  TYR A HA     3  
ATOM   8335   H  HB2    . TYR A 1 44  ? 6.309   -4.768  -3.220  1.00 0.00 ? 51  TYR A HB2    3  
ATOM   8336   H  HB3    . TYR A 1 44  ? 7.548   -5.251  -4.379  1.00 0.00 ? 51  TYR A HB3    3  
ATOM   8337   H  HD1    . TYR A 1 44  ? 9.840   -5.877  -3.472  1.00 0.00 ? 51  TYR A HD1    3  
ATOM   8338   H  HD2    . TYR A 1 44  ? 6.411   -5.486  -0.984  1.00 0.00 ? 51  TYR A HD2    3  
ATOM   8339   H  HE1    . TYR A 1 44  ? 10.970  -7.179  -1.721  1.00 0.00 ? 51  TYR A HE1    3  
ATOM   8340   H  HE2    . TYR A 1 44  ? 7.533   -6.790  0.775   1.00 0.00 ? 51  TYR A HE2    3  
ATOM   8341   H  HH     . TYR A 1 44  ? 9.370   -8.492  0.921   1.00 0.00 ? 51  TYR A HH     3  
ATOM   8342   N  N      . ARG A 1 45  ? 8.508   -2.155  -5.477  1.00 0.00 ? 52  ARG A N      3  
ATOM   8343   C  CA     . ARG A 1 45  ? 8.329   -1.452  -6.736  1.00 0.00 ? 52  ARG A CA     3  
ATOM   8344   C  C      . ARG A 1 45  ? 8.047   -2.431  -7.865  1.00 0.00 ? 52  ARG A C      3  
ATOM   8345   O  O      . ARG A 1 45  ? 8.935   -3.161  -8.310  1.00 0.00 ? 52  ARG A O      3  
ATOM   8346   C  CB     . ARG A 1 45  ? 9.576   -0.627  -7.060  1.00 0.00 ? 52  ARG A CB     3  
ATOM   8347   C  CG     . ARG A 1 45  ? 9.873   0.448   -6.029  1.00 0.00 ? 52  ARG A CG     3  
ATOM   8348   C  CD     . ARG A 1 45  ? 11.264  1.040   -6.202  1.00 0.00 ? 52  ARG A CD     3  
ATOM   8349   N  NE     . ARG A 1 45  ? 11.457  1.656   -7.516  1.00 0.00 ? 52  ARG A NE     3  
ATOM   8350   C  CZ     . ARG A 1 45  ? 12.409  2.551   -7.788  1.00 0.00 ? 52  ARG A CZ     3  
ATOM   8351   N  NH1    . ARG A 1 45  ? 13.256  2.938   -6.839  1.00 0.00 ? 52  ARG A NH1    3  
ATOM   8352   N  NH2    . ARG A 1 45  ? 12.520  3.052   -9.010  1.00 0.00 ? 52  ARG A NH2    3  
ATOM   8353   H  H      . ARG A 1 45  ? 9.410   -2.257  -5.118  1.00 0.00 ? 52  ARG A H      3  
ATOM   8354   H  HA     . ARG A 1 45  ? 7.485   -0.789  -6.628  1.00 0.00 ? 52  ARG A HA     3  
ATOM   8355   H  HB2    . ARG A 1 45  ? 10.428  -1.288  -7.115  1.00 0.00 ? 52  ARG A HB2    3  
ATOM   8356   H  HB3    . ARG A 1 45  ? 9.438   -0.150  -8.017  1.00 0.00 ? 52  ARG A HB3    3  
ATOM   8357   H  HG2    . ARG A 1 45  ? 9.144   1.237   -6.130  1.00 0.00 ? 52  ARG A HG2    3  
ATOM   8358   H  HG3    . ARG A 1 45  ? 9.799   0.015   -5.042  1.00 0.00 ? 52  ARG A HG3    3  
ATOM   8359   H  HD2    . ARG A 1 45  ? 11.414  1.792   -5.443  1.00 0.00 ? 52  ARG A HD2    3  
ATOM   8360   H  HD3    . ARG A 1 45  ? 11.994  0.252   -6.074  1.00 0.00 ? 52  ARG A HD3    3  
ATOM   8361   H  HE     . ARG A 1 45  ? 10.844  1.385   -8.233  1.00 0.00 ? 52  ARG A HE     3  
ATOM   8362   H  HH11   . ARG A 1 45  ? 13.179  2.562   -5.917  1.00 0.00 ? 52  ARG A HH11   3  
ATOM   8363   H  HH12   . ARG A 1 45  ? 13.987  3.600   -7.046  1.00 0.00 ? 52  ARG A HH12   3  
ATOM   8364   H  HH21   . ARG A 1 45  ? 11.889  2.756   -9.736  1.00 0.00 ? 52  ARG A HH21   3  
ATOM   8365   H  HH22   . ARG A 1 45  ? 13.233  3.733   -9.217  1.00 0.00 ? 52  ARG A HH22   3  
ATOM   8366   N  N      . LYS A 1 46  ? 6.807   -2.453  -8.313  1.00 0.00 ? 53  LYS A N      3  
ATOM   8367   C  CA     . LYS A 1 46  ? 6.395   -3.336  -9.389  1.00 0.00 ? 53  LYS A CA     3  
ATOM   8368   C  C      . LYS A 1 46  ? 6.316   -2.560  -10.701 1.00 0.00 ? 53  LYS A C      3  
ATOM   8369   O  O      . LYS A 1 46  ? 5.722   -1.480  -10.755 1.00 0.00 ? 53  LYS A O      3  
ATOM   8370   C  CB     . LYS A 1 46  ? 5.032   -3.955  -9.052  1.00 0.00 ? 53  LYS A CB     3  
ATOM   8371   C  CG     . LYS A 1 46  ? 4.493   -4.912  -10.105 1.00 0.00 ? 53  LYS A CG     3  
ATOM   8372   C  CD     . LYS A 1 46  ? 5.323   -6.184  -10.204 1.00 0.00 ? 53  LYS A CD     3  
ATOM   8373   C  CE     . LYS A 1 46  ? 4.790   -7.106  -11.290 1.00 0.00 ? 53  LYS A CE     3  
ATOM   8374   N  NZ     . LYS A 1 46  ? 5.502   -8.410  -11.314 1.00 0.00 ? 53  LYS A NZ     3  
ATOM   8375   H  H      . LYS A 1 46  ? 6.142   -1.851  -7.905  1.00 0.00 ? 53  LYS A H      3  
ATOM   8376   H  HA     . LYS A 1 46  ? 7.131   -4.120  -9.483  1.00 0.00 ? 53  LYS A HA     3  
ATOM   8377   H  HB2    . LYS A 1 46  ? 5.118   -4.495  -8.121  1.00 0.00 ? 53  LYS A HB2    3  
ATOM   8378   H  HB3    . LYS A 1 46  ? 4.315   -3.157  -8.925  1.00 0.00 ? 53  LYS A HB3    3  
ATOM   8379   H  HG2    . LYS A 1 46  ? 3.480   -5.182  -9.844  1.00 0.00 ? 53  LYS A HG2    3  
ATOM   8380   H  HG3    . LYS A 1 46  ? 4.499   -4.413  -11.063 1.00 0.00 ? 53  LYS A HG3    3  
ATOM   8381   H  HD2    . LYS A 1 46  ? 6.343   -5.920  -10.439 1.00 0.00 ? 53  LYS A HD2    3  
ATOM   8382   H  HD3    . LYS A 1 46  ? 5.290   -6.700  -9.254  1.00 0.00 ? 53  LYS A HD3    3  
ATOM   8383   H  HE2    . LYS A 1 46  ? 3.741   -7.282  -11.110 1.00 0.00 ? 53  LYS A HE2    3  
ATOM   8384   H  HE3    . LYS A 1 46  ? 4.912   -6.620  -12.247 1.00 0.00 ? 53  LYS A HE3    3  
ATOM   8385   H  HZ1    . LYS A 1 46  ? 5.220   -8.963  -12.153 1.00 0.00 ? 53  LYS A HZ1    3  
ATOM   8386   H  HZ2    . LYS A 1 46  ? 5.268   -8.962  -10.462 1.00 0.00 ? 53  LYS A HZ2    3  
ATOM   8387   H  HZ3    . LYS A 1 46  ? 6.533   -8.263  -11.343 1.00 0.00 ? 53  LYS A HZ3    3  
ATOM   8388   N  N      . LYS A 1 47  ? 6.939   -3.091  -11.747 1.00 0.00 ? 54  LYS A N      3  
ATOM   8389   C  CA     . LYS A 1 47  ? 6.848   -2.482  -13.066 1.00 0.00 ? 54  LYS A CA     3  
ATOM   8390   C  C      . LYS A 1 47  ? 5.618   -2.997  -13.797 1.00 0.00 ? 54  LYS A C      3  
ATOM   8391   O  O      . LYS A 1 47  ? 5.544   -4.174  -14.148 1.00 0.00 ? 54  LYS A O      3  
ATOM   8392   C  CB     . LYS A 1 47  ? 8.095   -2.769  -13.906 1.00 0.00 ? 54  LYS A CB     3  
ATOM   8393   C  CG     . LYS A 1 47  ? 7.994   -2.206  -15.318 1.00 0.00 ? 54  LYS A CG     3  
ATOM   8394   C  CD     . LYS A 1 47  ? 9.117   -2.691  -16.219 1.00 0.00 ? 54  LYS A CD     3  
ATOM   8395   C  CE     . LYS A 1 47  ? 10.459  -2.096  -15.830 1.00 0.00 ? 54  LYS A CE     3  
ATOM   8396   N  NZ     . LYS A 1 47  ? 11.481  -2.327  -16.880 1.00 0.00 ? 54  LYS A NZ     3  
ATOM   8397   H  H      . LYS A 1 47  ? 7.465   -3.917  -11.630 1.00 0.00 ? 54  LYS A H      3  
ATOM   8398   H  HA     . LYS A 1 47  ? 6.751   -1.416  -12.932 1.00 0.00 ? 54  LYS A HA     3  
ATOM   8399   H  HB2    . LYS A 1 47  ? 8.954   -2.327  -13.419 1.00 0.00 ? 54  LYS A HB2    3  
ATOM   8400   H  HB3    . LYS A 1 47  ? 8.236   -3.837  -13.974 1.00 0.00 ? 54  LYS A HB3    3  
ATOM   8401   H  HG2    . LYS A 1 47  ? 7.051   -2.510  -15.747 1.00 0.00 ? 54  LYS A HG2    3  
ATOM   8402   H  HG3    . LYS A 1 47  ? 8.031   -1.126  -15.266 1.00 0.00 ? 54  LYS A HG3    3  
ATOM   8403   H  HD2    . LYS A 1 47  ? 9.180   -3.767  -16.146 1.00 0.00 ? 54  LYS A HD2    3  
ATOM   8404   H  HD3    . LYS A 1 47  ? 8.893   -2.412  -17.238 1.00 0.00 ? 54  LYS A HD3    3  
ATOM   8405   H  HE2    . LYS A 1 47  ? 10.337  -1.033  -15.683 1.00 0.00 ? 54  LYS A HE2    3  
ATOM   8406   H  HE3    . LYS A 1 47  ? 10.788  -2.554  -14.908 1.00 0.00 ? 54  LYS A HE3    3  
ATOM   8407   H  HZ1    . LYS A 1 47  ? 12.404  -1.949  -16.576 1.00 0.00 ? 54  LYS A HZ1    3  
ATOM   8408   H  HZ2    . LYS A 1 47  ? 11.196  -1.848  -17.765 1.00 0.00 ? 54  LYS A HZ2    3  
ATOM   8409   H  HZ3    . LYS A 1 47  ? 11.581  -3.348  -17.068 1.00 0.00 ? 54  LYS A HZ3    3  
ATOM   8410   N  N      . VAL A 1 48  ? 4.660   -2.117  -14.016 1.00 0.00 ? 55  VAL A N      3  
ATOM   8411   C  CA     . VAL A 1 48  ? 3.435   -2.474  -14.713 1.00 0.00 ? 55  VAL A CA     3  
ATOM   8412   C  C      . VAL A 1 48  ? 3.085   -1.419  -15.751 1.00 0.00 ? 55  VAL A C      3  
ATOM   8413   O  O      . VAL A 1 48  ? 3.481   -0.262  -15.633 1.00 0.00 ? 55  VAL A O      3  
ATOM   8414   C  CB     . VAL A 1 48  ? 2.243   -2.648  -13.745 1.00 0.00 ? 55  VAL A CB     3  
ATOM   8415   C  CG1    . VAL A 1 48  ? 2.439   -3.870  -12.860 1.00 0.00 ? 55  VAL A CG1    3  
ATOM   8416   C  CG2    . VAL A 1 48  ? 2.047   -1.401  -12.893 1.00 0.00 ? 55  VAL A CG2    3  
ATOM   8417   H  H      . VAL A 1 48  ? 4.781   -1.189  -13.709 1.00 0.00 ? 55  VAL A H      3  
ATOM   8418   H  HA     . VAL A 1 48  ? 3.604   -3.415  -15.217 1.00 0.00 ? 55  VAL A HA     3  
ATOM   8419   H  HB     . VAL A 1 48  ? 1.349   -2.799  -14.333 1.00 0.00 ? 55  VAL A HB     3  
ATOM   8420   H  HG11   . VAL A 1 48  ? 2.469   -4.760  -13.474 1.00 0.00 ? 55  VAL A HG11   3  
ATOM   8421   H  HG12   . VAL A 1 48  ? 1.620   -3.943  -12.160 1.00 0.00 ? 55  VAL A HG12   3  
ATOM   8422   H  HG13   . VAL A 1 48  ? 3.368   -3.775  -12.319 1.00 0.00 ? 55  VAL A HG13   3  
ATOM   8423   H  HG21   . VAL A 1 48  ? 1.890   -0.546  -13.534 1.00 0.00 ? 55  VAL A HG21   3  
ATOM   8424   H  HG22   . VAL A 1 48  ? 2.925   -1.240  -12.284 1.00 0.00 ? 55  VAL A HG22   3  
ATOM   8425   H  HG23   . VAL A 1 48  ? 1.185   -1.533  -12.257 1.00 0.00 ? 55  VAL A HG23   3  
ATOM   8426   N  N      . VAL A 1 49  ? 2.365   -1.825  -16.775 1.00 0.00 ? 56  VAL A N      3  
ATOM   8427   C  CA     . VAL A 1 49  ? 1.918   -0.900  -17.795 1.00 0.00 ? 56  VAL A CA     3  
ATOM   8428   C  C      . VAL A 1 49  ? 0.622   -1.382  -18.428 1.00 0.00 ? 56  VAL A C      3  
ATOM   8429   O  O      . VAL A 1 49  ? 0.457   -2.569  -18.703 1.00 0.00 ? 56  VAL A O      3  
ATOM   8430   C  CB     . VAL A 1 49  ? 2.999   -0.680  -18.889 1.00 0.00 ? 56  VAL A CB     3  
ATOM   8431   C  CG1    . VAL A 1 49  ? 3.474   -1.991  -19.495 1.00 0.00 ? 56  VAL A CG1    3  
ATOM   8432   C  CG2    . VAL A 1 49  ? 2.493   0.243   -19.988 1.00 0.00 ? 56  VAL A CG2    3  
ATOM   8433   H  H      . VAL A 1 49  ? 2.127   -2.775  -16.852 1.00 0.00 ? 56  VAL A H      3  
ATOM   8434   H  HA     . VAL A 1 49  ? 1.732   0.048   -17.313 1.00 0.00 ? 56  VAL A HA     3  
ATOM   8435   H  HB     . VAL A 1 49  ? 3.847   -0.210  -18.420 1.00 0.00 ? 56  VAL A HB     3  
ATOM   8436   H  HG11   . VAL A 1 49  ? 2.650   -2.473  -20.001 1.00 0.00 ? 56  VAL A HG11   3  
ATOM   8437   H  HG12   . VAL A 1 49  ? 3.848   -2.636  -18.716 1.00 0.00 ? 56  VAL A HG12   3  
ATOM   8438   H  HG13   . VAL A 1 49  ? 4.263   -1.788  -20.209 1.00 0.00 ? 56  VAL A HG13   3  
ATOM   8439   H  HG21   . VAL A 1 49  ? 1.633   -0.202  -20.468 1.00 0.00 ? 56  VAL A HG21   3  
ATOM   8440   H  HG22   . VAL A 1 49  ? 3.274   0.392   -20.719 1.00 0.00 ? 56  VAL A HG22   3  
ATOM   8441   H  HG23   . VAL A 1 49  ? 2.215   1.196   -19.561 1.00 0.00 ? 56  VAL A HG23   3  
ATOM   8442   N  N      . LEU A 1 50  ? -0.305  -0.461  -18.626 1.00 0.00 ? 57  LEU A N      3  
ATOM   8443   C  CA     . LEU A 1 50  ? -1.499  -0.757  -19.385 1.00 0.00 ? 57  LEU A CA     3  
ATOM   8444   C  C      . LEU A 1 50  ? -1.556  0.180   -20.583 1.00 0.00 ? 57  LEU A C      3  
ATOM   8445   O  O      . LEU A 1 50  ? -1.968  1.332   -20.467 1.00 0.00 ? 57  LEU A O      3  
ATOM   8446   C  CB     . LEU A 1 50  ? -2.779  -0.672  -18.516 1.00 0.00 ? 57  LEU A CB     3  
ATOM   8447   C  CG     . LEU A 1 50  ? -3.285  0.726   -18.106 1.00 0.00 ? 57  LEU A CG     3  
ATOM   8448   C  CD1    . LEU A 1 50  ? -4.720  0.640   -17.614 1.00 0.00 ? 57  LEU A CD1    3  
ATOM   8449   C  CD2    . LEU A 1 50  ? -2.414  1.356   -17.028 1.00 0.00 ? 57  LEU A CD2    3  
ATOM   8450   H  H      . LEU A 1 50  ? -0.170  0.439   -18.274 1.00 0.00 ? 57  LEU A H      3  
ATOM   8451   H  HA     . LEU A 1 50  ? -1.396  -1.769  -19.755 1.00 0.00 ? 57  LEU A HA     3  
ATOM   8452   H  HB2    . LEU A 1 50  ? -3.575  -1.161  -19.056 1.00 0.00 ? 57  LEU A HB2    3  
ATOM   8453   H  HB3    . LEU A 1 50  ? -2.597  -1.236  -17.613 1.00 0.00 ? 57  LEU A HB3    3  
ATOM   8454   H  HG     . LEU A 1 50  ? -3.270  1.372   -18.973 1.00 0.00 ? 57  LEU A HG     3  
ATOM   8455   H  HD11   . LEU A 1 50  ? -5.351  0.277   -18.412 1.00 0.00 ? 57  LEU A HD11   3  
ATOM   8456   H  HD12   . LEU A 1 50  ? -5.054  1.620   -17.309 1.00 0.00 ? 57  LEU A HD12   3  
ATOM   8457   H  HD13   . LEU A 1 50  ? -4.773  -0.039  -16.775 1.00 0.00 ? 57  LEU A HD13   3  
ATOM   8458   H  HD21   . LEU A 1 50  ? -2.249  0.644   -16.232 1.00 0.00 ? 57  LEU A HD21   3  
ATOM   8459   H  HD22   . LEU A 1 50  ? -2.918  2.228   -16.630 1.00 0.00 ? 57  LEU A HD22   3  
ATOM   8460   H  HD23   . LEU A 1 50  ? -1.468  1.653   -17.452 1.00 0.00 ? 57  LEU A HD23   3  
ATOM   8461   N  N      . ASP A 1 51  ? -1.087  -0.328  -21.722 1.00 0.00 ? 58  ASP A N      3  
ATOM   8462   C  CA     . ASP A 1 51  ? -1.034  0.430   -22.975 1.00 0.00 ? 58  ASP A CA     3  
ATOM   8463   C  C      . ASP A 1 51  ? -0.455  1.830   -22.769 1.00 0.00 ? 58  ASP A C      3  
ATOM   8464   O  O      . ASP A 1 51  ? -1.190  2.818   -22.751 1.00 0.00 ? 58  ASP A O      3  
ATOM   8465   C  CB     . ASP A 1 51  ? -2.421  0.522   -23.619 1.00 0.00 ? 58  ASP A CB     3  
ATOM   8466   C  CG     . ASP A 1 51  ? -2.935  -0.823  -24.098 1.00 0.00 ? 58  ASP A CG     3  
ATOM   8467   O  OD1    . ASP A 1 51  ? -2.646  -1.194  -25.255 1.00 0.00 ? 58  ASP A OD1    3  
ATOM   8468   O  OD2    . ASP A 1 51  ? -3.633  -1.509  -23.323 1.00 0.00 ? 58  ASP A OD2    3  
ATOM   8469   H  H      . ASP A 1 51  ? -0.754  -1.254  -21.721 1.00 0.00 ? 58  ASP A H      3  
ATOM   8470   H  HA     . ASP A 1 51  ? -0.380  -0.108  -23.647 1.00 0.00 ? 58  ASP A HA     3  
ATOM   8471   H  HB2    . ASP A 1 51  ? -3.120  0.915   -22.895 1.00 0.00 ? 58  ASP A HB2    3  
ATOM   8472   H  HB3    . ASP A 1 51  ? -2.373  1.191   -24.465 1.00 0.00 ? 58  ASP A HB3    3  
ATOM   8473   N  N      . GLY A 1 52  ? 0.860   1.916   -22.600 1.00 0.00 ? 59  GLY A N      3  
ATOM   8474   C  CA     . GLY A 1 52  ? 1.487   3.205   -22.381 1.00 0.00 ? 59  GLY A CA     3  
ATOM   8475   C  C      . GLY A 1 52  ? 2.946   3.107   -21.975 1.00 0.00 ? 59  GLY A C      3  
ATOM   8476   O  O      . GLY A 1 52  ? 3.723   2.373   -22.585 1.00 0.00 ? 59  GLY A O      3  
ATOM   8477   H  H      . GLY A 1 52  ? 1.409   1.101   -22.641 1.00 0.00 ? 59  GLY A H      3  
ATOM   8478   H  HA2    . GLY A 1 52  ? 1.424   3.772   -23.291 1.00 0.00 ? 59  GLY A HA2    3  
ATOM   8479   H  HA3    . GLY A 1 52  ? 0.945   3.728   -21.607 1.00 0.00 ? 59  GLY A HA3    3  
ATOM   8480   N  N      . GLU A 1 53  ? 3.310   3.839   -20.929 1.00 0.00 ? 60  GLU A N      3  
ATOM   8481   C  CA     . GLU A 1 53  ? 4.698   3.946   -20.500 1.00 0.00 ? 60  GLU A CA     3  
ATOM   8482   C  C      . GLU A 1 53  ? 4.995   2.948   -19.392 1.00 0.00 ? 60  GLU A C      3  
ATOM   8483   O  O      . GLU A 1 53  ? 4.081   2.491   -18.708 1.00 0.00 ? 60  GLU A O      3  
ATOM   8484   C  CB     . GLU A 1 53  ? 4.967   5.373   -20.012 1.00 0.00 ? 60  GLU A CB     3  
ATOM   8485   C  CG     . GLU A 1 53  ? 4.039   5.817   -18.889 1.00 0.00 ? 60  GLU A CG     3  
ATOM   8486   C  CD     . GLU A 1 53  ? 4.147   7.299   -18.590 1.00 0.00 ? 60  GLU A CD     3  
ATOM   8487   O  OE1    . GLU A 1 53  ? 5.229   7.742   -18.153 1.00 0.00 ? 60  GLU A OE1    3  
ATOM   8488   O  OE2    . GLU A 1 53  ? 3.148   8.020   -18.790 1.00 0.00 ? 60  GLU A OE2    3  
ATOM   8489   H  H      . GLU A 1 53  ? 2.624   4.308   -20.413 1.00 0.00 ? 60  GLU A H      3  
ATOM   8490   H  HA     . GLU A 1 53  ? 5.334   3.735   -21.347 1.00 0.00 ? 60  GLU A HA     3  
ATOM   8491   H  HB2    . GLU A 1 53  ? 5.986   5.433   -19.656 1.00 0.00 ? 60  GLU A HB2    3  
ATOM   8492   H  HB3    . GLU A 1 53  ? 4.845   6.051   -20.840 1.00 0.00 ? 60  GLU A HB3    3  
ATOM   8493   H  HG2    . GLU A 1 53  ? 3.018   5.598   -19.172 1.00 0.00 ? 60  GLU A HG2    3  
ATOM   8494   H  HG3    . GLU A 1 53  ? 4.288   5.266   -17.994 1.00 0.00 ? 60  GLU A HG3    3  
ATOM   8495   N  N      . GLU A 1 54  ? 6.268   2.608   -19.227 1.00 0.00 ? 61  GLU A N      3  
ATOM   8496   C  CA     . GLU A 1 54  ? 6.681   1.714   -18.150 1.00 0.00 ? 61  GLU A CA     3  
ATOM   8497   C  C      . GLU A 1 54  ? 6.456   2.392   -16.810 1.00 0.00 ? 61  GLU A C      3  
ATOM   8498   O  O      . GLU A 1 54  ? 7.135   3.360   -16.470 1.00 0.00 ? 61  GLU A O      3  
ATOM   8499   C  CB     . GLU A 1 54  ? 8.148   1.303   -18.292 1.00 0.00 ? 61  GLU A CB     3  
ATOM   8500   C  CG     . GLU A 1 54  ? 8.405   0.337   -19.435 1.00 0.00 ? 61  GLU A CG     3  
ATOM   8501   C  CD     . GLU A 1 54  ? 9.866   -0.051  -19.549 1.00 0.00 ? 61  GLU A CD     3  
ATOM   8502   O  OE1    . GLU A 1 54  ? 10.280  -1.031  -18.888 1.00 0.00 ? 61  GLU A OE1    3  
ATOM   8503   O  OE2    . GLU A 1 54  ? 10.608  0.620   -20.294 1.00 0.00 ? 61  GLU A OE2    3  
ATOM   8504   H  H      . GLU A 1 54  ? 6.948   2.987   -19.832 1.00 0.00 ? 61  GLU A H      3  
ATOM   8505   H  HA     . GLU A 1 54  ? 6.063   0.831   -18.199 1.00 0.00 ? 61  GLU A HA     3  
ATOM   8506   H  HB2    . GLU A 1 54  ? 8.748   2.187   -18.453 1.00 0.00 ? 61  GLU A HB2    3  
ATOM   8507   H  HB3    . GLU A 1 54  ? 8.462   0.828   -17.375 1.00 0.00 ? 61  GLU A HB3    3  
ATOM   8508   H  HG2    . GLU A 1 54  ? 7.822   -0.558  -19.268 1.00 0.00 ? 61  GLU A HG2    3  
ATOM   8509   H  HG3    . GLU A 1 54  ? 8.092   0.801   -20.359 1.00 0.00 ? 61  GLU A HG3    3  
ATOM   8510   N  N      . VAL A 1 55  ? 5.503   1.879   -16.056 1.00 0.00 ? 62  VAL A N      3  
ATOM   8511   C  CA     . VAL A 1 55  ? 5.079   2.516   -14.828 1.00 0.00 ? 62  VAL A CA     3  
ATOM   8512   C  C      . VAL A 1 55  ? 5.590   1.739   -13.621 1.00 0.00 ? 62  VAL A C      3  
ATOM   8513   O  O      . VAL A 1 55  ? 5.628   0.508   -13.629 1.00 0.00 ? 62  VAL A O      3  
ATOM   8514   C  CB     . VAL A 1 55  ? 3.534   2.613   -14.771 1.00 0.00 ? 62  VAL A CB     3  
ATOM   8515   C  CG1    . VAL A 1 55  ? 3.064   3.210   -13.461 1.00 0.00 ? 62  VAL A CG1    3  
ATOM   8516   C  CG2    . VAL A 1 55  ? 2.995   3.428   -15.936 1.00 0.00 ? 62  VAL A CG2    3  
ATOM   8517   H  H      . VAL A 1 55  ? 5.076   1.039   -16.326 1.00 0.00 ? 62  VAL A H      3  
ATOM   8518   H  HA     . VAL A 1 55  ? 5.487   3.517   -14.808 1.00 0.00 ? 62  VAL A HA     3  
ATOM   8519   H  HB     . VAL A 1 55  ? 3.131   1.613   -14.848 1.00 0.00 ? 62  VAL A HB     3  
ATOM   8520   H  HG11   . VAL A 1 55  ? 3.477   4.202   -13.351 1.00 0.00 ? 62  VAL A HG11   3  
ATOM   8521   H  HG12   . VAL A 1 55  ? 3.392   2.588   -12.643 1.00 0.00 ? 62  VAL A HG12   3  
ATOM   8522   H  HG13   . VAL A 1 55  ? 1.986   3.269   -13.461 1.00 0.00 ? 62  VAL A HG13   3  
ATOM   8523   H  HG21   . VAL A 1 55  ? 3.373   4.437   -15.878 1.00 0.00 ? 62  VAL A HG21   3  
ATOM   8524   H  HG22   . VAL A 1 55  ? 1.915   3.445   -15.894 1.00 0.00 ? 62  VAL A HG22   3  
ATOM   8525   H  HG23   . VAL A 1 55  ? 3.311   2.980   -16.868 1.00 0.00 ? 62  VAL A HG23   3  
ATOM   8526   N  N      . GLN A 1 56  ? 5.996   2.468   -12.596 1.00 0.00 ? 63  GLN A N      3  
ATOM   8527   C  CA     . GLN A 1 56  ? 6.454   1.867   -11.362 1.00 0.00 ? 63  GLN A CA     3  
ATOM   8528   C  C      . GLN A 1 56  ? 5.486   2.196   -10.237 1.00 0.00 ? 63  GLN A C      3  
ATOM   8529   O  O      . GLN A 1 56  ? 5.265   3.367   -9.901  1.00 0.00 ? 63  GLN A O      3  
ATOM   8530   C  CB     . GLN A 1 56  ? 7.858   2.361   -11.008 1.00 0.00 ? 63  GLN A CB     3  
ATOM   8531   C  CG     . GLN A 1 56  ? 8.925   1.945   -12.008 1.00 0.00 ? 63  GLN A CG     3  
ATOM   8532   C  CD     . GLN A 1 56  ? 10.310  2.404   -11.603 1.00 0.00 ? 63  GLN A CD     3  
ATOM   8533   O  OE1    . GLN A 1 56  ? 11.021  1.706   -10.881 1.00 0.00 ? 63  GLN A OE1    3  
ATOM   8534   N  NE2    . GLN A 1 56  ? 10.703  3.582   -12.061 1.00 0.00 ? 63  GLN A NE2    3  
ATOM   8535   H  H      . GLN A 1 56  ? 5.985   3.450   -12.670 1.00 0.00 ? 63  GLN A H      3  
ATOM   8536   H  HA     . GLN A 1 56  ? 6.478   0.797   -11.500 1.00 0.00 ? 63  GLN A HA     3  
ATOM   8537   H  HB2    . GLN A 1 56  ? 7.845   3.439   -10.960 1.00 0.00 ? 63  GLN A HB2    3  
ATOM   8538   H  HB3    . GLN A 1 56  ? 8.130   1.967   -10.039 1.00 0.00 ? 63  GLN A HB3    3  
ATOM   8539   H  HG2    . GLN A 1 56  ? 8.929   0.867   -12.086 1.00 0.00 ? 63  GLN A HG2    3  
ATOM   8540   H  HG3    . GLN A 1 56  ? 8.686   2.374   -12.970 1.00 0.00 ? 63  GLN A HG3    3  
ATOM   8541   H  HE21   . GLN A 1 56  ? 10.079  4.096   -12.632 1.00 0.00 ? 63  GLN A HE21   3  
ATOM   8542   H  HE22   . GLN A 1 56  ? 11.604  3.895   -11.825 1.00 0.00 ? 63  GLN A HE22   3  
ATOM   8543   N  N      . ILE A 1 57  ? 4.892   1.159   -9.683  1.00 0.00 ? 64  ILE A N      3  
ATOM   8544   C  CA     . ILE A 1 57  ? 3.956   1.305   -8.589  1.00 0.00 ? 64  ILE A CA     3  
ATOM   8545   C  C      . ILE A 1 57  ? 4.571   0.769   -7.305  1.00 0.00 ? 64  ILE A C      3  
ATOM   8546   O  O      . ILE A 1 57  ? 5.049   -0.370  -7.260  1.00 0.00 ? 64  ILE A O      3  
ATOM   8547   C  CB     . ILE A 1 57  ? 2.622   0.580   -8.894  1.00 0.00 ? 64  ILE A CB     3  
ATOM   8548   C  CG1    . ILE A 1 57  ? 1.674   0.651   -7.690  1.00 0.00 ? 64  ILE A CG1    3  
ATOM   8549   C  CG2    . ILE A 1 57  ? 2.872   -0.867  -9.300  1.00 0.00 ? 64  ILE A CG2    3  
ATOM   8550   C  CD1    . ILE A 1 57  ? 0.360   -0.073  -7.908  1.00 0.00 ? 64  ILE A CD1    3  
ATOM   8551   H  H      . ILE A 1 57  ? 5.098   0.258   -10.016 1.00 0.00 ? 64  ILE A H      3  
ATOM   8552   H  HA     . ILE A 1 57  ? 3.750   2.359   -8.464  1.00 0.00 ? 64  ILE A HA     3  
ATOM   8553   H  HB     . ILE A 1 57  ? 2.159   1.079   -9.732  1.00 0.00 ? 64  ILE A HB     3  
ATOM   8554   H  HG12   . ILE A 1 57  ? 2.158   0.208   -6.832  1.00 0.00 ? 64  ILE A HG12   3  
ATOM   8555   H  HG13   . ILE A 1 57  ? 1.452   1.687   -7.476  1.00 0.00 ? 64  ILE A HG13   3  
ATOM   8556   H  HG21   . ILE A 1 57  ? 3.312   -1.404  -8.472  1.00 0.00 ? 64  ILE A HG21   3  
ATOM   8557   H  HG22   . ILE A 1 57  ? 3.544   -0.896  -10.145 1.00 0.00 ? 64  ILE A HG22   3  
ATOM   8558   H  HG23   . ILE A 1 57  ? 1.935   -1.331  -9.571  1.00 0.00 ? 64  ILE A HG23   3  
ATOM   8559   H  HD11   . ILE A 1 57  ? -0.263  0.040   -7.034  1.00 0.00 ? 64  ILE A HD11   3  
ATOM   8560   H  HD12   . ILE A 1 57  ? 0.553   -1.122  -8.079  1.00 0.00 ? 64  ILE A HD12   3  
ATOM   8561   H  HD13   . ILE A 1 57  ? -0.144  0.345   -8.767  1.00 0.00 ? 64  ILE A HD13   3  
ATOM   8562   N  N      . ASP A 1 58  ? 4.602   1.601   -6.277  1.00 0.00 ? 65  ASP A N      3  
ATOM   8563   C  CA     . ASP A 1 58  ? 5.156   1.189   -5.000  1.00 0.00 ? 65  ASP A CA     3  
ATOM   8564   C  C      . ASP A 1 58  ? 4.033   0.992   -3.993  1.00 0.00 ? 65  ASP A C      3  
ATOM   8565   O  O      . ASP A 1 58  ? 3.111   1.815   -3.906  1.00 0.00 ? 65  ASP A O      3  
ATOM   8566   C  CB     . ASP A 1 58  ? 6.166   2.216   -4.486  1.00 0.00 ? 65  ASP A CB     3  
ATOM   8567   C  CG     . ASP A 1 58  ? 7.316   1.564   -3.744  1.00 0.00 ? 65  ASP A CG     3  
ATOM   8568   O  OD1    . ASP A 1 58  ? 7.136   0.438   -3.230  1.00 0.00 ? 65  ASP A OD1    3  
ATOM   8569   O  OD2    . ASP A 1 58  ? 8.413   2.166   -3.703  1.00 0.00 ? 65  ASP A OD2    3  
ATOM   8570   H  H      . ASP A 1 58  ? 4.240   2.507   -6.377  1.00 0.00 ? 65  ASP A H      3  
ATOM   8571   H  HA     . ASP A 1 58  ? 5.659   0.244   -5.146  1.00 0.00 ? 65  ASP A HA     3  
ATOM   8572   H  HB2    . ASP A 1 58  ? 6.568   2.769   -5.323  1.00 0.00 ? 65  ASP A HB2    3  
ATOM   8573   H  HB3    . ASP A 1 58  ? 5.668   2.899   -3.814  1.00 0.00 ? 65  ASP A HB3    3  
ATOM   8574   N  N      . ILE A 1 59  ? 4.104   -0.098  -3.245  1.00 0.00 ? 66  ILE A N      3  
ATOM   8575   C  CA     . ILE A 1 59  ? 3.020   -0.498  -2.356  1.00 0.00 ? 66  ILE A CA     3  
ATOM   8576   C  C      . ILE A 1 59  ? 3.472   -0.522  -0.901  1.00 0.00 ? 66  ILE A C      3  
ATOM   8577   O  O      . ILE A 1 59  ? 4.455   -1.176  -0.560  1.00 0.00 ? 66  ILE A O      3  
ATOM   8578   C  CB     . ILE A 1 59  ? 2.478   -1.900  -2.718  1.00 0.00 ? 66  ILE A CB     3  
ATOM   8579   C  CG1    . ILE A 1 59  ? 2.047   -1.963  -4.185  1.00 0.00 ? 66  ILE A CG1    3  
ATOM   8580   C  CG2    . ILE A 1 59  ? 1.311   -2.268  -1.810  1.00 0.00 ? 66  ILE A CG2    3  
ATOM   8581   C  CD1    . ILE A 1 59  ? 0.902   -1.034  -4.527  1.00 0.00 ? 66  ILE A CD1    3  
ATOM   8582   H  H      . ILE A 1 59  ? 4.922   -0.640  -3.276  1.00 0.00 ? 66  ILE A H      3  
ATOM   8583   H  HA     . ILE A 1 59  ? 2.216   0.215   -2.464  1.00 0.00 ? 66  ILE A HA     3  
ATOM   8584   H  HB     . ILE A 1 59  ? 3.268   -2.619  -2.551  1.00 0.00 ? 66  ILE A HB     3  
ATOM   8585   H  HG12   . ILE A 1 59  ? 2.886   -1.698  -4.809  1.00 0.00 ? 66  ILE A HG12   3  
ATOM   8586   H  HG13   . ILE A 1 59  ? 1.737   -2.972  -4.418  1.00 0.00 ? 66  ILE A HG13   3  
ATOM   8587   H  HG21   . ILE A 1 59  ? 0.966   -3.263  -2.054  1.00 0.00 ? 66  ILE A HG21   3  
ATOM   8588   H  HG22   . ILE A 1 59  ? 0.506   -1.562  -1.956  1.00 0.00 ? 66  ILE A HG22   3  
ATOM   8589   H  HG23   . ILE A 1 59  ? 1.632   -2.240  -0.781  1.00 0.00 ? 66  ILE A HG23   3  
ATOM   8590   H  HD11   . ILE A 1 59  ? 0.663   -1.131  -5.575  1.00 0.00 ? 66  ILE A HD11   3  
ATOM   8591   H  HD12   . ILE A 1 59  ? 1.189   -0.014  -4.315  1.00 0.00 ? 66  ILE A HD12   3  
ATOM   8592   H  HD13   . ILE A 1 59  ? 0.038   -1.296  -3.936  1.00 0.00 ? 66  ILE A HD13   3  
ATOM   8593   N  N      . LEU A 1 60  ? 2.742   0.184   -0.049  1.00 0.00 ? 67  LEU A N      3  
ATOM   8594   C  CA     . LEU A 1 60  ? 2.997   0.154   1.382   1.00 0.00 ? 67  LEU A CA     3  
ATOM   8595   C  C      . LEU A 1 60  ? 2.044   -0.804  2.081   1.00 0.00 ? 67  LEU A C      3  
ATOM   8596   O  O      . LEU A 1 60  ? 0.867   -0.488  2.267   1.00 0.00 ? 67  LEU A O      3  
ATOM   8597   C  CB     . LEU A 1 60  ? 2.842   1.550   2.001   1.00 0.00 ? 67  LEU A CB     3  
ATOM   8598   C  CG     . LEU A 1 60  ? 4.000   2.521   1.769   1.00 0.00 ? 67  LEU A CG     3  
ATOM   8599   C  CD1    . LEU A 1 60  ? 3.701   3.866   2.412   1.00 0.00 ? 67  LEU A CD1    3  
ATOM   8600   C  CD2    . LEU A 1 60  ? 5.298   1.958   2.324   1.00 0.00 ? 67  LEU A CD2    3  
ATOM   8601   H  H      . LEU A 1 60  ? 2.012   0.743   -0.397  1.00 0.00 ? 67  LEU A H      3  
ATOM   8602   H  HA     . LEU A 1 60  ? 4.008   -0.190  1.533   1.00 0.00 ? 67  LEU A HA     3  
ATOM   8603   H  HB2    . LEU A 1 60  ? 1.945   1.997   1.594   1.00 0.00 ? 67  LEU A HB2    3  
ATOM   8604   H  HB3    . LEU A 1 60  ? 2.708   1.431   3.066   1.00 0.00 ? 67  LEU A HB3    3  
ATOM   8605   H  HG     . LEU A 1 60  ? 4.126   2.677   0.709   1.00 0.00 ? 67  LEU A HG     3  
ATOM   8606   H  HD11   . LEU A 1 60  ? 4.529   4.538   2.242   1.00 0.00 ? 67  LEU A HD11   3  
ATOM   8607   H  HD12   . LEU A 1 60  ? 3.555   3.735   3.474   1.00 0.00 ? 67  LEU A HD12   3  
ATOM   8608   H  HD13   . LEU A 1 60  ? 2.805   4.283   1.974   1.00 0.00 ? 67  LEU A HD13   3  
ATOM   8609   H  HD21   . LEU A 1 60  ? 5.179   1.745   3.376   1.00 0.00 ? 67  LEU A HD21   3  
ATOM   8610   H  HD22   . LEU A 1 60  ? 6.088   2.684   2.190   1.00 0.00 ? 67  LEU A HD22   3  
ATOM   8611   H  HD23   . LEU A 1 60  ? 5.553   1.051   1.799   1.00 0.00 ? 67  LEU A HD23   3  
ATOM   8612   N  N      . ASP A 1 61  ? 2.538   -1.973  2.455   1.00 0.00 ? 68  ASP A N      3  
ATOM   8613   C  CA     . ASP A 1 61  ? 1.758   -2.886  3.279   1.00 0.00 ? 68  ASP A CA     3  
ATOM   8614   C  C      . ASP A 1 61  ? 2.102   -2.645  4.742   1.00 0.00 ? 68  ASP A C      3  
ATOM   8615   O  O      . ASP A 1 61  ? 2.916   -3.350  5.330   1.00 0.00 ? 68  ASP A O      3  
ATOM   8616   C  CB     . ASP A 1 61  ? 2.007   -4.350  2.893   1.00 0.00 ? 68  ASP A CB     3  
ATOM   8617   C  CG     . ASP A 1 61  ? 1.137   -5.317  3.682   1.00 0.00 ? 68  ASP A CG     3  
ATOM   8618   O  OD1    . ASP A 1 61  ? -0.077  -5.062  3.815   1.00 0.00 ? 68  ASP A OD1    3  
ATOM   8619   O  OD2    . ASP A 1 61  ? 1.655   -6.347  4.169   1.00 0.00 ? 68  ASP A OD2    3  
ATOM   8620   H  H      . ASP A 1 61  ? 3.444   -2.229  2.176   1.00 0.00 ? 68  ASP A H      3  
ATOM   8621   H  HA     . ASP A 1 61  ? 0.711   -2.650  3.125   1.00 0.00 ? 68  ASP A HA     3  
ATOM   8622   H  HB2    . ASP A 1 61  ? 1.794   -4.481  1.844   1.00 0.00 ? 68  ASP A HB2    3  
ATOM   8623   H  HB3    . ASP A 1 61  ? 3.042   -4.592  3.079   1.00 0.00 ? 68  ASP A HB3    3  
ATOM   8624   N  N      . THR A 1 62  ? 1.497   -1.608  5.301   1.00 0.00 ? 69  THR A N      3  
ATOM   8625   C  CA     . THR A 1 62  ? 1.835   -1.137  6.633   1.00 0.00 ? 69  THR A CA     3  
ATOM   8626   C  C      . THR A 1 62  ? 1.252   -2.027  7.732   1.00 0.00 ? 69  THR A C      3  
ATOM   8627   O  O      . THR A 1 62  ? 0.305   -2.793  7.496   1.00 0.00 ? 69  THR A O      3  
ATOM   8628   C  CB     . THR A 1 62  ? 1.341   0.309   6.823   1.00 0.00 ? 69  THR A CB     3  
ATOM   8629   O  OG1    . THR A 1 62  ? -0.050  0.396   6.481   1.00 0.00 ? 69  THR A OG1    3  
ATOM   8630   C  CG2    . THR A 1 62  ? 2.133   1.272   5.951   1.00 0.00 ? 69  THR A CG2    3  
ATOM   8631   H  H      . THR A 1 62  ? 0.804   -1.133  4.798   1.00 0.00 ? 69  THR A H      3  
ATOM   8632   H  HA     . THR A 1 62  ? 2.913   -1.136  6.721   1.00 0.00 ? 69  THR A HA     3  
ATOM   8633   H  HB     . THR A 1 62  ? 1.472   0.589   7.857   1.00 0.00 ? 69  THR A HB     3  
ATOM   8634   H  HG1    . THR A 1 62  ? -0.301  1.321   6.396   1.00 0.00 ? 69  THR A HG1    3  
ATOM   8635   H  HG21   . THR A 1 62  ? 3.186   1.177   6.174   1.00 0.00 ? 69  THR A HG21   3  
ATOM   8636   H  HG22   . THR A 1 62  ? 1.813   2.282   6.150   1.00 0.00 ? 69  THR A HG22   3  
ATOM   8637   H  HG23   . THR A 1 62  ? 1.962   1.039   4.910   1.00 0.00 ? 69  THR A HG23   3  
ATOM   8638   N  N      . ALA A 1 63  ? 1.839   -1.922  8.924   1.00 0.00 ? 70  ALA A N      3  
ATOM   8639   C  CA     . ALA A 1 63  ? 1.368   -2.649  10.095  1.00 0.00 ? 70  ALA A CA     3  
ATOM   8640   C  C      . ALA A 1 63  ? 0.356   -1.814  10.872  1.00 0.00 ? 70  ALA A C      3  
ATOM   8641   O  O      . ALA A 1 63  ? 0.642   -0.680  11.258  1.00 0.00 ? 70  ALA A O      3  
ATOM   8642   C  CB     . ALA A 1 63  ? 2.542   -3.024  10.996  1.00 0.00 ? 70  ALA A CB     3  
ATOM   8643   H  H      . ALA A 1 63  ? 2.618   -1.337  9.015   1.00 0.00 ? 70  ALA A H      3  
ATOM   8644   H  HA     . ALA A 1 63  ? 0.891   -3.559  9.761   1.00 0.00 ? 70  ALA A HA     3  
ATOM   8645   H  HB1    . ALA A 1 63  ? 3.260   -3.602  10.432  1.00 0.00 ? 70  ALA A HB1    3  
ATOM   8646   H  HB2    . ALA A 1 63  ? 2.185   -3.610  11.830  1.00 0.00 ? 70  ALA A HB2    3  
ATOM   8647   H  HB3    . ALA A 1 63  ? 3.016   -2.124  11.369  1.00 0.00 ? 70  ALA A HB3    3  
ATOM   8648   N  N      . GLY A 1 64  ? -0.820  -2.375  11.099  1.00 0.00 ? 71  GLY A N      3  
ATOM   8649   C  CA     . GLY A 1 64  ? -1.862  -1.657  11.806  1.00 0.00 ? 71  GLY A CA     3  
ATOM   8650   C  C      . GLY A 1 64  ? -1.739  -1.803  13.306  1.00 0.00 ? 71  GLY A C      3  
ATOM   8651   O  O      . GLY A 1 64  ? -2.588  -2.413  13.954  1.00 0.00 ? 71  GLY A O      3  
ATOM   8652   H  H      . GLY A 1 64  ? -0.985  -3.290  10.789  1.00 0.00 ? 71  GLY A H      3  
ATOM   8653   H  HA2    . GLY A 1 64  ? -1.796  -0.611  11.549  1.00 0.00 ? 71  GLY A HA2    3  
ATOM   8654   H  HA3    . GLY A 1 64  ? -2.824  -2.036  11.493  1.00 0.00 ? 71  GLY A HA3    3  
ATOM   8655   N  N      . LEU A 1 65  ? -0.673  -1.243  13.853  1.00 0.00 ? 72  LEU A N      3  
ATOM   8656   C  CA     . LEU A 1 65  ? -0.413  -1.308  15.284  1.00 0.00 ? 72  LEU A CA     3  
ATOM   8657   C  C      . LEU A 1 65  ? -0.041  0.069   15.829  1.00 0.00 ? 72  LEU A C      3  
ATOM   8658   O  O      . LEU A 1 65  ? -0.017  1.051   15.087  1.00 0.00 ? 72  LEU A O      3  
ATOM   8659   C  CB     . LEU A 1 65  ? 0.686   -2.340  15.586  1.00 0.00 ? 72  LEU A CB     3  
ATOM   8660   C  CG     . LEU A 1 65  ? 1.809   -2.466  14.541  1.00 0.00 ? 72  LEU A CG     3  
ATOM   8661   C  CD1    . LEU A 1 65  ? 2.610   -1.178  14.430  1.00 0.00 ? 72  LEU A CD1    3  
ATOM   8662   C  CD2    . LEU A 1 65  ? 2.723   -3.633  14.883  1.00 0.00 ? 72  LEU A CD2    3  
ATOM   8663   H  H      . LEU A 1 65  ? -0.043  -0.761  13.275  1.00 0.00 ? 72  LEU A H      3  
ATOM   8664   H  HA     . LEU A 1 65  ? -1.327  -1.626  15.762  1.00 0.00 ? 72  LEU A HA     3  
ATOM   8665   H  HB2    . LEU A 1 65  ? 1.138   -2.079  16.533  1.00 0.00 ? 72  LEU A HB2    3  
ATOM   8666   H  HB3    . LEU A 1 65  ? 0.215   -3.307  15.690  1.00 0.00 ? 72  LEU A HB3    3  
ATOM   8667   H  HG     . LEU A 1 65  ? 1.365   -2.663  13.574  1.00 0.00 ? 72  LEU A HG     3  
ATOM   8668   H  HD11   . LEU A 1 65  ? 3.032   -0.934  15.394  1.00 0.00 ? 72  LEU A HD11   3  
ATOM   8669   H  HD12   . LEU A 1 65  ? 1.960   -0.377  14.110  1.00 0.00 ? 72  LEU A HD12   3  
ATOM   8670   H  HD13   . LEU A 1 65  ? 3.404   -1.308  13.711  1.00 0.00 ? 72  LEU A HD13   3  
ATOM   8671   H  HD21   . LEU A 1 65  ? 3.162   -3.474  15.858  1.00 0.00 ? 72  LEU A HD21   3  
ATOM   8672   H  HD22   . LEU A 1 65  ? 3.507   -3.707  14.144  1.00 0.00 ? 72  LEU A HD22   3  
ATOM   8673   H  HD23   . LEU A 1 65  ? 2.151   -4.550  14.891  1.00 0.00 ? 72  LEU A HD23   3  
ATOM   8674   N  N      . GLU A 1 66  ? 0.254   0.134   17.120  1.00 0.00 ? 73  GLU A N      3  
ATOM   8675   C  CA     . GLU A 1 66  ? 0.559   1.404   17.766  1.00 0.00 ? 73  GLU A CA     3  
ATOM   8676   C  C      . GLU A 1 66  ? 2.059   1.555   17.989  1.00 0.00 ? 73  GLU A C      3  
ATOM   8677   O  O      . GLU A 1 66  ? 2.521   2.556   18.533  1.00 0.00 ? 73  GLU A O      3  
ATOM   8678   C  CB     . GLU A 1 66  ? -0.182  1.512   19.099  1.00 0.00 ? 73  GLU A CB     3  
ATOM   8679   C  CG     . GLU A 1 66  ? -1.686  1.349   18.961  1.00 0.00 ? 73  GLU A CG     3  
ATOM   8680   C  CD     . GLU A 1 66  ? -2.415  1.564   20.269  1.00 0.00 ? 73  GLU A CD     3  
ATOM   8681   O  OE1    . GLU A 1 66  ? -2.764  2.725   20.570  1.00 0.00 ? 73  GLU A OE1    3  
ATOM   8682   O  OE2    . GLU A 1 66  ? -2.630  0.577   21.001  1.00 0.00 ? 73  GLU A OE2    3  
ATOM   8683   H  H      . GLU A 1 66  ? 0.264   -0.688  17.653  1.00 0.00 ? 73  GLU A H      3  
ATOM   8684   H  HA     . GLU A 1 66  ? 0.223   2.197   17.112  1.00 0.00 ? 73  GLU A HA     3  
ATOM   8685   H  HB2    . GLU A 1 66  ? 0.186   0.748   19.768  1.00 0.00 ? 73  GLU A HB2    3  
ATOM   8686   H  HB3    . GLU A 1 66  ? 0.016   2.483   19.532  1.00 0.00 ? 73  GLU A HB3    3  
ATOM   8687   H  HG2    . GLU A 1 66  ? -2.048  2.068   18.241  1.00 0.00 ? 73  GLU A HG2    3  
ATOM   8688   H  HG3    . GLU A 1 66  ? -1.897  0.350   18.609  1.00 0.00 ? 73  GLU A HG3    3  
ATOM   8689   N  N      . ASP A 1 67  ? 2.809   0.549   17.569  1.00 0.00 ? 74  ASP A N      3  
ATOM   8690   C  CA     . ASP A 1 67  ? 4.261   0.543   17.730  1.00 0.00 ? 74  ASP A CA     3  
ATOM   8691   C  C      . ASP A 1 67  ? 4.929   1.485   16.745  1.00 0.00 ? 74  ASP A C      3  
ATOM   8692   O  O      . ASP A 1 67  ? 5.391   2.569   17.106  1.00 0.00 ? 74  ASP A O      3  
ATOM   8693   C  CB     . ASP A 1 67  ? 4.813   -0.863  17.509  1.00 0.00 ? 74  ASP A CB     3  
ATOM   8694   C  CG     . ASP A 1 67  ? 4.256   -1.868  18.493  1.00 0.00 ? 74  ASP A CG     3  
ATOM   8695   O  OD1    . ASP A 1 67  ? 3.175   -2.433  18.219  1.00 0.00 ? 74  ASP A OD1    3  
ATOM   8696   O  OD2    . ASP A 1 67  ? 4.893   -2.095  19.540  1.00 0.00 ? 74  ASP A OD2    3  
ATOM   8697   H  H      . ASP A 1 67  ? 2.375   -0.224  17.155  1.00 0.00 ? 74  ASP A H      3  
ATOM   8698   H  HA     . ASP A 1 67  ? 4.492   0.860   18.736  1.00 0.00 ? 74  ASP A HA     3  
ATOM   8699   H  HB2    . ASP A 1 67  ? 4.562   -1.181  16.511  1.00 0.00 ? 74  ASP A HB2    3  
ATOM   8700   H  HB3    . ASP A 1 67  ? 5.888   -0.841  17.604  1.00 0.00 ? 74  ASP A HB3    3  
ATOM   8701   N  N      . TYR A 1 68  ? 4.964   1.062   15.490  1.00 0.00 ? 75  TYR A N      3  
ATOM   8702   C  CA     . TYR A 1 68  ? 5.652   1.802   14.450  1.00 0.00 ? 75  TYR A CA     3  
ATOM   8703   C  C      . TYR A 1 68  ? 4.806   2.961   13.956  1.00 0.00 ? 75  TYR A C      3  
ATOM   8704   O  O      . TYR A 1 68  ? 4.284   2.939   12.840  1.00 0.00 ? 75  TYR A O      3  
ATOM   8705   C  CB     . TYR A 1 68  ? 6.013   0.883   13.286  1.00 0.00 ? 75  TYR A CB     3  
ATOM   8706   C  CG     . TYR A 1 68  ? 6.917   -0.270  13.663  1.00 0.00 ? 75  TYR A CG     3  
ATOM   8707   C  CD1    . TYR A 1 68  ? 8.252   -0.057  13.978  1.00 0.00 ? 75  TYR A CD1    3  
ATOM   8708   C  CD2    . TYR A 1 68  ? 6.434   -1.571  13.693  1.00 0.00 ? 75  TYR A CD2    3  
ATOM   8709   C  CE1    . TYR A 1 68  ? 9.082   -1.109  14.312  1.00 0.00 ? 75  TYR A CE1    3  
ATOM   8710   C  CE2    . TYR A 1 68  ? 7.254   -2.628  14.028  1.00 0.00 ? 75  TYR A CE2    3  
ATOM   8711   C  CZ     . TYR A 1 68  ? 8.576   -2.394  14.335  1.00 0.00 ? 75  TYR A CZ     3  
ATOM   8712   O  OH     . TYR A 1 68  ? 9.392   -3.453  14.658  1.00 0.00 ? 75  TYR A OH     3  
ATOM   8713   H  H      . TYR A 1 68  ? 4.507   0.230   15.258  1.00 0.00 ? 75  TYR A H      3  
ATOM   8714   H  HA     . TYR A 1 68  ? 6.562   2.199   14.876  1.00 0.00 ? 75  TYR A HA     3  
ATOM   8715   H  HB2    . TYR A 1 68  ? 5.108   0.468   12.870  1.00 0.00 ? 75  TYR A HB2    3  
ATOM   8716   H  HB3    . TYR A 1 68  ? 6.517   1.462   12.525  1.00 0.00 ? 75  TYR A HB3    3  
ATOM   8717   H  HD1    . TYR A 1 68  ? 8.640   0.950   13.958  1.00 0.00 ? 75  TYR A HD1    3  
ATOM   8718   H  HD2    . TYR A 1 68  ? 5.396   -1.751  13.449  1.00 0.00 ? 75  TYR A HD2    3  
ATOM   8719   H  HE1    . TYR A 1 68  ? 10.121  -0.922  14.554  1.00 0.00 ? 75  TYR A HE1    3  
ATOM   8720   H  HE2    . TYR A 1 68  ? 6.858   -3.632  14.046  1.00 0.00 ? 75  TYR A HE2    3  
ATOM   8721   H  HH     . TYR A 1 68  ? 9.831   -3.276  15.506  1.00 0.00 ? 75  TYR A HH     3  
ATOM   8722   N  N      . ALA A 1 69  ? 4.671   3.971   14.800  1.00 0.00 ? 76  ALA A N      3  
ATOM   8723   C  CA     . ALA A 1 69  ? 3.963   5.188   14.438  1.00 0.00 ? 76  ALA A CA     3  
ATOM   8724   C  C      . ALA A 1 69  ? 4.660   5.882   13.278  1.00 0.00 ? 76  ALA A C      3  
ATOM   8725   O  O      . ALA A 1 69  ? 4.039   6.606   12.501  1.00 0.00 ? 76  ALA A O      3  
ATOM   8726   C  CB     . ALA A 1 69  ? 3.883   6.115   15.634  1.00 0.00 ? 76  ALA A CB     3  
ATOM   8727   H  H      . ALA A 1 69  ? 5.046   3.886   15.709  1.00 0.00 ? 76  ALA A H      3  
ATOM   8728   H  HA     . ALA A 1 69  ? 2.957   4.922   14.143  1.00 0.00 ? 76  ALA A HA     3  
ATOM   8729   H  HB1    . ALA A 1 69  ? 4.882   6.372   15.952  1.00 0.00 ? 76  ALA A HB1    3  
ATOM   8730   H  HB2    . ALA A 1 69  ? 3.363   5.619   16.439  1.00 0.00 ? 76  ALA A HB2    3  
ATOM   8731   H  HB3    . ALA A 1 69  ? 3.351   7.012   15.356  1.00 0.00 ? 76  ALA A HB3    3  
ATOM   8732   N  N      . ALA A 1 70  ? 5.958   5.629   13.156  1.00 0.00 ? 77  ALA A N      3  
ATOM   8733   C  CA     . ALA A 1 70  ? 6.763   6.205   12.091  1.00 0.00 ? 77  ALA A CA     3  
ATOM   8734   C  C      . ALA A 1 70  ? 6.316   5.696   10.726  1.00 0.00 ? 77  ALA A C      3  
ATOM   8735   O  O      . ALA A 1 70  ? 6.542   6.341   9.711   1.00 0.00 ? 77  ALA A O      3  
ATOM   8736   C  CB     . ALA A 1 70  ? 8.233   5.891   12.320  1.00 0.00 ? 77  ALA A CB     3  
ATOM   8737   H  H      . ALA A 1 70  ? 6.387   5.037   13.808  1.00 0.00 ? 77  ALA A H      3  
ATOM   8738   H  HA     . ALA A 1 70  ? 6.641   7.277   12.120  1.00 0.00 ? 77  ALA A HA     3  
ATOM   8739   H  HB1    . ALA A 1 70  ? 8.830   6.378   11.562  1.00 0.00 ? 77  ALA A HB1    3  
ATOM   8740   H  HB2    . ALA A 1 70  ? 8.386   4.824   12.267  1.00 0.00 ? 77  ALA A HB2    3  
ATOM   8741   H  HB3    . ALA A 1 70  ? 8.528   6.248   13.296  1.00 0.00 ? 77  ALA A HB3    3  
ATOM   8742   N  N      . ILE A 1 71  ? 5.671   4.539   10.717  1.00 0.00 ? 78  ILE A N      3  
ATOM   8743   C  CA     . ILE A 1 71  ? 5.203   3.935   9.480   1.00 0.00 ? 78  ILE A CA     3  
ATOM   8744   C  C      . ILE A 1 71  ? 3.741   4.311   9.229   1.00 0.00 ? 78  ILE A C      3  
ATOM   8745   O  O      . ILE A 1 71  ? 3.229   4.187   8.118   1.00 0.00 ? 78  ILE A O      3  
ATOM   8746   C  CB     . ILE A 1 71  ? 5.363   2.399   9.531   1.00 0.00 ? 78  ILE A CB     3  
ATOM   8747   C  CG1    . ILE A 1 71  ? 6.813   2.042   9.861   1.00 0.00 ? 78  ILE A CG1    3  
ATOM   8748   C  CG2    . ILE A 1 71  ? 4.955   1.760   8.211   1.00 0.00 ? 78  ILE A CG2    3  
ATOM   8749   C  CD1    . ILE A 1 71  ? 7.030   0.570   10.131  1.00 0.00 ? 78  ILE A CD1    3  
ATOM   8750   H  H      . ILE A 1 71  ? 5.495   4.083   11.568  1.00 0.00 ? 78  ILE A H      3  
ATOM   8751   H  HA     . ILE A 1 71  ? 5.808   4.319   8.670   1.00 0.00 ? 78  ILE A HA     3  
ATOM   8752   H  HB     . ILE A 1 71  ? 4.719   2.014   10.307  1.00 0.00 ? 78  ILE A HB     3  
ATOM   8753   H  HG12   . ILE A 1 71  ? 7.441   2.322   9.028   1.00 0.00 ? 78  ILE A HG12   3  
ATOM   8754   H  HG13   . ILE A 1 71  ? 7.122   2.592   10.737  1.00 0.00 ? 78  ILE A HG13   3  
ATOM   8755   H  HG21   . ILE A 1 71  ? 5.063   0.688   8.283   1.00 0.00 ? 78  ILE A HG21   3  
ATOM   8756   H  HG22   . ILE A 1 71  ? 5.589   2.132   7.419   1.00 0.00 ? 78  ILE A HG22   3  
ATOM   8757   H  HG23   . ILE A 1 71  ? 3.926   2.004   7.995   1.00 0.00 ? 78  ILE A HG23   3  
ATOM   8758   H  HD11   . ILE A 1 71  ? 6.766   -0.002  9.255   1.00 0.00 ? 78  ILE A HD11   3  
ATOM   8759   H  HD12   . ILE A 1 71  ? 6.409   0.264   10.963  1.00 0.00 ? 78  ILE A HD12   3  
ATOM   8760   H  HD13   . ILE A 1 71  ? 8.068   0.400   10.377  1.00 0.00 ? 78  ILE A HD13   3  
ATOM   8761   N  N      . ARG A 1 72  ? 3.084   4.800   10.269  1.00 0.00 ? 79  ARG A N      3  
ATOM   8762   C  CA     . ARG A 1 72  ? 1.696   5.222   10.162  1.00 0.00 ? 79  ARG A CA     3  
ATOM   8763   C  C      . ARG A 1 72  ? 1.601   6.701   9.813   1.00 0.00 ? 79  ARG A C      3  
ATOM   8764   O  O      . ARG A 1 72  ? 1.101   7.068   8.758   1.00 0.00 ? 79  ARG A O      3  
ATOM   8765   C  CB     . ARG A 1 72  ? 0.952   4.961   11.471  1.00 0.00 ? 79  ARG A CB     3  
ATOM   8766   C  CG     . ARG A 1 72  ? 0.660   3.494   11.742  1.00 0.00 ? 79  ARG A CG     3  
ATOM   8767   C  CD     . ARG A 1 72  ? -0.150  3.325   13.018  1.00 0.00 ? 79  ARG A CD     3  
ATOM   8768   N  NE     . ARG A 1 72  ? -1.372  4.133   12.998  1.00 0.00 ? 79  ARG A NE     3  
ATOM   8769   C  CZ     . ARG A 1 72  ? -2.290  4.136   13.963  1.00 0.00 ? 79  ARG A CZ     3  
ATOM   8770   N  NH1    . ARG A 1 72  ? -2.153  3.346   15.022  1.00 0.00 ? 79  ARG A NH1    3  
ATOM   8771   N  NH2    . ARG A 1 72  ? -3.347  4.934   13.863  1.00 0.00 ? 79  ARG A NH2    3  
ATOM   8772   H  H      . ARG A 1 72  ? 3.545   4.885   11.128  1.00 0.00 ? 79  ARG A H      3  
ATOM   8773   H  HA     . ARG A 1 72  ? 1.233   4.648   9.374   1.00 0.00 ? 79  ARG A HA     3  
ATOM   8774   H  HB2    . ARG A 1 72  ? 1.544   5.341   12.289  1.00 0.00 ? 79  ARG A HB2    3  
ATOM   8775   H  HB3    . ARG A 1 72  ? 0.012   5.492   11.445  1.00 0.00 ? 79  ARG A HB3    3  
ATOM   8776   H  HG2    . ARG A 1 72  ? 0.097   3.089   10.914  1.00 0.00 ? 79  ARG A HG2    3  
ATOM   8777   H  HG3    . ARG A 1 72  ? 1.594   2.963   11.843  1.00 0.00 ? 79  ARG A HG3    3  
ATOM   8778   H  HD2    . ARG A 1 72  ? -0.419  2.285   13.125  1.00 0.00 ? 79  ARG A HD2    3  
ATOM   8779   H  HD3    . ARG A 1 72  ? 0.456   3.627   13.859  1.00 0.00 ? 79  ARG A HD3    3  
ATOM   8780   H  HE     . ARG A 1 72  ? -1.507  4.722   12.217  1.00 0.00 ? 79  ARG A HE     3  
ATOM   8781   H  HH11   . ARG A 1 72  ? -1.355  2.741   15.102  1.00 0.00 ? 79  ARG A HH11   3  
ATOM   8782   H  HH12   . ARG A 1 72  ? -2.847  3.355   15.758  1.00 0.00 ? 79  ARG A HH12   3  
ATOM   8783   H  HH21   . ARG A 1 72  ? -3.452  5.529   13.064  1.00 0.00 ? 79  ARG A HH21   3  
ATOM   8784   H  HH22   . ARG A 1 72  ? -4.049  4.951   14.592  1.00 0.00 ? 79  ARG A HH22   3  
ATOM   8785   N  N      . ASP A 1 73  ? 2.083   7.538   10.717  1.00 0.00 ? 80  ASP A N      3  
ATOM   8786   C  CA     . ASP A 1 73  ? 1.994   8.986   10.563  1.00 0.00 ? 80  ASP A CA     3  
ATOM   8787   C  C      . ASP A 1 73  ? 3.009   9.498   9.544   1.00 0.00 ? 80  ASP A C      3  
ATOM   8788   O  O      . ASP A 1 73  ? 2.653   10.100  8.530   1.00 0.00 ? 80  ASP A O      3  
ATOM   8789   C  CB     . ASP A 1 73  ? 2.239   9.653   11.925  1.00 0.00 ? 80  ASP A CB     3  
ATOM   8790   C  CG     . ASP A 1 73  ? 2.041   11.160  11.911  1.00 0.00 ? 80  ASP A CG     3  
ATOM   8791   O  OD1    . ASP A 1 73  ? 2.964   11.886  11.492  1.00 0.00 ? 80  ASP A OD1    3  
ATOM   8792   O  OD2    . ASP A 1 73  ? 0.970   11.621  12.357  1.00 0.00 ? 80  ASP A OD2    3  
ATOM   8793   H  H      . ASP A 1 73  ? 2.519   7.173   11.517  1.00 0.00 ? 80  ASP A H      3  
ATOM   8794   H  HA     . ASP A 1 73  ? 0.999   9.227   10.222  1.00 0.00 ? 80  ASP A HA     3  
ATOM   8795   H  HB2    . ASP A 1 73  ? 1.556   9.232   12.649  1.00 0.00 ? 80  ASP A HB2    3  
ATOM   8796   H  HB3    . ASP A 1 73  ? 3.252   9.447   12.240  1.00 0.00 ? 80  ASP A HB3    3  
ATOM   8797   N  N      . ASN A 1 74  ? 4.272   9.199   9.812   1.00 0.00 ? 81  ASN A N      3  
ATOM   8798   C  CA     . ASN A 1 74  ? 5.393   9.789   9.086   1.00 0.00 ? 81  ASN A CA     3  
ATOM   8799   C  C      . ASN A 1 74  ? 5.492   9.263   7.653   1.00 0.00 ? 81  ASN A C      3  
ATOM   8800   O  O      . ASN A 1 74  ? 5.839   10.006  6.735   1.00 0.00 ? 81  ASN A O      3  
ATOM   8801   C  CB     . ASN A 1 74  ? 6.698   9.513   9.845   1.00 0.00 ? 81  ASN A CB     3  
ATOM   8802   C  CG     . ASN A 1 74  ? 6.611   9.909   11.314  1.00 0.00 ? 81  ASN A CG     3  
ATOM   8803   O  OD1    . ASN A 1 74  ? 5.912   10.846  11.675  1.00 0.00 ? 81  ASN A OD1    3  
ATOM   8804   N  ND2    . ASN A 1 74  ? 7.306   9.189   12.180  1.00 0.00 ? 81  ASN A ND2    3  
ATOM   8805   H  H      . ASN A 1 74  ? 4.457   8.568   10.536  1.00 0.00 ? 81  ASN A H      3  
ATOM   8806   H  HA     . ASN A 1 74  ? 5.234   10.856  9.050   1.00 0.00 ? 81  ASN A HA     3  
ATOM   8807   H  HB2    . ASN A 1 74  ? 6.928   8.460   9.787   1.00 0.00 ? 81  ASN A HB2    3  
ATOM   8808   H  HB3    . ASN A 1 74  ? 7.498   10.077  9.387   1.00 0.00 ? 81  ASN A HB3    3  
ATOM   8809   H  HD21   . ASN A 1 74  ? 7.842   8.441   11.846  1.00 0.00 ? 81  ASN A HD21   3  
ATOM   8810   H  HD22   . ASN A 1 74  ? 7.254   9.439   13.130  1.00 0.00 ? 81  ASN A HD22   3  
ATOM   8811   N  N      . TYR A 1 75  ? 5.176   7.987   7.461   1.00 0.00 ? 82  TYR A N      3  
ATOM   8812   C  CA     . TYR A 1 75  ? 5.302   7.356   6.147   1.00 0.00 ? 82  TYR A CA     3  
ATOM   8813   C  C      . TYR A 1 75  ? 4.276   7.891   5.154   1.00 0.00 ? 82  TYR A C      3  
ATOM   8814   O  O      . TYR A 1 75  ? 4.547   7.965   3.953   1.00 0.00 ? 82  TYR A O      3  
ATOM   8815   C  CB     . TYR A 1 75  ? 5.143   5.842   6.266   1.00 0.00 ? 82  TYR A CB     3  
ATOM   8816   C  CG     . TYR A 1 75  ? 6.433   5.064   6.124   1.00 0.00 ? 82  TYR A CG     3  
ATOM   8817   C  CD1    . TYR A 1 75  ? 7.489   5.255   7.005   1.00 0.00 ? 82  TYR A CD1    3  
ATOM   8818   C  CD2    . TYR A 1 75  ? 6.589   4.126   5.111   1.00 0.00 ? 82  TYR A CD2    3  
ATOM   8819   C  CE1    . TYR A 1 75  ? 8.662   4.537   6.878   1.00 0.00 ? 82  TYR A CE1    3  
ATOM   8820   C  CE2    . TYR A 1 75  ? 7.758   3.402   4.981   1.00 0.00 ? 82  TYR A CE2    3  
ATOM   8821   C  CZ     . TYR A 1 75  ? 8.790   3.613   5.869   1.00 0.00 ? 82  TYR A CZ     3  
ATOM   8822   O  OH     . TYR A 1 75  ? 9.958   2.891   5.752   1.00 0.00 ? 82  TYR A OH     3  
ATOM   8823   H  H      . TYR A 1 75  ? 4.851   7.457   8.219   1.00 0.00 ? 82  TYR A H      3  
ATOM   8824   H  HA     . TYR A 1 75  ? 6.290   7.572   5.772   1.00 0.00 ? 82  TYR A HA     3  
ATOM   8825   H  HB2    . TYR A 1 75  ? 4.721   5.606   7.232   1.00 0.00 ? 82  TYR A HB2    3  
ATOM   8826   H  HB3    . TYR A 1 75  ? 4.467   5.503   5.494   1.00 0.00 ? 82  TYR A HB3    3  
ATOM   8827   H  HD1    . TYR A 1 75  ? 7.389   5.983   7.797   1.00 0.00 ? 82  TYR A HD1    3  
ATOM   8828   H  HD2    . TYR A 1 75  ? 5.777   3.965   4.416   1.00 0.00 ? 82  TYR A HD2    3  
ATOM   8829   H  HE1    . TYR A 1 75  ? 9.472   4.702   7.573   1.00 0.00 ? 82  TYR A HE1    3  
ATOM   8830   H  HE2    . TYR A 1 75  ? 7.860   2.676   4.186   1.00 0.00 ? 82  TYR A HE2    3  
ATOM   8831   H  HH     . TYR A 1 75  ? 10.231  2.877   4.827   1.00 0.00 ? 82  TYR A HH     3  
ATOM   8832   N  N      . PHE A 1 76  ? 3.107   8.270   5.651   1.00 0.00 ? 83  PHE A N      3  
ATOM   8833   C  CA     . PHE A 1 76  ? 2.013   8.692   4.781   1.00 0.00 ? 83  PHE A CA     3  
ATOM   8834   C  C      . PHE A 1 76  ? 2.335   9.980   4.031   1.00 0.00 ? 83  PHE A C      3  
ATOM   8835   O  O      . PHE A 1 76  ? 1.826   10.197  2.929   1.00 0.00 ? 83  PHE A O      3  
ATOM   8836   C  CB     . PHE A 1 76  ? 0.721   8.881   5.584   1.00 0.00 ? 83  PHE A CB     3  
ATOM   8837   C  CG     . PHE A 1 76  ? 0.010   7.600   5.937   1.00 0.00 ? 83  PHE A CG     3  
ATOM   8838   C  CD1    . PHE A 1 76  ? 0.590   6.363   5.696   1.00 0.00 ? 83  PHE A CD1    3  
ATOM   8839   C  CD2    . PHE A 1 76  ? -1.252  7.641   6.509   1.00 0.00 ? 83  PHE A CD2    3  
ATOM   8840   C  CE1    . PHE A 1 76  ? -0.074  5.195   6.023   1.00 0.00 ? 83  PHE A CE1    3  
ATOM   8841   C  CE2    . PHE A 1 76  ? -1.919  6.477   6.838   1.00 0.00 ? 83  PHE A CE2    3  
ATOM   8842   C  CZ     . PHE A 1 76  ? -1.329  5.253   6.593   1.00 0.00 ? 83  PHE A CZ     3  
ATOM   8843   H  H      . PHE A 1 76  ? 2.974   8.269   6.624   1.00 0.00 ? 83  PHE A H      3  
ATOM   8844   H  HA     . PHE A 1 76  ? 1.856   7.906   4.060   1.00 0.00 ? 83  PHE A HA     3  
ATOM   8845   H  HB2    . PHE A 1 76  ? 0.951   9.392   6.506   1.00 0.00 ? 83  PHE A HB2    3  
ATOM   8846   H  HB3    . PHE A 1 76  ? 0.039   9.490   5.006   1.00 0.00 ? 83  PHE A HB3    3  
ATOM   8847   H  HD1    . PHE A 1 76  ? 1.574   6.317   5.252   1.00 0.00 ? 83  PHE A HD1    3  
ATOM   8848   H  HD2    . PHE A 1 76  ? -1.714  8.597   6.701   1.00 0.00 ? 83  PHE A HD2    3  
ATOM   8849   H  HE1    . PHE A 1 76  ? 0.389   4.238   5.831   1.00 0.00 ? 83  PHE A HE1    3  
ATOM   8850   H  HE2    . PHE A 1 76  ? -2.902  6.526   7.284   1.00 0.00 ? 83  PHE A HE2    3  
ATOM   8851   H  HZ     . PHE A 1 76  ? -1.850  4.343   6.849   1.00 0.00 ? 83  PHE A HZ     3  
ATOM   8852   N  N      . ARG A 1 77  ? 3.195   10.812  4.611   1.00 0.00 ? 84  ARG A N      3  
ATOM   8853   C  CA     . ARG A 1 77  ? 3.422   12.170  4.114   1.00 0.00 ? 84  ARG A CA     3  
ATOM   8854   C  C      . ARG A 1 77  ? 3.950   12.177  2.672   1.00 0.00 ? 84  ARG A C      3  
ATOM   8855   O  O      . ARG A 1 77  ? 3.677   13.101  1.916   1.00 0.00 ? 84  ARG A O      3  
ATOM   8856   C  CB     . ARG A 1 77  ? 4.377   12.917  5.055   1.00 0.00 ? 84  ARG A CB     3  
ATOM   8857   C  CG     . ARG A 1 77  ? 4.116   14.420  5.141   1.00 0.00 ? 84  ARG A CG     3  
ATOM   8858   C  CD     . ARG A 1 77  ? 4.650   15.181  3.936   1.00 0.00 ? 84  ARG A CD     3  
ATOM   8859   N  NE     . ARG A 1 77  ? 6.108   15.271  3.945   1.00 0.00 ? 84  ARG A NE     3  
ATOM   8860   C  CZ     . ARG A 1 77  ? 6.862   15.427  2.860   1.00 0.00 ? 84  ARG A CZ     3  
ATOM   8861   N  NH1    . ARG A 1 77  ? 6.308   15.486  1.653   1.00 0.00 ? 84  ARG A NH1    3  
ATOM   8862   N  NH2    . ARG A 1 77  ? 8.178   15.537  2.991   1.00 0.00 ? 84  ARG A NH2    3  
ATOM   8863   H  H      . ARG A 1 77  ? 3.696   10.505  5.400   1.00 0.00 ? 84  ARG A H      3  
ATOM   8864   H  HA     . ARG A 1 77  ? 2.469   12.678  4.125   1.00 0.00 ? 84  ARG A HA     3  
ATOM   8865   H  HB2    . ARG A 1 77  ? 4.279   12.502  6.047   1.00 0.00 ? 84  ARG A HB2    3  
ATOM   8866   H  HB3    . ARG A 1 77  ? 5.390   12.768  4.712   1.00 0.00 ? 84  ARG A HB3    3  
ATOM   8867   H  HG2    . ARG A 1 77  ? 3.051   14.581  5.204   1.00 0.00 ? 84  ARG A HG2    3  
ATOM   8868   H  HG3    . ARG A 1 77  ? 4.588   14.803  6.035   1.00 0.00 ? 84  ARG A HG3    3  
ATOM   8869   H  HD2    . ARG A 1 77  ? 4.336   14.673  3.036   1.00 0.00 ? 84  ARG A HD2    3  
ATOM   8870   H  HD3    . ARG A 1 77  ? 4.237   16.180  3.946   1.00 0.00 ? 84  ARG A HD3    3  
ATOM   8871   H  HE     . ARG A 1 77  ? 6.560   15.230  4.833   1.00 0.00 ? 84  ARG A HE     3  
ATOM   8872   H  HH11   . ARG A 1 77  ? 5.307   15.420  1.547   1.00 0.00 ? 84  ARG A HH11   3  
ATOM   8873   H  HH12   . ARG A 1 77  ? 6.888   15.591  0.832   1.00 0.00 ? 84  ARG A HH12   3  
ATOM   8874   H  HH21   . ARG A 1 77  ? 8.594   15.500  3.905   1.00 0.00 ? 84  ARG A HH21   3  
ATOM   8875   H  HH22   . ARG A 1 77  ? 8.763   15.663  2.184   1.00 0.00 ? 84  ARG A HH22   3  
ATOM   8876   N  N      . SER A 1 78  ? 4.689   11.144  2.288   1.00 0.00 ? 85  SER A N      3  
ATOM   8877   C  CA     . SER A 1 78  ? 5.224   11.060  0.930   1.00 0.00 ? 85  SER A CA     3  
ATOM   8878   C  C      . SER A 1 78  ? 4.433   10.058  0.085   1.00 0.00 ? 85  SER A C      3  
ATOM   8879   O  O      . SER A 1 78  ? 4.905   9.583   -0.952  1.00 0.00 ? 85  SER A O      3  
ATOM   8880   C  CB     . SER A 1 78  ? 6.701   10.674  0.978   1.00 0.00 ? 85  SER A CB     3  
ATOM   8881   O  OG     . SER A 1 78  ? 7.436   11.604  1.756   1.00 0.00 ? 85  SER A OG     3  
ATOM   8882   H  H      . SER A 1 78  ? 4.880   10.422  2.925   1.00 0.00 ? 85  SER A H      3  
ATOM   8883   H  HA     . SER A 1 78  ? 5.134   12.040  0.480   1.00 0.00 ? 85  SER A HA     3  
ATOM   8884   H  HB2    . SER A 1 78  ? 6.802   9.694   1.420   1.00 0.00 ? 85  SER A HB2    3  
ATOM   8885   H  HB3    . SER A 1 78  ? 7.104   10.662  -0.024  1.00 0.00 ? 85  SER A HB3    3  
ATOM   8886   H  HG     . SER A 1 78  ? 6.831   12.246  2.137   1.00 0.00 ? 85  SER A HG     3  
ATOM   8887   N  N      . GLY A 1 79  ? 3.222   9.749   0.531   1.00 0.00 ? 86  GLY A N      3  
ATOM   8888   C  CA     . GLY A 1 79  ? 2.365   8.840   -0.204  1.00 0.00 ? 86  GLY A CA     3  
ATOM   8889   C  C      . GLY A 1 79  ? 1.355   9.582   -1.055  1.00 0.00 ? 86  GLY A C      3  
ATOM   8890   O  O      . GLY A 1 79  ? 1.489   10.782  -1.265  1.00 0.00 ? 86  GLY A O      3  
ATOM   8891   H  H      . GLY A 1 79  ? 2.901   10.155  1.366   1.00 0.00 ? 86  GLY A H      3  
ATOM   8892   H  HA2    . GLY A 1 79  ? 2.976   8.218   -0.843  1.00 0.00 ? 86  GLY A HA2    3  
ATOM   8893   H  HA3    . GLY A 1 79  ? 1.835   8.212   0.496   1.00 0.00 ? 86  GLY A HA3    3  
ATOM   8894   N  N      . GLU A 1 80  ? 0.333   8.881   -1.527  1.00 0.00 ? 87  GLU A N      3  
ATOM   8895   C  CA     . GLU A 1 80  ? -0.675  9.493   -2.388  1.00 0.00 ? 87  GLU A CA     3  
ATOM   8896   C  C      . GLU A 1 80  ? -1.991  8.725   -2.316  1.00 0.00 ? 87  GLU A C      3  
ATOM   8897   O  O      . GLU A 1 80  ? -2.939  9.166   -1.669  1.00 0.00 ? 87  GLU A O      3  
ATOM   8898   C  CB     . GLU A 1 80  ? -0.168  9.541   -3.828  1.00 0.00 ? 87  GLU A CB     3  
ATOM   8899   C  CG     . GLU A 1 80  ? -1.084  10.287  -4.774  1.00 0.00 ? 87  GLU A CG     3  
ATOM   8900   C  CD     . GLU A 1 80  ? -0.553  10.303  -6.187  1.00 0.00 ? 87  GLU A CD     3  
ATOM   8901   O  OE1    . GLU A 1 80  ? 0.651   10.012  -6.381  1.00 0.00 ? 87  GLU A OE1    3  
ATOM   8902   O  OE2    . GLU A 1 80  ? -1.325  10.621  -7.113  1.00 0.00 ? 87  GLU A OE2    3  
ATOM   8903   H  H      . GLU A 1 80  ? 0.253   7.932   -1.298  1.00 0.00 ? 87  GLU A H      3  
ATOM   8904   H  HA     . GLU A 1 80  ? -0.847  10.508  -2.047  1.00 0.00 ? 87  GLU A HA     3  
ATOM   8905   H  HB2    . GLU A 1 80  ? 0.796   10.029  -3.840  1.00 0.00 ? 87  GLU A HB2    3  
ATOM   8906   H  HB3    . GLU A 1 80  ? -0.055  8.529   -4.192  1.00 0.00 ? 87  GLU A HB3    3  
ATOM   8907   H  HG2    . GLU A 1 80  ? -2.052  9.808   -4.773  1.00 0.00 ? 87  GLU A HG2    3  
ATOM   8908   H  HG3    . GLU A 1 80  ? -1.187  11.307  -4.430  1.00 0.00 ? 87  GLU A HG3    3  
ATOM   8909   N  N      . GLY A 1 81  ? -2.031  7.566   -2.964  1.00 0.00 ? 88  GLY A N      3  
ATOM   8910   C  CA     . GLY A 1 81  ? -3.244  6.776   -3.006  1.00 0.00 ? 88  GLY A CA     3  
ATOM   8911   C  C      . GLY A 1 81  ? -3.339  5.798   -1.855  1.00 0.00 ? 88  GLY A C      3  
ATOM   8912   O  O      . GLY A 1 81  ? -2.317  5.346   -1.336  1.00 0.00 ? 88  GLY A O      3  
ATOM   8913   H  H      . GLY A 1 81  ? -1.224  7.238   -3.417  1.00 0.00 ? 88  GLY A H      3  
ATOM   8914   H  HA2    . GLY A 1 81  ? -4.095  7.441   -2.972  1.00 0.00 ? 88  GLY A HA2    3  
ATOM   8915   H  HA3    . GLY A 1 81  ? -3.265  6.228   -3.934  1.00 0.00 ? 88  GLY A HA3    3  
ATOM   8916   N  N      . PHE A 1 82  ? -4.561  5.476   -1.451  1.00 0.00 ? 89  PHE A N      3  
ATOM   8917   C  CA     . PHE A 1 82  ? -4.786  4.575   -0.327  1.00 0.00 ? 89  PHE A CA     3  
ATOM   8918   C  C      . PHE A 1 82  ? -5.863  3.539   -0.647  1.00 0.00 ? 89  PHE A C      3  
ATOM   8919   O  O      . PHE A 1 82  ? -6.924  3.870   -1.185  1.00 0.00 ? 89  PHE A O      3  
ATOM   8920   C  CB     . PHE A 1 82  ? -5.195  5.362   0.919   1.00 0.00 ? 89  PHE A CB     3  
ATOM   8921   C  CG     . PHE A 1 82  ? -4.110  6.240   1.479   1.00 0.00 ? 89  PHE A CG     3  
ATOM   8922   C  CD1    . PHE A 1 82  ? -3.890  7.507   0.965   1.00 0.00 ? 89  PHE A CD1    3  
ATOM   8923   C  CD2    . PHE A 1 82  ? -3.321  5.801   2.529   1.00 0.00 ? 89  PHE A CD2    3  
ATOM   8924   C  CE1    . PHE A 1 82  ? -2.902  8.320   1.488   1.00 0.00 ? 89  PHE A CE1    3  
ATOM   8925   C  CE2    . PHE A 1 82  ? -2.333  6.609   3.055   1.00 0.00 ? 89  PHE A CE2    3  
ATOM   8926   C  CZ     . PHE A 1 82  ? -2.123  7.871   2.533   1.00 0.00 ? 89  PHE A CZ     3  
ATOM   8927   H  H      . PHE A 1 82  ? -5.337  5.858   -1.923  1.00 0.00 ? 89  PHE A H      3  
ATOM   8928   H  HA     . PHE A 1 82  ? -3.860  4.059   -0.126  1.00 0.00 ? 89  PHE A HA     3  
ATOM   8929   H  HB2    . PHE A 1 82  ? -6.033  5.996   0.673   1.00 0.00 ? 89  PHE A HB2    3  
ATOM   8930   H  HB3    . PHE A 1 82  ? -5.492  4.667   1.690   1.00 0.00 ? 89  PHE A HB3    3  
ATOM   8931   H  HD1    . PHE A 1 82  ? -4.500  7.860   0.147   1.00 0.00 ? 89  PHE A HD1    3  
ATOM   8932   H  HD2    . PHE A 1 82  ? -3.483  4.815   2.938   1.00 0.00 ? 89  PHE A HD2    3  
ATOM   8933   H  HE1    . PHE A 1 82  ? -2.741  9.305   1.077   1.00 0.00 ? 89  PHE A HE1    3  
ATOM   8934   H  HE2    . PHE A 1 82  ? -1.722  6.253   3.873   1.00 0.00 ? 89  PHE A HE2    3  
ATOM   8935   H  HZ     . PHE A 1 82  ? -1.350  8.504   2.943   1.00 0.00 ? 89  PHE A HZ     3  
ATOM   8936   N  N      . LEU A 1 83  ? -5.579  2.288   -0.309  1.00 0.00 ? 90  LEU A N      3  
ATOM   8937   C  CA     . LEU A 1 83  ? -6.535  1.203   -0.481  1.00 0.00 ? 90  LEU A CA     3  
ATOM   8938   C  C      . LEU A 1 83  ? -7.152  0.818   0.856   1.00 0.00 ? 90  LEU A C      3  
ATOM   8939   O  O      . LEU A 1 83  ? -6.442  0.510   1.815   1.00 0.00 ? 90  LEU A O      3  
ATOM   8940   C  CB     . LEU A 1 83  ? -5.870  -0.024  -1.112  1.00 0.00 ? 90  LEU A CB     3  
ATOM   8941   C  CG     . LEU A 1 83  ? -5.524  0.106   -2.595  1.00 0.00 ? 90  LEU A CG     3  
ATOM   8942   C  CD1    . LEU A 1 83  ? -4.826  -1.153  -3.087  1.00 0.00 ? 90  LEU A CD1    3  
ATOM   8943   C  CD2    . LEU A 1 83  ? -6.783  0.364   -3.409  1.00 0.00 ? 90  LEU A CD2    3  
ATOM   8944   H  H      . LEU A 1 83  ? -4.698  2.092   0.081   1.00 0.00 ? 90  LEU A H      3  
ATOM   8945   H  HA     . LEU A 1 83  ? -7.319  1.555   -1.136  1.00 0.00 ? 90  LEU A HA     3  
ATOM   8946   H  HB2    . LEU A 1 83  ? -4.958  -0.230  -0.569  1.00 0.00 ? 90  LEU A HB2    3  
ATOM   8947   H  HB3    . LEU A 1 83  ? -6.535  -0.866  -0.995  1.00 0.00 ? 90  LEU A HB3    3  
ATOM   8948   H  HG     . LEU A 1 83  ? -4.854  0.942   -2.734  1.00 0.00 ? 90  LEU A HG     3  
ATOM   8949   H  HD11   . LEU A 1 83  ? -3.917  -1.304  -2.524  1.00 0.00 ? 90  LEU A HD11   3  
ATOM   8950   H  HD12   . LEU A 1 83  ? -4.587  -1.046  -4.134  1.00 0.00 ? 90  LEU A HD12   3  
ATOM   8951   H  HD13   . LEU A 1 83  ? -5.478  -2.003  -2.951  1.00 0.00 ? 90  LEU A HD13   3  
ATOM   8952   H  HD21   . LEU A 1 83  ? -6.526  0.428   -4.456  1.00 0.00 ? 90  LEU A HD21   3  
ATOM   8953   H  HD22   . LEU A 1 83  ? -7.234  1.292   -3.092  1.00 0.00 ? 90  LEU A HD22   3  
ATOM   8954   H  HD23   . LEU A 1 83  ? -7.482  -0.445  -3.256  1.00 0.00 ? 90  LEU A HD23   3  
ATOM   8955   N  N      . LEU A 1 84  ? -8.472  0.842   0.909   1.00 0.00 ? 91  LEU A N      3  
ATOM   8956   C  CA     . LEU A 1 84  ? -9.208  0.486   2.117   1.00 0.00 ? 91  LEU A CA     3  
ATOM   8957   C  C      . LEU A 1 84  ? -9.669  -0.962  2.043   1.00 0.00 ? 91  LEU A C      3  
ATOM   8958   O  O      . LEU A 1 84  ? -10.578 -1.276  1.287   1.00 0.00 ? 91  LEU A O      3  
ATOM   8959   C  CB     . LEU A 1 84  ? -10.437 1.393   2.274   1.00 0.00 ? 91  LEU A CB     3  
ATOM   8960   C  CG     . LEU A 1 84  ? -10.242 2.691   3.066   1.00 0.00 ? 91  LEU A CG     3  
ATOM   8961   C  CD1    . LEU A 1 84  ? -9.964  2.387   4.522   1.00 0.00 ? 91  LEU A CD1    3  
ATOM   8962   C  CD2    . LEU A 1 84  ? -9.124  3.534   2.488   1.00 0.00 ? 91  LEU A CD2    3  
ATOM   8963   H  H      . LEU A 1 84  ? -8.976  1.095   0.101   1.00 0.00 ? 91  LEU A H      3  
ATOM   8964   H  HA     . LEU A 1 84  ? -8.554  0.615   2.967   1.00 0.00 ? 91  LEU A HA     3  
ATOM   8965   H  HB2    . LEU A 1 84  ? -10.786 1.658   1.287   1.00 0.00 ? 91  LEU A HB2    3  
ATOM   8966   H  HB3    . LEU A 1 84  ? -11.211 0.819   2.761   1.00 0.00 ? 91  LEU A HB3    3  
ATOM   8967   H  HG     . LEU A 1 84  ? -11.153 3.269   3.019   1.00 0.00 ? 91  LEU A HG     3  
ATOM   8968   H  HD11   . LEU A 1 84  ? -10.803 1.849   4.941   1.00 0.00 ? 91  LEU A HD11   3  
ATOM   8969   H  HD12   . LEU A 1 84  ? -9.821  3.312   5.061   1.00 0.00 ? 91  LEU A HD12   3  
ATOM   8970   H  HD13   . LEU A 1 84  ? -9.072  1.782   4.598   1.00 0.00 ? 91  LEU A HD13   3  
ATOM   8971   H  HD21   . LEU A 1 84  ? -8.202  2.976   2.519   1.00 0.00 ? 91  LEU A HD21   3  
ATOM   8972   H  HD22   . LEU A 1 84  ? -9.020  4.435   3.074   1.00 0.00 ? 91  LEU A HD22   3  
ATOM   8973   H  HD23   . LEU A 1 84  ? -9.358  3.792   1.466   1.00 0.00 ? 91  LEU A HD23   3  
ATOM   8974   N  N      . VAL A 1 85  ? -9.056  -1.843  2.815   1.00 0.00 ? 92  VAL A N      3  
ATOM   8975   C  CA     . VAL A 1 85  ? -9.455  -3.241  2.806   1.00 0.00 ? 92  VAL A CA     3  
ATOM   8976   C  C      . VAL A 1 85  ? -10.229 -3.593  4.073   1.00 0.00 ? 92  VAL A C      3  
ATOM   8977   O  O      . VAL A 1 85  ? -9.830  -3.231  5.181   1.00 0.00 ? 92  VAL A O      3  
ATOM   8978   C  CB     . VAL A 1 85  ? -8.244  -4.195  2.649   1.00 0.00 ? 92  VAL A CB     3  
ATOM   8979   C  CG1    . VAL A 1 85  ? -7.565  -3.986  1.303   1.00 0.00 ? 92  VAL A CG1    3  
ATOM   8980   C  CG2    . VAL A 1 85  ? -7.244  -4.014  3.782   1.00 0.00 ? 92  VAL A CG2    3  
ATOM   8981   H  H      . VAL A 1 85  ? -8.330  -1.552  3.406   1.00 0.00 ? 92  VAL A H      3  
ATOM   8982   H  HA     . VAL A 1 85  ? -10.107 -3.386  1.955   1.00 0.00 ? 92  VAL A HA     3  
ATOM   8983   H  HB     . VAL A 1 85  ? -8.611  -5.210  2.682   1.00 0.00 ? 92  VAL A HB     3  
ATOM   8984   H  HG11   . VAL A 1 85  ? -8.260  -4.214  0.508   1.00 0.00 ? 92  VAL A HG11   3  
ATOM   8985   H  HG12   . VAL A 1 85  ? -6.706  -4.637  1.227   1.00 0.00 ? 92  VAL A HG12   3  
ATOM   8986   H  HG13   . VAL A 1 85  ? -7.246  -2.958  1.218   1.00 0.00 ? 92  VAL A HG13   3  
ATOM   8987   H  HG21   . VAL A 1 85  ? -6.865  -3.002  3.770   1.00 0.00 ? 92  VAL A HG21   3  
ATOM   8988   H  HG22   . VAL A 1 85  ? -6.426  -4.707  3.654   1.00 0.00 ? 92  VAL A HG22   3  
ATOM   8989   H  HG23   . VAL A 1 85  ? -7.733  -4.204  4.726   1.00 0.00 ? 92  VAL A HG23   3  
ATOM   8990   N  N      . PHE A 1 86  ? -11.353 -4.272  3.899   1.00 0.00 ? 93  PHE A N      3  
ATOM   8991   C  CA     . PHE A 1 86  ? -12.143 -4.734  5.029   1.00 0.00 ? 93  PHE A CA     3  
ATOM   8992   C  C      . PHE A 1 86  ? -12.945 -5.968  4.632   1.00 0.00 ? 93  PHE A C      3  
ATOM   8993   O  O      . PHE A 1 86  ? -13.078 -6.275  3.444   1.00 0.00 ? 93  PHE A O      3  
ATOM   8994   C  CB     . PHE A 1 86  ? -13.080 -3.628  5.539   1.00 0.00 ? 93  PHE A CB     3  
ATOM   8995   C  CG     . PHE A 1 86  ? -14.295 -3.390  4.682   1.00 0.00 ? 93  PHE A CG     3  
ATOM   8996   C  CD1    . PHE A 1 86  ? -14.205 -2.670  3.500   1.00 0.00 ? 93  PHE A CD1    3  
ATOM   8997   C  CD2    . PHE A 1 86  ? -15.531 -3.884  5.070   1.00 0.00 ? 93  PHE A CD2    3  
ATOM   8998   C  CE1    . PHE A 1 86  ? -15.328 -2.451  2.723   1.00 0.00 ? 93  PHE A CE1    3  
ATOM   8999   C  CE2    . PHE A 1 86  ? -16.654 -3.669  4.296   1.00 0.00 ? 93  PHE A CE2    3  
ATOM   9000   C  CZ     . PHE A 1 86  ? -16.552 -2.951  3.123   1.00 0.00 ? 93  PHE A CZ     3  
ATOM   9001   H  H      . PHE A 1 86  ? -11.663 -4.466  2.987   1.00 0.00 ? 93  PHE A H      3  
ATOM   9002   H  HA     . PHE A 1 86  ? -11.458 -5.005  5.820   1.00 0.00 ? 93  PHE A HA     3  
ATOM   9003   H  HB2    . PHE A 1 86  ? -13.425 -3.890  6.527   1.00 0.00 ? 93  PHE A HB2    3  
ATOM   9004   H  HB3    . PHE A 1 86  ? -12.527 -2.701  5.594   1.00 0.00 ? 93  PHE A HB3    3  
ATOM   9005   H  HD1    . PHE A 1 86  ? -13.248 -2.278  3.185   1.00 0.00 ? 93  PHE A HD1    3  
ATOM   9006   H  HD2    . PHE A 1 86  ? -15.612 -4.446  5.988   1.00 0.00 ? 93  PHE A HD2    3  
ATOM   9007   H  HE1    . PHE A 1 86  ? -15.248 -1.889  1.804   1.00 0.00 ? 93  PHE A HE1    3  
ATOM   9008   H  HE2    . PHE A 1 86  ? -17.610 -4.062  4.610   1.00 0.00 ? 93  PHE A HE2    3  
ATOM   9009   H  HZ     . PHE A 1 86  ? -17.429 -2.781  2.516   1.00 0.00 ? 93  PHE A HZ     3  
ATOM   9010   N  N      . SER A 1 87  ? -13.466 -6.668  5.627   1.00 0.00 ? 94  SER A N      3  
ATOM   9011   C  CA     . SER A 1 87  ? -14.297 -7.833  5.392   1.00 0.00 ? 94  SER A CA     3  
ATOM   9012   C  C      . SER A 1 87  ? -15.703 -7.570  5.920   1.00 0.00 ? 94  SER A C      3  
ATOM   9013   O  O      . SER A 1 87  ? -15.873 -6.996  6.997   1.00 0.00 ? 94  SER A O      3  
ATOM   9014   C  CB     . SER A 1 87  ? -13.685 -9.062  6.072   1.00 0.00 ? 94  SER A CB     3  
ATOM   9015   O  OG     . SER A 1 87  ? -14.406 -10.241 5.755   1.00 0.00 ? 94  SER A OG     3  
ATOM   9016   H  H      . SER A 1 87  ? -13.290 -6.390  6.550   1.00 0.00 ? 94  SER A H      3  
ATOM   9017   H  HA     . SER A 1 87  ? -14.347 -8.002  4.325   1.00 0.00 ? 94  SER A HA     3  
ATOM   9018   H  HB2    . SER A 1 87  ? -12.663 -9.182  5.741   1.00 0.00 ? 94  SER A HB2    3  
ATOM   9019   H  HB3    . SER A 1 87  ? -13.702 -8.923  7.143   1.00 0.00 ? 94  SER A HB3    3  
ATOM   9020   H  HG     . SER A 1 87  ? -14.771 -10.626 6.564   1.00 0.00 ? 94  SER A HG     3  
ATOM   9021   N  N      . ILE A 1 88  ? -16.711 -7.994  5.168   1.00 0.00 ? 95  ILE A N      3  
ATOM   9022   C  CA     . ILE A 1 88  ? -18.103 -7.734  5.536   1.00 0.00 ? 95  ILE A CA     3  
ATOM   9023   C  C      . ILE A 1 88  ? -18.568 -8.649  6.667   1.00 0.00 ? 95  ILE A C      3  
ATOM   9024   O  O      . ILE A 1 88  ? -19.730 -8.611  7.073   1.00 0.00 ? 95  ILE A O      3  
ATOM   9025   C  CB     . ILE A 1 88  ? -19.075 -7.861  4.335   1.00 0.00 ? 95  ILE A CB     3  
ATOM   9026   C  CG1    . ILE A 1 88  ? -19.168 -9.305  3.812   1.00 0.00 ? 95  ILE A CG1    3  
ATOM   9027   C  CG2    . ILE A 1 88  ? -18.654 -6.913  3.223   1.00 0.00 ? 95  ILE A CG2    3  
ATOM   9028   C  CD1    . ILE A 1 88  ? -17.940 -9.794  3.075   1.00 0.00 ? 95  ILE A CD1    3  
ATOM   9029   H  H      . ILE A 1 88  ? -16.515 -8.489  4.345   1.00 0.00 ? 95  ILE A H      3  
ATOM   9030   H  HA     . ILE A 1 88  ? -18.153 -6.714  5.889   1.00 0.00 ? 95  ILE A HA     3  
ATOM   9031   H  HB     . ILE A 1 88  ? -20.053 -7.551  4.671   1.00 0.00 ? 95  ILE A HB     3  
ATOM   9032   H  HG12   . ILE A 1 88  ? -19.329 -9.968  4.648   1.00 0.00 ? 95  ILE A HG12   3  
ATOM   9033   H  HG13   . ILE A 1 88  ? -20.010 -9.378  3.136   1.00 0.00 ? 95  ILE A HG13   3  
ATOM   9034   H  HG21   . ILE A 1 88  ? -19.319 -7.026  2.381   1.00 0.00 ? 95  ILE A HG21   3  
ATOM   9035   H  HG22   . ILE A 1 88  ? -17.643 -7.143  2.917   1.00 0.00 ? 95  ILE A HG22   3  
ATOM   9036   H  HG23   . ILE A 1 88  ? -18.698 -5.895  3.583   1.00 0.00 ? 95  ILE A HG23   3  
ATOM   9037   H  HD11   . ILE A 1 88  ? -17.116 -9.874  3.769   1.00 0.00 ? 95  ILE A HD11   3  
ATOM   9038   H  HD12   . ILE A 1 88  ? -17.687 -9.095  2.293   1.00 0.00 ? 95  ILE A HD12   3  
ATOM   9039   H  HD13   . ILE A 1 88  ? -18.141 -10.763 2.641   1.00 0.00 ? 95  ILE A HD13   3  
ATOM   9040   N  N      . THR A 1 89  ? -17.656 -9.456  7.178   1.00 0.00 ? 96  THR A N      3  
ATOM   9041   C  CA     . THR A 1 89  ? -17.927 -10.302 8.325   1.00 0.00 ? 96  THR A CA     3  
ATOM   9042   C  C      . THR A 1 89  ? -17.483 -9.600  9.596   1.00 0.00 ? 96  THR A C      3  
ATOM   9043   O  O      . THR A 1 89  ? -17.785 -10.041 10.705  1.00 0.00 ? 96  THR A O      3  
ATOM   9044   C  CB     . THR A 1 89  ? -17.185 -11.643 8.207   1.00 0.00 ? 96  THR A CB     3  
ATOM   9045   O  OG1    . THR A 1 89  ? -15.887 -11.424 7.643   1.00 0.00 ? 96  THR A OG1    3  
ATOM   9046   C  CG2    . THR A 1 89  ? -17.954 -12.625 7.347   1.00 0.00 ? 96  THR A CG2    3  
ATOM   9047   H  H      . THR A 1 89  ? -16.762 -9.475  6.783   1.00 0.00 ? 96  THR A H      3  
ATOM   9048   H  HA     . THR A 1 89  ? -18.991 -10.495 8.366   1.00 0.00 ? 96  THR A HA     3  
ATOM   9049   H  HB     . THR A 1 89  ? -17.072 -12.064 9.196   1.00 0.00 ? 96  THR A HB     3  
ATOM   9050   H  HG1    . THR A 1 89  ? -15.285 -12.122 7.950   1.00 0.00 ? 96  THR A HG1    3  
ATOM   9051   H  HG21   . THR A 1 89  ? -17.385 -13.540 7.243   1.00 0.00 ? 96  THR A HG21   3  
ATOM   9052   H  HG22   . THR A 1 89  ? -18.113 -12.193 6.366   1.00 0.00 ? 96  THR A HG22   3  
ATOM   9053   H  HG23   . THR A 1 89  ? -18.906 -12.842 7.805   1.00 0.00 ? 96  THR A HG23   3  
ATOM   9054   N  N      . GLU A 1 90  ? -16.757 -8.499  9.420   1.00 0.00 ? 97  GLU A N      3  
ATOM   9055   C  CA     . GLU A 1 90  ? -16.202 -7.757  10.538  1.00 0.00 ? 97  GLU A CA     3  
ATOM   9056   C  C      . GLU A 1 90  ? -16.712 -6.326  10.544  1.00 0.00 ? 97  GLU A C      3  
ATOM   9057   O  O      . GLU A 1 90  ? -16.330 -5.517  9.698   1.00 0.00 ? 97  GLU A O      3  
ATOM   9058   C  CB     . GLU A 1 90  ? -14.678 -7.726  10.456  1.00 0.00 ? 97  GLU A CB     3  
ATOM   9059   C  CG     . GLU A 1 90  ? -14.030 -9.090  10.341  1.00 0.00 ? 97  GLU A CG     3  
ATOM   9060   C  CD     . GLU A 1 90  ? -12.552 -9.000  10.034  1.00 0.00 ? 97  GLU A CD     3  
ATOM   9061   O  OE1    . GLU A 1 90  ? -11.988 -7.888  10.129  1.00 0.00 ? 97  GLU A OE1    3  
ATOM   9062   O  OE2    . GLU A 1 90  ? -11.954 -10.040 9.698   1.00 0.00 ? 97  GLU A OE2    3  
ATOM   9063   H  H      . GLU A 1 90  ? -16.593 -8.175  8.508   1.00 0.00 ? 97  GLU A H      3  
ATOM   9064   H  HA     . GLU A 1 90  ? -16.500 -8.247  11.451  1.00 0.00 ? 97  GLU A HA     3  
ATOM   9065   H  HB2    . GLU A 1 90  ? -14.389 -7.144  9.593   1.00 0.00 ? 97  GLU A HB2    3  
ATOM   9066   H  HB3    . GLU A 1 90  ? -14.295 -7.246  11.345  1.00 0.00 ? 97  GLU A HB3    3  
ATOM   9067   H  HG2    . GLU A 1 90  ? -14.157 -9.615  11.276  1.00 0.00 ? 97  GLU A HG2    3  
ATOM   9068   H  HG3    . GLU A 1 90  ? -14.515 -9.642  9.549   1.00 0.00 ? 97  GLU A HG3    3  
ATOM   9069   N  N      . HIS A 1 91  ? -17.570 -6.008  11.497  1.00 0.00 ? 98  HIS A N      3  
ATOM   9070   C  CA     . HIS A 1 91  ? -17.990 -4.626  11.695  1.00 0.00 ? 98  HIS A CA     3  
ATOM   9071   C  C      . HIS A 1 91  ? -16.806 -3.809  12.208  1.00 0.00 ? 98  HIS A C      3  
ATOM   9072   O  O      . HIS A 1 91  ? -16.744 -2.595  12.024  1.00 0.00 ? 98  HIS A O      3  
ATOM   9073   C  CB     . HIS A 1 91  ? -19.162 -4.543  12.684  1.00 0.00 ? 98  HIS A CB     3  
ATOM   9074   C  CG     . HIS A 1 91  ? -19.629 -3.138  12.944  1.00 0.00 ? 98  HIS A CG     3  
ATOM   9075   N  ND1    . HIS A 1 91  ? -19.398 -2.472  14.127  1.00 0.00 ? 98  HIS A ND1    3  
ATOM   9076   C  CD2    . HIS A 1 91  ? -20.306 -2.270  12.155  1.00 0.00 ? 98  HIS A CD2    3  
ATOM   9077   C  CE1    . HIS A 1 91  ? -19.913 -1.256  14.054  1.00 0.00 ? 98  HIS A CE1    3  
ATOM   9078   N  NE2    . HIS A 1 91  ? -20.468 -1.106  12.867  1.00 0.00 ? 98  HIS A NE2    3  
ATOM   9079   H  H      . HIS A 1 91  ? -17.929 -6.716  12.080  1.00 0.00 ? 98  HIS A H      3  
ATOM   9080   H  HA     . HIS A 1 91  ? -18.300 -4.230  10.739  1.00 0.00 ? 98  HIS A HA     3  
ATOM   9081   H  HB2    . HIS A 1 91  ? -19.997 -5.103  12.289  1.00 0.00 ? 98  HIS A HB2    3  
ATOM   9082   H  HB3    . HIS A 1 91  ? -18.859 -4.974  13.628  1.00 0.00 ? 98  HIS A HB3    3  
ATOM   9083   H  HD1    . HIS A 1 91  ? -18.914 -2.833  14.911  1.00 0.00 ? 98  HIS A HD1    3  
ATOM   9084   H  HD2    . HIS A 1 91  ? -20.653 -2.457  11.148  1.00 0.00 ? 98  HIS A HD2    3  
ATOM   9085   H  HE1    . HIS A 1 91  ? -19.880 -0.510  14.836  1.00 0.00 ? 98  HIS A HE1    3  
ATOM   9086   H  HE2    . HIS A 1 91  ? -20.700 -0.230  12.467  1.00 0.00 ? 98  HIS A HE2    3  
ATOM   9087   N  N      . GLU A 1 92  ? -15.861 -4.503  12.833  1.00 0.00 ? 99  GLU A N      3  
ATOM   9088   C  CA     . GLU A 1 92  ? -14.679 -3.870  13.404  1.00 0.00 ? 99  GLU A CA     3  
ATOM   9089   C  C      . GLU A 1 92  ? -13.861 -3.165  12.325  1.00 0.00 ? 99  GLU A C      3  
ATOM   9090   O  O      . GLU A 1 92  ? -13.633 -1.955  12.394  1.00 0.00 ? 99  GLU A O      3  
ATOM   9091   C  CB     . GLU A 1 92  ? -13.818 -4.918  14.110  1.00 0.00 ? 99  GLU A CB     3  
ATOM   9092   C  CG     . GLU A 1 92  ? -12.693 -4.330  14.945  1.00 0.00 ? 99  GLU A CG     3  
ATOM   9093   C  CD     . GLU A 1 92  ? -13.213 -3.447  16.058  1.00 0.00 ? 99  GLU A CD     3  
ATOM   9094   O  OE1    . GLU A 1 92  ? -13.865 -3.980  16.978  1.00 0.00 ? 99  GLU A OE1    3  
ATOM   9095   O  OE2    . GLU A 1 92  ? -12.985 -2.222  16.005  1.00 0.00 ? 99  GLU A OE2    3  
ATOM   9096   H  H      . GLU A 1 92  ? -15.963 -5.474  12.913  1.00 0.00 ? 99  GLU A H      3  
ATOM   9097   H  HA     . GLU A 1 92  ? -15.009 -3.138  14.126  1.00 0.00 ? 99  GLU A HA     3  
ATOM   9098   H  HB2    . GLU A 1 92  ? -14.451 -5.502  14.761  1.00 0.00 ? 99  GLU A HB2    3  
ATOM   9099   H  HB3    . GLU A 1 92  ? -13.382 -5.569  13.367  1.00 0.00 ? 99  GLU A HB3    3  
ATOM   9100   H  HG2    . GLU A 1 92  ? -12.125 -5.137  15.382  1.00 0.00 ? 99  GLU A HG2    3  
ATOM   9101   H  HG3    . GLU A 1 92  ? -12.050 -3.741  14.307  1.00 0.00 ? 99  GLU A HG3    3  
ATOM   9102   N  N      . SER A 1 93  ? -13.444 -3.921  11.318  1.00 0.00 ? 100 SER A N      3  
ATOM   9103   C  CA     . SER A 1 93  ? -12.621 -3.375  10.255  1.00 0.00 ? 100 SER A CA     3  
ATOM   9104   C  C      . SER A 1 93  ? -13.433 -2.426  9.380   1.00 0.00 ? 100 SER A C      3  
ATOM   9105   O  O      . SER A 1 93  ? -12.883 -1.522  8.749   1.00 0.00 ? 100 SER A O      3  
ATOM   9106   C  CB     . SER A 1 93  ? -12.002 -4.507  9.429   1.00 0.00 ? 100 SER A CB     3  
ATOM   9107   O  OG     . SER A 1 93  ? -12.956 -5.512  9.136   1.00 0.00 ? 100 SER A OG     3  
ATOM   9108   H  H      . SER A 1 93  ? -13.704 -4.864  11.281  1.00 0.00 ? 100 SER A H      3  
ATOM   9109   H  HA     . SER A 1 93  ? -11.826 -2.810  10.719  1.00 0.00 ? 100 SER A HA     3  
ATOM   9110   H  HB2    . SER A 1 93  ? -11.622 -4.106  8.501   1.00 0.00 ? 100 SER A HB2    3  
ATOM   9111   H  HB3    . SER A 1 93  ? -11.190 -4.950  9.988   1.00 0.00 ? 100 SER A HB3    3  
ATOM   9112   H  HG     . SER A 1 93  ? -12.610 -6.378  9.427   1.00 0.00 ? 100 SER A HG     3  
ATOM   9113   N  N      . PHE A 1 94  ? -14.748 -2.616  9.371   1.00 0.00 ? 101 PHE A N      3  
ATOM   9114   C  CA     . PHE A 1 94  ? -15.641 -1.723  8.649   1.00 0.00 ? 101 PHE A CA     3  
ATOM   9115   C  C      . PHE A 1 94  ? -15.596 -0.321  9.252   1.00 0.00 ? 101 PHE A C      3  
ATOM   9116   O  O      . PHE A 1 94  ? -15.455 0.665   8.535   1.00 0.00 ? 101 PHE A O      3  
ATOM   9117   C  CB     . PHE A 1 94  ? -17.078 -2.254  8.662   1.00 0.00 ? 101 PHE A CB     3  
ATOM   9118   C  CG     . PHE A 1 94  ? -18.056 -1.341  7.973   1.00 0.00 ? 101 PHE A CG     3  
ATOM   9119   C  CD1    . PHE A 1 94  ? -18.128 -1.295  6.590   1.00 0.00 ? 101 PHE A CD1    3  
ATOM   9120   C  CD2    . PHE A 1 94  ? -18.899 -0.524  8.710   1.00 0.00 ? 101 PHE A CD2    3  
ATOM   9121   C  CE1    . PHE A 1 94  ? -19.021 -0.452  5.957   1.00 0.00 ? 101 PHE A CE1    3  
ATOM   9122   C  CE2    . PHE A 1 94  ? -19.794 0.318   8.082   1.00 0.00 ? 101 PHE A CE2    3  
ATOM   9123   C  CZ     . PHE A 1 94  ? -19.854 0.354   6.704   1.00 0.00 ? 101 PHE A CZ     3  
ATOM   9124   H  H      . PHE A 1 94  ? -15.124 -3.382  9.856   1.00 0.00 ? 101 PHE A H      3  
ATOM   9125   H  HA     . PHE A 1 94  ? -15.295 -1.670  7.626   1.00 0.00 ? 101 PHE A HA     3  
ATOM   9126   H  HB2    . PHE A 1 94  ? -17.107 -3.211  8.165   1.00 0.00 ? 101 PHE A HB2    3  
ATOM   9127   H  HB3    . PHE A 1 94  ? -17.401 -2.376  9.687   1.00 0.00 ? 101 PHE A HB3    3  
ATOM   9128   H  HD1    . PHE A 1 94  ? -17.478 -1.928  6.002   1.00 0.00 ? 101 PHE A HD1    3  
ATOM   9129   H  HD2    . PHE A 1 94  ? -18.854 -0.551  9.788   1.00 0.00 ? 101 PHE A HD2    3  
ATOM   9130   H  HE1    . PHE A 1 94  ? -19.067 -0.425  4.879   1.00 0.00 ? 101 PHE A HE1    3  
ATOM   9131   H  HE2    . PHE A 1 94  ? -20.444 0.950   8.668   1.00 0.00 ? 101 PHE A HE2    3  
ATOM   9132   H  HZ     . PHE A 1 94  ? -20.553 1.013   6.210   1.00 0.00 ? 101 PHE A HZ     3  
ATOM   9133   N  N      . THR A 1 95  ? -15.708 -0.239  10.573  1.00 0.00 ? 102 THR A N      3  
ATOM   9134   C  CA     . THR A 1 95  ? -15.657 1.041   11.266  1.00 0.00 ? 102 THR A CA     3  
ATOM   9135   C  C      . THR A 1 95  ? -14.272 1.679   11.127  1.00 0.00 ? 102 THR A C      3  
ATOM   9136   O  O      . THR A 1 95  ? -14.136 2.904   11.073  1.00 0.00 ? 102 THR A O      3  
ATOM   9137   C  CB     . THR A 1 95  ? -15.994 0.865   12.760  1.00 0.00 ? 102 THR A CB     3  
ATOM   9138   O  OG1    . THR A 1 95  ? -17.208 0.118   12.903  1.00 0.00 ? 102 THR A OG1    3  
ATOM   9139   C  CG2    . THR A 1 95  ? -16.145 2.208   13.460  1.00 0.00 ? 102 THR A CG2    3  
ATOM   9140   H  H      . THR A 1 95  ? -15.841 -1.061  11.097  1.00 0.00 ? 102 THR A H      3  
ATOM   9141   H  HA     . THR A 1 95  ? -16.393 1.696   10.824  1.00 0.00 ? 102 THR A HA     3  
ATOM   9142   H  HB     . THR A 1 95  ? -15.190 0.320   13.232  1.00 0.00 ? 102 THR A HB     3  
ATOM   9143   H  HG1    . THR A 1 95  ? -17.101 -0.523  13.620  1.00 0.00 ? 102 THR A HG1    3  
ATOM   9144   H  HG21   . THR A 1 95  ? -15.221 2.763   13.379  1.00 0.00 ? 102 THR A HG21   3  
ATOM   9145   H  HG22   . THR A 1 95  ? -16.377 2.046   14.502  1.00 0.00 ? 102 THR A HG22   3  
ATOM   9146   H  HG23   . THR A 1 95  ? -16.945 2.768   12.997  1.00 0.00 ? 102 THR A HG23   3  
ATOM   9147   N  N      . ALA A 1 96  ? -13.253 0.833   11.032  1.00 0.00 ? 103 ALA A N      3  
ATOM   9148   C  CA     . ALA A 1 96  ? -11.872 1.290   10.950  1.00 0.00 ? 103 ALA A CA     3  
ATOM   9149   C  C      . ALA A 1 96  ? -11.605 2.091   9.674   1.00 0.00 ? 103 ALA A C      3  
ATOM   9150   O  O      . ALA A 1 96  ? -10.710 2.936   9.650   1.00 0.00 ? 103 ALA A O      3  
ATOM   9151   C  CB     . ALA A 1 96  ? -10.927 0.103   11.039  1.00 0.00 ? 103 ALA A CB     3  
ATOM   9152   H  H      . ALA A 1 96  ? -13.434 -0.131  11.028  1.00 0.00 ? 103 ALA A H      3  
ATOM   9153   H  HA     . ALA A 1 96  ? -11.685 1.927   11.802  1.00 0.00 ? 103 ALA A HA     3  
ATOM   9154   H  HB1    . ALA A 1 96  ? -11.136 -0.455  11.940  1.00 0.00 ? 103 ALA A HB1    3  
ATOM   9155   H  HB2    . ALA A 1 96  ? -9.906  0.455   11.063  1.00 0.00 ? 103 ALA A HB2    3  
ATOM   9156   H  HB3    . ALA A 1 96  ? -11.067 -0.536  10.180  1.00 0.00 ? 103 ALA A HB3    3  
ATOM   9157   N  N      . THR A 1 97  ? -12.382 1.834   8.621   1.00 0.00 ? 104 THR A N      3  
ATOM   9158   C  CA     . THR A 1 97  ? -12.206 2.528   7.340   1.00 0.00 ? 104 THR A CA     3  
ATOM   9159   C  C      . THR A 1 97  ? -12.282 4.041   7.518   1.00 0.00 ? 104 THR A C      3  
ATOM   9160   O  O      . THR A 1 97  ? -11.518 4.788   6.903   1.00 0.00 ? 104 THR A O      3  
ATOM   9161   C  CB     . THR A 1 97  ? -13.264 2.090   6.307   1.00 0.00 ? 104 THR A CB     3  
ATOM   9162   O  OG1    . THR A 1 97  ? -14.579 2.369   6.800   1.00 0.00 ? 104 THR A OG1    3  
ATOM   9163   C  CG2    . THR A 1 97  ? -13.137 0.607   5.994   1.00 0.00 ? 104 THR A CG2    3  
ATOM   9164   H  H      . THR A 1 97  ? -13.091 1.160   8.705   1.00 0.00 ? 104 THR A H      3  
ATOM   9165   H  HA     . THR A 1 97  ? -11.228 2.274   6.949   1.00 0.00 ? 104 THR A HA     3  
ATOM   9166   H  HB     . THR A 1 97  ? -13.106 2.648   5.395   1.00 0.00 ? 104 THR A HB     3  
ATOM   9167   H  HG1    . THR A 1 97  ? -14.911 1.603   7.289   1.00 0.00 ? 104 THR A HG1    3  
ATOM   9168   H  HG21   . THR A 1 97  ? -13.885 0.330   5.266   1.00 0.00 ? 104 THR A HG21   3  
ATOM   9169   H  HG22   . THR A 1 97  ? -13.284 0.037   6.898   1.00 0.00 ? 104 THR A HG22   3  
ATOM   9170   H  HG23   . THR A 1 97  ? -12.153 0.405   5.596   1.00 0.00 ? 104 THR A HG23   3  
ATOM   9171   N  N      . ALA A 1 98  ? -13.199 4.482   8.376   1.00 0.00 ? 105 ALA A N      3  
ATOM   9172   C  CA     . ALA A 1 98  ? -13.361 5.898   8.662   1.00 0.00 ? 105 ALA A CA     3  
ATOM   9173   C  C      . ALA A 1 98  ? -12.090 6.461   9.280   1.00 0.00 ? 105 ALA A C      3  
ATOM   9174   O  O      . ALA A 1 98  ? -11.586 7.494   8.843   1.00 0.00 ? 105 ALA A O      3  
ATOM   9175   C  CB     . ALA A 1 98  ? -14.551 6.119   9.583   1.00 0.00 ? 105 ALA A CB     3  
ATOM   9176   H  H      . ALA A 1 98  ? -13.781 3.834   8.827   1.00 0.00 ? 105 ALA A H      3  
ATOM   9177   H  HA     . ALA A 1 98  ? -13.553 6.407   7.729   1.00 0.00 ? 105 ALA A HA     3  
ATOM   9178   H  HB1    . ALA A 1 98  ? -15.426 5.650   9.158   1.00 0.00 ? 105 ALA A HB1    3  
ATOM   9179   H  HB2    . ALA A 1 98  ? -14.729 7.179   9.693   1.00 0.00 ? 105 ALA A HB2    3  
ATOM   9180   H  HB3    . ALA A 1 98  ? -14.345 5.686   10.551  1.00 0.00 ? 105 ALA A HB3    3  
ATOM   9181   N  N      . GLU A 1 99  ? -11.556 5.750   10.267  1.00 0.00 ? 106 GLU A N      3  
ATOM   9182   C  CA     . GLU A 1 99  ? -10.333 6.168   10.939  1.00 0.00 ? 106 GLU A CA     3  
ATOM   9183   C  C      . GLU A 1 99  ? -9.178  6.222   9.946   1.00 0.00 ? 106 GLU A C      3  
ATOM   9184   O  O      . GLU A 1 99  ? -8.397  7.173   9.940   1.00 0.00 ? 106 GLU A O      3  
ATOM   9185   C  CB     . GLU A 1 99  ? -9.999  5.206   12.086  1.00 0.00 ? 106 GLU A CB     3  
ATOM   9186   C  CG     . GLU A 1 99  ? -8.685  5.510   12.792  1.00 0.00 ? 106 GLU A CG     3  
ATOM   9187   C  CD     . GLU A 1 99  ? -8.677  6.863   13.475  1.00 0.00 ? 106 GLU A CD     3  
ATOM   9188   O  OE1    . GLU A 1 99  ? -9.078  6.934   14.653  1.00 0.00 ? 106 GLU A OE1    3  
ATOM   9189   O  OE2    . GLU A 1 99  ? -8.261  7.853   12.839  1.00 0.00 ? 106 GLU A OE2    3  
ATOM   9190   H  H      . GLU A 1 99  ? -11.989 4.917   10.543  1.00 0.00 ? 106 GLU A H      3  
ATOM   9191   H  HA     . GLU A 1 99  ? -10.495 7.155   11.342  1.00 0.00 ? 106 GLU A HA     3  
ATOM   9192   H  HB2    . GLU A 1 99  ? -10.791 5.249   12.816  1.00 0.00 ? 106 GLU A HB2    3  
ATOM   9193   H  HB3    . GLU A 1 99  ? -9.944  4.201   11.690  1.00 0.00 ? 106 GLU A HB3    3  
ATOM   9194   H  HG2    . GLU A 1 99  ? -8.512  4.751   13.540  1.00 0.00 ? 106 GLU A HG2    3  
ATOM   9195   H  HG3    . GLU A 1 99  ? -7.884  5.483   12.066  1.00 0.00 ? 106 GLU A HG3    3  
ATOM   9196   N  N      . PHE A 1 100 ? -9.089  5.209   9.088   1.00 0.00 ? 107 PHE A N      3  
ATOM   9197   C  CA     . PHE A 1 100 ? -8.025  5.149   8.097   1.00 0.00 ? 107 PHE A CA     3  
ATOM   9198   C  C      . PHE A 1 100 ? -8.045  6.391   7.215   1.00 0.00 ? 107 PHE A C      3  
ATOM   9199   O  O      . PHE A 1 100 ? -7.032  7.067   7.064   1.00 0.00 ? 107 PHE A O      3  
ATOM   9200   C  CB     . PHE A 1 100 ? -8.156  3.911   7.199   1.00 0.00 ? 107 PHE A CB     3  
ATOM   9201   C  CG     . PHE A 1 100 ? -8.050  2.582   7.900   1.00 0.00 ? 107 PHE A CG     3  
ATOM   9202   C  CD1    . PHE A 1 100 ? -7.107  2.364   8.891   1.00 0.00 ? 107 PHE A CD1    3  
ATOM   9203   C  CD2    . PHE A 1 100 ? -8.893  1.543   7.546   1.00 0.00 ? 107 PHE A CD2    3  
ATOM   9204   C  CE1    . PHE A 1 100 ? -7.015  1.133   9.517   1.00 0.00 ? 107 PHE A CE1    3  
ATOM   9205   C  CE2    . PHE A 1 100 ? -8.807  0.314   8.161   1.00 0.00 ? 107 PHE A CE2    3  
ATOM   9206   C  CZ     . PHE A 1 100 ? -7.866  0.106   9.151   1.00 0.00 ? 107 PHE A CZ     3  
ATOM   9207   H  H      . PHE A 1 100 ? -9.753  4.485   9.131   1.00 0.00 ? 107 PHE A H      3  
ATOM   9208   H  HA     . PHE A 1 100 ? -7.083  5.107   8.622   1.00 0.00 ? 107 PHE A HA     3  
ATOM   9209   H  HB2    . PHE A 1 100 ? -9.119  3.940   6.709   1.00 0.00 ? 107 PHE A HB2    3  
ATOM   9210   H  HB3    . PHE A 1 100 ? -7.381  3.949   6.448   1.00 0.00 ? 107 PHE A HB3    3  
ATOM   9211   H  HD1    . PHE A 1 100 ? -6.443  3.167   9.177   1.00 0.00 ? 107 PHE A HD1    3  
ATOM   9212   H  HD2    . PHE A 1 100 ? -9.631  1.703   6.781   1.00 0.00 ? 107 PHE A HD2    3  
ATOM   9213   H  HE1    . PHE A 1 100 ? -6.278  0.973   10.291  1.00 0.00 ? 107 PHE A HE1    3  
ATOM   9214   H  HE2    . PHE A 1 100 ? -9.478  -0.485  7.865   1.00 0.00 ? 107 PHE A HE2    3  
ATOM   9215   H  HZ     . PHE A 1 100 ? -7.796  -0.856  9.639   1.00 0.00 ? 107 PHE A HZ     3  
ATOM   9216   N  N      . ARG A 1 101 ? -9.211  6.706   6.658   1.00 0.00 ? 108 ARG A N      3  
ATOM   9217   C  CA     . ARG A 1 101 ? -9.318  7.794   5.697   1.00 0.00 ? 108 ARG A CA     3  
ATOM   9218   C  C      . ARG A 1 101 ? -9.230  9.158   6.376   1.00 0.00 ? 108 ARG A C      3  
ATOM   9219   O  O      . ARG A 1 101 ? -8.679  10.097  5.806   1.00 0.00 ? 108 ARG A O      3  
ATOM   9220   C  CB     . ARG A 1 101 ? -10.596 7.662   4.853   1.00 0.00 ? 108 ARG A CB     3  
ATOM   9221   C  CG     . ARG A 1 101 ? -11.905 7.686   5.632   1.00 0.00 ? 108 ARG A CG     3  
ATOM   9222   C  CD     . ARG A 1 101 ? -12.459 9.094   5.783   1.00 0.00 ? 108 ARG A CD     3  
ATOM   9223   N  NE     . ARG A 1 101 ? -12.646 9.749   4.490   1.00 0.00 ? 108 ARG A NE     3  
ATOM   9224   C  CZ     . ARG A 1 101 ? -13.702 10.500  4.181   1.00 0.00 ? 108 ARG A CZ     3  
ATOM   9225   N  NH1    . ARG A 1 101 ? -14.701 10.638  5.047   1.00 0.00 ? 108 ARG A NH1    3  
ATOM   9226   N  NH2    . ARG A 1 101 ? -13.758 11.100  2.998   1.00 0.00 ? 108 ARG A NH2    3  
ATOM   9227   H  H      . ARG A 1 101 ? -10.013 6.194   6.897   1.00 0.00 ? 108 ARG A H      3  
ATOM   9228   H  HA     . ARG A 1 101 ? -8.471  7.705   5.035   1.00 0.00 ? 108 ARG A HA     3  
ATOM   9229   H  HB2    . ARG A 1 101 ? -10.622 8.473   4.142   1.00 0.00 ? 108 ARG A HB2    3  
ATOM   9230   H  HB3    . ARG A 1 101 ? -10.550 6.730   4.310   1.00 0.00 ? 108 ARG A HB3    3  
ATOM   9231   H  HG2    . ARG A 1 101 ? -12.630 7.082   5.109   1.00 0.00 ? 108 ARG A HG2    3  
ATOM   9232   H  HG3    . ARG A 1 101 ? -11.732 7.270   6.614   1.00 0.00 ? 108 ARG A HG3    3  
ATOM   9233   H  HD2    . ARG A 1 101 ? -13.412 9.040   6.288   1.00 0.00 ? 108 ARG A HD2    3  
ATOM   9234   H  HD3    . ARG A 1 101 ? -11.770 9.679   6.377   1.00 0.00 ? 108 ARG A HD3    3  
ATOM   9235   H  HE     . ARG A 1 101 ? -11.933 9.639   3.824   1.00 0.00 ? 108 ARG A HE     3  
ATOM   9236   H  HH11   . ARG A 1 101 ? -14.663 10.177  5.942   1.00 0.00 ? 108 ARG A HH11   3  
ATOM   9237   H  HH12   . ARG A 1 101 ? -15.507 11.197  4.814   1.00 0.00 ? 108 ARG A HH12   3  
ATOM   9238   H  HH21   . ARG A 1 101 ? -13.002 10.987  2.340   1.00 0.00 ? 108 ARG A HH21   3  
ATOM   9239   H  HH22   . ARG A 1 101 ? -14.549 11.679  2.753   1.00 0.00 ? 108 ARG A HH22   3  
ATOM   9240   N  N      . GLU A 1 102 ? -9.744  9.269   7.594   1.00 0.00 ? 109 GLU A N      3  
ATOM   9241   C  CA     . GLU A 1 102 ? -9.674  10.529  8.321   1.00 0.00 ? 109 GLU A CA     3  
ATOM   9242   C  C      . GLU A 1 102 ? -8.249  10.831  8.747   1.00 0.00 ? 109 GLU A C      3  
ATOM   9243   O  O      . GLU A 1 102 ? -7.811  11.980  8.710   1.00 0.00 ? 109 GLU A O      3  
ATOM   9244   C  CB     . GLU A 1 102 ? -10.592 10.512  9.537   1.00 0.00 ? 109 GLU A CB     3  
ATOM   9245   C  CG     . GLU A 1 102 ? -12.047 10.745  9.182   1.00 0.00 ? 109 GLU A CG     3  
ATOM   9246   C  CD     . GLU A 1 102 ? -12.913 10.963  10.404  1.00 0.00 ? 109 GLU A CD     3  
ATOM   9247   O  OE1    . GLU A 1 102 ? -12.965 12.106  10.901  1.00 0.00 ? 109 GLU A OE1    3  
ATOM   9248   O  OE2    . GLU A 1 102 ? -13.551 9.994   10.865  1.00 0.00 ? 109 GLU A OE2    3  
ATOM   9249   H  H      . GLU A 1 102 ? -10.182 8.493   8.012   1.00 0.00 ? 109 GLU A H      3  
ATOM   9250   H  HA     . GLU A 1 102 ? -10.002 11.310  7.652   1.00 0.00 ? 109 GLU A HA     3  
ATOM   9251   H  HB2    . GLU A 1 102 ? -10.512 9.547   10.019  1.00 0.00 ? 109 GLU A HB2    3  
ATOM   9252   H  HB3    . GLU A 1 102 ? -10.277 11.278  10.229  1.00 0.00 ? 109 GLU A HB3    3  
ATOM   9253   H  HG2    . GLU A 1 102 ? -12.113 11.617  8.544   1.00 0.00 ? 109 GLU A HG2    3  
ATOM   9254   H  HG3    . GLU A 1 102 ? -12.415 9.882   8.647   1.00 0.00 ? 109 GLU A HG3    3  
ATOM   9255   N  N      . GLN A 1 103 ? -7.525  9.791   9.130   1.00 0.00 ? 110 GLN A N      3  
ATOM   9256   C  CA     . GLN A 1 103 ? -6.141  9.936   9.548   1.00 0.00 ? 110 GLN A CA     3  
ATOM   9257   C  C      . GLN A 1 103 ? -5.292  10.452  8.389   1.00 0.00 ? 110 GLN A C      3  
ATOM   9258   O  O      . GLN A 1 103 ? -4.324  11.181  8.590   1.00 0.00 ? 110 GLN A O      3  
ATOM   9259   C  CB     . GLN A 1 103 ? -5.607  8.594   10.049  1.00 0.00 ? 110 GLN A CB     3  
ATOM   9260   C  CG     . GLN A 1 103 ? -4.410  8.713   10.972  1.00 0.00 ? 110 GLN A CG     3  
ATOM   9261   C  CD     . GLN A 1 103 ? -4.716  9.507   12.230  1.00 0.00 ? 110 GLN A CD     3  
ATOM   9262   O  OE1    . GLN A 1 103 ? -3.839  10.163  12.786  1.00 0.00 ? 110 GLN A OE1    3  
ATOM   9263   N  NE2    . GLN A 1 103 ? -5.958  9.450   12.693  1.00 0.00 ? 110 GLN A NE2    3  
ATOM   9264   H  H      . GLN A 1 103 ? -7.937  8.898   9.146   1.00 0.00 ? 110 GLN A H      3  
ATOM   9265   H  HA     . GLN A 1 103 ? -6.107  10.653  10.353  1.00 0.00 ? 110 GLN A HA     3  
ATOM   9266   H  HB2    . GLN A 1 103 ? -6.395  8.085   10.583  1.00 0.00 ? 110 GLN A HB2    3  
ATOM   9267   H  HB3    . GLN A 1 103 ? -5.319  7.995   9.198   1.00 0.00 ? 110 GLN A HB3    3  
ATOM   9268   H  HG2    . GLN A 1 103 ? -4.093  7.722   11.260  1.00 0.00 ? 110 GLN A HG2    3  
ATOM   9269   H  HG3    . GLN A 1 103 ? -3.608  9.206   10.441  1.00 0.00 ? 110 GLN A HG3    3  
ATOM   9270   H  HE21   . GLN A 1 103 ? -6.624  8.900   12.207  1.00 0.00 ? 110 GLN A HE21   3  
ATOM   9271   H  HE22   . GLN A 1 103 ? -6.171  9.952   13.507  1.00 0.00 ? 110 GLN A HE22   3  
ATOM   9272   N  N      . ILE A 1 104 ? -5.689  10.094  7.174   1.00 0.00 ? 111 ILE A N      3  
ATOM   9273   C  CA     . ILE A 1 104 ? -4.993  10.534  5.972   1.00 0.00 ? 111 ILE A CA     3  
ATOM   9274   C  C      . ILE A 1 104 ? -5.058  12.053  5.823   1.00 0.00 ? 111 ILE A C      3  
ATOM   9275   O  O      . ILE A 1 104 ? -4.034  12.711  5.631   1.00 0.00 ? 111 ILE A O      3  
ATOM   9276   C  CB     . ILE A 1 104 ? -5.593  9.875   4.715   1.00 0.00 ? 111 ILE A CB     3  
ATOM   9277   C  CG1    . ILE A 1 104 ? -5.476  8.356   4.806   1.00 0.00 ? 111 ILE A CG1    3  
ATOM   9278   C  CG2    . ILE A 1 104 ? -4.907  10.384  3.458   1.00 0.00 ? 111 ILE A CG2    3  
ATOM   9279   C  CD1    . ILE A 1 104 ? -6.257  7.626   3.736   1.00 0.00 ? 111 ILE A CD1    3  
ATOM   9280   H  H      . ILE A 1 104 ? -6.474  9.511   7.083   1.00 0.00 ? 111 ILE A H      3  
ATOM   9281   H  HA     . ILE A 1 104 ? -3.958  10.231  6.054   1.00 0.00 ? 111 ILE A HA     3  
ATOM   9282   H  HB     . ILE A 1 104 ? -6.636  10.144  4.660   1.00 0.00 ? 111 ILE A HB     3  
ATOM   9283   H  HG12   . ILE A 1 104 ? -4.438  8.073   4.708   1.00 0.00 ? 111 ILE A HG12   3  
ATOM   9284   H  HG13   . ILE A 1 104 ? -5.844  8.030   5.767   1.00 0.00 ? 111 ILE A HG13   3  
ATOM   9285   H  HG21   . ILE A 1 104 ? -5.019  11.456  3.395   1.00 0.00 ? 111 ILE A HG21   3  
ATOM   9286   H  HG22   . ILE A 1 104 ? -5.359  9.923   2.592   1.00 0.00 ? 111 ILE A HG22   3  
ATOM   9287   H  HG23   . ILE A 1 104 ? -3.857  10.133  3.495   1.00 0.00 ? 111 ILE A HG23   3  
ATOM   9288   H  HD11   . ILE A 1 104 ? -6.140  6.563   3.873   1.00 0.00 ? 111 ILE A HD11   3  
ATOM   9289   H  HD12   . ILE A 1 104 ? -5.882  7.908   2.762   1.00 0.00 ? 111 ILE A HD12   3  
ATOM   9290   H  HD13   . ILE A 1 104 ? -7.301  7.888   3.811   1.00 0.00 ? 111 ILE A HD13   3  
ATOM   9291   N  N      . LEU A 1 105 ? -6.260  12.610  5.921   1.00 0.00 ? 112 LEU A N      3  
ATOM   9292   C  CA     . LEU A 1 105 ? -6.437  14.054  5.786   1.00 0.00 ? 112 LEU A CA     3  
ATOM   9293   C  C      . LEU A 1 105 ? -5.923  14.772  7.027   1.00 0.00 ? 112 LEU A C      3  
ATOM   9294   O  O      . LEU A 1 105 ? -5.595  15.957  6.981   1.00 0.00 ? 112 LEU A O      3  
ATOM   9295   C  CB     . LEU A 1 105 ? -7.907  14.425  5.536   1.00 0.00 ? 112 LEU A CB     3  
ATOM   9296   C  CG     . LEU A 1 105 ? -8.456  14.090  4.144   1.00 0.00 ? 112 LEU A CG     3  
ATOM   9297   C  CD1    . LEU A 1 105 ? -8.699  12.598  3.995   1.00 0.00 ? 112 LEU A CD1    3  
ATOM   9298   C  CD2    . LEU A 1 105 ? -9.736  14.866  3.881   1.00 0.00 ? 112 LEU A CD2    3  
ATOM   9299   H  H      . LEU A 1 105 ? -7.043  12.043  6.093   1.00 0.00 ? 112 LEU A H      3  
ATOM   9300   H  HA     . LEU A 1 105 ? -5.850  14.373  4.937   1.00 0.00 ? 112 LEU A HA     3  
ATOM   9301   H  HB2    . LEU A 1 105 ? -8.511  13.910  6.268   1.00 0.00 ? 112 LEU A HB2    3  
ATOM   9302   H  HB3    . LEU A 1 105 ? -8.016  15.488  5.692   1.00 0.00 ? 112 LEU A HB3    3  
ATOM   9303   H  HG     . LEU A 1 105 ? -7.729  14.385  3.401   1.00 0.00 ? 112 LEU A HG     3  
ATOM   9304   H  HD11   . LEU A 1 105 ? -9.409  12.275  4.746   1.00 0.00 ? 112 LEU A HD11   3  
ATOM   9305   H  HD12   . LEU A 1 105 ? -7.768  12.067  4.128   1.00 0.00 ? 112 LEU A HD12   3  
ATOM   9306   H  HD13   . LEU A 1 105 ? -9.095  12.392  3.012   1.00 0.00 ? 112 LEU A HD13   3  
ATOM   9307   H  HD21   . LEU A 1 105 ? -10.115 14.613  2.902   1.00 0.00 ? 112 LEU A HD21   3  
ATOM   9308   H  HD22   . LEU A 1 105 ? -9.532  15.926  3.925   1.00 0.00 ? 112 LEU A HD22   3  
ATOM   9309   H  HD23   . LEU A 1 105 ? -10.471 14.610  4.630   1.00 0.00 ? 112 LEU A HD23   3  
ATOM   9310   N  N      . ARG A 1 106 ? -5.853  14.042  8.130   1.00 0.00 ? 113 ARG A N      3  
ATOM   9311   C  CA     . ARG A 1 106 ? -5.333  14.582  9.378   1.00 0.00 ? 113 ARG A CA     3  
ATOM   9312   C  C      . ARG A 1 106 ? -3.836  14.860  9.271   1.00 0.00 ? 113 ARG A C      3  
ATOM   9313   O  O      . ARG A 1 106 ? -3.367  15.923  9.668   1.00 0.00 ? 113 ARG A O      3  
ATOM   9314   C  CB     . ARG A 1 106 ? -5.605  13.611  10.528  1.00 0.00 ? 113 ARG A CB     3  
ATOM   9315   C  CG     . ARG A 1 106 ? -4.986  14.037  11.848  1.00 0.00 ? 113 ARG A CG     3  
ATOM   9316   C  CD     . ARG A 1 106 ? -5.323  13.057  12.957  1.00 0.00 ? 113 ARG A CD     3  
ATOM   9317   N  NE     . ARG A 1 106 ? -4.693  13.425  14.223  1.00 0.00 ? 113 ARG A NE     3  
ATOM   9318   C  CZ     . ARG A 1 106 ? -5.255  13.242  15.416  1.00 0.00 ? 113 ARG A CZ     3  
ATOM   9319   N  NH1    . ARG A 1 106 ? -6.455  12.676  15.508  1.00 0.00 ? 113 ARG A NH1    3  
ATOM   9320   N  NH2    . ARG A 1 106 ? -4.618  13.618  16.518  1.00 0.00 ? 113 ARG A NH2    3  
ATOM   9321   H  H      . ARG A 1 106 ? -6.173  13.114  8.109   1.00 0.00 ? 113 ARG A H      3  
ATOM   9322   H  HA     . ARG A 1 106 ? -5.847  15.510  9.576   1.00 0.00 ? 113 ARG A HA     3  
ATOM   9323   H  HB2    . ARG A 1 106 ? -6.673  13.530  10.667  1.00 0.00 ? 113 ARG A HB2    3  
ATOM   9324   H  HB3    . ARG A 1 106 ? -5.210  12.640  10.266  1.00 0.00 ? 113 ARG A HB3    3  
ATOM   9325   H  HG2    . ARG A 1 106 ? -3.913  14.082  11.736  1.00 0.00 ? 113 ARG A HG2    3  
ATOM   9326   H  HG3    . ARG A 1 106 ? -5.365  15.012  12.113  1.00 0.00 ? 113 ARG A HG3    3  
ATOM   9327   H  HD2    . ARG A 1 106 ? -6.395  13.041  13.092  1.00 0.00 ? 113 ARG A HD2    3  
ATOM   9328   H  HD3    . ARG A 1 106 ? -4.982  12.074  12.668  1.00 0.00 ? 113 ARG A HD3    3  
ATOM   9329   H  HE     . ARG A 1 106 ? -3.795  13.830  14.176  1.00 0.00 ? 113 ARG A HE     3  
ATOM   9330   H  HH11   . ARG A 1 106 ? -6.945  12.380  14.677  1.00 0.00 ? 113 ARG A HH11   3  
ATOM   9331   H  HH12   . ARG A 1 106 ? -6.884  12.537  16.410  1.00 0.00 ? 113 ARG A HH12   3  
ATOM   9332   H  HH21   . ARG A 1 106 ? -3.705  14.046  16.457  1.00 0.00 ? 113 ARG A HH21   3  
ATOM   9333   H  HH22   . ARG A 1 106 ? -5.047  13.483  17.423  1.00 0.00 ? 113 ARG A HH22   3  
ATOM   9334   N  N      . VAL A 1 107 ? -3.095  13.903  8.727   1.00 0.00 ? 114 VAL A N      3  
ATOM   9335   C  CA     . VAL A 1 107 ? -1.646  14.023  8.644   1.00 0.00 ? 114 VAL A CA     3  
ATOM   9336   C  C      . VAL A 1 107 ? -1.203  14.750  7.374   1.00 0.00 ? 114 VAL A C      3  
ATOM   9337   O  O      . VAL A 1 107 ? -0.096  15.282  7.313   1.00 0.00 ? 114 VAL A O      3  
ATOM   9338   C  CB     . VAL A 1 107 ? -0.952  12.641  8.711   1.00 0.00 ? 114 VAL A CB     3  
ATOM   9339   C  CG1    . VAL A 1 107 ? -1.307  11.926  10.005  1.00 0.00 ? 114 VAL A CG1    3  
ATOM   9340   C  CG2    . VAL A 1 107 ? -1.318  11.780  7.508   1.00 0.00 ? 114 VAL A CG2    3  
ATOM   9341   H  H      . VAL A 1 107 ? -3.530  13.093  8.384   1.00 0.00 ? 114 VAL A H      3  
ATOM   9342   H  HA     . VAL A 1 107 ? -1.320  14.598  9.499   1.00 0.00 ? 114 VAL A HA     3  
ATOM   9343   H  HB     . VAL A 1 107 ? 0.116   12.799  8.698   1.00 0.00 ? 114 VAL A HB     3  
ATOM   9344   H  HG11   . VAL A 1 107 ? -0.999  12.531  10.846  1.00 0.00 ? 114 VAL A HG11   3  
ATOM   9345   H  HG12   . VAL A 1 107 ? -0.799  10.974  10.043  1.00 0.00 ? 114 VAL A HG12   3  
ATOM   9346   H  HG13   . VAL A 1 107 ? -2.374  11.766  10.047  1.00 0.00 ? 114 VAL A HG13   3  
ATOM   9347   H  HG21   . VAL A 1 107 ? -0.963  12.255  6.605   1.00 0.00 ? 114 VAL A HG21   3  
ATOM   9348   H  HG22   . VAL A 1 107 ? -2.392  11.670  7.458   1.00 0.00 ? 114 VAL A HG22   3  
ATOM   9349   H  HG23   . VAL A 1 107 ? -0.860  10.808  7.607   1.00 0.00 ? 114 VAL A HG23   3  
ATOM   9350   N  N      . LYS A 1 108 ? -2.066  14.783  6.364   1.00 0.00 ? 115 LYS A N      3  
ATOM   9351   C  CA     . LYS A 1 108 ? -1.690  15.376  5.087   1.00 0.00 ? 115 LYS A CA     3  
ATOM   9352   C  C      . LYS A 1 108 ? -2.694  16.419  4.611   1.00 0.00 ? 115 LYS A C      3  
ATOM   9353   O  O      . LYS A 1 108 ? -2.681  17.552  5.090   1.00 0.00 ? 115 LYS A O      3  
ATOM   9354   C  CB     . LYS A 1 108 ? -1.512  14.293  4.023   1.00 0.00 ? 115 LYS A CB     3  
ATOM   9355   C  CG     . LYS A 1 108 ? -0.345  13.367  4.304   1.00 0.00 ? 115 LYS A CG     3  
ATOM   9356   C  CD     . LYS A 1 108 ? 0.083   12.620  3.061   1.00 0.00 ? 115 LYS A CD     3  
ATOM   9357   C  CE     . LYS A 1 108 ? -1.005  11.700  2.536   1.00 0.00 ? 115 LYS A CE     3  
ATOM   9358   N  NZ     . LYS A 1 108 ? -0.663  11.189  1.181   1.00 0.00 ? 115 LYS A NZ     3  
ATOM   9359   H  H      . LYS A 1 108 ? -2.964  14.410  6.481   1.00 0.00 ? 115 LYS A H      3  
ATOM   9360   H  HA     . LYS A 1 108 ? -0.740  15.868  5.232   1.00 0.00 ? 115 LYS A HA     3  
ATOM   9361   H  HB2    . LYS A 1 108 ? -2.413  13.697  3.982   1.00 0.00 ? 115 LYS A HB2    3  
ATOM   9362   H  HB3    . LYS A 1 108 ? -1.357  14.759  3.060   1.00 0.00 ? 115 LYS A HB3    3  
ATOM   9363   H  HG2    . LYS A 1 108 ? 0.487   13.954  4.663   1.00 0.00 ? 115 LYS A HG2    3  
ATOM   9364   H  HG3    . LYS A 1 108 ? -0.638  12.654  5.061   1.00 0.00 ? 115 LYS A HG3    3  
ATOM   9365   H  HD2    . LYS A 1 108 ? 0.329   13.338  2.291   1.00 0.00 ? 115 LYS A HD2    3  
ATOM   9366   H  HD3    . LYS A 1 108 ? 0.958   12.031  3.294   1.00 0.00 ? 115 LYS A HD3    3  
ATOM   9367   H  HE2    . LYS A 1 108 ? -1.114  10.866  3.212   1.00 0.00 ? 115 LYS A HE2    3  
ATOM   9368   H  HE3    . LYS A 1 108 ? -1.935  12.250  2.483   1.00 0.00 ? 115 LYS A HE3    3  
ATOM   9369   H  HZ1    . LYS A 1 108 ? -1.377  10.511  0.858   1.00 0.00 ? 115 LYS A HZ1    3  
ATOM   9370   H  HZ2    . LYS A 1 108 ? 0.267   10.727  1.196   1.00 0.00 ? 115 LYS A HZ2    3  
ATOM   9371   H  HZ3    . LYS A 1 108 ? -0.627  11.989  0.503   1.00 0.00 ? 115 LYS A HZ3    3  
ATOM   9372   N  N      . ALA A 1 109 ? -3.545  16.024  3.656   1.00 0.00 ? 116 ALA A N      3  
ATOM   9373   C  CA     . ALA A 1 109 ? -4.541  16.907  3.033   1.00 0.00 ? 116 ALA A CA     3  
ATOM   9374   C  C      . ALA A 1 109 ? -3.904  18.000  2.162   1.00 0.00 ? 116 ALA A C      3  
ATOM   9375   O  O      . ALA A 1 109 ? -4.370  18.262  1.055   1.00 0.00 ? 116 ALA A O      3  
ATOM   9376   C  CB     . ALA A 1 109 ? -5.456  17.519  4.083   1.00 0.00 ? 116 ALA A CB     3  
ATOM   9377   H  H      . ALA A 1 109 ? -3.508  15.097  3.360   1.00 0.00 ? 116 ALA A H      3  
ATOM   9378   H  HA     . ALA A 1 109 ? -5.154  16.287  2.393   1.00 0.00 ? 116 ALA A HA     3  
ATOM   9379   H  HB1    . ALA A 1 109 ? -5.880  16.730  4.686   1.00 0.00 ? 116 ALA A HB1    3  
ATOM   9380   H  HB2    . ALA A 1 109 ? -6.248  18.067  3.597   1.00 0.00 ? 116 ALA A HB2    3  
ATOM   9381   H  HB3    . ALA A 1 109 ? -4.885  18.186  4.711   1.00 0.00 ? 116 ALA A HB3    3  
ATOM   9382   N  N      . GLU A 1 110 ? -2.831  18.610  2.650   1.00 0.00 ? 117 GLU A N      3  
ATOM   9383   C  CA     . GLU A 1 110 ? -2.193  19.741  1.974   1.00 0.00 ? 117 GLU A CA     3  
ATOM   9384   C  C      . GLU A 1 110 ? -1.300  19.294  0.810   1.00 0.00 ? 117 GLU A C      3  
ATOM   9385   O  O      . GLU A 1 110 ? -0.273  19.918  0.535   1.00 0.00 ? 117 GLU A O      3  
ATOM   9386   C  CB     . GLU A 1 110 ? -1.352  20.528  2.980   1.00 0.00 ? 117 GLU A CB     3  
ATOM   9387   C  CG     . GLU A 1 110 ? -2.128  20.979  4.207   1.00 0.00 ? 117 GLU A CG     3  
ATOM   9388   C  CD     . GLU A 1 110 ? -1.272  21.767  5.179   1.00 0.00 ? 117 GLU A CD     3  
ATOM   9389   O  OE1    . GLU A 1 110 ? -0.338  21.181  5.760   1.00 0.00 ? 117 GLU A OE1    3  
ATOM   9390   O  OE2    . GLU A 1 110 ? -1.527  22.975  5.352   1.00 0.00 ? 117 GLU A OE2    3  
ATOM   9391   H  H      . GLU A 1 110 ? -2.461  18.299  3.505   1.00 0.00 ? 117 GLU A H      3  
ATOM   9392   H  HA     . GLU A 1 110 ? -2.970  20.382  1.593   1.00 0.00 ? 117 GLU A HA     3  
ATOM   9393   H  HB2    . GLU A 1 110 ? -0.533  19.907  3.307   1.00 0.00 ? 117 GLU A HB2    3  
ATOM   9394   H  HB3    . GLU A 1 110 ? -0.954  21.403  2.491   1.00 0.00 ? 117 GLU A HB3    3  
ATOM   9395   H  HG2    . GLU A 1 110 ? -2.950  21.603  3.890   1.00 0.00 ? 117 GLU A HG2    3  
ATOM   9396   H  HG3    . GLU A 1 110 ? -2.513  20.107  4.716   1.00 0.00 ? 117 GLU A HG3    3  
ATOM   9397   N  N      . GLU A 1 111 ? -1.693  18.237  0.115   1.00 0.00 ? 118 GLU A N      3  
ATOM   9398   C  CA     . GLU A 1 111 ? -0.916  17.743  -1.015  1.00 0.00 ? 118 GLU A CA     3  
ATOM   9399   C  C      . GLU A 1 111 ? -1.490  18.259  -2.337  1.00 0.00 ? 118 GLU A C      3  
ATOM   9400   O  O      . GLU A 1 111 ? -1.192  19.377  -2.758  1.00 0.00 ? 118 GLU A O      3  
ATOM   9401   C  CB     . GLU A 1 111 ? -0.877  16.213  -1.016  1.00 0.00 ? 118 GLU A CB     3  
ATOM   9402   C  CG     . GLU A 1 111 ? -0.229  15.605  0.206   1.00 0.00 ? 118 GLU A CG     3  
ATOM   9403   C  CD     . GLU A 1 111 ? -0.246  14.097  0.143   1.00 0.00 ? 118 GLU A CD     3  
ATOM   9404   O  OE1    . GLU A 1 111 ? -1.348  13.514  0.108   1.00 0.00 ? 118 GLU A OE1    3  
ATOM   9405   O  OE2    . GLU A 1 111 ? 0.834   13.483  0.123   1.00 0.00 ? 118 GLU A OE2    3  
ATOM   9406   H  H      . GLU A 1 111 ? -2.531  17.787  0.359   1.00 0.00 ? 118 GLU A H      3  
ATOM   9407   H  HA     . GLU A 1 111 ? 0.091   18.118  -0.912  1.00 0.00 ? 118 GLU A HA     3  
ATOM   9408   H  HB2    . GLU A 1 111 ? -1.888  15.840  -1.067  1.00 0.00 ? 118 GLU A HB2    3  
ATOM   9409   H  HB3    . GLU A 1 111 ? -0.334  15.877  -1.889  1.00 0.00 ? 118 GLU A HB3    3  
ATOM   9410   H  HG2    . GLU A 1 111 ? 0.795   15.942  0.266   1.00 0.00 ? 118 GLU A HG2    3  
ATOM   9411   H  HG3    . GLU A 1 111 ? -0.771  15.920  1.086   1.00 0.00 ? 118 GLU A HG3    3  
ATOM   9412   N  N      . ASP A 1 112 ? -2.318  17.444  -2.974  1.00 0.00 ? 119 ASP A N      3  
ATOM   9413   C  CA     . ASP A 1 112 ? -2.987  17.818  -4.209  1.00 0.00 ? 119 ASP A CA     3  
ATOM   9414   C  C      . ASP A 1 112 ? -4.386  17.225  -4.221  1.00 0.00 ? 119 ASP A C      3  
ATOM   9415   O  O      . ASP A 1 112 ? -5.367  17.932  -4.008  1.00 0.00 ? 119 ASP A O      3  
ATOM   9416   C  CB     . ASP A 1 112 ? -2.187  17.337  -5.427  1.00 0.00 ? 119 ASP A CB     3  
ATOM   9417   C  CG     . ASP A 1 112 ? -2.972  17.447  -6.723  1.00 0.00 ? 119 ASP A CG     3  
ATOM   9418   O  OD1    . ASP A 1 112 ? -3.289  18.581  -7.136  1.00 0.00 ? 119 ASP A OD1    3  
ATOM   9419   O  OD2    . ASP A 1 112 ? -3.277  16.395  -7.321  1.00 0.00 ? 119 ASP A OD2    3  
ATOM   9420   H  H      . ASP A 1 112 ? -2.486  16.555  -2.608  1.00 0.00 ? 119 ASP A H      3  
ATOM   9421   H  HA     . ASP A 1 112 ? -3.062  18.895  -4.235  1.00 0.00 ? 119 ASP A HA     3  
ATOM   9422   H  HB2    . ASP A 1 112 ? -1.293  17.934  -5.520  1.00 0.00 ? 119 ASP A HB2    3  
ATOM   9423   H  HB3    . ASP A 1 112 ? -1.910  16.303  -5.284  1.00 0.00 ? 119 ASP A HB3    3  
ATOM   9424   N  N      . LYS A 1 113 ? -4.458  15.912  -4.415  1.00 0.00 ? 120 LYS A N      3  
ATOM   9425   C  CA     . LYS A 1 113 ? -5.723  15.188  -4.437  1.00 0.00 ? 120 LYS A CA     3  
ATOM   9426   C  C      . LYS A 1 113 ? -5.473  13.756  -3.996  1.00 0.00 ? 120 LYS A C      3  
ATOM   9427   O  O      . LYS A 1 113 ? -4.787  13.002  -4.685  1.00 0.00 ? 120 LYS A O      3  
ATOM   9428   C  CB     . LYS A 1 113 ? -6.352  15.187  -5.836  1.00 0.00 ? 120 LYS A CB     3  
ATOM   9429   C  CG     . LYS A 1 113 ? -6.870  16.536  -6.307  1.00 0.00 ? 120 LYS A CG     3  
ATOM   9430   C  CD     . LYS A 1 113 ? -8.010  17.050  -5.437  1.00 0.00 ? 120 LYS A CD     3  
ATOM   9431   C  CE     . LYS A 1 113 ? -8.538  18.376  -5.960  1.00 0.00 ? 120 LYS A CE     3  
ATOM   9432   N  NZ     . LYS A 1 113 ? -9.528  18.992  -5.042  1.00 0.00 ? 120 LYS A NZ     3  
ATOM   9433   H  H      . LYS A 1 113 ? -3.620  15.398  -4.532  1.00 0.00 ? 120 LYS A H      3  
ATOM   9434   H  HA     . LYS A 1 113 ? -6.397  15.662  -3.738  1.00 0.00 ? 120 LYS A HA     3  
ATOM   9435   H  HB2    . LYS A 1 113 ? -5.608  14.852  -6.543  1.00 0.00 ? 120 LYS A HB2    3  
ATOM   9436   H  HB3    . LYS A 1 113 ? -7.175  14.489  -5.844  1.00 0.00 ? 120 LYS A HB3    3  
ATOM   9437   H  HG2    . LYS A 1 113 ? -6.060  17.248  -6.272  1.00 0.00 ? 120 LYS A HG2    3  
ATOM   9438   H  HG3    . LYS A 1 113 ? -7.219  16.438  -7.324  1.00 0.00 ? 120 LYS A HG3    3  
ATOM   9439   H  HD2    . LYS A 1 113 ? -8.812  16.327  -5.442  1.00 0.00 ? 120 LYS A HD2    3  
ATOM   9440   H  HD3    . LYS A 1 113 ? -7.650  17.188  -4.430  1.00 0.00 ? 120 LYS A HD3    3  
ATOM   9441   H  HE2    . LYS A 1 113 ? -7.706  19.055  -6.083  1.00 0.00 ? 120 LYS A HE2    3  
ATOM   9442   H  HE3    . LYS A 1 113 ? -9.005  18.208  -6.920  1.00 0.00 ? 120 LYS A HE3    3  
ATOM   9443   H  HZ1    . LYS A 1 113 ? -9.931  19.851  -5.476  1.00 0.00 ? 120 LYS A HZ1    3  
ATOM   9444   H  HZ2    . LYS A 1 113 ? -9.068  19.259  -4.145  1.00 0.00 ? 120 LYS A HZ2    3  
ATOM   9445   H  HZ3    . LYS A 1 113 ? -10.301 18.323  -4.838  1.00 0.00 ? 120 LYS A HZ3    3  
ATOM   9446   N  N      . ILE A 1 114 ? -6.018  13.389  -2.851  1.00 0.00 ? 121 ILE A N      3  
ATOM   9447   C  CA     . ILE A 1 114 ? -5.780  12.073  -2.285  1.00 0.00 ? 121 ILE A CA     3  
ATOM   9448   C  C      . ILE A 1 114 ? -6.831  11.080  -2.785  1.00 0.00 ? 121 ILE A C      3  
ATOM   9449   O  O      . ILE A 1 114 ? -8.003  11.159  -2.414  1.00 0.00 ? 121 ILE A O      3  
ATOM   9450   C  CB     . ILE A 1 114 ? -5.771  12.135  -0.737  1.00 0.00 ? 121 ILE A CB     3  
ATOM   9451   C  CG1    . ILE A 1 114 ? -4.665  13.091  -0.263  1.00 0.00 ? 121 ILE A CG1    3  
ATOM   9452   C  CG2    . ILE A 1 114 ? -5.572  10.750  -0.136  1.00 0.00 ? 121 ILE A CG2    3  
ATOM   9453   C  CD1    . ILE A 1 114 ? -4.597  13.275  1.241   1.00 0.00 ? 121 ILE A CD1    3  
ATOM   9454   H  H      . ILE A 1 114 ? -6.621  14.013  -2.384  1.00 0.00 ? 121 ILE A H      3  
ATOM   9455   H  HA     . ILE A 1 114 ? -4.806  11.744  -2.614  1.00 0.00 ? 121 ILE A HA     3  
ATOM   9456   H  HB     . ILE A 1 114 ? -6.728  12.511  -0.405  1.00 0.00 ? 121 ILE A HB     3  
ATOM   9457   H  HG12   . ILE A 1 114 ? -3.709  12.707  -0.588  1.00 0.00 ? 121 ILE A HG12   3  
ATOM   9458   H  HG13   . ILE A 1 114 ? -4.824  14.063  -0.711  1.00 0.00 ? 121 ILE A HG13   3  
ATOM   9459   H  HG21   . ILE A 1 114 ? -6.343  10.086  -0.496  1.00 0.00 ? 121 ILE A HG21   3  
ATOM   9460   H  HG22   . ILE A 1 114 ? -5.628  10.816  0.942   1.00 0.00 ? 121 ILE A HG22   3  
ATOM   9461   H  HG23   . ILE A 1 114 ? -4.603  10.369  -0.423  1.00 0.00 ? 121 ILE A HG23   3  
ATOM   9462   H  HD11   . ILE A 1 114 ? -4.505  12.309  1.717   1.00 0.00 ? 121 ILE A HD11   3  
ATOM   9463   H  HD12   . ILE A 1 114 ? -5.497  13.765  1.586   1.00 0.00 ? 121 ILE A HD12   3  
ATOM   9464   H  HD13   . ILE A 1 114 ? -3.736  13.881  1.492   1.00 0.00 ? 121 ILE A HD13   3  
ATOM   9465   N  N      . PRO A 1 115 ? -6.421  10.154  -3.673  1.00 0.00 ? 122 PRO A N      3  
ATOM   9466   C  CA     . PRO A 1 115 ? -7.308  9.164   -4.262  1.00 0.00 ? 122 PRO A CA     3  
ATOM   9467   C  C      . PRO A 1 115 ? -7.355  7.869   -3.455  1.00 0.00 ? 122 PRO A C      3  
ATOM   9468   O  O      . PRO A 1 115 ? -6.321  7.292   -3.112  1.00 0.00 ? 122 PRO A O      3  
ATOM   9469   C  CB     . PRO A 1 115 ? -6.681  8.923   -5.636  1.00 0.00 ? 122 PRO A CB     3  
ATOM   9470   C  CG     . PRO A 1 115 ? -5.224  9.248   -5.485  1.00 0.00 ? 122 PRO A CG     3  
ATOM   9471   C  CD     . PRO A 1 115 ? -5.051  10.005  -4.185  1.00 0.00 ? 122 PRO A CD     3  
ATOM   9472   H  HA     . PRO A 1 115 ? -8.309  9.551   -4.383  1.00 0.00 ? 122 PRO A HA     3  
ATOM   9473   H  HB2    . PRO A 1 115 ? -6.824  7.891   -5.920  1.00 0.00 ? 122 PRO A HB2    3  
ATOM   9474   H  HB3    . PRO A 1 115 ? -7.152  9.567   -6.365  1.00 0.00 ? 122 PRO A HB3    3  
ATOM   9475   H  HG2    . PRO A 1 115 ? -4.650  8.333   -5.459  1.00 0.00 ? 122 PRO A HG2    3  
ATOM   9476   H  HG3    . PRO A 1 115 ? -4.905  9.860   -6.314  1.00 0.00 ? 122 PRO A HG3    3  
ATOM   9477   H  HD2    . PRO A 1 115 ? -4.446  9.435   -3.496  1.00 0.00 ? 122 PRO A HD2    3  
ATOM   9478   H  HD3    . PRO A 1 115 ? -4.600  10.971  -4.369  1.00 0.00 ? 122 PRO A HD3    3  
ATOM   9479   N  N      . LEU A 1 116 ? -8.555  7.411   -3.148  1.00 0.00 ? 123 LEU A N      3  
ATOM   9480   C  CA     . LEU A 1 116 ? -8.716  6.183   -2.392  1.00 0.00 ? 123 LEU A CA     3  
ATOM   9481   C  C      . LEU A 1 116 ? -9.608  5.208   -3.143  1.00 0.00 ? 123 LEU A C      3  
ATOM   9482   O  O      . LEU A 1 116 ? -10.302 5.582   -4.090  1.00 0.00 ? 123 LEU A O      3  
ATOM   9483   C  CB     . LEU A 1 116 ? -9.320  6.445   -1.003  1.00 0.00 ? 123 LEU A CB     3  
ATOM   9484   C  CG     . LEU A 1 116 ? -8.476  7.287   -0.036  1.00 0.00 ? 123 LEU A CG     3  
ATOM   9485   C  CD1    . LEU A 1 116 ? -8.596  8.767   -0.357  1.00 0.00 ? 123 LEU A CD1    3  
ATOM   9486   C  CD2    . LEU A 1 116 ? -8.900  7.021   1.399   1.00 0.00 ? 123 LEU A CD2    3  
ATOM   9487   H  H      . LEU A 1 116 ? -9.351  7.901   -3.441  1.00 0.00 ? 123 LEU A H      3  
ATOM   9488   H  HA     . LEU A 1 116 ? -7.736  5.739   -2.277  1.00 0.00 ? 123 LEU A HA     3  
ATOM   9489   H  HB2    . LEU A 1 116 ? -10.265 6.948   -1.143  1.00 0.00 ? 123 LEU A HB2    3  
ATOM   9490   H  HB3    . LEU A 1 116 ? -9.511  5.489   -0.536  1.00 0.00 ? 123 LEU A HB3    3  
ATOM   9491   H  HG     . LEU A 1 116 ? -7.439  7.008   -0.137  1.00 0.00 ? 123 LEU A HG     3  
ATOM   9492   H  HD11   . LEU A 1 116 ? -7.957  9.331   0.307   1.00 0.00 ? 123 LEU A HD11   3  
ATOM   9493   H  HD12   . LEU A 1 116 ? -9.620  9.083   -0.227  1.00 0.00 ? 123 LEU A HD12   3  
ATOM   9494   H  HD13   . LEU A 1 116 ? -8.294  8.937   -1.379  1.00 0.00 ? 123 LEU A HD13   3  
ATOM   9495   H  HD21   . LEU A 1 116 ? -8.298  7.618   2.069   1.00 0.00 ? 123 LEU A HD21   3  
ATOM   9496   H  HD22   . LEU A 1 116 ? -8.759  5.976   1.629   1.00 0.00 ? 123 LEU A HD22   3  
ATOM   9497   H  HD23   . LEU A 1 116 ? -9.941  7.279   1.522   1.00 0.00 ? 123 LEU A HD23   3  
ATOM   9498   N  N      . LEU A 1 117 ? -9.574  3.963   -2.712  1.00 0.00 ? 124 LEU A N      3  
ATOM   9499   C  CA     . LEU A 1 117 ? -10.438 2.932   -3.246  1.00 0.00 ? 124 LEU A CA     3  
ATOM   9500   C  C      . LEU A 1 117 ? -10.719 1.900   -2.160  1.00 0.00 ? 124 LEU A C      3  
ATOM   9501   O  O      . LEU A 1 117 ? -9.793  1.305   -1.605  1.00 0.00 ? 124 LEU A O      3  
ATOM   9502   C  CB     . LEU A 1 117 ? -9.788  2.292   -4.481  1.00 0.00 ? 124 LEU A CB     3  
ATOM   9503   C  CG     . LEU A 1 117 ? -10.435 1.004   -4.999  1.00 0.00 ? 124 LEU A CG     3  
ATOM   9504   C  CD1    . LEU A 1 117 ? -11.939 1.152   -5.108  1.00 0.00 ? 124 LEU A CD1    3  
ATOM   9505   C  CD2    . LEU A 1 117 ? -9.864  0.645   -6.358  1.00 0.00 ? 124 LEU A CD2    3  
ATOM   9506   H  H      . LEU A 1 117 ? -8.930  3.722   -2.012  1.00 0.00 ? 124 LEU A H      3  
ATOM   9507   H  HA     . LEU A 1 117 ? -11.370 3.395   -3.535  1.00 0.00 ? 124 LEU A HA     3  
ATOM   9508   H  HB2    . LEU A 1 117 ? -9.805  3.018   -5.282  1.00 0.00 ? 124 LEU A HB2    3  
ATOM   9509   H  HB3    . LEU A 1 117 ? -8.757  2.078   -4.243  1.00 0.00 ? 124 LEU A HB3    3  
ATOM   9510   H  HG     . LEU A 1 117 ? -10.221 0.195   -4.319  1.00 0.00 ? 124 LEU A HG     3  
ATOM   9511   H  HD11   . LEU A 1 117 ? -12.335 1.510   -4.167  1.00 0.00 ? 124 LEU A HD11   3  
ATOM   9512   H  HD12   . LEU A 1 117 ? -12.378 0.193   -5.340  1.00 0.00 ? 124 LEU A HD12   3  
ATOM   9513   H  HD13   . LEU A 1 117 ? -12.175 1.855   -5.889  1.00 0.00 ? 124 LEU A HD13   3  
ATOM   9514   H  HD21   . LEU A 1 117 ? -10.266 -0.303  -6.678  1.00 0.00 ? 124 LEU A HD21   3  
ATOM   9515   H  HD22   . LEU A 1 117 ? -8.788  0.578   -6.292  1.00 0.00 ? 124 LEU A HD22   3  
ATOM   9516   H  HD23   . LEU A 1 117 ? -10.137 1.410   -7.073  1.00 0.00 ? 124 LEU A HD23   3  
ATOM   9517   N  N      . VAL A 1 118 ? -11.992 1.728   -1.828  1.00 0.00 ? 125 VAL A N      3  
ATOM   9518   C  CA     . VAL A 1 118 ? -12.378 0.772   -0.804  1.00 0.00 ? 125 VAL A CA     3  
ATOM   9519   C  C      . VAL A 1 118 ? -12.602 -0.590  -1.438  1.00 0.00 ? 125 VAL A C      3  
ATOM   9520   O  O      . VAL A 1 118 ? -13.381 -0.735  -2.385  1.00 0.00 ? 125 VAL A O      3  
ATOM   9521   C  CB     . VAL A 1 118 ? -13.645 1.211   -0.034  1.00 0.00 ? 125 VAL A CB     3  
ATOM   9522   C  CG1    . VAL A 1 118 ? -13.828 0.374   1.230   1.00 0.00 ? 125 VAL A CG1    3  
ATOM   9523   C  CG2    . VAL A 1 118 ? -13.577 2.691   0.305   1.00 0.00 ? 125 VAL A CG2    3  
ATOM   9524   H  H      . VAL A 1 118 ? -12.687 2.240   -2.294  1.00 0.00 ? 125 VAL A H      3  
ATOM   9525   H  HA     . VAL A 1 118 ? -11.562 0.695   -0.100  1.00 0.00 ? 125 VAL A HA     3  
ATOM   9526   H  HB     . VAL A 1 118 ? -14.502 1.050   -0.672  1.00 0.00 ? 125 VAL A HB     3  
ATOM   9527   H  HG11   . VAL A 1 118 ? -12.957 0.480   1.867   1.00 0.00 ? 125 VAL A HG11   3  
ATOM   9528   H  HG12   . VAL A 1 118 ? -13.949 -0.665  0.961   1.00 0.00 ? 125 VAL A HG12   3  
ATOM   9529   H  HG13   . VAL A 1 118 ? -14.704 0.709   1.763   1.00 0.00 ? 125 VAL A HG13   3  
ATOM   9530   H  HG21   . VAL A 1 118 ? -12.716 2.878   0.932   1.00 0.00 ? 125 VAL A HG21   3  
ATOM   9531   H  HG22   . VAL A 1 118 ? -14.475 2.984   0.828   1.00 0.00 ? 125 VAL A HG22   3  
ATOM   9532   H  HG23   . VAL A 1 118 ? -13.487 3.265   -0.606  1.00 0.00 ? 125 VAL A HG23   3  
ATOM   9533   N  N      . VAL A 1 119 ? -11.899 -1.573  -0.919  1.00 0.00 ? 126 VAL A N      3  
ATOM   9534   C  CA     . VAL A 1 119 ? -11.908 -2.909  -1.468  1.00 0.00 ? 126 VAL A CA     3  
ATOM   9535   C  C      . VAL A 1 119 ? -12.546 -3.885  -0.487  1.00 0.00 ? 126 VAL A C      3  
ATOM   9536   O  O      . VAL A 1 119 ? -12.005 -4.147  0.591   1.00 0.00 ? 126 VAL A O      3  
ATOM   9537   C  CB     . VAL A 1 119 ? -10.471 -3.374  -1.792  1.00 0.00 ? 126 VAL A CB     3  
ATOM   9538   C  CG1    . VAL A 1 119 ? -10.480 -4.709  -2.513  1.00 0.00 ? 126 VAL A CG1    3  
ATOM   9539   C  CG2    . VAL A 1 119 ? -9.738  -2.322  -2.615  1.00 0.00 ? 126 VAL A CG2    3  
ATOM   9540   H  H      . VAL A 1 119 ? -11.351 -1.394  -0.119  1.00 0.00 ? 126 VAL A H      3  
ATOM   9541   H  HA     . VAL A 1 119 ? -12.480 -2.897  -2.383  1.00 0.00 ? 126 VAL A HA     3  
ATOM   9542   H  HB     . VAL A 1 119 ? -9.940  -3.501  -0.860  1.00 0.00 ? 126 VAL A HB     3  
ATOM   9543   H  HG11   . VAL A 1 119 ? -9.465  -5.017  -2.713  1.00 0.00 ? 126 VAL A HG11   3  
ATOM   9544   H  HG12   . VAL A 1 119 ? -11.015 -4.610  -3.446  1.00 0.00 ? 126 VAL A HG12   3  
ATOM   9545   H  HG13   . VAL A 1 119 ? -10.966 -5.450  -1.895  1.00 0.00 ? 126 VAL A HG13   3  
ATOM   9546   H  HG21   . VAL A 1 119 ? -8.734  -2.664  -2.823  1.00 0.00 ? 126 VAL A HG21   3  
ATOM   9547   H  HG22   . VAL A 1 119 ? -9.694  -1.395  -2.061  1.00 0.00 ? 126 VAL A HG22   3  
ATOM   9548   H  HG23   . VAL A 1 119 ? -10.263 -2.162  -3.544  1.00 0.00 ? 126 VAL A HG23   3  
ATOM   9549   N  N      . GLY A 1 120 ? -13.710 -4.398  -0.852  1.00 0.00 ? 127 GLY A N      3  
ATOM   9550   C  CA     . GLY A 1 120 ? -14.368 -5.391  -0.033  1.00 0.00 ? 127 GLY A CA     3  
ATOM   9551   C  C      . GLY A 1 120 ? -13.867 -6.781  -0.357  1.00 0.00 ? 127 GLY A C      3  
ATOM   9552   O  O      . GLY A 1 120 ? -14.100 -7.281  -1.455  1.00 0.00 ? 127 GLY A O      3  
ATOM   9553   H  H      . GLY A 1 120 ? -14.122 -4.106  -1.692  1.00 0.00 ? 127 GLY A H      3  
ATOM   9554   H  HA2    . GLY A 1 120 ? -14.177 -5.175  1.009   1.00 0.00 ? 127 GLY A HA2    3  
ATOM   9555   H  HA3    . GLY A 1 120 ? -15.432 -5.348  -0.214  1.00 0.00 ? 127 GLY A HA3    3  
ATOM   9556   N  N      . ASN A 1 121 ? -13.163 -7.402  0.578   1.00 0.00 ? 128 ASN A N      3  
ATOM   9557   C  CA     . ASN A 1 121 ? -12.583 -8.714  0.330   1.00 0.00 ? 128 ASN A CA     3  
ATOM   9558   C  C      . ASN A 1 121 ? -13.433 -9.790  0.997   1.00 0.00 ? 128 ASN A C      3  
ATOM   9559   O  O      . ASN A 1 121 ? -14.252 -9.484  1.861   1.00 0.00 ? 128 ASN A O      3  
ATOM   9560   C  CB     . ASN A 1 121 ? -11.138 -8.772  0.848   1.00 0.00 ? 128 ASN A CB     3  
ATOM   9561   C  CG     . ASN A 1 121 ? -10.254 -9.760  0.087   1.00 0.00 ? 128 ASN A CG     3  
ATOM   9562   O  OD1    . ASN A 1 121 ? -10.713 -10.787 -0.421  1.00 0.00 ? 128 ASN A OD1    3  
ATOM   9563   N  ND2    . ASN A 1 121 ? -8.966  -9.452  0.008   1.00 0.00 ? 128 ASN A ND2    3  
ATOM   9564   H  H      . ASN A 1 121 ? -13.049 -6.979  1.458   1.00 0.00 ? 128 ASN A H      3  
ATOM   9565   H  HA     . ASN A 1 121 ? -12.583 -8.884  -0.737  1.00 0.00 ? 128 ASN A HA     3  
ATOM   9566   H  HB2    . ASN A 1 121 ? -10.695 -7.793  0.762   1.00 0.00 ? 128 ASN A HB2    3  
ATOM   9567   H  HB3    . ASN A 1 121 ? -11.151 -9.060  1.891   1.00 0.00 ? 128 ASN A HB3    3  
ATOM   9568   H  HD21   . ASN A 1 121 ? -8.661  -8.620  0.434   1.00 0.00 ? 128 ASN A HD21   3  
ATOM   9569   H  HD22   . ASN A 1 121 ? -8.370  -10.067 -0.471  1.00 0.00 ? 128 ASN A HD22   3  
ATOM   9570   N  N      . LYS A 1 122 ? -13.227 -11.038 0.584   1.00 0.00 ? 129 LYS A N      3  
ATOM   9571   C  CA     . LYS A 1 122 ? -13.986 -12.180 1.093   1.00 0.00 ? 129 LYS A CA     3  
ATOM   9572   C  C      . LYS A 1 122 ? -15.465 -12.088 0.738   1.00 0.00 ? 129 LYS A C      3  
ATOM   9573   O  O      . LYS A 1 122 ? -16.298 -11.779 1.580   1.00 0.00 ? 129 LYS A O      3  
ATOM   9574   C  CB     . LYS A 1 122 ? -13.838 -12.346 2.613   1.00 0.00 ? 129 LYS A CB     3  
ATOM   9575   C  CG     . LYS A 1 122 ? -12.526 -12.967 3.053   1.00 0.00 ? 129 LYS A CG     3  
ATOM   9576   C  CD     . LYS A 1 122 ? -11.380 -11.973 3.010   1.00 0.00 ? 129 LYS A CD     3  
ATOM   9577   C  CE     . LYS A 1 122 ? -10.090 -12.601 3.508   1.00 0.00 ? 129 LYS A CE     3  
ATOM   9578   N  NZ     . LYS A 1 122 ? -10.216 -13.114 4.899   1.00 0.00 ? 129 LYS A NZ     3  
ATOM   9579   H  H      . LYS A 1 122 ? -12.532 -11.197 -0.089  1.00 0.00 ? 129 LYS A H      3  
ATOM   9580   H  HA     . LYS A 1 122 ? -13.585 -13.063 0.617   1.00 0.00 ? 129 LYS A HA     3  
ATOM   9581   H  HB2    . LYS A 1 122 ? -13.918 -11.374 3.076   1.00 0.00 ? 129 LYS A HB2    3  
ATOM   9582   H  HB3    . LYS A 1 122 ? -14.642 -12.970 2.973   1.00 0.00 ? 129 LYS A HB3    3  
ATOM   9583   H  HG2    . LYS A 1 122 ? -12.633 -13.329 4.065   1.00 0.00 ? 129 LYS A HG2    3  
ATOM   9584   H  HG3    . LYS A 1 122 ? -12.296 -13.795 2.398   1.00 0.00 ? 129 LYS A HG3    3  
ATOM   9585   H  HD2    . LYS A 1 122 ? -11.242 -11.644 1.990   1.00 0.00 ? 129 LYS A HD2    3  
ATOM   9586   H  HD3    . LYS A 1 122 ? -11.625 -11.127 3.633   1.00 0.00 ? 129 LYS A HD3    3  
ATOM   9587   H  HE2    . LYS A 1 122 ? -9.827  -13.421 2.857   1.00 0.00 ? 129 LYS A HE2    3  
ATOM   9588   H  HE3    . LYS A 1 122 ? -9.308  -11.855 3.477   1.00 0.00 ? 129 LYS A HE3    3  
ATOM   9589   H  HZ1    . LYS A 1 122 ? -10.996 -13.803 4.962   1.00 0.00 ? 129 LYS A HZ1    3  
ATOM   9590   H  HZ2    . LYS A 1 122 ? -10.406 -12.329 5.562   1.00 0.00 ? 129 LYS A HZ2    3  
ATOM   9591   H  HZ3    . LYS A 1 122 ? -9.333  -13.586 5.191   1.00 0.00 ? 129 LYS A HZ3    3  
ATOM   9592   N  N      . SER A 1 123 ? -15.794 -12.353 -0.512  1.00 0.00 ? 130 SER A N      3  
ATOM   9593   C  CA     . SER A 1 123 ? -17.189 -12.420 -0.918  1.00 0.00 ? 130 SER A CA     3  
ATOM   9594   C  C      . SER A 1 123 ? -17.653 -13.874 -0.899  1.00 0.00 ? 130 SER A C      3  
ATOM   9595   O  O      . SER A 1 123 ? -18.821 -14.177 -1.141  1.00 0.00 ? 130 SER A O      3  
ATOM   9596   C  CB     . SER A 1 123 ? -17.367 -11.820 -2.312  1.00 0.00 ? 130 SER A CB     3  
ATOM   9597   O  OG     . SER A 1 123 ? -16.812 -10.516 -2.377  1.00 0.00 ? 130 SER A OG     3  
ATOM   9598   H  H      . SER A 1 123 ? -15.088 -12.505 -1.179  1.00 0.00 ? 130 SER A H      3  
ATOM   9599   H  HA     . SER A 1 123 ? -17.773 -11.852 -0.203  1.00 0.00 ? 130 SER A HA     3  
ATOM   9600   H  HB2    . SER A 1 123 ? -16.874 -12.446 -3.040  1.00 0.00 ? 130 SER A HB2    3  
ATOM   9601   H  HB3    . SER A 1 123 ? -18.422 -11.761 -2.544  1.00 0.00 ? 130 SER A HB3    3  
ATOM   9602   H  HG     . SER A 1 123 ? -16.320 -10.334 -1.570  1.00 0.00 ? 130 SER A HG     3  
ATOM   9603   N  N      . ASP A 1 124 ? -16.718 -14.761 -0.582  1.00 0.00 ? 131 ASP A N      3  
ATOM   9604   C  CA     . ASP A 1 124 ? -16.967 -16.198 -0.567  1.00 0.00 ? 131 ASP A CA     3  
ATOM   9605   C  C      . ASP A 1 124 ? -17.700 -16.635 0.701   1.00 0.00 ? 131 ASP A C      3  
ATOM   9606   O  O      . ASP A 1 124 ? -18.051 -17.804 0.853   1.00 0.00 ? 131 ASP A O      3  
ATOM   9607   C  CB     . ASP A 1 124 ? -15.644 -16.962 -0.718  1.00 0.00 ? 131 ASP A CB     3  
ATOM   9608   C  CG     . ASP A 1 124 ? -14.571 -16.492 0.251   1.00 0.00 ? 131 ASP A CG     3  
ATOM   9609   O  OD1    . ASP A 1 124 ? -14.029 -15.376 0.055   1.00 0.00 ? 131 ASP A OD1    3  
ATOM   9610   O  OD2    . ASP A 1 124 ? -14.260 -17.232 1.203   1.00 0.00 ? 131 ASP A OD2    3  
ATOM   9611   H  H      . ASP A 1 124 ? -15.817 -14.439 -0.351  1.00 0.00 ? 131 ASP A H      3  
ATOM   9612   H  HA     . ASP A 1 124 ? -17.594 -16.425 -1.417  1.00 0.00 ? 131 ASP A HA     3  
ATOM   9613   H  HB2    . ASP A 1 124 ? -15.823 -18.010 -0.537  1.00 0.00 ? 131 ASP A HB2    3  
ATOM   9614   H  HB3    . ASP A 1 124 ? -15.275 -16.832 -1.724  1.00 0.00 ? 131 ASP A HB3    3  
ATOM   9615   N  N      . LEU A 1 125 ? -17.937 -15.697 1.609   1.00 0.00 ? 132 LEU A N      3  
ATOM   9616   C  CA     . LEU A 1 125 ? -18.732 -15.981 2.800   1.00 0.00 ? 132 LEU A CA     3  
ATOM   9617   C  C      . LEU A 1 125 ? -20.210 -15.702 2.529   1.00 0.00 ? 132 LEU A C      3  
ATOM   9618   O  O      . LEU A 1 125 ? -21.071 -16.493 2.898   1.00 0.00 ? 132 LEU A O      3  
ATOM   9619   C  CB     . LEU A 1 125 ? -18.238 -15.159 3.992   1.00 0.00 ? 132 LEU A CB     3  
ATOM   9620   C  CG     . LEU A 1 125 ? -18.087 -13.668 3.732   1.00 0.00 ? 132 LEU A CG     3  
ATOM   9621   C  CD1    . LEU A 1 125 ? -19.265 -12.906 4.309   1.00 0.00 ? 132 LEU A CD1    3  
ATOM   9622   C  CD2    . LEU A 1 125 ? -16.778 -13.178 4.315   1.00 0.00 ? 132 LEU A CD2    3  
ATOM   9623   H  H      . LEU A 1 125 ? -17.565 -14.801 1.476   1.00 0.00 ? 132 LEU A H      3  
ATOM   9624   H  HA     . LEU A 1 125 ? -18.614 -17.027 3.028   1.00 0.00 ? 132 LEU A HA     3  
ATOM   9625   H  HB2    . LEU A 1 125 ? -18.941 -15.289 4.802   1.00 0.00 ? 132 LEU A HB2    3  
ATOM   9626   H  HB3    . LEU A 1 125 ? -17.281 -15.543 4.310   1.00 0.00 ? 132 LEU A HB3    3  
ATOM   9627   H  HG     . LEU A 1 125 ? -18.066 -13.495 2.666   1.00 0.00 ? 132 LEU A HG     3  
ATOM   9628   H  HD11   . LEU A 1 125 ? -19.099 -11.845 4.192   1.00 0.00 ? 132 LEU A HD11   3  
ATOM   9629   H  HD12   . LEU A 1 125 ? -19.362 -13.144 5.360   1.00 0.00 ? 132 LEU A HD12   3  
ATOM   9630   H  HD13   . LEU A 1 125 ? -20.168 -13.192 3.791   1.00 0.00 ? 132 LEU A HD13   3  
ATOM   9631   H  HD21   . LEU A 1 125 ? -15.962 -13.742 3.887   1.00 0.00 ? 132 LEU A HD21   3  
ATOM   9632   H  HD22   . LEU A 1 125 ? -16.790 -13.317 5.386   1.00 0.00 ? 132 LEU A HD22   3  
ATOM   9633   H  HD23   . LEU A 1 125 ? -16.653 -12.130 4.088   1.00 0.00 ? 132 LEU A HD23   3  
ATOM   9634   N  N      . GLU A 1 126 ? -20.473 -14.555 1.892   1.00 0.00 ? 133 GLU A N      3  
ATOM   9635   C  CA     . GLU A 1 126 ? -21.812 -14.142 1.460   1.00 0.00 ? 133 GLU A CA     3  
ATOM   9636   C  C      . GLU A 1 126 ? -22.813 -14.048 2.620   1.00 0.00 ? 133 GLU A C      3  
ATOM   9637   O  O      . GLU A 1 126 ? -23.081 -12.959 3.127   1.00 0.00 ? 133 GLU A O      3  
ATOM   9638   C  CB     . GLU A 1 126 ? -22.335 -15.078 0.370   1.00 0.00 ? 133 GLU A CB     3  
ATOM   9639   C  CG     . GLU A 1 126 ? -23.656 -14.636 -0.225  1.00 0.00 ? 133 GLU A CG     3  
ATOM   9640   C  CD     . GLU A 1 126 ? -24.172 -15.616 -1.250  1.00 0.00 ? 133 GLU A CD     3  
ATOM   9641   O  OE1    . GLU A 1 126 ? -23.799 -15.491 -2.434  1.00 0.00 ? 133 GLU A OE1    3  
ATOM   9642   O  OE2    . GLU A 1 126 ? -24.941 -16.518 -0.873  1.00 0.00 ? 133 GLU A OE2    3  
ATOM   9643   H  H      . GLU A 1 126 ? -19.727 -13.956 1.704   1.00 0.00 ? 133 GLU A H      3  
ATOM   9644   H  HA     . GLU A 1 126 ? -21.711 -13.155 1.033   1.00 0.00 ? 133 GLU A HA     3  
ATOM   9645   H  HB2    . GLU A 1 126 ? -21.605 -15.126 -0.424  1.00 0.00 ? 133 GLU A HB2    3  
ATOM   9646   H  HB3    . GLU A 1 126 ? -22.464 -16.066 0.787   1.00 0.00 ? 133 GLU A HB3    3  
ATOM   9647   H  HG2    . GLU A 1 126 ? -24.386 -14.547 0.566   1.00 0.00 ? 133 GLU A HG2    3  
ATOM   9648   H  HG3    . GLU A 1 126 ? -23.519 -13.676 -0.701  1.00 0.00 ? 133 GLU A HG3    3  
ATOM   9649   N  N      . GLU A 1 127 ? -23.330 -15.195 3.052   1.00 0.00 ? 134 GLU A N      3  
ATOM   9650   C  CA     . GLU A 1 127 ? -24.387 -15.254 4.065   1.00 0.00 ? 134 GLU A CA     3  
ATOM   9651   C  C      . GLU A 1 127 ? -23.896 -14.788 5.426   1.00 0.00 ? 134 GLU A C      3  
ATOM   9652   O  O      . GLU A 1 127 ? -24.690 -14.519 6.323   1.00 0.00 ? 134 GLU A O      3  
ATOM   9653   C  CB     . GLU A 1 127 ? -24.935 -16.677 4.177   1.00 0.00 ? 134 GLU A CB     3  
ATOM   9654   C  CG     . GLU A 1 127 ? -25.910 -17.038 3.074   1.00 0.00 ? 134 GLU A CG     3  
ATOM   9655   C  CD     . GLU A 1 127 ? -27.213 -16.272 3.191   1.00 0.00 ? 134 GLU A CD     3  
ATOM   9656   O  OE1    . GLU A 1 127 ? -27.263 -15.104 2.756   1.00 0.00 ? 134 GLU A OE1    3  
ATOM   9657   O  OE2    . GLU A 1 127 ? -28.186 -16.833 3.734   1.00 0.00 ? 134 GLU A OE2    3  
ATOM   9658   H  H      . GLU A 1 127 ? -22.977 -16.035 2.686   1.00 0.00 ? 134 GLU A H      3  
ATOM   9659   H  HA     . GLU A 1 127 ? -25.184 -14.600 3.745   1.00 0.00 ? 134 GLU A HA     3  
ATOM   9660   H  HB2    . GLU A 1 127 ? -24.109 -17.374 4.141   1.00 0.00 ? 134 GLU A HB2    3  
ATOM   9661   H  HB3    . GLU A 1 127 ? -25.443 -16.781 5.125   1.00 0.00 ? 134 GLU A HB3    3  
ATOM   9662   H  HG2    . GLU A 1 127 ? -25.459 -16.810 2.120   1.00 0.00 ? 134 GLU A HG2    3  
ATOM   9663   H  HG3    . GLU A 1 127 ? -26.124 -18.096 3.129   1.00 0.00 ? 134 GLU A HG3    3  
ATOM   9664   N  N      . ARG A 1 128 ? -22.589 -14.689 5.576   1.00 0.00 ? 135 ARG A N      3  
ATOM   9665   C  CA     . ARG A 1 128 ? -22.006 -14.296 6.848   1.00 0.00 ? 135 ARG A CA     3  
ATOM   9666   C  C      . ARG A 1 128 ? -21.759 -12.792 6.898   1.00 0.00 ? 135 ARG A C      3  
ATOM   9667   O  O      . ARG A 1 128 ? -21.090 -12.293 7.803   1.00 0.00 ? 135 ARG A O      3  
ATOM   9668   C  CB     . ARG A 1 128 ? -20.712 -15.071 7.089   1.00 0.00 ? 135 ARG A CB     3  
ATOM   9669   C  CG     . ARG A 1 128 ? -20.943 -16.564 7.224   1.00 0.00 ? 135 ARG A CG     3  
ATOM   9670   C  CD     . ARG A 1 128 ? -19.648 -17.318 7.456   1.00 0.00 ? 135 ARG A CD     3  
ATOM   9671   N  NE     . ARG A 1 128 ? -19.898 -18.733 7.718   1.00 0.00 ? 135 ARG A NE     3  
ATOM   9672   C  CZ     . ARG A 1 128 ? -19.022 -19.558 8.290   1.00 0.00 ? 135 ARG A CZ     3  
ATOM   9673   N  NH1    . ARG A 1 128 ? -17.814 -19.126 8.629   1.00 0.00 ? 135 ARG A NH1    3  
ATOM   9674   N  NH2    . ARG A 1 128 ? -19.361 -20.819 8.524   1.00 0.00 ? 135 ARG A NH2    3  
ATOM   9675   H  H      . ARG A 1 128 ? -22.004 -14.884 4.815   1.00 0.00 ? 135 ARG A H      3  
ATOM   9676   H  HA     . ARG A 1 128 ? -22.715 -14.554 7.622   1.00 0.00 ? 135 ARG A HA     3  
ATOM   9677   H  HB2    . ARG A 1 128 ? -20.040 -14.902 6.259   1.00 0.00 ? 135 ARG A HB2    3  
ATOM   9678   H  HB3    . ARG A 1 128 ? -20.251 -14.714 7.998   1.00 0.00 ? 135 ARG A HB3    3  
ATOM   9679   H  HG2    . ARG A 1 128 ? -21.603 -16.741 8.060   1.00 0.00 ? 135 ARG A HG2    3  
ATOM   9680   H  HG3    . ARG A 1 128 ? -21.402 -16.927 6.318   1.00 0.00 ? 135 ARG A HG3    3  
ATOM   9681   H  HD2    . ARG A 1 128 ? -19.027 -17.222 6.576   1.00 0.00 ? 135 ARG A HD2    3  
ATOM   9682   H  HD3    . ARG A 1 128 ? -19.138 -16.886 8.306   1.00 0.00 ? 135 ARG A HD3    3  
ATOM   9683   H  HE     . ARG A 1 128 ? -20.789 -19.085 7.465   1.00 0.00 ? 135 ARG A HE     3  
ATOM   9684   H  HH11   . ARG A 1 128 ? -17.545 -18.169 8.450   1.00 0.00 ? 135 ARG A HH11   3  
ATOM   9685   H  HH12   . ARG A 1 128 ? -17.162 -19.749 9.079   1.00 0.00 ? 135 ARG A HH12   3  
ATOM   9686   H  HH21   . ARG A 1 128 ? -20.278 -21.153 8.278   1.00 0.00 ? 135 ARG A HH21   3  
ATOM   9687   H  HH22   . ARG A 1 128 ? -18.698 -21.456 8.940   1.00 0.00 ? 135 ARG A HH22   3  
ATOM   9688   N  N      . ARG A 1 129 ? -22.316 -12.070 5.929   1.00 0.00 ? 136 ARG A N      3  
ATOM   9689   C  CA     . ARG A 1 129 ? -22.191 -10.620 5.892   1.00 0.00 ? 136 ARG A CA     3  
ATOM   9690   C  C      . ARG A 1 129 ? -22.922 -10.010 7.083   1.00 0.00 ? 136 ARG A C      3  
ATOM   9691   O  O      . ARG A 1 129 ? -24.144 -10.101 7.188   1.00 0.00 ? 136 ARG A O      3  
ATOM   9692   C  CB     . ARG A 1 129 ? -22.754 -10.071 4.577   1.00 0.00 ? 136 ARG A CB     3  
ATOM   9693   C  CG     . ARG A 1 129 ? -22.603 -8.568  4.424   1.00 0.00 ? 136 ARG A CG     3  
ATOM   9694   C  CD     . ARG A 1 129 ? -23.050 -8.104  3.047   1.00 0.00 ? 136 ARG A CD     3  
ATOM   9695   N  NE     . ARG A 1 129 ? -24.457 -8.409  2.797   1.00 0.00 ? 136 ARG A NE     3  
ATOM   9696   C  CZ     . ARG A 1 129 ? -24.940 -8.778  1.610   1.00 0.00 ? 136 ARG A CZ     3  
ATOM   9697   N  NH1    . ARG A 1 129 ? -24.127 -8.900  0.566   1.00 0.00 ? 136 ARG A NH1    3  
ATOM   9698   N  NH2    . ARG A 1 129 ? -26.235 -9.028  1.466   1.00 0.00 ? 136 ARG A NH2    3  
ATOM   9699   H  H      . ARG A 1 129 ? -22.829 -12.523 5.228   1.00 0.00 ? 136 ARG A H      3  
ATOM   9700   H  HA     . ARG A 1 129 ? -21.141 -10.373 5.959   1.00 0.00 ? 136 ARG A HA     3  
ATOM   9701   H  HB2    . ARG A 1 129 ? -22.244 -10.545 3.752   1.00 0.00 ? 136 ARG A HB2    3  
ATOM   9702   H  HB3    . ARG A 1 129 ? -23.807 -10.310 4.522   1.00 0.00 ? 136 ARG A HB3    3  
ATOM   9703   H  HG2    . ARG A 1 129 ? -23.209 -8.078  5.171   1.00 0.00 ? 136 ARG A HG2    3  
ATOM   9704   H  HG3    . ARG A 1 129 ? -21.565 -8.302  4.565   1.00 0.00 ? 136 ARG A HG3    3  
ATOM   9705   H  HD2    . ARG A 1 129 ? -22.905 -7.037  2.978   1.00 0.00 ? 136 ARG A HD2    3  
ATOM   9706   H  HD3    . ARG A 1 129 ? -22.446 -8.600  2.302   1.00 0.00 ? 136 ARG A HD3    3  
ATOM   9707   H  HE     . ARG A 1 129 ? -25.080 -8.328  3.564   1.00 0.00 ? 136 ARG A HE     3  
ATOM   9708   H  HH11   . ARG A 1 129 ? -23.141 -8.715  0.665   1.00 0.00 ? 136 ARG A HH11   3  
ATOM   9709   H  HH12   . ARG A 1 129 ? -24.489 -9.175  -0.333  1.00 0.00 ? 136 ARG A HH12   3  
ATOM   9710   H  HH21   . ARG A 1 129 ? -26.865 -8.937  2.251   1.00 0.00 ? 136 ARG A HH21   3  
ATOM   9711   H  HH22   . ARG A 1 129 ? -26.599 -9.321  0.571   1.00 0.00 ? 136 ARG A HH22   3  
ATOM   9712   N  N      . GLN A 1 130 ? -22.163 -9.408  7.986   1.00 0.00 ? 137 GLN A N      3  
ATOM   9713   C  CA     . GLN A 1 130 ? -22.726 -8.829  9.194   1.00 0.00 ? 137 GLN A CA     3  
ATOM   9714   C  C      . GLN A 1 130 ? -23.012 -7.353  8.986   1.00 0.00 ? 137 GLN A C      3  
ATOM   9715   O  O      . GLN A 1 130 ? -23.966 -6.807  9.536   1.00 0.00 ? 137 GLN A O      3  
ATOM   9716   C  CB     . GLN A 1 130 ? -21.774 -9.008  10.380  1.00 0.00 ? 137 GLN A CB     3  
ATOM   9717   C  CG     . GLN A 1 130 ? -21.466 -10.460 10.719  1.00 0.00 ? 137 GLN A CG     3  
ATOM   9718   C  CD     . GLN A 1 130 ? -22.717 -11.276 10.977  1.00 0.00 ? 137 GLN A CD     3  
ATOM   9719   O  OE1    . GLN A 1 130 ? -23.208 -11.341 12.102  1.00 0.00 ? 137 GLN A OE1    3  
ATOM   9720   N  NE2    . GLN A 1 130 ? -23.228 -11.915 9.939   1.00 0.00 ? 137 GLN A NE2    3  
ATOM   9721   H  H      . GLN A 1 130 ? -21.194 -9.346  7.828   1.00 0.00 ? 137 GLN A H      3  
ATOM   9722   H  HA     . GLN A 1 130 ? -23.653 -9.338  9.405   1.00 0.00 ? 137 GLN A HA     3  
ATOM   9723   H  HB2    . GLN A 1 130 ? -20.841 -8.510  10.156  1.00 0.00 ? 137 GLN A HB2    3  
ATOM   9724   H  HB3    . GLN A 1 130 ? -22.216 -8.544  11.252  1.00 0.00 ? 137 GLN A HB3    3  
ATOM   9725   H  HG2    . GLN A 1 130 ? -20.929 -10.906 9.895   1.00 0.00 ? 137 GLN A HG2    3  
ATOM   9726   H  HG3    . GLN A 1 130 ? -20.848 -10.486 11.605  1.00 0.00 ? 137 GLN A HG3    3  
ATOM   9727   H  HE21   . GLN A 1 130 ? -22.775 -11.830 9.074   1.00 0.00 ? 137 GLN A HE21   3  
ATOM   9728   H  HE22   . GLN A 1 130 ? -24.047 -12.449 10.073  1.00 0.00 ? 137 GLN A HE22   3  
ATOM   9729   N  N      . VAL A 1 131 ? -22.179 -6.714  8.184   1.00 0.00 ? 138 VAL A N      3  
ATOM   9730   C  CA     . VAL A 1 131 ? -22.350 -5.307  7.880   1.00 0.00 ? 138 VAL A CA     3  
ATOM   9731   C  C      . VAL A 1 131 ? -22.973 -5.138  6.498   1.00 0.00 ? 138 VAL A C      3  
ATOM   9732   O  O      . VAL A 1 131 ? -22.480 -5.694  5.513   1.00 0.00 ? 138 VAL A O      3  
ATOM   9733   C  CB     . VAL A 1 131 ? -21.011 -4.531  7.962   1.00 0.00 ? 138 VAL A CB     3  
ATOM   9734   C  CG1    . VAL A 1 131 ? -19.930 -5.202  7.127   1.00 0.00 ? 138 VAL A CG1    3  
ATOM   9735   C  CG2    . VAL A 1 131 ? -21.204 -3.085  7.529   1.00 0.00 ? 138 VAL A CG2    3  
ATOM   9736   H  H      . VAL A 1 131 ? -21.438 -7.207  7.773   1.00 0.00 ? 138 VAL A H      3  
ATOM   9737   H  HA     . VAL A 1 131 ? -23.026 -4.893  8.615   1.00 0.00 ? 138 VAL A HA     3  
ATOM   9738   H  HB     . VAL A 1 131 ? -20.686 -4.531  8.992   1.00 0.00 ? 138 VAL A HB     3  
ATOM   9739   H  HG11   . VAL A 1 131 ? -19.027 -4.612  7.162   1.00 0.00 ? 138 VAL A HG11   3  
ATOM   9740   H  HG12   . VAL A 1 131 ? -20.266 -5.288  6.105   1.00 0.00 ? 138 VAL A HG12   3  
ATOM   9741   H  HG13   . VAL A 1 131 ? -19.732 -6.187  7.523   1.00 0.00 ? 138 VAL A HG13   3  
ATOM   9742   H  HG21   . VAL A 1 131 ? -21.550 -3.058  6.505   1.00 0.00 ? 138 VAL A HG21   3  
ATOM   9743   H  HG22   . VAL A 1 131 ? -20.265 -2.556  7.604   1.00 0.00 ? 138 VAL A HG22   3  
ATOM   9744   H  HG23   . VAL A 1 131 ? -21.936 -2.612  8.168   1.00 0.00 ? 138 VAL A HG23   3  
ATOM   9745   N  N      . PRO A 1 132 ? -24.089 -4.398  6.416   1.00 0.00 ? 139 PRO A N      3  
ATOM   9746   C  CA     . PRO A 1 132 ? -24.769 -4.130  5.149   1.00 0.00 ? 139 PRO A CA     3  
ATOM   9747   C  C      . PRO A 1 132 ? -23.844 -3.472  4.135   1.00 0.00 ? 139 PRO A C      3  
ATOM   9748   O  O      . PRO A 1 132 ? -23.447 -2.315  4.294   1.00 0.00 ? 139 PRO A O      3  
ATOM   9749   C  CB     . PRO A 1 132 ? -25.899 -3.174  5.537   1.00 0.00 ? 139 PRO A CB     3  
ATOM   9750   C  CG     . PRO A 1 132 ? -26.127 -3.427  6.985   1.00 0.00 ? 139 PRO A CG     3  
ATOM   9751   C  CD     . PRO A 1 132 ? -24.778 -3.768  7.553   1.00 0.00 ? 139 PRO A CD     3  
ATOM   9752   H  HA     . PRO A 1 132 ? -25.185 -5.035  4.724   1.00 0.00 ? 139 PRO A HA     3  
ATOM   9753   H  HB2    . PRO A 1 132 ? -25.590 -2.153  5.357   1.00 0.00 ? 139 PRO A HB2    3  
ATOM   9754   H  HB3    . PRO A 1 132 ? -26.781 -3.398  4.954   1.00 0.00 ? 139 PRO A HB3    3  
ATOM   9755   H  HG2    . PRO A 1 132 ? -26.520 -2.540  7.458   1.00 0.00 ? 139 PRO A HG2    3  
ATOM   9756   H  HG3    . PRO A 1 132 ? -26.808 -4.256  7.112   1.00 0.00 ? 139 PRO A HG3    3  
ATOM   9757   H  HD2    . PRO A 1 132 ? -24.263 -2.872  7.868   1.00 0.00 ? 139 PRO A HD2    3  
ATOM   9758   H  HD3    . PRO A 1 132 ? -24.878 -4.459  8.376   1.00 0.00 ? 139 PRO A HD3    3  
ATOM   9759   N  N      . VAL A 1 133 ? -23.496 -4.214  3.091   1.00 0.00 ? 140 VAL A N      3  
ATOM   9760   C  CA     . VAL A 1 133 ? -22.607 -3.700  2.064   1.00 0.00 ? 140 VAL A CA     3  
ATOM   9761   C  C      . VAL A 1 133 ? -23.308 -2.588  1.287   1.00 0.00 ? 140 VAL A C      3  
ATOM   9762   O  O      . VAL A 1 133 ? -22.672 -1.794  0.596   1.00 0.00 ? 140 VAL A O      3  
ATOM   9763   C  CB     . VAL A 1 133 ? -22.132 -4.821  1.105   1.00 0.00 ? 140 VAL A CB     3  
ATOM   9764   C  CG1    . VAL A 1 133 ? -23.072 -5.001  -0.079  1.00 0.00 ? 140 VAL A CG1    3  
ATOM   9765   C  CG2    . VAL A 1 133 ? -20.717 -4.551  0.625   1.00 0.00 ? 140 VAL A CG2    3  
ATOM   9766   H  H      . VAL A 1 133 ? -23.851 -5.125  3.011   1.00 0.00 ? 140 VAL A H      3  
ATOM   9767   H  HA     . VAL A 1 133 ? -21.739 -3.284  2.557   1.00 0.00 ? 140 VAL A HA     3  
ATOM   9768   H  HB     . VAL A 1 133 ? -22.120 -5.746  1.659   1.00 0.00 ? 140 VAL A HB     3  
ATOM   9769   H  HG11   . VAL A 1 133 ? -22.791 -5.888  -0.630  1.00 0.00 ? 140 VAL A HG11   3  
ATOM   9770   H  HG12   . VAL A 1 133 ? -22.994 -4.140  -0.728  1.00 0.00 ? 140 VAL A HG12   3  
ATOM   9771   H  HG13   . VAL A 1 133 ? -24.086 -5.098  0.276   1.00 0.00 ? 140 VAL A HG13   3  
ATOM   9772   H  HG21   . VAL A 1 133 ? -20.407 -5.341  -0.042  1.00 0.00 ? 140 VAL A HG21   3  
ATOM   9773   H  HG22   . VAL A 1 133 ? -20.049 -4.514  1.474   1.00 0.00 ? 140 VAL A HG22   3  
ATOM   9774   H  HG23   . VAL A 1 133 ? -20.686 -3.607  0.102   1.00 0.00 ? 140 VAL A HG23   3  
ATOM   9775   N  N      . GLU A 1 134 ? -24.627 -2.543  1.434   1.00 0.00 ? 141 GLU A N      3  
ATOM   9776   C  CA     . GLU A 1 134 ? -25.439 -1.493  0.850   1.00 0.00 ? 141 GLU A CA     3  
ATOM   9777   C  C      . GLU A 1 134 ? -24.961 -0.122  1.323   1.00 0.00 ? 141 GLU A C      3  
ATOM   9778   O  O      . GLU A 1 134 ? -24.665 0.754   0.511   1.00 0.00 ? 141 GLU A O      3  
ATOM   9779   C  CB     . GLU A 1 134 ? -26.905 -1.709  1.230   1.00 0.00 ? 141 GLU A CB     3  
ATOM   9780   C  CG     . GLU A 1 134 ? -27.845 -0.648  0.689   1.00 0.00 ? 141 GLU A CG     3  
ATOM   9781   C  CD     . GLU A 1 134 ? -29.281 -0.908  1.076   1.00 0.00 ? 141 GLU A CD     3  
ATOM   9782   O  OE1    . GLU A 1 134 ? -29.665 -0.554  2.208   1.00 0.00 ? 141 GLU A OE1    3  
ATOM   9783   O  OE2    . GLU A 1 134 ? -30.027 -1.474  0.253   1.00 0.00 ? 141 GLU A OE2    3  
ATOM   9784   H  H      . GLU A 1 134 ? -25.068 -3.253  1.950   1.00 0.00 ? 141 GLU A H      3  
ATOM   9785   H  HA     . GLU A 1 134 ? -25.340 -1.549  -0.223  1.00 0.00 ? 141 GLU A HA     3  
ATOM   9786   H  HB2    . GLU A 1 134 ? -27.225 -2.667  0.849   1.00 0.00 ? 141 GLU A HB2    3  
ATOM   9787   H  HB3    . GLU A 1 134 ? -26.988 -1.715  2.307   1.00 0.00 ? 141 GLU A HB3    3  
ATOM   9788   H  HG2    . GLU A 1 134 ? -27.547 0.313   1.082   1.00 0.00 ? 141 GLU A HG2    3  
ATOM   9789   H  HG3    . GLU A 1 134 ? -27.773 -0.633  -0.389  1.00 0.00 ? 141 GLU A HG3    3  
ATOM   9790   N  N      . GLU A 1 135 ? -24.851 0.053   2.639   1.00 0.00 ? 142 GLU A N      3  
ATOM   9791   C  CA     . GLU A 1 135 ? -24.399 1.325   3.182   1.00 0.00 ? 142 GLU A CA     3  
ATOM   9792   C  C      . GLU A 1 135 ? -22.894 1.476   2.980   1.00 0.00 ? 142 GLU A C      3  
ATOM   9793   O  O      . GLU A 1 135 ? -22.374 2.589   2.951   1.00 0.00 ? 142 GLU A O      3  
ATOM   9794   C  CB     . GLU A 1 135 ? -24.757 1.477   4.668   1.00 0.00 ? 142 GLU A CB     3  
ATOM   9795   C  CG     . GLU A 1 135 ? -23.965 0.570   5.602   1.00 0.00 ? 142 GLU A CG     3  
ATOM   9796   C  CD     . GLU A 1 135 ? -24.091 0.983   7.057   1.00 0.00 ? 142 GLU A CD     3  
ATOM   9797   O  OE1    . GLU A 1 135 ? -23.346 1.894   7.484   1.00 0.00 ? 142 GLU A OE1    3  
ATOM   9798   O  OE2    . GLU A 1 135 ? -24.929 0.406   7.774   1.00 0.00 ? 142 GLU A OE2    3  
ATOM   9799   H  H      . GLU A 1 135 ? -25.072 -0.684  3.247   1.00 0.00 ? 142 GLU A H      3  
ATOM   9800   H  HA     . GLU A 1 135 ? -24.895 2.105   2.624   1.00 0.00 ? 142 GLU A HA     3  
ATOM   9801   H  HB2    . GLU A 1 135 ? -24.577 2.499   4.962   1.00 0.00 ? 142 GLU A HB2    3  
ATOM   9802   H  HB3    . GLU A 1 135 ? -25.807 1.256   4.794   1.00 0.00 ? 142 GLU A HB3    3  
ATOM   9803   H  HG2    . GLU A 1 135 ? -24.329 -0.441  5.497   1.00 0.00 ? 142 GLU A HG2    3  
ATOM   9804   H  HG3    . GLU A 1 135 ? -22.923 0.607   5.320   1.00 0.00 ? 142 GLU A HG3    3  
ATOM   9805   N  N      . ALA A 1 136 ? -22.202 0.349   2.832   1.00 0.00 ? 143 ALA A N      3  
ATOM   9806   C  CA     . ALA A 1 136 ? -20.769 0.358   2.551   1.00 0.00 ? 143 ALA A CA     3  
ATOM   9807   C  C      . ALA A 1 136 ? -20.503 0.977   1.184   1.00 0.00 ? 143 ALA A C      3  
ATOM   9808   O  O      . ALA A 1 136 ? -19.490 1.644   0.975   1.00 0.00 ? 143 ALA A O      3  
ATOM   9809   C  CB     . ALA A 1 136 ? -20.200 -1.053  2.622   1.00 0.00 ? 143 ALA A CB     3  
ATOM   9810   H  H      . ALA A 1 136 ? -22.664 -0.510  2.922   1.00 0.00 ? 143 ALA A H      3  
ATOM   9811   H  HA     . ALA A 1 136 ? -20.283 0.958   3.308   1.00 0.00 ? 143 ALA A HA     3  
ATOM   9812   H  HB1    . ALA A 1 136 ? -20.674 -1.670  1.873   1.00 0.00 ? 143 ALA A HB1    3  
ATOM   9813   H  HB2    . ALA A 1 136 ? -20.389 -1.467  3.603   1.00 0.00 ? 143 ALA A HB2    3  
ATOM   9814   H  HB3    . ALA A 1 136 ? -19.136 -1.022  2.443   1.00 0.00 ? 143 ALA A HB3    3  
ATOM   9815   N  N      . ARG A 1 137 ? -21.430 0.760   0.260   1.00 0.00 ? 144 ARG A N      3  
ATOM   9816   C  CA     . ARG A 1 137 ? -21.374 1.394   -1.049  1.00 0.00 ? 144 ARG A CA     3  
ATOM   9817   C  C      . ARG A 1 137 ? -21.665 2.882   -0.911  1.00 0.00 ? 144 ARG A C      3  
ATOM   9818   O  O      . ARG A 1 137 ? -21.036 3.714   -1.565  1.00 0.00 ? 144 ARG A O      3  
ATOM   9819   C  CB     . ARG A 1 137 ? -22.383 0.754   -2.000  1.00 0.00 ? 144 ARG A CB     3  
ATOM   9820   C  CG     . ARG A 1 137 ? -22.110 -0.711  -2.290  1.00 0.00 ? 144 ARG A CG     3  
ATOM   9821   C  CD     . ARG A 1 137 ? -23.272 -1.359  -3.023  1.00 0.00 ? 144 ARG A CD     3  
ATOM   9822   N  NE     . ARG A 1 137 ? -23.532 -0.742  -4.324  1.00 0.00 ? 144 ARG A NE     3  
ATOM   9823   C  CZ     . ARG A 1 137 ? -24.579 -1.047  -5.094  1.00 0.00 ? 144 ARG A CZ     3  
ATOM   9824   N  NH1    . ARG A 1 137 ? -25.449 -1.967  -4.701  1.00 0.00 ? 144 ARG A NH1    3  
ATOM   9825   N  NH2    . ARG A 1 137 ? -24.753 -0.429  -6.254  1.00 0.00 ? 144 ARG A NH2    3  
ATOM   9826   H  H      . ARG A 1 137 ? -22.175 0.150   0.465   1.00 0.00 ? 144 ARG A H      3  
ATOM   9827   H  HA     . ARG A 1 137 ? -20.378 1.263   -1.443  1.00 0.00 ? 144 ARG A HA     3  
ATOM   9828   H  HB2    . ARG A 1 137 ? -23.368 0.834   -1.567  1.00 0.00 ? 144 ARG A HB2    3  
ATOM   9829   H  HB3    . ARG A 1 137 ? -22.368 1.293   -2.936  1.00 0.00 ? 144 ARG A HB3    3  
ATOM   9830   H  HG2    . ARG A 1 137 ? -21.222 -0.791  -2.900  1.00 0.00 ? 144 ARG A HG2    3  
ATOM   9831   H  HG3    . ARG A 1 137 ? -21.952 -1.228  -1.354  1.00 0.00 ? 144 ARG A HG3    3  
ATOM   9832   H  HD2    . ARG A 1 137 ? -23.044 -2.400  -3.172  1.00 0.00 ? 144 ARG A HD2    3  
ATOM   9833   H  HD3    . ARG A 1 137 ? -24.157 -1.270  -2.410  1.00 0.00 ? 144 ARG A HD3    3  
ATOM   9834   H  HE     . ARG A 1 137 ? -22.898 -0.059  -4.635  1.00 0.00 ? 144 ARG A HE     3  
ATOM   9835   H  HH11   . ARG A 1 137 ? -25.320 -2.439  -3.821  1.00 0.00 ? 144 ARG A HH11   3  
ATOM   9836   H  HH12   . ARG A 1 137 ? -26.247 -2.197  -5.274  1.00 0.00 ? 144 ARG A HH12   3  
ATOM   9837   H  HH21   . ARG A 1 137 ? -24.093 0.272   -6.562  1.00 0.00 ? 144 ARG A HH21   3  
ATOM   9838   H  HH22   . ARG A 1 137 ? -25.549 -0.650  -6.833  1.00 0.00 ? 144 ARG A HH22   3  
ATOM   9839   N  N      . SER A 1 138 ? -22.616 3.207   -0.041  1.00 0.00 ? 145 SER A N      3  
ATOM   9840   C  CA     . SER A 1 138 ? -22.970 4.569   0.245   1.00 0.00 ? 145 SER A CA     3  
ATOM   9841   C  C      . SER A 1 138 ? -21.787 5.351   0.816   1.00 0.00 ? 145 SER A C      3  
ATOM   9842   O  O      . SER A 1 138 ? -21.674 6.553   0.592   1.00 0.00 ? 145 SER A O      3  
ATOM   9843   C  CB     . SER A 1 138 ? -24.135 4.557   1.218   1.00 0.00 ? 145 SER A CB     3  
ATOM   9844   O  OG     . SER A 1 138 ? -25.220 3.810   0.695   1.00 0.00 ? 145 SER A OG     3  
ATOM   9845   H  H      . SER A 1 138 ? -23.119 2.505   0.414   1.00 0.00 ? 145 SER A H      3  
ATOM   9846   H  HA     . SER A 1 138 ? -23.287 5.033   -0.675  1.00 0.00 ? 145 SER A HA     3  
ATOM   9847   H  HB2    . SER A 1 138 ? -23.822 4.115   2.153   1.00 0.00 ? 145 SER A HB2    3  
ATOM   9848   H  HB3    . SER A 1 138 ? -24.451 5.553   1.386   1.00 0.00 ? 145 SER A HB3    3  
ATOM   9849   H  HG     . SER A 1 138 ? -25.228 3.898   -0.271  1.00 0.00 ? 145 SER A HG     3  
ATOM   9850   N  N      . LYS A 1 139 ? -20.902 4.667   1.545   1.00 0.00 ? 146 LYS A N      3  
ATOM   9851   C  CA     . LYS A 1 139 ? -19.701 5.313   2.079   1.00 0.00 ? 146 LYS A CA     3  
ATOM   9852   C  C      . LYS A 1 139 ? -18.859 5.859   0.932   1.00 0.00 ? 146 LYS A C      3  
ATOM   9853   O  O      . LYS A 1 139 ? -18.428 7.007   0.956   1.00 0.00 ? 146 LYS A O      3  
ATOM   9854   C  CB     . LYS A 1 139 ? -18.847 4.339   2.901   1.00 0.00 ? 146 LYS A CB     3  
ATOM   9855   C  CG     . LYS A 1 139 ? -19.621 3.497   3.908   1.00 0.00 ? 146 LYS A CG     3  
ATOM   9856   C  CD     . LYS A 1 139 ? -20.382 4.335   4.924   1.00 0.00 ? 146 LYS A CD     3  
ATOM   9857   C  CE     . LYS A 1 139 ? -21.125 3.430   5.895   1.00 0.00 ? 146 LYS A CE     3  
ATOM   9858   N  NZ     . LYS A 1 139 ? -22.065 4.172   6.770   1.00 0.00 ? 146 LYS A NZ     3  
ATOM   9859   H  H      . LYS A 1 139 ? -21.068 3.717   1.738   1.00 0.00 ? 146 LYS A H      3  
ATOM   9860   H  HA     . LYS A 1 139 ? -20.014 6.134   2.707   1.00 0.00 ? 146 LYS A HA     3  
ATOM   9861   H  HB2    . LYS A 1 139 ? -18.343 3.666   2.223   1.00 0.00 ? 146 LYS A HB2    3  
ATOM   9862   H  HB3    . LYS A 1 139 ? -18.102 4.906   3.441   1.00 0.00 ? 146 LYS A HB3    3  
ATOM   9863   H  HG2    . LYS A 1 139 ? -20.328 2.882   3.371   1.00 0.00 ? 146 LYS A HG2    3  
ATOM   9864   H  HG3    . LYS A 1 139 ? -18.924 2.860   4.433   1.00 0.00 ? 146 LYS A HG3    3  
ATOM   9865   H  HD2    . LYS A 1 139 ? -19.682 4.951   5.475   1.00 0.00 ? 146 LYS A HD2    3  
ATOM   9866   H  HD3    . LYS A 1 139 ? -21.094 4.961   4.408   1.00 0.00 ? 146 LYS A HD3    3  
ATOM   9867   H  HE2    . LYS A 1 139 ? -21.684 2.701   5.326   1.00 0.00 ? 146 LYS A HE2    3  
ATOM   9868   H  HE3    . LYS A 1 139 ? -20.400 2.919   6.511   1.00 0.00 ? 146 LYS A HE3    3  
ATOM   9869   H  HZ1    . LYS A 1 139 ? -21.544 4.828   7.391   1.00 0.00 ? 146 LYS A HZ1    3  
ATOM   9870   H  HZ2    . LYS A 1 139 ? -22.604 3.499   7.365   1.00 0.00 ? 146 LYS A HZ2    3  
ATOM   9871   H  HZ3    . LYS A 1 139 ? -22.741 4.719   6.193   1.00 0.00 ? 146 LYS A HZ3    3  
ATOM   9872   N  N      . ALA A 1 140 ? -18.652 5.024   -0.083  1.00 0.00 ? 147 ALA A N      3  
ATOM   9873   C  CA     . ALA A 1 140 ? -17.881 5.412   -1.258  1.00 0.00 ? 147 ALA A CA     3  
ATOM   9874   C  C      . ALA A 1 140 ? -18.497 6.630   -1.938  1.00 0.00 ? 147 ALA A C      3  
ATOM   9875   O  O      . ALA A 1 140 ? -17.786 7.525   -2.387  1.00 0.00 ? 147 ALA A O      3  
ATOM   9876   C  CB     . ALA A 1 140 ? -17.784 4.244   -2.230  1.00 0.00 ? 147 ALA A CB     3  
ATOM   9877   H  H      . ALA A 1 140 ? -19.029 4.120   -0.039  1.00 0.00 ? 147 ALA A H      3  
ATOM   9878   H  HA     . ALA A 1 140 ? -16.881 5.664   -0.934  1.00 0.00 ? 147 ALA A HA     3  
ATOM   9879   H  HB1    . ALA A 1 140 ? -17.357 3.392   -1.724  1.00 0.00 ? 147 ALA A HB1    3  
ATOM   9880   H  HB2    . ALA A 1 140 ? -17.157 4.521   -3.063  1.00 0.00 ? 147 ALA A HB2    3  
ATOM   9881   H  HB3    . ALA A 1 140 ? -18.771 3.991   -2.591  1.00 0.00 ? 147 ALA A HB3    3  
ATOM   9882   N  N      . GLU A 1 141 ? -19.821 6.659   -1.990  1.00 0.00 ? 148 GLU A N      3  
ATOM   9883   C  CA     . GLU A 1 141 ? -20.545 7.788   -2.557  1.00 0.00 ? 148 GLU A CA     3  
ATOM   9884   C  C      . GLU A 1 141 ? -20.265 9.061   -1.753  1.00 0.00 ? 148 GLU A C      3  
ATOM   9885   O  O      . GLU A 1 141 ? -19.944 10.108  -2.314  1.00 0.00 ? 148 GLU A O      3  
ATOM   9886   C  CB     . GLU A 1 141 ? -22.046 7.486   -2.568  1.00 0.00 ? 148 GLU A CB     3  
ATOM   9887   C  CG     . GLU A 1 141 ? -22.884 8.569   -3.226  1.00 0.00 ? 148 GLU A CG     3  
ATOM   9888   C  CD     . GLU A 1 141 ? -22.661 8.650   -4.723  1.00 0.00 ? 148 GLU A CD     3  
ATOM   9889   O  OE1    . GLU A 1 141 ? -21.640 9.229   -5.149  1.00 0.00 ? 148 GLU A OE1    3  
ATOM   9890   O  OE2    . GLU A 1 141 ? -23.514 8.136   -5.476  1.00 0.00 ? 148 GLU A OE2    3  
ATOM   9891   H  H      . GLU A 1 141 ? -20.328 5.897   -1.637  1.00 0.00 ? 148 GLU A H      3  
ATOM   9892   H  HA     . GLU A 1 141 ? -20.205 7.930   -3.571  1.00 0.00 ? 148 GLU A HA     3  
ATOM   9893   H  HB2    . GLU A 1 141 ? -22.211 6.561   -3.104  1.00 0.00 ? 148 GLU A HB2    3  
ATOM   9894   H  HB3    . GLU A 1 141 ? -22.386 7.365   -1.549  1.00 0.00 ? 148 GLU A HB3    3  
ATOM   9895   H  HG2    . GLU A 1 141 ? -23.927 8.361   -3.043  1.00 0.00 ? 148 GLU A HG2    3  
ATOM   9896   H  HG3    . GLU A 1 141 ? -22.623 9.521   -2.787  1.00 0.00 ? 148 GLU A HG3    3  
ATOM   9897   N  N      . GLU A 1 142 ? -20.373 8.949   -0.432  1.00 0.00 ? 149 GLU A N      3  
ATOM   9898   C  CA     . GLU A 1 142 ? -20.149 10.077  0.470   1.00 0.00 ? 149 GLU A CA     3  
ATOM   9899   C  C      . GLU A 1 142 ? -18.703 10.560  0.418   1.00 0.00 ? 149 GLU A C      3  
ATOM   9900   O  O      . GLU A 1 142 ? -18.443 11.763  0.405   1.00 0.00 ? 149 GLU A O      3  
ATOM   9901   C  CB     . GLU A 1 142 ? -20.494 9.674   1.906   1.00 0.00 ? 149 GLU A CB     3  
ATOM   9902   C  CG     . GLU A 1 142 ? -21.946 9.276   2.102   1.00 0.00 ? 149 GLU A CG     3  
ATOM   9903   C  CD     . GLU A 1 142 ? -22.899 10.444  1.959   1.00 0.00 ? 149 GLU A CD     3  
ATOM   9904   O  OE1    . GLU A 1 142 ? -23.336 10.728  0.825   1.00 0.00 ? 149 GLU A OE1    3  
ATOM   9905   O  OE2    . GLU A 1 142 ? -23.224 11.073  2.985   1.00 0.00 ? 149 GLU A OE2    3  
ATOM   9906   H  H      . GLU A 1 142 ? -20.622 8.079   -0.052  1.00 0.00 ? 149 GLU A H      3  
ATOM   9907   H  HA     . GLU A 1 142 ? -20.800 10.882  0.167   1.00 0.00 ? 149 GLU A HA     3  
ATOM   9908   H  HB2    . GLU A 1 142 ? -19.875 8.834   2.188   1.00 0.00 ? 149 GLU A HB2    3  
ATOM   9909   H  HB3    . GLU A 1 142 ? -20.278 10.504  2.560   1.00 0.00 ? 149 GLU A HB3    3  
ATOM   9910   H  HG2    . GLU A 1 142 ? -22.204 8.533   1.361   1.00 0.00 ? 149 GLU A HG2    3  
ATOM   9911   H  HG3    . GLU A 1 142 ? -22.059 8.856   3.090   1.00 0.00 ? 149 GLU A HG3    3  
ATOM   9912   N  N      . TRP A 1 143 ? -17.768 9.617   0.389   1.00 0.00 ? 150 TRP A N      3  
ATOM   9913   C  CA     . TRP A 1 143 ? -16.347 9.946   0.429   1.00 0.00 ? 150 TRP A CA     3  
ATOM   9914   C  C      . TRP A 1 143 ? -15.867 10.455  -0.927  1.00 0.00 ? 150 TRP A C      3  
ATOM   9915   O  O      . TRP A 1 143 ? -14.871 11.173  -1.014  1.00 0.00 ? 150 TRP A O      3  
ATOM   9916   C  CB     . TRP A 1 143 ? -15.513 8.723   0.842   1.00 0.00 ? 150 TRP A CB     3  
ATOM   9917   C  CG     . TRP A 1 143 ? -15.859 8.155   2.192   1.00 0.00 ? 150 TRP A CG     3  
ATOM   9918   C  CD1    . TRP A 1 143 ? -16.815 8.605   3.060   1.00 0.00 ? 150 TRP A CD1    3  
ATOM   9919   C  CD2    . TRP A 1 143 ? -15.249 7.023   2.824   1.00 0.00 ? 150 TRP A CD2    3  
ATOM   9920   N  NE1    . TRP A 1 143 ? -16.843 7.814   4.184   1.00 0.00 ? 150 TRP A NE1    3  
ATOM   9921   C  CE2    . TRP A 1 143 ? -15.889 6.841   4.064   1.00 0.00 ? 150 TRP A CE2    3  
ATOM   9922   C  CE3    . TRP A 1 143 ? -14.225 6.143   2.460   1.00 0.00 ? 150 TRP A CE3    3  
ATOM   9923   C  CZ2    . TRP A 1 143 ? -15.540 5.817   4.940   1.00 0.00 ? 150 TRP A CZ2    3  
ATOM   9924   C  CZ3    . TRP A 1 143 ? -13.878 5.128   3.330   1.00 0.00 ? 150 TRP A CZ3    3  
ATOM   9925   C  CH2    . TRP A 1 143 ? -14.536 4.972   4.557   1.00 0.00 ? 150 TRP A CH2    3  
ATOM   9926   H  H      . TRP A 1 143 ? -18.041 8.673   0.352   1.00 0.00 ? 150 TRP A H      3  
ATOM   9927   H  HA     . TRP A 1 143 ? -16.209 10.728  1.161   1.00 0.00 ? 150 TRP A HA     3  
ATOM   9928   H  HB2    . TRP A 1 143 ? -15.657 7.940   0.112   1.00 0.00 ? 150 TRP A HB2    3  
ATOM   9929   H  HB3    . TRP A 1 143 ? -14.471 9.002   0.858   1.00 0.00 ? 150 TRP A HB3    3  
ATOM   9930   H  HD1    . TRP A 1 143 ? -17.456 9.455   2.873   1.00 0.00 ? 150 TRP A HD1    3  
ATOM   9931   H  HE1    . TRP A 1 143 ? -17.453 7.931   4.954   1.00 0.00 ? 150 TRP A HE1    3  
ATOM   9932   H  HE3    . TRP A 1 143 ? -13.706 6.247   1.520   1.00 0.00 ? 150 TRP A HE3    3  
ATOM   9933   H  HZ2    . TRP A 1 143 ? -16.038 5.680   5.888   1.00 0.00 ? 150 TRP A HZ2    3  
ATOM   9934   H  HZ3    . TRP A 1 143 ? -13.089 4.438   3.065   1.00 0.00 ? 150 TRP A HZ3    3  
ATOM   9935   H  HH2    . TRP A 1 143 ? -14.231 4.163   5.208   1.00 0.00 ? 150 TRP A HH2    3  
ATOM   9936   N  N      . GLY A 1 144 ? -16.577 10.080  -1.982  1.00 0.00 ? 151 GLY A N      3  
ATOM   9937   C  CA     . GLY A 1 144 ? -16.196 10.493  -3.316  1.00 0.00 ? 151 GLY A CA     3  
ATOM   9938   C  C      . GLY A 1 144 ? -15.208 9.536   -3.951  1.00 0.00 ? 151 GLY A C      3  
ATOM   9939   O  O      . GLY A 1 144 ? -14.257 9.958   -4.612  1.00 0.00 ? 151 GLY A O      3  
ATOM   9940   H  H      . GLY A 1 144 ? -17.371 9.517   -1.853  1.00 0.00 ? 151 GLY A H      3  
ATOM   9941   H  HA2    . GLY A 1 144 ? -17.081 10.546  -3.932  1.00 0.00 ? 151 GLY A HA2    3  
ATOM   9942   H  HA3    . GLY A 1 144 ? -15.747 11.474  -3.261  1.00 0.00 ? 151 GLY A HA3    3  
ATOM   9943   N  N      . VAL A 1 145 ? -15.432 8.245   -3.748  1.00 0.00 ? 152 VAL A N      3  
ATOM   9944   C  CA     . VAL A 1 145 ? -14.558 7.216   -4.294  1.00 0.00 ? 152 VAL A CA     3  
ATOM   9945   C  C      . VAL A 1 145 ? -15.365 6.095   -4.917  1.00 0.00 ? 152 VAL A C      3  
ATOM   9946   O  O      . VAL A 1 145 ? -16.582 6.199   -5.069  1.00 0.00 ? 152 VAL A O      3  
ATOM   9947   C  CB     . VAL A 1 145 ? -13.632 6.609   -3.219  1.00 0.00 ? 152 VAL A CB     3  
ATOM   9948   C  CG1    . VAL A 1 145 ? -12.576 7.611   -2.805  1.00 0.00 ? 152 VAL A CG1    3  
ATOM   9949   C  CG2    . VAL A 1 145 ? -14.433 6.141   -2.013  1.00 0.00 ? 152 VAL A CG2    3  
ATOM   9950   H  H      . VAL A 1 145 ? -16.223 7.972   -3.226  1.00 0.00 ? 152 VAL A H      3  
ATOM   9951   H  HA     . VAL A 1 145 ? -13.941 7.670   -5.055  1.00 0.00 ? 152 VAL A HA     3  
ATOM   9952   H  HB     . VAL A 1 145 ? -13.132 5.752   -3.646  1.00 0.00 ? 152 VAL A HB     3  
ATOM   9953   H  HG11   . VAL A 1 145 ? -11.899 7.150   -2.105  1.00 0.00 ? 152 VAL A HG11   3  
ATOM   9954   H  HG12   . VAL A 1 145 ? -13.053 8.461   -2.344  1.00 0.00 ? 152 VAL A HG12   3  
ATOM   9955   H  HG13   . VAL A 1 145 ? -12.033 7.932   -3.680  1.00 0.00 ? 152 VAL A HG13   3  
ATOM   9956   H  HG21   . VAL A 1 145 ? -15.158 5.405   -2.328  1.00 0.00 ? 152 VAL A HG21   3  
ATOM   9957   H  HG22   . VAL A 1 145 ? -14.945 6.984   -1.572  1.00 0.00 ? 152 VAL A HG22   3  
ATOM   9958   H  HG23   . VAL A 1 145 ? -13.767 5.702   -1.286  1.00 0.00 ? 152 VAL A HG23   3  
ATOM   9959   N  N      . GLN A 1 146 ? -14.679 5.024   -5.275  1.00 0.00 ? 153 GLN A N      3  
ATOM   9960   C  CA     . GLN A 1 146 ? -15.340 3.856   -5.811  1.00 0.00 ? 153 GLN A CA     3  
ATOM   9961   C  C      . GLN A 1 146 ? -15.256 2.698   -4.830  1.00 0.00 ? 153 GLN A C      3  
ATOM   9962   O  O      . GLN A 1 146 ? -14.398 2.681   -3.944  1.00 0.00 ? 153 GLN A O      3  
ATOM   9963   C  CB     . GLN A 1 146 ? -14.769 3.443   -7.180  1.00 0.00 ? 153 GLN A CB     3  
ATOM   9964   C  CG     . GLN A 1 146 ? -13.262 3.622   -7.341  1.00 0.00 ? 153 GLN A CG     3  
ATOM   9965   C  CD     . GLN A 1 146 ? -12.870 5.062   -7.617  1.00 0.00 ? 153 GLN A CD     3  
ATOM   9966   O  OE1    . GLN A 1 146 ? -13.640 5.830   -8.196  1.00 0.00 ? 153 GLN A OE1    3  
ATOM   9967   N  NE2    . GLN A 1 146 ? -11.671 5.440   -7.209  1.00 0.00 ? 153 GLN A NE2    3  
ATOM   9968   H  H      . GLN A 1 146 ? -13.706 5.017   -5.169  1.00 0.00 ? 153 GLN A H      3  
ATOM   9969   H  HA     . GLN A 1 146 ? -16.375 4.122   -5.934  1.00 0.00 ? 153 GLN A HA     3  
ATOM   9970   H  HB2    . GLN A 1 146 ? -14.993 2.397   -7.342  1.00 0.00 ? 153 GLN A HB2    3  
ATOM   9971   H  HB3    . GLN A 1 146 ? -15.259 4.026   -7.947  1.00 0.00 ? 153 GLN A HB3    3  
ATOM   9972   H  HG2    . GLN A 1 146 ? -12.772 3.297   -6.434  1.00 0.00 ? 153 GLN A HG2    3  
ATOM   9973   H  HG3    . GLN A 1 146 ? -12.926 3.011   -8.165  1.00 0.00 ? 153 GLN A HG3    3  
ATOM   9974   H  HE21   . GLN A 1 146 ? -11.106 4.780   -6.756  1.00 0.00 ? 153 GLN A HE21   3  
ATOM   9975   H  HE22   . GLN A 1 146 ? -11.394 6.363   -7.385  1.00 0.00 ? 153 GLN A HE22   3  
ATOM   9976   N  N      . TYR A 1 147 ? -16.159 1.744   -4.983  1.00 0.00 ? 154 TYR A N      3  
ATOM   9977   C  CA     . TYR A 1 147 ? -16.174 0.559   -4.144  1.00 0.00 ? 154 TYR A CA     3  
ATOM   9978   C  C      . TYR A 1 147 ? -16.154 -0.686  -5.015  1.00 0.00 ? 154 TYR A C      3  
ATOM   9979   O  O      . TYR A 1 147 ? -17.041 -0.885  -5.844  1.00 0.00 ? 154 TYR A O      3  
ATOM   9980   C  CB     . TYR A 1 147 ? -17.411 0.558   -3.233  1.00 0.00 ? 154 TYR A CB     3  
ATOM   9981   C  CG     . TYR A 1 147 ? -17.491 -0.641  -2.312  1.00 0.00 ? 154 TYR A CG     3  
ATOM   9982   C  CD1    . TYR A 1 147 ? -16.463 -0.923  -1.423  1.00 0.00 ? 154 TYR A CD1    3  
ATOM   9983   C  CD2    . TYR A 1 147 ? -18.590 -1.493  -2.335  1.00 0.00 ? 154 TYR A CD2    3  
ATOM   9984   C  CE1    . TYR A 1 147 ? -16.525 -2.015  -0.584  1.00 0.00 ? 154 TYR A CE1    3  
ATOM   9985   C  CE2    . TYR A 1 147 ? -18.661 -2.590  -1.496  1.00 0.00 ? 154 TYR A CE2    3  
ATOM   9986   C  CZ     . TYR A 1 147 ? -17.623 -2.844  -0.624  1.00 0.00 ? 154 TYR A CZ     3  
ATOM   9987   O  OH     . TYR A 1 147 ? -17.682 -3.933  0.214   1.00 0.00 ? 154 TYR A OH     3  
ATOM   9988   H  H      . TYR A 1 147 ? -16.835 1.833   -5.688  1.00 0.00 ? 154 TYR A H      3  
ATOM   9989   H  HA     . TYR A 1 147 ? -15.284 0.573   -3.532  1.00 0.00 ? 154 TYR A HA     3  
ATOM   9990   H  HB2    . TYR A 1 147 ? -17.398 1.445   -2.620  1.00 0.00 ? 154 TYR A HB2    3  
ATOM   9991   H  HB3    . TYR A 1 147 ? -18.302 0.565   -3.844  1.00 0.00 ? 154 TYR A HB3    3  
ATOM   9992   H  HD1    . TYR A 1 147 ? -15.604 -0.274  -1.392  1.00 0.00 ? 154 TYR A HD1    3  
ATOM   9993   H  HD2    . TYR A 1 147 ? -19.400 -1.288  -3.019  1.00 0.00 ? 154 TYR A HD2    3  
ATOM   9994   H  HE1    . TYR A 1 147 ? -15.713 -2.216  0.101   1.00 0.00 ? 154 TYR A HE1    3  
ATOM   9995   H  HE2    . TYR A 1 147 ? -19.529 -3.243  -1.524  1.00 0.00 ? 154 TYR A HE2    3  
ATOM   9996   H  HH     . TYR A 1 147 ? -17.420 -3.673  1.101   1.00 0.00 ? 154 TYR A HH     3  
ATOM   9997   N  N      . VAL A 1 148 ? -15.133 -1.510  -4.846  1.00 0.00 ? 155 VAL A N      3  
ATOM   9998   C  CA     . VAL A 1 148 ? -14.992 -2.715  -5.650  1.00 0.00 ? 155 VAL A CA     3  
ATOM   9999   C  C      . VAL A 1 148 ? -15.017 -3.962  -4.768  1.00 0.00 ? 155 VAL A C      3  
ATOM   10000  O  O      . VAL A 1 148 ? -14.279 -4.053  -3.783  1.00 0.00 ? 155 VAL A O      3  
ATOM   10001  C  CB     . VAL A 1 148 ? -13.688 -2.685  -6.485  1.00 0.00 ? 155 VAL A CB     3  
ATOM   10002  C  CG1    . VAL A 1 148 ? -13.539 -3.951  -7.318  1.00 0.00 ? 155 VAL A CG1    3  
ATOM   10003  C  CG2    . VAL A 1 148 ? -13.656 -1.455  -7.384  1.00 0.00 ? 155 VAL A CG2    3  
ATOM   10004  H  H      . VAL A 1 148 ? -14.456 -1.305  -4.160  1.00 0.00 ? 155 VAL A H      3  
ATOM   10005  H  HA     . VAL A 1 148 ? -15.830 -2.756  -6.332  1.00 0.00 ? 155 VAL A HA     3  
ATOM   10006  H  HB     . VAL A 1 148 ? -12.851 -2.630  -5.804  1.00 0.00 ? 155 VAL A HB     3  
ATOM   10007  H  HG11   . VAL A 1 148 ? -13.484 -4.807  -6.663  1.00 0.00 ? 155 VAL A HG11   3  
ATOM   10008  H  HG12   . VAL A 1 148 ? -12.636 -3.891  -7.908  1.00 0.00 ? 155 VAL A HG12   3  
ATOM   10009  H  HG13   . VAL A 1 148 ? -14.392 -4.052  -7.974  1.00 0.00 ? 155 VAL A HG13   3  
ATOM   10010  H  HG21   . VAL A 1 148 ? -12.718 -1.425  -7.919  1.00 0.00 ? 155 VAL A HG21   3  
ATOM   10011  H  HG22   . VAL A 1 148 ? -13.760 -0.564  -6.782  1.00 0.00 ? 155 VAL A HG22   3  
ATOM   10012  H  HG23   . VAL A 1 148 ? -14.471 -1.507  -8.091  1.00 0.00 ? 155 VAL A HG23   3  
ATOM   10013  N  N      . GLU A 1 149 ? -15.886 -4.906  -5.114  1.00 0.00 ? 156 GLU A N      3  
ATOM   10014  C  CA     . GLU A 1 149 ? -15.976 -6.174  -4.397  1.00 0.00 ? 156 GLU A CA     3  
ATOM   10015  C  C      . GLU A 1 149 ? -14.974 -7.165  -4.975  1.00 0.00 ? 156 GLU A C      3  
ATOM   10016  O  O      . GLU A 1 149 ? -14.940 -7.391  -6.188  1.00 0.00 ? 156 GLU A O      3  
ATOM   10017  C  CB     . GLU A 1 149 ? -17.392 -6.746  -4.499  1.00 0.00 ? 156 GLU A CB     3  
ATOM   10018  C  CG     . GLU A 1 149 ? -18.466 -5.821  -3.955  1.00 0.00 ? 156 GLU A CG     3  
ATOM   10019  C  CD     . GLU A 1 149 ? -19.863 -6.356  -4.190  1.00 0.00 ? 156 GLU A CD     3  
ATOM   10020  O  OE1    . GLU A 1 149 ? -20.359 -6.239  -5.332  1.00 0.00 ? 156 GLU A OE1    3  
ATOM   10021  O  OE2    . GLU A 1 149 ? -20.469 -6.895  -3.239  1.00 0.00 ? 156 GLU A OE2    3  
ATOM   10022  H  H      . GLU A 1 149 ? -16.481 -4.750  -5.881  1.00 0.00 ? 156 GLU A H      3  
ATOM   10023  H  HA     . GLU A 1 149 ? -15.737 -5.992  -3.359  1.00 0.00 ? 156 GLU A HA     3  
ATOM   10024  H  HB2    . GLU A 1 149 ? -17.612 -6.943  -5.538  1.00 0.00 ? 156 GLU A HB2    3  
ATOM   10025  H  HB3    . GLU A 1 149 ? -17.433 -7.675  -3.949  1.00 0.00 ? 156 GLU A HB3    3  
ATOM   10026  H  HG2    . GLU A 1 149 ? -18.315 -5.699  -2.892  1.00 0.00 ? 156 GLU A HG2    3  
ATOM   10027  H  HG3    . GLU A 1 149 ? -18.374 -4.864  -4.444  1.00 0.00 ? 156 GLU A HG3    3  
ATOM   10028  N  N      . THR A 1 150 ? -14.159 -7.753  -4.113  1.00 0.00 ? 157 THR A N      3  
ATOM   10029  C  CA     . THR A 1 150 ? -13.111 -8.658  -4.557  1.00 0.00 ? 157 THR A CA     3  
ATOM   10030  C  C      . THR A 1 150 ? -13.049 -9.904  -3.678  1.00 0.00 ? 157 THR A C      3  
ATOM   10031  O  O      . THR A 1 150 ? -13.719 -9.991  -2.648  1.00 0.00 ? 157 THR A O      3  
ATOM   10032  C  CB     . THR A 1 150 ? -11.726 -7.976  -4.529  1.00 0.00 ? 157 THR A CB     3  
ATOM   10033  O  OG1    . THR A 1 150 ? -11.393 -7.607  -3.188  1.00 0.00 ? 157 THR A OG1    3  
ATOM   10034  C  CG2    . THR A 1 150 ? -11.692 -6.742  -5.416  1.00 0.00 ? 157 THR A CG2    3  
ATOM   10035  H  H      . THR A 1 150 ? -14.272 -7.581  -3.148  1.00 0.00 ? 157 THR A H      3  
ATOM   10036  H  HA     . THR A 1 150 ? -13.327 -8.951  -5.573  1.00 0.00 ? 157 THR A HA     3  
ATOM   10037  H  HB     . THR A 1 150 ? -10.992 -8.680  -4.892  1.00 0.00 ? 157 THR A HB     3  
ATOM   10038  H  HG1    . THR A 1 150 ? -12.183 -7.291  -2.739  1.00 0.00 ? 157 THR A HG1    3  
ATOM   10039  H  HG21   . THR A 1 150 ? -12.438 -6.038  -5.082  1.00 0.00 ? 157 THR A HG21   3  
ATOM   10040  H  HG22   . THR A 1 150 ? -11.896 -7.027  -6.438  1.00 0.00 ? 157 THR A HG22   3  
ATOM   10041  H  HG23   . THR A 1 150 ? -10.714 -6.285  -5.359  1.00 0.00 ? 157 THR A HG23   3  
ATOM   10042  N  N      . SER A 1 151 ? -12.252 -10.871 -4.099  1.00 0.00 ? 158 SER A N      3  
ATOM   10043  C  CA     . SER A 1 151 ? -11.966 -12.043 -3.287  1.00 0.00 ? 158 SER A CA     3  
ATOM   10044  C  C      . SER A 1 151 ? -10.606 -12.611 -3.671  1.00 0.00 ? 158 SER A C      3  
ATOM   10045  O  O      . SER A 1 151 ? -10.449 -13.199 -4.739  1.00 0.00 ? 158 SER A O      3  
ATOM   10046  C  CB     . SER A 1 151 ? -13.066 -13.097 -3.444  1.00 0.00 ? 158 SER A CB     3  
ATOM   10047  O  OG     . SER A 1 151 ? -14.305 -12.607 -2.956  1.00 0.00 ? 158 SER A OG     3  
ATOM   10048  H  H      . SER A 1 151 ? -11.841 -10.796 -4.991  1.00 0.00 ? 158 SER A H      3  
ATOM   10049  H  HA     . SER A 1 151 ? -11.930 -11.725 -2.255  1.00 0.00 ? 158 SER A HA     3  
ATOM   10050  H  HB2    . SER A 1 151 ? -13.179 -13.350 -4.488  1.00 0.00 ? 158 SER A HB2    3  
ATOM   10051  H  HB3    . SER A 1 151 ? -12.799 -13.982 -2.886  1.00 0.00 ? 158 SER A HB3    3  
ATOM   10052  H  HG     . SER A 1 151 ? -14.317 -11.641 -3.033  1.00 0.00 ? 158 SER A HG     3  
ATOM   10053  N  N      . ALA A 1 152 ? -9.620  -12.405 -2.804  1.00 0.00 ? 159 ALA A N      3  
ATOM   10054  C  CA     . ALA A 1 152 ? -8.249  -12.822 -3.083  1.00 0.00 ? 159 ALA A CA     3  
ATOM   10055  C  C      . ALA A 1 152 ? -8.134  -14.337 -3.195  1.00 0.00 ? 159 ALA A C      3  
ATOM   10056  O  O      . ALA A 1 152 ? -7.286  -14.847 -3.926  1.00 0.00 ? 159 ALA A O      3  
ATOM   10057  C  CB     . ALA A 1 152 ? -7.308  -12.302 -2.009  1.00 0.00 ? 159 ALA A CB     3  
ATOM   10058  H  H      . ALA A 1 152 ? -9.819  -11.952 -1.956  1.00 0.00 ? 159 ALA A H      3  
ATOM   10059  H  HA     . ALA A 1 152 ? -7.956  -12.382 -4.026  1.00 0.00 ? 159 ALA A HA     3  
ATOM   10060  H  HB1    . ALA A 1 152 ? -6.289  -12.532 -2.283  1.00 0.00 ? 159 ALA A HB1    3  
ATOM   10061  H  HB2    . ALA A 1 152 ? -7.543  -12.773 -1.067  1.00 0.00 ? 159 ALA A HB2    3  
ATOM   10062  H  HB3    . ALA A 1 152 ? -7.422  -11.231 -1.917  1.00 0.00 ? 159 ALA A HB3    3  
ATOM   10063  N  N      . LYS A 1 153 ? -8.999  -15.046 -2.478  1.00 0.00 ? 160 LYS A N      3  
ATOM   10064  C  CA     . LYS A 1 153 ? -8.998  -16.505 -2.489  1.00 0.00 ? 160 LYS A CA     3  
ATOM   10065  C  C      . LYS A 1 153 ? -9.294  -17.037 -3.892  1.00 0.00 ? 160 LYS A C      3  
ATOM   10066  O  O      . LYS A 1 153 ? -8.737  -18.048 -4.317  1.00 0.00 ? 160 LYS A O      3  
ATOM   10067  C  CB     . LYS A 1 153 ? -10.036 -17.037 -1.496  1.00 0.00 ? 160 LYS A CB     3  
ATOM   10068  C  CG     . LYS A 1 153 ? -10.061 -18.553 -1.388  1.00 0.00 ? 160 LYS A CG     3  
ATOM   10069  C  CD     . LYS A 1 153 ? -8.742  -19.103 -0.862  1.00 0.00 ? 160 LYS A CD     3  
ATOM   10070  C  CE     . LYS A 1 153 ? -8.730  -20.625 -0.861  1.00 0.00 ? 160 LYS A CE     3  
ATOM   10071  N  NZ     . LYS A 1 153 ? -9.767  -21.201 0.035   1.00 0.00 ? 160 LYS A NZ     3  
ATOM   10072  H  H      . LYS A 1 153 ? -9.650  -14.577 -1.921  1.00 0.00 ? 160 LYS A H      3  
ATOM   10073  H  HA     . LYS A 1 153 ? -8.017  -16.841 -2.187  1.00 0.00 ? 160 LYS A HA     3  
ATOM   10074  H  HB2    . LYS A 1 153 ? -9.822  -16.631 -0.519  1.00 0.00 ? 160 LYS A HB2    3  
ATOM   10075  H  HB3    . LYS A 1 153 ? -11.015 -16.704 -1.806  1.00 0.00 ? 160 LYS A HB3    3  
ATOM   10076  H  HG2    . LYS A 1 153 ? -10.853 -18.840 -0.716  1.00 0.00 ? 160 LYS A HG2    3  
ATOM   10077  H  HG3    . LYS A 1 153 ? -10.247 -18.968 -2.367  1.00 0.00 ? 160 LYS A HG3    3  
ATOM   10078  H  HD2    . LYS A 1 153 ? -7.938  -18.749 -1.492  1.00 0.00 ? 160 LYS A HD2    3  
ATOM   10079  H  HD3    . LYS A 1 153 ? -8.591  -18.749 0.148   1.00 0.00 ? 160 LYS A HD3    3  
ATOM   10080  H  HE2    . LYS A 1 153 ? -8.909  -20.973 -1.868  1.00 0.00 ? 160 LYS A HE2    3  
ATOM   10081  H  HE3    . LYS A 1 153 ? -7.758  -20.962 -0.533  1.00 0.00 ? 160 LYS A HE3    3  
ATOM   10082  H  HZ1    . LYS A 1 153 ? -10.696 -20.770 -0.164  1.00 0.00 ? 160 LYS A HZ1    3  
ATOM   10083  H  HZ2    . LYS A 1 153 ? -9.522  -21.029 1.035   1.00 0.00 ? 160 LYS A HZ2    3  
ATOM   10084  H  HZ3    . LYS A 1 153 ? -9.838  -22.231 -0.121  1.00 0.00 ? 160 LYS A HZ3    3  
ATOM   10085  N  N      . THR A 1 154 ? -10.168 -16.345 -4.605  1.00 0.00 ? 161 THR A N      3  
ATOM   10086  C  CA     . THR A 1 154 ? -10.539 -16.741 -5.953  1.00 0.00 ? 161 THR A CA     3  
ATOM   10087  C  C      . THR A 1 154 ? -9.852  -15.860 -6.991  1.00 0.00 ? 161 THR A C      3  
ATOM   10088  O  O      . THR A 1 154 ? -10.092 -16.002 -8.189  1.00 0.00 ? 161 THR A O      3  
ATOM   10089  C  CB     . THR A 1 154 ? -12.063 -16.662 -6.142  1.00 0.00 ? 161 THR A CB     3  
ATOM   10090  O  OG1    . THR A 1 154 ? -12.561 -15.466 -5.526  1.00 0.00 ? 161 THR A OG1    3  
ATOM   10091  C  CG2    . THR A 1 154 ? -12.752 -17.878 -5.539  1.00 0.00 ? 161 THR A CG2    3  
ATOM   10092  H  H      . THR A 1 154 ? -10.579 -15.545 -4.219  1.00 0.00 ? 161 THR A H      3  
ATOM   10093  H  HA     . THR A 1 154 ? -10.230 -17.765 -6.099  1.00 0.00 ? 161 THR A HA     3  
ATOM   10094  H  HB     . THR A 1 154 ? -12.278 -16.632 -7.203  1.00 0.00 ? 161 THR A HB     3  
ATOM   10095  H  HG1    . THR A 1 154 ? -13.522 -15.416 -5.647  1.00 0.00 ? 161 THR A HG1    3  
ATOM   10096  H  HG21   . THR A 1 154 ? -12.385 -18.774 -6.017  1.00 0.00 ? 161 THR A HG21   3  
ATOM   10097  H  HG22   . THR A 1 154 ? -13.819 -17.799 -5.693  1.00 0.00 ? 161 THR A HG22   3  
ATOM   10098  H  HG23   . THR A 1 154 ? -12.544 -17.925 -4.481  1.00 0.00 ? 161 THR A HG23   3  
ATOM   10099  N  N      . ARG A 1 155 ? -8.996  -14.952 -6.509  1.00 0.00 ? 162 ARG A N      3  
ATOM   10100  C  CA     . ARG A 1 155 ? -8.256  -14.024 -7.369  1.00 0.00 ? 162 ARG A CA     3  
ATOM   10101  C  C      . ARG A 1 155 ? -9.221  -13.157 -8.181  1.00 0.00 ? 162 ARG A C      3  
ATOM   10102  O  O      . ARG A 1 155 ? -8.919  -12.740 -9.299  1.00 0.00 ? 162 ARG A O      3  
ATOM   10103  C  CB     . ARG A 1 155 ? -7.310  -14.799 -8.297  1.00 0.00 ? 162 ARG A CB     3  
ATOM   10104  C  CG     . ARG A 1 155 ? -6.288  -15.644 -7.550  1.00 0.00 ? 162 ARG A CG     3  
ATOM   10105  C  CD     . ARG A 1 155 ? -5.517  -16.559 -8.489  1.00 0.00 ? 162 ARG A CD     3  
ATOM   10106  N  NE     . ARG A 1 155 ? -4.680  -15.820 -9.434  1.00 0.00 ? 162 ARG A NE     3  
ATOM   10107  C  CZ     . ARG A 1 155 ? -4.537  -16.163 -10.714 1.00 0.00 ? 162 ARG A CZ     3  
ATOM   10108  N  NH1    . ARG A 1 155 ? -5.234  -17.177 -11.215 1.00 0.00 ? 162 ARG A NH1    3  
ATOM   10109  N  NH2    . ARG A 1 155 ? -3.703  -15.496 -11.497 1.00 0.00 ? 162 ARG A NH2    3  
ATOM   10110  H  H      . ARG A 1 155 ? -8.856  -14.909 -5.540  1.00 0.00 ? 162 ARG A H      3  
ATOM   10111  H  HA     . ARG A 1 155 ? -7.670  -13.380 -6.730  1.00 0.00 ? 162 ARG A HA     3  
ATOM   10112  H  HB2    . ARG A 1 155 ? -7.896  -15.452 -8.925  1.00 0.00 ? 162 ARG A HB2    3  
ATOM   10113  H  HB3    . ARG A 1 155 ? -6.779  -14.096 -8.920  1.00 0.00 ? 162 ARG A HB3    3  
ATOM   10114  H  HG2    . ARG A 1 155 ? -5.591  -14.990 -7.051  1.00 0.00 ? 162 ARG A HG2    3  
ATOM   10115  H  HG3    . ARG A 1 155 ? -6.804  -16.248 -6.817  1.00 0.00 ? 162 ARG A HG3    3  
ATOM   10116  H  HD2    . ARG A 1 155 ? -4.886  -17.206 -7.899  1.00 0.00 ? 162 ARG A HD2    3  
ATOM   10117  H  HD3    . ARG A 1 155 ? -6.225  -17.158 -9.043  1.00 0.00 ? 162 ARG A HD3    3  
ATOM   10118  H  HE     . ARG A 1 155 ? -4.173  -15.045 -9.086  1.00 0.00 ? 162 ARG A HE     3  
ATOM   10119  H  HH11   . ARG A 1 155 ? -5.881  -17.689 -10.633 1.00 0.00 ? 162 ARG A HH11   3  
ATOM   10120  H  HH12   . ARG A 1 155 ? -5.109  -17.453 -12.176 1.00 0.00 ? 162 ARG A HH12   3  
ATOM   10121  H  HH21   . ARG A 1 155 ? -3.158  -14.718 -11.134 1.00 0.00 ? 162 ARG A HH21   3  
ATOM   10122  H  HH22   . ARG A 1 155 ? -3.590  -15.765 -12.461 1.00 0.00 ? 162 ARG A HH22   3  
ATOM   10123  N  N      . ALA A 1 156 ? -10.371 -12.861 -7.584  1.00 0.00 ? 163 ALA A N      3  
ATOM   10124  C  CA     . ALA A 1 156 ? -11.422 -12.124 -8.267  1.00 0.00 ? 163 ALA A CA     3  
ATOM   10125  C  C      . ALA A 1 156 ? -11.244 -10.618 -8.106  1.00 0.00 ? 163 ALA A C      3  
ATOM   10126  O  O      . ALA A 1 156 ? -11.285 -10.098 -6.988  1.00 0.00 ? 163 ALA A O      3  
ATOM   10127  C  CB     . ALA A 1 156 ? -12.789 -12.554 -7.748  1.00 0.00 ? 163 ALA A CB     3  
ATOM   10128  H  H      . ALA A 1 156 ? -10.510 -13.143 -6.654  1.00 0.00 ? 163 ALA A H      3  
ATOM   10129  H  HA     . ALA A 1 156 ? -11.372 -12.371 -9.316  1.00 0.00 ? 163 ALA A HA     3  
ATOM   10130  H  HB1    . ALA A 1 156 ? -12.876 -12.290 -6.703  1.00 0.00 ? 163 ALA A HB1    3  
ATOM   10131  H  HB2    . ALA A 1 156 ? -12.898 -13.623 -7.857  1.00 0.00 ? 163 ALA A HB2    3  
ATOM   10132  H  HB3    . ALA A 1 156 ? -13.562 -12.054 -8.312  1.00 0.00 ? 163 ALA A HB3    3  
ATOM   10133  N  N      . ASN A 1 157 ? -11.024 -9.938  -9.234  1.00 0.00 ? 164 ASN A N      3  
ATOM   10134  C  CA     . ASN A 1 157 ? -10.959 -8.471  -9.291  1.00 0.00 ? 164 ASN A CA     3  
ATOM   10135  C  C      . ASN A 1 157 ? -9.788  -7.900  -8.498  1.00 0.00 ? 164 ASN A C      3  
ATOM   10136  O  O      . ASN A 1 157 ? -9.756  -6.703  -8.205  1.00 0.00 ? 164 ASN A O      3  
ATOM   10137  C  CB     . ASN A 1 157 ? -12.276 -7.857  -8.802  1.00 0.00 ? 164 ASN A CB     3  
ATOM   10138  C  CG     . ASN A 1 157 ? -13.394 -8.007  -9.815  1.00 0.00 ? 164 ASN A CG     3  
ATOM   10139  O  OD1    . ASN A 1 157 ? -14.092 -9.019  -9.843  1.00 0.00 ? 164 ASN A OD1    3  
ATOM   10140  N  ND2    . ASN A 1 157 ? -13.580 -6.991  -10.643 1.00 0.00 ? 164 ASN A ND2    3  
ATOM   10141  H  H      . ASN A 1 157 ? -10.908 -10.447 -10.071 1.00 0.00 ? 164 ASN A H      3  
ATOM   10142  H  HA     . ASN A 1 157 ? -10.825 -8.200  -10.328 1.00 0.00 ? 164 ASN A HA     3  
ATOM   10143  H  HB2    . ASN A 1 157 ? -12.577 -8.346  -7.888  1.00 0.00 ? 164 ASN A HB2    3  
ATOM   10144  H  HB3    . ASN A 1 157 ? -12.126 -6.805  -8.609  1.00 0.00 ? 164 ASN A HB3    3  
ATOM   10145  H  HD21   . ASN A 1 157 ? -13.000 -6.208  -10.554 1.00 0.00 ? 164 ASN A HD21   3  
ATOM   10146  H  HD22   . ASN A 1 157 ? -14.288 -7.067  -11.323 1.00 0.00 ? 164 ASN A HD22   3  
ATOM   10147  N  N      . VAL A 1 158 ? -8.814  -8.745  -8.185  1.00 0.00 ? 165 VAL A N      3  
ATOM   10148  C  CA     . VAL A 1 158 ? -7.647  -8.315  -7.423  1.00 0.00 ? 165 VAL A CA     3  
ATOM   10149  C  C      . VAL A 1 158 ? -6.797  -7.347  -8.241  1.00 0.00 ? 165 VAL A C      3  
ATOM   10150  O  O      . VAL A 1 158 ? -6.273  -6.364  -7.722  1.00 0.00 ? 165 VAL A O      3  
ATOM   10151  C  CB     . VAL A 1 158 ? -6.778  -9.517  -6.991  1.00 0.00 ? 165 VAL A CB     3  
ATOM   10152  C  CG1    . VAL A 1 158 ? -5.555  -9.057  -6.209  1.00 0.00 ? 165 VAL A CG1    3  
ATOM   10153  C  CG2    . VAL A 1 158 ? -7.597  -10.501 -6.171  1.00 0.00 ? 165 VAL A CG2    3  
ATOM   10154  H  H      . VAL A 1 158 ? -8.878  -9.676  -8.479  1.00 0.00 ? 165 VAL A H      3  
ATOM   10155  H  HA     . VAL A 1 158 ? -7.994  -7.810  -6.534  1.00 0.00 ? 165 VAL A HA     3  
ATOM   10156  H  HB     . VAL A 1 158 ? -6.435  -10.024 -7.882  1.00 0.00 ? 165 VAL A HB     3  
ATOM   10157  H  HG11   . VAL A 1 158 ? -5.871  -8.520  -5.327  1.00 0.00 ? 165 VAL A HG11   3  
ATOM   10158  H  HG12   . VAL A 1 158 ? -4.952  -8.409  -6.830  1.00 0.00 ? 165 VAL A HG12   3  
ATOM   10159  H  HG13   . VAL A 1 158 ? -4.971  -9.918  -5.917  1.00 0.00 ? 165 VAL A HG13   3  
ATOM   10160  H  HG21   . VAL A 1 158 ? -6.978  -11.341 -5.893  1.00 0.00 ? 165 VAL A HG21   3  
ATOM   10161  H  HG22   . VAL A 1 158 ? -8.434  -10.849 -6.759  1.00 0.00 ? 165 VAL A HG22   3  
ATOM   10162  H  HG23   . VAL A 1 158 ? -7.962  -10.011 -5.280  1.00 0.00 ? 165 VAL A HG23   3  
ATOM   10163  N  N      . ASP A 1 159 ? -6.696  -7.619  -9.531  1.00 0.00 ? 166 ASP A N      3  
ATOM   10164  C  CA     . ASP A 1 159 ? -5.867  -6.825  -10.429 1.00 0.00 ? 166 ASP A CA     3  
ATOM   10165  C  C      . ASP A 1 159 ? -6.489  -5.460  -10.706 1.00 0.00 ? 166 ASP A C      3  
ATOM   10166  O  O      . ASP A 1 159 ? -5.777  -4.486  -10.960 1.00 0.00 ? 166 ASP A O      3  
ATOM   10167  C  CB     . ASP A 1 159 ? -5.656  -7.580  -11.744 1.00 0.00 ? 166 ASP A CB     3  
ATOM   10168  C  CG     . ASP A 1 159 ? -6.958  -7.891  -12.460 1.00 0.00 ? 166 ASP A CG     3  
ATOM   10169  O  OD1    . ASP A 1 159 ? -7.805  -8.603  -11.875 1.00 0.00 ? 166 ASP A OD1    3  
ATOM   10170  O  OD2    . ASP A 1 159 ? -7.134  -7.433  -13.608 1.00 0.00 ? 166 ASP A OD2    3  
ATOM   10171  H  H      . ASP A 1 159 ? -7.201  -8.377  -9.900  1.00 0.00 ? 166 ASP A H      3  
ATOM   10172  H  HA     . ASP A 1 159 ? -4.910  -6.680  -9.951  1.00 0.00 ? 166 ASP A HA     3  
ATOM   10173  H  HB2    . ASP A 1 159 ? -5.043  -6.981  -12.400 1.00 0.00 ? 166 ASP A HB2    3  
ATOM   10174  H  HB3    . ASP A 1 159 ? -5.150  -8.512  -11.537 1.00 0.00 ? 166 ASP A HB3    3  
ATOM   10175  N  N      . LYS A 1 160 ? -7.814  -5.390  -10.636 1.00 0.00 ? 167 LYS A N      3  
ATOM   10176  C  CA     . LYS A 1 160 ? -8.535  -4.164  -10.959 1.00 0.00 ? 167 LYS A CA     3  
ATOM   10177  C  C      . LYS A 1 160 ? -8.127  -3.016  -10.040 1.00 0.00 ? 167 LYS A C      3  
ATOM   10178  O  O      . LYS A 1 160 ? -7.711  -1.963  -10.512 1.00 0.00 ? 167 LYS A O      3  
ATOM   10179  C  CB     . LYS A 1 160 ? -10.048 -4.382  -10.863 1.00 0.00 ? 167 LYS A CB     3  
ATOM   10180  C  CG     . LYS A 1 160 ? -10.873 -3.166  -11.270 1.00 0.00 ? 167 LYS A CG     3  
ATOM   10181  C  CD     . LYS A 1 160 ? -12.359 -3.411  -11.056 1.00 0.00 ? 167 LYS A CD     3  
ATOM   10182  C  CE     . LYS A 1 160 ? -13.214 -2.265  -11.585 1.00 0.00 ? 167 LYS A CE     3  
ATOM   10183  N  NZ     . LYS A 1 160 ? -12.929 -0.972  -10.903 1.00 0.00 ? 167 LYS A NZ     3  
ATOM   10184  H  H      . LYS A 1 160 ? -8.317  -6.187  -10.369 1.00 0.00 ? 167 LYS A H      3  
ATOM   10185  H  HA     . LYS A 1 160 ? -8.288  -3.897  -11.973 1.00 0.00 ? 167 LYS A HA     3  
ATOM   10186  H  HB2    . LYS A 1 160 ? -10.326 -5.205  -11.504 1.00 0.00 ? 167 LYS A HB2    3  
ATOM   10187  H  HB3    . LYS A 1 160 ? -10.297 -4.631  -9.844  1.00 0.00 ? 167 LYS A HB3    3  
ATOM   10188  H  HG2    . LYS A 1 160 ? -10.569 -2.319  -10.672 1.00 0.00 ? 167 LYS A HG2    3  
ATOM   10189  H  HG3    . LYS A 1 160 ? -10.697 -2.956  -12.315 1.00 0.00 ? 167 LYS A HG3    3  
ATOM   10190  H  HD2    . LYS A 1 160 ? -12.639 -4.319  -11.567 1.00 0.00 ? 167 LYS A HD2    3  
ATOM   10191  H  HD3    . LYS A 1 160 ? -12.541 -3.523  -9.996  1.00 0.00 ? 167 LYS A HD3    3  
ATOM   10192  H  HE2    . LYS A 1 160 ? -13.021 -2.151  -12.639 1.00 0.00 ? 167 LYS A HE2    3  
ATOM   10193  H  HE3    . LYS A 1 160 ? -14.254 -2.515  -11.440 1.00 0.00 ? 167 LYS A HE3    3  
ATOM   10194  H  HZ1    . LYS A 1 160 ? -12.015 -0.580  -11.229 1.00 0.00 ? 167 LYS A HZ1    3  
ATOM   10195  H  HZ2    . LYS A 1 160 ? -12.888 -1.106  -9.876  1.00 0.00 ? 167 LYS A HZ2    3  
ATOM   10196  H  HZ3    . LYS A 1 160 ? -13.679 -0.277  -11.117 1.00 0.00 ? 167 LYS A HZ3    3  
ATOM   10197  N  N      . VAL A 1 161 ? -8.222  -3.244  -8.731  1.00 0.00 ? 168 VAL A N      3  
ATOM   10198  C  CA     . VAL A 1 161 ? -8.053  -2.176  -7.744  1.00 0.00 ? 168 VAL A CA     3  
ATOM   10199  C  C      . VAL A 1 161 ? -6.705  -1.454  -7.860  1.00 0.00 ? 168 VAL A C      3  
ATOM   10200  O  O      . VAL A 1 161 ? -6.622  -0.251  -7.610  1.00 0.00 ? 168 VAL A O      3  
ATOM   10201  C  CB     . VAL A 1 161 ? -8.241  -2.700  -6.301  1.00 0.00 ? 168 VAL A CB     3  
ATOM   10202  C  CG1    . VAL A 1 161 ? -9.655  -3.229  -6.109  1.00 0.00 ? 168 VAL A CG1    3  
ATOM   10203  C  CG2    . VAL A 1 161 ? -7.222  -3.779  -5.963  1.00 0.00 ? 168 VAL A CG2    3  
ATOM   10204  H  H      . VAL A 1 161 ? -8.409  -4.154  -8.417  1.00 0.00 ? 168 VAL A H      3  
ATOM   10205  H  HA     . VAL A 1 161 ? -8.833  -1.451  -7.929  1.00 0.00 ? 168 VAL A HA     3  
ATOM   10206  H  HB     . VAL A 1 161 ? -8.097  -1.873  -5.621  1.00 0.00 ? 168 VAL A HB     3  
ATOM   10207  H  HG11   . VAL A 1 161 ? -10.366 -2.437  -6.302  1.00 0.00 ? 168 VAL A HG11   3  
ATOM   10208  H  HG12   . VAL A 1 161 ? -9.773  -3.577  -5.094  1.00 0.00 ? 168 VAL A HG12   3  
ATOM   10209  H  HG13   . VAL A 1 161 ? -9.831  -4.046  -6.794  1.00 0.00 ? 168 VAL A HG13   3  
ATOM   10210  H  HG21   . VAL A 1 161 ? -7.340  -4.613  -6.640  1.00 0.00 ? 168 VAL A HG21   3  
ATOM   10211  H  HG22   . VAL A 1 161 ? -7.378  -4.117  -4.949  1.00 0.00 ? 168 VAL A HG22   3  
ATOM   10212  H  HG23   . VAL A 1 161 ? -6.224  -3.376  -6.058  1.00 0.00 ? 168 VAL A HG23   3  
ATOM   10213  N  N      . PHE A 1 162 ? -5.660  -2.171  -8.257  1.00 0.00 ? 169 PHE A N      3  
ATOM   10214  C  CA     . PHE A 1 162 ? -4.340  -1.566  -8.379  1.00 0.00 ? 169 PHE A CA     3  
ATOM   10215  C  C      . PHE A 1 162 ? -4.290  -0.604  -9.560  1.00 0.00 ? 169 PHE A C      3  
ATOM   10216  O  O      . PHE A 1 162 ? -3.910  0.556   -9.409  1.00 0.00 ? 169 PHE A O      3  
ATOM   10217  C  CB     . PHE A 1 162 ? -3.256  -2.632  -8.530  1.00 0.00 ? 169 PHE A CB     3  
ATOM   10218  C  CG     . PHE A 1 162 ? -3.045  -3.467  -7.300  1.00 0.00 ? 169 PHE A CG     3  
ATOM   10219  C  CD1    . PHE A 1 162 ? -2.130  -3.086  -6.330  1.00 0.00 ? 169 PHE A CD1    3  
ATOM   10220  C  CD2    . PHE A 1 162 ? -3.755  -4.638  -7.121  1.00 0.00 ? 169 PHE A CD2    3  
ATOM   10221  C  CE1    . PHE A 1 162 ? -1.932  -3.866  -5.203  1.00 0.00 ? 169 PHE A CE1    3  
ATOM   10222  C  CE2    . PHE A 1 162 ? -3.564  -5.418  -5.999  1.00 0.00 ? 169 PHE A CE2    3  
ATOM   10223  C  CZ     . PHE A 1 162 ? -2.650  -5.032  -5.040  1.00 0.00 ? 169 PHE A CZ     3  
ATOM   10224  H  H      . PHE A 1 162 ? -5.781  -3.119  -8.479  1.00 0.00 ? 169 PHE A H      3  
ATOM   10225  H  HA     . PHE A 1 162 ? -4.154  -1.006  -7.475  1.00 0.00 ? 169 PHE A HA     3  
ATOM   10226  H  HB2    . PHE A 1 162 ? -3.527  -3.297  -9.336  1.00 0.00 ? 169 PHE A HB2    3  
ATOM   10227  H  HB3    . PHE A 1 162 ? -2.318  -2.150  -8.769  1.00 0.00 ? 169 PHE A HB3    3  
ATOM   10228  H  HD1    . PHE A 1 162 ? -1.571  -2.170  -6.456  1.00 0.00 ? 169 PHE A HD1    3  
ATOM   10229  H  HD2    . PHE A 1 162 ? -4.471  -4.942  -7.871  1.00 0.00 ? 169 PHE A HD2    3  
ATOM   10230  H  HE1    . PHE A 1 162 ? -1.215  -3.564  -4.451  1.00 0.00 ? 169 PHE A HE1    3  
ATOM   10231  H  HE2    . PHE A 1 162 ? -4.127  -6.330  -5.874  1.00 0.00 ? 169 PHE A HE2    3  
ATOM   10232  H  HZ     . PHE A 1 162 ? -2.496  -5.642  -4.163  1.00 0.00 ? 169 PHE A HZ     3  
ATOM   10233  N  N      . PHE A 1 163 ? -4.684  -1.084  -10.734 1.00 0.00 ? 170 PHE A N      3  
ATOM   10234  C  CA     . PHE A 1 163 ? -4.674  -0.251  -11.934 1.00 0.00 ? 170 PHE A CA     3  
ATOM   10235  C  C      . PHE A 1 163 ? -5.731  0.844   -11.846 1.00 0.00 ? 170 PHE A C      3  
ATOM   10236  O  O      . PHE A 1 163 ? -5.547  1.941   -12.373 1.00 0.00 ? 170 PHE A O      3  
ATOM   10237  C  CB     . PHE A 1 163 ? -4.912  -1.093  -13.189 1.00 0.00 ? 170 PHE A CB     3  
ATOM   10238  C  CG     . PHE A 1 163 ? -3.769  -2.007  -13.536 1.00 0.00 ? 170 PHE A CG     3  
ATOM   10239  C  CD1    . PHE A 1 163 ? -2.706  -1.548  -14.299 1.00 0.00 ? 170 PHE A CD1    3  
ATOM   10240  C  CD2    . PHE A 1 163 ? -3.762  -3.323  -13.107 1.00 0.00 ? 170 PHE A CD2    3  
ATOM   10241  C  CE1    . PHE A 1 163 ? -1.655  -2.387  -14.625 1.00 0.00 ? 170 PHE A CE1    3  
ATOM   10242  C  CE2    . PHE A 1 163 ? -2.716  -4.165  -13.429 1.00 0.00 ? 170 PHE A CE2    3  
ATOM   10243  C  CZ     . PHE A 1 163 ? -1.661  -3.698  -14.190 1.00 0.00 ? 170 PHE A CZ     3  
ATOM   10244  H  H      . PHE A 1 163 ? -4.988  -2.017  -10.795 1.00 0.00 ? 170 PHE A H      3  
ATOM   10245  H  HA     . PHE A 1 163 ? -3.701  0.212   -12.003 1.00 0.00 ? 170 PHE A HA     3  
ATOM   10246  H  HB2    . PHE A 1 163 ? -5.790  -1.706  -13.041 1.00 0.00 ? 170 PHE A HB2    3  
ATOM   10247  H  HB3    . PHE A 1 163 ? -5.079  -0.433  -14.027 1.00 0.00 ? 170 PHE A HB3    3  
ATOM   10248  H  HD1    . PHE A 1 163 ? -2.699  -0.522  -14.638 1.00 0.00 ? 170 PHE A HD1    3  
ATOM   10249  H  HD2    . PHE A 1 163 ? -4.586  -3.689  -12.513 1.00 0.00 ? 170 PHE A HD2    3  
ATOM   10250  H  HE1    . PHE A 1 163 ? -0.832  -2.017  -15.219 1.00 0.00 ? 170 PHE A HE1    3  
ATOM   10251  H  HE2    . PHE A 1 163 ? -2.723  -5.188  -13.087 1.00 0.00 ? 170 PHE A HE2    3  
ATOM   10252  H  HZ     . PHE A 1 163 ? -0.844  -4.355  -14.442 1.00 0.00 ? 170 PHE A HZ     3  
ATOM   10253  N  N      . ASP A 1 164 ? -6.827  0.535   -11.166 1.00 0.00 ? 171 ASP A N      3  
ATOM   10254  C  CA     . ASP A 1 164 ? -7.954  1.452   -11.033 1.00 0.00 ? 171 ASP A CA     3  
ATOM   10255  C  C      . ASP A 1 164 ? -7.533  2.720   -10.298 1.00 0.00 ? 171 ASP A C      3  
ATOM   10256  O  O      . ASP A 1 164 ? -7.733  3.833   -10.785 1.00 0.00 ? 171 ASP A O      3  
ATOM   10257  C  CB     . ASP A 1 164 ? -9.083  0.759   -10.269 1.00 0.00 ? 171 ASP A CB     3  
ATOM   10258  C  CG     . ASP A 1 164 ? -10.449 1.307   -10.606 1.00 0.00 ? 171 ASP A CG     3  
ATOM   10259  O  OD1    . ASP A 1 164 ? -10.898 2.258   -9.941  1.00 0.00 ? 171 ASP A OD1    3  
ATOM   10260  O  OD2    . ASP A 1 164 ? -11.089 0.759   -11.530 1.00 0.00 ? 171 ASP A OD2    3  
ATOM   10261  H  H      . ASP A 1 164 ? -6.888  -0.351  -10.743 1.00 0.00 ? 171 ASP A H      3  
ATOM   10262  H  HA     . ASP A 1 164 ? -8.298  1.713   -12.023 1.00 0.00 ? 171 ASP A HA     3  
ATOM   10263  H  HB2    . ASP A 1 164 ? -9.072  -0.294  -10.507 1.00 0.00 ? 171 ASP A HB2    3  
ATOM   10264  H  HB3    . ASP A 1 164 ? -8.918  0.883   -9.210  1.00 0.00 ? 171 ASP A HB3    3  
ATOM   10265  N  N      . LEU A 1 165 ? -6.912  2.541   -9.140  1.00 0.00 ? 172 LEU A N      3  
ATOM   10266  C  CA     . LEU A 1 165 ? -6.470  3.662   -8.325  1.00 0.00 ? 172 LEU A CA     3  
ATOM   10267  C  C      . LEU A 1 165 ? -5.328  4.400   -9.015  1.00 0.00 ? 172 LEU A C      3  
ATOM   10268  O  O      . LEU A 1 165 ? -5.224  5.626   -8.936  1.00 0.00 ? 172 LEU A O      3  
ATOM   10269  C  CB     . LEU A 1 165 ? -6.053  3.162   -6.940  1.00 0.00 ? 172 LEU A CB     3  
ATOM   10270  C  CG     . LEU A 1 165 ? -5.889  4.247   -5.875  1.00 0.00 ? 172 LEU A CG     3  
ATOM   10271  C  CD1    . LEU A 1 165 ? -6.241  3.704   -4.503  1.00 0.00 ? 172 LEU A CD1    3  
ATOM   10272  C  CD2    . LEU A 1 165 ? -4.478  4.777   -5.860  1.00 0.00 ? 172 LEU A CD2    3  
ATOM   10273  H  H      . LEU A 1 165 ? -6.753  1.626   -8.821  1.00 0.00 ? 172 LEU A H      3  
ATOM   10274  H  HA     . LEU A 1 165 ? -7.298  4.342   -8.214  1.00 0.00 ? 172 LEU A HA     3  
ATOM   10275  H  HB2    . LEU A 1 165 ? -6.798  2.459   -6.597  1.00 0.00 ? 172 LEU A HB2    3  
ATOM   10276  H  HB3    . LEU A 1 165 ? -5.112  2.643   -7.039  1.00 0.00 ? 172 LEU A HB3    3  
ATOM   10277  H  HG     . LEU A 1 165 ? -6.545  5.071   -6.097  1.00 0.00 ? 172 LEU A HG     3  
ATOM   10278  H  HD11   . LEU A 1 165 ? -6.137  4.487   -3.769  1.00 0.00 ? 172 LEU A HD11   3  
ATOM   10279  H  HD12   . LEU A 1 165 ? -5.572  2.889   -4.258  1.00 0.00 ? 172 LEU A HD12   3  
ATOM   10280  H  HD13   . LEU A 1 165 ? -7.259  3.344   -4.507  1.00 0.00 ? 172 LEU A HD13   3  
ATOM   10281  H  HD21   . LEU A 1 165 ? -4.237  5.165   -6.837  1.00 0.00 ? 172 LEU A HD21   3  
ATOM   10282  H  HD22   . LEU A 1 165 ? -3.796  3.978   -5.607  1.00 0.00 ? 172 LEU A HD22   3  
ATOM   10283  H  HD23   . LEU A 1 165 ? -4.405  5.566   -5.129  1.00 0.00 ? 172 LEU A HD23   3  
ATOM   10284  N  N      . MET A 1 166 ? -4.489  3.648   -9.719  1.00 0.00 ? 173 MET A N      3  
ATOM   10285  C  CA     . MET A 1 166 ? -3.369  4.228   -10.444 1.00 0.00 ? 173 MET A CA     3  
ATOM   10286  C  C      . MET A 1 166 ? -3.845  5.168   -11.542 1.00 0.00 ? 173 MET A C      3  
ATOM   10287  O  O      . MET A 1 166 ? -3.158  6.132   -11.883 1.00 0.00 ? 173 MET A O      3  
ATOM   10288  C  CB     . MET A 1 166 ? -2.474  3.146   -11.050 1.00 0.00 ? 173 MET A CB     3  
ATOM   10289  C  CG     . MET A 1 166 ? -1.490  2.547   -10.061 1.00 0.00 ? 173 MET A CG     3  
ATOM   10290  S  SD     . MET A 1 166 ? -0.148  1.661   -10.876 1.00 0.00 ? 173 MET A SD     3  
ATOM   10291  C  CE     . MET A 1 166 ? -1.022  0.254   -11.555 1.00 0.00 ? 173 MET A CE     3  
ATOM   10292  H  H      . MET A 1 166 ? -4.635  2.678   -9.755  1.00 0.00 ? 173 MET A H      3  
ATOM   10293  H  HA     . MET A 1 166 ? -2.787  4.799   -9.738  1.00 0.00 ? 173 MET A HA     3  
ATOM   10294  H  HB2    . MET A 1 166 ? -3.100  2.351   -11.431 1.00 0.00 ? 173 MET A HB2    3  
ATOM   10295  H  HB3    . MET A 1 166 ? -1.915  3.574   -11.868 1.00 0.00 ? 173 MET A HB3    3  
ATOM   10296  H  HG2    . MET A 1 166 ? -1.068  3.344   -9.470  1.00 0.00 ? 173 MET A HG2    3  
ATOM   10297  H  HG3    . MET A 1 166 ? -2.019  1.860   -9.416  1.00 0.00 ? 173 MET A HG3    3  
ATOM   10298  H  HE1    . MET A 1 166 ? -1.765  0.596   -12.259 1.00 0.00 ? 173 MET A HE1    3  
ATOM   10299  H  HE2    . MET A 1 166 ? -1.505  -0.288  -10.755 1.00 0.00 ? 173 MET A HE2    3  
ATOM   10300  H  HE3    . MET A 1 166 ? -0.321  -0.398  -12.057 1.00 0.00 ? 173 MET A HE3    3  
ATOM   10301  N  N      . ARG A 1 167 ? -5.010  4.884   -12.097 1.00 0.00 ? 174 ARG A N      3  
ATOM   10302  C  CA     . ARG A 1 167 ? -5.540  5.672   -13.197 1.00 0.00 ? 174 ARG A CA     3  
ATOM   10303  C  C      . ARG A 1 167 ? -5.875  7.097   -12.772 1.00 0.00 ? 174 ARG A C      3  
ATOM   10304  O  O      . ARG A 1 167 ? -5.533  8.047   -13.476 1.00 0.00 ? 174 ARG A O      3  
ATOM   10305  C  CB     . ARG A 1 167 ? -6.747  4.975   -13.812 1.00 0.00 ? 174 ARG A CB     3  
ATOM   10306  C  CG     . ARG A 1 167 ? -6.345  3.895   -14.803 1.00 0.00 ? 174 ARG A CG     3  
ATOM   10307  C  CD     . ARG A 1 167 ? -5.559  4.494   -15.958 1.00 0.00 ? 174 ARG A CD     3  
ATOM   10308  N  NE     . ARG A 1 167 ? -6.375  5.441   -16.713 1.00 0.00 ? 174 ARG A NE     3  
ATOM   10309  C  CZ     . ARG A 1 167 ? -5.916  6.233   -17.677 1.00 0.00 ? 174 ARG A CZ     3  
ATOM   10310  N  NH1    . ARG A 1 167 ? -4.691  6.067   -18.156 1.00 0.00 ? 174 ARG A NH1    3  
ATOM   10311  N  NH2    . ARG A 1 167 ? -6.704  7.163   -18.195 1.00 0.00 ? 174 ARG A NH2    3  
ATOM   10312  H  H      . ARG A 1 167 ? -5.535  4.125   -11.754 1.00 0.00 ? 174 ARG A H      3  
ATOM   10313  H  HA     . ARG A 1 167 ? -4.764  5.726   -13.948 1.00 0.00 ? 174 ARG A HA     3  
ATOM   10314  H  HB2    . ARG A 1 167 ? -7.331  4.519   -13.024 1.00 0.00 ? 174 ARG A HB2    3  
ATOM   10315  H  HB3    . ARG A 1 167 ? -7.354  5.705   -14.329 1.00 0.00 ? 174 ARG A HB3    3  
ATOM   10316  H  HG2    . ARG A 1 167 ? -5.732  3.164   -14.299 1.00 0.00 ? 174 ARG A HG2    3  
ATOM   10317  H  HG3    . ARG A 1 167 ? -7.235  3.421   -15.191 1.00 0.00 ? 174 ARG A HG3    3  
ATOM   10318  H  HD2    . ARG A 1 167 ? -4.700  5.015   -15.558 1.00 0.00 ? 174 ARG A HD2    3  
ATOM   10319  H  HD3    . ARG A 1 167 ? -5.227  3.706   -16.610 1.00 0.00 ? 174 ARG A HD3    3  
ATOM   10320  H  HE     . ARG A 1 167 ? -7.324  5.522   -16.444 1.00 0.00 ? 174 ARG A HE     3  
ATOM   10321  H  HH11   . ARG A 1 167 ? -4.104  5.340   -17.799 1.00 0.00 ? 174 ARG A HH11   3  
ATOM   10322  H  HH12   . ARG A 1 167 ? -4.346  6.672   -18.889 1.00 0.00 ? 174 ARG A HH12   3  
ATOM   10323  H  HH21   . ARG A 1 167 ? -7.649  7.274   -17.859 1.00 0.00 ? 174 ARG A HH21   3  
ATOM   10324  H  HH22   . ARG A 1 167 ? -6.359  7.782   -18.908 1.00 0.00 ? 174 ARG A HH22   3  
ATOM   10325  N  N      . GLU A 1 168 ? -6.518  7.251   -11.617 1.00 0.00 ? 175 GLU A N      3  
ATOM   10326  C  CA     . GLU A 1 168 ? -6.768  8.567   -11.052 1.00 0.00 ? 175 GLU A CA     3  
ATOM   10327  C  C      . GLU A 1 168 ? -5.468  9.340   -10.861 1.00 0.00 ? 175 GLU A C      3  
ATOM   10328  O  O      . GLU A 1 168 ? -5.396  10.543  -11.112 1.00 0.00 ? 175 GLU A O      3  
ATOM   10329  C  CB     . GLU A 1 168 ? -7.457  8.400   -9.712  1.00 0.00 ? 175 GLU A CB     3  
ATOM   10330  C  CG     . GLU A 1 168 ? -8.844  7.816   -9.833  1.00 0.00 ? 175 GLU A CG     3  
ATOM   10331  C  CD     . GLU A 1 168 ? -9.919  8.881   -9.757  1.00 0.00 ? 175 GLU A CD     3  
ATOM   10332  O  OE1    . GLU A 1 168 ? -9.744  9.846   -8.981  1.00 0.00 ? 175 GLU A OE1    3  
ATOM   10333  O  OE2    . GLU A 1 168 ? -10.922 8.773   -10.490 1.00 0.00 ? 175 GLU A OE2    3  
ATOM   10334  H  H      . GLU A 1 168 ? -6.858  6.456   -11.136 1.00 0.00 ? 175 GLU A H      3  
ATOM   10335  H  HA     . GLU A 1 168 ? -7.414  9.112   -11.723 1.00 0.00 ? 175 GLU A HA     3  
ATOM   10336  H  HB2    . GLU A 1 168 ? -6.864  7.740   -9.095  1.00 0.00 ? 175 GLU A HB2    3  
ATOM   10337  H  HB3    . GLU A 1 168 ? -7.532  9.364   -9.231  1.00 0.00 ? 175 GLU A HB3    3  
ATOM   10338  H  HG2    . GLU A 1 168 ? -8.923  7.315   -10.786 1.00 0.00 ? 175 GLU A HG2    3  
ATOM   10339  H  HG3    . GLU A 1 168 ? -8.988  7.102   -9.044  1.00 0.00 ? 175 GLU A HG3    3  
ATOM   10340  N  N      . ILE A 1 169 ? -4.444  8.620   -10.432 1.00 0.00 ? 176 ILE A N      3  
ATOM   10341  C  CA     . ILE A 1 169 ? -3.133  9.197   -10.156 1.00 0.00 ? 176 ILE A CA     3  
ATOM   10342  C  C      . ILE A 1 169 ? -2.526  9.847   -11.404 1.00 0.00 ? 176 ILE A C      3  
ATOM   10343  O  O      . ILE A 1 169 ? -1.727  10.782  -11.300 1.00 0.00 ? 176 ILE A O      3  
ATOM   10344  C  CB     . ILE A 1 169 ? -2.199  8.104   -9.579  1.00 0.00 ? 176 ILE A CB     3  
ATOM   10345  C  CG1    . ILE A 1 169 ? -2.783  7.622   -8.246  1.00 0.00 ? 176 ILE A CG1    3  
ATOM   10346  C  CG2    . ILE A 1 169 ? -0.775  8.616   -9.395  1.00 0.00 ? 176 ILE A CG2    3  
ATOM   10347  C  CD1    . ILE A 1 169 ? -2.096  6.413   -7.651  1.00 0.00 ? 176 ILE A CD1    3  
ATOM   10348  H  H      . ILE A 1 169 ? -4.576  7.661   -10.281 1.00 0.00 ? 176 ILE A H      3  
ATOM   10349  H  HA     . ILE A 1 169 ? -3.263  9.957   -9.399  1.00 0.00 ? 176 ILE A HA     3  
ATOM   10350  H  HB     . ILE A 1 169 ? -2.175  7.277   -10.273 1.00 0.00 ? 176 ILE A HB     3  
ATOM   10351  H  HG12   . ILE A 1 169 ? -2.714  8.421   -7.524  1.00 0.00 ? 176 ILE A HG12   3  
ATOM   10352  H  HG13   . ILE A 1 169 ? -3.823  7.371   -8.394  1.00 0.00 ? 176 ILE A HG13   3  
ATOM   10353  H  HG21   . ILE A 1 169 ? -0.149  7.816   -9.026  1.00 0.00 ? 176 ILE A HG21   3  
ATOM   10354  H  HG22   . ILE A 1 169 ? -0.775  9.429   -8.684  1.00 0.00 ? 176 ILE A HG22   3  
ATOM   10355  H  HG23   . ILE A 1 169 ? -0.389  8.966   -10.341 1.00 0.00 ? 176 ILE A HG23   3  
ATOM   10356  H  HD11   . ILE A 1 169 ? -1.948  5.670   -8.418  1.00 0.00 ? 176 ILE A HD11   3  
ATOM   10357  H  HD12   . ILE A 1 169 ? -2.726  5.998   -6.868  1.00 0.00 ? 176 ILE A HD12   3  
ATOM   10358  H  HD13   . ILE A 1 169 ? -1.143  6.703   -7.234  1.00 0.00 ? 176 ILE A HD13   3  
ATOM   10359  N  N      . ARG A 1 170 ? -2.923  9.374   -12.585 1.00 0.00 ? 177 ARG A N      3  
ATOM   10360  C  CA     . ARG A 1 170 ? -2.478  9.987   -13.834 1.00 0.00 ? 177 ARG A CA     3  
ATOM   10361  C  C      . ARG A 1 170 ? -3.140  11.349  -14.020 1.00 0.00 ? 177 ARG A C      3  
ATOM   10362  O  O      . ARG A 1 170 ? -2.464  12.354  -14.234 1.00 0.00 ? 177 ARG A O      3  
ATOM   10363  C  CB     . ARG A 1 170 ? -2.799  9.107   -15.047 1.00 0.00 ? 177 ARG A CB     3  
ATOM   10364  C  CG     . ARG A 1 170 ? -1.893  7.898   -15.214 1.00 0.00 ? 177 ARG A CG     3  
ATOM   10365  C  CD     . ARG A 1 170 ? -2.117  7.239   -16.570 1.00 0.00 ? 177 ARG A CD     3  
ATOM   10366  N  NE     . ARG A 1 170 ? -1.266  6.065   -16.780 1.00 0.00 ? 177 ARG A NE     3  
ATOM   10367  C  CZ     . ARG A 1 170 ? -0.919  5.605   -17.991 1.00 0.00 ? 177 ARG A CZ     3  
ATOM   10368  N  NH1    . ARG A 1 170 ? -1.333  6.233   -19.083 1.00 0.00 ? 177 ARG A NH1    3  
ATOM   10369  N  NH2    . ARG A 1 170 ? -0.145  4.532   -18.106 1.00 0.00 ? 177 ARG A NH2    3  
ATOM   10370  H  H      . ARG A 1 170 ? -3.542  8.613   -12.615 1.00 0.00 ? 177 ARG A H      3  
ATOM   10371  H  HA     . ARG A 1 170 ? -1.408  10.127  -13.771 1.00 0.00 ? 177 ARG A HA     3  
ATOM   10372  H  HB2    . ARG A 1 170 ? -3.814  8.752   -14.953 1.00 0.00 ? 177 ARG A HB2    3  
ATOM   10373  H  HB3    . ARG A 1 170 ? -2.725  9.710   -15.940 1.00 0.00 ? 177 ARG A HB3    3  
ATOM   10374  H  HG2    . ARG A 1 170 ? -0.863  8.217   -15.142 1.00 0.00 ? 177 ARG A HG2    3  
ATOM   10375  H  HG3    . ARG A 1 170 ? -2.109  7.186   -14.434 1.00 0.00 ? 177 ARG A HG3    3  
ATOM   10376  H  HD2    . ARG A 1 170 ? -3.151  6.935   -16.641 1.00 0.00 ? 177 ARG A HD2    3  
ATOM   10377  H  HD3    . ARG A 1 170 ? -1.905  7.963   -17.343 1.00 0.00 ? 177 ARG A HD3    3  
ATOM   10378  H  HE     . ARG A 1 170 ? -0.944  5.596   -15.982 1.00 0.00 ? 177 ARG A HE     3  
ATOM   10379  H  HH11   . ARG A 1 170 ? -1.907  7.054   -19.008 1.00 0.00 ? 177 ARG A HH11   3  
ATOM   10380  H  HH12   . ARG A 1 170 ? -1.073  5.894   -20.000 1.00 0.00 ? 177 ARG A HH12   3  
ATOM   10381  H  HH21   . ARG A 1 170 ? 0.187   4.055   -17.293 1.00 0.00 ? 177 ARG A HH21   3  
ATOM   10382  H  HH22   . ARG A 1 170 ? 0.103   4.190   -19.016 1.00 0.00 ? 177 ARG A HH22   3  
ATOM   10383  N  N      . THR A 1 171 ? -4.462  11.368  -13.912 1.00 0.00 ? 178 THR A N      3  
ATOM   10384  C  CA     . THR A 1 171 ? -5.245  12.573  -14.136 1.00 0.00 ? 178 THR A CA     3  
ATOM   10385  C  C      . THR A 1 171 ? -4.863  13.678  -13.149 1.00 0.00 ? 178 THR A C      3  
ATOM   10386  O  O      . THR A 1 171 ? -4.801  14.855  -13.511 1.00 0.00 ? 178 THR A O      3  
ATOM   10387  C  CB     . THR A 1 171 ? -6.746  12.264  -14.014 1.00 0.00 ? 178 THR A CB     3  
ATOM   10388  O  OG1    . THR A 1 171 ? -7.059  11.095  -14.786 1.00 0.00 ? 178 THR A OG1    3  
ATOM   10389  C  CG2    . THR A 1 171 ? -7.583  13.439  -14.498 1.00 0.00 ? 178 THR A CG2    3  
ATOM   10390  H  H      . THR A 1 171 ? -4.931  10.538  -13.677 1.00 0.00 ? 178 THR A H      3  
ATOM   10391  H  HA     . THR A 1 171 ? -5.048  12.916  -15.141 1.00 0.00 ? 178 THR A HA     3  
ATOM   10392  H  HB     . THR A 1 171 ? -6.977  12.077  -12.976 1.00 0.00 ? 178 THR A HB     3  
ATOM   10393  H  HG1    . THR A 1 171 ? -7.699  10.550  -14.297 1.00 0.00 ? 178 THR A HG1    3  
ATOM   10394  H  HG21   . THR A 1 171 ? -7.354  14.313  -13.905 1.00 0.00 ? 178 THR A HG21   3  
ATOM   10395  H  HG22   . THR A 1 171 ? -8.631  13.200  -14.396 1.00 0.00 ? 178 THR A HG22   3  
ATOM   10396  H  HG23   . THR A 1 171 ? -7.357  13.639  -15.536 1.00 0.00 ? 178 THR A HG23   3  
ATOM   10397  N  N      . LYS A 1 172 ? -4.606  13.285  -11.907 1.00 0.00 ? 179 LYS A N      3  
ATOM   10398  C  CA     . LYS A 1 172 ? -4.160  14.217  -10.875 1.00 0.00 ? 179 LYS A CA     3  
ATOM   10399  C  C      . LYS A 1 172 ? -2.915  14.982  -11.321 1.00 0.00 ? 179 LYS A C      3  
ATOM   10400  O  O      . LYS A 1 172 ? -2.893  16.211  -11.328 1.00 0.00 ? 179 LYS A O      3  
ATOM   10401  C  CB     . LYS A 1 172 ? -3.854  13.455  -9.584  1.00 0.00 ? 179 LYS A CB     3  
ATOM   10402  C  CG     . LYS A 1 172 ? -4.979  13.454  -8.558  1.00 0.00 ? 179 LYS A CG     3  
ATOM   10403  C  CD     . LYS A 1 172 ? -6.249  12.776  -9.062  1.00 0.00 ? 179 LYS A CD     3  
ATOM   10404  C  CE     . LYS A 1 172 ? -7.277  12.667  -7.945  1.00 0.00 ? 179 LYS A CE     3  
ATOM   10405  N  NZ     . LYS A 1 172 ? -8.600  12.175  -8.418  1.00 0.00 ? 179 LYS A NZ     3  
ATOM   10406  H  H      . LYS A 1 172 ? -4.724  12.336  -11.673 1.00 0.00 ? 179 LYS A H      3  
ATOM   10407  H  HA     . LYS A 1 172 ? -4.959  14.919  -10.688 1.00 0.00 ? 179 LYS A HA     3  
ATOM   10408  H  HB2    . LYS A 1 172 ? -3.629  12.428  -9.834  1.00 0.00 ? 179 LYS A HB2    3  
ATOM   10409  H  HB3    . LYS A 1 172 ? -2.983  13.900  -9.129  1.00 0.00 ? 179 LYS A HB3    3  
ATOM   10410  H  HG2    . LYS A 1 172 ? -4.639  12.933  -7.677  1.00 0.00 ? 179 LYS A HG2    3  
ATOM   10411  H  HG3    . LYS A 1 172 ? -5.210  14.479  -8.301  1.00 0.00 ? 179 LYS A HG3    3  
ATOM   10412  H  HD2    . LYS A 1 172 ? -6.665  13.361  -9.871  1.00 0.00 ? 179 LYS A HD2    3  
ATOM   10413  H  HD3    . LYS A 1 172 ? -6.003  11.786  -9.416  1.00 0.00 ? 179 LYS A HD3    3  
ATOM   10414  H  HE2    . LYS A 1 172 ? -6.903  11.983  -7.198  1.00 0.00 ? 179 LYS A HE2    3  
ATOM   10415  H  HE3    . LYS A 1 172 ? -7.405  13.643  -7.500  1.00 0.00 ? 179 LYS A HE3    3  
ATOM   10416  H  HZ1    . LYS A 1 172 ? -9.278  12.168  -7.626  1.00 0.00 ? 179 LYS A HZ1    3  
ATOM   10417  H  HZ2    . LYS A 1 172 ? -8.522  11.205  -8.790  1.00 0.00 ? 179 LYS A HZ2    3  
ATOM   10418  H  HZ3    . LYS A 1 172 ? -8.969  12.797  -9.170  1.00 0.00 ? 179 LYS A HZ3    3  
ATOM   10419  N  N      . LYS A 1 173 ? -1.891  14.238  -11.720 1.00 0.00 ? 180 LYS A N      3  
ATOM   10420  C  CA     . LYS A 1 173 ? -0.603  14.822  -12.085 1.00 0.00 ? 180 LYS A CA     3  
ATOM   10421  C  C      . LYS A 1 173 ? -0.669  15.558  -13.412 1.00 0.00 ? 180 LYS A C      3  
ATOM   10422  O  O      . LYS A 1 173 ? 0.100   16.492  -13.649 1.00 0.00 ? 180 LYS A O      3  
ATOM   10423  C  CB     . LYS A 1 173 ? 0.459   13.736  -12.144 1.00 0.00 ? 180 LYS A CB     3  
ATOM   10424  C  CG     . LYS A 1 173 ? 0.824   13.199  -10.775 1.00 0.00 ? 180 LYS A CG     3  
ATOM   10425  C  CD     . LYS A 1 173 ? 1.620   11.909  -10.859 1.00 0.00 ? 180 LYS A CD     3  
ATOM   10426  C  CE     . LYS A 1 173 ? 1.986   11.419  -9.468  1.00 0.00 ? 180 LYS A CE     3  
ATOM   10427  N  NZ     . LYS A 1 173 ? 0.815   11.462  -8.550  1.00 0.00 ? 180 LYS A NZ     3  
ATOM   10428  H  H      . LYS A 1 173 ? -2.003  13.265  -11.772 1.00 0.00 ? 180 LYS A H      3  
ATOM   10429  H  HA     . LYS A 1 173 ? -0.332  15.528  -11.314 1.00 0.00 ? 180 LYS A HA     3  
ATOM   10430  H  HB2    . LYS A 1 173 ? 0.087   12.920  -12.745 1.00 0.00 ? 180 LYS A HB2    3  
ATOM   10431  H  HB3    . LYS A 1 173 ? 1.347   14.138  -12.602 1.00 0.00 ? 180 LYS A HB3    3  
ATOM   10432  H  HG2    . LYS A 1 173 ? 1.417   13.938  -10.256 1.00 0.00 ? 180 LYS A HG2    3  
ATOM   10433  H  HG3    . LYS A 1 173 ? -0.084  13.014  -10.222 1.00 0.00 ? 180 LYS A HG3    3  
ATOM   10434  H  HD2    . LYS A 1 173 ? 1.024   11.157  -11.353 1.00 0.00 ? 180 LYS A HD2    3  
ATOM   10435  H  HD3    . LYS A 1 173 ? 2.526   12.087  -11.421 1.00 0.00 ? 180 LYS A HD3    3  
ATOM   10436  H  HE2    . LYS A 1 173 ? 2.342   10.401  -9.539  1.00 0.00 ? 180 LYS A HE2    3  
ATOM   10437  H  HE3    . LYS A 1 173 ? 2.770   12.048  -9.072  1.00 0.00 ? 180 LYS A HE3    3  
ATOM   10438  H  HZ1    . LYS A 1 173 ? 1.042   10.994  -7.641  1.00 0.00 ? 180 LYS A HZ1    3  
ATOM   10439  H  HZ2    . LYS A 1 173 ? 0.003   10.973  -8.974  1.00 0.00 ? 180 LYS A HZ2    3  
ATOM   10440  H  HZ3    . LYS A 1 173 ? 0.541   12.449  -8.355  1.00 0.00 ? 180 LYS A HZ3    3  
ATOM   10441  N  N      . MET A 1 174 ? -1.562  15.123  -14.289 1.00 0.00 ? 181 MET A N      3  
ATOM   10442  C  CA     . MET A 1 174 ? -1.809  15.852  -15.522 1.00 0.00 ? 181 MET A CA     3  
ATOM   10443  C  C      . MET A 1 174 ? -2.350  17.233  -15.195 1.00 0.00 ? 181 MET A C      3  
ATOM   10444  O  O      . MET A 1 174 ? -1.848  18.235  -15.695 1.00 0.00 ? 181 MET A O      3  
ATOM   10445  C  CB     . MET A 1 174 ? -2.803  15.111  -16.416 1.00 0.00 ? 181 MET A CB     3  
ATOM   10446  C  CG     . MET A 1 174 ? -2.249  13.854  -17.057 1.00 0.00 ? 181 MET A CG     3  
ATOM   10447  S  SD     . MET A 1 174 ? -3.482  12.993  -18.050 1.00 0.00 ? 181 MET A SD     3  
ATOM   10448  C  CE     . MET A 1 174 ? -2.486  11.693  -18.771 1.00 0.00 ? 181 MET A CE     3  
ATOM   10449  H  H      . MET A 1 174 ? -2.058  14.294  -14.106 1.00 0.00 ? 181 MET A H      3  
ATOM   10450  H  HA     . MET A 1 174 ? -0.868  15.957  -16.044 1.00 0.00 ? 181 MET A HA     3  
ATOM   10451  H  HB2    . MET A 1 174 ? -3.663  14.834  -15.825 1.00 0.00 ? 181 MET A HB2    3  
ATOM   10452  H  HB3    . MET A 1 174 ? -3.120  15.778  -17.203 1.00 0.00 ? 181 MET A HB3    3  
ATOM   10453  H  HG2    . MET A 1 174 ? -1.418  14.122  -17.692 1.00 0.00 ? 181 MET A HG2    3  
ATOM   10454  H  HG3    . MET A 1 174 ? -1.906  13.190  -16.277 1.00 0.00 ? 181 MET A HG3    3  
ATOM   10455  H  HE1    . MET A 1 174 ? -3.096  11.099  -19.435 1.00 0.00 ? 181 MET A HE1    3  
ATOM   10456  H  HE2    . MET A 1 174 ? -2.091  11.063  -17.987 1.00 0.00 ? 181 MET A HE2    3  
ATOM   10457  H  HE3    . MET A 1 174 ? -1.670  12.132  -19.326 1.00 0.00 ? 181 MET A HE3    3  
ATOM   10458  N  N      . SER A 1 175 ? -3.344  17.254  -14.307 1.00 0.00 ? 182 SER A N      3  
ATOM   10459  C  CA     . SER A 1 175 ? -4.065  18.470  -13.934 1.00 0.00 ? 182 SER A CA     3  
ATOM   10460  C  C      . SER A 1 175 ? -4.730  19.132  -15.140 1.00 0.00 ? 182 SER A C      3  
ATOM   10461  O  O      . SER A 1 175 ? -4.073  19.563  -16.089 1.00 0.00 ? 182 SER A O      3  
ATOM   10462  C  CB     . SER A 1 175 ? -3.144  19.465  -13.241 1.00 0.00 ? 182 SER A CB     3  
ATOM   10463  O  OG     . SER A 1 175 ? -2.545  18.897  -12.085 1.00 0.00 ? 182 SER A OG     3  
ATOM   10464  H  H      . SER A 1 175 ? -3.590  16.410  -13.864 1.00 0.00 ? 182 SER A H      3  
ATOM   10465  H  HA     . SER A 1 175 ? -4.841  18.181  -13.240 1.00 0.00 ? 182 SER A HA     3  
ATOM   10466  H  HB2    . SER A 1 175 ? -2.365  19.764  -13.926 1.00 0.00 ? 182 SER A HB2    3  
ATOM   10467  H  HB3    . SER A 1 175 ? -3.721  20.331  -12.949 1.00 0.00 ? 182 SER A HB3    3  
ATOM   10468  H  HG     . SER A 1 175 ? -2.763  17.956  -12.036 1.00 0.00 ? 182 SER A HG     3  
ATOM   10469  N  N      . GLU A 1 176 ? -6.041  19.211  -15.096 1.00 0.00 ? 183 GLU A N      3  
ATOM   10470  C  CA     . GLU A 1 176 ? -6.797  19.845  -16.154 1.00 0.00 ? 183 GLU A CA     3  
ATOM   10471  C  C      . GLU A 1 176 ? -6.745  21.361  -16.015 1.00 0.00 ? 183 GLU A C      3  
ATOM   10472  O  O      . GLU A 1 176 ? -7.120  21.913  -14.979 1.00 0.00 ? 183 GLU A O      3  
ATOM   10473  C  CB     . GLU A 1 176 ? -8.237  19.364  -16.119 1.00 0.00 ? 183 GLU A CB     3  
ATOM   10474  C  CG     . GLU A 1 176 ? -9.094  19.965  -17.217 1.00 0.00 ? 183 GLU A CG     3  
ATOM   10475  C  CD     . GLU A 1 176 ? -10.488 19.384  -17.255 1.00 0.00 ? 183 GLU A CD     3  
ATOM   10476  O  OE1    . GLU A 1 176 ? -11.277 19.656  -16.330 1.00 0.00 ? 183 GLU A OE1    3  
ATOM   10477  O  OE2    . GLU A 1 176 ? -10.795 18.653  -18.220 1.00 0.00 ? 183 GLU A OE2    3  
ATOM   10478  H  H      . GLU A 1 176 ? -6.519  18.834  -14.321 1.00 0.00 ? 183 GLU A H      3  
ATOM   10479  H  HA     . GLU A 1 176 ? -6.358  19.565  -17.098 1.00 0.00 ? 183 GLU A HA     3  
ATOM   10480  H  HB2    . GLU A 1 176 ? -8.250  18.289  -16.223 1.00 0.00 ? 183 GLU A HB2    3  
ATOM   10481  H  HB3    . GLU A 1 176 ? -8.660  19.633  -15.164 1.00 0.00 ? 183 GLU A HB3    3  
ATOM   10482  H  HG2    . GLU A 1 176 ? -9.165  21.028  -17.054 1.00 0.00 ? 183 GLU A HG2    3  
ATOM   10483  H  HG3    . GLU A 1 176 ? -8.616  19.782  -18.167 1.00 0.00 ? 183 GLU A HG3    3  
ATOM   10484  N  N      . ASN A 1 177 ? -6.269  22.024  -17.057 1.00 0.00 ? 184 ASN A N      3  
ATOM   10485  C  CA     . ASN A 1 177 ? -6.186  23.476  -17.064 1.00 0.00 ? 184 ASN A CA     3  
ATOM   10486  C  C      . ASN A 1 177 ? -7.060  24.061  -18.160 1.00 0.00 ? 184 ASN A C      3  
ATOM   10487  O  O      . ASN A 1 177 ? -7.011  25.262  -18.418 1.00 0.00 ? 184 ASN A O      3  
ATOM   10488  C  CB     . ASN A 1 177 ? -4.742  23.952  -17.269 1.00 0.00 ? 184 ASN A CB     3  
ATOM   10489  C  CG     . ASN A 1 177 ? -3.818  23.562  -16.133 1.00 0.00 ? 184 ASN A CG     3  
ATOM   10490  O  OD1    . ASN A 1 177 ? -3.728  24.259  -15.122 1.00 0.00 ? 184 ASN A OD1    3  
ATOM   10491  N  ND2    . ASN A 1 177 ? -3.102  22.463  -16.308 1.00 0.00 ? 184 ASN A ND2    3  
ATOM   10492  H  H      . ASN A 1 177 ? -5.963  21.519  -17.845 1.00 0.00 ? 184 ASN A H      3  
ATOM   10493  H  HA     . ASN A 1 177 ? -6.539  23.832  -16.108 1.00 0.00 ? 184 ASN A HA     3  
ATOM   10494  H  HB2    . ASN A 1 177 ? -4.353  23.521  -18.180 1.00 0.00 ? 184 ASN A HB2    3  
ATOM   10495  H  HB3    . ASN A 1 177 ? -4.736  25.028  -17.359 1.00 0.00 ? 184 ASN A HB3    3  
ATOM   10496  H  HD21   . ASN A 1 177 ? -3.206  21.972  -17.151 1.00 0.00 ? 184 ASN A HD21   3  
ATOM   10497  H  HD22   . ASN A 1 177 ? -2.494  22.184  -15.592 1.00 0.00 ? 184 ASN A HD22   3  
ATOM   10498  N  N      . LYS A 1 178 ? -7.849  23.220  -18.818 1.00 0.00 ? 185 LYS A N      3  
ATOM   10499  C  CA     . LYS A 1 178 ? -8.705  23.689  -19.886 1.00 0.00 ? 185 LYS A CA     3  
ATOM   10500  C  C      . LYS A 1 178 ? -10.082 24.061  -19.344 1.00 0.00 ? 185 LYS A C      3  
ATOM   10501  O  O      . LYS A 1 178 ? -10.749 23.193  -18.749 1.00 0.00 ? 185 LYS A O      3  
ATOM   10502  C  CB     . LYS A 1 178 ? -8.807  22.655  -21.018 1.00 0.00 ? 185 LYS A CB     3  
ATOM   10503  C  CG     . LYS A 1 178 ? -9.530  21.363  -20.667 1.00 0.00 ? 185 LYS A CG     3  
ATOM   10504  C  CD     . LYS A 1 178 ? -9.740  20.514  -21.910 1.00 0.00 ? 185 LYS A CD     3  
ATOM   10505  C  CE     . LYS A 1 178 ? -10.691 19.352  -21.662 1.00 0.00 ? 185 LYS A CE     3  
ATOM   10506  N  NZ     . LYS A 1 178 ? -10.125 18.340  -20.734 1.00 0.00 ? 185 LYS A NZ     3  
ATOM   10507  O  OXT    . LYS A 1 178 ? -10.486 25.227  -19.516 1.00 0.00 ? 185 LYS A OXT    3  
ATOM   10508  H  H      . LYS A 1 178 ? -7.868  22.278  -18.574 1.00 0.00 ? 185 LYS A H      3  
ATOM   10509  H  HA     . LYS A 1 178 ? -8.251  24.585  -20.286 1.00 0.00 ? 185 LYS A HA     3  
ATOM   10510  H  HB2    . LYS A 1 178 ? -9.330  23.107  -21.838 1.00 0.00 ? 185 LYS A HB2    3  
ATOM   10511  H  HB3    . LYS A 1 178 ? -7.808  22.402  -21.343 1.00 0.00 ? 185 LYS A HB3    3  
ATOM   10512  H  HG2    . LYS A 1 178 ? -8.937  20.808  -19.955 1.00 0.00 ? 185 LYS A HG2    3  
ATOM   10513  H  HG3    . LYS A 1 178 ? -10.492 21.601  -20.235 1.00 0.00 ? 185 LYS A HG3    3  
ATOM   10514  H  HD2    . LYS A 1 178 ? -10.150 21.135  -22.691 1.00 0.00 ? 185 LYS A HD2    3  
ATOM   10515  H  HD3    . LYS A 1 178 ? -8.785  20.121  -22.227 1.00 0.00 ? 185 LYS A HD3    3  
ATOM   10516  H  HE2    . LYS A 1 178 ? -11.604 19.739  -21.238 1.00 0.00 ? 185 LYS A HE2    3  
ATOM   10517  H  HE3    . LYS A 1 178 ? -10.908 18.879  -22.608 1.00 0.00 ? 185 LYS A HE3    3  
ATOM   10518  H  HZ1    . LYS A 1 178 ? -9.138  18.125  -20.992 1.00 0.00 ? 185 LYS A HZ1    3  
ATOM   10519  H  HZ2    . LYS A 1 178 ? -10.683 17.462  -20.787 1.00 0.00 ? 185 LYS A HZ2    3  
ATOM   10520  H  HZ3    . LYS A 1 178 ? -10.155 18.693  -19.750 1.00 0.00 ? 185 LYS A HZ3    3  
ATOM   10521  N  N      . GLY B 2 1   ? 28.638  -19.569 -0.414  1.00 0.00 ? 391 GLY B N      3  
ATOM   10522  C  CA     . GLY B 2 1   ? 29.535  -18.767 -1.276  1.00 0.00 ? 391 GLY B CA     3  
ATOM   10523  C  C      . GLY B 2 1   ? 28.850  -17.521 -1.786  1.00 0.00 ? 391 GLY B C      3  
ATOM   10524  O  O      . GLY B 2 1   ? 27.684  -17.569 -2.177  1.00 0.00 ? 391 GLY B O      3  
ATOM   10525  H  H1     . GLY B 2 1   ? 29.093  -20.471 -0.155  1.00 0.00 ? 391 GLY B H1     3  
ATOM   10526  H  H2     . GLY B 2 1   ? 27.745  -19.774 -0.915  1.00 0.00 ? 391 GLY B H2     3  
ATOM   10527  H  H3     . GLY B 2 1   ? 28.417  -19.044 0.459   1.00 0.00 ? 391 GLY B H3     3  
ATOM   10528  H  HA2    . GLY B 2 1   ? 30.408  -18.483 -0.709  1.00 0.00 ? 391 GLY B HA2    3  
ATOM   10529  H  HA3    . GLY B 2 1   ? 29.841  -19.369 -2.120  1.00 0.00 ? 391 GLY B HA3    3  
ATOM   10530  N  N      . SER B 2 2   ? 29.564  -16.408 -1.781  1.00 0.00 ? 392 SER B N      3  
ATOM   10531  C  CA     . SER B 2 2   ? 29.008  -15.146 -2.233  1.00 0.00 ? 392 SER B CA     3  
ATOM   10532  C  C      . SER B 2 2   ? 30.107  -14.103 -2.410  1.00 0.00 ? 392 SER B C      3  
ATOM   10533  O  O      . SER B 2 2   ? 30.618  -13.554 -1.437  1.00 0.00 ? 392 SER B O      3  
ATOM   10534  C  CB     . SER B 2 2   ? 27.945  -14.649 -1.243  1.00 0.00 ? 392 SER B CB     3  
ATOM   10535  O  OG     . SER B 2 2   ? 28.418  -14.695 0.093   1.00 0.00 ? 392 SER B OG     3  
ATOM   10536  H  H      . SER B 2 2   ? 30.500  -16.436 -1.471  1.00 0.00 ? 392 SER B H      3  
ATOM   10537  H  HA     . SER B 2 2   ? 28.540  -15.317 -3.191  1.00 0.00 ? 392 SER B HA     3  
ATOM   10538  H  HB2    . SER B 2 2   ? 27.686  -13.630 -1.482  1.00 0.00 ? 392 SER B HB2    3  
ATOM   10539  H  HB3    . SER