data_2KWO
# 
_entry.id   2KWO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KWO         
RCSB  RCSB101666   
WWPDB D_1000101666 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2kwj unspecified 'DPF3b PHD with H3 peptide at ALY14'                    
PDB 2kwk unspecified 'DPF3b PHD with H3 peptide in wild type'                
PDB 2kwo unspecified 'DPF3 PHD with H4 peptide at N-terminal actyl-serine 1' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KWO 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-14 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zeng, L.'        1 
'Zhang, Q.'       2 
'Li, S.'          3 
'Plotnikov, A.N.' 4 
'Walsh, M.J.'     5 
'Zhou, M.'        6 
# 
_citation.id                        primary 
_citation.title                     'Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            466 
_citation.page_first                258 
_citation.page_last                 262 
_citation.year                      2010 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20613843 
_citation.pdbx_database_id_DOI      10.1038/nature09139 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zeng, L.'        1 
primary 'Zhang, Q.'       2 
primary 'Li, S.'          3 
primary 'Plotnikov, A.N.' 4 
primary 'Walsh, M.J.'     5 
primary 'Zhou, M.M.'      6 
# 
_cell.entry_id           2KWO 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2KWO 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'Histone peptide'          2043.406  1 ? ? ?                                    ? 
2 polymer     man 'Zinc finger protein DPF3' 12746.472 1 ? ? 'PHD-types 1 and 2 residues 261-372' ? 
3 non-polymer syn 'ZINC ION'                 65.409    4 ? ? ?                                    ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Zinc finger protein cer-d4, BRG1-associated factor 45C, BAF45C' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes '(SAC)GRGKGGKGLGKGGAKRHRK' SGRGKGGKGLGKGGAKRHRK B ? 
2 'polypeptide(L)' no no  
;GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCD
RGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
;
;GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCD
RGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SAC n 
1 2   GLY n 
1 3   ARG n 
1 4   GLY n 
1 5   LYS n 
1 6   GLY n 
1 7   GLY n 
1 8   LYS n 
1 9   GLY n 
1 10  LEU n 
1 11  GLY n 
1 12  LYS n 
1 13  GLY n 
1 14  GLY n 
1 15  ALA n 
1 16  LYS n 
1 17  ARG n 
1 18  HIS n 
1 19  ARG n 
1 20  LYS n 
2 1   GLY n 
2 2   SER n 
2 3   TYR n 
2 4   CYS n 
2 5   ASP n 
2 6   PHE n 
2 7   CYS n 
2 8   LEU n 
2 9   GLY n 
2 10  GLY n 
2 11  SER n 
2 12  ASN n 
2 13  MET n 
2 14  ASN n 
2 15  LYS n 
2 16  LYS n 
2 17  SER n 
2 18  GLY n 
2 19  ARG n 
2 20  PRO n 
2 21  GLU n 
2 22  GLU n 
2 23  LEU n 
2 24  VAL n 
2 25  SER n 
2 26  CYS n 
2 27  ALA n 
2 28  ASP n 
2 29  CYS n 
2 30  GLY n 
2 31  ARG n 
2 32  SER n 
2 33  GLY n 
2 34  HIS n 
2 35  PRO n 
2 36  THR n 
2 37  CYS n 
2 38  LEU n 
2 39  GLN n 
2 40  PHE n 
2 41  THR n 
2 42  LEU n 
2 43  ASN n 
2 44  MET n 
2 45  THR n 
2 46  GLU n 
2 47  ALA n 
2 48  VAL n 
2 49  LYS n 
2 50  THR n 
2 51  TYR n 
2 52  LYS n 
2 53  TRP n 
2 54  GLN n 
2 55  CYS n 
2 56  ILE n 
2 57  GLU n 
2 58  CYS n 
2 59  LYS n 
2 60  SER n 
2 61  CYS n 
2 62  ILE n 
2 63  LEU n 
2 64  CYS n 
2 65  GLY n 
2 66  THR n 
2 67  SER n 
2 68  GLU n 
2 69  ASN n 
2 70  ASP n 
2 71  ASP n 
2 72  GLN n 
2 73  LEU n 
2 74  LEU n 
2 75  PHE n 
2 76  CYS n 
2 77  ASP n 
2 78  ASP n 
2 79  CYS n 
2 80  ASP n 
2 81  ARG n 
2 82  GLY n 
2 83  TYR n 
2 84  HIS n 
2 85  MET n 
2 86  TYR n 
2 87  CYS n 
2 88  LEU n 
2 89  ASN n 
2 90  PRO n 
2 91  PRO n 
2 92  VAL n 
2 93  ALA n 
2 94  GLU n 
2 95  PRO n 
2 96  PRO n 
2 97  GLU n 
2 98  GLY n 
2 99  SER n 
2 100 TRP n 
2 101 SER n 
2 102 CYS n 
2 103 HIS n 
2 104 LEU n 
2 105 CYS n 
2 106 TRP n 
2 107 GLU n 
2 108 LEU n 
2 109 LEU n 
2 110 LYS n 
2 111 GLU n 
2 112 LYS n 
2 113 ALA n 
2 114 SER n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DPF3, BAF45C, CERD4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 PDB 2KWO       2KWO   1 '(SAC)GRGKGGKGLGKGGAKRHRK' 1   ? 
2 UNP DPF3_HUMAN Q92784 2 
;YCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRG
YHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
;
261 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KWO B 1 ? 20  ? 2KWO   1   ? 20  ? 1   20  
2 2 2KWO A 3 ? 114 ? Q92784 261 ? 372 ? 261 372 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KWO GLY A 1 ? UNP Q92784 ? ? 'EXPRESSION TAG' 259 1 
1 2KWO SER A 2 ? UNP Q92784 ? ? 'EXPRESSION TAG' 260 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SAC 'L-peptide linking' n N-ACETYL-SERINE ? 'C5 H9 N O4'     147.129 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 2 '3D HNCACB'                            
1 2 2 '3D HN(COCA)CB'                        
1 3 1 '3D 1H-15N NOESY'                      
1 4 1 '3D 1H-13C NOESY'                      
1 5 1 '3D_13C-Edited_13C/15N-filtered NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'100 mM sodium phosphate, 2 mM DTT, 100% D2O'        1 '100% D2O'        
'100 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
900 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
600 Bruker Avance 3 'Bruker Avance' 
500 Bruker DRX    4 'Bruker DRX'    
# 
_pdbx_nmr_refine.entry_id           2KWO 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KWO 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KWO 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
;Linge, O'Donoghue and Nilges
;
refinement                   ARIA    2.2  1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                   NMRPipe 2.3  2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift calculation' NMRPipe 2.3  3 
'Johnson, One Moon Scientific'                      'peak picking'               NMRView 5.04 4 
'Johnson, One Moon Scientific'                      'chemical shift assignment'  NMRView 5.04 5 
'Johnson, One Moon Scientific'                      'data analysis'              NMRView 5.04 6 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'         CNS     1.2  7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KWO 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KWO 
_struct.title                     
;Solution structure of the double PHD (plant homeodomain) fingers of human transcriptional protein DPF3b bound to a histone H4 peptide containing N-terminal acetylation at Serine 1
;
_struct.pdbx_descriptor           'entity_1, Zinc finger protein DPF3' 
_struct.pdbx_model_details        'lowest energy, model 20' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KWO 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'acetyl-lysine, Transcription regulation, Nucleus, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR B 41  ? TYR B 51  ? THR A 299 TYR A 309 1 ? 11 
HELX_P HELX_P2 2 CYS B 102 ? ALA B 113 ? CYS A 360 ALA A 371 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A SAC 1   C   ? ? ? 1_555 A GLY 2 N  ? ? B SAC 1   B GLY 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc1  metalc ? ? B HIS 34  ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 292 A ZN  501 1_555 ? ? ? ? ? ? ? 2.093 ? 
metalc2  metalc ? ? B HIS 84  ND1 ? ? ? 1_555 F ZN  . ZN ? ? A HIS 342 A ZN  801 1_555 ? ? ? ? ? ? ? 2.097 ? 
metalc3  metalc ? ? B CYS 4   SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 262 A ZN  501 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc4  metalc ? ? B CYS 105 SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 363 A ZN  701 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc5  metalc ? ? B CYS 64  SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 322 A ZN  801 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc6  metalc ? ? B CYS 61  SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 319 A ZN  801 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc7  metalc ? ? B CYS 58  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 316 A ZN  601 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc8  metalc ? ? B CYS 7   SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 265 A ZN  501 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc9  metalc ? ? B CYS 79  SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 337 A ZN  701 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc10 metalc ? ? B CYS 102 SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 360 A ZN  701 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc11 metalc ? ? B CYS 55  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 313 A ZN  601 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc12 metalc ? ? B CYS 37  SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 295 A ZN  501 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc13 metalc ? ? B CYS 29  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 287 A ZN  601 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc14 metalc ? ? B CYS 76  SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 334 A ZN  701 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc15 metalc ? ? B CYS 87  SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 345 A ZN  801 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc16 metalc ? ? B CYS 26  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 284 A ZN  601 1_555 ? ? ? ? ? ? ? 2.335 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 501' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 601' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 701' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS B 4   ? CYS A 262 . ? 1_555 ? 
2  AC1 5 CYS B 7   ? CYS A 265 . ? 1_555 ? 
3  AC1 5 ASN B 14  ? ASN A 272 . ? 1_555 ? 
4  AC1 5 HIS B 34  ? HIS A 292 . ? 1_555 ? 
5  AC1 5 CYS B 37  ? CYS A 295 . ? 1_555 ? 
6  AC2 4 CYS B 26  ? CYS A 284 . ? 1_555 ? 
7  AC2 4 CYS B 29  ? CYS A 287 . ? 1_555 ? 
8  AC2 4 CYS B 55  ? CYS A 313 . ? 1_555 ? 
9  AC2 4 CYS B 58  ? CYS A 316 . ? 1_555 ? 
10 AC3 5 CYS B 76  ? CYS A 334 . ? 1_555 ? 
11 AC3 5 CYS B 79  ? CYS A 337 . ? 1_555 ? 
12 AC3 5 ARG B 81  ? ARG A 339 . ? 1_555 ? 
13 AC3 5 CYS B 102 ? CYS A 360 . ? 1_555 ? 
14 AC3 5 CYS B 105 ? CYS A 363 . ? 1_555 ? 
15 AC4 4 CYS B 61  ? CYS A 319 . ? 1_555 ? 
16 AC4 4 CYS B 64  ? CYS A 322 . ? 1_555 ? 
17 AC4 4 HIS B 84  ? HIS A 342 . ? 1_555 ? 
18 AC4 4 CYS B 87  ? CYS A 345 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KWO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     C  C1A  . SAC A 1 1   ? 6.398   5.235   -0.718  1.00 0.00 ? 1   SAC B C1A  1  
HETATM 2     C  C2A  . SAC A 1 1   ? 7.559   4.950   -1.677  1.00 0.00 ? 1   SAC B C2A  1  
HETATM 3     O  OAC  . SAC A 1 1   ? 5.533   6.045   -1.055  1.00 0.00 ? 1   SAC B OAC  1  
HETATM 4     N  N    . SAC A 1 1   ? 6.323   4.561   0.427   1.00 0.00 ? 1   SAC B N    1  
HETATM 5     C  CA   . SAC A 1 1   ? 5.113   4.593   1.247   1.00 0.00 ? 1   SAC B CA   1  
HETATM 6     C  C    . SAC A 1 1   ? 4.872   5.995   1.794   1.00 0.00 ? 1   SAC B C    1  
HETATM 7     O  O    . SAC A 1 1   ? 5.788   6.817   1.842   1.00 0.00 ? 1   SAC B O    1  
HETATM 8     C  CB   . SAC A 1 1   ? 5.211   3.584   2.395   1.00 0.00 ? 1   SAC B CB   1  
HETATM 9     O  OG   . SAC A 1 1   ? 4.223   3.832   3.379   1.00 0.00 ? 1   SAC B OG   1  
HETATM 10    H  H1   . SAC A 1 1   ? 7.035   3.926   0.654   1.00 0.00 ? 1   SAC B H1   1  
HETATM 11    H  H2A1 . SAC A 1 1   ? 7.359   5.415   -2.632  1.00 0.00 ? 1   SAC B H2A1 1  
HETATM 12    H  H2A2 . SAC A 1 1   ? 7.663   3.885   -1.810  1.00 0.00 ? 1   SAC B H2A2 1  
HETATM 13    H  H2A3 . SAC A 1 1   ? 8.472   5.353   -1.267  1.00 0.00 ? 1   SAC B H2A3 1  
HETATM 14    H  HA   . SAC A 1 1   ? 4.278   4.323   0.614   1.00 0.00 ? 1   SAC B HA   1  
HETATM 15    H  HB2  . SAC A 1 1   ? 5.068   2.587   2.007   1.00 0.00 ? 1   SAC B HB2  1  
HETATM 16    H  HB3  . SAC A 1 1   ? 6.185   3.653   2.853   1.00 0.00 ? 1   SAC B HB3  1  
HETATM 17    H  HG   . SAC A 1 1   ? 4.040   3.022   3.861   1.00 0.00 ? 1   SAC B HG   1  
ATOM   18    N  N    . GLY A 1 2   ? 3.637   6.262   2.207   1.00 0.00 ? 2   GLY B N    1  
ATOM   19    C  CA   . GLY A 1 2   ? 3.301   7.574   2.725   1.00 0.00 ? 2   GLY B CA   1  
ATOM   20    C  C    . GLY A 1 2   ? 3.502   8.650   1.679   1.00 0.00 ? 2   GLY B C    1  
ATOM   21    O  O    . GLY A 1 2   ? 3.625   9.832   2.001   1.00 0.00 ? 2   GLY B O    1  
ATOM   22    H  H    . GLY A 1 2   ? 2.951   5.564   2.158   1.00 0.00 ? 2   GLY B H    1  
ATOM   23    H  HA2  . GLY A 1 2   ? 2.267   7.574   3.040   1.00 0.00 ? 2   GLY B HA2  1  
ATOM   24    H  HA3  . GLY A 1 2   ? 3.930   7.789   3.576   1.00 0.00 ? 2   GLY B HA3  1  
ATOM   25    N  N    . ARG A 1 3   ? 3.533   8.221   0.418   1.00 0.00 ? 3   ARG B N    1  
ATOM   26    C  CA   . ARG A 1 3   ? 3.733   9.115   -0.718  1.00 0.00 ? 3   ARG B CA   1  
ATOM   27    C  C    . ARG A 1 3   ? 5.129   9.740   -0.676  1.00 0.00 ? 3   ARG B C    1  
ATOM   28    O  O    . ARG A 1 3   ? 5.671   10.006  0.397   1.00 0.00 ? 3   ARG B O    1  
ATOM   29    C  CB   . ARG A 1 3   ? 2.652   10.207  -0.763  1.00 0.00 ? 3   ARG B CB   1  
ATOM   30    C  CG   . ARG A 1 3   ? 3.125   11.517  -1.381  1.00 0.00 ? 3   ARG B CG   1  
ATOM   31    C  CD   . ARG A 1 3   ? 2.024   12.566  -1.401  1.00 0.00 ? 3   ARG B CD   1  
ATOM   32    N  NE   . ARG A 1 3   ? 1.729   13.076  -0.064  1.00 0.00 ? 3   ARG B NE   1  
ATOM   33    C  CZ   . ARG A 1 3   ? 0.905   14.094  0.172   1.00 0.00 ? 3   ARG B CZ   1  
ATOM   34    N  NH1  . ARG A 1 3   ? 0.297   14.707  -0.835  1.00 0.00 ? 3   ARG B NH1  1  
ATOM   35    N  NH2  . ARG A 1 3   ? 0.691   14.500  1.416   1.00 0.00 ? 3   ARG B NH2  1  
ATOM   36    H  H    . ARG A 1 3   ? 3.416   7.263   0.246   1.00 0.00 ? 3   ARG B H    1  
ATOM   37    H  HA   . ARG A 1 3   ? 3.649   8.509   -1.611  1.00 0.00 ? 3   ARG B HA   1  
ATOM   38    H  HB2  . ARG A 1 3   ? 1.822   9.843   -1.348  1.00 0.00 ? 3   ARG B HB2  1  
ATOM   39    H  HB3  . ARG A 1 3   ? 2.310   10.406  0.237   1.00 0.00 ? 3   ARG B HB3  1  
ATOM   40    H  HG2  . ARG A 1 3   ? 3.955   11.897  -0.804  1.00 0.00 ? 3   ARG B HG2  1  
ATOM   41    H  HG3  . ARG A 1 3   ? 3.448   11.329  -2.394  1.00 0.00 ? 3   ARG B HG3  1  
ATOM   42    H  HD2  . ARG A 1 3   ? 2.339   13.387  -2.027  1.00 0.00 ? 3   ARG B HD2  1  
ATOM   43    H  HD3  . ARG A 1 3   ? 1.131   12.122  -1.813  1.00 0.00 ? 3   ARG B HD3  1  
ATOM   44    H  HE   . ARG A 1 3   ? 2.167   12.638  0.695   1.00 0.00 ? 3   ARG B HE   1  
ATOM   45    H  HH11 . ARG A 1 3   ? 0.455   14.405  -1.775  1.00 0.00 ? 3   ARG B HH11 1  
ATOM   46    H  HH12 . ARG A 1 3   ? -0.322  15.472  -0.653  1.00 0.00 ? 3   ARG B HH12 1  
ATOM   47    H  HH21 . ARG A 1 3   ? 1.149   14.040  2.177   1.00 0.00 ? 3   ARG B HH21 1  
ATOM   48    H  HH22 . ARG A 1 3   ? 0.073   15.265  1.593   1.00 0.00 ? 3   ARG B HH22 1  
ATOM   49    N  N    . GLY A 1 4   ? 5.705   9.969   -1.852  1.00 0.00 ? 4   GLY B N    1  
ATOM   50    C  CA   . GLY A 1 4   ? 7.029   10.558  -1.931  1.00 0.00 ? 4   GLY B CA   1  
ATOM   51    C  C    . GLY A 1 4   ? 6.998   12.074  -1.907  1.00 0.00 ? 4   GLY B C    1  
ATOM   52    O  O    . GLY A 1 4   ? 6.066   12.674  -1.370  1.00 0.00 ? 4   GLY B O    1  
ATOM   53    H  H    . GLY A 1 4   ? 5.227   9.735   -2.674  1.00 0.00 ? 4   GLY B H    1  
ATOM   54    H  HA2  . GLY A 1 4   ? 7.616   10.209  -1.095  1.00 0.00 ? 4   GLY B HA2  1  
ATOM   55    H  HA3  . GLY A 1 4   ? 7.500   10.234  -2.847  1.00 0.00 ? 4   GLY B HA3  1  
ATOM   56    N  N    . LYS A 1 5   ? 8.019   12.694  -2.492  1.00 0.00 ? 5   LYS B N    1  
ATOM   57    C  CA   . LYS A 1 5   ? 8.112   14.150  -2.536  1.00 0.00 ? 5   LYS B CA   1  
ATOM   58    C  C    . LYS A 1 5   ? 6.935   14.751  -3.299  1.00 0.00 ? 5   LYS B C    1  
ATOM   59    O  O    . LYS A 1 5   ? 6.355   14.108  -4.173  1.00 0.00 ? 5   LYS B O    1  
ATOM   60    C  CB   . LYS A 1 5   ? 9.431   14.579  -3.186  1.00 0.00 ? 5   LYS B CB   1  
ATOM   61    C  CG   . LYS A 1 5   ? 9.658   16.083  -3.168  1.00 0.00 ? 5   LYS B CG   1  
ATOM   62    C  CD   . LYS A 1 5   ? 10.955  16.470  -3.866  1.00 0.00 ? 5   LYS B CD   1  
ATOM   63    C  CE   . LYS A 1 5   ? 12.177  16.134  -3.023  1.00 0.00 ? 5   LYS B CE   1  
ATOM   64    N  NZ   . LYS A 1 5   ? 12.501  14.681  -3.058  1.00 0.00 ? 5   LYS B NZ   1  
ATOM   65    H  H    . LYS A 1 5   ? 8.728   12.158  -2.905  1.00 0.00 ? 5   LYS B H    1  
ATOM   66    H  HA   . LYS A 1 5   ? 8.089   14.513  -1.519  1.00 0.00 ? 5   LYS B HA   1  
ATOM   67    H  HB2  . LYS A 1 5   ? 10.246  14.106  -2.660  1.00 0.00 ? 5   LYS B HB2  1  
ATOM   68    H  HB3  . LYS A 1 5   ? 9.437   14.247  -4.214  1.00 0.00 ? 5   LYS B HB3  1  
ATOM   69    H  HG2  . LYS A 1 5   ? 8.835   16.566  -3.672  1.00 0.00 ? 5   LYS B HG2  1  
ATOM   70    H  HG3  . LYS A 1 5   ? 9.700   16.417  -2.142  1.00 0.00 ? 5   LYS B HG3  1  
ATOM   71    H  HD2  . LYS A 1 5   ? 11.021  15.936  -4.802  1.00 0.00 ? 5   LYS B HD2  1  
ATOM   72    H  HD3  . LYS A 1 5   ? 10.943  17.534  -4.059  1.00 0.00 ? 5   LYS B HD3  1  
ATOM   73    H  HE2  . LYS A 1 5   ? 13.022  16.690  -3.401  1.00 0.00 ? 5   LYS B HE2  1  
ATOM   74    H  HE3  . LYS A 1 5   ? 11.984  16.427  -2.002  1.00 0.00 ? 5   LYS B HE3  1  
ATOM   75    H  HZ1  . LYS A 1 5   ? 13.397  14.503  -2.561  1.00 0.00 ? 5   LYS B HZ1  1  
ATOM   76    H  HZ2  . LYS A 1 5   ? 12.594  14.358  -4.042  1.00 0.00 ? 5   LYS B HZ2  1  
ATOM   77    H  HZ3  . LYS A 1 5   ? 11.747  14.135  -2.596  1.00 0.00 ? 5   LYS B HZ3  1  
ATOM   78    N  N    . GLY A 1 6   ? 6.591   15.989  -2.958  1.00 0.00 ? 6   GLY B N    1  
ATOM   79    C  CA   . GLY A 1 6   ? 5.487   16.666  -3.614  1.00 0.00 ? 6   GLY B CA   1  
ATOM   80    C  C    . GLY A 1 6   ? 4.863   17.731  -2.736  1.00 0.00 ? 6   GLY B C    1  
ATOM   81    O  O    . GLY A 1 6   ? 3.839   18.317  -3.089  1.00 0.00 ? 6   GLY B O    1  
ATOM   82    H  H    . GLY A 1 6   ? 7.093   16.449  -2.253  1.00 0.00 ? 6   GLY B H    1  
ATOM   83    H  HA2  . GLY A 1 6   ? 5.849   17.127  -4.521  1.00 0.00 ? 6   GLY B HA2  1  
ATOM   84    H  HA3  . GLY A 1 6   ? 4.732   15.937  -3.870  1.00 0.00 ? 6   GLY B HA3  1  
ATOM   85    N  N    . GLY A 1 7   ? 5.485   17.981  -1.588  1.00 0.00 ? 7   GLY B N    1  
ATOM   86    C  CA   . GLY A 1 7   ? 4.978   18.980  -0.666  1.00 0.00 ? 7   GLY B CA   1  
ATOM   87    C  C    . GLY A 1 7   ? 5.527   18.802  0.736   1.00 0.00 ? 7   GLY B C    1  
ATOM   88    O  O    . GLY A 1 7   ? 6.643   18.312  0.913   1.00 0.00 ? 7   GLY B O    1  
ATOM   89    H  H    . GLY A 1 7   ? 6.298   17.481  -1.364  1.00 0.00 ? 7   GLY B H    1  
ATOM   90    H  HA2  . GLY A 1 7   ? 5.252   19.961  -1.027  1.00 0.00 ? 7   GLY B HA2  1  
ATOM   91    H  HA3  . GLY A 1 7   ? 3.901   18.909  -0.630  1.00 0.00 ? 7   GLY B HA3  1  
ATOM   92    N  N    . LYS A 1 8   ? 4.744   19.200  1.734   1.00 0.00 ? 8   LYS B N    1  
ATOM   93    C  CA   . LYS A 1 8   ? 5.161   19.078  3.126   1.00 0.00 ? 8   LYS B CA   1  
ATOM   94    C  C    . LYS A 1 8   ? 4.329   18.027  3.853   1.00 0.00 ? 8   LYS B C    1  
ATOM   95    O  O    . LYS A 1 8   ? 4.782   17.432  4.832   1.00 0.00 ? 8   LYS B O    1  
ATOM   96    C  CB   . LYS A 1 8   ? 5.041   20.427  3.839   1.00 0.00 ? 8   LYS B CB   1  
ATOM   97    C  CG   . LYS A 1 8   ? 3.636   21.008  3.816   1.00 0.00 ? 8   LYS B CG   1  
ATOM   98    C  CD   . LYS A 1 8   ? 3.542   22.293  4.627   1.00 0.00 ? 8   LYS B CD   1  
ATOM   99    C  CE   . LYS A 1 8   ? 4.111   23.486  3.870   1.00 0.00 ? 8   LYS B CE   1  
ATOM   100   N  NZ   . LYS A 1 8   ? 5.588   23.397  3.702   1.00 0.00 ? 8   LYS B NZ   1  
ATOM   101   H  H    . LYS A 1 8   ? 3.866   19.584  1.529   1.00 0.00 ? 8   LYS B H    1  
ATOM   102   H  HA   . LYS A 1 8   ? 6.196   18.769  3.134   1.00 0.00 ? 8   LYS B HA   1  
ATOM   103   H  HB2  . LYS A 1 8   ? 5.340   20.304  4.869   1.00 0.00 ? 8   LYS B HB2  1  
ATOM   104   H  HB3  . LYS A 1 8   ? 5.706   21.131  3.362   1.00 0.00 ? 8   LYS B HB3  1  
ATOM   105   H  HG2  . LYS A 1 8   ? 3.361   21.220  2.794   1.00 0.00 ? 8   LYS B HG2  1  
ATOM   106   H  HG3  . LYS A 1 8   ? 2.951   20.281  4.231   1.00 0.00 ? 8   LYS B HG3  1  
ATOM   107   H  HD2  . LYS A 1 8   ? 2.505   22.488  4.854   1.00 0.00 ? 8   LYS B HD2  1  
ATOM   108   H  HD3  . LYS A 1 8   ? 4.095   22.166  5.546   1.00 0.00 ? 8   LYS B HD3  1  
ATOM   109   H  HE2  . LYS A 1 8   ? 3.651   23.528  2.895   1.00 0.00 ? 8   LYS B HE2  1  
ATOM   110   H  HE3  . LYS A 1 8   ? 3.873   24.387  4.417   1.00 0.00 ? 8   LYS B HE3  1  
ATOM   111   H  HZ1  . LYS A 1 8   ? 5.828   22.628  3.045   1.00 0.00 ? 8   LYS B HZ1  1  
ATOM   112   H  HZ2  . LYS A 1 8   ? 6.041   23.208  4.619   1.00 0.00 ? 8   LYS B HZ2  1  
ATOM   113   H  HZ3  . LYS A 1 8   ? 5.959   24.292  3.323   1.00 0.00 ? 8   LYS B HZ3  1  
ATOM   114   N  N    . GLY A 1 9   ? 3.112   17.803  3.368   1.00 0.00 ? 9   GLY B N    1  
ATOM   115   C  CA   . GLY A 1 9   ? 2.236   16.822  3.982   1.00 0.00 ? 9   GLY B CA   1  
ATOM   116   C  C    . GLY A 1 9   ? 0.947   17.432  4.495   1.00 0.00 ? 9   GLY B C    1  
ATOM   117   O  O    . GLY A 1 9   ? 0.661   18.602  4.239   1.00 0.00 ? 9   GLY B O    1  
ATOM   118   H  H    . GLY A 1 9   ? 2.805   18.309  2.587   1.00 0.00 ? 9   GLY B H    1  
ATOM   119   H  HA2  . GLY A 1 9   ? 1.997   16.063  3.253   1.00 0.00 ? 9   GLY B HA2  1  
ATOM   120   H  HA3  . GLY A 1 9   ? 2.755   16.360  4.809   1.00 0.00 ? 9   GLY B HA3  1  
ATOM   121   N  N    . LEU A 1 10  ? 0.167   16.636  5.220   1.00 0.00 ? 10  LEU B N    1  
ATOM   122   C  CA   . LEU A 1 10  ? -1.100  17.101  5.773   1.00 0.00 ? 10  LEU B CA   1  
ATOM   123   C  C    . LEU A 1 10  ? -1.209  16.752  7.254   1.00 0.00 ? 10  LEU B C    1  
ATOM   124   O  O    . LEU A 1 10  ? -2.102  17.235  7.952   1.00 0.00 ? 10  LEU B O    1  
ATOM   125   C  CB   . LEU A 1 10  ? -2.275  16.498  4.995   1.00 0.00 ? 10  LEU B CB   1  
ATOM   126   C  CG   . LEU A 1 10  ? -2.159  15.003  4.680   1.00 0.00 ? 10  LEU B CG   1  
ATOM   127   C  CD1  . LEU A 1 10  ? -2.403  14.164  5.926   1.00 0.00 ? 10  LEU B CD1  1  
ATOM   128   C  CD2  . LEU A 1 10  ? -3.135  14.616  3.579   1.00 0.00 ? 10  LEU B CD2  1  
ATOM   129   H  H    . LEU A 1 10  ? 0.450   15.714  5.387   1.00 0.00 ? 10  LEU B H    1  
ATOM   130   H  HA   . LEU A 1 10  ? -1.129  18.176  5.670   1.00 0.00 ? 10  LEU B HA   1  
ATOM   131   H  HB2  . LEU A 1 10  ? -3.176  16.653  5.570   1.00 0.00 ? 10  LEU B HB2  1  
ATOM   132   H  HB3  . LEU A 1 10  ? -2.370  17.031  4.061   1.00 0.00 ? 10  LEU B HB3  1  
ATOM   133   H  HG   . LEU A 1 10  ? -1.159  14.793  4.329   1.00 0.00 ? 10  LEU B HG   1  
ATOM   134   H  HD11 . LEU A 1 10  ? -2.397  13.117  5.662   1.00 0.00 ? 10  LEU B HD11 1  
ATOM   135   H  HD12 . LEU A 1 10  ? -3.362  14.423  6.352   1.00 0.00 ? 10  LEU B HD12 1  
ATOM   136   H  HD13 . LEU A 1 10  ? -1.625  14.357  6.649   1.00 0.00 ? 10  LEU B HD13 1  
ATOM   137   H  HD21 . LEU A 1 10  ? -3.034  13.563  3.362   1.00 0.00 ? 10  LEU B HD21 1  
ATOM   138   H  HD22 . LEU A 1 10  ? -2.919  15.190  2.690   1.00 0.00 ? 10  LEU B HD22 1  
ATOM   139   H  HD23 . LEU A 1 10  ? -4.144  14.822  3.904   1.00 0.00 ? 10  LEU B HD23 1  
ATOM   140   N  N    . GLY A 1 11  ? -0.295  15.910  7.727   1.00 0.00 ? 11  GLY B N    1  
ATOM   141   C  CA   . GLY A 1 11  ? -0.303  15.509  9.122   1.00 0.00 ? 11  GLY B CA   1  
ATOM   142   C  C    . GLY A 1 11  ? 0.886   16.053  9.887   1.00 0.00 ? 11  GLY B C    1  
ATOM   143   O  O    . GLY A 1 11  ? 1.892   16.439  9.291   1.00 0.00 ? 11  GLY B O    1  
ATOM   144   H  H    . GLY A 1 11  ? 0.392   15.558  7.123   1.00 0.00 ? 11  GLY B H    1  
ATOM   145   H  HA2  . GLY A 1 11  ? -1.211  15.870  9.583   1.00 0.00 ? 11  GLY B HA2  1  
ATOM   146   H  HA3  . GLY A 1 11  ? -0.289  14.430  9.175   1.00 0.00 ? 11  GLY B HA3  1  
ATOM   147   N  N    . LYS A 1 12  ? 0.772   16.084  11.211  1.00 0.00 ? 12  LYS B N    1  
ATOM   148   C  CA   . LYS A 1 12  ? 1.847   16.586  12.060  1.00 0.00 ? 12  LYS B CA   1  
ATOM   149   C  C    . LYS A 1 12  ? 2.094   15.650  13.239  1.00 0.00 ? 12  LYS B C    1  
ATOM   150   O  O    . LYS A 1 12  ? 2.432   16.093  14.337  1.00 0.00 ? 12  LYS B O    1  
ATOM   151   C  CB   . LYS A 1 12  ? 1.510   17.990  12.568  1.00 0.00 ? 12  LYS B CB   1  
ATOM   152   C  CG   . LYS A 1 12  ? 1.271   18.997  11.455  1.00 0.00 ? 12  LYS B CG   1  
ATOM   153   C  CD   . LYS A 1 12  ? 1.127   20.408  12.001  1.00 0.00 ? 12  LYS B CD   1  
ATOM   154   C  CE   . LYS A 1 12  ? 0.910   21.417  10.885  1.00 0.00 ? 12  LYS B CE   1  
ATOM   155   N  NZ   . LYS A 1 12  ? 0.895   22.815  11.396  1.00 0.00 ? 12  LYS B NZ   1  
ATOM   156   H  H    . LYS A 1 12  ? -0.055  15.762  11.628  1.00 0.00 ? 12  LYS B H    1  
ATOM   157   H  HA   . LYS A 1 12  ? 2.744   16.636  11.462  1.00 0.00 ? 12  LYS B HA   1  
ATOM   158   H  HB2  . LYS A 1 12  ? 0.617   17.937  13.174  1.00 0.00 ? 12  LYS B HB2  1  
ATOM   159   H  HB3  . LYS A 1 12  ? 2.328   18.346  13.177  1.00 0.00 ? 12  LYS B HB3  1  
ATOM   160   H  HG2  . LYS A 1 12  ? 2.106   18.969  10.772  1.00 0.00 ? 12  LYS B HG2  1  
ATOM   161   H  HG3  . LYS A 1 12  ? 0.365   18.729  10.930  1.00 0.00 ? 12  LYS B HG3  1  
ATOM   162   H  HD2  . LYS A 1 12  ? 0.282   20.440  12.671  1.00 0.00 ? 12  LYS B HD2  1  
ATOM   163   H  HD3  . LYS A 1 12  ? 2.027   20.668  12.539  1.00 0.00 ? 12  LYS B HD3  1  
ATOM   164   H  HE2  . LYS A 1 12  ? 1.707   21.315  10.164  1.00 0.00 ? 12  LYS B HE2  1  
ATOM   165   H  HE3  . LYS A 1 12  ? -0.036  21.207  10.406  1.00 0.00 ? 12  LYS B HE3  1  
ATOM   166   H  HZ1  . LYS A 1 12  ? 0.755   23.481  10.610  1.00 0.00 ? 12  LYS B HZ1  1  
ATOM   167   H  HZ2  . LYS A 1 12  ? 1.797   23.034  11.865  1.00 0.00 ? 12  LYS B HZ2  1  
ATOM   168   H  HZ3  . LYS A 1 12  ? 0.122   22.936  12.082  1.00 0.00 ? 12  LYS B HZ3  1  
ATOM   169   N  N    . GLY A 1 13  ? 1.925   14.352  13.002  1.00 0.00 ? 13  GLY B N    1  
ATOM   170   C  CA   . GLY A 1 13  ? 2.134   13.372  14.052  1.00 0.00 ? 13  GLY B CA   1  
ATOM   171   C  C    . GLY A 1 13  ? 2.954   12.187  13.583  1.00 0.00 ? 13  GLY B C    1  
ATOM   172   O  O    . GLY A 1 13  ? 4.056   12.354  13.059  1.00 0.00 ? 13  GLY B O    1  
ATOM   173   H  H    . GLY A 1 13  ? 1.657   14.057  12.107  1.00 0.00 ? 13  GLY B H    1  
ATOM   174   H  HA2  . GLY A 1 13  ? 2.647   13.848  14.876  1.00 0.00 ? 13  GLY B HA2  1  
ATOM   175   H  HA3  . GLY A 1 13  ? 1.174   13.018  14.396  1.00 0.00 ? 13  GLY B HA3  1  
ATOM   176   N  N    . GLY A 1 14  ? 2.416   10.986  13.772  1.00 0.00 ? 14  GLY B N    1  
ATOM   177   C  CA   . GLY A 1 14  ? 3.117   9.784   13.360  1.00 0.00 ? 14  GLY B CA   1  
ATOM   178   C  C    . GLY A 1 14  ? 2.190   8.594   13.208  1.00 0.00 ? 14  GLY B C    1  
ATOM   179   O  O    . GLY A 1 14  ? 2.632   7.493   12.880  1.00 0.00 ? 14  GLY B O    1  
ATOM   180   H  H    . GLY A 1 14  ? 1.535   10.916  14.195  1.00 0.00 ? 14  GLY B H    1  
ATOM   181   H  HA2  . GLY A 1 14  ? 3.603   9.970   12.413  1.00 0.00 ? 14  GLY B HA2  1  
ATOM   182   H  HA3  . GLY A 1 14  ? 3.869   9.548   14.098  1.00 0.00 ? 14  GLY B HA3  1  
ATOM   183   N  N    . ALA A 1 15  ? 0.901   8.816   13.446  1.00 0.00 ? 15  ALA B N    1  
ATOM   184   C  CA   . ALA A 1 15  ? -0.091  7.753   13.334  1.00 0.00 ? 15  ALA B CA   1  
ATOM   185   C  C    . ALA A 1 15  ? -0.499  7.535   11.881  1.00 0.00 ? 15  ALA B C    1  
ATOM   186   O  O    . ALA A 1 15  ? -0.593  8.486   11.105  1.00 0.00 ? 15  ALA B O    1  
ATOM   187   C  CB   . ALA A 1 15  ? -1.310  8.077   14.185  1.00 0.00 ? 15  ALA B CB   1  
ATOM   188   H  H    . ALA A 1 15  ? 0.610   9.716   13.702  1.00 0.00 ? 15  ALA B H    1  
ATOM   189   H  HA   . ALA A 1 15  ? 0.352   6.844   13.714  1.00 0.00 ? 15  ALA B HA   1  
ATOM   190   H  HB1  . ALA A 1 15  ? -2.027  7.273   14.108  1.00 0.00 ? 15  ALA B HB1  1  
ATOM   191   H  HB2  . ALA A 1 15  ? -1.759  8.995   13.836  1.00 0.00 ? 15  ALA B HB2  1  
ATOM   192   H  HB3  . ALA A 1 15  ? -1.009  8.193   15.216  1.00 0.00 ? 15  ALA B HB3  1  
ATOM   193   N  N    . LYS A 1 16  ? -0.736  6.273   11.523  1.00 0.00 ? 16  LYS B N    1  
ATOM   194   C  CA   . LYS A 1 16  ? -1.135  5.912   10.163  1.00 0.00 ? 16  LYS B CA   1  
ATOM   195   C  C    . LYS A 1 16  ? -0.043  6.267   9.155   1.00 0.00 ? 16  LYS B C    1  
ATOM   196   O  O    . LYS A 1 16  ? 0.862   7.049   9.450   1.00 0.00 ? 16  LYS B O    1  
ATOM   197   C  CB   . LYS A 1 16  ? -2.449  6.602   9.779   1.00 0.00 ? 16  LYS B CB   1  
ATOM   198   C  CG   . LYS A 1 16  ? -3.665  6.071   10.524  1.00 0.00 ? 16  LYS B CG   1  
ATOM   199   C  CD   . LYS A 1 16  ? -3.728  6.599   11.949  1.00 0.00 ? 16  LYS B CD   1  
ATOM   200   C  CE   . LYS A 1 16  ? -4.963  6.095   12.677  1.00 0.00 ? 16  LYS B CE   1  
ATOM   201   N  NZ   . LYS A 1 16  ? -5.078  6.674   14.044  1.00 0.00 ? 16  LYS B NZ   1  
ATOM   202   H  H    . LYS A 1 16  ? -0.642  5.564   12.193  1.00 0.00 ? 16  LYS B H    1  
ATOM   203   H  HA   . LYS A 1 16  ? -1.286  4.843   10.142  1.00 0.00 ? 16  LYS B HA   1  
ATOM   204   H  HB2  . LYS A 1 16  ? -2.361  7.658   9.987   1.00 0.00 ? 16  LYS B HB2  1  
ATOM   205   H  HB3  . LYS A 1 16  ? -2.615  6.467   8.721   1.00 0.00 ? 16  LYS B HB3  1  
ATOM   206   H  HG2  . LYS A 1 16  ? -4.558  6.376   9.999   1.00 0.00 ? 16  LYS B HG2  1  
ATOM   207   H  HG3  . LYS A 1 16  ? -3.614  4.992   10.552  1.00 0.00 ? 16  LYS B HG3  1  
ATOM   208   H  HD2  . LYS A 1 16  ? -2.849  6.271   12.483  1.00 0.00 ? 16  LYS B HD2  1  
ATOM   209   H  HD3  . LYS A 1 16  ? -3.753  7.679   11.921  1.00 0.00 ? 16  LYS B HD3  1  
ATOM   210   H  HE2  . LYS A 1 16  ? -5.838  6.367   12.106  1.00 0.00 ? 16  LYS B HE2  1  
ATOM   211   H  HE3  . LYS A 1 16  ? -4.905  5.019   12.755  1.00 0.00 ? 16  LYS B HE3  1  
ATOM   212   H  HZ1  . LYS A 1 16  ? -5.933  6.315   14.514  1.00 0.00 ? 16  LYS B HZ1  1  
ATOM   213   H  HZ2  . LYS A 1 16  ? -5.136  7.711   13.989  1.00 0.00 ? 16  LYS B HZ2  1  
ATOM   214   H  HZ3  . LYS A 1 16  ? -4.247  6.414   14.613  1.00 0.00 ? 16  LYS B HZ3  1  
ATOM   215   N  N    . ARG A 1 17  ? -0.136  5.682   7.964   1.00 0.00 ? 17  ARG B N    1  
ATOM   216   C  CA   . ARG A 1 17  ? 0.840   5.929   6.906   1.00 0.00 ? 17  ARG B CA   1  
ATOM   217   C  C    . ARG A 1 17  ? 0.386   5.300   5.591   1.00 0.00 ? 17  ARG B C    1  
ATOM   218   O  O    . ARG A 1 17  ? -0.566  4.520   5.567   1.00 0.00 ? 17  ARG B O    1  
ATOM   219   C  CB   . ARG A 1 17  ? 2.214   5.374   7.304   1.00 0.00 ? 17  ARG B CB   1  
ATOM   220   C  CG   . ARG A 1 17  ? 2.368   3.869   7.105   1.00 0.00 ? 17  ARG B CG   1  
ATOM   221   C  CD   . ARG A 1 17  ? 1.515   3.069   8.080   1.00 0.00 ? 17  ARG B CD   1  
ATOM   222   N  NE   . ARG A 1 17  ? 0.124   2.964   7.643   1.00 0.00 ? 17  ARG B NE   1  
ATOM   223   C  CZ   . ARG A 1 17  ? -0.504  1.809   7.446   1.00 0.00 ? 17  ARG B CZ   1  
ATOM   224   N  NH1  . ARG A 1 17  ? 0.133   0.660   7.629   1.00 0.00 ? 17  ARG B NH1  1  
ATOM   225   N  NH2  . ARG A 1 17  ? -1.773  1.802   7.061   1.00 0.00 ? 17  ARG B NH2  1  
ATOM   226   H  H    . ARG A 1 17  ? -0.880  5.069   7.791   1.00 0.00 ? 17  ARG B H    1  
ATOM   227   H  HA   . ARG A 1 17  ? 0.919   6.997   6.772   1.00 0.00 ? 17  ARG B HA   1  
ATOM   228   H  HB2  . ARG A 1 17  ? 2.971   5.869   6.714   1.00 0.00 ? 17  ARG B HB2  1  
ATOM   229   H  HB3  . ARG A 1 17  ? 2.387   5.595   8.347   1.00 0.00 ? 17  ARG B HB3  1  
ATOM   230   H  HG2  . ARG A 1 17  ? 2.072   3.618   6.098   1.00 0.00 ? 17  ARG B HG2  1  
ATOM   231   H  HG3  . ARG A 1 17  ? 3.405   3.605   7.250   1.00 0.00 ? 17  ARG B HG3  1  
ATOM   232   H  HD2  . ARG A 1 17  ? 1.929   2.076   8.168   1.00 0.00 ? 17  ARG B HD2  1  
ATOM   233   H  HD3  . ARG A 1 17  ? 1.543   3.555   9.044   1.00 0.00 ? 17  ARG B HD3  1  
ATOM   234   H  HE   . ARG A 1 17  ? -0.368  3.796   7.493   1.00 0.00 ? 17  ARG B HE   1  
ATOM   235   H  HH11 . ARG A 1 17  ? 1.091   0.660   7.916   1.00 0.00 ? 17  ARG B HH11 1  
ATOM   236   H  HH12 . ARG A 1 17  ? -0.344  -0.206  7.479   1.00 0.00 ? 17  ARG B HH12 1  
ATOM   237   H  HH21 . ARG A 1 17  ? -2.257  2.666   6.919   1.00 0.00 ? 17  ARG B HH21 1  
ATOM   238   H  HH22 . ARG A 1 17  ? -2.246  0.934   6.913   1.00 0.00 ? 17  ARG B HH22 1  
ATOM   239   N  N    . HIS A 1 18  ? 1.076   5.643   4.503   1.00 0.00 ? 18  HIS B N    1  
ATOM   240   C  CA   . HIS A 1 18  ? 0.749   5.108   3.183   1.00 0.00 ? 18  HIS B CA   1  
ATOM   241   C  C    . HIS A 1 18  ? -0.673  5.483   2.783   1.00 0.00 ? 18  HIS B C    1  
ATOM   242   O  O    . HIS A 1 18  ? -1.653  5.023   3.370   1.00 0.00 ? 18  HIS B O    1  
ATOM   243   C  CB   . HIS A 1 18  ? 0.998   3.588   3.167   1.00 0.00 ? 18  HIS B CB   1  
ATOM   244   C  CG   . HIS A 1 18  ? 0.287   2.804   2.109   1.00 0.00 ? 18  HIS B CG   1  
ATOM   245   N  ND1  . HIS A 1 18  ? 0.955   2.081   1.138   1.00 0.00 ? 18  HIS B ND1  1  
ATOM   246   C  CD2  . HIS A 1 18  ? -1.023  2.626   1.862   1.00 0.00 ? 18  HIS B CD2  1  
ATOM   247   C  CE1  . HIS A 1 18  ? 0.084   1.504   0.350   1.00 0.00 ? 18  HIS B CE1  1  
ATOM   248   N  NE2  . HIS A 1 18  ? -1.126  1.809   0.766   1.00 0.00 ? 18  HIS B NE2  1  
ATOM   249   H  H    . HIS A 1 18  ? 1.823   6.270   4.592   1.00 0.00 ? 18  HIS B H    1  
ATOM   250   H  HA   . HIS A 1 18  ? 1.420   5.571   2.474   1.00 0.00 ? 18  HIS B HA   1  
ATOM   251   H  HB2  . HIS A 1 18  ? 2.044   3.437   2.994   1.00 0.00 ? 18  HIS B HB2  1  
ATOM   252   H  HB3  . HIS A 1 18  ? 0.732   3.174   4.129   1.00 0.00 ? 18  HIS B HB3  1  
ATOM   253   H  HD1  . HIS A 1 18  ? 1.928   2.008   1.046   1.00 0.00 ? 18  HIS B HD1  1  
ATOM   254   H  HD2  . HIS A 1 18  ? -1.834  3.102   2.377   1.00 0.00 ? 18  HIS B HD2  1  
ATOM   255   H  HE1  . HIS A 1 18  ? 0.321   0.940   -0.522  1.00 0.00 ? 18  HIS B HE1  1  
ATOM   256   H  HE2  . HIS A 1 18  ? -1.956  1.592   0.293   1.00 0.00 ? 18  HIS B HE2  1  
ATOM   257   N  N    . ARG A 1 19  ? -0.759  6.349   1.781   1.00 0.00 ? 19  ARG B N    1  
ATOM   258   C  CA   . ARG A 1 19  ? -2.029  6.828   1.269   1.00 0.00 ? 19  ARG B CA   1  
ATOM   259   C  C    . ARG A 1 19  ? -1.833  7.532   -0.068  1.00 0.00 ? 19  ARG B C    1  
ATOM   260   O  O    . ARG A 1 19  ? -2.349  7.079   -1.088  1.00 0.00 ? 19  ARG B O    1  
ATOM   261   C  CB   . ARG A 1 19  ? -2.628  7.789   2.277   1.00 0.00 ? 19  ARG B CB   1  
ATOM   262   C  CG   . ARG A 1 19  ? -3.311  9.000   1.664   1.00 0.00 ? 19  ARG B CG   1  
ATOM   263   C  CD   . ARG A 1 19  ? -4.740  8.725   1.314   1.00 0.00 ? 19  ARG B CD   1  
ATOM   264   N  NE   . ARG A 1 19  ? -5.569  9.921   1.418   1.00 0.00 ? 19  ARG B NE   1  
ATOM   265   C  CZ   . ARG A 1 19  ? -6.251  10.249  2.514   1.00 0.00 ? 19  ARG B CZ   1  
ATOM   266   N  NH1  . ARG A 1 19  ? -6.196  9.476   3.594   1.00 0.00 ? 19  ARG B NH1  1  
ATOM   267   N  NH2  . ARG A 1 19  ? -6.986  11.353  2.532   1.00 0.00 ? 19  ARG B NH2  1  
ATOM   268   H  H    . ARG A 1 19  ? 0.068   6.681   1.373   1.00 0.00 ? 19  ARG B H    1  
ATOM   269   H  HA   . ARG A 1 19  ? -2.688  5.984   1.140   1.00 0.00 ? 19  ARG B HA   1  
ATOM   270   H  HB2  . ARG A 1 19  ? -3.349  7.260   2.883   1.00 0.00 ? 19  ARG B HB2  1  
ATOM   271   H  HB3  . ARG A 1 19  ? -1.828  8.133   2.900   1.00 0.00 ? 19  ARG B HB3  1  
ATOM   272   H  HG2  . ARG A 1 19  ? -3.280  9.804   2.354   1.00 0.00 ? 19  ARG B HG2  1  
ATOM   273   H  HG3  . ARG A 1 19  ? -2.788  9.275   0.764   1.00 0.00 ? 19  ARG B HG3  1  
ATOM   274   H  HD2  . ARG A 1 19  ? -4.764  8.352   0.296   1.00 0.00 ? 19  ARG B HD2  1  
ATOM   275   H  HD3  . ARG A 1 19  ? -5.122  7.970   1.985   1.00 0.00 ? 19  ARG B HD3  1  
ATOM   276   H  HE   . ARG A 1 19  ? -5.622  10.508  0.635   1.00 0.00 ? 19  ARG B HE   1  
ATOM   277   H  HH11 . ARG A 1 19  ? -5.641  8.644   3.586   1.00 0.00 ? 19  ARG B HH11 1  
ATOM   278   H  HH12 . ARG A 1 19  ? -6.710  9.726   4.415   1.00 0.00 ? 19  ARG B HH12 1  
ATOM   279   H  HH21 . ARG A 1 19  ? -7.029  11.939  1.723   1.00 0.00 ? 19  ARG B HH21 1  
ATOM   280   H  HH22 . ARG A 1 19  ? -7.499  11.599  3.355   1.00 0.00 ? 19  ARG B HH22 1  
ATOM   281   N  N    . LYS A 1 20  ? -1.089  8.651   -0.025  1.00 0.00 ? 20  LYS B N    1  
ATOM   282   C  CA   . LYS A 1 20  ? -0.790  9.487   -1.195  1.00 0.00 ? 20  LYS B CA   1  
ATOM   283   C  C    . LYS A 1 20  ? -0.768  10.960  -0.797  1.00 0.00 ? 20  LYS B C    1  
ATOM   284   O  O    . LYS A 1 20  ? -0.224  11.269  0.284   1.00 0.00 ? 20  LYS B O    1  
ATOM   285   C  CB   . LYS A 1 20  ? -1.801  9.276   -2.325  1.00 0.00 ? 20  LYS B CB   1  
ATOM   286   C  CG   . LYS A 1 20  ? -3.248  9.540   -1.942  1.00 0.00 ? 20  LYS B CG   1  
ATOM   287   C  CD   . LYS A 1 20  ? -4.185  9.347   -3.119  1.00 0.00 ? 20  LYS B CD   1  
ATOM   288   C  CE   . LYS A 1 20  ? -3.734  8.239   -4.058  1.00 0.00 ? 20  LYS B CE   1  
ATOM   289   N  NZ   . LYS A 1 20  ? -4.689  8.061   -5.183  1.00 0.00 ? 20  LYS B NZ   1  
ATOM   290   O  OXT  . LYS A 1 20  ? -1.286  11.794  -1.571  1.00 0.00 ? 20  LYS B OXT  1  
ATOM   291   H  H    . LYS A 1 20  ? -0.724  8.927   0.841   1.00 0.00 ? 20  LYS B H    1  
ATOM   292   H  HA   . LYS A 1 20  ? 0.193   9.213   -1.549  1.00 0.00 ? 20  LYS B HA   1  
ATOM   293   H  HB2  . LYS A 1 20  ? -1.553  9.922   -3.145  1.00 0.00 ? 20  LYS B HB2  1  
ATOM   294   H  HB3  . LYS A 1 20  ? -1.726  8.253   -2.656  1.00 0.00 ? 20  LYS B HB3  1  
ATOM   295   H  HG2  . LYS A 1 20  ? -3.539  8.854   -1.160  1.00 0.00 ? 20  LYS B HG2  1  
ATOM   296   H  HG3  . LYS A 1 20  ? -3.337  10.556  -1.585  1.00 0.00 ? 20  LYS B HG3  1  
ATOM   297   H  HD2  . LYS A 1 20  ? -5.157  9.086   -2.737  1.00 0.00 ? 20  LYS B HD2  1  
ATOM   298   H  HD3  . LYS A 1 20  ? -4.250  10.273  -3.672  1.00 0.00 ? 20  LYS B HD3  1  
ATOM   299   H  HE2  . LYS A 1 20  ? -2.765  8.496   -4.461  1.00 0.00 ? 20  LYS B HE2  1  
ATOM   300   H  HE3  . LYS A 1 20  ? -3.659  7.313   -3.499  1.00 0.00 ? 20  LYS B HE3  1  
ATOM   301   H  HZ1  . LYS A 1 20  ? -5.635  7.834   -4.817  1.00 0.00 ? 20  LYS B HZ1  1  
ATOM   302   H  HZ2  . LYS A 1 20  ? -4.372  7.288   -5.801  1.00 0.00 ? 20  LYS B HZ2  1  
ATOM   303   H  HZ3  . LYS A 1 20  ? -4.744  8.935   -5.742  1.00 0.00 ? 20  LYS B HZ3  1  
ATOM   304   N  N    . GLY B 2 1   ? 17.289  0.545   -12.785 1.00 0.00 ? 259 GLY A N    1  
ATOM   305   C  CA   . GLY B 2 1   ? 17.669  0.070   -11.426 1.00 0.00 ? 259 GLY A CA   1  
ATOM   306   C  C    . GLY B 2 1   ? 17.034  0.893   -10.322 1.00 0.00 ? 259 GLY A C    1  
ATOM   307   O  O    . GLY B 2 1   ? 17.325  2.081   -10.180 1.00 0.00 ? 259 GLY A O    1  
ATOM   308   H  H1   . GLY B 2 1   ? 17.749  -0.042  -13.511 1.00 0.00 ? 259 GLY A H1   1  
ATOM   309   H  H2   . GLY B 2 1   ? 17.587  1.533   -12.915 1.00 0.00 ? 259 GLY A H2   1  
ATOM   310   H  H3   . GLY B 2 1   ? 16.258  0.487   -12.909 1.00 0.00 ? 259 GLY A H3   1  
ATOM   311   H  HA2  . GLY B 2 1   ? 17.359  -0.959  -11.317 1.00 0.00 ? 259 GLY A HA2  1  
ATOM   312   H  HA3  . GLY B 2 1   ? 18.743  0.122   -11.326 1.00 0.00 ? 259 GLY A HA3  1  
ATOM   313   N  N    . SER B 2 2   ? 16.166  0.260   -9.539  1.00 0.00 ? 260 SER A N    1  
ATOM   314   C  CA   . SER B 2 2   ? 15.486  0.940   -8.441  1.00 0.00 ? 260 SER A CA   1  
ATOM   315   C  C    . SER B 2 2   ? 15.994  0.479   -7.090  1.00 0.00 ? 260 SER A C    1  
ATOM   316   O  O    . SER B 2 2   ? 16.971  -0.263  -6.989  1.00 0.00 ? 260 SER A O    1  
ATOM   317   C  CB   . SER B 2 2   ? 13.990  0.706   -8.497  1.00 0.00 ? 260 SER A CB   1  
ATOM   318   O  OG   . SER B 2 2   ? 13.692  -0.667  -8.689  1.00 0.00 ? 260 SER A OG   1  
ATOM   319   H  H    . SER B 2 2   ? 15.977  -0.688  -9.703  1.00 0.00 ? 260 SER A H    1  
ATOM   320   H  HA   . SER B 2 2   ? 15.664  1.995   -8.530  1.00 0.00 ? 260 SER A HA   1  
ATOM   321   H  HB2  . SER B 2 2   ? 13.566  1.029   -7.555  1.00 0.00 ? 260 SER A HB2  1  
ATOM   322   H  HB3  . SER B 2 2   ? 13.562  1.279   -9.307  1.00 0.00 ? 260 SER A HB3  1  
ATOM   323   H  HG   . SER B 2 2   ? 13.557  -0.838  -9.624  1.00 0.00 ? 260 SER A HG   1  
ATOM   324   N  N    . TYR B 2 3   ? 15.300  0.934   -6.056  1.00 0.00 ? 261 TYR A N    1  
ATOM   325   C  CA   . TYR B 2 3   ? 15.634  0.603   -4.685  1.00 0.00 ? 261 TYR A CA   1  
ATOM   326   C  C    . TYR B 2 3   ? 14.642  1.247   -3.725  1.00 0.00 ? 261 TYR A C    1  
ATOM   327   O  O    . TYR B 2 3   ? 13.894  2.154   -4.093  1.00 0.00 ? 261 TYR A O    1  
ATOM   328   C  CB   . TYR B 2 3   ? 17.048  1.071   -4.353  1.00 0.00 ? 261 TYR A CB   1  
ATOM   329   C  CG   . TYR B 2 3   ? 17.398  2.395   -4.971  1.00 0.00 ? 261 TYR A CG   1  
ATOM   330   C  CD1  . TYR B 2 3   ? 16.629  3.492   -4.694  1.00 0.00 ? 261 TYR A CD1  1  
ATOM   331   C  CD2  . TYR B 2 3   ? 18.483  2.543   -5.826  1.00 0.00 ? 261 TYR A CD2  1  
ATOM   332   C  CE1  . TYR B 2 3   ? 16.908  4.721   -5.238  1.00 0.00 ? 261 TYR A CE1  1  
ATOM   333   C  CE2  . TYR B 2 3   ? 18.781  3.773   -6.383  1.00 0.00 ? 261 TYR A CE2  1  
ATOM   334   C  CZ   . TYR B 2 3   ? 17.988  4.863   -6.085  1.00 0.00 ? 261 TYR A CZ   1  
ATOM   335   O  OH   . TYR B 2 3   ? 18.274  6.092   -6.632  1.00 0.00 ? 261 TYR A OH   1  
ATOM   336   H  H    . TYR B 2 3   ? 14.532  1.517   -6.224  1.00 0.00 ? 261 TYR A H    1  
ATOM   337   H  HA   . TYR B 2 3   ? 15.582  -0.469  -4.577  1.00 0.00 ? 261 TYR A HA   1  
ATOM   338   H  HB2  . TYR B 2 3   ? 17.144  1.168   -3.285  1.00 0.00 ? 261 TYR A HB2  1  
ATOM   339   H  HB3  . TYR B 2 3   ? 17.747  0.355   -4.700  1.00 0.00 ? 261 TYR A HB3  1  
ATOM   340   H  HD1  . TYR B 2 3   ? 15.792  3.367   -4.028  1.00 0.00 ? 261 TYR A HD1  1  
ATOM   341   H  HD2  . TYR B 2 3   ? 19.096  1.684   -6.054  1.00 0.00 ? 261 TYR A HD2  1  
ATOM   342   H  HE1  . TYR B 2 3   ? 16.284  5.563   -4.995  1.00 0.00 ? 261 TYR A HE1  1  
ATOM   343   H  HE2  . TYR B 2 3   ? 19.627  3.877   -7.045  1.00 0.00 ? 261 TYR A HE2  1  
ATOM   344   H  HH   . TYR B 2 3   ? 18.256  6.762   -5.944  1.00 0.00 ? 261 TYR A HH   1  
ATOM   345   N  N    . CYS B 2 4   ? 14.645  0.758   -2.502  1.00 0.00 ? 262 CYS A N    1  
ATOM   346   C  CA   . CYS B 2 4   ? 13.758  1.259   -1.451  1.00 0.00 ? 262 CYS A CA   1  
ATOM   347   C  C    . CYS B 2 4   ? 13.891  2.761   -1.251  1.00 0.00 ? 262 CYS A C    1  
ATOM   348   O  O    . CYS B 2 4   ? 14.961  3.261   -0.947  1.00 0.00 ? 262 CYS A O    1  
ATOM   349   C  CB   . CYS B 2 4   ? 14.067  0.549   -0.144  1.00 0.00 ? 262 CYS A CB   1  
ATOM   350   S  SG   . CYS B 2 4   ? 13.582  1.406   1.386   1.00 0.00 ? 262 CYS A SG   1  
ATOM   351   H  H    . CYS B 2 4   ? 15.250  0.009   -2.304  1.00 0.00 ? 262 CYS A H    1  
ATOM   352   H  HA   . CYS B 2 4   ? 12.748  1.017   -1.737  1.00 0.00 ? 262 CYS A HA   1  
ATOM   353   H  HB2  . CYS B 2 4   ? 13.560  -0.400  -0.139  1.00 0.00 ? 262 CYS A HB2  1  
ATOM   354   H  HB3  . CYS B 2 4   ? 15.127  0.370   -0.098  1.00 0.00 ? 262 CYS A HB3  1  
ATOM   355   N  N    . ASP B 2 5   ? 12.795  3.476   -1.416  1.00 0.00 ? 263 ASP A N    1  
ATOM   356   C  CA   . ASP B 2 5   ? 12.791  4.922   -1.219  1.00 0.00 ? 263 ASP A CA   1  
ATOM   357   C  C    . ASP B 2 5   ? 13.215  5.292   0.210   1.00 0.00 ? 263 ASP A C    1  
ATOM   358   O  O    . ASP B 2 5   ? 13.382  6.466   0.541   1.00 0.00 ? 263 ASP A O    1  
ATOM   359   C  CB   . ASP B 2 5   ? 11.390  5.444   -1.523  1.00 0.00 ? 263 ASP A CB   1  
ATOM   360   C  CG   . ASP B 2 5   ? 10.824  6.368   -0.457  1.00 0.00 ? 263 ASP A CG   1  
ATOM   361   O  OD1  . ASP B 2 5   ? 11.322  7.507   -0.331  1.00 0.00 ? 263 ASP A OD1  1  
ATOM   362   O  OD2  . ASP B 2 5   ? 9.870   5.956   0.241   1.00 0.00 ? 263 ASP A OD2  1  
ATOM   363   H  H    . ASP B 2 5   ? 11.969  3.026   -1.703  1.00 0.00 ? 263 ASP A H    1  
ATOM   364   H  HA   . ASP B 2 5   ? 13.485  5.353   -1.919  1.00 0.00 ? 263 ASP A HA   1  
ATOM   365   H  HB2  . ASP B 2 5   ? 11.407  5.977   -2.461  1.00 0.00 ? 263 ASP A HB2  1  
ATOM   366   H  HB3  . ASP B 2 5   ? 10.743  4.593   -1.611  1.00 0.00 ? 263 ASP A HB3  1  
ATOM   367   N  N    . PHE B 2 6   ? 13.423  4.273   1.038   1.00 0.00 ? 264 PHE A N    1  
ATOM   368   C  CA   . PHE B 2 6   ? 13.800  4.477   2.443   1.00 0.00 ? 264 PHE A CA   1  
ATOM   369   C  C    . PHE B 2 6   ? 15.283  4.167   2.704   1.00 0.00 ? 264 PHE A C    1  
ATOM   370   O  O    . PHE B 2 6   ? 15.873  4.713   3.634   1.00 0.00 ? 264 PHE A O    1  
ATOM   371   C  CB   . PHE B 2 6   ? 12.898  3.641   3.366   1.00 0.00 ? 264 PHE A CB   1  
ATOM   372   C  CG   . PHE B 2 6   ? 11.435  3.892   3.147   1.00 0.00 ? 264 PHE A CG   1  
ATOM   373   C  CD1  . PHE B 2 6   ? 10.781  3.313   2.076   1.00 0.00 ? 264 PHE A CD1  1  
ATOM   374   C  CD2  . PHE B 2 6   ? 10.716  4.701   4.011   1.00 0.00 ? 264 PHE A CD2  1  
ATOM   375   C  CE1  . PHE B 2 6   ? 9.435   3.534   1.863   1.00 0.00 ? 264 PHE A CE1  1  
ATOM   376   C  CE2  . PHE B 2 6   ? 9.368   4.928   3.805   1.00 0.00 ? 264 PHE A CE2  1  
ATOM   377   C  CZ   . PHE B 2 6   ? 8.727   4.344   2.729   1.00 0.00 ? 264 PHE A CZ   1  
ATOM   378   H  H    . PHE B 2 6   ? 13.333  3.365   0.689   1.00 0.00 ? 264 PHE A H    1  
ATOM   379   H  HA   . PHE B 2 6   ? 13.634  5.516   2.662   1.00 0.00 ? 264 PHE A HA   1  
ATOM   380   H  HB2  . PHE B 2 6   ? 13.080  2.591   3.190   1.00 0.00 ? 264 PHE A HB2  1  
ATOM   381   H  HB3  . PHE B 2 6   ? 13.124  3.867   4.394   1.00 0.00 ? 264 PHE A HB3  1  
ATOM   382   H  HD1  . PHE B 2 6   ? 11.337  2.684   1.398   1.00 0.00 ? 264 PHE A HD1  1  
ATOM   383   H  HD2  . PHE B 2 6   ? 11.217  5.158   4.851   1.00 0.00 ? 264 PHE A HD2  1  
ATOM   384   H  HE1  . PHE B 2 6   ? 8.937   3.074   1.022   1.00 0.00 ? 264 PHE A HE1  1  
ATOM   385   H  HE2  . PHE B 2 6   ? 8.817   5.562   4.483   1.00 0.00 ? 264 PHE A HE2  1  
ATOM   386   H  HZ   . PHE B 2 6   ? 7.676   4.520   2.564   1.00 0.00 ? 264 PHE A HZ   1  
ATOM   387   N  N    . CYS B 2 7   ? 15.879  3.288   1.894   1.00 0.00 ? 265 CYS A N    1  
ATOM   388   C  CA   . CYS B 2 7   ? 17.303  2.943   2.040   1.00 0.00 ? 265 CYS A CA   1  
ATOM   389   C  C    . CYS B 2 7   ? 18.022  3.149   0.739   1.00 0.00 ? 265 CYS A C    1  
ATOM   390   O  O    . CYS B 2 7   ? 19.184  3.551   0.705   1.00 0.00 ? 265 CYS A O    1  
ATOM   391   C  CB   . CYS B 2 7   ? 17.523  1.493   2.473   1.00 0.00 ? 265 CYS A CB   1  
ATOM   392   S  SG   . CYS B 2 7   ? 16.500  0.933   3.859   1.00 0.00 ? 265 CYS A SG   1  
ATOM   393   H  H    . CYS B 2 7   ? 15.358  2.873   1.178   1.00 0.00 ? 265 CYS A H    1  
ATOM   394   H  HA   . CYS B 2 7   ? 17.737  3.595   2.765   1.00 0.00 ? 265 CYS A HA   1  
ATOM   395   H  HB2  . CYS B 2 7   ? 17.329  0.847   1.647   1.00 0.00 ? 265 CYS A HB2  1  
ATOM   396   H  HB3  . CYS B 2 7   ? 18.554  1.378   2.761   1.00 0.00 ? 265 CYS A HB3  1  
ATOM   397   N  N    . LEU B 2 8   ? 17.304  2.876   -0.327  1.00 0.00 ? 266 LEU A N    1  
ATOM   398   C  CA   . LEU B 2 8   ? 17.824  2.997   -1.656  1.00 0.00 ? 266 LEU A CA   1  
ATOM   399   C  C    . LEU B 2 8   ? 18.917  1.967   -1.893  1.00 0.00 ? 266 LEU A C    1  
ATOM   400   O  O    . LEU B 2 8   ? 19.837  2.185   -2.682  1.00 0.00 ? 266 LEU A O    1  
ATOM   401   C  CB   . LEU B 2 8   ? 18.322  4.405   -1.896  1.00 0.00 ? 266 LEU A CB   1  
ATOM   402   C  CG   . LEU B 2 8   ? 17.418  5.475   -1.323  1.00 0.00 ? 266 LEU A CG   1  
ATOM   403   C  CD1  . LEU B 2 8   ? 18.132  6.810   -1.242  1.00 0.00 ? 266 LEU A CD1  1  
ATOM   404   C  CD2  . LEU B 2 8   ? 16.170  5.573   -2.154  1.00 0.00 ? 266 LEU A CD2  1  
ATOM   405   H  H    . LEU B 2 8   ? 16.379  2.599   -0.213  1.00 0.00 ? 266 LEU A H    1  
ATOM   406   H  HA   . LEU B 2 8   ? 17.009  2.808   -2.323  1.00 0.00 ? 266 LEU A HA   1  
ATOM   407   H  HB2  . LEU B 2 8   ? 19.300  4.505   -1.465  1.00 0.00 ? 266 LEU A HB2  1  
ATOM   408   H  HB3  . LEU B 2 8   ? 18.381  4.554   -2.953  1.00 0.00 ? 266 LEU A HB3  1  
ATOM   409   H  HG   . LEU B 2 8   ? 17.127  5.176   -0.339  1.00 0.00 ? 266 LEU A HG   1  
ATOM   410   H  HD11 . LEU B 2 8   ? 19.195  6.640   -1.242  1.00 0.00 ? 266 LEU A HD11 1  
ATOM   411   H  HD12 . LEU B 2 8   ? 17.847  7.317   -0.332  1.00 0.00 ? 266 LEU A HD12 1  
ATOM   412   H  HD13 . LEU B 2 8   ? 17.863  7.416   -2.094  1.00 0.00 ? 266 LEU A HD13 1  
ATOM   413   H  HD21 . LEU B 2 8   ? 15.863  4.571   -2.404  1.00 0.00 ? 266 LEU A HD21 1  
ATOM   414   H  HD22 . LEU B 2 8   ? 16.373  6.131   -3.056  1.00 0.00 ? 266 LEU A HD22 1  
ATOM   415   H  HD23 . LEU B 2 8   ? 15.391  6.061   -1.588  1.00 0.00 ? 266 LEU A HD23 1  
ATOM   416   N  N    . GLY B 2 9   ? 18.796  0.836   -1.201  1.00 0.00 ? 267 GLY A N    1  
ATOM   417   C  CA   . GLY B 2 9   ? 19.764  -0.228  -1.332  1.00 0.00 ? 267 GLY A CA   1  
ATOM   418   C  C    . GLY B 2 9   ? 19.386  -1.200  -2.421  1.00 0.00 ? 267 GLY A C    1  
ATOM   419   O  O    . GLY B 2 9   ? 19.628  -0.940  -3.600  1.00 0.00 ? 267 GLY A O    1  
ATOM   420   H  H    . GLY B 2 9   ? 18.030  0.719   -0.601  1.00 0.00 ? 267 GLY A H    1  
ATOM   421   H  HA2  . GLY B 2 9   ? 20.732  0.201   -1.553  1.00 0.00 ? 267 GLY A HA2  1  
ATOM   422   H  HA3  . GLY B 2 9   ? 19.824  -0.760  -0.394  1.00 0.00 ? 267 GLY A HA3  1  
ATOM   423   N  N    . GLY B 2 10  ? 18.790  -2.324  -2.036  1.00 0.00 ? 268 GLY A N    1  
ATOM   424   C  CA   . GLY B 2 10  ? 18.384  -3.294  -3.051  1.00 0.00 ? 268 GLY A CA   1  
ATOM   425   C  C    . GLY B 2 10  ? 17.782  -4.605  -2.545  1.00 0.00 ? 268 GLY A C    1  
ATOM   426   O  O    . GLY B 2 10  ? 18.423  -5.651  -2.631  1.00 0.00 ? 268 GLY A O    1  
ATOM   427   H  H    . GLY B 2 10  ? 18.636  -2.484  -1.076  1.00 0.00 ? 268 GLY A H    1  
ATOM   428   H  HA2  . GLY B 2 10  ? 17.652  -2.821  -3.687  1.00 0.00 ? 268 GLY A HA2  1  
ATOM   429   H  HA3  . GLY B 2 10  ? 19.247  -3.527  -3.656  1.00 0.00 ? 268 GLY A HA3  1  
ATOM   430   N  N    . SER B 2 11  ? 16.550  -4.539  -2.035  1.00 0.00 ? 269 SER A N    1  
ATOM   431   C  CA   . SER B 2 11  ? 15.798  -5.723  -1.580  1.00 0.00 ? 269 SER A CA   1  
ATOM   432   C  C    . SER B 2 11  ? 16.630  -6.660  -0.706  1.00 0.00 ? 269 SER A C    1  
ATOM   433   O  O    . SER B 2 11  ? 16.498  -6.644  0.517   1.00 0.00 ? 269 SER A O    1  
ATOM   434   C  CB   . SER B 2 11  ? 15.236  -6.457  -2.795  1.00 0.00 ? 269 SER A CB   1  
ATOM   435   O  OG   . SER B 2 11  ? 14.081  -5.847  -3.324  1.00 0.00 ? 269 SER A OG   1  
ATOM   436   H  H    . SER B 2 11  ? 16.132  -3.659  -1.943  1.00 0.00 ? 269 SER A H    1  
ATOM   437   H  HA   . SER B 2 11  ? 14.975  -5.372  -0.999  1.00 0.00 ? 269 SER A HA   1  
ATOM   438   H  HB2  . SER B 2 11  ? 15.963  -6.448  -3.546  1.00 0.00 ? 269 SER A HB2  1  
ATOM   439   H  HB3  . SER B 2 11  ? 14.995  -7.463  -2.534  1.00 0.00 ? 269 SER A HB3  1  
ATOM   440   H  HG   . SER B 2 11  ? 13.508  -6.520  -3.700  1.00 0.00 ? 269 SER A HG   1  
ATOM   441   N  N    . ASN B 2 12  ? 17.475  -7.486  -1.330  1.00 0.00 ? 270 ASN A N    1  
ATOM   442   C  CA   . ASN B 2 12  ? 18.345  -8.404  -0.589  1.00 0.00 ? 270 ASN A CA   1  
ATOM   443   C  C    . ASN B 2 12  ? 19.226  -7.633  0.379   1.00 0.00 ? 270 ASN A C    1  
ATOM   444   O  O    . ASN B 2 12  ? 20.064  -8.211  1.070   1.00 0.00 ? 270 ASN A O    1  
ATOM   445   C  CB   . ASN B 2 12  ? 19.203  -9.210  -1.542  1.00 0.00 ? 270 ASN A CB   1  
ATOM   446   C  CG   . ASN B 2 12  ? 18.415  -9.780  -2.706  1.00 0.00 ? 270 ASN A CG   1  
ATOM   447   O  OD1  . ASN B 2 12  ? 18.936  -9.925  -3.811  1.00 0.00 ? 270 ASN A OD1  1  
ATOM   448   N  ND2  . ASN B 2 12  ? 17.151  -10.112 -2.462  1.00 0.00 ? 270 ASN A ND2  1  
ATOM   449   H  H    . ASN B 2 12  ? 17.514  -7.477  -2.309  1.00 0.00 ? 270 ASN A H    1  
ATOM   450   H  HA   . ASN B 2 12  ? 17.742  -9.081  -0.025  1.00 0.00 ? 270 ASN A HA   1  
ATOM   451   H  HB2  . ASN B 2 12  ? 19.967  -8.575  -1.924  1.00 0.00 ? 270 ASN A HB2  1  
ATOM   452   H  HB3  . ASN B 2 12  ? 19.653  -10.027 -1.001  1.00 0.00 ? 270 ASN A HB3  1  
ATOM   453   H  HD21 . ASN B 2 12  ? 16.802  -9.973  -1.558  1.00 0.00 ? 270 ASN A HD21 1  
ATOM   454   H  HD22 . ASN B 2 12  ? 16.621  -10.484 -3.198  1.00 0.00 ? 270 ASN A HD22 1  
ATOM   455   N  N    . MET B 2 13  ? 19.031  -6.320  0.414   1.00 0.00 ? 271 MET A N    1  
ATOM   456   C  CA   . MET B 2 13  ? 19.771  -5.459  1.311   1.00 0.00 ? 271 MET A CA   1  
ATOM   457   C  C    . MET B 2 13  ? 18.882  -4.305  1.773   1.00 0.00 ? 271 MET A C    1  
ATOM   458   O  O    . MET B 2 13  ? 18.243  -3.639  0.960   1.00 0.00 ? 271 MET A O    1  
ATOM   459   C  CB   . MET B 2 13  ? 21.027  -4.918  0.639   1.00 0.00 ? 271 MET A CB   1  
ATOM   460   C  CG   . MET B 2 13  ? 22.320  -5.380  1.292   1.00 0.00 ? 271 MET A CG   1  
ATOM   461   S  SD   . MET B 2 13  ? 22.740  -7.086  0.883   1.00 0.00 ? 271 MET A SD   1  
ATOM   462   C  CE   . MET B 2 13  ? 22.922  -7.793  2.519   1.00 0.00 ? 271 MET A CE   1  
ATOM   463   H  H    . MET B 2 13  ? 18.363  -5.919  -0.186  1.00 0.00 ? 271 MET A H    1  
ATOM   464   H  HA   . MET B 2 13  ? 20.057  -6.052  2.165   1.00 0.00 ? 271 MET A HA   1  
ATOM   465   H  HB2  . MET B 2 13  ? 21.033  -5.239  -0.390  1.00 0.00 ? 271 MET A HB2  1  
ATOM   466   H  HB3  . MET B 2 13  ? 20.997  -3.844  0.674   1.00 0.00 ? 271 MET A HB3  1  
ATOM   467   H  HG2  . MET B 2 13  ? 23.123  -4.739  0.960   1.00 0.00 ? 271 MET A HG2  1  
ATOM   468   H  HG3  . MET B 2 13  ? 22.215  -5.297  2.364   1.00 0.00 ? 271 MET A HG3  1  
ATOM   469   H  HE1  . MET B 2 13  ? 21.963  -7.806  3.015   1.00 0.00 ? 271 MET A HE1  1  
ATOM   470   H  HE2  . MET B 2 13  ? 23.616  -7.197  3.093   1.00 0.00 ? 271 MET A HE2  1  
ATOM   471   H  HE3  . MET B 2 13  ? 23.298  -8.802  2.435   1.00 0.00 ? 271 MET A HE3  1  
ATOM   472   N  N    . ASN B 2 14  ? 18.855  -4.076  3.078   1.00 0.00 ? 272 ASN A N    1  
ATOM   473   C  CA   . ASN B 2 14  ? 18.042  -3.025  3.675   1.00 0.00 ? 272 ASN A CA   1  
ATOM   474   C  C    . ASN B 2 14  ? 18.916  -1.824  3.947   1.00 0.00 ? 272 ASN A C    1  
ATOM   475   O  O    . ASN B 2 14  ? 18.641  -1.036  4.842   1.00 0.00 ? 272 ASN A O    1  
ATOM   476   C  CB   . ASN B 2 14  ? 17.405  -3.524  4.978   1.00 0.00 ? 272 ASN A CB   1  
ATOM   477   C  CG   . ASN B 2 14  ? 16.433  -2.530  5.581   1.00 0.00 ? 272 ASN A CG   1  
ATOM   478   O  OD1  . ASN B 2 14  ? 16.298  -2.440  6.801   1.00 0.00 ? 272 ASN A OD1  1  
ATOM   479   N  ND2  . ASN B 2 14  ? 15.745  -1.783  4.729   1.00 0.00 ? 272 ASN A ND2  1  
ATOM   480   H  H    . ASN B 2 14  ? 19.420  -4.621  3.661   1.00 0.00 ? 272 ASN A H    1  
ATOM   481   H  HA   . ASN B 2 14  ? 17.269  -2.754  2.976   1.00 0.00 ? 272 ASN A HA   1  
ATOM   482   H  HB2  . ASN B 2 14  ? 16.872  -4.442  4.780   1.00 0.00 ? 272 ASN A HB2  1  
ATOM   483   H  HB3  . ASN B 2 14  ? 18.187  -3.718  5.699   1.00 0.00 ? 272 ASN A HB3  1  
ATOM   484   H  HD21 . ASN B 2 14  ? 15.898  -1.913  3.770   1.00 0.00 ? 272 ASN A HD21 1  
ATOM   485   H  HD22 . ASN B 2 14  ? 15.115  -1.129  5.094   1.00 0.00 ? 272 ASN A HD22 1  
ATOM   486   N  N    . LYS B 2 15  ? 19.946  -1.710  3.112   1.00 0.00 ? 273 LYS A N    1  
ATOM   487   C  CA   . LYS B 2 15  ? 20.966  -0.678  3.174   1.00 0.00 ? 273 LYS A CA   1  
ATOM   488   C  C    . LYS B 2 15  ? 21.042  0.069   4.502   1.00 0.00 ? 273 LYS A C    1  
ATOM   489   O  O    . LYS B 2 15  ? 22.059  -0.002  5.193   1.00 0.00 ? 273 LYS A O    1  
ATOM   490   C  CB   . LYS B 2 15  ? 20.825  0.246   1.991   1.00 0.00 ? 273 LYS A CB   1  
ATOM   491   C  CG   . LYS B 2 15  ? 21.961  0.008   1.017   1.00 0.00 ? 273 LYS A CG   1  
ATOM   492   C  CD   . LYS B 2 15  ? 22.618  1.291   0.556   1.00 0.00 ? 273 LYS A CD   1  
ATOM   493   C  CE   . LYS B 2 15  ? 21.610  2.190   -0.097  1.00 0.00 ? 273 LYS A CE   1  
ATOM   494   N  NZ   . LYS B 2 15  ? 21.915  3.631   0.114   1.00 0.00 ? 273 LYS A NZ   1  
ATOM   495   H  H    . LYS B 2 15  ? 19.999  -2.340  2.375   1.00 0.00 ? 273 LYS A H    1  
ATOM   496   H  HA   . LYS B 2 15  ? 21.903  -1.188  3.048   1.00 0.00 ? 273 LYS A HA   1  
ATOM   497   H  HB2  . LYS B 2 15  ? 19.881  0.057   1.495   1.00 0.00 ? 273 LYS A HB2  1  
ATOM   498   H  HB3  . LYS B 2 15  ? 20.849  1.254   2.312   1.00 0.00 ? 273 LYS A HB3  1  
ATOM   499   H  HG2  . LYS B 2 15  ? 22.696  -0.591  1.517   1.00 0.00 ? 273 LYS A HG2  1  
ATOM   500   H  HG3  . LYS B 2 15  ? 21.583  -0.526  0.165   1.00 0.00 ? 273 LYS A HG3  1  
ATOM   501   H  HD2  . LYS B 2 15  ? 23.035  1.794   1.407   1.00 0.00 ? 273 LYS A HD2  1  
ATOM   502   H  HD3  . LYS B 2 15  ? 23.398  1.057   -0.153  1.00 0.00 ? 273 LYS A HD3  1  
ATOM   503   H  HE2  . LYS B 2 15  ? 21.589  1.981   -1.157  1.00 0.00 ? 273 LYS A HE2  1  
ATOM   504   H  HE3  . LYS B 2 15  ? 20.652  1.957   0.337   1.00 0.00 ? 273 LYS A HE3  1  
ATOM   505   H  HZ1  . LYS B 2 15  ? 22.854  3.857   -0.273  1.00 0.00 ? 273 LYS A HZ1  1  
ATOM   506   H  HZ2  . LYS B 2 15  ? 21.909  3.854   1.129   1.00 0.00 ? 273 LYS A HZ2  1  
ATOM   507   H  HZ3  . LYS B 2 15  ? 21.204  4.221   -0.364  1.00 0.00 ? 273 LYS A HZ3  1  
ATOM   508   N  N    . LYS B 2 16  ? 19.990  0.785   4.859   1.00 0.00 ? 274 LYS A N    1  
ATOM   509   C  CA   . LYS B 2 16  ? 19.958  1.509   6.118   1.00 0.00 ? 274 LYS A CA   1  
ATOM   510   C  C    . LYS B 2 16  ? 20.221  0.550   7.282   1.00 0.00 ? 274 LYS A C    1  
ATOM   511   O  O    . LYS B 2 16  ? 20.483  0.973   8.408   1.00 0.00 ? 274 LYS A O    1  
ATOM   512   C  CB   . LYS B 2 16  ? 18.606  2.203   6.270   1.00 0.00 ? 274 LYS A CB   1  
ATOM   513   C  CG   . LYS B 2 16  ? 18.366  3.263   5.207   1.00 0.00 ? 274 LYS A CG   1  
ATOM   514   C  CD   . LYS B 2 16  ? 18.681  4.656   5.730   1.00 0.00 ? 274 LYS A CD   1  
ATOM   515   C  CE   . LYS B 2 16  ? 18.635  5.692   4.626   1.00 0.00 ? 274 LYS A CE   1  
ATOM   516   N  NZ   . LYS B 2 16  ? 18.772  7.076   5.157   1.00 0.00 ? 274 LYS A NZ   1  
ATOM   517   H  H    . LYS B 2 16  ? 19.213  0.817   4.272   1.00 0.00 ? 274 LYS A H    1  
ATOM   518   H  HA   . LYS B 2 16  ? 20.739  2.255   6.095   1.00 0.00 ? 274 LYS A HA   1  
ATOM   519   H  HB2  . LYS B 2 16  ? 17.823  1.462   6.194   1.00 0.00 ? 274 LYS A HB2  1  
ATOM   520   H  HB3  . LYS B 2 16  ? 18.558  2.674   7.240   1.00 0.00 ? 274 LYS A HB3  1  
ATOM   521   H  HG2  . LYS B 2 16  ? 19.004  3.055   4.359   1.00 0.00 ? 274 LYS A HG2  1  
ATOM   522   H  HG3  . LYS B 2 16  ? 17.332  3.222   4.893   1.00 0.00 ? 274 LYS A HG3  1  
ATOM   523   H  HD2  . LYS B 2 16  ? 17.962  4.920   6.490   1.00 0.00 ? 274 LYS A HD2  1  
ATOM   524   H  HD3  . LYS B 2 16  ? 19.673  4.651   6.153   1.00 0.00 ? 274 LYS A HD3  1  
ATOM   525   H  HE2  . LYS B 2 16  ? 19.447  5.496   3.946   1.00 0.00 ? 274 LYS A HE2  1  
ATOM   526   H  HE3  . LYS B 2 16  ? 17.696  5.605   4.103   1.00 0.00 ? 274 LYS A HE3  1  
ATOM   527   H  HZ1  . LYS B 2 16  ? 18.038  7.259   5.871   1.00 0.00 ? 274 LYS A HZ1  1  
ATOM   528   H  HZ2  . LYS B 2 16  ? 18.669  7.766   4.386   1.00 0.00 ? 274 LYS A HZ2  1  
ATOM   529   H  HZ3  . LYS B 2 16  ? 19.707  7.200   5.595   1.00 0.00 ? 274 LYS A HZ3  1  
ATOM   530   N  N    . SER B 2 17  ? 20.146  -0.750  6.987   1.00 0.00 ? 275 SER A N    1  
ATOM   531   C  CA   . SER B 2 17  ? 20.395  -1.796  7.960   1.00 0.00 ? 275 SER A CA   1  
ATOM   532   C  C    . SER B 2 17  ? 21.291  -2.865  7.351   1.00 0.00 ? 275 SER A C    1  
ATOM   533   O  O    . SER B 2 17  ? 21.711  -3.802  8.031   1.00 0.00 ? 275 SER A O    1  
ATOM   534   C  CB   . SER B 2 17  ? 19.085  -2.430  8.419   1.00 0.00 ? 275 SER A CB   1  
ATOM   535   O  OG   . SER B 2 17  ? 18.217  -1.466  8.990   1.00 0.00 ? 275 SER A OG   1  
ATOM   536   H  H    . SER B 2 17  ? 19.907  -1.014  6.083   1.00 0.00 ? 275 SER A H    1  
ATOM   537   H  HA   . SER B 2 17  ? 20.898  -1.357  8.802   1.00 0.00 ? 275 SER A HA   1  
ATOM   538   H  HB2  . SER B 2 17  ? 18.592  -2.890  7.575   1.00 0.00 ? 275 SER A HB2  1  
ATOM   539   H  HB3  . SER B 2 17  ? 19.300  -3.184  9.154   1.00 0.00 ? 275 SER A HB3  1  
ATOM   540   H  HG   . SER B 2 17  ? 18.626  -0.599  8.941   1.00 0.00 ? 275 SER A HG   1  
ATOM   541   N  N    . GLY B 2 18  ? 21.578  -2.710  6.061   1.00 0.00 ? 276 GLY A N    1  
ATOM   542   C  CA   . GLY B 2 18  ? 22.415  -3.664  5.363   1.00 0.00 ? 276 GLY A CA   1  
ATOM   543   C  C    . GLY B 2 18  ? 21.904  -5.082  5.449   1.00 0.00 ? 276 GLY A C    1  
ATOM   544   O  O    . GLY B 2 18  ? 22.637  -6.032  5.174   1.00 0.00 ? 276 GLY A O    1  
ATOM   545   H  H    . GLY B 2 18  ? 21.231  -1.926  5.579   1.00 0.00 ? 276 GLY A H    1  
ATOM   546   H  HA2  . GLY B 2 18  ? 22.459  -3.383  4.327   1.00 0.00 ? 276 GLY A HA2  1  
ATOM   547   H  HA3  . GLY B 2 18  ? 23.403  -3.627  5.781   1.00 0.00 ? 276 GLY A HA3  1  
ATOM   548   N  N    . ARG B 2 19  ? 20.647  -5.226  5.827   1.00 0.00 ? 277 ARG A N    1  
ATOM   549   C  CA   . ARG B 2 19  ? 20.039  -6.549  5.941   1.00 0.00 ? 277 ARG A CA   1  
ATOM   550   C  C    . ARG B 2 19  ? 19.132  -6.876  4.778   1.00 0.00 ? 277 ARG A C    1  
ATOM   551   O  O    . ARG B 2 19  ? 18.519  -6.019  4.172   1.00 0.00 ? 277 ARG A O    1  
ATOM   552   C  CB   . ARG B 2 19  ? 19.273  -6.729  7.229   1.00 0.00 ? 277 ARG A CB   1  
ATOM   553   C  CG   . ARG B 2 19  ? 20.004  -7.607  8.217   1.00 0.00 ? 277 ARG A CG   1  
ATOM   554   C  CD   . ARG B 2 19  ? 21.462  -7.244  8.329   1.00 0.00 ? 277 ARG A CD   1  
ATOM   555   N  NE   . ARG B 2 19  ? 22.076  -7.780  9.542   1.00 0.00 ? 277 ARG A NE   1  
ATOM   556   C  CZ   . ARG B 2 19  ? 23.344  -8.173  9.616   1.00 0.00 ? 277 ARG A CZ   1  
ATOM   557   N  NH1  . ARG B 2 19  ? 24.123  -8.122  8.544   1.00 0.00 ? 277 ARG A NH1  1  
ATOM   558   N  NH2  . ARG B 2 19  ? 23.833  -8.624  10.763  1.00 0.00 ? 277 ARG A NH2  1  
ATOM   559   H  H    . ARG B 2 19  ? 20.126  -4.428  6.034   1.00 0.00 ? 277 ARG A H    1  
ATOM   560   H  HA   . ARG B 2 19  ? 20.840  -7.268  5.944   1.00 0.00 ? 277 ARG A HA   1  
ATOM   561   H  HB2  . ARG B 2 19  ? 19.094  -5.773  7.678   1.00 0.00 ? 277 ARG A HB2  1  
ATOM   562   H  HB3  . ARG B 2 19  ? 18.328  -7.204  7.004   1.00 0.00 ? 277 ARG A HB3  1  
ATOM   563   H  HG2  . ARG B 2 19  ? 19.560  -7.467  9.156   1.00 0.00 ? 277 ARG A HG2  1  
ATOM   564   H  HG3  . ARG B 2 19  ? 19.915  -8.639  7.915   1.00 0.00 ? 277 ARG A HG3  1  
ATOM   565   H  HD2  . ARG B 2 19  ? 21.987  -7.627  7.467   1.00 0.00 ? 277 ARG A HD2  1  
ATOM   566   H  HD3  . ARG B 2 19  ? 21.523  -6.179  8.345   1.00 0.00 ? 277 ARG A HD3  1  
ATOM   567   H  HE   . ARG B 2 19  ? 21.517  -7.840  10.344  1.00 0.00 ? 277 ARG A HE   1  
ATOM   568   H  HH11 . ARG B 2 19  ? 23.758  -7.787  7.676   1.00 0.00 ? 277 ARG A HH11 1  
ATOM   569   H  HH12 . ARG B 2 19  ? 25.076  -8.419  8.604   1.00 0.00 ? 277 ARG A HH12 1  
ATOM   570   H  HH21 . ARG B 2 19  ? 23.248  -8.667  11.573  1.00 0.00 ? 277 ARG A HH21 1  
ATOM   571   H  HH22 . ARG B 2 19  ? 24.787  -8.919  10.818  1.00 0.00 ? 277 ARG A HH22 1  
ATOM   572   N  N    . PRO B 2 20  ? 18.989  -8.157  4.516   1.00 0.00 ? 278 PRO A N    1  
ATOM   573   C  CA   . PRO B 2 20  ? 18.191  -8.655  3.410   1.00 0.00 ? 278 PRO A CA   1  
ATOM   574   C  C    . PRO B 2 20  ? 16.691  -8.528  3.618   1.00 0.00 ? 278 PRO A C    1  
ATOM   575   O  O    . PRO B 2 20  ? 16.190  -8.578  4.742   1.00 0.00 ? 278 PRO A O    1  
ATOM   576   C  CB   . PRO B 2 20  ? 18.585  -10.119 3.289   1.00 0.00 ? 278 PRO A CB   1  
ATOM   577   C  CG   . PRO B 2 20  ? 19.638  -10.358 4.321   1.00 0.00 ? 278 PRO A CG   1  
ATOM   578   C  CD   . PRO B 2 20  ? 19.567  -9.223  5.310   1.00 0.00 ? 278 PRO A CD   1  
ATOM   579   H  HA   . PRO B 2 20  ? 18.458  -8.158  2.500   1.00 0.00 ? 278 PRO A HA   1  
ATOM   580   H  HB2  . PRO B 2 20  ? 17.720  -10.738 3.447   1.00 0.00 ? 278 PRO A HB2  1  
ATOM   581   H  HB3  . PRO B 2 20  ? 18.975  -10.282 2.296   1.00 0.00 ? 278 PRO A HB3  1  
ATOM   582   H  HG2  . PRO B 2 20  ? 19.468  -11.303 4.815   1.00 0.00 ? 278 PRO A HG2  1  
ATOM   583   H  HG3  . PRO B 2 20  ? 20.594  -10.356 3.826   1.00 0.00 ? 278 PRO A HG3  1  
ATOM   584   H  HD2  . PRO B 2 20  ? 18.935  -9.441  6.155   1.00 0.00 ? 278 PRO A HD2  1  
ATOM   585   H  HD3  . PRO B 2 20  ? 20.551  -8.945  5.662   1.00 0.00 ? 278 PRO A HD3  1  
ATOM   586   N  N    . GLU B 2 21  ? 15.989  -8.366  2.504   1.00 0.00 ? 279 GLU A N    1  
ATOM   587   C  CA   . GLU B 2 21  ? 14.542  -8.235  2.495   1.00 0.00 ? 279 GLU A CA   1  
ATOM   588   C  C    . GLU B 2 21  ? 14.032  -8.382  1.061   1.00 0.00 ? 279 GLU A C    1  
ATOM   589   O  O    . GLU B 2 21  ? 14.386  -9.341  0.374   1.00 0.00 ? 279 GLU A O    1  
ATOM   590   C  CB   . GLU B 2 21  ? 14.129  -6.891  3.084   1.00 0.00 ? 279 GLU A CB   1  
ATOM   591   C  CG   . GLU B 2 21  ? 12.737  -6.916  3.686   1.00 0.00 ? 279 GLU A CG   1  
ATOM   592   C  CD   . GLU B 2 21  ? 12.604  -7.924  4.811   1.00 0.00 ? 279 GLU A CD   1  
ATOM   593   O  OE1  . GLU B 2 21  ? 12.998  -7.597  5.951   1.00 0.00 ? 279 GLU A OE1  1  
ATOM   594   O  OE2  . GLU B 2 21  ? 12.104  -9.039  4.553   1.00 0.00 ? 279 GLU A OE2  1  
ATOM   595   H  H    . GLU B 2 21  ? 16.468  -8.329  1.651   1.00 0.00 ? 279 GLU A H    1  
ATOM   596   H  HA   . GLU B 2 21  ? 14.124  -9.024  3.099   1.00 0.00 ? 279 GLU A HA   1  
ATOM   597   H  HB2  . GLU B 2 21  ? 14.831  -6.616  3.858   1.00 0.00 ? 279 GLU A HB2  1  
ATOM   598   H  HB3  . GLU B 2 21  ? 14.149  -6.143  2.306   1.00 0.00 ? 279 GLU A HB3  1  
ATOM   599   H  HG2  . GLU B 2 21  ? 12.514  -5.940  4.073   1.00 0.00 ? 279 GLU A HG2  1  
ATOM   600   H  HG3  . GLU B 2 21  ? 12.029  -7.168  2.911   1.00 0.00 ? 279 GLU A HG3  1  
ATOM   601   N  N    . GLU B 2 22  ? 13.215  -7.435  0.607   1.00 0.00 ? 280 GLU A N    1  
ATOM   602   C  CA   . GLU B 2 22  ? 12.680  -7.474  -0.752  1.00 0.00 ? 280 GLU A CA   1  
ATOM   603   C  C    . GLU B 2 22  ? 11.797  -6.276  -1.033  1.00 0.00 ? 280 GLU A C    1  
ATOM   604   O  O    . GLU B 2 22  ? 10.621  -6.246  -0.674  1.00 0.00 ? 280 GLU A O    1  
ATOM   605   C  CB   . GLU B 2 22  ? 11.876  -8.730  -0.992  1.00 0.00 ? 280 GLU A CB   1  
ATOM   606   C  CG   . GLU B 2 22  ? 11.812  -9.091  -2.455  1.00 0.00 ? 280 GLU A CG   1  
ATOM   607   C  CD   . GLU B 2 22  ? 13.097  -9.713  -2.966  1.00 0.00 ? 280 GLU A CD   1  
ATOM   608   O  OE1  . GLU B 2 22  ? 13.358  -10.890 -2.640  1.00 0.00 ? 280 GLU A OE1  1  
ATOM   609   O  OE2  . GLU B 2 22  ? 13.842  -9.021  -3.693  1.00 0.00 ? 280 GLU A OE2  1  
ATOM   610   H  H    . GLU B 2 22  ? 12.965  -6.694  1.195   1.00 0.00 ? 280 GLU A H    1  
ATOM   611   H  HA   . GLU B 2 22  ? 13.513  -7.457  -1.452  1.00 0.00 ? 280 GLU A HA   1  
ATOM   612   H  HB2  . GLU B 2 22  ? 12.316  -9.552  -0.446  1.00 0.00 ? 280 GLU A HB2  1  
ATOM   613   H  HB3  . GLU B 2 22  ? 10.870  -8.562  -0.645  1.00 0.00 ? 280 GLU A HB3  1  
ATOM   614   H  HG2  . GLU B 2 22  ? 11.007  -9.785  -2.601  1.00 0.00 ? 280 GLU A HG2  1  
ATOM   615   H  HG3  . GLU B 2 22  ? 11.620  -8.187  -3.016  1.00 0.00 ? 280 GLU A HG3  1  
ATOM   616   N  N    . LEU B 2 23  ? 12.397  -5.299  -1.673  1.00 0.00 ? 281 LEU A N    1  
ATOM   617   C  CA   . LEU B 2 23  ? 11.730  -4.068  -2.066  1.00 0.00 ? 281 LEU A CA   1  
ATOM   618   C  C    . LEU B 2 23  ? 10.394  -4.288  -2.758  1.00 0.00 ? 281 LEU A C    1  
ATOM   619   O  O    . LEU B 2 23  ? 9.894   -5.405  -2.893  1.00 0.00 ? 281 LEU A O    1  
ATOM   620   C  CB   . LEU B 2 23  ? 12.609  -3.317  -3.045  1.00 0.00 ? 281 LEU A CB   1  
ATOM   621   C  CG   . LEU B 2 23  ? 14.046  -3.162  -2.622  1.00 0.00 ? 281 LEU A CG   1  
ATOM   622   C  CD1  . LEU B 2 23  ? 14.945  -3.115  -3.827  1.00 0.00 ? 281 LEU A CD1  1  
ATOM   623   C  CD2  . LEU B 2 23  ? 14.195  -1.922  -1.823  1.00 0.00 ? 281 LEU A CD2  1  
ATOM   624   H  H    . LEU B 2 23  ? 13.352  -5.394  -1.864  1.00 0.00 ? 281 LEU A H    1  
ATOM   625   H  HA   . LEU B 2 23  ? 11.589  -3.459  -1.190  1.00 0.00 ? 281 LEU A HA   1  
ATOM   626   H  HB2  . LEU B 2 23  ? 12.585  -3.835  -3.991  1.00 0.00 ? 281 LEU A HB2  1  
ATOM   627   H  HB3  . LEU B 2 23  ? 12.195  -2.334  -3.181  1.00 0.00 ? 281 LEU A HB3  1  
ATOM   628   H  HG   . LEU B 2 23  ? 14.330  -3.990  -2.013  1.00 0.00 ? 281 LEU A HG   1  
ATOM   629   H  HD11 . LEU B 2 23  ? 14.356  -2.844  -4.665  1.00 0.00 ? 281 LEU A HD11 1  
ATOM   630   H  HD12 . LEU B 2 23  ? 15.386  -4.087  -3.992  1.00 0.00 ? 281 LEU A HD12 1  
ATOM   631   H  HD13 . LEU B 2 23  ? 15.722  -2.382  -3.675  1.00 0.00 ? 281 LEU A HD13 1  
ATOM   632   H  HD21 . LEU B 2 23  ? 13.624  -1.142  -2.293  1.00 0.00 ? 281 LEU A HD21 1  
ATOM   633   H  HD22 . LEU B 2 23  ? 15.236  -1.638  -1.781  1.00 0.00 ? 281 LEU A HD22 1  
ATOM   634   H  HD23 . LEU B 2 23  ? 13.822  -2.085  -0.826  1.00 0.00 ? 281 LEU A HD23 1  
ATOM   635   N  N    . VAL B 2 24  ? 9.855   -3.171  -3.215  1.00 0.00 ? 282 VAL A N    1  
ATOM   636   C  CA   . VAL B 2 24  ? 8.597   -3.129  -3.953  1.00 0.00 ? 282 VAL A CA   1  
ATOM   637   C  C    . VAL B 2 24  ? 8.582   -1.875  -4.787  1.00 0.00 ? 282 VAL A C    1  
ATOM   638   O  O    . VAL B 2 24  ? 8.446   -0.780  -4.251  1.00 0.00 ? 282 VAL A O    1  
ATOM   639   C  CB   . VAL B 2 24  ? 7.369   -3.085  -3.029  1.00 0.00 ? 282 VAL A CB   1  
ATOM   640   C  CG1  . VAL B 2 24  ? 6.914   -4.453  -2.610  1.00 0.00 ? 282 VAL A CG1  1  
ATOM   641   C  CG2  . VAL B 2 24  ? 7.660   -2.292  -1.820  1.00 0.00 ? 282 VAL A CG2  1  
ATOM   642   H  H    . VAL B 2 24  ? 10.340  -2.321  -3.048  1.00 0.00 ? 282 VAL A H    1  
ATOM   643   H  HA   . VAL B 2 24  ? 8.533   -3.997  -4.592  1.00 0.00 ? 282 VAL A HA   1  
ATOM   644   H  HB   . VAL B 2 24  ? 6.568   -2.596  -3.528  1.00 0.00 ? 282 VAL A HB   1  
ATOM   645   H  HG11 . VAL B 2 24  ? 6.329   -4.343  -1.701  1.00 0.00 ? 282 VAL A HG11 1  
ATOM   646   H  HG12 . VAL B 2 24  ? 7.772   -5.082  -2.421  1.00 0.00 ? 282 VAL A HG12 1  
ATOM   647   H  HG13 . VAL B 2 24  ? 6.302   -4.888  -3.385  1.00 0.00 ? 282 VAL A HG13 1  
ATOM   648   H  HG21 . VAL B 2 24  ? 7.855   -2.975  -1.009  1.00 0.00 ? 282 VAL A HG21 1  
ATOM   649   H  HG22 . VAL B 2 24  ? 6.806   -1.674  -1.578  1.00 0.00 ? 282 VAL A HG22 1  
ATOM   650   H  HG23 . VAL B 2 24  ? 8.524   -1.670  -1.990  1.00 0.00 ? 282 VAL A HG23 1  
ATOM   651   N  N    . SER B 2 25  ? 8.692   -2.026  -6.091  1.00 0.00 ? 283 SER A N    1  
ATOM   652   C  CA   . SER B 2 25  ? 8.716   -0.875  -6.969  1.00 0.00 ? 283 SER A CA   1  
ATOM   653   C  C    . SER B 2 25  ? 7.311   -0.557  -7.480  1.00 0.00 ? 283 SER A C    1  
ATOM   654   O  O    . SER B 2 25  ? 6.438   -1.426  -7.481  1.00 0.00 ? 283 SER A O    1  
ATOM   655   C  CB   . SER B 2 25  ? 9.672   -1.134  -8.131  1.00 0.00 ? 283 SER A CB   1  
ATOM   656   O  OG   . SER B 2 25  ? 9.251   -2.245  -8.903  1.00 0.00 ? 283 SER A OG   1  
ATOM   657   H  H    . SER B 2 25  ? 8.760   -2.927  -6.471  1.00 0.00 ? 283 SER A H    1  
ATOM   658   H  HA   . SER B 2 25  ? 9.090   -0.040  -6.389  1.00 0.00 ? 283 SER A HA   1  
ATOM   659   H  HB2  . SER B 2 25  ? 9.710   -0.262  -8.766  1.00 0.00 ? 283 SER A HB2  1  
ATOM   660   H  HB3  . SER B 2 25  ? 10.660  -1.339  -7.732  1.00 0.00 ? 283 SER A HB3  1  
ATOM   661   H  HG   . SER B 2 25  ? 8.761   -1.936  -9.668  1.00 0.00 ? 283 SER A HG   1  
ATOM   662   N  N    . CYS B 2 26  ? 7.088   0.683   -7.914  1.00 0.00 ? 284 CYS A N    1  
ATOM   663   C  CA   . CYS B 2 26  ? 5.782   1.076   -8.424  1.00 0.00 ? 284 CYS A CA   1  
ATOM   664   C  C    . CYS B 2 26  ? 5.703   0.682   -9.894  1.00 0.00 ? 284 CYS A C    1  
ATOM   665   O  O    . CYS B 2 26  ? 6.621   0.974   -10.660 1.00 0.00 ? 284 CYS A O    1  
ATOM   666   C  CB   . CYS B 2 26  ? 5.566   2.596   -8.237  1.00 0.00 ? 284 CYS A CB   1  
ATOM   667   S  SG   . CYS B 2 26  ? 4.151   3.297   -9.161  1.00 0.00 ? 284 CYS A SG   1  
ATOM   668   H  H    . CYS B 2 26  ? 7.820   1.331   -7.923  1.00 0.00 ? 284 CYS A H    1  
ATOM   669   H  HA   . CYS B 2 26  ? 5.031   0.537   -7.866  1.00 0.00 ? 284 CYS A HA   1  
ATOM   670   H  HB2  . CYS B 2 26  ? 5.392   2.790   -7.191  1.00 0.00 ? 284 CYS A HB2  1  
ATOM   671   H  HB3  . CYS B 2 26  ? 6.454   3.122   -8.544  1.00 0.00 ? 284 CYS A HB3  1  
ATOM   672   N  N    . ALA B 2 27  ? 4.619   0.020   -10.302 1.00 0.00 ? 285 ALA A N    1  
ATOM   673   C  CA   . ALA B 2 27  ? 4.493   -0.403  -11.691 1.00 0.00 ? 285 ALA A CA   1  
ATOM   674   C  C    . ALA B 2 27  ? 4.195   0.780   -12.600 1.00 0.00 ? 285 ALA A C    1  
ATOM   675   O  O    . ALA B 2 27  ? 3.745   0.618   -13.735 1.00 0.00 ? 285 ALA A O    1  
ATOM   676   C  CB   . ALA B 2 27  ? 3.440   -1.482  -11.826 1.00 0.00 ? 285 ALA A CB   1  
ATOM   677   H  H    . ALA B 2 27  ? 3.897   -0.192  -9.664  1.00 0.00 ? 285 ALA A H    1  
ATOM   678   H  HA   . ALA B 2 27  ? 5.442   -0.829  -11.986 1.00 0.00 ? 285 ALA A HA   1  
ATOM   679   H  HB1  . ALA B 2 27  ? 2.483   -1.038  -12.048 1.00 0.00 ? 285 ALA A HB1  1  
ATOM   680   H  HB2  . ALA B 2 27  ? 3.372   -2.034  -10.900 1.00 0.00 ? 285 ALA A HB2  1  
ATOM   681   H  HB3  . ALA B 2 27  ? 3.718   -2.154  -12.624 1.00 0.00 ? 285 ALA A HB3  1  
ATOM   682   N  N    . ASP B 2 28  ? 4.454   1.968   -12.078 1.00 0.00 ? 286 ASP A N    1  
ATOM   683   C  CA   . ASP B 2 28  ? 4.248   3.206   -12.809 1.00 0.00 ? 286 ASP A CA   1  
ATOM   684   C  C    . ASP B 2 28  ? 5.500   4.070   -12.731 1.00 0.00 ? 286 ASP A C    1  
ATOM   685   O  O    . ASP B 2 28  ? 5.940   4.645   -13.726 1.00 0.00 ? 286 ASP A O    1  
ATOM   686   C  CB   . ASP B 2 28  ? 3.073   3.974   -12.216 1.00 0.00 ? 286 ASP A CB   1  
ATOM   687   C  CG   . ASP B 2 28  ? 2.627   5.124   -13.097 1.00 0.00 ? 286 ASP A CG   1  
ATOM   688   O  OD1  . ASP B 2 28  ? 3.173   6.237   -12.943 1.00 0.00 ? 286 ASP A OD1  1  
ATOM   689   O  OD2  . ASP B 2 28  ? 1.731   4.912   -13.941 1.00 0.00 ? 286 ASP A OD2  1  
ATOM   690   H  H    . ASP B 2 28  ? 4.786   2.013   -11.162 1.00 0.00 ? 286 ASP A H    1  
ATOM   691   H  HA   . ASP B 2 28  ? 4.038   2.963   -13.839 1.00 0.00 ? 286 ASP A HA   1  
ATOM   692   H  HB2  . ASP B 2 28  ? 2.242   3.301   -12.079 1.00 0.00 ? 286 ASP A HB2  1  
ATOM   693   H  HB3  . ASP B 2 28  ? 3.372   4.373   -11.256 1.00 0.00 ? 286 ASP A HB3  1  
ATOM   694   N  N    . CYS B 2 29  ? 6.067   4.148   -11.530 1.00 0.00 ? 287 CYS A N    1  
ATOM   695   C  CA   . CYS B 2 29  ? 7.265   4.941   -11.291 1.00 0.00 ? 287 CYS A CA   1  
ATOM   696   C  C    . CYS B 2 29  ? 8.506   4.066   -11.263 1.00 0.00 ? 287 CYS A C    1  
ATOM   697   O  O    . CYS B 2 29  ? 9.502   4.344   -11.931 1.00 0.00 ? 287 CYS A O    1  
ATOM   698   C  CB   . CYS B 2 29  ? 7.155   5.667   -9.959  1.00 0.00 ? 287 CYS A CB   1  
ATOM   699   S  SG   . CYS B 2 29  ? 5.700   6.746   -9.801  1.00 0.00 ? 287 CYS A SG   1  
ATOM   700   H  H    . CYS B 2 29  ? 5.668   3.654   -10.780 1.00 0.00 ? 287 CYS A H    1  
ATOM   701   H  HA   . CYS B 2 29  ? 7.356   5.663   -12.073 1.00 0.00 ? 287 CYS A HA   1  
ATOM   702   H  HB2  . CYS B 2 29  ? 7.103   4.937   -9.180  1.00 0.00 ? 287 CYS A HB2  1  
ATOM   703   H  HB3  . CYS B 2 29  ? 8.035   6.277   -9.816  1.00 0.00 ? 287 CYS A HB3  1  
ATOM   704   N  N    . GLY B 2 30  ? 8.424   3.003   -10.478 1.00 0.00 ? 288 GLY A N    1  
ATOM   705   C  CA   . GLY B 2 30  ? 9.543   2.098   -10.321 1.00 0.00 ? 288 GLY A CA   1  
ATOM   706   C  C    . GLY B 2 30  ? 10.148  2.244   -8.944  1.00 0.00 ? 288 GLY A C    1  
ATOM   707   O  O    . GLY B 2 30  ? 11.094  1.544   -8.584  1.00 0.00 ? 288 GLY A O    1  
ATOM   708   H  H    . GLY B 2 30  ? 7.588   2.833   -9.995  1.00 0.00 ? 288 GLY A H    1  
ATOM   709   H  HA2  . GLY B 2 30  ? 9.201   1.082   -10.457 1.00 0.00 ? 288 GLY A HA2  1  
ATOM   710   H  HA3  . GLY B 2 30  ? 10.293  2.326   -11.063 1.00 0.00 ? 288 GLY A HA3  1  
ATOM   711   N  N    . ARG B 2 31  ? 9.582   3.172   -8.178  1.00 0.00 ? 289 ARG A N    1  
ATOM   712   C  CA   . ARG B 2 31  ? 10.031  3.449   -6.822  1.00 0.00 ? 289 ARG A CA   1  
ATOM   713   C  C    . ARG B 2 31  ? 9.884   2.223   -5.947  1.00 0.00 ? 289 ARG A C    1  
ATOM   714   O  O    . ARG B 2 31  ? 8.783   1.877   -5.525  1.00 0.00 ? 289 ARG A O    1  
ATOM   715   C  CB   . ARG B 2 31  ? 9.211   4.583   -6.235  1.00 0.00 ? 289 ARG A CB   1  
ATOM   716   C  CG   . ARG B 2 31  ? 9.646   5.001   -4.849  1.00 0.00 ? 289 ARG A CG   1  
ATOM   717   C  CD   . ARG B 2 31  ? 9.759   6.507   -4.752  1.00 0.00 ? 289 ARG A CD   1  
ATOM   718   N  NE   . ARG B 2 31  ? 9.514   6.999   -3.400  1.00 0.00 ? 289 ARG A NE   1  
ATOM   719   C  CZ   . ARG B 2 31  ? 9.708   8.261   -3.029  1.00 0.00 ? 289 ARG A CZ   1  
ATOM   720   N  NH1  . ARG B 2 31  ? 10.171  9.148   -3.899  1.00 0.00 ? 289 ARG A NH1  1  
ATOM   721   N  NH2  . ARG B 2 31  ? 9.443   8.636   -1.786  1.00 0.00 ? 289 ARG A NH2  1  
ATOM   722   H  H    . ARG B 2 31  ? 8.830   3.687   -8.540  1.00 0.00 ? 289 ARG A H    1  
ATOM   723   H  HA   . ARG B 2 31  ? 11.069  3.740   -6.858  1.00 0.00 ? 289 ARG A HA   1  
ATOM   724   H  HB2  . ARG B 2 31  ? 9.282   5.435   -6.889  1.00 0.00 ? 289 ARG A HB2  1  
ATOM   725   H  HB3  . ARG B 2 31  ? 8.183   4.267   -6.177  1.00 0.00 ? 289 ARG A HB3  1  
ATOM   726   H  HG2  . ARG B 2 31  ? 8.913   4.655   -4.138  1.00 0.00 ? 289 ARG A HG2  1  
ATOM   727   H  HG3  . ARG B 2 31  ? 10.606  4.559   -4.630  1.00 0.00 ? 289 ARG A HG3  1  
ATOM   728   H  HD2  . ARG B 2 31  ? 10.756  6.792   -5.052  1.00 0.00 ? 289 ARG A HD2  1  
ATOM   729   H  HD3  . ARG B 2 31  ? 9.036   6.949   -5.424  1.00 0.00 ? 289 ARG A HD3  1  
ATOM   730   H  HE   . ARG B 2 31  ? 9.182   6.359   -2.737  1.00 0.00 ? 289 ARG A HE   1  
ATOM   731   H  HH11 . ARG B 2 31  ? 10.375  8.869   -4.838  1.00 0.00 ? 289 ARG A HH11 1  
ATOM   732   H  HH12 . ARG B 2 31  ? 10.317  10.097  -3.617  1.00 0.00 ? 289 ARG A HH12 1  
ATOM   733   H  HH21 . ARG B 2 31  ? 9.096   7.970   -1.126  1.00 0.00 ? 289 ARG A HH21 1  
ATOM   734   H  HH22 . ARG B 2 31  ? 9.590   9.585   -1.508  1.00 0.00 ? 289 ARG A HH22 1  
ATOM   735   N  N    . SER B 2 32  ? 10.999  1.609   -5.620  1.00 0.00 ? 290 SER A N    1  
ATOM   736   C  CA   . SER B 2 32  ? 10.966  0.403   -4.815  1.00 0.00 ? 290 SER A CA   1  
ATOM   737   C  C    . SER B 2 32  ? 11.004  0.734   -3.336  1.00 0.00 ? 290 SER A C    1  
ATOM   738   O  O    . SER B 2 32  ? 11.346  1.850   -2.956  1.00 0.00 ? 290 SER A O    1  
ATOM   739   C  CB   . SER B 2 32  ? 12.118  -0.522  -5.182  1.00 0.00 ? 290 SER A CB   1  
ATOM   740   O  OG   . SER B 2 32  ? 12.233  -0.667  -6.583  1.00 0.00 ? 290 SER A OG   1  
ATOM   741   H  H    . SER B 2 32  ? 11.857  1.983   -5.909  1.00 0.00 ? 290 SER A H    1  
ATOM   742   H  HA   . SER B 2 32  ? 10.044  -0.099  -5.027  1.00 0.00 ? 290 SER A HA   1  
ATOM   743   H  HB2  . SER B 2 32  ? 13.029  -0.113  -4.802  1.00 0.00 ? 290 SER A HB2  1  
ATOM   744   H  HB3  . SER B 2 32  ? 11.949  -1.493  -4.747  1.00 0.00 ? 290 SER A HB3  1  
ATOM   745   H  HG   . SER B 2 32  ? 12.365  -1.593  -6.799  1.00 0.00 ? 290 SER A HG   1  
ATOM   746   N  N    . GLY B 2 33  ? 10.607  -0.230  -2.509  1.00 0.00 ? 291 GLY A N    1  
ATOM   747   C  CA   . GLY B 2 33  ? 10.611  -0.013  -1.065  1.00 0.00 ? 291 GLY A CA   1  
ATOM   748   C  C    . GLY B 2 33  ? 10.604  -1.298  -0.261  1.00 0.00 ? 291 GLY A C    1  
ATOM   749   O  O    . GLY B 2 33  ? 9.960   -2.263  -0.634  1.00 0.00 ? 291 GLY A O    1  
ATOM   750   H  H    . GLY B 2 33  ? 10.285  -1.085  -2.886  1.00 0.00 ? 291 GLY A H    1  
ATOM   751   H  HA2  . GLY B 2 33  ? 11.486  0.553   -0.798  1.00 0.00 ? 291 GLY A HA2  1  
ATOM   752   H  HA3  . GLY B 2 33  ? 9.736   0.563   -0.802  1.00 0.00 ? 291 GLY A HA3  1  
ATOM   753   N  N    . HIS B 2 34  ? 11.328  -1.336  0.846   1.00 0.00 ? 292 HIS A N    1  
ATOM   754   C  CA   . HIS B 2 34  ? 11.322  -2.541  1.670   1.00 0.00 ? 292 HIS A CA   1  
ATOM   755   C  C    . HIS B 2 34  ? 10.050  -2.564  2.503   1.00 0.00 ? 292 HIS A C    1  
ATOM   756   O  O    . HIS B 2 34  ? 9.753   -1.592  3.188   1.00 0.00 ? 292 HIS A O    1  
ATOM   757   C  CB   . HIS B 2 34  ? 12.536  -2.597  2.592   1.00 0.00 ? 292 HIS A CB   1  
ATOM   758   C  CG   . HIS B 2 34  ? 13.847  -2.648  1.871   1.00 0.00 ? 292 HIS A CG   1  
ATOM   759   N  ND1  . HIS B 2 34  ? 14.796  -1.670  2.009   1.00 0.00 ? 292 HIS A ND1  1  
ATOM   760   C  CD2  . HIS B 2 34  ? 14.351  -3.538  0.984   1.00 0.00 ? 292 HIS A CD2  1  
ATOM   761   C  CE1  . HIS B 2 34  ? 15.837  -1.950  1.246   1.00 0.00 ? 292 HIS A CE1  1  
ATOM   762   N  NE2  . HIS B 2 34  ? 15.593  -3.084  0.619   1.00 0.00 ? 292 HIS A NE2  1  
ATOM   763   H  H    . HIS B 2 34  ? 11.867  -0.553  1.111   1.00 0.00 ? 292 HIS A H    1  
ATOM   764   H  HA   . HIS B 2 34  ? 11.327  -3.392  1.009   1.00 0.00 ? 292 HIS A HA   1  
ATOM   765   H  HB2  . HIS B 2 34  ? 12.534  -1.710  3.215   1.00 0.00 ? 292 HIS A HB2  1  
ATOM   766   H  HB3  . HIS B 2 34  ? 12.462  -3.474  3.219   1.00 0.00 ? 292 HIS A HB3  1  
ATOM   767   H  HD2  . HIS B 2 34  ? 13.833  -4.380  0.560   1.00 0.00 ? 292 HIS A HD2  1  
ATOM   768   H  HE1  . HIS B 2 34  ? 16.700  -1.322  1.097   1.00 0.00 ? 292 HIS A HE1  1  
ATOM   769   H  HE2  . HIS B 2 34  ? 16.232  -3.565  0.053   1.00 0.00 ? 292 HIS A HE2  1  
ATOM   770   N  N    . PRO B 2 35  ? 9.271   -3.665  2.460   1.00 0.00 ? 293 PRO A N    1  
ATOM   771   C  CA   . PRO B 2 35  ? 8.014   -3.766  3.210   1.00 0.00 ? 293 PRO A CA   1  
ATOM   772   C  C    . PRO B 2 35  ? 8.228   -3.541  4.702   1.00 0.00 ? 293 PRO A C    1  
ATOM   773   O  O    . PRO B 2 35  ? 7.275   -3.346  5.455   1.00 0.00 ? 293 PRO A O    1  
ATOM   774   C  CB   . PRO B 2 35  ? 7.529   -5.188  2.892   1.00 0.00 ? 293 PRO A CB   1  
ATOM   775   C  CG   . PRO B 2 35  ? 8.195   -5.512  1.608   1.00 0.00 ? 293 PRO A CG   1  
ATOM   776   C  CD   . PRO B 2 35  ? 9.544   -4.905  1.724   1.00 0.00 ? 293 PRO A CD   1  
ATOM   777   H  HA   . PRO B 2 35  ? 7.291   -3.043  2.843   1.00 0.00 ? 293 PRO A HA   1  
ATOM   778   H  HB2  . PRO B 2 35  ? 7.837   -5.869  3.666   1.00 0.00 ? 293 PRO A HB2  1  
ATOM   779   H  HB3  . PRO B 2 35  ? 6.454   -5.198  2.793   1.00 0.00 ? 293 PRO A HB3  1  
ATOM   780   H  HG2  . PRO B 2 35  ? 8.283   -6.576  1.495   1.00 0.00 ? 293 PRO A HG2  1  
ATOM   781   H  HG3  . PRO B 2 35  ? 7.652   -5.084  0.782   1.00 0.00 ? 293 PRO A HG3  1  
ATOM   782   H  HD2  . PRO B 2 35  ? 10.180  -5.553  2.298   1.00 0.00 ? 293 PRO A HD2  1  
ATOM   783   H  HD3  . PRO B 2 35  ? 9.957   -4.713  0.750   1.00 0.00 ? 293 PRO A HD3  1  
ATOM   784   N  N    . THR B 2 36  ? 9.491   -3.572  5.121   1.00 0.00 ? 294 THR A N    1  
ATOM   785   C  CA   . THR B 2 36  ? 9.842   -3.315  6.509   1.00 0.00 ? 294 THR A CA   1  
ATOM   786   C  C    . THR B 2 36  ? 9.894   -1.812  6.727   1.00 0.00 ? 294 THR A C    1  
ATOM   787   O  O    . THR B 2 36  ? 9.516   -1.300  7.781   1.00 0.00 ? 294 THR A O    1  
ATOM   788   C  CB   . THR B 2 36  ? 11.201  -3.918  6.884   1.00 0.00 ? 294 THR A CB   1  
ATOM   789   O  OG1  . THR B 2 36  ? 11.318  -5.255  6.381   1.00 0.00 ? 294 THR A OG1  1  
ATOM   790   C  CG2  . THR B 2 36  ? 11.348  -3.915  8.382   1.00 0.00 ? 294 THR A CG2  1  
ATOM   791   H  H    . THR B 2 36  ? 10.202  -3.774  4.478   1.00 0.00 ? 294 THR A H    1  
ATOM   792   H  HA   . THR B 2 36  ? 9.087   -3.740  7.152   1.00 0.00 ? 294 THR A HA   1  
ATOM   793   H  HB   . THR B 2 36  ? 11.979  -3.305  6.468   1.00 0.00 ? 294 THR A HB   1  
ATOM   794   H  HG1  . THR B 2 36  ? 12.063  -5.306  5.778   1.00 0.00 ? 294 THR A HG1  1  
ATOM   795   H  HG21 . THR B 2 36  ? 10.874  -3.027  8.757   1.00 0.00 ? 294 THR A HG21 1  
ATOM   796   H  HG22 . THR B 2 36  ? 12.396  -3.910  8.645   1.00 0.00 ? 294 THR A HG22 1  
ATOM   797   H  HG23 . THR B 2 36  ? 10.870  -4.788  8.798   1.00 0.00 ? 294 THR A HG23 1  
ATOM   798   N  N    . CYS B 2 37  ? 10.375  -1.121  5.702   1.00 0.00 ? 295 CYS A N    1  
ATOM   799   C  CA   . CYS B 2 37  ? 10.472  0.328   5.709   1.00 0.00 ? 295 CYS A CA   1  
ATOM   800   C  C    . CYS B 2 37  ? 9.136   0.925   5.288   1.00 0.00 ? 295 CYS A C    1  
ATOM   801   O  O    . CYS B 2 37  ? 8.900   2.127   5.409   1.00 0.00 ? 295 CYS A O    1  
ATOM   802   C  CB   . CYS B 2 37  ? 11.587  0.772   4.769   1.00 0.00 ? 295 CYS A CB   1  
ATOM   803   S  SG   . CYS B 2 37  ? 13.031  -0.323  4.823   1.00 0.00 ? 295 CYS A SG   1  
ATOM   804   H  H    . CYS B 2 37  ? 10.680  -1.608  4.909   1.00 0.00 ? 295 CYS A H    1  
ATOM   805   H  HA   . CYS B 2 37  ? 10.705  0.644   6.704   1.00 0.00 ? 295 CYS A HA   1  
ATOM   806   H  HB2  . CYS B 2 37  ? 11.217  0.793   3.770   1.00 0.00 ? 295 CYS A HB2  1  
ATOM   807   H  HB3  . CYS B 2 37  ? 11.918  1.750   5.041   1.00 0.00 ? 295 CYS A HB3  1  
ATOM   808   N  N    . LEU B 2 38  ? 8.270   0.049   4.787   1.00 0.00 ? 296 LEU A N    1  
ATOM   809   C  CA   . LEU B 2 38  ? 6.942   0.425   4.327   1.00 0.00 ? 296 LEU A CA   1  
ATOM   810   C  C    . LEU B 2 38  ? 5.909   0.128   5.402   1.00 0.00 ? 296 LEU A C    1  
ATOM   811   O  O    . LEU B 2 38  ? 4.770   0.591   5.332   1.00 0.00 ? 296 LEU A O    1  
ATOM   812   C  CB   . LEU B 2 38  ? 6.588   -0.375  3.078   1.00 0.00 ? 296 LEU A CB   1  
ATOM   813   C  CG   . LEU B 2 38  ? 7.479   -0.149  1.863   1.00 0.00 ? 296 LEU A CG   1  
ATOM   814   C  CD1  . LEU B 2 38  ? 7.517   -1.401  1.022   1.00 0.00 ? 296 LEU A CD1  1  
ATOM   815   C  CD2  . LEU B 2 38  ? 6.974   1.010   1.036   1.00 0.00 ? 296 LEU A CD2  1  
ATOM   816   H  H    . LEU B 2 38  ? 8.531   -0.896  4.739   1.00 0.00 ? 296 LEU A H    1  
ATOM   817   H  HA   . LEU B 2 38  ? 6.939   1.479   4.096   1.00 0.00 ? 296 LEU A HA   1  
ATOM   818   H  HB2  . LEU B 2 38  ? 6.632   -1.424  3.332   1.00 0.00 ? 296 LEU A HB2  1  
ATOM   819   H  HB3  . LEU B 2 38  ? 5.574   -0.139  2.799   1.00 0.00 ? 296 LEU A HB3  1  
ATOM   820   H  HG   . LEU B 2 38  ? 8.484   0.070   2.181   1.00 0.00 ? 296 LEU A HG   1  
ATOM   821   H  HD11 . LEU B 2 38  ? 7.904   -1.178  0.040   1.00 0.00 ? 296 LEU A HD11 1  
ATOM   822   H  HD12 . LEU B 2 38  ? 6.525   -1.798  0.932   1.00 0.00 ? 296 LEU A HD12 1  
ATOM   823   H  HD13 . LEU B 2 38  ? 8.148   -2.128  1.492   1.00 0.00 ? 296 LEU A HD13 1  
ATOM   824   H  HD21 . LEU B 2 38  ? 7.157   0.798   -0.002  1.00 0.00 ? 296 LEU A HD21 1  
ATOM   825   H  HD22 . LEU B 2 38  ? 7.494   1.913   1.320   1.00 0.00 ? 296 LEU A HD22 1  
ATOM   826   H  HD23 . LEU B 2 38  ? 5.914   1.136   1.198   1.00 0.00 ? 296 LEU A HD23 1  
ATOM   827   N  N    . GLN B 2 39  ? 6.326   -0.667  6.385   1.00 0.00 ? 297 GLN A N    1  
ATOM   828   C  CA   . GLN B 2 39  ? 5.461   -1.073  7.486   1.00 0.00 ? 297 GLN A CA   1  
ATOM   829   C  C    . GLN B 2 39  ? 4.391   -2.040  6.992   1.00 0.00 ? 297 GLN A C    1  
ATOM   830   O  O    . GLN B 2 39  ? 3.355   -2.219  7.634   1.00 0.00 ? 297 GLN A O    1  
ATOM   831   C  CB   . GLN B 2 39  ? 4.814   0.139   8.159   1.00 0.00 ? 297 GLN A CB   1  
ATOM   832   C  CG   . GLN B 2 39  ? 5.794   0.974   8.949   1.00 0.00 ? 297 GLN A CG   1  
ATOM   833   C  CD   . GLN B 2 39  ? 5.154   2.206   9.561   1.00 0.00 ? 297 GLN A CD   1  
ATOM   834   O  OE1  . GLN B 2 39  ? 4.690   2.176   10.701  1.00 0.00 ? 297 GLN A OE1  1  
ATOM   835   N  NE2  . GLN B 2 39  ? 5.118   3.297   8.803   1.00 0.00 ? 297 GLN A NE2  1  
ATOM   836   H  H    . GLN B 2 39  ? 7.249   -0.997  6.366   1.00 0.00 ? 297 GLN A H    1  
ATOM   837   H  HA   . GLN B 2 39  ? 6.083   -1.578  8.208   1.00 0.00 ? 297 GLN A HA   1  
ATOM   838   H  HB2  . GLN B 2 39  ? 4.380   0.769   7.400   1.00 0.00 ? 297 GLN A HB2  1  
ATOM   839   H  HB3  . GLN B 2 39  ? 4.037   -0.202  8.829   1.00 0.00 ? 297 GLN A HB3  1  
ATOM   840   H  HG2  . GLN B 2 39  ? 6.209   0.369   9.741   1.00 0.00 ? 297 GLN A HG2  1  
ATOM   841   H  HG3  . GLN B 2 39  ? 6.579   1.283   8.283   1.00 0.00 ? 297 GLN A HG3  1  
ATOM   842   H  HE21 . GLN B 2 39  ? 5.499   3.249   7.902   1.00 0.00 ? 297 GLN A HE21 1  
ATOM   843   H  HE22 . GLN B 2 39  ? 4.710   4.106   9.177   1.00 0.00 ? 297 GLN A HE22 1  
ATOM   844   N  N    . PHE B 2 40  ? 4.655   -2.665  5.845   1.00 0.00 ? 298 PHE A N    1  
ATOM   845   C  CA   . PHE B 2 40  ? 3.717   -3.613  5.250   1.00 0.00 ? 298 PHE A CA   1  
ATOM   846   C  C    . PHE B 2 40  ? 3.529   -4.846  6.108   1.00 0.00 ? 298 PHE A C    1  
ATOM   847   O  O    . PHE B 2 40  ? 4.267   -5.093  7.062   1.00 0.00 ? 298 PHE A O    1  
ATOM   848   C  CB   . PHE B 2 40  ? 4.201   -4.105  3.878   1.00 0.00 ? 298 PHE A CB   1  
ATOM   849   C  CG   . PHE B 2 40  ? 4.093   -3.117  2.756   1.00 0.00 ? 298 PHE A CG   1  
ATOM   850   C  CD1  . PHE B 2 40  ? 3.561   -1.847  2.935   1.00 0.00 ? 298 PHE A CD1  1  
ATOM   851   C  CD2  . PHE B 2 40  ? 4.530   -3.482  1.500   1.00 0.00 ? 298 PHE A CD2  1  
ATOM   852   C  CE1  . PHE B 2 40  ? 3.477   -0.970  1.870   1.00 0.00 ? 298 PHE A CE1  1  
ATOM   853   C  CE2  . PHE B 2 40  ? 4.446   -2.612  0.441   1.00 0.00 ? 298 PHE A CE2  1  
ATOM   854   C  CZ   . PHE B 2 40  ? 3.925   -1.363  0.623   1.00 0.00 ? 298 PHE A CZ   1  
ATOM   855   H  H    . PHE B 2 40  ? 5.500   -2.480  5.386   1.00 0.00 ? 298 PHE A H    1  
ATOM   856   H  HA   . PHE B 2 40  ? 2.767   -3.117  5.130   1.00 0.00 ? 298 PHE A HA   1  
ATOM   857   H  HB2  . PHE B 2 40  ? 5.242   -4.410  3.945   1.00 0.00 ? 298 PHE A HB2  1  
ATOM   858   H  HB3  . PHE B 2 40  ? 3.611   -4.970  3.604   1.00 0.00 ? 298 PHE A HB3  1  
ATOM   859   H  HD1  . PHE B 2 40  ? 3.213   -1.546  3.911   1.00 0.00 ? 298 PHE A HD1  1  
ATOM   860   H  HD2  . PHE B 2 40  ? 4.939   -4.466  1.354   1.00 0.00 ? 298 PHE A HD2  1  
ATOM   861   H  HE1  . PHE B 2 40  ? 3.065   0.018   2.012   1.00 0.00 ? 298 PHE A HE1  1  
ATOM   862   H  HE2  . PHE B 2 40  ? 4.793   -2.905  -0.532  1.00 0.00 ? 298 PHE A HE2  1  
ATOM   863   H  HZ   . PHE B 2 40  ? 3.873   -0.695  -0.211  1.00 0.00 ? 298 PHE A HZ   1  
ATOM   864   N  N    . THR B 2 41  ? 2.518   -5.612  5.737   1.00 0.00 ? 299 THR A N    1  
ATOM   865   C  CA   . THR B 2 41  ? 2.226   -6.874  6.373   1.00 0.00 ? 299 THR A CA   1  
ATOM   866   C  C    . THR B 2 41  ? 2.724   -7.955  5.433   1.00 0.00 ? 299 THR A C    1  
ATOM   867   O  O    . THR B 2 41  ? 2.983   -7.664  4.270   1.00 0.00 ? 299 THR A O    1  
ATOM   868   C  CB   . THR B 2 41  ? 0.723   -7.060  6.626   1.00 0.00 ? 299 THR A CB   1  
ATOM   869   O  OG1  . THR B 2 41  ? 0.128   -5.820  7.026   1.00 0.00 ? 299 THR A OG1  1  
ATOM   870   C  CG2  . THR B 2 41  ? 0.507   -8.098  7.697   1.00 0.00 ? 299 THR A CG2  1  
ATOM   871   H  H    . THR B 2 41  ? 1.944   -5.312  5.002   1.00 0.00 ? 299 THR A H    1  
ATOM   872   H  HA   . THR B 2 41  ? 2.759   -6.934  7.312   1.00 0.00 ? 299 THR A HA   1  
ATOM   873   H  HB   . THR B 2 41  ? 0.259   -7.407  5.719   1.00 0.00 ? 299 THR A HB   1  
ATOM   874   H  HG1  . THR B 2 41  ? -0.739  -5.987  7.401   1.00 0.00 ? 299 THR A HG1  1  
ATOM   875   H  HG21 . THR B 2 41  ? 1.078   -8.972  7.444   1.00 0.00 ? 299 THR A HG21 1  
ATOM   876   H  HG22 . THR B 2 41  ? -0.541  -8.350  7.752   1.00 0.00 ? 299 THR A HG22 1  
ATOM   877   H  HG23 . THR B 2 41  ? 0.840   -7.711  8.648   1.00 0.00 ? 299 THR A HG23 1  
ATOM   878   N  N    . LEU B 2 42  ? 2.874   -9.182  5.897   1.00 0.00 ? 300 LEU A N    1  
ATOM   879   C  CA   . LEU B 2 42  ? 3.365   -10.231 5.014   1.00 0.00 ? 300 LEU A CA   1  
ATOM   880   C  C    . LEU B 2 42  ? 2.565   -10.291 3.741   1.00 0.00 ? 300 LEU A C    1  
ATOM   881   O  O    . LEU B 2 42  ? 3.071   -9.967  2.683   1.00 0.00 ? 300 LEU A O    1  
ATOM   882   C  CB   . LEU B 2 42  ? 3.375   -11.580 5.699   1.00 0.00 ? 300 LEU A CB   1  
ATOM   883   C  CG   . LEU B 2 42  ? 4.724   -11.958 6.295   1.00 0.00 ? 300 LEU A CG   1  
ATOM   884   C  CD1  . LEU B 2 42  ? 5.686   -12.412 5.210   1.00 0.00 ? 300 LEU A CD1  1  
ATOM   885   C  CD2  . LEU B 2 42  ? 5.283   -10.780 7.054   1.00 0.00 ? 300 LEU A CD2  1  
ATOM   886   H  H    . LEU B 2 42  ? 2.656   -9.386  6.831   1.00 0.00 ? 300 LEU A H    1  
ATOM   887   H  HA   . LEU B 2 42  ? 4.375   -9.982  4.762   1.00 0.00 ? 300 LEU A HA   1  
ATOM   888   H  HB2  . LEU B 2 42  ? 2.646   -11.559 6.485   1.00 0.00 ? 300 LEU A HB2  1  
ATOM   889   H  HB3  . LEU B 2 42  ? 3.099   -12.332 4.980   1.00 0.00 ? 300 LEU A HB3  1  
ATOM   890   H  HG   . LEU B 2 42  ? 4.590   -12.756 6.983   1.00 0.00 ? 300 LEU A HG   1  
ATOM   891   H  HD11 . LEU B 2 42  ? 5.605   -11.751 4.361   1.00 0.00 ? 300 LEU A HD11 1  
ATOM   892   H  HD12 . LEU B 2 42  ? 5.440   -13.419 4.909   1.00 0.00 ? 300 LEU A HD12 1  
ATOM   893   H  HD13 . LEU B 2 42  ? 6.696   -12.387 5.591   1.00 0.00 ? 300 LEU A HD13 1  
ATOM   894   H  HD21 . LEU B 2 42  ? 4.551   -9.993  7.022   1.00 0.00 ? 300 LEU A HD21 1  
ATOM   895   H  HD22 . LEU B 2 42  ? 6.200   -10.448 6.589   1.00 0.00 ? 300 LEU A HD22 1  
ATOM   896   H  HD23 . LEU B 2 42  ? 5.472   -11.061 8.079   1.00 0.00 ? 300 LEU A HD23 1  
ATOM   897   N  N    . ASN B 2 43  ? 1.311   -10.675 3.852   1.00 0.00 ? 301 ASN A N    1  
ATOM   898   C  CA   . ASN B 2 43  ? 0.449   -10.776 2.674   1.00 0.00 ? 301 ASN A CA   1  
ATOM   899   C  C    . ASN B 2 43  ? 0.693   -9.607  1.720   1.00 0.00 ? 301 ASN A C    1  
ATOM   900   O  O    . ASN B 2 43  ? 0.862   -9.817  0.523   1.00 0.00 ? 301 ASN A O    1  
ATOM   901   C  CB   . ASN B 2 43  ? -1.016  -10.846 3.074   1.00 0.00 ? 301 ASN A CB   1  
ATOM   902   C  CG   . ASN B 2 43  ? -1.378  -12.144 3.754   1.00 0.00 ? 301 ASN A CG   1  
ATOM   903   O  OD1  . ASN B 2 43  ? -0.537  -12.793 4.376   1.00 0.00 ? 301 ASN A OD1  1  
ATOM   904   N  ND2  . ASN B 2 43  ? -2.642  -12.525 3.643   1.00 0.00 ? 301 ASN A ND2  1  
ATOM   905   H  H    . ASN B 2 43  ? 0.961   -10.892 4.744   1.00 0.00 ? 301 ASN A H    1  
ATOM   906   H  HA   . ASN B 2 43  ? 0.719   -11.685 2.162   1.00 0.00 ? 301 ASN A HA   1  
ATOM   907   H  HB2  . ASN B 2 43  ? -1.225  -10.046 3.749   1.00 0.00 ? 301 ASN A HB2  1  
ATOM   908   H  HB3  . ASN B 2 43  ? -1.632  -10.740 2.193   1.00 0.00 ? 301 ASN A HB3  1  
ATOM   909   H  HD21 . ASN B 2 43  ? -3.255  -11.954 3.134   1.00 0.00 ? 301 ASN A HD21 1  
ATOM   910   H  HD22 . ASN B 2 43  ? -2.912  -13.355 4.076   1.00 0.00 ? 301 ASN A HD22 1  
ATOM   911   N  N    . MET B 2 44  ? 0.690   -8.379  2.244   1.00 0.00 ? 302 MET A N    1  
ATOM   912   C  CA   . MET B 2 44  ? 0.990   -7.206  1.421   1.00 0.00 ? 302 MET A CA   1  
ATOM   913   C  C    . MET B 2 44  ? 2.308   -7.445  0.753   1.00 0.00 ? 302 MET A C    1  
ATOM   914   O  O    . MET B 2 44  ? 2.388   -7.604  -0.450  1.00 0.00 ? 302 MET A O    1  
ATOM   915   C  CB   . MET B 2 44  ? 1.124   -5.968  2.280   1.00 0.00 ? 302 MET A CB   1  
ATOM   916   C  CG   . MET B 2 44  ? 1.464   -4.696  1.522   1.00 0.00 ? 302 MET A CG   1  
ATOM   917   S  SD   . MET B 2 44  ? 0.131   -4.094  0.491   1.00 0.00 ? 302 MET A SD   1  
ATOM   918   C  CE   . MET B 2 44  ? 0.538   -2.362  0.459   1.00 0.00 ? 302 MET A CE   1  
ATOM   919   H  H    . MET B 2 44  ? 0.483   -8.261  3.195   1.00 0.00 ? 302 MET A H    1  
ATOM   920   H  HA   . MET B 2 44  ? 0.219   -7.058  0.683   1.00 0.00 ? 302 MET A HA   1  
ATOM   921   H  HB2  . MET B 2 44  ? 0.211   -5.811  2.805   1.00 0.00 ? 302 MET A HB2  1  
ATOM   922   H  HB3  . MET B 2 44  ? 1.902   -6.143  2.988   1.00 0.00 ? 302 MET A HB3  1  
ATOM   923   H  HG2  . MET B 2 44  ? 1.692   -3.935  2.245   1.00 0.00 ? 302 MET A HG2  1  
ATOM   924   H  HG3  . MET B 2 44  ? 2.332   -4.869  0.893   1.00 0.00 ? 302 MET A HG3  1  
ATOM   925   H  HE1  . MET B 2 44  ? 0.844   -2.067  1.444   1.00 0.00 ? 302 MET A HE1  1  
ATOM   926   H  HE2  . MET B 2 44  ? -0.328  -1.790  0.161   1.00 0.00 ? 302 MET A HE2  1  
ATOM   927   H  HE3  . MET B 2 44  ? 1.345   -2.191  -0.238  1.00 0.00 ? 302 MET A HE3  1  
ATOM   928   N  N    . THR B 2 45  ? 3.328   -7.492  1.589   1.00 0.00 ? 303 THR A N    1  
ATOM   929   C  CA   . THR B 2 45  ? 4.685   -7.731  1.172   1.00 0.00 ? 303 THR A CA   1  
ATOM   930   C  C    . THR B 2 45  ? 4.732   -8.711  0.002   1.00 0.00 ? 303 THR A C    1  
ATOM   931   O  O    . THR B 2 45  ? 5.166   -8.369  -1.094  1.00 0.00 ? 303 THR A O    1  
ATOM   932   C  CB   . THR B 2 45  ? 5.507   -8.272  2.371   1.00 0.00 ? 303 THR A CB   1  
ATOM   933   O  OG1  . THR B 2 45  ? 5.480   -7.320  3.441   1.00 0.00 ? 303 THR A OG1  1  
ATOM   934   C  CG2  . THR B 2 45  ? 6.937   -8.518  1.960   1.00 0.00 ? 303 THR A CG2  1  
ATOM   935   H  H    . THR B 2 45  ? 3.157   -7.353  2.534   1.00 0.00 ? 303 THR A H    1  
ATOM   936   H  HA   . THR B 2 45  ? 5.114   -6.789  0.863   1.00 0.00 ? 303 THR A HA   1  
ATOM   937   H  HB   . THR B 2 45  ? 5.074   -9.208  2.727   1.00 0.00 ? 303 THR A HB   1  
ATOM   938   H  HG1  . THR B 2 45  ? 4.984   -6.544  3.168   1.00 0.00 ? 303 THR A HG1  1  
ATOM   939   H  HG21 . THR B 2 45  ? 7.246   -7.723  1.294   1.00 0.00 ? 303 THR A HG21 1  
ATOM   940   H  HG22 . THR B 2 45  ? 7.010   -9.469  1.454   1.00 0.00 ? 303 THR A HG22 1  
ATOM   941   H  HG23 . THR B 2 45  ? 7.571   -8.523  2.834   1.00 0.00 ? 303 THR A HG23 1  
ATOM   942   N  N    . GLU B 2 46  ? 4.228   -9.907  0.239   1.00 0.00 ? 304 GLU A N    1  
ATOM   943   C  CA   . GLU B 2 46  ? 4.204   -10.968 -0.755  1.00 0.00 ? 304 GLU A CA   1  
ATOM   944   C  C    . GLU B 2 46  ? 3.398   -10.595 -2.002  1.00 0.00 ? 304 GLU A C    1  
ATOM   945   O  O    . GLU B 2 46  ? 3.754   -10.978 -3.116  1.00 0.00 ? 304 GLU A O    1  
ATOM   946   C  CB   . GLU B 2 46  ? 3.591   -12.217 -0.125  1.00 0.00 ? 304 GLU A CB   1  
ATOM   947   C  CG   . GLU B 2 46  ? 4.086   -12.477 1.282   1.00 0.00 ? 304 GLU A CG   1  
ATOM   948   C  CD   . GLU B 2 46  ? 3.821   -13.896 1.746   1.00 0.00 ? 304 GLU A CD   1  
ATOM   949   O  OE1  . GLU B 2 46  ? 4.568   -14.806 1.329   1.00 0.00 ? 304 GLU A OE1  1  
ATOM   950   O  OE2  . GLU B 2 46  ? 2.865   -14.097 2.524   1.00 0.00 ? 304 GLU A OE2  1  
ATOM   951   H  H    . GLU B 2 46  ? 3.858   -10.090 1.120   1.00 0.00 ? 304 GLU A H    1  
ATOM   952   H  HA   . GLU B 2 46  ? 5.225   -11.181 -1.034  1.00 0.00 ? 304 GLU A HA   1  
ATOM   953   H  HB2  . GLU B 2 46  ? 2.514   -12.095 -0.086  1.00 0.00 ? 304 GLU A HB2  1  
ATOM   954   H  HB3  . GLU B 2 46  ? 3.830   -13.075 -0.737  1.00 0.00 ? 304 GLU A HB3  1  
ATOM   955   H  HG2  . GLU B 2 46  ? 5.141   -12.291 1.312   1.00 0.00 ? 304 GLU A HG2  1  
ATOM   956   H  HG3  . GLU B 2 46  ? 3.589   -11.796 1.953   1.00 0.00 ? 304 GLU A HG3  1  
ATOM   957   N  N    . ALA B 2 47  ? 2.316   -9.846  -1.808  1.00 0.00 ? 305 ALA A N    1  
ATOM   958   C  CA   . ALA B 2 47  ? 1.432   -9.467  -2.918  1.00 0.00 ? 305 ALA A CA   1  
ATOM   959   C  C    . ALA B 2 47  ? 1.983   -8.317  -3.749  1.00 0.00 ? 305 ALA A C    1  
ATOM   960   O  O    . ALA B 2 47  ? 1.797   -8.273  -4.961  1.00 0.00 ? 305 ALA A O    1  
ATOM   961   C  CB   . ALA B 2 47  ? 0.047   -9.096  -2.389  1.00 0.00 ? 305 ALA A CB   1  
ATOM   962   H  H    . ALA B 2 47  ? 2.111   -9.529  -0.898  1.00 0.00 ? 305 ALA A H    1  
ATOM   963   H  HA   . ALA B 2 47  ? 1.319   -10.330 -3.556  1.00 0.00 ? 305 ALA A HA   1  
ATOM   964   H  HB1  . ALA B 2 47  ? -0.013  -8.020  -2.223  1.00 0.00 ? 305 ALA A HB1  1  
ATOM   965   H  HB2  . ALA B 2 47  ? -0.132  -9.614  -1.458  1.00 0.00 ? 305 ALA A HB2  1  
ATOM   966   H  HB3  . ALA B 2 47  ? -0.701  -9.389  -3.111  1.00 0.00 ? 305 ALA A HB3  1  
ATOM   967   N  N    . VAL B 2 48  ? 2.679   -7.411  -3.090  1.00 0.00 ? 306 VAL A N    1  
ATOM   968   C  CA   . VAL B 2 48  ? 3.214   -6.223  -3.726  1.00 0.00 ? 306 VAL A CA   1  
ATOM   969   C  C    . VAL B 2 48  ? 4.513   -6.478  -4.493  1.00 0.00 ? 306 VAL A C    1  
ATOM   970   O  O    . VAL B 2 48  ? 4.856   -5.723  -5.403  1.00 0.00 ? 306 VAL A O    1  
ATOM   971   C  CB   . VAL B 2 48  ? 3.422   -5.122  -2.679  1.00 0.00 ? 306 VAL A CB   1  
ATOM   972   C  CG1  . VAL B 2 48  ? 2.101   -4.564  -2.233  1.00 0.00 ? 306 VAL A CG1  1  
ATOM   973   C  CG2  . VAL B 2 48  ? 4.188   -5.631  -1.485  1.00 0.00 ? 306 VAL A CG2  1  
ATOM   974   H  H    . VAL B 2 48  ? 2.852   -7.552  -2.142  1.00 0.00 ? 306 VAL A H    1  
ATOM   975   H  HA   . VAL B 2 48  ? 2.475   -5.869  -4.422  1.00 0.00 ? 306 VAL A HA   1  
ATOM   976   H  HB   . VAL B 2 48  ? 3.981   -4.327  -3.119  1.00 0.00 ? 306 VAL A HB   1  
ATOM   977   H  HG11 . VAL B 2 48  ? 2.257   -3.554  -1.885  1.00 0.00 ? 306 VAL A HG11 1  
ATOM   978   H  HG12 . VAL B 2 48  ? 1.701   -5.169  -1.432  1.00 0.00 ? 306 VAL A HG12 1  
ATOM   979   H  HG13 . VAL B 2 48  ? 1.414   -4.557  -3.064  1.00 0.00 ? 306 VAL A HG13 1  
ATOM   980   H  HG21 . VAL B 2 48  ? 4.934   -4.908  -1.224  1.00 0.00 ? 306 VAL A HG21 1  
ATOM   981   H  HG22 . VAL B 2 48  ? 4.660   -6.566  -1.731  1.00 0.00 ? 306 VAL A HG22 1  
ATOM   982   H  HG23 . VAL B 2 48  ? 3.513   -5.768  -0.651  1.00 0.00 ? 306 VAL A HG23 1  
ATOM   983   N  N    . LYS B 2 49  ? 5.231   -7.535  -4.133  1.00 0.00 ? 307 LYS A N    1  
ATOM   984   C  CA   . LYS B 2 49  ? 6.480   -7.871  -4.815  1.00 0.00 ? 307 LYS A CA   1  
ATOM   985   C  C    . LYS B 2 49  ? 6.211   -8.552  -6.150  1.00 0.00 ? 307 LYS A C    1  
ATOM   986   O  O    . LYS B 2 49  ? 7.055   -8.543  -7.046  1.00 0.00 ? 307 LYS A O    1  
ATOM   987   C  CB   . LYS B 2 49  ? 7.313   -8.801  -3.961  1.00 0.00 ? 307 LYS A CB   1  
ATOM   988   C  CG   . LYS B 2 49  ? 8.074   -8.092  -2.858  1.00 0.00 ? 307 LYS A CG   1  
ATOM   989   C  CD   . LYS B 2 49  ? 8.573   -9.077  -1.816  1.00 0.00 ? 307 LYS A CD   1  
ATOM   990   C  CE   . LYS B 2 49  ? 7.426   -9.848  -1.196  1.00 0.00 ? 307 LYS A CE   1  
ATOM   991   N  NZ   . LYS B 2 49  ? 7.728   -11.299 -1.060  1.00 0.00 ? 307 LYS A NZ   1  
ATOM   992   H  H    . LYS B 2 49  ? 4.920   -8.098  -3.393  1.00 0.00 ? 307 LYS A H    1  
ATOM   993   H  HA   . LYS B 2 49  ? 7.036   -6.967  -4.974  1.00 0.00 ? 307 LYS A HA   1  
ATOM   994   H  HB2  . LYS B 2 49  ? 6.657   -9.520  -3.513  1.00 0.00 ? 307 LYS A HB2  1  
ATOM   995   H  HB3  . LYS B 2 49  ? 8.022   -9.315  -4.591  1.00 0.00 ? 307 LYS A HB3  1  
ATOM   996   H  HG2  . LYS B 2 49  ? 8.920   -7.580  -3.291  1.00 0.00 ? 307 LYS A HG2  1  
ATOM   997   H  HG3  . LYS B 2 49  ? 7.419   -7.376  -2.386  1.00 0.00 ? 307 LYS A HG3  1  
ATOM   998   H  HD2  . LYS B 2 49  ? 9.250   -9.774  -2.285  1.00 0.00 ? 307 LYS A HD2  1  
ATOM   999   H  HD3  . LYS B 2 49  ? 9.089   -8.534  -1.039  1.00 0.00 ? 307 LYS A HD3  1  
ATOM   1000  H  HE2  . LYS B 2 49  ? 7.224   -9.438  -0.225  1.00 0.00 ? 307 LYS A HE2  1  
ATOM   1001  H  HE3  . LYS B 2 49  ? 6.551   -9.720  -1.816  1.00 0.00 ? 307 LYS A HE3  1  
ATOM   1002  H  HZ1  . LYS B 2 49  ? 6.919   -11.794 -0.632  1.00 0.00 ? 307 LYS A HZ1  1  
ATOM   1003  H  HZ2  . LYS B 2 49  ? 8.563   -11.436 -0.456  1.00 0.00 ? 307 LYS A HZ2  1  
ATOM   1004  H  HZ3  . LYS B 2 49  ? 7.919   -11.714 -1.995  1.00 0.00 ? 307 LYS A HZ3  1  
ATOM   1005  N  N    . THR B 2 50  ? 5.026   -9.139  -6.272  1.00 0.00 ? 308 THR A N    1  
ATOM   1006  C  CA   . THR B 2 50  ? 4.655   -9.865  -7.479  1.00 0.00 ? 308 THR A CA   1  
ATOM   1007  C  C    . THR B 2 50  ? 3.882   -9.006  -8.466  1.00 0.00 ? 308 THR A C    1  
ATOM   1008  O  O    . THR B 2 50  ? 4.248   -8.918  -9.638  1.00 0.00 ? 308 THR A O    1  
ATOM   1009  C  CB   . THR B 2 50  ? 3.811   -11.101 -7.136  1.00 0.00 ? 308 THR A CB   1  
ATOM   1010  O  OG1  . THR B 2 50  ? 2.470   -10.715 -6.811  1.00 0.00 ? 308 THR A OG1  1  
ATOM   1011  C  CG2  . THR B 2 50  ? 4.430   -11.826 -5.962  1.00 0.00 ? 308 THR A CG2  1  
ATOM   1012  H  H    . THR B 2 50  ? 4.386   -9.083  -5.533  1.00 0.00 ? 308 THR A H    1  
ATOM   1013  H  HA   . THR B 2 50  ? 5.564   -10.207 -7.945  1.00 0.00 ? 308 THR A HA   1  
ATOM   1014  H  HB   . THR B 2 50  ? 3.798   -11.765 -7.987  1.00 0.00 ? 308 THR A HB   1  
ATOM   1015  H  HG1  . THR B 2 50  ? 2.255   -11.016 -5.925  1.00 0.00 ? 308 THR A HG1  1  
ATOM   1016  H  HG21 . THR B 2 50  ? 4.933   -11.103 -5.339  1.00 0.00 ? 308 THR A HG21 1  
ATOM   1017  H  HG22 . THR B 2 50  ? 5.142   -12.556 -6.320  1.00 0.00 ? 308 THR A HG22 1  
ATOM   1018  H  HG23 . THR B 2 50  ? 3.658   -12.321 -5.392  1.00 0.00 ? 308 THR A HG23 1  
ATOM   1019  N  N    . TYR B 2 51  ? 2.813   -8.372  -7.996  1.00 0.00 ? 309 TYR A N    1  
ATOM   1020  C  CA   . TYR B 2 51  ? 1.989   -7.558  -8.873  1.00 0.00 ? 309 TYR A CA   1  
ATOM   1021  C  C    . TYR B 2 51  ? 2.368   -6.076  -8.811  1.00 0.00 ? 309 TYR A C    1  
ATOM   1022  O  O    . TYR B 2 51  ? 3.391   -5.705  -8.236  1.00 0.00 ? 309 TYR A O    1  
ATOM   1023  C  CB   . TYR B 2 51  ? 0.500   -7.803  -8.569  1.00 0.00 ? 309 TYR A CB   1  
ATOM   1024  C  CG   . TYR B 2 51  ? -0.206  -6.729  -7.779  1.00 0.00 ? 309 TYR A CG   1  
ATOM   1025  C  CD1  . TYR B 2 51  ? 0.258   -6.331  -6.541  1.00 0.00 ? 309 TYR A CD1  1  
ATOM   1026  C  CD2  . TYR B 2 51  ? -1.359  -6.130  -8.272  1.00 0.00 ? 309 TYR A CD2  1  
ATOM   1027  C  CE1  . TYR B 2 51  ? -0.397  -5.371  -5.815  1.00 0.00 ? 309 TYR A CE1  1  
ATOM   1028  C  CE2  . TYR B 2 51  ? -2.022  -5.160  -7.550  1.00 0.00 ? 309 TYR A CE2  1  
ATOM   1029  C  CZ   . TYR B 2 51  ? -1.536  -4.783  -6.319  1.00 0.00 ? 309 TYR A CZ   1  
ATOM   1030  O  OH   . TYR B 2 51  ? -2.192  -3.819  -5.588  1.00 0.00 ? 309 TYR A OH   1  
ATOM   1031  H  H    . TYR B 2 51  ? 2.578   -8.454  -7.047  1.00 0.00 ? 309 TYR A H    1  
ATOM   1032  H  HA   . TYR B 2 51  ? 2.182   -7.899  -9.880  1.00 0.00 ? 309 TYR A HA   1  
ATOM   1033  H  HB2  . TYR B 2 51  ? -0.025  -7.905  -9.498  1.00 0.00 ? 309 TYR A HB2  1  
ATOM   1034  H  HB3  . TYR B 2 51  ? 0.410   -8.728  -8.018  1.00 0.00 ? 309 TYR A HB3  1  
ATOM   1035  H  HD1  . TYR B 2 51  ? 1.155   -6.779  -6.146  1.00 0.00 ? 309 TYR A HD1  1  
ATOM   1036  H  HD2  . TYR B 2 51  ? -1.735  -6.432  -9.239  1.00 0.00 ? 309 TYR A HD2  1  
ATOM   1037  H  HE1  . TYR B 2 51  ? -0.016  -5.088  -4.856  1.00 0.00 ? 309 TYR A HE1  1  
ATOM   1038  H  HE2  . TYR B 2 51  ? -2.915  -4.702  -7.949  1.00 0.00 ? 309 TYR A HE2  1  
ATOM   1039  H  HH   . TYR B 2 51  ? -1.555  -3.183  -5.252  1.00 0.00 ? 309 TYR A HH   1  
ATOM   1040  N  N    . LYS B 2 52  ? 1.527   -5.245  -9.410  1.00 0.00 ? 310 LYS A N    1  
ATOM   1041  C  CA   . LYS B 2 52  ? 1.758   -3.813  -9.494  1.00 0.00 ? 310 LYS A CA   1  
ATOM   1042  C  C    . LYS B 2 52  ? 1.585   -3.095  -8.170  1.00 0.00 ? 310 LYS A C    1  
ATOM   1043  O  O    . LYS B 2 52  ? 0.472   -2.692  -7.830  1.00 0.00 ? 310 LYS A O    1  
ATOM   1044  C  CB   . LYS B 2 52  ? 0.794   -3.191  -10.483 1.00 0.00 ? 310 LYS A CB   1  
ATOM   1045  C  CG   . LYS B 2 52  ? 0.534   -4.043  -11.666 1.00 0.00 ? 310 LYS A CG   1  
ATOM   1046  C  CD   . LYS B 2 52  ? 1.291   -3.539  -12.832 1.00 0.00 ? 310 LYS A CD   1  
ATOM   1047  C  CE   . LYS B 2 52  ? 1.223   -4.480  -14.002 1.00 0.00 ? 310 LYS A CE   1  
ATOM   1048  N  NZ   . LYS B 2 52  ? 0.770   -5.845  -13.613 1.00 0.00 ? 310 LYS A NZ   1  
ATOM   1049  H  H    . LYS B 2 52  ? 0.714   -5.607  -9.799  1.00 0.00 ? 310 LYS A H    1  
ATOM   1050  H  HA   . LYS B 2 52  ? 2.748   -3.659  -9.861  1.00 0.00 ? 310 LYS A HA   1  
ATOM   1051  H  HB2  . LYS B 2 52  ? -0.121  -3.008  -9.998  1.00 0.00 ? 310 LYS A HB2  1  
ATOM   1052  H  HB3  . LYS B 2 52  ? 1.197   -2.266  -10.832 1.00 0.00 ? 310 LYS A HB3  1  
ATOM   1053  H  HG2  . LYS B 2 52  ? 0.878   -5.020  -11.443 1.00 0.00 ? 310 LYS A HG2  1  
ATOM   1054  H  HG3  . LYS B 2 52  ? -0.511  -4.043  -11.888 1.00 0.00 ? 310 LYS A HG3  1  
ATOM   1055  H  HD2  . LYS B 2 52  ? 0.905   -2.574  -13.124 1.00 0.00 ? 310 LYS A HD2  1  
ATOM   1056  H  HD3  . LYS B 2 52  ? 2.307   -3.449  -12.520 1.00 0.00 ? 310 LYS A HD3  1  
ATOM   1057  H  HE2  . LYS B 2 52  ? 0.548   -4.077  -14.743 1.00 0.00 ? 310 LYS A HE2  1  
ATOM   1058  H  HE3  . LYS B 2 52  ? 2.208   -4.542  -14.406 1.00 0.00 ? 310 LYS A HE3  1  
ATOM   1059  H  HZ1  . LYS B 2 52  ? -0.192  -5.805  -13.220 1.00 0.00 ? 310 LYS A HZ1  1  
ATOM   1060  H  HZ2  . LYS B 2 52  ? 1.409   -6.243  -12.896 1.00 0.00 ? 310 LYS A HZ2  1  
ATOM   1061  H  HZ3  . LYS B 2 52  ? 0.768   -6.471  -14.444 1.00 0.00 ? 310 LYS A HZ3  1  
ATOM   1062  N  N    . TRP B 2 53  ? 2.657   -2.933  -7.410  1.00 0.00 ? 311 TRP A N    1  
ATOM   1063  C  CA   . TRP B 2 53  ? 2.540   -2.179  -6.181  1.00 0.00 ? 311 TRP A CA   1  
ATOM   1064  C  C    . TRP B 2 53  ? 2.636   -0.701  -6.538  1.00 0.00 ? 311 TRP A C    1  
ATOM   1065  O  O    . TRP B 2 53  ? 3.646   -0.049  -6.299  1.00 0.00 ? 311 TRP A O    1  
ATOM   1066  C  CB   . TRP B 2 53  ? 3.591   -2.561  -5.122  1.00 0.00 ? 311 TRP A CB   1  
ATOM   1067  C  CG   . TRP B 2 53  ? 3.570   -1.626  -3.947  1.00 0.00 ? 311 TRP A CG   1  
ATOM   1068  C  CD1  . TRP B 2 53  ? 2.662   -1.599  -2.940  1.00 0.00 ? 311 TRP A CD1  1  
ATOM   1069  C  CD2  . TRP B 2 53  ? 4.483   -0.566  -3.681  1.00 0.00 ? 311 TRP A CD2  1  
ATOM   1070  N  NE1  . TRP B 2 53  ? 2.955   -0.594  -2.061  1.00 0.00 ? 311 TRP A NE1  1  
ATOM   1071  C  CE2  . TRP B 2 53  ? 4.072   0.056   -2.496  1.00 0.00 ? 311 TRP A CE2  1  
ATOM   1072  C  CE3  . TRP B 2 53  ? 5.606   -0.089  -4.331  1.00 0.00 ? 311 TRP A CE3  1  
ATOM   1073  C  CZ2  . TRP B 2 53  ? 4.750   1.133   -1.948  1.00 0.00 ? 311 TRP A CZ2  1  
ATOM   1074  C  CZ3  . TRP B 2 53  ? 6.283   0.986   -3.792  1.00 0.00 ? 311 TRP A CZ3  1  
ATOM   1075  C  CH2  . TRP B 2 53  ? 5.853   1.586   -2.609  1.00 0.00 ? 311 TRP A CH2  1  
ATOM   1076  H  H    . TRP B 2 53  ? 3.518   -3.320  -7.676  1.00 0.00 ? 311 TRP A H    1  
ATOM   1077  H  HA   . TRP B 2 53  ? 1.551   -2.369  -5.781  1.00 0.00 ? 311 TRP A HA   1  
ATOM   1078  H  HB2  . TRP B 2 53  ? 3.382   -3.556  -4.761  1.00 0.00 ? 311 TRP A HB2  1  
ATOM   1079  H  HB3  . TRP B 2 53  ? 4.581   -2.539  -5.552  1.00 0.00 ? 311 TRP A HB3  1  
ATOM   1080  H  HD1  . TRP B 2 53  ? 1.841   -2.287  -2.852  1.00 0.00 ? 311 TRP A HD1  1  
ATOM   1081  H  HE1  . TRP B 2 53  ? 2.446   -0.377  -1.252  1.00 0.00 ? 311 TRP A HE1  1  
ATOM   1082  H  HE3  . TRP B 2 53  ? 5.943   -0.547  -5.242  1.00 0.00 ? 311 TRP A HE3  1  
ATOM   1083  H  HZ2  . TRP B 2 53  ? 4.430   1.597   -1.036  1.00 0.00 ? 311 TRP A HZ2  1  
ATOM   1084  H  HZ3  . TRP B 2 53  ? 7.158   1.373   -4.285  1.00 0.00 ? 311 TRP A HZ3  1  
ATOM   1085  H  HH2  . TRP B 2 53  ? 6.409   2.424   -2.226  1.00 0.00 ? 311 TRP A HH2  1  
ATOM   1086  N  N    . GLN B 2 54  ? 1.594   -0.193  -7.184  1.00 0.00 ? 312 GLN A N    1  
ATOM   1087  C  CA   . GLN B 2 54  ? 1.561   1.207   -7.569  1.00 0.00 ? 312 GLN A CA   1  
ATOM   1088  C  C    . GLN B 2 54  ? 1.852   2.064   -6.351  1.00 0.00 ? 312 GLN A C    1  
ATOM   1089  O  O    . GLN B 2 54  ? 1.059   2.078   -5.409  1.00 0.00 ? 312 GLN A O    1  
ATOM   1090  C  CB   . GLN B 2 54  ? 0.191   1.567   -8.150  1.00 0.00 ? 312 GLN A CB   1  
ATOM   1091  C  CG   . GLN B 2 54  ? 0.027   1.171   -9.609  1.00 0.00 ? 312 GLN A CG   1  
ATOM   1092  C  CD   . GLN B 2 54  ? -1.236  1.735   -10.234 1.00 0.00 ? 312 GLN A CD   1  
ATOM   1093  O  OE1  . GLN B 2 54  ? -1.278  2.009   -11.433 1.00 0.00 ? 312 GLN A OE1  1  
ATOM   1094  N  NE2  . GLN B 2 54  ? -2.274  1.909   -9.423  1.00 0.00 ? 312 GLN A NE2  1  
ATOM   1095  H  H    . GLN B 2 54  ? 0.834   -0.770  -7.404  1.00 0.00 ? 312 GLN A H    1  
ATOM   1096  H  HA   . GLN B 2 54  ? 2.324   1.372   -8.316  1.00 0.00 ? 312 GLN A HA   1  
ATOM   1097  H  HB2  . GLN B 2 54  ? -0.571  1.060   -7.576  1.00 0.00 ? 312 GLN A HB2  1  
ATOM   1098  H  HB3  . GLN B 2 54  ? 0.041   2.633   -8.064  1.00 0.00 ? 312 GLN A HB3  1  
ATOM   1099  H  HG2  . GLN B 2 54  ? 0.878   1.533   -10.166 1.00 0.00 ? 312 GLN A HG2  1  
ATOM   1100  H  HG3  . GLN B 2 54  ? -0.009  0.093   -9.673  1.00 0.00 ? 312 GLN A HG3  1  
ATOM   1101  H  HE21 . GLN B 2 54  ? -2.170  1.667   -8.477  1.00 0.00 ? 312 GLN A HE21 1  
ATOM   1102  H  HE22 . GLN B 2 54  ? -3.104  2.272   -9.806  1.00 0.00 ? 312 GLN A HE22 1  
ATOM   1103  N  N    . CYS B 2 55  ? 2.997   2.757   -6.353  1.00 0.00 ? 313 CYS A N    1  
ATOM   1104  C  CA   . CYS B 2 55  ? 3.354   3.594   -5.217  1.00 0.00 ? 313 CYS A CA   1  
ATOM   1105  C  C    . CYS B 2 55  ? 2.119   4.314   -4.728  1.00 0.00 ? 313 CYS A C    1  
ATOM   1106  O  O    . CYS B 2 55  ? 1.276   4.744   -5.510  1.00 0.00 ? 313 CYS A O    1  
ATOM   1107  C  CB   . CYS B 2 55  ? 4.474   4.590   -5.539  1.00 0.00 ? 313 CYS A CB   1  
ATOM   1108  S  SG   . CYS B 2 55  ? 3.962   6.051   -6.497  1.00 0.00 ? 313 CYS A SG   1  
ATOM   1109  H  H    . CYS B 2 55  ? 3.599   2.696   -7.118  1.00 0.00 ? 313 CYS A H    1  
ATOM   1110  H  HA   . CYS B 2 55  ? 3.693   2.934   -4.426  1.00 0.00 ? 313 CYS A HA   1  
ATOM   1111  H  HB2  . CYS B 2 55  ? 4.888   4.950   -4.609  1.00 0.00 ? 313 CYS A HB2  1  
ATOM   1112  H  HB3  . CYS B 2 55  ? 5.247   4.085   -6.085  1.00 0.00 ? 313 CYS A HB3  1  
ATOM   1113  N  N    . ILE B 2 56  ? 2.038   4.417   -3.424  1.00 0.00 ? 314 ILE A N    1  
ATOM   1114  C  CA   . ILE B 2 56  ? 0.898   5.007   -2.733  1.00 0.00 ? 314 ILE A CA   1  
ATOM   1115  C  C    . ILE B 2 56  ? 0.320   6.232   -3.415  1.00 0.00 ? 314 ILE A C    1  
ATOM   1116  O  O    . ILE B 2 56  ? -0.832  6.589   -3.197  1.00 0.00 ? 314 ILE A O    1  
ATOM   1117  C  CB   . ILE B 2 56  ? 1.281   5.348   -1.306  1.00 0.00 ? 314 ILE A CB   1  
ATOM   1118  C  CG1  . ILE B 2 56  ? 0.336   4.710   -0.324  1.00 0.00 ? 314 ILE A CG1  1  
ATOM   1119  C  CG2  . ILE B 2 56  ? 1.323   6.830   -1.076  1.00 0.00 ? 314 ILE A CG2  1  
ATOM   1120  C  CD1  . ILE B 2 56  ? -1.075  4.515   -0.780  1.00 0.00 ? 314 ILE A CD1  1  
ATOM   1121  H  H    . ILE B 2 56  ? 2.797   4.096   -2.894  1.00 0.00 ? 314 ILE A H    1  
ATOM   1122  H  HA   . ILE B 2 56  ? 0.132   4.257   -2.693  1.00 0.00 ? 314 ILE A HA   1  
ATOM   1123  H  HB   . ILE B 2 56  ? 2.254   4.949   -1.141  1.00 0.00 ? 314 ILE A HB   1  
ATOM   1124  H  HG12 . ILE B 2 56  ? 0.710   3.773   -0.094  1.00 0.00 ? 314 ILE A HG12 1  
ATOM   1125  H  HG13 . ILE B 2 56  ? 0.306   5.307   0.566   1.00 0.00 ? 314 ILE A HG13 1  
ATOM   1126  H  HG21 . ILE B 2 56  ? 0.321   7.191   -1.119  1.00 0.00 ? 314 ILE A HG21 1  
ATOM   1127  H  HG22 . ILE B 2 56  ? 1.918   7.304   -1.844  1.00 0.00 ? 314 ILE A HG22 1  
ATOM   1128  H  HG23 . ILE B 2 56  ? 1.744   7.037   -0.104  1.00 0.00 ? 314 ILE A HG23 1  
ATOM   1129  H  HD11 . ILE B 2 56  ? -1.548  5.456   -0.793  1.00 0.00 ? 314 ILE A HD11 1  
ATOM   1130  H  HD12 . ILE B 2 56  ? -1.592  3.865   -0.094  1.00 0.00 ? 314 ILE A HD12 1  
ATOM   1131  H  HD13 . ILE B 2 56  ? -1.092  4.083   -1.764  1.00 0.00 ? 314 ILE A HD13 1  
ATOM   1132  N  N    . GLU B 2 57  ? 1.138   6.916   -4.149  1.00 0.00 ? 315 GLU A N    1  
ATOM   1133  C  CA   . GLU B 2 57  ? 0.692   8.070   -4.891  1.00 0.00 ? 315 GLU A CA   1  
ATOM   1134  C  C    . GLU B 2 57  ? -0.165  7.629   -6.080  1.00 0.00 ? 315 GLU A C    1  
ATOM   1135  O  O    . GLU B 2 57  ? -1.286  8.102   -6.264  1.00 0.00 ? 315 GLU A O    1  
ATOM   1136  C  CB   . GLU B 2 57  ? 1.902   8.864   -5.323  1.00 0.00 ? 315 GLU A CB   1  
ATOM   1137  C  CG   . GLU B 2 57  ? 2.826   9.092   -4.151  1.00 0.00 ? 315 GLU A CG   1  
ATOM   1138  C  CD   . GLU B 2 57  ? 4.032   9.940   -4.502  1.00 0.00 ? 315 GLU A CD   1  
ATOM   1139  O  OE1  . GLU B 2 57  ? 3.892   11.180  -4.551  1.00 0.00 ? 315 GLU A OE1  1  
ATOM   1140  O  OE2  . GLU B 2 57  ? 5.117   9.364   -4.728  1.00 0.00 ? 315 GLU A OE2  1  
ATOM   1141  H  H    . GLU B 2 57  ? 2.075   6.684   -4.139  1.00 0.00 ? 315 GLU A H    1  
ATOM   1142  H  HA   . GLU B 2 57  ? 0.101   8.668   -4.221  1.00 0.00 ? 315 GLU A HA   1  
ATOM   1143  H  HB2  . GLU B 2 57  ? 2.435   8.320   -6.091  1.00 0.00 ? 315 GLU A HB2  1  
ATOM   1144  H  HB3  . GLU B 2 57  ? 1.587   9.821   -5.706  1.00 0.00 ? 315 GLU A HB3  1  
ATOM   1145  H  HG2  . GLU B 2 57  ? 2.260   9.578   -3.376  1.00 0.00 ? 315 GLU A HG2  1  
ATOM   1146  H  HG3  . GLU B 2 57  ? 3.160   8.132   -3.782  1.00 0.00 ? 315 GLU A HG3  1  
ATOM   1147  N  N    . CYS B 2 58  ? 0.382   6.716   -6.880  1.00 0.00 ? 316 CYS A N    1  
ATOM   1148  C  CA   . CYS B 2 58  ? -0.341  6.151   -8.032  1.00 0.00 ? 316 CYS A CA   1  
ATOM   1149  C  C    . CYS B 2 58  ? -1.393  5.165   -7.538  1.00 0.00 ? 316 CYS A C    1  
ATOM   1150  O  O    . CYS B 2 58  ? -2.277  4.740   -8.283  1.00 0.00 ? 316 CYS A O    1  
ATOM   1151  C  CB   . CYS B 2 58  ? 0.606   5.394   -8.969  1.00 0.00 ? 316 CYS A CB   1  
ATOM   1152  S  SG   . CYS B 2 58  ? 1.970   6.375   -9.656  1.00 0.00 ? 316 CYS A SG   1  
ATOM   1153  H  H    . CYS B 2 58  ? 1.300   6.425   -6.696  1.00 0.00 ? 316 CYS A H    1  
ATOM   1154  H  HA   . CYS B 2 58  ? -0.820  6.956   -8.568  1.00 0.00 ? 316 CYS A HA   1  
ATOM   1155  H  HB2  . CYS B 2 58  ? 1.044   4.570   -8.428  1.00 0.00 ? 316 CYS A HB2  1  
ATOM   1156  H  HB3  . CYS B 2 58  ? 0.034   5.005   -9.797  1.00 0.00 ? 316 CYS A HB3  1  
ATOM   1157  N  N    . LYS B 2 59  ? -1.258  4.815   -6.269  1.00 0.00 ? 317 LYS A N    1  
ATOM   1158  C  CA   . LYS B 2 59  ? -2.107  3.868   -5.583  1.00 0.00 ? 317 LYS A CA   1  
ATOM   1159  C  C    . LYS B 2 59  ? -3.567  3.936   -6.022  1.00 0.00 ? 317 LYS A C    1  
ATOM   1160  O  O    . LYS B 2 59  ? -4.116  2.944   -6.505  1.00 0.00 ? 317 LYS A O    1  
ATOM   1161  C  CB   . LYS B 2 59  ? -1.967  4.221   -4.112  1.00 0.00 ? 317 LYS A CB   1  
ATOM   1162  C  CG   . LYS B 2 59  ? -3.195  4.050   -3.304  1.00 0.00 ? 317 LYS A CG   1  
ATOM   1163  C  CD   . LYS B 2 59  ? -3.524  2.596   -3.197  1.00 0.00 ? 317 LYS A CD   1  
ATOM   1164  C  CE   . LYS B 2 59  ? -2.551  1.886   -2.273  1.00 0.00 ? 317 LYS A CE   1  
ATOM   1165  N  NZ   . LYS B 2 59  ? -2.931  0.469   -2.058  1.00 0.00 ? 317 LYS A NZ   1  
ATOM   1166  H  H    . LYS B 2 59  ? -0.558  5.239   -5.745  1.00 0.00 ? 317 LYS A H    1  
ATOM   1167  H  HA   . LYS B 2 59  ? -1.733  2.872   -5.737  1.00 0.00 ? 317 LYS A HA   1  
ATOM   1168  H  HB2  . LYS B 2 59  ? -1.208  3.613   -3.670  1.00 0.00 ? 317 LYS A HB2  1  
ATOM   1169  H  HB3  . LYS B 2 59  ? -1.673  5.247   -4.048  1.00 0.00 ? 317 LYS A HB3  1  
ATOM   1170  H  HG2  . LYS B 2 59  ? -3.036  4.462   -2.322  1.00 0.00 ? 317 LYS A HG2  1  
ATOM   1171  H  HG3  . LYS B 2 59  ? -3.982  4.565   -3.787  1.00 0.00 ? 317 LYS A HG3  1  
ATOM   1172  H  HD2  . LYS B 2 59  ? -4.521  2.491   -2.838  1.00 0.00 ? 317 LYS A HD2  1  
ATOM   1173  H  HD3  . LYS B 2 59  ? -3.446  2.167   -4.176  1.00 0.00 ? 317 LYS A HD3  1  
ATOM   1174  H  HE2  . LYS B 2 59  ? -1.566  1.933   -2.710  1.00 0.00 ? 317 LYS A HE2  1  
ATOM   1175  H  HE3  . LYS B 2 59  ? -2.530  2.389   -1.327  1.00 0.00 ? 317 LYS A HE3  1  
ATOM   1176  H  HZ1  . LYS B 2 59  ? -3.010  -0.019  -2.972  1.00 0.00 ? 317 LYS A HZ1  1  
ATOM   1177  H  HZ2  . LYS B 2 59  ? -3.847  0.414   -1.568  1.00 0.00 ? 317 LYS A HZ2  1  
ATOM   1178  H  HZ3  . LYS B 2 59  ? -2.212  -0.012  -1.480  1.00 0.00 ? 317 LYS A HZ3  1  
ATOM   1179  N  N    . SER B 2 60  ? -4.171  5.108   -5.884  1.00 0.00 ? 318 SER A N    1  
ATOM   1180  C  CA   . SER B 2 60  ? -5.568  5.312   -6.259  1.00 0.00 ? 318 SER A CA   1  
ATOM   1181  C  C    . SER B 2 60  ? -6.440  4.152   -5.825  1.00 0.00 ? 318 SER A C    1  
ATOM   1182  O  O    . SER B 2 60  ? -6.033  3.296   -5.038  1.00 0.00 ? 318 SER A O    1  
ATOM   1183  C  CB   . SER B 2 60  ? -5.703  5.518   -7.773  1.00 0.00 ? 318 SER A CB   1  
ATOM   1184  O  OG   . SER B 2 60  ? -5.255  4.377   -8.485  1.00 0.00 ? 318 SER A OG   1  
ATOM   1185  H  H    . SER B 2 60  ? -3.674  5.849   -5.487  1.00 0.00 ? 318 SER A H    1  
ATOM   1186  H  HA   . SER B 2 60  ? -5.923  6.189   -5.748  1.00 0.00 ? 318 SER A HA   1  
ATOM   1187  H  HB2  . SER B 2 60  ? -6.739  5.694   -8.021  1.00 0.00 ? 318 SER A HB2  1  
ATOM   1188  H  HB3  . SER B 2 60  ? -5.117  6.367   -8.077  1.00 0.00 ? 318 SER A HB3  1  
ATOM   1189  H  HG   . SER B 2 60  ? -4.870  4.652   -9.321  1.00 0.00 ? 318 SER A HG   1  
ATOM   1190  N  N    . CYS B 2 61  ? -7.660  4.152   -6.319  1.00 0.00 ? 319 CYS A N    1  
ATOM   1191  C  CA   . CYS B 2 61  ? -8.592  3.101   -6.009  1.00 0.00 ? 319 CYS A CA   1  
ATOM   1192  C  C    . CYS B 2 61  ? -8.262  1.868   -6.847  1.00 0.00 ? 319 CYS A C    1  
ATOM   1193  O  O    . CYS B 2 61  ? -7.275  1.832   -7.580  1.00 0.00 ? 319 CYS A O    1  
ATOM   1194  C  CB   . CYS B 2 61  ? -10.010 3.572   -6.316  1.00 0.00 ? 319 CYS A CB   1  
ATOM   1195  S  SG   . CYS B 2 61  ? -11.389 2.713   -5.463  1.00 0.00 ? 319 CYS A SG   1  
ATOM   1196  H  H    . CYS B 2 61  ? -7.942  4.885   -6.904  1.00 0.00 ? 319 CYS A H    1  
ATOM   1197  H  HA   . CYS B 2 61  ? -8.517  2.893   -4.962  1.00 0.00 ? 319 CYS A HA   1  
ATOM   1198  H  HB2  . CYS B 2 61  ? -10.082 4.609   -6.048  1.00 0.00 ? 319 CYS A HB2  1  
ATOM   1199  H  HB3  . CYS B 2 61  ? -10.175 3.476   -7.368  1.00 0.00 ? 319 CYS A HB3  1  
ATOM   1200  N  N    . ILE B 2 62  ? -9.080  0.865   -6.688  1.00 0.00 ? 320 ILE A N    1  
ATOM   1201  C  CA   . ILE B 2 62  ? -9.012  -0.373  -7.450  1.00 0.00 ? 320 ILE A CA   1  
ATOM   1202  C  C    . ILE B 2 62  ? -10.436 -0.573  -7.878  1.00 0.00 ? 320 ILE A C    1  
ATOM   1203  O  O    . ILE B 2 62  ? -10.753 -1.271  -8.842  1.00 0.00 ? 320 ILE A O    1  
ATOM   1204  C  CB   . ILE B 2 62  ? -8.488  -1.545  -6.590  1.00 0.00 ? 320 ILE A CB   1  
ATOM   1205  C  CG1  . ILE B 2 62  ? -9.169  -2.878  -6.853  1.00 0.00 ? 320 ILE A CG1  1  
ATOM   1206  C  CG2  . ILE B 2 62  ? -8.724  -1.201  -5.181  1.00 0.00 ? 320 ILE A CG2  1  
ATOM   1207  C  CD1  . ILE B 2 62  ? -8.331  -3.864  -7.624  1.00 0.00 ? 320 ILE A CD1  1  
ATOM   1208  H  H    . ILE B 2 62  ? -9.780  0.949   -6.009  1.00 0.00 ? 320 ILE A H    1  
ATOM   1209  H  HA   . ILE B 2 62  ? -8.378  -0.227  -8.315  1.00 0.00 ? 320 ILE A HA   1  
ATOM   1210  H  HB   . ILE B 2 62  ? -7.430  -1.648  -6.741  1.00 0.00 ? 320 ILE A HB   1  
ATOM   1211  H  HG12 . ILE B 2 62  ? -9.386  -3.327  -5.901  1.00 0.00 ? 320 ILE A HG12 1  
ATOM   1212  H  HG13 . ILE B 2 62  ? -10.084 -2.719  -7.372  1.00 0.00 ? 320 ILE A HG13 1  
ATOM   1213  H  HG21 . ILE B 2 62  ? -9.801  -1.091  -5.047  1.00 0.00 ? 320 ILE A HG21 1  
ATOM   1214  H  HG22 . ILE B 2 62  ? -8.218  -0.281  -4.948  1.00 0.00 ? 320 ILE A HG22 1  
ATOM   1215  H  HG23 . ILE B 2 62  ? -8.359  -1.989  -4.548  1.00 0.00 ? 320 ILE A HG23 1  
ATOM   1216  H  HD11 . ILE B 2 62  ? -7.843  -4.527  -6.920  1.00 0.00 ? 320 ILE A HD11 1  
ATOM   1217  H  HD12 . ILE B 2 62  ? -7.588  -3.334  -8.201  1.00 0.00 ? 320 ILE A HD12 1  
ATOM   1218  H  HD13 . ILE B 2 62  ? -8.963  -4.439  -8.284  1.00 0.00 ? 320 ILE A HD13 1  
ATOM   1219  N  N    . LEU B 2 63  ? -11.293 0.099   -7.104  1.00 0.00 ? 321 LEU A N    1  
ATOM   1220  C  CA   . LEU B 2 63  ? -12.701 0.129   -7.348  1.00 0.00 ? 321 LEU A CA   1  
ATOM   1221  C  C    . LEU B 2 63  ? -12.945 1.212   -8.390  1.00 0.00 ? 321 LEU A C    1  
ATOM   1222  O  O    . LEU B 2 63  ? -13.995 1.272   -9.030  1.00 0.00 ? 321 LEU A O    1  
ATOM   1223  C  CB   . LEU B 2 63  ? -13.444 0.401   -6.030  1.00 0.00 ? 321 LEU A CB   1  
ATOM   1224  C  CG   . LEU B 2 63  ? -13.052 -0.524  -4.867  1.00 0.00 ? 321 LEU A CG   1  
ATOM   1225  C  CD1  . LEU B 2 63  ? -14.266 -0.970  -4.080  1.00 0.00 ? 321 LEU A CD1  1  
ATOM   1226  C  CD2  . LEU B 2 63  ? -12.285 -1.724  -5.364  1.00 0.00 ? 321 LEU A CD2  1  
ATOM   1227  H  H    . LEU B 2 63  ? -10.953 0.566   -6.304  1.00 0.00 ? 321 LEU A H    1  
ATOM   1228  H  HA   . LEU B 2 63  ? -12.982 -0.830  -7.730  1.00 0.00 ? 321 LEU A HA   1  
ATOM   1229  H  HB2  . LEU B 2 63  ? -13.234 1.418   -5.733  1.00 0.00 ? 321 LEU A HB2  1  
ATOM   1230  H  HB3  . LEU B 2 63  ? -14.505 0.309   -6.190  1.00 0.00 ? 321 LEU A HB3  1  
ATOM   1231  H  HG   . LEU B 2 63  ? -12.398 0.017   -4.197  1.00 0.00 ? 321 LEU A HG   1  
ATOM   1232  H  HD11 . LEU B 2 63  ? -14.185 -0.602  -3.061  1.00 0.00 ? 321 LEU A HD11 1  
ATOM   1233  H  HD12 . LEU B 2 63  ? -14.315 -2.050  -4.072  1.00 0.00 ? 321 LEU A HD12 1  
ATOM   1234  H  HD13 . LEU B 2 63  ? -15.159 -0.571  -4.537  1.00 0.00 ? 321 LEU A HD13 1  
ATOM   1235  H  HD21 . LEU B 2 63  ? -11.353 -1.371  -5.772  1.00 0.00 ? 321 LEU A HD21 1  
ATOM   1236  H  HD22 . LEU B 2 63  ? -12.854 -2.229  -6.132  1.00 0.00 ? 321 LEU A HD22 1  
ATOM   1237  H  HD23 . LEU B 2 63  ? -12.093 -2.401  -4.549  1.00 0.00 ? 321 LEU A HD23 1  
ATOM   1238  N  N    . CYS B 2 64  ? -11.925 2.075   -8.537  1.00 0.00 ? 322 CYS A N    1  
ATOM   1239  C  CA   . CYS B 2 64  ? -11.936 3.154   -9.513  1.00 0.00 ? 322 CYS A CA   1  
ATOM   1240  C  C    . CYS B 2 64  ? -10.563 3.307   -10.168 1.00 0.00 ? 322 CYS A C    1  
ATOM   1241  O  O    . CYS B 2 64  ? -10.474 3.578   -11.366 1.00 0.00 ? 322 CYS A O    1  
ATOM   1242  C  CB   . CYS B 2 64  ? -12.298 4.490   -8.872  1.00 0.00 ? 322 CYS A CB   1  
ATOM   1243  S  SG   . CYS B 2 64  ? -13.796 4.486   -7.856  1.00 0.00 ? 322 CYS A SG   1  
ATOM   1244  H  H    . CYS B 2 64  ? -11.148 1.991   -7.947  1.00 0.00 ? 322 CYS A H    1  
ATOM   1245  H  HA   . CYS B 2 64  ? -12.661 2.914   -10.268 1.00 0.00 ? 322 CYS A HA   1  
ATOM   1246  H  HB2  . CYS B 2 64  ? -11.483 4.805   -8.239  1.00 0.00 ? 322 CYS A HB2  1  
ATOM   1247  H  HB3  . CYS B 2 64  ? -12.437 5.222   -9.654  1.00 0.00 ? 322 CYS A HB3  1  
ATOM   1248  N  N    . GLY B 2 65  ? -9.491  3.128   -9.384  1.00 0.00 ? 323 GLY A N    1  
ATOM   1249  C  CA   . GLY B 2 65  ? -8.152  3.307   -9.925  1.00 0.00 ? 323 GLY A CA   1  
ATOM   1250  C  C    . GLY B 2 65  ? -8.013  4.666   -10.573 1.00 0.00 ? 323 GLY A C    1  
ATOM   1251  O  O    . GLY B 2 65  ? -7.364  4.817   -11.609 1.00 0.00 ? 323 GLY A O    1  
ATOM   1252  H  H    . GLY B 2 65  ? -9.611  2.866   -8.440  1.00 0.00 ? 323 GLY A H    1  
ATOM   1253  H  HA2  . GLY B 2 65  ? -7.432  3.222   -9.125  1.00 0.00 ? 323 GLY A HA2  1  
ATOM   1254  H  HA3  . GLY B 2 65  ? -7.955  2.545   -10.660 1.00 0.00 ? 323 GLY A HA3  1  
ATOM   1255  N  N    . THR B 2 66  ? -8.640  5.652   -9.946  1.00 0.00 ? 324 THR A N    1  
ATOM   1256  C  CA   . THR B 2 66  ? -8.639  7.019   -10.443 1.00 0.00 ? 324 THR A CA   1  
ATOM   1257  C  C    . THR B 2 66  ? -8.121  8.002   -9.406  1.00 0.00 ? 324 THR A C    1  
ATOM   1258  O  O    . THR B 2 66  ? -7.698  9.104   -9.753  1.00 0.00 ? 324 THR A O    1  
ATOM   1259  C  CB   . THR B 2 66  ? -10.063 7.445   -10.798 1.00 0.00 ? 324 THR A CB   1  
ATOM   1260  O  OG1  . THR B 2 66  ? -10.074 8.792   -11.286 1.00 0.00 ? 324 THR A OG1  1  
ATOM   1261  C  CG2  . THR B 2 66  ? -10.963 7.328   -9.584  1.00 0.00 ? 324 THR A CG2  1  
ATOM   1262  H  H    . THR B 2 66  ? -9.127  5.451   -9.122  1.00 0.00 ? 324 THR A H    1  
ATOM   1263  H  HA   . THR B 2 66  ? -8.036  7.068   -11.333 1.00 0.00 ? 324 THR A HA   1  
ATOM   1264  H  HB   . THR B 2 66  ? -10.434 6.793   -11.555 1.00 0.00 ? 324 THR A HB   1  
ATOM   1265  H  HG1  . THR B 2 66  ? -9.231  8.989   -11.700 1.00 0.00 ? 324 THR A HG1  1  
ATOM   1266  H  HG21 . THR B 2 66  ? -10.807 6.370   -9.103  1.00 0.00 ? 324 THR A HG21 1  
ATOM   1267  H  HG22 . THR B 2 66  ? -11.995 7.410   -9.893  1.00 0.00 ? 324 THR A HG22 1  
ATOM   1268  H  HG23 . THR B 2 66  ? -10.732 8.118   -8.891  1.00 0.00 ? 324 THR A HG23 1  
ATOM   1269  N  N    . SER B 2 67  ? -8.190  7.590   -8.138  1.00 0.00 ? 325 SER A N    1  
ATOM   1270  C  CA   . SER B 2 67  ? -7.784  8.412   -7.006  1.00 0.00 ? 325 SER A CA   1  
ATOM   1271  C  C    . SER B 2 67  ? -8.935  9.322   -6.616  1.00 0.00 ? 325 SER A C    1  
ATOM   1272  O  O    . SER B 2 67  ? -9.040  9.756   -5.477  1.00 0.00 ? 325 SER A O    1  
ATOM   1273  C  CB   . SER B 2 67  ? -6.526  9.219   -7.320  1.00 0.00 ? 325 SER A CB   1  
ATOM   1274  O  OG   . SER B 2 67  ? -6.844  10.463  -7.919  1.00 0.00 ? 325 SER A OG   1  
ATOM   1275  H  H    . SER B 2 67  ? -8.529  6.698   -7.956  1.00 0.00 ? 325 SER A H    1  
ATOM   1276  H  HA   . SER B 2 67  ? -7.582  7.748   -6.183  1.00 0.00 ? 325 SER A HA   1  
ATOM   1277  H  HB2  . SER B 2 67  ? -5.981  9.403   -6.407  1.00 0.00 ? 325 SER A HB2  1  
ATOM   1278  H  HB3  . SER B 2 67  ? -5.912  8.650   -7.999  1.00 0.00 ? 325 SER A HB3  1  
ATOM   1279  H  HG   . SER B 2 67  ? -6.820  11.155  -7.254  1.00 0.00 ? 325 SER A HG   1  
ATOM   1280  N  N    . GLU B 2 68  ? -9.810  9.558   -7.587  1.00 0.00 ? 326 GLU A N    1  
ATOM   1281  C  CA   . GLU B 2 68  ? -11.001 10.385  -7.428  1.00 0.00 ? 326 GLU A CA   1  
ATOM   1282  C  C    . GLU B 2 68  ? -10.992 11.253  -6.173  1.00 0.00 ? 326 GLU A C    1  
ATOM   1283  O  O    . GLU B 2 68  ? -10.516 12.389  -6.196  1.00 0.00 ? 326 GLU A O    1  
ATOM   1284  C  CB   . GLU B 2 68  ? -12.201 9.479   -7.414  1.00 0.00 ? 326 GLU A CB   1  
ATOM   1285  C  CG   . GLU B 2 68  ? -13.016 9.535   -8.692  1.00 0.00 ? 326 GLU A CG   1  
ATOM   1286  C  CD   . GLU B 2 68  ? -14.306 10.316  -8.535  1.00 0.00 ? 326 GLU A CD   1  
ATOM   1287  O  OE1  . GLU B 2 68  ? -14.264 11.559  -8.650  1.00 0.00 ? 326 GLU A OE1  1  
ATOM   1288  O  OE2  . GLU B 2 68  ? -15.357 9.685   -8.298  1.00 0.00 ? 326 GLU A OE2  1  
ATOM   1289  H  H    . GLU B 2 68  ? -9.663  9.129   -8.452  1.00 0.00 ? 326 GLU A H    1  
ATOM   1290  H  HA   . GLU B 2 68  ? -11.079 11.012  -8.290  1.00 0.00 ? 326 GLU A HA   1  
ATOM   1291  H  HB2  . GLU B 2 68  ? -11.847 8.481   -7.275  1.00 0.00 ? 326 GLU A HB2  1  
ATOM   1292  H  HB3  . GLU B 2 68  ? -12.824 9.739   -6.595  1.00 0.00 ? 326 GLU A HB3  1  
ATOM   1293  H  HG2  . GLU B 2 68  ? -12.419 10.001  -9.462  1.00 0.00 ? 326 GLU A HG2  1  
ATOM   1294  H  HG3  . GLU B 2 68  ? -13.250 8.528   -8.991  1.00 0.00 ? 326 GLU A HG3  1  
ATOM   1295  N  N    . ASN B 2 69  ? -11.524 10.709  -5.078  1.00 0.00 ? 327 ASN A N    1  
ATOM   1296  C  CA   . ASN B 2 69  ? -11.591 11.434  -3.820  1.00 0.00 ? 327 ASN A CA   1  
ATOM   1297  C  C    . ASN B 2 69  ? -10.314 11.258  -3.023  1.00 0.00 ? 327 ASN A C    1  
ATOM   1298  O  O    . ASN B 2 69  ? -9.861  12.182  -2.348  1.00 0.00 ? 327 ASN A O    1  
ATOM   1299  C  CB   . ASN B 2 69  ? -12.787 10.968  -2.983  1.00 0.00 ? 327 ASN A CB   1  
ATOM   1300  C  CG   . ASN B 2 69  ? -14.101 11.493  -3.502  1.00 0.00 ? 327 ASN A CG   1  
ATOM   1301  O  OD1  . ASN B 2 69  ? -14.970 11.902  -2.733  1.00 0.00 ? 327 ASN A OD1  1  
ATOM   1302  N  ND2  . ASN B 2 69  ? -14.258 11.469  -4.814  1.00 0.00 ? 327 ASN A ND2  1  
ATOM   1303  H  H    . ASN B 2 69  ? -11.866 9.792   -5.116  1.00 0.00 ? 327 ASN A H    1  
ATOM   1304  H  HA   . ASN B 2 69  ? -11.721 12.469  -4.047  1.00 0.00 ? 327 ASN A HA   1  
ATOM   1305  H  HB2  . ASN B 2 69  ? -12.833 9.901   -3.005  1.00 0.00 ? 327 ASN A HB2  1  
ATOM   1306  H  HB3  . ASN B 2 69  ? -12.666 11.295  -1.963  1.00 0.00 ? 327 ASN A HB3  1  
ATOM   1307  H  HD21 . ASN B 2 69  ? -13.526 11.122  -5.363  1.00 0.00 ? 327 ASN A HD21 1  
ATOM   1308  H  HD22 . ASN B 2 69  ? -15.101 11.785  -5.177  1.00 0.00 ? 327 ASN A HD22 1  
ATOM   1309  N  N    . ASP B 2 70  ? -9.735  10.062  -3.127  1.00 0.00 ? 328 ASP A N    1  
ATOM   1310  C  CA   . ASP B 2 70  ? -8.521  9.694   -2.389  1.00 0.00 ? 328 ASP A CA   1  
ATOM   1311  C  C    . ASP B 2 70  ? -8.588  10.107  -0.926  1.00 0.00 ? 328 ASP A C    1  
ATOM   1312  O  O    . ASP B 2 70  ? -7.604  9.993   -0.198  1.00 0.00 ? 328 ASP A O    1  
ATOM   1313  C  CB   . ASP B 2 70  ? -7.220  10.204  -3.022  1.00 0.00 ? 328 ASP A CB   1  
ATOM   1314  C  CG   . ASP B 2 70  ? -7.380  11.317  -4.039  1.00 0.00 ? 328 ASP A CG   1  
ATOM   1315  O  OD1  . ASP B 2 70  ? -7.858  12.408  -3.668  1.00 0.00 ? 328 ASP A OD1  1  
ATOM   1316  O  OD2  . ASP B 2 70  ? -6.989  11.104  -5.204  1.00 0.00 ? 328 ASP A OD2  1  
ATOM   1317  H  H    . ASP B 2 70  ? -10.143 9.392   -3.731  1.00 0.00 ? 328 ASP A H    1  
ATOM   1318  H  HA   . ASP B 2 70  ? -8.483  8.620   -2.404  1.00 0.00 ? 328 ASP A HA   1  
ATOM   1319  H  HB2  . ASP B 2 70  ? -6.576  10.568  -2.236  1.00 0.00 ? 328 ASP A HB2  1  
ATOM   1320  H  HB3  . ASP B 2 70  ? -6.732  9.361   -3.509  1.00 0.00 ? 328 ASP A HB3  1  
ATOM   1321  N  N    . ASP B 2 71  ? -9.749  10.580  -0.498  1.00 0.00 ? 329 ASP A N    1  
ATOM   1322  C  CA   . ASP B 2 71  ? -9.953  10.961  0.876   1.00 0.00 ? 329 ASP A CA   1  
ATOM   1323  C  C    . ASP B 2 71  ? -10.707 9.844   1.556   1.00 0.00 ? 329 ASP A C    1  
ATOM   1324  O  O    . ASP B 2 71  ? -10.976 9.883   2.756   1.00 0.00 ? 329 ASP A O    1  
ATOM   1325  C  CB   . ASP B 2 71  ? -10.728 12.266  0.978   1.00 0.00 ? 329 ASP A CB   1  
ATOM   1326  C  CG   . ASP B 2 71  ? -10.086 13.393  0.193   1.00 0.00 ? 329 ASP A CG   1  
ATOM   1327  O  OD1  . ASP B 2 71  ? -8.902  13.696  0.450   1.00 0.00 ? 329 ASP A OD1  1  
ATOM   1328  O  OD2  . ASP B 2 71  ? -10.768 13.972  -0.678  1.00 0.00 ? 329 ASP A OD2  1  
ATOM   1329  H  H    . ASP B 2 71  ? -10.492 10.667  -1.124  1.00 0.00 ? 329 ASP A H    1  
ATOM   1330  H  HA   . ASP B 2 71  ? -8.996  11.079  1.344   1.00 0.00 ? 329 ASP A HA   1  
ATOM   1331  H  HB2  . ASP B 2 71  ? -11.732 12.117  0.611   1.00 0.00 ? 329 ASP A HB2  1  
ATOM   1332  H  HB3  . ASP B 2 71  ? -10.763 12.551  2.012   1.00 0.00 ? 329 ASP A HB3  1  
ATOM   1333  N  N    . GLN B 2 72  ? -11.043 8.839   0.752   1.00 0.00 ? 330 GLN A N    1  
ATOM   1334  C  CA   . GLN B 2 72  ? -11.759 7.686   1.225   1.00 0.00 ? 330 GLN A CA   1  
ATOM   1335  C  C    . GLN B 2 72  ? -11.003 6.437   0.829   1.00 0.00 ? 330 GLN A C    1  
ATOM   1336  O  O    . GLN B 2 72  ? -11.063 5.423   1.501   1.00 0.00 ? 330 GLN A O    1  
ATOM   1337  C  CB   . GLN B 2 72  ? -13.162 7.697   0.657   1.00 0.00 ? 330 GLN A CB   1  
ATOM   1338  C  CG   . GLN B 2 72  ? -13.761 9.073   0.756   1.00 0.00 ? 330 GLN A CG   1  
ATOM   1339  C  CD   . GLN B 2 72  ? -15.274 9.089   0.823   1.00 0.00 ? 330 GLN A CD   1  
ATOM   1340  O  OE1  . GLN B 2 72  ? -15.921 9.986   0.282   1.00 0.00 ? 330 GLN A OE1  1  
ATOM   1341  N  NE2  . GLN B 2 72  ? -15.848 8.106   1.509   1.00 0.00 ? 330 GLN A NE2  1  
ATOM   1342  H  H    . GLN B 2 72  ? -10.794 8.875   -0.200  1.00 0.00 ? 330 GLN A H    1  
ATOM   1343  H  HA   . GLN B 2 72  ? -11.825 7.751   2.290   1.00 0.00 ? 330 GLN A HA   1  
ATOM   1344  H  HB2  . GLN B 2 72  ? -13.122 7.410   -0.376  1.00 0.00 ? 330 GLN A HB2  1  
ATOM   1345  H  HB3  . GLN B 2 72  ? -13.785 7.007   1.201   1.00 0.00 ? 330 GLN A HB3  1  
ATOM   1346  H  HG2  . GLN B 2 72  ? -13.379 9.533   1.647   1.00 0.00 ? 330 GLN A HG2  1  
ATOM   1347  H  HG3  . GLN B 2 72  ? -13.432 9.633   -0.096  1.00 0.00 ? 330 GLN A HG3  1  
ATOM   1348  H  HE21 . GLN B 2 72  ? -15.270 7.435   1.928   1.00 0.00 ? 330 GLN A HE21 1  
ATOM   1349  H  HE22 . GLN B 2 72  ? -16.826 8.094   1.569   1.00 0.00 ? 330 GLN A HE22 1  
ATOM   1350  N  N    . LEU B 2 73  ? -10.246 6.528   -0.255  1.00 0.00 ? 331 LEU A N    1  
ATOM   1351  C  CA   . LEU B 2 73  ? -9.475  5.387   -0.717  1.00 0.00 ? 331 LEU A CA   1  
ATOM   1352  C  C    . LEU B 2 73  ? -8.967  4.594   0.458   1.00 0.00 ? 331 LEU A C    1  
ATOM   1353  O  O    . LEU B 2 73  ? -8.373  5.143   1.374   1.00 0.00 ? 331 LEU A O    1  
ATOM   1354  C  CB   . LEU B 2 73  ? -8.298  5.834   -1.543  1.00 0.00 ? 331 LEU A CB   1  
ATOM   1355  C  CG   . LEU B 2 73  ? -8.638  6.355   -2.927  1.00 0.00 ? 331 LEU A CG   1  
ATOM   1356  C  CD1  . LEU B 2 73  ? -7.385  6.769   -3.627  1.00 0.00 ? 331 LEU A CD1  1  
ATOM   1357  C  CD2  . LEU B 2 73  ? -9.343  5.299   -3.718  1.00 0.00 ? 331 LEU A CD2  1  
ATOM   1358  H  H    . LEU B 2 73  ? -10.194 7.380   -0.738  1.00 0.00 ? 331 LEU A H    1  
ATOM   1359  H  HA   . LEU B 2 73  ? -10.111 4.761   -1.325  1.00 0.00 ? 331 LEU A HA   1  
ATOM   1360  H  HB2  . LEU B 2 73  ? -7.797  6.605   -0.999  1.00 0.00 ? 331 LEU A HB2  1  
ATOM   1361  H  HB3  . LEU B 2 73  ? -7.623  4.998   -1.654  1.00 0.00 ? 331 LEU A HB3  1  
ATOM   1362  H  HG   . LEU B 2 73  ? -9.274  7.213   -2.844  1.00 0.00 ? 331 LEU A HG   1  
ATOM   1363  H  HD11 . LEU B 2 73  ? -6.624  6.851   -2.894  1.00 0.00 ? 331 LEU A HD11 1  
ATOM   1364  H  HD12 . LEU B 2 73  ? -7.533  7.722   -4.113  1.00 0.00 ? 331 LEU A HD12 1  
ATOM   1365  H  HD13 . LEU B 2 73  ? -7.110  6.024   -4.356  1.00 0.00 ? 331 LEU A HD13 1  
ATOM   1366  H  HD21 . LEU B 2 73  ? -8.697  4.454   -3.798  1.00 0.00 ? 331 LEU A HD21 1  
ATOM   1367  H  HD22 . LEU B 2 73  ? -9.570  5.675   -4.703  1.00 0.00 ? 331 LEU A HD22 1  
ATOM   1368  H  HD23 . LEU B 2 73  ? -10.255 5.013   -3.217  1.00 0.00 ? 331 LEU A HD23 1  
ATOM   1369  N  N    . LEU B 2 74  ? -9.288  3.329   0.474   1.00 0.00 ? 332 LEU A N    1  
ATOM   1370  C  CA   . LEU B 2 74  ? -8.822  2.464   1.527   1.00 0.00 ? 332 LEU A CA   1  
ATOM   1371  C  C    . LEU B 2 74  ? -7.695  1.611   1.038   1.00 0.00 ? 332 LEU A C    1  
ATOM   1372  O  O    . LEU B 2 74  ? -7.882  0.683   0.261   1.00 0.00 ? 332 LEU A O    1  
ATOM   1373  C  CB   . LEU B 2 74  ? -9.939  1.594   2.059   1.00 0.00 ? 332 LEU A CB   1  
ATOM   1374  C  CG   . LEU B 2 74  ? -10.450 1.978   3.416   1.00 0.00 ? 332 LEU A CG   1  
ATOM   1375  C  CD1  . LEU B 2 74  ? -11.584 1.080   3.850   1.00 0.00 ? 332 LEU A CD1  1  
ATOM   1376  C  CD2  . LEU B 2 74  ? -9.360  1.949   4.444   1.00 0.00 ? 332 LEU A CD2  1  
ATOM   1377  H  H    . LEU B 2 74  ? -9.900  2.984   -0.204  1.00 0.00 ? 332 LEU A H    1  
ATOM   1378  H  HA   . LEU B 2 74  ? -8.436  3.101   2.307   1.00 0.00 ? 332 LEU A HA   1  
ATOM   1379  H  HB2  . LEU B 2 74  ? -10.763 1.633   1.367   1.00 0.00 ? 332 LEU A HB2  1  
ATOM   1380  H  HB3  . LEU B 2 74  ? -9.582  0.594   2.108   1.00 0.00 ? 332 LEU A HB3  1  
ATOM   1381  H  HG   . LEU B 2 74  ? -10.808 2.967   3.351   1.00 0.00 ? 332 LEU A HG   1  
ATOM   1382  H  HD11 . LEU B 2 74  ? -12.326 1.647   4.381   1.00 0.00 ? 332 LEU A HD11 1  
ATOM   1383  H  HD12 . LEU B 2 74  ? -11.199 0.313   4.500   1.00 0.00 ? 332 LEU A HD12 1  
ATOM   1384  H  HD13 . LEU B 2 74  ? -12.029 0.623   2.981   1.00 0.00 ? 332 LEU A HD13 1  
ATOM   1385  H  HD21 . LEU B 2 74  ? -9.818  2.024   5.419   1.00 0.00 ? 332 LEU A HD21 1  
ATOM   1386  H  HD22 . LEU B 2 74  ? -8.691  2.783   4.289   1.00 0.00 ? 332 LEU A HD22 1  
ATOM   1387  H  HD23 . LEU B 2 74  ? -8.813  1.021   4.371   1.00 0.00 ? 332 LEU A HD23 1  
ATOM   1388  N  N    . PHE B 2 75  ? -6.549  1.878   1.598   1.00 0.00 ? 333 PHE A N    1  
ATOM   1389  C  CA   . PHE B 2 75  ? -5.334  1.240   1.188   1.00 0.00 ? 333 PHE A CA   1  
ATOM   1390  C  C    . PHE B 2 75  ? -5.131  -0.086  1.860   1.00 0.00 ? 333 PHE A C    1  
ATOM   1391  O  O    . PHE B 2 75  ? -4.624  -0.166  2.978   1.00 0.00 ? 333 PHE A O    1  
ATOM   1392  C  CB   . PHE B 2 75  ? -4.196  2.203   1.484   1.00 0.00 ? 333 PHE A CB   1  
ATOM   1393  C  CG   . PHE B 2 75  ? -4.600  3.589   1.089   1.00 0.00 ? 333 PHE A CG   1  
ATOM   1394  C  CD1  . PHE B 2 75  ? -5.387  4.357   1.920   1.00 0.00 ? 333 PHE A CD1  1  
ATOM   1395  C  CD2  . PHE B 2 75  ? -4.271  4.079   -0.145  1.00 0.00 ? 333 PHE A CD2  1  
ATOM   1396  C  CE1  . PHE B 2 75  ? -5.828  5.587   1.513   1.00 0.00 ? 333 PHE A CE1  1  
ATOM   1397  C  CE2  . PHE B 2 75  ? -4.722  5.300   -0.580  1.00 0.00 ? 333 PHE A CE2  1  
ATOM   1398  C  CZ   . PHE B 2 75  ? -5.508  6.051   0.257   1.00 0.00 ? 333 PHE A CZ   1  
ATOM   1399  H  H    . PHE B 2 75  ? -6.523  2.507   2.349   1.00 0.00 ? 333 PHE A H    1  
ATOM   1400  H  HA   . PHE B 2 75  ? -5.394  1.088   0.120   1.00 0.00 ? 333 PHE A HA   1  
ATOM   1401  H  HB2  . PHE B 2 75  ? -3.973  2.192   2.540   1.00 0.00 ? 333 PHE A HB2  1  
ATOM   1402  H  HB3  . PHE B 2 75  ? -3.321  1.917   0.918   1.00 0.00 ? 333 PHE A HB3  1  
ATOM   1403  H  HD1  . PHE B 2 75  ? -5.636  3.991   2.905   1.00 0.00 ? 333 PHE A HD1  1  
ATOM   1404  H  HD2  . PHE B 2 75  ? -3.675  3.489   -0.774  1.00 0.00 ? 333 PHE A HD2  1  
ATOM   1405  H  HE1  . PHE B 2 75  ? -6.448  6.182   2.167   1.00 0.00 ? 333 PHE A HE1  1  
ATOM   1406  H  HE2  . PHE B 2 75  ? -4.423  5.684   -1.565  1.00 0.00 ? 333 PHE A HE2  1  
ATOM   1407  H  HZ   . PHE B 2 75  ? -5.898  6.989   -0.073  1.00 0.00 ? 333 PHE A HZ   1  
ATOM   1408  N  N    . CYS B 2 76  ? -5.530  -1.134  1.165   1.00 0.00 ? 334 CYS A N    1  
ATOM   1409  C  CA   . CYS B 2 76  ? -5.351  -2.458  1.683   1.00 0.00 ? 334 CYS A CA   1  
ATOM   1410  C  C    . CYS B 2 76  ? -3.878  -2.741  1.753   1.00 0.00 ? 334 CYS A C    1  
ATOM   1411  O  O    . CYS B 2 76  ? -3.285  -3.130  0.749   1.00 0.00 ? 334 CYS A O    1  
ATOM   1412  C  CB   . CYS B 2 76  ? -6.018  -3.510  0.801   1.00 0.00 ? 334 CYS A CB   1  
ATOM   1413  S  SG   . CYS B 2 76  ? -5.411  -5.197  1.134   1.00 0.00 ? 334 CYS A SG   1  
ATOM   1414  H  H    . CYS B 2 76  ? -5.951  -1.006  0.288   1.00 0.00 ? 334 CYS A H    1  
ATOM   1415  H  HA   . CYS B 2 76  ? -5.768  -2.494  2.670   1.00 0.00 ? 334 CYS A HA   1  
ATOM   1416  H  HB2  . CYS B 2 76  ? -7.083  -3.498  0.979   1.00 0.00 ? 334 CYS A HB2  1  
ATOM   1417  H  HB3  . CYS B 2 76  ? -5.823  -3.285  -0.238  1.00 0.00 ? 334 CYS A HB3  1  
ATOM   1418  N  N    . ASP B 2 77  ? -3.254  -2.533  2.905   1.00 0.00 ? 335 ASP A N    1  
ATOM   1419  C  CA   . ASP B 2 77  ? -1.840  -2.820  2.965   1.00 0.00 ? 335 ASP A CA   1  
ATOM   1420  C  C    . ASP B 2 77  ? -1.637  -4.313  3.118   1.00 0.00 ? 335 ASP A C    1  
ATOM   1421  O  O    . ASP B 2 77  ? -0.853  -4.766  3.950   1.00 0.00 ? 335 ASP A O    1  
ATOM   1422  C  CB   . ASP B 2 77  ? -1.101  -2.055  4.055   1.00 0.00 ? 335 ASP A CB   1  
ATOM   1423  C  CG   . ASP B 2 77  ? -2.029  -1.426  5.074   1.00 0.00 ? 335 ASP A CG   1  
ATOM   1424  O  OD1  . ASP B 2 77  ? -2.489  -2.150  5.982   1.00 0.00 ? 335 ASP A OD1  1  
ATOM   1425  O  OD2  . ASP B 2 77  ? -2.291  -0.210  4.966   1.00 0.00 ? 335 ASP A OD2  1  
ATOM   1426  H  H    . ASP B 2 77  ? -3.746  -2.209  3.703   1.00 0.00 ? 335 ASP A H    1  
ATOM   1427  H  HA   . ASP B 2 77  ? -1.433  -2.521  2.007   1.00 0.00 ? 335 ASP A HA   1  
ATOM   1428  H  HB2  . ASP B 2 77  ? -0.435  -2.736  4.567   1.00 0.00 ? 335 ASP A HB2  1  
ATOM   1429  H  HB3  . ASP B 2 77  ? -0.512  -1.277  3.584   1.00 0.00 ? 335 ASP A HB3  1  
ATOM   1430  N  N    . ASP B 2 78  ? -2.427  -5.069  2.355   1.00 0.00 ? 336 ASP A N    1  
ATOM   1431  C  CA   . ASP B 2 78  ? -2.320  -6.512  2.319   1.00 0.00 ? 336 ASP A CA   1  
ATOM   1432  C  C    . ASP B 2 78  ? -2.041  -6.950  0.880   1.00 0.00 ? 336 ASP A C    1  
ATOM   1433  O  O    . ASP B 2 78  ? -2.022  -8.139  0.560   1.00 0.00 ? 336 ASP A O    1  
ATOM   1434  C  CB   . ASP B 2 78  ? -3.592  -7.170  2.857   1.00 0.00 ? 336 ASP A CB   1  
ATOM   1435  C  CG   . ASP B 2 78  ? -3.378  -8.612  3.265   1.00 0.00 ? 336 ASP A CG   1  
ATOM   1436  O  OD1  . ASP B 2 78  ? -2.965  -8.846  4.421   1.00 0.00 ? 336 ASP A OD1  1  
ATOM   1437  O  OD2  . ASP B 2 78  ? -3.629  -9.508  2.432   1.00 0.00 ? 336 ASP A OD2  1  
ATOM   1438  H  H    . ASP B 2 78  ? -3.132  -4.638  1.830   1.00 0.00 ? 336 ASP A H    1  
ATOM   1439  H  HA   . ASP B 2 78  ? -1.477  -6.786  2.935   1.00 0.00 ? 336 ASP A HA   1  
ATOM   1440  H  HB2  . ASP B 2 78  ? -3.938  -6.618  3.718   1.00 0.00 ? 336 ASP A HB2  1  
ATOM   1441  H  HB3  . ASP B 2 78  ? -4.352  -7.144  2.091   1.00 0.00 ? 336 ASP A HB3  1  
ATOM   1442  N  N    . CYS B 2 79  ? -1.821  -5.946  0.026   1.00 0.00 ? 337 CYS A N    1  
ATOM   1443  C  CA   . CYS B 2 79  ? -1.493  -6.132  -1.378  1.00 0.00 ? 337 CYS A CA   1  
ATOM   1444  C  C    . CYS B 2 79  ? -1.356  -4.781  -2.059  1.00 0.00 ? 337 CYS A C    1  
ATOM   1445  O  O    . CYS B 2 79  ? -0.644  -4.659  -3.045  1.00 0.00 ? 337 CYS A O    1  
ATOM   1446  C  CB   . CYS B 2 79  ? -2.539  -6.928  -2.132  1.00 0.00 ? 337 CYS A CB   1  
ATOM   1447  S  SG   . CYS B 2 79  ? -4.103  -6.012  -2.366  1.00 0.00 ? 337 CYS A SG   1  
ATOM   1448  H  H    . CYS B 2 79  ? -1.869  -5.034  0.360   1.00 0.00 ? 337 CYS A H    1  
ATOM   1449  H  HA   . CYS B 2 79  ? -0.543  -6.642  -1.415  1.00 0.00 ? 337 CYS A HA   1  
ATOM   1450  H  HB2  . CYS B 2 79  ? -2.144  -7.157  -3.118  1.00 0.00 ? 337 CYS A HB2  1  
ATOM   1451  H  HB3  . CYS B 2 79  ? -2.744  -7.844  -1.605  1.00 0.00 ? 337 CYS A HB3  1  
ATOM   1452  N  N    . ASP B 2 80  ? -2.096  -3.794  -1.540  1.00 0.00 ? 338 ASP A N    1  
ATOM   1453  C  CA   . ASP B 2 80  ? -2.069  -2.417  -2.038  1.00 0.00 ? 338 ASP A CA   1  
ATOM   1454  C  C    . ASP B 2 80  ? -3.205  -2.131  -3.030  1.00 0.00 ? 338 ASP A C    1  
ATOM   1455  O  O    . ASP B 2 80  ? -2.973  -1.669  -4.147  1.00 0.00 ? 338 ASP A O    1  
ATOM   1456  C  CB   . ASP B 2 80  ? -0.703  -2.083  -2.651  1.00 0.00 ? 338 ASP A CB   1  
ATOM   1457  C  CG   . ASP B 2 80  ? -0.529  -0.611  -2.981  1.00 0.00 ? 338 ASP A CG   1  
ATOM   1458  O  OD1  . ASP B 2 80  ? -0.923  -0.199  -4.093  1.00 0.00 ? 338 ASP A OD1  1  
ATOM   1459  O  OD2  . ASP B 2 80  ? 0.012   0.129   -2.129  1.00 0.00 ? 338 ASP A OD2  1  
ATOM   1460  H  H    . ASP B 2 80  ? -2.698  -4.006  -0.800  1.00 0.00 ? 338 ASP A H    1  
ATOM   1461  H  HA   . ASP B 2 80  ? -2.216  -1.778  -1.179  1.00 0.00 ? 338 ASP A HA   1  
ATOM   1462  H  HB2  . ASP B 2 80  ? 0.070   -2.361  -1.950  1.00 0.00 ? 338 ASP A HB2  1  
ATOM   1463  H  HB3  . ASP B 2 80  ? -0.580  -2.656  -3.552  1.00 0.00 ? 338 ASP A HB3  1  
ATOM   1464  N  N    . ARG B 2 81  ? -4.435  -2.423  -2.609  1.00 0.00 ? 339 ARG A N    1  
ATOM   1465  C  CA   . ARG B 2 81  ? -5.627  -2.150  -3.418  1.00 0.00 ? 339 ARG A CA   1  
ATOM   1466  C  C    . ARG B 2 81  ? -6.504  -1.100  -2.710  1.00 0.00 ? 339 ARG A C    1  
ATOM   1467  O  O    . ARG B 2 81  ? -7.340  -1.451  -1.877  1.00 0.00 ? 339 ARG A O    1  
ATOM   1468  C  CB   . ARG B 2 81  ? -6.425  -3.439  -3.644  1.00 0.00 ? 339 ARG A CB   1  
ATOM   1469  C  CG   . ARG B 2 81  ? -5.798  -4.378  -4.660  1.00 0.00 ? 339 ARG A CG   1  
ATOM   1470  C  CD   . ARG B 2 81  ? -6.647  -5.626  -4.879  1.00 0.00 ? 339 ARG A CD   1  
ATOM   1471  N  NE   . ARG B 2 81  ? -5.867  -6.710  -5.478  1.00 0.00 ? 339 ARG A NE   1  
ATOM   1472  C  CZ   . ARG B 2 81  ? -5.523  -7.826  -4.839  1.00 0.00 ? 339 ARG A CZ   1  
ATOM   1473  N  NH1  . ARG B 2 81  ? -5.876  -8.011  -3.575  1.00 0.00 ? 339 ARG A NH1  1  
ATOM   1474  N  NH2  . ARG B 2 81  ? -4.820  -8.759  -5.467  1.00 0.00 ? 339 ARG A NH2  1  
ATOM   1475  H  H    . ARG B 2 81  ? -4.544  -2.863  -1.739  1.00 0.00 ? 339 ARG A H    1  
ATOM   1476  H  HA   . ARG B 2 81  ? -5.310  -1.761  -4.377  1.00 0.00 ? 339 ARG A HA   1  
ATOM   1477  H  HB2  . ARG B 2 81  ? -6.514  -3.965  -2.706  1.00 0.00 ? 339 ARG A HB2  1  
ATOM   1478  H  HB3  . ARG B 2 81  ? -7.407  -3.179  -3.994  1.00 0.00 ? 339 ARG A HB3  1  
ATOM   1479  H  HG2  . ARG B 2 81  ? -5.697  -3.858  -5.601  1.00 0.00 ? 339 ARG A HG2  1  
ATOM   1480  H  HG3  . ARG B 2 81  ? -4.821  -4.675  -4.307  1.00 0.00 ? 339 ARG A HG3  1  
ATOM   1481  H  HD2  . ARG B 2 81  ? -7.053  -5.949  -3.940  1.00 0.00 ? 339 ARG A HD2  1  
ATOM   1482  H  HD3  . ARG B 2 81  ? -7.461  -5.385  -5.535  1.00 0.00 ? 339 ARG A HD3  1  
ATOM   1483  H  HE   . ARG B 2 81  ? -5.587  -6.601  -6.411  1.00 0.00 ? 339 ARG A HE   1  
ATOM   1484  H  HH11 . ARG B 2 81  ? -6.403  -7.310  -3.097  1.00 0.00 ? 339 ARG A HH11 1  
ATOM   1485  H  HH12 . ARG B 2 81  ? -5.616  -8.852  -3.101  1.00 0.00 ? 339 ARG A HH12 1  
ATOM   1486  H  HH21 . ARG B 2 81  ? -4.549  -8.624  -6.420  1.00 0.00 ? 339 ARG A HH21 1  
ATOM   1487  H  HH22 . ARG B 2 81  ? -4.562  -9.598  -4.988  1.00 0.00 ? 339 ARG A HH22 1  
ATOM   1488  N  N    . GLY B 2 82  ? -6.305  0.189   -3.033  1.00 0.00 ? 340 GLY A N    1  
ATOM   1489  C  CA   . GLY B 2 82  ? -7.082  1.252   -2.386  1.00 0.00 ? 340 GLY A CA   1  
ATOM   1490  C  C    . GLY B 2 82  ? -8.534  1.293   -2.829  1.00 0.00 ? 340 GLY A C    1  
ATOM   1491  O  O    . GLY B 2 82  ? -8.830  1.201   -4.006  1.00 0.00 ? 340 GLY A O    1  
ATOM   1492  H  H    . GLY B 2 82  ? -5.632  0.418   -3.708  1.00 0.00 ? 340 GLY A H    1  
ATOM   1493  H  HA2  . GLY B 2 82  ? -7.053  1.088   -1.328  1.00 0.00 ? 340 GLY A HA2  1  
ATOM   1494  H  HA3  . GLY B 2 82  ? -6.632  2.217   -2.589  1.00 0.00 ? 340 GLY A HA3  1  
ATOM   1495  N  N    . TYR B 2 83  ? -9.445  1.478   -1.887  1.00 0.00 ? 341 TYR A N    1  
ATOM   1496  C  CA   . TYR B 2 83  ? -10.879 1.527   -2.216  1.00 0.00 ? 341 TYR A CA   1  
ATOM   1497  C  C    . TYR B 2 83  ? -11.501 2.721   -1.578  1.00 0.00 ? 341 TYR A C    1  
ATOM   1498  O  O    . TYR B 2 83  ? -11.650 2.714   -0.357  1.00 0.00 ? 341 TYR A O    1  
ATOM   1499  C  CB   . TYR B 2 83  ? -11.734 0.388   -1.646  1.00 0.00 ? 341 TYR A CB   1  
ATOM   1500  C  CG   . TYR B 2 83  ? -11.451 -1.043  -2.029  1.00 0.00 ? 341 TYR A CG   1  
ATOM   1501  C  CD1  . TYR B 2 83  ? -10.278 -1.430  -2.613  1.00 0.00 ? 341 TYR A CD1  1  
ATOM   1502  C  CD2  . TYR B 2 83  ? -12.416 -2.021  -1.788  1.00 0.00 ? 341 TYR A CD2  1  
ATOM   1503  C  CE1  . TYR B 2 83  ? -10.058 -2.745  -2.959  1.00 0.00 ? 341 TYR A CE1  1  
ATOM   1504  C  CE2  . TYR B 2 83  ? -12.202 -3.338  -2.130  1.00 0.00 ? 341 TYR A CE2  1  
ATOM   1505  C  CZ   . TYR B 2 83  ? -11.017 -3.691  -2.721  1.00 0.00 ? 341 TYR A CZ   1  
ATOM   1506  O  OH   . TYR B 2 83  ? -10.778 -4.994  -3.076  1.00 0.00 ? 341 TYR A OH   1  
ATOM   1507  H  H    . TYR B 2 83  ? -9.147  1.673   -0.970  1.00 0.00 ? 341 TYR A H    1  
ATOM   1508  H  HA   . TYR B 2 83  ? -10.998 1.574   -3.281  1.00 0.00 ? 341 TYR A HA   1  
ATOM   1509  H  HB2  . TYR B 2 83  ? -11.716 0.445   -0.573  1.00 0.00 ? 341 TYR A HB2  1  
ATOM   1510  H  HB3  . TYR B 2 83  ? -12.747 0.593   -1.949  1.00 0.00 ? 341 TYR A HB3  1  
ATOM   1511  H  HD1  . TYR B 2 83  ? -9.525  -0.689  -2.812  1.00 0.00 ? 341 TYR A HD1  1  
ATOM   1512  H  HD2  . TYR B 2 83  ? -13.347 -1.734  -1.323  1.00 0.00 ? 341 TYR A HD2  1  
ATOM   1513  H  HE1  . TYR B 2 83  ? -9.131  -3.024  -3.421  1.00 0.00 ? 341 TYR A HE1  1  
ATOM   1514  H  HE2  . TYR B 2 83  ? -12.964 -4.079  -1.939  1.00 0.00 ? 341 TYR A HE2  1  
ATOM   1515  H  HH   . TYR B 2 83  ? -9.873  -5.227  -2.854  1.00 0.00 ? 341 TYR A HH   1  
ATOM   1516  N  N    . HIS B 2 84  ? -11.929 3.720   -2.334  1.00 0.00 ? 342 HIS A N    1  
ATOM   1517  C  CA   . HIS B 2 84  ? -12.575 4.813   -1.668  1.00 0.00 ? 342 HIS A CA   1  
ATOM   1518  C  C    . HIS B 2 84  ? -13.514 4.148   -0.696  1.00 0.00 ? 342 HIS A C    1  
ATOM   1519  O  O    . HIS B 2 84  ? -14.315 3.321   -1.097  1.00 0.00 ? 342 HIS A O    1  
ATOM   1520  C  CB   . HIS B 2 84  ? -13.332 5.702   -2.623  1.00 0.00 ? 342 HIS A CB   1  
ATOM   1521  C  CG   . HIS B 2 84  ? -12.486 6.405   -3.628  1.00 0.00 ? 342 HIS A CG   1  
ATOM   1522  N  ND1  . HIS B 2 84  ? -12.370 5.968   -4.923  1.00 0.00 ? 342 HIS A ND1  1  
ATOM   1523  C  CD2  . HIS B 2 84  ? -11.713 7.513   -3.531  1.00 0.00 ? 342 HIS A CD2  1  
ATOM   1524  C  CE1  . HIS B 2 84  ? -11.573 6.771   -5.593  1.00 0.00 ? 342 HIS A CE1  1  
ATOM   1525  N  NE2  . HIS B 2 84  ? -11.161 7.724   -4.773  1.00 0.00 ? 342 HIS A NE2  1  
ATOM   1526  H  H    . HIS B 2 84  ? -11.855 3.695   -3.309  1.00 0.00 ? 342 HIS A H    1  
ATOM   1527  H  HA   . HIS B 2 84  ? -11.834 5.377   -1.128  1.00 0.00 ? 342 HIS A HA   1  
ATOM   1528  H  HB2  . HIS B 2 84  ? -14.041 5.109   -3.151  1.00 0.00 ? 342 HIS A HB2  1  
ATOM   1529  H  HB3  . HIS B 2 84  ? -13.849 6.434   -2.055  1.00 0.00 ? 342 HIS A HB3  1  
ATOM   1530  H  HD2  . HIS B 2 84  ? -11.501 8.074   -2.627  1.00 0.00 ? 342 HIS A HD2  1  
ATOM   1531  H  HE1  . HIS B 2 84  ? -11.260 6.637   -6.617  1.00 0.00 ? 342 HIS A HE1  1  
ATOM   1532  H  HE2  . HIS B 2 84  ? -10.487 8.402   -4.988  1.00 0.00 ? 342 HIS A HE2  1  
ATOM   1533  N  N    . MET B 2 85  ? -13.350 4.439   0.574   1.00 0.00 ? 343 MET A N    1  
ATOM   1534  C  CA   . MET B 2 85  ? -14.131 3.799   1.621   1.00 0.00 ? 343 MET A CA   1  
ATOM   1535  C  C    . MET B 2 85  ? -15.615 3.725   1.298   1.00 0.00 ? 343 MET A C    1  
ATOM   1536  O  O    . MET B 2 85  ? -16.379 3.140   2.051   1.00 0.00 ? 343 MET A O    1  
ATOM   1537  C  CB   . MET B 2 85  ? -13.908 4.487   2.949   1.00 0.00 ? 343 MET A CB   1  
ATOM   1538  C  CG   . MET B 2 85  ? -12.516 4.343   3.491   1.00 0.00 ? 343 MET A CG   1  
ATOM   1539  S  SD   . MET B 2 85  ? -11.707 5.893   3.948   1.00 0.00 ? 343 MET A SD   1  
ATOM   1540  C  CE   . MET B 2 85  ? -13.058 6.777   4.691   1.00 0.00 ? 343 MET A CE   1  
ATOM   1541  H  H    . MET B 2 85  ? -12.687 5.109   0.819   1.00 0.00 ? 343 MET A H    1  
ATOM   1542  H  HA   . MET B 2 85  ? -13.768 2.784   1.706   1.00 0.00 ? 343 MET A HA   1  
ATOM   1543  H  HB2  . MET B 2 85  ? -14.122 5.518   2.851   1.00 0.00 ? 343 MET A HB2  1  
ATOM   1544  H  HB3  . MET B 2 85  ? -14.565 4.051   3.655   1.00 0.00 ? 343 MET A HB3  1  
ATOM   1545  H  HG2  . MET B 2 85  ? -12.564 3.727   4.362   1.00 0.00 ? 343 MET A HG2  1  
ATOM   1546  H  HG3  . MET B 2 85  ? -11.931 3.851   2.743   1.00 0.00 ? 343 MET A HG3  1  
ATOM   1547  H  HE1  . MET B 2 85  ? -13.966 6.523   4.171   1.00 0.00 ? 343 MET A HE1  1  
ATOM   1548  H  HE2  . MET B 2 85  ? -12.882 7.840   4.616   1.00 0.00 ? 343 MET A HE2  1  
ATOM   1549  H  HE3  . MET B 2 85  ? -13.145 6.496   5.728   1.00 0.00 ? 343 MET A HE3  1  
ATOM   1550  N  N    . TYR B 2 86  ? -16.024 4.328   0.199   1.00 0.00 ? 344 TYR A N    1  
ATOM   1551  C  CA   . TYR B 2 86  ? -17.409 4.251   -0.221  1.00 0.00 ? 344 TYR A CA   1  
ATOM   1552  C  C    . TYR B 2 86  ? -17.490 3.497   -1.542  1.00 0.00 ? 344 TYR A C    1  
ATOM   1553  O  O    . TYR B 2 86  ? -18.390 3.704   -2.356  1.00 0.00 ? 344 TYR A O    1  
ATOM   1554  C  CB   . TYR B 2 86  ? -18.064 5.635   -0.310  1.00 0.00 ? 344 TYR A CB   1  
ATOM   1555  C  CG   . TYR B 2 86  ? -17.455 6.596   -1.313  1.00 0.00 ? 344 TYR A CG   1  
ATOM   1556  C  CD1  . TYR B 2 86  ? -16.127 7.006   -1.225  1.00 0.00 ? 344 TYR A CD1  1  
ATOM   1557  C  CD2  . TYR B 2 86  ? -18.241 7.144   -2.320  1.00 0.00 ? 344 TYR A CD2  1  
ATOM   1558  C  CE1  . TYR B 2 86  ? -15.605 7.932   -2.115  1.00 0.00 ? 344 TYR A CE1  1  
ATOM   1559  C  CE2  . TYR B 2 86  ? -17.723 8.057   -3.218  1.00 0.00 ? 344 TYR A CE2  1  
ATOM   1560  C  CZ   . TYR B 2 86  ? -16.407 8.449   -3.110  1.00 0.00 ? 344 TYR A CZ   1  
ATOM   1561  O  OH   . TYR B 2 86  ? -15.894 9.367   -3.996  1.00 0.00 ? 344 TYR A OH   1  
ATOM   1562  H  H    . TYR B 2 86  ? -15.381 4.826   -0.339  1.00 0.00 ? 344 TYR A H    1  
ATOM   1563  H  HA   . TYR B 2 86  ? -17.928 3.664   0.530   1.00 0.00 ? 344 TYR A HA   1  
ATOM   1564  H  HB2  . TYR B 2 86  ? -19.101 5.508   -0.576  1.00 0.00 ? 344 TYR A HB2  1  
ATOM   1565  H  HB3  . TYR B 2 86  ? -18.012 6.102   0.664   1.00 0.00 ? 344 TYR A HB3  1  
ATOM   1566  H  HD1  . TYR B 2 86  ? -15.489 6.582   -0.454  1.00 0.00 ? 344 TYR A HD1  1  
ATOM   1567  H  HD2  . TYR B 2 86  ? -19.273 6.837   -2.404  1.00 0.00 ? 344 TYR A HD2  1  
ATOM   1568  H  HE1  . TYR B 2 86  ? -14.567 8.247   -2.024  1.00 0.00 ? 344 TYR A HE1  1  
ATOM   1569  H  HE2  . TYR B 2 86  ? -18.351 8.463   -3.997  1.00 0.00 ? 344 TYR A HE2  1  
ATOM   1570  H  HH   . TYR B 2 86  ? -15.029 9.075   -4.294  1.00 0.00 ? 344 TYR A HH   1  
ATOM   1571  N  N    . CYS B 2 87  ? -16.512 2.612   -1.721  1.00 0.00 ? 345 CYS A N    1  
ATOM   1572  C  CA   . CYS B 2 87  ? -16.409 1.757   -2.896  1.00 0.00 ? 345 CYS A CA   1  
ATOM   1573  C  C    . CYS B 2 87  ? -16.506 0.313   -2.448  1.00 0.00 ? 345 CYS A C    1  
ATOM   1574  O  O    . CYS B 2 87  ? -17.015 -0.547  -3.168  1.00 0.00 ? 345 CYS A O    1  
ATOM   1575  C  CB   . CYS B 2 87  ? -15.104 2.020   -3.687  1.00 0.00 ? 345 CYS A CB   1  
ATOM   1576  S  SG   . CYS B 2 87  ? -15.067 3.694   -4.372  1.00 0.00 ? 345 CYS A SG   1  
ATOM   1577  H  H    . CYS B 2 87  ? -15.838 2.527   -1.020  1.00 0.00 ? 345 CYS A H    1  
ATOM   1578  H  HA   . CYS B 2 87  ? -17.252 1.980   -3.525  1.00 0.00 ? 345 CYS A HA   1  
ATOM   1579  H  HB2  . CYS B 2 87  ? -14.241 1.894   -3.048  1.00 0.00 ? 345 CYS A HB2  1  
ATOM   1580  H  HB3  . CYS B 2 87  ? -15.036 1.323   -4.511  1.00 0.00 ? 345 CYS A HB3  1  
ATOM   1581  N  N    . LEU B 2 88  ? -16.013 0.066   -1.237  1.00 0.00 ? 346 LEU A N    1  
ATOM   1582  C  CA   . LEU B 2 88  ? -16.054 -1.265  -0.638  1.00 0.00 ? 346 LEU A CA   1  
ATOM   1583  C  C    . LEU B 2 88  ? -17.467 -1.829  -0.641  1.00 0.00 ? 346 LEU A C    1  
ATOM   1584  O  O    . LEU B 2 88  ? -18.416 -1.175  -1.073  1.00 0.00 ? 346 LEU A O    1  
ATOM   1585  C  CB   . LEU B 2 88  ? -15.563 -1.233  0.810   1.00 0.00 ? 346 LEU A CB   1  
ATOM   1586  C  CG   . LEU B 2 88  ? -14.916 0.064   1.291   1.00 0.00 ? 346 LEU A CG   1  
ATOM   1587  C  CD1  . LEU B 2 88  ? -14.421 -0.074  2.700   1.00 0.00 ? 346 LEU A CD1  1  
ATOM   1588  C  CD2  . LEU B 2 88  ? -13.780 0.440   0.394   1.00 0.00 ? 346 LEU A CD2  1  
ATOM   1589  H  H    . LEU B 2 88  ? -15.579 0.800   -0.741  1.00 0.00 ? 346 LEU A H    1  
ATOM   1590  H  HA   . LEU B 2 88  ? -15.415 -1.912  -1.199  1.00 0.00 ? 346 LEU A HA   1  
ATOM   1591  H  HB2  . LEU B 2 88  ? -16.402 -1.433  1.433   1.00 0.00 ? 346 LEU A HB2  1  
ATOM   1592  H  HB3  . LEU B 2 88  ? -14.849 -2.029  0.940   1.00 0.00 ? 346 LEU A HB3  1  
ATOM   1593  H  HG   . LEU B 2 88  ? -15.626 0.865   1.276   1.00 0.00 ? 346 LEU A HG   1  
ATOM   1594  H  HD11 . LEU B 2 88  ? -13.635 0.644   2.846   1.00 0.00 ? 346 LEU A HD11 1  
ATOM   1595  H  HD12 . LEU B 2 88  ? -14.039 -1.073  2.858   1.00 0.00 ? 346 LEU A HD12 1  
ATOM   1596  H  HD13 . LEU B 2 88  ? -15.226 0.123   3.391   1.00 0.00 ? 346 LEU A HD13 1  
ATOM   1597  H  HD21 . LEU B 2 88  ? -13.960 0.027   -0.592  1.00 0.00 ? 346 LEU A HD21 1  
ATOM   1598  H  HD22 . LEU B 2 88  ? -12.858 0.042   0.791   1.00 0.00 ? 346 LEU A HD22 1  
ATOM   1599  H  HD23 . LEU B 2 88  ? -13.711 1.515   0.326   1.00 0.00 ? 346 LEU A HD23 1  
ATOM   1600  N  N    . ASN B 2 89  ? -17.595 -3.050  -0.143  1.00 0.00 ? 347 ASN A N    1  
ATOM   1601  C  CA   . ASN B 2 89  ? -18.888 -3.693  -0.034  1.00 0.00 ? 347 ASN A CA   1  
ATOM   1602  C  C    . ASN B 2 89  ? -19.505 -3.231  1.262   1.00 0.00 ? 347 ASN A C    1  
ATOM   1603  O  O    . ASN B 2 89  ? -20.706 -2.962  1.329   1.00 0.00 ? 347 ASN A O    1  
ATOM   1604  C  CB   . ASN B 2 89  ? -18.765 -5.212  -0.090  1.00 0.00 ? 347 ASN A CB   1  
ATOM   1605  C  CG   . ASN B 2 89  ? -18.189 -5.701  -1.400  1.00 0.00 ? 347 ASN A CG   1  
ATOM   1606  O  OD1  . ASN B 2 89  ? -17.344 -5.044  -2.008  1.00 0.00 ? 347 ASN A OD1  1  
ATOM   1607  N  ND2  . ASN B 2 89  ? -18.655 -6.859  -1.843  1.00 0.00 ? 347 ASN A ND2  1  
ATOM   1608  H  H    . ASN B 2 89  ? -16.806 -3.513  0.188   1.00 0.00 ? 347 ASN A H    1  
ATOM   1609  H  HA   . ASN B 2 89  ? -19.499 -3.334  -0.838  1.00 0.00 ? 347 ASN A HA   1  
ATOM   1610  H  HB2  . ASN B 2 89  ? -18.126 -5.545  0.711   1.00 0.00 ? 347 ASN A HB2  1  
ATOM   1611  H  HB3  . ASN B 2 89  ? -19.735 -5.645  0.031   1.00 0.00 ? 347 ASN A HB3  1  
ATOM   1612  H  HD21 . ASN B 2 89  ? -19.332 -7.322  -1.306  1.00 0.00 ? 347 ASN A HD21 1  
ATOM   1613  H  HD22 . ASN B 2 89  ? -18.308 -7.202  -2.687  1.00 0.00 ? 347 ASN A HD22 1  
ATOM   1614  N  N    . PRO B 2 90  ? -18.692 -3.191  2.332   1.00 0.00 ? 348 PRO A N    1  
ATOM   1615  C  CA   . PRO B 2 90  ? -19.074 -2.630  3.594   1.00 0.00 ? 348 PRO A CA   1  
ATOM   1616  C  C    . PRO B 2 90  ? -18.375 -1.274  3.710   1.00 0.00 ? 348 PRO A C    1  
ATOM   1617  O  O    . PRO B 2 90  ? -17.556 -1.061  4.606   1.00 0.00 ? 348 PRO A O    1  
ATOM   1618  C  CB   . PRO B 2 90  ? -18.484 -3.648  4.550   1.00 0.00 ? 348 PRO A CB   1  
ATOM   1619  C  CG   . PRO B 2 90  ? -17.175 -3.989  3.937   1.00 0.00 ? 348 PRO A CG   1  
ATOM   1620  C  CD   . PRO B 2 90  ? -17.346 -3.798  2.453   1.00 0.00 ? 348 PRO A CD   1  
ATOM   1621  H  HA   . PRO B 2 90  ? -20.139 -2.542  3.714   1.00 0.00 ? 348 PRO A HA   1  
ATOM   1622  H  HB2  . PRO B 2 90  ? -18.360 -3.209  5.513   1.00 0.00 ? 348 PRO A HB2  1  
ATOM   1623  H  HB3  . PRO B 2 90  ? -19.129 -4.510  4.606   1.00 0.00 ? 348 PRO A HB3  1  
ATOM   1624  H  HG2  . PRO B 2 90  ? -16.415 -3.323  4.314   1.00 0.00 ? 348 PRO A HG2  1  
ATOM   1625  H  HG3  . PRO B 2 90  ? -16.921 -5.015  4.157   1.00 0.00 ? 348 PRO A HG3  1  
ATOM   1626  H  HD2  . PRO B 2 90  ? -16.586 -3.140  2.064   1.00 0.00 ? 348 PRO A HD2  1  
ATOM   1627  H  HD3  . PRO B 2 90  ? -17.312 -4.749  1.962   1.00 0.00 ? 348 PRO A HD3  1  
ATOM   1628  N  N    . PRO B 2 91  ? -18.700 -0.333  2.789   1.00 0.00 ? 349 PRO A N    1  
ATOM   1629  C  CA   . PRO B 2 91  ? -18.040 0.971   2.707   1.00 0.00 ? 349 PRO A CA   1  
ATOM   1630  C  C    . PRO B 2 91  ? -17.945 1.685   4.052   1.00 0.00 ? 349 PRO A C    1  
ATOM   1631  O  O    . PRO B 2 91  ? -18.927 1.750   4.792   1.00 0.00 ? 349 PRO A O    1  
ATOM   1632  C  CB   . PRO B 2 91  ? -18.914 1.762   1.727   1.00 0.00 ? 349 PRO A CB   1  
ATOM   1633  C  CG   . PRO B 2 91  ? -20.181 1.015   1.645   1.00 0.00 ? 349 PRO A CG   1  
ATOM   1634  C  CD   . PRO B 2 91  ? -19.802 -0.416  1.818   1.00 0.00 ? 349 PRO A CD   1  
ATOM   1635  H  HA   . PRO B 2 91  ? -17.056 0.873   2.279   1.00 0.00 ? 349 PRO A HA   1  
ATOM   1636  H  HB2  . PRO B 2 91  ? -19.066 2.753   2.094   1.00 0.00 ? 349 PRO A HB2  1  
ATOM   1637  H  HB3  . PRO B 2 91  ? -18.433 1.804   0.769   1.00 0.00 ? 349 PRO A HB3  1  
ATOM   1638  H  HG2  . PRO B 2 91  ? -20.838 1.332   2.432   1.00 0.00 ? 349 PRO A HG2  1  
ATOM   1639  H  HG3  . PRO B 2 91  ? -20.636 1.170   0.688   1.00 0.00 ? 349 PRO A HG3  1  
ATOM   1640  H  HD2  . PRO B 2 91  ? -20.634 -0.972  2.215   1.00 0.00 ? 349 PRO A HD2  1  
ATOM   1641  H  HD3  . PRO B 2 91  ? -19.466 -0.846  0.880   1.00 0.00 ? 349 PRO A HD3  1  
ATOM   1642  N  N    . VAL B 2 92  ? -16.762 2.223   4.371   1.00 0.00 ? 350 VAL A N    1  
ATOM   1643  C  CA   . VAL B 2 92  ? -16.571 2.924   5.607   1.00 0.00 ? 350 VAL A CA   1  
ATOM   1644  C  C    . VAL B 2 92  ? -16.570 4.415   5.323   1.00 0.00 ? 350 VAL A C    1  
ATOM   1645  O  O    . VAL B 2 92  ? -16.613 4.838   4.167   1.00 0.00 ? 350 VAL A O    1  
ATOM   1646  C  CB   . VAL B 2 92  ? -15.265 2.473   6.318   1.00 0.00 ? 350 VAL A CB   1  
ATOM   1647  C  CG1  . VAL B 2 92  ? -14.854 1.081   5.865   1.00 0.00 ? 350 VAL A CG1  1  
ATOM   1648  C  CG2  . VAL B 2 92  ? -14.120 3.442   6.102   1.00 0.00 ? 350 VAL A CG2  1  
ATOM   1649  H  H    . VAL B 2 92  ? -16.008 2.169   3.755   1.00 0.00 ? 350 VAL A H    1  
ATOM   1650  H  HA   . VAL B 2 92  ? -17.401 2.696   6.250   1.00 0.00 ? 350 VAL A HA   1  
ATOM   1651  H  HB   . VAL B 2 92  ? -15.458 2.423   7.374   1.00 0.00 ? 350 VAL A HB   1  
ATOM   1652  H  HG11 . VAL B 2 92  ? -14.072 1.162   5.121   1.00 0.00 ? 350 VAL A HG11 1  
ATOM   1653  H  HG12 . VAL B 2 92  ? -15.706 0.573   5.438   1.00 0.00 ? 350 VAL A HG12 1  
ATOM   1654  H  HG13 . VAL B 2 92  ? -14.488 0.520   6.712   1.00 0.00 ? 350 VAL A HG13 1  
ATOM   1655  H  HG21 . VAL B 2 92  ? -13.681 3.686   7.052   1.00 0.00 ? 350 VAL A HG21 1  
ATOM   1656  H  HG22 . VAL B 2 92  ? -14.474 4.340   5.626   1.00 0.00 ? 350 VAL A HG22 1  
ATOM   1657  H  HG23 . VAL B 2 92  ? -13.376 2.973   5.479   1.00 0.00 ? 350 VAL A HG23 1  
ATOM   1658  N  N    . ALA B 2 93  ? -16.533 5.201   6.369   1.00 0.00 ? 351 ALA A N    1  
ATOM   1659  C  CA   . ALA B 2 93  ? -16.538 6.652   6.226   1.00 0.00 ? 351 ALA A CA   1  
ATOM   1660  C  C    . ALA B 2 93  ? -15.262 7.262   6.743   1.00 0.00 ? 351 ALA A C    1  
ATOM   1661  O  O    . ALA B 2 93  ? -14.925 8.406   6.436   1.00 0.00 ? 351 ALA A O    1  
ATOM   1662  C  CB   . ALA B 2 93  ? -17.692 7.250   7.003   1.00 0.00 ? 351 ALA A CB   1  
ATOM   1663  H  H    . ALA B 2 93  ? -16.502 4.796   7.257   1.00 0.00 ? 351 ALA A H    1  
ATOM   1664  H  HA   . ALA B 2 93  ? -16.654 6.889   5.187   1.00 0.00 ? 351 ALA A HA   1  
ATOM   1665  H  HB1  . ALA B 2 93  ? -17.360 7.444   8.023   1.00 0.00 ? 351 ALA A HB1  1  
ATOM   1666  H  HB2  . ALA B 2 93  ? -18.520 6.556   7.016   1.00 0.00 ? 351 ALA A HB2  1  
ATOM   1667  H  HB3  . ALA B 2 93  ? -18.000 8.176   6.541   1.00 0.00 ? 351 ALA A HB3  1  
ATOM   1668  N  N    . GLU B 2 94  ? -14.562 6.479   7.529   1.00 0.00 ? 352 GLU A N    1  
ATOM   1669  C  CA   . GLU B 2 94  ? -13.341 6.918   8.183   1.00 0.00 ? 352 GLU A CA   1  
ATOM   1670  C  C    . GLU B 2 94  ? -12.605 5.713   8.769   1.00 0.00 ? 352 GLU A C    1  
ATOM   1671  O  O    . GLU B 2 94  ? -11.401 5.556   8.571   1.00 0.00 ? 352 GLU A O    1  
ATOM   1672  C  CB   . GLU B 2 94  ? -13.678 7.896   9.318   1.00 0.00 ? 352 GLU A CB   1  
ATOM   1673  C  CG   . GLU B 2 94  ? -15.148 8.245   9.440   1.00 0.00 ? 352 GLU A CG   1  
ATOM   1674  C  CD   . GLU B 2 94  ? -15.457 9.062   10.678  1.00 0.00 ? 352 GLU A CD   1  
ATOM   1675  O  OE1  . GLU B 2 94  ? -15.703 8.457   11.743  1.00 0.00 ? 352 GLU A OE1  1  
ATOM   1676  O  OE2  . GLU B 2 94  ? -15.454 10.307  10.583  1.00 0.00 ? 352 GLU A OE2  1  
ATOM   1677  H  H    . GLU B 2 94  ? -14.862 5.553   7.654   1.00 0.00 ? 352 GLU A H    1  
ATOM   1678  H  HA   . GLU B 2 94  ? -12.719 7.406   7.448   1.00 0.00 ? 352 GLU A HA   1  
ATOM   1679  H  HB2  . GLU B 2 94  ? -13.399 7.433   10.241  1.00 0.00 ? 352 GLU A HB2  1  
ATOM   1680  H  HB3  . GLU B 2 94  ? -13.115 8.807   9.186   1.00 0.00 ? 352 GLU A HB3  1  
ATOM   1681  H  HG2  . GLU B 2 94  ? -15.447 8.808   8.570   1.00 0.00 ? 352 GLU A HG2  1  
ATOM   1682  H  HG3  . GLU B 2 94  ? -15.708 7.319   9.483   1.00 0.00 ? 352 GLU A HG3  1  
ATOM   1683  N  N    . PRO B 2 95  ? -13.345 4.851   9.505   1.00 0.00 ? 353 PRO A N    1  
ATOM   1684  C  CA   . PRO B 2 95  ? -12.868 3.642   10.133  1.00 0.00 ? 353 PRO A CA   1  
ATOM   1685  C  C    . PRO B 2 95  ? -11.387 3.245   9.876   1.00 0.00 ? 353 PRO A C    1  
ATOM   1686  O  O    . PRO B 2 95  ? -10.513 3.762   10.572  1.00 0.00 ? 353 PRO A O    1  
ATOM   1687  C  CB   . PRO B 2 95  ? -13.924 2.724   9.540   1.00 0.00 ? 353 PRO A CB   1  
ATOM   1688  C  CG   . PRO B 2 95  ? -15.183 3.465   9.824   1.00 0.00 ? 353 PRO A CG   1  
ATOM   1689  C  CD   . PRO B 2 95  ? -14.797 4.923   9.781   1.00 0.00 ? 353 PRO A CD   1  
ATOM   1690  H  HA   . PRO B 2 95  ? -13.021 3.687   11.200  1.00 0.00 ? 353 PRO A HA   1  
ATOM   1691  H  HB2  . PRO B 2 95  ? -13.767 2.643   8.479   1.00 0.00 ? 353 PRO A HB2  1  
ATOM   1692  H  HB3  . PRO B 2 95  ? -13.900 1.753   9.992   1.00 0.00 ? 353 PRO A HB3  1  
ATOM   1693  H  HG2  . PRO B 2 95  ? -15.921 3.250   9.072   1.00 0.00 ? 353 PRO A HG2  1  
ATOM   1694  H  HG3  . PRO B 2 95  ? -15.547 3.212   10.794  1.00 0.00 ? 353 PRO A HG3  1  
ATOM   1695  H  HD2  . PRO B 2 95  ? -15.327 5.428   9.002   1.00 0.00 ? 353 PRO A HD2  1  
ATOM   1696  H  HD3  . PRO B 2 95  ? -14.988 5.386   10.726  1.00 0.00 ? 353 PRO A HD3  1  
ATOM   1697  N  N    . PRO B 2 96  ? -11.042 2.353   8.909   1.00 0.00 ? 354 PRO A N    1  
ATOM   1698  C  CA   . PRO B 2 96  ? -9.664  1.926   8.700   1.00 0.00 ? 354 PRO A CA   1  
ATOM   1699  C  C    . PRO B 2 96  ? -8.947  2.640   7.559   1.00 0.00 ? 354 PRO A C    1  
ATOM   1700  O  O    . PRO B 2 96  ? -8.180  2.019   6.828   1.00 0.00 ? 354 PRO A O    1  
ATOM   1701  C  CB   . PRO B 2 96  ? -9.926  0.504   8.298   1.00 0.00 ? 354 PRO A CB   1  
ATOM   1702  C  CG   . PRO B 2 96  ? -11.002 0.663   7.308   1.00 0.00 ? 354 PRO A CG   1  
ATOM   1703  C  CD   . PRO B 2 96  ? -11.908 1.668   7.929   1.00 0.00 ? 354 PRO A CD   1  
ATOM   1704  H  HA   . PRO B 2 96  ? -9.084  1.952   9.588   1.00 0.00 ? 354 PRO A HA   1  
ATOM   1705  H  HB2  . PRO B 2 96  ? -9.041  0.078   7.880   1.00 0.00 ? 354 PRO A HB2  1  
ATOM   1706  H  HB3  . PRO B 2 96  ? -10.268 -0.069  9.131   1.00 0.00 ? 354 PRO A HB3  1  
ATOM   1707  H  HG2  . PRO B 2 96  ? -10.605 1.028   6.377   1.00 0.00 ? 354 PRO A HG2  1  
ATOM   1708  H  HG3  . PRO B 2 96  ? -11.522 -0.267  7.164   1.00 0.00 ? 354 PRO A HG3  1  
ATOM   1709  H  HD2  . PRO B 2 96  ? -12.260 2.352   7.196   1.00 0.00 ? 354 PRO A HD2  1  
ATOM   1710  H  HD3  . PRO B 2 96  ? -12.728 1.171   8.418   1.00 0.00 ? 354 PRO A HD3  1  
ATOM   1711  N  N    . GLU B 2 97  ? -9.147  3.942   7.471   1.00 0.00 ? 355 GLU A N    1  
ATOM   1712  C  CA   . GLU B 2 97  ? -8.604  4.766   6.393   1.00 0.00 ? 355 GLU A CA   1  
ATOM   1713  C  C    . GLU B 2 97  ? -7.247  4.305   5.854   1.00 0.00 ? 355 GLU A C    1  
ATOM   1714  O  O    . GLU B 2 97  ? -7.013  4.364   4.648   1.00 0.00 ? 355 GLU A O    1  
ATOM   1715  C  CB   . GLU B 2 97  ? -8.499  6.212   6.849   1.00 0.00 ? 355 GLU A CB   1  
ATOM   1716  C  CG   . GLU B 2 97  ? -7.723  6.362   8.133   1.00 0.00 ? 355 GLU A CG   1  
ATOM   1717  C  CD   . GLU B 2 97  ? -6.894  7.633   8.168   1.00 0.00 ? 355 GLU A CD   1  
ATOM   1718  O  OE1  . GLU B 2 97  ? -6.442  8.079   7.088   1.00 0.00 ? 355 GLU A OE1  1  
ATOM   1719  O  OE2  . GLU B 2 97  ? -6.697  8.184   9.272   1.00 0.00 ? 355 GLU A OE2  1  
ATOM   1720  H  H    . GLU B 2 97  ? -9.652  4.381   8.176   1.00 0.00 ? 355 GLU A H    1  
ATOM   1721  H  HA   . GLU B 2 97  ? -9.310  4.721   5.594   1.00 0.00 ? 355 GLU A HA   1  
ATOM   1722  H  HB2  . GLU B 2 97  ? -8.008  6.790   6.081   1.00 0.00 ? 355 GLU A HB2  1  
ATOM   1723  H  HB3  . GLU B 2 97  ? -9.492  6.603   7.009   1.00 0.00 ? 355 GLU A HB3  1  
ATOM   1724  H  HG2  . GLU B 2 97  ? -8.423  6.379   8.947   1.00 0.00 ? 355 GLU A HG2  1  
ATOM   1725  H  HG3  . GLU B 2 97  ? -7.071  5.511   8.242   1.00 0.00 ? 355 GLU A HG3  1  
ATOM   1726  N  N    . GLY B 2 98  ? -6.356  3.856   6.727   1.00 0.00 ? 356 GLY A N    1  
ATOM   1727  C  CA   . GLY B 2 98  ? -5.042  3.445   6.270   1.00 0.00 ? 356 GLY A CA   1  
ATOM   1728  C  C    . GLY B 2 98  ? -4.885  1.953   6.063   1.00 0.00 ? 356 GLY A C    1  
ATOM   1729  O  O    . GLY B 2 98  ? -4.764  1.488   4.932   1.00 0.00 ? 356 GLY A O    1  
ATOM   1730  H  H    . GLY B 2 98  ? -6.585  3.806   7.674   1.00 0.00 ? 356 GLY A H    1  
ATOM   1731  H  HA2  . GLY B 2 98  ? -4.844  3.940   5.341   1.00 0.00 ? 356 GLY A HA2  1  
ATOM   1732  H  HA3  . GLY B 2 98  ? -4.313  3.769   6.989   1.00 0.00 ? 356 GLY A HA3  1  
ATOM   1733  N  N    . SER B 2 99  ? -4.866  1.212   7.163   1.00 0.00 ? 357 SER A N    1  
ATOM   1734  C  CA   . SER B 2 99  ? -4.702  -0.244  7.129   1.00 0.00 ? 357 SER A CA   1  
ATOM   1735  C  C    . SER B 2 99  ? -5.849  -0.896  6.365   1.00 0.00 ? 357 SER A C    1  
ATOM   1736  O  O    . SER B 2 99  ? -6.091  -0.554  5.208   1.00 0.00 ? 357 SER A O    1  
ATOM   1737  C  CB   . SER B 2 99  ? -4.671  -0.774  8.551   1.00 0.00 ? 357 SER A CB   1  
ATOM   1738  O  OG   . SER B 2 99  ? -4.320  -2.146  8.585   1.00 0.00 ? 357 SER A OG   1  
ATOM   1739  H  H    . SER B 2 99  ? -4.984  1.657   8.028   1.00 0.00 ? 357 SER A H    1  
ATOM   1740  H  HA   . SER B 2 99  ? -3.768  -0.472  6.640   1.00 0.00 ? 357 SER A HA   1  
ATOM   1741  H  HB2  . SER B 2 99  ? -3.955  -0.212  9.132   1.00 0.00 ? 357 SER A HB2  1  
ATOM   1742  H  HB3  . SER B 2 99  ? -5.656  -0.653  8.972   1.00 0.00 ? 357 SER A HB3  1  
ATOM   1743  H  HG   . SER B 2 99  ? -4.658  -2.544  9.390   1.00 0.00 ? 357 SER A HG   1  
ATOM   1744  N  N    . TRP B 2 100 ? -6.537  -1.861  7.002   1.00 0.00 ? 358 TRP A N    1  
ATOM   1745  C  CA   . TRP B 2 100 ? -7.689  -2.498  6.378   1.00 0.00 ? 358 TRP A CA   1  
ATOM   1746  C  C    . TRP B 2 100 ? -7.308  -3.299  5.148   1.00 0.00 ? 358 TRP A C    1  
ATOM   1747  O  O    . TRP B 2 100 ? -6.481  -2.872  4.356   1.00 0.00 ? 358 TRP A O    1  
ATOM   1748  C  CB   . TRP B 2 100 ? -8.632  -1.374  6.034   1.00 0.00 ? 358 TRP A CB   1  
ATOM   1749  C  CG   . TRP B 2 100 ? -9.817  -1.704  5.236   1.00 0.00 ? 358 TRP A CG   1  
ATOM   1750  C  CD1  . TRP B 2 100 ? -11.047 -1.971  5.709   1.00 0.00 ? 358 TRP A CD1  1  
ATOM   1751  C  CD2  . TRP B 2 100 ? -9.905  -1.696  3.832   1.00 0.00 ? 358 TRP A CD2  1  
ATOM   1752  N  NE1  . TRP B 2 100 ? -11.923 -2.134  4.676   1.00 0.00 ? 358 TRP A NE1  1  
ATOM   1753  C  CE2  . TRP B 2 100 ? -11.238 -1.982  3.499   1.00 0.00 ? 358 TRP A CE2  1  
ATOM   1754  C  CE3  . TRP B 2 100 ? -8.982  -1.478  2.825   1.00 0.00 ? 358 TRP A CE3  1  
ATOM   1755  C  CZ2  . TRP B 2 100 ? -11.669 -2.042  2.185   1.00 0.00 ? 358 TRP A CZ2  1  
ATOM   1756  C  CZ3  . TRP B 2 100 ? -9.413  -1.531  1.526   1.00 0.00 ? 358 TRP A CZ3  1  
ATOM   1757  C  CH2  . TRP B 2 100 ? -10.747 -1.805  1.212   1.00 0.00 ? 358 TRP A CH2  1  
ATOM   1758  H  H    . TRP B 2 100 ? -6.273  -2.130  7.897   1.00 0.00 ? 358 TRP A H    1  
ATOM   1759  H  HA   . TRP B 2 100 ? -8.178  -3.147  7.095   1.00 0.00 ? 358 TRP A HA   1  
ATOM   1760  H  HB2  . TRP B 2 100 ? -8.988  -0.971  6.945   1.00 0.00 ? 358 TRP A HB2  1  
ATOM   1761  H  HB3  . TRP B 2 100 ? -8.089  -0.605  5.512   1.00 0.00 ? 358 TRP A HB3  1  
ATOM   1762  H  HD1  . TRP B 2 100 ? -11.283 -2.008  6.758   1.00 0.00 ? 358 TRP A HD1  1  
ATOM   1763  H  HE1  . TRP B 2 100 ? -12.873 -2.325  4.769   1.00 0.00 ? 358 TRP A HE1  1  
ATOM   1764  H  HE3  . TRP B 2 100 ? -7.942  -1.271  3.049   1.00 0.00 ? 358 TRP A HE3  1  
ATOM   1765  H  HZ2  . TRP B 2 100 ? -12.691 -2.242  1.927   1.00 0.00 ? 358 TRP A HZ2  1  
ATOM   1766  H  HZ3  . TRP B 2 100 ? -8.731  -1.308  0.740   1.00 0.00 ? 358 TRP A HZ3  1  
ATOM   1767  H  HH2  . TRP B 2 100 ? -11.038 -1.830  0.179   1.00 0.00 ? 358 TRP A HH2  1  
ATOM   1768  N  N    . SER B 2 101 ? -7.901  -4.475  5.009   1.00 0.00 ? 359 SER A N    1  
ATOM   1769  C  CA   . SER B 2 101 ? -7.637  -5.321  3.857   1.00 0.00 ? 359 SER A CA   1  
ATOM   1770  C  C    . SER B 2 101 ? -8.692  -5.072  2.799   1.00 0.00 ? 359 SER A C    1  
ATOM   1771  O  O    . SER B 2 101 ? -9.732  -4.482  3.078   1.00 0.00 ? 359 SER A O    1  
ATOM   1772  C  CB   . SER B 2 101 ? -7.631  -6.795  4.250   1.00 0.00 ? 359 SER A CB   1  
ATOM   1773  O  OG   . SER B 2 101 ? -8.637  -7.076  5.207   1.00 0.00 ? 359 SER A OG   1  
ATOM   1774  H  H    . SER B 2 101 ? -8.531  -4.778  5.694   1.00 0.00 ? 359 SER A H    1  
ATOM   1775  H  HA   . SER B 2 101 ? -6.664  -5.051  3.459   1.00 0.00 ? 359 SER A HA   1  
ATOM   1776  H  HB2  . SER B 2 101 ? -7.809  -7.399  3.373   1.00 0.00 ? 359 SER A HB2  1  
ATOM   1777  H  HB3  . SER B 2 101 ? -6.672  -7.044  4.666   1.00 0.00 ? 359 SER A HB3  1  
ATOM   1778  H  HG   . SER B 2 101 ? -8.246  -7.114  6.083   1.00 0.00 ? 359 SER A HG   1  
ATOM   1779  N  N    . CYS B 2 102 ? -8.440  -5.542  1.593   1.00 0.00 ? 360 CYS A N    1  
ATOM   1780  C  CA   . CYS B 2 102 ? -9.378  -5.326  0.503   1.00 0.00 ? 360 CYS A CA   1  
ATOM   1781  C  C    . CYS B 2 102 ? -10.263 -6.542  0.267   1.00 0.00 ? 360 CYS A C    1  
ATOM   1782  O  O    . CYS B 2 102 ? -10.260 -7.483  1.061   1.00 0.00 ? 360 CYS A O    1  
ATOM   1783  C  CB   . CYS B 2 102 ? -8.634  -4.967  -0.772  1.00 0.00 ? 360 CYS A CB   1  
ATOM   1784  S  SG   . CYS B 2 102 ? -7.796  -6.369  -1.576  1.00 0.00 ? 360 CYS A SG   1  
ATOM   1785  H  H    . CYS B 2 102 ? -7.616  -6.052  1.439   1.00 0.00 ? 360 CYS A H    1  
ATOM   1786  H  HA   . CYS B 2 102 ? -10.009 -4.494  0.779   1.00 0.00 ? 360 CYS A HA   1  
ATOM   1787  H  HB2  . CYS B 2 102 ? -9.338  -4.559  -1.467  1.00 0.00 ? 360 CYS A HB2  1  
ATOM   1788  H  HB3  . CYS B 2 102 ? -7.890  -4.221  -0.551  1.00 0.00 ? 360 CYS A HB3  1  
ATOM   1789  N  N    . HIS B 2 103 ? -11.022 -6.522  -0.830  1.00 0.00 ? 361 HIS A N    1  
ATOM   1790  C  CA   . HIS B 2 103 ? -11.915 -7.626  -1.138  1.00 0.00 ? 361 HIS A CA   1  
ATOM   1791  C  C    . HIS B 2 103 ? -11.176 -8.776  -1.808  1.00 0.00 ? 361 HIS A C    1  
ATOM   1792  O  O    . HIS B 2 103 ? -11.415 -9.933  -1.474  1.00 0.00 ? 361 HIS A O    1  
ATOM   1793  C  CB   . HIS B 2 103 ? -13.122 -7.168  -1.983  1.00 0.00 ? 361 HIS A CB   1  
ATOM   1794  C  CG   . HIS B 2 103 ? -12.824 -6.834  -3.420  1.00 0.00 ? 361 HIS A CG   1  
ATOM   1795  N  ND1  . HIS B 2 103 ? -13.158 -5.630  -4.006  1.00 0.00 ? 361 HIS A ND1  1  
ATOM   1796  C  CD2  . HIS B 2 103 ? -12.237 -7.560  -4.395  1.00 0.00 ? 361 HIS A CD2  1  
ATOM   1797  C  CE1  . HIS B 2 103 ? -12.785 -5.645  -5.276  1.00 0.00 ? 361 HIS A CE1  1  
ATOM   1798  N  NE2  . HIS B 2 103 ? -12.228 -6.803  -5.532  1.00 0.00 ? 361 HIS A NE2  1  
ATOM   1799  H  H    . HIS B 2 103 ? -10.974 -5.758  -1.436  1.00 0.00 ? 361 HIS A H    1  
ATOM   1800  H  HA   . HIS B 2 103 ? -12.287 -7.988  -0.196  1.00 0.00 ? 361 HIS A HA   1  
ATOM   1801  H  HB2  . HIS B 2 103 ? -13.861 -7.955  -1.983  1.00 0.00 ? 361 HIS A HB2  1  
ATOM   1802  H  HB3  . HIS B 2 103 ? -13.548 -6.292  -1.520  1.00 0.00 ? 361 HIS A HB3  1  
ATOM   1803  H  HD1  . HIS B 2 103 ? -13.602 -4.879  -3.560  1.00 0.00 ? 361 HIS A HD1  1  
ATOM   1804  H  HD2  . HIS B 2 103 ? -11.811 -8.543  -4.288  1.00 0.00 ? 361 HIS A HD2  1  
ATOM   1805  H  HE1  . HIS B 2 103 ? -12.899 -4.844  -5.980  1.00 0.00 ? 361 HIS A HE1  1  
ATOM   1806  H  HE2  . HIS B 2 103 ? -11.775 -7.039  -6.369  1.00 0.00 ? 361 HIS A HE2  1  
ATOM   1807  N  N    . LEU B 2 104 ? -10.271 -8.479  -2.742  1.00 0.00 ? 362 LEU A N    1  
ATOM   1808  C  CA   . LEU B 2 104 ? -9.543  -9.543  -3.414  1.00 0.00 ? 362 LEU A CA   1  
ATOM   1809  C  C    . LEU B 2 104 ? -8.784  -10.385 -2.403  1.00 0.00 ? 362 LEU A C    1  
ATOM   1810  O  O    . LEU B 2 104 ? -8.671  -11.605 -2.539  1.00 0.00 ? 362 LEU A O    1  
ATOM   1811  C  CB   . LEU B 2 104 ? -8.609  -8.958  -4.478  1.00 0.00 ? 362 LEU A CB   1  
ATOM   1812  C  CG   . LEU B 2 104 ? -9.313  -8.406  -5.716  1.00 0.00 ? 362 LEU A CG   1  
ATOM   1813  C  CD1  . LEU B 2 104 ? -8.311  -8.063  -6.786  1.00 0.00 ? 362 LEU A CD1  1  
ATOM   1814  C  CD2  . LEU B 2 104 ? -10.343 -9.385  -6.239  1.00 0.00 ? 362 LEU A CD2  1  
ATOM   1815  H  H    . LEU B 2 104 ? -10.099 -7.536  -2.993  1.00 0.00 ? 362 LEU A H    1  
ATOM   1816  H  HA   . LEU B 2 104 ? -10.267 -10.171 -3.890  1.00 0.00 ? 362 LEU A HA   1  
ATOM   1817  H  HB2  . LEU B 2 104 ? -8.043  -8.156  -4.028  1.00 0.00 ? 362 LEU A HB2  1  
ATOM   1818  H  HB3  . LEU B 2 104 ? -7.923  -9.722  -4.797  1.00 0.00 ? 362 LEU A HB3  1  
ATOM   1819  H  HG   . LEU B 2 104 ? -9.824  -7.496  -5.448  1.00 0.00 ? 362 LEU A HG   1  
ATOM   1820  H  HD11 . LEU B 2 104 ? -7.706  -7.255  -6.431  1.00 0.00 ? 362 LEU A HD11 1  
ATOM   1821  H  HD12 . LEU B 2 104 ? -8.827  -7.763  -7.686  1.00 0.00 ? 362 LEU A HD12 1  
ATOM   1822  H  HD13 . LEU B 2 104 ? -7.687  -8.920  -6.991  1.00 0.00 ? 362 LEU A HD13 1  
ATOM   1823  H  HD21 . LEU B 2 104 ? -11.185 -9.388  -5.565  1.00 0.00 ? 362 LEU A HD21 1  
ATOM   1824  H  HD22 . LEU B 2 104 ? -9.912  -10.375 -6.287  1.00 0.00 ? 362 LEU A HD22 1  
ATOM   1825  H  HD23 . LEU B 2 104 ? -10.668 -9.081  -7.223  1.00 0.00 ? 362 LEU A HD23 1  
ATOM   1826  N  N    . CYS B 2 105 ? -8.328  -9.727  -1.357  1.00 0.00 ? 363 CYS A N    1  
ATOM   1827  C  CA   . CYS B 2 105 ? -7.577  -10.392 -0.298  1.00 0.00 ? 363 CYS A CA   1  
ATOM   1828  C  C    . CYS B 2 105 ? -8.474  -11.188 0.578   1.00 0.00 ? 363 CYS A C    1  
ATOM   1829  O  O    . CYS B 2 105 ? -8.066  -12.184 1.153   1.00 0.00 ? 363 CYS A O    1  
ATOM   1830  C  CB   . CYS B 2 105 ? -6.862  -9.393  0.587   1.00 0.00 ? 363 CYS A CB   1  
ATOM   1831  S  SG   . CYS B 2 105 ? -5.296  -8.767  -0.082  1.00 0.00 ? 363 CYS A SG   1  
ATOM   1832  H  H    . CYS B 2 105 ? -8.525  -8.772  -1.286  1.00 0.00 ? 363 CYS A H    1  
ATOM   1833  H  HA   . CYS B 2 105 ? -6.874  -11.047 -0.740  1.00 0.00 ? 363 CYS A HA   1  
ATOM   1834  H  HB2  . CYS B 2 105 ? -7.510  -8.549  0.737   1.00 0.00 ? 363 CYS A HB2  1  
ATOM   1835  H  HB3  . CYS B 2 105 ? -6.668  -9.859  1.543   1.00 0.00 ? 363 CYS A HB3  1  
ATOM   1836  N  N    . TRP B 2 106 ? -9.682  -10.722 0.690   1.00 0.00 ? 364 TRP A N    1  
ATOM   1837  C  CA   . TRP B 2 106 ? -10.650 -11.350 1.531   1.00 0.00 ? 364 TRP A CA   1  
ATOM   1838  C  C    . TRP B 2 106 ? -11.223 -12.575 0.927   1.00 0.00 ? 364 TRP A C    1  
ATOM   1839  O  O    . TRP B 2 106 ? -11.256 -13.619 1.548   1.00 0.00 ? 364 TRP A O    1  
ATOM   1840  C  CB   . TRP B 2 106 ? -11.733 -10.380 1.840   1.00 0.00 ? 364 TRP A CB   1  
ATOM   1841  C  CG   . TRP B 2 106 ? -11.683 -10.036 3.240   1.00 0.00 ? 364 TRP A CG   1  
ATOM   1842  C  CD1  . TRP B 2 106 ? -10.575 -9.725  3.921   1.00 0.00 ? 364 TRP A CD1  1  
ATOM   1843  C  CD2  . TRP B 2 106 ? -12.755 -10.009 4.128   1.00 0.00 ? 364 TRP A CD2  1  
ATOM   1844  N  NE1  . TRP B 2 106 ? -10.878 -9.485  5.217   1.00 0.00 ? 364 TRP A NE1  1  
ATOM   1845  C  CE2  . TRP B 2 106 ? -12.245 -9.654  5.379   1.00 0.00 ? 364 TRP A CE2  1  
ATOM   1846  C  CE3  . TRP B 2 106 ? -14.102 -10.250 3.966   1.00 0.00 ? 364 TRP A CE3  1  
ATOM   1847  C  CZ2  . TRP B 2 106 ? -13.069 -9.536  6.490   1.00 0.00 ? 364 TRP A CZ2  1  
ATOM   1848  C  CZ3  . TRP B 2 106 ? -14.927 -10.133 5.066   1.00 0.00 ? 364 TRP A CZ3  1  
ATOM   1849  C  CH2  . TRP B 2 106 ? -14.407 -9.778  6.316   1.00 0.00 ? 364 TRP A CH2  1  
ATOM   1850  H  H    . TRP B 2 106 ? -9.931  -9.924  0.191   1.00 0.00 ? 364 TRP A H    1  
ATOM   1851  H  HA   . TRP B 2 106 ? -10.157 -11.618 2.453   1.00 0.00 ? 364 TRP A HA   1  
ATOM   1852  H  HB2  . TRP B 2 106 ? -11.575 -9.491  1.275   1.00 0.00 ? 364 TRP A HB2  1  
ATOM   1853  H  HB3  . TRP B 2 106 ? -12.698 -10.806 1.617   1.00 0.00 ? 364 TRP A HB3  1  
ATOM   1854  H  HD1  . TRP B 2 106 ? -9.599  -9.689  3.475   1.00 0.00 ? 364 TRP A HD1  1  
ATOM   1855  H  HE1  . TRP B 2 106 ? -10.229 -9.237  5.895   1.00 0.00 ? 364 TRP A HE1  1  
ATOM   1856  H  HE3  . TRP B 2 106 ? -14.493 -10.534 2.988   1.00 0.00 ? 364 TRP A HE3  1  
ATOM   1857  H  HZ2  . TRP B 2 106 ? -12.691 -9.273  7.451   1.00 0.00 ? 364 TRP A HZ2  1  
ATOM   1858  H  HZ3  . TRP B 2 106 ? -15.983 -10.315 4.971   1.00 0.00 ? 364 TRP A HZ3  1  
ATOM   1859  H  HH2  . TRP B 2 106 ? -15.085 -9.699  7.152   1.00 0.00 ? 364 TRP A HH2  1  
ATOM   1860  N  N    . GLU B 2 107 ? -11.703 -12.455 -0.268  1.00 0.00 ? 365 GLU A N    1  
ATOM   1861  C  CA   . GLU B 2 107 ? -12.252 -13.581 -0.921  1.00 0.00 ? 365 GLU A CA   1  
ATOM   1862  C  C    . GLU B 2 107 ? -11.165 -14.635 -0.993  1.00 0.00 ? 365 GLU A C    1  
ATOM   1863  O  O    . GLU B 2 107 ? -11.418 -15.840 -1.020  1.00 0.00 ? 365 GLU A O    1  
ATOM   1864  C  CB   . GLU B 2 107 ? -12.703 -13.125 -2.274  1.00 0.00 ? 365 GLU A CB   1  
ATOM   1865  C  CG   . GLU B 2 107 ? -13.537 -11.879 -2.124  1.00 0.00 ? 365 GLU A CG   1  
ATOM   1866  C  CD   . GLU B 2 107 ? -13.661 -11.076 -3.403  1.00 0.00 ? 365 GLU A CD   1  
ATOM   1867  O  OE1  . GLU B 2 107 ? -12.626 -10.580 -3.894  1.00 0.00 ? 365 GLU A OE1  1  
ATOM   1868  O  OE2  . GLU B 2 107 ? -14.793 -10.944 -3.914  1.00 0.00 ? 365 GLU A OE2  1  
ATOM   1869  H  H    . GLU B 2 107 ? -11.687 -11.594 -0.728  1.00 0.00 ? 365 GLU A H    1  
ATOM   1870  H  HA   . GLU B 2 107 ? -13.097 -13.911 -0.329  1.00 0.00 ? 365 GLU A HA   1  
ATOM   1871  H  HB2  . GLU B 2 107 ? -11.826 -12.899 -2.877  1.00 0.00 ? 365 GLU A HB2  1  
ATOM   1872  H  HB3  . GLU B 2 107 ? -13.294 -13.893 -2.747  1.00 0.00 ? 365 GLU A HB3  1  
ATOM   1873  H  HG2  . GLU B 2 107 ? -14.506 -12.165 -1.791  1.00 0.00 ? 365 GLU A HG2  1  
ATOM   1874  H  HG3  . GLU B 2 107 ? -13.085 -11.268 -1.356  1.00 0.00 ? 365 GLU A HG3  1  
ATOM   1875  N  N    . LEU B 2 108 ? -9.933  -14.124 -0.986  1.00 0.00 ? 366 LEU A N    1  
ATOM   1876  C  CA   . LEU B 2 108 ? -8.740  -14.936 -1.015  1.00 0.00 ? 366 LEU A CA   1  
ATOM   1877  C  C    . LEU B 2 108 ? -8.394  -15.371 0.408   1.00 0.00 ? 366 LEU A C    1  
ATOM   1878  O  O    . LEU B 2 108 ? -7.698  -16.360 0.632   1.00 0.00 ? 366 LEU A O    1  
ATOM   1879  C  CB   . LEU B 2 108 ? -7.626  -14.116 -1.643  1.00 0.00 ? 366 LEU A CB   1  
ATOM   1880  C  CG   . LEU B 2 108 ? -6.275  -14.788 -1.783  1.00 0.00 ? 366 LEU A CG   1  
ATOM   1881  C  CD1  . LEU B 2 108 ? -5.482  -14.593 -0.514  1.00 0.00 ? 366 LEU A CD1  1  
ATOM   1882  C  CD2  . LEU B 2 108 ? -6.464  -16.250 -2.118  1.00 0.00 ? 366 LEU A CD2  1  
ATOM   1883  H  H    . LEU B 2 108 ? -9.825  -13.143 -0.957  1.00 0.00 ? 366 LEU A H    1  
ATOM   1884  H  HA   . LEU B 2 108 ? -8.923  -15.790 -1.622  1.00 0.00 ? 366 LEU A HA   1  
ATOM   1885  H  HB2  . LEU B 2 108 ? -7.948  -13.832 -2.622  1.00 0.00 ? 366 LEU A HB2  1  
ATOM   1886  H  HB3  . LEU B 2 108 ? -7.505  -13.232 -1.055  1.00 0.00 ? 366 LEU A HB3  1  
ATOM   1887  H  HG   . LEU B 2 108 ? -5.737  -14.327 -2.593  1.00 0.00 ? 366 LEU A HG   1  
ATOM   1888  H  HD11 . LEU B 2 108 ? -5.861  -13.714 -0.007  1.00 0.00 ? 366 LEU A HD11 1  
ATOM   1889  H  HD12 . LEU B 2 108 ? -4.438  -14.454 -0.756  1.00 0.00 ? 366 LEU A HD12 1  
ATOM   1890  H  HD13 . LEU B 2 108 ? -5.597  -15.456 0.121   1.00 0.00 ? 366 LEU A HD13 1  
ATOM   1891  H  HD21 . LEU B 2 108 ? -7.399  -16.353 -2.651  1.00 0.00 ? 366 LEU A HD21 1  
ATOM   1892  H  HD22 . LEU B 2 108 ? -6.495  -16.832 -1.209  1.00 0.00 ? 366 LEU A HD22 1  
ATOM   1893  H  HD23 . LEU B 2 108 ? -5.651  -16.590 -2.742  1.00 0.00 ? 366 LEU A HD23 1  
ATOM   1894  N  N    . LEU B 2 109 ? -8.922  -14.607 1.356   1.00 0.00 ? 367 LEU A N    1  
ATOM   1895  C  CA   . LEU B 2 109 ? -8.743  -14.839 2.783   1.00 0.00 ? 367 LEU A CA   1  
ATOM   1896  C  C    . LEU B 2 109 ? -9.529  -16.055 3.177   1.00 0.00 ? 367 LEU A C    1  
ATOM   1897  O  O    . LEU B 2 109 ? -9.008  -17.034 3.710   1.00 0.00 ? 367 LEU A O    1  
ATOM   1898  C  CB   . LEU B 2 109 ? -9.295  -13.648 3.539   1.00 0.00 ? 367 LEU A CB   1  
ATOM   1899  C  CG   . LEU B 2 109 ? -8.447  -13.097 4.665   1.00 0.00 ? 367 LEU A CG   1  
ATOM   1900  C  CD1  . LEU B 2 109 ? -7.467  -12.096 4.096   1.00 0.00 ? 367 LEU A CD1  1  
ATOM   1901  C  CD2  . LEU B 2 109 ? -9.330  -12.457 5.726   1.00 0.00 ? 367 LEU A CD2  1  
ATOM   1902  H  H    . LEU B 2 109 ? -9.470  -13.843 1.080   1.00 0.00 ? 367 LEU A H    1  
ATOM   1903  H  HA   . LEU B 2 109 ? -7.705  -14.962 3.005   1.00 0.00 ? 367 LEU A HA   1  
ATOM   1904  H  HB2  . LEU B 2 109 ? -9.419  -12.868 2.825   1.00 0.00 ? 367 LEU A HB2  1  
ATOM   1905  H  HB3  . LEU B 2 109 ? -10.265 -13.909 3.933   1.00 0.00 ? 367 LEU A HB3  1  
ATOM   1906  H  HG   . LEU B 2 109 ? -7.892  -13.897 5.116   1.00 0.00 ? 367 LEU A HG   1  
ATOM   1907  H  HD11 . LEU B 2 109 ? -7.787  -11.835 3.095   1.00 0.00 ? 367 LEU A HD11 1  
ATOM   1908  H  HD12 . LEU B 2 109 ? -6.480  -12.533 4.061   1.00 0.00 ? 367 LEU A HD12 1  
ATOM   1909  H  HD13 . LEU B 2 109 ? -7.452  -11.211 4.713   1.00 0.00 ? 367 LEU A HD13 1  
ATOM   1910  H  HD21 . LEU B 2 109 ? -10.204 -12.023 5.254   1.00 0.00 ? 367 LEU A HD21 1  
ATOM   1911  H  HD22 . LEU B 2 109 ? -8.776  -11.684 6.238   1.00 0.00 ? 367 LEU A HD22 1  
ATOM   1912  H  HD23 . LEU B 2 109 ? -9.641  -13.208 6.437   1.00 0.00 ? 367 LEU A HD23 1  
ATOM   1913  N  N    . LYS B 2 110 ? -10.810 -15.949 2.903   1.00 0.00 ? 368 LYS A N    1  
ATOM   1914  C  CA   . LYS B 2 110 ? -11.745 -17.005 3.176   1.00 0.00 ? 368 LYS A CA   1  
ATOM   1915  C  C    . LYS B 2 110 ? -11.325 -18.233 2.397   1.00 0.00 ? 368 LYS A C    1  
ATOM   1916  O  O    . LYS B 2 110 ? -11.507 -19.367 2.841   1.00 0.00 ? 368 LYS A O    1  
ATOM   1917  C  CB   . LYS B 2 110 ? -13.151 -16.550 2.786   1.00 0.00 ? 368 LYS A CB   1  
ATOM   1918  C  CG   . LYS B 2 110 ? -13.376 -15.065 3.033   1.00 0.00 ? 368 LYS A CG   1  
ATOM   1919  C  CD   . LYS B 2 110 ? -14.772 -14.630 2.672   1.00 0.00 ? 368 LYS A CD   1  
ATOM   1920  C  CE   . LYS B 2 110 ? -15.054 -13.239 3.206   1.00 0.00 ? 368 LYS A CE   1  
ATOM   1921  N  NZ   . LYS B 2 110 ? -16.274 -12.644 2.595   1.00 0.00 ? 368 LYS A NZ   1  
ATOM   1922  H  H    . LYS B 2 110 ? -11.134 -15.115 2.498   1.00 0.00 ? 368 LYS A H    1  
ATOM   1923  H  HA   . LYS B 2 110 ? -11.703 -17.219 4.228   1.00 0.00 ? 368 LYS A HA   1  
ATOM   1924  H  HB2  . LYS B 2 110 ? -13.302 -16.746 1.735   1.00 0.00 ? 368 LYS A HB2  1  
ATOM   1925  H  HB3  . LYS B 2 110 ? -13.875 -17.106 3.361   1.00 0.00 ? 368 LYS A HB3  1  
ATOM   1926  H  HG2  . LYS B 2 110 ? -13.199 -14.848 4.074   1.00 0.00 ? 368 LYS A HG2  1  
ATOM   1927  H  HG3  . LYS B 2 110 ? -12.683 -14.502 2.421   1.00 0.00 ? 368 LYS A HG3  1  
ATOM   1928  H  HD2  . LYS B 2 110 ? -14.853 -14.612 1.600   1.00 0.00 ? 368 LYS A HD2  1  
ATOM   1929  H  HD3  . LYS B 2 110 ? -15.486 -15.325 3.088   1.00 0.00 ? 368 LYS A HD3  1  
ATOM   1930  H  HE2  . LYS B 2 110 ? -15.192 -13.300 4.275   1.00 0.00 ? 368 LYS A HE2  1  
ATOM   1931  H  HE3  . LYS B 2 110 ? -14.200 -12.606 2.987   1.00 0.00 ? 368 LYS A HE3  1  
ATOM   1932  H  HZ1  . LYS B 2 110 ? -16.471 -11.716 3.022   1.00 0.00 ? 368 LYS A HZ1  1  
ATOM   1933  H  HZ2  . LYS B 2 110 ? -17.093 -13.266 2.750   1.00 0.00 ? 368 LYS A HZ2  1  
ATOM   1934  H  HZ3  . LYS B 2 110 ? -16.137 -12.519 1.571   1.00 0.00 ? 368 LYS A HZ3  1  
ATOM   1935  N  N    . GLU B 2 111 ? -10.758 -17.987 1.221   1.00 0.00 ? 369 GLU A N    1  
ATOM   1936  C  CA   . GLU B 2 111 ? -10.260 -19.057 0.385   1.00 0.00 ? 369 GLU A CA   1  
ATOM   1937  C  C    . GLU B 2 111 ? -9.077  -19.733 1.064   1.00 0.00 ? 369 GLU A C    1  
ATOM   1938  O  O    . GLU B 2 111 ? -8.889  -20.943 0.938   1.00 0.00 ? 369 GLU A O    1  
ATOM   1939  C  CB   . GLU B 2 111 ? -9.838  -18.524 -0.977  1.00 0.00 ? 369 GLU A CB   1  
ATOM   1940  C  CG   . GLU B 2 111 ? -10.478 -19.273 -2.129  1.00 0.00 ? 369 GLU A CG   1  
ATOM   1941  C  CD   . GLU B 2 111 ? -10.149 -20.754 -2.119  1.00 0.00 ? 369 GLU A CD   1  
ATOM   1942  O  OE1  . GLU B 2 111 ? -9.051  -21.122 -2.587  1.00 0.00 ? 369 GLU A OE1  1  
ATOM   1943  O  OE2  . GLU B 2 111 ? -10.989 -21.545 -1.642  1.00 0.00 ? 369 GLU A OE2  1  
ATOM   1944  H  H    . GLU B 2 111 ? -10.691 -17.059 0.903   1.00 0.00 ? 369 GLU A H    1  
ATOM   1945  H  HA   . GLU B 2 111 ? -11.051 -19.778 0.248   1.00 0.00 ? 369 GLU A HA   1  
ATOM   1946  H  HB2  . GLU B 2 111 ? -10.117 -17.485 -1.049  1.00 0.00 ? 369 GLU A HB2  1  
ATOM   1947  H  HB3  . GLU B 2 111 ? -8.766  -18.609 -1.068  1.00 0.00 ? 369 GLU A HB3  1  
ATOM   1948  H  HG2  . GLU B 2 111 ? -11.549 -19.158 -2.065  1.00 0.00 ? 369 GLU A HG2  1  
ATOM   1949  H  HG3  . GLU B 2 111 ? -10.128 -18.849 -3.051  1.00 0.00 ? 369 GLU A HG3  1  
ATOM   1950  N  N    . LYS B 2 112 ? -8.274  -18.944 1.790   1.00 0.00 ? 370 LYS A N    1  
ATOM   1951  C  CA   . LYS B 2 112 ? -7.119  -19.487 2.480   1.00 0.00 ? 370 LYS A CA   1  
ATOM   1952  C  C    . LYS B 2 112 ? -7.519  -20.519 3.530   1.00 0.00 ? 370 LYS A C    1  
ATOM   1953  O  O    . LYS B 2 112 ? -6.767  -21.451 3.813   1.00 0.00 ? 370 LYS A O    1  
ATOM   1954  C  CB   . LYS B 2 112 ? -6.323  -18.363 3.116   1.00 0.00 ? 370 LYS A CB   1  
ATOM   1955  C  CG   . LYS B 2 112 ? -5.409  -17.688 2.139   1.00 0.00 ? 370 LYS A CG   1  
ATOM   1956  C  CD   . LYS B 2 112 ? -5.281  -16.222 2.442   1.00 0.00 ? 370 LYS A CD   1  
ATOM   1957  C  CE   . LYS B 2 112 ? -4.857  -15.965 3.875   1.00 0.00 ? 370 LYS A CE   1  
ATOM   1958  N  NZ   . LYS B 2 112 ? -3.666  -16.771 4.261   1.00 0.00 ? 370 LYS A NZ   1  
ATOM   1959  H  H    . LYS B 2 112 ? -8.449  -17.971 1.847   1.00 0.00 ? 370 LYS A H    1  
ATOM   1960  H  HA   . LYS B 2 112 ? -6.505  -19.959 1.738   1.00 0.00 ? 370 LYS A HA   1  
ATOM   1961  H  HB2  . LYS B 2 112 ? -7.004  -17.624 3.491   1.00 0.00 ? 370 LYS A HB2  1  
ATOM   1962  H  HB3  . LYS B 2 112 ? -5.733  -18.748 3.924   1.00 0.00 ? 370 LYS A HB3  1  
ATOM   1963  H  HG2  . LYS B 2 112 ? -4.435  -18.151 2.166   1.00 0.00 ? 370 LYS A HG2  1  
ATOM   1964  H  HG3  . LYS B 2 112 ? -5.845  -17.794 1.169   1.00 0.00 ? 370 LYS A HG3  1  
ATOM   1965  H  HD2  . LYS B 2 112 ? -4.560  -15.780 1.772   1.00 0.00 ? 370 LYS A HD2  1  
ATOM   1966  H  HD3  . LYS B 2 112 ? -6.247  -15.788 2.279   1.00 0.00 ? 370 LYS A HD3  1  
ATOM   1967  H  HE2  . LYS B 2 112 ? -4.623  -14.916 3.985   1.00 0.00 ? 370 LYS A HE2  1  
ATOM   1968  H  HE3  . LYS B 2 112 ? -5.681  -16.219 4.520   1.00 0.00 ? 370 LYS A HE3  1  
ATOM   1969  H  HZ1  . LYS B 2 112 ? -3.352  -16.509 5.217   1.00 0.00 ? 370 LYS A HZ1  1  
ATOM   1970  H  HZ2  . LYS B 2 112 ? -2.887  -16.601 3.593   1.00 0.00 ? 370 LYS A HZ2  1  
ATOM   1971  H  HZ3  . LYS B 2 112 ? -3.902  -17.784 4.250   1.00 0.00 ? 370 LYS A HZ3  1  
ATOM   1972  N  N    . ALA B 2 113 ? -8.705  -20.345 4.107   1.00 0.00 ? 371 ALA A N    1  
ATOM   1973  C  CA   . ALA B 2 113 ? -9.202  -21.263 5.124   1.00 0.00 ? 371 ALA A CA   1  
ATOM   1974  C  C    . ALA B 2 113 ? -9.390  -22.665 4.571   1.00 0.00 ? 371 ALA A C    1  
ATOM   1975  O  O    . ALA B 2 113 ? -9.058  -22.949 3.419   1.00 0.00 ? 371 ALA A O    1  
ATOM   1976  C  CB   . ALA B 2 113 ? -10.512 -20.755 5.698   1.00 0.00 ? 371 ALA A CB   1  
ATOM   1977  H  H    . ALA B 2 113 ? -9.257  -19.578 3.849   1.00 0.00 ? 371 ALA A H    1  
ATOM   1978  H  HA   . ALA B 2 113 ? -8.479  -21.300 5.925   1.00 0.00 ? 371 ALA A HA   1  
ATOM   1979  H  HB1  . ALA B 2 113 ? -10.315 -19.912 6.335   1.00 0.00 ? 371 ALA A HB1  1  
ATOM   1980  H  HB2  . ALA B 2 113 ? -10.983 -21.539 6.272   1.00 0.00 ? 371 ALA A HB2  1  
ATOM   1981  H  HB3  . ALA B 2 113 ? -11.166 -20.454 4.893   1.00 0.00 ? 371 ALA A HB3  1  
ATOM   1982  N  N    . SER B 2 114 ? -9.935  -23.533 5.412   1.00 0.00 ? 372 SER A N    1  
ATOM   1983  C  CA   . SER B 2 114 ? -10.183 -24.923 5.041   1.00 0.00 ? 372 SER A CA   1  
ATOM   1984  C  C    . SER B 2 114 ? -8.904  -25.597 4.554   1.00 0.00 ? 372 SER A C    1  
ATOM   1985  O  O    . SER B 2 114 ? -8.151  -26.119 5.404   1.00 0.00 ? 372 SER A O    1  
ATOM   1986  C  CB   . SER B 2 114 ? -11.262 -25.002 3.958   1.00 0.00 ? 372 SER A CB   1  
ATOM   1987  O  OG   . SER B 2 114 ? -11.517 -26.346 3.588   1.00 0.00 ? 372 SER A OG   1  
ATOM   1988  O  OXT  . SER B 2 114 ? -8.666  -25.601 3.328   1.00 0.00 ? 372 SER A OXT  1  
ATOM   1989  H  H    . SER B 2 114 ? -10.179 -23.224 6.311   1.00 0.00 ? 372 SER A H    1  
ATOM   1990  H  HA   . SER B 2 114 ? -10.534 -25.441 5.921   1.00 0.00 ? 372 SER A HA   1  
ATOM   1991  H  HB2  . SER B 2 114 ? -12.176 -24.565 4.330   1.00 0.00 ? 372 SER A HB2  1  
ATOM   1992  H  HB3  . SER B 2 114 ? -10.932 -24.457 3.085   1.00 0.00 ? 372 SER A HB3  1  
ATOM   1993  H  HG   . SER B 2 114 ? -11.044 -26.936 4.178   1.00 0.00 ? 372 SER A HG   1  
HETATM 1994  ZN ZN   . ZN  C 3 .   ? 14.483  0.111   3.063   1.00 0.00 ? 501 ZN  A ZN   1  
HETATM 1995  ZN ZN   . ZN  D 3 .   ? 3.966   5.592   -8.773  1.00 0.00 ? 601 ZN  A ZN   1  
HETATM 1996  ZN ZN   . ZN  E 3 .   ? -5.645  -6.572  -0.726  1.00 0.00 ? 701 ZN  A ZN   1  
HETATM 1997  ZN ZN   . ZN  F 3 .   ? -13.180 4.174   -5.645  1.00 0.00 ? 801 ZN  A ZN   1  
HETATM 1998  C  C1A  . SAC A 1 1   ? 6.471   4.784   -0.366  1.00 0.00 ? 1   SAC B C1A  2  
HETATM 1999  C  C2A  . SAC A 1 1   ? 7.644   4.153   -1.120  1.00 0.00 ? 1   SAC B C2A  2  
HETATM 2000  O  OAC  . SAC A 1 1   ? 5.788   5.638   -0.932  1.00 0.00 ? 1   SAC B OAC  2  
HETATM 2001  N  N    . SAC A 1 1   ? 6.193   4.354   0.858   1.00 0.00 ? 1   SAC B N    2  
HETATM 2002  C  CA   . SAC A 1 1   ? 4.912   4.652   1.496   1.00 0.00 ? 1   SAC B CA   2  
HETATM 2003  C  C    . SAC A 1 1   ? 4.791   6.140   1.791   1.00 0.00 ? 1   SAC B C    2  
HETATM 2004  O  O    . SAC A 1 1   ? 5.794   6.828   1.986   1.00 0.00 ? 1   SAC B O    2  
HETATM 2005  C  CB   . SAC A 1 1   ? 4.760   3.849   2.790   1.00 0.00 ? 1   SAC B CB   2  
HETATM 2006  O  OG   . SAC A 1 1   ? 5.735   4.229   3.745   1.00 0.00 ? 1   SAC B OG   2  
HETATM 2007  H  H1   . SAC A 1 1   ? 6.771   3.674   1.260   1.00 0.00 ? 1   SAC B H1   2  
HETATM 2008  H  H2A1 . SAC A 1 1   ? 8.466   3.993   -0.439  1.00 0.00 ? 1   SAC B H2A1 2  
HETATM 2009  H  H2A2 . SAC A 1 1   ? 7.957   4.813   -1.913  1.00 0.00 ? 1   SAC B H2A2 2  
HETATM 2010  H  H2A3 . SAC A 1 1   ? 7.337   3.207   -1.539  1.00 0.00 ? 1   SAC B H2A3 2  
HETATM 2011  H  HA   . SAC A 1 1   ? 4.121   4.370   0.811   1.00 0.00 ? 1   SAC B HA   2  
HETATM 2012  H  HB2  . SAC A 1 1   ? 3.779   4.024   3.206   1.00 0.00 ? 1   SAC B HB2  2  
HETATM 2013  H  HB3  . SAC A 1 1   ? 4.876   2.797   2.573   1.00 0.00 ? 1   SAC B HB3  2  
HETATM 2014  H  HG   . SAC A 1 1   ? 6.284   4.927   3.383   1.00 0.00 ? 1   SAC B HG   2  
ATOM   2015  N  N    . GLY A 1 2   ? 3.558   6.629   1.826   1.00 0.00 ? 2   GLY B N    2  
ATOM   2016  C  CA   . GLY A 1 2   ? 3.327   8.035   2.085   1.00 0.00 ? 2   GLY B CA   2  
ATOM   2017  C  C    . GLY A 1 2   ? 3.768   8.887   0.921   1.00 0.00 ? 2   GLY B C    2  
ATOM   2018  O  O    . GLY A 1 2   ? 4.958   8.951   0.609   1.00 0.00 ? 2   GLY B O    2  
ATOM   2019  H  H    . GLY A 1 2   ? 2.800   6.032   1.666   1.00 0.00 ? 2   GLY B H    2  
ATOM   2020  H  HA2  . GLY A 1 2   ? 2.270   8.192   2.254   1.00 0.00 ? 2   GLY B HA2  2  
ATOM   2021  H  HA3  . GLY A 1 2   ? 3.876   8.328   2.966   1.00 0.00 ? 2   GLY B HA3  2  
ATOM   2022  N  N    . ARG A 1 3   ? 2.814   9.540   0.271   1.00 0.00 ? 3   ARG B N    2  
ATOM   2023  C  CA   . ARG A 1 3   ? 3.119   10.373  -0.881  1.00 0.00 ? 3   ARG B CA   2  
ATOM   2024  C  C    . ARG A 1 3   ? 4.229   11.370  -0.556  1.00 0.00 ? 3   ARG B C    2  
ATOM   2025  O  O    . ARG A 1 3   ? 4.428   11.735  0.603   1.00 0.00 ? 3   ARG B O    2  
ATOM   2026  C  CB   . ARG A 1 3   ? 1.872   11.122  -1.357  1.00 0.00 ? 3   ARG B CB   2  
ATOM   2027  C  CG   . ARG A 1 3   ? 1.434   12.249  -0.439  1.00 0.00 ? 3   ARG B CG   2  
ATOM   2028  C  CD   . ARG A 1 3   ? 0.464   13.181  -1.148  1.00 0.00 ? 3   ARG B CD   2  
ATOM   2029  N  NE   . ARG A 1 3   ? -0.129  14.155  -0.236  1.00 0.00 ? 3   ARG B NE   2  
ATOM   2030  C  CZ   . ARG A 1 3   ? -0.949  15.128  -0.625  1.00 0.00 ? 3   ARG B CZ   2  
ATOM   2031  N  NH1  . ARG A 1 3   ? -1.273  15.257  -1.905  1.00 0.00 ? 3   ARG B NH1  2  
ATOM   2032  N  NH2  . ARG A 1 3   ? -1.446  15.972  0.269   1.00 0.00 ? 3   ARG B NH2  2  
ATOM   2033  H  H    . ARG A 1 3   ? 1.884   9.458   0.572   1.00 0.00 ? 3   ARG B H    2  
ATOM   2034  H  HA   . ARG A 1 3   ? 3.453   9.709   -1.670  1.00 0.00 ? 3   ARG B HA   2  
ATOM   2035  H  HB2  . ARG A 1 3   ? 2.073   11.542  -2.331  1.00 0.00 ? 3   ARG B HB2  2  
ATOM   2036  H  HB3  . ARG A 1 3   ? 1.057   10.418  -1.441  1.00 0.00 ? 3   ARG B HB3  2  
ATOM   2037  H  HG2  . ARG A 1 3   ? 0.948   11.829  0.428   1.00 0.00 ? 3   ARG B HG2  2  
ATOM   2038  H  HG3  . ARG A 1 3   ? 2.303   12.813  -0.133  1.00 0.00 ? 3   ARG B HG3  2  
ATOM   2039  H  HD2  . ARG A 1 3   ? 0.996   13.710  -1.925  1.00 0.00 ? 3   ARG B HD2  2  
ATOM   2040  H  HD3  . ARG A 1 3   ? -0.324  12.588  -1.593  1.00 0.00 ? 3   ARG B HD3  2  
ATOM   2041  H  HE   . ARG A 1 3   ? 0.095   14.080  0.716   1.00 0.00 ? 3   ARG B HE   2  
ATOM   2042  H  HH11 . ARG A 1 3   ? -0.899  14.623  -2.582  1.00 0.00 ? 3   ARG B HH11 2  
ATOM   2043  H  HH12 . ARG A 1 3   ? -1.890  15.989  -2.193  1.00 0.00 ? 3   ARG B HH12 2  
ATOM   2044  H  HH21 . ARG A 1 3   ? -1.206  15.878  1.234   1.00 0.00 ? 3   ARG B HH21 2  
ATOM   2045  H  HH22 . ARG A 1 3   ? -2.063  16.703  -0.024  1.00 0.00 ? 3   ARG B HH22 2  
ATOM   2046  N  N    . GLY A 1 4   ? 4.947   11.812  -1.585  1.00 0.00 ? 4   GLY B N    2  
ATOM   2047  C  CA   . GLY A 1 4   ? 6.023   12.765  -1.379  1.00 0.00 ? 4   GLY B CA   2  
ATOM   2048  C  C    . GLY A 1 4   ? 7.131   12.627  -2.404  1.00 0.00 ? 4   GLY B C    2  
ATOM   2049  O  O    . GLY A 1 4   ? 7.797   11.593  -2.473  1.00 0.00 ? 4   GLY B O    2  
ATOM   2050  H  H    . GLY A 1 4   ? 4.745   11.488  -2.487  1.00 0.00 ? 4   GLY B H    2  
ATOM   2051  H  HA2  . GLY A 1 4   ? 5.618   13.765  -1.436  1.00 0.00 ? 4   GLY B HA2  2  
ATOM   2052  H  HA3  . GLY A 1 4   ? 6.439   12.613  -0.394  1.00 0.00 ? 4   GLY B HA3  2  
ATOM   2053  N  N    . LYS A 1 5   ? 7.327   13.672  -3.201  1.00 0.00 ? 5   LYS B N    2  
ATOM   2054  C  CA   . LYS A 1 5   ? 8.363   13.669  -4.228  1.00 0.00 ? 5   LYS B CA   2  
ATOM   2055  C  C    . LYS A 1 5   ? 8.557   15.073  -4.796  1.00 0.00 ? 5   LYS B C    2  
ATOM   2056  O  O    . LYS A 1 5   ? 8.155   15.361  -5.924  1.00 0.00 ? 5   LYS B O    2  
ATOM   2057  C  CB   . LYS A 1 5   ? 7.996   12.694  -5.352  1.00 0.00 ? 5   LYS B CB   2  
ATOM   2058  C  CG   . LYS A 1 5   ? 9.199   12.024  -6.004  1.00 0.00 ? 5   LYS B CG   2  
ATOM   2059  C  CD   . LYS A 1 5   ? 10.112  13.033  -6.682  1.00 0.00 ? 5   LYS B CD   2  
ATOM   2060  C  CE   . LYS A 1 5   ? 11.352  12.366  -7.254  1.00 0.00 ? 5   LYS B CE   2  
ATOM   2061  N  NZ   . LYS A 1 5   ? 12.285  13.354  -7.861  1.00 0.00 ? 5   LYS B NZ   2  
ATOM   2062  H  H    . LYS A 1 5   ? 6.762   14.466  -3.095  1.00 0.00 ? 5   LYS B H    2  
ATOM   2063  H  HA   . LYS A 1 5   ? 9.286   13.348  -3.769  1.00 0.00 ? 5   LYS B HA   2  
ATOM   2064  H  HB2  . LYS A 1 5   ? 7.360   11.921  -4.946  1.00 0.00 ? 5   LYS B HB2  2  
ATOM   2065  H  HB3  . LYS A 1 5   ? 7.454   13.229  -6.115  1.00 0.00 ? 5   LYS B HB3  2  
ATOM   2066  H  HG2  . LYS A 1 5   ? 9.761   11.500  -5.246  1.00 0.00 ? 5   LYS B HG2  2  
ATOM   2067  H  HG3  . LYS A 1 5   ? 8.846   11.318  -6.742  1.00 0.00 ? 5   LYS B HG3  2  
ATOM   2068  H  HD2  . LYS A 1 5   ? 9.571   13.511  -7.484  1.00 0.00 ? 5   LYS B HD2  2  
ATOM   2069  H  HD3  . LYS A 1 5   ? 10.415  13.774  -5.957  1.00 0.00 ? 5   LYS B HD3  2  
ATOM   2070  H  HE2  . LYS A 1 5   ? 11.864  11.843  -6.459  1.00 0.00 ? 5   LYS B HE2  2  
ATOM   2071  H  HE3  . LYS A 1 5   ? 11.048  11.658  -8.010  1.00 0.00 ? 5   LYS B HE3  2  
ATOM   2072  H  HZ1  . LYS A 1 5   ? 11.806  13.874  -8.625  1.00 0.00 ? 5   LYS B HZ1  2  
ATOM   2073  H  HZ2  . LYS A 1 5   ? 13.114  12.868  -8.256  1.00 0.00 ? 5   LYS B HZ2  2  
ATOM   2074  H  HZ3  . LYS A 1 5   ? 12.604  14.033  -7.141  1.00 0.00 ? 5   LYS B HZ3  2  
ATOM   2075  N  N    . GLY A 1 6   ? 9.177   15.945  -4.006  1.00 0.00 ? 6   GLY B N    2  
ATOM   2076  C  CA   . GLY A 1 6   ? 9.412   17.307  -4.446  1.00 0.00 ? 6   GLY B CA   2  
ATOM   2077  C  C    . GLY A 1 6   ? 10.818  17.782  -4.139  1.00 0.00 ? 6   GLY B C    2  
ATOM   2078  O  O    . GLY A 1 6   ? 11.789  17.061  -4.370  1.00 0.00 ? 6   GLY B O    2  
ATOM   2079  H  H    . GLY A 1 6   ? 9.477   15.659  -3.118  1.00 0.00 ? 6   GLY B H    2  
ATOM   2080  H  HA2  . GLY A 1 6   ? 9.250   17.363  -5.512  1.00 0.00 ? 6   GLY B HA2  2  
ATOM   2081  H  HA3  . GLY A 1 6   ? 8.708   17.961  -3.952  1.00 0.00 ? 6   GLY B HA3  2  
ATOM   2082  N  N    . GLY A 1 7   ? 10.928  18.999  -3.615  1.00 0.00 ? 7   GLY B N    2  
ATOM   2083  C  CA   . GLY A 1 7   ? 12.229  19.550  -3.283  1.00 0.00 ? 7   GLY B CA   2  
ATOM   2084  C  C    . GLY A 1 7   ? 12.209  20.370  -2.009  1.00 0.00 ? 7   GLY B C    2  
ATOM   2085  O  O    . GLY A 1 7   ? 11.792  21.530  -2.017  1.00 0.00 ? 7   GLY B O    2  
ATOM   2086  H  H    . GLY A 1 7   ? 10.119  19.528  -3.453  1.00 0.00 ? 7   GLY B H    2  
ATOM   2087  H  HA2  . GLY A 1 7   ? 12.931  18.738  -3.164  1.00 0.00 ? 7   GLY B HA2  2  
ATOM   2088  H  HA3  . GLY A 1 7   ? 12.559  20.179  -4.098  1.00 0.00 ? 7   GLY B HA3  2  
ATOM   2089  N  N    . LYS A 1 8   ? 12.657  19.761  -0.910  1.00 0.00 ? 8   LYS B N    2  
ATOM   2090  C  CA   . LYS A 1 8   ? 12.702  20.429  0.390   1.00 0.00 ? 8   LYS B CA   2  
ATOM   2091  C  C    . LYS A 1 8   ? 11.301  20.762  0.895   1.00 0.00 ? 8   LYS B C    2  
ATOM   2092  O  O    . LYS A 1 8   ? 10.391  21.027  0.111   1.00 0.00 ? 8   LYS B O    2  
ATOM   2093  C  CB   . LYS A 1 8   ? 13.547  21.705  0.309   1.00 0.00 ? 8   LYS B CB   2  
ATOM   2094  C  CG   . LYS A 1 8   ? 14.961  21.471  -0.202  1.00 0.00 ? 8   LYS B CG   2  
ATOM   2095  C  CD   . LYS A 1 8   ? 15.762  20.590  0.745   1.00 0.00 ? 8   LYS B CD   2  
ATOM   2096  C  CE   . LYS A 1 8   ? 17.166  20.342  0.219   1.00 0.00 ? 8   LYS B CE   2  
ATOM   2097  N  NZ   . LYS A 1 8   ? 17.931  21.608  0.058   1.00 0.00 ? 8   LYS B NZ   2  
ATOM   2098  H  H    . LYS A 1 8   ? 12.967  18.834  -0.977  1.00 0.00 ? 8   LYS B H    2  
ATOM   2099  H  HA   . LYS A 1 8   ? 13.166  19.750  1.089   1.00 0.00 ? 8   LYS B HA   2  
ATOM   2100  H  HB2  . LYS A 1 8   ? 13.060  22.404  -0.353  1.00 0.00 ? 8   LYS B HB2  2  
ATOM   2101  H  HB3  . LYS A 1 8   ? 13.611  22.142  1.294   1.00 0.00 ? 8   LYS B HB3  2  
ATOM   2102  H  HG2  . LYS A 1 8   ? 14.909  20.989  -1.166  1.00 0.00 ? 8   LYS B HG2  2  
ATOM   2103  H  HG3  . LYS A 1 8   ? 15.459  22.424  -0.301  1.00 0.00 ? 8   LYS B HG3  2  
ATOM   2104  H  HD2  . LYS A 1 8   ? 15.828  21.079  1.706   1.00 0.00 ? 8   LYS B HD2  2  
ATOM   2105  H  HD3  . LYS A 1 8   ? 15.255  19.642  0.855   1.00 0.00 ? 8   LYS B HD3  2  
ATOM   2106  H  HE2  . LYS A 1 8   ? 17.689  19.703  0.915   1.00 0.00 ? 8   LYS B HE2  2  
ATOM   2107  H  HE3  . LYS A 1 8   ? 17.096  19.847  -0.739  1.00 0.00 ? 8   LYS B HE3  2  
ATOM   2108  H  HZ1  . LYS A 1 8   ? 17.447  22.235  -0.616  1.00 0.00 ? 8   LYS B HZ1  2  
ATOM   2109  H  HZ2  . LYS A 1 8   ? 18.886  21.407  -0.300  1.00 0.00 ? 8   LYS B HZ2  2  
ATOM   2110  H  HZ3  . LYS A 1 8   ? 18.012  22.096  0.972   1.00 0.00 ? 8   LYS B HZ3  2  
ATOM   2111  N  N    . GLY A 1 9   ? 11.138  20.748  2.216   1.00 0.00 ? 9   GLY B N    2  
ATOM   2112  C  CA   . GLY A 1 9   ? 9.850   21.052  2.810   1.00 0.00 ? 9   GLY B CA   2  
ATOM   2113  C  C    . GLY A 1 9   ? 9.189   19.833  3.424   1.00 0.00 ? 9   GLY B C    2  
ATOM   2114  O  O    . GLY A 1 9   ? 9.671   19.296  4.421   1.00 0.00 ? 9   GLY B O    2  
ATOM   2115  H  H    . GLY A 1 9   ? 11.900  20.528  2.792   1.00 0.00 ? 9   GLY B H    2  
ATOM   2116  H  HA2  . GLY A 1 9   ? 9.987   21.798  3.579   1.00 0.00 ? 9   GLY B HA2  2  
ATOM   2117  H  HA3  . GLY A 1 9   ? 9.200   21.454  2.047   1.00 0.00 ? 9   GLY B HA3  2  
ATOM   2118  N  N    . LEU A 1 10  ? 8.084   19.399  2.824   1.00 0.00 ? 10  LEU B N    2  
ATOM   2119  C  CA   . LEU A 1 10  ? 7.348   18.236  3.312   1.00 0.00 ? 10  LEU B CA   2  
ATOM   2120  C  C    . LEU A 1 10  ? 6.930   18.428  4.768   1.00 0.00 ? 10  LEU B C    2  
ATOM   2121  O  O    . LEU A 1 10  ? 6.945   19.546  5.284   1.00 0.00 ? 10  LEU B O    2  
ATOM   2122  C  CB   . LEU A 1 10  ? 8.191   16.961  3.171   1.00 0.00 ? 10  LEU B CB   2  
ATOM   2123  C  CG   . LEU A 1 10  ? 8.452   16.489  1.733   1.00 0.00 ? 10  LEU B CG   2  
ATOM   2124  C  CD1  . LEU A 1 10  ? 7.146   16.325  0.970   1.00 0.00 ? 10  LEU B CD1  2  
ATOM   2125  C  CD2  . LEU A 1 10  ? 9.379   17.454  1.007   1.00 0.00 ? 10  LEU B CD2  2  
ATOM   2126  H  H    . LEU A 1 10  ? 7.754   19.873  2.032   1.00 0.00 ? 10  LEU B H    2  
ATOM   2127  H  HA   . LEU A 1 10  ? 6.458   18.135  2.709   1.00 0.00 ? 10  LEU B HA   2  
ATOM   2128  H  HB2  . LEU A 1 10  ? 9.145   17.135  3.646   1.00 0.00 ? 10  LEU B HB2  2  
ATOM   2129  H  HB3  . LEU A 1 10  ? 7.688   16.165  3.698   1.00 0.00 ? 10  LEU B HB3  2  
ATOM   2130  H  HG   . LEU A 1 10  ? 8.938   15.524  1.766   1.00 0.00 ? 10  LEU B HG   2  
ATOM   2131  H  HD11 . LEU A 1 10  ? 7.353   15.946  -0.020  1.00 0.00 ? 10  LEU B HD11 2  
ATOM   2132  H  HD12 . LEU A 1 10  ? 6.651   17.282  0.893   1.00 0.00 ? 10  LEU B HD12 2  
ATOM   2133  H  HD13 . LEU A 1 10  ? 6.506   15.630  1.495   1.00 0.00 ? 10  LEU B HD13 2  
ATOM   2134  H  HD21 . LEU A 1 10  ? 9.608   17.063  0.027   1.00 0.00 ? 10  LEU B HD21 2  
ATOM   2135  H  HD22 . LEU A 1 10  ? 10.292  17.569  1.571   1.00 0.00 ? 10  LEU B HD22 2  
ATOM   2136  H  HD23 . LEU A 1 10  ? 8.893   18.413  0.908   1.00 0.00 ? 10  LEU B HD23 2  
ATOM   2137  N  N    . GLY A 1 11  ? 6.556   17.334  5.425   1.00 0.00 ? 11  GLY B N    2  
ATOM   2138  C  CA   . GLY A 1 11  ? 6.136   17.411  6.813   1.00 0.00 ? 11  GLY B CA   2  
ATOM   2139  C  C    . GLY A 1 11  ? 7.171   16.850  7.769   1.00 0.00 ? 11  GLY B C    2  
ATOM   2140  O  O    . GLY A 1 11  ? 7.586   17.530  8.708   1.00 0.00 ? 11  GLY B O    2  
ATOM   2141  H  H    . GLY A 1 11  ? 6.564   16.469  4.965   1.00 0.00 ? 11  GLY B H    2  
ATOM   2142  H  HA2  . GLY A 1 11  ? 5.955   18.445  7.065   1.00 0.00 ? 11  GLY B HA2  2  
ATOM   2143  H  HA3  . GLY A 1 11  ? 5.216   16.857  6.930   1.00 0.00 ? 11  GLY B HA3  2  
ATOM   2144  N  N    . LYS A 1 12  ? 7.585   15.606  7.526   1.00 0.00 ? 12  LYS B N    2  
ATOM   2145  C  CA   . LYS A 1 12  ? 8.573   14.935  8.369   1.00 0.00 ? 12  LYS B CA   2  
ATOM   2146  C  C    . LYS A 1 12  ? 8.035   14.713  9.780   1.00 0.00 ? 12  LYS B C    2  
ATOM   2147  O  O    . LYS A 1 12  ? 7.525   15.635  10.416  1.00 0.00 ? 12  LYS B O    2  
ATOM   2148  C  CB   . LYS A 1 12  ? 9.876   15.740  8.426   1.00 0.00 ? 12  LYS B CB   2  
ATOM   2149  C  CG   . LYS A 1 12  ? 10.655  15.736  7.120   1.00 0.00 ? 12  LYS B CG   2  
ATOM   2150  C  CD   . LYS A 1 12  ? 11.182  14.348  6.789   1.00 0.00 ? 12  LYS B CD   2  
ATOM   2151  C  CE   . LYS A 1 12  ? 12.099  14.374  5.577   1.00 0.00 ? 12  LYS B CE   2  
ATOM   2152  N  NZ   . LYS A 1 12  ? 11.398  14.872  4.362   1.00 0.00 ? 12  LYS B NZ   2  
ATOM   2153  H  H    . LYS A 1 12  ? 7.214   15.125  6.757   1.00 0.00 ? 12  LYS B H    2  
ATOM   2154  H  HA   . LYS A 1 12  ? 8.780   13.972  7.926   1.00 0.00 ? 12  LYS B HA   2  
ATOM   2155  H  HB2  . LYS A 1 12  ? 9.641   16.764  8.676   1.00 0.00 ? 12  LYS B HB2  2  
ATOM   2156  H  HB3  . LYS A 1 12  ? 10.506  15.326  9.198   1.00 0.00 ? 12  LYS B HB3  2  
ATOM   2157  H  HG2  . LYS A 1 12  ? 10.006  16.062  6.322   1.00 0.00 ? 12  LYS B HG2  2  
ATOM   2158  H  HG3  . LYS A 1 12  ? 11.490  16.416  7.209   1.00 0.00 ? 12  LYS B HG3  2  
ATOM   2159  H  HD2  . LYS A 1 12  ? 11.735  13.971  7.638   1.00 0.00 ? 12  LYS B HD2  2  
ATOM   2160  H  HD3  . LYS A 1 12  ? 10.347  13.696  6.583   1.00 0.00 ? 12  LYS B HD3  2  
ATOM   2161  H  HE2  . LYS A 1 12  ? 12.937  15.021  5.790   1.00 0.00 ? 12  LYS B HE2  2  
ATOM   2162  H  HE3  . LYS A 1 12  ? 12.457  13.371  5.392   1.00 0.00 ? 12  LYS B HE3  2  
ATOM   2163  H  HZ1  . LYS A 1 12  ? 10.967  15.798  4.552   1.00 0.00 ? 12  LYS B HZ1  2  
ATOM   2164  H  HZ2  . LYS A 1 12  ? 10.653  14.204  4.080   1.00 0.00 ? 12  LYS B HZ2  2  
ATOM   2165  H  HZ3  . LYS A 1 12  ? 12.074  14.969  3.576   1.00 0.00 ? 12  LYS B HZ3  2  
ATOM   2166  N  N    . GLY A 1 13  ? 8.155   13.480  10.263  1.00 0.00 ? 13  GLY B N    2  
ATOM   2167  C  CA   . GLY A 1 13  ? 7.678   13.153  11.593  1.00 0.00 ? 13  GLY B CA   2  
ATOM   2168  C  C    . GLY A 1 13  ? 6.878   11.866  11.618  1.00 0.00 ? 13  GLY B C    2  
ATOM   2169  O  O    . GLY A 1 13  ? 5.661   11.880  11.429  1.00 0.00 ? 13  GLY B O    2  
ATOM   2170  H  H    . GLY A 1 13  ? 8.571   12.786  9.709   1.00 0.00 ? 13  GLY B H    2  
ATOM   2171  H  HA2  . GLY A 1 13  ? 8.528   13.048  12.253  1.00 0.00 ? 13  GLY B HA2  2  
ATOM   2172  H  HA3  . GLY A 1 13  ? 7.055   13.958  11.950  1.00 0.00 ? 13  GLY B HA3  2  
ATOM   2173  N  N    . GLY A 1 14  ? 7.562   10.750  11.850  1.00 0.00 ? 14  GLY B N    2  
ATOM   2174  C  CA   . GLY A 1 14  ? 6.891   9.465   11.893  1.00 0.00 ? 14  GLY B CA   2  
ATOM   2175  C  C    . GLY A 1 14  ? 6.670   8.879   10.512  1.00 0.00 ? 14  GLY B C    2  
ATOM   2176  O  O    . GLY A 1 14  ? 6.292   7.715   10.382  1.00 0.00 ? 14  GLY B O    2  
ATOM   2177  H  H    . GLY A 1 14  ? 8.531   10.801  11.991  1.00 0.00 ? 14  GLY B H    2  
ATOM   2178  H  HA2  . GLY A 1 14  ? 7.492   8.777   12.471  1.00 0.00 ? 14  GLY B HA2  2  
ATOM   2179  H  HA3  . GLY A 1 14  ? 5.935   9.586   12.379  1.00 0.00 ? 14  GLY B HA3  2  
ATOM   2180  N  N    . ALA A 1 15  ? 6.909   9.693   9.483   1.00 0.00 ? 15  ALA B N    2  
ATOM   2181  C  CA   . ALA A 1 15  ? 6.738   9.264   8.097   1.00 0.00 ? 15  ALA B CA   2  
ATOM   2182  C  C    . ALA A 1 15  ? 5.279   8.941   7.787   1.00 0.00 ? 15  ALA B C    2  
ATOM   2183  O  O    . ALA A 1 15  ? 4.637   8.172   8.503   1.00 0.00 ? 15  ALA B O    2  
ATOM   2184  C  CB   . ALA A 1 15  ? 7.623   8.060   7.799   1.00 0.00 ? 15  ALA B CB   2  
ATOM   2185  H  H    . ALA A 1 15  ? 7.211   10.608  9.662   1.00 0.00 ? 15  ALA B H    2  
ATOM   2186  H  HA   . ALA A 1 15  ? 7.056   10.076  7.458   1.00 0.00 ? 15  ALA B HA   2  
ATOM   2187  H  HB1  . ALA A 1 15  ? 8.645   8.291   8.061   1.00 0.00 ? 15  ALA B HB1  2  
ATOM   2188  H  HB2  . ALA A 1 15  ? 7.567   7.824   6.747   1.00 0.00 ? 15  ALA B HB2  2  
ATOM   2189  H  HB3  . ALA A 1 15  ? 7.286   7.213   8.377   1.00 0.00 ? 15  ALA B HB3  2  
ATOM   2190  N  N    . LYS A 1 16  ? 4.761   9.534   6.715   1.00 0.00 ? 16  LYS B N    2  
ATOM   2191  C  CA   . LYS A 1 16  ? 3.379   9.306   6.308   1.00 0.00 ? 16  LYS B CA   2  
ATOM   2192  C  C    . LYS A 1 16  ? 3.131   7.824   6.046   1.00 0.00 ? 16  LYS B C    2  
ATOM   2193  O  O    . LYS A 1 16  ? 3.731   7.232   5.149   1.00 0.00 ? 16  LYS B O    2  
ATOM   2194  C  CB   . LYS A 1 16  ? 3.046   10.119  5.056   1.00 0.00 ? 16  LYS B CB   2  
ATOM   2195  C  CG   . LYS A 1 16  ? 2.960   11.615  5.303   1.00 0.00 ? 16  LYS B CG   2  
ATOM   2196  C  CD   . LYS A 1 16  ? 2.565   12.364  4.040   1.00 0.00 ? 16  LYS B CD   2  
ATOM   2197  C  CE   . LYS A 1 16  ? 2.349   13.844  4.312   1.00 0.00 ? 16  LYS B CE   2  
ATOM   2198  N  NZ   . LYS A 1 16  ? 3.585   14.505  4.811   1.00 0.00 ? 16  LYS B NZ   2  
ATOM   2199  H  H    . LYS A 1 16  ? 5.321   10.139  6.185   1.00 0.00 ? 16  LYS B H    2  
ATOM   2200  H  HA   . LYS A 1 16  ? 2.738   9.627   7.116   1.00 0.00 ? 16  LYS B HA   2  
ATOM   2201  H  HB2  . LYS A 1 16  ? 3.810   9.942   4.313   1.00 0.00 ? 16  LYS B HB2  2  
ATOM   2202  H  HB3  . LYS A 1 16  ? 2.095   9.785   4.666   1.00 0.00 ? 16  LYS B HB3  2  
ATOM   2203  H  HG2  . LYS A 1 16  ? 2.220   11.803  6.067   1.00 0.00 ? 16  LYS B HG2  2  
ATOM   2204  H  HG3  . LYS A 1 16  ? 3.924   11.972  5.636   1.00 0.00 ? 16  LYS B HG3  2  
ATOM   2205  H  HD2  . LYS A 1 16  ? 3.350   12.255  3.308   1.00 0.00 ? 16  LYS B HD2  2  
ATOM   2206  H  HD3  . LYS A 1 16  ? 1.648   11.940  3.654   1.00 0.00 ? 16  LYS B HD3  2  
ATOM   2207  H  HE2  . LYS A 1 16  ? 2.040   14.324  3.395   1.00 0.00 ? 16  LYS B HE2  2  
ATOM   2208  H  HE3  . LYS A 1 16  ? 1.570   13.950  5.053   1.00 0.00 ? 16  LYS B HE3  2  
ATOM   2209  H  HZ1  . LYS A 1 16  ? 3.920   14.032  5.675   1.00 0.00 ? 16  LYS B HZ1  2  
ATOM   2210  H  HZ2  . LYS A 1 16  ? 3.395   15.504  5.029   1.00 0.00 ? 16  LYS B HZ2  2  
ATOM   2211  H  HZ3  . LYS A 1 16  ? 4.333   14.456  4.089   1.00 0.00 ? 16  LYS B HZ3  2  
ATOM   2212  N  N    . ARG A 1 17  ? 2.240   7.234   6.835   1.00 0.00 ? 17  ARG B N    2  
ATOM   2213  C  CA   . ARG A 1 17  ? 1.910   5.820   6.697   1.00 0.00 ? 17  ARG B CA   2  
ATOM   2214  C  C    . ARG A 1 17  ? 1.049   5.583   5.460   1.00 0.00 ? 17  ARG B C    2  
ATOM   2215  O  O    . ARG A 1 17  ? -0.177  5.495   5.554   1.00 0.00 ? 17  ARG B O    2  
ATOM   2216  C  CB   . ARG A 1 17  ? 1.180   5.328   7.950   1.00 0.00 ? 17  ARG B CB   2  
ATOM   2217  C  CG   . ARG A 1 17  ? 1.601   3.939   8.405   1.00 0.00 ? 17  ARG B CG   2  
ATOM   2218  C  CD   . ARG A 1 17  ? 1.197   2.868   7.405   1.00 0.00 ? 17  ARG B CD   2  
ATOM   2219  N  NE   . ARG A 1 17  ? 1.403   1.523   7.934   1.00 0.00 ? 17  ARG B NE   2  
ATOM   2220  C  CZ   . ARG A 1 17  ? 0.478   0.567   7.901   1.00 0.00 ? 17  ARG B CZ   2  
ATOM   2221  N  NH1  . ARG A 1 17  ? -0.707  0.806   7.357   1.00 0.00 ? 17  ARG B NH1  2  
ATOM   2222  N  NH2  . ARG A 1 17  ? 0.739   -0.627  8.413   1.00 0.00 ? 17  ARG B NH2  2  
ATOM   2223  H  H    . ARG A 1 17  ? 1.792   7.762   7.528   1.00 0.00 ? 17  ARG B H    2  
ATOM   2224  H  HA   . ARG A 1 17  ? 2.835   5.272   6.590   1.00 0.00 ? 17  ARG B HA   2  
ATOM   2225  H  HB2  . ARG A 1 17  ? 1.371   6.020   8.757   1.00 0.00 ? 17  ARG B HB2  2  
ATOM   2226  H  HB3  . ARG A 1 17  ? 0.120   5.310   7.749   1.00 0.00 ? 17  ARG B HB3  2  
ATOM   2227  H  HG2  . ARG A 1 17  ? 2.675   3.919   8.521   1.00 0.00 ? 17  ARG B HG2  2  
ATOM   2228  H  HG3  . ARG A 1 17  ? 1.133   3.726   9.355   1.00 0.00 ? 17  ARG B HG3  2  
ATOM   2229  H  HD2  . ARG A 1 17  ? 0.152   2.993   7.164   1.00 0.00 ? 17  ARG B HD2  2  
ATOM   2230  H  HD3  . ARG A 1 17  ? 1.788   2.987   6.509   1.00 0.00 ? 17  ARG B HD3  2  
ATOM   2231  H  HE   . ARG A 1 17  ? 2.273   1.322   8.338   1.00 0.00 ? 17  ARG B HE   2  
ATOM   2232  H  HH11 . ARG A 1 17  ? -0.908  1.706   6.970   1.00 0.00 ? 17  ARG B HH11 2  
ATOM   2233  H  HH12 . ARG A 1 17  ? -1.400  0.085   7.334   1.00 0.00 ? 17  ARG B HH12 2  
ATOM   2234  H  HH21 . ARG A 1 17  ? 1.632   -0.811  8.824   1.00 0.00 ? 17  ARG B HH21 2  
ATOM   2235  H  HH22 . ARG A 1 17  ? 0.044   -1.345  8.388   1.00 0.00 ? 17  ARG B HH22 2  
ATOM   2236  N  N    . HIS A 1 18  ? 1.697   5.483   4.301   1.00 0.00 ? 18  HIS B N    2  
ATOM   2237  C  CA   . HIS A 1 18  ? 0.988   5.257   3.043   1.00 0.00 ? 18  HIS B CA   2  
ATOM   2238  C  C    . HIS A 1 18  ? -0.052  6.326   2.800   1.00 0.00 ? 18  HIS B C    2  
ATOM   2239  O  O    . HIS A 1 18  ? 0.010   7.418   3.365   1.00 0.00 ? 18  HIS B O    2  
ATOM   2240  C  CB   . HIS A 1 18  ? 0.310   3.887   3.037   1.00 0.00 ? 18  HIS B CB   2  
ATOM   2241  C  CG   . HIS A 1 18  ? 0.560   3.140   1.773   1.00 0.00 ? 18  HIS B CG   2  
ATOM   2242  N  ND1  . HIS A 1 18  ? -0.429  2.558   1.013   1.00 0.00 ? 18  HIS B ND1  2  
ATOM   2243  C  CD2  . HIS A 1 18  ? 1.708   2.939   1.104   1.00 0.00 ? 18  HIS B CD2  2  
ATOM   2244  C  CE1  . HIS A 1 18  ? 0.111   2.039   -0.072  1.00 0.00 ? 18  HIS B CE1  2  
ATOM   2245  N  NE2  . HIS A 1 18  ? 1.408   2.251   -0.036  1.00 0.00 ? 18  HIS B NE2  2  
ATOM   2246  H  H    . HIS A 1 18  ? 2.673   5.561   4.290   1.00 0.00 ? 18  HIS B H    2  
ATOM   2247  H  HA   . HIS A 1 18  ? 1.698   5.293   2.233   1.00 0.00 ? 18  HIS B HA   2  
ATOM   2248  H  HB2  . HIS A 1 18  ? 0.678   3.294   3.862   1.00 0.00 ? 18  HIS B HB2  2  
ATOM   2249  H  HB3  . HIS A 1 18  ? -0.757  4.024   3.135   1.00 0.00 ? 18  HIS B HB3  2  
ATOM   2250  H  HD1  . HIS A 1 18  ? -1.384  2.529   1.236   1.00 0.00 ? 18  HIS B HD1  2  
ATOM   2251  H  HD2  . HIS A 1 18  ? 2.667   3.310   1.388   1.00 0.00 ? 18  HIS B HD2  2  
ATOM   2252  H  HE1  . HIS A 1 18  ? -0.422  1.596   -0.881  1.00 0.00 ? 18  HIS B HE1  2  
ATOM   2253  H  HE2  . HIS A 1 18  ? 2.028   2.075   -0.774  1.00 0.00 ? 18  HIS B HE2  2  
ATOM   2254  N  N    . ARG A 1 19  ? -0.986  5.987   1.925   1.00 0.00 ? 19  ARG B N    2  
ATOM   2255  C  CA   . ARG A 1 19  ? -2.087  6.856   1.562   1.00 0.00 ? 19  ARG B CA   2  
ATOM   2256  C  C    . ARG A 1 19  ? -1.712  7.896   0.518   1.00 0.00 ? 19  ARG B C    2  
ATOM   2257  O  O    . ARG A 1 19  ? -1.435  7.556   -0.606  1.00 0.00 ? 19  ARG B O    2  
ATOM   2258  C  CB   . ARG A 1 19  ? -2.655  7.541   2.767   1.00 0.00 ? 19  ARG B CB   2  
ATOM   2259  C  CG   . ARG A 1 19  ? -4.151  7.564   2.717   1.00 0.00 ? 19  ARG B CG   2  
ATOM   2260  C  CD   . ARG A 1 19  ? -4.675  8.715   1.887   1.00 0.00 ? 19  ARG B CD   2  
ATOM   2261  N  NE   . ARG A 1 19  ? -4.888  9.928   2.675   1.00 0.00 ? 19  ARG B NE   2  
ATOM   2262  C  CZ   . ARG A 1 19  ? -5.896  10.082  3.534   1.00 0.00 ? 19  ARG B CZ   2  
ATOM   2263  N  NH1  . ARG A 1 19  ? -6.722  9.073   3.783   1.00 0.00 ? 19  ARG B NH1  2  
ATOM   2264  N  NH2  . ARG A 1 19  ? -6.069  11.241  4.157   1.00 0.00 ? 19  ARG B NH2  2  
ATOM   2265  H  H    . ARG A 1 19  ? -0.932  5.106   1.502   1.00 0.00 ? 19  ARG B H    2  
ATOM   2266  H  HA   . ARG A 1 19  ? -2.856  6.226   1.141   1.00 0.00 ? 19  ARG B HA   2  
ATOM   2267  H  HB2  . ARG A 1 19  ? -2.334  7.033   3.664   1.00 0.00 ? 19  ARG B HB2  2  
ATOM   2268  H  HB3  . ARG A 1 19  ? -2.292  8.541   2.763   1.00 0.00 ? 19  ARG B HB3  2  
ATOM   2269  H  HG2  . ARG A 1 19  ? -4.459  6.650   2.261   1.00 0.00 ? 19  ARG B HG2  2  
ATOM   2270  H  HG3  . ARG A 1 19  ? -4.547  7.622   3.700   1.00 0.00 ? 19  ARG B HG3  2  
ATOM   2271  H  HD2  . ARG A 1 19  ? -3.955  8.921   1.110   1.00 0.00 ? 19  ARG B HD2  2  
ATOM   2272  H  HD3  . ARG A 1 19  ? -5.611  8.418   1.438   1.00 0.00 ? 19  ARG B HD3  2  
ATOM   2273  H  HE   . ARG A 1 19  ? -4.269  10.675  2.536   1.00 0.00 ? 19  ARG B HE   2  
ATOM   2274  H  HH11 . ARG A 1 19  ? -6.589  8.193   3.326   1.00 0.00 ? 19  ARG B HH11 2  
ATOM   2275  H  HH12 . ARG A 1 19  ? -7.477  9.192   4.428   1.00 0.00 ? 19  ARG B HH12 2  
ATOM   2276  H  HH21 . ARG A 1 19  ? -5.444  12.001  3.981   1.00 0.00 ? 19  ARG B HH21 2  
ATOM   2277  H  HH22 . ARG A 1 19  ? -6.826  11.355  4.800   1.00 0.00 ? 19  ARG B HH22 2  
ATOM   2278  N  N    . LYS A 1 20  ? -1.727  9.177   0.876   1.00 0.00 ? 20  LYS B N    2  
ATOM   2279  C  CA   . LYS A 1 20  ? -1.421  10.223  -0.090  1.00 0.00 ? 20  LYS B CA   2  
ATOM   2280  C  C    . LYS A 1 20  ? -1.774  11.600  0.471   1.00 0.00 ? 20  LYS B C    2  
ATOM   2281  O  O    . LYS A 1 20  ? -1.062  12.063  1.387   1.00 0.00 ? 20  LYS B O    2  
ATOM   2282  C  CB   . LYS A 1 20  ? -2.208  9.949   -1.380  1.00 0.00 ? 20  LYS B CB   2  
ATOM   2283  C  CG   . LYS A 1 20  ? -3.666  9.600   -1.112  1.00 0.00 ? 20  LYS B CG   2  
ATOM   2284  C  CD   . LYS A 1 20  ? -4.584  9.875   -2.280  1.00 0.00 ? 20  LYS B CD   2  
ATOM   2285  C  CE   . LYS A 1 20  ? -4.102  9.241   -3.560  1.00 0.00 ? 20  LYS B CE   2  
ATOM   2286  N  NZ   . LYS A 1 20  ? -5.143  9.242   -4.623  1.00 0.00 ? 20  LYS B NZ   2  
ATOM   2287  O  OXT  . LYS A 1 20  ? -2.756  12.205  -0.011  1.00 0.00 ? 20  LYS B OXT  2  
ATOM   2288  H  H    . LYS A 1 20  ? -1.942  9.424   1.798   1.00 0.00 ? 20  LYS B H    2  
ATOM   2289  H  HA   . LYS A 1 20  ? -0.365  10.187  -0.304  1.00 0.00 ? 20  LYS B HA   2  
ATOM   2290  H  HB2  . LYS A 1 20  ? -2.166  10.807  -2.021  1.00 0.00 ? 20  LYS B HB2  2  
ATOM   2291  H  HB3  . LYS A 1 20  ? -1.750  9.101   -1.888  1.00 0.00 ? 20  LYS B HB3  2  
ATOM   2292  H  HG2  . LYS A 1 20  ? -3.735  8.550   -0.878  1.00 0.00 ? 20  LYS B HG2  2  
ATOM   2293  H  HG3  . LYS A 1 20  ? -4.006  10.175  -0.262  1.00 0.00 ? 20  LYS B HG3  2  
ATOM   2294  H  HD2  . LYS A 1 20  ? -5.548  9.454   -2.044  1.00 0.00 ? 20  LYS B HD2  2  
ATOM   2295  H  HD3  . LYS A 1 20  ? -4.673  10.943  -2.420  1.00 0.00 ? 20  LYS B HD3  2  
ATOM   2296  H  HE2  . LYS A 1 20  ? -3.240  9.787   -3.914  1.00 0.00 ? 20  LYS B HE2  2  
ATOM   2297  H  HE3  . LYS A 1 20  ? -3.816  8.219   -3.339  1.00 0.00 ? 20  LYS B HE3  2  
ATOM   2298  H  HZ1  . LYS A 1 20  ? -4.758  8.834   -5.499  1.00 0.00 ? 20  LYS B HZ1  2  
ATOM   2299  H  HZ2  . LYS A 1 20  ? -5.458  10.214  -4.816  1.00 0.00 ? 20  LYS B HZ2  2  
ATOM   2300  H  HZ3  . LYS A 1 20  ? -5.962  8.678   -4.322  1.00 0.00 ? 20  LYS B HZ3  2  
ATOM   2301  N  N    . GLY B 2 1   ? 18.595  -0.472  -10.957 1.00 0.00 ? 259 GLY A N    2  
ATOM   2302  C  CA   . GLY B 2 1   ? 17.257  -1.122  -10.869 1.00 0.00 ? 259 GLY A CA   2  
ATOM   2303  C  C    . GLY B 2 1   ? 16.468  -0.661  -9.660  1.00 0.00 ? 259 GLY A C    2  
ATOM   2304  O  O    . GLY B 2 1   ? 15.948  -1.480  -8.901  1.00 0.00 ? 259 GLY A O    2  
ATOM   2305  H  H1   . GLY B 2 1   ? 19.104  -0.815  -11.796 1.00 0.00 ? 259 GLY A H1   2  
ATOM   2306  H  H2   . GLY B 2 1   ? 19.156  -0.694  -10.110 1.00 0.00 ? 259 GLY A H2   2  
ATOM   2307  H  H3   . GLY B 2 1   ? 18.487  0.559   -11.027 1.00 0.00 ? 259 GLY A H3   2  
ATOM   2308  H  HA2  . GLY B 2 1   ? 16.696  -0.888  -11.762 1.00 0.00 ? 259 GLY A HA2  2  
ATOM   2309  H  HA3  . GLY B 2 1   ? 17.391  -2.192  -10.811 1.00 0.00 ? 259 GLY A HA3  2  
ATOM   2310  N  N    . SER B 2 2   ? 16.380  0.655   -9.483  1.00 0.00 ? 260 SER A N    2  
ATOM   2311  C  CA   . SER B 2 2   ? 15.650  1.236   -8.360  1.00 0.00 ? 260 SER A CA   2  
ATOM   2312  C  C    . SER B 2 2   ? 16.180  0.755   -7.026  1.00 0.00 ? 260 SER A C    2  
ATOM   2313  O  O    . SER B 2 2   ? 17.204  0.075   -6.945  1.00 0.00 ? 260 SER A O    2  
ATOM   2314  C  CB   . SER B 2 2   ? 14.170  0.908   -8.443  1.00 0.00 ? 260 SER A CB   2  
ATOM   2315  O  OG   . SER B 2 2   ? 13.562  1.579   -9.532  1.00 0.00 ? 260 SER A OG   2  
ATOM   2316  H  H    . SER B 2 2   ? 16.818  1.252   -10.124 1.00 0.00 ? 260 SER A H    2  
ATOM   2317  H  HA   . SER B 2 2   ? 15.758  2.304   -8.402  1.00 0.00 ? 260 SER A HA   2  
ATOM   2318  H  HB2  . SER B 2 2   ? 14.043  -0.157  -8.571  1.00 0.00 ? 260 SER A HB2  2  
ATOM   2319  H  HB3  . SER B 2 2   ? 13.699  1.224   -7.522  1.00 0.00 ? 260 SER A HB3  2  
ATOM   2320  H  HG   . SER B 2 2   ? 13.437  2.505   -9.308  1.00 0.00 ? 260 SER A HG   2  
ATOM   2321  N  N    . TYR B 2 3   ? 15.454  1.124   -5.982  1.00 0.00 ? 261 TYR A N    2  
ATOM   2322  C  CA   . TYR B 2 3   ? 15.799  0.766   -4.622  1.00 0.00 ? 261 TYR A CA   2  
ATOM   2323  C  C    . TYR B 2 3   ? 14.743  1.291   -3.665  1.00 0.00 ? 261 TYR A C    2  
ATOM   2324  O  O    . TYR B 2 3   ? 13.938  2.153   -4.019  1.00 0.00 ? 261 TYR A O    2  
ATOM   2325  C  CB   . TYR B 2 3   ? 17.162  1.338   -4.249  1.00 0.00 ? 261 TYR A CB   2  
ATOM   2326  C  CG   . TYR B 2 3   ? 17.409  2.712   -4.809  1.00 0.00 ? 261 TYR A CG   2  
ATOM   2327  C  CD1  . TYR B 2 3   ? 16.552  3.734   -4.496  1.00 0.00 ? 261 TYR A CD1  2  
ATOM   2328  C  CD2  . TYR B 2 3   ? 18.487  2.980   -5.641  1.00 0.00 ? 261 TYR A CD2  2  
ATOM   2329  C  CE1  . TYR B 2 3   ? 16.741  5.003   -4.988  1.00 0.00 ? 261 TYR A CE1  2  
ATOM   2330  C  CE2  . TYR B 2 3   ? 18.692  4.251   -6.145  1.00 0.00 ? 261 TYR A CE2  2  
ATOM   2331  C  CZ   . TYR B 2 3   ? 17.814  5.262   -5.813  1.00 0.00 ? 261 TYR A CZ   2  
ATOM   2332  O  OH   . TYR B 2 3   ? 18.009  6.529   -6.310  1.00 0.00 ? 261 TYR A OH   2  
ATOM   2333  H  H    . TYR B 2 3   ? 14.649  1.661   -6.134  1.00 0.00 ? 261 TYR A H    2  
ATOM   2334  H  HA   . TYR B 2 3   ? 15.834  -0.311  -4.555  1.00 0.00 ? 261 TYR A HA   2  
ATOM   2335  H  HB2  . TYR B 2 3   ? 17.233  1.399   -3.177  1.00 0.00 ? 261 TYR A HB2  2  
ATOM   2336  H  HB3  . TYR B 2 3   ? 17.923  0.698   -4.609  1.00 0.00 ? 261 TYR A HB3  2  
ATOM   2337  H  HD1  . TYR B 2 3   ? 15.721  3.518   -3.848  1.00 0.00 ? 261 TYR A HD1  2  
ATOM   2338  H  HD2  . TYR B 2 3   ? 19.169  2.182   -5.895  1.00 0.00 ? 261 TYR A HD2  2  
ATOM   2339  H  HE1  . TYR B 2 3   ? 16.052  5.784   -4.720  1.00 0.00 ? 261 TYR A HE1  2  
ATOM   2340  H  HE2  . TYR B 2 3   ? 19.535  4.447   -6.791  1.00 0.00 ? 261 TYR A HE2  2  
ATOM   2341  H  HH   . TYR B 2 3   ? 18.180  6.481   -7.253  1.00 0.00 ? 261 TYR A HH   2  
ATOM   2342  N  N    . CYS B 2 4   ? 14.751  0.760   -2.459  1.00 0.00 ? 262 CYS A N    2  
ATOM   2343  C  CA   . CYS B 2 4   ? 13.797  1.165   -1.436  1.00 0.00 ? 262 CYS A CA   2  
ATOM   2344  C  C    . CYS B 2 4   ? 13.848  2.665   -1.198  1.00 0.00 ? 262 CYS A C    2  
ATOM   2345  O  O    . CYS B 2 4   ? 14.857  3.197   -0.759  1.00 0.00 ? 262 CYS A O    2  
ATOM   2346  C  CB   . CYS B 2 4   ? 14.098  0.437   -0.144  1.00 0.00 ? 262 CYS A CB   2  
ATOM   2347  S  SG   . CYS B 2 4   ? 13.653  1.309   1.394   1.00 0.00 ? 262 CYS A SG   2  
ATOM   2348  H  H    . CYS B 2 4   ? 15.418  0.073   -2.250  1.00 0.00 ? 262 CYS A H    2  
ATOM   2349  H  HA   . CYS B 2 4   ? 12.807  0.875   -1.768  1.00 0.00 ? 262 CYS A HA   2  
ATOM   2350  H  HB2  . CYS B 2 4   ? 13.562  -0.495  -0.141  1.00 0.00 ? 262 CYS A HB2  2  
ATOM   2351  H  HB3  . CYS B 2 4   ? 15.152  0.224   -0.110  1.00 0.00 ? 262 CYS A HB3  2  
ATOM   2352  N  N    . ASP B 2 5   ? 12.759  3.338   -1.506  1.00 0.00 ? 263 ASP A N    2  
ATOM   2353  C  CA   . ASP B 2 5   ? 12.653  4.780   -1.300  1.00 0.00 ? 263 ASP A CA   2  
ATOM   2354  C  C    . ASP B 2 5   ? 13.087  5.194   0.117   1.00 0.00 ? 263 ASP A C    2  
ATOM   2355  O  O    . ASP B 2 5   ? 13.213  6.383   0.415   1.00 0.00 ? 263 ASP A O    2  
ATOM   2356  C  CB   . ASP B 2 5   ? 11.211  5.201   -1.573  1.00 0.00 ? 263 ASP A CB   2  
ATOM   2357  C  CG   . ASP B 2 5   ? 10.635  6.167   -0.550  1.00 0.00 ? 263 ASP A CG   2  
ATOM   2358  O  OD1  . ASP B 2 5   ? 11.073  7.336   -0.524  1.00 0.00 ? 263 ASP A OD1  2  
ATOM   2359  O  OD2  . ASP B 2 5   ? 9.731   5.755   0.216   1.00 0.00 ? 263 ASP A OD2  2  
ATOM   2360  H  H    . ASP B 2 5   ? 12.010  2.858   -1.920  1.00 0.00 ? 263 ASP A H    2  
ATOM   2361  H  HA   . ASP B 2 5   ? 13.293  5.261   -2.016  1.00 0.00 ? 263 ASP A HA   2  
ATOM   2362  H  HB2  . ASP B 2 5   ? 11.156  5.667   -2.546  1.00 0.00 ? 263 ASP A HB2  2  
ATOM   2363  H  HB3  . ASP B 2 5   ? 10.608  4.313   -1.576  1.00 0.00 ? 263 ASP A HB3  2  
ATOM   2364  N  N    . PHE B 2 6   ? 13.342  4.209   0.978   1.00 0.00 ? 264 PHE A N    2  
ATOM   2365  C  CA   . PHE B 2 6   ? 13.738  4.479   2.364   1.00 0.00 ? 264 PHE A CA   2  
ATOM   2366  C  C    . PHE B 2 6   ? 15.235  4.227   2.627   1.00 0.00 ? 264 PHE A C    2  
ATOM   2367  O  O    . PHE B 2 6   ? 15.856  4.969   3.384   1.00 0.00 ? 264 PHE A O    2  
ATOM   2368  C  CB   . PHE B 2 6   ? 12.872  3.664   3.330   1.00 0.00 ? 264 PHE A CB   2  
ATOM   2369  C  CG   . PHE B 2 6   ? 11.401  3.844   3.097   1.00 0.00 ? 264 PHE A CG   2  
ATOM   2370  C  CD1  . PHE B 2 6   ? 10.766  3.146   2.086   1.00 0.00 ? 264 PHE A CD1  2  
ATOM   2371  C  CD2  . PHE B 2 6   ? 10.654  4.702   3.887   1.00 0.00 ? 264 PHE A CD2  2  
ATOM   2372  C  CE1  . PHE B 2 6   ? 9.411   3.297   1.862   1.00 0.00 ? 264 PHE A CE1  2  
ATOM   2373  C  CE2  . PHE B 2 6   ? 9.298   4.860   3.669   1.00 0.00 ? 264 PHE A CE2  2  
ATOM   2374  C  CZ   . PHE B 2 6   ? 8.676   4.157   2.655   1.00 0.00 ? 264 PHE A CZ   2  
ATOM   2375  H  H    . PHE B 2 6   ? 13.259  3.286   0.674   1.00 0.00 ? 264 PHE A H    2  
ATOM   2376  H  HA   . PHE B 2 6   ? 13.543  5.517   2.541   1.00 0.00 ? 264 PHE A HA   2  
ATOM   2377  H  HB2  . PHE B 2 6   ? 13.098  2.614   3.214   1.00 0.00 ? 264 PHE A HB2  2  
ATOM   2378  H  HB3  . PHE B 2 6   ? 13.087  3.963   4.343   1.00 0.00 ? 264 PHE A HB3  2  
ATOM   2379  H  HD1  . PHE B 2 6   ? 11.344  2.482   1.465   1.00 0.00 ? 264 PHE A HD1  2  
ATOM   2380  H  HD2  . PHE B 2 6   ? 11.140  5.252   4.679   1.00 0.00 ? 264 PHE A HD2  2  
ATOM   2381  H  HE1  . PHE B 2 6   ? 8.925   2.743   1.067   1.00 0.00 ? 264 PHE A HE1  2  
ATOM   2382  H  HE2  . PHE B 2 6   ? 8.726   5.533   4.290   1.00 0.00 ? 264 PHE A HE2  2  
ATOM   2383  H  HZ   . PHE B 2 6   ? 7.619   4.279   2.483   1.00 0.00 ? 264 PHE A HZ   2  
ATOM   2384  N  N    . CYS B 2 7   ? 15.813  3.194   2.007   1.00 0.00 ? 265 CYS A N    2  
ATOM   2385  C  CA   . CYS B 2 7   ? 17.243  2.891   2.189   1.00 0.00 ? 265 CYS A CA   2  
ATOM   2386  C  C    . CYS B 2 7   ? 17.972  3.192   0.917   1.00 0.00 ? 265 CYS A C    2  
ATOM   2387  O  O    . CYS B 2 7   ? 19.128  3.619   0.919   1.00 0.00 ? 265 CYS A O    2  
ATOM   2388  C  CB   . CYS B 2 7   ? 17.530  1.421   2.539   1.00 0.00 ? 265 CYS A CB   2  
ATOM   2389  S  SG   . CYS B 2 7   ? 16.534  0.688   3.868   1.00 0.00 ? 265 CYS A SG   2  
ATOM   2390  H  H    . CYS B 2 7   ? 15.288  2.659   1.384   1.00 0.00 ? 265 CYS A H    2  
ATOM   2391  H  HA   . CYS B 2 7   ? 17.630  3.530   2.955   1.00 0.00 ? 265 CYS A HA   2  
ATOM   2392  H  HB2  . CYS B 2 7   ? 17.385  0.824   1.668   1.00 0.00 ? 265 CYS A HB2  2  
ATOM   2393  H  HB3  . CYS B 2 7   ? 18.566  1.342   2.837   1.00 0.00 ? 265 CYS A HB3  2  
ATOM   2394  N  N    . LEU B 2 8   ? 17.273  2.957   -0.173  1.00 0.00 ? 266 LEU A N    2  
ATOM   2395  C  CA   . LEU B 2 8   ? 17.803  3.183   -1.482  1.00 0.00 ? 266 LEU A CA   2  
ATOM   2396  C  C    . LEU B 2 8   ? 18.952  2.230   -1.757  1.00 0.00 ? 266 LEU A C    2  
ATOM   2397  O  O    . LEU B 2 8   ? 19.927  2.570   -2.426  1.00 0.00 ? 266 LEU A O    2  
ATOM   2398  C  CB   . LEU B 2 8   ? 18.215  4.629   -1.612  1.00 0.00 ? 266 LEU A CB   2  
ATOM   2399  C  CG   . LEU B 2 8   ? 17.236  5.586   -0.966  1.00 0.00 ? 266 LEU A CG   2  
ATOM   2400  C  CD1  . LEU B 2 8   ? 17.870  6.939   -0.719  1.00 0.00 ? 266 LEU A CD1  2  
ATOM   2401  C  CD2  . LEU B 2 8   ? 16.009  5.695   -1.827  1.00 0.00 ? 266 LEU A CD2  2  
ATOM   2402  H  H    . LEU B 2 8   ? 16.358  2.624   -0.088  1.00 0.00 ? 266 LEU A H    2  
ATOM   2403  H  HA   . LEU B 2 8   ? 17.013  2.992   -2.178  1.00 0.00 ? 266 LEU A HA   2  
ATOM   2404  H  HB2  . LEU B 2 8   ? 19.180  4.759   -1.164  1.00 0.00 ? 266 LEU A HB2  2  
ATOM   2405  H  HB3  . LEU B 2 8   ? 18.265  4.861   -2.650  1.00 0.00 ? 266 LEU A HB3  2  
ATOM   2406  H  HG   . LEU B 2 8   ? 16.934  5.173   -0.026  1.00 0.00 ? 266 LEU A HG   2  
ATOM   2407  H  HD11 . LEU B 2 8   ? 18.923  6.876   -0.933  1.00 0.00 ? 266 LEU A HD11 2  
ATOM   2408  H  HD12 . LEU B 2 8   ? 17.730  7.220   0.315   1.00 0.00 ? 266 LEU A HD12 2  
ATOM   2409  H  HD13 . LEU B 2 8   ? 17.413  7.676   -1.361  1.00 0.00 ? 266 LEU A HD13 2  
ATOM   2410  H  HD21 . LEU B 2 8   ? 15.753  4.700   -2.160  1.00 0.00 ? 266 LEU A HD21 2  
ATOM   2411  H  HD22 . LEU B 2 8   ? 16.215  6.326   -2.679  1.00 0.00 ? 266 LEU A HD22 2  
ATOM   2412  H  HD23 . LEU B 2 8   ? 15.194  6.108   -1.254  1.00 0.00 ? 266 LEU A HD23 2  
ATOM   2413  N  N    . GLY B 2 9   ? 18.803  1.020   -1.226  1.00 0.00 ? 267 GLY A N    2  
ATOM   2414  C  CA   . GLY B 2 9   ? 19.800  -0.013  -1.393  1.00 0.00 ? 267 GLY A CA   2  
ATOM   2415  C  C    . GLY B 2 9   ? 19.390  -1.024  -2.442  1.00 0.00 ? 267 GLY A C    2  
ATOM   2416  O  O    . GLY B 2 9   ? 19.624  -0.829  -3.635  1.00 0.00 ? 267 GLY A O    2  
ATOM   2417  H  H    . GLY B 2 9   ? 17.990  0.825   -0.713  1.00 0.00 ? 267 GLY A H    2  
ATOM   2418  H  HA2  . GLY B 2 9   ? 20.747  0.439   -1.664  1.00 0.00 ? 267 GLY A HA2  2  
ATOM   2419  H  HA3  . GLY B 2 9   ? 19.917  -0.527  -0.451  1.00 0.00 ? 267 GLY A HA3  2  
ATOM   2420  N  N    . GLY B 2 10  ? 18.772  -2.109  -1.985  1.00 0.00 ? 268 GLY A N    2  
ATOM   2421  C  CA   . GLY B 2 10  ? 18.310  -3.147  -2.889  1.00 0.00 ? 268 GLY A CA   2  
ATOM   2422  C  C    . GLY B 2 10  ? 17.586  -4.266  -2.160  1.00 0.00 ? 268 GLY A C    2  
ATOM   2423  O  O    . GLY B 2 10  ? 17.702  -4.396  -0.942  1.00 0.00 ? 268 GLY A O    2  
ATOM   2424  H  H    . GLY B 2 10  ? 18.640  -2.209  -1.016  1.00 0.00 ? 268 GLY A H    2  
ATOM   2425  H  HA2  . GLY B 2 10  ? 17.637  -2.708  -3.608  1.00 0.00 ? 268 GLY A HA2  2  
ATOM   2426  H  HA3  . GLY B 2 10  ? 19.156  -3.561  -3.413  1.00 0.00 ? 268 GLY A HA3  2  
ATOM   2427  N  N    . SER B 2 11  ? 16.840  -5.077  -2.907  1.00 0.00 ? 269 SER A N    2  
ATOM   2428  C  CA   . SER B 2 11  ? 16.103  -6.179  -2.335  1.00 0.00 ? 269 SER A CA   2  
ATOM   2429  C  C    . SER B 2 11  ? 17.063  -7.286  -1.946  1.00 0.00 ? 269 SER A C    2  
ATOM   2430  O  O    . SER B 2 11  ? 18.135  -7.430  -2.535  1.00 0.00 ? 269 SER A O    2  
ATOM   2431  C  CB   . SER B 2 11  ? 15.057  -6.686  -3.329  1.00 0.00 ? 269 SER A CB   2  
ATOM   2432  O  OG   . SER B 2 11  ? 15.574  -7.734  -4.132  1.00 0.00 ? 269 SER A OG   2  
ATOM   2433  H  H    . SER B 2 11  ? 16.795  -4.939  -3.861  1.00 0.00 ? 269 SER A H    2  
ATOM   2434  H  HA   . SER B 2 11  ? 15.604  -5.820  -1.447  1.00 0.00 ? 269 SER A HA   2  
ATOM   2435  H  HB2  . SER B 2 11  ? 14.197  -7.040  -2.795  1.00 0.00 ? 269 SER A HB2  2  
ATOM   2436  H  HB3  . SER B 2 11  ? 14.754  -5.880  -3.965  1.00 0.00 ? 269 SER A HB3  2  
ATOM   2437  H  HG   . SER B 2 11  ? 14.881  -8.372  -4.309  1.00 0.00 ? 269 SER A HG   2  
ATOM   2438  N  N    . ASN B 2 12  ? 16.671  -8.059  -0.954  1.00 0.00 ? 270 ASN A N    2  
ATOM   2439  C  CA   . ASN B 2 12  ? 17.513  -9.141  -0.450  1.00 0.00 ? 270 ASN A CA   2  
ATOM   2440  C  C    . ASN B 2 12  ? 18.834  -8.566  0.017   1.00 0.00 ? 270 ASN A C    2  
ATOM   2441  O  O    . ASN B 2 12  ? 19.835  -9.274  0.125   1.00 0.00 ? 270 ASN A O    2  
ATOM   2442  C  CB   . ASN B 2 12  ? 17.753  -10.192 -1.514  1.00 0.00 ? 270 ASN A CB   2  
ATOM   2443  C  CG   . ASN B 2 12  ? 16.471  -10.723 -2.126  1.00 0.00 ? 270 ASN A CG   2  
ATOM   2444  O  OD1  . ASN B 2 12  ? 16.391  -10.937 -3.335  1.00 0.00 ? 270 ASN A OD1  2  
ATOM   2445  N  ND2  . ASN B 2 12  ? 15.466  -10.953 -1.291  1.00 0.00 ? 270 ASN A ND2  2  
ATOM   2446  H  H    . ASN B 2 12  ? 15.798  -7.893  -0.557  1.00 0.00 ? 270 ASN A H    2  
ATOM   2447  H  HA   . ASN B 2 12  ? 17.033  -9.601  0.382   1.00 0.00 ? 270 ASN A HA   2  
ATOM   2448  H  HB2  . ASN B 2 12  ? 18.346  -9.760  -2.283  1.00 0.00 ? 270 ASN A HB2  2  
ATOM   2449  H  HB3  . ASN B 2 12  ? 18.286  -11.017 -1.070  1.00 0.00 ? 270 ASN A HB3  2  
ATOM   2450  H  HD21 . ASN B 2 12  ? 15.605  -10.772 -0.338  1.00 0.00 ? 270 ASN A HD21 2  
ATOM   2451  H  HD22 . ASN B 2 12  ? 14.628  -11.299 -1.660  1.00 0.00 ? 270 ASN A HD22 2  
ATOM   2452  N  N    . MET B 2 13  ? 18.822  -7.266  0.298   1.00 0.00 ? 271 MET A N    2  
ATOM   2453  C  CA   . MET B 2 13  ? 20.020  -6.581  0.754   1.00 0.00 ? 271 MET A CA   2  
ATOM   2454  C  C    . MET B 2 13  ? 19.716  -5.167  1.236   1.00 0.00 ? 271 MET A C    2  
ATOM   2455  O  O    . MET B 2 13  ? 20.272  -4.196  0.719   1.00 0.00 ? 271 MET A O    2  
ATOM   2456  C  CB   . MET B 2 13  ? 21.019  -6.487  -0.368  1.00 0.00 ? 271 MET A CB   2  
ATOM   2457  C  CG   . MET B 2 13  ? 22.458  -6.306  0.092   1.00 0.00 ? 271 MET A CG   2  
ATOM   2458  S  SD   . MET B 2 13  ? 23.311  -7.871  0.372   1.00 0.00 ? 271 MET A SD   2  
ATOM   2459  C  CE   . MET B 2 13  ? 22.714  -8.307  2.003   1.00 0.00 ? 271 MET A CE   2  
ATOM   2460  H  H    . MET B 2 13  ? 17.987  -6.757  0.188   1.00 0.00 ? 271 MET A H    2  
ATOM   2461  H  HA   . MET B 2 13  ? 20.447  -7.150  1.554   1.00 0.00 ? 271 MET A HA   2  
ATOM   2462  H  HB2  . MET B 2 13  ? 20.957  -7.376  -0.979  1.00 0.00 ? 271 MET A HB2  2  
ATOM   2463  H  HB3  . MET B 2 13  ? 20.740  -5.637  -0.946  1.00 0.00 ? 271 MET A HB3  2  
ATOM   2464  H  HG2  . MET B 2 13  ? 22.995  -5.751  -0.663  1.00 0.00 ? 271 MET A HG2  2  
ATOM   2465  H  HG3  . MET B 2 13  ? 22.455  -5.743  1.017   1.00 0.00 ? 271 MET A HG3  2  
ATOM   2466  H  HE1  . MET B 2 13  ? 21.636  -8.337  1.995   1.00 0.00 ? 271 MET A HE1  2  
ATOM   2467  H  HE2  . MET B 2 13  ? 23.049  -7.570  2.717   1.00 0.00 ? 271 MET A HE2  2  
ATOM   2468  H  HE3  . MET B 2 13  ? 23.100  -9.277  2.280   1.00 0.00 ? 271 MET A HE3  2  
ATOM   2469  N  N    . ASN B 2 14  ? 18.825  -5.058  2.202   1.00 0.00 ? 272 ASN A N    2  
ATOM   2470  C  CA   . ASN B 2 14  ? 18.463  -3.770  2.780   1.00 0.00 ? 272 ASN A CA   2  
ATOM   2471  C  C    . ASN B 2 14  ? 19.722  -2.955  2.995   1.00 0.00 ? 272 ASN A C    2  
ATOM   2472  O  O    . ASN B 2 14  ? 20.786  -3.513  3.241   1.00 0.00 ? 272 ASN A O    2  
ATOM   2473  C  CB   . ASN B 2 14  ? 17.740  -3.962  4.117   1.00 0.00 ? 272 ASN A CB   2  
ATOM   2474  C  CG   . ASN B 2 14  ? 17.169  -2.668  4.665   1.00 0.00 ? 272 ASN A CG   2  
ATOM   2475  O  OD1  . ASN B 2 14  ? 17.871  -1.891  5.312   1.00 0.00 ? 272 ASN A OD1  2  
ATOM   2476  N  ND2  . ASN B 2 14  ? 15.886  -2.437  4.418   1.00 0.00 ? 272 ASN A ND2  2  
ATOM   2477  H  H    . ASN B 2 14  ? 18.403  -5.864  2.533   1.00 0.00 ? 272 ASN A H    2  
ATOM   2478  H  HA   . ASN B 2 14  ? 17.815  -3.255  2.089   1.00 0.00 ? 272 ASN A HA   2  
ATOM   2479  H  HB2  . ASN B 2 14  ? 16.932  -4.664  3.986   1.00 0.00 ? 272 ASN A HB2  2  
ATOM   2480  H  HB3  . ASN B 2 14  ? 18.438  -4.358  4.840   1.00 0.00 ? 272 ASN A HB3  2  
ATOM   2481  H  HD21 . ASN B 2 14  ? 15.385  -3.105  3.904   1.00 0.00 ? 272 ASN A HD21 2  
ATOM   2482  H  HD22 . ASN B 2 14  ? 15.490  -1.608  4.761   1.00 0.00 ? 272 ASN A HD22 2  
ATOM   2483  N  N    . LYS B 2 15  ? 19.616  -1.646  2.889   1.00 0.00 ? 273 LYS A N    2  
ATOM   2484  C  CA   . LYS B 2 15  ? 20.779  -0.807  3.059   1.00 0.00 ? 273 LYS A CA   2  
ATOM   2485  C  C    . LYS B 2 15  ? 20.856  -0.184  4.436   1.00 0.00 ? 273 LYS A C    2  
ATOM   2486  O  O    . LYS B 2 15  ? 21.919  -0.162  5.055   1.00 0.00 ? 273 LYS A O    2  
ATOM   2487  C  CB   . LYS B 2 15  ? 20.819  0.246   1.985   1.00 0.00 ? 273 LYS A CB   2  
ATOM   2488  C  CG   . LYS B 2 15  ? 21.982  -0.009  1.067   1.00 0.00 ? 273 LYS A CG   2  
ATOM   2489  C  CD   . LYS B 2 15  ? 22.680  1.267   0.632   1.00 0.00 ? 273 LYS A CD   2  
ATOM   2490  C  CE   . LYS B 2 15  ? 21.689  2.249   0.066   1.00 0.00 ? 273 LYS A CE   2  
ATOM   2491  N  NZ   . LYS B 2 15  ? 21.979  3.647   0.486   1.00 0.00 ? 273 LYS A NZ   2  
ATOM   2492  H  H    . LYS B 2 15  ? 18.755  -1.240  2.677   1.00 0.00 ? 273 LYS A H    2  
ATOM   2493  H  HA   . LYS B 2 15  ? 21.642  -1.436  2.930   1.00 0.00 ? 273 LYS A HA   2  
ATOM   2494  H  HB2  . LYS B 2 15  ? 19.897  0.218   1.416   1.00 0.00 ? 273 LYS A HB2  2  
ATOM   2495  H  HB3  . LYS B 2 15  ? 20.929  1.214   2.425   1.00 0.00 ? 273 LYS A HB3  2  
ATOM   2496  H  HG2  . LYS B 2 15  ? 22.676  -0.629  1.600   1.00 0.00 ? 273 LYS A HG2  2  
ATOM   2497  H  HG3  . LYS B 2 15  ? 21.625  -0.530  0.202   1.00 0.00 ? 273 LYS A HG3  2  
ATOM   2498  H  HD2  . LYS B 2 15  ? 23.160  1.708   1.480   1.00 0.00 ? 273 LYS A HD2  2  
ATOM   2499  H  HD3  . LYS B 2 15  ? 23.413  1.029   -0.123  1.00 0.00 ? 273 LYS A HD3  2  
ATOM   2500  H  HE2  . LYS B 2 15  ? 21.715  2.191   -1.013  1.00 0.00 ? 273 LYS A HE2  2  
ATOM   2501  H  HE3  . LYS B 2 15  ? 20.713  1.963   0.420   1.00 0.00 ? 273 LYS A HE3  2  
ATOM   2502  H  HZ1  . LYS B 2 15  ? 21.959  3.719   1.525   1.00 0.00 ? 273 LYS A HZ1  2  
ATOM   2503  H  HZ2  . LYS B 2 15  ? 21.266  4.295   0.093   1.00 0.00 ? 273 LYS A HZ2  2  
ATOM   2504  H  HZ3  . LYS B 2 15  ? 22.918  3.936   0.146   1.00 0.00 ? 273 LYS A HZ3  2  
ATOM   2505  N  N    . LYS B 2 16  ? 19.740  0.327   4.911   1.00 0.00 ? 274 LYS A N    2  
ATOM   2506  C  CA   . LYS B 2 16  ? 19.705  0.934   6.226   1.00 0.00 ? 274 LYS A CA   2  
ATOM   2507  C  C    . LYS B 2 16  ? 19.970  -0.118  7.299   1.00 0.00 ? 274 LYS A C    2  
ATOM   2508  O  O    . LYS B 2 16  ? 20.086  0.202   8.483   1.00 0.00 ? 274 LYS A O    2  
ATOM   2509  C  CB   . LYS B 2 16  ? 18.364  1.628   6.444   1.00 0.00 ? 274 LYS A CB   2  
ATOM   2510  C  CG   . LYS B 2 16  ? 18.161  2.823   5.522   1.00 0.00 ? 274 LYS A CG   2  
ATOM   2511  C  CD   . LYS B 2 16  ? 18.454  4.135   6.230   1.00 0.00 ? 274 LYS A CD   2  
ATOM   2512  C  CE   . LYS B 2 16  ? 18.194  5.322   5.328   1.00 0.00 ? 274 LYS A CE   2  
ATOM   2513  N  NZ   . LYS B 2 16  ? 18.471  6.615   6.014   1.00 0.00 ? 274 LYS A NZ   2  
ATOM   2514  H  H    . LYS B 2 16  ? 18.927  0.298   4.366   1.00 0.00 ? 274 LYS A H    2  
ATOM   2515  H  HA   . LYS B 2 16  ? 20.492  1.674   6.266   1.00 0.00 ? 274 LYS A HA   2  
ATOM   2516  H  HB2  . LYS B 2 16  ? 17.569  0.918   6.263   1.00 0.00 ? 274 LYS A HB2  2  
ATOM   2517  H  HB3  . LYS B 2 16  ? 18.307  1.971   7.465   1.00 0.00 ? 274 LYS A HB3  2  
ATOM   2518  H  HG2  . LYS B 2 16  ? 18.832  2.727   4.680   1.00 0.00 ? 274 LYS A HG2  2  
ATOM   2519  H  HG3  . LYS B 2 16  ? 17.140  2.825   5.165   1.00 0.00 ? 274 LYS A HG3  2  
ATOM   2520  H  HD2  . LYS B 2 16  ? 17.830  4.215   7.106   1.00 0.00 ? 274 LYS A HD2  2  
ATOM   2521  H  HD3  . LYS B 2 16  ? 19.492  4.147   6.519   1.00 0.00 ? 274 LYS A HD3  2  
ATOM   2522  H  HE2  . LYS B 2 16  ? 18.836  5.239   4.468   1.00 0.00 ? 274 LYS A HE2  2  
ATOM   2523  H  HE3  . LYS B 2 16  ? 17.162  5.303   5.014   1.00 0.00 ? 274 LYS A HE3  2  
ATOM   2524  H  HZ1  . LYS B 2 16  ? 19.469  6.658   6.304   1.00 0.00 ? 274 LYS A HZ1  2  
ATOM   2525  H  HZ2  . LYS B 2 16  ? 17.873  6.706   6.860   1.00 0.00 ? 274 LYS A HZ2  2  
ATOM   2526  H  HZ3  . LYS B 2 16  ? 18.271  7.410   5.375   1.00 0.00 ? 274 LYS A HZ3  2  
ATOM   2527  N  N    . SER B 2 17  ? 20.066  -1.381  6.872   1.00 0.00 ? 275 SER A N    2  
ATOM   2528  C  CA   . SER B 2 17  ? 20.341  -2.478  7.781   1.00 0.00 ? 275 SER A CA   2  
ATOM   2529  C  C    . SER B 2 17  ? 21.383  -3.429  7.224   1.00 0.00 ? 275 SER A C    2  
ATOM   2530  O  O    . SER B 2 17  ? 22.088  -4.095  7.980   1.00 0.00 ? 275 SER A O    2  
ATOM   2531  C  CB   . SER B 2 17  ? 19.069  -3.270  8.078   1.00 0.00 ? 275 SER A CB   2  
ATOM   2532  O  OG   . SER B 2 17  ? 18.060  -2.442  8.629   1.00 0.00 ? 275 SER A OG   2  
ATOM   2533  H  H    . SER B 2 17  ? 19.926  -1.579  5.929   1.00 0.00 ? 275 SER A H    2  
ATOM   2534  H  HA   . SER B 2 17  ? 20.715  -2.064  8.688   1.00 0.00 ? 275 SER A HA   2  
ATOM   2535  H  HB2  . SER B 2 17  ? 18.699  -3.715  7.165   1.00 0.00 ? 275 SER A HB2  2  
ATOM   2536  H  HB3  . SER B 2 17  ? 19.300  -4.054  8.777   1.00 0.00 ? 275 SER A HB3  2  
ATOM   2537  H  HG   . SER B 2 17  ? 17.960  -2.637  9.564   1.00 0.00 ? 275 SER A HG   2  
ATOM   2538  N  N    . GLY B 2 18  ? 21.528  -3.449  5.910   1.00 0.00 ? 276 GLY A N    2  
ATOM   2539  C  CA   . GLY B 2 18  ? 22.447  -4.390  5.306   1.00 0.00 ? 276 GLY A CA   2  
ATOM   2540  C  C    . GLY B 2 18  ? 21.919  -5.805  5.417   1.00 0.00 ? 276 GLY A C    2  
ATOM   2541  O  O    . GLY B 2 18  ? 22.657  -6.778  5.258   1.00 0.00 ? 276 GLY A O    2  
ATOM   2542  H  H    . GLY B 2 18  ? 21.051  -2.790  5.355   1.00 0.00 ? 276 GLY A H    2  
ATOM   2543  H  HA2  . GLY B 2 18  ? 22.575  -4.141  4.267   1.00 0.00 ? 276 GLY A HA2  2  
ATOM   2544  H  HA3  . GLY B 2 18  ? 23.393  -4.330  5.810   1.00 0.00 ? 276 GLY A HA3  2  
ATOM   2545  N  N    . ARG B 2 19  ? 20.621  -5.901  5.684   1.00 0.00 ? 277 ARG A N    2  
ATOM   2546  C  CA   . ARG B 2 19  ? 19.940  -7.189  5.837   1.00 0.00 ? 277 ARG A CA   2  
ATOM   2547  C  C    . ARG B 2 19  ? 19.128  -7.526  4.606   1.00 0.00 ? 277 ARG A C    2  
ATOM   2548  O  O    . ARG B 2 19  ? 18.616  -6.651  3.940   1.00 0.00 ? 277 ARG A O    2  
ATOM   2549  C  CB   . ARG B 2 19  ? 18.974  -7.182  7.012   1.00 0.00 ? 277 ARG A CB   2  
ATOM   2550  C  CG   . ARG B 2 19  ? 19.610  -7.342  8.385   1.00 0.00 ? 277 ARG A CG   2  
ATOM   2551  C  CD   . ARG B 2 19  ? 20.871  -6.534  8.547   1.00 0.00 ? 277 ARG A CD   2  
ATOM   2552  N  NE   . ARG B 2 19  ? 21.501  -6.758  9.847   1.00 0.00 ? 277 ARG A NE   2  
ATOM   2553  C  CZ   . ARG B 2 19  ? 21.228  -6.045  10.936  1.00 0.00 ? 277 ARG A CZ   2  
ATOM   2554  N  NH1  . ARG B 2 19  ? 20.347  -5.057  10.885  1.00 0.00 ? 277 ARG A NH1  2  
ATOM   2555  N  NH2  . ARG B 2 19  ? 21.840  -6.323  12.081  1.00 0.00 ? 277 ARG A NH2  2  
ATOM   2556  H  H    . ARG B 2 19  ? 20.103  -5.076  5.759   1.00 0.00 ? 277 ARG A H    2  
ATOM   2557  H  HA   . ARG B 2 19  ? 20.683  -7.953  5.997   1.00 0.00 ? 277 ARG A HA   2  
ATOM   2558  H  HB2  . ARG B 2 19  ? 18.430  -6.270  6.985   1.00 0.00 ? 277 ARG A HB2  2  
ATOM   2559  H  HB3  . ARG B 2 19  ? 18.278  -7.999  6.875   1.00 0.00 ? 277 ARG A HB3  2  
ATOM   2560  H  HG2  . ARG B 2 19  ? 18.904  -7.040  9.141   1.00 0.00 ? 277 ARG A HG2  2  
ATOM   2561  H  HG3  . ARG B 2 19  ? 19.857  -8.370  8.518   1.00 0.00 ? 277 ARG A HG3  2  
ATOM   2562  H  HD2  . ARG B 2 19  ? 21.555  -6.833  7.772   1.00 0.00 ? 277 ARG A HD2  2  
ATOM   2563  H  HD3  . ARG B 2 19  ? 20.632  -5.488  8.442   1.00 0.00 ? 277 ARG A HD3  2  
ATOM   2564  H  HE   . ARG B 2 19  ? 22.159  -7.481  9.911   1.00 0.00 ? 277 ARG A HE   2  
ATOM   2565  H  HH11 . ARG B 2 19  ? 19.883  -4.845  10.025  1.00 0.00 ? 277 ARG A HH11 2  
ATOM   2566  H  HH12 . ARG B 2 19  ? 20.144  -4.525  11.706  1.00 0.00 ? 277 ARG A HH12 2  
ATOM   2567  H  HH21 . ARG B 2 19  ? 22.505  -7.068  12.124  1.00 0.00 ? 277 ARG A HH21 2  
ATOM   2568  H  HH22 . ARG B 2 19  ? 21.634  -5.787  12.900  1.00 0.00 ? 277 ARG A HH22 2  
ATOM   2569  N  N    . PRO B 2 20  ? 18.958  -8.810  4.336   1.00 0.00 ? 278 PRO A N    2  
ATOM   2570  C  CA   . PRO B 2 20  ? 18.193  -9.290  3.192   1.00 0.00 ? 278 PRO A CA   2  
ATOM   2571  C  C    . PRO B 2 20  ? 16.698  -9.045  3.341   1.00 0.00 ? 278 PRO A C    2  
ATOM   2572  O  O    . PRO B 2 20  ? 16.062  -9.551  4.265   1.00 0.00 ? 278 PRO A O    2  
ATOM   2573  C  CB   . PRO B 2 20  ? 18.471  -10.788 3.152   1.00 0.00 ? 278 PRO A CB   2  
ATOM   2574  C  CG   . PRO B 2 20  ? 19.554  -11.029 4.147   1.00 0.00 ? 278 PRO A CG   2  
ATOM   2575  C  CD   . PRO B 2 20  ? 19.500  -9.893  5.133   1.00 0.00 ? 278 PRO A CD   2  
ATOM   2576  H  HA   . PRO B 2 20  ? 18.535  -8.844  2.280   1.00 0.00 ? 278 PRO A HA   2  
ATOM   2577  H  HB2  . PRO B 2 20  ? 17.573  -11.323 3.403   1.00 0.00 ? 278 PRO A HB2  2  
ATOM   2578  H  HB3  . PRO B 2 20  ? 18.790  -11.057 2.156   1.00 0.00 ? 278 PRO A HB3  2  
ATOM   2579  H  HG2  . PRO B 2 20  ? 19.395  -11.973 4.646   1.00 0.00 ? 278 PRO A HG2  2  
ATOM   2580  H  HG3  . PRO B 2 20  ? 20.498  -11.027 3.630   1.00 0.00 ? 278 PRO A HG3  2  
ATOM   2581  H  HD2  . PRO B 2 20  ? 18.852  -10.107 5.968   1.00 0.00 ? 278 PRO A HD2  2  
ATOM   2582  H  HD3  . PRO B 2 20  ? 20.487  -9.640  5.486   1.00 0.00 ? 278 PRO A HD3  2  
ATOM   2583  N  N    . GLU B 2 21  ? 16.146  -8.269  2.419   1.00 0.00 ? 279 GLU A N    2  
ATOM   2584  C  CA   . GLU B 2 21  ? 14.727  -7.957  2.422   1.00 0.00 ? 279 GLU A CA   2  
ATOM   2585  C  C    . GLU B 2 21  ? 14.132  -8.268  1.052   1.00 0.00 ? 279 GLU A C    2  
ATOM   2586  O  O    . GLU B 2 21  ? 14.434  -9.304  0.463   1.00 0.00 ? 279 GLU A O    2  
ATOM   2587  C  CB   . GLU B 2 21  ? 14.515  -6.493  2.786   1.00 0.00 ? 279 GLU A CB   2  
ATOM   2588  C  CG   . GLU B 2 21  ? 13.153  -6.228  3.401   1.00 0.00 ? 279 GLU A CG   2  
ATOM   2589  C  CD   . GLU B 2 21  ? 12.914  -7.037  4.662   1.00 0.00 ? 279 GLU A CD   2  
ATOM   2590  O  OE1  . GLU B 2 21  ? 13.333  -6.583  5.747   1.00 0.00 ? 279 GLU A OE1  2  
ATOM   2591  O  OE2  . GLU B 2 21  ? 12.310  -8.125  4.562   1.00 0.00 ? 279 GLU A OE2  2  
ATOM   2592  H  H    . GLU B 2 21  ? 16.711  -7.894  1.712   1.00 0.00 ? 279 GLU A H    2  
ATOM   2593  H  HA   . GLU B 2 21  ? 14.242  -8.572  3.163   1.00 0.00 ? 279 GLU A HA   2  
ATOM   2594  H  HB2  . GLU B 2 21  ? 15.274  -6.193  3.493   1.00 0.00 ? 279 GLU A HB2  2  
ATOM   2595  H  HB3  . GLU B 2 21  ? 14.608  -5.893  1.894   1.00 0.00 ? 279 GLU A HB3  2  
ATOM   2596  H  HG2  . GLU B 2 21  ? 13.085  -5.186  3.646   1.00 0.00 ? 279 GLU A HG2  2  
ATOM   2597  H  HG3  . GLU B 2 21  ? 12.390  -6.479  2.678   1.00 0.00 ? 279 GLU A HG3  2  
ATOM   2598  N  N    . GLU B 2 22  ? 13.290  -7.375  0.547   1.00 0.00 ? 280 GLU A N    2  
ATOM   2599  C  CA   . GLU B 2 22  ? 12.670  -7.561  -0.758  1.00 0.00 ? 280 GLU A CA   2  
ATOM   2600  C  C    . GLU B 2 22  ? 11.858  -6.345  -1.147  1.00 0.00 ? 280 GLU A C    2  
ATOM   2601  O  O    . GLU B 2 22  ? 10.691  -6.201  -0.780  1.00 0.00 ? 280 GLU A O    2  
ATOM   2602  C  CB   . GLU B 2 22  ? 11.789  -8.798  -0.780  1.00 0.00 ? 280 GLU A CB   2  
ATOM   2603  C  CG   . GLU B 2 22  ? 11.628  -9.360  -2.173  1.00 0.00 ? 280 GLU A CG   2  
ATOM   2604  C  CD   . GLU B 2 22  ? 12.807  -10.207 -2.609  1.00 0.00 ? 280 GLU A CD   2  
ATOM   2605  O  OE1  . GLU B 2 22  ? 13.777  -9.638  -3.152  1.00 0.00 ? 280 GLU A OE1  2  
ATOM   2606  O  OE2  . GLU B 2 22  ? 12.758  -11.439 -2.412  1.00 0.00 ? 280 GLU A OE2  2  
ATOM   2607  H  H    . GLU B 2 22  ? 13.083  -6.568  1.061   1.00 0.00 ? 280 GLU A H    2  
ATOM   2608  H  HA   . GLU B 2 22  ? 13.458  -7.683  -1.495  1.00 0.00 ? 280 GLU A HA   2  
ATOM   2609  H  HB2  . GLU B 2 22  ? 12.225  -9.558  -0.147  1.00 0.00 ? 280 GLU A HB2  2  
ATOM   2610  H  HB3  . GLU B 2 22  ? 10.810  -8.537  -0.405  1.00 0.00 ? 280 GLU A HB3  2  
ATOM   2611  H  HG2  . GLU B 2 22  ? 10.741  -9.965  -2.197  1.00 0.00 ? 280 GLU A HG2  2  
ATOM   2612  H  HG3  . GLU B 2 22  ? 11.523  -8.533  -2.862  1.00 0.00 ? 280 GLU A HG3  2  
ATOM   2613  N  N    . LEU B 2 23  ? 12.514  -5.476  -1.886  1.00 0.00 ? 281 LEU A N    2  
ATOM   2614  C  CA   . LEU B 2 23  ? 11.923  -4.248  -2.380  1.00 0.00 ? 281 LEU A CA   2  
ATOM   2615  C  C    . LEU B 2 23  ? 10.562  -4.444  -3.025  1.00 0.00 ? 281 LEU A C    2  
ATOM   2616  O  O    . LEU B 2 23  ? 10.103  -5.563  -3.258  1.00 0.00 ? 281 LEU A O    2  
ATOM   2617  C  CB   . LEU B 2 23  ? 12.851  -3.648  -3.406  1.00 0.00 ? 281 LEU A CB   2  
ATOM   2618  C  CG   . LEU B 2 23  ? 14.219  -3.274  -2.887  1.00 0.00 ? 281 LEU A CG   2  
ATOM   2619  C  CD1  . LEU B 2 23  ? 15.082  -2.876  -4.046  1.00 0.00 ? 281 LEU A CD1  2  
ATOM   2620  C  CD2  . LEU B 2 23  ? 14.104  -2.132  -1.905  1.00 0.00 ? 281 LEU A CD2  2  
ATOM   2621  H  H    . LEU B 2 23  ? 13.454  -5.663  -2.099  1.00 0.00 ? 281 LEU A H    2  
ATOM   2622  H  HA   . LEU B 2 23  ? 11.828  -3.552  -1.567  1.00 0.00 ? 281 LEU A HA   2  
ATOM   2623  H  HB2  . LEU B 2 23  ? 12.972  -4.352  -4.215  1.00 0.00 ? 281 LEU A HB2  2  
ATOM   2624  H  HB3  . LEU B 2 23  ? 12.393  -2.761  -3.788  1.00 0.00 ? 281 LEU A HB3  2  
ATOM   2625  H  HG   . LEU B 2 23  ? 14.663  -4.115  -2.391  1.00 0.00 ? 281 LEU A HG   2  
ATOM   2626  H  HD11 . LEU B 2 23  ? 14.456  -2.373  -4.753  1.00 0.00 ? 281 LEU A HD11 2  
ATOM   2627  H  HD12 . LEU B 2 23  ? 15.515  -3.757  -4.500  1.00 0.00 ? 281 LEU A HD12 2  
ATOM   2628  H  HD13 . LEU B 2 23  ? 15.864  -2.211  -3.713  1.00 0.00 ? 281 LEU A HD13 2  
ATOM   2629  H  HD21 . LEU B 2 23  ? 13.672  -1.271  -2.404  1.00 0.00 ? 281 LEU A HD21 2  
ATOM   2630  H  HD22 . LEU B 2 23  ? 15.082  -1.879  -1.527  1.00 0.00 ? 281 LEU A HD22 2  
ATOM   2631  H  HD23 . LEU B 2 23  ? 13.464  -2.426  -1.089  1.00 0.00 ? 281 LEU A HD23 2  
ATOM   2632  N  N    . VAL B 2 24  ? 9.942   -3.313  -3.313  1.00 0.00 ? 282 VAL A N    2  
ATOM   2633  C  CA   . VAL B 2 24  ? 8.641   -3.265  -3.977  1.00 0.00 ? 282 VAL A CA   2  
ATOM   2634  C  C    . VAL B 2 24  ? 8.598   -2.012  -4.812  1.00 0.00 ? 282 VAL A C    2  
ATOM   2635  O  O    . VAL B 2 24  ? 8.475   -0.915  -4.273  1.00 0.00 ? 282 VAL A O    2  
ATOM   2636  C  CB   . VAL B 2 24  ? 7.461   -3.211  -2.987  1.00 0.00 ? 282 VAL A CB   2  
ATOM   2637  C  CG1  . VAL B 2 24  ? 7.037   -4.572  -2.513  1.00 0.00 ? 282 VAL A CG1  2  
ATOM   2638  C  CG2  . VAL B 2 24  ? 7.805   -2.391  -1.805  1.00 0.00 ? 282 VAL A CG2  2  
ATOM   2639  H  H    . VAL B 2 24  ? 10.393  -2.459  -3.076  1.00 0.00 ? 282 VAL A H    2  
ATOM   2640  H  HA   . VAL B 2 24  ? 8.538   -4.133  -4.612  1.00 0.00 ? 282 VAL A HA   2  
ATOM   2641  H  HB   . VAL B 2 24  ? 6.627   -2.740  -3.458  1.00 0.00 ? 282 VAL A HB   2  
ATOM   2642  H  HG11 . VAL B 2 24  ? 6.468   -4.441  -1.595  1.00 0.00 ? 282 VAL A HG11 2  
ATOM   2643  H  HG12 . VAL B 2 24  ? 7.909   -5.181  -2.321  1.00 0.00 ? 282 VAL A HG12 2  
ATOM   2644  H  HG13 . VAL B 2 24  ? 6.416   -5.044  -3.259  1.00 0.00 ? 282 VAL A HG13 2  
ATOM   2645  H  HG21 . VAL B 2 24  ? 7.982   -3.053  -0.973  1.00 0.00 ? 282 VAL A HG21 2  
ATOM   2646  H  HG22 . VAL B 2 24  ? 6.983   -1.728  -1.573  1.00 0.00 ? 282 VAL A HG22 2  
ATOM   2647  H  HG23 . VAL B 2 24  ? 8.693   -1.814  -2.008  1.00 0.00 ? 282 VAL A HG23 2  
ATOM   2648  N  N    . SER B 2 25  ? 8.656   -2.168  -6.120  1.00 0.00 ? 283 SER A N    2  
ATOM   2649  C  CA   . SER B 2 25  ? 8.667   -1.017  -6.997  1.00 0.00 ? 283 SER A CA   2  
ATOM   2650  C  C    . SER B 2 25  ? 7.276   -0.695  -7.518  1.00 0.00 ? 283 SER A C    2  
ATOM   2651  O  O    . SER B 2 25  ? 6.368   -1.523  -7.454  1.00 0.00 ? 283 SER A O    2  
ATOM   2652  C  CB   . SER B 2 25  ? 9.643   -1.248  -8.150  1.00 0.00 ? 283 SER A CB   2  
ATOM   2653  O  OG   . SER B 2 25  ? 9.293   -2.403  -8.894  1.00 0.00 ? 283 SER A OG   2  
ATOM   2654  H  H    . SER B 2 25  ? 8.693   -3.070  -6.502  1.00 0.00 ? 283 SER A H    2  
ATOM   2655  H  HA   . SER B 2 25  ? 9.018   -0.180  -6.412  1.00 0.00 ? 283 SER A HA   2  
ATOM   2656  H  HB2  . SER B 2 25  ? 9.631   -0.393  -8.808  1.00 0.00 ? 283 SER A HB2  2  
ATOM   2657  H  HB3  . SER B 2 25  ? 10.641  -1.382  -7.745  1.00 0.00 ? 283 SER A HB3  2  
ATOM   2658  H  HG   . SER B 2 25  ? 9.891   -2.496  -9.639  1.00 0.00 ? 283 SER A HG   2  
ATOM   2659  N  N    . CYS B 2 26  ? 7.122   0.515   -8.040  1.00 0.00 ? 284 CYS A N    2  
ATOM   2660  C  CA   . CYS B 2 26  ? 5.848   0.957   -8.565  1.00 0.00 ? 284 CYS A CA   2  
ATOM   2661  C  C    . CYS B 2 26  ? 5.815   0.686   -10.064 1.00 0.00 ? 284 CYS A C    2  
ATOM   2662  O  O    . CYS B 2 26  ? 6.746   1.041   -10.780 1.00 0.00 ? 284 CYS A O    2  
ATOM   2663  C  CB   . CYS B 2 26  ? 5.657   2.456   -8.248  1.00 0.00 ? 284 CYS A CB   2  
ATOM   2664  S  SG   . CYS B 2 26  ? 4.253   3.245   -9.099  1.00 0.00 ? 284 CYS A SG   2  
ATOM   2665  H  H    . CYS B 2 26  ? 7.893   1.111   -8.104  1.00 0.00 ? 284 CYS A H    2  
ATOM   2666  H  HA   . CYS B 2 26  ? 5.071   0.389   -8.084  1.00 0.00 ? 284 CYS A HA   2  
ATOM   2667  H  HB2  . CYS B 2 26  ? 5.490   2.564   -7.188  1.00 0.00 ? 284 CYS A HB2  2  
ATOM   2668  H  HB3  . CYS B 2 26  ? 6.551   2.993   -8.515  1.00 0.00 ? 284 CYS A HB3  2  
ATOM   2669  N  N    . ALA B 2 27  ? 4.749   0.057   -10.547 1.00 0.00 ? 285 ALA A N    2  
ATOM   2670  C  CA   . ALA B 2 27  ? 4.662   -0.252  -11.967 1.00 0.00 ? 285 ALA A CA   2  
ATOM   2671  C  C    . ALA B 2 27  ? 4.356   1.000   -12.766 1.00 0.00 ? 285 ALA A C    2  
ATOM   2672  O  O    . ALA B 2 27  ? 4.171   0.949   -13.982 1.00 0.00 ? 285 ALA A O    2  
ATOM   2673  C  CB   . ALA B 2 27  ? 3.641   -1.343  -12.236 1.00 0.00 ? 285 ALA A CB   2  
ATOM   2674  H  H    . ALA B 2 27  ? 4.018   -0.204  -9.946  1.00 0.00 ? 285 ALA A H    2  
ATOM   2675  H  HA   . ALA B 2 27  ? 5.630   -0.622  -12.276 1.00 0.00 ? 285 ALA A HA   2  
ATOM   2676  H  HB1  . ALA B 2 27  ? 2.651   -0.991  -11.992 1.00 0.00 ? 285 ALA A HB1  2  
ATOM   2677  H  HB2  . ALA B 2 27  ? 3.872   -2.207  -11.631 1.00 0.00 ? 285 ALA A HB2  2  
ATOM   2678  H  HB3  . ALA B 2 27  ? 3.677   -1.617  -13.280 1.00 0.00 ? 285 ALA A HB3  2  
ATOM   2679  N  N    . ASP B 2 28  ? 4.307   2.127   -12.067 1.00 0.00 ? 286 ASP A N    2  
ATOM   2680  C  CA   . ASP B 2 28  ? 4.054   3.408   -12.701 1.00 0.00 ? 286 ASP A CA   2  
ATOM   2681  C  C    . ASP B 2 28  ? 5.333   4.226   -12.703 1.00 0.00 ? 286 ASP A C    2  
ATOM   2682  O  O    . ASP B 2 28  ? 5.699   4.849   -13.700 1.00 0.00 ? 286 ASP A O    2  
ATOM   2683  C  CB   . ASP B 2 28  ? 2.970   4.169   -11.950 1.00 0.00 ? 286 ASP A CB   2  
ATOM   2684  C  CG   . ASP B 2 28  ? 2.517   5.416   -12.685 1.00 0.00 ? 286 ASP A CG   2  
ATOM   2685  O  OD1  . ASP B 2 28  ? 3.114   6.488   -12.459 1.00 0.00 ? 286 ASP A OD1  2  
ATOM   2686  O  OD2  . ASP B 2 28  ? 1.566   5.318   -13.489 1.00 0.00 ? 286 ASP A OD2  2  
ATOM   2687  H  H    . ASP B 2 28  ? 4.445   2.093   -11.090 1.00 0.00 ? 286 ASP A H    2  
ATOM   2688  H  HA   . ASP B 2 28  ? 3.735   3.227   -13.716 1.00 0.00 ? 286 ASP A HA   2  
ATOM   2689  H  HB2  . ASP B 2 28  ? 2.117   3.523   -11.807 1.00 0.00 ? 286 ASP A HB2  2  
ATOM   2690  H  HB3  . ASP B 2 28  ? 3.362   4.464   -10.986 1.00 0.00 ? 286 ASP A HB3  2  
ATOM   2691  N  N    . CYS B 2 29  ? 6.002   4.207   -11.558 1.00 0.00 ? 287 CYS A N    2  
ATOM   2692  C  CA   . CYS B 2 29  ? 7.253   4.926   -11.371 1.00 0.00 ? 287 CYS A CA   2  
ATOM   2693  C  C    . CYS B 2 29  ? 8.428   3.976   -11.485 1.00 0.00 ? 287 CYS A C    2  
ATOM   2694  O  O    . CYS B 2 29  ? 9.314   4.143   -12.324 1.00 0.00 ? 287 CYS A O    2  
ATOM   2695  C  CB   . CYS B 2 29  ? 7.282   5.569   -9.995  1.00 0.00 ? 287 CYS A CB   2  
ATOM   2696  S  SG   . CYS B 2 29  ? 5.891   6.686   -9.652  1.00 0.00 ? 287 CYS A SG   2  
ATOM   2697  H  H    . CYS B 2 29  ? 5.641   3.687   -10.811 1.00 0.00 ? 287 CYS A H    2  
ATOM   2698  H  HA   . CYS B 2 29  ? 7.328   5.687   -12.116 1.00 0.00 ? 287 CYS A HA   2  
ATOM   2699  H  HB2  . CYS B 2 29  ? 7.262   4.791   -9.261  1.00 0.00 ? 287 CYS A HB2  2  
ATOM   2700  H  HB3  . CYS B 2 29  ? 8.195   6.135   -9.888  1.00 0.00 ? 287 CYS A HB3  2  
ATOM   2701  N  N    . GLY B 2 30  ? 8.410   2.975   -10.620 1.00 0.00 ? 288 GLY A N    2  
ATOM   2702  C  CA   . GLY B 2 30  ? 9.471   1.988   -10.582 1.00 0.00 ? 288 GLY A CA   2  
ATOM   2703  C  C    . GLY B 2 30  ? 10.230  2.074   -9.281  1.00 0.00 ? 288 GLY A C    2  
ATOM   2704  O  O    . GLY B 2 30  ? 11.170  1.319   -9.039  1.00 0.00 ? 288 GLY A O    2  
ATOM   2705  H  H    . GLY B 2 30  ? 7.658   2.912   -9.987  1.00 0.00 ? 288 GLY A H    2  
ATOM   2706  H  HA2  . GLY B 2 30  ? 9.042   1.001   -10.681 1.00 0.00 ? 288 GLY A HA2  2  
ATOM   2707  H  HA3  . GLY B 2 30  ? 10.152  2.165   -11.401 1.00 0.00 ? 288 GLY A HA3  2  
ATOM   2708  N  N    . ARG B 2 31  ? 9.786   2.991   -8.434  1.00 0.00 ? 289 ARG A N    2  
ATOM   2709  C  CA   . ARG B 2 31  ? 10.406  3.225   -7.142  1.00 0.00 ? 289 ARG A CA   2  
ATOM   2710  C  C    . ARG B 2 31  ? 10.103  2.090   -6.182  1.00 0.00 ? 289 ARG A C    2  
ATOM   2711  O  O    . ARG B 2 31  ? 8.953   1.854   -5.819  1.00 0.00 ? 289 ARG A O    2  
ATOM   2712  C  CB   . ARG B 2 31  ? 9.917   4.555   -6.585  1.00 0.00 ? 289 ARG A CB   2  
ATOM   2713  C  CG   . ARG B 2 31  ? 10.179  4.759   -5.114  1.00 0.00 ? 289 ARG A CG   2  
ATOM   2714  C  CD   . ARG B 2 31  ? 8.959   4.419   -4.281  1.00 0.00 ? 289 ARG A CD   2  
ATOM   2715  N  NE   . ARG B 2 31  ? 7.827   5.289   -4.590  1.00 0.00 ? 289 ARG A NE   2  
ATOM   2716  C  CZ   . ARG B 2 31  ? 7.676   6.511   -4.086  1.00 0.00 ? 289 ARG A CZ   2  
ATOM   2717  N  NH1  . ARG B 2 31  ? 8.584   7.007   -3.255  1.00 0.00 ? 289 ARG A NH1  2  
ATOM   2718  N  NH2  . ARG B 2 31  ? 6.618   7.238   -4.413  1.00 0.00 ? 289 ARG A NH2  2  
ATOM   2719  H  H    . ARG B 2 31  ? 8.994   3.516   -8.680  1.00 0.00 ? 289 ARG A H    2  
ATOM   2720  H  HA   . ARG B 2 31  ? 11.470  3.280   -7.288  1.00 0.00 ? 289 ARG A HA   2  
ATOM   2721  H  HB2  . ARG B 2 31  ? 10.410  5.351   -7.117  1.00 0.00 ? 289 ARG A HB2  2  
ATOM   2722  H  HB3  . ARG B 2 31  ? 8.857   4.626   -6.753  1.00 0.00 ? 289 ARG A HB3  2  
ATOM   2723  H  HG2  . ARG B 2 31  ? 11.003  4.133   -4.808  1.00 0.00 ? 289 ARG A HG2  2  
ATOM   2724  H  HG3  . ARG B 2 31  ? 10.428  5.792   -4.962  1.00 0.00 ? 289 ARG A HG3  2  
ATOM   2725  H  HD2  . ARG B 2 31  ? 8.680   3.397   -4.482  1.00 0.00 ? 289 ARG A HD2  2  
ATOM   2726  H  HD3  . ARG B 2 31  ? 9.207   4.525   -3.237  1.00 0.00 ? 289 ARG A HD3  2  
ATOM   2727  H  HE   . ARG B 2 31  ? 7.146   4.946   -5.204  1.00 0.00 ? 289 ARG A HE   2  
ATOM   2728  H  HH11 . ARG B 2 31  ? 9.385   6.464   -3.005  1.00 0.00 ? 289 ARG A HH11 2  
ATOM   2729  H  HH12 . ARG B 2 31  ? 8.466   7.927   -2.878  1.00 0.00 ? 289 ARG A HH12 2  
ATOM   2730  H  HH21 . ARG B 2 31  ? 5.933   6.869   -5.041  1.00 0.00 ? 289 ARG A HH21 2  
ATOM   2731  H  HH22 . ARG B 2 31  ? 6.506   8.156   -4.034  1.00 0.00 ? 289 ARG A HH22 2  
ATOM   2732  N  N    . SER B 2 32  ? 11.148  1.417   -5.734  1.00 0.00 ? 290 SER A N    2  
ATOM   2733  C  CA   . SER B 2 32  ? 10.977  0.288   -4.839  1.00 0.00 ? 290 SER A CA   2  
ATOM   2734  C  C    . SER B 2 32  ? 10.958  0.718   -3.394  1.00 0.00 ? 290 SER A C    2  
ATOM   2735  O  O    . SER B 2 32  ? 11.219  1.870   -3.068  1.00 0.00 ? 290 SER A O    2  
ATOM   2736  C  CB   . SER B 2 32  ? 12.095  -0.725  -5.014  1.00 0.00 ? 290 SER A CB   2  
ATOM   2737  O  OG   . SER B 2 32  ? 12.993  -0.648  -3.945  1.00 0.00 ? 290 SER A OG   2  
ATOM   2738  H  H    . SER B 2 32  ? 12.048  1.688   -6.008  1.00 0.00 ? 290 SER A H    2  
ATOM   2739  H  HA   . SER B 2 32  ? 10.045  -0.181  -5.077  1.00 0.00 ? 290 SER A HA   2  
ATOM   2740  H  HB2  . SER B 2 32  ? 11.689  -1.722  -5.055  1.00 0.00 ? 290 SER A HB2  2  
ATOM   2741  H  HB3  . SER B 2 32  ? 12.628  -0.523  -5.904  1.00 0.00 ? 290 SER A HB3  2  
ATOM   2742  H  HG   . SER B 2 32  ? 13.888  -0.770  -4.268  1.00 0.00 ? 290 SER A HG   2  
ATOM   2743  N  N    . GLY B 2 33  ? 10.611  -0.229  -2.541  1.00 0.00 ? 291 GLY A N    2  
ATOM   2744  C  CA   . GLY B 2 33  ? 10.587  0.021   -1.109  1.00 0.00 ? 291 GLY A CA   2  
ATOM   2745  C  C    . GLY B 2 33  ? 10.633  -1.263  -0.313  1.00 0.00 ? 291 GLY A C    2  
ATOM   2746  O  O    . GLY B 2 33  ? 10.224  -2.305  -0.799  1.00 0.00 ? 291 GLY A O    2  
ATOM   2747  H  H    . GLY B 2 33  ? 10.325  -1.107  -2.898  1.00 0.00 ? 291 GLY A H    2  
ATOM   2748  H  HA2  . GLY B 2 33  ? 11.433  0.630   -0.842  1.00 0.00 ? 291 GLY A HA2  2  
ATOM   2749  H  HA3  . GLY B 2 33  ? 9.681   0.552   -0.862  1.00 0.00 ? 291 GLY A HA3  2  
ATOM   2750  N  N    . HIS B 2 34  ? 11.177  -1.237  0.891   1.00 0.00 ? 292 HIS A N    2  
ATOM   2751  C  CA   . HIS B 2 34  ? 11.158  -2.461  1.684   1.00 0.00 ? 292 HIS A CA   2  
ATOM   2752  C  C    . HIS B 2 34  ? 9.929   -2.461  2.566   1.00 0.00 ? 292 HIS A C    2  
ATOM   2753  O  O    . HIS B 2 34  ? 9.775   -1.588  3.407   1.00 0.00 ? 292 HIS A O    2  
ATOM   2754  C  CB   . HIS B 2 34  ? 12.383  -2.580  2.572   1.00 0.00 ? 292 HIS A CB   2  
ATOM   2755  C  CG   . HIS B 2 34  ? 13.663  -2.714  1.828   1.00 0.00 ? 292 HIS A CG   2  
ATOM   2756  N  ND1  . HIS B 2 34  ? 14.690  -1.828  1.993   1.00 0.00 ? 292 HIS A ND1  2  
ATOM   2757  C  CD2  . HIS B 2 34  ? 14.070  -3.614  0.910   1.00 0.00 ? 292 HIS A CD2  2  
ATOM   2758  C  CE1  . HIS B 2 34  ? 15.702  -2.178  1.217   1.00 0.00 ? 292 HIS A CE1  2  
ATOM   2759  N  NE2  . HIS B 2 34  ? 15.351  -3.267  0.553   1.00 0.00 ? 292 HIS A NE2  2  
ATOM   2760  H  H    . HIS B 2 34  ? 11.609  -0.418  1.228   1.00 0.00 ? 292 HIS A H    2  
ATOM   2761  H  HA   . HIS B 2 34  ? 11.116  -3.297  1.007   1.00 0.00 ? 292 HIS A HA   2  
ATOM   2762  H  HB2  . HIS B 2 34  ? 12.448  -1.690  3.186   1.00 0.00 ? 292 HIS A HB2  2  
ATOM   2763  H  HB3  . HIS B 2 34  ? 12.271  -3.446  3.209   1.00 0.00 ? 292 HIS A HB3  2  
ATOM   2764  H  HD2  . HIS B 2 34  ? 13.456  -4.375  0.445   1.00 0.00 ? 292 HIS A HD2  2  
ATOM   2765  H  HE1  . HIS B 2 34  ? 16.613  -1.622  1.076   1.00 0.00 ? 292 HIS A HE1  2  
ATOM   2766  H  HE2  . HIS B 2 34  ? 15.878  -3.689  -0.157  1.00 0.00 ? 292 HIS A HE2  2  
ATOM   2767  N  N    . PRO B 2 35  ? 9.011   -3.421  2.347   1.00 0.00 ? 293 PRO A N    2  
ATOM   2768  C  CA   . PRO B 2 35  ? 7.791   -3.555  3.129   1.00 0.00 ? 293 PRO A CA   2  
ATOM   2769  C  C    . PRO B 2 35  ? 7.977   -3.195  4.603   1.00 0.00 ? 293 PRO A C    2  
ATOM   2770  O  O    . PRO B 2 35  ? 7.036   -2.756  5.261   1.00 0.00 ? 293 PRO A O    2  
ATOM   2771  C  CB   . PRO B 2 35  ? 7.448   -5.031  2.952   1.00 0.00 ? 293 PRO A CB   2  
ATOM   2772  C  CG   . PRO B 2 35  ? 8.036   -5.427  1.634   1.00 0.00 ? 293 PRO A CG   2  
ATOM   2773  C  CD   . PRO B 2 35  ? 9.011   -4.362  1.222   1.00 0.00 ? 293 PRO A CD   2  
ATOM   2774  H  HA   . PRO B 2 35  ? 6.999   -2.943  2.709   1.00 0.00 ? 293 PRO A HA   2  
ATOM   2775  H  HB2  . PRO B 2 35  ? 7.877   -5.607  3.756   1.00 0.00 ? 293 PRO A HB2  2  
ATOM   2776  H  HB3  . PRO B 2 35  ? 6.375   -5.151  2.951   1.00 0.00 ? 293 PRO A HB3  2  
ATOM   2777  H  HG2  . PRO B 2 35  ? 8.550   -6.370  1.736   1.00 0.00 ? 293 PRO A HG2  2  
ATOM   2778  H  HG3  . PRO B 2 35  ? 7.249   -5.513  0.898   1.00 0.00 ? 293 PRO A HG3  2  
ATOM   2779  H  HD2  . PRO B 2 35  ? 9.983   -4.778  1.056   1.00 0.00 ? 293 PRO A HD2  2  
ATOM   2780  H  HD3  . PRO B 2 35  ? 8.668   -3.881  0.331   1.00 0.00 ? 293 PRO A HD3  2  
ATOM   2781  N  N    . THR B 2 36  ? 9.186   -3.396  5.120   1.00 0.00 ? 294 THR A N    2  
ATOM   2782  C  CA   . THR B 2 36  ? 9.488   -3.047  6.502   1.00 0.00 ? 294 THR A CA   2  
ATOM   2783  C  C    . THR B 2 36  ? 9.577   -1.533  6.632   1.00 0.00 ? 294 THR A C    2  
ATOM   2784  O  O    . THR B 2 36  ? 8.999   -0.932  7.539   1.00 0.00 ? 294 THR A O    2  
ATOM   2785  C  CB   . THR B 2 36  ? 10.812  -3.663  6.971   1.00 0.00 ? 294 THR A CB   2  
ATOM   2786  O  OG1  . THR B 2 36  ? 10.928  -5.015  6.513   1.00 0.00 ? 294 THR A OG1  2  
ATOM   2787  C  CG2  . THR B 2 36  ? 10.879  -3.622  8.475   1.00 0.00 ? 294 THR A CG2  2  
ATOM   2788  H  H    . THR B 2 36  ? 9.888   -3.788  4.561   1.00 0.00 ? 294 THR A H    2  
ATOM   2789  H  HA   . THR B 2 36  ? 8.696   -3.410  7.139   1.00 0.00 ? 294 THR A HA   2  
ATOM   2790  H  HB   . THR B 2 36  ? 11.624  -3.076  6.581   1.00 0.00 ? 294 THR A HB   2  
ATOM   2791  H  HG1  . THR B 2 36  ? 10.137  -5.258  6.026   1.00 0.00 ? 294 THR A HG1  2  
ATOM   2792  H  HG21 . THR B 2 36  ? 10.409  -2.713  8.803   1.00 0.00 ? 294 THR A HG21 2  
ATOM   2793  H  HG22 . THR B 2 36  ? 11.912  -3.634  8.793   1.00 0.00 ? 294 THR A HG22 2  
ATOM   2794  H  HG23 . THR B 2 36  ? 10.358  -4.471  8.888   1.00 0.00 ? 294 THR A HG23 2  
ATOM   2795  N  N    . CYS B 2 37  ? 10.315  -0.932  5.708   1.00 0.00 ? 295 CYS A N    2  
ATOM   2796  C  CA   . CYS B 2 37  ? 10.496  0.510   5.660   1.00 0.00 ? 295 CYS A CA   2  
ATOM   2797  C  C    . CYS B 2 37  ? 9.226   1.191   5.155   1.00 0.00 ? 295 CYS A C    2  
ATOM   2798  O  O    . CYS B 2 37  ? 9.068   2.404   5.268   1.00 0.00 ? 295 CYS A O    2  
ATOM   2799  C  CB   . CYS B 2 37  ? 11.661  0.838   4.741   1.00 0.00 ? 295 CYS A CB   2  
ATOM   2800  S  SG   . CYS B 2 37  ? 13.009  -0.373  4.817   1.00 0.00 ? 295 CYS A SG   2  
ATOM   2801  H  H    . CYS B 2 37  ? 10.763  -1.485  5.034   1.00 0.00 ? 295 CYS A H    2  
ATOM   2802  H  HA   . CYS B 2 37  ? 10.720  0.858   6.646   1.00 0.00 ? 295 CYS A HA   2  
ATOM   2803  H  HB2  . CYS B 2 37  ? 11.307  0.879   3.735   1.00 0.00 ? 295 CYS A HB2  2  
ATOM   2804  H  HB3  . CYS B 2 37  ? 12.070  1.790   5.006   1.00 0.00 ? 295 CYS A HB3  2  
ATOM   2805  N  N    . LEU B 2 38  ? 8.324   0.383   4.610   1.00 0.00 ? 296 LEU A N    2  
ATOM   2806  C  CA   . LEU B 2 38  ? 7.060   0.866   4.068   1.00 0.00 ? 296 LEU A CA   2  
ATOM   2807  C  C    . LEU B 2 38  ? 5.972   0.762   5.122   1.00 0.00 ? 296 LEU A C    2  
ATOM   2808  O  O    . LEU B 2 38  ? 4.899   1.350   4.990   1.00 0.00 ? 296 LEU A O    2  
ATOM   2809  C  CB   . LEU B 2 38  ? 6.655   0.019   2.871   1.00 0.00 ? 296 LEU A CB   2  
ATOM   2810  C  CG   . LEU B 2 38  ? 7.497   0.198   1.615   1.00 0.00 ? 296 LEU A CG   2  
ATOM   2811  C  CD1  . LEU B 2 38  ? 7.745   -1.139  0.973   1.00 0.00 ? 296 LEU A CD1  2  
ATOM   2812  C  CD2  . LEU B 2 38  ? 6.813   1.129   0.642   1.00 0.00 ? 296 LEU A CD2  2  
ATOM   2813  H  H    . LEU B 2 38  ? 8.505   -0.581  4.590   1.00 0.00 ? 296 LEU A H    2  
ATOM   2814  H  HA   . LEU B 2 38  ? 7.179   1.895   3.755   1.00 0.00 ? 296 LEU A HA   2  
ATOM   2815  H  HB2  . LEU B 2 38  ? 6.706   -1.020  3.163   1.00 0.00 ? 296 LEU A HB2  2  
ATOM   2816  H  HB3  . LEU B 2 38  ? 5.633   0.253   2.626   1.00 0.00 ? 296 LEU A HB3  2  
ATOM   2817  H  HG   . LEU B 2 38  ? 8.451   0.618   1.872   1.00 0.00 ? 296 LEU A HG   2  
ATOM   2818  H  HD11 . LEU B 2 38  ? 7.777   -1.034  -0.092  1.00 0.00 ? 296 LEU A HD11 2  
ATOM   2819  H  HD12 . LEU B 2 38  ? 6.962   -1.825  1.246   1.00 0.00 ? 296 LEU A HD12 2  
ATOM   2820  H  HD13 . LEU B 2 38  ? 8.684   -1.518  1.310   1.00 0.00 ? 296 LEU A HD13 2  
ATOM   2821  H  HD21 . LEU B 2 38  ? 6.966   0.757   -0.352  1.00 0.00 ? 296 LEU A HD21 2  
ATOM   2822  H  HD22 . LEU B 2 38  ? 7.234   2.119   0.730   1.00 0.00 ? 296 LEU A HD22 2  
ATOM   2823  H  HD23 . LEU B 2 38  ? 5.754   1.165   0.856   1.00 0.00 ? 296 LEU A HD23 2  
ATOM   2824  N  N    . GLN B 2 39  ? 6.273   -0.014  6.160   1.00 0.00 ? 297 GLN A N    2  
ATOM   2825  C  CA   . GLN B 2 39  ? 5.348   -0.257  7.258   1.00 0.00 ? 297 GLN A CA   2  
ATOM   2826  C  C    . GLN B 2 39  ? 4.238   -1.205  6.819   1.00 0.00 ? 297 GLN A C    2  
ATOM   2827  O  O    . GLN B 2 39  ? 3.194   -1.299  7.465   1.00 0.00 ? 297 GLN A O    2  
ATOM   2828  C  CB   . GLN B 2 39  ? 4.754   1.050   7.785   1.00 0.00 ? 297 GLN A CB   2  
ATOM   2829  C  CG   . GLN B 2 39  ? 5.795   2.098   8.125   1.00 0.00 ? 297 GLN A CG   2  
ATOM   2830  C  CD   . GLN B 2 39  ? 5.180   3.435   8.488   1.00 0.00 ? 297 GLN A CD   2  
ATOM   2831  O  OE1  . GLN B 2 39  ? 4.961   4.286   7.626   1.00 0.00 ? 297 GLN A OE1  2  
ATOM   2832  N  NE2  . GLN B 2 39  ? 4.897   3.627   9.771   1.00 0.00 ? 297 GLN A NE2  2  
ATOM   2833  H  H    . GLN B 2 39  ? 7.155   -0.440  6.189   1.00 0.00 ? 297 GLN A H    2  
ATOM   2834  H  HA   . GLN B 2 39  ? 5.908   -0.726  8.048   1.00 0.00 ? 297 GLN A HA   2  
ATOM   2835  H  HB2  . GLN B 2 39  ? 4.092   1.457   7.039   1.00 0.00 ? 297 GLN A HB2  2  
ATOM   2836  H  HB3  . GLN B 2 39  ? 4.190   0.838   8.681   1.00 0.00 ? 297 GLN A HB3  2  
ATOM   2837  H  HG2  . GLN B 2 39  ? 6.371   1.746   8.965   1.00 0.00 ? 297 GLN A HG2  2  
ATOM   2838  H  HG3  . GLN B 2 39  ? 6.445   2.234   7.273   1.00 0.00 ? 297 GLN A HG3  2  
ATOM   2839  H  HE21 . GLN B 2 39  ? 5.099   2.905   10.402  1.00 0.00 ? 297 GLN A HE21 2  
ATOM   2840  H  HE22 . GLN B 2 39  ? 4.498   4.482   10.034  1.00 0.00 ? 297 GLN A HE22 2  
ATOM   2841  N  N    . PHE B 2 40  ? 4.474   -1.908  5.711   1.00 0.00 ? 298 PHE A N    2  
ATOM   2842  C  CA   . PHE B 2 40  ? 3.500   -2.857  5.179   1.00 0.00 ? 298 PHE A CA   2  
ATOM   2843  C  C    . PHE B 2 40  ? 3.215   -3.971  6.163   1.00 0.00 ? 298 PHE A C    2  
ATOM   2844  O  O    . PHE B 2 40  ? 3.818   -4.062  7.234   1.00 0.00 ? 298 PHE A O    2  
ATOM   2845  C  CB   . PHE B 2 40  ? 4.006   -3.521  3.891   1.00 0.00 ? 298 PHE A CB   2  
ATOM   2846  C  CG   . PHE B 2 40  ? 4.067   -2.645  2.684   1.00 0.00 ? 298 PHE A CG   2  
ATOM   2847  C  CD1  . PHE B 2 40  ? 3.566   -1.352  2.685   1.00 0.00 ? 298 PHE A CD1  2  
ATOM   2848  C  CD2  . PHE B 2 40  ? 4.642   -3.137  1.532   1.00 0.00 ? 298 PHE A CD2  2  
ATOM   2849  C  CE1  . PHE B 2 40  ? 3.649   -0.575  1.548   1.00 0.00 ? 298 PHE A CE1  2  
ATOM   2850  C  CE2  . PHE B 2 40  ? 4.725   -2.366  0.403   1.00 0.00 ? 298 PHE A CE2  2  
ATOM   2851  C  CZ   . PHE B 2 40  ? 4.234   -1.094  0.410   1.00 0.00 ? 298 PHE A CZ   2  
ATOM   2852  H  H    . PHE B 2 40  ? 5.323   -1.783  5.240   1.00 0.00 ? 298 PHE A H    2  
ATOM   2853  H  HA   . PHE B 2 40  ? 2.587   -2.324  4.968   1.00 0.00 ? 298 PHE A HA   2  
ATOM   2854  H  HB2  . PHE B 2 40  ? 5.006   -3.903  4.053   1.00 0.00 ? 298 PHE A HB2  2  
ATOM   2855  H  HB3  . PHE B 2 40  ? 3.355   -4.351  3.655   1.00 0.00 ? 298 PHE A HB3  2  
ATOM   2856  H  HD1  . PHE B 2 40  ? 3.110   -0.955  3.579   1.00 0.00 ? 298 PHE A HD1  2  
ATOM   2857  H  HD2  . PHE B 2 40  ? 5.030   -4.141  1.525   1.00 0.00 ? 298 PHE A HD2  2  
ATOM   2858  H  HE1  . PHE B 2 40  ? 3.261   0.433   1.548   1.00 0.00 ? 298 PHE A HE1  2  
ATOM   2859  H  HE2  . PHE B 2 40  ? 5.176   -2.753  -0.490  1.00 0.00 ? 298 PHE A HE2  2  
ATOM   2860  H  HZ   . PHE B 2 40  ? 4.313   -0.507  -0.476  1.00 0.00 ? 298 PHE A HZ   2  
ATOM   2861  N  N    . THR B 2 41  ? 2.281   -4.819  5.770   1.00 0.00 ? 299 THR A N    2  
ATOM   2862  C  CA   . THR B 2 41  ? 1.923   -5.987  6.538   1.00 0.00 ? 299 THR A CA   2  
ATOM   2863  C  C    . THR B 2 41  ? 2.462   -7.193  5.794   1.00 0.00 ? 299 THR A C    2  
ATOM   2864  O  O    . THR B 2 41  ? 2.434   -7.208  4.565   1.00 0.00 ? 299 THR A O    2  
ATOM   2865  C  CB   . THR B 2 41  ? 0.403   -6.123  6.707   1.00 0.00 ? 299 THR A CB   2  
ATOM   2866  O  OG1  . THR B 2 41  ? -0.202  -4.830  6.835   1.00 0.00 ? 299 THR A OG1  2  
ATOM   2867  C  CG2  . THR B 2 41  ? 0.091   -6.955  7.928   1.00 0.00 ? 299 THR A CG2  2  
ATOM   2868  H  H    . THR B 2 41  ? 1.816   -4.649  4.925   1.00 0.00 ? 299 THR A H    2  
ATOM   2869  H  HA   . THR B 2 41  ? 2.385   -5.925  7.514   1.00 0.00 ? 299 THR A HA   2  
ATOM   2870  H  HB   . THR B 2 41  ? 0.001   -6.625  5.843   1.00 0.00 ? 299 THR A HB   2  
ATOM   2871  H  HG1  . THR B 2 41  ? 0.313   -4.295  7.443   1.00 0.00 ? 299 THR A HG1  2  
ATOM   2872  H  HG21 . THR B 2 41  ? 0.641   -7.875  7.863   1.00 0.00 ? 299 THR A HG21 2  
ATOM   2873  H  HG22 . THR B 2 41  ? -0.968  -7.165  7.963   1.00 0.00 ? 299 THR A HG22 2  
ATOM   2874  H  HG23 . THR B 2 41  ? 0.386   -6.417  8.816   1.00 0.00 ? 299 THR A HG23 2  
ATOM   2875  N  N    . LEU B 2 42  ? 2.973   -8.185  6.516   1.00 0.00 ? 300 LEU A N    2  
ATOM   2876  C  CA   . LEU B 2 42  ? 3.538   -9.366  5.872   1.00 0.00 ? 300 LEU A CA   2  
ATOM   2877  C  C    . LEU B 2 42  ? 2.789   -9.727  4.606   1.00 0.00 ? 300 LEU A C    2  
ATOM   2878  O  O    . LEU B 2 42  ? 3.393   -9.903  3.557   1.00 0.00 ? 300 LEU A O    2  
ATOM   2879  C  CB   . LEU B 2 42  ? 3.548   -10.558 6.806   1.00 0.00 ? 300 LEU A CB   2  
ATOM   2880  C  CG   . LEU B 2 42  ? 4.808   -11.419 6.724   1.00 0.00 ? 300 LEU A CG   2  
ATOM   2881  C  CD1  . LEU B 2 42  ? 5.085   -11.833 5.290   1.00 0.00 ? 300 LEU A CD1  2  
ATOM   2882  C  CD2  . LEU B 2 42  ? 5.991   -10.663 7.297   1.00 0.00 ? 300 LEU A CD2  2  
ATOM   2883  H  H    . LEU B 2 42  ? 2.968   -8.123  7.495   1.00 0.00 ? 300 LEU A H    2  
ATOM   2884  H  HA   . LEU B 2 42  ? 4.551   -9.145  5.610   1.00 0.00 ? 300 LEU A HA   2  
ATOM   2885  H  HB2  . LEU B 2 42  ? 3.444   -10.196 7.811   1.00 0.00 ? 300 LEU A HB2  2  
ATOM   2886  H  HB3  . LEU B 2 42  ? 2.704   -11.170 6.567   1.00 0.00 ? 300 LEU A HB3  2  
ATOM   2887  H  HG   . LEU B 2 42  ? 4.664   -12.312 7.300   1.00 0.00 ? 300 LEU A HG   2  
ATOM   2888  H  HD11 . LEU B 2 42  ? 4.151   -11.903 4.760   1.00 0.00 ? 300 LEU A HD11 2  
ATOM   2889  H  HD12 . LEU B 2 42  ? 5.581   -12.791 5.280   1.00 0.00 ? 300 LEU A HD12 2  
ATOM   2890  H  HD13 . LEU B 2 42  ? 5.713   -11.095 4.816   1.00 0.00 ? 300 LEU A HD13 2  
ATOM   2891  H  HD21 . LEU B 2 42  ? 5.949   -9.637  6.957   1.00 0.00 ? 300 LEU A HD21 2  
ATOM   2892  H  HD22 . LEU B 2 42  ? 6.910   -11.119 6.958   1.00 0.00 ? 300 LEU A HD22 2  
ATOM   2893  H  HD23 . LEU B 2 42  ? 5.949   -10.689 8.375   1.00 0.00 ? 300 LEU A HD23 2  
ATOM   2894  N  N    . ASN B 2 43  ? 1.473   -9.813  4.698   1.00 0.00 ? 301 ASN A N    2  
ATOM   2895  C  CA   . ASN B 2 43  ? 0.675   -10.164 3.540   1.00 0.00 ? 301 ASN A CA   2  
ATOM   2896  C  C    . ASN B 2 43  ? 0.925   -9.208  2.379   1.00 0.00 ? 301 ASN A C    2  
ATOM   2897  O  O    . ASN B 2 43  ? 1.228   -9.662  1.277   1.00 0.00 ? 301 ASN A O    2  
ATOM   2898  C  CB   . ASN B 2 43  ? -0.801  -10.207 3.890   1.00 0.00 ? 301 ASN A CB   2  
ATOM   2899  C  CG   . ASN B 2 43  ? -1.176  -11.418 4.711   1.00 0.00 ? 301 ASN A CG   2  
ATOM   2900  O  OD1  . ASN B 2 43  ? -0.355  -11.976 5.439   1.00 0.00 ? 301 ASN A OD1  2  
ATOM   2901  N  ND2  . ASN B 2 43  ? -2.432  -11.827 4.599   1.00 0.00 ? 301 ASN A ND2  2  
ATOM   2902  H  H    . ASN B 2 43  ? 1.033   -9.636  5.556   1.00 0.00 ? 301 ASN A H    2  
ATOM   2903  H  HA   . ASN B 2 43  ? 0.989   -11.147 3.232   1.00 0.00 ? 301 ASN A HA   2  
ATOM   2904  H  HB2  . ASN B 2 43  ? -1.045  -9.334  4.456   1.00 0.00 ? 301 ASN A HB2  2  
ATOM   2905  H  HB3  . ASN B 2 43  ? -1.382  -10.220 2.982   1.00 0.00 ? 301 ASN A HB3  2  
ATOM   2906  H  HD21 . ASN B 2 43  ? -3.028  -11.330 4.002   1.00 0.00 ? 301 ASN A HD21 2  
ATOM   2907  H  HD22 . ASN B 2 43  ? -2.711  -12.603 5.117   1.00 0.00 ? 301 ASN A HD22 2  
ATOM   2908  N  N    . MET B 2 44  ? 0.790   -7.889  2.596   1.00 0.00 ? 302 MET A N    2  
ATOM   2909  C  CA   . MET B 2 44  ? 1.060   -6.958  1.504   1.00 0.00 ? 302 MET A CA   2  
ATOM   2910  C  C    . MET B 2 44  ? 2.407   -7.267  0.941   1.00 0.00 ? 302 MET A C    2  
ATOM   2911  O  O    . MET B 2 44  ? 2.546   -7.529  -0.239  1.00 0.00 ? 302 MET A O    2  
ATOM   2912  C  CB   . MET B 2 44  ? 1.068   -5.499  1.896   1.00 0.00 ? 302 MET A CB   2  
ATOM   2913  C  CG   . MET B 2 44  ? 1.178   -4.638  0.657   1.00 0.00 ? 302 MET A CG   2  
ATOM   2914  S  SD   . MET B 2 44  ? -0.161  -3.455  0.478   1.00 0.00 ? 302 MET A SD   2  
ATOM   2915  C  CE   . MET B 2 44  ? 0.661   -1.962  0.963   1.00 0.00 ? 302 MET A CE   2  
ATOM   2916  H  H    . MET B 2 44  ? 0.515   -7.556  3.476   1.00 0.00 ? 302 MET A H    2  
ATOM   2917  H  HA   . MET B 2 44  ? 0.319   -7.101  0.739   1.00 0.00 ? 302 MET A HA   2  
ATOM   2918  H  HB2  . MET B 2 44  ? 0.165   -5.260  2.414   1.00 0.00 ? 302 MET A HB2  2  
ATOM   2919  H  HB3  . MET B 2 44  ? 1.916   -5.300  2.524   1.00 0.00 ? 302 MET A HB3  2  
ATOM   2920  H  HG2  . MET B 2 44  ? 2.119   -4.108  0.665   1.00 0.00 ? 302 MET A HG2  2  
ATOM   2921  H  HG3  . MET B 2 44  ? 1.155   -5.300  -0.194  1.00 0.00 ? 302 MET A HG3  2  
ATOM   2922  H  HE1  . MET B 2 44  ? 1.183   -2.154  1.874   1.00 0.00 ? 302 MET A HE1  2  
ATOM   2923  H  HE2  . MET B 2 44  ? -0.065  -1.178  1.115   1.00 0.00 ? 302 MET A HE2  2  
ATOM   2924  H  HE3  . MET B 2 44  ? 1.364   -1.666  0.197   1.00 0.00 ? 302 MET A HE3  2  
ATOM   2925  N  N    . THR B 2 45  ? 3.395   -7.236  1.817   1.00 0.00 ? 303 THR A N    2  
ATOM   2926  C  CA   . THR B 2 45  ? 4.753   -7.529  1.439   1.00 0.00 ? 303 THR A CA   2  
ATOM   2927  C  C    . THR B 2 45  ? 4.745   -8.597  0.362   1.00 0.00 ? 303 THR A C    2  
ATOM   2928  O  O    . THR B 2 45  ? 5.121   -8.346  -0.779  1.00 0.00 ? 303 THR A O    2  
ATOM   2929  C  CB   . THR B 2 45  ? 5.553   -8.024  2.671   1.00 0.00 ? 303 THR A CB   2  
ATOM   2930  O  OG1  . THR B 2 45  ? 5.522   -7.036  3.706   1.00 0.00 ? 303 THR A OG1  2  
ATOM   2931  C  CG2  . THR B 2 45  ? 6.989   -8.334  2.307   1.00 0.00 ? 303 THR A CG2  2  
ATOM   2932  H  H    . THR B 2 45  ? 3.197   -7.009  2.744   1.00 0.00 ? 303 THR A H    2  
ATOM   2933  H  HA   . THR B 2 45  ? 5.209   -6.624  1.051   1.00 0.00 ? 303 THR A HA   2  
ATOM   2934  H  HB   . THR B 2 45  ? 5.093   -8.930  3.049   1.00 0.00 ? 303 THR A HB   2  
ATOM   2935  H  HG1  . THR B 2 45  ? 6.282   -7.149  4.281   1.00 0.00 ? 303 THR A HG1  2  
ATOM   2936  H  HG21 . THR B 2 45  ? 7.330   -7.620  1.573   1.00 0.00 ? 303 THR A HG21 2  
ATOM   2937  H  HG22 . THR B 2 45  ? 7.052   -9.333  1.900   1.00 0.00 ? 303 THR A HG22 2  
ATOM   2938  H  HG23 . THR B 2 45  ? 7.607   -8.266  3.190   1.00 0.00 ? 303 THR A HG23 2  
ATOM   2939  N  N    . GLU B 2 46  ? 4.216   -9.755  0.725   1.00 0.00 ? 304 GLU A N    2  
ATOM   2940  C  CA   . GLU B 2 46  ? 4.135   -10.901 -0.169  1.00 0.00 ? 304 GLU A CA   2  
ATOM   2941  C  C    . GLU B 2 46  ? 3.354   -10.598 -1.453  1.00 0.00 ? 304 GLU A C    2  
ATOM   2942  O  O    . GLU B 2 46  ? 3.716   -11.072 -2.529  1.00 0.00 ? 304 GLU A O    2  
ATOM   2943  C  CB   . GLU B 2 46  ? 3.469   -12.059 0.573   1.00 0.00 ? 304 GLU A CB   2  
ATOM   2944  C  CG   . GLU B 2 46  ? 4.064   -12.302 1.943   1.00 0.00 ? 304 GLU A CG   2  
ATOM   2945  C  CD   . GLU B 2 46  ? 3.773   -13.692 2.475   1.00 0.00 ? 304 GLU A CD   2  
ATOM   2946  O  OE1  . GLU B 2 46  ? 4.568   -14.614 2.193   1.00 0.00 ? 304 GLU A OE1  2  
ATOM   2947  O  OE2  . GLU B 2 46  ? 2.753   -13.859 3.176   1.00 0.00 ? 304 GLU A OE2  2  
ATOM   2948  H  H    . GLU B 2 46  ? 3.864   -9.845  1.635   1.00 0.00 ? 304 GLU A H    2  
ATOM   2949  H  HA   . GLU B 2 46  ? 5.143   -11.186 -0.429  1.00 0.00 ? 304 GLU A HA   2  
ATOM   2950  H  HB2  . GLU B 2 46  ? 2.414   -11.834 0.705   1.00 0.00 ? 304 GLU A HB2  2  
ATOM   2951  H  HB3  . GLU B 2 46  ? 3.571   -12.961 -0.011  1.00 0.00 ? 304 GLU A HB3  2  
ATOM   2952  H  HG2  . GLU B 2 46  ? 5.129   -12.161 1.890   1.00 0.00 ? 304 GLU A HG2  2  
ATOM   2953  H  HG3  . GLU B 2 46  ? 3.646   -11.579 2.622   1.00 0.00 ? 304 GLU A HG3  2  
ATOM   2954  N  N    . ALA B 2 47  ? 2.288   -9.811  -1.338  1.00 0.00 ? 305 ALA A N    2  
ATOM   2955  C  CA   . ALA B 2 47  ? 1.445   -9.483  -2.498  1.00 0.00 ? 305 ALA A CA   2  
ATOM   2956  C  C    . ALA B 2 47  ? 2.104   -8.473  -3.440  1.00 0.00 ? 305 ALA A C    2  
ATOM   2957  O  O    . ALA B 2 47  ? 2.294   -8.742  -4.626  1.00 0.00 ? 305 ALA A O    2  
ATOM   2958  C  CB   . ALA B 2 47  ? 0.076   -8.980  -2.036  1.00 0.00 ? 305 ALA A CB   2  
ATOM   2959  H  H    . ALA B 2 47  ? 2.067   -9.435  -0.453  1.00 0.00 ? 305 ALA A H    2  
ATOM   2960  H  HA   . ALA B 2 47  ? 1.285   -10.396 -3.049  1.00 0.00 ? 305 ALA A HA   2  
ATOM   2961  H  HB1  . ALA B 2 47  ? 0.033   -7.898  -2.094  1.00 0.00 ? 305 ALA A HB1  2  
ATOM   2962  H  HB2  . ALA B 2 47  ? -0.091  -9.289  -1.014  1.00 0.00 ? 305 ALA A HB2  2  
ATOM   2963  H  HB3  . ALA B 2 47  ? -0.692  -9.403  -2.666  1.00 0.00 ? 305 ALA A HB3  2  
ATOM   2964  N  N    . VAL B 2 48  ? 2.441   -7.317  -2.898  1.00 0.00 ? 306 VAL A N    2  
ATOM   2965  C  CA   . VAL B 2 48  ? 3.053   -6.232  -3.650  1.00 0.00 ? 306 VAL A CA   2  
ATOM   2966  C  C    . VAL B 2 48  ? 4.332   -6.626  -4.394  1.00 0.00 ? 306 VAL A C    2  
ATOM   2967  O  O    . VAL B 2 48  ? 4.598   -6.110  -5.479  1.00 0.00 ? 306 VAL A O    2  
ATOM   2968  C  CB   . VAL B 2 48  ? 3.345   -5.049  -2.723  1.00 0.00 ? 306 VAL A CB   2  
ATOM   2969  C  CG1  . VAL B 2 48  ? 2.066   -4.368  -2.329  1.00 0.00 ? 306 VAL A CG1  2  
ATOM   2970  C  CG2  . VAL B 2 48  ? 4.105   -5.471  -1.494  1.00 0.00 ? 306 VAL A CG2  2  
ATOM   2971  H  H    . VAL B 2 48  ? 2.260   -7.177  -1.950  1.00 0.00 ? 306 VAL A H    2  
ATOM   2972  H  HA   . VAL B 2 48  ? 2.331   -5.897  -4.376  1.00 0.00 ? 306 VAL A HA   2  
ATOM   2973  H  HB   . VAL B 2 48  ? 3.949   -4.338  -3.247  1.00 0.00 ? 306 VAL A HB   2  
ATOM   2974  H  HG11 . VAL B 2 48  ? 2.302   -3.511  -1.707  1.00 0.00 ? 306 VAL A HG11 2  
ATOM   2975  H  HG12 . VAL B 2 48  ? 1.442   -5.057  -1.784  1.00 0.00 ? 306 VAL A HG12 2  
ATOM   2976  H  HG13 . VAL B 2 48  ? 1.547   -4.035  -3.215  1.00 0.00 ? 306 VAL A HG13 2  
ATOM   2977  H  HG21 . VAL B 2 48  ? 4.899   -4.766  -1.341  1.00 0.00 ? 306 VAL A HG21 2  
ATOM   2978  H  HG22 . VAL B 2 48  ? 4.514   -6.459  -1.638  1.00 0.00 ? 306 VAL A HG22 2  
ATOM   2979  H  HG23 . VAL B 2 48  ? 3.445   -5.467  -0.635  1.00 0.00 ? 306 VAL A HG23 2  
ATOM   2980  N  N    . LYS B 2 49  ? 5.123   -7.526  -3.824  1.00 0.00 ? 307 LYS A N    2  
ATOM   2981  C  CA   . LYS B 2 49  ? 6.368   -7.953  -4.466  1.00 0.00 ? 307 LYS A CA   2  
ATOM   2982  C  C    . LYS B 2 49  ? 6.103   -8.678  -5.777  1.00 0.00 ? 307 LYS A C    2  
ATOM   2983  O  O    . LYS B 2 49  ? 6.864   -8.551  -6.737  1.00 0.00 ? 307 LYS A O    2  
ATOM   2984  C  CB   . LYS B 2 49  ? 7.147   -8.871  -3.550  1.00 0.00 ? 307 LYS A CB   2  
ATOM   2985  C  CG   . LYS B 2 49  ? 7.945   -8.137  -2.493  1.00 0.00 ? 307 LYS A CG   2  
ATOM   2986  C  CD   . LYS B 2 49  ? 8.463   -9.092  -1.432  1.00 0.00 ? 307 LYS A CD   2  
ATOM   2987  C  CE   . LYS B 2 49  ? 7.335   -9.855  -0.775  1.00 0.00 ? 307 LYS A CE   2  
ATOM   2988  N  NZ   . LYS B 2 49  ? 7.618   -11.314 -0.684  1.00 0.00 ? 307 LYS A NZ   2  
ATOM   2989  H  H    . LYS B 2 49  ? 4.870   -7.912  -2.959  1.00 0.00 ? 307 LYS A H    2  
ATOM   2990  H  HA   . LYS B 2 49  ? 6.965   -7.080  -4.654  1.00 0.00 ? 307 LYS A HA   2  
ATOM   2991  H  HB2  . LYS B 2 49  ? 6.451   -9.523  -3.060  1.00 0.00 ? 307 LYS A HB2  2  
ATOM   2992  H  HB3  . LYS B 2 49  ? 7.827   -9.464  -4.143  1.00 0.00 ? 307 LYS A HB3  2  
ATOM   2993  H  HG2  . LYS B 2 49  ? 8.785   -7.648  -2.965  1.00 0.00 ? 307 LYS A HG2  2  
ATOM   2994  H  HG3  . LYS B 2 49  ? 7.311   -7.398  -2.028  1.00 0.00 ? 307 LYS A HG3  2  
ATOM   2995  H  HD2  . LYS B 2 49  ? 9.135   -9.796  -1.894  1.00 0.00 ? 307 LYS A HD2  2  
ATOM   2996  H  HD3  . LYS B 2 49  ? 8.990   -8.527  -0.677  1.00 0.00 ? 307 LYS A HD3  2  
ATOM   2997  H  HE2  . LYS B 2 49  ? 7.185   -9.461  0.212   1.00 0.00 ? 307 LYS A HE2  2  
ATOM   2998  H  HE3  . LYS B 2 49  ? 6.436   -9.701  -1.354  1.00 0.00 ? 307 LYS A HE3  2  
ATOM   2999  H  HZ1  . LYS B 2 49  ? 7.724   -11.719 -1.636  1.00 0.00 ? 307 LYS A HZ1  2  
ATOM   3000  H  HZ2  . LYS B 2 49  ? 6.838   -11.799 -0.198  1.00 0.00 ? 307 LYS A HZ2  2  
ATOM   3001  H  HZ3  . LYS B 2 49  ? 8.497   -11.474 -0.150  1.00 0.00 ? 307 LYS A HZ3  2  
ATOM   3002  N  N    . THR B 2 50  ? 5.018   -9.439  -5.808  1.00 0.00 ? 308 THR A N    2  
ATOM   3003  C  CA   . THR B 2 50  ? 4.659   -10.217 -6.984  1.00 0.00 ? 308 THR A CA   2  
ATOM   3004  C  C    . THR B 2 50  ? 3.980   -9.373  -8.049  1.00 0.00 ? 308 THR A C    2  
ATOM   3005  O  O    . THR B 2 50  ? 4.217   -9.561  -9.243  1.00 0.00 ? 308 THR A O    2  
ATOM   3006  C  CB   . THR B 2 50  ? 3.725   -11.377 -6.611  1.00 0.00 ? 308 THR A CB   2  
ATOM   3007  O  OG1  . THR B 2 50  ? 2.391   -10.891 -6.407  1.00 0.00 ? 308 THR A OG1  2  
ATOM   3008  C  CG2  . THR B 2 50  ? 4.222   -12.045 -5.349  1.00 0.00 ? 308 THR A CG2  2  
ATOM   3009  H  H    . THR B 2 50  ? 4.442   -9.479  -5.016  1.00 0.00 ? 308 THR A H    2  
ATOM   3010  H  HA   . THR B 2 50  ? 5.565   -10.639 -7.387  1.00 0.00 ? 308 THR A HA   2  
ATOM   3011  H  HB   . THR B 2 50  ? 3.724   -12.101 -7.411  1.00 0.00 ? 308 THR A HB   2  
ATOM   3012  H  HG1  . THR B 2 50  ? 1.865   -11.571 -5.979  1.00 0.00 ? 308 THR A HG1  2  
ATOM   3013  H  HG21 . THR B 2 50  ? 4.765   -11.315 -4.766  1.00 0.00 ? 308 THR A HG21 2  
ATOM   3014  H  HG22 . THR B 2 50  ? 4.876   -12.865 -5.606  1.00 0.00 ? 308 THR A HG22 2  
ATOM   3015  H  HG23 . THR B 2 50  ? 3.383   -12.413 -4.777  1.00 0.00 ? 308 THR A HG23 2  
ATOM   3016  N  N    . TYR B 2 51  ? 3.138   -8.443  -7.620  1.00 0.00 ? 309 TYR A N    2  
ATOM   3017  C  CA   . TYR B 2 51  ? 2.415   -7.604  -8.565  1.00 0.00 ? 309 TYR A CA   2  
ATOM   3018  C  C    . TYR B 2 51  ? 2.858   -6.133  -8.511  1.00 0.00 ? 309 TYR A C    2  
ATOM   3019  O  O    . TYR B 2 51  ? 3.889   -5.797  -7.931  1.00 0.00 ? 309 TYR A O    2  
ATOM   3020  C  CB   . TYR B 2 51  ? 0.898   -7.783  -8.361  1.00 0.00 ? 309 TYR A CB   2  
ATOM   3021  C  CG   . TYR B 2 51  ? 0.183   -6.663  -7.645  1.00 0.00 ? 309 TYR A CG   2  
ATOM   3022  C  CD1  . TYR B 2 51  ? 0.510   -6.328  -6.348  1.00 0.00 ? 309 TYR A CD1  2  
ATOM   3023  C  CD2  . TYR B 2 51  ? -0.831  -5.951  -8.275  1.00 0.00 ? 309 TYR A CD2  2  
ATOM   3024  C  CE1  . TYR B 2 51  ? -0.149  -5.317  -5.691  1.00 0.00 ? 309 TYR A CE1  2  
ATOM   3025  C  CE2  . TYR B 2 51  ? -1.496  -4.931  -7.624  1.00 0.00 ? 309 TYR A CE2  2  
ATOM   3026  C  CZ   . TYR B 2 51  ? -1.150  -4.618  -6.329  1.00 0.00 ? 309 TYR A CZ   2  
ATOM   3027  O  OH   . TYR B 2 51  ? -1.806  -3.603  -5.670  1.00 0.00 ? 309 TYR A OH   2  
ATOM   3028  H  H    . TYR B 2 51  ? 2.996   -8.325  -6.655  1.00 0.00 ? 309 TYR A H    2  
ATOM   3029  H  HA   . TYR B 2 51  ? 2.659   -7.973  -9.551  1.00 0.00 ? 309 TYR A HA   2  
ATOM   3030  H  HB2  . TYR B 2 51  ? 0.433   -7.887  -9.320  1.00 0.00 ? 309 TYR A HB2  2  
ATOM   3031  H  HB3  . TYR B 2 51  ? 0.732   -8.689  -7.796  1.00 0.00 ? 309 TYR A HB3  2  
ATOM   3032  H  HD1  . TYR B 2 51  ? 1.296   -6.871  -5.848  1.00 0.00 ? 309 TYR A HD1  2  
ATOM   3033  H  HD2  . TYR B 2 51  ? -1.097  -6.204  -9.291  1.00 0.00 ? 309 TYR A HD2  2  
ATOM   3034  H  HE1  . TYR B 2 51  ? 0.122   -5.077  -4.685  1.00 0.00 ? 309 TYR A HE1  2  
ATOM   3035  H  HE2  . TYR B 2 51  ? -2.280  -4.388  -8.129  1.00 0.00 ? 309 TYR A HE2  2  
ATOM   3036  H  HH   . TYR B 2 51  ? -2.749  -3.671  -5.833  1.00 0.00 ? 309 TYR A HH   2  
ATOM   3037  N  N    . LYS B 2 52  ? 2.057   -5.280  -9.135  1.00 0.00 ? 310 LYS A N    2  
ATOM   3038  C  CA   . LYS B 2 52  ? 2.324   -3.849  -9.252  1.00 0.00 ? 310 LYS A CA   2  
ATOM   3039  C  C    . LYS B 2 52  ? 2.660   -3.154  -7.936  1.00 0.00 ? 310 LYS A C    2  
ATOM   3040  O  O    . LYS B 2 52  ? 3.776   -2.677  -7.739  1.00 0.00 ? 310 LYS A O    2  
ATOM   3041  C  CB   . LYS B 2 52  ? 1.104   -3.172  -9.847  1.00 0.00 ? 310 LYS A CB   2  
ATOM   3042  C  CG   . LYS B 2 52  ? 0.565   -3.876  -11.042 1.00 0.00 ? 310 LYS A CG   2  
ATOM   3043  C  CD   . LYS B 2 52  ? 1.084   -3.252  -12.292 1.00 0.00 ? 310 LYS A CD   2  
ATOM   3044  C  CE   . LYS B 2 52  ? 0.675   -4.022  -13.525 1.00 0.00 ? 310 LYS A CE   2  
ATOM   3045  N  NZ   . LYS B 2 52  ? 0.212   -3.122  -14.616 1.00 0.00 ? 310 LYS A NZ   2  
ATOM   3046  H  H    . LYS B 2 52  ? 1.229   -5.623  -9.519  1.00 0.00 ? 310 LYS A H    2  
ATOM   3047  H  HA   . LYS B 2 52  ? 3.133   -3.719  -9.938  1.00 0.00 ? 310 LYS A HA   2  
ATOM   3048  H  HB2  . LYS B 2 52  ? 0.341   -3.132  -9.113  1.00 0.00 ? 310 LYS A HB2  2  
ATOM   3049  H  HB3  . LYS B 2 52  ? 1.364   -2.180  -10.148 1.00 0.00 ? 310 LYS A HB3  2  
ATOM   3050  H  HG2  . LYS B 2 52  ? 0.898   -4.882  -11.001 1.00 0.00 ? 310 LYS A HG2  2  
ATOM   3051  H  HG3  . LYS B 2 52  ? -0.504  -3.828  -11.036 1.00 0.00 ? 310 LYS A HG3  2  
ATOM   3052  H  HD2  . LYS B 2 52  ? 0.720   -2.239  -12.367 1.00 0.00 ? 310 LYS A HD2  2  
ATOM   3053  H  HD3  . LYS B 2 52  ? 2.147   -3.256  -12.216 1.00 0.00 ? 310 LYS A HD3  2  
ATOM   3054  H  HE2  . LYS B 2 52  ? 1.531   -4.575  -13.866 1.00 0.00 ? 310 LYS A HE2  2  
ATOM   3055  H  HE3  . LYS B 2 52  ? -0.120  -4.707  -13.265 1.00 0.00 ? 310 LYS A HE3  2  
ATOM   3056  H  HZ1  . LYS B 2 52  ? -0.656  -2.627  -14.326 1.00 0.00 ? 310 LYS A HZ1  2  
ATOM   3057  H  HZ2  . LYS B 2 52  ? 0.012   -3.673  -15.475 1.00 0.00 ? 310 LYS A HZ2  2  
ATOM   3058  H  HZ3  . LYS B 2 52  ? 0.945   -2.417  -14.833 1.00 0.00 ? 310 LYS A HZ3  2  
ATOM   3059  N  N    . TRP B 2 53  ? 1.663   -3.103  -7.058  1.00 0.00 ? 311 TRP A N    2  
ATOM   3060  C  CA   . TRP B 2 53  ? 1.744   -2.398  -5.780  1.00 0.00 ? 311 TRP A CA   2  
ATOM   3061  C  C    . TRP B 2 53  ? 1.507   -0.918  -6.034  1.00 0.00 ? 311 TRP A C    2  
ATOM   3062  O  O    . TRP B 2 53  ? 0.799   -0.265  -5.274  1.00 0.00 ? 311 TRP A O    2  
ATOM   3063  C  CB   . TRP B 2 53  ? 3.067   -2.605  -5.003  1.00 0.00 ? 311 TRP A CB   2  
ATOM   3064  C  CG   . TRP B 2 53  ? 3.259   -1.579  -3.918  1.00 0.00 ? 311 TRP A CG   2  
ATOM   3065  C  CD1  . TRP B 2 53  ? 2.481   -1.412  -2.815  1.00 0.00 ? 311 TRP A CD1  2  
ATOM   3066  C  CD2  . TRP B 2 53  ? 4.283   -0.582  -3.829  1.00 0.00 ? 311 TRP A CD2  2  
ATOM   3067  N  NE1  . TRP B 2 53  ? 2.942   -0.375  -2.056  1.00 0.00 ? 311 TRP A NE1  2  
ATOM   3068  C  CE2  . TRP B 2 53  ? 4.050   0.148   -2.653  1.00 0.00 ? 311 TRP A CE2  2  
ATOM   3069  C  CE3  . TRP B 2 53  ? 5.366   -0.235  -4.622  1.00 0.00 ? 311 TRP A CE3  2  
ATOM   3070  C  CZ2  . TRP B 2 53  ? 4.862   1.198   -2.249  1.00 0.00 ? 311 TRP A CZ2  2  
ATOM   3071  C  CZ3  . TRP B 2 53  ? 6.180   0.812   -4.221  1.00 0.00 ? 311 TRP A CZ3  2  
ATOM   3072  C  CH2  . TRP B 2 53  ? 5.921   1.517   -3.039  1.00 0.00 ? 311 TRP A CH2  2  
ATOM   3073  H  H    . TRP B 2 53  ? 0.827   -3.563  -7.281  1.00 0.00 ? 311 TRP A H    2  
ATOM   3074  H  HA   . TRP B 2 53  ? 0.926   -2.763  -5.171  1.00 0.00 ? 311 TRP A HA   2  
ATOM   3075  H  HB2  . TRP B 2 53  ? 3.048   -3.573  -4.537  1.00 0.00 ? 311 TRP A HB2  2  
ATOM   3076  H  HB3  . TRP B 2 53  ? 3.911   -2.559  -5.659  1.00 0.00 ? 311 TRP A HB3  2  
ATOM   3077  H  HD1  . TRP B 2 53  ? 1.629   -2.025  -2.583  1.00 0.00 ? 311 TRP A HD1  2  
ATOM   3078  H  HE1  . TRP B 2 53  ? 2.545   -0.064  -1.216  1.00 0.00 ? 311 TRP A HE1  2  
ATOM   3079  H  HE3  . TRP B 2 53  ? 5.574   -0.771  -5.530  1.00 0.00 ? 311 TRP A HE3  2  
ATOM   3080  H  HZ2  . TRP B 2 53  ? 4.677   1.742   -1.337  1.00 0.00 ? 311 TRP A HZ2  2  
ATOM   3081  H  HZ3  . TRP B 2 53  ? 7.030   1.094   -4.821  1.00 0.00 ? 311 TRP A HZ3  2  
ATOM   3082  H  HH2  . TRP B 2 53  ? 6.583   2.323   -2.754  1.00 0.00 ? 311 TRP A HH2  2  
ATOM   3083  N  N    . GLN B 2 54  ? 2.079   -0.412  -7.135  1.00 0.00 ? 312 GLN A N    2  
ATOM   3084  C  CA   . GLN B 2 54  ? 1.941   0.991   -7.519  1.00 0.00 ? 312 GLN A CA   2  
ATOM   3085  C  C    . GLN B 2 54  ? 2.098   1.900   -6.317  1.00 0.00 ? 312 GLN A C    2  
ATOM   3086  O  O    . GLN B 2 54  ? 1.188   2.009   -5.494  1.00 0.00 ? 312 GLN A O    2  
ATOM   3087  C  CB   . GLN B 2 54  ? 0.584   1.246   -8.179  1.00 0.00 ? 312 GLN A CB   2  
ATOM   3088  C  CG   . GLN B 2 54  ? 0.459   0.649   -9.571  1.00 0.00 ? 312 GLN A CG   2  
ATOM   3089  C  CD   . GLN B 2 54  ? -0.926  0.825   -10.164 1.00 0.00 ? 312 GLN A CD   2  
ATOM   3090  O  OE1  . GLN B 2 54  ? -1.385  -0.004  -10.950 1.00 0.00 ? 312 GLN A OE1  2  
ATOM   3091  N  NE2  . GLN B 2 54  ? -1.600  1.910   -9.794  1.00 0.00 ? 312 GLN A NE2  2  
ATOM   3092  H  H    . GLN B 2 54  ? 2.611   -1.005  -7.704  1.00 0.00 ? 312 GLN A H    2  
ATOM   3093  H  HA   . GLN B 2 54  ? 2.723   1.219   -8.228  1.00 0.00 ? 312 GLN A HA   2  
ATOM   3094  H  HB2  . GLN B 2 54  ? -0.185  0.823   -7.560  1.00 0.00 ? 312 GLN A HB2  2  
ATOM   3095  H  HB3  . GLN B 2 54  ? 0.422   2.312   -8.249  1.00 0.00 ? 312 GLN A HB3  2  
ATOM   3096  H  HG2  . GLN B 2 54  ? 1.175   1.130   -10.220 1.00 0.00 ? 312 GLN A HG2  2  
ATOM   3097  H  HG3  . GLN B 2 54  ? 0.678   -0.408  -9.516  1.00 0.00 ? 312 GLN A HG3  2  
ATOM   3098  H  HE21 . GLN B 2 54  ? -1.170  2.531   -9.165  1.00 0.00 ? 312 GLN A HE21 2  
ATOM   3099  H  HE22 . GLN B 2 54  ? -2.500  2.045   -10.165 1.00 0.00 ? 312 GLN A HE22 2  
ATOM   3100  N  N    . CYS B 2 55  ? 3.248   2.558   -6.221  1.00 0.00 ? 313 CYS A N    2  
ATOM   3101  C  CA   . CYS B 2 55  ? 3.509   3.454   -5.111  1.00 0.00 ? 313 CYS A CA   2  
ATOM   3102  C  C    . CYS B 2 55  ? 2.257   4.247   -4.786  1.00 0.00 ? 313 CYS A C    2  
ATOM   3103  O  O    . CYS B 2 55  ? 1.415   4.479   -5.652  1.00 0.00 ? 313 CYS A O    2  
ATOM   3104  C  CB   . CYS B 2 55  ? 4.674   4.397   -5.415  1.00 0.00 ? 313 CYS A CB   2  
ATOM   3105  S  SG   . CYS B 2 55  ? 4.219   5.908   -6.328  1.00 0.00 ? 313 CYS A SG   2  
ATOM   3106  H  H    . CYS B 2 55  ? 3.929   2.434   -6.908  1.00 0.00 ? 313 CYS A H    2  
ATOM   3107  H  HA   . CYS B 2 55  ? 3.763   2.848   -4.254  1.00 0.00 ? 313 CYS A HA   2  
ATOM   3108  H  HB2  . CYS B 2 55  ? 5.121   4.707   -4.482  1.00 0.00 ? 313 CYS A HB2  2  
ATOM   3109  H  HB3  . CYS B 2 55  ? 5.408   3.869   -5.991  1.00 0.00 ? 313 CYS A HB3  2  
ATOM   3110  N  N    . ILE B 2 56  ? 2.154   4.657   -3.540  1.00 0.00 ? 314 ILE A N    2  
ATOM   3111  C  CA   . ILE B 2 56  ? 0.998   5.399   -3.064  1.00 0.00 ? 314 ILE A CA   2  
ATOM   3112  C  C    . ILE B 2 56  ? 0.548   6.396   -4.090  1.00 0.00 ? 314 ILE A C    2  
ATOM   3113  O  O    . ILE B 2 56  ? -0.413  6.172   -4.747  1.00 0.00 ? 314 ILE A O    2  
ATOM   3114  C  CB   . ILE B 2 56  ? 1.313   6.067   -1.693  1.00 0.00 ? 314 ILE A CB   2  
ATOM   3115  C  CG1  . ILE B 2 56  ? 0.436   5.568   -0.557  1.00 0.00 ? 314 ILE A CG1  2  
ATOM   3116  C  CG2  . ILE B 2 56  ? 1.254   7.580   -1.660  1.00 0.00 ? 314 ILE A CG2  2  
ATOM   3117  C  CD1  . ILE B 2 56  ? -0.901  4.962   -0.899  1.00 0.00 ? 314 ILE A CD1  2  
ATOM   3118  H  H    . ILE B 2 56  ? 2.896   4.490   -2.931  1.00 0.00 ? 314 ILE A H    2  
ATOM   3119  H  HA   . ILE B 2 56  ? 0.180   4.706   -2.913  1.00 0.00 ? 314 ILE A HA   2  
ATOM   3120  H  HB   . ILE B 2 56  ? 2.309   5.786   -1.463  1.00 0.00 ? 314 ILE A HB   2  
ATOM   3121  H  HG12 . ILE B 2 56  ? 0.971   4.861   -0.045  1.00 0.00 ? 314 ILE A HG12 2  
ATOM   3122  H  HG13 . ILE B 2 56  ? 0.243   6.397   0.109   1.00 0.00 ? 314 ILE A HG13 2  
ATOM   3123  H  HG21 . ILE B 2 56  ? 0.366   7.859   -1.134  1.00 0.00 ? 314 ILE A HG21 2  
ATOM   3124  H  HG22 . ILE B 2 56  ? 1.234   7.988   -2.646  1.00 0.00 ? 314 ILE A HG22 2  
ATOM   3125  H  HG23 . ILE B 2 56  ? 2.113   7.960   -1.128  1.00 0.00 ? 314 ILE A HG23 2  
ATOM   3126  H  HD11 . ILE B 2 56  ? -1.626  5.752   -0.916  1.00 0.00 ? 314 ILE A HD11 2  
ATOM   3127  H  HD12 . ILE B 2 56  ? -1.174  4.242   -0.143  1.00 0.00 ? 314 ILE A HD12 2  
ATOM   3128  H  HD13 . ILE B 2 56  ? -0.864  4.479   -1.860  1.00 0.00 ? 314 ILE A HD13 2  
ATOM   3129  N  N    . GLU B 2 57  ? 1.295   7.417   -4.310  1.00 0.00 ? 315 GLU A N    2  
ATOM   3130  C  CA   . GLU B 2 57  ? 0.872   8.476   -5.210  1.00 0.00 ? 315 GLU A CA   2  
ATOM   3131  C  C    . GLU B 2 57  ? 0.136   7.955   -6.460  1.00 0.00 ? 315 GLU A C    2  
ATOM   3132  O  O    . GLU B 2 57  ? -0.670  8.667   -7.058  1.00 0.00 ? 315 GLU A O    2  
ATOM   3133  C  CB   . GLU B 2 57  ? 2.064   9.346   -5.548  1.00 0.00 ? 315 GLU A CB   2  
ATOM   3134  C  CG   . GLU B 2 57  ? 2.716   9.891   -4.289  1.00 0.00 ? 315 GLU A CG   2  
ATOM   3135  C  CD   . GLU B 2 57  ? 3.903   10.789  -4.576  1.00 0.00 ? 315 GLU A CD   2  
ATOM   3136  O  OE1  . GLU B 2 57  ? 3.691   12.002  -4.790  1.00 0.00 ? 315 GLU A OE1  2  
ATOM   3137  O  OE2  . GLU B 2 57  ? 5.043   10.279  -4.589  1.00 0.00 ? 315 GLU A OE2  2  
ATOM   3138  H  H    . GLU B 2 57  ? 2.156   7.465   -3.866  1.00 0.00 ? 315 GLU A H    2  
ATOM   3139  H  HA   . GLU B 2 57  ? 0.172   9.070   -4.639  1.00 0.00 ? 315 GLU A HA   2  
ATOM   3140  H  HB2  . GLU B 2 57  ? 2.791   8.760   -6.093  1.00 0.00 ? 315 GLU A HB2  2  
ATOM   3141  H  HB3  . GLU B 2 57  ? 1.742   10.177  -6.155  1.00 0.00 ? 315 GLU A HB3  2  
ATOM   3142  H  HG2  . GLU B 2 57  ? 1.974   10.451  -3.737  1.00 0.00 ? 315 GLU A HG2  2  
ATOM   3143  H  HG3  . GLU B 2 57  ? 3.043   9.060   -3.676  1.00 0.00 ? 315 GLU A HG3  2  
ATOM   3144  N  N    . CYS B 2 58  ? 0.424   6.717   -6.841  1.00 0.00 ? 316 CYS A N    2  
ATOM   3145  C  CA   . CYS B 2 58  ? -0.222  6.072   -8.001  1.00 0.00 ? 316 CYS A CA   2  
ATOM   3146  C  C    . CYS B 2 58  ? -1.333  5.074   -7.609  1.00 0.00 ? 316 CYS A C    2  
ATOM   3147  O  O    . CYS B 2 58  ? -2.136  4.669   -8.450  1.00 0.00 ? 316 CYS A O    2  
ATOM   3148  C  CB   . CYS B 2 58  ? 0.816   5.331   -8.832  1.00 0.00 ? 316 CYS A CB   2  
ATOM   3149  S  SG   . CYS B 2 58  ? 2.169   6.375   -9.441  1.00 0.00 ? 316 CYS A SG   2  
ATOM   3150  H  H    . CYS B 2 58  ? 1.079   6.213   -6.311  1.00 0.00 ? 316 CYS A H    2  
ATOM   3151  H  HA   . CYS B 2 58  ? -0.657  6.851   -8.608  1.00 0.00 ? 316 CYS A HA   2  
ATOM   3152  H  HB2  . CYS B 2 58  ? 1.254   4.548   -8.232  1.00 0.00 ? 316 CYS A HB2  2  
ATOM   3153  H  HB3  . CYS B 2 58  ? 0.331   4.891   -9.685  1.00 0.00 ? 316 CYS A HB3  2  
ATOM   3154  N  N    . LYS B 2 59  ? -1.358  4.687   -6.338  1.00 0.00 ? 317 LYS A N    2  
ATOM   3155  C  CA   . LYS B 2 59  ? -2.284  3.694   -5.806  1.00 0.00 ? 317 LYS A CA   2  
ATOM   3156  C  C    . LYS B 2 59  ? -3.726  3.849   -6.305  1.00 0.00 ? 317 LYS A C    2  
ATOM   3157  O  O    . LYS B 2 59  ? -4.300  2.888   -6.819  1.00 0.00 ? 317 LYS A O    2  
ATOM   3158  C  CB   . LYS B 2 59  ? -2.226  3.695   -4.256  1.00 0.00 ? 317 LYS A CB   2  
ATOM   3159  C  CG   . LYS B 2 59  ? -3.111  4.699   -3.600  1.00 0.00 ? 317 LYS A CG   2  
ATOM   3160  C  CD   . LYS B 2 59  ? -2.826  6.062   -4.112  1.00 0.00 ? 317 LYS A CD   2  
ATOM   3161  C  CE   . LYS B 2 59  ? -2.131  6.892   -3.074  1.00 0.00 ? 317 LYS A CE   2  
ATOM   3162  N  NZ   . LYS B 2 59  ? -1.543  8.130   -3.657  1.00 0.00 ? 317 LYS A NZ   2  
ATOM   3163  H  H    . LYS B 2 59  ? -0.745  5.098   -5.720  1.00 0.00 ? 317 LYS A H    2  
ATOM   3164  H  HA   . LYS B 2 59  ? -1.931  2.750   -6.141  1.00 0.00 ? 317 LYS A HA   2  
ATOM   3165  H  HB2  . LYS B 2 59  ? -2.512  2.730   -3.890  1.00 0.00 ? 317 LYS A HB2  2  
ATOM   3166  H  HB3  . LYS B 2 59  ? -1.222  3.912   -3.938  1.00 0.00 ? 317 LYS A HB3  2  
ATOM   3167  H  HG2  . LYS B 2 59  ? -4.112  4.455   -3.801  1.00 0.00 ? 317 LYS A HG2  2  
ATOM   3168  H  HG3  . LYS B 2 59  ? -2.941  4.690   -2.543  1.00 0.00 ? 317 LYS A HG3  2  
ATOM   3169  H  HD2  . LYS B 2 59  ? -2.191  5.977   -4.964  1.00 0.00 ? 317 LYS A HD2  2  
ATOM   3170  H  HD3  . LYS B 2 59  ? -3.730  6.512   -4.407  1.00 0.00 ? 317 LYS A HD3  2  
ATOM   3171  H  HE2  . LYS B 2 59  ? -2.826  7.140   -2.306  1.00 0.00 ? 317 LYS A HE2  2  
ATOM   3172  H  HE3  . LYS B 2 59  ? -1.337  6.307   -2.654  1.00 0.00 ? 317 LYS A HE3  2  
ATOM   3173  H  HZ1  . LYS B 2 59  ? -1.575  8.086   -4.695  1.00 0.00 ? 317 LYS A HZ1  2  
ATOM   3174  H  HZ2  . LYS B 2 59  ? -0.553  8.227   -3.358  1.00 0.00 ? 317 LYS A HZ2  2  
ATOM   3175  H  HZ3  . LYS B 2 59  ? -2.066  8.963   -3.341  1.00 0.00 ? 317 LYS A HZ3  2  
ATOM   3176  N  N    . SER B 2 60  ? -4.288  5.052   -6.195  1.00 0.00 ? 318 SER A N    2  
ATOM   3177  C  CA   . SER B 2 60  ? -5.671  5.304   -6.576  1.00 0.00 ? 318 SER A CA   2  
ATOM   3178  C  C    . SER B 2 60  ? -6.575  4.183   -6.126  1.00 0.00 ? 318 SER A C    2  
ATOM   3179  O  O    . SER B 2 60  ? -6.179  3.285   -5.381  1.00 0.00 ? 318 SER A O    2  
ATOM   3180  C  CB   . SER B 2 60  ? -5.815  5.495   -8.088  1.00 0.00 ? 318 SER A CB   2  
ATOM   3181  O  OG   . SER B 2 60  ? -4.818  4.780   -8.795  1.00 0.00 ? 318 SER A OG   2  
ATOM   3182  H  H    . SER B 2 60  ? -3.751  5.796   -5.880  1.00 0.00 ? 318 SER A H    2  
ATOM   3183  H  HA   . SER B 2 60  ? -5.999  6.199   -6.076  1.00 0.00 ? 318 SER A HA   2  
ATOM   3184  H  HB2  . SER B 2 60  ? -6.782  5.130   -8.393  1.00 0.00 ? 318 SER A HB2  2  
ATOM   3185  H  HB3  . SER B 2 60  ? -5.739  6.542   -8.332  1.00 0.00 ? 318 SER A HB3  2  
ATOM   3186  H  HG   . SER B 2 60  ? -5.232  4.231   -9.465  1.00 0.00 ? 318 SER A HG   2  
ATOM   3187  N  N    . CYS B 2 61  ? -7.808  4.270   -6.549  1.00 0.00 ? 319 CYS A N    2  
ATOM   3188  C  CA   . CYS B 2 61  ? -8.773  3.264   -6.231  1.00 0.00 ? 319 CYS A CA   2  
ATOM   3189  C  C    . CYS B 2 61  ? -8.544  2.048   -7.123  1.00 0.00 ? 319 CYS A C    2  
ATOM   3190  O  O    . CYS B 2 61  ? -7.649  2.036   -7.969  1.00 0.00 ? 319 CYS A O    2  
ATOM   3191  C  CB   . CYS B 2 61  ? -10.155 3.808   -6.474  1.00 0.00 ? 319 CYS A CB   2  
ATOM   3192  S  SG   . CYS B 2 61  ? -11.524 3.006   -5.588  1.00 0.00 ? 319 CYS A SG   2  
ATOM   3193  H  H    . CYS B 2 61  ? -8.080  5.045   -7.082  1.00 0.00 ? 319 CYS A H    2  
ATOM   3194  H  HA   . CYS B 2 61  ? -8.676  3.021   -5.192  1.00 0.00 ? 319 CYS A HA   2  
ATOM   3195  H  HB2  . CYS B 2 61  ? -10.164 4.840   -6.178  1.00 0.00 ? 319 CYS A HB2  2  
ATOM   3196  H  HB3  . CYS B 2 61  ? -10.364 3.735   -7.518  1.00 0.00 ? 319 CYS A HB3  2  
ATOM   3197  N  N    . ILE B 2 62  ? -9.348  1.040   -6.911  1.00 0.00 ? 320 ILE A N    2  
ATOM   3198  C  CA   . ILE B 2 62  ? -9.339  -0.177  -7.709  1.00 0.00 ? 320 ILE A CA   2  
ATOM   3199  C  C    . ILE B 2 62  ? -10.785 -0.425  -8.028  1.00 0.00 ? 320 ILE A C    2  
ATOM   3200  O  O    . ILE B 2 62  ? -11.147 -1.114  -8.984  1.00 0.00 ? 320 ILE A O    2  
ATOM   3201  C  CB   . ILE B 2 62  ? -8.735  -1.371  -6.932  1.00 0.00 ? 320 ILE A CB   2  
ATOM   3202  C  CG1  . ILE B 2 62  ? -9.384  -2.715  -7.310  1.00 0.00 ? 320 ILE A CG1  2  
ATOM   3203  C  CG2  . ILE B 2 62  ? -8.913  -1.106  -5.481  1.00 0.00 ? 320 ILE A CG2  2  
ATOM   3204  C  CD1  . ILE B 2 62  ? -9.319  -3.779  -6.231  1.00 0.00 ? 320 ILE A CD1  2  
ATOM   3205  H  H    . ILE B 2 62  ? -9.989  1.107   -6.173  1.00 0.00 ? 320 ILE A H    2  
ATOM   3206  H  HA   . ILE B 2 62  ? -8.780  -0.004  -8.619  1.00 0.00 ? 320 ILE A HA   2  
ATOM   3207  H  HB   . ILE B 2 62  ? -7.679  -1.411  -7.138  1.00 0.00 ? 320 ILE A HB   2  
ATOM   3208  H  HG12 . ILE B 2 62  ? -10.420 -2.551  -7.531  1.00 0.00 ? 320 ILE A HG12 2  
ATOM   3209  H  HG13 . ILE B 2 62  ? -8.888  -3.111  -8.175  1.00 0.00 ? 320 ILE A HG13 2  
ATOM   3210  H  HG21 . ILE B 2 62  ? -9.979  -1.053  -5.268  1.00 0.00 ? 320 ILE A HG21 2  
ATOM   3211  H  HG22 . ILE B 2 62  ? -8.438  -0.175  -5.228  1.00 0.00 ? 320 ILE A HG22 2  
ATOM   3212  H  HG23 . ILE B 2 62  ? -8.469  -1.901  -4.910  1.00 0.00 ? 320 ILE A HG23 2  
ATOM   3213  H  HD11 . ILE B 2 62  ? -8.344  -3.771  -5.772  1.00 0.00 ? 320 ILE A HD11 2  
ATOM   3214  H  HD12 . ILE B 2 62  ? -9.501  -4.749  -6.672  1.00 0.00 ? 320 ILE A HD12 2  
ATOM   3215  H  HD13 . ILE B 2 62  ? -10.072 -3.580  -5.484  1.00 0.00 ? 320 ILE A HD13 2  
ATOM   3216  N  N    . LEU B 2 63  ? -11.609 0.194   -7.186  1.00 0.00 ? 321 LEU A N    2  
ATOM   3217  C  CA   . LEU B 2 63  ? -13.035 0.118   -7.307  1.00 0.00 ? 321 LEU A CA   2  
ATOM   3218  C  C    . LEU B 2 63  ? -13.478 1.055   -8.403  1.00 0.00 ? 321 LEU A C    2  
ATOM   3219  O  O    . LEU B 2 63  ? -14.431 0.784   -9.133  1.00 0.00 ? 321 LEU A O    2  
ATOM   3220  C  CB   . LEU B 2 63  ? -13.656 0.466   -5.957  1.00 0.00 ? 321 LEU A CB   2  
ATOM   3221  C  CG   . LEU B 2 63  ? -13.223 -0.453  -4.812  1.00 0.00 ? 321 LEU A CG   2  
ATOM   3222  C  CD1  . LEU B 2 63  ? -14.402 -0.868  -3.973  1.00 0.00 ? 321 LEU A CD1  2  
ATOM   3223  C  CD2  . LEU B 2 63  ? -12.502 -1.668  -5.330  1.00 0.00 ? 321 LEU A CD2  2  
ATOM   3224  H  H    . LEU B 2 63  ? -11.230 0.718   -6.440  1.00 0.00 ? 321 LEU A H    2  
ATOM   3225  H  HA   . LEU B 2 63  ? -13.292 -0.889  -7.564  1.00 0.00 ? 321 LEU A HA   2  
ATOM   3226  H  HB2  . LEU B 2 63  ? -13.365 1.477   -5.702  1.00 0.00 ? 321 LEU A HB2  2  
ATOM   3227  H  HB3  . LEU B 2 63  ? -14.728 0.426   -6.038  1.00 0.00 ? 321 LEU A HB3  2  
ATOM   3228  H  HG   . LEU B 2 63  ? -12.528 0.083   -4.181  1.00 0.00 ? 321 LEU A HG   2  
ATOM   3229  H  HD11 . LEU B 2 63  ? -14.355 -0.356  -3.027  1.00 0.00 ? 321 LEU A HD11 2  
ATOM   3230  H  HD12 . LEU B 2 63  ? -14.372 -1.935  -3.809  1.00 0.00 ? 321 LEU A HD12 2  
ATOM   3231  H  HD13 . LEU B 2 63  ? -15.317 -0.606  -4.482  1.00 0.00 ? 321 LEU A HD13 2  
ATOM   3232  H  HD21 . LEU B 2 63  ? -11.605 -1.328  -5.806  1.00 0.00 ? 321 LEU A HD21 2  
ATOM   3233  H  HD22 . LEU B 2 63  ? -13.125 -2.187  -6.046  1.00 0.00 ? 321 LEU A HD22 2  
ATOM   3234  H  HD23 . LEU B 2 63  ? -12.255 -2.326  -4.514  1.00 0.00 ? 321 LEU A HD23 2  
ATOM   3235  N  N    . CYS B 2 64  ? -12.765 2.169   -8.508  1.00 0.00 ? 322 CYS A N    2  
ATOM   3236  C  CA   . CYS B 2 64  ? -13.031 3.131   -9.542  1.00 0.00 ? 322 CYS A CA   2  
ATOM   3237  C  C    . CYS B 2 64  ? -11.720 3.677   -10.137 1.00 0.00 ? 322 CYS A C    2  
ATOM   3238  O  O    . CYS B 2 64  ? -11.741 4.396   -11.138 1.00 0.00 ? 322 CYS A O    2  
ATOM   3239  C  CB   . CYS B 2 64  ? -14.016 4.183   -9.028  1.00 0.00 ? 322 CYS A CB   2  
ATOM   3240  S  SG   . CYS B 2 64  ? -13.402 5.407   -7.847  1.00 0.00 ? 322 CYS A SG   2  
ATOM   3241  H  H    . CYS B 2 64  ? -12.072 2.362   -7.849  1.00 0.00 ? 322 CYS A H    2  
ATOM   3242  H  HA   . CYS B 2 64  ? -13.521 2.593   -10.333 1.00 0.00 ? 322 CYS A HA   2  
ATOM   3243  H  HB2  . CYS B 2 64  ? -14.414 4.728   -9.866  1.00 0.00 ? 322 CYS A HB2  2  
ATOM   3244  H  HB3  . CYS B 2 64  ? -14.812 3.662   -8.544  1.00 0.00 ? 322 CYS A HB3  2  
ATOM   3245  N  N    . GLY B 2 65  ? -10.578 3.314   -9.509  1.00 0.00 ? 323 GLY A N    2  
ATOM   3246  C  CA   . GLY B 2 65  ? -9.256  3.670   -10.016 1.00 0.00 ? 323 GLY A CA   2  
ATOM   3247  C  C    . GLY B 2 65  ? -9.206  5.028   -10.643 1.00 0.00 ? 323 GLY A C    2  
ATOM   3248  O  O    . GLY B 2 65  ? -8.830  5.187   -11.805 1.00 0.00 ? 323 GLY A O    2  
ATOM   3249  H  H    . GLY B 2 65  ? -10.635 2.866   -8.644  1.00 0.00 ? 323 GLY A H    2  
ATOM   3250  H  HA2  . GLY B 2 65  ? -8.554  3.646   -9.196  1.00 0.00 ? 323 GLY A HA2  2  
ATOM   3251  H  HA3  . GLY B 2 65  ? -8.953  2.937   -10.748 1.00 0.00 ? 323 GLY A HA3  2  
ATOM   3252  N  N    . THR B 2 66  ? -9.584  6.001   -9.860  1.00 0.00 ? 324 THR A N    2  
ATOM   3253  C  CA   . THR B 2 66  ? -9.606  7.376   -10.313 1.00 0.00 ? 324 THR A CA   2  
ATOM   3254  C  C    . THR B 2 66  ? -8.969  8.316   -9.307  1.00 0.00 ? 324 THR A C    2  
ATOM   3255  O  O    . THR B 2 66  ? -8.601  9.438   -9.651  1.00 0.00 ? 324 THR A O    2  
ATOM   3256  C  CB   . THR B 2 66  ? -11.047 7.822   -10.540 1.00 0.00 ? 324 THR A CB   2  
ATOM   3257  O  OG1  . THR B 2 66  ? -11.096 9.207   -10.900 1.00 0.00 ? 324 THR A OG1  2  
ATOM   3258  C  CG2  . THR B 2 66  ? -11.882 7.578   -9.302  1.00 0.00 ? 324 THR A CG2  2  
ATOM   3259  H  H    . THR B 2 66  ? -9.884  5.780   -8.955  1.00 0.00 ? 324 THR A H    2  
ATOM   3260  H  HA   . THR B 2 66  ? -9.080  7.437   -11.251 1.00 0.00 ? 324 THR A HA   2  
ATOM   3261  H  HB   . THR B 2 66  ? -11.453 7.236   -11.331 1.00 0.00 ? 324 THR A HB   2  
ATOM   3262  H  HG1  . THR B 2 66  ? -11.278 9.734   -10.118 1.00 0.00 ? 324 THR A HG1  2  
ATOM   3263  H  HG21 . THR B 2 66  ? -12.015 6.512   -9.153  1.00 0.00 ? 324 THR A HG21 2  
ATOM   3264  H  HG22 . THR B 2 66  ? -12.848 8.042   -9.427  1.00 0.00 ? 324 THR A HG22 2  
ATOM   3265  H  HG23 . THR B 2 66  ? -11.386 8.002   -8.443  1.00 0.00 ? 324 THR A HG23 2  
ATOM   3266  N  N    . SER B 2 67  ? -8.864  7.849   -8.064  1.00 0.00 ? 325 SER A N    2  
ATOM   3267  C  CA   . SER B 2 67  ? -8.325  8.636   -6.966  1.00 0.00 ? 325 SER A CA   2  
ATOM   3268  C  C    . SER B 2 67  ? -9.396  9.601   -6.502  1.00 0.00 ? 325 SER A C    2  
ATOM   3269  O  O    . SER B 2 67  ? -9.433  10.003  -5.350  1.00 0.00 ? 325 SER A O    2  
ATOM   3270  C  CB   . SER B 2 67  ? -7.046  9.374   -7.362  1.00 0.00 ? 325 SER A CB   2  
ATOM   3271  O  OG   . SER B 2 67  ? -7.329  10.648  -7.916  1.00 0.00 ? 325 SER A OG   2  
ATOM   3272  H  H    . SER B 2 67  ? -9.173  6.945   -7.877  1.00 0.00 ? 325 SER A H    2  
ATOM   3273  H  HA   . SER B 2 67  ? -8.107  7.958   -6.160  1.00 0.00 ? 325 SER A HA   2  
ATOM   3274  H  HB2  . SER B 2 67  ? -6.423  9.505   -6.491  1.00 0.00 ? 325 SER A HB2  2  
ATOM   3275  H  HB3  . SER B 2 67  ? -6.520  8.785   -8.095  1.00 0.00 ? 325 SER A HB3  2  
ATOM   3276  H  HG   . SER B 2 67  ? -8.267  10.716  -8.103  1.00 0.00 ? 325 SER A HG   2  
ATOM   3277  N  N    . GLU B 2 68  ? -10.287 9.915   -7.433  1.00 0.00 ? 326 GLU A N    2  
ATOM   3278  C  CA   . GLU B 2 68  ? -11.425 10.791  -7.212  1.00 0.00 ? 326 GLU A CA   2  
ATOM   3279  C  C    . GLU B 2 68  ? -11.349 11.616  -5.938  1.00 0.00 ? 326 GLU A C    2  
ATOM   3280  O  O    . GLU B 2 68  ? -10.921 12.770  -5.940  1.00 0.00 ? 326 GLU A O    2  
ATOM   3281  C  CB   . GLU B 2 68  ? -12.653 9.927   -7.168  1.00 0.00 ? 326 GLU A CB   2  
ATOM   3282  C  CG   . GLU B 2 68  ? -13.550 10.113  -8.370  1.00 0.00 ? 326 GLU A CG   2  
ATOM   3283  C  CD   . GLU B 2 68  ? -14.616 11.170  -8.155  1.00 0.00 ? 326 GLU A CD   2  
ATOM   3284  O  OE1  . GLU B 2 68  ? -15.705 10.821  -7.653  1.00 0.00 ? 326 GLU A OE1  2  
ATOM   3285  O  OE2  . GLU B 2 68  ? -14.362 12.346  -8.491  1.00 0.00 ? 326 GLU A OE2  2  
ATOM   3286  H  H    . GLU B 2 68  ? -10.193 9.508   -8.314  1.00 0.00 ? 326 GLU A H    2  
ATOM   3287  H  HA   . GLU B 2 68  ? -11.517 11.439  -8.057  1.00 0.00 ? 326 GLU A HA   2  
ATOM   3288  H  HB2  . GLU B 2 68  ? -12.331 8.906   -7.123  1.00 0.00 ? 326 GLU A HB2  2  
ATOM   3289  H  HB3  . GLU B 2 68  ? -13.205 10.147  -6.288  1.00 0.00 ? 326 GLU A HB3  2  
ATOM   3290  H  HG2  . GLU B 2 68  ? -12.938 10.406  -9.205  1.00 0.00 ? 326 GLU A HG2  2  
ATOM   3291  H  HG3  . GLU B 2 68  ? -14.023 9.176   -8.593  1.00 0.00 ? 326 GLU A HG3  2  
ATOM   3292  N  N    . ASN B 2 69  ? -11.780 10.991  -4.854  1.00 0.00 ? 327 ASN A N    2  
ATOM   3293  C  CA   . ASN B 2 69  ? -11.829 11.615  -3.551  1.00 0.00 ? 327 ASN A CA   2  
ATOM   3294  C  C    . ASN B 2 69  ? -10.529 11.413  -2.802  1.00 0.00 ? 327 ASN A C    2  
ATOM   3295  O  O    . ASN B 2 69  ? -10.062 12.303  -2.091  1.00 0.00 ? 327 ASN A O    2  
ATOM   3296  C  CB   . ASN B 2 69  ? -12.983 10.993  -2.781  1.00 0.00 ? 327 ASN A CB   2  
ATOM   3297  C  CG   . ASN B 2 69  ? -14.010 10.427  -3.702  1.00 0.00 ? 327 ASN A CG   2  
ATOM   3298  O  OD1  . ASN B 2 69  ? -14.128 9.214   -3.861  1.00 0.00 ? 327 ASN A OD1  2  
ATOM   3299  N  ND2  . ASN B 2 69  ? -14.733 11.297  -4.343  1.00 0.00 ? 327 ASN A ND2  2  
ATOM   3300  H  H    . ASN B 2 69  ? -12.066 10.058  -4.934  1.00 0.00 ? 327 ASN A H    2  
ATOM   3301  H  HA   . ASN B 2 69  ? -12.015 12.662  -3.675  1.00 0.00 ? 327 ASN A HA   2  
ATOM   3302  H  HB2  . ASN B 2 69  ? -12.622 10.201  -2.190  1.00 0.00 ? 327 ASN A HB2  2  
ATOM   3303  H  HB3  . ASN B 2 69  ? -13.451 11.728  -2.152  1.00 0.00 ? 327 ASN A HB3  2  
ATOM   3304  H  HD21 . ASN B 2 69  ? -14.559 12.242  -4.186  1.00 0.00 ? 327 ASN A HD21 2  
ATOM   3305  H  HD22 . ASN B 2 69  ? -15.410 10.962  -4.937  1.00 0.00 ? 327 ASN A HD22 2  
ATOM   3306  N  N    . ASP B 2 70  ? -9.957  10.226  -2.983  1.00 0.00 ? 328 ASP A N    2  
ATOM   3307  C  CA   . ASP B 2 70  ? -8.709  9.827   -2.339  1.00 0.00 ? 328 ASP A CA   2  
ATOM   3308  C  C    . ASP B 2 70  ? -8.679  10.121  -0.845  1.00 0.00 ? 328 ASP A C    2  
ATOM   3309  O  O    . ASP B 2 70  ? -7.670  9.872   -0.184  1.00 0.00 ? 328 ASP A O    2  
ATOM   3310  C  CB   . ASP B 2 70  ? -7.475  10.426  -3.009  1.00 0.00 ? 328 ASP A CB   2  
ATOM   3311  C  CG   . ASP B 2 70  ? -7.740  11.593  -3.946  1.00 0.00 ? 328 ASP A CG   2  
ATOM   3312  O  OD1  . ASP B 2 70  ? -8.112  12.678  -3.457  1.00 0.00 ? 328 ASP A OD1  2  
ATOM   3313  O  OD2  . ASP B 2 70  ? -7.539  11.432  -5.168  1.00 0.00 ? 328 ASP A OD2  2  
ATOM   3314  H  H    . ASP B 2 70  ? -10.397 9.581   -3.589  1.00 0.00 ? 328 ASP A H    2  
ATOM   3315  H  HA   . ASP B 2 70  ? -8.647  8.761   -2.447  1.00 0.00 ? 328 ASP A HA   2  
ATOM   3316  H  HB2  . ASP B 2 70  ? -6.810  10.776  -2.236  1.00 0.00 ? 328 ASP A HB2  2  
ATOM   3317  H  HB3  . ASP B 2 70  ? -6.978  9.631   -3.564  1.00 0.00 ? 328 ASP A HB3  2  
ATOM   3318  N  N    . ASP B 2 71  ? -9.770  10.642  -0.311  1.00 0.00 ? 329 ASP A N    2  
ATOM   3319  C  CA   . ASP B 2 71  ? -9.850  10.913  1.105   1.00 0.00 ? 329 ASP A CA   2  
ATOM   3320  C  C    . ASP B 2 71  ? -10.612 9.777   1.747   1.00 0.00 ? 329 ASP A C    2  
ATOM   3321  O  O    . ASP B 2 71  ? -10.813 9.736   2.962   1.00 0.00 ? 329 ASP A O    2  
ATOM   3322  C  CB   . ASP B 2 71  ? -10.522 12.248  1.377   1.00 0.00 ? 329 ASP A CB   2  
ATOM   3323  C  CG   . ASP B 2 71  ? -10.588 12.567  2.858   1.00 0.00 ? 329 ASP A CG   2  
ATOM   3324  O  OD1  . ASP B 2 71  ? -9.520  12.571  3.511   1.00 0.00 ? 329 ASP A OD1  2  
ATOM   3325  O  OD2  . ASP B 2 71  ? -11.704 12.805  3.367   1.00 0.00 ? 329 ASP A OD2  2  
ATOM   3326  H  H    . ASP B 2 71  ? -10.541 10.836  -0.878  1.00 0.00 ? 329 ASP A H    2  
ATOM   3327  H  HA   . ASP B 2 71  ? -8.847  10.941  1.494   1.00 0.00 ? 329 ASP A HA   2  
ATOM   3328  H  HB2  . ASP B 2 71  ? -9.949  13.017  0.892   1.00 0.00 ? 329 ASP A HB2  2  
ATOM   3329  H  HB3  . ASP B 2 71  ? -11.526 12.236  0.978   1.00 0.00 ? 329 ASP A HB3  2  
ATOM   3330  N  N    . GLN B 2 72  ? -11.029 8.844   0.893   1.00 0.00 ? 330 GLN A N    2  
ATOM   3331  C  CA   . GLN B 2 72  ? -11.761 7.685   1.318   1.00 0.00 ? 330 GLN A CA   2  
ATOM   3332  C  C    . GLN B 2 72  ? -11.003 6.452   0.894   1.00 0.00 ? 330 GLN A C    2  
ATOM   3333  O  O    . GLN B 2 72  ? -11.021 5.434   1.562   1.00 0.00 ? 330 GLN A O    2  
ATOM   3334  C  CB   . GLN B 2 72  ? -13.131 7.715   0.723   1.00 0.00 ? 330 GLN A CB   2  
ATOM   3335  C  CG   . GLN B 2 72  ? -13.756 9.031   1.028   1.00 0.00 ? 330 GLN A CG   2  
ATOM   3336  C  CD   . GLN B 2 72  ? -15.211 8.933   1.381   1.00 0.00 ? 330 GLN A CD   2  
ATOM   3337  O  OE1  . GLN B 2 72  ? -15.696 7.886   1.810   1.00 0.00 ? 330 GLN A OE1  2  
ATOM   3338  N  NE2  . GLN B 2 72  ? -15.910 10.036  1.244   1.00 0.00 ? 330 GLN A NE2  2  
ATOM   3339  H  H    . GLN B 2 72  ? -10.826 8.937   -0.067  1.00 0.00 ? 330 GLN A H    2  
ATOM   3340  H  HA   . GLN B 2 72  ? -11.868 7.727   2.382   1.00 0.00 ? 330 GLN A HA   2  
ATOM   3341  H  HB2  . GLN B 2 72  ? -13.061 7.589   -0.343  1.00 0.00 ? 330 GLN A HB2  2  
ATOM   3342  H  HB3  . GLN B 2 72  ? -13.739 6.933   1.152   1.00 0.00 ? 330 GLN A HB3  2  
ATOM   3343  H  HG2  . GLN B 2 72  ? -13.233 9.462   1.869   1.00 0.00 ? 330 GLN A HG2  2  
ATOM   3344  H  HG3  . GLN B 2 72  ? -13.625 9.657   0.169   1.00 0.00 ? 330 GLN A HG3  2  
ATOM   3345  H  HE21 . GLN B 2 72  ? -15.450 10.838  0.922   1.00 0.00 ? 330 GLN A HE21 2  
ATOM   3346  H  HE22 . GLN B 2 72  ? -16.847 10.009  1.484   1.00 0.00 ? 330 GLN A HE22 2  
ATOM   3347  N  N    . LEU B 2 73  ? -10.304 6.571   -0.230  1.00 0.00 ? 331 LEU A N    2  
ATOM   3348  C  CA   . LEU B 2 73  ? -9.522  5.457   -0.740  1.00 0.00 ? 331 LEU A CA   2  
ATOM   3349  C  C    . LEU B 2 73  ? -8.971  4.660   0.412   1.00 0.00 ? 331 LEU A C    2  
ATOM   3350  O  O    . LEU B 2 73  ? -8.416  5.218   1.347   1.00 0.00 ? 331 LEU A O    2  
ATOM   3351  C  CB   . LEU B 2 73  ? -8.371  5.935   -1.601  1.00 0.00 ? 331 LEU A CB   2  
ATOM   3352  C  CG   . LEU B 2 73  ? -8.760  6.476   -2.969  1.00 0.00 ? 331 LEU A CG   2  
ATOM   3353  C  CD1  . LEU B 2 73  ? -7.539  6.925   -3.711  1.00 0.00 ? 331 LEU A CD1  2  
ATOM   3354  C  CD2  . LEU B 2 73  ? -9.472  5.420   -3.756  1.00 0.00 ? 331 LEU A CD2  2  
ATOM   3355  H  H    . LEU B 2 73  ? -10.312 7.427   -0.713  1.00 0.00 ? 331 LEU A H    2  
ATOM   3356  H  HA   . LEU B 2 73  ? -10.167 4.825   -1.335  1.00 0.00 ? 331 LEU A HA   2  
ATOM   3357  H  HB2  . LEU B 2 73  ? -7.854  6.699   -1.062  1.00 0.00 ? 331 LEU A HB2  2  
ATOM   3358  H  HB3  . LEU B 2 73  ? -7.695  5.105   -1.749  1.00 0.00 ? 331 LEU A HB3  2  
ATOM   3359  H  HG   . LEU B 2 73  ? -9.406  7.319   -2.852  1.00 0.00 ? 331 LEU A HG   2  
ATOM   3360  H  HD11 . LEU B 2 73  ? -6.741  6.969   -3.018  1.00 0.00 ? 331 LEU A HD11 2  
ATOM   3361  H  HD12 . LEU B 2 73  ? -7.708  7.904   -4.137  1.00 0.00 ? 331 LEU A HD12 2  
ATOM   3362  H  HD13 . LEU B 2 73  ? -7.304  6.220   -4.494  1.00 0.00 ? 331 LEU A HD13 2  
ATOM   3363  H  HD21 . LEU B 2 73  ? -8.817  4.590   -3.862  1.00 0.00 ? 331 LEU A HD21 2  
ATOM   3364  H  HD22 . LEU B 2 73  ? -9.725  5.805   -4.730  1.00 0.00 ? 331 LEU A HD22 2  
ATOM   3365  H  HD23 . LEU B 2 73  ? -10.367 5.115   -3.236  1.00 0.00 ? 331 LEU A HD23 2  
ATOM   3366  N  N    . LEU B 2 74  ? -9.231  3.382   0.404   1.00 0.00 ? 332 LEU A N    2  
ATOM   3367  C  CA   . LEU B 2 74  ? -8.702  2.521   1.436   1.00 0.00 ? 332 LEU A CA   2  
ATOM   3368  C  C    . LEU B 2 74  ? -7.579  1.691   0.894   1.00 0.00 ? 332 LEU A C    2  
ATOM   3369  O  O    . LEU B 2 74  ? -7.781  0.807   0.068   1.00 0.00 ? 332 LEU A O    2  
ATOM   3370  C  CB   . LEU B 2 74  ? -9.781  1.619   2.006   1.00 0.00 ? 332 LEU A CB   2  
ATOM   3371  C  CG   . LEU B 2 74  ? -10.349 2.022   3.340   1.00 0.00 ? 332 LEU A CG   2  
ATOM   3372  C  CD1  . LEU B 2 74  ? -11.510 1.129   3.721   1.00 0.00 ? 332 LEU A CD1  2  
ATOM   3373  C  CD2  . LEU B 2 74  ? -9.306  1.980   4.417   1.00 0.00 ? 332 LEU A CD2  2  
ATOM   3374  H  H    . LEU B 2 74  ? -9.850  3.023   -0.269  1.00 0.00 ? 332 LEU A H    2  
ATOM   3375  H  HA   . LEU B 2 74  ? -8.293  3.159   2.201   1.00 0.00 ? 332 LEU A HA   2  
ATOM   3376  H  HB2  . LEU B 2 74  ? -10.595 1.577   1.305   1.00 0.00 ? 332 LEU A HB2  2  
ATOM   3377  H  HB3  . LEU B 2 74  ? -9.366  0.645   2.106   1.00 0.00 ? 332 LEU A HB3  2  
ATOM   3378  H  HG   . LEU B 2 74  ? -10.699 3.014   3.259   1.00 0.00 ? 332 LEU A HG   2  
ATOM   3379  H  HD11 . LEU B 2 74  ? -12.194 1.657   4.359   1.00 0.00 ? 332 LEU A HD11 2  
ATOM   3380  H  HD12 . LEU B 2 74  ? -11.137 0.271   4.249   1.00 0.00 ? 332 LEU A HD12 2  
ATOM   3381  H  HD13 . LEU B 2 74  ? -12.021 0.808   2.827   1.00 0.00 ? 332 LEU A HD13 2  
ATOM   3382  H  HD21 . LEU B 2 74  ? -9.808  2.003   5.374   1.00 0.00 ? 332 LEU A HD21 2  
ATOM   3383  H  HD22 . LEU B 2 74  ? -8.655  2.837   4.325   1.00 0.00 ? 332 LEU A HD22 2  
ATOM   3384  H  HD23 . LEU B 2 74  ? -8.729  1.072   4.332   1.00 0.00 ? 332 LEU A HD23 2  
ATOM   3385  N  N    . PHE B 2 75  ? -6.413  1.925   1.445   1.00 0.00 ? 333 PHE A N    2  
ATOM   3386  C  CA   . PHE B 2 75  ? -5.222  1.278   0.980   1.00 0.00 ? 333 PHE A CA   2  
ATOM   3387  C  C    . PHE B 2 75  ? -4.997  -0.005  1.720   1.00 0.00 ? 333 PHE A C    2  
ATOM   3388  O  O    . PHE B 2 75  ? -4.409  -0.032  2.800   1.00 0.00 ? 333 PHE A O    2  
ATOM   3389  C  CB   . PHE B 2 75  ? -4.054  2.263   1.122   1.00 0.00 ? 333 PHE A CB   2  
ATOM   3390  C  CG   . PHE B 2 75  ? -4.527  3.648   0.740   1.00 0.00 ? 333 PHE A CG   2  
ATOM   3391  C  CD1  . PHE B 2 75  ? -5.392  4.348   1.557   1.00 0.00 ? 333 PHE A CD1  2  
ATOM   3392  C  CD2  . PHE B 2 75  ? -4.190  4.196   -0.469  1.00 0.00 ? 333 PHE A CD2  2  
ATOM   3393  C  CE1  . PHE B 2 75  ? -5.894  5.563   1.170   1.00 0.00 ? 333 PHE A CE1  2  
ATOM   3394  C  CE2  . PHE B 2 75  ? -4.700  5.417   -0.880  1.00 0.00 ? 333 PHE A CE2  2  
ATOM   3395  C  CZ   . PHE B 2 75  ? -5.557  6.098   -0.047  1.00 0.00 ? 333 PHE A CZ   2  
ATOM   3396  H  H    . PHE B 2 75  ? -6.359  2.525   2.219   1.00 0.00 ? 333 PHE A H    2  
ATOM   3397  H  HA   . PHE B 2 75  ? -5.369  1.057   -0.069  1.00 0.00 ? 333 PHE A HA   2  
ATOM   3398  H  HB2  . PHE B 2 75  ? -3.690  2.280   2.145   1.00 0.00 ? 333 PHE A HB2  2  
ATOM   3399  H  HB3  . PHE B 2 75  ? -3.250  1.966   0.461   1.00 0.00 ? 333 PHE A HB3  2  
ATOM   3400  H  HD1  . PHE B 2 75  ? -5.663  3.935   2.517   1.00 0.00 ? 333 PHE A HD1  2  
ATOM   3401  H  HD2  . PHE B 2 75  ? -3.532  3.665   -1.088  1.00 0.00 ? 333 PHE A HD2  2  
ATOM   3402  H  HE1  . PHE B 2 75  ? -6.563  6.100   1.825   1.00 0.00 ? 333 PHE A HE1  2  
ATOM   3403  H  HE2  . PHE B 2 75  ? -4.415  5.843   -1.851  1.00 0.00 ? 333 PHE A HE2  2  
ATOM   3404  H  HZ   . PHE B 2 75  ? -5.982  7.036   -0.351  1.00 0.00 ? 333 PHE A HZ   2  
ATOM   3405  N  N    . CYS B 2 76  ? -5.480  -1.073  1.116   1.00 0.00 ? 334 CYS A N    2  
ATOM   3406  C  CA   . CYS B 2 76  ? -5.333  -2.379  1.690   1.00 0.00 ? 334 CYS A CA   2  
ATOM   3407  C  C    . CYS B 2 76  ? -3.866  -2.687  1.819   1.00 0.00 ? 334 CYS A C    2  
ATOM   3408  O  O    . CYS B 2 76  ? -3.237  -3.045  0.829   1.00 0.00 ? 334 CYS A O    2  
ATOM   3409  C  CB   . CYS B 2 76  ? -5.996  -3.438  0.806   1.00 0.00 ? 334 CYS A CB   2  
ATOM   3410  S  SG   . CYS B 2 76  ? -5.406  -5.123  1.150   1.00 0.00 ? 334 CYS A SG   2  
ATOM   3411  H  H    . CYS B 2 76  ? -5.950  -0.972  0.258   1.00 0.00 ? 334 CYS A H    2  
ATOM   3412  H  HA   . CYS B 2 76  ? -5.790  -2.380  2.662   1.00 0.00 ? 334 CYS A HA   2  
ATOM   3413  H  HB2  . CYS B 2 76  ? -7.064  -3.419  0.969   1.00 0.00 ? 334 CYS A HB2  2  
ATOM   3414  H  HB3  . CYS B 2 76  ? -5.787  -3.218  -0.230  1.00 0.00 ? 334 CYS A HB3  2  
ATOM   3415  N  N    . ASP B 2 77  ? -3.284  -2.542  3.004   1.00 0.00 ? 335 ASP A N    2  
ATOM   3416  C  CA   . ASP B 2 77  ? -1.874  -2.850  3.097   1.00 0.00 ? 335 ASP A CA   2  
ATOM   3417  C  C    . ASP B 2 77  ? -1.671  -4.360  3.148   1.00 0.00 ? 335 ASP A C    2  
ATOM   3418  O  O    . ASP B 2 77  ? -0.899  -4.870  3.962   1.00 0.00 ? 335 ASP A O    2  
ATOM   3419  C  CB   . ASP B 2 77  ? -1.163  -2.175  4.260   1.00 0.00 ? 335 ASP A CB   2  
ATOM   3420  C  CG   . ASP B 2 77  ? -2.108  -1.488  5.220   1.00 0.00 ? 335 ASP A CG   2  
ATOM   3421  O  OD1  . ASP B 2 77  ? -2.468  -0.319  4.967   1.00 0.00 ? 335 ASP A OD1  2  
ATOM   3422  O  OD2  . ASP B 2 77  ? -2.489  -2.120  6.228   1.00 0.00 ? 335 ASP A OD2  2  
ATOM   3423  H  H    . ASP B 2 77  ? -3.796  -2.241  3.795   1.00 0.00 ? 335 ASP A H    2  
ATOM   3424  H  HA   . ASP B 2 77  ? -1.435  -2.474  2.177   1.00 0.00 ? 335 ASP A HA   2  
ATOM   3425  H  HB2  . ASP B 2 77  ? -0.598  -2.920  4.802   1.00 0.00 ? 335 ASP A HB2  2  
ATOM   3426  H  HB3  . ASP B 2 77  ? -0.474  -1.441  3.854   1.00 0.00 ? 335 ASP A HB3  2  
ATOM   3427  N  N    . ASP B 2 78  ? -2.428  -5.070  2.311   1.00 0.00 ? 336 ASP A N    2  
ATOM   3428  C  CA   . ASP B 2 78  ? -2.314  -6.514  2.181   1.00 0.00 ? 336 ASP A CA   2  
ATOM   3429  C  C    . ASP B 2 78  ? -2.025  -6.849  0.717   1.00 0.00 ? 336 ASP A C    2  
ATOM   3430  O  O    . ASP B 2 78  ? -2.009  -8.012  0.312   1.00 0.00 ? 336 ASP A O    2  
ATOM   3431  C  CB   . ASP B 2 78  ? -3.600  -7.197  2.653   1.00 0.00 ? 336 ASP A CB   2  
ATOM   3432  C  CG   . ASP B 2 78  ? -3.401  -8.650  3.028   1.00 0.00 ? 336 ASP A CG   2  
ATOM   3433  O  OD1  . ASP B 2 78  ? -3.228  -9.483  2.115   1.00 0.00 ? 336 ASP A OD1  2  
ATOM   3434  O  OD2  . ASP B 2 78  ? -3.430  -8.957  4.238   1.00 0.00 ? 336 ASP A OD2  2  
ATOM   3435  H  H    . ASP B 2 78  ? -3.117  -4.610  1.793   1.00 0.00 ? 336 ASP A H    2  
ATOM   3436  H  HA   . ASP B 2 78  ? -1.483  -6.835  2.784   1.00 0.00 ? 336 ASP A HA   2  
ATOM   3437  H  HB2  . ASP B 2 78  ? -3.981  -6.674  3.516   1.00 0.00 ? 336 ASP A HB2  2  
ATOM   3438  H  HB3  . ASP B 2 78  ? -4.331  -7.151  1.861   1.00 0.00 ? 336 ASP A HB3  2  
ATOM   3439  N  N    . CYS B 2 79  ? -1.782  -5.787  -0.055  1.00 0.00 ? 337 CYS A N    2  
ATOM   3440  C  CA   . CYS B 2 79  ? -1.473  -5.862  -1.480  1.00 0.00 ? 337 CYS A CA   2  
ATOM   3441  C  C    . CYS B 2 79  ? -1.422  -4.447  -2.055  1.00 0.00 ? 337 CYS A C    2  
ATOM   3442  O  O    . CYS B 2 79  ? -0.725  -4.180  -3.029  1.00 0.00 ? 337 CYS A O    2  
ATOM   3443  C  CB   . CYS B 2 79  ? -2.517  -6.672  -2.228  1.00 0.00 ? 337 CYS A CB   2  
ATOM   3444  S  SG   . CYS B 2 79  ? -4.109  -5.801  -2.386  1.00 0.00 ? 337 CYS A SG   2  
ATOM   3445  H  H    . CYS B 2 79  ? -1.805  -4.906  0.360   1.00 0.00 ? 337 CYS A H    2  
ATOM   3446  H  HA   . CYS B 2 79  ? -0.503  -6.324  -1.587  1.00 0.00 ? 337 CYS A HA   2  
ATOM   3447  H  HB2  . CYS B 2 79  ? -2.151  -6.882  -3.223  1.00 0.00 ? 337 CYS A HB2  2  
ATOM   3448  H  HB3  . CYS B 2 79  ? -2.685  -7.601  -1.708  1.00 0.00 ? 337 CYS A HB3  2  
ATOM   3449  N  N    . ASP B 2 80  ? -2.216  -3.569  -1.438  1.00 0.00 ? 338 ASP A N    2  
ATOM   3450  C  CA   . ASP B 2 80  ? -2.284  -2.142  -1.772  1.00 0.00 ? 338 ASP A CA   2  
ATOM   3451  C  C    . ASP B 2 80  ? -3.332  -1.809  -2.832  1.00 0.00 ? 338 ASP A C    2  
ATOM   3452  O  O    . ASP B 2 80  ? -3.039  -1.138  -3.823  1.00 0.00 ? 338 ASP A O    2  
ATOM   3453  C  CB   . ASP B 2 80  ? -0.916  -1.589  -2.170  1.00 0.00 ? 338 ASP A CB   2  
ATOM   3454  C  CG   . ASP B 2 80  ? -0.937  -0.081  -2.333  1.00 0.00 ? 338 ASP A CG   2  
ATOM   3455  O  OD1  . ASP B 2 80  ? -1.855  0.562   -1.777  1.00 0.00 ? 338 ASP A OD1  2  
ATOM   3456  O  OD2  . ASP B 2 80  ? -0.038  0.457   -3.011  1.00 0.00 ? 338 ASP A OD2  2  
ATOM   3457  H  H    . ASP B 2 80  ? -2.799  -3.900  -0.726  1.00 0.00 ? 338 ASP A H    2  
ATOM   3458  H  HA   . ASP B 2 80  ? -2.584  -1.638  -0.865  1.00 0.00 ? 338 ASP A HA   2  
ATOM   3459  H  HB2  . ASP B 2 80  ? -0.196  -1.837  -1.400  1.00 0.00 ? 338 ASP A HB2  2  
ATOM   3460  H  HB3  . ASP B 2 80  ? -0.610  -2.033  -3.104  1.00 0.00 ? 338 ASP A HB3  2  
ATOM   3461  N  N    . ARG B 2 81  ? -4.554  -2.283  -2.620  1.00 0.00 ? 339 ARG A N    2  
ATOM   3462  C  CA   . ARG B 2 81  ? -5.658  -1.966  -3.515  1.00 0.00 ? 339 ARG A CA   2  
ATOM   3463  C  C    . ARG B 2 81  ? -6.531  -0.900  -2.847  1.00 0.00 ? 339 ARG A C    2  
ATOM   3464  O  O    . ARG B 2 81  ? -7.342  -1.217  -1.975  1.00 0.00 ? 339 ARG A O    2  
ATOM   3465  C  CB   . ARG B 2 81  ? -6.501  -3.208  -3.825  1.00 0.00 ? 339 ARG A CB   2  
ATOM   3466  C  CG   . ARG B 2 81  ? -5.826  -4.243  -4.709  1.00 0.00 ? 339 ARG A CG   2  
ATOM   3467  C  CD   . ARG B 2 81  ? -6.722  -5.467  -4.873  1.00 0.00 ? 339 ARG A CD   2  
ATOM   3468  N  NE   . ARG B 2 81  ? -6.088  -6.686  -4.378  1.00 0.00 ? 339 ARG A NE   2  
ATOM   3469  C  CZ   . ARG B 2 81  ? -5.346  -7.488  -5.136  1.00 0.00 ? 339 ARG A CZ   2  
ATOM   3470  N  NH1  . ARG B 2 81  ? -5.138  -7.194  -6.412  1.00 0.00 ? 339 ARG A NH1  2  
ATOM   3471  N  NH2  . ARG B 2 81  ? -4.807  -8.583  -4.616  1.00 0.00 ? 339 ARG A NH2  2  
ATOM   3472  H  H    . ARG B 2 81  ? -4.715  -2.871  -1.853  1.00 0.00 ? 339 ARG A H    2  
ATOM   3473  H  HA   . ARG B 2 81  ? -5.248  -1.567  -4.432  1.00 0.00 ? 339 ARG A HA   2  
ATOM   3474  H  HB2  . ARG B 2 81  ? -6.768  -3.689  -2.899  1.00 0.00 ? 339 ARG A HB2  2  
ATOM   3475  H  HB3  . ARG B 2 81  ? -7.399  -2.890  -4.321  1.00 0.00 ? 339 ARG A HB3  2  
ATOM   3476  H  HG2  . ARG B 2 81  ? -5.634  -3.810  -5.680  1.00 0.00 ? 339 ARG A HG2  2  
ATOM   3477  H  HG3  . ARG B 2 81  ? -4.893  -4.544  -4.256  1.00 0.00 ? 339 ARG A HG3  2  
ATOM   3478  H  HD2  . ARG B 2 81  ? -7.638  -5.299  -4.324  1.00 0.00 ? 339 ARG A HD2  2  
ATOM   3479  H  HD3  . ARG B 2 81  ? -6.964  -5.596  -5.914  1.00 0.00 ? 339 ARG A HD3  2  
ATOM   3480  H  HE   . ARG B 2 81  ? -6.225  -6.919  -3.435  1.00 0.00 ? 339 ARG A HE   2  
ATOM   3481  H  HH11 . ARG B 2 81  ? -5.539  -6.367  -6.807  1.00 0.00 ? 339 ARG A HH11 2  
ATOM   3482  H  HH12 . ARG B 2 81  ? -4.580  -7.799  -6.980  1.00 0.00 ? 339 ARG A HH12 2  
ATOM   3483  H  HH21 . ARG B 2 81  ? -4.958  -8.805  -3.652  1.00 0.00 ? 339 ARG A HH21 2  
ATOM   3484  H  HH22 . ARG B 2 81  ? -4.252  -9.185  -5.187  1.00 0.00 ? 339 ARG A HH22 2  
ATOM   3485  N  N    . GLY B 2 82  ? -6.352  0.366   -3.235  1.00 0.00 ? 340 GLY A N    2  
ATOM   3486  C  CA   . GLY B 2 82  ? -7.125  1.442   -2.626  1.00 0.00 ? 340 GLY A CA   2  
ATOM   3487  C  C    . GLY B 2 82  ? -8.584  1.442   -3.030  1.00 0.00 ? 340 GLY A C    2  
ATOM   3488  O  O    . GLY B 2 82  ? -8.910  1.326   -4.199  1.00 0.00 ? 340 GLY A O    2  
ATOM   3489  H  H    . GLY B 2 82  ? -5.694  0.569   -3.934  1.00 0.00 ? 340 GLY A H    2  
ATOM   3490  H  HA2  . GLY B 2 82  ? -7.067  1.334   -1.561  1.00 0.00 ? 340 GLY A HA2  2  
ATOM   3491  H  HA3  . GLY B 2 82  ? -6.695  2.394   -2.890  1.00 0.00 ? 340 GLY A HA3  2  
ATOM   3492  N  N    . TYR B 2 83  ? -9.464  1.603   -2.057  1.00 0.00 ? 341 TYR A N    2  
ATOM   3493  C  CA   . TYR B 2 83  ? -10.906 1.632   -2.331  1.00 0.00 ? 341 TYR A CA   2  
ATOM   3494  C  C    . TYR B 2 83  ? -11.522 2.796   -1.622  1.00 0.00 ? 341 TYR A C    2  
ATOM   3495  O  O    . TYR B 2 83  ? -11.607 2.751   -0.396  1.00 0.00 ? 341 TYR A O    2  
ATOM   3496  C  CB   . TYR B 2 83  ? -11.728 0.465   -1.769  1.00 0.00 ? 341 TYR A CB   2  
ATOM   3497  C  CG   . TYR B 2 83  ? -11.408 -0.964  -2.139  1.00 0.00 ? 341 TYR A CG   2  
ATOM   3498  C  CD1  . TYR B 2 83  ? -10.259 -1.324  -2.786  1.00 0.00 ? 341 TYR A CD1  2  
ATOM   3499  C  CD2  . TYR B 2 83  ? -12.322 -1.969  -1.822  1.00 0.00 ? 341 TYR A CD2  2  
ATOM   3500  C  CE1  . TYR B 2 83  ? -10.012 -2.641  -3.117  1.00 0.00 ? 341 TYR A CE1  2  
ATOM   3501  C  CE2  . TYR B 2 83  ? -12.083 -3.286  -2.147  1.00 0.00 ? 341 TYR A CE2  2  
ATOM   3502  C  CZ   . TYR B 2 83  ? -10.922 -3.615  -2.797  1.00 0.00 ? 341 TYR A CZ   2  
ATOM   3503  O  OH   . TYR B 2 83  ? -10.664 -4.923  -3.130  1.00 0.00 ? 341 TYR A OH   2  
ATOM   3504  H  H    . TYR B 2 83  ? -9.135  1.780   -1.149  1.00 0.00 ? 341 TYR A H    2  
ATOM   3505  H  HA   . TYR B 2 83  ? -11.066 1.719   -3.391  1.00 0.00 ? 341 TYR A HA   2  
ATOM   3506  H  HB2  . TYR B 2 83  ? -11.721 0.527   -0.696  1.00 0.00 ? 341 TYR A HB2  2  
ATOM   3507  H  HB3  . TYR B 2 83  ? -12.742 0.644   -2.078  1.00 0.00 ? 341 TYR A HB3  2  
ATOM   3508  H  HD1  . TYR B 2 83  ? -9.547  -0.564  -3.041  1.00 0.00 ? 341 TYR A HD1  2  
ATOM   3509  H  HD2  . TYR B 2 83  ? -13.235 -1.702  -1.310  1.00 0.00 ? 341 TYR A HD2  2  
ATOM   3510  H  HE1  . TYR B 2 83  ? -9.107  -2.897  -3.640  1.00 0.00 ? 341 TYR A HE1  2  
ATOM   3511  H  HE2  . TYR B 2 83  ? -12.805 -4.047  -1.892  1.00 0.00 ? 341 TYR A HE2  2  
ATOM   3512  H  HH   . TYR B 2 83  ? -9.734  -5.113  -2.983  1.00 0.00 ? 341 TYR A HH   2  
ATOM   3513  N  N    . HIS B 2 84  ? -12.008 3.808   -2.321  1.00 0.00 ? 342 HIS A N    2  
ATOM   3514  C  CA   . HIS B 2 84  ? -12.638 4.869   -1.587  1.00 0.00 ? 342 HIS A CA   2  
ATOM   3515  C  C    . HIS B 2 84  ? -13.540 4.174   -0.617  1.00 0.00 ? 342 HIS A C    2  
ATOM   3516  O  O    . HIS B 2 84  ? -14.338 3.349   -1.018  1.00 0.00 ? 342 HIS A O    2  
ATOM   3517  C  CB   . HIS B 2 84  ? -13.421 5.797   -2.479  1.00 0.00 ? 342 HIS A CB   2  
ATOM   3518  C  CG   . HIS B 2 84  ? -12.565 6.588   -3.395  1.00 0.00 ? 342 HIS A CG   2  
ATOM   3519  N  ND1  . HIS B 2 84  ? -12.408 6.265   -4.711  1.00 0.00 ? 342 HIS A ND1  2  
ATOM   3520  C  CD2  . HIS B 2 84  ? -11.821 7.707   -3.194  1.00 0.00 ? 342 HIS A CD2  2  
ATOM   3521  C  CE1  . HIS B 2 84  ? -11.616 7.143   -5.295  1.00 0.00 ? 342 HIS A CE1  2  
ATOM   3522  N  NE2  . HIS B 2 84  ? -11.249 8.032   -4.398  1.00 0.00 ? 342 HIS A NE2  2  
ATOM   3523  H  H    . HIS B 2 84  ? -11.991 3.812   -3.300  1.00 0.00 ? 342 HIS A H    2  
ATOM   3524  H  HA   . HIS B 2 84  ? -11.881 5.411   -1.047  1.00 0.00 ? 342 HIS A HA   2  
ATOM   3525  H  HB2  . HIS B 2 84  ? -14.095 5.212   -3.074  1.00 0.00 ? 342 HIS A HB2  2  
ATOM   3526  H  HB3  . HIS B 2 84  ? -13.981 6.479   -1.871  1.00 0.00 ? 342 HIS A HB3  2  
ATOM   3527  H  HD2  . HIS B 2 84  ? -11.648 8.211   -2.252  1.00 0.00 ? 342 HIS A HD2  2  
ATOM   3528  H  HE1  . HIS B 2 84  ? -11.289 7.109   -6.326  1.00 0.00 ? 342 HIS A HE1  2  
ATOM   3529  H  HE2  . HIS B 2 84  ? -10.798 8.877   -4.599  1.00 0.00 ? 342 HIS A HE2  2  
ATOM   3530  N  N    . MET B 2 85  ? -13.345 4.436   0.651   1.00 0.00 ? 343 MET A N    2  
ATOM   3531  C  CA   . MET B 2 85  ? -14.098 3.768   1.690   1.00 0.00 ? 343 MET A CA   2  
ATOM   3532  C  C    . MET B 2 85  ? -15.580 3.678   1.385   1.00 0.00 ? 343 MET A C    2  
ATOM   3533  O  O    . MET B 2 85  ? -16.310 2.999   2.089   1.00 0.00 ? 343 MET A O    2  
ATOM   3534  C  CB   . MET B 2 85  ? -13.877 4.436   3.022   1.00 0.00 ? 343 MET A CB   2  
ATOM   3535  C  CG   . MET B 2 85  ? -12.477 4.326   3.540   1.00 0.00 ? 343 MET A CG   2  
ATOM   3536  S  SD   . MET B 2 85  ? -11.719 5.891   4.031   1.00 0.00 ? 343 MET A SD   2  
ATOM   3537  C  CE   . MET B 2 85  ? -13.109 6.723   4.763   1.00 0.00 ? 343 MET A CE   2  
ATOM   3538  H  H    . MET B 2 85  ? -12.676 5.101   0.897   1.00 0.00 ? 343 MET A H    2  
ATOM   3539  H  HA   . MET B 2 85  ? -13.719 2.761   1.755   1.00 0.00 ? 343 MET A HA   2  
ATOM   3540  H  HB2  . MET B 2 85  ? -14.134 5.461   2.946   1.00 0.00 ? 343 MET A HB2  2  
ATOM   3541  H  HB3  . MET B 2 85  ? -14.505 3.960   3.727   1.00 0.00 ? 343 MET A HB3  2  
ATOM   3542  H  HG2  . MET B 2 85  ? -12.494 3.685   4.394   1.00 0.00 ? 343 MET A HG2  2  
ATOM   3543  H  HG3  . MET B 2 85  ? -11.886 3.874   2.774   1.00 0.00 ? 343 MET A HG3  2  
ATOM   3544  H  HE1  . MET B 2 85  ? -14.001 6.442   4.227   1.00 0.00 ? 343 MET A HE1  2  
ATOM   3545  H  HE2  . MET B 2 85  ? -12.969 7.792   4.699   1.00 0.00 ? 343 MET A HE2  2  
ATOM   3546  H  HE3  . MET B 2 85  ? -13.202 6.431   5.796   1.00 0.00 ? 343 MET A HE3  2  
ATOM   3547  N  N    . TYR B 2 86  ? -16.033 4.366   0.356   1.00 0.00 ? 344 TYR A N    2  
ATOM   3548  C  CA   . TYR B 2 86  ? -17.424 4.283   -0.022  1.00 0.00 ? 344 TYR A CA   2  
ATOM   3549  C  C    . TYR B 2 86  ? -17.540 3.663   -1.409  1.00 0.00 ? 344 TYR A C    2  
ATOM   3550  O  O    . TYR B 2 86  ? -18.483 3.916   -2.160  1.00 0.00 ? 344 TYR A O    2  
ATOM   3551  C  CB   . TYR B 2 86  ? -18.123 5.637   0.081   1.00 0.00 ? 344 TYR A CB   2  
ATOM   3552  C  CG   . TYR B 2 86  ? -17.663 6.692   -0.895  1.00 0.00 ? 344 TYR A CG   2  
ATOM   3553  C  CD1  . TYR B 2 86  ? -16.338 7.133   -0.941  1.00 0.00 ? 344 TYR A CD1  2  
ATOM   3554  C  CD2  . TYR B 2 86  ? -18.585 7.290   -1.740  1.00 0.00 ? 344 TYR A CD2  2  
ATOM   3555  C  CE1  . TYR B 2 86  ? -15.960 8.139   -1.811  1.00 0.00 ? 344 TYR A CE1  2  
ATOM   3556  C  CE2  . TYR B 2 86  ? -18.213 8.284   -2.614  1.00 0.00 ? 344 TYR A CE2  2  
ATOM   3557  C  CZ   . TYR B 2 86  ? -16.907 8.708   -2.647  1.00 0.00 ? 344 TYR A CZ   2  
ATOM   3558  O  OH   . TYR B 2 86  ? -16.553 9.709   -3.514  1.00 0.00 ? 344 TYR A OH   2  
ATOM   3559  H  H    . TYR B 2 86  ? -15.423 4.927   -0.158  1.00 0.00 ? 344 TYR A H    2  
ATOM   3560  H  HA   . TYR B 2 86  ? -17.890 3.601   0.680   1.00 0.00 ? 344 TYR A HA   2  
ATOM   3561  H  HB2  . TYR B 2 86  ? -19.181 5.492   -0.080  1.00 0.00 ? 344 TYR A HB2  2  
ATOM   3562  H  HB3  . TYR B 2 86  ? -17.974 6.026   1.079   1.00 0.00 ? 344 TYR A HB3  2  
ATOM   3563  H  HD1  . TYR B 2 86  ? -15.594 6.674   -0.294  1.00 0.00 ? 344 TYR A HD1  2  
ATOM   3564  H  HD2  . TYR B 2 86  ? -19.612 6.957   -1.713  1.00 0.00 ? 344 TYR A HD2  2  
ATOM   3565  H  HE1  . TYR B 2 86  ? -14.928 8.477   -1.830  1.00 0.00 ? 344 TYR A HE1  2  
ATOM   3566  H  HE2  . TYR B 2 86  ? -18.948 8.731   -3.267  1.00 0.00 ? 344 TYR A HE2  2  
ATOM   3567  H  HH   . TYR B 2 86  ? -17.212 10.406  -3.485  1.00 0.00 ? 344 TYR A HH   2  
ATOM   3568  N  N    . CYS B 2 87  ? -16.543 2.836   -1.716  1.00 0.00 ? 345 CYS A N    2  
ATOM   3569  C  CA   . CYS B 2 87  ? -16.478 2.084   -2.959  1.00 0.00 ? 345 CYS A CA   2  
ATOM   3570  C  C    . CYS B 2 87  ? -16.566 0.616   -2.582  1.00 0.00 ? 345 CYS A C    2  
ATOM   3571  O  O    . CYS B 2 87  ? -17.128 -0.200  -3.314  1.00 0.00 ? 345 CYS A O    2  
ATOM   3572  C  CB   . CYS B 2 87  ? -15.194 2.366   -3.798  1.00 0.00 ? 345 CYS A CB   2  
ATOM   3573  S  SG   . CYS B 2 87  ? -15.231 3.992   -4.672  1.00 0.00 ? 345 CYS A SG   2  
ATOM   3574  H  H    . CYS B 2 87  ? -15.837 2.703   -1.057  1.00 0.00 ? 345 CYS A H    2  
ATOM   3575  H  HA   . CYS B 2 87  ? -17.344 2.344   -3.538  1.00 0.00 ? 345 CYS A HA   2  
ATOM   3576  H  HB2  . CYS B 2 87  ? -14.315 2.319   -3.164  1.00 0.00 ? 345 CYS A HB2  2  
ATOM   3577  H  HB3  . CYS B 2 87  ? -15.108 1.595   -4.549  1.00 0.00 ? 345 CYS A HB3  2  
ATOM   3578  N  N    . LEU B 2 88  ? -16.007 0.301   -1.402  1.00 0.00 ? 346 LEU A N    2  
ATOM   3579  C  CA   . LEU B 2 88  ? -16.018 -1.063  -0.869  1.00 0.00 ? 346 LEU A CA   2  
ATOM   3580  C  C    . LEU B 2 88  ? -17.415 -1.659  -0.875  1.00 0.00 ? 346 LEU A C    2  
ATOM   3581  O  O    . LEU B 2 88  ? -18.396 -0.991  -1.202  1.00 0.00 ? 346 LEU A O    2  
ATOM   3582  C  CB   . LEU B 2 88  ? -15.495 -1.115  0.573   1.00 0.00 ? 346 LEU A CB   2  
ATOM   3583  C  CG   . LEU B 2 88  ? -14.888 0.165   1.149   1.00 0.00 ? 346 LEU A CG   2  
ATOM   3584  C  CD1  . LEU B 2 88  ? -14.388 -0.055  2.547   1.00 0.00 ? 346 LEU A CD1  2  
ATOM   3585  C  CD2  . LEU B 2 88  ? -13.765 0.631   0.289   1.00 0.00 ? 346 LEU A CD2  2  
ATOM   3586  H  H    . LEU B 2 88  ? -15.553 1.010   -0.885  1.00 0.00 ? 346 LEU A H    2  
ATOM   3587  H  HA   . LEU B 2 88  ? -15.381 -1.668  -1.477  1.00 0.00 ? 346 LEU A HA   2  
ATOM   3588  H  HB2  . LEU B 2 88  ? -16.313 -1.401  1.194   1.00 0.00 ? 346 LEU A HB2  2  
ATOM   3589  H  HB3  . LEU B 2 88  ? -14.747 -1.890  0.627   1.00 0.00 ? 346 LEU A HB3  2  
ATOM   3590  H  HG   . LEU B 2 88  ? -15.619 0.947   1.189   1.00 0.00 ? 346 LEU A HG   2  
ATOM   3591  H  HD11 . LEU B 2 88  ? -13.601 0.654   2.731   1.00 0.00 ? 346 LEU A HD11 2  
ATOM   3592  H  HD12 . LEU B 2 88  ? -14.005 -1.062  2.644   1.00 0.00 ? 346 LEU A HD12 2  
ATOM   3593  H  HD13 . LEU B 2 88  ? -15.190 0.100   3.252   1.00 0.00 ? 346 LEU A HD13 2  
ATOM   3594  H  HD21 . LEU B 2 88  ? -13.880 0.195   -0.693  1.00 0.00 ? 346 LEU A HD21 2  
ATOM   3595  H  HD22 . LEU B 2 88  ? -12.825 0.314   0.719   1.00 0.00 ? 346 LEU A HD22 2  
ATOM   3596  H  HD23 . LEU B 2 88  ? -13.785 1.705   0.212   1.00 0.00 ? 346 LEU A HD23 2  
ATOM   3597  N  N    . ASN B 2 89  ? -17.489 -2.926  -0.497  1.00 0.00 ? 347 ASN A N    2  
ATOM   3598  C  CA   . ASN B 2 89  ? -18.749 -3.622  -0.402  1.00 0.00 ? 347 ASN A CA   2  
ATOM   3599  C  C    . ASN B 2 89  ? -19.332 -3.289  0.940   1.00 0.00 ? 347 ASN A C    2  
ATOM   3600  O  O    . ASN B 2 89  ? -20.536 -3.062  1.068   1.00 0.00 ? 347 ASN A O    2  
ATOM   3601  C  CB   . ASN B 2 89  ? -18.541 -5.114  -0.558  1.00 0.00 ? 347 ASN A CB   2  
ATOM   3602  C  CG   . ASN B 2 89  ? -19.749 -5.823  -1.106  1.00 0.00 ? 347 ASN A CG   2  
ATOM   3603  O  OD1  . ASN B 2 89  ? -20.889 -5.481  -0.792  1.00 0.00 ? 347 ASN A OD1  2  
ATOM   3604  N  ND2  . ASN B 2 89  ? -19.500 -6.814  -1.944  1.00 0.00 ? 347 ASN A ND2  2  
ATOM   3605  H  H    . ASN B 2 89  ? -16.674 -3.400  -0.249  1.00 0.00 ? 347 ASN A H    2  
ATOM   3606  H  HA   . ASN B 2 89  ? -19.401 -3.244  -1.162  1.00 0.00 ? 347 ASN A HA   2  
ATOM   3607  H  HB2  . ASN B 2 89  ? -17.722 -5.278  -1.225  1.00 0.00 ? 347 ASN A HB2  2  
ATOM   3608  H  HB3  . ASN B 2 89  ? -18.299 -5.532  0.403   1.00 0.00 ? 347 ASN A HB3  2  
ATOM   3609  H  HD21 . ASN B 2 89  ? -18.564 -7.022  -2.150  1.00 0.00 ? 347 ASN A HD21 2  
ATOM   3610  H  HD22 . ASN B 2 89  ? -20.253 -7.288  -2.326  1.00 0.00 ? 347 ASN A HD22 2  
ATOM   3611  N  N    . PRO B 2 90  ? -18.484 -3.320  1.980   1.00 0.00 ? 348 PRO A N    2  
ATOM   3612  C  CA   . PRO B 2 90  ? -18.843 -2.881  3.290   1.00 0.00 ? 348 PRO A CA   2  
ATOM   3613  C  C    . PRO B 2 90  ? -18.184 -1.515  3.494   1.00 0.00 ? 348 PRO A C    2  
ATOM   3614  O  O    . PRO B 2 90  ? -17.327 -1.349  4.362   1.00 0.00 ? 348 PRO A O    2  
ATOM   3615  C  CB   . PRO B 2 90  ? -18.193 -3.951  4.143   1.00 0.00 ? 348 PRO A CB   2  
ATOM   3616  C  CG   . PRO B 2 90  ? -16.892 -4.196  3.470   1.00 0.00 ? 348 PRO A CG   2  
ATOM   3617  C  CD   . PRO B 2 90  ? -17.120 -3.901  2.011   1.00 0.00 ? 348 PRO A CD   2  
ATOM   3618  H  HA   . PRO B 2 90  ? -19.904 -2.844  3.434   1.00 0.00 ? 348 PRO A HA   2  
ATOM   3619  H  HB2  . PRO B 2 90  ? -18.054 -3.586  5.135   1.00 0.00 ? 348 PRO A HB2  2  
ATOM   3620  H  HB3  . PRO B 2 90  ? -18.807 -4.837  4.148   1.00 0.00 ? 348 PRO A HB3  2  
ATOM   3621  H  HG2  . PRO B 2 90  ? -16.145 -3.531  3.872   1.00 0.00 ? 348 PRO A HG2  2  
ATOM   3622  H  HG3  . PRO B 2 90  ? -16.594 -5.225  3.602   1.00 0.00 ? 348 PRO A HG3  2  
ATOM   3623  H  HD2  . PRO B 2 90  ? -16.389 -3.196  1.647   1.00 0.00 ? 348 PRO A HD2  2  
ATOM   3624  H  HD3  . PRO B 2 90  ? -17.081 -4.812  1.449   1.00 0.00 ? 348 PRO A HD3  2  
ATOM   3625  N  N    . PRO B 2 91  ? -18.588 -0.511  2.679   1.00 0.00 ? 349 PRO A N    2  
ATOM   3626  C  CA   . PRO B 2 91  ? -17.970 0.817   2.675   1.00 0.00 ? 349 PRO A CA   2  
ATOM   3627  C  C    . PRO B 2 91  ? -17.892 1.473   4.050   1.00 0.00 ? 349 PRO A C    2  
ATOM   3628  O  O    . PRO B 2 91  ? -18.854 1.439   4.817   1.00 0.00 ? 349 PRO A O    2  
ATOM   3629  C  CB   . PRO B 2 91  ? -18.867 1.631   1.735   1.00 0.00 ? 349 PRO A CB   2  
ATOM   3630  C  CG   . PRO B 2 91  ? -20.133 0.882   1.672   1.00 0.00 ? 349 PRO A CG   2  
ATOM   3631  C  CD   . PRO B 2 91  ? -19.737 -0.551  1.758   1.00 0.00 ? 349 PRO A CD   2  
ATOM   3632  H  HA   . PRO B 2 91  ? -16.987 0.772   2.242   1.00 0.00 ? 349 PRO A HA   2  
ATOM   3633  H  HB2  . PRO B 2 91  ? -19.011 2.615   2.128   1.00 0.00 ? 349 PRO A HB2  2  
ATOM   3634  H  HB3  . PRO B 2 91  ? -18.411 1.694   0.767   1.00 0.00 ? 349 PRO A HB3  2  
ATOM   3635  H  HG2  . PRO B 2 91  ? -20.756 1.156   2.500   1.00 0.00 ? 349 PRO A HG2  2  
ATOM   3636  H  HG3  . PRO B 2 91  ? -20.629 1.079   0.743   1.00 0.00 ? 349 PRO A HG3  2  
ATOM   3637  H  HD2  . PRO B 2 91  ? -20.546 -1.133  2.166   1.00 0.00 ? 349 PRO A HD2  2  
ATOM   3638  H  HD3  . PRO B 2 91  ? -19.444 -0.932  0.785   1.00 0.00 ? 349 PRO A HD3  2  
ATOM   3639  N  N    . VAL B 2 92  ? -16.735 2.072   4.361   1.00 0.00 ? 350 VAL A N    2  
ATOM   3640  C  CA   . VAL B 2 92  ? -16.545 2.745   5.611   1.00 0.00 ? 350 VAL A CA   2  
ATOM   3641  C  C    . VAL B 2 92  ? -16.580 4.242   5.351   1.00 0.00 ? 350 VAL A C    2  
ATOM   3642  O  O    . VAL B 2 92  ? -16.617 4.680   4.202   1.00 0.00 ? 350 VAL A O    2  
ATOM   3643  C  CB   . VAL B 2 92  ? -15.216 2.312   6.291   1.00 0.00 ? 350 VAL A CB   2  
ATOM   3644  C  CG1  . VAL B 2 92  ? -14.758 0.957   5.775   1.00 0.00 ? 350 VAL A CG1  2  
ATOM   3645  C  CG2  . VAL B 2 92  ? -14.110 3.333   6.112   1.00 0.00 ? 350 VAL A CG2  2  
ATOM   3646  H  H    . VAL B 2 92  ? -15.993 2.077   3.727   1.00 0.00 ? 350 VAL A H    2  
ATOM   3647  H  HA   . VAL B 2 92  ? -17.361 2.485   6.259   1.00 0.00 ? 350 VAL A HA   2  
ATOM   3648  H  HB   . VAL B 2 92  ? -15.399 2.208   7.344   1.00 0.00 ? 350 VAL A HB   2  
ATOM   3649  H  HG11 . VAL B 2 92  ? -13.995 1.101   5.022   1.00 0.00 ? 350 VAL A HG11 2  
ATOM   3650  H  HG12 . VAL B 2 92  ? -15.597 0.431   5.343   1.00 0.00 ? 350 VAL A HG12 2  
ATOM   3651  H  HG13 . VAL B 2 92  ? -14.352 0.380   6.592   1.00 0.00 ? 350 VAL A HG13 2  
ATOM   3652  H  HG21 . VAL B 2 92  ? -13.702 3.585   7.074   1.00 0.00 ? 350 VAL A HG21 2  
ATOM   3653  H  HG22 . VAL B 2 92  ? -14.492 4.221   5.638   1.00 0.00 ? 350 VAL A HG22 2  
ATOM   3654  H  HG23 . VAL B 2 92  ? -13.332 2.906   5.501   1.00 0.00 ? 350 VAL A HG23 2  
ATOM   3655  N  N    . ALA B 2 93  ? -16.575 5.015   6.407   1.00 0.00 ? 351 ALA A N    2  
ATOM   3656  C  CA   . ALA B 2 93  ? -16.616 6.469   6.281   1.00 0.00 ? 351 ALA A CA   2  
ATOM   3657  C  C    . ALA B 2 93  ? -15.356 7.105   6.808   1.00 0.00 ? 351 ALA A C    2  
ATOM   3658  O  O    . ALA B 2 93  ? -15.040 8.256   6.508   1.00 0.00 ? 351 ALA A O    2  
ATOM   3659  C  CB   . ALA B 2 93  ? -17.787 7.027   7.064   1.00 0.00 ? 351 ALA A CB   2  
ATOM   3660  H  H    . ALA B 2 93  ? -16.544 4.601   7.290   1.00 0.00 ? 351 ALA A H    2  
ATOM   3661  H  HA   . ALA B 2 93  ? -16.736 6.716   5.244   1.00 0.00 ? 351 ALA A HA   2  
ATOM   3662  H  HB1  . ALA B 2 93  ? -17.466 7.199   8.090   1.00 0.00 ? 351 ALA A HB1  2  
ATOM   3663  H  HB2  . ALA B 2 93  ? -18.603 6.318   7.051   1.00 0.00 ? 351 ALA A HB2  2  
ATOM   3664  H  HB3  . ALA B 2 93  ? -18.107 7.959   6.623   1.00 0.00 ? 351 ALA A HB3  2  
ATOM   3665  N  N    . GLU B 2 94  ? -14.646 6.332   7.595   1.00 0.00 ? 352 GLU A N    2  
ATOM   3666  C  CA   . GLU B 2 94  ? -13.439 6.787   8.260   1.00 0.00 ? 352 GLU A CA   2  
ATOM   3667  C  C    . GLU B 2 94  ? -12.681 5.588   8.829   1.00 0.00 ? 352 GLU A C    2  
ATOM   3668  O  O    . GLU B 2 94  ? -11.472 5.459   8.634   1.00 0.00 ? 352 GLU A O    2  
ATOM   3669  C  CB   . GLU B 2 94  ? -13.798 7.738   9.411   1.00 0.00 ? 352 GLU A CB   2  
ATOM   3670  C  CG   . GLU B 2 94  ? -15.273 8.067   9.523   1.00 0.00 ? 352 GLU A CG   2  
ATOM   3671  C  CD   . GLU B 2 94  ? -15.602 8.880   10.759  1.00 0.00 ? 352 GLU A CD   2  
ATOM   3672  O  OE1  . GLU B 2 94  ? -15.450 10.119  10.713  1.00 0.00 ? 352 GLU A OE1  2  
ATOM   3673  O  OE2  . GLU B 2 94  ? -16.014 8.278   11.773  1.00 0.00 ? 352 GLU A OE2  2  
ATOM   3674  H  H    . GLU B 2 94  ? -14.931 5.401   7.711   1.00 0.00 ? 352 GLU A H    2  
ATOM   3675  H  HA   . GLU B 2 94  ? -12.824 7.302   7.535   1.00 0.00 ? 352 GLU A HA   2  
ATOM   3676  H  HB2  . GLU B 2 94  ? -13.521 7.262   10.328  1.00 0.00 ? 352 GLU A HB2  2  
ATOM   3677  H  HB3  . GLU B 2 94  ? -13.246 8.660   9.301   1.00 0.00 ? 352 GLU A HB3  2  
ATOM   3678  H  HG2  . GLU B 2 94  ? -15.574 8.627   8.651   1.00 0.00 ? 352 GLU A HG2  2  
ATOM   3679  H  HG3  . GLU B 2 94  ? -15.820 7.133   9.562   1.00 0.00 ? 352 GLU A HG3  2  
ATOM   3680  N  N    . PRO B 2 95  ? -13.408 4.698   9.544   1.00 0.00 ? 353 PRO A N    2  
ATOM   3681  C  CA   . PRO B 2 95  ? -12.911 3.486   10.150  1.00 0.00 ? 353 PRO A CA   2  
ATOM   3682  C  C    . PRO B 2 95  ? -11.425 3.115   9.894   1.00 0.00 ? 353 PRO A C    2  
ATOM   3683  O  O    . PRO B 2 95  ? -10.561 3.634   10.600  1.00 0.00 ? 353 PRO A O    2  
ATOM   3684  C  CB   . PRO B 2 95  ? -13.947 2.564   9.532   1.00 0.00 ? 353 PRO A CB   2  
ATOM   3685  C  CG   . PRO B 2 95  ? -15.219 3.271   9.837   1.00 0.00 ? 353 PRO A CG   2  
ATOM   3686  C  CD   . PRO B 2 95  ? -14.863 4.737   9.816   1.00 0.00 ? 353 PRO A CD   2  
ATOM   3687  H  HA   . PRO B 2 95  ? -13.071 3.505   11.218  1.00 0.00 ? 353 PRO A HA   2  
ATOM   3688  H  HB2  . PRO B 2 95  ? -13.785 2.517   8.468   1.00 0.00 ? 353 PRO A HB2  2  
ATOM   3689  H  HB3  . PRO B 2 95  ? -13.901 1.580   9.954   1.00 0.00 ? 353 PRO A HB3  2  
ATOM   3690  H  HG2  . PRO B 2 95  ? -15.957 3.053   9.084   1.00 0.00 ? 353 PRO A HG2  2  
ATOM   3691  H  HG3  . PRO B 2 95  ? -15.572 2.993   10.805  1.00 0.00 ? 353 PRO A HG3  2  
ATOM   3692  H  HD2  . PRO B 2 95  ? -15.401 5.242   9.042   1.00 0.00 ? 353 PRO A HD2  2  
ATOM   3693  H  HD3  . PRO B 2 95  ? -15.067 5.183   10.766  1.00 0.00 ? 353 PRO A HD3  2  
ATOM   3694  N  N    . PRO B 2 96  ? -11.064 2.243   8.913   1.00 0.00 ? 354 PRO A N    2  
ATOM   3695  C  CA   . PRO B 2 96  ? -9.681  1.835   8.706   1.00 0.00 ? 354 PRO A CA   2  
ATOM   3696  C  C    . PRO B 2 96  ? -8.968  2.577   7.580   1.00 0.00 ? 354 PRO A C    2  
ATOM   3697  O  O    . PRO B 2 96  ? -8.204  1.974   6.832   1.00 0.00 ? 354 PRO A O    2  
ATOM   3698  C  CB   . PRO B 2 96  ? -9.926  0.417   8.280   1.00 0.00 ? 354 PRO A CB   2  
ATOM   3699  C  CG   . PRO B 2 96  ? -10.991 0.587   7.279   1.00 0.00 ? 354 PRO A CG   2  
ATOM   3700  C  CD   . PRO B 2 96  ? -11.915 1.564   7.915   1.00 0.00 ? 354 PRO A CD   2  
ATOM   3701  H  HA   . PRO B 2 96  ? -9.108  1.854   9.598   1.00 0.00 ? 354 PRO A HA   2  
ATOM   3702  H  HB2  . PRO B 2 96  ? -9.033  0.004   7.866   1.00 0.00 ? 354 PRO A HB2  2  
ATOM   3703  H  HB3  . PRO B 2 96  ? -10.274 -0.171  9.099   1.00 0.00 ? 354 PRO A HB3  2  
ATOM   3704  H  HG2  . PRO B 2 96  ? -10.586 0.981   6.362   1.00 0.00 ? 354 PRO A HG2  2  
ATOM   3705  H  HG3  . PRO B 2 96  ? -11.496 -0.344  7.106   1.00 0.00 ? 354 PRO A HG3  2  
ATOM   3706  H  HD2  . PRO B 2 96  ? -12.273 2.258   7.195   1.00 0.00 ? 354 PRO A HD2  2  
ATOM   3707  H  HD3  . PRO B 2 96  ? -12.729 1.045   8.390   1.00 0.00 ? 354 PRO A HD3  2  
ATOM   3708  N  N    . GLU B 2 97  ? -9.170  3.880   7.523   1.00 0.00 ? 355 GLU A N    2  
ATOM   3709  C  CA   . GLU B 2 97  ? -8.629  4.731   6.467   1.00 0.00 ? 355 GLU A CA   2  
ATOM   3710  C  C    . GLU B 2 97  ? -7.276  4.283   5.910   1.00 0.00 ? 355 GLU A C    2  
ATOM   3711  O  O    . GLU B 2 97  ? -7.045  4.374   4.703   1.00 0.00 ? 355 GLU A O    2  
ATOM   3712  C  CB   . GLU B 2 97  ? -8.519  6.161   6.970   1.00 0.00 ? 355 GLU A CB   2  
ATOM   3713  C  CG   . GLU B 2 97  ? -7.778  6.261   8.279   1.00 0.00 ? 355 GLU A CG   2  
ATOM   3714  C  CD   . GLU B 2 97  ? -6.985  7.548   8.407   1.00 0.00 ? 355 GLU A CD   2  
ATOM   3715  O  OE1  . GLU B 2 97  ? -6.476  8.036   7.374   1.00 0.00 ? 355 GLU A OE1  2  
ATOM   3716  O  OE2  . GLU B 2 97  ? -6.873  8.067   9.537   1.00 0.00 ? 355 GLU A OE2  2  
ATOM   3717  H  H    . GLU B 2 97  ? -9.678  4.299   8.237   1.00 0.00 ? 355 GLU A H    2  
ATOM   3718  H  HA   . GLU B 2 97  ? -9.340  4.713   5.669   1.00 0.00 ? 355 GLU A HA   2  
ATOM   3719  H  HB2  . GLU B 2 97  ? -7.999  6.756   6.233   1.00 0.00 ? 355 GLU A HB2  2  
ATOM   3720  H  HB3  . GLU B 2 97  ? -9.511  6.561   7.113   1.00 0.00 ? 355 GLU A HB3  2  
ATOM   3721  H  HG2  . GLU B 2 97  ? -8.498  6.215   9.075   1.00 0.00 ? 355 GLU A HG2  2  
ATOM   3722  H  HG3  . GLU B 2 97  ? -7.106  5.422   8.359   1.00 0.00 ? 355 GLU A HG3  2  
ATOM   3723  N  N    . GLY B 2 98  ? -6.380  3.811   6.766   1.00 0.00 ? 356 GLY A N    2  
ATOM   3724  C  CA   . GLY B 2 98  ? -5.069  3.409   6.293   1.00 0.00 ? 356 GLY A CA   2  
ATOM   3725  C  C    . GLY B 2 98  ? -4.893  1.915   6.104   1.00 0.00 ? 356 GLY A C    2  
ATOM   3726  O  O    . GLY B 2 98  ? -4.750  1.442   4.978   1.00 0.00 ? 356 GLY A O    2  
ATOM   3727  H  H    . GLY B 2 98  ? -6.605  3.740   7.712   1.00 0.00 ? 356 GLY A H    2  
ATOM   3728  H  HA2  . GLY B 2 98  ? -4.893  3.892   5.354   1.00 0.00 ? 356 GLY A HA2  2  
ATOM   3729  H  HA3  . GLY B 2 98  ? -4.333  3.750   6.993   1.00 0.00 ? 356 GLY A HA3  2  
ATOM   3730  N  N    . SER B 2 99  ? -4.879  1.183   7.212   1.00 0.00 ? 357 SER A N    2  
ATOM   3731  C  CA   . SER B 2 99  ? -4.697  -0.271  7.185   1.00 0.00 ? 357 SER A CA   2  
ATOM   3732  C  C    . SER B 2 99  ? -5.814  -0.935  6.387   1.00 0.00 ? 357 SER A C    2  
ATOM   3733  O  O    . SER B 2 99  ? -6.001  -0.620  5.212   1.00 0.00 ? 357 SER A O    2  
ATOM   3734  C  CB   . SER B 2 99  ? -4.692  -0.806  8.609   1.00 0.00 ? 357 SER A CB   2  
ATOM   3735  O  OG   . SER B 2 99  ? -4.343  -2.179  8.643   1.00 0.00 ? 357 SER A OG   2  
ATOM   3736  H  H    . SER B 2 99  ? -5.011  1.633   8.072   1.00 0.00 ? 357 SER A H    2  
ATOM   3737  H  HA   . SER B 2 99  ? -3.750  -0.484  6.719   1.00 0.00 ? 357 SER A HA   2  
ATOM   3738  H  HB2  . SER B 2 99  ? -3.983  -0.249  9.203   1.00 0.00 ? 357 SER A HB2  2  
ATOM   3739  H  HB3  . SER B 2 99  ? -5.681  -0.688  9.018   1.00 0.00 ? 357 SER A HB3  2  
ATOM   3740  H  HG   . SER B 2 99  ? -4.557  -2.585  7.798   1.00 0.00 ? 357 SER A HG   2  
ATOM   3741  N  N    . TRP B 2 100 ? -6.533  -1.881  7.013   1.00 0.00 ? 358 TRP A N    2  
ATOM   3742  C  CA   . TRP B 2 100 ? -7.665  -2.519  6.355   1.00 0.00 ? 358 TRP A CA   2  
ATOM   3743  C  C    . TRP B 2 100 ? -7.253  -3.341  5.150   1.00 0.00 ? 358 TRP A C    2  
ATOM   3744  O  O    . TRP B 2 100 ? -6.374  -2.954  4.392   1.00 0.00 ? 358 TRP A O    2  
ATOM   3745  C  CB   . TRP B 2 100 ? -8.578  -1.389  5.953   1.00 0.00 ? 358 TRP A CB   2  
ATOM   3746  C  CG   . TRP B 2 100 ? -9.762  -1.717  5.143   1.00 0.00 ? 358 TRP A CG   2  
ATOM   3747  C  CD1  . TRP B 2 100 ? -10.999 -1.993  5.603   1.00 0.00 ? 358 TRP A CD1  2  
ATOM   3748  C  CD2  . TRP B 2 100 ? -9.843  -1.686  3.736   1.00 0.00 ? 358 TRP A CD2  2  
ATOM   3749  N  NE1  . TRP B 2 100 ? -11.868 -2.135  4.561   1.00 0.00 ? 358 TRP A NE1  2  
ATOM   3750  C  CE2  . TRP B 2 100 ? -11.174 -1.964  3.390   1.00 0.00 ? 358 TRP A CE2  2  
ATOM   3751  C  CE3  . TRP B 2 100 ? -8.915  -1.453  2.737   1.00 0.00 ? 358 TRP A CE3  2  
ATOM   3752  C  CZ2  . TRP B 2 100 ? -11.600 -1.998  2.072   1.00 0.00 ? 358 TRP A CZ2  2  
ATOM   3753  C  CZ3  . TRP B 2 100 ? -9.338  -1.481  1.433   1.00 0.00 ? 358 TRP A CZ3  2  
ATOM   3754  C  CH2  . TRP B 2 100 ? -10.670 -1.745  1.106   1.00 0.00 ? 358 TRP A CH2  2  
ATOM   3755  H  H    . TRP B 2 100 ? -6.307  -2.137  7.922   1.00 0.00 ? 358 TRP A H    2  
ATOM   3756  H  HA   . TRP B 2 100 ? -8.188  -3.149  7.064   1.00 0.00 ? 358 TRP A HA   2  
ATOM   3757  H  HB2  . TRP B 2 100 ? -8.937  -0.939  6.839   1.00 0.00 ? 358 TRP A HB2  2  
ATOM   3758  H  HB3  . TRP B 2 100 ? -8.006  -0.656  5.411   1.00 0.00 ? 358 TRP A HB3  2  
ATOM   3759  H  HD1  . TRP B 2 100 ? -11.245 -2.050  6.650   1.00 0.00 ? 358 TRP A HD1  2  
ATOM   3760  H  HE1  . TRP B 2 100 ? -12.819 -2.326  4.643   1.00 0.00 ? 358 TRP A HE1  2  
ATOM   3761  H  HE3  . TRP B 2 100 ? -7.877  -1.249  2.970   1.00 0.00 ? 358 TRP A HE3  2  
ATOM   3762  H  HZ2  . TRP B 2 100 ? -12.623 -2.190  1.808   1.00 0.00 ? 358 TRP A HZ2  2  
ATOM   3763  H  HZ3  . TRP B 2 100 ? -8.648  -1.248  0.655   1.00 0.00 ? 358 TRP A HZ3  2  
ATOM   3764  H  HH2  . TRP B 2 100 ? -10.953 -1.747  0.068   1.00 0.00 ? 358 TRP A HH2  2  
ATOM   3765  N  N    . SER B 2 101 ? -7.879  -4.496  5.001   1.00 0.00 ? 359 SER A N    2  
ATOM   3766  C  CA   . SER B 2 101 ? -7.612  -5.359  3.868   1.00 0.00 ? 359 SER A CA   2  
ATOM   3767  C  C    . SER B 2 101 ? -8.675  -5.131  2.815   1.00 0.00 ? 359 SER A C    2  
ATOM   3768  O  O    . SER B 2 101 ? -9.730  -4.567  3.099   1.00 0.00 ? 359 SER A O    2  
ATOM   3769  C  CB   . SER B 2 101 ? -7.602  -6.824  4.287   1.00 0.00 ? 359 SER A CB   2  
ATOM   3770  O  OG   . SER B 2 101 ? -8.598  -7.088  5.259   1.00 0.00 ? 359 SER A OG   2  
ATOM   3771  H  H    . SER B 2 101 ? -8.531  -4.778  5.674   1.00 0.00 ? 359 SER A H    2  
ATOM   3772  H  HA   . SER B 2 101 ? -6.643  -5.094  3.459   1.00 0.00 ? 359 SER A HA   2  
ATOM   3773  H  HB2  . SER B 2 101 ? -7.789  -7.444  3.423   1.00 0.00 ? 359 SER A HB2  2  
ATOM   3774  H  HB3  . SER B 2 101 ? -6.639  -7.064  4.697   1.00 0.00 ? 359 SER A HB3  2  
ATOM   3775  H  HG   . SER B 2 101 ? -9.410  -6.637  5.017   1.00 0.00 ? 359 SER A HG   2  
ATOM   3776  N  N    . CYS B 2 102 ? -8.408  -5.580  1.607   1.00 0.00 ? 360 CYS A N    2  
ATOM   3777  C  CA   . CYS B 2 102 ? -9.354  -5.394  0.522   1.00 0.00 ? 360 CYS A CA   2  
ATOM   3778  C  C    . CYS B 2 102 ? -10.205 -6.640  0.318   1.00 0.00 ? 360 CYS A C    2  
ATOM   3779  O  O    . CYS B 2 102 ? -10.157 -7.569  1.125   1.00 0.00 ? 360 CYS A O    2  
ATOM   3780  C  CB   . CYS B 2 102 ? -8.626  -5.027  -0.762  1.00 0.00 ? 360 CYS A CB   2  
ATOM   3781  S  SG   . CYS B 2 102 ? -7.745  -6.411  -1.546  1.00 0.00 ? 360 CYS A SG   2  
ATOM   3782  H  H    . CYS B 2 102 ? -7.566  -6.059  1.449   1.00 0.00 ? 360 CYS A H    2  
ATOM   3783  H  HA   . CYS B 2 102 ? -10.006 -4.577  0.796   1.00 0.00 ? 360 CYS A HA   2  
ATOM   3784  H  HB2  . CYS B 2 102 ? -9.343  -4.648  -1.465  1.00 0.00 ? 360 CYS A HB2  2  
ATOM   3785  H  HB3  . CYS B 2 102 ? -7.902  -4.256  -0.548  1.00 0.00 ? 360 CYS A HB3  2  
ATOM   3786  N  N    . HIS B 2 103 ? -10.978 -6.662  -0.761  1.00 0.00 ? 361 HIS A N    2  
ATOM   3787  C  CA   . HIS B 2 103 ? -11.844 -7.798  -1.036  1.00 0.00 ? 361 HIS A CA   2  
ATOM   3788  C  C    . HIS B 2 103 ? -11.095 -8.935  -1.721  1.00 0.00 ? 361 HIS A C    2  
ATOM   3789  O  O    . HIS B 2 103 ? -11.389 -10.102 -1.483  1.00 0.00 ? 361 HIS A O    2  
ATOM   3790  C  CB   . HIS B 2 103 ? -13.064 -7.372  -1.868  1.00 0.00 ? 361 HIS A CB   2  
ATOM   3791  C  CG   . HIS B 2 103 ? -12.743 -6.920  -3.265  1.00 0.00 ? 361 HIS A CG   2  
ATOM   3792  N  ND1  . HIS B 2 103 ? -13.179 -5.729  -3.803  1.00 0.00 ? 361 HIS A ND1  2  
ATOM   3793  C  CD2  . HIS B 2 103 ? -12.029 -7.518  -4.239  1.00 0.00 ? 361 HIS A CD2  2  
ATOM   3794  C  CE1  . HIS B 2 103 ? -12.737 -5.630  -5.048  1.00 0.00 ? 361 HIS A CE1  2  
ATOM   3795  N  NE2  . HIS B 2 103 ? -12.042 -6.702  -5.330  1.00 0.00 ? 361 HIS A NE2  2  
ATOM   3796  H  H    . HIS B 2 103 ? -10.966 -5.903  -1.381  1.00 0.00 ? 361 HIS A H    2  
ATOM   3797  H  HA   . HIS B 2 103 ? -12.192 -8.162  -0.086  1.00 0.00 ? 361 HIS A HA   2  
ATOM   3798  H  HB2  . HIS B 2 103 ? -13.741 -8.208  -1.944  1.00 0.00 ? 361 HIS A HB2  2  
ATOM   3799  H  HB3  . HIS B 2 103 ? -13.563 -6.560  -1.362  1.00 0.00 ? 361 HIS A HB3  2  
ATOM   3800  H  HD1  . HIS B 2 103 ? -13.728 -5.058  -3.345  1.00 0.00 ? 361 HIS A HD1  2  
ATOM   3801  H  HD2  . HIS B 2 103 ? -11.502 -8.453  -4.158  1.00 0.00 ? 361 HIS A HD2  2  
ATOM   3802  H  HE1  . HIS B 2 103 ? -12.893 -4.806  -5.710  1.00 0.00 ? 361 HIS A HE1  2  
ATOM   3803  H  HE2  . HIS B 2 103 ? -11.518 -6.835  -6.146  1.00 0.00 ? 361 HIS A HE2  2  
ATOM   3804  N  N    . LEU B 2 104 ? -10.125 -8.601  -2.565  1.00 0.00 ? 362 LEU A N    2  
ATOM   3805  C  CA   . LEU B 2 104 ? -9.369  -9.622  -3.273  1.00 0.00 ? 362 LEU A CA   2  
ATOM   3806  C  C    . LEU B 2 104 ? -8.542  -10.432 -2.297  1.00 0.00 ? 362 LEU A C    2  
ATOM   3807  O  O    . LEU B 2 104 ? -8.361  -11.642 -2.453  1.00 0.00 ? 362 LEU A O    2  
ATOM   3808  C  CB   . LEU B 2 104 ? -8.485  -8.990  -4.355  1.00 0.00 ? 362 LEU A CB   2  
ATOM   3809  C  CG   . LEU B 2 104 ? -9.234  -8.457  -5.576  1.00 0.00 ? 362 LEU A CG   2  
ATOM   3810  C  CD1  . LEU B 2 104 ? -8.260  -8.092  -6.669  1.00 0.00 ? 362 LEU A CD1  2  
ATOM   3811  C  CD2  . LEU B 2 104 ? -10.260 -9.461  -6.075  1.00 0.00 ? 362 LEU A CD2  2  
ATOM   3812  H  H    . LEU B 2 104 ? -9.917  -7.653  -2.714  1.00 0.00 ? 362 LEU A H    2  
ATOM   3813  H  HA   . LEU B 2 104 ? -10.077 -10.280 -3.738  1.00 0.00 ? 362 LEU A HA   2  
ATOM   3814  H  HB2  . LEU B 2 104 ? -7.942  -8.169  -3.910  1.00 0.00 ? 362 LEU A HB2  2  
ATOM   3815  H  HB3  . LEU B 2 104 ? -7.775  -9.722  -4.694  1.00 0.00 ? 362 LEU A HB3  2  
ATOM   3816  H  HG   . LEU B 2 104 ? -9.755  -7.557  -5.296  1.00 0.00 ? 362 LEU A HG   2  
ATOM   3817  H  HD11 . LEU B 2 104 ? -7.676  -7.257  -6.336  1.00 0.00 ? 362 LEU A HD11 2  
ATOM   3818  H  HD12 . LEU B 2 104 ? -8.801  -7.825  -7.565  1.00 0.00 ? 362 LEU A HD12 2  
ATOM   3819  H  HD13 . LEU B 2 104 ? -7.609  -8.930  -6.872  1.00 0.00 ? 362 LEU A HD13 2  
ATOM   3820  H  HD21 . LEU B 2 104 ? -11.116 -9.449  -5.409  1.00 0.00 ? 362 LEU A HD21 2  
ATOM   3821  H  HD22 . LEU B 2 104 ? -9.824  -10.449 -6.086  1.00 0.00 ? 362 LEU A HD22 2  
ATOM   3822  H  HD23 . LEU B 2 104 ? -10.575 -9.193  -7.073  1.00 0.00 ? 362 LEU A HD23 2  
ATOM   3823  N  N    . CYS B 2 105 ? -8.093  -9.758  -1.262  1.00 0.00 ? 363 CYS A N    2  
ATOM   3824  C  CA   . CYS B 2 105 ? -7.282  -10.388 -0.230  1.00 0.00 ? 363 CYS A CA   2  
ATOM   3825  C  C    . CYS B 2 105 ? -8.139  -11.207 0.664   1.00 0.00 ? 363 CYS A C    2  
ATOM   3826  O  O    . CYS B 2 105 ? -7.677  -12.146 1.292   1.00 0.00 ? 363 CYS A O    2  
ATOM   3827  C  CB   . CYS B 2 105 ? -6.583  -9.360  0.629   1.00 0.00 ? 363 CYS A CB   2  
ATOM   3828  S  SG   . CYS B 2 105 ? -5.082  -8.659  -0.111  1.00 0.00 ? 363 CYS A SG   2  
ATOM   3829  H  H    . CYS B 2 105 ? -8.347  -8.816  -1.172  1.00 0.00 ? 363 CYS A H    2  
ATOM   3830  H  HA   . CYS B 2 105 ? -6.562  -11.022 -0.693  1.00 0.00 ? 363 CYS A HA   2  
ATOM   3831  H  HB2  . CYS B 2 105 ? -7.265  -8.548  0.812   1.00 0.00 ? 363 CYS A HB2  2  
ATOM   3832  H  HB3  . CYS B 2 105 ? -6.325  -9.819  1.574   1.00 0.00 ? 363 CYS A HB3  2  
ATOM   3833  N  N    . TRP B 2 106 ? -9.382  -10.812 0.733   1.00 0.00 ? 364 TRP A N    2  
ATOM   3834  C  CA   . TRP B 2 106 ? -10.335 -11.471 1.569   1.00 0.00 ? 364 TRP A CA   2  
ATOM   3835  C  C    . TRP B 2 106 ? -10.868 -12.717 0.966   1.00 0.00 ? 364 TRP A C    2  
ATOM   3836  O  O    . TRP B 2 106 ? -10.931 -13.747 1.618   1.00 0.00 ? 364 TRP A O    2  
ATOM   3837  C  CB   . TRP B 2 106 ? -11.452 -10.541 1.884   1.00 0.00 ? 364 TRP A CB   2  
ATOM   3838  C  CG   . TRP B 2 106 ? -11.399 -10.200 3.286   1.00 0.00 ? 364 TRP A CG   2  
ATOM   3839  C  CD1  . TRP B 2 106 ? -10.300 -9.826  3.952   1.00 0.00 ? 364 TRP A CD1  2  
ATOM   3840  C  CD2  . TRP B 2 106 ? -12.456 -10.249 4.193   1.00 0.00 ? 364 TRP A CD2  2  
ATOM   3841  N  NE1  . TRP B 2 106 ? -10.596 -9.616  5.254   1.00 0.00 ? 364 TRP A NE1  2  
ATOM   3842  C  CE2  . TRP B 2 106 ? -11.947 -9.871  5.438   1.00 0.00 ? 364 TRP A CE2  2  
ATOM   3843  C  CE3  . TRP B 2 106 ? -13.789 -10.572 4.054   1.00 0.00 ? 364 TRP A CE3  2  
ATOM   3844  C  CZ2  . TRP B 2 106 ? -12.757 -9.813  6.564   1.00 0.00 ? 364 TRP A CZ2  2  
ATOM   3845  C  CZ3  . TRP B 2 106 ? -14.599 -10.517 5.169   1.00 0.00 ? 364 TRP A CZ3  2  
ATOM   3846  C  CH2  . TRP B 2 106 ? -14.080 -10.139 6.412   1.00 0.00 ? 364 TRP A CH2  2  
ATOM   3847  H  H    . TRP B 2 106 ? -9.661  -10.037 0.212   1.00 0.00 ? 364 TRP A H    2  
ATOM   3848  H  HA   . TRP B 2 106 ? -9.835  -11.723 2.491   1.00 0.00 ? 364 TRP A HA   2  
ATOM   3849  H  HB2  . TRP B 2 106 ? -11.338 -9.648  1.318   1.00 0.00 ? 364 TRP A HB2  2  
ATOM   3850  H  HB3  . TRP B 2 106 ? -12.401 -11.007 1.672   1.00 0.00 ? 364 TRP A HB3  2  
ATOM   3851  H  HD1  . TRP B 2 106 ? -9.335  -9.724  3.492   1.00 0.00 ? 364 TRP A HD1  2  
ATOM   3852  H  HE1  . TRP B 2 106 ? -9.951  -9.332  5.923   1.00 0.00 ? 364 TRP A HE1  2  
ATOM   3853  H  HE3  . TRP B 2 106 ? -14.181 -10.874 3.082   1.00 0.00 ? 364 TRP A HE3  2  
ATOM   3854  H  HZ2  . TRP B 2 106 ? -12.379 -9.534  7.519   1.00 0.00 ? 364 TRP A HZ2  2  
ATOM   3855  H  HZ3  . TRP B 2 106 ? -15.643 -10.765 5.092   1.00 0.00 ? 364 TRP A HZ3  2  
ATOM   3856  H  HH2  . TRP B 2 106 ? -14.744 -10.108 7.261   1.00 0.00 ? 364 TRP A HH2  2  
ATOM   3857  N  N    . GLU B 2 107 ? -11.272 -12.638 -0.268  1.00 0.00 ? 365 GLU A N    2  
ATOM   3858  C  CA   . GLU B 2 107 ? -11.780 -13.798 -0.904  1.00 0.00 ? 365 GLU A CA   2  
ATOM   3859  C  C    . GLU B 2 107 ? -10.646 -14.801 -0.932  1.00 0.00 ? 365 GLU A C    2  
ATOM   3860  O  O    . GLU B 2 107 ? -10.840 -16.017 -0.925  1.00 0.00 ? 365 GLU A O    2  
ATOM   3861  C  CB   . GLU B 2 107 ? -12.234 -13.427 -2.297  1.00 0.00 ? 365 GLU A CB   2  
ATOM   3862  C  CG   . GLU B 2 107 ? -13.191 -12.258 -2.270  1.00 0.00 ? 365 GLU A CG   2  
ATOM   3863  C  CD   . GLU B 2 107 ? -14.596 -12.635 -2.697  1.00 0.00 ? 365 GLU A CD   2  
ATOM   3864  O  OE1  . GLU B 2 107 ? -14.887 -12.564 -3.909  1.00 0.00 ? 365 GLU A OE1  2  
ATOM   3865  O  OE2  . GLU B 2 107 ? -15.405 -13.002 -1.819  1.00 0.00 ? 365 GLU A OE2  2  
ATOM   3866  H  H    . GLU B 2 107 ? -11.197 -11.798 -0.764  1.00 0.00 ? 365 GLU A H    2  
ATOM   3867  H  HA   . GLU B 2 107 ? -12.615 -14.157 -0.302  1.00 0.00 ? 365 GLU A HA   2  
ATOM   3868  H  HB2  . GLU B 2 107 ? -11.360 -13.146 -2.880  1.00 0.00 ? 365 GLU A HB2  2  
ATOM   3869  H  HB3  . GLU B 2 107 ? -12.726 -14.271 -2.758  1.00 0.00 ? 365 GLU A HB3  2  
ATOM   3870  H  HG2  . GLU B 2 107 ? -13.223 -11.883 -1.252  1.00 0.00 ? 365 GLU A HG2  2  
ATOM   3871  H  HG3  . GLU B 2 107 ? -12.817 -11.486 -2.925  1.00 0.00 ? 365 GLU A HG3  2  
ATOM   3872  N  N    . LEU B 2 108 ? -9.442  -14.228 -0.918  1.00 0.00 ? 366 LEU A N    2  
ATOM   3873  C  CA   . LEU B 2 108 ? -8.207  -14.973 -0.919  1.00 0.00 ? 366 LEU A CA   2  
ATOM   3874  C  C    . LEU B 2 108 ? -7.833  -15.321 0.514   1.00 0.00 ? 366 LEU A C    2  
ATOM   3875  O  O    . LEU B 2 108 ? -7.029  -16.216 0.777   1.00 0.00 ? 366 LEU A O    2  
ATOM   3876  C  CB   . LEU B 2 108 ? -7.140  -14.119 -1.584  1.00 0.00 ? 366 LEU A CB   2  
ATOM   3877  C  CG   . LEU B 2 108 ? -5.757  -14.729 -1.720  1.00 0.00 ? 366 LEU A CG   2  
ATOM   3878  C  CD1  . LEU B 2 108 ? -4.959  -14.467 -0.465  1.00 0.00 ? 366 LEU A CD1  2  
ATOM   3879  C  CD2  . LEU B 2 108 ? -5.873  -16.206 -2.021  1.00 0.00 ? 366 LEU A CD2  2  
ATOM   3880  H  H    . LEU B 2 108 ? -9.387  -13.242 -0.892  1.00 0.00 ? 366 LEU A H    2  
ATOM   3881  H  HA   . LEU B 2 108 ? -8.343  -15.861 -1.488  1.00 0.00 ? 366 LEU A HA   2  
ATOM   3882  H  HB2  . LEU B 2 108 ? -7.484  -13.880 -2.566  1.00 0.00 ? 366 LEU A HB2  2  
ATOM   3883  H  HB3  . LEU B 2 108 ? -7.056  -13.213 -1.022  1.00 0.00 ? 366 LEU A HB3  2  
ATOM   3884  H  HG   . LEU B 2 108 ? -5.250  -14.260 -2.545  1.00 0.00 ? 366 LEU A HG   2  
ATOM   3885  H  HD11 . LEU B 2 108 ? -5.366  -13.590 0.021   1.00 0.00 ? 366 LEU A HD11 2  
ATOM   3886  H  HD12 . LEU B 2 108 ? -3.924  -14.292 -0.724  1.00 0.00 ? 366 LEU A HD12 2  
ATOM   3887  H  HD13 . LEU B 2 108 ? -5.030  -15.315 0.197   1.00 0.00 ? 366 LEU A HD13 2  
ATOM   3888  H  HD21 . LEU B 2 108 ? -6.804  -16.369 -2.546  1.00 0.00 ? 366 LEU A HD21 2  
ATOM   3889  H  HD22 . LEU B 2 108 ? -5.871  -16.769 -1.097  1.00 0.00 ? 366 LEU A HD22 2  
ATOM   3890  H  HD23 . LEU B 2 108 ? -5.047  -16.519 -2.641  1.00 0.00 ? 366 LEU A HD23 2  
ATOM   3891  N  N    . LEU B 2 109 ? -8.461  -14.601 1.434   1.00 0.00 ? 367 LEU A N    2  
ATOM   3892  C  CA   . LEU B 2 109 ? -8.248  -14.780 2.862   1.00 0.00 ? 367 LEU A CA   2  
ATOM   3893  C  C    . LEU B 2 109 ? -8.937  -16.036 3.293   1.00 0.00 ? 367 LEU A C    2  
ATOM   3894  O  O    . LEU B 2 109 ? -8.341  -16.958 3.845   1.00 0.00 ? 367 LEU A O    2  
ATOM   3895  C  CB   . LEU B 2 109 ? -8.862  -13.617 3.610   1.00 0.00 ? 367 LEU A CB   2  
ATOM   3896  C  CG   . LEU B 2 109 ? -8.063  -13.057 4.766   1.00 0.00 ? 367 LEU A CG   2  
ATOM   3897  C  CD1  . LEU B 2 109 ? -7.172  -11.951 4.249   1.00 0.00 ? 367 LEU A CD1  2  
ATOM   3898  C  CD2  . LEU B 2 109 ? -8.995  -12.548 5.855   1.00 0.00 ? 367 LEU A CD2  2  
ATOM   3899  H  H    . LEU B 2 109 ? -9.110  -13.923 1.136   1.00 0.00 ? 367 LEU A H    2  
ATOM   3900  H  HA   . LEU B 2 109 ? -7.200  -14.827 3.059   1.00 0.00 ? 367 LEU A HA   2  
ATOM   3901  H  HB2  . LEU B 2 109 ? -8.993  -12.833 2.903   1.00 0.00 ? 367 LEU A HB2  2  
ATOM   3902  H  HB3  . LEU B 2 109 ? -9.832  -13.916 3.977   1.00 0.00 ? 367 LEU A HB3  2  
ATOM   3903  H  HG   . LEU B 2 109 ? -7.442  -13.830 5.176   1.00 0.00 ? 367 LEU A HG   2  
ATOM   3904  H  HD11 . LEU B 2 109 ? -7.475  -11.714 3.236   1.00 0.00 ? 367 LEU A HD11 2  
ATOM   3905  H  HD12 . LEU B 2 109 ? -6.143  -12.281 4.254   1.00 0.00 ? 367 LEU A HD12 2  
ATOM   3906  H  HD13 . LEU B 2 109 ? -7.278  -11.077 4.872   1.00 0.00 ? 367 LEU A HD13 2  
ATOM   3907  H  HD21 . LEU B 2 109 ? -9.879  -12.118 5.400   1.00 0.00 ? 367 LEU A HD21 2  
ATOM   3908  H  HD22 . LEU B 2 109 ? -8.488  -11.795 6.441   1.00 0.00 ? 367 LEU A HD22 2  
ATOM   3909  H  HD23 . LEU B 2 109 ? -9.282  -13.369 6.495   1.00 0.00 ? 367 LEU A HD23 2  
ATOM   3910  N  N    . LYS B 2 110 ? -10.224 -16.032 3.031   1.00 0.00 ? 368 LYS A N    2  
ATOM   3911  C  CA   . LYS B 2 110 ? -11.068 -17.155 3.335   1.00 0.00 ? 368 LYS A CA   2  
ATOM   3912  C  C    . LYS B 2 110 ? -10.561 -18.343 2.545   1.00 0.00 ? 368 LYS A C    2  
ATOM   3913  O  O    . LYS B 2 110 ? -10.673 -19.493 2.969   1.00 0.00 ? 368 LYS A O    2  
ATOM   3914  C  CB   . LYS B 2 110 ? -12.510 -16.811 2.970   1.00 0.00 ? 368 LYS A CB   2  
ATOM   3915  C  CG   . LYS B 2 110 ? -12.847 -15.357 3.252   1.00 0.00 ? 368 LYS A CG   2  
ATOM   3916  C  CD   . LYS B 2 110 ? -14.254 -15.007 2.852   1.00 0.00 ? 368 LYS A CD   2  
ATOM   3917  C  CE   . LYS B 2 110 ? -14.611 -13.612 3.327   1.00 0.00 ? 368 LYS A CE   2  
ATOM   3918  N  NZ   . LYS B 2 110 ? -15.883 -13.126 2.726   1.00 0.00 ? 368 LYS A NZ   2  
ATOM   3919  H  H    . LYS B 2 110 ? -10.617 -15.233 2.611   1.00 0.00 ? 368 LYS A H    2  
ATOM   3920  H  HA   . LYS B 2 110 ? -10.990 -17.363 4.389   1.00 0.00 ? 368 LYS A HA   2  
ATOM   3921  H  HB2  . LYS B 2 110 ? -12.655 -16.996 1.917   1.00 0.00 ? 368 LYS A HB2  2  
ATOM   3922  H  HB3  . LYS B 2 110 ? -13.181 -17.436 3.540   1.00 0.00 ? 368 LYS A HB3  2  
ATOM   3923  H  HG2  . LYS B 2 110 ? -12.722 -15.159 4.303   1.00 0.00 ? 368 LYS A HG2  2  
ATOM   3924  H  HG3  . LYS B 2 110 ? -12.175 -14.731 2.682   1.00 0.00 ? 368 LYS A HG3  2  
ATOM   3925  H  HD2  . LYS B 2 110 ? -14.315 -15.034 1.779   1.00 0.00 ? 368 LYS A HD2  2  
ATOM   3926  H  HD3  . LYS B 2 110 ? -14.940 -15.720 3.284   1.00 0.00 ? 368 LYS A HD3  2  
ATOM   3927  H  HE2  . LYS B 2 110 ? -14.715 -13.630 4.402   1.00 0.00 ? 368 LYS A HE2  2  
ATOM   3928  H  HE3  . LYS B 2 110 ? -13.804 -12.936 3.054   1.00 0.00 ? 368 LYS A HE3  2  
ATOM   3929  H  HZ1  . LYS B 2 110 ? -15.824 -13.156 1.689   1.00 0.00 ? 368 LYS A HZ1  2  
ATOM   3930  H  HZ2  . LYS B 2 110 ? -16.068 -12.147 3.024   1.00 0.00 ? 368 LYS A HZ2  2  
ATOM   3931  H  HZ3  . LYS B 2 110 ? -16.676 -13.724 3.036   1.00 0.00 ? 368 LYS A HZ3  2  
ATOM   3932  N  N    . GLU B 2 111 ? -10.000 -18.039 1.378   1.00 0.00 ? 369 GLU A N    2  
ATOM   3933  C  CA   . GLU B 2 111 ? -9.416  -19.052 0.526   1.00 0.00 ? 369 GLU A CA   2  
ATOM   3934  C  C    . GLU B 2 111 ? -8.220  -19.698 1.214   1.00 0.00 ? 369 GLU A C    2  
ATOM   3935  O  O    . GLU B 2 111 ? -7.961  -20.886 1.018   1.00 0.00 ? 369 GLU A O    2  
ATOM   3936  C  CB   . GLU B 2 111 ? -8.976  -18.450 -0.799  1.00 0.00 ? 369 GLU A CB   2  
ATOM   3937  C  CG   . GLU B 2 111 ? -9.474  -19.235 -1.996  1.00 0.00 ? 369 GLU A CG   2  
ATOM   3938  C  CD   . GLU B 2 111 ? -8.951  -20.659 -2.020  1.00 0.00 ? 369 GLU A CD   2  
ATOM   3939  O  OE1  . GLU B 2 111 ? -7.849  -20.877 -2.567  1.00 0.00 ? 369 GLU A OE1  2  
ATOM   3940  O  OE2  . GLU B 2 111 ? -9.642  -21.555 -1.492  1.00 0.00 ? 369 GLU A OE2  2  
ATOM   3941  H  H    . GLU B 2 111 ? -10.010 -17.105 1.069   1.00 0.00 ? 369 GLU A H    2  
ATOM   3942  H  HA   . GLU B 2 111 ? -10.164 -19.805 0.334   1.00 0.00 ? 369 GLU A HA   2  
ATOM   3943  H  HB2  . GLU B 2 111 ? -9.355  -17.444 -0.871  1.00 0.00 ? 369 GLU A HB2  2  
ATOM   3944  H  HB3  . GLU B 2 111 ? -7.898  -18.426 -0.831  1.00 0.00 ? 369 GLU A HB3  2  
ATOM   3945  H  HG2  . GLU B 2 111 ? -10.552 -19.265 -1.963  1.00 0.00 ? 369 GLU A HG2  2  
ATOM   3946  H  HG3  . GLU B 2 111 ? -9.156  -18.735 -2.891  1.00 0.00 ? 369 GLU A HG3  2  
ATOM   3947  N  N    . LYS B 2 112 ? -7.480  -18.917 2.018   1.00 0.00 ? 370 LYS A N    2  
ATOM   3948  C  CA   . LYS B 2 112 ? -6.320  -19.462 2.711   1.00 0.00 ? 370 LYS A CA   2  
ATOM   3949  C  C    . LYS B 2 112 ? -6.691  -20.702 3.516   1.00 0.00 ? 370 LYS A C    2  
ATOM   3950  O  O    . LYS B 2 112 ? -5.846  -21.559 3.783   1.00 0.00 ? 370 LYS A O    2  
ATOM   3951  C  CB   . LYS B 2 112 ? -5.714  -18.428 3.641   1.00 0.00 ? 370 LYS A CB   2  
ATOM   3952  C  CG   . LYS B 2 112 ? -4.942  -17.357 2.936   1.00 0.00 ? 370 LYS A CG   2  
ATOM   3953  C  CD   . LYS B 2 112 ? -5.046  -16.088 3.717   1.00 0.00 ? 370 LYS A CD   2  
ATOM   3954  C  CE   . LYS B 2 112 ? -4.608  -14.889 2.905   1.00 0.00 ? 370 LYS A CE   2  
ATOM   3955  N  NZ   . LYS B 2 112 ? -3.203  -15.018 2.435   1.00 0.00 ? 370 LYS A NZ   2  
ATOM   3956  H  H    . LYS B 2 112 ? -7.712  -17.958 2.141   1.00 0.00 ? 370 LYS A H    2  
ATOM   3957  H  HA   . LYS B 2 112 ? -5.596  -19.720 1.965   1.00 0.00 ? 370 LYS A HA   2  
ATOM   3958  H  HB2  . LYS B 2 112 ? -6.507  -17.943 4.177   1.00 0.00 ? 370 LYS A HB2  2  
ATOM   3959  H  HB3  . LYS B 2 112 ? -5.057  -18.921 4.342   1.00 0.00 ? 370 LYS A HB3  2  
ATOM   3960  H  HG2  . LYS B 2 112 ? -3.908  -17.647 2.842   1.00 0.00 ? 370 LYS A HG2  2  
ATOM   3961  H  HG3  . LYS B 2 112 ? -5.381  -17.201 1.973   1.00 0.00 ? 370 LYS A HG3  2  
ATOM   3962  H  HD2  . LYS B 2 112 ? -6.081  -15.975 3.981   1.00 0.00 ? 370 LYS A HD2  2  
ATOM   3963  H  HD3  . LYS B 2 112 ? -4.440  -16.162 4.609   1.00 0.00 ? 370 LYS A HD3  2  
ATOM   3964  H  HE2  . LYS B 2 112 ? -5.260  -14.806 2.052   1.00 0.00 ? 370 LYS A HE2  2  
ATOM   3965  H  HE3  . LYS B 2 112 ? -4.698  -14.002 3.516   1.00 0.00 ? 370 LYS A HE3  2  
ATOM   3966  H  HZ1  . LYS B 2 112 ? -2.560  -15.098 3.249   1.00 0.00 ? 370 LYS A HZ1  2  
ATOM   3967  H  HZ2  . LYS B 2 112 ? -2.933  -14.182 1.877   1.00 0.00 ? 370 LYS A HZ2  2  
ATOM   3968  H  HZ3  . LYS B 2 112 ? -3.100  -15.864 1.839   1.00 0.00 ? 370 LYS A HZ3  2  
ATOM   3969  N  N    . ALA B 2 113 ? -7.960  -20.782 3.907   1.00 0.00 ? 371 ALA A N    2  
ATOM   3970  C  CA   . ALA B 2 113 ? -8.458  -21.902 4.696   1.00 0.00 ? 371 ALA A CA   2  
ATOM   3971  C  C    . ALA B 2 113 ? -8.201  -23.240 4.021   1.00 0.00 ? 371 ALA A C    2  
ATOM   3972  O  O    . ALA B 2 113 ? -7.597  -23.315 2.951   1.00 0.00 ? 371 ALA A O    2  
ATOM   3973  C  CB   . ALA B 2 113 ? -9.943  -21.736 4.965   1.00 0.00 ? 371 ALA A CB   2  
ATOM   3974  H  H    . ALA B 2 113 ? -8.581  -20.066 3.656   1.00 0.00 ? 371 ALA A H    2  
ATOM   3975  H  HA   . ALA B 2 113 ? -7.947  -21.892 5.648   1.00 0.00 ? 371 ALA A HA   2  
ATOM   3976  H  HB1  . ALA B 2 113 ? -10.091 -20.951 5.686   1.00 0.00 ? 371 ALA A HB1  2  
ATOM   3977  H  HB2  . ALA B 2 113 ? -10.346 -22.661 5.352   1.00 0.00 ? 371 ALA A HB2  2  
ATOM   3978  H  HB3  . ALA B 2 113 ? -10.449 -21.480 4.045   1.00 0.00 ? 371 ALA A HB3  2  
ATOM   3979  N  N    . SER B 2 114 ? -8.685  -24.293 4.662   1.00 0.00 ? 372 SER A N    2  
ATOM   3980  C  CA   . SER B 2 114 ? -8.522  -25.650 4.155   1.00 0.00 ? 372 SER A CA   2  
ATOM   3981  C  C    . SER B 2 114 ? -9.563  -26.584 4.762   1.00 0.00 ? 372 SER A C    2  
ATOM   3982  O  O    . SER B 2 114 ? -9.327  -27.086 5.881   1.00 0.00 ? 372 SER A O    2  
ATOM   3983  C  CB   . SER B 2 114 ? -7.115  -26.170 4.460   1.00 0.00 ? 372 SER A CB   2  
ATOM   3984  O  OG   . SER B 2 114 ? -6.127  -25.387 3.811   1.00 0.00 ? 372 SER A OG   2  
ATOM   3985  O  OXT  . SER B 2 114 ? -10.608 -26.806 4.113   1.00 0.00 ? 372 SER A OXT  2  
ATOM   3986  H  H    . SER B 2 114 ? -9.175  -24.150 5.499   1.00 0.00 ? 372 SER A H    2  
ATOM   3987  H  HA   . SER B 2 114 ? -8.662  -25.620 3.086   1.00 0.00 ? 372 SER A HA   2  
ATOM   3988  H  HB2  . SER B 2 114 ? -6.942  -26.132 5.524   1.00 0.00 ? 372 SER A HB2  2  
ATOM   3989  H  HB3  . SER B 2 114 ? -7.029  -27.191 4.117   1.00 0.00 ? 372 SER A HB3  2  
ATOM   3990  H  HG   . SER B 2 114 ? -5.344  -25.338 4.363   1.00 0.00 ? 372 SER A HG   2  
HETATM 3991  ZN ZN   . ZN  C 3 .   ? 14.489  -0.037  3.059   1.00 0.00 ? 501 ZN  A ZN   2  
HETATM 3992  ZN ZN   . ZN  D 3 .   ? 4.160   5.528   -8.621  1.00 0.00 ? 601 ZN  A ZN   2  
HETATM 3993  ZN ZN   . ZN  E 3 .   ? -5.576  -6.484  -0.726  1.00 0.00 ? 701 ZN  A ZN   2  
HETATM 3994  ZN ZN   . ZN  F 3 .   ? -13.201 4.591   -5.683  1.00 0.00 ? 801 ZN  A ZN   2  
HETATM 3995  C  C1A  . SAC A 1 1   ? 5.788   5.218   -0.383  1.00 0.00 ? 1   SAC B C1A  3  
HETATM 3996  C  C2A  . SAC A 1 1   ? 6.977   5.831   -1.127  1.00 0.00 ? 1   SAC B C2A  3  
HETATM 3997  O  OAC  . SAC A 1 1   ? 4.800   4.865   -1.028  1.00 0.00 ? 1   SAC B OAC  3  
HETATM 3998  N  N    . SAC A 1 1   ? 5.826   5.144   0.944   1.00 0.00 ? 1   SAC B N    3  
HETATM 3999  C  CA   . SAC A 1 1   ? 4.619   4.857   1.724   1.00 0.00 ? 1   SAC B CA   3  
HETATM 4000  C  C    . SAC A 1 1   ? 4.059   6.128   2.351   1.00 0.00 ? 1   SAC B C    3  
HETATM 4001  O  O    . SAC A 1 1   ? 2.905   6.162   2.781   1.00 0.00 ? 1   SAC B O    3  
HETATM 4002  C  CB   . SAC A 1 1   ? 4.925   3.830   2.815   1.00 0.00 ? 1   SAC B CB   3  
HETATM 4003  O  OG   . SAC A 1 1   ? 5.902   4.320   3.717   1.00 0.00 ? 1   SAC B OG   3  
HETATM 4004  H  H1   . SAC A 1 1   ? 6.636   5.436   1.412   1.00 0.00 ? 1   SAC B H1   3  
HETATM 4005  H  H2A1 . SAC A 1 1   ? 6.701   6.023   -2.153  1.00 0.00 ? 1   SAC B H2A1 3  
HETATM 4006  H  H2A2 . SAC A 1 1   ? 7.811   5.145   -1.100  1.00 0.00 ? 1   SAC B H2A2 3  
HETATM 4007  H  H2A3 . SAC A 1 1   ? 7.259   6.759   -0.650  1.00 0.00 ? 1   SAC B H2A3 3  
HETATM 4008  H  HA   . SAC A 1 1   ? 3.871   4.449   1.052   1.00 0.00 ? 1   SAC B HA   3  
HETATM 4009  H  HB2  . SAC A 1 1   ? 4.022   3.613   3.366   1.00 0.00 ? 1   SAC B HB2  3  
HETATM 4010  H  HB3  . SAC A 1 1   ? 5.294   2.924   2.360   1.00 0.00 ? 1   SAC B HB3  3  
HETATM 4011  H  HG   . SAC A 1 1   ? 6.433   3.589   4.042   1.00 0.00 ? 1   SAC B HG   3  
ATOM   4012  N  N    . GLY A 1 2   ? 4.880   7.170   2.400   1.00 0.00 ? 2   GLY B N    3  
ATOM   4013  C  CA   . GLY A 1 2   ? 4.443   8.432   2.964   1.00 0.00 ? 2   GLY B CA   3  
ATOM   4014  C  C    . GLY A 1 2   ? 4.456   9.540   1.933   1.00 0.00 ? 2   GLY B C    3  
ATOM   4015  O  O    . GLY A 1 2   ? 4.697   10.702  2.261   1.00 0.00 ? 2   GLY B O    3  
ATOM   4016  H  H    . GLY A 1 2   ? 5.791   7.080   2.050   1.00 0.00 ? 2   GLY B H    3  
ATOM   4017  H  HA2  . GLY A 1 2   ? 3.438   8.318   3.344   1.00 0.00 ? 2   GLY B HA2  3  
ATOM   4018  H  HA3  . GLY A 1 2   ? 5.099   8.701   3.778   1.00 0.00 ? 2   GLY B HA3  3  
ATOM   4019  N  N    . ARG A 1 3   ? 4.190   9.163   0.682   1.00 0.00 ? 3   ARG B N    3  
ATOM   4020  C  CA   . ARG A 1 3   ? 4.174   10.097  -0.441  1.00 0.00 ? 3   ARG B CA   3  
ATOM   4021  C  C    . ARG A 1 3   ? 5.297   11.126  -0.332  1.00 0.00 ? 3   ARG B C    3  
ATOM   4022  O  O    . ARG A 1 3   ? 5.111   12.303  -0.640  1.00 0.00 ? 3   ARG B O    3  
ATOM   4023  C  CB   . ARG A 1 3   ? 2.816   10.800  -0.562  1.00 0.00 ? 3   ARG B CB   3  
ATOM   4024  C  CG   . ARG A 1 3   ? 2.459   11.689  0.615   1.00 0.00 ? 3   ARG B CG   3  
ATOM   4025  C  CD   . ARG A 1 3   ? 1.265   12.571  0.291   1.00 0.00 ? 3   ARG B CD   3  
ATOM   4026  N  NE   . ARG A 1 3   ? 1.618   13.659  -0.618  1.00 0.00 ? 3   ARG B NE   3  
ATOM   4027  C  CZ   . ARG A 1 3   ? 1.487   14.948  -0.317  1.00 0.00 ? 3   ARG B CZ   3  
ATOM   4028  N  NH1  . ARG A 1 3   ? 1.023   15.312  0.871   1.00 0.00 ? 3   ARG B NH1  3  
ATOM   4029  N  NH2  . ARG A 1 3   ? 1.821   15.875  -1.203  1.00 0.00 ? 3   ARG B NH2  3  
ATOM   4030  H  H    . ARG A 1 3   ? 3.997   8.218   0.509   1.00 0.00 ? 3   ARG B H    3  
ATOM   4031  H  HA   . ARG A 1 3   ? 4.334   9.515   -1.335  1.00 0.00 ? 3   ARG B HA   3  
ATOM   4032  H  HB2  . ARG A 1 3   ? 2.820   11.410  -1.452  1.00 0.00 ? 3   ARG B HB2  3  
ATOM   4033  H  HB3  . ARG A 1 3   ? 2.046   10.047  -0.660  1.00 0.00 ? 3   ARG B HB3  3  
ATOM   4034  H  HG2  . ARG A 1 3   ? 2.216   11.069  1.466   1.00 0.00 ? 3   ARG B HG2  3  
ATOM   4035  H  HG3  . ARG A 1 3   ? 3.305   12.317  0.853   1.00 0.00 ? 3   ARG B HG3  3  
ATOM   4036  H  HD2  . ARG A 1 3   ? 0.505   11.962  -0.177  1.00 0.00 ? 3   ARG B HD2  3  
ATOM   4037  H  HD3  . ARG A 1 3   ? 0.879   12.990  1.209   1.00 0.00 ? 3   ARG B HD3  3  
ATOM   4038  H  HE   . ARG A 1 3   ? 1.968   13.415  -1.501  1.00 0.00 ? 3   ARG B HE   3  
ATOM   4039  H  HH11 . ARG A 1 3   ? 0.770   14.617  1.544   1.00 0.00 ? 3   ARG B HH11 3  
ATOM   4040  H  HH12 . ARG A 1 3   ? 0.927   16.282  1.095   1.00 0.00 ? 3   ARG B HH12 3  
ATOM   4041  H  HH21 . ARG A 1 3   ? 2.173   15.606  -2.099  1.00 0.00 ? 3   ARG B HH21 3  
ATOM   4042  H  HH22 . ARG A 1 3   ? 1.722   16.844  -0.975  1.00 0.00 ? 3   ARG B HH22 3  
ATOM   4043  N  N    . GLY A 1 4   ? 6.467   10.666  0.103   1.00 0.00 ? 4   GLY B N    3  
ATOM   4044  C  CA   . GLY A 1 4   ? 7.607   11.553  0.252   1.00 0.00 ? 4   GLY B CA   3  
ATOM   4045  C  C    . GLY A 1 4   ? 8.127   11.591  1.675   1.00 0.00 ? 4   GLY B C    3  
ATOM   4046  O  O    . GLY A 1 4   ? 7.385   11.326  2.620   1.00 0.00 ? 4   GLY B O    3  
ATOM   4047  H  H    . GLY A 1 4   ? 6.557   9.717   0.327   1.00 0.00 ? 4   GLY B H    3  
ATOM   4048  H  HA2  . GLY A 1 4   ? 8.399   11.216  -0.401  1.00 0.00 ? 4   GLY B HA2  3  
ATOM   4049  H  HA3  . GLY A 1 4   ? 7.313   12.551  -0.039  1.00 0.00 ? 4   GLY B HA3  3  
ATOM   4050  N  N    . LYS A 1 5   ? 9.406   11.919  1.829   1.00 0.00 ? 5   LYS B N    3  
ATOM   4051  C  CA   . LYS A 1 5   ? 10.024  11.990  3.148   1.00 0.00 ? 5   LYS B CA   3  
ATOM   4052  C  C    . LYS A 1 5   ? 9.384   13.086  3.993   1.00 0.00 ? 5   LYS B C    3  
ATOM   4053  O  O    . LYS A 1 5   ? 9.051   14.159  3.489   1.00 0.00 ? 5   LYS B O    3  
ATOM   4054  C  CB   . LYS A 1 5   ? 11.526  12.240  3.020   1.00 0.00 ? 5   LYS B CB   3  
ATOM   4055  C  CG   . LYS A 1 5   ? 12.269  11.117  2.314   1.00 0.00 ? 5   LYS B CG   3  
ATOM   4056  C  CD   . LYS A 1 5   ? 13.762  11.391  2.251   1.00 0.00 ? 5   LYS B CD   3  
ATOM   4057  C  CE   . LYS A 1 5   ? 14.506  10.252  1.572   1.00 0.00 ? 5   LYS B CE   3  
ATOM   4058  N  NZ   . LYS A 1 5   ? 14.319  8.961   2.291   1.00 0.00 ? 5   LYS B NZ   3  
ATOM   4059  H  H    . LYS A 1 5   ? 9.947   12.119  1.036   1.00 0.00 ? 5   LYS B H    3  
ATOM   4060  H  HA   . LYS A 1 5   ? 9.867   11.039  3.637   1.00 0.00 ? 5   LYS B HA   3  
ATOM   4061  H  HB2  . LYS A 1 5   ? 11.682  13.152  2.463   1.00 0.00 ? 5   LYS B HB2  3  
ATOM   4062  H  HB3  . LYS A 1 5   ? 11.947  12.354  4.008   1.00 0.00 ? 5   LYS B HB3  3  
ATOM   4063  H  HG2  . LYS A 1 5   ? 12.105  10.196  2.853   1.00 0.00 ? 5   LYS B HG2  3  
ATOM   4064  H  HG3  . LYS A 1 5   ? 11.885  11.022  1.308   1.00 0.00 ? 5   LYS B HG3  3  
ATOM   4065  H  HD2  . LYS A 1 5   ? 13.929  12.300  1.693   1.00 0.00 ? 5   LYS B HD2  3  
ATOM   4066  H  HD3  . LYS A 1 5   ? 14.139  11.507  3.256   1.00 0.00 ? 5   LYS B HD3  3  
ATOM   4067  H  HE2  . LYS A 1 5   ? 14.137  10.149  0.563   1.00 0.00 ? 5   LYS B HE2  3  
ATOM   4068  H  HE3  . LYS A 1 5   ? 15.558  10.492  1.547   1.00 0.00 ? 5   LYS B HE3  3  
ATOM   4069  H  HZ1  . LYS A 1 5   ? 14.745  9.015   3.238   1.00 0.00 ? 5   LYS B HZ1  3  
ATOM   4070  H  HZ2  . LYS A 1 5   ? 14.770  8.188   1.763   1.00 0.00 ? 5   LYS B HZ2  3  
ATOM   4071  H  HZ3  . LYS A 1 5   ? 13.305  8.752   2.391   1.00 0.00 ? 5   LYS B HZ3  3  
ATOM   4072  N  N    . GLY A 1 6   ? 9.216   12.808  5.283   1.00 0.00 ? 6   GLY B N    3  
ATOM   4073  C  CA   . GLY A 1 6   ? 8.617   13.776  6.182   1.00 0.00 ? 6   GLY B CA   3  
ATOM   4074  C  C    . GLY A 1 6   ? 7.621   13.141  7.131   1.00 0.00 ? 6   GLY B C    3  
ATOM   4075  O  O    . GLY A 1 6   ? 7.987   12.305  7.957   1.00 0.00 ? 6   GLY B O    3  
ATOM   4076  H  H    . GLY A 1 6   ? 9.504   11.936  5.626   1.00 0.00 ? 6   GLY B H    3  
ATOM   4077  H  HA2  . GLY A 1 6   ? 9.399   14.247  6.758   1.00 0.00 ? 6   GLY B HA2  3  
ATOM   4078  H  HA3  . GLY A 1 6   ? 8.111   14.529  5.596   1.00 0.00 ? 6   GLY B HA3  3  
ATOM   4079  N  N    . GLY A 1 7   ? 6.358   13.540  7.016   1.00 0.00 ? 7   GLY B N    3  
ATOM   4080  C  CA   . GLY A 1 7   ? 5.324   12.993  7.876   1.00 0.00 ? 7   GLY B CA   3  
ATOM   4081  C  C    . GLY A 1 7   ? 4.538   14.070  8.597   1.00 0.00 ? 7   GLY B C    3  
ATOM   4082  O  O    . GLY A 1 7   ? 4.043   15.010  7.975   1.00 0.00 ? 7   GLY B O    3  
ATOM   4083  H  H    . GLY A 1 7   ? 6.125   14.211  6.341   1.00 0.00 ? 7   GLY B H    3  
ATOM   4084  H  HA2  . GLY A 1 7   ? 4.644   12.409  7.275   1.00 0.00 ? 7   GLY B HA2  3  
ATOM   4085  H  HA3  . GLY A 1 7   ? 5.786   12.348  8.608   1.00 0.00 ? 7   GLY B HA3  3  
ATOM   4086  N  N    . LYS A 1 8   ? 4.425   13.933  9.915   1.00 0.00 ? 8   LYS B N    3  
ATOM   4087  C  CA   . LYS A 1 8   ? 3.694   14.900  10.727  1.00 0.00 ? 8   LYS B CA   3  
ATOM   4088  C  C    . LYS A 1 8   ? 4.174   14.863  12.174  1.00 0.00 ? 8   LYS B C    3  
ATOM   4089  O  O    . LYS A 1 8   ? 3.744   14.019  12.961  1.00 0.00 ? 8   LYS B O    3  
ATOM   4090  C  CB   . LYS A 1 8   ? 2.190   14.614  10.665  1.00 0.00 ? 8   LYS B CB   3  
ATOM   4091  C  CG   . LYS A 1 8   ? 1.349   15.552  11.521  1.00 0.00 ? 8   LYS B CG   3  
ATOM   4092  C  CD   . LYS A 1 8   ? 1.429   16.992  11.033  1.00 0.00 ? 8   LYS B CD   3  
ATOM   4093  C  CE   . LYS A 1 8   ? 0.794   17.157  9.662   1.00 0.00 ? 8   LYS B CE   3  
ATOM   4094  N  NZ   . LYS A 1 8   ? 0.805   18.576  9.212   1.00 0.00 ? 8   LYS B NZ   3  
ATOM   4095  H  H    . LYS A 1 8   ? 4.845   13.163  10.353  1.00 0.00 ? 8   LYS B H    3  
ATOM   4096  H  HA   . LYS A 1 8   ? 3.881   15.882  10.321  1.00 0.00 ? 8   LYS B HA   3  
ATOM   4097  H  HB2  . LYS A 1 8   ? 1.861   14.706  9.640   1.00 0.00 ? 8   LYS B HB2  3  
ATOM   4098  H  HB3  . LYS A 1 8   ? 2.015   13.603  10.999  1.00 0.00 ? 8   LYS B HB3  3  
ATOM   4099  H  HG2  . LYS A 1 8   ? 0.319   15.229  11.484  1.00 0.00 ? 8   LYS B HG2  3  
ATOM   4100  H  HG3  . LYS A 1 8   ? 1.704   15.506  12.541  1.00 0.00 ? 8   LYS B HG3  3  
ATOM   4101  H  HD2  . LYS A 1 8   ? 0.914   17.628  11.736  1.00 0.00 ? 8   LYS B HD2  3  
ATOM   4102  H  HD3  . LYS A 1 8   ? 2.468   17.284  10.977  1.00 0.00 ? 8   LYS B HD3  3  
ATOM   4103  H  HE2  . LYS A 1 8   ? 1.343   16.560  8.950   1.00 0.00 ? 8   LYS B HE2  3  
ATOM   4104  H  HE3  . LYS A 1 8   ? -0.228  16.812  9.708   1.00 0.00 ? 8   LYS B HE3  3  
ATOM   4105  H  HZ1  . LYS A 1 8   ? 0.235   19.161  9.856   1.00 0.00 ? 8   LYS B HZ1  3  
ATOM   4106  H  HZ2  . LYS A 1 8   ? 0.411   18.652  8.253   1.00 0.00 ? 8   LYS B HZ2  3  
ATOM   4107  H  HZ3  . LYS A 1 8   ? 1.780   18.941  9.203   1.00 0.00 ? 8   LYS B HZ3  3  
ATOM   4108  N  N    . GLY A 1 9   ? 5.068   15.785  12.518  1.00 0.00 ? 9   GLY B N    3  
ATOM   4109  C  CA   . GLY A 1 9   ? 5.595   15.842  13.869  1.00 0.00 ? 9   GLY B CA   3  
ATOM   4110  C  C    . GLY A 1 9   ? 7.108   15.926  13.897  1.00 0.00 ? 9   GLY B C    3  
ATOM   4111  O  O    . GLY A 1 9   ? 7.761   15.841  12.857  1.00 0.00 ? 9   GLY B O    3  
ATOM   4112  H  H    . GLY A 1 9   ? 5.374   16.431  11.847  1.00 0.00 ? 9   GLY B H    3  
ATOM   4113  H  HA2  . GLY A 1 9   ? 5.188   16.710  14.366  1.00 0.00 ? 9   GLY B HA2  3  
ATOM   4114  H  HA3  . GLY A 1 9   ? 5.284   14.956  14.402  1.00 0.00 ? 9   GLY B HA3  3  
ATOM   4115  N  N    . LEU A 1 10  ? 7.667   16.091  15.092  1.00 0.00 ? 10  LEU B N    3  
ATOM   4116  C  CA   . LEU A 1 10  ? 9.114   16.186  15.252  1.00 0.00 ? 10  LEU B CA   3  
ATOM   4117  C  C    . LEU A 1 10  ? 9.736   14.802  15.403  1.00 0.00 ? 10  LEU B C    3  
ATOM   4118  O  O    . LEU A 1 10  ? 10.944  14.632  15.238  1.00 0.00 ? 10  LEU B O    3  
ATOM   4119  C  CB   . LEU A 1 10  ? 9.463   17.049  16.468  1.00 0.00 ? 10  LEU B CB   3  
ATOM   4120  C  CG   . LEU A 1 10  ? 9.165   18.544  16.318  1.00 0.00 ? 10  LEU B CG   3  
ATOM   4121  C  CD1  . LEU A 1 10  ? 7.666   18.802  16.339  1.00 0.00 ? 10  LEU B CD1  3  
ATOM   4122  C  CD2  . LEU A 1 10  ? 9.858   19.336  17.417  1.00 0.00 ? 10  LEU B CD2  3  
ATOM   4123  H  H    . LEU A 1 10  ? 7.094   16.150  15.884  1.00 0.00 ? 10  LEU B H    3  
ATOM   4124  H  HA   . LEU A 1 10  ? 9.514   16.651  14.365  1.00 0.00 ? 10  LEU B HA   3  
ATOM   4125  H  HB2  . LEU A 1 10  ? 8.910   16.677  17.317  1.00 0.00 ? 10  LEU B HB2  3  
ATOM   4126  H  HB3  . LEU A 1 10  ? 10.518  16.936  16.671  1.00 0.00 ? 10  LEU B HB3  3  
ATOM   4127  H  HG   . LEU A 1 10  ? 9.548   18.887  15.368  1.00 0.00 ? 10  LEU B HG   3  
ATOM   4128  H  HD11 . LEU A 1 10  ? 7.243   18.394  17.246  1.00 0.00 ? 10  LEU B HD11 3  
ATOM   4129  H  HD12 . LEU A 1 10  ? 7.207   18.329  15.484  1.00 0.00 ? 10  LEU B HD12 3  
ATOM   4130  H  HD13 . LEU A 1 10  ? 7.482   19.866  16.304  1.00 0.00 ? 10  LEU B HD13 3  
ATOM   4131  H  HD21 . LEU A 1 10  ? 9.521   18.983  18.381  1.00 0.00 ? 10  LEU B HD21 3  
ATOM   4132  H  HD22 . LEU A 1 10  ? 9.618   20.383  17.313  1.00 0.00 ? 10  LEU B HD22 3  
ATOM   4133  H  HD23 . LEU A 1 10  ? 10.927  19.201  17.338  1.00 0.00 ? 10  LEU B HD23 3  
ATOM   4134  N  N    . GLY A 1 11  ? 8.903   13.815  15.719  1.00 0.00 ? 11  GLY B N    3  
ATOM   4135  C  CA   . GLY A 1 11  ? 9.391   12.458  15.885  1.00 0.00 ? 11  GLY B CA   3  
ATOM   4136  C  C    . GLY A 1 11  ? 8.600   11.677  16.918  1.00 0.00 ? 11  GLY B C    3  
ATOM   4137  O  O    . GLY A 1 11  ? 9.153   10.831  17.621  1.00 0.00 ? 11  GLY B O    3  
ATOM   4138  H  H    . GLY A 1 11  ? 7.951   14.009  15.840  1.00 0.00 ? 11  GLY B H    3  
ATOM   4139  H  HA2  . GLY A 1 11  ? 9.327   11.946  14.937  1.00 0.00 ? 11  GLY B HA2  3  
ATOM   4140  H  HA3  . GLY A 1 11  ? 10.424  12.496  16.194  1.00 0.00 ? 11  GLY B HA3  3  
ATOM   4141  N  N    . LYS A 1 12  ? 7.305   11.961  17.009  1.00 0.00 ? 12  LYS B N    3  
ATOM   4142  C  CA   . LYS A 1 12  ? 6.439   11.278  17.963  1.00 0.00 ? 12  LYS B CA   3  
ATOM   4143  C  C    . LYS A 1 12  ? 5.787   10.052  17.329  1.00 0.00 ? 12  LYS B C    3  
ATOM   4144  O  O    . LYS A 1 12  ? 6.078   8.917   17.710  1.00 0.00 ? 12  LYS B O    3  
ATOM   4145  C  CB   . LYS A 1 12  ? 5.362   12.232  18.485  1.00 0.00 ? 12  LYS B CB   3  
ATOM   4146  C  CG   . LYS A 1 12  ? 4.372   11.578  19.437  1.00 0.00 ? 12  LYS B CG   3  
ATOM   4147  C  CD   . LYS A 1 12  ? 5.054   11.084  20.704  1.00 0.00 ? 12  LYS B CD   3  
ATOM   4148  C  CE   . LYS A 1 12  ? 4.076   10.367  21.620  1.00 0.00 ? 12  LYS B CE   3  
ATOM   4149  N  NZ   . LYS A 1 12  ? 2.958   11.256  22.044  1.00 0.00 ? 12  LYS B NZ   3  
ATOM   4150  H  H    . LYS A 1 12  ? 6.922   12.646  16.421  1.00 0.00 ? 12  LYS B H    3  
ATOM   4151  H  HA   . LYS A 1 12  ? 7.052   10.955  18.791  1.00 0.00 ? 12  LYS B HA   3  
ATOM   4152  H  HB2  . LYS A 1 12  ? 5.844   13.047  19.006  1.00 0.00 ? 12  LYS B HB2  3  
ATOM   4153  H  HB3  . LYS A 1 12  ? 4.812   12.629  17.645  1.00 0.00 ? 12  LYS B HB3  3  
ATOM   4154  H  HG2  . LYS A 1 12  ? 3.617   12.301  19.708  1.00 0.00 ? 12  LYS B HG2  3  
ATOM   4155  H  HG3  . LYS A 1 12  ? 3.909   10.740  18.938  1.00 0.00 ? 12  LYS B HG3  3  
ATOM   4156  H  HD2  . LYS A 1 12  ? 5.844   10.400  20.433  1.00 0.00 ? 12  LYS B HD2  3  
ATOM   4157  H  HD3  . LYS A 1 12  ? 5.473   11.930  21.229  1.00 0.00 ? 12  LYS B HD3  3  
ATOM   4158  H  HE2  . LYS A 1 12  ? 3.669   9.516   21.095  1.00 0.00 ? 12  LYS B HE2  3  
ATOM   4159  H  HE3  . LYS A 1 12  ? 4.608   10.028  22.497  1.00 0.00 ? 12  LYS B HE3  3  
ATOM   4160  H  HZ1  . LYS A 1 12  ? 2.454   11.618  21.210  1.00 0.00 ? 12  LYS B HZ1  3  
ATOM   4161  H  HZ2  . LYS A 1 12  ? 3.327   12.060  22.590  1.00 0.00 ? 12  LYS B HZ2  3  
ATOM   4162  H  HZ3  . LYS A 1 12  ? 2.287   10.727  22.638  1.00 0.00 ? 12  LYS B HZ3  3  
ATOM   4163  N  N    . GLY A 1 13  ? 4.905   10.288  16.364  1.00 0.00 ? 13  GLY B N    3  
ATOM   4164  C  CA   . GLY A 1 13  ? 4.224   9.194   15.696  1.00 0.00 ? 13  GLY B CA   3  
ATOM   4165  C  C    . GLY A 1 13  ? 4.425   9.213   14.193  1.00 0.00 ? 13  GLY B C    3  
ATOM   4166  O  O    . GLY A 1 13  ? 3.584   9.728   13.455  1.00 0.00 ? 13  GLY B O    3  
ATOM   4167  H  H    . GLY A 1 13  ? 4.714   11.213  16.103  1.00 0.00 ? 13  GLY B H    3  
ATOM   4168  H  HA2  . GLY A 1 13  ? 4.601   8.260   16.085  1.00 0.00 ? 13  GLY B HA2  3  
ATOM   4169  H  HA3  . GLY A 1 13  ? 3.168   9.260   15.908  1.00 0.00 ? 13  GLY B HA3  3  
ATOM   4170  N  N    . GLY A 1 14  ? 5.540   8.650   13.740  1.00 0.00 ? 14  GLY B N    3  
ATOM   4171  C  CA   . GLY A 1 14  ? 5.830   8.611   12.318  1.00 0.00 ? 14  GLY B CA   3  
ATOM   4172  C  C    . GLY A 1 14  ? 5.562   7.249   11.709  1.00 0.00 ? 14  GLY B C    3  
ATOM   4173  O  O    . GLY A 1 14  ? 6.374   6.734   10.941  1.00 0.00 ? 14  GLY B O    3  
ATOM   4174  H  H    . GLY A 1 14  ? 6.173   8.256   14.377  1.00 0.00 ? 14  GLY B H    3  
ATOM   4175  H  HA2  . GLY A 1 14  ? 5.215   9.344   11.816  1.00 0.00 ? 14  GLY B HA2  3  
ATOM   4176  H  HA3  . GLY A 1 14  ? 6.869   8.863   12.165  1.00 0.00 ? 14  GLY B HA3  3  
ATOM   4177  N  N    . ALA A 1 15  ? 4.418   6.664   12.055  1.00 0.00 ? 15  ALA B N    3  
ATOM   4178  C  CA   . ALA A 1 15  ? 4.044   5.353   11.541  1.00 0.00 ? 15  ALA B CA   3  
ATOM   4179  C  C    . ALA A 1 15  ? 3.648   5.430   10.069  1.00 0.00 ? 15  ALA B C    3  
ATOM   4180  O  O    . ALA A 1 15  ? 4.006   4.555   9.281   1.00 0.00 ? 15  ALA B O    3  
ATOM   4181  C  CB   . ALA A 1 15  ? 2.908   4.767   12.366  1.00 0.00 ? 15  ALA B CB   3  
ATOM   4182  H  H    . ALA A 1 15  ? 3.811   7.128   12.669  1.00 0.00 ? 15  ALA B H    3  
ATOM   4183  H  HA   . ALA A 1 15  ? 4.900   4.701   11.638  1.00 0.00 ? 15  ALA B HA   3  
ATOM   4184  H  HB1  . ALA A 1 15  ? 2.695   3.765   12.024  1.00 0.00 ? 15  ALA B HB1  3  
ATOM   4185  H  HB2  . ALA A 1 15  ? 2.027   5.381   12.255  1.00 0.00 ? 15  ALA B HB2  3  
ATOM   4186  H  HB3  . ALA A 1 15  ? 3.198   4.739   13.406  1.00 0.00 ? 15  ALA B HB3  3  
ATOM   4187  N  N    . LYS A 1 16  ? 2.913   6.488   9.716   1.00 0.00 ? 16  LYS B N    3  
ATOM   4188  C  CA   . LYS A 1 16  ? 2.451   6.710   8.341   1.00 0.00 ? 16  LYS B CA   3  
ATOM   4189  C  C    . LYS A 1 16  ? 2.043   5.405   7.658   1.00 0.00 ? 16  LYS B C    3  
ATOM   4190  O  O    . LYS A 1 16  ? 2.855   4.744   7.010   1.00 0.00 ? 16  LYS B O    3  
ATOM   4191  C  CB   . LYS A 1 16  ? 3.523   7.438   7.515   1.00 0.00 ? 16  LYS B CB   3  
ATOM   4192  C  CG   . LYS A 1 16  ? 4.893   6.775   7.537   1.00 0.00 ? 16  LYS B CG   3  
ATOM   4193  C  CD   . LYS A 1 16  ? 5.891   7.519   6.662   1.00 0.00 ? 16  LYS B CD   3  
ATOM   4194  C  CE   . LYS A 1 16  ? 6.217   8.895   7.227   1.00 0.00 ? 16  LYS B CE   3  
ATOM   4195  N  NZ   . LYS A 1 16  ? 7.211   9.620   6.388   1.00 0.00 ? 16  LYS B NZ   3  
ATOM   4196  H  H    . LYS A 1 16  ? 2.672   7.143   10.404  1.00 0.00 ? 16  LYS B H    3  
ATOM   4197  H  HA   . LYS A 1 16  ? 1.578   7.344   8.399   1.00 0.00 ? 16  LYS B HA   3  
ATOM   4198  H  HB2  . LYS A 1 16  ? 3.193   7.489   6.488   1.00 0.00 ? 16  LYS B HB2  3  
ATOM   4199  H  HB3  . LYS A 1 16  ? 3.629   8.443   7.897   1.00 0.00 ? 16  LYS B HB3  3  
ATOM   4200  H  HG2  . LYS A 1 16  ? 5.260   6.763   8.551   1.00 0.00 ? 16  LYS B HG2  3  
ATOM   4201  H  HG3  . LYS A 1 16  ? 4.798   5.762   7.175   1.00 0.00 ? 16  LYS B HG3  3  
ATOM   4202  H  HD2  . LYS A 1 16  ? 6.802   6.943   6.602   1.00 0.00 ? 16  LYS B HD2  3  
ATOM   4203  H  HD3  . LYS A 1 16  ? 5.472   7.637   5.674   1.00 0.00 ? 16  LYS B HD3  3  
ATOM   4204  H  HE2  . LYS A 1 16  ? 5.308   9.475   7.275   1.00 0.00 ? 16  LYS B HE2  3  
ATOM   4205  H  HE3  . LYS A 1 16  ? 6.620   8.774   8.222   1.00 0.00 ? 16  LYS B HE3  3  
ATOM   4206  H  HZ1  . LYS A 1 16  ? 7.416   10.551  6.802   1.00 0.00 ? 16  LYS B HZ1  3  
ATOM   4207  H  HZ2  . LYS A 1 16  ? 6.837   9.754   5.426   1.00 0.00 ? 16  LYS B HZ2  3  
ATOM   4208  H  HZ3  . LYS A 1 16  ? 8.094   9.075   6.330   1.00 0.00 ? 16  LYS B HZ3  3  
ATOM   4209  N  N    . ARG A 1 17  ? 0.770   5.045   7.802   1.00 0.00 ? 17  ARG B N    3  
ATOM   4210  C  CA   . ARG A 1 17  ? 0.247   3.821   7.203   1.00 0.00 ? 17  ARG B CA   3  
ATOM   4211  C  C    . ARG A 1 17  ? 0.402   3.838   5.686   1.00 0.00 ? 17  ARG B C    3  
ATOM   4212  O  O    . ARG A 1 17  ? 1.341   3.255   5.147   1.00 0.00 ? 17  ARG B O    3  
ATOM   4213  C  CB   . ARG A 1 17  ? -1.225  3.626   7.578   1.00 0.00 ? 17  ARG B CB   3  
ATOM   4214  C  CG   . ARG A 1 17  ? -1.430  3.053   8.972   1.00 0.00 ? 17  ARG B CG   3  
ATOM   4215  C  CD   . ARG A 1 17  ? -1.024  1.589   9.037   1.00 0.00 ? 17  ARG B CD   3  
ATOM   4216  N  NE   . ARG A 1 17  ? -1.283  1.006   10.352  1.00 0.00 ? 17  ARG B NE   3  
ATOM   4217  C  CZ   . ARG A 1 17  ? -1.836  -0.191  10.533  1.00 0.00 ? 17  ARG B CZ   3  
ATOM   4218  N  NH1  . ARG A 1 17  ? -2.199  -0.925  9.488   1.00 0.00 ? 17  ARG B NH1  3  
ATOM   4219  N  NH2  . ARG A 1 17  ? -2.029  -0.653  11.761  1.00 0.00 ? 17  ARG B NH2  3  
ATOM   4220  H  H    . ARG A 1 17  ? 0.168   5.617   8.323   1.00 0.00 ? 17  ARG B H    3  
ATOM   4221  H  HA   . ARG A 1 17  ? 0.819   2.995   7.598   1.00 0.00 ? 17  ARG B HA   3  
ATOM   4222  H  HB2  . ARG A 1 17  ? -1.726  4.582   7.528   1.00 0.00 ? 17  ARG B HB2  3  
ATOM   4223  H  HB3  . ARG A 1 17  ? -1.678  2.954   6.866   1.00 0.00 ? 17  ARG B HB3  3  
ATOM   4224  H  HG2  . ARG A 1 17  ? -0.830  3.614   9.673   1.00 0.00 ? 17  ARG B HG2  3  
ATOM   4225  H  HG3  . ARG A 1 17  ? -2.474  3.142   9.235   1.00 0.00 ? 17  ARG B HG3  3  
ATOM   4226  H  HD2  . ARG A 1 17  ? -1.583  1.040   8.294   1.00 0.00 ? 17  ARG B HD2  3  
ATOM   4227  H  HD3  . ARG A 1 17  ? 0.031   1.512   8.822   1.00 0.00 ? 17  ARG B HD3  3  
ATOM   4228  H  HE   . ARG A 1 17  ? -1.029  1.531   11.138  1.00 0.00 ? 17  ARG B HE   3  
ATOM   4229  H  HH11 . ARG A 1 17  ? -2.058  -0.580  8.561   1.00 0.00 ? 17  ARG B HH11 3  
ATOM   4230  H  HH12 . ARG A 1 17  ? -2.614  -1.824  9.629   1.00 0.00 ? 17  ARG B HH12 3  
ATOM   4231  H  HH21 . ARG A 1 17  ? -1.759  -0.103  12.551  1.00 0.00 ? 17  ARG B HH21 3  
ATOM   4232  H  HH22 . ARG A 1 17  ? -2.445  -1.552  11.896  1.00 0.00 ? 17  ARG B HH22 3  
ATOM   4233  N  N    . HIS A 1 18  ? -0.521  4.512   5.000   1.00 0.00 ? 18  HIS B N    3  
ATOM   4234  C  CA   . HIS A 1 18  ? -0.477  4.594   3.541   1.00 0.00 ? 18  HIS B CA   3  
ATOM   4235  C  C    . HIS A 1 18  ? -1.543  5.525   2.996   1.00 0.00 ? 18  HIS B C    3  
ATOM   4236  O  O    . HIS A 1 18  ? -2.737  5.250   3.112   1.00 0.00 ? 18  HIS B O    3  
ATOM   4237  C  CB   . HIS A 1 18  ? -0.693  3.218   2.913   1.00 0.00 ? 18  HIS B CB   3  
ATOM   4238  C  CG   . HIS A 1 18  ? 0.410   2.773   2.008   1.00 0.00 ? 18  HIS B CG   3  
ATOM   4239  N  ND1  . HIS A 1 18  ? 0.182   2.218   0.767   1.00 0.00 ? 18  HIS B ND1  3  
ATOM   4240  C  CD2  . HIS A 1 18  ? 1.750   2.791   2.166   1.00 0.00 ? 18  HIS B CD2  3  
ATOM   4241  C  CE1  . HIS A 1 18  ? 1.336   1.913   0.203   1.00 0.00 ? 18  HIS B CE1  3  
ATOM   4242  N  NE2  . HIS A 1 18  ? 2.304   2.252   1.032   1.00 0.00 ? 18  HIS B NE2  3  
ATOM   4243  H  H    . HIS A 1 18  ? -1.245  4.961   5.483   1.00 0.00 ? 18  HIS B H    3  
ATOM   4244  H  HA   . HIS A 1 18  ? 0.492   4.964   3.249   1.00 0.00 ? 18  HIS B HA   3  
ATOM   4245  H  HB2  . HIS A 1 18  ? -0.803  2.481   3.694   1.00 0.00 ? 18  HIS B HB2  3  
ATOM   4246  H  HB3  . HIS A 1 18  ? -1.597  3.256   2.325   1.00 0.00 ? 18  HIS B HB3  3  
ATOM   4247  H  HD1  . HIS A 1 18  ? -0.697  2.073   0.359   1.00 0.00 ? 18  HIS B HD1  3  
ATOM   4248  H  HD2  . HIS A 1 18  ? 2.282   3.165   3.021   1.00 0.00 ? 18  HIS B HD2  3  
ATOM   4249  H  HE1  . HIS A 1 18  ? 1.464   1.462   -0.769  1.00 0.00 ? 18  HIS B HE1  3  
ATOM   4250  H  HE2  . HIS A 1 18  ? 3.262   2.222   0.824   1.00 0.00 ? 18  HIS B HE2  3  
ATOM   4251  N  N    . ARG A 1 19  ? -1.111  6.628   2.401   1.00 0.00 ? 19  ARG B N    3  
ATOM   4252  C  CA   . ARG A 1 19  ? -2.036  7.552   1.780   1.00 0.00 ? 19  ARG B CA   3  
ATOM   4253  C  C    . ARG A 1 19  ? -1.322  8.557   0.893   1.00 0.00 ? 19  ARG B C    3  
ATOM   4254  O  O    . ARG A 1 19  ? -0.095  8.552   0.789   1.00 0.00 ? 19  ARG B O    3  
ATOM   4255  C  CB   . ARG A 1 19  ? -2.845  8.256   2.823   1.00 0.00 ? 19  ARG B CB   3  
ATOM   4256  C  CG   . ARG A 1 19  ? -4.296  8.335   2.455   1.00 0.00 ? 19  ARG B CG   3  
ATOM   4257  C  CD   . ARG A 1 19  ? -5.117  7.582   3.459   1.00 0.00 ? 19  ARG B CD   3  
ATOM   4258  N  NE   . ARG A 1 19  ? -6.547  7.843   3.302   1.00 0.00 ? 19  ARG B NE   3  
ATOM   4259  C  CZ   . ARG A 1 19  ? -7.266  8.566   4.159   1.00 0.00 ? 19  ARG B CZ   3  
ATOM   4260  N  NH1  . ARG A 1 19  ? -6.701  9.055   5.255   1.00 0.00 ? 19  ARG B NH1  3  
ATOM   4261  N  NH2  . ARG A 1 19  ? -8.552  8.797   3.921   1.00 0.00 ? 19  ARG B NH2  3  
ATOM   4262  H  H    . ARG A 1 19  ? -0.151  6.824   2.385   1.00 0.00 ? 19  ARG B H    3  
ATOM   4263  H  HA   . ARG A 1 19  ? -2.707  6.951   1.158   1.00 0.00 ? 19  ARG B HA   3  
ATOM   4264  H  HB2  . ARG A 1 19  ? -2.755  7.694   3.735   1.00 0.00 ? 19  ARG B HB2  3  
ATOM   4265  H  HB3  . ARG A 1 19  ? -2.462  9.256   2.967   1.00 0.00 ? 19  ARG B HB3  3  
ATOM   4266  H  HG2  . ARG A 1 19  ? -4.610  9.358   2.414   1.00 0.00 ? 19  ARG B HG2  3  
ATOM   4267  H  HG3  . ARG A 1 19  ? -4.432  7.881   1.486   1.00 0.00 ? 19  ARG B HG3  3  
ATOM   4268  H  HD2  . ARG A 1 19  ? -4.916  6.527   3.298   1.00 0.00 ? 19  ARG B HD2  3  
ATOM   4269  H  HD3  . ARG A 1 19  ? -4.805  7.866   4.454   1.00 0.00 ? 19  ARG B HD3  3  
ATOM   4270  H  HE   . ARG A 1 19  ? -6.991  7.475   2.509   1.00 0.00 ? 19  ARG B HE   3  
ATOM   4271  H  HH11 . ARG A 1 19  ? -5.735  8.881   5.440   1.00 0.00 ? 19  ARG B HH11 3  
ATOM   4272  H  HH12 . ARG A 1 19  ? -7.244  9.599   5.896   1.00 0.00 ? 19  ARG B HH12 3  
ATOM   4273  H  HH21 . ARG A 1 19  ? -8.982  8.427   3.097   1.00 0.00 ? 19  ARG B HH21 3  
ATOM   4274  H  HH22 . ARG A 1 19  ? -9.090  9.340   4.564   1.00 0.00 ? 19  ARG B HH22 3  
ATOM   4275  N  N    . LYS A 1 20  ? -2.090  9.448   0.285   1.00 0.00 ? 20  LYS B N    3  
ATOM   4276  C  CA   . LYS A 1 20  ? -1.520  10.407  -0.641  1.00 0.00 ? 20  LYS B CA   3  
ATOM   4277  C  C    . LYS A 1 20  ? -2.328  11.701  -0.727  1.00 0.00 ? 20  LYS B C    3  
ATOM   4278  O  O    . LYS A 1 20  ? -3.124  11.963  0.200   1.00 0.00 ? 20  LYS B O    3  
ATOM   4279  C  CB   . LYS A 1 20  ? -1.374  9.692   -1.997  1.00 0.00 ? 20  LYS B CB   3  
ATOM   4280  C  CG   . LYS A 1 20  ? -2.535  9.747   -3.013  1.00 0.00 ? 20  LYS B CG   3  
ATOM   4281  C  CD   . LYS A 1 20  ? -3.914  9.990   -2.428  1.00 0.00 ? 20  LYS B CD   3  
ATOM   4282  C  CE   . LYS A 1 20  ? -4.302  8.931   -1.429  1.00 0.00 ? 20  LYS B CE   3  
ATOM   4283  N  NZ   . LYS A 1 20  ? -4.832  9.537   -0.179  1.00 0.00 ? 20  LYS B NZ   3  
ATOM   4284  O  OXT  . LYS A 1 20  ? -2.152  12.445  -1.714  1.00 0.00 ? 20  LYS B OXT  3  
ATOM   4285  H  H    . LYS A 1 20  ? -3.048  9.463   0.471   1.00 0.00 ? 20  LYS B H    3  
ATOM   4286  H  HA   . LYS A 1 20  ? -0.534  10.651  -0.281  1.00 0.00 ? 20  LYS B HA   3  
ATOM   4287  H  HB2  . LYS A 1 20  ? -0.505  10.078  -2.490  1.00 0.00 ? 20  LYS B HB2  3  
ATOM   4288  H  HB3  . LYS A 1 20  ? -1.198  8.642   -1.773  1.00 0.00 ? 20  LYS B HB3  3  
ATOM   4289  H  HG2  . LYS A 1 20  ? -2.330  10.520  -3.734  1.00 0.00 ? 20  LYS B HG2  3  
ATOM   4290  H  HG3  . LYS A 1 20  ? -2.562  8.785   -3.520  1.00 0.00 ? 20  LYS B HG3  3  
ATOM   4291  H  HD2  . LYS A 1 20  ? -3.942  10.952  -1.951  1.00 0.00 ? 20  LYS B HD2  3  
ATOM   4292  H  HD3  . LYS A 1 20  ? -4.639  9.964   -3.232  1.00 0.00 ? 20  LYS B HD3  3  
ATOM   4293  H  HE2  . LYS A 1 20  ? -5.075  8.318   -1.872  1.00 0.00 ? 20  LYS B HE2  3  
ATOM   4294  H  HE3  . LYS A 1 20  ? -3.432  8.318   -1.223  1.00 0.00 ? 20  LYS B HE3  3  
ATOM   4295  H  HZ1  . LYS A 1 20  ? -4.078  10.044  0.325   1.00 0.00 ? 20  LYS B HZ1  3  
ATOM   4296  H  HZ2  . LYS A 1 20  ? -5.215  8.798   0.441   1.00 0.00 ? 20  LYS B HZ2  3  
ATOM   4297  H  HZ3  . LYS A 1 20  ? -5.593  10.210  -0.405  1.00 0.00 ? 20  LYS B HZ3  3  
ATOM   4298  N  N    . GLY B 2 1   ? 15.720  -0.772  -12.541 1.00 0.00 ? 259 GLY A N    3  
ATOM   4299  C  CA   . GLY B 2 1   ? 16.602  0.341   -12.093 1.00 0.00 ? 259 GLY A CA   3  
ATOM   4300  C  C    . GLY B 2 1   ? 16.034  1.092   -10.906 1.00 0.00 ? 259 GLY A C    3  
ATOM   4301  O  O    . GLY B 2 1   ? 16.329  2.272   -10.710 1.00 0.00 ? 259 GLY A O    3  
ATOM   4302  H  H1   . GLY B 2 1   ? 16.149  -1.263  -13.350 1.00 0.00 ? 259 GLY A H1   3  
ATOM   4303  H  H2   . GLY B 2 1   ? 14.793  -0.399  -12.828 1.00 0.00 ? 259 GLY A H2   3  
ATOM   4304  H  H3   . GLY B 2 1   ? 15.584  -1.453  -11.767 1.00 0.00 ? 259 GLY A H3   3  
ATOM   4305  H  HA2  . GLY B 2 1   ? 17.565  -0.064  -11.821 1.00 0.00 ? 259 GLY A HA2  3  
ATOM   4306  H  HA3  . GLY B 2 1   ? 16.733  1.033   -12.912 1.00 0.00 ? 259 GLY A HA3  3  
ATOM   4307  N  N    . SER B 2 2   ? 15.215  0.410   -10.110 1.00 0.00 ? 260 SER A N    3  
ATOM   4308  C  CA   . SER B 2 2   ? 14.605  1.021   -8.935  1.00 0.00 ? 260 SER A CA   3  
ATOM   4309  C  C    . SER B 2 2   ? 15.308  0.618   -7.658  1.00 0.00 ? 260 SER A C    3  
ATOM   4310  O  O    . SER B 2 2   ? 16.353  -0.034  -7.677  1.00 0.00 ? 260 SER A O    3  
ATOM   4311  C  CB   . SER B 2 2   ? 13.143  0.637   -8.815  1.00 0.00 ? 260 SER A CB   3  
ATOM   4312  O  OG   . SER B 2 2   ? 12.376  1.183   -9.873  1.00 0.00 ? 260 SER A OG   3  
ATOM   4313  H  H    . SER B 2 2   ? 15.019  -0.528  -10.317 1.00 0.00 ? 260 SER A H    3  
ATOM   4314  H  HA   . SER B 2 2   ? 14.666  2.091   -9.035  1.00 0.00 ? 260 SER A HA   3  
ATOM   4315  H  HB2  . SER B 2 2   ? 13.051  -0.440  -8.836  1.00 0.00 ? 260 SER A HB2  3  
ATOM   4316  H  HB3  . SER B 2 2   ? 12.769  1.016   -7.870  1.00 0.00 ? 260 SER A HB3  3  
ATOM   4317  H  HG   . SER B 2 2   ? 11.912  0.478   -10.330 1.00 0.00 ? 260 SER A HG   3  
ATOM   4318  N  N    . TYR B 2 3   ? 14.703  1.016   -6.548  1.00 0.00 ? 261 TYR A N    3  
ATOM   4319  C  CA   . TYR B 2 3   ? 15.225  0.726   -5.229  1.00 0.00 ? 261 TYR A CA   3  
ATOM   4320  C  C    . TYR B 2 3   ? 14.312  1.301   -4.159  1.00 0.00 ? 261 TYR A C    3  
ATOM   4321  O  O    . TYR B 2 3   ? 13.478  2.166   -4.429  1.00 0.00 ? 261 TYR A O    3  
ATOM   4322  C  CB   . TYR B 2 3   ? 16.621  1.309   -5.067  1.00 0.00 ? 261 TYR A CB   3  
ATOM   4323  C  CG   . TYR B 2 3   ? 16.783  2.658   -5.706  1.00 0.00 ? 261 TYR A CG   3  
ATOM   4324  C  CD1  . TYR B 2 3   ? 15.968  3.689   -5.324  1.00 0.00 ? 261 TYR A CD1  3  
ATOM   4325  C  CD2  . TYR B 2 3   ? 17.739  2.897   -6.686  1.00 0.00 ? 261 TYR A CD2  3  
ATOM   4326  C  CE1  . TYR B 2 3   ? 16.079  4.937   -5.884  1.00 0.00 ? 261 TYR A CE1  3  
ATOM   4327  C  CE2  . TYR B 2 3   ? 17.866  4.147   -7.260  1.00 0.00 ? 261 TYR A CE2  3  
ATOM   4328  C  CZ   . TYR B 2 3   ? 17.031  5.167   -6.855  1.00 0.00 ? 261 TYR A CZ   3  
ATOM   4329  O  OH   . TYR B 2 3   ? 17.147  6.417   -7.420  1.00 0.00 ? 261 TYR A OH   3  
ATOM   4330  H  H    . TYR B 2 3   ? 13.874  1.529   -6.621  1.00 0.00 ? 261 TYR A H    3  
ATOM   4331  H  HA   . TYR B 2 3   ? 15.272  -0.347  -5.114  1.00 0.00 ? 261 TYR A HA   3  
ATOM   4332  H  HB2  . TYR B 2 3   ? 16.838  1.410   -4.018  1.00 0.00 ? 261 TYR A HB2  3  
ATOM   4333  H  HB3  . TYR B 2 3   ? 17.328  0.655   -5.502  1.00 0.00 ? 261 TYR A HB3  3  
ATOM   4334  H  HD1  . TYR B 2 3   ? 15.231  3.494   -4.563  1.00 0.00 ? 261 TYR A HD1  3  
ATOM   4335  H  HD2  . TYR B 2 3   ? 18.388  2.091   -6.996  1.00 0.00 ? 261 TYR A HD2  3  
ATOM   4336  H  HE1  . TYR B 2 3   ? 15.425  5.725   -5.557  1.00 0.00 ? 261 TYR A HE1  3  
ATOM   4337  H  HE2  . TYR B 2 3   ? 18.613  4.320   -8.020  1.00 0.00 ? 261 TYR A HE2  3  
ATOM   4338  H  HH   . TYR B 2 3   ? 17.085  7.086   -6.734  1.00 0.00 ? 261 TYR A HH   3  
ATOM   4339  N  N    . CYS B 2 4   ? 14.475  0.801   -2.953  1.00 0.00 ? 262 CYS A N    3  
ATOM   4340  C  CA   . CYS B 2 4   ? 13.687  1.252   -1.811  1.00 0.00 ? 262 CYS A CA   3  
ATOM   4341  C  C    . CYS B 2 4   ? 13.759  2.761   -1.632  1.00 0.00 ? 262 CYS A C    3  
ATOM   4342  O  O    . CYS B 2 4   ? 14.833  3.340   -1.579  1.00 0.00 ? 262 CYS A O    3  
ATOM   4343  C  CB   . CYS B 2 4   ? 14.172  0.558   -0.555  1.00 0.00 ? 262 CYS A CB   3  
ATOM   4344  S  SG   . CYS B 2 4   ? 13.857  1.415   1.019   1.00 0.00 ? 262 CYS A SG   3  
ATOM   4345  H  H    . CYS B 2 4   ? 15.132  0.080   -2.830  1.00 0.00 ? 262 CYS A H    3  
ATOM   4346  H  HA   . CYS B 2 4   ? 12.665  0.959   -1.986  1.00 0.00 ? 262 CYS A HA   3  
ATOM   4347  H  HB2  . CYS B 2 4   ? 13.690  -0.403  -0.486  1.00 0.00 ? 262 CYS A HB2  3  
ATOM   4348  H  HB3  . CYS B 2 4   ? 15.232  0.403   -0.640  1.00 0.00 ? 262 CYS A HB3  3  
ATOM   4349  N  N    . ASP B 2 5   ? 12.605  3.386   -1.535  1.00 0.00 ? 263 ASP A N    3  
ATOM   4350  C  CA   . ASP B 2 5   ? 12.516  4.831   -1.348  1.00 0.00 ? 263 ASP A CA   3  
ATOM   4351  C  C    . ASP B 2 5   ? 13.097  5.246   0.007   1.00 0.00 ? 263 ASP A C    3  
ATOM   4352  O  O    . ASP B 2 5   ? 13.179  6.430   0.334   1.00 0.00 ? 263 ASP A O    3  
ATOM   4353  C  CB   . ASP B 2 5   ? 11.048  5.235   -1.489  1.00 0.00 ? 263 ASP A CB   3  
ATOM   4354  C  CG   . ASP B 2 5   ? 10.532  6.181   -0.412  1.00 0.00 ? 263 ASP A CG   3  
ATOM   4355  O  OD1  . ASP B 2 5   ? 11.021  7.328   -0.339  1.00 0.00 ? 263 ASP A OD1  3  
ATOM   4356  O  OD2  . ASP B 2 5   ? 9.611   5.777   0.340   1.00 0.00 ? 263 ASP A OD2  3  
ATOM   4357  H  H    . ASP B 2 5   ? 11.780  2.862   -1.607  1.00 0.00 ? 263 ASP A H    3  
ATOM   4358  H  HA   . ASP B 2 5   ? 13.086  5.298   -2.134  1.00 0.00 ? 263 ASP A HA   3  
ATOM   4359  H  HB2  . ASP B 2 5   ? 10.905  5.709   -2.447  1.00 0.00 ? 263 ASP A HB2  3  
ATOM   4360  H  HB3  . ASP B 2 5   ? 10.466  4.336   -1.453  1.00 0.00 ? 263 ASP A HB3  3  
ATOM   4361  N  N    . PHE B 2 6   ? 13.533  4.253   0.770   1.00 0.00 ? 264 PHE A N    3  
ATOM   4362  C  CA   . PHE B 2 6   ? 14.101  4.488   2.103   1.00 0.00 ? 264 PHE A CA   3  
ATOM   4363  C  C    . PHE B 2 6   ? 15.613  4.221   2.158   1.00 0.00 ? 264 PHE A C    3  
ATOM   4364  O  O    . PHE B 2 6   ? 16.309  4.802   2.986   1.00 0.00 ? 264 PHE A O    3  
ATOM   4365  C  CB   . PHE B 2 6   ? 13.371  3.644   3.154   1.00 0.00 ? 264 PHE A CB   3  
ATOM   4366  C  CG   . PHE B 2 6   ? 11.884  3.857   3.168   1.00 0.00 ? 264 PHE A CG   3  
ATOM   4367  C  CD1  . PHE B 2 6   ? 11.087  3.268   2.205   1.00 0.00 ? 264 PHE A CD1  3  
ATOM   4368  C  CD2  . PHE B 2 6   ? 11.286  4.639   4.144   1.00 0.00 ? 264 PHE A CD2  3  
ATOM   4369  C  CE1  . PHE B 2 6   ? 9.719   3.449   2.210   1.00 0.00 ? 264 PHE A CE1  3  
ATOM   4370  C  CE2  . PHE B 2 6   ? 9.917   4.827   4.155   1.00 0.00 ? 264 PHE A CE2  3  
ATOM   4371  C  CZ   . PHE B 2 6   ? 9.132   4.230   3.185   1.00 0.00 ? 264 PHE A CZ   3  
ATOM   4372  H  H    . PHE B 2 6   ? 13.472  3.343   0.426   1.00 0.00 ? 264 PHE A H    3  
ATOM   4373  H  HA   . PHE B 2 6   ? 13.939  5.527   2.332   1.00 0.00 ? 264 PHE A HA   3  
ATOM   4374  H  HB2  . PHE B 2 6   ? 13.549  2.597   2.958   1.00 0.00 ? 264 PHE A HB2  3  
ATOM   4375  H  HB3  . PHE B 2 6   ? 13.751  3.888   4.134   1.00 0.00 ? 264 PHE A HB3  3  
ATOM   4376  H  HD1  . PHE B 2 6   ? 11.547  2.659   1.441   1.00 0.00 ? 264 PHE A HD1  3  
ATOM   4377  H  HD2  . PHE B 2 6   ? 11.900  5.105   4.901   1.00 0.00 ? 264 PHE A HD2  3  
ATOM   4378  H  HE1  . PHE B 2 6   ? 9.108   2.982   1.451   1.00 0.00 ? 264 PHE A HE1  3  
ATOM   4379  H  HE2  . PHE B 2 6   ? 9.461   5.439   4.919   1.00 0.00 ? 264 PHE A HE2  3  
ATOM   4380  H  HZ   . PHE B 2 6   ? 8.062   4.373   3.191   1.00 0.00 ? 264 PHE A HZ   3  
ATOM   4381  N  N    . CYS B 2 7   ? 16.120  3.336   1.291   1.00 0.00 ? 265 CYS A N    3  
ATOM   4382  C  CA   . CYS B 2 7   ? 17.562  3.035   1.251   1.00 0.00 ? 265 CYS A CA   3  
ATOM   4383  C  C    . CYS B 2 7   ? 18.104  3.277   -0.127  1.00 0.00 ? 265 CYS A C    3  
ATOM   4384  O  O    . CYS B 2 7   ? 19.261  3.660   -0.302  1.00 0.00 ? 265 CYS A O    3  
ATOM   4385  C  CB   . CYS B 2 7   ? 17.896  1.589   1.634   1.00 0.00 ? 265 CYS A CB   3  
ATOM   4386  S  SG   . CYS B 2 7   ? 17.054  0.935   3.108   1.00 0.00 ? 265 CYS A SG   3  
ATOM   4387  H  H    . CYS B 2 7   ? 15.522  2.893   0.657   1.00 0.00 ? 265 CYS A H    3  
ATOM   4388  H  HA   . CYS B 2 7   ? 18.060  3.705   1.918   1.00 0.00 ? 265 CYS A HA   3  
ATOM   4389  H  HB2  . CYS B 2 7   ? 17.662  0.948   0.814   1.00 0.00 ? 265 CYS A HB2  3  
ATOM   4390  H  HB3  . CYS B 2 7   ? 18.957  1.529   1.820   1.00 0.00 ? 265 CYS A HB3  3  
ATOM   4391  N  N    . LEU B 2 8   ? 17.253  3.042   -1.102  1.00 0.00 ? 266 LEU A N    3  
ATOM   4392  C  CA   . LEU B 2 8   ? 17.607  3.219   -2.478  1.00 0.00 ? 266 LEU A CA   3  
ATOM   4393  C  C    . LEU B 2 8   ? 18.692  2.240   -2.881  1.00 0.00 ? 266 LEU A C    3  
ATOM   4394  O  O    . LEU B 2 8   ? 19.532  2.526   -3.736  1.00 0.00 ? 266 LEU A O    3  
ATOM   4395  C  CB   . LEU B 2 8   ? 18.027  4.648   -2.711  1.00 0.00 ? 266 LEU A CB   3  
ATOM   4396  C  CG   . LEU B 2 8   ? 17.173  5.648   -1.967  1.00 0.00 ? 266 LEU A CG   3  
ATOM   4397  C  CD1  . LEU B 2 8   ? 17.889  6.972   -1.823  1.00 0.00 ? 266 LEU A CD1  3  
ATOM   4398  C  CD2  . LEU B 2 8   ? 15.855  5.794   -2.678  1.00 0.00 ? 266 LEU A CD2  3  
ATOM   4399  H  H    . LEU B 2 8   ? 16.350  2.755   -0.883  1.00 0.00 ? 266 LEU A H    3  
ATOM   4400  H  HA   . LEU B 2 8   ? 16.724  3.027   -3.053  1.00 0.00 ? 266 LEU A HA   3  
ATOM   4401  H  HB2  . LEU B 2 8   ? 19.048  4.765   -2.404  1.00 0.00 ? 266 LEU A HB2  3  
ATOM   4402  H  HB3  . LEU B 2 8   ? 17.941  4.851   -3.757  1.00 0.00 ? 266 LEU A HB3  3  
ATOM   4403  H  HG   . LEU B 2 8   ? 16.972  5.258   -0.992  1.00 0.00 ? 266 LEU A HG   3  
ATOM   4404  H  HD11 . LEU B 2 8   ? 18.866  6.886   -2.263  1.00 0.00 ? 266 LEU A HD11 3  
ATOM   4405  H  HD12 . LEU B 2 8   ? 17.985  7.217   -0.774  1.00 0.00 ? 266 LEU A HD12 3  
ATOM   4406  H  HD13 . LEU B 2 8   ? 17.331  7.745   -2.328  1.00 0.00 ? 266 LEU A HD13 3  
ATOM   4407  H  HD21 . LEU B 2 8   ? 15.504  4.803   -2.926  1.00 0.00 ? 266 LEU A HD21 3  
ATOM   4408  H  HD22 . LEU B 2 8   ? 15.988  6.375   -3.579  1.00 0.00 ? 266 LEU A HD22 3  
ATOM   4409  H  HD23 . LEU B 2 8   ? 15.142  6.281   -2.031  1.00 0.00 ? 266 LEU A HD23 3  
ATOM   4410  N  N    . GLY B 2 9   ? 18.650  1.070   -2.254  1.00 0.00 ? 267 GLY A N    3  
ATOM   4411  C  CA   . GLY B 2 9   ? 19.613  0.031   -2.532  1.00 0.00 ? 267 GLY A CA   3  
ATOM   4412  C  C    . GLY B 2 9   ? 19.074  -1.005  -3.490  1.00 0.00 ? 267 GLY A C    3  
ATOM   4413  O  O    . GLY B 2 9   ? 19.090  -0.813  -4.706  1.00 0.00 ? 267 GLY A O    3  
ATOM   4414  H  H    . GLY B 2 9   ? 17.949  0.913   -1.588  1.00 0.00 ? 267 GLY A H    3  
ATOM   4415  H  HA2  . GLY B 2 9   ? 20.512  0.476   -2.942  1.00 0.00 ? 267 GLY A HA2  3  
ATOM   4416  H  HA3  . GLY B 2 9   ? 19.862  -0.458  -1.603  1.00 0.00 ? 267 GLY A HA3  3  
ATOM   4417  N  N    . GLY B 2 10  ? 18.593  -2.110  -2.932  1.00 0.00 ? 268 GLY A N    3  
ATOM   4418  C  CA   . GLY B 2 10  ? 18.035  -3.173  -3.747  1.00 0.00 ? 268 GLY A CA   3  
ATOM   4419  C  C    . GLY B 2 10  ? 17.374  -4.261  -2.922  1.00 0.00 ? 268 GLY A C    3  
ATOM   4420  O  O    . GLY B 2 10  ? 17.652  -4.408  -1.732  1.00 0.00 ? 268 GLY A O    3  
ATOM   4421  H  H    . GLY B 2 10  ? 18.625  -2.207  -1.955  1.00 0.00 ? 268 GLY A H    3  
ATOM   4422  H  HA2  . GLY B 2 10  ? 17.300  -2.747  -4.415  1.00 0.00 ? 268 GLY A HA2  3  
ATOM   4423  H  HA3  . GLY B 2 10  ? 18.824  -3.612  -4.337  1.00 0.00 ? 268 GLY A HA3  3  
ATOM   4424  N  N    . SER B 2 11  ? 16.497  -5.025  -3.566  1.00 0.00 ? 269 SER A N    3  
ATOM   4425  C  CA   . SER B 2 11  ? 15.787  -6.105  -2.926  1.00 0.00 ? 269 SER A CA   3  
ATOM   4426  C  C    . SER B 2 11  ? 16.757  -7.231  -2.624  1.00 0.00 ? 269 SER A C    3  
ATOM   4427  O  O    . SER B 2 11  ? 17.682  -7.490  -3.396  1.00 0.00 ? 269 SER A O    3  
ATOM   4428  C  CB   . SER B 2 11  ? 14.666  -6.595  -3.831  1.00 0.00 ? 269 SER A CB   3  
ATOM   4429  O  OG   . SER B 2 11  ? 13.535  -5.769  -3.811  1.00 0.00 ? 269 SER A OG   3  
ATOM   4430  H  H    . SER B 2 11  ? 16.334  -4.866  -4.504  1.00 0.00 ? 269 SER A H    3  
ATOM   4431  H  HA   . SER B 2 11  ? 15.365  -5.739  -2.015  1.00 0.00 ? 269 SER A HA   3  
ATOM   4432  H  HB2  . SER B 2 11  ? 15.022  -6.604  -4.808  1.00 0.00 ? 269 SER A HB2  3  
ATOM   4433  H  HB3  . SER B 2 11  ? 14.373  -7.575  -3.545  1.00 0.00 ? 269 SER A HB3  3  
ATOM   4434  H  HG   . SER B 2 11  ? 12.767  -6.272  -4.088  1.00 0.00 ? 269 SER A HG   3  
ATOM   4435  N  N    . ASN B 2 12  ? 16.545  -7.888  -1.504  1.00 0.00 ? 270 ASN A N    3  
ATOM   4436  C  CA   . ASN B 2 12  ? 17.423  -8.977  -1.079  1.00 0.00 ? 270 ASN A CA   3  
ATOM   4437  C  C    . ASN B 2 12  ? 18.828  -8.439  -0.893  1.00 0.00 ? 270 ASN A C    3  
ATOM   4438  O  O    . ASN B 2 12  ? 19.811  -9.176  -0.969  1.00 0.00 ? 270 ASN A O    3  
ATOM   4439  C  CB   . ASN B 2 12  ? 17.417  -10.109 -2.091  1.00 0.00 ? 270 ASN A CB   3  
ATOM   4440  C  CG   . ASN B 2 12  ? 16.061  -10.307 -2.740  1.00 0.00 ? 270 ASN A CG   3  
ATOM   4441  O  OD1  . ASN B 2 12  ? 15.779  -9.745  -3.798  1.00 0.00 ? 270 ASN A OD1  3  
ATOM   4442  N  ND2  . ASN B 2 12  ? 15.211  -11.104 -2.103  1.00 0.00 ? 270 ASN A ND2  3  
ATOM   4443  H  H    . ASN B 2 12  ? 15.790  -7.626  -0.951  1.00 0.00 ? 270 ASN A H    3  
ATOM   4444  H  HA   . ASN B 2 12  ? 17.083  -9.356  -0.139  1.00 0.00 ? 270 ASN A HA   3  
ATOM   4445  H  HB2  . ASN B 2 12  ? 18.133  -9.886  -2.848  1.00 0.00 ? 270 ASN A HB2  3  
ATOM   4446  H  HB3  . ASN B 2 12  ? 17.697  -11.027 -1.595  1.00 0.00 ? 270 ASN A HB3  3  
ATOM   4447  H  HD21 . ASN B 2 12  ? 15.503  -11.515 -1.263  1.00 0.00 ? 270 ASN A HD21 3  
ATOM   4448  H  HD22 . ASN B 2 12  ? 14.326  -11.248 -2.500  1.00 0.00 ? 270 ASN A HD22 3  
ATOM   4449  N  N    . MET B 2 13  ? 18.900  -7.135  -0.641  1.00 0.00 ? 271 MET A N    3  
ATOM   4450  C  CA   . MET B 2 13  ? 20.173  -6.466  -0.432  1.00 0.00 ? 271 MET A CA   3  
ATOM   4451  C  C    . MET B 2 13  ? 19.971  -5.025  0.018   1.00 0.00 ? 271 MET A C    3  
ATOM   4452  O  O    . MET B 2 13  ? 20.454  -4.091  -0.624  1.00 0.00 ? 271 MET A O    3  
ATOM   4453  C  CB   . MET B 2 13  ? 20.977  -6.457  -1.703  1.00 0.00 ? 271 MET A CB   3  
ATOM   4454  C  CG   . MET B 2 13  ? 22.461  -6.191  -1.494  1.00 0.00 ? 271 MET A CG   3  
ATOM   4455  S  SD   . MET B 2 13  ? 23.418  -7.699  -1.234  1.00 0.00 ? 271 MET A SD   3  
ATOM   4456  C  CE   . MET B 2 13  ? 23.029  -8.073  0.474   1.00 0.00 ? 271 MET A CE   3  
ATOM   4457  H  H    . MET B 2 13  ? 18.070  -6.610  -0.602  1.00 0.00 ? 271 MET A H    3  
ATOM   4458  H  HA   . MET B 2 13  ? 20.713  -7.002  0.320   1.00 0.00 ? 271 MET A HA   3  
ATOM   4459  H  HB2  . MET B 2 13  ? 20.858  -7.402  -2.210  1.00 0.00 ? 271 MET A HB2  3  
ATOM   4460  H  HB3  . MET B 2 13  ? 20.577  -5.676  -2.306  1.00 0.00 ? 271 MET A HB3  3  
ATOM   4461  H  HG2  . MET B 2 13  ? 22.847  -5.684  -2.366  1.00 0.00 ? 271 MET A HG2  3  
ATOM   4462  H  HG3  . MET B 2 13  ? 22.578  -5.553  -0.627  1.00 0.00 ? 271 MET A HG3  3  
ATOM   4463  H  HE1  . MET B 2 13  ? 21.958  -8.125  0.596   1.00 0.00 ? 271 MET A HE1  3  
ATOM   4464  H  HE2  . MET B 2 13  ? 23.428  -7.300  1.112   1.00 0.00 ? 271 MET A HE2  3  
ATOM   4465  H  HE3  . MET B 2 13  ? 23.467  -9.024  0.742   1.00 0.00 ? 271 MET A HE3  3  
ATOM   4466  N  N    . ASN B 2 14  ? 19.240  -4.859  1.103   1.00 0.00 ? 272 ASN A N    3  
ATOM   4467  C  CA   . ASN B 2 14  ? 18.978  -3.542  1.671   1.00 0.00 ? 272 ASN A CA   3  
ATOM   4468  C  C    . ASN B 2 14  ? 20.258  -2.731  1.670   1.00 0.00 ? 272 ASN A C    3  
ATOM   4469  O  O    . ASN B 2 14  ? 21.350  -3.291  1.699   1.00 0.00 ? 272 ASN A O    3  
ATOM   4470  C  CB   . ASN B 2 14  ? 18.443  -3.668  3.100   1.00 0.00 ? 272 ASN A CB   3  
ATOM   4471  C  CG   . ASN B 2 14  ? 17.948  -2.350  3.659   1.00 0.00 ? 272 ASN A CG   3  
ATOM   4472  O  OD1  . ASN B 2 14  ? 16.758  -2.041  3.590   1.00 0.00 ? 272 ASN A OD1  3  
ATOM   4473  N  ND2  . ASN B 2 14  ? 18.860  -1.564  4.216   1.00 0.00 ? 272 ASN A ND2  3  
ATOM   4474  H  H    . ASN B 2 14  ? 18.865  -5.642  1.528   1.00 0.00 ? 272 ASN A H    3  
ATOM   4475  H  HA   . ASN B 2 14  ? 18.245  -3.047  1.054   1.00 0.00 ? 272 ASN A HA   3  
ATOM   4476  H  HB2  . ASN B 2 14  ? 17.625  -4.372  3.110   1.00 0.00 ? 272 ASN A HB2  3  
ATOM   4477  H  HB3  . ASN B 2 14  ? 19.232  -4.036  3.740   1.00 0.00 ? 272 ASN A HB3  3  
ATOM   4478  H  HD21 . ASN B 2 14  ? 19.789  -1.875  4.235   1.00 0.00 ? 272 ASN A HD21 3  
ATOM   4479  H  HD22 . ASN B 2 14  ? 18.567  -0.705  4.585   1.00 0.00 ? 272 ASN A HD22 3  
ATOM   4480  N  N    . LYS B 2 15  ? 20.135  -1.420  1.621   1.00 0.00 ? 273 LYS A N    3  
ATOM   4481  C  CA   . LYS B 2 15  ? 21.306  -0.577  1.590   1.00 0.00 ? 273 LYS A CA   3  
ATOM   4482  C  C    . LYS B 2 15  ? 21.607  0.084   2.915   1.00 0.00 ? 273 LYS A C    3  
ATOM   4483  O  O    . LYS B 2 15  ? 22.756  0.115   3.356   1.00 0.00 ? 273 LYS A O    3  
ATOM   4484  C  CB   . LYS B 2 15  ? 21.158  0.456   0.508   1.00 0.00 ? 273 LYS A CB   3  
ATOM   4485  C  CG   . LYS B 2 15  ? 22.166  0.197   -0.574  1.00 0.00 ? 273 LYS A CG   3  
ATOM   4486  C  CD   . LYS B 2 15  ? 22.780  1.471   -1.121  1.00 0.00 ? 273 LYS A CD   3  
ATOM   4487  C  CE   . LYS B 2 15  ? 21.708  2.436   -1.559  1.00 0.00 ? 273 LYS A CE   3  
ATOM   4488  N  NZ   . LYS B 2 15  ? 22.035  3.844   -1.204  1.00 0.00 ? 273 LYS A NZ   3  
ATOM   4489  H  H    . LYS B 2 15  ? 19.249  -1.014  1.586   1.00 0.00 ? 273 LYS A H    3  
ATOM   4490  H  HA   . LYS B 2 15  ? 22.141  -1.202  1.329   1.00 0.00 ? 273 LYS A HA   3  
ATOM   4491  H  HB2  . LYS B 2 15  ? 20.158  0.403   0.092   1.00 0.00 ? 273 LYS A HB2  3  
ATOM   4492  H  HB3  . LYS B 2 15  ? 21.318  1.433   0.908   1.00 0.00 ? 273 LYS A HB3  3  
ATOM   4493  H  HG2  . LYS B 2 15  ? 22.936  -0.416  -0.147  1.00 0.00 ? 273 LYS A HG2  3  
ATOM   4494  H  HG3  . LYS B 2 15  ? 21.683  -0.335  -1.368  1.00 0.00 ? 273 LYS A HG3  3  
ATOM   4495  H  HD2  . LYS B 2 15  ? 23.371  1.932   -0.353  1.00 0.00 ? 273 LYS A HD2  3  
ATOM   4496  H  HD3  . LYS B 2 15  ? 23.405  1.228   -1.967  1.00 0.00 ? 273 LYS A HD3  3  
ATOM   4497  H  HE2  . LYS B 2 15  ? 21.585  2.359   -2.630  1.00 0.00 ? 273 LYS A HE2  3  
ATOM   4498  H  HE3  . LYS B 2 15  ? 20.794  2.147   -1.068  1.00 0.00 ? 273 LYS A HE3  3  
ATOM   4499  H  HZ1  . LYS B 2 15  ? 21.286  4.481   -1.541  1.00 0.00 ? 273 LYS A HZ1  3  
ATOM   4500  H  HZ2  . LYS B 2 15  ? 22.936  4.123   -1.643  1.00 0.00 ? 273 LYS A HZ2  3  
ATOM   4501  H  HZ3  . LYS B 2 15  ? 22.121  3.941   -0.172  1.00 0.00 ? 273 LYS A HZ3  3  
ATOM   4502  N  N    . LYS B 2 16  ? 20.584  0.613   3.550   1.00 0.00 ? 274 LYS A N    3  
ATOM   4503  C  CA   . LYS B 2 16  ? 20.760  1.270   4.826   1.00 0.00 ? 274 LYS A CA   3  
ATOM   4504  C  C    . LYS B 2 16  ? 21.155  0.257   5.893   1.00 0.00 ? 274 LYS A C    3  
ATOM   4505  O  O    . LYS B 2 16  ? 21.373  0.606   7.053   1.00 0.00 ? 274 LYS A O    3  
ATOM   4506  C  CB   . LYS B 2 16  ? 19.488  2.022   5.195   1.00 0.00 ? 274 LYS A CB   3  
ATOM   4507  C  CG   . LYS B 2 16  ? 19.218  3.189   4.257   1.00 0.00 ? 274 LYS A CG   3  
ATOM   4508  C  CD   . LYS B 2 16  ? 19.751  4.495   4.825   1.00 0.00 ? 274 LYS A CD   3  
ATOM   4509  C  CE   . LYS B 2 16  ? 19.894  5.564   3.759   1.00 0.00 ? 274 LYS A CE   3  
ATOM   4510  N  NZ   . LYS B 2 16  ? 18.604  5.875   3.091   1.00 0.00 ? 274 LYS A NZ   3  
ATOM   4511  H  H    . LYS B 2 16  ? 19.690  0.554   3.155   1.00 0.00 ? 274 LYS A H    3  
ATOM   4512  H  HA   . LYS B 2 16  ? 21.566  1.982   4.716   1.00 0.00 ? 274 LYS A HA   3  
ATOM   4513  H  HB2  . LYS B 2 16  ? 18.651  1.339   5.151   1.00 0.00 ? 274 LYS A HB2  3  
ATOM   4514  H  HB3  . LYS B 2 16  ? 19.584  2.403   6.198   1.00 0.00 ? 274 LYS A HB3  3  
ATOM   4515  H  HG2  . LYS B 2 16  ? 19.716  2.995   3.318   1.00 0.00 ? 274 LYS A HG2  3  
ATOM   4516  H  HG3  . LYS B 2 16  ? 18.154  3.272   4.087   1.00 0.00 ? 274 LYS A HG3  3  
ATOM   4517  H  HD2  . LYS B 2 16  ? 19.079  4.850   5.591   1.00 0.00 ? 274 LYS A HD2  3  
ATOM   4518  H  HD3  . LYS B 2 16  ? 20.722  4.309   5.251   1.00 0.00 ? 274 LYS A HD3  3  
ATOM   4519  H  HE2  . LYS B 2 16  ? 20.275  6.463   4.219   1.00 0.00 ? 274 LYS A HE2  3  
ATOM   4520  H  HE3  . LYS B 2 16  ? 20.598  5.214   3.023   1.00 0.00 ? 274 LYS A HE3  3  
ATOM   4521  H  HZ1  . LYS B 2 16  ? 18.260  5.043   2.572   1.00 0.00 ? 274 LYS A HZ1  3  
ATOM   4522  H  HZ2  . LYS B 2 16  ? 18.728  6.660   2.419   1.00 0.00 ? 274 LYS A HZ2  3  
ATOM   4523  H  HZ3  . LYS B 2 16  ? 17.892  6.149   3.797   1.00 0.00 ? 274 LYS A HZ3  3  
ATOM   4524  N  N    . SER B 2 17  ? 21.243  -1.009  5.482   1.00 0.00 ? 275 SER A N    3  
ATOM   4525  C  CA   . SER B 2 17  ? 21.638  -2.082  6.369   1.00 0.00 ? 275 SER A CA   3  
ATOM   4526  C  C    . SER B 2 17  ? 22.539  -3.082  5.672   1.00 0.00 ? 275 SER A C    3  
ATOM   4527  O  O    . SER B 2 17  ? 23.353  -3.744  6.315   1.00 0.00 ? 275 SER A O    3  
ATOM   4528  C  CB   . SER B 2 17  ? 20.412  -2.813  6.911   1.00 0.00 ? 275 SER A CB   3  
ATOM   4529  O  OG   . SER B 2 17  ? 19.554  -1.931  7.615   1.00 0.00 ? 275 SER A OG   3  
ATOM   4530  H  H    . SER B 2 17  ? 21.014  -1.227  4.563   1.00 0.00 ? 275 SER A H    3  
ATOM   4531  H  HA   . SER B 2 17  ? 22.176  -1.652  7.180   1.00 0.00 ? 275 SER A HA   3  
ATOM   4532  H  HB2  . SER B 2 17  ? 19.866  -3.257  6.091   1.00 0.00 ? 275 SER A HB2  3  
ATOM   4533  H  HB3  . SER B 2 17  ? 20.737  -3.590  7.576   1.00 0.00 ? 275 SER A HB3  3  
ATOM   4534  H  HG   . SER B 2 17  ? 19.038  -2.428  8.252   1.00 0.00 ? 275 SER A HG   3  
ATOM   4535  N  N    . GLY B 2 18  ? 22.444  -3.147  4.354   1.00 0.00 ? 276 GLY A N    3  
ATOM   4536  C  CA   . GLY B 2 18  ? 23.215  -4.133  3.628   1.00 0.00 ? 276 GLY A CA   3  
ATOM   4537  C  C    . GLY B 2 18  ? 22.681  -5.530  3.863   1.00 0.00 ? 276 GLY A C    3  
ATOM   4538  O  O    . GLY B 2 18  ? 23.364  -6.524  3.615   1.00 0.00 ? 276 GLY A O    3  
ATOM   4539  H  H    . GLY B 2 18  ? 21.895  -2.488  3.871   1.00 0.00 ? 276 GLY A H    3  
ATOM   4540  H  HA2  . GLY B 2 18  ? 23.168  -3.911  2.576   1.00 0.00 ? 276 GLY A HA2  3  
ATOM   4541  H  HA3  . GLY B 2 18  ? 24.235  -4.091  3.957   1.00 0.00 ? 276 GLY A HA3  3  
ATOM   4542  N  N    . ARG B 2 19  ? 21.444  -5.591  4.343   1.00 0.00 ? 277 ARG A N    3  
ATOM   4543  C  CA   . ARG B 2 19  ? 20.778  -6.866  4.637   1.00 0.00 ? 277 ARG A CA   3  
ATOM   4544  C  C    . ARG B 2 19  ? 19.802  -7.247  3.544   1.00 0.00 ? 277 ARG A C    3  
ATOM   4545  O  O    . ARG B 2 19  ? 19.184  -6.398  2.933   1.00 0.00 ? 277 ARG A O    3  
ATOM   4546  C  CB   . ARG B 2 19  ? 19.982  -6.812  5.932   1.00 0.00 ? 277 ARG A CB   3  
ATOM   4547  C  CG   . ARG B 2 19  ? 20.806  -6.876  7.208   1.00 0.00 ? 277 ARG A CG   3  
ATOM   4548  C  CD   . ARG B 2 19  ? 22.076  -6.068  7.119   1.00 0.00 ? 277 ARG A CD   3  
ATOM   4549  N  NE   . ARG B 2 19  ? 22.760  -5.976  8.405   1.00 0.00 ? 277 ARG A NE   3  
ATOM   4550  C  CZ   . ARG B 2 19  ? 24.070  -6.147  8.558   1.00 0.00 ? 277 ARG A CZ   3  
ATOM   4551  N  NH1  . ARG B 2 19  ? 24.834  -6.428  7.511   1.00 0.00 ? 277 ARG A NH1  3  
ATOM   4552  N  NH2  . ARG B 2 19  ? 24.618  -6.039  9.761   1.00 0.00 ? 277 ARG A NH2  3  
ATOM   4553  H  H    . ARG B 2 19  ? 20.963  -4.752  4.490   1.00 0.00 ? 277 ARG A H    3  
ATOM   4554  H  HA   . ARG B 2 19  ? 21.534  -7.629  4.726   1.00 0.00 ? 277 ARG A HA   3  
ATOM   4555  H  HB2  . ARG B 2 19  ? 19.412  -5.916  5.932   1.00 0.00 ? 277 ARG A HB2  3  
ATOM   4556  H  HB3  . ARG B 2 19  ? 19.300  -7.652  5.939   1.00 0.00 ? 277 ARG A HB3  3  
ATOM   4557  H  HG2  . ARG B 2 19  ? 20.215  -6.507  8.030   1.00 0.00 ? 277 ARG A HG2  3  
ATOM   4558  H  HG3  . ARG B 2 19  ? 21.069  -7.897  7.385   1.00 0.00 ? 277 ARG A HG3  3  
ATOM   4559  H  HD2  . ARG B 2 19  ? 22.727  -6.550  6.408   1.00 0.00 ? 277 ARG A HD2  3  
ATOM   4560  H  HD3  . ARG B 2 19  ? 21.831  -5.077  6.776   1.00 0.00 ? 277 ARG A HD3  3  
ATOM   4561  H  HE   . ARG B 2 19  ? 22.217  -5.774  9.195   1.00 0.00 ? 277 ARG A HE   3  
ATOM   4562  H  HH11 . ARG B 2 19  ? 24.424  -6.512  6.602   1.00 0.00 ? 277 ARG A HH11 3  
ATOM   4563  H  HH12 . ARG B 2 19  ? 25.818  -6.558  7.630   1.00 0.00 ? 277 ARG A HH12 3  
ATOM   4564  H  HH21 . ARG B 2 19  ? 24.046  -5.829  10.554  1.00 0.00 ? 277 ARG A HH21 3  
ATOM   4565  H  HH22 . ARG B 2 19  ? 25.603  -6.169  9.876   1.00 0.00 ? 277 ARG A HH22 3  
ATOM   4566  N  N    . PRO B 2 20  ? 19.614  -8.542  3.341   1.00 0.00 ? 278 PRO A N    3  
ATOM   4567  C  CA   . PRO B 2 20  ? 18.701  -9.071  2.334   1.00 0.00 ? 278 PRO A CA   3  
ATOM   4568  C  C    . PRO B 2 20  ? 17.236  -8.851  2.684   1.00 0.00 ? 278 PRO A C    3  
ATOM   4569  O  O    . PRO B 2 20  ? 16.777  -9.231  3.761   1.00 0.00 ? 278 PRO A O    3  
ATOM   4570  C  CB   . PRO B 2 20  ? 19.003  -10.565 2.297   1.00 0.00 ? 278 PRO A CB   3  
ATOM   4571  C  CG   . PRO B 2 20  ? 20.222  -10.755 3.130   1.00 0.00 ? 278 PRO A CG   3  
ATOM   4572  C  CD   . PRO B 2 20  ? 20.286  -9.591  4.083   1.00 0.00 ? 278 PRO A CD   3  
ATOM   4573  H  HA   . PRO B 2 20  ? 18.901  -8.649  1.369   1.00 0.00 ? 278 PRO A HA   3  
ATOM   4574  H  HB2  . PRO B 2 20  ? 18.164  -11.108 2.692   1.00 0.00 ? 278 PRO A HB2  3  
ATOM   4575  H  HB3  . PRO B 2 20  ? 19.182  -10.861 1.273   1.00 0.00 ? 278 PRO A HB3  3  
ATOM   4576  H  HG2  . PRO B 2 20  ? 20.160  -11.686 3.673   1.00 0.00 ? 278 PRO A HG2  3  
ATOM   4577  H  HG3  . PRO B 2 20  ? 21.082  -10.752 2.483   1.00 0.00 ? 278 PRO A HG3  3  
ATOM   4578  H  HD2  . PRO B 2 20  ? 19.766  -9.791  5.007   1.00 0.00 ? 278 PRO A HD2  3  
ATOM   4579  H  HD3  . PRO B 2 20  ? 21.307  -9.312  4.284   1.00 0.00 ? 278 PRO A HD3  3  
ATOM   4580  N  N    . GLU B 2 21  ? 16.512  -8.236  1.759   1.00 0.00 ? 279 GLU A N    3  
ATOM   4581  C  CA   . GLU B 2 21  ? 15.095  -7.970  1.935   1.00 0.00 ? 279 GLU A CA   3  
ATOM   4582  C  C    . GLU B 2 21  ? 14.350  -8.254  0.630   1.00 0.00 ? 279 GLU A C    3  
ATOM   4583  O  O    . GLU B 2 21  ? 14.567  -9.292  0.004   1.00 0.00 ? 279 GLU A O    3  
ATOM   4584  C  CB   . GLU B 2 21  ? 14.884  -6.526  2.376   1.00 0.00 ? 279 GLU A CB   3  
ATOM   4585  C  CG   . GLU B 2 21  ? 13.632  -6.338  3.211   1.00 0.00 ? 279 GLU A CG   3  
ATOM   4586  C  CD   . GLU B 2 21  ? 13.651  -7.158  4.487   1.00 0.00 ? 279 GLU A CD   3  
ATOM   4587  O  OE1  . GLU B 2 21  ? 14.151  -6.649  5.512   1.00 0.00 ? 279 GLU A OE1  3  
ATOM   4588  O  OE2  . GLU B 2 21  ? 13.166  -8.308  4.461   1.00 0.00 ? 279 GLU A OE2  3  
ATOM   4589  H  H    . GLU B 2 21  ? 16.949  -7.946  0.932   1.00 0.00 ? 279 GLU A H    3  
ATOM   4590  H  HA   . GLU B 2 21  ? 14.720  -8.627  2.704   1.00 0.00 ? 279 GLU A HA   3  
ATOM   4591  H  HB2  . GLU B 2 21  ? 15.735  -6.210  2.962   1.00 0.00 ? 279 GLU A HB2  3  
ATOM   4592  H  HB3  . GLU B 2 21  ? 14.806  -5.901  1.500   1.00 0.00 ? 279 GLU A HB3  3  
ATOM   4593  H  HG2  . GLU B 2 21  ? 13.547  -5.301  3.473   1.00 0.00 ? 279 GLU A HG2  3  
ATOM   4594  H  HG3  . GLU B 2 21  ? 12.774  -6.633  2.624   1.00 0.00 ? 279 GLU A HG3  3  
ATOM   4595  N  N    . GLU B 2 22  ? 13.480  -7.335  0.219   1.00 0.00 ? 280 GLU A N    3  
ATOM   4596  C  CA   . GLU B 2 22  ? 12.720  -7.491  -1.015  1.00 0.00 ? 280 GLU A CA   3  
ATOM   4597  C  C    . GLU B 2 22  ? 11.821  -6.291  -1.225  1.00 0.00 ? 280 GLU A C    3  
ATOM   4598  O  O    . GLU B 2 22  ? 10.669  -6.270  -0.788  1.00 0.00 ? 280 GLU A O    3  
ATOM   4599  C  CB   . GLU B 2 22  ? 11.867  -8.746  -0.982  1.00 0.00 ? 280 GLU A CB   3  
ATOM   4600  C  CG   . GLU B 2 22  ? 11.869  -9.489  -2.297  1.00 0.00 ? 280 GLU A CG   3  
ATOM   4601  C  CD   . GLU B 2 22  ? 11.619  -8.591  -3.493  1.00 0.00 ? 280 GLU A CD   3  
ATOM   4602  O  OE1  . GLU B 2 22  ? 10.649  -7.810  -3.460  1.00 0.00 ? 280 GLU A OE1  3  
ATOM   4603  O  OE2  . GLU B 2 22  ? 12.401  -8.667  -4.464  1.00 0.00 ? 280 GLU A OE2  3  
ATOM   4604  H  H    . GLU B 2 22  ? 13.340  -6.530  0.760   1.00 0.00 ? 280 GLU A H    3  
ATOM   4605  H  HA   . GLU B 2 22  ? 13.422  -7.560  -1.855  1.00 0.00 ? 280 GLU A HA   3  
ATOM   4606  H  HB2  . GLU B 2 22  ? 12.240  -9.406  -0.213  1.00 0.00 ? 280 GLU A HB2  3  
ATOM   4607  H  HB3  . GLU B 2 22  ? 10.849  -8.474  -0.751  1.00 0.00 ? 280 GLU A HB3  3  
ATOM   4608  H  HG2  . GLU B 2 22  ? 12.831  -9.951  -2.421  1.00 0.00 ? 280 GLU A HG2  3  
ATOM   4609  H  HG3  . GLU B 2 22  ? 11.101  -10.242 -2.261  1.00 0.00 ? 280 GLU A HG3  3  
ATOM   4610  N  N    . LEU B 2 23  ? 12.383  -5.290  -1.864  1.00 0.00 ? 281 LEU A N    3  
ATOM   4611  C  CA   . LEU B 2 23  ? 11.685  -4.057  -2.192  1.00 0.00 ? 281 LEU A CA   3  
ATOM   4612  C  C    . LEU B 2 23  ? 10.291  -4.289  -2.753  1.00 0.00 ? 281 LEU A C    3  
ATOM   4613  O  O    . LEU B 2 23  ? 9.794   -5.407  -2.855  1.00 0.00 ? 281 LEU A O    3  
ATOM   4614  C  CB   . LEU B 2 23  ? 12.448  -3.302  -3.261  1.00 0.00 ? 281 LEU A CB   3  
ATOM   4615  C  CG   . LEU B 2 23  ? 13.943  -3.188  -3.060  1.00 0.00 ? 281 LEU A CG   3  
ATOM   4616  C  CD1  . LEU B 2 23  ? 14.626  -3.151  -4.400  1.00 0.00 ? 281 LEU A CD1  3  
ATOM   4617  C  CD2  . LEU B 2 23  ? 14.231  -1.940  -2.311  1.00 0.00 ? 281 LEU A CD2  3  
ATOM   4618  H  H    . LEU B 2 23  ? 13.327  -5.374  -2.111  1.00 0.00 ? 281 LEU A H    3  
ATOM   4619  H  HA   . LEU B 2 23  ? 11.626  -3.444  -1.309  1.00 0.00 ? 281 LEU A HA   3  
ATOM   4620  H  HB2  . LEU B 2 23  ? 12.273  -3.790  -4.208  1.00 0.00 ? 281 LEU A HB2  3  
ATOM   4621  H  HB3  . LEU B 2 23  ? 12.047  -2.306  -3.314  1.00 0.00 ? 281 LEU A HB3  3  
ATOM   4622  H  HG   . LEU B 2 23  ? 14.310  -4.026  -2.498  1.00 0.00 ? 281 LEU A HG   3  
ATOM   4623  H  HD11 . LEU B 2 23  ? 13.955  -2.711  -5.099  1.00 0.00 ? 281 LEU A HD11 3  
ATOM   4624  H  HD12 . LEU B 2 23  ? 14.870  -4.154  -4.714  1.00 0.00 ? 281 LEU A HD12 3  
ATOM   4625  H  HD13 . LEU B 2 23  ? 15.525  -2.558  -4.336  1.00 0.00 ? 281 LEU A HD13 3  
ATOM   4626  H  HD21 . LEU B 2 23  ? 13.544  -1.184  -2.651  1.00 0.00 ? 281 LEU A HD21 3  
ATOM   4627  H  HD22 . LEU B 2 23  ? 15.248  -1.624  -2.502  1.00 0.00 ? 281 LEU A HD22 3  
ATOM   4628  H  HD23 . LEU B 2 23  ? 14.092  -2.104  -1.257  1.00 0.00 ? 281 LEU A HD23 3  
ATOM   4629  N  N    . VAL B 2 24  ? 9.696   -3.180  -3.146  1.00 0.00 ? 282 VAL A N    3  
ATOM   4630  C  CA   . VAL B 2 24  ? 8.380   -3.162  -3.765  1.00 0.00 ? 282 VAL A CA   3  
ATOM   4631  C  C    . VAL B 2 24  ? 8.302   -1.941  -4.638  1.00 0.00 ? 282 VAL A C    3  
ATOM   4632  O  O    . VAL B 2 24  ? 8.170   -0.831  -4.131  1.00 0.00 ? 282 VAL A O    3  
ATOM   4633  C  CB   . VAL B 2 24  ? 7.247   -3.067  -2.731  1.00 0.00 ? 282 VAL A CB   3  
ATOM   4634  C  CG1  . VAL B 2 24  ? 6.829   -4.406  -2.214  1.00 0.00 ? 282 VAL A CG1  3  
ATOM   4635  C  CG2  . VAL B 2 24  ? 7.660   -2.236  -1.586  1.00 0.00 ? 282 VAL A CG2  3  
ATOM   4636  H  H    . VAL B 2 24  ? 10.175  -2.324  -3.014  1.00 0.00 ? 282 VAL A H    3  
ATOM   4637  H  HA   . VAL B 2 24  ? 8.254   -4.054  -4.360  1.00 0.00 ? 282 VAL A HA   3  
ATOM   4638  H  HB   . VAL B 2 24  ? 6.401   -2.590  -3.164  1.00 0.00 ? 282 VAL A HB   3  
ATOM   4639  H  HG11 . VAL B 2 24  ? 6.273   -4.243  -1.294  1.00 0.00 ? 282 VAL A HG11 3  
ATOM   4640  H  HG12 . VAL B 2 24  ? 7.702   -5.011  -2.014  1.00 0.00 ? 282 VAL A HG12 3  
ATOM   4641  H  HG13 . VAL B 2 24  ? 6.198   -4.899  -2.938  1.00 0.00 ? 282 VAL A HG13 3  
ATOM   4642  H  HG21 . VAL B 2 24  ? 7.891   -2.892  -0.761  1.00 0.00 ? 282 VAL A HG21 3  
ATOM   4643  H  HG22 . VAL B 2 24  ? 6.852   -1.571  -1.311  1.00 0.00 ? 282 VAL A HG22 3  
ATOM   4644  H  HG23 . VAL B 2 24  ? 8.532   -1.659  -1.849  1.00 0.00 ? 282 VAL A HG23 3  
ATOM   4645  N  N    . SER B 2 25  ? 8.342   -2.136  -5.942  1.00 0.00 ? 283 SER A N    3  
ATOM   4646  C  CA   . SER B 2 25  ? 8.295   -1.006  -6.839  1.00 0.00 ? 283 SER A CA   3  
ATOM   4647  C  C    . SER B 2 25  ? 6.872   -0.671  -7.204  1.00 0.00 ? 283 SER A C    3  
ATOM   4648  O  O    . SER B 2 25  ? 5.949   -1.454  -6.975  1.00 0.00 ? 283 SER A O    3  
ATOM   4649  C  CB   . SER B 2 25  ? 9.112   -1.256  -8.104  1.00 0.00 ? 283 SER A CB   3  
ATOM   4650  O  OG   . SER B 2 25  ? 8.716   -2.460  -8.739  1.00 0.00 ? 283 SER A OG   3  
ATOM   4651  H  H    . SER B 2 25  ? 8.402   -3.045  -6.301  1.00 0.00 ? 283 SER A H    3  
ATOM   4652  H  HA   . SER B 2 25  ? 8.727   -0.165  -6.312  1.00 0.00 ? 283 SER A HA   3  
ATOM   4653  H  HB2  . SER B 2 25  ? 8.958   -0.428  -8.795  1.00 0.00 ? 283 SER A HB2  3  
ATOM   4654  H  HB3  . SER B 2 25  ? 10.161  -1.325  -7.838  1.00 0.00 ? 283 SER A HB3  3  
ATOM   4655  H  HG   . SER B 2 25  ? 8.534   -2.288  -9.665  1.00 0.00 ? 283 SER A HG   3  
ATOM   4656  N  N    . CYS B 2 26  ? 6.708   0.499   -7.774  1.00 0.00 ? 284 CYS A N    3  
ATOM   4657  C  CA   . CYS B 2 26  ? 5.414   0.973   -8.183  1.00 0.00 ? 284 CYS A CA   3  
ATOM   4658  C  C    . CYS B 2 26  ? 5.179   0.615   -9.633  1.00 0.00 ? 284 CYS A C    3  
ATOM   4659  O  O    . CYS B 2 26  ? 6.047   0.843   -10.476 1.00 0.00 ? 284 CYS A O    3  
ATOM   4660  C  CB   . CYS B 2 26  ? 5.393   2.478   -8.031  1.00 0.00 ? 284 CYS A CB   3  
ATOM   4661  S  SG   . CYS B 2 26  ? 3.759   3.253   -8.031  1.00 0.00 ? 284 CYS A SG   3  
ATOM   4662  H  H    . CYS B 2 26  ? 7.491   1.065   -7.933  1.00 0.00 ? 284 CYS A H    3  
ATOM   4663  H  HA   . CYS B 2 26  ? 4.658   0.530   -7.552  1.00 0.00 ? 284 CYS A HA   3  
ATOM   4664  H  HB2  . CYS B 2 26  ? 5.870   2.740   -7.118  1.00 0.00 ? 284 CYS A HB2  3  
ATOM   4665  H  HB3  . CYS B 2 26  ? 5.950   2.911   -8.831  1.00 0.00 ? 284 CYS A HB3  3  
ATOM   4666  N  N    . ALA B 2 27  ? 4.021   0.060   -9.939  1.00 0.00 ? 285 ALA A N    3  
ATOM   4667  C  CA   . ALA B 2 27  ? 3.728   -0.279  -11.311 1.00 0.00 ? 285 ALA A CA   3  
ATOM   4668  C  C    . ALA B 2 27  ? 3.161   0.934   -12.021 1.00 0.00 ? 285 ALA A C    3  
ATOM   4669  O  O    . ALA B 2 27  ? 2.481   0.814   -13.042 1.00 0.00 ? 285 ALA A O    3  
ATOM   4670  C  CB   . ALA B 2 27  ? 2.777   -1.449  -11.385 1.00 0.00 ? 285 ALA A CB   3  
ATOM   4671  H  H    . ALA B 2 27  ? 3.358   -0.130  -9.234  1.00 0.00 ? 285 ALA A H    3  
ATOM   4672  H  HA   . ALA B 2 27  ? 4.655   -0.563  -11.790 1.00 0.00 ? 285 ALA A HA   3  
ATOM   4673  H  HB1  . ALA B 2 27  ? 1.769   -1.111  -11.199 1.00 0.00 ? 285 ALA A HB1  3  
ATOM   4674  H  HB2  . ALA B 2 27  ? 3.051   -2.183  -10.641 1.00 0.00 ? 285 ALA A HB2  3  
ATOM   4675  H  HB3  . ALA B 2 27  ? 2.831   -1.895  -12.367 1.00 0.00 ? 285 ALA A HB3  3  
ATOM   4676  N  N    . ASP B 2 28  ? 3.449   2.110   -11.466 1.00 0.00 ? 286 ASP A N    3  
ATOM   4677  C  CA   . ASP B 2 28  ? 2.976   3.347   -12.032 1.00 0.00 ? 286 ASP A CA   3  
ATOM   4678  C  C    . ASP B 2 28  ? 4.130   4.318   -12.203 1.00 0.00 ? 286 ASP A C    3  
ATOM   4679  O  O    . ASP B 2 28  ? 4.195   5.040   -13.199 1.00 0.00 ? 286 ASP A O    3  
ATOM   4680  C  CB   . ASP B 2 28  ? 1.912   3.967   -11.131 1.00 0.00 ? 286 ASP A CB   3  
ATOM   4681  C  CG   . ASP B 2 28  ? 1.036   4.963   -11.867 1.00 0.00 ? 286 ASP A CG   3  
ATOM   4682  O  OD1  . ASP B 2 28  ? 1.409   6.153   -11.925 1.00 0.00 ? 286 ASP A OD1  3  
ATOM   4683  O  OD2  . ASP B 2 28  ? -0.024  4.551   -12.384 1.00 0.00 ? 286 ASP A OD2  3  
ATOM   4684  H  H    . ASP B 2 28  ? 4.001   2.146   -10.655 1.00 0.00 ? 286 ASP A H    3  
ATOM   4685  H  HA   . ASP B 2 28  ? 2.544   3.131   -12.997 1.00 0.00 ? 286 ASP A HA   3  
ATOM   4686  H  HB2  . ASP B 2 28  ? 1.288   3.185   -10.734 1.00 0.00 ? 286 ASP A HB2  3  
ATOM   4687  H  HB3  . ASP B 2 28  ? 2.399   4.480   -10.314 1.00 0.00 ? 286 ASP A HB3  3  
ATOM   4688  N  N    . CYS B 2 29  ? 5.049   4.340   -11.232 1.00 0.00 ? 287 CYS A N    3  
ATOM   4689  C  CA   . CYS B 2 29  ? 6.170   5.260   -11.317 1.00 0.00 ? 287 CYS A CA   3  
ATOM   4690  C  C    . CYS B 2 29  ? 7.528   4.588   -11.122 1.00 0.00 ? 287 CYS A C    3  
ATOM   4691  O  O    . CYS B 2 29  ? 8.571   5.161   -11.443 1.00 0.00 ? 287 CYS A O    3  
ATOM   4692  C  CB   . CYS B 2 29  ? 5.935   6.377   -10.329 1.00 0.00 ? 287 CYS A CB   3  
ATOM   4693  S  SG   . CYS B 2 29  ? 6.206   5.990   -8.574  1.00 0.00 ? 287 CYS A SG   3  
ATOM   4694  H  H    . CYS B 2 29  ? 4.944   3.763   -10.431 1.00 0.00 ? 287 CYS A H    3  
ATOM   4695  H  HA   . CYS B 2 29  ? 6.152   5.684   -12.309 1.00 0.00 ? 287 CYS A HA   3  
ATOM   4696  H  HB2  . CYS B 2 29  ? 6.573   7.188   -10.580 1.00 0.00 ? 287 CYS A HB2  3  
ATOM   4697  H  HB3  . CYS B 2 29  ? 4.902   6.668   -10.432 1.00 0.00 ? 287 CYS A HB3  3  
ATOM   4698  N  N    . GLY B 2 30  ? 7.502   3.382   -10.601 1.00 0.00 ? 288 GLY A N    3  
ATOM   4699  C  CA   . GLY B 2 30  ? 8.710   2.605   -10.407 1.00 0.00 ? 288 GLY A CA   3  
ATOM   4700  C  C    . GLY B 2 30  ? 9.491   2.940   -9.153  1.00 0.00 ? 288 GLY A C    3  
ATOM   4701  O  O    . GLY B 2 30  ? 10.720  2.925   -9.168  1.00 0.00 ? 288 GLY A O    3  
ATOM   4702  H  H    . GLY B 2 30  ? 6.650   3.012   -10.344 1.00 0.00 ? 288 GLY A H    3  
ATOM   4703  H  HA2  . GLY B 2 30  ? 8.427   1.566   -10.352 1.00 0.00 ? 288 GLY A HA2  3  
ATOM   4704  H  HA3  . GLY B 2 30  ? 9.352   2.744   -11.265 1.00 0.00 ? 288 GLY A HA3  3  
ATOM   4705  N  N    . ARG B 2 31  ? 8.796   3.251   -8.071  1.00 0.00 ? 289 ARG A N    3  
ATOM   4706  C  CA   . ARG B 2 31  ? 9.465   3.533   -6.810  1.00 0.00 ? 289 ARG A CA   3  
ATOM   4707  C  C    . ARG B 2 31  ? 9.379   2.312   -5.913  1.00 0.00 ? 289 ARG A C    3  
ATOM   4708  O  O    . ARG B 2 31  ? 8.298   1.920   -5.477  1.00 0.00 ? 289 ARG A O    3  
ATOM   4709  C  CB   . ARG B 2 31  ? 8.868   4.757   -6.132  1.00 0.00 ? 289 ARG A CB   3  
ATOM   4710  C  CG   . ARG B 2 31  ? 8.788   4.669   -4.625  1.00 0.00 ? 289 ARG A CG   3  
ATOM   4711  C  CD   . ARG B 2 31  ? 8.818   6.054   -4.026  1.00 0.00 ? 289 ARG A CD   3  
ATOM   4712  N  NE   . ARG B 2 31  ? 7.619   6.818   -4.358  1.00 0.00 ? 289 ARG A NE   3  
ATOM   4713  C  CZ   . ARG B 2 31  ? 7.577   7.745   -5.313  1.00 0.00 ? 289 ARG A CZ   3  
ATOM   4714  N  NH1  . ARG B 2 31  ? 8.666   8.031   -6.014  1.00 0.00 ? 289 ARG A NH1  3  
ATOM   4715  N  NH2  . ARG B 2 31  ? 6.444   8.385   -5.566  1.00 0.00 ? 289 ARG A NH2  3  
ATOM   4716  H  H    . ARG B 2 31  ? 7.819   3.293   -8.120  1.00 0.00 ? 289 ARG A H    3  
ATOM   4717  H  HA   . ARG B 2 31  ? 10.506  3.727   -7.026  1.00 0.00 ? 289 ARG A HA   3  
ATOM   4718  H  HB2  . ARG B 2 31  ? 9.477   5.613   -6.374  1.00 0.00 ? 289 ARG A HB2  3  
ATOM   4719  H  HB3  . ARG B 2 31  ? 7.880   4.913   -6.513  1.00 0.00 ? 289 ARG A HB3  3  
ATOM   4720  H  HG2  . ARG B 2 31  ? 7.863   4.181   -4.350  1.00 0.00 ? 289 ARG A HG2  3  
ATOM   4721  H  HG3  . ARG B 2 31  ? 9.628   4.102   -4.253  1.00 0.00 ? 289 ARG A HG3  3  
ATOM   4722  H  HD2  . ARG B 2 31  ? 8.903   5.975   -2.952  1.00 0.00 ? 289 ARG A HD2  3  
ATOM   4723  H  HD3  . ARG B 2 31  ? 9.680   6.565   -4.423  1.00 0.00 ? 289 ARG A HD3  3  
ATOM   4724  H  HE   . ARG B 2 31  ? 6.803   6.628   -3.850  1.00 0.00 ? 289 ARG A HE   3  
ATOM   4725  H  HH11 . ARG B 2 31  ? 9.522   7.551   -5.827  1.00 0.00 ? 289 ARG A HH11 3  
ATOM   4726  H  HH12 . ARG B 2 31  ? 8.630   8.728   -6.731  1.00 0.00 ? 289 ARG A HH12 3  
ATOM   4727  H  HH21 . ARG B 2 31  ? 5.621   8.172   -5.041  1.00 0.00 ? 289 ARG A HH21 3  
ATOM   4728  H  HH22 . ARG B 2 31  ? 6.413   9.081   -6.283  1.00 0.00 ? 289 ARG A HH22 3  
ATOM   4729  N  N    . SER B 2 32  ? 10.524  1.722   -5.634  1.00 0.00 ? 290 SER A N    3  
ATOM   4730  C  CA   . SER B 2 32  ? 10.569  0.519   -4.814  1.00 0.00 ? 290 SER A CA   3  
ATOM   4731  C  C    . SER B 2 32  ? 10.729  0.852   -3.343  1.00 0.00 ? 290 SER A C    3  
ATOM   4732  O  O    . SER B 2 32  ? 11.055  1.979   -2.990  1.00 0.00 ? 290 SER A O    3  
ATOM   4733  C  CB   . SER B 2 32  ? 11.692  -0.411  -5.263  1.00 0.00 ? 290 SER A CB   3  
ATOM   4734  O  OG   . SER B 2 32  ? 11.681  -0.592  -6.664  1.00 0.00 ? 290 SER A OG   3  
ATOM   4735  H  H    . SER B 2 32  ? 11.353  2.115   -5.969  1.00 0.00 ? 290 SER A H    3  
ATOM   4736  H  HA   . SER B 2 32  ? 9.634   0.013   -4.946  1.00 0.00 ? 290 SER A HA   3  
ATOM   4737  H  HB2  . SER B 2 32  ? 12.636  0.005   -4.975  1.00 0.00 ? 290 SER A HB2  3  
ATOM   4738  H  HB3  . SER B 2 32  ? 11.566  -1.374  -4.790  1.00 0.00 ? 290 SER A HB3  3  
ATOM   4739  H  HG   . SER B 2 32  ? 12.527  -0.944  -6.949  1.00 0.00 ? 290 SER A HG   3  
ATOM   4740  N  N    . GLY B 2 33  ? 10.461  -0.135  -2.491  1.00 0.00 ? 291 GLY A N    3  
ATOM   4741  C  CA   . GLY B 2 33  ? 10.604  0.066   -1.051  1.00 0.00 ? 291 GLY A CA   3  
ATOM   4742  C  C    . GLY B 2 33  ? 10.697  -1.234  -0.275  1.00 0.00 ? 291 GLY A C    3  
ATOM   4743  O  O    . GLY B 2 33  ? 10.062  -2.211  -0.628  1.00 0.00 ? 291 GLY A O    3  
ATOM   4744  H  H    . GLY B 2 33  ? 10.128  -0.997  -2.846  1.00 0.00 ? 291 GLY A H    3  
ATOM   4745  H  HA2  . GLY B 2 33  ? 11.492  0.645   -0.863  1.00 0.00 ? 291 GLY A HA2  3  
ATOM   4746  H  HA3  . GLY B 2 33  ? 9.749   0.621   -0.693  1.00 0.00 ? 291 GLY A HA3  3  
ATOM   4747  N  N    . HIS B 2 34  ? 11.496  -1.280  0.781   1.00 0.00 ? 292 HIS A N    3  
ATOM   4748  C  CA   . HIS B 2 34  ? 11.563  -2.514  1.560   1.00 0.00 ? 292 HIS A CA   3  
ATOM   4749  C  C    . HIS B 2 34  ? 10.370  -2.535  2.508   1.00 0.00 ? 292 HIS A C    3  
ATOM   4750  O  O    . HIS B 2 34  ? 10.148  -1.565  3.213   1.00 0.00 ? 292 HIS A O    3  
ATOM   4751  C  CB   . HIS B 2 34  ? 12.874  -2.632  2.346   1.00 0.00 ? 292 HIS A CB   3  
ATOM   4752  C  CG   . HIS B 2 34  ? 14.109  -2.665  1.490   1.00 0.00 ? 292 HIS A CG   3  
ATOM   4753  N  ND1  . HIS B 2 34  ? 15.087  -1.688  1.527   1.00 0.00 ? 292 HIS A ND1  3  
ATOM   4754  C  CD2  . HIS B 2 34  ? 14.512  -3.557  0.556   1.00 0.00 ? 292 HIS A CD2  3  
ATOM   4755  C  CE1  . HIS B 2 34  ? 16.036  -1.987  0.657   1.00 0.00 ? 292 HIS A CE1  3  
ATOM   4756  N  NE2  . HIS B 2 34  ? 15.714  -3.118  0.063   1.00 0.00 ? 292 HIS A NE2  3  
ATOM   4757  H  H    . HIS B 2 34  ? 12.025  -0.485  1.048   1.00 0.00 ? 292 HIS A H    3  
ATOM   4758  H  HA   . HIS B 2 34  ? 11.474  -3.340  0.872   1.00 0.00 ? 292 HIS A HA   3  
ATOM   4759  H  HB2  . HIS B 2 34  ? 12.957  -1.794  3.015   1.00 0.00 ? 292 HIS A HB2  3  
ATOM   4760  H  HB3  . HIS B 2 34  ? 12.845  -3.545  2.925   1.00 0.00 ? 292 HIS A HB3  3  
ATOM   4761  H  HD2  . HIS B 2 34  ? 13.948  -4.397  0.190   1.00 0.00 ? 292 HIS A HD2  3  
ATOM   4762  H  HE1  . HIS B 2 34  ? 16.884  -1.368  0.409   1.00 0.00 ? 292 HIS A HE1  3  
ATOM   4763  H  HE2  . HIS B 2 34  ? 16.195  -3.512  -0.693  1.00 0.00 ? 292 HIS A HE2  3  
ATOM   4764  N  N    . PRO B 2 35  ? 9.569   -3.625  2.539   1.00 0.00 ? 293 PRO A N    3  
ATOM   4765  C  CA   . PRO B 2 35  ? 8.380   -3.702  3.396   1.00 0.00 ? 293 PRO A CA   3  
ATOM   4766  C  C    . PRO B 2 35  ? 8.720   -3.499  4.868   1.00 0.00 ? 293 PRO A C    3  
ATOM   4767  O  O    . PRO B 2 35  ? 7.836   -3.281  5.695   1.00 0.00 ? 293 PRO A O    3  
ATOM   4768  C  CB   . PRO B 2 35  ? 7.828   -5.106  3.111   1.00 0.00 ? 293 PRO A CB   3  
ATOM   4769  C  CG   . PRO B 2 35  ? 8.383   -5.445  1.779   1.00 0.00 ? 293 PRO A CG   3  
ATOM   4770  C  CD   . PRO B 2 35  ? 9.756   -4.878  1.799   1.00 0.00 ? 293 PRO A CD   3  
ATOM   4771  H  HA   . PRO B 2 35  ? 7.647   -2.957  3.098   1.00 0.00 ? 293 PRO A HA   3  
ATOM   4772  H  HB2  . PRO B 2 35  ? 8.174   -5.797  3.859   1.00 0.00 ? 293 PRO A HB2  3  
ATOM   4773  H  HB3  . PRO B 2 35  ? 6.748   -5.082  3.097   1.00 0.00 ? 293 PRO A HB3  3  
ATOM   4774  H  HG2  . PRO B 2 35  ? 8.428   -6.511  1.656   1.00 0.00 ? 293 PRO A HG2  3  
ATOM   4775  H  HG3  . PRO B 2 35  ? 7.794   -4.995  0.998   1.00 0.00 ? 293 PRO A HG3  3  
ATOM   4776  H  HD2  . PRO B 2 35  ? 10.400  -5.540  2.343   1.00 0.00 ? 293 PRO A HD2  3  
ATOM   4777  H  HD3  . PRO B 2 35  ? 10.117  -4.708  0.800   1.00 0.00 ? 293 PRO A HD3  3  
ATOM   4778  N  N    . THR B 2 36  ? 10.006  -3.582  5.192   1.00 0.00 ? 294 THR A N    3  
ATOM   4779  C  CA   . THR B 2 36  ? 10.467  -3.343  6.553   1.00 0.00 ? 294 THR A CA   3  
ATOM   4780  C  C    . THR B 2 36  ? 10.631  -1.846  6.740   1.00 0.00 ? 294 THR A C    3  
ATOM   4781  O  O    . THR B 2 36  ? 10.430  -1.300  7.825   1.00 0.00 ? 294 THR A O    3  
ATOM   4782  C  CB   . THR B 2 36  ? 11.806  -4.031  6.842   1.00 0.00 ? 294 THR A CB   3  
ATOM   4783  O  OG1  . THR B 2 36  ? 11.781  -5.394  6.400   1.00 0.00 ? 294 THR A OG1  3  
ATOM   4784  C  CG2  . THR B 2 36  ? 12.081  -3.971  8.321   1.00 0.00 ? 294 THR A CG2  3  
ATOM   4785  H  H    . THR B 2 36  ? 10.660  -3.810  4.498   1.00 0.00 ? 294 THR A H    3  
ATOM   4786  H  HA   . THR B 2 36  ? 9.729   -3.709  7.250   1.00 0.00 ? 294 THR A HA   3  
ATOM   4787  H  HB   . THR B 2 36  ? 12.586  -3.498  6.333   1.00 0.00 ? 294 THR A HB   3  
ATOM   4788  H  HG1  . THR B 2 36  ? 11.181  -5.478  5.656   1.00 0.00 ? 294 THR A HG1  3  
ATOM   4789  H  HG21 . THR B 2 36  ? 11.681  -3.045  8.691   1.00 0.00 ? 294 THR A HG21 3  
ATOM   4790  H  HG22 . THR B 2 36  ? 13.146  -4.007  8.495   1.00 0.00 ? 294 THR A HG22 3  
ATOM   4791  H  HG23 . THR B 2 36  ? 11.599  -4.800  8.817   1.00 0.00 ? 294 THR A HG23 3  
ATOM   4792  N  N    . CYS B 2 37  ? 11.005  -1.203  5.644   1.00 0.00 ? 295 CYS A N    3  
ATOM   4793  C  CA   . CYS B 2 37  ? 11.191  0.236   5.586   1.00 0.00 ? 295 CYS A CA   3  
ATOM   4794  C  C    . CYS B 2 37  ? 9.845   0.908   5.397   1.00 0.00 ? 295 CYS A C    3  
ATOM   4795  O  O    . CYS B 2 37  ? 9.648   2.085   5.699   1.00 0.00 ? 295 CYS A O    3  
ATOM   4796  C  CB   . CYS B 2 37  ? 12.093  0.555   4.402   1.00 0.00 ? 295 CYS A CB   3  
ATOM   4797  S  SG   . CYS B 2 37  ? 13.728  -0.216  4.525   1.00 0.00 ? 295 CYS A SG   3  
ATOM   4798  H  H    . CYS B 2 37  ? 11.170  -1.726  4.833   1.00 0.00 ? 295 CYS A H    3  
ATOM   4799  H  HA   . CYS B 2 37  ? 11.651  0.568   6.503   1.00 0.00 ? 295 CYS A HA   3  
ATOM   4800  H  HB2  . CYS B 2 37  ? 11.626  0.193   3.501   1.00 0.00 ? 295 CYS A HB2  3  
ATOM   4801  H  HB3  . CYS B 2 37  ? 12.222  1.612   4.325   1.00 0.00 ? 295 CYS A HB3  3  
ATOM   4802  N  N    . LEU B 2 38  ? 8.936   0.107   4.886   1.00 0.00 ? 296 LEU A N    3  
ATOM   4803  C  CA   . LEU B 2 38  ? 7.576   0.505   4.593   1.00 0.00 ? 296 LEU A CA   3  
ATOM   4804  C  C    . LEU B 2 38  ? 6.685   0.243   5.795   1.00 0.00 ? 296 LEU A C    3  
ATOM   4805  O  O    . LEU B 2 38  ? 5.605   0.821   5.927   1.00 0.00 ? 296 LEU A O    3  
ATOM   4806  C  CB   . LEU B 2 38  ? 7.076   -0.327  3.427   1.00 0.00 ? 296 LEU A CB   3  
ATOM   4807  C  CG   . LEU B 2 38  ? 7.759   -0.084  2.091   1.00 0.00 ? 296 LEU A CG   3  
ATOM   4808  C  CD1  . LEU B 2 38  ? 7.680   -1.327  1.242   1.00 0.00 ? 296 LEU A CD1  3  
ATOM   4809  C  CD2  . LEU B 2 38  ? 7.120   1.081   1.372   1.00 0.00 ? 296 LEU A CD2  3  
ATOM   4810  H  H    . LEU B 2 38  ? 9.196   -0.817  4.703   1.00 0.00 ? 296 LEU A H    3  
ATOM   4811  H  HA   . LEU B 2 38  ? 7.556   1.553   4.325   1.00 0.00 ? 296 LEU A HA   3  
ATOM   4812  H  HB2  . LEU B 2 38  ? 7.203   -1.368  3.682   1.00 0.00 ? 296 LEU A HB2  3  
ATOM   4813  H  HB3  . LEU B 2 38  ? 6.030   -0.138  3.305   1.00 0.00 ? 296 LEU A HB3  3  
ATOM   4814  H  HG   . LEU B 2 38  ? 8.797   0.141   2.251   1.00 0.00 ? 296 LEU A HG   3  
ATOM   4815  H  HD11 . LEU B 2 38  ? 7.993   -1.104  0.234   1.00 0.00 ? 296 LEU A HD11 3  
ATOM   4816  H  HD12 . LEU B 2 38  ? 6.668   -1.689  1.230   1.00 0.00 ? 296 LEU A HD12 3  
ATOM   4817  H  HD13 . LEU B 2 38  ? 8.323   -2.082  1.653   1.00 0.00 ? 296 LEU A HD13 3  
ATOM   4818  H  HD21 . LEU B 2 38  ? 7.177   0.905   0.313   1.00 0.00 ? 296 LEU A HD21 3  
ATOM   4819  H  HD22 . LEU B 2 38  ? 7.645   1.992   1.618   1.00 0.00 ? 296 LEU A HD22 3  
ATOM   4820  H  HD23 . LEU B 2 38  ? 6.086   1.168   1.668   1.00 0.00 ? 296 LEU A HD23 3  
ATOM   4821  N  N    . GLN B 2 39  ? 7.160   -0.662  6.649   1.00 0.00 ? 297 GLN A N    3  
ATOM   4822  C  CA   . GLN B 2 39  ? 6.448   -1.069  7.853   1.00 0.00 ? 297 GLN A CA   3  
ATOM   4823  C  C    . GLN B 2 39  ? 5.255   -1.958  7.507   1.00 0.00 ? 297 GLN A C    3  
ATOM   4824  O  O    . GLN B 2 39  ? 4.298   -2.055  8.274   1.00 0.00 ? 297 GLN A O    3  
ATOM   4825  C  CB   . GLN B 2 39  ? 5.993   0.144   8.669   1.00 0.00 ? 297 GLN A CB   3  
ATOM   4826  C  CG   . GLN B 2 39  ? 7.126   0.831   9.396   1.00 0.00 ? 297 GLN A CG   3  
ATOM   4827  C  CD   . GLN B 2 39  ? 6.673   2.067   10.152  1.00 0.00 ? 297 GLN A CD   3  
ATOM   4828  O  OE1  . GLN B 2 39  ? 5.534   2.144   10.612  1.00 0.00 ? 297 GLN A OE1  3  
ATOM   4829  N  NE2  . GLN B 2 39  ? 7.566   3.041   10.281  1.00 0.00 ? 297 GLN A NE2  3  
ATOM   4830  H  H    . GLN B 2 39  ? 8.029   -1.072  6.460   1.00 0.00 ? 297 GLN A H    3  
ATOM   4831  H  HA   . GLN B 2 39  ? 7.144   -1.640  8.446   1.00 0.00 ? 297 GLN A HA   3  
ATOM   4832  H  HB2  . GLN B 2 39  ? 5.543   0.863   8.005   1.00 0.00 ? 297 GLN A HB2  3  
ATOM   4833  H  HB3  . GLN B 2 39  ? 5.264   -0.176  9.399   1.00 0.00 ? 297 GLN A HB3  3  
ATOM   4834  H  HG2  . GLN B 2 39  ? 7.564   0.137   10.097  1.00 0.00 ? 297 GLN A HG2  3  
ATOM   4835  H  HG3  . GLN B 2 39  ? 7.863   1.120   8.668   1.00 0.00 ? 297 GLN A HG3  3  
ATOM   4836  H  HE21 . GLN B 2 39  ? 8.454   2.911   9.889   1.00 0.00 ? 297 GLN A HE21 3  
ATOM   4837  H  HE22 . GLN B 2 39  ? 7.299   3.851   10.765  1.00 0.00 ? 297 GLN A HE22 3  
ATOM   4838  N  N    . PHE B 2 40  ? 5.324   -2.611  6.345   1.00 0.00 ? 298 PHE A N    3  
ATOM   4839  C  CA   . PHE B 2 40  ? 4.251   -3.496  5.897   1.00 0.00 ? 298 PHE A CA   3  
ATOM   4840  C  C    . PHE B 2 40  ? 4.116   -4.713  6.793   1.00 0.00 ? 298 PHE A C    3  
ATOM   4841  O  O    . PHE B 2 40  ? 4.965   -4.983  7.642   1.00 0.00 ? 298 PHE A O    3  
ATOM   4842  C  CB   . PHE B 2 40  ? 4.493   -4.005  4.469   1.00 0.00 ? 298 PHE A CB   3  
ATOM   4843  C  CG   . PHE B 2 40  ? 4.381   -2.974  3.386   1.00 0.00 ? 298 PHE A CG   3  
ATOM   4844  C  CD1  . PHE B 2 40  ? 4.107   -1.641  3.657   1.00 0.00 ? 298 PHE A CD1  3  
ATOM   4845  C  CD2  . PHE B 2 40  ? 4.548   -3.362  2.076   1.00 0.00 ? 298 PHE A CD2  3  
ATOM   4846  C  CE1  . PHE B 2 40  ? 4.008   -0.724  2.624   1.00 0.00 ? 298 PHE A CE1  3  
ATOM   4847  C  CE2  . PHE B 2 40  ? 4.453   -2.455  1.053   1.00 0.00 ? 298 PHE A CE2  3  
ATOM   4848  C  CZ   . PHE B 2 40  ? 4.188   -1.144  1.321   1.00 0.00 ? 298 PHE A CZ   3  
ATOM   4849  H  H    . PHE B 2 40  ? 6.111   -2.490  5.775   1.00 0.00 ? 298 PHE A H    3  
ATOM   4850  H  HA   . PHE B 2 40  ? 3.327   -2.939  5.920   1.00 0.00 ? 298 PHE A HA   3  
ATOM   4851  H  HB2  . PHE B 2 40  ? 5.487   -4.453  4.396   1.00 0.00 ? 298 PHE A HB2  3  
ATOM   4852  H  HB3  . PHE B 2 40  ? 3.750   -4.769  4.257   1.00 0.00 ? 298 PHE A HB3  3  
ATOM   4853  H  HD1  . PHE B 2 40  ? 3.968   -1.319  4.678   1.00 0.00 ? 298 PHE A HD1  3  
ATOM   4854  H  HD2  . PHE B 2 40  ? 4.758   -4.393  1.858   1.00 0.00 ? 298 PHE A HD2  3  
ATOM   4855  H  HE1  . PHE B 2 40  ? 3.798   0.314   2.836   1.00 0.00 ? 298 PHE A HE1  3  
ATOM   4856  H  HE2  . PHE B 2 40  ? 4.583   -2.768  0.038   1.00 0.00 ? 298 PHE A HE2  3  
ATOM   4857  H  HZ   . PHE B 2 40  ? 4.131   -0.450  0.508   1.00 0.00 ? 298 PHE A HZ   3  
ATOM   4858  N  N    . THR B 2 41  ? 3.029   -5.443  6.582   1.00 0.00 ? 299 THR A N    3  
ATOM   4859  C  CA   . THR B 2 41  ? 2.777   -6.673  7.305   1.00 0.00 ? 299 THR A CA   3  
ATOM   4860  C  C    . THR B 2 41  ? 3.402   -7.808  6.511   1.00 0.00 ? 299 THR A C    3  
ATOM   4861  O  O    . THR B 2 41  ? 4.321   -7.570  5.733   1.00 0.00 ? 299 THR A O    3  
ATOM   4862  C  CB   . THR B 2 41  ? 1.273   -6.932  7.474   1.00 0.00 ? 299 THR A CB   3  
ATOM   4863  O  OG1  . THR B 2 41  ? 0.537   -5.714  7.313   1.00 0.00 ? 299 THR A OG1  3  
ATOM   4864  C  CG2  . THR B 2 41  ? 0.995   -7.517  8.840   1.00 0.00 ? 299 THR A CG2  3  
ATOM   4865  H  H    . THR B 2 41  ? 2.375   -5.140  5.918   1.00 0.00 ? 299 THR A H    3  
ATOM   4866  H  HA   . THR B 2 41  ? 3.241   -6.610  8.278   1.00 0.00 ? 299 THR A HA   3  
ATOM   4867  H  HB   . THR B 2 41  ? 0.956   -7.644  6.728   1.00 0.00 ? 299 THR A HB   3  
ATOM   4868  H  HG1  . THR B 2 41  ? -0.350  -5.826  7.661   1.00 0.00 ? 299 THR A HG1  3  
ATOM   4869  H  HG21 . THR B 2 41  ? 1.531   -8.445  8.936   1.00 0.00 ? 299 THR A HG21 3  
ATOM   4870  H  HG22 . THR B 2 41  ? -0.065  -7.696  8.947   1.00 0.00 ? 299 THR A HG22 3  
ATOM   4871  H  HG23 . THR B 2 41  ? 1.325   -6.827  9.600   1.00 0.00 ? 299 THR A HG23 3  
ATOM   4872  N  N    . LEU B 2 42  ? 2.934   -9.033  6.688   1.00 0.00 ? 300 LEU A N    3  
ATOM   4873  C  CA   . LEU B 2 42  ? 3.494   -10.132 5.917   1.00 0.00 ? 300 LEU A CA   3  
ATOM   4874  C  C    . LEU B 2 42  ? 2.743   -10.316 4.613   1.00 0.00 ? 300 LEU A C    3  
ATOM   4875  O  O    . LEU B 2 42  ? 3.291   -10.059 3.544   1.00 0.00 ? 300 LEU A O    3  
ATOM   4876  C  CB   . LEU B 2 42  ? 3.514   -11.426 6.694   1.00 0.00 ? 300 LEU A CB   3  
ATOM   4877  C  CG   . LEU B 2 42  ? 4.837   -12.184 6.600   1.00 0.00 ? 300 LEU A CG   3  
ATOM   4878  C  CD1  . LEU B 2 42  ? 5.247   -12.376 5.150   1.00 0.00 ? 300 LEU A CD1  3  
ATOM   4879  C  CD2  . LEU B 2 42  ? 5.916   -11.438 7.363   1.00 0.00 ? 300 LEU A CD2  3  
ATOM   4880  H  H    . LEU B 2 42  ? 2.218   -9.200  7.335   1.00 0.00 ? 300 LEU A H    3  
ATOM   4881  H  HA   . LEU B 2 42  ? 4.506   -9.875  5.680   1.00 0.00 ? 300 LEU A HA   3  
ATOM   4882  H  HB2  . LEU B 2 42  ? 3.318   -11.202 7.725   1.00 0.00 ? 300 LEU A HB2  3  
ATOM   4883  H  HB3  . LEU B 2 42  ? 2.736   -12.056 6.315   1.00 0.00 ? 300 LEU A HB3  3  
ATOM   4884  H  HG   . LEU B 2 42  ? 4.722   -13.153 7.038   1.00 0.00 ? 300 LEU A HG   3  
ATOM   4885  H  HD11 . LEU B 2 42  ? 4.365   -12.532 4.551   1.00 0.00 ? 300 LEU A HD11 3  
ATOM   4886  H  HD12 . LEU B 2 42  ? 5.896   -13.235 5.068   1.00 0.00 ? 300 LEU A HD12 3  
ATOM   4887  H  HD13 . LEU B 2 42  ? 5.767   -11.496 4.802   1.00 0.00 ? 300 LEU A HD13 3  
ATOM   4888  H  HD21 . LEU B 2 42  ? 5.831   -10.382 7.149   1.00 0.00 ? 300 LEU A HD21 3  
ATOM   4889  H  HD22 . LEU B 2 42  ? 6.888   -11.792 7.054   1.00 0.00 ? 300 LEU A HD22 3  
ATOM   4890  H  HD23 . LEU B 2 42  ? 5.790   -11.603 8.422   1.00 0.00 ? 300 LEU A HD23 3  
ATOM   4891  N  N    . ASN B 2 43  ? 1.488   -10.752 4.702   1.00 0.00 ? 301 ASN A N    3  
ATOM   4892  C  CA   . ASN B 2 43  ? 0.683   -10.959 3.507   1.00 0.00 ? 301 ASN A CA   3  
ATOM   4893  C  C    . ASN B 2 43  ? 0.838   -9.773  2.567   1.00 0.00 ? 301 ASN A C    3  
ATOM   4894  O  O    . ASN B 2 43  ? 0.926   -9.940  1.350   1.00 0.00 ? 301 ASN A O    3  
ATOM   4895  C  CB   . ASN B 2 43  ? -0.783  -11.166 3.866   1.00 0.00 ? 301 ASN A CB   3  
ATOM   4896  C  CG   . ASN B 2 43  ? -1.019  -12.429 4.661   1.00 0.00 ? 301 ASN A CG   3  
ATOM   4897  O  OD1  . ASN B 2 43  ? -0.127  -12.924 5.350   1.00 0.00 ? 301 ASN A OD1  3  
ATOM   4898  N  ND2  . ASN B 2 43  ? -2.233  -12.951 4.576   1.00 0.00 ? 301 ASN A ND2  3  
ATOM   4899  H  H    . ASN B 2 43  ? 1.101   -10.936 5.583   1.00 0.00 ? 301 ASN A H    3  
ATOM   4900  H  HA   . ASN B 2 43  ? 1.056   -11.839 3.019   1.00 0.00 ? 301 ASN A HA   3  
ATOM   4901  H  HB2  . ASN B 2 43  ? -1.112  -10.336 4.450   1.00 0.00 ? 301 ASN A HB2  3  
ATOM   4902  H  HB3  . ASN B 2 43  ? -1.367  -11.221 2.960   1.00 0.00 ? 301 ASN A HB3  3  
ATOM   4903  H  HD21 . ASN B 2 43  ? -2.895  -12.497 4.013   1.00 0.00 ? 301 ASN A HD21 3  
ATOM   4904  H  HD22 . ASN B 2 43  ? -2.419  -13.763 5.080   1.00 0.00 ? 301 ASN A HD22 3  
ATOM   4905  N  N    . MET B 2 44  ? 0.862   -8.573  3.143   1.00 0.00 ? 302 MET A N    3  
ATOM   4906  C  CA   . MET B 2 44  ? 1.066   -7.360  2.366   1.00 0.00 ? 302 MET A CA   3  
ATOM   4907  C  C    . MET B 2 44  ? 2.352   -7.504  1.596   1.00 0.00 ? 302 MET A C    3  
ATOM   4908  O  O    . MET B 2 44  ? 2.355   -7.582  0.380   1.00 0.00 ? 302 MET A O    3  
ATOM   4909  C  CB   . MET B 2 44  ? 1.207   -6.161  3.282   1.00 0.00 ? 302 MET A CB   3  
ATOM   4910  C  CG   . MET B 2 44  ? 1.054   -4.823  2.598   1.00 0.00 ? 302 MET A CG   3  
ATOM   4911  S  SD   . MET B 2 44  ? 1.297   -3.472  3.762   1.00 0.00 ? 302 MET A SD   3  
ATOM   4912  C  CE   . MET B 2 44  ? 1.047   -2.076  2.688   1.00 0.00 ? 302 MET A CE   3  
ATOM   4913  H  H    . MET B 2 44  ? 0.739   -8.506  4.113   1.00 0.00 ? 302 MET A H    3  
ATOM   4914  H  HA   . MET B 2 44  ? 0.239   -7.215  1.690   1.00 0.00 ? 302 MET A HA   3  
ATOM   4915  H  HB2  . MET B 2 44  ? 0.483   -6.226  4.067   1.00 0.00 ? 302 MET A HB2  3  
ATOM   4916  H  HB3  . MET B 2 44  ? 2.185   -6.191  3.711   1.00 0.00 ? 302 MET A HB3  3  
ATOM   4917  H  HG2  . MET B 2 44  ? 1.788   -4.744  1.805   1.00 0.00 ? 302 MET A HG2  3  
ATOM   4918  H  HG3  . MET B 2 44  ? 0.060   -4.752  2.183   1.00 0.00 ? 302 MET A HG3  3  
ATOM   4919  H  HE1  . MET B 2 44  ? 0.199   -2.265  2.074   1.00 0.00 ? 302 MET A HE1  3  
ATOM   4920  H  HE2  . MET B 2 44  ? 1.917   -1.938  2.067   1.00 0.00 ? 302 MET A HE2  3  
ATOM   4921  H  HE3  . MET B 2 44  ? 0.876   -1.188  3.279   1.00 0.00 ? 302 MET A HE3  3  
ATOM   4922  N  N    . THR B 2 45  ? 3.442   -7.552  2.349   1.00 0.00 ? 303 THR A N    3  
ATOM   4923  C  CA   . THR B 2 45  ? 4.766   -7.702  1.796   1.00 0.00 ? 303 THR A CA   3  
ATOM   4924  C  C    . THR B 2 45  ? 4.758   -8.674  0.624   1.00 0.00 ? 303 THR A C    3  
ATOM   4925  O  O    . THR B 2 45  ? 5.118   -8.323  -0.494  1.00 0.00 ? 303 THR A O    3  
ATOM   4926  C  CB   . THR B 2 45  ? 5.750   -8.198  2.881   1.00 0.00 ? 303 THR A CB   3  
ATOM   4927  O  OG1  . THR B 2 45  ? 5.867   -7.212  3.911   1.00 0.00 ? 303 THR A OG1  3  
ATOM   4928  C  CG2  . THR B 2 45  ? 7.112   -8.450  2.278   1.00 0.00 ? 303 THR A CG2  3  
ATOM   4929  H  H    . THR B 2 45  ? 3.348   -7.478  3.315   1.00 0.00 ? 303 THR A H    3  
ATOM   4930  H  HA   . THR B 2 45  ? 5.100   -6.735  1.451   1.00 0.00 ? 303 THR A HA   3  
ATOM   4931  H  HB   . THR B 2 45  ? 5.378   -9.125  3.315   1.00 0.00 ? 303 THR A HB   3  
ATOM   4932  H  HG1  . THR B 2 45  ? 6.665   -7.374  4.420   1.00 0.00 ? 303 THR A HG1  3  
ATOM   4933  H  HG21 . THR B 2 45  ? 7.339   -7.649  1.587   1.00 0.00 ? 303 THR A HG21 3  
ATOM   4934  H  HG22 . THR B 2 45  ? 7.106   -9.394  1.754   1.00 0.00 ? 303 THR A HG22 3  
ATOM   4935  H  HG23 . THR B 2 45  ? 7.856   -8.474  3.060   1.00 0.00 ? 303 THR A HG23 3  
ATOM   4936  N  N    . GLU B 2 46  ? 4.301   -9.883  0.889   1.00 0.00 ? 304 GLU A N    3  
ATOM   4937  C  CA   . GLU B 2 46  ? 4.245   -10.930 -0.118  1.00 0.00 ? 304 GLU A CA   3  
ATOM   4938  C  C    . GLU B 2 46  ? 3.393   -10.531 -1.325  1.00 0.00 ? 304 GLU A C    3  
ATOM   4939  O  O    . GLU B 2 46  ? 3.704   -10.896 -2.459  1.00 0.00 ? 304 GLU A O    3  
ATOM   4940  C  CB   . GLU B 2 46  ? 3.681   -12.195 0.514   1.00 0.00 ? 304 GLU A CB   3  
ATOM   4941  C  CG   . GLU B 2 46  ? 4.277   -12.481 1.878   1.00 0.00 ? 304 GLU A CG   3  
ATOM   4942  C  CD   . GLU B 2 46  ? 4.020   -13.901 2.346   1.00 0.00 ? 304 GLU A CD   3  
ATOM   4943  O  OE1  . GLU B 2 46  ? 4.799   -14.801 1.969   1.00 0.00 ? 304 GLU A OE1  3  
ATOM   4944  O  OE2  . GLU B 2 46  ? 3.038   -14.112 3.089   1.00 0.00 ? 304 GLU A OE2  3  
ATOM   4945  H  H    . GLU B 2 46  ? 3.987   -10.082 1.794   1.00 0.00 ? 304 GLU A H    3  
ATOM   4946  H  HA   . GLU B 2 46  ? 5.256   -11.123 -0.446  1.00 0.00 ? 304 GLU A HA   3  
ATOM   4947  H  HB2  . GLU B 2 46  ? 2.610   -12.079 0.628   1.00 0.00 ? 304 GLU A HB2  3  
ATOM   4948  H  HB3  . GLU B 2 46  ? 3.884   -13.036 -0.132  1.00 0.00 ? 304 GLU A HB3  3  
ATOM   4949  H  HG2  . GLU B 2 46  ? 5.339   -12.314 1.830   1.00 0.00 ? 304 GLU A HG2  3  
ATOM   4950  H  HG3  . GLU B 2 46  ? 3.846   -11.798 2.592   1.00 0.00 ? 304 GLU A HG3  3  
ATOM   4951  N  N    . ALA B 2 47  ? 2.323   -9.782  -1.076  1.00 0.00 ? 305 ALA A N    3  
ATOM   4952  C  CA   . ALA B 2 47  ? 1.418   -9.360  -2.152  1.00 0.00 ? 305 ALA A CA   3  
ATOM   4953  C  C    . ALA B 2 47  ? 2.010   -8.224  -2.983  1.00 0.00 ? 305 ALA A C    3  
ATOM   4954  O  O    . ALA B 2 47  ? 2.109   -8.312  -4.207  1.00 0.00 ? 305 ALA A O    3  
ATOM   4955  C  CB   . ALA B 2 47  ? 0.068   -8.940  -1.572  1.00 0.00 ? 305 ALA A CB   3  
ATOM   4956  H  H    . ALA B 2 47  ? 2.141   -9.500  -0.150  1.00 0.00 ? 305 ALA A H    3  
ATOM   4957  H  HA   . ALA B 2 47  ? 1.252   -10.211 -2.797  1.00 0.00 ? 305 ALA A HA   3  
ATOM   4958  H  HB1  . ALA B 2 47  ? 0.071   -7.875  -1.351  1.00 0.00 ? 305 ALA A HB1  3  
ATOM   4959  H  HB2  . ALA B 2 47  ? -0.118  -9.493  -0.663  1.00 0.00 ? 305 ALA A HB2  3  
ATOM   4960  H  HB3  . ALA B 2 47  ? -0.710  -9.155  -2.289  1.00 0.00 ? 305 ALA A HB3  3  
ATOM   4961  N  N    . VAL B 2 48  ? 2.396   -7.170  -2.291  1.00 0.00 ? 306 VAL A N    3  
ATOM   4962  C  CA   . VAL B 2 48  ? 2.959   -5.976  -2.893  1.00 0.00 ? 306 VAL A CA   3  
ATOM   4963  C  C    . VAL B 2 48  ? 4.117   -6.250  -3.857  1.00 0.00 ? 306 VAL A C    3  
ATOM   4964  O  O    . VAL B 2 48  ? 4.247   -5.575  -4.879  1.00 0.00 ? 306 VAL A O    3  
ATOM   4965  C  CB   . VAL B 2 48  ? 3.432   -5.016  -1.793  1.00 0.00 ? 306 VAL A CB   3  
ATOM   4966  C  CG1  . VAL B 2 48  ? 2.268   -4.519  -0.986  1.00 0.00 ? 306 VAL A CG1  3  
ATOM   4967  C  CG2  . VAL B 2 48  ? 4.424   -5.667  -0.871  1.00 0.00 ? 306 VAL A CG2  3  
ATOM   4968  H  H    . VAL B 2 48  ? 2.291   -7.191  -1.324  1.00 0.00 ? 306 VAL A H    3  
ATOM   4969  H  HA   . VAL B 2 48  ? 2.175   -5.481  -3.435  1.00 0.00 ? 306 VAL A HA   3  
ATOM   4970  H  HB   . VAL B 2 48  ? 3.908   -4.169  -2.252  1.00 0.00 ? 306 VAL A HB   3  
ATOM   4971  H  HG11 . VAL B 2 48  ? 2.317   -3.447  -0.945  1.00 0.00 ? 306 VAL A HG11 3  
ATOM   4972  H  HG12 . VAL B 2 48  ? 2.319   -4.924  0.014   1.00 0.00 ? 306 VAL A HG12 3  
ATOM   4973  H  HG13 . VAL B 2 48  ? 1.348   -4.824  -1.454  1.00 0.00 ? 306 VAL A HG13 3  
ATOM   4974  H  HG21 . VAL B 2 48  ? 5.018   -4.895  -0.416  1.00 0.00 ? 306 VAL A HG21 3  
ATOM   4975  H  HG22 . VAL B 2 48  ? 5.060   -6.336  -1.430  1.00 0.00 ? 306 VAL A HG22 3  
ATOM   4976  H  HG23 . VAL B 2 48  ? 3.901   -6.216  -0.104  1.00 0.00 ? 306 VAL A HG23 3  
ATOM   4977  N  N    . LYS B 2 49  ? 4.950   -7.231  -3.540  1.00 0.00 ? 307 LYS A N    3  
ATOM   4978  C  CA   . LYS B 2 49  ? 6.102   -7.554  -4.381  1.00 0.00 ? 307 LYS A CA   3  
ATOM   4979  C  C    . LYS B 2 49  ? 5.702   -8.153  -5.725  1.00 0.00 ? 307 LYS A C    3  
ATOM   4980  O  O    . LYS B 2 49  ? 6.281   -7.820  -6.760  1.00 0.00 ? 307 LYS A O    3  
ATOM   4981  C  CB   . LYS B 2 49  ? 7.015   -8.523  -3.661  1.00 0.00 ? 307 LYS A CB   3  
ATOM   4982  C  CG   . LYS B 2 49  ? 7.837   -7.871  -2.569  1.00 0.00 ? 307 LYS A CG   3  
ATOM   4983  C  CD   . LYS B 2 49  ? 8.464   -8.908  -1.654  1.00 0.00 ? 307 LYS A CD   3  
ATOM   4984  C  CE   . LYS B 2 49  ? 7.404   -9.728  -0.949  1.00 0.00 ? 307 LYS A CE   3  
ATOM   4985  N  NZ   . LYS B 2 49  ? 7.765   -11.171 -0.874  1.00 0.00 ? 307 LYS A NZ   3  
ATOM   4986  H  H    . LYS B 2 49  ? 4.793   -7.749  -2.722  1.00 0.00 ? 307 LYS A H    3  
ATOM   4987  H  HA   . LYS B 2 49  ? 6.649   -6.648  -4.547  1.00 0.00 ? 307 LYS A HA   3  
ATOM   4988  H  HB2  . LYS B 2 49  ? 6.410   -9.292  -3.219  1.00 0.00 ? 307 LYS A HB2  3  
ATOM   4989  H  HB3  . LYS B 2 49  ? 7.689   -8.971  -4.376  1.00 0.00 ? 307 LYS A HB3  3  
ATOM   4990  H  HG2  . LYS B 2 49  ? 8.620   -7.285  -3.025  1.00 0.00 ? 307 LYS A HG2  3  
ATOM   4991  H  HG3  . LYS B 2 49  ? 7.195   -7.225  -1.990  1.00 0.00 ? 307 LYS A HG3  3  
ATOM   4992  H  HD2  . LYS B 2 49  ? 9.086   -9.567  -2.241  1.00 0.00 ? 307 LYS A HD2  3  
ATOM   4993  H  HD3  . LYS B 2 49  ? 9.065   -8.404  -0.912  1.00 0.00 ? 307 LYS A HD3  3  
ATOM   4994  H  HE2  . LYS B 2 49  ? 7.281   -9.343  0.046   1.00 0.00 ? 307 LYS A HE2  3  
ATOM   4995  H  HE3  . LYS B 2 49  ? 6.472   -9.620  -1.484  1.00 0.00 ? 307 LYS A HE3  3  
ATOM   4996  H  HZ1  . LYS B 2 49  ? 8.670   -11.287 -0.374  1.00 0.00 ? 307 LYS A HZ1  3  
ATOM   4997  H  HZ2  . LYS B 2 49  ? 7.856   -11.567 -1.830  1.00 0.00 ? 307 LYS A HZ2  3  
ATOM   4998  H  HZ3  . LYS B 2 49  ? 7.028   -11.697 -0.361  1.00 0.00 ? 307 LYS A HZ3  3  
ATOM   4999  N  N    . THR B 2 50  ? 4.713   -9.037  -5.703  1.00 0.00 ? 308 THR A N    3  
ATOM   5000  C  CA   . THR B 2 50  ? 4.268   -9.719  -6.914  1.00 0.00 ? 308 THR A CA   3  
ATOM   5001  C  C    . THR B 2 50  ? 3.392   -8.847  -7.802  1.00 0.00 ? 308 THR A C    3  
ATOM   5002  O  O    . THR B 2 50  ? 3.672   -8.679  -8.989  1.00 0.00 ? 308 THR A O    3  
ATOM   5003  C  CB   . THR B 2 50  ? 3.493   -11.000 -6.566  1.00 0.00 ? 308 THR A CB   3  
ATOM   5004  O  OG1  . THR B 2 50  ? 2.173   -10.674 -6.114  1.00 0.00 ? 308 THR A OG1  3  
ATOM   5005  C  CG2  . THR B 2 50  ? 4.228   -11.760 -5.485  1.00 0.00 ? 308 THR A CG2  3  
ATOM   5006  H  H    . THR B 2 50  ? 4.270   -9.237  -4.853  1.00 0.00 ? 308 THR A H    3  
ATOM   5007  H  HA   . THR B 2 50  ? 5.147   -10.009 -7.464  1.00 0.00 ? 308 THR A HA   3  
ATOM   5008  H  HB   . THR B 2 50  ? 3.429   -11.621 -7.447  1.00 0.00 ? 308 THR A HB   3  
ATOM   5009  H  HG1  . THR B 2 50  ? 1.542   -10.852 -6.815  1.00 0.00 ? 308 THR A HG1  3  
ATOM   5010  H  HG21 . THR B 2 50  ? 4.758   -11.052 -4.867  1.00 0.00 ? 308 THR A HG21 3  
ATOM   5011  H  HG22 . THR B 2 50  ? 4.932   -12.445 -5.936  1.00 0.00 ? 308 THR A HG22 3  
ATOM   5012  H  HG23 . THR B 2 50  ? 3.521   -12.309 -4.882  1.00 0.00 ? 308 THR A HG23 3  
ATOM   5013  N  N    . TYR B 2 51  ? 2.334   -8.293  -7.227  1.00 0.00 ? 309 TYR A N    3  
ATOM   5014  C  CA   . TYR B 2 51  ? 1.402   -7.473  -7.984  1.00 0.00 ? 309 TYR A CA   3  
ATOM   5015  C  C    . TYR B 2 51  ? 1.813   -5.998  -7.981  1.00 0.00 ? 309 TYR A C    3  
ATOM   5016  O  O    . TYR B 2 51  ? 2.911   -5.645  -7.551  1.00 0.00 ? 309 TYR A O    3  
ATOM   5017  C  CB   . TYR B 2 51  ? -0.024  -7.673  -7.437  1.00 0.00 ? 309 TYR A CB   3  
ATOM   5018  C  CG   . TYR B 2 51  ? -0.548  -6.554  -6.569  1.00 0.00 ? 309 TYR A CG   3  
ATOM   5019  C  CD1  . TYR B 2 51  ? 0.159   -6.121  -5.463  1.00 0.00 ? 309 TYR A CD1  3  
ATOM   5020  C  CD2  . TYR B 2 51  ? -1.752  -5.928  -6.867  1.00 0.00 ? 309 TYR A CD2  3  
ATOM   5021  C  CE1  . TYR B 2 51  ? -0.311  -5.100  -4.678  1.00 0.00 ? 309 TYR A CE1  3  
ATOM   5022  C  CE2  . TYR B 2 51  ? -2.233  -4.901  -6.080  1.00 0.00 ? 309 TYR A CE2  3  
ATOM   5023  C  CZ   . TYR B 2 51  ? -1.507  -4.489  -4.985  1.00 0.00 ? 309 TYR A CZ   3  
ATOM   5024  O  OH   . TYR B 2 51  ? -1.977  -3.463  -4.196  1.00 0.00 ? 309 TYR A OH   3  
ATOM   5025  H  H    . TYR B 2 51  ? 2.179   -8.433  -6.270  1.00 0.00 ? 309 TYR A H    3  
ATOM   5026  H  HA   . TYR B 2 51  ? 1.427   -7.825  -9.005  1.00 0.00 ? 309 TYR A HA   3  
ATOM   5027  H  HB2  . TYR B 2 51  ? -0.699  -7.775  -8.263  1.00 0.00 ? 309 TYR A HB2  3  
ATOM   5028  H  HB3  . TYR B 2 51  ? -0.048  -8.582  -6.853  1.00 0.00 ? 309 TYR A HB3  3  
ATOM   5029  H  HD1  . TYR B 2 51  ? 1.095   -6.596  -5.220  1.00 0.00 ? 309 TYR A HD1  3  
ATOM   5030  H  HD2  . TYR B 2 51  ? -2.318  -6.257  -7.726  1.00 0.00 ? 309 TYR A HD2  3  
ATOM   5031  H  HE1  . TYR B 2 51  ? 0.262   -4.784  -3.830  1.00 0.00 ? 309 TYR A HE1  3  
ATOM   5032  H  HE2  . TYR B 2 51  ? -3.172  -4.425  -6.325  1.00 0.00 ? 309 TYR A HE2  3  
ATOM   5033  H  HH   . TYR B 2 51  ? -1.265  -2.848  -4.013  1.00 0.00 ? 309 TYR A HH   3  
ATOM   5034  N  N    . LYS B 2 52  ? 0.915   -5.152  -8.468  1.00 0.00 ? 310 LYS A N    3  
ATOM   5035  C  CA   . LYS B 2 52  ? 1.149   -3.722  -8.552  1.00 0.00 ? 310 LYS A CA   3  
ATOM   5036  C  C    . LYS B 2 52  ? 0.985   -3.050  -7.202  1.00 0.00 ? 310 LYS A C    3  
ATOM   5037  O  O    . LYS B 2 52  ? -0.082  -2.511  -6.904  1.00 0.00 ? 310 LYS A O    3  
ATOM   5038  C  CB   . LYS B 2 52  ? 0.176   -3.085  -9.523  1.00 0.00 ? 310 LYS A CB   3  
ATOM   5039  C  CG   . LYS B 2 52  ? -0.180  -3.970  -10.656 1.00 0.00 ? 310 LYS A CG   3  
ATOM   5040  C  CD   . LYS B 2 52  ? 0.516   -3.528  -11.886 1.00 0.00 ? 310 LYS A CD   3  
ATOM   5041  C  CE   . LYS B 2 52  ? 0.382   -4.525  -13.002 1.00 0.00 ? 310 LYS A CE   3  
ATOM   5042  N  NZ   . LYS B 2 52  ? -0.463  -4.014  -14.117 1.00 0.00 ? 310 LYS A NZ   3  
ATOM   5043  H  H    . LYS B 2 52  ? 0.064   -5.504  -8.774  1.00 0.00 ? 310 LYS A H    3  
ATOM   5044  H  HA   . LYS B 2 52  ? 2.138   -3.571  -8.917  1.00 0.00 ? 310 LYS A HA   3  
ATOM   5045  H  HB2  . LYS B 2 52  ? -0.708  -2.834  -9.008  1.00 0.00 ? 310 LYS A HB2  3  
ATOM   5046  H  HB3  . LYS B 2 52  ? 0.611   -2.199  -9.928  1.00 0.00 ? 310 LYS A HB3  3  
ATOM   5047  H  HG2  . LYS B 2 52  ? 0.152   -4.947  -10.412 1.00 0.00 ? 310 LYS A HG2  3  
ATOM   5048  H  HG3  . LYS B 2 52  ? -1.236  -3.949  -10.812 1.00 0.00 ? 310 LYS A HG3  3  
ATOM   5049  H  HD2  . LYS B 2 52  ? 0.120   -2.575  -12.202 1.00 0.00 ? 310 LYS A HD2  3  
ATOM   5050  H  HD3  . LYS B 2 52  ? 1.547   -3.430  -11.631 1.00 0.00 ? 310 LYS A HD3  3  
ATOM   5051  H  HE2  . LYS B 2 52  ? 1.367   -4.726  -13.369 1.00 0.00 ? 310 LYS A HE2  3  
ATOM   5052  H  HE3  . LYS B 2 52  ? -0.053  -5.433  -12.612 1.00 0.00 ? 310 LYS A HE3  3  
ATOM   5053  H  HZ1  . LYS B 2 52  ? -0.508  -4.717  -14.882 1.00 0.00 ? 310 LYS A HZ1  3  
ATOM   5054  H  HZ2  . LYS B 2 52  ? -0.064  -3.133  -14.494 1.00 0.00 ? 310 LYS A HZ2  3  
ATOM   5055  H  HZ3  . LYS B 2 52  ? -1.428  -3.827  -13.776 1.00 0.00 ? 310 LYS A HZ3  3  
ATOM   5056  N  N    . TRP B 2 53  ? 2.020   -3.082  -6.377  1.00 0.00 ? 311 TRP A N    3  
ATOM   5057  C  CA   . TRP B 2 53  ? 1.932   -2.434  -5.084  1.00 0.00 ? 311 TRP A CA   3  
ATOM   5058  C  C    . TRP B 2 53  ? 1.596   -0.966  -5.285  1.00 0.00 ? 311 TRP A C    3  
ATOM   5059  O  O    . TRP B 2 53  ? 0.892   -0.366  -4.475  1.00 0.00 ? 311 TRP A O    3  
ATOM   5060  C  CB   . TRP B 2 53  ? 3.230   -2.588  -4.291  1.00 0.00 ? 311 TRP A CB   3  
ATOM   5061  C  CG   . TRP B 2 53  ? 3.357   -1.601  -3.174  1.00 0.00 ? 311 TRP A CG   3  
ATOM   5062  C  CD1  . TRP B 2 53  ? 2.617   -1.553  -2.039  1.00 0.00 ? 311 TRP A CD1  3  
ATOM   5063  C  CD2  . TRP B 2 53  ? 4.274   -0.515  -3.095  1.00 0.00 ? 311 TRP A CD2  3  
ATOM   5064  N  NE1  . TRP B 2 53  ? 3.030   -0.521  -1.246  1.00 0.00 ? 311 TRP A NE1  3  
ATOM   5065  C  CE2  . TRP B 2 53  ? 4.049   0.133   -1.872  1.00 0.00 ? 311 TRP A CE2  3  
ATOM   5066  C  CE3  . TRP B 2 53  ? 5.266   -0.038  -3.935  1.00 0.00 ? 311 TRP A CE3  3  
ATOM   5067  C  CZ2  . TRP B 2 53  ? 4.787   1.232   -1.466  1.00 0.00 ? 311 TRP A CZ2  3  
ATOM   5068  C  CZ3  . TRP B 2 53  ? 6.002   1.062   -3.538  1.00 0.00 ? 311 TRP A CZ3  3  
ATOM   5069  C  CH2  . TRP B 2 53  ? 5.760   1.686   -2.307  1.00 0.00 ? 311 TRP A CH2  3  
ATOM   5070  H  H    . TRP B 2 53  ? 2.843   -3.545  -6.640  1.00 0.00 ? 311 TRP A H    3  
ATOM   5071  H  HA   . TRP B 2 53  ? 1.126   -2.900  -4.537  1.00 0.00 ? 311 TRP A HA   3  
ATOM   5072  H  HB2  . TRP B 2 53  ? 3.257   -3.576  -3.864  1.00 0.00 ? 311 TRP A HB2  3  
ATOM   5073  H  HB3  . TRP B 2 53  ? 4.081   -2.467  -4.943  1.00 0.00 ? 311 TRP A HB3  3  
ATOM   5074  H  HD1  . TRP B 2 53  ? 1.832   -2.250  -1.803  1.00 0.00 ? 311 TRP A HD1  3  
ATOM   5075  H  HE1  . TRP B 2 53  ? 2.655   -0.290  -0.370  1.00 0.00 ? 311 TRP A HE1  3  
ATOM   5076  H  HE3  . TRP B 2 53  ? 5.455   -0.511  -4.883  1.00 0.00 ? 311 TRP A HE3  3  
ATOM   5077  H  HZ2  . TRP B 2 53  ? 4.613   1.712   -0.519  1.00 0.00 ? 311 TRP A HZ2  3  
ATOM   5078  H  HZ3  . TRP B 2 53  ? 6.775   1.452   -4.179  1.00 0.00 ? 311 TRP A HZ3  3  
ATOM   5079  H  HH2  . TRP B 2 53  ? 6.358   2.539   -2.031  1.00 0.00 ? 311 TRP A HH2  3  
ATOM   5080  N  N    . GLN B 2 54  ? 2.088   -0.411  -6.393  1.00 0.00 ? 312 GLN A N    3  
ATOM   5081  C  CA   . GLN B 2 54  ? 1.853   0.985   -6.740  1.00 0.00 ? 312 GLN A CA   3  
ATOM   5082  C  C    . GLN B 2 54  ? 2.005   1.886   -5.517  1.00 0.00 ? 312 GLN A C    3  
ATOM   5083  O  O    . GLN B 2 54  ? 1.065   2.031   -4.734  1.00 0.00 ? 312 GLN A O    3  
ATOM   5084  C  CB   . GLN B 2 54  ? 0.457   1.160   -7.344  1.00 0.00 ? 312 GLN A CB   3  
ATOM   5085  C  CG   . GLN B 2 54  ? 0.208   0.290   -8.563  1.00 0.00 ? 312 GLN A CG   3  
ATOM   5086  C  CD   . GLN B 2 54  ? -1.154  0.528   -9.188  1.00 0.00 ? 312 GLN A CD   3  
ATOM   5087  O  OE1  . GLN B 2 54  ? -1.760  -0.384  -9.750  1.00 0.00 ? 312 GLN A OE1  3  
ATOM   5088  N  NE2  . GLN B 2 54  ? -1.643  1.761   -9.096  1.00 0.00 ? 312 GLN A NE2  3  
ATOM   5089  H  H    . GLN B 2 54  ? 2.628   -0.962  -6.996  1.00 0.00 ? 312 GLN A H    3  
ATOM   5090  H  HA   . GLN B 2 54  ? 2.588   1.264   -7.479  1.00 0.00 ? 312 GLN A HA   3  
ATOM   5091  H  HB2  . GLN B 2 54  ? -0.280  0.916   -6.595  1.00 0.00 ? 312 GLN A HB2  3  
ATOM   5092  H  HB3  . GLN B 2 54  ? 0.332   2.193   -7.634  1.00 0.00 ? 312 GLN A HB3  3  
ATOM   5093  H  HG2  . GLN B 2 54  ? 0.966   0.503   -9.303  1.00 0.00 ? 312 GLN A HG2  3  
ATOM   5094  H  HG3  . GLN B 2 54  ? 0.277   -0.747  -8.269  1.00 0.00 ? 312 GLN A HG3  3  
ATOM   5095  H  HE21 . GLN B 2 54  ? -1.104  2.442   -8.636  1.00 0.00 ? 312 GLN A HE21 3  
ATOM   5096  H  HE22 . GLN B 2 54  ? -2.524  1.940   -9.493  1.00 0.00 ? 312 GLN A HE22 3  
ATOM   5097  N  N    . CYS B 2 55  ? 3.187   2.487   -5.357  1.00 0.00 ? 313 CYS A N    3  
ATOM   5098  C  CA   . CYS B 2 55  ? 3.452   3.362   -4.219  1.00 0.00 ? 313 CYS A CA   3  
ATOM   5099  C  C    . CYS B 2 55  ? 2.226   4.176   -3.856  1.00 0.00 ? 313 CYS A C    3  
ATOM   5100  O  O    . CYS B 2 55  ? 1.441   4.569   -4.712  1.00 0.00 ? 313 CYS A O    3  
ATOM   5101  C  CB   . CYS B 2 55  ? 4.642   4.284   -4.478  1.00 0.00 ? 313 CYS A CB   3  
ATOM   5102  S  SG   . CYS B 2 55  ? 4.232   5.843   -5.324  1.00 0.00 ? 313 CYS A SG   3  
ATOM   5103  H  H    . CYS B 2 55  ? 3.896   2.330   -6.014  1.00 0.00 ? 313 CYS A H    3  
ATOM   5104  H  HA   . CYS B 2 55  ? 3.690   2.727   -3.379  1.00 0.00 ? 313 CYS A HA   3  
ATOM   5105  H  HB2  . CYS B 2 55  ? 5.100   4.538   -3.534  1.00 0.00 ? 313 CYS A HB2  3  
ATOM   5106  H  HB3  . CYS B 2 55  ? 5.358   3.758   -5.081  1.00 0.00 ? 313 CYS A HB3  3  
ATOM   5107  N  N    . ILE B 2 56  ? 2.106   4.431   -2.573  1.00 0.00 ? 314 ILE A N    3  
ATOM   5108  C  CA   . ILE B 2 56  ? 0.979   5.143   -1.999  1.00 0.00 ? 314 ILE A CA   3  
ATOM   5109  C  C    . ILE B 2 56  ? 0.634   6.453   -2.666  1.00 0.00 ? 314 ILE A C    3  
ATOM   5110  O  O    . ILE B 2 56  ? -0.296  7.097   -2.255  1.00 0.00 ? 314 ILE A O    3  
ATOM   5111  C  CB   . ILE B 2 56  ? 1.204   5.420   -0.532  1.00 0.00 ? 314 ILE A CB   3  
ATOM   5112  C  CG1  . ILE B 2 56  ? -0.079  5.763   0.118   1.00 0.00 ? 314 ILE A CG1  3  
ATOM   5113  C  CG2  . ILE B 2 56  ? 2.090   6.623   -0.375  1.00 0.00 ? 314 ILE A CG2  3  
ATOM   5114  C  CD1  . ILE B 2 56  ? -1.249  4.896   -0.189  1.00 0.00 ? 314 ILE A CD1  3  
ATOM   5115  H  H    . ILE B 2 56  ? 2.821   4.138   -1.977  1.00 0.00 ? 314 ILE A H    3  
ATOM   5116  H  HA   . ILE B 2 56  ? 0.104   4.506   -2.076  1.00 0.00 ? 314 ILE A HA   3  
ATOM   5117  H  HB   . ILE B 2 56  ? 1.635   4.578   -0.065  1.00 0.00 ? 314 ILE A HB   3  
ATOM   5118  H  HG12 . ILE B 2 56  ? 0.048   5.760   1.174   1.00 0.00 ? 314 ILE A HG12 3  
ATOM   5119  H  HG13 . ILE B 2 56  ? -0.320  6.750   -0.202  1.00 0.00 ? 314 ILE A HG13 3  
ATOM   5120  H  HG21 . ILE B 2 56  ? 1.449   7.497   -0.471  1.00 0.00 ? 314 ILE A HG21 3  
ATOM   5121  H  HG22 . ILE B 2 56  ? 2.845   6.628   -1.150  1.00 0.00 ? 314 ILE A HG22 3  
ATOM   5122  H  HG23 . ILE B 2 56  ? 2.555   6.617   0.597   1.00 0.00 ? 314 ILE A HG23 3  
ATOM   5123  H  HD11 . ILE B 2 56  ? -2.096  5.545   -0.302  1.00 0.00 ? 314 ILE A HD11 3  
ATOM   5124  H  HD12 . ILE B 2 56  ? -1.420  4.209   0.626   1.00 0.00 ? 314 ILE A HD12 3  
ATOM   5125  H  HD13 . ILE B 2 56  ? -1.087  4.348   -1.101  1.00 0.00 ? 314 ILE A HD13 3  
ATOM   5126  N  N    . GLU B 2 57  ? 1.419   6.930   -3.571  1.00 0.00 ? 315 GLU A N    3  
ATOM   5127  C  CA   . GLU B 2 57  ? 1.028   8.131   -4.266  1.00 0.00 ? 315 GLU A CA   3  
ATOM   5128  C  C    . GLU B 2 57  ? 0.206   7.761   -5.502  1.00 0.00 ? 315 GLU A C    3  
ATOM   5129  O  O    . GLU B 2 57  ? -0.769  8.434   -5.838  1.00 0.00 ? 315 GLU A O    3  
ATOM   5130  C  CB   . GLU B 2 57  ? 2.248   8.956   -4.656  1.00 0.00 ? 315 GLU A CB   3  
ATOM   5131  C  CG   . GLU B 2 57  ? 3.282   9.040   -3.550  1.00 0.00 ? 315 GLU A CG   3  
ATOM   5132  C  CD   . GLU B 2 57  ? 4.421   9.983   -3.879  1.00 0.00 ? 315 GLU A CD   3  
ATOM   5133  O  OE1  . GLU B 2 57  ? 4.179   10.984  -4.586  1.00 0.00 ? 315 GLU A OE1  3  
ATOM   5134  O  OE2  . GLU B 2 57  ? 5.555   9.726   -3.424  1.00 0.00 ? 315 GLU A OE2  3  
ATOM   5135  H  H    . GLU B 2 57  ? 2.286   6.548   -3.704  1.00 0.00 ? 315 GLU A H    3  
ATOM   5136  H  HA   . GLU B 2 57  ? 0.401   8.701   -3.585  1.00 0.00 ? 315 GLU A HA   3  
ATOM   5137  H  HB2  . GLU B 2 57  ? 2.711   8.510   -5.524  1.00 0.00 ? 315 GLU A HB2  3  
ATOM   5138  H  HB3  . GLU B 2 57  ? 1.927   9.957   -4.899  1.00 0.00 ? 315 GLU A HB3  3  
ATOM   5139  H  HG2  . GLU B 2 57  ? 2.794   9.385   -2.653  1.00 0.00 ? 315 GLU A HG2  3  
ATOM   5140  H  HG3  . GLU B 2 57  ? 3.686   8.053   -3.377  1.00 0.00 ? 315 GLU A HG3  3  
ATOM   5141  N  N    . CYS B 2 58  ? 0.612   6.679   -6.174  1.00 0.00 ? 316 CYS A N    3  
ATOM   5142  C  CA   . CYS B 2 58  ? -0.079  6.204   -7.371  1.00 0.00 ? 316 CYS A CA   3  
ATOM   5143  C  C    . CYS B 2 58  ? -1.048  5.054   -7.074  1.00 0.00 ? 316 CYS A C    3  
ATOM   5144  O  O    . CYS B 2 58  ? -1.880  4.722   -7.919  1.00 0.00 ? 316 CYS A O    3  
ATOM   5145  C  CB   . CYS B 2 58  ? 0.929   5.727   -8.408  1.00 0.00 ? 316 CYS A CB   3  
ATOM   5146  S  SG   . CYS B 2 58  ? 2.442   6.733   -8.533  1.00 0.00 ? 316 CYS A SG   3  
ATOM   5147  H  H    . CYS B 2 58  ? 1.402   6.194   -5.861  1.00 0.00 ? 316 CYS A H    3  
ATOM   5148  H  HA   . CYS B 2 58  ? -0.635  7.032   -7.782  1.00 0.00 ? 316 CYS A HA   3  
ATOM   5149  H  HB2  . CYS B 2 58  ? 1.230   4.721   -8.163  1.00 0.00 ? 316 CYS A HB2  3  
ATOM   5150  H  HB3  . CYS B 2 58  ? 0.454   5.723   -9.370  1.00 0.00 ? 316 CYS A HB3  3  
ATOM   5151  N  N    . LYS B 2 59  ? -0.922  4.438   -5.891  1.00 0.00 ? 317 LYS A N    3  
ATOM   5152  C  CA   . LYS B 2 59  ? -1.785  3.305   -5.503  1.00 0.00 ? 317 LYS A CA   3  
ATOM   5153  C  C    . LYS B 2 59  ? -3.183  3.484   -6.068  1.00 0.00 ? 317 LYS A C    3  
ATOM   5154  O  O    . LYS B 2 59  ? -3.751  2.560   -6.649  1.00 0.00 ? 317 LYS A O    3  
ATOM   5155  C  CB   . LYS B 2 59  ? -1.895  3.155   -3.963  1.00 0.00 ? 317 LYS A CB   3  
ATOM   5156  C  CG   . LYS B 2 59  ? -2.721  4.213   -3.320  1.00 0.00 ? 317 LYS A CG   3  
ATOM   5157  C  CD   . LYS B 2 59  ? -2.135  5.530   -3.636  1.00 0.00 ? 317 LYS A CD   3  
ATOM   5158  C  CE   . LYS B 2 59  ? -2.707  6.556   -2.763  1.00 0.00 ? 317 LYS A CE   3  
ATOM   5159  N  NZ   . LYS B 2 59  ? -4.041  6.974   -3.255  1.00 0.00 ? 317 LYS A NZ   3  
ATOM   5160  H  H    . LYS B 2 59  ? -0.246  4.754   -5.267  1.00 0.00 ? 317 LYS A H    3  
ATOM   5161  H  HA   . LYS B 2 59  ? -1.353  2.410   -5.911  1.00 0.00 ? 317 LYS A HA   3  
ATOM   5162  H  HB2  . LYS B 2 59  ? -2.340  2.211   -3.721  1.00 0.00 ? 317 LYS A HB2  3  
ATOM   5163  H  HB3  . LYS B 2 59  ? -0.920  3.213   -3.522  1.00 0.00 ? 317 LYS A HB3  3  
ATOM   5164  H  HG2  . LYS B 2 59  ? -3.715  4.174   -3.700  1.00 0.00 ? 317 LYS A HG2  3  
ATOM   5165  H  HG3  . LYS B 2 59  ? -2.733  4.078   -2.253  1.00 0.00 ? 317 LYS A HG3  3  
ATOM   5166  H  HD2  . LYS B 2 59  ? -1.075  5.480   -3.503  1.00 0.00 ? 317 LYS A HD2  3  
ATOM   5167  H  HD3  . LYS B 2 59  ? -2.364  5.778   -4.647  1.00 0.00 ? 317 LYS A HD3  3  
ATOM   5168  H  HE2  . LYS B 2 59  ? -2.788  6.150   -1.778  1.00 0.00 ? 317 LYS A HE2  3  
ATOM   5169  H  HE3  . LYS B 2 59  ? -2.044  7.388   -2.745  1.00 0.00 ? 317 LYS A HE3  3  
ATOM   5170  H  HZ1  . LYS B 2 59  ? -3.997  7.939   -3.637  1.00 0.00 ? 317 LYS A HZ1  3  
ATOM   5171  H  HZ2  . LYS B 2 59  ? -4.731  6.947   -2.480  1.00 0.00 ? 317 LYS A HZ2  3  
ATOM   5172  H  HZ3  . LYS B 2 59  ? -4.359  6.330   -4.009  1.00 0.00 ? 317 LYS A HZ3  3  
ATOM   5173  N  N    . SER B 2 60  ? -3.701  4.706   -5.927  1.00 0.00 ? 318 SER A N    3  
ATOM   5174  C  CA   . SER B 2 60  ? -5.035  5.045   -6.360  1.00 0.00 ? 318 SER A CA   3  
ATOM   5175  C  C    . SER B 2 60  ? -5.999  3.956   -5.989  1.00 0.00 ? 318 SER A C    3  
ATOM   5176  O  O    . SER B 2 60  ? -5.659  3.006   -5.284  1.00 0.00 ? 318 SER A O    3  
ATOM   5177  C  CB   . SER B 2 60  ? -5.073  5.291   -7.872  1.00 0.00 ? 318 SER A CB   3  
ATOM   5178  O  OG   . SER B 2 60  ? -4.635  4.149   -8.587  1.00 0.00 ? 318 SER A OG   3  
ATOM   5179  H  H    . SER B 2 60  ? -3.150  5.405   -5.539  1.00 0.00 ? 318 SER A H    3  
ATOM   5180  H  HA   . SER B 2 60  ? -5.334  5.940   -5.844  1.00 0.00 ? 318 SER A HA   3  
ATOM   5181  H  HB2  . SER B 2 60  ? -6.086  5.519   -8.171  1.00 0.00 ? 318 SER A HB2  3  
ATOM   5182  H  HB3  . SER B 2 60  ? -4.431  6.122   -8.117  1.00 0.00 ? 318 SER A HB3  3  
ATOM   5183  H  HG   . SER B 2 60  ? -5.022  3.360   -8.200  1.00 0.00 ? 318 SER A HG   3  
ATOM   5184  N  N    . CYS B 2 61  ? -7.218  4.112   -6.419  1.00 0.00 ? 319 CYS A N    3  
ATOM   5185  C  CA   . CYS B 2 61  ? -8.196  3.107   -6.159  1.00 0.00 ? 319 CYS A CA   3  
ATOM   5186  C  C    . CYS B 2 61  ? -7.858  1.903   -7.029  1.00 0.00 ? 319 CYS A C    3  
ATOM   5187  O  O    . CYS B 2 61  ? -6.829  1.869   -7.701  1.00 0.00 ? 319 CYS A O    3  
ATOM   5188  C  CB   . CYS B 2 61  ? -9.576  3.632   -6.509  1.00 0.00 ? 319 CYS A CB   3  
ATOM   5189  S  SG   . CYS B 2 61  ? -11.023 2.756   -5.810  1.00 0.00 ? 319 CYS A SG   3  
ATOM   5190  H  H    . CYS B 2 61  ? -7.463  4.920   -6.915  1.00 0.00 ? 319 CYS A H    3  
ATOM   5191  H  HA   . CYS B 2 61  ? -8.159  2.872   -5.114  1.00 0.00 ? 319 CYS A HA   3  
ATOM   5192  H  HB2  . CYS B 2 61  ? -9.641  4.647   -6.167  1.00 0.00 ? 319 CYS A HB2  3  
ATOM   5193  H  HB3  . CYS B 2 61  ? -9.678  3.616   -7.575  1.00 0.00 ? 319 CYS A HB3  3  
ATOM   5194  N  N    . ILE B 2 62  ? -8.700  0.921   -6.970  1.00 0.00 ? 320 ILE A N    3  
ATOM   5195  C  CA   . ILE B 2 62  ? -8.609  -0.261  -7.806  1.00 0.00 ? 320 ILE A CA   3  
ATOM   5196  C  C    . ILE B 2 62  ? -10.013 -0.417  -8.292  1.00 0.00 ? 320 ILE A C    3  
ATOM   5197  O  O    . ILE B 2 62  ? -10.304 -1.035  -9.317  1.00 0.00 ? 320 ILE A O    3  
ATOM   5198  C  CB   . ILE B 2 62  ? -8.131  -1.501  -7.027  1.00 0.00 ? 320 ILE A CB   3  
ATOM   5199  C  CG1  . ILE B 2 62  ? -8.802  -2.798  -7.505  1.00 0.00 ? 320 ILE A CG1  3  
ATOM   5200  C  CG2  . ILE B 2 62  ? -8.421  -1.270  -5.592  1.00 0.00 ? 320 ILE A CG2  3  
ATOM   5201  C  CD1  . ILE B 2 62  ? -8.831  -3.909  -6.476  1.00 0.00 ? 320 ILE A CD1  3  
ATOM   5202  H  H    . ILE B 2 62  ? -9.431  0.977   -6.322  1.00 0.00 ? 320 ILE A H    3  
ATOM   5203  H  HA   . ILE B 2 62  ? -7.945  -0.060  -8.638  1.00 0.00 ? 320 ILE A HA   3  
ATOM   5204  H  HB   . ILE B 2 62  ? -7.064  -1.586  -7.143  1.00 0.00 ? 320 ILE A HB   3  
ATOM   5205  H  HG12 . ILE B 2 62  ? -9.819  -2.585  -7.775  1.00 0.00 ? 320 ILE A HG12 3  
ATOM   5206  H  HG13 . ILE B 2 62  ? -8.271  -3.170  -8.360  1.00 0.00 ? 320 ILE A HG13 3  
ATOM   5207  H  HG21 . ILE B 2 62  ? -9.493  -1.137  -5.477  1.00 0.00 ? 320 ILE A HG21 3  
ATOM   5208  H  HG22 . ILE B 2 62  ? -7.899  -0.389  -5.260  1.00 0.00 ? 320 ILE A HG22 3  
ATOM   5209  H  HG23 . ILE B 2 62  ? -8.097  -2.117  -5.016  1.00 0.00 ? 320 ILE A HG23 3  
ATOM   5210  H  HD11 . ILE B 2 62  ? -7.922  -3.883  -5.896  1.00 0.00 ? 320 ILE A HD11 3  
ATOM   5211  H  HD12 . ILE B 2 62  ? -8.909  -4.863  -6.978  1.00 0.00 ? 320 ILE A HD12 3  
ATOM   5212  H  HD13 . ILE B 2 62  ? -9.680  -3.775  -5.823  1.00 0.00 ? 320 ILE A HD13 3  
ATOM   5213  N  N    . LEU B 2 63  ? -10.883 0.202   -7.496  1.00 0.00 ? 321 LEU A N    3  
ATOM   5214  C  CA   . LEU B 2 63  ? -12.279 0.260   -7.782  1.00 0.00 ? 321 LEU A CA   3  
ATOM   5215  C  C    . LEU B 2 63  ? -12.469 1.382   -8.799  1.00 0.00 ? 321 LEU A C    3  
ATOM   5216  O  O    . LEU B 2 63  ? -13.506 1.499   -9.450  1.00 0.00 ? 321 LEU A O    3  
ATOM   5217  C  CB   . LEU B 2 63  ? -13.060 0.493   -6.478  1.00 0.00 ? 321 LEU A CB   3  
ATOM   5218  C  CG   . LEU B 2 63  ? -12.675 -0.439  -5.310  1.00 0.00 ? 321 LEU A CG   3  
ATOM   5219  C  CD1  . LEU B 2 63  ? -13.893 -0.890  -4.532  1.00 0.00 ? 321 LEU A CD1  3  
ATOM   5220  C  CD2  . LEU B 2 63  ? -11.913 -1.639  -5.807  1.00 0.00 ? 321 LEU A CD2  3  
ATOM   5221  H  H    . LEU B 2 63  ? -10.559 0.611   -6.655  1.00 0.00 ? 321 LEU A H    3  
ATOM   5222  H  HA   . LEU B 2 63  ? -12.561 -0.680  -8.209  1.00 0.00 ? 321 LEU A HA   3  
ATOM   5223  H  HB2  . LEU B 2 63  ? -12.889 1.511   -6.165  1.00 0.00 ? 321 LEU A HB2  3  
ATOM   5224  H  HB3  . LEU B 2 63  ? -14.114 0.372   -6.671  1.00 0.00 ? 321 LEU A HB3  3  
ATOM   5225  H  HG   . LEU B 2 63  ? -12.021 0.098   -4.632  1.00 0.00 ? 321 LEU A HG   3  
ATOM   5226  H  HD11 . LEU B 2 63  ? -13.880 -0.436  -3.546  1.00 0.00 ? 321 LEU A HD11 3  
ATOM   5227  H  HD12 . LEU B 2 63  ? -13.880 -1.966  -4.434  1.00 0.00 ? 321 LEU A HD12 3  
ATOM   5228  H  HD13 . LEU B 2 63  ? -14.787 -0.587  -5.056  1.00 0.00 ? 321 LEU A HD13 3  
ATOM   5229  H  HD21 . LEU B 2 63  ? -10.948 -1.300  -6.136  1.00 0.00 ? 321 LEU A HD21 3  
ATOM   5230  H  HD22 . LEU B 2 63  ? -12.443 -2.093  -6.633  1.00 0.00 ? 321 LEU A HD22 3  
ATOM   5231  H  HD23 . LEU B 2 63  ? -11.796 -2.354  -5.012  1.00 0.00 ? 321 LEU A HD23 3  
ATOM   5232  N  N    . CYS B 2 64  ? -11.413 2.211   -8.908  1.00 0.00 ? 322 CYS A N    3  
ATOM   5233  C  CA   . CYS B 2 64  ? -11.358 3.311   -9.859  1.00 0.00 ? 322 CYS A CA   3  
ATOM   5234  C  C    . CYS B 2 64  ? -9.959  3.424   -10.454 1.00 0.00 ? 322 CYS A C    3  
ATOM   5235  O  O    . CYS B 2 64  ? -9.804  3.713   -11.641 1.00 0.00 ? 322 CYS A O    3  
ATOM   5236  C  CB   . CYS B 2 64  ? -11.691 4.648   -9.205  1.00 0.00 ? 322 CYS A CB   3  
ATOM   5237  S  SG   . CYS B 2 64  ? -13.238 4.686   -8.272  1.00 0.00 ? 322 CYS A SG   3  
ATOM   5238  H  H    . CYS B 2 64  ? -10.650 2.086   -8.308  1.00 0.00 ? 322 CYS A H    3  
ATOM   5239  H  HA   . CYS B 2 64  ? -12.063 3.111   -10.644 1.00 0.00 ? 322 CYS A HA   3  
ATOM   5240  H  HB2  . CYS B 2 64  ? -10.897 4.910   -8.524  1.00 0.00 ? 322 CYS A HB2  3  
ATOM   5241  H  HB3  . CYS B 2 64  ? -11.757 5.402   -9.976  1.00 0.00 ? 322 CYS A HB3  3  
ATOM   5242  N  N    . GLY B 2 65  ? -8.934  3.189   -9.625  1.00 0.00 ? 323 GLY A N    3  
ATOM   5243  C  CA   . GLY B 2 65  ? -7.567  3.320   -10.100 1.00 0.00 ? 323 GLY A CA   3  
ATOM   5244  C  C    . GLY B 2 65  ? -7.320  4.708   -10.643 1.00 0.00 ? 323 GLY A C    3  
ATOM   5245  O  O    . GLY B 2 65  ? -6.621  4.885   -11.642 1.00 0.00 ? 323 GLY A O    3  
ATOM   5246  H  H    . GLY B 2 65  ? -9.108  2.919   -8.690  1.00 0.00 ? 323 GLY A H    3  
ATOM   5247  H  HA2  . GLY B 2 65  ? -6.887  3.136   -9.283  1.00 0.00 ? 323 GLY A HA2  3  
ATOM   5248  H  HA3  . GLY B 2 65  ? -7.389  2.599   -10.881 1.00 0.00 ? 323 GLY A HA3  3  
ATOM   5249  N  N    . THR B 2 66  ? -7.909  5.694   -9.975  1.00 0.00 ? 324 THR A N    3  
ATOM   5250  C  CA   . THR B 2 66  ? -7.799  7.080   -10.391 1.00 0.00 ? 324 THR A CA   3  
ATOM   5251  C  C    . THR B 2 66  ? -7.327  7.996   -9.273  1.00 0.00 ? 324 THR A C    3  
ATOM   5252  O  O    . THR B 2 66  ? -7.049  9.171   -9.508  1.00 0.00 ? 324 THR A O    3  
ATOM   5253  C  CB   . THR B 2 66  ? -9.162  7.579   -10.863 1.00 0.00 ? 324 THR A CB   3  
ATOM   5254  O  OG1  . THR B 2 66  ? -9.069  8.934   -11.317 1.00 0.00 ? 324 THR A OG1  3  
ATOM   5255  C  CG2  . THR B 2 66  ? -10.182 7.479   -9.743  1.00 0.00 ? 324 THR A CG2  3  
ATOM   5256  H  H    . THR B 2 66  ? -8.448  5.480   -9.186  1.00 0.00 ? 324 THR A H    3  
ATOM   5257  H  HA   . THR B 2 66  ? -7.117  7.139   -11.220 1.00 0.00 ? 324 THR A HA   3  
ATOM   5258  H  HB   . THR B 2 66  ? -9.485  6.959   -11.665 1.00 0.00 ? 324 THR A HB   3  
ATOM   5259  H  HG1  . THR B 2 66  ? -8.552  8.967   -12.125 1.00 0.00 ? 324 THR A HG1  3  
ATOM   5260  H  HG21 . THR B 2 66  ? -10.095 6.522   -9.242  1.00 0.00 ? 324 THR A HG21 3  
ATOM   5261  H  HG22 . THR B 2 66  ? -11.176 7.578   -10.153 1.00 0.00 ? 324 THR A HG22 3  
ATOM   5262  H  HG23 . THR B 2 66  ? -10.007 8.269   -9.036  1.00 0.00 ? 324 THR A HG23 3  
ATOM   5263  N  N    . SER B 2 67  ? -7.247  7.459   -8.060  1.00 0.00 ? 325 SER A N    3  
ATOM   5264  C  CA   . SER B 2 67  ? -6.848  8.248   -6.901  1.00 0.00 ? 325 SER A CA   3  
ATOM   5265  C  C    . SER B 2 67  ? -7.788  9.438   -6.753  1.00 0.00 ? 325 SER A C    3  
ATOM   5266  O  O    . SER B 2 67  ? -7.470  10.417  -6.084  1.00 0.00 ? 325 SER A O    3  
ATOM   5267  C  CB   . SER B 2 67  ? -5.394  8.722   -7.022  1.00 0.00 ? 325 SER A CB   3  
ATOM   5268  O  OG   . SER B 2 67  ? -5.280  9.814   -7.916  1.00 0.00 ? 325 SER A OG   3  
ATOM   5269  H  H    . SER B 2 67  ? -7.463  6.510   -7.941  1.00 0.00 ? 325 SER A H    3  
ATOM   5270  H  HA   . SER B 2 67  ? -6.944  7.620   -6.027  1.00 0.00 ? 325 SER A HA   3  
ATOM   5271  H  HB2  . SER B 2 67  ? -5.039  9.032   -6.051  1.00 0.00 ? 325 SER A HB2  3  
ATOM   5272  H  HB3  . SER B 2 67  ? -4.783  7.909   -7.384  1.00 0.00 ? 325 SER A HB3  3  
ATOM   5273  H  HG   . SER B 2 67  ? -4.460  9.738   -8.410  1.00 0.00 ? 325 SER A HG   3  
ATOM   5274  N  N    . GLU B 2 68  ? -8.941  9.328   -7.419  1.00 0.00 ? 326 GLU A N    3  
ATOM   5275  C  CA   . GLU B 2 68  ? -9.992  10.353  -7.407  1.00 0.00 ? 326 GLU A CA   3  
ATOM   5276  C  C    . GLU B 2 68  ? -10.038 11.175  -6.121  1.00 0.00 ? 326 GLU A C    3  
ATOM   5277  O  O    . GLU B 2 68  ? -9.310  12.155  -5.968  1.00 0.00 ? 326 GLU A O    3  
ATOM   5278  C  CB   . GLU B 2 68  ? -11.335 9.691   -7.608  1.00 0.00 ? 326 GLU A CB   3  
ATOM   5279  C  CG   . GLU B 2 68  ? -11.932 9.932   -8.979  1.00 0.00 ? 326 GLU A CG   3  
ATOM   5280  C  CD   . GLU B 2 68  ? -13.110 10.885  -8.949  1.00 0.00 ? 326 GLU A CD   3  
ATOM   5281  O  OE1  . GLU B 2 68  ? -14.219 10.444  -8.582  1.00 0.00 ? 326 GLU A OE1  3  
ATOM   5282  O  OE2  . GLU B 2 68  ? -12.924 12.071  -9.292  1.00 0.00 ? 326 GLU A OE2  3  
ATOM   5283  H  H    . GLU B 2 68  ? -9.083  8.522   -7.971  1.00 0.00 ? 326 GLU A H    3  
ATOM   5284  H  HA   . GLU B 2 68  ? -9.824  11.008  -8.235  1.00 0.00 ? 326 GLU A HA   3  
ATOM   5285  H  HB2  . GLU B 2 68  ? -11.213 8.637   -7.458  1.00 0.00 ? 326 GLU A HB2  3  
ATOM   5286  H  HB3  . GLU B 2 68  ? -12.010 10.065  -6.881  1.00 0.00 ? 326 GLU A HB3  3  
ATOM   5287  H  HG2  . GLU B 2 68  ? -11.167 10.349  -9.609  1.00 0.00 ? 326 GLU A HG2  3  
ATOM   5288  H  HG3  . GLU B 2 68  ? -12.254 8.990   -9.387  1.00 0.00 ? 326 GLU A HG3  3  
ATOM   5289  N  N    . ASN B 2 69  ? -10.922 10.777  -5.207  1.00 0.00 ? 327 ASN A N    3  
ATOM   5290  C  CA   . ASN B 2 69  ? -11.091 11.477  -3.946  1.00 0.00 ? 327 ASN A CA   3  
ATOM   5291  C  C    . ASN B 2 69  ? -9.923  11.225  -3.016  1.00 0.00 ? 327 ASN A C    3  
ATOM   5292  O  O    . ASN B 2 69  ? -9.495  12.121  -2.288  1.00 0.00 ? 327 ASN A O    3  
ATOM   5293  C  CB   . ASN B 2 69  ? -12.397 11.055  -3.273  1.00 0.00 ? 327 ASN A CB   3  
ATOM   5294  C  CG   . ASN B 2 69  ? -13.587 11.811  -3.822  1.00 0.00 ? 327 ASN A CG   3  
ATOM   5295  O  OD1  . ASN B 2 69  ? -14.098 12.735  -3.189  1.00 0.00 ? 327 ASN A OD1  3  
ATOM   5296  N  ND2  . ASN B 2 69  ? -14.024 11.430  -5.013  1.00 0.00 ? 327 ASN A ND2  3  
ATOM   5297  H  H    . ASN B 2 69  ? -11.472 9.986   -5.387  1.00 0.00 ? 327 ASN A H    3  
ATOM   5298  H  HA   . ASN B 2 69  ? -11.148 12.522  -4.159  1.00 0.00 ? 327 ASN A HA   3  
ATOM   5299  H  HB2  . ASN B 2 69  ? -12.556 10.007  -3.439  1.00 0.00 ? 327 ASN A HB2  3  
ATOM   5300  H  HB3  . ASN B 2 69  ? -12.332 11.240  -2.213  1.00 0.00 ? 327 ASN A HB3  3  
ATOM   5301  H  HD21 . ASN B 2 69  ? -13.559 10.695  -5.465  1.00 0.00 ? 327 ASN A HD21 3  
ATOM   5302  H  HD22 . ASN B 2 69  ? -14.795 11.895  -5.392  1.00 0.00 ? 327 ASN A HD22 3  
ATOM   5303  N  N    . ASP B 2 70  ? -9.393  10.003  -3.077  1.00 0.00 ? 328 ASP A N    3  
ATOM   5304  C  CA   . ASP B 2 70  ? -8.287  9.568   -2.216  1.00 0.00 ? 328 ASP A CA   3  
ATOM   5305  C  C    . ASP B 2 70  ? -8.530  9.846   -0.739  1.00 0.00 ? 328 ASP A C    3  
ATOM   5306  O  O    . ASP B 2 70  ? -7.740  9.425   0.106   1.00 0.00 ? 328 ASP A O    3  
ATOM   5307  C  CB   . ASP B 2 70  ? -6.941  10.125  -2.619  1.00 0.00 ? 328 ASP A CB   3  
ATOM   5308  C  CG   . ASP B 2 70  ? -6.940  11.572  -3.048  1.00 0.00 ? 328 ASP A CG   3  
ATOM   5309  O  OD1  . ASP B 2 70  ? -7.483  11.886  -4.126  1.00 0.00 ? 328 ASP A OD1  3  
ATOM   5310  O  OD2  . ASP B 2 70  ? -6.378  12.395  -2.294  1.00 0.00 ? 328 ASP A OD2  3  
ATOM   5311  H  H    . ASP B 2 70  ? -9.753  9.364   -3.745  1.00 0.00 ? 328 ASP A H    3  
ATOM   5312  H  HA   . ASP B 2 70  ? -8.220  8.509   -2.325  1.00 0.00 ? 328 ASP A HA   3  
ATOM   5313  H  HB2  . ASP B 2 70  ? -6.300  10.055  -1.759  1.00 0.00 ? 328 ASP A HB2  3  
ATOM   5314  H  HB3  . ASP B 2 70  ? -6.525  9.504   -3.409  1.00 0.00 ? 328 ASP A HB3  3  
ATOM   5315  N  N    . ASP B 2 71  ? -9.609  10.546  -0.420  1.00 0.00 ? 329 ASP A N    3  
ATOM   5316  C  CA   . ASP B 2 71  ? -9.927  10.824  0.959   1.00 0.00 ? 329 ASP A CA   3  
ATOM   5317  C  C    . ASP B 2 71  ? -10.745 9.672   1.487   1.00 0.00 ? 329 ASP A C    3  
ATOM   5318  O  O    . ASP B 2 71  ? -11.096 9.611   2.666   1.00 0.00 ? 329 ASP A O    3  
ATOM   5319  C  CB   . ASP B 2 71  ? -10.675 12.140  1.100   1.00 0.00 ? 329 ASP A CB   3  
ATOM   5320  C  CG   . ASP B 2 71  ? -11.140 12.387  2.522   1.00 0.00 ? 329 ASP A CG   3  
ATOM   5321  O  OD1  . ASP B 2 71  ? -10.385 12.047  3.460   1.00 0.00 ? 329 ASP A OD1  3  
ATOM   5322  O  OD2  . ASP B 2 71  ? -12.260 12.911  2.699   1.00 0.00 ? 329 ASP A OD2  3  
ATOM   5323  H  H    . ASP B 2 71  ? -10.209 10.860  -1.121  1.00 0.00 ? 329 ASP A H    3  
ATOM   5324  H  HA   . ASP B 2 71  ? -9.003  10.884  1.502   1.00 0.00 ? 329 ASP A HA   3  
ATOM   5325  H  HB2  . ASP B 2 71  ? -10.012 12.938  0.818   1.00 0.00 ? 329 ASP A HB2  3  
ATOM   5326  H  HB3  . ASP B 2 71  ? -11.536 12.137  0.448   1.00 0.00 ? 329 ASP A HB3  3  
ATOM   5327  N  N    . GLN B 2 72  ? -11.034 8.747   0.581   1.00 0.00 ? 330 GLN A N    3  
ATOM   5328  C  CA   . GLN B 2 72  ? -11.789 7.576   0.909   1.00 0.00 ? 330 GLN A CA   3  
ATOM   5329  C  C    . GLN B 2 72  ? -10.958 6.366   0.586   1.00 0.00 ? 330 GLN A C    3  
ATOM   5330  O  O    . GLN B 2 72  ? -11.042 5.341   1.243   1.00 0.00 ? 330 GLN A O    3  
ATOM   5331  C  CB   . GLN B 2 72  ? -13.077 7.566   0.156   1.00 0.00 ? 330 GLN A CB   3  
ATOM   5332  C  CG   . GLN B 2 72  ? -13.735 8.890   0.303   1.00 0.00 ? 330 GLN A CG   3  
ATOM   5333  C  CD   . GLN B 2 72  ? -15.209 8.798   0.581   1.00 0.00 ? 330 GLN A CD   3  
ATOM   5334  O  OE1  . GLN B 2 72  ? -15.710 7.767   1.033   1.00 0.00 ? 330 GLN A OE1  3  
ATOM   5335  N  NE2  . GLN B 2 72  ? -15.908 9.886   0.353   1.00 0.00 ? 330 GLN A NE2  3  
ATOM   5336  H  H    . GLN B 2 72  ? -10.709 8.849   -0.341  1.00 0.00 ? 330 GLN A H    3  
ATOM   5337  H  HA   . GLN B 2 72  ? -12.022 7.619   1.948   1.00 0.00 ? 330 GLN A HA   3  
ATOM   5338  H  HB2  . GLN B 2 72  ? -12.886 7.371   -0.884  1.00 0.00 ? 330 GLN A HB2  3  
ATOM   5339  H  HB3  . GLN B 2 72  ? -13.730 6.808   0.562   1.00 0.00 ? 330 GLN A HB3  3  
ATOM   5340  H  HG2  . GLN B 2 72  ? -13.268 9.403   1.125   1.00 0.00 ? 330 GLN A HG2  3  
ATOM   5341  H  HG3  . GLN B 2 72  ? -13.564 9.438   -0.597  1.00 0.00 ? 330 GLN A HG3  3  
ATOM   5342  H  HE21 . GLN B 2 72  ? -15.436 10.676  0.018   1.00 0.00 ? 330 GLN A HE21 3  
ATOM   5343  H  HE22 . GLN B 2 72  ? -16.859 9.861   0.543   1.00 0.00 ? 330 GLN A HE22 3  
ATOM   5344  N  N    . LEU B 2 73  ? -10.122 6.506   -0.435  1.00 0.00 ? 331 LEU A N    3  
ATOM   5345  C  CA   . LEU B 2 73  ? -9.262  5.412   -0.834  1.00 0.00 ? 331 LEU A CA   3  
ATOM   5346  C  C    . LEU B 2 73  ? -8.818  4.654   0.391   1.00 0.00 ? 331 LEU A C    3  
ATOM   5347  O  O    . LEU B 2 73  ? -8.302  5.231   1.335   1.00 0.00 ? 331 LEU A O    3  
ATOM   5348  C  CB   . LEU B 2 73  ? -8.027  5.897   -1.573  1.00 0.00 ? 331 LEU A CB   3  
ATOM   5349  C  CG   . LEU B 2 73  ? -8.239  6.366   -3.003  1.00 0.00 ? 331 LEU A CG   3  
ATOM   5350  C  CD1  . LEU B 2 73  ? -6.916  6.720   -3.625  1.00 0.00 ? 331 LEU A CD1  3  
ATOM   5351  C  CD2  . LEU B 2 73  ? -8.924  5.303   -3.810  1.00 0.00 ? 331 LEU A CD2  3  
ATOM   5352  H  H    . LEU B 2 73  ? -10.084 7.360   -0.918  1.00 0.00 ? 331 LEU A H    3  
ATOM   5353  H  HA   . LEU B 2 73  ? -9.822  4.751   -1.479  1.00 0.00 ? 331 LEU A HA   3  
ATOM   5354  H  HB2  . LEU B 2 73  ? -7.603  6.708   -1.012  1.00 0.00 ? 331 LEU A HB2  3  
ATOM   5355  H  HB3  . LEU B 2 73  ? -7.311  5.089   -1.591  1.00 0.00 ? 331 LEU A HB3  3  
ATOM   5356  H  HG   . LEU B 2 73  ? -8.849  7.246   -3.005  1.00 0.00 ? 331 LEU A HG   3  
ATOM   5357  H  HD11 . LEU B 2 73  ? -6.193  6.830   -2.840  1.00 0.00 ? 331 LEU A HD11 3  
ATOM   5358  H  HD12 . LEU B 2 73  ? -7.005  7.649   -4.169  1.00 0.00 ? 331 LEU A HD12 3  
ATOM   5359  H  HD13 . LEU B 2 73  ? -6.606  5.933   -4.296  1.00 0.00 ? 331 LEU A HD13 3  
ATOM   5360  H  HD21 . LEU B 2 73  ? -8.290  4.451   -3.848  1.00 0.00 ? 331 LEU A HD21 3  
ATOM   5361  H  HD22 . LEU B 2 73  ? -9.102  5.667   -4.810  1.00 0.00 ? 331 LEU A HD22 3  
ATOM   5362  H  HD23 . LEU B 2 73  ? -9.862  5.039   -3.345  1.00 0.00 ? 331 LEU A HD23 3  
ATOM   5363  N  N    . LEU B 2 74  ? -9.147  3.396   0.422   1.00 0.00 ? 332 LEU A N    3  
ATOM   5364  C  CA   . LEU B 2 74  ? -8.728  2.539   1.503   1.00 0.00 ? 332 LEU A CA   3  
ATOM   5365  C  C    . LEU B 2 74  ? -7.555  1.722   1.053   1.00 0.00 ? 332 LEU A C    3  
ATOM   5366  O  O    . LEU B 2 74  ? -7.633  0.977   0.080   1.00 0.00 ? 332 LEU A O    3  
ATOM   5367  C  CB   . LEU B 2 74  ? -9.851  1.620   1.963   1.00 0.00 ? 332 LEU A CB   3  
ATOM   5368  C  CG   . LEU B 2 74  ? -10.587 2.033   3.215   1.00 0.00 ? 332 LEU A CG   3  
ATOM   5369  C  CD1  . LEU B 2 74  ? -11.767 1.120   3.480   1.00 0.00 ? 332 LEU A CD1  3  
ATOM   5370  C  CD2  . LEU B 2 74  ? -9.680  2.043   4.410   1.00 0.00 ? 332 LEU A CD2  3  
ATOM   5371  H  H    . LEU B 2 74  ? -9.735  3.048   -0.270  1.00 0.00 ? 332 LEU A H    3  
ATOM   5372  H  HA   . LEU B 2 74  ? -8.402  3.173   2.308   1.00 0.00 ? 332 LEU A HA   3  
ATOM   5373  H  HB2  . LEU B 2 74  ? -10.573 1.544   1.170   1.00 0.00 ? 332 LEU A HB2  3  
ATOM   5374  H  HB3  . LEU B 2 74  ? -9.427  0.657   2.131   1.00 0.00 ? 332 LEU A HB3  3  
ATOM   5375  H  HG   . LEU B 2 74  ? -10.951 3.013   3.074   1.00 0.00 ? 332 LEU A HG   3  
ATOM   5376  H  HD11 . LEU B 2 74  ? -12.551 1.656   3.990   1.00 0.00 ? 332 LEU A HD11 3  
ATOM   5377  H  HD12 . LEU B 2 74  ? -11.447 0.300   4.099   1.00 0.00 ? 332 LEU A HD12 3  
ATOM   5378  H  HD13 . LEU B 2 74  ? -12.140 0.737   2.543   1.00 0.00 ? 332 LEU A HD13 3  
ATOM   5379  H  HD21 . LEU B 2 74  ? -10.293 2.046   5.301   1.00 0.00 ? 332 LEU A HD21 3  
ATOM   5380  H  HD22 . LEU B 2 74  ? -9.060  2.927   4.390   1.00 0.00 ? 332 LEU A HD22 3  
ATOM   5381  H  HD23 . LEU B 2 74  ? -9.058  1.160   4.403   1.00 0.00 ? 332 LEU A HD23 3  
ATOM   5382  N  N    . PHE B 2 75  ? -6.484  1.832   1.791   1.00 0.00 ? 333 PHE A N    3  
ATOM   5383  C  CA   . PHE B 2 75  ? -5.278  1.157   1.425   1.00 0.00 ? 333 PHE A CA   3  
ATOM   5384  C  C    . PHE B 2 75  ? -5.156  -0.142  2.169   1.00 0.00 ? 333 PHE A C    3  
ATOM   5385  O  O    . PHE B 2 75  ? -4.653  -0.198  3.291   1.00 0.00 ? 333 PHE A O    3  
ATOM   5386  C  CB   . PHE B 2 75  ? -4.120  2.121   1.688   1.00 0.00 ? 333 PHE A CB   3  
ATOM   5387  C  CG   . PHE B 2 75  ? -4.507  3.477   1.174   1.00 0.00 ? 333 PHE A CG   3  
ATOM   5388  C  CD1  . PHE B 2 75  ? -5.340  4.294   1.900   1.00 0.00 ? 333 PHE A CD1  3  
ATOM   5389  C  CD2  . PHE B 2 75  ? -4.144  3.871   -0.082  1.00 0.00 ? 333 PHE A CD2  3  
ATOM   5390  C  CE1  . PHE B 2 75  ? -5.775  5.483   1.375   1.00 0.00 ? 333 PHE A CE1  3  
ATOM   5391  C  CE2  . PHE B 2 75  ? -4.591  5.046   -0.632  1.00 0.00 ? 333 PHE A CE2  3  
ATOM   5392  C  CZ   . PHE B 2 75  ? -5.410  5.858   0.108   1.00 0.00 ? 333 PHE A CZ   3  
ATOM   5393  H  H    . PHE B 2 75  ? -6.508  2.368   2.613   1.00 0.00 ? 333 PHE A H    3  
ATOM   5394  H  HA   . PHE B 2 75  ? -5.330  0.953   0.363   1.00 0.00 ? 333 PHE A HA   3  
ATOM   5395  H  HB2  . PHE B 2 75  ? -3.923  2.187   2.750   1.00 0.00 ? 333 PHE A HB2  3  
ATOM   5396  H  HB3  . PHE B 2 75  ? -3.235  1.786   1.167   1.00 0.00 ? 333 PHE A HB3  3  
ATOM   5397  H  HD1  . PHE B 2 75  ? -5.632  4.005   2.900   1.00 0.00 ? 333 PHE A HD1  3  
ATOM   5398  H  HD2  . PHE B 2 75  ? -3.494  3.262   -0.625  1.00 0.00 ? 333 PHE A HD2  3  
ATOM   5399  H  HE1  . PHE B 2 75  ? -6.421  6.121   1.957   1.00 0.00 ? 333 PHE A HE1  3  
ATOM   5400  H  HE2  . PHE B 2 75  ? -4.280  5.334   -1.647  1.00 0.00 ? 333 PHE A HE2  3  
ATOM   5401  H  HZ   . PHE B 2 75  ? -5.795  6.769   -0.308  1.00 0.00 ? 333 PHE A HZ   3  
ATOM   5402  N  N    . CYS B 2 76  ? -5.634  -1.195  1.520   1.00 0.00 ? 334 CYS A N    3  
ATOM   5403  C  CA   . CYS B 2 76  ? -5.569  -2.512  2.091   1.00 0.00 ? 334 CYS A CA   3  
ATOM   5404  C  C    . CYS B 2 76  ? -4.121  -2.848  2.307   1.00 0.00 ? 334 CYS A C    3  
ATOM   5405  O  O    . CYS B 2 76  ? -3.451  -3.256  1.373   1.00 0.00 ? 334 CYS A O    3  
ATOM   5406  C  CB   . CYS B 2 76  ? -6.209  -3.547  1.159   1.00 0.00 ? 334 CYS A CB   3  
ATOM   5407  S  SG   . CYS B 2 76  ? -5.630  -5.244  1.474   1.00 0.00 ? 334 CYS A SG   3  
ATOM   5408  H  H    . CYS B 2 76  ? -6.039  -1.072  0.634   1.00 0.00 ? 334 CYS A H    3  
ATOM   5409  H  HA   . CYS B 2 76  ? -6.083  -2.501  3.035   1.00 0.00 ? 334 CYS A HA   3  
ATOM   5410  H  HB2  . CYS B 2 76  ? -7.281  -3.533  1.299   1.00 0.00 ? 334 CYS A HB2  3  
ATOM   5411  H  HB3  . CYS B 2 76  ? -5.979  -3.301  0.129   1.00 0.00 ? 334 CYS A HB3  3  
ATOM   5412  N  N    . ASP B 2 77  ? -3.606  -2.683  3.514   1.00 0.00 ? 335 ASP A N    3  
ATOM   5413  C  CA   . ASP B 2 77  ? -2.199  -2.969  3.695   1.00 0.00 ? 335 ASP A CA   3  
ATOM   5414  C  C    . ASP B 2 77  ? -1.943  -4.468  3.770   1.00 0.00 ? 335 ASP A C    3  
ATOM   5415  O  O    . ASP B 2 77  ? -1.113  -4.935  4.548   1.00 0.00 ? 335 ASP A O    3  
ATOM   5416  C  CB   . ASP B 2 77  ? -1.590  -2.242  4.883   1.00 0.00 ? 335 ASP A CB   3  
ATOM   5417  C  CG   . ASP B 2 77  ? -2.018  -2.818  6.220   1.00 0.00 ? 335 ASP A CG   3  
ATOM   5418  O  OD1  . ASP B 2 77  ? -3.209  -2.684  6.569   1.00 0.00 ? 335 ASP A OD1  3  
ATOM   5419  O  OD2  . ASP B 2 77  ? -1.161  -3.400  6.918   1.00 0.00 ? 335 ASP A OD2  3  
ATOM   5420  H  H    . ASP B 2 77  ? -4.172  -2.394  4.276   1.00 0.00 ? 335 ASP A H    3  
ATOM   5421  H  HA   . ASP B 2 77  ? -1.708  -2.601  2.800   1.00 0.00 ? 335 ASP A HA   3  
ATOM   5422  H  HB2  . ASP B 2 77  ? -0.510  -2.308  4.796   1.00 0.00 ? 335 ASP A HB2  3  
ATOM   5423  H  HB3  . ASP B 2 77  ? -1.879  -1.205  4.841   1.00 0.00 ? 335 ASP A HB3  3  
ATOM   5424  N  N    . ASP B 2 78  ? -2.711  -5.215  2.985   1.00 0.00 ? 336 ASP A N    3  
ATOM   5425  C  CA   . ASP B 2 78  ? -2.534  -6.648  2.867   1.00 0.00 ? 336 ASP A CA   3  
ATOM   5426  C  C    . ASP B 2 78  ? -2.051  -6.925  1.449   1.00 0.00 ? 336 ASP A C    3  
ATOM   5427  O  O    . ASP B 2 78  ? -1.867  -8.071  1.038   1.00 0.00 ? 336 ASP A O    3  
ATOM   5428  C  CB   . ASP B 2 78  ? -3.836  -7.398  3.157   1.00 0.00 ? 336 ASP A CB   3  
ATOM   5429  C  CG   . ASP B 2 78  ? -3.608  -8.876  3.406   1.00 0.00 ? 336 ASP A CG   3  
ATOM   5430  O  OD1  . ASP B 2 78  ? -3.612  -9.652  2.428   1.00 0.00 ? 336 ASP A OD1  3  
ATOM   5431  O  OD2  . ASP B 2 78  ? -3.426  -9.259  4.582   1.00 0.00 ? 336 ASP A OD2  3  
ATOM   5432  H  H    . ASP B 2 78  ? -3.434  -4.790  2.485   1.00 0.00 ? 336 ASP A H    3  
ATOM   5433  H  HA   . ASP B 2 78  ? -1.774  -6.950  3.567   1.00 0.00 ? 336 ASP A HA   3  
ATOM   5434  H  HB2  . ASP B 2 78  ? -4.304  -6.972  4.031   1.00 0.00 ? 336 ASP A HB2  3  
ATOM   5435  H  HB3  . ASP B 2 78  ? -4.501  -7.293  2.312   1.00 0.00 ? 336 ASP A HB3  3  
ATOM   5436  N  N    . CYS B 2 79  ? -1.846  -5.824  0.717   1.00 0.00 ? 337 CYS A N    3  
ATOM   5437  C  CA   . CYS B 2 79  ? -1.374  -5.844  -0.655  1.00 0.00 ? 337 CYS A CA   3  
ATOM   5438  C  C    . CYS B 2 79  ? -1.246  -4.402  -1.153  1.00 0.00 ? 337 CYS A C    3  
ATOM   5439  O  O    . CYS B 2 79  ? -0.393  -4.093  -1.977  1.00 0.00 ? 337 CYS A O    3  
ATOM   5440  C  CB   . CYS B 2 79  ? -2.337  -6.615  -1.551  1.00 0.00 ? 337 CYS A CB   3  
ATOM   5441  S  SG   . CYS B 2 79  ? -3.888  -5.716  -1.888  1.00 0.00 ? 337 CYS A SG   3  
ATOM   5442  H  H    . CYS B 2 79  ? -2.017  -4.955  1.124   1.00 0.00 ? 337 CYS A H    3  
ATOM   5443  H  HA   . CYS B 2 79  ? -0.397  -6.316  -0.654  1.00 0.00 ? 337 CYS A HA   3  
ATOM   5444  H  HB2  . CYS B 2 79  ? -1.857  -6.811  -2.499  1.00 0.00 ? 337 CYS A HB2  3  
ATOM   5445  H  HB3  . CYS B 2 79  ? -2.587  -7.552  -1.078  1.00 0.00 ? 337 CYS A HB3  3  
ATOM   5446  N  N    . ASP B 2 80  ? -2.161  -3.553  -0.668  1.00 0.00 ? 338 ASP A N    3  
ATOM   5447  C  CA   . ASP B 2 80  ? -2.182  -2.106  -0.948  1.00 0.00 ? 338 ASP A CA   3  
ATOM   5448  C  C    . ASP B 2 80  ? -3.166  -1.672  -2.047  1.00 0.00 ? 338 ASP A C    3  
ATOM   5449  O  O    . ASP B 2 80  ? -2.936  -0.665  -2.717  1.00 0.00 ? 338 ASP A O    3  
ATOM   5450  C  CB   . ASP B 2 80  ? -0.777  -1.582  -1.252  1.00 0.00 ? 338 ASP A CB   3  
ATOM   5451  C  CG   . ASP B 2 80  ? -0.730  -0.073  -1.370  1.00 0.00 ? 338 ASP A CG   3  
ATOM   5452  O  OD1  . ASP B 2 80  ? -1.498  0.602   -0.652  1.00 0.00 ? 338 ASP A OD1  3  
ATOM   5453  O  OD2  . ASP B 2 80  ? 0.074   0.436   -2.177  1.00 0.00 ? 338 ASP A OD2  3  
ATOM   5454  H  H    . ASP B 2 80  ? -2.871  -3.922  -0.107  1.00 0.00 ? 338 ASP A H    3  
ATOM   5455  H  HA   . ASP B 2 80  ? -2.509  -1.633  -0.033  1.00 0.00 ? 338 ASP A HA   3  
ATOM   5456  H  HB2  . ASP B 2 80  ? -0.109  -1.882  -0.457  1.00 0.00 ? 338 ASP A HB2  3  
ATOM   5457  H  HB3  . ASP B 2 80  ? -0.436  -2.012  -2.180  1.00 0.00 ? 338 ASP A HB3  3  
ATOM   5458  N  N    . ARG B 2 81  ? -4.259  -2.407  -2.251  1.00 0.00 ? 339 ARG A N    3  
ATOM   5459  C  CA   . ARG B 2 81  ? -5.247  -2.000  -3.238  1.00 0.00 ? 339 ARG A CA   3  
ATOM   5460  C  C    . ARG B 2 81  ? -6.138  -0.881  -2.681  1.00 0.00 ? 339 ARG A C    3  
ATOM   5461  O  O    . ARG B 2 81  ? -6.988  -1.121  -1.823  1.00 0.00 ? 339 ARG A O    3  
ATOM   5462  C  CB   . ARG B 2 81  ? -6.091  -3.200  -3.651  1.00 0.00 ? 339 ARG A CB   3  
ATOM   5463  C  CG   . ARG B 2 81  ? -5.306  -4.238  -4.428  1.00 0.00 ? 339 ARG A CG   3  
ATOM   5464  C  CD   . ARG B 2 81  ? -6.147  -5.463  -4.725  1.00 0.00 ? 339 ARG A CD   3  
ATOM   5465  N  NE   . ARG B 2 81  ? -5.361  -6.537  -5.328  1.00 0.00 ? 339 ARG A NE   3  
ATOM   5466  C  CZ   . ARG B 2 81  ? -5.064  -7.676  -4.709  1.00 0.00 ? 339 ARG A CZ   3  
ATOM   5467  N  NH1  . ARG B 2 81  ? -5.477  -7.887  -3.466  1.00 0.00 ? 339 ARG A NH1  3  
ATOM   5468  N  NH2  . ARG B 2 81  ? -4.352  -8.604  -5.331  1.00 0.00 ? 339 ARG A NH2  3  
ATOM   5469  H  H    . ARG B 2 81  ? -4.388  -3.255  -1.775  1.00 0.00 ? 339 ARG A H    3  
ATOM   5470  H  HA   . ARG B 2 81  ? -4.718  -1.627  -4.103  1.00 0.00 ? 339 ARG A HA   3  
ATOM   5471  H  HB2  . ARG B 2 81  ? -6.490  -3.669  -2.763  1.00 0.00 ? 339 ARG A HB2  3  
ATOM   5472  H  HB3  . ARG B 2 81  ? -6.906  -2.861  -4.267  1.00 0.00 ? 339 ARG A HB3  3  
ATOM   5473  H  HG2  . ARG B 2 81  ? -4.982  -3.803  -5.362  1.00 0.00 ? 339 ARG A HG2  3  
ATOM   5474  H  HG3  . ARG B 2 81  ? -4.445  -4.533  -3.850  1.00 0.00 ? 339 ARG A HG3  3  
ATOM   5475  H  HD2  . ARG B 2 81  ? -6.601  -5.819  -3.818  1.00 0.00 ? 339 ARG A HD2  3  
ATOM   5476  H  HD3  . ARG B 2 81  ? -6.921  -5.177  -5.402  1.00 0.00 ? 339 ARG A HD3  3  
ATOM   5477  H  HE   . ARG B 2 81  ? -5.038  -6.403  -6.244  1.00 0.00 ? 339 ARG A HE   3  
ATOM   5478  H  HH11 . ARG B 2 81  ? -6.012  -7.190  -2.992  1.00 0.00 ? 339 ARG A HH11 3  
ATOM   5479  H  HH12 . ARG B 2 81  ? -5.252  -8.745  -3.004  1.00 0.00 ? 339 ARG A HH12 3  
ATOM   5480  H  HH21 . ARG B 2 81  ? -4.035  -8.449  -6.267  1.00 0.00 ? 339 ARG A HH21 3  
ATOM   5481  H  HH22 . ARG B 2 81  ? -4.129  -9.460  -4.864  1.00 0.00 ? 339 ARG A HH22 3  
ATOM   5482  N  N    . GLY B 2 82  ? -5.920  0.345   -3.166  1.00 0.00 ? 340 GLY A N    3  
ATOM   5483  C  CA   . GLY B 2 82  ? -6.705  1.494   -2.719  1.00 0.00 ? 340 GLY A CA   3  
ATOM   5484  C  C    . GLY B 2 82  ? -8.169  1.383   -3.111  1.00 0.00 ? 340 GLY A C    3  
ATOM   5485  O  O    . GLY B 2 82  ? -8.486  1.102   -4.253  1.00 0.00 ? 340 GLY A O    3  
ATOM   5486  H  H    . GLY B 2 82  ? -5.217  0.474   -3.839  1.00 0.00 ? 340 GLY A H    3  
ATOM   5487  H  HA2  . GLY B 2 82  ? -6.631  1.585   -1.645  1.00 0.00 ? 340 GLY A HA2  3  
ATOM   5488  H  HA3  . GLY B 2 82  ? -6.295  2.385   -3.164  1.00 0.00 ? 340 GLY A HA3  3  
ATOM   5489  N  N    . TYR B 2 83  ? -9.067  1.617   -2.171  1.00 0.00 ? 341 TYR A N    3  
ATOM   5490  C  CA   . TYR B 2 83  ? -10.496 1.531   -2.443  1.00 0.00 ? 341 TYR A CA   3  
ATOM   5491  C  C    . TYR B 2 83  ? -11.196 2.716   -1.844  1.00 0.00 ? 341 TYR A C    3  
ATOM   5492  O  O    . TYR B 2 83  ? -11.408 2.722   -0.633  1.00 0.00 ? 341 TYR A O    3  
ATOM   5493  C  CB   . TYR B 2 83  ? -11.103 0.356   -1.696  1.00 0.00 ? 341 TYR A CB   3  
ATOM   5494  C  CG   . TYR B 2 83  ? -11.024 -1.026  -2.293  1.00 0.00 ? 341 TYR A CG   3  
ATOM   5495  C  CD1  . TYR B 2 83  ? -9.896  -1.452  -2.920  1.00 0.00 ? 341 TYR A CD1  3  
ATOM   5496  C  CD2  . TYR B 2 83  ? -12.065 -1.937  -2.118  1.00 0.00 ? 341 TYR A CD2  3  
ATOM   5497  C  CE1  . TYR B 2 83  ? -9.771  -2.749  -3.376  1.00 0.00 ? 341 TYR A CE1  3  
ATOM   5498  C  CE2  . TYR B 2 83  ? -11.964 -3.231  -2.587  1.00 0.00 ? 341 TYR A CE2  3  
ATOM   5499  C  CZ   . TYR B 2 83  ? -10.807 -3.632  -3.213  1.00 0.00 ? 341 TYR A CZ   3  
ATOM   5500  O  OH   . TYR B 2 83  ? -10.672 -4.922  -3.661  1.00 0.00 ? 341 TYR A OH   3  
ATOM   5501  H  H    . TYR B 2 83  ? -8.770  1.872   -1.272  1.00 0.00 ? 341 TYR A H    3  
ATOM   5502  H  HA   . TYR B 2 83  ? -10.682 1.460   -3.504  1.00 0.00 ? 341 TYR A HA   3  
ATOM   5503  H  HB2  . TYR B 2 83  ? -10.614 0.307   -0.755  1.00 0.00 ? 341 TYR A HB2  3  
ATOM   5504  H  HB3  . TYR B 2 83  ? -12.124 0.577   -1.510  1.00 0.00 ? 341 TYR A HB3  3  
ATOM   5505  H  HD1  . TYR B 2 83  ? -9.109  -0.745  -3.074  1.00 0.00 ? 341 TYR A HD1  3  
ATOM   5506  H  HD2  . TYR B 2 83  ? -12.969 -1.611  -1.626  1.00 0.00 ? 341 TYR A HD2  3  
ATOM   5507  H  HE1  . TYR B 2 83  ? -8.859  -3.061  -3.869  1.00 0.00 ? 341 TYR A HE1  3  
ATOM   5508  H  HE2  . TYR B 2 83  ? -12.784 -3.921  -2.455  1.00 0.00 ? 341 TYR A HE2  3  
ATOM   5509  H  HH   . TYR B 2 83  ? -9.806  -5.257  -3.417  1.00 0.00 ? 341 TYR A HH   3  
ATOM   5510  N  N    . HIS B 2 84  ? -11.642 3.672   -2.631  1.00 0.00 ? 342 HIS A N    3  
ATOM   5511  C  CA   . HIS B 2 84  ? -12.343 4.763   -2.008  1.00 0.00 ? 342 HIS A CA   3  
ATOM   5512  C  C    . HIS B 2 84  ? -13.371 4.103   -1.133  1.00 0.00 ? 342 HIS A C    3  
ATOM   5513  O  O    . HIS B 2 84  ? -14.155 3.302   -1.613  1.00 0.00 ? 342 HIS A O    3  
ATOM   5514  C  CB   . HIS B 2 84  ? -13.011 5.687   -2.997  1.00 0.00 ? 342 HIS A CB   3  
ATOM   5515  C  CG   . HIS B 2 84  ? -12.090 6.406   -3.919  1.00 0.00 ? 342 HIS A CG   3  
ATOM   5516  N  ND1  . HIS B 2 84  ? -11.921 6.016   -5.220  1.00 0.00 ? 342 HIS A ND1  3  
ATOM   5517  C  CD2  . HIS B 2 84  ? -11.292 7.486   -3.738  1.00 0.00 ? 342 HIS A CD2  3  
ATOM   5518  C  CE1  . HIS B 2 84  ? -11.067 6.820   -5.818  1.00 0.00 ? 342 HIS A CE1  3  
ATOM   5519  N  NE2  . HIS B 2 84  ? -10.671 7.728   -4.941  1.00 0.00 ? 342 HIS A NE2  3  
ATOM   5520  H  H    . HIS B 2 84  ? -11.537 3.621   -3.596  1.00 0.00 ? 342 HIS A H    3  
ATOM   5521  H  HA   . HIS B 2 84  ? -11.646 5.311   -1.393  1.00 0.00 ? 342 HIS A HA   3  
ATOM   5522  H  HB2  . HIS B 2 84  ? -13.682 5.112   -3.590  1.00 0.00 ? 342 HIS A HB2  3  
ATOM   5523  H  HB3  . HIS B 2 84  ? -13.566 6.412   -2.452  1.00 0.00 ? 342 HIS A HB3  3  
ATOM   5524  H  HD2  . HIS B 2 84  ? -11.113 8.012   -2.805  1.00 0.00 ? 342 HIS A HD2  3  
ATOM   5525  H  HE1  . HIS B 2 84  ? -10.703 6.713   -6.828  1.00 0.00 ? 342 HIS A HE1  3  
ATOM   5526  H  HE2  . HIS B 2 84  ? -10.104 8.500   -5.145  1.00 0.00 ? 342 HIS A HE2  3  
ATOM   5527  N  N    . MET B 2 85  ? -13.310 4.382   0.146   1.00 0.00 ? 343 MET A N    3  
ATOM   5528  C  CA   . MET B 2 85  ? -14.194 3.758   1.113   1.00 0.00 ? 343 MET A CA   3  
ATOM   5529  C  C    . MET B 2 85  ? -15.646 3.713   0.661   1.00 0.00 ? 343 MET A C    3  
ATOM   5530  O  O    . MET B 2 85  ? -16.474 3.103   1.320   1.00 0.00 ? 343 MET A O    3  
ATOM   5531  C  CB   . MET B 2 85  ? -14.081 4.449   2.449   1.00 0.00 ? 343 MET A CB   3  
ATOM   5532  C  CG   . MET B 2 85  ? -12.732 4.328   3.093   1.00 0.00 ? 343 MET A CG   3  
ATOM   5533  S  SD   . MET B 2 85  ? -11.996 5.886   3.633   1.00 0.00 ? 343 MET A SD   3  
ATOM   5534  C  CE   . MET B 2 85  ? -13.430 6.744   4.238   1.00 0.00 ? 343 MET A CE   3  
ATOM   5535  H  H    . MET B 2 85  ? -12.653 5.031   0.455   1.00 0.00 ? 343 MET A H    3  
ATOM   5536  H  HA   . MET B 2 85  ? -13.859 2.738   1.234   1.00 0.00 ? 343 MET A HA   3  
ATOM   5537  H  HB2  . MET B 2 85  ? -14.308 5.477   2.331   1.00 0.00 ? 343 MET A HB2  3  
ATOM   5538  H  HB3  . MET B 2 85  ? -14.781 4.002   3.105   1.00 0.00 ? 343 MET A HB3  3  
ATOM   5539  H  HG2  . MET B 2 85  ? -12.834 3.698   3.950   1.00 0.00 ? 343 MET A HG2  3  
ATOM   5540  H  HG3  . MET B 2 85  ? -12.079 3.859   2.387   1.00 0.00 ? 343 MET A HG3  3  
ATOM   5541  H  HE1  . MET B 2 85  ? -14.277 6.478   3.626   1.00 0.00 ? 343 MET A HE1  3  
ATOM   5542  H  HE2  . MET B 2 85  ? -13.265 7.810   4.187   1.00 0.00 ? 343 MET A HE2  3  
ATOM   5543  H  HE3  . MET B 2 85  ? -13.619 6.454   5.259   1.00 0.00 ? 343 MET A HE3  3  
ATOM   5544  N  N    . TYR B 2 86  ? -15.963 4.363   -0.445  1.00 0.00 ? 344 TYR A N    3  
ATOM   5545  C  CA   . TYR B 2 86  ? -17.316 4.320   -0.964  1.00 0.00 ? 344 TYR A CA   3  
ATOM   5546  C  C    . TYR B 2 86  ? -17.317 3.583   -2.296  1.00 0.00 ? 344 TYR A C    3  
ATOM   5547  O  O    . TYR B 2 86  ? -18.152 3.818   -3.171  1.00 0.00 ? 344 TYR A O    3  
ATOM   5548  C  CB   . TYR B 2 86  ? -17.933 5.719   -1.083  1.00 0.00 ? 344 TYR A CB   3  
ATOM   5549  C  CG   . TYR B 2 86  ? -17.244 6.666   -2.047  1.00 0.00 ? 344 TYR A CG   3  
ATOM   5550  C  CD1  . TYR B 2 86  ? -15.918 7.057   -1.869  1.00 0.00 ? 344 TYR A CD1  3  
ATOM   5551  C  CD2  . TYR B 2 86  ? -17.948 7.213   -3.112  1.00 0.00 ? 344 TYR A CD2  3  
ATOM   5552  C  CE1  . TYR B 2 86  ? -15.319 7.964   -2.730  1.00 0.00 ? 344 TYR A CE1  3  
ATOM   5553  C  CE2  . TYR B 2 86  ? -17.354 8.108   -3.980  1.00 0.00 ? 344 TYR A CE2  3  
ATOM   5554  C  CZ   . TYR B 2 86  ? -16.043 8.481   -3.783  1.00 0.00 ? 344 TYR A CZ   3  
ATOM   5555  O  OH   . TYR B 2 86  ? -15.455 9.378   -4.641  1.00 0.00 ? 344 TYR A OH   3  
ATOM   5556  H  H    . TYR B 2 86  ? -15.274 4.867   -0.920  1.00 0.00 ? 344 TYR A H    3  
ATOM   5557  H  HA   . TYR B 2 86  ? -17.900 3.735   -0.260  1.00 0.00 ? 344 TYR A HA   3  
ATOM   5558  H  HB2  . TYR B 2 86  ? -18.956 5.618   -1.409  1.00 0.00 ? 344 TYR A HB2  3  
ATOM   5559  H  HB3  . TYR B 2 86  ? -17.924 6.181   -0.106  1.00 0.00 ? 344 TYR A HB3  3  
ATOM   5560  H  HD1  . TYR B 2 86  ? -15.344 6.630   -1.051  1.00 0.00 ? 344 TYR A HD1  3  
ATOM   5561  H  HD2  . TYR B 2 86  ? -18.977 6.922   -3.264  1.00 0.00 ? 344 TYR A HD2  3  
ATOM   5562  H  HE1  . TYR B 2 86  ? -14.286 8.268   -2.572  1.00 0.00 ? 344 TYR A HE1  3  
ATOM   5563  H  HE2  . TYR B 2 86  ? -17.920 8.515   -4.805  1.00 0.00 ? 344 TYR A HE2  3  
ATOM   5564  H  HH   . TYR B 2 86  ? -14.586 9.056   -4.895  1.00 0.00 ? 344 TYR A HH   3  
ATOM   5565  N  N    . CYS B 2 87  ? -16.349 2.681   -2.413  1.00 0.00 ? 345 CYS A N    3  
ATOM   5566  C  CA   . CYS B 2 87  ? -16.173 1.838   -3.587  1.00 0.00 ? 345 CYS A CA   3  
ATOM   5567  C  C    . CYS B 2 87  ? -16.284 0.387   -3.167  1.00 0.00 ? 345 CYS A C    3  
ATOM   5568  O  O    . CYS B 2 87  ? -16.677 -0.479  -3.949  1.00 0.00 ? 345 CYS A O    3  
ATOM   5569  C  CB   . CYS B 2 87  ? -14.816 2.113   -4.274  1.00 0.00 ? 345 CYS A CB   3  
ATOM   5570  S  SG   . CYS B 2 87  ? -14.720 3.805   -4.906  1.00 0.00 ? 345 CYS A SG   3  
ATOM   5571  H  H    . CYS B 2 87  ? -15.731 2.578   -1.665  1.00 0.00 ? 345 CYS A H    3  
ATOM   5572  H  HA   . CYS B 2 87  ? -16.968 2.067   -4.270  1.00 0.00 ? 345 CYS A HA   3  
ATOM   5573  H  HB2  . CYS B 2 87  ? -14.003 1.964   -3.578  1.00 0.00 ? 345 CYS A HB2  3  
ATOM   5574  H  HB3  . CYS B 2 87  ? -14.685 1.438   -5.106  1.00 0.00 ? 345 CYS A HB3  3  
ATOM   5575  N  N    . LEU B 2 88  ? -15.959 0.146   -1.905  1.00 0.00 ? 346 LEU A N    3  
ATOM   5576  C  CA   . LEU B 2 88  ? -16.004 -1.192  -1.333  1.00 0.00 ? 346 LEU A CA   3  
ATOM   5577  C  C    . LEU B 2 88  ? -17.398 -1.785  -1.428  1.00 0.00 ? 346 LEU A C    3  
ATOM   5578  O  O    . LEU B 2 88  ? -18.334 -1.141  -1.900  1.00 0.00 ? 346 LEU A O    3  
ATOM   5579  C  CB   . LEU B 2 88  ? -15.576 -1.175  0.132   1.00 0.00 ? 346 LEU A CB   3  
ATOM   5580  C  CG   . LEU B 2 88  ? -14.993 0.136   0.661   1.00 0.00 ? 346 LEU A CG   3  
ATOM   5581  C  CD1  . LEU B 2 88  ? -14.566 -0.009  2.092   1.00 0.00 ? 346 LEU A CD1  3  
ATOM   5582  C  CD2  . LEU B 2 88  ? -13.815 0.564   -0.168  1.00 0.00 ? 346 LEU A CD2  3  
ATOM   5583  H  H    . LEU B 2 88  ? -15.681 0.899   -1.335  1.00 0.00 ? 346 LEU A H    3  
ATOM   5584  H  HA   . LEU B 2 88  ? -15.326 -1.817  -1.875  1.00 0.00 ? 346 LEU A HA   3  
ATOM   5585  H  HB2  . LEU B 2 88  ? -16.432 -1.416  0.716   1.00 0.00 ? 346 LEU A HB2  3  
ATOM   5586  H  HB3  . LEU B 2 88  ? -14.840 -1.948  0.276   1.00 0.00 ? 346 LEU A HB3  3  
ATOM   5587  H  HG   . LEU B 2 88  ? -15.733 0.916   0.620   1.00 0.00 ? 346 LEU A HG   3  
ATOM   5588  H  HD11 . LEU B 2 88  ? -13.751 0.670   2.263   1.00 0.00 ? 346 LEU A HD11 3  
ATOM   5589  H  HD12 . LEU B 2 88  ? -14.243 -1.023  2.276   1.00 0.00 ? 346 LEU A HD12 3  
ATOM   5590  H  HD13 . LEU B 2 88  ? -15.389 0.238   2.745   1.00 0.00 ? 346 LEU A HD13 3  
ATOM   5591  H  HD21 . LEU B 2 88  ? -13.848 0.053   -1.120  1.00 0.00 ? 346 LEU A HD21 3  
ATOM   5592  H  HD22 . LEU B 2 88  ? -12.900 0.309   0.347   1.00 0.00 ? 346 LEU A HD22 3  
ATOM   5593  H  HD23 . LEU B 2 88  ? -13.854 1.629   -0.330  1.00 0.00 ? 346 LEU A HD23 3  
ATOM   5594  N  N    . ASN B 2 89  ? -17.520 -3.023  -0.980  1.00 0.00 ? 347 ASN A N    3  
ATOM   5595  C  CA   . ASN B 2 89  ? -18.792 -3.706  -0.963  1.00 0.00 ? 347 ASN A CA   3  
ATOM   5596  C  C    . ASN B 2 89  ? -19.531 -3.254  0.259   1.00 0.00 ? 347 ASN A C    3  
ATOM   5597  O  O    . ASN B 2 89  ? -20.741 -3.021  0.219   1.00 0.00 ? 347 ASN A O    3  
ATOM   5598  C  CB   . ASN B 2 89  ? -18.582 -5.207  -0.950  1.00 0.00 ? 347 ASN A CB   3  
ATOM   5599  C  CG   . ASN B 2 89  ? -19.746 -5.972  -1.519  1.00 0.00 ? 347 ASN A CG   3  
ATOM   5600  O  OD1  . ASN B 2 89  ? -20.905 -5.594  -1.350  1.00 0.00 ? 347 ASN A OD1  3  
ATOM   5601  N  ND2  . ASN B 2 89  ? -19.436 -7.053  -2.211  1.00 0.00 ? 347 ASN A ND2  3  
ATOM   5602  H  H    . ASN B 2 89  ? -16.736 -3.485  -0.628  1.00 0.00 ? 347 ASN A H    3  
ATOM   5603  H  HA   . ASN B 2 89  ? -19.346 -3.406  -1.825  1.00 0.00 ? 347 ASN A HA   3  
ATOM   5604  H  HB2  . ASN B 2 89  ? -17.712 -5.438  -1.527  1.00 0.00 ? 347 ASN A HB2  3  
ATOM   5605  H  HB3  . ASN B 2 89  ? -18.419 -5.525  0.065   1.00 0.00 ? 347 ASN A HB3  3  
ATOM   5606  H  HD21 . ASN B 2 89  ? -18.489 -7.288  -2.306  1.00 0.00 ? 347 ASN A HD21 3  
ATOM   5607  H  HD22 . ASN B 2 89  ? -20.158 -7.567  -2.603  1.00 0.00 ? 347 ASN A HD22 3  
ATOM   5608  N  N    . PRO B 2 90  ? -18.813 -3.167  1.387   1.00 0.00 ? 348 PRO A N    3  
ATOM   5609  C  CA   . PRO B 2 90  ? -19.319 -2.630  2.599   1.00 0.00 ? 348 PRO A CA   3  
ATOM   5610  C  C    . PRO B 2 90  ? -18.643 -1.276  2.794   1.00 0.00 ? 348 PRO A C    3  
ATOM   5611  O  O    . PRO B 2 90  ? -17.923 -1.059  3.768   1.00 0.00 ? 348 PRO A O    3  
ATOM   5612  C  CB   . PRO B 2 90  ? -18.835 -3.660  3.605   1.00 0.00 ? 348 PRO A CB   3  
ATOM   5613  C  CG   . PRO B 2 90  ? -17.574 -4.208  3.035   1.00 0.00 ? 348 PRO A CG   3  
ATOM   5614  C  CD   . PRO B 2 90  ? -17.461 -3.676  1.635   1.00 0.00 ? 348 PRO A CD   3  
ATOM   5615  H  HA   . PRO B 2 90  ? -20.386 -2.553  2.593   1.00 0.00 ? 348 PRO A HA   3  
ATOM   5616  H  HB2  . PRO B 2 90  ? -18.654 -3.190  4.543   1.00 0.00 ? 348 PRO A HB2  3  
ATOM   5617  H  HB3  . PRO B 2 90  ? -19.581 -4.430  3.709   1.00 0.00 ? 348 PRO A HB3  3  
ATOM   5618  H  HG2  . PRO B 2 90  ? -16.731 -3.889  3.628   1.00 0.00 ? 348 PRO A HG2  3  
ATOM   5619  H  HG3  . PRO B 2 90  ? -17.638 -5.274  3.018   1.00 0.00 ? 348 PRO A HG3  3  
ATOM   5620  H  HD2  . PRO B 2 90  ? -16.728 -2.885  1.587   1.00 0.00 ? 348 PRO A HD2  3  
ATOM   5621  H  HD3  . PRO B 2 90  ? -17.214 -4.467  0.959   1.00 0.00 ? 348 PRO A HD3  3  
ATOM   5622  N  N    . PRO B 2 91  ? -18.879 -0.344  1.842   1.00 0.00 ? 349 PRO A N    3  
ATOM   5623  C  CA   . PRO B 2 91  ? -18.225 0.964   1.813   1.00 0.00 ? 349 PRO A CA   3  
ATOM   5624  C  C    . PRO B 2 91  ? -18.236 1.674   3.161   1.00 0.00 ? 349 PRO A C    3  
ATOM   5625  O  O    . PRO B 2 91  ? -19.275 1.754   3.816   1.00 0.00 ? 349 PRO A O    3  
ATOM   5626  C  CB   . PRO B 2 91  ? -19.016 1.751   0.765   1.00 0.00 ? 349 PRO A CB   3  
ATOM   5627  C  CG   . PRO B 2 91  ? -20.248 0.976   0.532   1.00 0.00 ? 349 PRO A CG   3  
ATOM   5628  C  CD   . PRO B 2 91  ? -19.879 -0.448  0.771   1.00 0.00 ? 349 PRO A CD   3  
ATOM   5629  H  HA   . PRO B 2 91  ? -17.210 0.869   1.465   1.00 0.00 ? 349 PRO A HA   3  
ATOM   5630  H  HB2  . PRO B 2 91  ? -19.234 2.726   1.137   1.00 0.00 ? 349 PRO A HB2  3  
ATOM   5631  H  HB3  . PRO B 2 91  ? -18.439 1.832   -0.135  1.00 0.00 ? 349 PRO A HB3  3  
ATOM   5632  H  HG2  . PRO B 2 91  ? -21.008 1.292   1.221   1.00 0.00 ? 349 PRO A HG2  3  
ATOM   5633  H  HG3  . PRO B 2 91  ? -20.579 1.112   -0.478  1.00 0.00 ? 349 PRO A HG3  3  
ATOM   5634  H  HD2  . PRO B 2 91  ? -20.742 -1.000  1.098   1.00 0.00 ? 349 PRO A HD2  3  
ATOM   5635  H  HD3  . PRO B 2 91  ? -19.451 -0.901  -0.116  1.00 0.00 ? 349 PRO A HD3  3  
ATOM   5636  N  N    . VAL B 2 92  ? -17.076 2.192   3.579   1.00 0.00 ? 350 VAL A N    3  
ATOM   5637  C  CA   . VAL B 2 92  ? -16.978 2.886   4.826   1.00 0.00 ? 350 VAL A CA   3  
ATOM   5638  C  C    . VAL B 2 92  ? -16.954 4.378   4.553   1.00 0.00 ? 350 VAL A C    3  
ATOM   5639  O  O    . VAL B 2 92  ? -16.884 4.809   3.403   1.00 0.00 ? 350 VAL A O    3  
ATOM   5640  C  CB   . VAL B 2 92  ? -15.732 2.431   5.637   1.00 0.00 ? 350 VAL A CB   3  
ATOM   5641  C  CG1  . VAL B 2 92  ? -15.279 1.047   5.207   1.00 0.00 ? 350 VAL A CG1  3  
ATOM   5642  C  CG2  . VAL B 2 92  ? -14.579 3.408   5.534   1.00 0.00 ? 350 VAL A CG2  3  
ATOM   5643  H  H    . VAL B 2 92  ? -16.277 2.132   3.024   1.00 0.00 ? 350 VAL A H    3  
ATOM   5644  H  HA   . VAL B 2 92  ? -17.854 2.654   5.400   1.00 0.00 ? 350 VAL A HA   3  
ATOM   5645  H  HB   . VAL B 2 92  ? -16.012 2.367   6.671   1.00 0.00 ? 350 VAL A HB   3  
ATOM   5646  H  HG11 . VAL B 2 92  ? -14.445 1.140   4.527   1.00 0.00 ? 350 VAL A HG11 3  
ATOM   5647  H  HG12 . VAL B 2 92  ? -16.093 0.537   4.714   1.00 0.00 ? 350 VAL A HG12 3  
ATOM   5648  H  HG13 . VAL B 2 92  ? -14.974 0.482   6.076   1.00 0.00 ? 350 VAL A HG13 3  
ATOM   5649  H  HG21 . VAL B 2 92  ? -14.233 3.650   6.521   1.00 0.00 ? 350 VAL A HG21 3  
ATOM   5650  H  HG22 . VAL B 2 92  ? -14.894 4.308   5.032   1.00 0.00 ? 350 VAL A HG22 3  
ATOM   5651  H  HG23 . VAL B 2 92  ? -13.777 2.949   4.979   1.00 0.00 ? 350 VAL A HG23 3  
ATOM   5652  N  N    . ALA B 2 93  ? -17.023 5.155   5.605   1.00 0.00 ? 351 ALA A N    3  
ATOM   5653  C  CA   . ALA B 2 93  ? -17.016 6.606   5.479   1.00 0.00 ? 351 ALA A CA   3  
ATOM   5654  C  C    . ALA B 2 93  ? -15.787 7.200   6.115   1.00 0.00 ? 351 ALA A C    3  
ATOM   5655  O  O    . ALA B 2 93  ? -15.411 8.343   5.849   1.00 0.00 ? 351 ALA A O    3  
ATOM   5656  C  CB   . ALA B 2 93  ? -18.233 7.197   6.162   1.00 0.00 ? 351 ALA A CB   3  
ATOM   5657  H  H    . ALA B 2 93  ? -17.082 4.742   6.486   1.00 0.00 ? 351 ALA A H    3  
ATOM   5658  H  HA   . ALA B 2 93  ? -17.040 6.857   4.437   1.00 0.00 ? 351 ALA A HA   3  
ATOM   5659  H  HB1  . ALA B 2 93  ? -17.992 7.374   7.210   1.00 0.00 ? 351 ALA A HB1  3  
ATOM   5660  H  HB2  . ALA B 2 93  ? -19.060 6.505   6.091   1.00 0.00 ? 351 ALA A HB2  3  
ATOM   5661  H  HB3  . ALA B 2 93  ? -18.499 8.130   5.690   1.00 0.00 ? 351 ALA A HB3  3  
ATOM   5662  N  N    . GLU B 2 94  ? -15.171 6.402   6.956   1.00 0.00 ? 352 GLU A N    3  
ATOM   5663  C  CA   . GLU B 2 94  ? -14.010 6.816   7.725   1.00 0.00 ? 352 GLU A CA   3  
ATOM   5664  C  C    . GLU B 2 94  ? -13.362 5.593   8.378   1.00 0.00 ? 352 GLU A C    3  
ATOM   5665  O  O    . GLU B 2 94  ? -12.146 5.410   8.301   1.00 0.00 ? 352 GLU A O    3  
ATOM   5666  C  CB   . GLU B 2 94  ? -14.432 7.799   8.828   1.00 0.00 ? 352 GLU A CB   3  
ATOM   5667  C  CG   . GLU B 2 94  ? -15.899 8.179   8.809   1.00 0.00 ? 352 GLU A CG   3  
ATOM   5668  C  CD   . GLU B 2 94  ? -16.308 8.995   10.020  1.00 0.00 ? 352 GLU A CD   3  
ATOM   5669  O  OE1  . GLU B 2 94  ? -16.162 10.235  9.977   1.00 0.00 ? 352 GLU A OE1  3  
ATOM   5670  O  OE2  . GLU B 2 94  ? -16.773 8.395   11.012  1.00 0.00 ? 352 GLU A OE2  3  
ATOM   5671  H  H    . GLU B 2 94  ? -15.496 5.480   7.045   1.00 0.00 ? 352 GLU A H    3  
ATOM   5672  H  HA   . GLU B 2 94  ? -13.311 7.291   7.052   1.00 0.00 ? 352 GLU A HA   3  
ATOM   5673  H  HB2  . GLU B 2 94  ? -14.253 7.327   9.770   1.00 0.00 ? 352 GLU A HB2  3  
ATOM   5674  H  HB3  . GLU B 2 94  ? -13.838 8.698   8.754   1.00 0.00 ? 352 GLU A HB3  3  
ATOM   5675  H  HG2  . GLU B 2 94  ? -16.102 8.755   7.920   1.00 0.00 ? 352 GLU A HG2  3  
ATOM   5676  H  HG3  . GLU B 2 94  ? -16.480 7.267   8.792   1.00 0.00 ? 352 GLU A HG3  3  
ATOM   5677  N  N    . PRO B 2 95  ? -14.190 4.746   9.033   1.00 0.00 ? 353 PRO A N    3  
ATOM   5678  C  CA   . PRO B 2 95  ? -13.809 3.523   9.701   1.00 0.00 ? 353 PRO A CA   3  
ATOM   5679  C  C    . PRO B 2 95  ? -12.319 3.090   9.615   1.00 0.00 ? 353 PRO A C    3  
ATOM   5680  O  O    . PRO B 2 95  ? -11.518 3.577   10.412  1.00 0.00 ? 353 PRO A O    3  
ATOM   5681  C  CB   . PRO B 2 95  ? -14.810 2.638   8.978   1.00 0.00 ? 353 PRO A CB   3  
ATOM   5682  C  CG   . PRO B 2 95  ? -16.077 3.396   9.155   1.00 0.00 ? 353 PRO A CG   3  
ATOM   5683  C  CD   . PRO B 2 95  ? -15.662 4.848   9.162   1.00 0.00 ? 353 PRO A CD   3  
ATOM   5684  H  HA   . PRO B 2 95  ? -14.086 3.561   10.743  1.00 0.00 ? 353 PRO A HA   3  
ATOM   5685  H  HB2  . PRO B 2 95  ? -14.545 2.586   7.935   1.00 0.00 ? 353 PRO A HB2  3  
ATOM   5686  H  HB3  . PRO B 2 95  ? -14.845 1.655   9.398   1.00 0.00 ? 353 PRO A HB3  3  
ATOM   5687  H  HG2  . PRO B 2 95  ? -16.746 3.201   8.335   1.00 0.00 ? 353 PRO A HG2  3  
ATOM   5688  H  HG3  . PRO B 2 95  ? -16.533 3.141   10.086  1.00 0.00 ? 353 PRO A HG3  3  
ATOM   5689  H  HD2  . PRO B 2 95  ? -16.100 5.367   8.337   1.00 0.00 ? 353 PRO A HD2  3  
ATOM   5690  H  HD3  . PRO B 2 95  ? -15.938 5.309   10.086  1.00 0.00 ? 353 PRO A HD3  3  
ATOM   5691  N  N    . PRO B 2 96  ? -11.889 2.193   8.686   1.00 0.00 ? 354 PRO A N    3  
ATOM   5692  C  CA   . PRO B 2 96  ? -10.509 1.724   8.634   1.00 0.00 ? 354 PRO A CA   3  
ATOM   5693  C  C    . PRO B 2 96  ? -9.640  2.470   7.629   1.00 0.00 ? 354 PRO A C    3  
ATOM   5694  O  O    . PRO B 2 96  ? -8.826  1.862   6.938   1.00 0.00 ? 354 PRO A O    3  
ATOM   5695  C  CB   . PRO B 2 96  ? -10.756 0.327   8.145   1.00 0.00 ? 354 PRO A CB   3  
ATOM   5696  C  CG   . PRO B 2 96  ? -11.700 0.558   7.041   1.00 0.00 ? 354 PRO A CG   3  
ATOM   5697  C  CD   . PRO B 2 96  ? -12.652 1.558   7.595   1.00 0.00 ? 354 PRO A CD   3  
ATOM   5698  H  HA   . PRO B 2 96  ? -10.047 1.698   9.590   1.00 0.00 ? 354 PRO A HA   3  
ATOM   5699  H  HB2  . PRO B 2 96  ? -9.838  -0.108  7.819   1.00 0.00 ? 354 PRO A HB2  3  
ATOM   5700  H  HB3  . PRO B 2 96  ? -11.208 -0.267  8.908   1.00 0.00 ? 354 PRO A HB3  3  
ATOM   5701  H  HG2  . PRO B 2 96  ? -11.185 0.953   6.181   1.00 0.00 ? 354 PRO A HG2  3  
ATOM   5702  H  HG3  . PRO B 2 96  ? -12.220 -0.349  6.793   1.00 0.00 ? 354 PRO A HG3  3  
ATOM   5703  H  HD2  . PRO B 2 96  ? -12.910 2.273   6.853   1.00 0.00 ? 354 PRO A HD2  3  
ATOM   5704  H  HD3  . PRO B 2 96  ? -13.529 1.061   7.973   1.00 0.00 ? 354 PRO A HD3  3  
ATOM   5705  N  N    . GLU B 2 97  ? -9.779  3.781   7.617   1.00 0.00 ? 355 GLU A N    3  
ATOM   5706  C  CA   . GLU B 2 97  ? -9.089  4.663   6.683   1.00 0.00 ? 355 GLU A CA   3  
ATOM   5707  C  C    . GLU B 2 97  ? -7.707  4.179   6.239   1.00 0.00 ? 355 GLU A C    3  
ATOM   5708  O  O    . GLU B 2 97  ? -7.357  4.308   5.066   1.00 0.00 ? 355 GLU A O    3  
ATOM   5709  C  CB   . GLU B 2 97  ? -8.968  6.051   7.298   1.00 0.00 ? 355 GLU A CB   3  
ATOM   5710  C  CG   . GLU B 2 97  ? -8.493  6.013   8.732   1.00 0.00 ? 355 GLU A CG   3  
ATOM   5711  C  CD   . GLU B 2 97  ? -7.797  7.292   9.155   1.00 0.00 ? 355 GLU A CD   3  
ATOM   5712  O  OE1  . GLU B 2 97  ? -6.683  7.555   8.653   1.00 0.00 ? 355 GLU A OE1  3  
ATOM   5713  O  OE2  . GLU B 2 97  ? -8.366  8.030   9.985   1.00 0.00 ? 355 GLU A OE2  3  
ATOM   5714  H  H    . GLU B 2 97  ? -10.352 4.187   8.289   1.00 0.00 ? 355 GLU A H    3  
ATOM   5715  H  HA   . GLU B 2 97  ? -9.709  4.732   5.814   1.00 0.00 ? 355 GLU A HA   3  
ATOM   5716  H  HB2  . GLU B 2 97  ? -8.272  6.639   6.719   1.00 0.00 ? 355 GLU A HB2  3  
ATOM   5717  H  HB3  . GLU B 2 97  ? -9.936  6.527   7.281   1.00 0.00 ? 355 GLU A HB3  3  
ATOM   5718  H  HG2  . GLU B 2 97  ? -9.349  5.861   9.366   1.00 0.00 ? 355 GLU A HG2  3  
ATOM   5719  H  HG3  . GLU B 2 97  ? -7.812  5.186   8.847   1.00 0.00 ? 355 GLU A HG3  3  
ATOM   5720  N  N    . GLY B 2 98  ? -6.920  3.636   7.156   1.00 0.00 ? 356 GLY A N    3  
ATOM   5721  C  CA   . GLY B 2 98  ? -5.586  3.200   6.793   1.00 0.00 ? 356 GLY A CA   3  
ATOM   5722  C  C    . GLY B 2 98  ? -5.437  1.706   6.583   1.00 0.00 ? 356 GLY A C    3  
ATOM   5723  O  O    . GLY B 2 98  ? -5.209  1.253   5.463   1.00 0.00 ? 356 GLY A O    3  
ATOM   5724  H  H    . GLY B 2 98  ? -7.240  3.540   8.073   1.00 0.00 ? 356 GLY A H    3  
ATOM   5725  H  HA2  . GLY B 2 98  ? -5.311  3.698   5.885   1.00 0.00 ? 356 GLY A HA2  3  
ATOM   5726  H  HA3  . GLY B 2 98  ? -4.905  3.504   7.563   1.00 0.00 ? 356 GLY A HA3  3  
ATOM   5727  N  N    . SER B 2 99  ? -5.543  0.952   7.670   1.00 0.00 ? 357 SER A N    3  
ATOM   5728  C  CA   . SER B 2 99  ? -5.401  -0.508  7.631   1.00 0.00 ? 357 SER A CA   3  
ATOM   5729  C  C    . SER B 2 99  ? -6.438  -1.122  6.699   1.00 0.00 ? 357 SER A C    3  
ATOM   5730  O  O    . SER B 2 99  ? -6.467  -0.802  5.512   1.00 0.00 ? 357 SER A O    3  
ATOM   5731  C  CB   . SER B 2 99  ? -5.578  -1.069  9.031   1.00 0.00 ? 357 SER A CB   3  
ATOM   5732  O  OG   . SER B 2 99  ? -5.257  -2.449  9.078   1.00 0.00 ? 357 SER A OG   3  
ATOM   5733  H  H    . SER B 2 99  ? -5.745  1.389   8.524   1.00 0.00 ? 357 SER A H    3  
ATOM   5734  H  HA   . SER B 2 99  ? -4.411  -0.744  7.271   1.00 0.00 ? 357 SER A HA   3  
ATOM   5735  H  HB2  . SER B 2 99  ? -4.940  -0.536  9.720   1.00 0.00 ? 357 SER A HB2  3  
ATOM   5736  H  HB3  . SER B 2 99  ? -6.610  -0.941  9.317   1.00 0.00 ? 357 SER A HB3  3  
ATOM   5737  H  HG   . SER B 2 99  ? -5.471  -2.856  8.236   1.00 0.00 ? 357 SER A HG   3  
ATOM   5738  N  N    . TRP B 2 100 ? -7.271  -2.031  7.230   1.00 0.00 ? 358 TRP A N    3  
ATOM   5739  C  CA   . TRP B 2 100 ? -8.332  -2.622  6.437   1.00 0.00 ? 358 TRP A CA   3  
ATOM   5740  C  C    . TRP B 2 100 ? -7.794  -3.458  5.290   1.00 0.00 ? 358 TRP A C    3  
ATOM   5741  O  O    . TRP B 2 100 ? -6.740  -3.170  4.735   1.00 0.00 ? 358 TRP A O    3  
ATOM   5742  C  CB   . TRP B 2 100 ? -9.155  -1.457  5.940   1.00 0.00 ? 358 TRP A CB   3  
ATOM   5743  C  CG   . TRP B 2 100 ? -10.264 -1.754  5.024   1.00 0.00 ? 358 TRP A CG   3  
ATOM   5744  C  CD1  . TRP B 2 100 ? -11.544 -2.006  5.360   1.00 0.00 ? 358 TRP A CD1  3  
ATOM   5745  C  CD2  . TRP B 2 100 ? -10.204 -1.717  3.620   1.00 0.00 ? 358 TRP A CD2  3  
ATOM   5746  N  NE1  . TRP B 2 100 ? -12.306 -2.143  4.236   1.00 0.00 ? 358 TRP A NE1  3  
ATOM   5747  C  CE2  . TRP B 2 100 ? -11.496 -1.978  3.143   1.00 0.00 ? 358 TRP A CE2  3  
ATOM   5748  C  CE3  . TRP B 2 100 ? -9.177  -1.493  2.723   1.00 0.00 ? 358 TRP A CE3  3  
ATOM   5749  C  CZ2  . TRP B 2 100 ? -11.785 -2.009  1.791   1.00 0.00 ? 358 TRP A CZ2  3  
ATOM   5750  C  CZ3  . TRP B 2 100 ? -9.464  -1.514  1.387   1.00 0.00 ? 358 TRP A CZ3  3  
ATOM   5751  C  CH2  . TRP B 2 100 ? -10.757 -1.766  0.929   1.00 0.00 ? 358 TRP A CH2  3  
ATOM   5752  H  H    . TRP B 2 100 ? -7.173  -2.292  8.158   1.00 0.00 ? 358 TRP A H    3  
ATOM   5753  H  HA   . TRP B 2 100 ? -8.955  -3.242  7.072   1.00 0.00 ? 358 TRP A HA   3  
ATOM   5754  H  HB2  . TRP B 2 100 ? -9.582  -0.983  6.786   1.00 0.00 ? 358 TRP A HB2  3  
ATOM   5755  H  HB3  . TRP B 2 100 ? -8.506  -0.753  5.451   1.00 0.00 ? 358 TRP A HB3  3  
ATOM   5756  H  HD1  . TRP B 2 100 ? -11.895 -2.055  6.376   1.00 0.00 ? 358 TRP A HD1  3  
ATOM   5757  H  HE1  . TRP B 2 100 ? -13.263 -2.325  4.220   1.00 0.00 ? 358 TRP A HE1  3  
ATOM   5758  H  HE3  . TRP B 2 100 ? -8.168  -1.297  3.060   1.00 0.00 ? 358 TRP A HE3  3  
ATOM   5759  H  HZ2  . TRP B 2 100 ? -12.776 -2.189  1.422   1.00 0.00 ? 358 TRP A HZ2  3  
ATOM   5760  H  HZ3  . TRP B 2 100 ? -8.697  -1.288  0.683   1.00 0.00 ? 358 TRP A HZ3  3  
ATOM   5761  H  HH2  . TRP B 2 100 ? -10.931 -1.767  -0.129  1.00 0.00 ? 358 TRP A HH2  3  
ATOM   5762  N  N    . SER B 2 101 ? -8.512  -4.520  4.974   1.00 0.00 ? 359 SER A N    3  
ATOM   5763  C  CA   . SER B 2 101 ? -8.135  -5.398  3.879   1.00 0.00 ? 359 SER A CA   3  
ATOM   5764  C  C    . SER B 2 101 ? -9.073  -5.162  2.705   1.00 0.00 ? 359 SER A C    3  
ATOM   5765  O  O    . SER B 2 101 ? -10.179 -4.654  2.884   1.00 0.00 ? 359 SER A O    3  
ATOM   5766  C  CB   . SER B 2 101 ? -8.199  -6.857  4.313   1.00 0.00 ? 359 SER A CB   3  
ATOM   5767  O  OG   . SER B 2 101 ? -7.684  -7.028  5.622   1.00 0.00 ? 359 SER A OG   3  
ATOM   5768  H  H    . SER B 2 101 ? -9.315  -4.723  5.496   1.00 0.00 ? 359 SER A H    3  
ATOM   5769  H  HA   . SER B 2 101 ? -7.125  -5.156  3.585   1.00 0.00 ? 359 SER A HA   3  
ATOM   5770  H  HB2  . SER B 2 101 ? -9.221  -7.180  4.293   1.00 0.00 ? 359 SER A HB2  3  
ATOM   5771  H  HB3  . SER B 2 101 ? -7.619  -7.460  3.630   1.00 0.00 ? 359 SER A HB3  3  
ATOM   5772  H  HG   . SER B 2 101 ? -6.725  -7.054  5.589   1.00 0.00 ? 359 SER A HG   3  
ATOM   5773  N  N    . CYS B 2 102 ? -8.645  -5.539  1.512   1.00 0.00 ? 360 CYS A N    3  
ATOM   5774  C  CA   . CYS B 2 102 ? -9.467  -5.339  0.328   1.00 0.00 ? 360 CYS A CA   3  
ATOM   5775  C  C    . CYS B 2 102 ? -10.287 -6.587  0.024   1.00 0.00 ? 360 CYS A C    3  
ATOM   5776  O  O    . CYS B 2 102 ? -10.185 -7.586  0.736   1.00 0.00 ? 360 CYS A O    3  
ATOM   5777  C  CB   . CYS B 2 102 ? -8.604  -4.951  -0.868  1.00 0.00 ? 360 CYS A CB   3  
ATOM   5778  S  SG   . CYS B 2 102 ? -7.630  -6.318  -1.578  1.00 0.00 ? 360 CYS A SG   3  
ATOM   5779  H  H    . CYS B 2 102 ? -7.771  -5.970  1.428   1.00 0.00 ? 360 CYS A H    3  
ATOM   5780  H  HA   . CYS B 2 102 ? -10.147 -4.528  0.540   1.00 0.00 ? 360 CYS A HA   3  
ATOM   5781  H  HB2  . CYS B 2 102 ? -9.245  -4.566  -1.641  1.00 0.00 ? 360 CYS A HB2  3  
ATOM   5782  H  HB3  . CYS B 2 102 ? -7.913  -4.178  -0.567  1.00 0.00 ? 360 CYS A HB3  3  
ATOM   5783  N  N    . HIS B 2 103 ? -11.094 -6.538  -1.032  1.00 0.00 ? 361 HIS A N    3  
ATOM   5784  C  CA   . HIS B 2 103 ? -11.934 -7.676  -1.379  1.00 0.00 ? 361 HIS A CA   3  
ATOM   5785  C  C    . HIS B 2 103 ? -11.136 -8.776  -2.064  1.00 0.00 ? 361 HIS A C    3  
ATOM   5786  O  O    . HIS B 2 103 ? -11.458 -9.955  -1.932  1.00 0.00 ? 361 HIS A O    3  
ATOM   5787  C  CB   . HIS B 2 103 ? -13.125 -7.244  -2.253  1.00 0.00 ? 361 HIS A CB   3  
ATOM   5788  C  CG   . HIS B 2 103 ? -12.770 -6.854  -3.662  1.00 0.00 ? 361 HIS A CG   3  
ATOM   5789  N  ND1  . HIS B 2 103 ? -13.206 -5.691  -4.266  1.00 0.00 ? 361 HIS A ND1  3  
ATOM   5790  C  CD2  . HIS B 2 103 ? -12.033 -7.493  -4.593  1.00 0.00 ? 361 HIS A CD2  3  
ATOM   5791  C  CE1  . HIS B 2 103 ? -12.743 -5.648  -5.509  1.00 0.00 ? 361 HIS A CE1  3  
ATOM   5792  N  NE2  . HIS B 2 103 ? -12.034 -6.729  -5.724  1.00 0.00 ? 361 HIS A NE2  3  
ATOM   5793  H  H    . HIS B 2 103 ? -11.120 -5.729  -1.586  1.00 0.00 ? 361 HIS A H    3  
ATOM   5794  H  HA   . HIS B 2 103 ? -12.317 -8.073  -0.456  1.00 0.00 ? 361 HIS A HA   3  
ATOM   5795  H  HB2  . HIS B 2 103 ? -13.825 -8.062  -2.313  1.00 0.00 ? 361 HIS A HB2  3  
ATOM   5796  H  HB3  . HIS B 2 103 ? -13.609 -6.402  -1.785  1.00 0.00 ? 361 HIS A HB3  3  
ATOM   5797  H  HD1  . HIS B 2 103 ? -13.765 -5.002  -3.851  1.00 0.00 ? 361 HIS A HD1  3  
ATOM   5798  H  HD2  . HIS B 2 103 ? -11.500 -8.419  -4.452  1.00 0.00 ? 361 HIS A HD2  3  
ATOM   5799  H  HE1  . HIS B 2 103 ? -12.899 -4.857  -6.216  1.00 0.00 ? 361 HIS A HE1  3  
ATOM   5800  H  HE2  . HIS B 2 103 ? -11.502 -6.904  -6.529  1.00 0.00 ? 361 HIS A HE2  3  
ATOM   5801  N  N    . LEU B 2 104 ? -10.093 -8.393  -2.789  1.00 0.00 ? 362 LEU A N    3  
ATOM   5802  C  CA   . LEU B 2 104 ? -9.273  -9.365  -3.497  1.00 0.00 ? 362 LEU A CA   3  
ATOM   5803  C  C    . LEU B 2 104 ? -8.515  -10.233 -2.512  1.00 0.00 ? 362 LEU A C    3  
ATOM   5804  O  O    . LEU B 2 104 ? -8.311  -11.428 -2.736  1.00 0.00 ? 362 LEU A O    3  
ATOM   5805  C  CB   . LEU B 2 104 ? -8.321  -8.654  -4.467  1.00 0.00 ? 362 LEU A CB   3  
ATOM   5806  C  CG   . LEU B 2 104 ? -8.984  -8.084  -5.723  1.00 0.00 ? 362 LEU A CG   3  
ATOM   5807  C  CD1  . LEU B 2 104 ? -7.941  -7.584  -6.689  1.00 0.00 ? 362 LEU A CD1  3  
ATOM   5808  C  CD2  . LEU B 2 104 ? -9.878  -9.113  -6.388  1.00 0.00 ? 362 LEU A CD2  3  
ATOM   5809  H  H    . LEU B 2 104 ? -9.872  -7.441  -2.851  1.00 0.00 ? 362 LEU A H    3  
ATOM   5810  H  HA   . LEU B 2 104 ? -9.936  -9.994  -4.055  1.00 0.00 ? 362 LEU A HA   3  
ATOM   5811  H  HB2  . LEU B 2 104 ? -7.847  -7.840  -3.940  1.00 0.00 ? 362 LEU A HB2  3  
ATOM   5812  H  HB3  . LEU B 2 104 ? -7.560  -9.345  -4.778  1.00 0.00 ? 362 LEU A HB3  3  
ATOM   5813  H  HG   . LEU B 2 104 ? -9.595  -7.242  -5.442  1.00 0.00 ? 362 LEU A HG   3  
ATOM   5814  H  HD11 . LEU B 2 104 ? -7.443  -6.748  -6.242  1.00 0.00 ? 362 LEU A HD11 3  
ATOM   5815  H  HD12 . LEU B 2 104 ? -8.415  -7.276  -7.608  1.00 0.00 ? 362 LEU A HD12 3  
ATOM   5816  H  HD13 . LEU B 2 104 ? -7.226  -8.367  -6.890  1.00 0.00 ? 362 LEU A HD13 3  
ATOM   5817  H  HD21 . LEU B 2 104 ? -10.792 -9.196  -5.821  1.00 0.00 ? 362 LEU A HD21 3  
ATOM   5818  H  HD22 . LEU B 2 104 ? -9.375  -10.070 -6.408  1.00 0.00 ? 362 LEU A HD22 3  
ATOM   5819  H  HD23 . LEU B 2 104 ? -10.104 -8.800  -7.396  1.00 0.00 ? 362 LEU A HD23 3  
ATOM   5820  N  N    . CYS B 2 105 ? -8.155  -9.632  -1.398  1.00 0.00 ? 363 CYS A N    3  
ATOM   5821  C  CA   . CYS B 2 105 ? -7.425  -10.337 -0.353  1.00 0.00 ? 363 CYS A CA   3  
ATOM   5822  C  C    . CYS B 2 105 ? -8.357  -11.186 0.433   1.00 0.00 ? 363 CYS A C    3  
ATOM   5823  O  O    . CYS B 2 105 ? -7.936  -12.083 1.146   1.00 0.00 ? 363 CYS A O    3  
ATOM   5824  C  CB   . CYS B 2 105 ? -6.764  -9.383  0.613   1.00 0.00 ? 363 CYS A CB   3  
ATOM   5825  S  SG   . CYS B 2 105 ? -5.190  -8.691  0.033   1.00 0.00 ? 363 CYS A SG   3  
ATOM   5826  H  H    . CYS B 2 105 ? -8.417  -8.699  -1.264  1.00 0.00 ? 363 CYS A H    3  
ATOM   5827  H  HA   . CYS B 2 105 ? -6.690  -10.961 -0.806  1.00 0.00 ? 363 CYS A HA   3  
ATOM   5828  H  HB2  . CYS B 2 105 ? -7.433  -8.562  0.797   1.00 0.00 ? 363 CYS A HB2  3  
ATOM   5829  H  HB3  . CYS B 2 105 ? -6.589  -9.908  1.540   1.00 0.00 ? 363 CYS A HB3  3  
ATOM   5830  N  N    . TRP B 2 106 ? -9.616  -10.853 0.323   1.00 0.00 ? 364 TRP A N    3  
ATOM   5831  C  CA   . TRP B 2 106 ? -10.648 -11.556 1.024   1.00 0.00 ? 364 TRP A CA   3  
ATOM   5832  C  C    . TRP B 2 106 ? -11.101 -12.766 0.298   1.00 0.00 ? 364 TRP A C    3  
ATOM   5833  O  O    . TRP B 2 106 ? -11.170 -13.839 0.868   1.00 0.00 ? 364 TRP A O    3  
ATOM   5834  C  CB   . TRP B 2 106 ? -11.808 -10.645 1.250   1.00 0.00 ? 364 TRP A CB   3  
ATOM   5835  C  CG   . TRP B 2 106 ? -11.871 -10.292 2.648   1.00 0.00 ? 364 TRP A CG   3  
ATOM   5836  C  CD1  . TRP B 2 106 ? -10.837 -9.890  3.396   1.00 0.00 ? 364 TRP A CD1  3  
ATOM   5837  C  CD2  . TRP B 2 106 ? -12.995 -10.360 3.467   1.00 0.00 ? 364 TRP A CD2  3  
ATOM   5838  N  NE1  . TRP B 2 106 ? -11.243 -9.668  4.669   1.00 0.00 ? 364 TRP A NE1  3  
ATOM   5839  C  CE2  . TRP B 2 106 ? -12.599 -9.957  4.744   1.00 0.00 ? 364 TRP A CE2  3  
ATOM   5840  C  CE3  . TRP B 2 106 ? -14.303 -10.719 3.222   1.00 0.00 ? 364 TRP A CE3  3  
ATOM   5841  C  CZ2  . TRP B 2 106 ? -13.501 -9.910  5.797   1.00 0.00 ? 364 TRP A CZ2  3  
ATOM   5842  C  CZ3  . TRP B 2 106 ? -15.203 -10.675 4.264   1.00 0.00 ? 364 TRP A CZ3  3  
ATOM   5843  C  CH2  . TRP B 2 106 ? -14.798 -10.272 5.539   1.00 0.00 ? 364 TRP A CH2  3  
ATOM   5844  H  H    . TRP B 2 106 ? -9.856  -10.091 -0.237  1.00 0.00 ? 364 TRP A H    3  
ATOM   5845  H  HA   . TRP B 2 106 ? -10.252 -11.857 1.986   1.00 0.00 ? 364 TRP A HA   3  
ATOM   5846  H  HB2  . TRP B 2 106 ? -11.678 -9.747  0.684   1.00 0.00 ? 364 TRP A HB2  3  
ATOM   5847  H  HB3  . TRP B 2 106 ? -12.728 -11.135 0.974   1.00 0.00 ? 364 TRP A HB3  3  
ATOM   5848  H  HD1  . TRP B 2 106 ? -9.841  -9.772  3.012   1.00 0.00 ? 364 TRP A HD1  3  
ATOM   5849  H  HE1  . TRP B 2 106 ? -10.662 -9.357  5.387   1.00 0.00 ? 364 TRP A HE1  3  
ATOM   5850  H  HE3  . TRP B 2 106 ? -14.603 -11.039 2.225   1.00 0.00 ? 364 TRP A HE3  3  
ATOM   5851  H  HZ2  . TRP B 2 106 ? -13.211 -9.615  6.776   1.00 0.00 ? 364 TRP A HZ2  3  
ATOM   5852  H  HZ3  . TRP B 2 106 ? -16.229 -10.952 4.103   1.00 0.00 ? 364 TRP A HZ3  3  
ATOM   5853  H  HH2  . TRP B 2 106 ? -15.531 -10.255 6.329   1.00 0.00 ? 364 TRP A HH2  3  
ATOM   5854  N  N    . GLU B 2 107 ? -11.423 -12.611 -0.952  1.00 0.00 ? 365 GLU A N    3  
ATOM   5855  C  CA   . GLU B 2 107 ? -11.856 -13.735 -1.697  1.00 0.00 ? 365 GLU A CA   3  
ATOM   5856  C  C    . GLU B 2 107 ? -10.706 -14.715 -1.698  1.00 0.00 ? 365 GLU A C    3  
ATOM   5857  O  O    . GLU B 2 107 ? -10.877 -15.927 -1.817  1.00 0.00 ? 365 GLU A O    3  
ATOM   5858  C  CB   . GLU B 2 107 ? -12.205 -13.287 -3.095  1.00 0.00 ? 365 GLU A CB   3  
ATOM   5859  C  CG   . GLU B 2 107 ? -13.159 -12.118 -3.071  1.00 0.00 ? 365 GLU A CG   3  
ATOM   5860  C  CD   . GLU B 2 107 ? -14.528 -12.461 -3.625  1.00 0.00 ? 365 GLU A CD   3  
ATOM   5861  O  OE1  . GLU B 2 107 ? -14.698 -12.412 -4.860  1.00 0.00 ? 365 GLU A OE1  3  
ATOM   5862  O  OE2  . GLU B 2 107 ? -15.431 -12.778 -2.821  1.00 0.00 ? 365 GLU A OE2  3  
ATOM   5863  H  H    . GLU B 2 107 ? -11.329 -11.740 -1.392  1.00 0.00 ? 365 GLU A H    3  
ATOM   5864  H  HA   . GLU B 2 107 ? -12.729 -14.146 -1.187  1.00 0.00 ? 365 GLU A HA   3  
ATOM   5865  H  HB2  . GLU B 2 107 ? -11.288 -12.981 -3.591  1.00 0.00 ? 365 GLU A HB2  3  
ATOM   5866  H  HB3  . GLU B 2 107 ? -12.660 -14.102 -3.637  1.00 0.00 ? 365 GLU A HB3  3  
ATOM   5867  H  HG2  . GLU B 2 107 ? -13.269 -11.806 -2.036  1.00 0.00 ? 365 GLU A HG2  3  
ATOM   5868  H  HG3  . GLU B 2 107 ? -12.737 -11.309 -3.648  1.00 0.00 ? 365 GLU A HG3  3  
ATOM   5869  N  N    . LEU B 2 108 ? -9.517  -14.132 -1.528  1.00 0.00 ? 366 LEU A N    3  
ATOM   5870  C  CA   . LEU B 2 108 ? -8.282  -14.870 -1.465  1.00 0.00 ? 366 LEU A CA   3  
ATOM   5871  C  C    . LEU B 2 108 ? -8.041  -15.313 -0.030  1.00 0.00 ? 366 LEU A C    3  
ATOM   5872  O  O    . LEU B 2 108 ? -7.327  -16.278 0.236   1.00 0.00 ? 366 LEU A O    3  
ATOM   5873  C  CB   . LEU B 2 108 ? -7.160  -13.978 -1.964  1.00 0.00 ? 366 LEU A CB   3  
ATOM   5874  C  CG   . LEU B 2 108 ? -5.767  -14.583 -1.991  1.00 0.00 ? 366 LEU A CG   3  
ATOM   5875  C  CD1  . LEU B 2 108 ? -5.117  -14.428 -0.635  1.00 0.00 ? 366 LEU A CD1  3  
ATOM   5876  C  CD2  . LEU B 2 108 ? -5.845  -16.032 -2.420  1.00 0.00 ? 366 LEU A CD2  3  
ATOM   5877  H  H    . LEU B 2 108 ? -9.474  -13.148 -1.430  1.00 0.00 ? 366 LEU A H    3  
ATOM   5878  H  HA   . LEU B 2 108 ? -8.358  -15.719 -2.102  1.00 0.00 ? 366 LEU A HA   3  
ATOM   5879  H  HB2  . LEU B 2 108 ? -7.403  -13.678 -2.960  1.00 0.00 ? 366 LEU A HB2  3  
ATOM   5880  H  HB3  . LEU B 2 108 ? -7.138  -13.107 -1.343  1.00 0.00 ? 366 LEU A HB3  3  
ATOM   5881  H  HG   . LEU B 2 108 ? -5.170  -14.053 -2.713  1.00 0.00 ? 366 LEU A HG   3  
ATOM   5882  H  HD11 . LEU B 2 108 ? -5.570  -13.583 -0.136  1.00 0.00 ? 366 LEU A HD11 3  
ATOM   5883  H  HD12 . LEU B 2 108 ? -4.057  -14.254 -0.759  1.00 0.00 ? 366 LEU A HD12 3  
ATOM   5884  H  HD13 . LEU B 2 108 ? -5.274  -15.321 -0.052  1.00 0.00 ? 366 LEU A HD13 3  
ATOM   5885  H  HD21 . LEU B 2 108 ? -6.711  -16.147 -3.057  1.00 0.00 ? 366 LEU A HD21 3  
ATOM   5886  H  HD22 . LEU B 2 108 ? -5.944  -16.665 -1.550  1.00 0.00 ? 366 LEU A HD22 3  
ATOM   5887  H  HD23 . LEU B 2 108 ? -4.954  -16.299 -2.967  1.00 0.00 ? 366 LEU A HD23 3  
ATOM   5888  N  N    . LEU B 2 109 ? -8.686  -14.596 0.885   1.00 0.00 ? 367 LEU A N    3  
ATOM   5889  C  CA   . LEU B 2 109 ? -8.581  -14.864 2.312   1.00 0.00 ? 367 LEU A CA   3  
ATOM   5890  C  C    . LEU B 2 109 ? -9.307  -16.144 2.622   1.00 0.00 ? 367 LEU A C    3  
ATOM   5891  O  O    . LEU B 2 109 ? -8.761  -17.086 3.196   1.00 0.00 ? 367 LEU A O    3  
ATOM   5892  C  CB   . LEU B 2 109 ? -9.221  -13.725 3.091   1.00 0.00 ? 367 LEU A CB   3  
ATOM   5893  C  CG   . LEU B 2 109 ? -8.584  -13.398 4.427   1.00 0.00 ? 367 LEU A CG   3  
ATOM   5894  C  CD1  . LEU B 2 109 ? -7.206  -12.802 4.210   1.00 0.00 ? 367 LEU A CD1  3  
ATOM   5895  C  CD2  . LEU B 2 109 ? -9.471  -12.446 5.218   1.00 0.00 ? 367 LEU A CD2  3  
ATOM   5896  H  H    . LEU B 2 109 ? -9.277  -13.868 0.583   1.00 0.00 ? 367 LEU A H    3  
ATOM   5897  H  HA   . LEU B 2 109 ? -7.546  -14.946 2.581   1.00 0.00 ? 367 LEU A HA   3  
ATOM   5898  H  HB2  . LEU B 2 109 ? -9.167  -12.849 2.482   1.00 0.00 ? 367 LEU A HB2  3  
ATOM   5899  H  HB3  . LEU B 2 109 ? -10.260 -13.966 3.260   1.00 0.00 ? 367 LEU A HB3  3  
ATOM   5900  H  HG   . LEU B 2 109 ? -8.476  -14.302 4.986   1.00 0.00 ? 367 LEU A HG   3  
ATOM   5901  H  HD11 . LEU B 2 109 ? -7.082  -12.576 3.159   1.00 0.00 ? 367 LEU A HD11 3  
ATOM   5902  H  HD12 . LEU B 2 109 ? -6.453  -13.512 4.519   1.00 0.00 ? 367 LEU A HD12 3  
ATOM   5903  H  HD13 . LEU B 2 109 ? -7.109  -11.895 4.788   1.00 0.00 ? 367 LEU A HD13 3  
ATOM   5904  H  HD21 . LEU B 2 109 ? -10.464 -12.438 4.791   1.00 0.00 ? 367 LEU A HD21 3  
ATOM   5905  H  HD22 . LEU B 2 109 ? -9.054  -11.451 5.181   1.00 0.00 ? 367 LEU A HD22 3  
ATOM   5906  H  HD23 . LEU B 2 109 ? -9.523  -12.775 6.246   1.00 0.00 ? 367 LEU A HD23 3  
ATOM   5907  N  N    . LYS B 2 110 ? -10.563 -16.142 2.228   1.00 0.00 ? 368 LYS A N    3  
ATOM   5908  C  CA   . LYS B 2 110 ? -11.434 -17.279 2.413   1.00 0.00 ? 368 LYS A CA   3  
ATOM   5909  C  C    . LYS B 2 110 ? -10.939 -18.451 1.577   1.00 0.00 ? 368 LYS A C    3  
ATOM   5910  O  O    . LYS B 2 110 ? -11.046 -19.608 1.983   1.00 0.00 ? 368 LYS A O    3  
ATOM   5911  C  CB   . LYS B 2 110 ? -12.861 -16.899 2.015   1.00 0.00 ? 368 LYS A CB   3  
ATOM   5912  C  CG   . LYS B 2 110 ? -13.201 -15.448 2.315   1.00 0.00 ? 368 LYS A CG   3  
ATOM   5913  C  CD   . LYS B 2 110 ? -14.560 -15.068 1.784   1.00 0.00 ? 368 LYS A CD   3  
ATOM   5914  C  CE   . LYS B 2 110 ? -14.979 -13.699 2.283   1.00 0.00 ? 368 LYS A CE   3  
ATOM   5915  N  NZ   . LYS B 2 110 ? -16.176 -13.186 1.563   1.00 0.00 ? 368 LYS A NZ   3  
ATOM   5916  H  H    . LYS B 2 110 ? -10.918 -15.329 1.804   1.00 0.00 ? 368 LYS A H    3  
ATOM   5917  H  HA   . LYS B 2 110 ? -11.405 -17.552 3.452   1.00 0.00 ? 368 LYS A HA   3  
ATOM   5918  H  HB2  . LYS B 2 110 ? -12.979 -17.057 0.955   1.00 0.00 ? 368 LYS A HB2  3  
ATOM   5919  H  HB3  . LYS B 2 110 ? -13.556 -17.530 2.550   1.00 0.00 ? 368 LYS A HB3  3  
ATOM   5920  H  HG2  . LYS B 2 110 ? -13.182 -15.288 3.381   1.00 0.00 ? 368 LYS A HG2  3  
ATOM   5921  H  HG3  . LYS B 2 110 ? -12.468 -14.816 1.836   1.00 0.00 ? 368 LYS A HG3  3  
ATOM   5922  H  HD2  . LYS B 2 110 ? -14.503 -15.041 0.711   1.00 0.00 ? 368 LYS A HD2  3  
ATOM   5923  H  HD3  . LYS B 2 110 ? -15.287 -15.802 2.098   1.00 0.00 ? 368 LYS A HD3  3  
ATOM   5924  H  HE2  . LYS B 2 110 ? -15.206 -13.770 3.337   1.00 0.00 ? 368 LYS A HE2  3  
ATOM   5925  H  HE3  . LYS B 2 110 ? -14.152 -13.007 2.138   1.00 0.00 ? 368 LYS A HE3  3  
ATOM   5926  H  HZ1  . LYS B 2 110 ? -15.982 -13.125 0.543   1.00 0.00 ? 368 LYS A HZ1  3  
ATOM   5927  H  HZ2  . LYS B 2 110 ? -16.427 -12.241 1.915   1.00 0.00 ? 368 LYS A HZ2  3  
ATOM   5928  H  HZ3  . LYS B 2 110 ? -16.983 -13.825 1.714   1.00 0.00 ? 368 LYS A HZ3  3  
ATOM   5929  N  N    . GLU B 2 111 ? -10.399 -18.138 0.401   1.00 0.00 ? 369 GLU A N    3  
ATOM   5930  C  CA   . GLU B 2 111 ? -9.869  -19.160 -0.488  1.00 0.00 ? 369 GLU A CA   3  
ATOM   5931  C  C    . GLU B 2 111 ? -8.743  -19.929 0.189   1.00 0.00 ? 369 GLU A C    3  
ATOM   5932  O  O    . GLU B 2 111 ? -8.583  -21.131 -0.027  1.00 0.00 ? 369 GLU A O    3  
ATOM   5933  C  CB   . GLU B 2 111 ? -9.348  -18.533 -1.774  1.00 0.00 ? 369 GLU A CB   3  
ATOM   5934  C  CG   . GLU B 2 111 ? -9.989  -19.112 -3.019  1.00 0.00 ? 369 GLU A CG   3  
ATOM   5935  C  CD   . GLU B 2 111 ? -9.703  -20.592 -3.189  1.00 0.00 ? 369 GLU A CD   3  
ATOM   5936  O  OE1  . GLU B 2 111 ? -8.624  -20.931 -3.718  1.00 0.00 ? 369 GLU A OE1  3  
ATOM   5937  O  OE2  . GLU B 2 111 ? -10.559 -21.411 -2.793  1.00 0.00 ? 369 GLU A OE2  3  
ATOM   5938  H  H    . GLU B 2 111 ? -10.366 -17.196 0.123   1.00 0.00 ? 369 GLU A H    3  
ATOM   5939  H  HA   . GLU B 2 111 ? -10.667 -19.842 -0.734  1.00 0.00 ? 369 GLU A HA   3  
ATOM   5940  H  HB2  . GLU B 2 111 ? -9.544  -17.474 -1.751  1.00 0.00 ? 369 GLU A HB2  3  
ATOM   5941  H  HB3  . GLU B 2 111 ? -8.283  -18.694 -1.833  1.00 0.00 ? 369 GLU A HB3  3  
ATOM   5942  H  HG2  . GLU B 2 111 ? -11.057 -18.973 -2.955  1.00 0.00 ? 369 GLU A HG2  3  
ATOM   5943  H  HG3  . GLU B 2 111 ? -9.610  -18.587 -3.876  1.00 0.00 ? 369 GLU A HG3  3  
ATOM   5944  N  N    . LYS B 2 112 ? -7.962  -19.228 1.009   1.00 0.00 ? 370 LYS A N    3  
ATOM   5945  C  CA   . LYS B 2 112 ? -6.849  -19.846 1.705   1.00 0.00 ? 370 LYS A CA   3  
ATOM   5946  C  C    . LYS B 2 112 ? -7.312  -21.002 2.587   1.00 0.00 ? 370 LYS A C    3  
ATOM   5947  O  O    . LYS B 2 112 ? -6.599  -21.992 2.755   1.00 0.00 ? 370 LYS A O    3  
ATOM   5948  C  CB   . LYS B 2 112 ? -6.117  -18.807 2.537   1.00 0.00 ? 370 LYS A CB   3  
ATOM   5949  C  CG   . LYS B 2 112 ? -5.194  -17.949 1.715   1.00 0.00 ? 370 LYS A CG   3  
ATOM   5950  C  CD   . LYS B 2 112 ? -5.145  -16.547 2.250   1.00 0.00 ? 370 LYS A CD   3  
ATOM   5951  C  CE   . LYS B 2 112 ? -4.588  -16.499 3.659   1.00 0.00 ? 370 LYS A CE   3  
ATOM   5952  N  NZ   . LYS B 2 112 ? -3.180  -16.982 3.718   1.00 0.00 ? 370 LYS A NZ   3  
ATOM   5953  H  H    . LYS B 2 112 ? -8.134  -18.269 1.145   1.00 0.00 ? 370 LYS A H    3  
ATOM   5954  H  HA   . LYS B 2 112 ? -6.177  -20.217 0.957   1.00 0.00 ? 370 LYS A HA   3  
ATOM   5955  H  HB2  . LYS B 2 112 ? -6.841  -18.160 2.995   1.00 0.00 ? 370 LYS A HB2  3  
ATOM   5956  H  HB3  . LYS B 2 112 ? -5.539  -19.296 3.300   1.00 0.00 ? 370 LYS A HB3  3  
ATOM   5957  H  HG2  . LYS B 2 112 ? -4.203  -18.371 1.717   1.00 0.00 ? 370 LYS A HG2  3  
ATOM   5958  H  HG3  . LYS B 2 112 ? -5.581  -17.915 0.723   1.00 0.00 ? 370 LYS A HG3  3  
ATOM   5959  H  HD2  . LYS B 2 112 ? -4.532  -15.939 1.602   1.00 0.00 ? 370 LYS A HD2  3  
ATOM   5960  H  HD3  . LYS B 2 112 ? -6.153  -16.177 2.256   1.00 0.00 ? 370 LYS A HD3  3  
ATOM   5961  H  HE2  . LYS B 2 112 ? -4.627  -15.480 4.016   1.00 0.00 ? 370 LYS A HE2  3  
ATOM   5962  H  HE3  . LYS B 2 112 ? -5.202  -17.124 4.284   1.00 0.00 ? 370 LYS A HE3  3  
ATOM   5963  H  HZ1  . LYS B 2 112 ? -2.568  -16.371 3.142   1.00 0.00 ? 370 LYS A HZ1  3  
ATOM   5964  H  HZ2  . LYS B 2 112 ? -3.120  -17.954 3.355   1.00 0.00 ? 370 LYS A HZ2  3  
ATOM   5965  H  HZ3  . LYS B 2 112 ? -2.839  -16.970 4.701   1.00 0.00 ? 370 LYS A HZ3  3  
ATOM   5966  N  N    . ALA B 2 113 ? -8.509  -20.868 3.149   1.00 0.00 ? 371 ALA A N    3  
ATOM   5967  C  CA   . ALA B 2 113 ? -9.071  -21.897 4.012   1.00 0.00 ? 371 ALA A CA   3  
ATOM   5968  C  C    . ALA B 2 113 ? -9.313  -23.194 3.260   1.00 0.00 ? 371 ALA A C    3  
ATOM   5969  O  O    . ALA B 2 113 ? -8.973  -23.325 2.083   1.00 0.00 ? 371 ALA A O    3  
ATOM   5970  C  CB   . ALA B 2 113 ? -10.368 -21.410 4.632   1.00 0.00 ? 371 ALA A CB   3  
ATOM   5971  H  H    . ALA B 2 113 ? -9.027  -20.053 2.982   1.00 0.00 ? 371 ALA A H    3  
ATOM   5972  H  HA   . ALA B 2 113 ? -8.370  -22.084 4.812   1.00 0.00 ? 371 ALA A HA   3  
ATOM   5973  H  HB1  . ALA B 2 113 ? -10.148 -20.672 5.381   1.00 0.00 ? 371 ALA A HB1  3  
ATOM   5974  H  HB2  . ALA B 2 113 ? -10.886 -22.242 5.087   1.00 0.00 ? 371 ALA A HB2  3  
ATOM   5975  H  HB3  . ALA B 2 113 ? -10.992 -20.972 3.867   1.00 0.00 ? 371 ALA A HB3  3  
ATOM   5976  N  N    . SER B 2 114 ? -9.912  -24.147 3.961   1.00 0.00 ? 372 SER A N    3  
ATOM   5977  C  CA   . SER B 2 114 ? -10.219 -25.455 3.392   1.00 0.00 ? 372 SER A CA   3  
ATOM   5978  C  C    . SER B 2 114 ? -8.973  -26.101 2.791   1.00 0.00 ? 372 SER A C    3  
ATOM   5979  O  O    . SER B 2 114 ? -8.222  -26.750 3.548   1.00 0.00 ? 372 SER A O    3  
ATOM   5980  C  CB   . SER B 2 114 ? -11.309 -25.329 2.325   1.00 0.00 ? 372 SER A CB   3  
ATOM   5981  O  OG   . SER B 2 114 ? -11.629 -26.591 1.768   1.00 0.00 ? 372 SER A OG   3  
ATOM   5982  O  OXT  . SER B 2 114 ? -8.760  -25.953 1.569   1.00 0.00 ? 372 SER A OXT  3  
ATOM   5983  H  H    . SER B 2 114 ? -10.158 -23.958 4.893   1.00 0.00 ? 372 SER A H    3  
ATOM   5984  H  HA   . SER B 2 114 ? -10.584 -26.085 4.189   1.00 0.00 ? 372 SER A HA   3  
ATOM   5985  H  HB2  . SER B 2 114 ? -12.200 -24.910 2.771   1.00 0.00 ? 372 SER A HB2  3  
ATOM   5986  H  HB3  . SER B 2 114 ? -10.964 -24.677 1.536   1.00 0.00 ? 372 SER A HB3  3  
ATOM   5987  H  HG   . SER B 2 114 ? -12.518 -26.566 1.404   1.00 0.00 ? 372 SER A HG   3  
HETATM 5988  ZN ZN   . ZN  C 3 .   ? 14.943  0.122   2.580   1.00 0.00 ? 501 ZN  A ZN   3  
HETATM 5989  ZN ZN   . ZN  D 3 .   ? 4.157   5.482   -7.611  1.00 0.00 ? 601 ZN  A ZN   3  
HETATM 5990  ZN ZN   . ZN  E 3 .   ? -5.581  -6.475  -0.494  1.00 0.00 ? 701 ZN  A ZN   3  
HETATM 5991  ZN ZN   . ZN  F 3 .   ? -12.752 4.278   -6.047  1.00 0.00 ? 801 ZN  A ZN   3  
HETATM 5992  C  C1A  . SAC A 1 1   ? 5.786   4.498   -0.719  1.00 0.00 ? 1   SAC B C1A  4  
HETATM 5993  C  C2A  . SAC A 1 1   ? 7.175   4.915   -1.208  1.00 0.00 ? 1   SAC B C2A  4  
HETATM 5994  O  OAC  . SAC A 1 1   ? 4.856   4.464   -1.527  1.00 0.00 ? 1   SAC B OAC  4  
HETATM 5995  N  N    . SAC A 1 1   ? 5.599   4.278   0.578   1.00 0.00 ? 1   SAC B N    4  
HETATM 5996  C  CA   . SAC A 1 1   ? 4.258   4.294   1.156   1.00 0.00 ? 1   SAC B CA   4  
HETATM 5997  C  C    . SAC A 1 1   ? 3.645   5.688   1.057   1.00 0.00 ? 1   SAC B C    4  
HETATM 5998  O  O    . SAC A 1 1   ? 3.354   6.157   -0.041  1.00 0.00 ? 1   SAC B O    4  
HETATM 5999  C  CB   . SAC A 1 1   ? 4.291   3.827   2.613   1.00 0.00 ? 1   SAC B CB   4  
HETATM 6000  O  OG   . SAC A 1 1   ? 4.968   2.592   2.740   1.00 0.00 ? 1   SAC B OG   4  
HETATM 6001  H  H1   . SAC A 1 1   ? 6.371   4.316   1.179   1.00 0.00 ? 1   SAC B H1   4  
HETATM 6002  H  H2A1 . SAC A 1 1   ? 7.084   5.767   -1.867  1.00 0.00 ? 1   SAC B H2A1 4  
HETATM 6003  H  H2A2 . SAC A 1 1   ? 7.629   4.093   -1.742  1.00 0.00 ? 1   SAC B H2A2 4  
HETATM 6004  H  H2A3 . SAC A 1 1   ? 7.791   5.179   -0.362  1.00 0.00 ? 1   SAC B H2A3 4  
HETATM 6005  H  HA   . SAC A 1 1   ? 3.646   3.610   0.584   1.00 0.00 ? 1   SAC B HA   4  
HETATM 6006  H  HB2  . SAC A 1 1   ? 4.799   4.566   3.215   1.00 0.00 ? 1   SAC B HB2  4  
HETATM 6007  H  HB3  . SAC A 1 1   ? 3.280   3.704   2.972   1.00 0.00 ? 1   SAC B HB3  4  
HETATM 6008  H  HG   . SAC A 1 1   ? 5.240   2.469   3.653   1.00 0.00 ? 1   SAC B HG   4  
ATOM   6009  N  N    . GLY A 1 2   ? 3.457   6.353   2.200   1.00 0.00 ? 2   GLY B N    4  
ATOM   6010  C  CA   . GLY A 1 2   ? 2.882   7.688   2.192   1.00 0.00 ? 2   GLY B CA   4  
ATOM   6011  C  C    . GLY A 1 2   ? 3.490   8.558   1.117   1.00 0.00 ? 2   GLY B C    4  
ATOM   6012  O  O    . GLY A 1 2   ? 4.709   8.562   0.935   1.00 0.00 ? 2   GLY B O    4  
ATOM   6013  H  H    . GLY A 1 2   ? 3.711   5.937   3.050   1.00 0.00 ? 2   GLY B H    4  
ATOM   6014  H  HA2  . GLY A 1 2   ? 1.818   7.610   2.018   1.00 0.00 ? 2   GLY B HA2  4  
ATOM   6015  H  HA3  . GLY A 1 2   ? 3.048   8.149   3.154   1.00 0.00 ? 2   GLY B HA3  4  
ATOM   6016  N  N    . ARG A 1 3   ? 2.647   9.290   0.395   1.00 0.00 ? 3   ARG B N    4  
ATOM   6017  C  CA   . ARG A 1 3   ? 3.123   10.145  -0.682  1.00 0.00 ? 3   ARG B CA   4  
ATOM   6018  C  C    . ARG A 1 3   ? 4.253   11.053  -0.204  1.00 0.00 ? 3   ARG B C    4  
ATOM   6019  O  O    . ARG A 1 3   ? 4.278   11.479  0.950   1.00 0.00 ? 3   ARG B O    4  
ATOM   6020  C  CB   . ARG A 1 3   ? 1.986   10.980  -1.263  1.00 0.00 ? 3   ARG B CB   4  
ATOM   6021  C  CG   . ARG A 1 3   ? 1.427   12.031  -0.324  1.00 0.00 ? 3   ARG B CG   4  
ATOM   6022  C  CD   . ARG A 1 3   ? 0.569   13.023  -1.089  1.00 0.00 ? 3   ARG B CD   4  
ATOM   6023  N  NE   . ARG A 1 3   ? 1.371   13.880  -1.957  1.00 0.00 ? 3   ARG B NE   4  
ATOM   6024  C  CZ   . ARG A 1 3   ? 0.855   14.698  -2.869  1.00 0.00 ? 3   ARG B CZ   4  
ATOM   6025  N  NH1  . ARG A 1 3   ? -0.459  14.772  -3.031  1.00 0.00 ? 3   ARG B NH1  4  
ATOM   6026  N  NH2  . ARG A 1 3   ? 1.654   15.444  -3.620  1.00 0.00 ? 3   ARG B NH2  4  
ATOM   6027  H  H    . ARG A 1 3   ? 1.688   9.253   0.593   1.00 0.00 ? 3   ARG B H    4  
ATOM   6028  H  HA   . ARG A 1 3   ? 3.500   9.494   -1.456  1.00 0.00 ? 3   ARG B HA   4  
ATOM   6029  H  HB2  . ARG A 1 3   ? 2.346   11.482  -2.147  1.00 0.00 ? 3   ARG B HB2  4  
ATOM   6030  H  HB3  . ARG A 1 3   ? 1.181   10.317  -1.544  1.00 0.00 ? 3   ARG B HB3  4  
ATOM   6031  H  HG2  . ARG A 1 3   ? 0.822   11.547  0.429   1.00 0.00 ? 3   ARG B HG2  4  
ATOM   6032  H  HG3  . ARG A 1 3   ? 2.243   12.557  0.145   1.00 0.00 ? 3   ARG B HG3  4  
ATOM   6033  H  HD2  . ARG A 1 3   ? -0.137  12.471  -1.698  1.00 0.00 ? 3   ARG B HD2  4  
ATOM   6034  H  HD3  . ARG A 1 3   ? 0.032   13.639  -0.382  1.00 0.00 ? 3   ARG B HD3  4  
ATOM   6035  H  HE   . ARG A 1 3   ? 2.346   13.844  -1.856  1.00 0.00 ? 3   ARG B HE   4  
ATOM   6036  H  HH11 . ARG A 1 3   ? -1.066  14.211  -2.467  1.00 0.00 ? 3   ARG B HH11 4  
ATOM   6037  H  HH12 . ARG A 1 3   ? -0.845  15.388  -3.718  1.00 0.00 ? 3   ARG B HH12 4  
ATOM   6038  H  HH21 . ARG A 1 3   ? 2.645   15.392  -3.501  1.00 0.00 ? 3   ARG B HH21 4  
ATOM   6039  H  HH22 . ARG A 1 3   ? 1.265   16.060  -4.306  1.00 0.00 ? 3   ARG B HH22 4  
ATOM   6040  N  N    . GLY A 1 4   ? 5.189   11.341  -1.105  1.00 0.00 ? 4   GLY B N    4  
ATOM   6041  C  CA   . GLY A 1 4   ? 6.320   12.187  -0.767  1.00 0.00 ? 4   GLY B CA   4  
ATOM   6042  C  C    . GLY A 1 4   ? 5.917   13.609  -0.427  1.00 0.00 ? 4   GLY B C    4  
ATOM   6043  O  O    . GLY A 1 4   ? 6.613   14.289  0.326   1.00 0.00 ? 4   GLY B O    4  
ATOM   6044  H  H    . GLY A 1 4   ? 5.109   10.976  -2.012  1.00 0.00 ? 4   GLY B H    4  
ATOM   6045  H  HA2  . GLY A 1 4   ? 6.831   11.759  0.082   1.00 0.00 ? 4   GLY B HA2  4  
ATOM   6046  H  HA3  . GLY A 1 4   ? 7.000   12.210  -1.607  1.00 0.00 ? 4   GLY B HA3  4  
ATOM   6047  N  N    . LYS A 1 5   ? 4.796   14.059  -0.984  1.00 0.00 ? 5   LYS B N    4  
ATOM   6048  C  CA   . LYS A 1 5   ? 4.306   15.412  -0.736  1.00 0.00 ? 5   LYS B CA   4  
ATOM   6049  C  C    . LYS A 1 5   ? 5.374   16.449  -1.078  1.00 0.00 ? 5   LYS B C    4  
ATOM   6050  O  O    . LYS A 1 5   ? 6.072   16.951  -0.196  1.00 0.00 ? 5   LYS B O    4  
ATOM   6051  C  CB   . LYS A 1 5   ? 3.871   15.565  0.726   1.00 0.00 ? 5   LYS B CB   4  
ATOM   6052  C  CG   . LYS A 1 5   ? 3.356   16.954  1.075   1.00 0.00 ? 5   LYS B CG   4  
ATOM   6053  C  CD   . LYS A 1 5   ? 2.061   17.278  0.343   1.00 0.00 ? 5   LYS B CD   4  
ATOM   6054  C  CE   . LYS A 1 5   ? 0.909   16.414  0.836   1.00 0.00 ? 5   LYS B CE   4  
ATOM   6055  N  NZ   . LYS A 1 5   ? -0.362  16.730  0.127   1.00 0.00 ? 5   LYS B NZ   4  
ATOM   6056  H  H    . LYS A 1 5   ? 4.285   13.467  -1.576  1.00 0.00 ? 5   LYS B H    4  
ATOM   6057  H  HA   . LYS A 1 5   ? 3.449   15.574  -1.374  1.00 0.00 ? 5   LYS B HA   4  
ATOM   6058  H  HB2  . LYS A 1 5   ? 3.087   14.851  0.932   1.00 0.00 ? 5   LYS B HB2  4  
ATOM   6059  H  HB3  . LYS A 1 5   ? 4.717   15.348  1.364   1.00 0.00 ? 5   LYS B HB3  4  
ATOM   6060  H  HG2  . LYS A 1 5   ? 3.177   17.004  2.138   1.00 0.00 ? 5   LYS B HG2  4  
ATOM   6061  H  HG3  . LYS A 1 5   ? 4.104   17.683  0.799   1.00 0.00 ? 5   LYS B HG3  4  
ATOM   6062  H  HD2  . LYS A 1 5   ? 1.815   18.316  0.509   1.00 0.00 ? 5   LYS B HD2  4  
ATOM   6063  H  HD3  . LYS A 1 5   ? 2.203   17.104  -0.714  1.00 0.00 ? 5   LYS B HD3  4  
ATOM   6064  H  HE2  . LYS A 1 5   ? 1.156   15.377  0.668   1.00 0.00 ? 5   LYS B HE2  4  
ATOM   6065  H  HE3  . LYS A 1 5   ? 0.774   16.586  1.894   1.00 0.00 ? 5   LYS B HE3  4  
ATOM   6066  H  HZ1  . LYS A 1 5   ? -0.246  16.586  -0.896  1.00 0.00 ? 5   LYS B HZ1  4  
ATOM   6067  H  HZ2  . LYS A 1 5   ? -0.631  17.719  0.299   1.00 0.00 ? 5   LYS B HZ2  4  
ATOM   6068  H  HZ3  . LYS A 1 5   ? -1.124  16.110  0.470   1.00 0.00 ? 5   LYS B HZ3  4  
ATOM   6069  N  N    . GLY A 1 6   ? 5.498   16.760  -2.365  1.00 0.00 ? 6   GLY B N    4  
ATOM   6070  C  CA   . GLY A 1 6   ? 6.481   17.734  -2.804  1.00 0.00 ? 6   GLY B CA   4  
ATOM   6071  C  C    . GLY A 1 6   ? 7.903   17.313  -2.484  1.00 0.00 ? 6   GLY B C    4  
ATOM   6072  O  O    . GLY A 1 6   ? 8.540   16.609  -3.269  1.00 0.00 ? 6   GLY B O    4  
ATOM   6073  H  H    . GLY A 1 6   ? 4.915   16.325  -3.022  1.00 0.00 ? 6   GLY B H    4  
ATOM   6074  H  HA2  . GLY A 1 6   ? 6.389   17.865  -3.872  1.00 0.00 ? 6   GLY B HA2  4  
ATOM   6075  H  HA3  . GLY A 1 6   ? 6.279   18.677  -2.318  1.00 0.00 ? 6   GLY B HA3  4  
ATOM   6076  N  N    . GLY A 1 7   ? 8.400   17.747  -1.330  1.00 0.00 ? 7   GLY B N    4  
ATOM   6077  C  CA   . GLY A 1 7   ? 9.753   17.407  -0.928  1.00 0.00 ? 7   GLY B CA   4  
ATOM   6078  C  C    . GLY A 1 7   ? 10.752  18.485  -1.300  1.00 0.00 ? 7   GLY B C    4  
ATOM   6079  O  O    . GLY A 1 7   ? 11.173  18.578  -2.454  1.00 0.00 ? 7   GLY B O    4  
ATOM   6080  H  H    . GLY A 1 7   ? 7.844   18.302  -0.745  1.00 0.00 ? 7   GLY B H    4  
ATOM   6081  H  HA2  . GLY A 1 7   ? 9.775   17.264  0.142   1.00 0.00 ? 7   GLY B HA2  4  
ATOM   6082  H  HA3  . GLY A 1 7   ? 10.040  16.484  -1.410  1.00 0.00 ? 7   GLY B HA3  4  
ATOM   6083  N  N    . LYS A 1 8   ? 11.132  19.301  -0.322  1.00 0.00 ? 8   LYS B N    4  
ATOM   6084  C  CA   . LYS A 1 8   ? 12.084  20.381  -0.557  1.00 0.00 ? 8   LYS B CA   4  
ATOM   6085  C  C    . LYS A 1 8   ? 13.335  20.208  0.299   1.00 0.00 ? 8   LYS B C    4  
ATOM   6086  O  O    . LYS A 1 8   ? 14.418  20.663  -0.071  1.00 0.00 ? 8   LYS B O    4  
ATOM   6087  C  CB   . LYS A 1 8   ? 11.431  21.734  -0.265  1.00 0.00 ? 8   LYS B CB   4  
ATOM   6088  C  CG   . LYS A 1 8   ? 12.296  22.924  -0.641  1.00 0.00 ? 8   LYS B CG   4  
ATOM   6089  C  CD   . LYS A 1 8   ? 11.571  24.238  -0.398  1.00 0.00 ? 8   LYS B CD   4  
ATOM   6090  C  CE   . LYS A 1 8   ? 12.398  25.426  -0.861  1.00 0.00 ? 8   LYS B CE   4  
ATOM   6091  N  NZ   . LYS A 1 8   ? 13.736  25.458  -0.208  1.00 0.00 ? 8   LYS B NZ   4  
ATOM   6092  H  H    . LYS A 1 8   ? 10.764  19.174  0.578   1.00 0.00 ? 8   LYS B H    4  
ATOM   6093  H  HA   . LYS A 1 8   ? 12.369  20.349  -1.597  1.00 0.00 ? 8   LYS B HA   4  
ATOM   6094  H  HB2  . LYS A 1 8   ? 10.505  21.800  -0.817  1.00 0.00 ? 8   LYS B HB2  4  
ATOM   6095  H  HB3  . LYS A 1 8   ? 11.213  21.794  0.792   1.00 0.00 ? 8   LYS B HB3  4  
ATOM   6096  H  HG2  . LYS A 1 8   ? 13.196  22.906  -0.045  1.00 0.00 ? 8   LYS B HG2  4  
ATOM   6097  H  HG3  . LYS A 1 8   ? 12.554  22.852  -1.688  1.00 0.00 ? 8   LYS B HG3  4  
ATOM   6098  H  HD2  . LYS A 1 8   ? 10.638  24.228  -0.944  1.00 0.00 ? 8   LYS B HD2  4  
ATOM   6099  H  HD3  . LYS A 1 8   ? 11.371  24.338  0.658   1.00 0.00 ? 8   LYS B HD3  4  
ATOM   6100  H  HE2  . LYS A 1 8   ? 12.531  25.362  -1.931  1.00 0.00 ? 8   LYS B HE2  4  
ATOM   6101  H  HE3  . LYS A 1 8   ? 11.867  26.334  -0.618  1.00 0.00 ? 8   LYS B HE3  4  
ATOM   6102  H  HZ1  . LYS A 1 8   ? 13.629  25.473  0.827   1.00 0.00 ? 8   LYS B HZ1  4  
ATOM   6103  H  HZ2  . LYS A 1 8   ? 14.257  26.309  -0.504  1.00 0.00 ? 8   LYS B HZ2  4  
ATOM   6104  H  HZ3  . LYS A 1 8   ? 14.286  24.618  -0.478  1.00 0.00 ? 8   LYS B HZ3  4  
ATOM   6105  N  N    . GLY A 1 9   ? 13.183  19.547  1.444   1.00 0.00 ? 9   GLY B N    4  
ATOM   6106  C  CA   . GLY A 1 9   ? 14.317  19.332  2.327   1.00 0.00 ? 9   GLY B CA   4  
ATOM   6107  C  C    . GLY A 1 9   ? 13.940  18.612  3.608   1.00 0.00 ? 9   GLY B C    4  
ATOM   6108  O  O    . GLY A 1 9   ? 13.271  19.180  4.472   1.00 0.00 ? 9   GLY B O    4  
ATOM   6109  H  H    . GLY A 1 9   ? 12.299  19.205  1.691   1.00 0.00 ? 9   GLY B H    4  
ATOM   6110  H  HA2  . GLY A 1 9   ? 15.057  18.745  1.805   1.00 0.00 ? 9   GLY B HA2  4  
ATOM   6111  H  HA3  . GLY A 1 9   ? 14.746  20.290  2.580   1.00 0.00 ? 9   GLY B HA3  4  
ATOM   6112  N  N    . LEU A 1 10  ? 14.380  17.360  3.727   1.00 0.00 ? 10  LEU B N    4  
ATOM   6113  C  CA   . LEU A 1 10  ? 14.103  16.542  4.908   1.00 0.00 ? 10  LEU B CA   4  
ATOM   6114  C  C    . LEU A 1 10  ? 12.604  16.319  5.097   1.00 0.00 ? 10  LEU B C    4  
ATOM   6115  O  O    . LEU A 1 10  ? 11.849  17.259  5.339   1.00 0.00 ? 10  LEU B O    4  
ATOM   6116  C  CB   . LEU A 1 10  ? 14.697  17.191  6.162   1.00 0.00 ? 10  LEU B CB   4  
ATOM   6117  C  CG   . LEU A 1 10  ? 14.555  16.372  7.449   1.00 0.00 ? 10  LEU B CG   4  
ATOM   6118  C  CD1  . LEU A 1 10  ? 15.355  15.082  7.355   1.00 0.00 ? 10  LEU B CD1  4  
ATOM   6119  C  CD2  . LEU A 1 10  ? 14.999  17.191  8.651   1.00 0.00 ? 10  LEU B CD2  4  
ATOM   6120  H  H    . LEU A 1 10  ? 14.906  16.973  2.997   1.00 0.00 ? 10  LEU B H    4  
ATOM   6121  H  HA   . LEU A 1 10  ? 14.576  15.583  4.757   1.00 0.00 ? 10  LEU B HA   4  
ATOM   6122  H  HB2  . LEU A 1 10  ? 15.749  17.367  5.987   1.00 0.00 ? 10  LEU B HB2  4  
ATOM   6123  H  HB3  . LEU A 1 10  ? 14.211  18.144  6.314   1.00 0.00 ? 10  LEU B HB3  4  
ATOM   6124  H  HG   . LEU A 1 10  ? 13.515  16.110  7.586   1.00 0.00 ? 10  LEU B HG   4  
ATOM   6125  H  HD11 . LEU A 1 10  ? 15.011  14.505  6.509   1.00 0.00 ? 10  LEU B HD11 4  
ATOM   6126  H  HD12 . LEU A 1 10  ? 15.221  14.508  8.261   1.00 0.00 ? 10  LEU B HD12 4  
ATOM   6127  H  HD13 . LEU A 1 10  ? 16.402  15.316  7.229   1.00 0.00 ? 10  LEU B HD13 4  
ATOM   6128  H  HD21 . LEU A 1 10  ? 16.025  17.501  8.517   1.00 0.00 ? 10  LEU B HD21 4  
ATOM   6129  H  HD22 . LEU A 1 10  ? 14.918  16.589  9.545   1.00 0.00 ? 10  LEU B HD22 4  
ATOM   6130  H  HD23 . LEU A 1 10  ? 14.369  18.061  8.748   1.00 0.00 ? 10  LEU B HD23 4  
ATOM   6131  N  N    . GLY A 1 11  ? 12.185  15.060  4.991   1.00 0.00 ? 11  GLY B N    4  
ATOM   6132  C  CA   . GLY A 1 11  ? 10.782  14.727  5.156   1.00 0.00 ? 11  GLY B CA   4  
ATOM   6133  C  C    . GLY A 1 11  ? 10.526  13.919  6.413   1.00 0.00 ? 11  GLY B C    4  
ATOM   6134  O  O    . GLY A 1 11  ? 11.081  12.832  6.583   1.00 0.00 ? 11  GLY B O    4  
ATOM   6135  H  H    . GLY A 1 11  ? 12.835  14.352  4.797   1.00 0.00 ? 11  GLY B H    4  
ATOM   6136  H  HA2  . GLY A 1 11  ? 10.208  15.641  5.204   1.00 0.00 ? 11  GLY B HA2  4  
ATOM   6137  H  HA3  . GLY A 1 11  ? 10.456  14.154  4.299   1.00 0.00 ? 11  GLY B HA3  4  
ATOM   6138  N  N    . LYS A 1 12  ? 9.685   14.450  7.295   1.00 0.00 ? 12  LYS B N    4  
ATOM   6139  C  CA   . LYS A 1 12  ? 9.360   13.772  8.546   1.00 0.00 ? 12  LYS B CA   4  
ATOM   6140  C  C    . LYS A 1 12  ? 8.091   14.351  9.168   1.00 0.00 ? 12  LYS B C    4  
ATOM   6141  O  O    . LYS A 1 12  ? 8.101   15.463  9.698   1.00 0.00 ? 12  LYS B O    4  
ATOM   6142  C  CB   . LYS A 1 12  ? 10.526  13.892  9.531   1.00 0.00 ? 12  LYS B CB   4  
ATOM   6143  C  CG   . LYS A 1 12  ? 10.259  13.243  10.879  1.00 0.00 ? 12  LYS B CG   4  
ATOM   6144  C  CD   . LYS A 1 12  ? 11.414  13.459  11.845  1.00 0.00 ? 12  LYS B CD   4  
ATOM   6145  C  CE   . LYS A 1 12  ? 12.665  12.716  11.400  1.00 0.00 ? 12  LYS B CE   4  
ATOM   6146  N  NZ   . LYS A 1 12  ? 13.805  12.945  12.329  1.00 0.00 ? 12  LYS B NZ   4  
ATOM   6147  H  H    . LYS A 1 12  ? 9.274   15.317  7.101   1.00 0.00 ? 12  LYS B H    4  
ATOM   6148  H  HA   . LYS A 1 12  ? 9.194   12.729  8.324   1.00 0.00 ? 12  LYS B HA   4  
ATOM   6149  H  HB2  . LYS A 1 12  ? 11.397  13.423  9.096   1.00 0.00 ? 12  LYS B HB2  4  
ATOM   6150  H  HB3  . LYS A 1 12  ? 10.738  14.939  9.694   1.00 0.00 ? 12  LYS B HB3  4  
ATOM   6151  H  HG2  . LYS A 1 12  ? 9.364   13.673  11.304  1.00 0.00 ? 12  LYS B HG2  4  
ATOM   6152  H  HG3  . LYS A 1 12  ? 10.116  12.182  10.734  1.00 0.00 ? 12  LYS B HG3  4  
ATOM   6153  H  HD2  . LYS A 1 12  ? 11.636  14.515  11.896  1.00 0.00 ? 12  LYS B HD2  4  
ATOM   6154  H  HD3  . LYS A 1 12  ? 11.123  13.104  12.824  1.00 0.00 ? 12  LYS B HD3  4  
ATOM   6155  H  HE2  . LYS A 1 12  ? 12.447  11.659  11.367  1.00 0.00 ? 12  LYS B HE2  4  
ATOM   6156  H  HE3  . LYS A 1 12  ? 12.939  13.057  10.414  1.00 0.00 ? 12  LYS B HE3  4  
ATOM   6157  H  HZ1  . LYS A 1 12  ? 14.654  12.451  11.982  1.00 0.00 ? 12  LYS B HZ1  4  
ATOM   6158  H  HZ2  . LYS A 1 12  ? 13.574  12.586  13.277  1.00 0.00 ? 12  LYS B HZ2  4  
ATOM   6159  H  HZ3  . LYS A 1 12  ? 14.012  13.961  12.397  1.00 0.00 ? 12  LYS B HZ3  4  
ATOM   6160  N  N    . GLY A 1 13  ? 7.002   13.592  9.097   1.00 0.00 ? 13  GLY B N    4  
ATOM   6161  C  CA   . GLY A 1 13  ? 5.743   14.044  9.661   1.00 0.00 ? 13  GLY B CA   4  
ATOM   6162  C  C    . GLY A 1 13  ? 4.678   14.272  8.606   1.00 0.00 ? 13  GLY B C    4  
ATOM   6163  O  O    . GLY A 1 13  ? 4.985   14.384  7.418   1.00 0.00 ? 13  GLY B O    4  
ATOM   6164  H  H    . GLY A 1 13  ? 7.053   12.718  8.658   1.00 0.00 ? 13  GLY B H    4  
ATOM   6165  H  HA2  . GLY A 1 13  ? 5.386   13.301  10.359  1.00 0.00 ? 13  GLY B HA2  4  
ATOM   6166  H  HA3  . GLY A 1 13  ? 5.910   14.969  10.193  1.00 0.00 ? 13  GLY B HA3  4  
ATOM   6167  N  N    . GLY A 1 14  ? 3.423   14.342  9.041   1.00 0.00 ? 14  GLY B N    4  
ATOM   6168  C  CA   . GLY A 1 14  ? 2.326   14.559  8.117   1.00 0.00 ? 14  GLY B CA   4  
ATOM   6169  C  C    . GLY A 1 14  ? 1.943   13.302  7.361   1.00 0.00 ? 14  GLY B C    4  
ATOM   6170  O  O    . GLY A 1 14  ? 0.981   12.622  7.721   1.00 0.00 ? 14  GLY B O    4  
ATOM   6171  H  H    . GLY A 1 14  ? 3.241   14.243  10.000  1.00 0.00 ? 14  GLY B H    4  
ATOM   6172  H  HA2  . GLY A 1 14  ? 1.466   14.907  8.673   1.00 0.00 ? 14  GLY B HA2  4  
ATOM   6173  H  HA3  . GLY A 1 14  ? 2.613   15.320  7.407   1.00 0.00 ? 14  GLY B HA3  4  
ATOM   6174  N  N    . ALA A 1 15  ? 2.698   12.993  6.311   1.00 0.00 ? 15  ALA B N    4  
ATOM   6175  C  CA   . ALA A 1 15  ? 2.435   11.812  5.500   1.00 0.00 ? 15  ALA B CA   4  
ATOM   6176  C  C    . ALA A 1 15  ? 2.541   10.539  6.332   1.00 0.00 ? 15  ALA B C    4  
ATOM   6177  O  O    . ALA A 1 15  ? 3.639   10.061  6.617   1.00 0.00 ? 15  ALA B O    4  
ATOM   6178  C  CB   . ALA A 1 15  ? 3.394   11.757  4.321   1.00 0.00 ? 15  ALA B CB   4  
ATOM   6179  H  H    . ALA A 1 15  ? 3.451   13.576  6.076   1.00 0.00 ? 15  ALA B H    4  
ATOM   6180  H  HA   . ALA A 1 15  ? 1.429   11.892  5.111   1.00 0.00 ? 15  ALA B HA   4  
ATOM   6181  H  HB1  . ALA A 1 15  ? 3.308   12.666  3.745   1.00 0.00 ? 15  ALA B HB1  4  
ATOM   6182  H  HB2  . ALA A 1 15  ? 3.149   10.911  3.696   1.00 0.00 ? 15  ALA B HB2  4  
ATOM   6183  H  HB3  . ALA A 1 15  ? 4.406   11.655  4.685   1.00 0.00 ? 15  ALA B HB3  4  
ATOM   6184  N  N    . LYS A 1 16  ? 1.391   9.996   6.720   1.00 0.00 ? 16  LYS B N    4  
ATOM   6185  C  CA   . LYS A 1 16  ? 1.353   8.778   7.521   1.00 0.00 ? 16  LYS B CA   4  
ATOM   6186  C  C    . LYS A 1 16  ? 1.644   7.553   6.660   1.00 0.00 ? 16  LYS B C    4  
ATOM   6187  O  O    . LYS A 1 16  ? 2.037   7.680   5.499   1.00 0.00 ? 16  LYS B O    4  
ATOM   6188  C  CB   . LYS A 1 16  ? -0.011  8.631   8.197   1.00 0.00 ? 16  LYS B CB   4  
ATOM   6189  C  CG   . LYS A 1 16  ? -1.170  8.534   7.217   1.00 0.00 ? 16  LYS B CG   4  
ATOM   6190  C  CD   . LYS A 1 16  ? -2.508  8.468   7.936   1.00 0.00 ? 16  LYS B CD   4  
ATOM   6191  C  CE   . LYS A 1 16  ? -2.854  9.792   8.601   1.00 0.00 ? 16  LYS B CE   4  
ATOM   6192  N  NZ   . LYS A 1 16  ? -2.956  10.900  7.612   1.00 0.00 ? 16  LYS B NZ   4  
ATOM   6193  H  H    . LYS A 1 16  ? 0.549   10.424  6.461   1.00 0.00 ? 16  LYS B H    4  
ATOM   6194  H  HA   . LYS A 1 16  ? 2.116   8.858   8.281   1.00 0.00 ? 16  LYS B HA   4  
ATOM   6195  H  HB2  . LYS A 1 16  ? -0.005  7.738   8.804   1.00 0.00 ? 16  LYS B HB2  4  
ATOM   6196  H  HB3  . LYS A 1 16  ? -0.178  9.488   8.835   1.00 0.00 ? 16  LYS B HB3  4  
ATOM   6197  H  HG2  . LYS A 1 16  ? -1.160  9.402   6.577   1.00 0.00 ? 16  LYS B HG2  4  
ATOM   6198  H  HG3  . LYS A 1 16  ? -1.047  7.642   6.620   1.00 0.00 ? 16  LYS B HG3  4  
ATOM   6199  H  HD2  . LYS A 1 16  ? -3.279  8.226   7.220   1.00 0.00 ? 16  LYS B HD2  4  
ATOM   6200  H  HD3  . LYS A 1 16  ? -2.463  7.697   8.692   1.00 0.00 ? 16  LYS B HD3  4  
ATOM   6201  H  HE2  . LYS A 1 16  ? -3.799  9.689   9.112   1.00 0.00 ? 16  LYS B HE2  4  
ATOM   6202  H  HE3  . LYS A 1 16  ? -2.083  10.031  9.319   1.00 0.00 ? 16  LYS B HE3  4  
ATOM   6203  H  HZ1  . LYS A 1 16  ? -3.188  11.791  8.096   1.00 0.00 ? 16  LYS B HZ1  4  
ATOM   6204  H  HZ2  . LYS A 1 16  ? -3.702  10.692  6.917   1.00 0.00 ? 16  LYS B HZ2  4  
ATOM   6205  H  HZ3  . LYS A 1 16  ? -2.053  11.015  7.110   1.00 0.00 ? 16  LYS B HZ3  4  
ATOM   6206  N  N    . ARG A 1 17  ? 1.450   6.371   7.232   1.00 0.00 ? 17  ARG B N    4  
ATOM   6207  C  CA   . ARG A 1 17  ? 1.691   5.125   6.512   1.00 0.00 ? 17  ARG B CA   4  
ATOM   6208  C  C    . ARG A 1 17  ? 0.850   5.052   5.244   1.00 0.00 ? 17  ARG B C    4  
ATOM   6209  O  O    . ARG A 1 17  ? -0.380  5.060   5.304   1.00 0.00 ? 17  ARG B O    4  
ATOM   6210  C  CB   . ARG A 1 17  ? 1.375   3.920   7.404   1.00 0.00 ? 17  ARG B CB   4  
ATOM   6211  C  CG   . ARG A 1 17  ? 1.251   2.610   6.637   1.00 0.00 ? 17  ARG B CG   4  
ATOM   6212  C  CD   . ARG A 1 17  ? 0.782   1.474   7.530   1.00 0.00 ? 17  ARG B CD   4  
ATOM   6213  N  NE   . ARG A 1 17  ? -0.395  1.841   8.312   1.00 0.00 ? 17  ARG B NE   4  
ATOM   6214  C  CZ   . ARG A 1 17  ? -1.363  0.988   8.635   1.00 0.00 ? 17  ARG B CZ   4  
ATOM   6215  N  NH1  . ARG A 1 17  ? -1.308  -0.272  8.222   1.00 0.00 ? 17  ARG B NH1  4  
ATOM   6216  N  NH2  . ARG A 1 17  ? -2.391  1.399   9.366   1.00 0.00 ? 17  ARG B NH2  4  
ATOM   6217  H  H    . ARG A 1 17  ? 1.137   6.334   8.160   1.00 0.00 ? 17  ARG B H    4  
ATOM   6218  H  HA   . ARG A 1 17  ? 2.736   5.096   6.241   1.00 0.00 ? 17  ARG B HA   4  
ATOM   6219  H  HB2  . ARG A 1 17  ? 2.163   3.810   8.135   1.00 0.00 ? 17  ARG B HB2  4  
ATOM   6220  H  HB3  . ARG A 1 17  ? 0.443   4.100   7.920   1.00 0.00 ? 17  ARG B HB3  4  
ATOM   6221  H  HG2  . ARG A 1 17  ? 0.536   2.740   5.838   1.00 0.00 ? 17  ARG B HG2  4  
ATOM   6222  H  HG3  . ARG A 1 17  ? 2.215   2.356   6.220   1.00 0.00 ? 17  ARG B HG3  4  
ATOM   6223  H  HD2  . ARG A 1 17  ? 0.540   0.624   6.912   1.00 0.00 ? 17  ARG B HD2  4  
ATOM   6224  H  HD3  . ARG A 1 17  ? 1.584   1.210   8.205   1.00 0.00 ? 17  ARG B HD3  4  
ATOM   6225  H  HE   . ARG A 1 17  ? -0.465  2.769   8.618   1.00 0.00 ? 17  ARG B HE   4  
ATOM   6226  H  HH11 . ARG A 1 17  ? -0.537  -0.584  7.667   1.00 0.00 ? 17  ARG B HH11 4  
ATOM   6227  H  HH12 . ARG A 1 17  ? -2.037  -0.911  8.468   1.00 0.00 ? 17  ARG B HH12 4  
ATOM   6228  H  HH21 . ARG A 1 17  ? -2.436  2.349   9.673   1.00 0.00 ? 17  ARG B HH21 4  
ATOM   6229  H  HH22 . ARG A 1 17  ? -3.118  0.759   9.610   1.00 0.00 ? 17  ARG B HH22 4  
ATOM   6230  N  N    . HIS A 1 18  ? 1.520   4.985   4.096   1.00 0.00 ? 18  HIS B N    4  
ATOM   6231  C  CA   . HIS A 1 18  ? 0.828   4.885   2.818   1.00 0.00 ? 18  HIS B CA   4  
ATOM   6232  C  C    . HIS A 1 18  ? -0.143  6.038   2.616   1.00 0.00 ? 18  HIS B C    4  
ATOM   6233  O  O    . HIS A 1 18  ? -0.053  7.064   3.290   1.00 0.00 ? 18  HIS B O    4  
ATOM   6234  C  CB   . HIS A 1 18  ? 0.098   3.547   2.738   1.00 0.00 ? 18  HIS B CB   4  
ATOM   6235  C  CG   . HIS A 1 18  ? 0.160   2.930   1.385   1.00 0.00 ? 18  HIS B CG   4  
ATOM   6236  N  ND1  . HIS A 1 18  ? 1.335   2.596   0.755   1.00 0.00 ? 18  HIS B ND1  4  
ATOM   6237  C  CD2  . HIS A 1 18  ? -0.820  2.635   0.517   1.00 0.00 ? 18  HIS B CD2  4  
ATOM   6238  C  CE1  . HIS A 1 18  ? 1.064   2.132   -0.444  1.00 0.00 ? 18  HIS B CE1  4  
ATOM   6239  N  NE2  . HIS A 1 18  ? -0.237  2.140   -0.612  1.00 0.00 ? 18  HIS B NE2  4  
ATOM   6240  H  H    . HIS A 1 18  ? 2.499   5.003   4.111   1.00 0.00 ? 18  HIS B H    4  
ATOM   6241  H  HA   . HIS A 1 18  ? 1.557   4.926   2.023   1.00 0.00 ? 18  HIS B HA   4  
ATOM   6242  H  HB2  . HIS A 1 18  ? 0.537   2.858   3.443   1.00 0.00 ? 18  HIS B HB2  4  
ATOM   6243  H  HB3  . HIS A 1 18  ? -0.942  3.701   2.985   1.00 0.00 ? 18  HIS B HB3  4  
ATOM   6244  H  HD1  . HIS A 1 18  ? 2.235   2.688   1.132   1.00 0.00 ? 18  HIS B HD1  4  
ATOM   6245  H  HD2  . HIS A 1 18  ? -1.864  2.815   0.664   1.00 0.00 ? 18  HIS B HD2  4  
ATOM   6246  H  HE1  . HIS A 1 18  ? 1.780   1.820   -1.171  1.00 0.00 ? 18  HIS B HE1  4  
ATOM   6247  H  HE2  . HIS A 1 18  ? -0.699  1.956   -1.456  1.00 0.00 ? 18  HIS B HE2  4  
ATOM   6248  N  N    . ARG A 1 19  ? -1.066  5.850   1.678   1.00 0.00 ? 19  ARG B N    4  
ATOM   6249  C  CA   . ARG A 1 19  ? -2.051  6.868   1.337   1.00 0.00 ? 19  ARG B CA   4  
ATOM   6250  C  C    . ARG A 1 19  ? -1.368  8.105   0.742   1.00 0.00 ? 19  ARG B C    4  
ATOM   6251  O  O    . ARG A 1 19  ? -0.284  8.492   1.175   1.00 0.00 ? 19  ARG B O    4  
ATOM   6252  C  CB   . ARG A 1 19  ? -2.819  7.245   2.570   1.00 0.00 ? 19  ARG B CB   4  
ATOM   6253  C  CG   . ARG A 1 19  ? -4.094  8.011   2.293   1.00 0.00 ? 19  ARG B CG   4  
ATOM   6254  C  CD   . ARG A 1 19  ? -3.828  9.477   2.032   1.00 0.00 ? 19  ARG B CD   4  
ATOM   6255  N  NE   . ARG A 1 19  ? -5.029  10.292  2.204   1.00 0.00 ? 19  ARG B NE   4  
ATOM   6256  C  CZ   . ARG A 1 19  ? -5.607  10.518  3.382   1.00 0.00 ? 19  ARG B CZ   4  
ATOM   6257  N  NH1  . ARG A 1 19  ? -5.106  9.982   4.490   1.00 0.00 ? 19  ARG B NH1  4  
ATOM   6258  N  NH2  . ARG A 1 19  ? -6.691  11.280  3.453   1.00 0.00 ? 19  ARG B NH2  4  
ATOM   6259  H  H    . ARG A 1 19  ? -1.091  4.994   1.208   1.00 0.00 ? 19  ARG B H    4  
ATOM   6260  H  HA   . ARG A 1 19  ? -2.729  6.451   0.608   1.00 0.00 ? 19  ARG B HA   4  
ATOM   6261  H  HB2  . ARG A 1 19  ? -3.066  6.351   3.122   1.00 0.00 ? 19  ARG B HB2  4  
ATOM   6262  H  HB3  . ARG A 1 19  ? -2.173  7.851   3.151   1.00 0.00 ? 19  ARG B HB3  4  
ATOM   6263  H  HG2  . ARG A 1 19  ? -4.555  7.592   1.421   1.00 0.00 ? 19  ARG B HG2  4  
ATOM   6264  H  HG3  . ARG A 1 19  ? -4.757  7.909   3.128   1.00 0.00 ? 19  ARG B HG3  4  
ATOM   6265  H  HD2  . ARG A 1 19  ? -3.065  9.822   2.713   1.00 0.00 ? 19  ARG B HD2  4  
ATOM   6266  H  HD3  . ARG A 1 19  ? -3.477  9.574   1.011   1.00 0.00 ? 19  ARG B HD3  4  
ATOM   6267  H  HE   . ARG A 1 19  ? -5.424  10.693  1.400   1.00 0.00 ? 19  ARG B HE   4  
ATOM   6268  H  HH11 . ARG A 1 19  ? -4.291  9.406   4.442   1.00 0.00 ? 19  ARG B HH11 4  
ATOM   6269  H  HH12 . ARG A 1 19  ? -5.544  10.157  5.373   1.00 0.00 ? 19  ARG B HH12 4  
ATOM   6270  H  HH21 . ARG A 1 19  ? -7.073  11.684  2.623   1.00 0.00 ? 19  ARG B HH21 4  
ATOM   6271  H  HH22 . ARG A 1 19  ? -7.124  11.451  4.339   1.00 0.00 ? 19  ARG B HH22 4  
ATOM   6272  N  N    . LYS A 1 20  ? -2.005  8.724   -0.254  1.00 0.00 ? 20  LYS B N    4  
ATOM   6273  C  CA   . LYS A 1 20  ? -1.437  9.911   -0.898  1.00 0.00 ? 20  LYS B CA   4  
ATOM   6274  C  C    . LYS A 1 20  ? -1.855  11.205  -0.194  1.00 0.00 ? 20  LYS B C    4  
ATOM   6275  O  O    . LYS A 1 20  ? -1.659  11.294  1.036   1.00 0.00 ? 20  LYS B O    4  
ATOM   6276  C  CB   . LYS A 1 20  ? -1.790  9.937   -2.405  1.00 0.00 ? 20  LYS B CB   4  
ATOM   6277  C  CG   . LYS A 1 20  ? -3.254  10.115  -2.805  1.00 0.00 ? 20  LYS B CG   4  
ATOM   6278  C  CD   . LYS A 1 20  ? -4.248  10.070  -1.662  1.00 0.00 ? 20  LYS B CD   4  
ATOM   6279  C  CE   . LYS A 1 20  ? -4.860  8.709   -1.536  1.00 0.00 ? 20  LYS B CE   4  
ATOM   6280  N  NZ   . LYS A 1 20  ? -5.668  8.607   -0.298  1.00 0.00 ? 20  LYS B NZ   4  
ATOM   6281  O  OXT  . LYS A 1 20  ? -2.356  12.123  -0.878  1.00 0.00 ? 20  LYS B OXT  4  
ATOM   6282  H  H    . LYS A 1 20  ? -2.865  8.376   -0.560  1.00 0.00 ? 20  LYS B H    4  
ATOM   6283  H  HA   . LYS A 1 20  ? -0.364  9.825   -0.810  1.00 0.00 ? 20  LYS B HA   4  
ATOM   6284  H  HB2  . LYS A 1 20  ? -1.259  10.743  -2.861  1.00 0.00 ? 20  LYS B HB2  4  
ATOM   6285  H  HB3  . LYS A 1 20  ? -1.442  9.013   -2.843  1.00 0.00 ? 20  LYS B HB3  4  
ATOM   6286  H  HG2  . LYS A 1 20  ? -3.361  11.062  -3.307  1.00 0.00 ? 20  LYS B HG2  4  
ATOM   6287  H  HG3  . LYS A 1 20  ? -3.494  9.324   -3.494  1.00 0.00 ? 20  LYS B HG3  4  
ATOM   6288  H  HD2  . LYS A 1 20  ? -3.763  10.324  -0.739  1.00 0.00 ? 20  LYS B HD2  4  
ATOM   6289  H  HD3  . LYS A 1 20  ? -5.034  10.771  -1.862  1.00 0.00 ? 20  LYS B HD3  4  
ATOM   6290  H  HE2  . LYS A 1 20  ? -5.503  8.543   -2.387  1.00 0.00 ? 20  LYS B HE2  4  
ATOM   6291  H  HE3  . LYS A 1 20  ? -4.067  7.970   -1.532  1.00 0.00 ? 20  LYS B HE3  4  
ATOM   6292  H  HZ1  . LYS A 1 20  ? -5.234  7.935   0.353   1.00 0.00 ? 20  LYS B HZ1  4  
ATOM   6293  H  HZ2  . LYS A 1 20  ? -6.630  8.283   -0.523  1.00 0.00 ? 20  LYS B HZ2  4  
ATOM   6294  H  HZ3  . LYS A 1 20  ? -5.727  9.535   0.167   1.00 0.00 ? 20  LYS B HZ3  4  
ATOM   6295  N  N    . GLY B 2 1   ? 16.879  -0.460  -11.724 1.00 0.00 ? 259 GLY A N    4  
ATOM   6296  C  CA   . GLY B 2 1   ? 17.870  0.264   -10.882 1.00 0.00 ? 259 GLY A CA   4  
ATOM   6297  C  C    . GLY B 2 1   ? 17.214  1.070   -9.777  1.00 0.00 ? 259 GLY A C    4  
ATOM   6298  O  O    . GLY B 2 1   ? 17.601  2.210   -9.519  1.00 0.00 ? 259 GLY A O    4  
ATOM   6299  H  H1   . GLY B 2 1   ? 17.368  -1.001  -12.466 1.00 0.00 ? 259 GLY A H1   4  
ATOM   6300  H  H2   . GLY B 2 1   ? 16.229  0.216   -12.174 1.00 0.00 ? 259 GLY A H2   4  
ATOM   6301  H  H3   . GLY B 2 1   ? 16.325  -1.118  -11.138 1.00 0.00 ? 259 GLY A H3   4  
ATOM   6302  H  HA2  . GLY B 2 1   ? 18.542  -0.455  -10.438 1.00 0.00 ? 259 GLY A HA2  4  
ATOM   6303  H  HA3  . GLY B 2 1   ? 18.439  0.933   -11.512 1.00 0.00 ? 259 GLY A HA3  4  
ATOM   6304  N  N    . SER B 2 2   ? 16.219  0.475   -9.125  1.00 0.00 ? 260 SER A N    4  
ATOM   6305  C  CA   . SER B 2 2   ? 15.508  1.144   -8.042  1.00 0.00 ? 260 SER A CA   4  
ATOM   6306  C  C    . SER B 2 2   ? 15.982  0.674   -6.683  1.00 0.00 ? 260 SER A C    4  
ATOM   6307  O  O    . SER B 2 2   ? 16.956  -0.071  -6.564  1.00 0.00 ? 260 SER A O    4  
ATOM   6308  C  CB   . SER B 2 2   ? 14.014  0.904   -8.141  1.00 0.00 ? 260 SER A CB   4  
ATOM   6309  O  OG   . SER B 2 2   ? 13.456  1.583   -9.252  1.00 0.00 ? 260 SER A OG   4  
ATOM   6310  H  H    . SER B 2 2   ? 15.959  -0.435  -9.377  1.00 0.00 ? 260 SER A H    4  
ATOM   6311  H  HA   . SER B 2 2   ? 15.686  2.202   -8.117  1.00 0.00 ? 260 SER A HA   4  
ATOM   6312  H  HB2  . SER B 2 2   ? 13.825  -0.155  -8.246  1.00 0.00 ? 260 SER A HB2  4  
ATOM   6313  H  HB3  . SER B 2 2   ? 13.551  1.268   -7.233  1.00 0.00 ? 260 SER A HB3  4  
ATOM   6314  H  HG   . SER B 2 2   ? 13.761  2.493   -9.258  1.00 0.00 ? 260 SER A HG   4  
ATOM   6315  N  N    . TYR B 2 3   ? 15.266  1.121   -5.664  1.00 0.00 ? 261 TYR A N    4  
ATOM   6316  C  CA   . TYR B 2 3   ? 15.569  0.777   -4.290  1.00 0.00 ? 261 TYR A CA   4  
ATOM   6317  C  C    . TYR B 2 3   ? 14.529  1.372   -3.353  1.00 0.00 ? 261 TYR A C    4  
ATOM   6318  O  O    . TYR B 2 3   ? 13.759  2.253   -3.737  1.00 0.00 ? 261 TYR A O    4  
ATOM   6319  C  CB   . TYR B 2 3   ? 16.954  1.285   -3.907  1.00 0.00 ? 261 TYR A CB   4  
ATOM   6320  C  CG   . TYR B 2 3   ? 17.291  2.622   -4.507  1.00 0.00 ? 261 TYR A CG   4  
ATOM   6321  C  CD1  . TYR B 2 3   ? 16.497  3.703   -4.236  1.00 0.00 ? 261 TYR A CD1  4  
ATOM   6322  C  CD2  . TYR B 2 3   ? 18.393  2.797   -5.333  1.00 0.00 ? 261 TYR A CD2  4  
ATOM   6323  C  CE1  . TYR B 2 3   ? 16.769  4.943   -4.761  1.00 0.00 ? 261 TYR A CE1  4  
ATOM   6324  C  CE2  . TYR B 2 3   ? 18.683  4.036   -5.872  1.00 0.00 ? 261 TYR A CE2  4  
ATOM   6325  C  CZ   . TYR B 2 3   ? 17.866  5.110   -5.582  1.00 0.00 ? 261 TYR A CZ   4  
ATOM   6326  O  OH   . TYR B 2 3   ? 18.145  6.349   -6.111  1.00 0.00 ? 261 TYR A OH   4  
ATOM   6327  H  H    . TYR B 2 3   ? 14.501  1.706   -5.845  1.00 0.00 ? 261 TYR A H    4  
ATOM   6328  H  HA   . TYR B 2 3   ? 15.550  -0.297  -4.202  1.00 0.00 ? 261 TYR A HA   4  
ATOM   6329  H  HB2  . TYR B 2 3   ? 17.008  1.380   -2.837  1.00 0.00 ? 261 TYR A HB2  4  
ATOM   6330  H  HB3  . TYR B 2 3   ? 17.687  0.592   -4.229  1.00 0.00 ? 261 TYR A HB3  4  
ATOM   6331  H  HD1  . TYR B 2 3   ? 15.645  3.558   -3.593  1.00 0.00 ? 261 TYR A HD1  4  
ATOM   6332  H  HD2  . TYR B 2 3   ? 19.026  1.951   -5.555  1.00 0.00 ? 261 TYR A HD2  4  
ATOM   6333  H  HE1  . TYR B 2 3   ? 16.127  5.773   -4.526  1.00 0.00 ? 261 TYR A HE1  4  
ATOM   6334  H  HE2  . TYR B 2 3   ? 19.542  4.161   -6.514  1.00 0.00 ? 261 TYR A HE2  4  
ATOM   6335  H  HH   . TYR B 2 3   ? 18.358  6.258   -7.043  1.00 0.00 ? 261 TYR A HH   4  
ATOM   6336  N  N    . CYS B 2 4   ? 14.517  0.878   -2.130  1.00 0.00 ? 262 CYS A N    4  
ATOM   6337  C  CA   . CYS B 2 4   ? 13.581  1.346   -1.117  1.00 0.00 ? 262 CYS A CA   4  
ATOM   6338  C  C    . CYS B 2 4   ? 13.689  2.847   -0.930  1.00 0.00 ? 262 CYS A C    4  
ATOM   6339  O  O    . CYS B 2 4   ? 14.770  3.376   -0.716  1.00 0.00 ? 262 CYS A O    4  
ATOM   6340  C  CB   . CYS B 2 4   ? 13.860  0.636   0.193   1.00 0.00 ? 262 CYS A CB   4  
ATOM   6341  S  SG   . CYS B 2 4   ? 13.331  1.482   1.715   1.00 0.00 ? 262 CYS A SG   4  
ATOM   6342  H  H    . CYS B 2 4   ? 15.152  0.171   -1.904  1.00 0.00 ? 262 CYS A H    4  
ATOM   6343  H  HA   . CYS B 2 4   ? 12.584  1.085   -1.441  1.00 0.00 ? 262 CYS A HA   4  
ATOM   6344  H  HB2  . CYS B 2 4   ? 13.357  -0.315  0.179   1.00 0.00 ? 262 CYS A HB2  4  
ATOM   6345  H  HB3  . CYS B 2 4   ? 14.918  0.460   0.264   1.00 0.00 ? 262 CYS A HB3  4  
ATOM   6346  N  N    . ASP B 2 5   ? 12.566  3.527   -1.006  1.00 0.00 ? 263 ASP A N    4  
ATOM   6347  C  CA   . ASP B 2 5   ? 12.542  4.971   -0.842  1.00 0.00 ? 263 ASP A CA   4  
ATOM   6348  C  C    . ASP B 2 5   ? 12.864  5.362   0.600   1.00 0.00 ? 263 ASP A C    4  
ATOM   6349  O  O    . ASP B 2 5   ? 12.805  6.536   0.968   1.00 0.00 ? 263 ASP A O    4  
ATOM   6350  C  CB   . ASP B 2 5   ? 11.174  5.500   -1.225  1.00 0.00 ? 263 ASP A CB   4  
ATOM   6351  C  CG   . ASP B 2 5   ? 10.759  5.114   -2.628  1.00 0.00 ? 263 ASP A CG   4  
ATOM   6352  O  OD1  . ASP B 2 5   ? 11.494  5.449   -3.581  1.00 0.00 ? 263 ASP A OD1  4  
ATOM   6353  O  OD2  . ASP B 2 5   ? 9.695   4.473   -2.772  1.00 0.00 ? 263 ASP A OD2  4  
ATOM   6354  H  H    . ASP B 2 5   ? 11.731  3.049   -1.179  1.00 0.00 ? 263 ASP A H    4  
ATOM   6355  H  HA   . ASP B 2 5   ? 13.275  5.396   -1.496  1.00 0.00 ? 263 ASP A HA   4  
ATOM   6356  H  HB2  . ASP B 2 5   ? 10.467  5.083   -0.548  1.00 0.00 ? 263 ASP A HB2  4  
ATOM   6357  H  HB3  . ASP B 2 5   ? 11.166  6.577   -1.143  1.00 0.00 ? 263 ASP A HB3  4  
ATOM   6358  N  N    . PHE B 2 6   ? 13.202  4.362   1.408   1.00 0.00 ? 264 PHE A N    4  
ATOM   6359  C  CA   . PHE B 2 6   ? 13.525  4.573   2.818   1.00 0.00 ? 264 PHE A CA   4  
ATOM   6360  C  C    . PHE B 2 6   ? 14.998  4.251   3.118   1.00 0.00 ? 264 PHE A C    4  
ATOM   6361  O  O    . PHE B 2 6   ? 15.568  4.785   4.069   1.00 0.00 ? 264 PHE A O    4  
ATOM   6362  C  CB   . PHE B 2 6   ? 12.584  3.741   3.706   1.00 0.00 ? 264 PHE A CB   4  
ATOM   6363  C  CG   . PHE B 2 6   ? 11.127  3.980   3.417   1.00 0.00 ? 264 PHE A CG   4  
ATOM   6364  C  CD1  . PHE B 2 6   ? 10.537  3.427   2.293   1.00 0.00 ? 264 PHE A CD1  4  
ATOM   6365  C  CD2  . PHE B 2 6   ? 10.350  4.755   4.265   1.00 0.00 ? 264 PHE A CD2  4  
ATOM   6366  C  CE1  . PHE B 2 6   ? 9.200   3.638   2.018   1.00 0.00 ? 264 PHE A CE1  4  
ATOM   6367  C  CE2  . PHE B 2 6   ? 9.010   4.970   3.994   1.00 0.00 ? 264 PHE A CE2  4  
ATOM   6368  C  CZ   . PHE B 2 6   ? 8.435   4.411   2.867   1.00 0.00 ? 264 PHE A CZ   4  
ATOM   6369  H  H    . PHE B 2 6   ? 13.230  3.459   1.045   1.00 0.00 ? 264 PHE A H    4  
ATOM   6370  H  HA   . PHE B 2 6   ? 13.359  5.615   3.028   1.00 0.00 ? 264 PHE A HA   4  
ATOM   6371  H  HB2  . PHE B 2 6   ? 12.779  2.690   3.548   1.00 0.00 ? 264 PHE A HB2  4  
ATOM   6372  H  HB3  . PHE B 2 6   ? 12.762  3.979   4.741   1.00 0.00 ? 264 PHE A HB3  4  
ATOM   6373  H  HD1  . PHE B 2 6   ? 11.135  2.826   1.627   1.00 0.00 ? 264 PHE A HD1  4  
ATOM   6374  H  HD2  . PHE B 2 6   ? 10.798  5.191   5.146   1.00 0.00 ? 264 PHE A HD2  4  
ATOM   6375  H  HE1  . PHE B 2 6   ? 8.753   3.199   1.136   1.00 0.00 ? 264 PHE A HE1  4  
ATOM   6376  H  HE2  . PHE B 2 6   ? 8.415   5.576   4.662   1.00 0.00 ? 264 PHE A HE2  4  
ATOM   6377  H  HZ   . PHE B 2 6   ? 7.391   4.579   2.651   1.00 0.00 ? 264 PHE A HZ   4  
ATOM   6378  N  N    . CYS B 2 7   ? 15.611  3.375   2.311   1.00 0.00 ? 265 CYS A N    4  
ATOM   6379  C  CA   . CYS B 2 7   ? 17.030  3.020   2.490   1.00 0.00 ? 265 CYS A CA   4  
ATOM   6380  C  C    . CYS B 2 7   ? 17.793  3.262   1.212   1.00 0.00 ? 265 CYS A C    4  
ATOM   6381  O  O    . CYS B 2 7   ? 18.955  3.666   1.232   1.00 0.00 ? 265 CYS A O    4  
ATOM   6382  C  CB   . CYS B 2 7   ? 17.234  1.556   2.904   1.00 0.00 ? 265 CYS A CB   4  
ATOM   6383  S  SG   . CYS B 2 7   ? 16.172  0.973   4.253   1.00 0.00 ? 265 CYS A SG   4  
ATOM   6384  H  H    . CYS B 2 7   ? 15.106  2.969   1.578   1.00 0.00 ? 265 CYS A H    4  
ATOM   6385  H  HA   . CYS B 2 7   ? 17.439  3.662   3.241   1.00 0.00 ? 265 CYS A HA   4  
ATOM   6386  H  HB2  . CYS B 2 7   ? 17.056  0.922   2.057   1.00 0.00 ? 265 CYS A HB2  4  
ATOM   6387  H  HB3  . CYS B 2 7   ? 18.259  1.429   3.221   1.00 0.00 ? 265 CYS A HB3  4  
ATOM   6388  N  N    . LEU B 2 8   ? 17.118  3.011   0.108   1.00 0.00 ? 266 LEU A N    4  
ATOM   6389  C  CA   . LEU B 2 8   ? 17.682  3.192   -1.203  1.00 0.00 ? 266 LEU A CA   4  
ATOM   6390  C  C    . LEU B 2 8   ? 18.790  2.192   -1.478  1.00 0.00 ? 266 LEU A C    4  
ATOM   6391  O  O    . LEU B 2 8   ? 19.743  2.480   -2.204  1.00 0.00 ? 266 LEU A O    4  
ATOM   6392  C  CB   . LEU B 2 8   ? 18.169  4.612   -1.357  1.00 0.00 ? 266 LEU A CB   4  
ATOM   6393  C  CG   . LEU B 2 8   ? 17.235  5.635   -0.751  1.00 0.00 ? 266 LEU A CG   4  
ATOM   6394  C  CD1  . LEU B 2 8   ? 17.943  6.952   -0.528  1.00 0.00 ? 266 LEU A CD1  4  
ATOM   6395  C  CD2  . LEU B 2 8   ? 16.030  5.789   -1.637  1.00 0.00 ? 266 LEU A CD2  4  
ATOM   6396  H  H    . LEU B 2 8   ? 16.198  2.707   0.178   1.00 0.00 ? 266 LEU A H    4  
ATOM   6397  H  HA   . LEU B 2 8   ? 16.889  3.034   -1.905  1.00 0.00 ? 266 LEU A HA   4  
ATOM   6398  H  HB2  . LEU B 2 8   ? 19.133  4.702   -0.895  1.00 0.00 ? 266 LEU A HB2  4  
ATOM   6399  H  HB3  . LEU B 2 8   ? 18.251  4.818   -2.402  1.00 0.00 ? 266 LEU A HB3  4  
ATOM   6400  H  HG   . LEU B 2 8   ? 16.896  5.262   0.192   1.00 0.00 ? 266 LEU A HG   4  
ATOM   6401  H  HD11 . LEU B 2 8   ? 18.996  6.813   -0.702  1.00 0.00 ? 266 LEU A HD11 4  
ATOM   6402  H  HD12 . LEU B 2 8   ? 17.786  7.279   0.489   1.00 0.00 ? 266 LEU A HD12 4  
ATOM   6403  H  HD13 . LEU B 2 8   ? 17.558  7.692   -1.212  1.00 0.00 ? 266 LEU A HD13 4  
ATOM   6404  H  HD21 . LEU B 2 8   ? 15.719  4.802   -1.940  1.00 0.00 ? 266 LEU A HD21 4  
ATOM   6405  H  HD22 . LEU B 2 8   ? 16.288  6.378   -2.505  1.00 0.00 ? 266 LEU A HD22 4  
ATOM   6406  H  HD23 . LEU B 2 8   ? 15.233  6.270   -1.090  1.00 0.00 ? 266 LEU A HD23 4  
ATOM   6407  N  N    . GLY B 2 9   ? 18.644  1.007   -0.900  1.00 0.00 ? 267 GLY A N    4  
ATOM   6408  C  CA   . GLY B 2 9   ? 19.624  -0.041  -1.084  1.00 0.00 ? 267 GLY A CA   4  
ATOM   6409  C  C    . GLY B 2 9   ? 19.217  -1.018  -2.164  1.00 0.00 ? 267 GLY A C    4  
ATOM   6410  O  O    . GLY B 2 9   ? 19.410  -0.768  -3.354  1.00 0.00 ? 267 GLY A O    4  
ATOM   6411  H  H    . GLY B 2 9   ? 17.856  0.842   -0.342  1.00 0.00 ? 267 GLY A H    4  
ATOM   6412  H  HA2  . GLY B 2 9   ? 20.581  0.403   -1.330  1.00 0.00 ? 267 GLY A HA2  4  
ATOM   6413  H  HA3  . GLY B 2 9   ? 19.722  -0.581  -0.154  1.00 0.00 ? 267 GLY A HA3  4  
ATOM   6414  N  N    . GLY B 2 10  ? 18.650  -2.138  -1.733  1.00 0.00 ? 268 GLY A N    4  
ATOM   6415  C  CA   . GLY B 2 10  ? 18.194  -3.158  -2.660  1.00 0.00 ? 268 GLY A CA   4  
ATOM   6416  C  C    . GLY B 2 10  ? 17.329  -4.200  -1.977  1.00 0.00 ? 268 GLY A C    4  
ATOM   6417  O  O    . GLY B 2 10  ? 17.343  -4.317  -0.752  1.00 0.00 ? 268 GLY A O    4  
ATOM   6418  H  H    . GLY B 2 10  ? 18.546  -2.275  -0.767  1.00 0.00 ? 268 GLY A H    4  
ATOM   6419  H  HA2  . GLY B 2 10  ? 17.617  -2.684  -3.442  1.00 0.00 ? 268 GLY A HA2  4  
ATOM   6420  H  HA3  . GLY B 2 10  ? 19.045  -3.644  -3.103  1.00 0.00 ? 268 GLY A HA3  4  
ATOM   6421  N  N    . SER B 2 11  ? 16.583  -4.963  -2.768  1.00 0.00 ? 269 SER A N    4  
ATOM   6422  C  CA   . SER B 2 11  ? 15.696  -5.985  -2.226  1.00 0.00 ? 269 SER A CA   4  
ATOM   6423  C  C    . SER B 2 11  ? 16.483  -7.051  -1.477  1.00 0.00 ? 269 SER A C    4  
ATOM   6424  O  O    . SER B 2 11  ? 16.355  -7.176  -0.260  1.00 0.00 ? 269 SER A O    4  
ATOM   6425  C  CB   . SER B 2 11  ? 14.851  -6.596  -3.345  1.00 0.00 ? 269 SER A CB   4  
ATOM   6426  O  OG   . SER B 2 11  ? 15.590  -7.529  -4.111  1.00 0.00 ? 269 SER A OG   4  
ATOM   6427  H  H    . SER B 2 11  ? 16.631  -4.836  -3.738  1.00 0.00 ? 269 SER A H    4  
ATOM   6428  H  HA   . SER B 2 11  ? 15.040  -5.502  -1.522  1.00 0.00 ? 269 SER A HA   4  
ATOM   6429  H  HB2  . SER B 2 11  ? 13.999  -7.084  -2.919  1.00 0.00 ? 269 SER A HB2  4  
ATOM   6430  H  HB3  . SER B 2 11  ? 14.507  -5.811  -3.992  1.00 0.00 ? 269 SER A HB3  4  
ATOM   6431  H  HG   . SER B 2 11  ? 14.996  -8.194  -4.465  1.00 0.00 ? 269 SER A HG   4  
ATOM   6432  N  N    . ASN B 2 12  ? 17.302  -7.813  -2.190  1.00 0.00 ? 270 ASN A N    4  
ATOM   6433  C  CA   . ASN B 2 12  ? 18.117  -8.838  -1.551  1.00 0.00 ? 270 ASN A CA   4  
ATOM   6434  C  C    . ASN B 2 12  ? 19.337  -8.202  -0.913  1.00 0.00 ? 270 ASN A C    4  
ATOM   6435  O  O    . ASN B 2 12  ? 20.401  -8.817  -0.831  1.00 0.00 ? 270 ASN A O    4  
ATOM   6436  C  CB   . ASN B 2 12  ? 18.541  -9.913  -2.543  1.00 0.00 ? 270 ASN A CB   4  
ATOM   6437  C  CG   . ASN B 2 12  ? 18.182  -9.567  -3.975  1.00 0.00 ? 270 ASN A CG   4  
ATOM   6438  O  OD1  . ASN B 2 12  ? 18.993  -9.011  -4.715  1.00 0.00 ? 270 ASN A OD1  4  
ATOM   6439  N  ND2  . ASN B 2 12  ? 16.956  -9.890  -4.372  1.00 0.00 ? 270 ASN A ND2  4  
ATOM   6440  H  H    . ASN B 2 12  ? 17.362  -7.682  -3.158  1.00 0.00 ? 270 ASN A H    4  
ATOM   6441  H  HA   . ASN B 2 12  ? 17.533  -9.300  -0.773  1.00 0.00 ? 270 ASN A HA   4  
ATOM   6442  H  HB2  . ASN B 2 12  ? 19.605  -10.036 -2.476  1.00 0.00 ? 270 ASN A HB2  4  
ATOM   6443  H  HB3  . ASN B 2 12  ? 18.061  -10.844 -2.279  1.00 0.00 ? 270 ASN A HB3  4  
ATOM   6444  H  HD21 . ASN B 2 12  ? 16.360  -10.325 -3.727  1.00 0.00 ? 270 ASN A HD21 4  
ATOM   6445  H  HD22 . ASN B 2 12  ? 16.698  -9.680  -5.293  1.00 0.00 ? 270 ASN A HD22 4  
ATOM   6446  N  N    . MET B 2 13  ? 19.177  -6.963  -0.454  1.00 0.00 ? 271 MET A N    4  
ATOM   6447  C  CA   . MET B 2 13  ? 20.275  -6.258  0.187   1.00 0.00 ? 271 MET A CA   4  
ATOM   6448  C  C    . MET B 2 13  ? 19.809  -4.967  0.862   1.00 0.00 ? 271 MET A C    4  
ATOM   6449  O  O    . MET B 2 13  ? 20.429  -3.913  0.720   1.00 0.00 ? 271 MET A O    4  
ATOM   6450  C  CB   . MET B 2 13  ? 21.342  -5.923  -0.827  1.00 0.00 ? 271 MET A CB   4  
ATOM   6451  C  CG   . MET B 2 13  ? 22.734  -5.763  -0.234  1.00 0.00 ? 271 MET A CG   4  
ATOM   6452  S  SD   . MET B 2 13  ? 23.635  -7.322  -0.126  1.00 0.00 ? 271 MET A SD   4  
ATOM   6453  C  CE   . MET B 2 13  ? 22.973  -8.005  1.391   1.00 0.00 ? 271 MET A CE   4  
ATOM   6454  H  H    . MET B 2 13  ? 18.302  -6.518  -0.551  1.00 0.00 ? 271 MET A H    4  
ATOM   6455  H  HA   . MET B 2 13  ? 20.688  -6.916  0.924   1.00 0.00 ? 271 MET A HA   4  
ATOM   6456  H  HB2  . MET B 2 13  ? 21.373  -6.697  -1.579  1.00 0.00 ? 271 MET A HB2  4  
ATOM   6457  H  HB3  . MET B 2 13  ? 21.059  -5.001  -1.279  1.00 0.00 ? 271 MET A HB3  4  
ATOM   6458  H  HG2  . MET B 2 13  ? 23.298  -5.081  -0.852  1.00 0.00 ? 271 MET A HG2  4  
ATOM   6459  H  HG3  . MET B 2 13  ? 22.639  -5.350  0.760   1.00 0.00 ? 271 MET A HG3  4  
ATOM   6460  H  HE1  . MET B 2 13  ? 21.900  -8.090  1.309   1.00 0.00 ? 271 MET A HE1  4  
ATOM   6461  H  HE2  . MET B 2 13  ? 23.221  -7.356  2.217   1.00 0.00 ? 271 MET A HE2  4  
ATOM   6462  H  HE3  . MET B 2 13  ? 23.399  -8.983  1.562   1.00 0.00 ? 271 MET A HE3  4  
ATOM   6463  N  N    . ASN B 2 14  ? 18.710  -5.078  1.579   1.00 0.00 ? 272 ASN A N    4  
ATOM   6464  C  CA   . ASN B 2 14  ? 18.110  -3.976  2.323   1.00 0.00 ? 272 ASN A CA   4  
ATOM   6465  C  C    . ASN B 2 14  ? 19.165  -3.070  2.917   1.00 0.00 ? 272 ASN A C    4  
ATOM   6466  O  O    . ASN B 2 14  ? 19.894  -3.491  3.803   1.00 0.00 ? 272 ASN A O    4  
ATOM   6467  C  CB   . ASN B 2 14  ? 17.280  -4.548  3.475   1.00 0.00 ? 272 ASN A CB   4  
ATOM   6468  C  CG   . ASN B 2 14  ? 16.365  -3.527  4.124   1.00 0.00 ? 272 ASN A CG   4  
ATOM   6469  O  OD1  . ASN B 2 14  ? 16.699  -2.347  4.220   1.00 0.00 ? 272 ASN A OD1  4  
ATOM   6470  N  ND2  . ASN B 2 14  ? 15.202  -3.979  4.578   1.00 0.00 ? 272 ASN A ND2  4  
ATOM   6471  H  H    . ASN B 2 14  ? 18.281  -5.946  1.616   1.00 0.00 ? 272 ASN A H    4  
ATOM   6472  H  HA   . ASN B 2 14  ? 17.472  -3.415  1.662   1.00 0.00 ? 272 ASN A HA   4  
ATOM   6473  H  HB2  . ASN B 2 14  ? 16.682  -5.362  3.110   1.00 0.00 ? 272 ASN A HB2  4  
ATOM   6474  H  HB3  . ASN B 2 14  ? 17.958  -4.925  4.233   1.00 0.00 ? 272 ASN A HB3  4  
ATOM   6475  H  HD21 . ASN B 2 14  ? 15.003  -4.932  4.469   1.00 0.00 ? 272 ASN A HD21 4  
ATOM   6476  H  HD22 . ASN B 2 14  ? 14.591  -3.341  5.002   1.00 0.00 ? 272 ASN A HD22 4  
ATOM   6477  N  N    . LYS B 2 15  ? 19.258  -1.837  2.446   1.00 0.00 ? 273 LYS A N    4  
ATOM   6478  C  CA   . LYS B 2 15  ? 20.233  -0.931  3.018   1.00 0.00 ? 273 LYS A CA   4  
ATOM   6479  C  C    . LYS B 2 15  ? 19.811  -0.557  4.421   1.00 0.00 ? 273 LYS A C    4  
ATOM   6480  O  O    . LYS B 2 15  ? 18.670  -0.806  4.809   1.00 0.00 ? 273 LYS A O    4  
ATOM   6481  C  CB   . LYS B 2 15  ? 20.455  0.295   2.157   1.00 0.00 ? 273 LYS A CB   4  
ATOM   6482  C  CG   . LYS B 2 15  ? 21.726  0.155   1.341   1.00 0.00 ? 273 LYS A CG   4  
ATOM   6483  C  CD   . LYS B 2 15  ? 22.364  1.490   1.023   1.00 0.00 ? 273 LYS A CD   4  
ATOM   6484  C  CE   . LYS B 2 15  ? 21.397  2.370   0.287   1.00 0.00 ? 273 LYS A CE   4  
ATOM   6485  N  NZ   . LYS B 2 15  ? 21.600  3.813   0.592   1.00 0.00 ? 273 LYS A NZ   4  
ATOM   6486  H  H    . LYS B 2 15  ? 18.674  -1.539  1.718   1.00 0.00 ? 273 LYS A H    4  
ATOM   6487  H  HA   . LYS B 2 15  ? 21.165  -1.465  3.078   1.00 0.00 ? 273 LYS A HA   4  
ATOM   6488  H  HB2  . LYS B 2 15  ? 19.613  0.426   1.491   1.00 0.00 ? 273 LYS A HB2  4  
ATOM   6489  H  HB3  . LYS B 2 15  ? 20.546  1.158   2.782   1.00 0.00 ? 273 LYS A HB3  4  
ATOM   6490  H  HG2  . LYS B 2 15  ? 22.420  -0.435  1.903   1.00 0.00 ? 273 LYS A HG2  4  
ATOM   6491  H  HG3  . LYS B 2 15  ? 21.487  -0.348  0.424   1.00 0.00 ? 273 LYS A HG3  4  
ATOM   6492  H  HD2  . LYS B 2 15  ? 22.644  1.969   1.937   1.00 0.00 ? 273 LYS A HD2  4  
ATOM   6493  H  HD3  . LYS B 2 15  ? 23.238  1.330   0.407   1.00 0.00 ? 273 LYS A HD3  4  
ATOM   6494  H  HE2  . LYS B 2 15  ? 21.515  2.210   -0.774  1.00 0.00 ? 273 LYS A HE2  4  
ATOM   6495  H  HE3  . LYS B 2 15  ? 20.406  2.073   0.591   1.00 0.00 ? 273 LYS A HE3  4  
ATOM   6496  H  HZ1  . LYS B 2 15  ? 22.578  4.090   0.372   1.00 0.00 ? 273 LYS A HZ1  4  
ATOM   6497  H  HZ2  . LYS B 2 15  ? 21.418  3.995   1.598   1.00 0.00 ? 273 LYS A HZ2  4  
ATOM   6498  H  HZ3  . LYS B 2 15  ? 20.951  4.393   0.023   1.00 0.00 ? 273 LYS A HZ3  4  
ATOM   6499  N  N    . LYS B 2 16  ? 20.732  0.018   5.184   1.00 0.00 ? 274 LYS A N    4  
ATOM   6500  C  CA   . LYS B 2 16  ? 20.462  0.387   6.569   1.00 0.00 ? 274 LYS A CA   4  
ATOM   6501  C  C    . LYS B 2 16  ? 20.493  -0.869  7.446   1.00 0.00 ? 274 LYS A C    4  
ATOM   6502  O  O    . LYS B 2 16  ? 20.728  -0.794  8.652   1.00 0.00 ? 274 LYS A O    4  
ATOM   6503  C  CB   . LYS B 2 16  ? 19.116  1.111   6.695   1.00 0.00 ? 274 LYS A CB   4  
ATOM   6504  C  CG   . LYS B 2 16  ? 18.980  2.295   5.752   1.00 0.00 ? 274 LYS A CG   4  
ATOM   6505  C  CD   . LYS B 2 16  ? 19.629  3.545   6.320   1.00 0.00 ? 274 LYS A CD   4  
ATOM   6506  C  CE   . LYS B 2 16  ? 19.452  4.729   5.394   1.00 0.00 ? 274 LYS A CE   4  
ATOM   6507  N  NZ   . LYS B 2 16  ? 18.017  5.008   5.111   1.00 0.00 ? 274 LYS A NZ   4  
ATOM   6508  H  H    . LYS B 2 16  ? 21.619  0.200   4.807   1.00 0.00 ? 274 LYS A H    4  
ATOM   6509  H  HA   . LYS B 2 16  ? 21.251  1.053   6.890   1.00 0.00 ? 274 LYS A HA   4  
ATOM   6510  H  HB2  . LYS B 2 16  ? 18.319  0.414   6.478   1.00 0.00 ? 274 LYS A HB2  4  
ATOM   6511  H  HB3  . LYS B 2 16  ? 19.004  1.469   7.705   1.00 0.00 ? 274 LYS A HB3  4  
ATOM   6512  H  HG2  . LYS B 2 16  ? 19.464  2.051   4.819   1.00 0.00 ? 274 LYS A HG2  4  
ATOM   6513  H  HG3  . LYS B 2 16  ? 17.932  2.488   5.574   1.00 0.00 ? 274 LYS A HG3  4  
ATOM   6514  H  HD2  . LYS B 2 16  ? 19.183  3.774   7.276   1.00 0.00 ? 274 LYS A HD2  4  
ATOM   6515  H  HD3  . LYS B 2 16  ? 20.684  3.362   6.444   1.00 0.00 ? 274 LYS A HD3  4  
ATOM   6516  H  HE2  . LYS B 2 16  ? 19.898  5.599   5.852   1.00 0.00 ? 274 LYS A HE2  4  
ATOM   6517  H  HE3  . LYS B 2 16  ? 19.959  4.510   4.468   1.00 0.00 ? 274 LYS A HE3  4  
ATOM   6518  H  HZ1  . LYS B 2 16  ? 17.933  5.765   4.402   1.00 0.00 ? 274 LYS A HZ1  4  
ATOM   6519  H  HZ2  . LYS B 2 16  ? 17.533  5.309   5.981   1.00 0.00 ? 274 LYS A HZ2  4  
ATOM   6520  H  HZ3  . LYS B 2 16  ? 17.551  4.154   4.747   1.00 0.00 ? 274 LYS A HZ3  4  
ATOM   6521  N  N    . SER B 2 17  ? 20.253  -2.026  6.817   1.00 0.00 ? 275 SER A N    4  
ATOM   6522  C  CA   . SER B 2 17  ? 20.280  -3.309  7.500   1.00 0.00 ? 275 SER A CA   4  
ATOM   6523  C  C    . SER B 2 17  ? 21.260  -4.240  6.826   1.00 0.00 ? 275 SER A C    4  
ATOM   6524  O  O    . SER B 2 17  ? 21.834  -5.129  7.449   1.00 0.00 ? 275 SER A O    4  
ATOM   6525  C  CB   . SER B 2 17  ? 18.900  -3.975  7.485   1.00 0.00 ? 275 SER A CB   4  
ATOM   6526  O  OG   . SER B 2 17  ? 17.898  -3.099  7.970   1.00 0.00 ? 275 SER A OG   4  
ATOM   6527  H  H    . SER B 2 17  ? 20.037  -2.013  5.866   1.00 0.00 ? 275 SER A H    4  
ATOM   6528  H  HA   . SER B 2 17  ? 20.590  -3.150  8.505   1.00 0.00 ? 275 SER A HA   4  
ATOM   6529  H  HB2  . SER B 2 17  ? 18.655  -4.271  6.475   1.00 0.00 ? 275 SER A HB2  4  
ATOM   6530  H  HB3  . SER B 2 17  ? 18.927  -4.854  8.104   1.00 0.00 ? 275 SER A HB3  4  
ATOM   6531  H  HG   . SER B 2 17  ? 17.053  -3.553  7.979   1.00 0.00 ? 275 SER A HG   4  
ATOM   6532  N  N    . GLY B 2 18  ? 21.485  -3.990  5.555   1.00 0.00 ? 276 GLY A N    4  
ATOM   6533  C  CA   . GLY B 2 18  ? 22.342  -4.856  4.786   1.00 0.00 ? 276 GLY A CA   4  
ATOM   6534  C  C    . GLY B 2 18  ? 21.764  -6.249  4.722   1.00 0.00 ? 276 GLY A C    4  
ATOM   6535  O  O    . GLY B 2 18  ? 22.486  -7.227  4.533   1.00 0.00 ? 276 GLY A O    4  
ATOM   6536  H  H    . GLY B 2 18  ? 21.092  -3.191  5.148   1.00 0.00 ? 276 GLY A H    4  
ATOM   6537  H  HA2  . GLY B 2 18  ? 22.441  -4.463  3.787   1.00 0.00 ? 276 GLY A HA2  4  
ATOM   6538  H  HA3  . GLY B 2 18  ? 23.304  -4.900  5.252   1.00 0.00 ? 276 GLY A HA3  4  
ATOM   6539  N  N    . ARG B 2 19  ? 20.445  -6.329  4.878   1.00 0.00 ? 277 ARG A N    4  
ATOM   6540  C  CA   . ARG B 2 19  ? 19.749  -7.610  4.859   1.00 0.00 ? 277 ARG A CA   4  
ATOM   6541  C  C    . ARG B 2 19  ? 19.071  -7.838  3.533   1.00 0.00 ? 277 ARG A C    4  
ATOM   6542  O  O    . ARG B 2 19  ? 18.664  -6.914  2.873   1.00 0.00 ? 277 ARG A O    4  
ATOM   6543  C  CB   . ARG B 2 19  ? 18.664  -7.699  5.923   1.00 0.00 ? 277 ARG A CB   4  
ATOM   6544  C  CG   . ARG B 2 19  ? 19.111  -8.193  7.293   1.00 0.00 ? 277 ARG A CG   4  
ATOM   6545  C  CD   . ARG B 2 19  ? 20.344  -7.510  7.806   1.00 0.00 ? 277 ARG A CD   4  
ATOM   6546  N  NE   . ARG B 2 19  ? 20.038  -6.494  8.806   1.00 0.00 ? 277 ARG A NE   4  
ATOM   6547  C  CZ   . ARG B 2 19  ? 20.865  -6.150  9.791   1.00 0.00 ? 277 ARG A CZ   4  
ATOM   6548  N  NH1  . ARG B 2 19  ? 22.054  -6.729  9.897   1.00 0.00 ? 277 ARG A NH1  4  
ATOM   6549  N  NH2  . ARG B 2 19  ? 20.502  -5.226  10.670  1.00 0.00 ? 277 ARG A NH2  4  
ATOM   6550  H  H    . ARG B 2 19  ? 19.925  -5.500  4.974   1.00 0.00 ? 277 ARG A H    4  
ATOM   6551  H  HA   . ARG B 2 19  ? 20.473  -8.390  5.028   1.00 0.00 ? 277 ARG A HA   4  
ATOM   6552  H  HB2  . ARG B 2 19  ? 18.218  -6.742  6.025   1.00 0.00 ? 277 ARG A HB2  4  
ATOM   6553  H  HB3  . ARG B 2 19  ? 17.911  -8.390  5.561   1.00 0.00 ? 277 ARG A HB3  4  
ATOM   6554  H  HG2  . ARG B 2 19  ? 18.315  -8.047  8.003   1.00 0.00 ? 277 ARG A HG2  4  
ATOM   6555  H  HG3  . ARG B 2 19  ? 19.326  -9.216  7.211   1.00 0.00 ? 277 ARG A HG3  4  
ATOM   6556  H  HD2  . ARG B 2 19  ? 20.991  -8.255  8.248   1.00 0.00 ? 277 ARG A HD2  4  
ATOM   6557  H  HD3  . ARG B 2 19  ? 20.834  -7.068  6.971   1.00 0.00 ? 277 ARG A HD3  4  
ATOM   6558  H  HE   . ARG B 2 19  ? 19.167  -6.053  8.751   1.00 0.00 ? 277 ARG A HE   4  
ATOM   6559  H  HH11 . ARG B 2 19  ? 22.332  -7.425  9.237   1.00 0.00 ? 277 ARG A HH11 4  
ATOM   6560  H  HH12 . ARG B 2 19  ? 22.673  -6.466  10.638  1.00 0.00 ? 277 ARG A HH12 4  
ATOM   6561  H  HH21 . ARG B 2 19  ? 19.606  -4.789  10.594  1.00 0.00 ? 277 ARG A HH21 4  
ATOM   6562  H  HH22 . ARG B 2 19  ? 21.123  -4.968  11.410  1.00 0.00 ? 277 ARG A HH22 4  
ATOM   6563  N  N    . PRO B 2 20  ? 18.920  -9.088  3.158   1.00 0.00 ? 278 PRO A N    4  
ATOM   6564  C  CA   . PRO B 2 20  ? 18.263  -9.472  1.920   1.00 0.00 ? 278 PRO A CA   4  
ATOM   6565  C  C    . PRO B 2 20  ? 16.737  -9.432  2.022   1.00 0.00 ? 278 PRO A C    4  
ATOM   6566  O  O    . PRO B 2 20  ? 16.080  -10.472 1.955   1.00 0.00 ? 278 PRO A O    4  
ATOM   6567  C  CB   . PRO B 2 20  ? 18.721  -10.907 1.684   1.00 0.00 ? 278 PRO A CB   4  
ATOM   6568  C  CG   . PRO B 2 20  ? 19.616  -11.254 2.823   1.00 0.00 ? 278 PRO A CG   4  
ATOM   6569  C  CD   . PRO B 2 20  ? 19.405  -10.221 3.903   1.00 0.00 ? 278 PRO A CD   4  
ATOM   6570  H  HA   . PRO B 2 20  ? 18.596  -8.859  1.106   1.00 0.00 ? 278 PRO A HA   4  
ATOM   6571  H  HB2  . PRO B 2 20  ? 17.863  -11.555 1.643   1.00 0.00 ? 278 PRO A HB2  4  
ATOM   6572  H  HB3  . PRO B 2 20  ? 19.253  -10.950 0.745   1.00 0.00 ? 278 PRO A HB3  4  
ATOM   6573  H  HG2  . PRO B 2 20  ? 19.384  -12.241 3.193   1.00 0.00 ? 278 PRO A HG2  4  
ATOM   6574  H  HG3  . PRO B 2 20  ? 20.628  -11.210 2.467   1.00 0.00 ? 278 PRO A HG3  4  
ATOM   6575  H  HD2  . PRO B 2 20  ? 18.678  -10.519 4.642   1.00 0.00 ? 278 PRO A HD2  4  
ATOM   6576  H  HD3  . PRO B 2 20  ? 20.338  -9.975  4.384   1.00 0.00 ? 278 PRO A HD3  4  
ATOM   6577  N  N    . GLU B 2 21  ? 16.171  -8.240  2.186   1.00 0.00 ? 279 GLU A N    4  
ATOM   6578  C  CA   . GLU B 2 21  ? 14.726  -8.102  2.288   1.00 0.00 ? 279 GLU A CA   4  
ATOM   6579  C  C    . GLU B 2 21  ? 14.083  -8.319  0.921   1.00 0.00 ? 279 GLU A C    4  
ATOM   6580  O  O    . GLU B 2 21  ? 14.393  -9.293  0.235   1.00 0.00 ? 279 GLU A O    4  
ATOM   6581  C  CB   . GLU B 2 21  ? 14.365  -6.731  2.847   1.00 0.00 ? 279 GLU A CB   4  
ATOM   6582  C  CG   . GLU B 2 21  ? 13.012  -6.714  3.529   1.00 0.00 ? 279 GLU A CG   4  
ATOM   6583  C  CD   . GLU B 2 21  ? 12.945  -7.654  4.717   1.00 0.00 ? 279 GLU A CD   4  
ATOM   6584  O  OE1  . GLU B 2 21  ? 13.321  -7.232  5.831   1.00 0.00 ? 279 GLU A OE1  4  
ATOM   6585  O  OE2  . GLU B 2 21  ? 12.517  -8.813  4.533   1.00 0.00 ? 279 GLU A OE2  4  
ATOM   6586  H  H    . GLU B 2 21  ? 16.729  -7.440  2.228   1.00 0.00 ? 279 GLU A H    4  
ATOM   6587  H  HA   . GLU B 2 21  ? 14.361  -8.857  2.967   1.00 0.00 ? 279 GLU A HA   4  
ATOM   6588  H  HB2  . GLU B 2 21  ? 15.113  -6.439  3.568   1.00 0.00 ? 279 GLU A HB2  4  
ATOM   6589  H  HB3  . GLU B 2 21  ? 14.349  -6.015  2.040   1.00 0.00 ? 279 GLU A HB3  4  
ATOM   6590  H  HG2  . GLU B 2 21  ? 12.812  -5.717  3.871   1.00 0.00 ? 279 GLU A HG2  4  
ATOM   6591  H  HG3  . GLU B 2 21  ? 12.259  -7.008  2.814   1.00 0.00 ? 279 GLU A HG3  4  
ATOM   6592  N  N    . GLU B 2 22  ? 13.197  -7.414  0.520   1.00 0.00 ? 280 GLU A N    4  
ATOM   6593  C  CA   . GLU B 2 22  ? 12.531  -7.528  -0.770  1.00 0.00 ? 280 GLU A CA   4  
ATOM   6594  C  C    . GLU B 2 22  ? 11.709  -6.292  -1.061  1.00 0.00 ? 280 GLU A C    4  
ATOM   6595  O  O    . GLU B 2 22  ? 10.550  -6.181  -0.660  1.00 0.00 ? 280 GLU A O    4  
ATOM   6596  C  CB   . GLU B 2 22  ? 11.648  -8.760  -0.812  1.00 0.00 ? 280 GLU A CB   4  
ATOM   6597  C  CG   . GLU B 2 22  ? 11.599  -9.391  -2.183  1.00 0.00 ? 280 GLU A CG   4  
ATOM   6598  C  CD   . GLU B 2 22  ? 12.872  -10.136 -2.534  1.00 0.00 ? 280 GLU A CD   4  
ATOM   6599  O  OE1  . GLU B 2 22  ? 13.818  -9.493  -3.035  1.00 0.00 ? 280 GLU A OE1  4  
ATOM   6600  O  OE2  . GLU B 2 22  ? 12.922  -11.363 -2.308  1.00 0.00 ? 280 GLU A OE2  4  
ATOM   6601  H  H    . GLU B 2 22  ? 12.983  -6.652  1.101   1.00 0.00 ? 280 GLU A H    4  
ATOM   6602  H  HA   . GLU B 2 22  ? 13.289  -7.618  -1.539  1.00 0.00 ? 280 GLU A HA   4  
ATOM   6603  H  HB2  . GLU B 2 22  ? 12.021  -9.489  -0.109  1.00 0.00 ? 280 GLU A HB2  4  
ATOM   6604  H  HB3  . GLU B 2 22  ? 10.643  -8.477  -0.534  1.00 0.00 ? 280 GLU A HB3  4  
ATOM   6605  H  HG2  . GLU B 2 22  ? 10.774  -10.081 -2.209  1.00 0.00 ? 280 GLU A HG2  4  
ATOM   6606  H  HG3  . GLU B 2 22  ? 11.440  -8.608  -2.914  1.00 0.00 ? 280 GLU A HG3  4  
ATOM   6607  N  N    . LEU B 2 23  ? 12.335  -5.371  -1.762  1.00 0.00 ? 281 LEU A N    4  
ATOM   6608  C  CA   . LEU B 2 23  ? 11.712  -4.114  -2.136  1.00 0.00 ? 281 LEU A CA   4  
ATOM   6609  C  C    . LEU B 2 23  ? 10.380  -4.282  -2.848  1.00 0.00 ? 281 LEU A C    4  
ATOM   6610  O  O    . LEU B 2 23  ? 9.905   -5.390  -3.099  1.00 0.00 ? 281 LEU A O    4  
ATOM   6611  C  CB   . LEU B 2 23  ? 12.634  -3.363  -3.071  1.00 0.00 ? 281 LEU A CB   4  
ATOM   6612  C  CG   . LEU B 2 23  ? 13.992  -3.034  -2.505  1.00 0.00 ? 281 LEU A CG   4  
ATOM   6613  C  CD1  . LEU B 2 23  ? 14.929  -2.670  -3.623  1.00 0.00 ? 281 LEU A CD1  4  
ATOM   6614  C  CD2  . LEU B 2 23  ? 13.874  -1.902  -1.522  1.00 0.00 ? 281 LEU A CD2  4  
ATOM   6615  H  H    . LEU B 2 23  ? 13.269  -5.535  -2.029  1.00 0.00 ? 281 LEU A H    4  
ATOM   6616  H  HA   . LEU B 2 23  ? 11.567  -3.525  -1.247  1.00 0.00 ? 281 LEU A HA   4  
ATOM   6617  H  HB2  . LEU B 2 23  ? 12.771  -3.955  -3.964  1.00 0.00 ? 281 LEU A HB2  4  
ATOM   6618  H  HB3  . LEU B 2 23  ? 12.156  -2.443  -3.341  1.00 0.00 ? 281 LEU A HB3  4  
ATOM   6619  H  HG   . LEU B 2 23  ? 14.381  -3.888  -1.993  1.00 0.00 ? 281 LEU A HG   4  
ATOM   6620  H  HD11 . LEU B 2 23  ? 14.347  -2.277  -4.429  1.00 0.00 ? 281 LEU A HD11 4  
ATOM   6621  H  HD12 . LEU B 2 23  ? 15.462  -3.549  -3.955  1.00 0.00 ? 281 LEU A HD12 4  
ATOM   6622  H  HD13 . LEU B 2 23  ? 15.631  -1.924  -3.284  1.00 0.00 ? 281 LEU A HD13 4  
ATOM   6623  H  HD21 . LEU B 2 23  ? 13.451  -1.036  -2.014  1.00 0.00 ? 281 LEU A HD21 4  
ATOM   6624  H  HD22 . LEU B 2 23  ? 14.852  -1.656  -1.136  1.00 0.00 ? 281 LEU A HD22 4  
ATOM   6625  H  HD23 . LEU B 2 23  ? 13.230  -2.200  -0.709  1.00 0.00 ? 281 LEU A HD23 4  
ATOM   6626  N  N    . VAL B 2 24  ? 9.807   -3.134  -3.169  1.00 0.00 ? 282 VAL A N    4  
ATOM   6627  C  CA   . VAL B 2 24  ? 8.547   -3.048  -3.906  1.00 0.00 ? 282 VAL A CA   4  
ATOM   6628  C  C    . VAL B 2 24  ? 8.555   -1.760  -4.687  1.00 0.00 ? 282 VAL A C    4  
ATOM   6629  O  O    . VAL B 2 24  ? 8.407   -0.691  -4.107  1.00 0.00 ? 282 VAL A O    4  
ATOM   6630  C  CB   . VAL B 2 24  ? 7.314   -3.016  -2.986  1.00 0.00 ? 282 VAL A CB   4  
ATOM   6631  C  CG1  . VAL B 2 24  ? 6.764   -4.378  -2.688  1.00 0.00 ? 282 VAL A CG1  4  
ATOM   6632  C  CG2  . VAL B 2 24  ? 7.638   -2.356  -1.706  1.00 0.00 ? 282 VAL A CG2  4  
ATOM   6633  H  H    . VAL B 2 24  ? 10.261  -2.292  -2.897  1.00 0.00 ? 282 VAL A H    4  
ATOM   6634  H  HA   . VAL B 2 24  ? 8.473   -3.889  -4.579  1.00 0.00 ? 282 VAL A HA   4  
ATOM   6635  H  HB   . VAL B 2 24  ? 6.547   -2.435  -3.448  1.00 0.00 ? 282 VAL A HB   4  
ATOM   6636  H  HG11 . VAL B 2 24  ? 6.200   -4.303  -1.764  1.00 0.00 ? 282 VAL A HG11 4  
ATOM   6637  H  HG12 . VAL B 2 24  ? 7.575   -5.083  -2.570  1.00 0.00 ? 282 VAL A HG12 4  
ATOM   6638  H  HG13 . VAL B 2 24  ? 6.112   -4.695  -3.487  1.00 0.00 ? 282 VAL A HG13 4  
ATOM   6639  H  HG21 . VAL B 2 24  ? 7.774   -3.117  -0.954  1.00 0.00 ? 282 VAL A HG21 4  
ATOM   6640  H  HG22 . VAL B 2 24  ? 6.823   -1.705  -1.422  1.00 0.00 ? 282 VAL A HG22 4  
ATOM   6641  H  HG23 . VAL B 2 24  ? 8.542   -1.780  -1.813  1.00 0.00 ? 282 VAL A HG23 4  
ATOM   6642  N  N    . SER B 2 25  ? 8.687   -1.858  -5.995  1.00 0.00 ? 283 SER A N    4  
ATOM   6643  C  CA   . SER B 2 25  ? 8.734   -0.670  -6.822  1.00 0.00 ? 283 SER A CA   4  
ATOM   6644  C  C    . SER B 2 25  ? 7.352   -0.351  -7.381  1.00 0.00 ? 283 SER A C    4  
ATOM   6645  O  O    . SER B 2 25  ? 6.450   -1.188  -7.332  1.00 0.00 ? 283 SER A O    4  
ATOM   6646  C  CB   . SER B 2 25  ? 9.739   -0.868  -7.956  1.00 0.00 ? 283 SER A CB   4  
ATOM   6647  O  OG   . SER B 2 25  ? 9.356   -1.941  -8.799  1.00 0.00 ? 283 SER A OG   4  
ATOM   6648  H  H    . SER B 2 25  ? 8.753   -2.742  -6.411  1.00 0.00 ? 283 SER A H    4  
ATOM   6649  H  HA   . SER B 2 25  ? 9.068   0.146   -6.196  1.00 0.00 ? 283 SER A HA   4  
ATOM   6650  H  HB2  . SER B 2 25  ? 9.797   0.035   -8.545  1.00 0.00 ? 283 SER A HB2  4  
ATOM   6651  H  HB3  . SER B 2 25  ? 10.710  -1.087  -7.530  1.00 0.00 ? 283 SER A HB3  4  
ATOM   6652  H  HG   . SER B 2 25  ? 9.157   -2.713  -8.264  1.00 0.00 ? 283 SER A HG   4  
ATOM   6653  N  N    . CYS B 2 26  ? 7.182   0.856   -7.911  1.00 0.00 ? 284 CYS A N    4  
ATOM   6654  C  CA   . CYS B 2 26  ? 5.902   1.247   -8.477  1.00 0.00 ? 284 CYS A CA   4  
ATOM   6655  C  C    . CYS B 2 26  ? 5.910   0.895   -9.958  1.00 0.00 ? 284 CYS A C    4  
ATOM   6656  O  O    . CYS B 2 26  ? 6.858   1.235   -10.666 1.00 0.00 ? 284 CYS A O    4  
ATOM   6657  C  CB   . CYS B 2 26  ? 5.652   2.757   -8.258  1.00 0.00 ? 284 CYS A CB   4  
ATOM   6658  S  SG   . CYS B 2 26  ? 4.217   3.428   -9.173  1.00 0.00 ? 284 CYS A SG   4  
ATOM   6659  H  H    . CYS B 2 26  ? 7.935   1.477   -7.955  1.00 0.00 ? 284 CYS A H    4  
ATOM   6660  H  HA   . CYS B 2 26  ? 5.132   0.681   -7.977  1.00 0.00 ? 284 CYS A HA   4  
ATOM   6661  H  HB2  . CYS B 2 26  ? 5.472   2.926   -7.209  1.00 0.00 ? 284 CYS A HB2  4  
ATOM   6662  H  HB3  . CYS B 2 26  ? 6.524   3.312   -8.555  1.00 0.00 ? 284 CYS A HB3  4  
ATOM   6663  N  N    . ALA B 2 27  ? 4.868   0.219   -10.443 1.00 0.00 ? 285 ALA A N    4  
ATOM   6664  C  CA   . ALA B 2 27  ? 4.829   -0.157  -11.850 1.00 0.00 ? 285 ALA A CA   4  
ATOM   6665  C  C    . ALA B 2 27  ? 4.482   1.042   -12.715 1.00 0.00 ? 285 ALA A C    4  
ATOM   6666  O  O    . ALA B 2 27  ? 4.090   0.904   -13.874 1.00 0.00 ? 285 ALA A O    4  
ATOM   6667  C  CB   . ALA B 2 27  ? 3.860   -1.299  -12.077 1.00 0.00 ? 285 ALA A CB   4  
ATOM   6668  H  H    . ALA B 2 27  ? 4.120   -0.033  -9.851  1.00 0.00 ? 285 ALA A H    4  
ATOM   6669  H  HA   . ALA B 2 27  ? 5.818   -0.500  -12.123 1.00 0.00 ? 285 ALA A HA   4  
ATOM   6670  H  HB1  . ALA B 2 27  ? 2.851   -0.922  -12.110 1.00 0.00 ? 285 ALA A HB1  4  
ATOM   6671  H  HB2  . ALA B 2 27  ? 3.951   -2.012  -11.271 1.00 0.00 ? 285 ALA A HB2  4  
ATOM   6672  H  HB3  . ALA B 2 27  ? 4.091   -1.785  -13.014 1.00 0.00 ? 285 ALA A HB3  4  
ATOM   6673  N  N    . ASP B 2 28  ? 4.633   2.219   -12.129 1.00 0.00 ? 286 ASP A N    4  
ATOM   6674  C  CA   . ASP B 2 28  ? 4.358   3.467   -12.815 1.00 0.00 ? 286 ASP A CA   4  
ATOM   6675  C  C    . ASP B 2 28  ? 5.550   4.410   -12.688 1.00 0.00 ? 286 ASP A C    4  
ATOM   6676  O  O    . ASP B 2 28  ? 5.911   5.110   -13.633 1.00 0.00 ? 286 ASP A O    4  
ATOM   6677  C  CB   . ASP B 2 28  ? 3.127   4.134   -12.212 1.00 0.00 ? 286 ASP A CB   4  
ATOM   6678  C  CG   . ASP B 2 28  ? 2.578   5.244   -13.086 1.00 0.00 ? 286 ASP A CG   4  
ATOM   6679  O  OD1  . ASP B 2 28  ? 3.055   6.392   -12.957 1.00 0.00 ? 286 ASP A OD1  4  
ATOM   6680  O  OD2  . ASP B 2 28  ? 1.672   4.967   -13.900 1.00 0.00 ? 286 ASP A OD2  4  
ATOM   6681  H  H    . ASP B 2 28  ? 4.930   2.247   -11.198 1.00 0.00 ? 286 ASP A H    4  
ATOM   6682  H  HA   . ASP B 2 28  ? 4.176   3.247   -13.854 1.00 0.00 ? 286 ASP A HA   4  
ATOM   6683  H  HB2  . ASP B 2 28  ? 2.358   3.393   -12.072 1.00 0.00 ? 286 ASP A HB2  4  
ATOM   6684  H  HB3  . ASP B 2 28  ? 3.395   4.554   -11.252 1.00 0.00 ? 286 ASP A HB3  4  
ATOM   6685  N  N    . CYS B 2 29  ? 6.154   4.415   -11.501 1.00 0.00 ? 287 CYS A N    4  
ATOM   6686  C  CA   . CYS B 2 29  ? 7.302   5.274   -11.221 1.00 0.00 ? 287 CYS A CA   4  
ATOM   6687  C  C    . CYS B 2 29  ? 8.584   4.470   -11.081 1.00 0.00 ? 287 CYS A C    4  
ATOM   6688  O  O    . CYS B 2 29  ? 9.632   4.845   -11.606 1.00 0.00 ? 287 CYS A O    4  
ATOM   6689  C  CB   . CYS B 2 29  ? 7.079   6.044   -9.931  1.00 0.00 ? 287 CYS A CB   4  
ATOM   6690  S  SG   . CYS B 2 29  ? 5.518   6.966   -9.860  1.00 0.00 ? 287 CYS A SG   4  
ATOM   6691  H  H    . CYS B 2 29  ? 5.816   3.821   -10.793 1.00 0.00 ? 287 CYS A H    4  
ATOM   6692  H  HA   . CYS B 2 29  ? 7.408   5.971   -12.024 1.00 0.00 ? 287 CYS A HA   4  
ATOM   6693  H  HB2  . CYS B 2 29  ? 7.083   5.347   -9.119  1.00 0.00 ? 287 CYS A HB2  4  
ATOM   6694  H  HB3  . CYS B 2 29  ? 7.886   6.751   -9.797  1.00 0.00 ? 287 CYS A HB3  4  
ATOM   6695  N  N    . GLY B 2 30  ? 8.482   3.361   -10.366 1.00 0.00 ? 288 GLY A N    4  
ATOM   6696  C  CA   . GLY B 2 30  ? 9.635   2.522   -10.122 1.00 0.00 ? 288 GLY A CA   4  
ATOM   6697  C  C    . GLY B 2 30  ? 10.159  2.674   -8.706  1.00 0.00 ? 288 GLY A C    4  
ATOM   6698  O  O    . GLY B 2 30  ? 11.093  1.979   -8.308  1.00 0.00 ? 288 GLY A O    4  
ATOM   6699  H  H    . GLY B 2 30  ? 7.607   3.100   -10.017 1.00 0.00 ? 288 GLY A H    4  
ATOM   6700  H  HA2  . GLY B 2 30  ? 9.358   1.491   -10.286 1.00 0.00 ? 288 GLY A HA2  4  
ATOM   6701  H  HA3  . GLY B 2 30  ? 10.418  2.790   -10.816 1.00 0.00 ? 288 GLY A HA3  4  
ATOM   6702  N  N    . ARG B 2 31  ? 9.553   3.583   -7.937  1.00 0.00 ? 289 ARG A N    4  
ATOM   6703  C  CA   . ARG B 2 31  ? 9.974   3.811   -6.556  1.00 0.00 ? 289 ARG A CA   4  
ATOM   6704  C  C    . ARG B 2 31  ? 9.776   2.552   -5.735  1.00 0.00 ? 289 ARG A C    4  
ATOM   6705  O  O    . ARG B 2 31  ? 8.651   2.128   -5.492  1.00 0.00 ? 289 ARG A O    4  
ATOM   6706  C  CB   . ARG B 2 31  ? 9.197   4.957   -5.922  1.00 0.00 ? 289 ARG A CB   4  
ATOM   6707  C  CG   . ARG B 2 31  ? 9.779   6.325   -6.207  1.00 0.00 ? 289 ARG A CG   4  
ATOM   6708  C  CD   . ARG B 2 31  ? 9.460   7.284   -5.078  1.00 0.00 ? 289 ARG A CD   4  
ATOM   6709  N  NE   . ARG B 2 31  ? 10.266  8.501   -5.142  1.00 0.00 ? 289 ARG A NE   4  
ATOM   6710  C  CZ   . ARG B 2 31  ? 10.524  9.270   -4.088  1.00 0.00 ? 289 ARG A CZ   4  
ATOM   6711  N  NH1  . ARG B 2 31  ? 10.047  8.945   -2.894  1.00 0.00 ? 289 ARG A NH1  4  
ATOM   6712  N  NH2  . ARG B 2 31  ? 11.263  10.361  -4.228  1.00 0.00 ? 289 ARG A NH2  4  
ATOM   6713  H  H    . ARG B 2 31  ? 8.802   4.096   -8.302  1.00 0.00 ? 289 ARG A H    4  
ATOM   6714  H  HA   . ARG B 2 31  ? 11.024  4.060   -6.565  1.00 0.00 ? 289 ARG A HA   4  
ATOM   6715  H  HB2  . ARG B 2 31  ? 8.190   4.936   -6.288  1.00 0.00 ? 289 ARG A HB2  4  
ATOM   6716  H  HB3  . ARG B 2 31  ? 9.181   4.814   -4.852  1.00 0.00 ? 289 ARG A HB3  4  
ATOM   6717  H  HG2  . ARG B 2 31  ? 10.851  6.241   -6.308  1.00 0.00 ? 289 ARG A HG2  4  
ATOM   6718  H  HG3  . ARG B 2 31  ? 9.355   6.706   -7.124  1.00 0.00 ? 289 ARG A HG3  4  
ATOM   6719  H  HD2  . ARG B 2 31  ? 8.416   7.552   -5.135  1.00 0.00 ? 289 ARG A HD2  4  
ATOM   6720  H  HD3  . ARG B 2 31  ? 9.652   6.780   -4.140  1.00 0.00 ? 289 ARG A HD3  4  
ATOM   6721  H  HE   . ARG B 2 31  ? 10.630  8.758   -6.014  1.00 0.00 ? 289 ARG A HE   4  
ATOM   6722  H  HH11 . ARG B 2 31  ? 9.492   8.121   -2.782  1.00 0.00 ? 289 ARG A HH11 4  
ATOM   6723  H  HH12 . ARG B 2 31  ? 10.244  9.526   -2.103  1.00 0.00 ? 289 ARG A HH12 4  
ATOM   6724  H  HH21 . ARG B 2 31  ? 11.627  10.607  -5.127  1.00 0.00 ? 289 ARG A HH21 4  
ATOM   6725  H  HH22 . ARG B 2 31  ? 11.457  10.939  -3.435  1.00 0.00 ? 289 ARG A HH22 4  
ATOM   6726  N  N    . SER B 2 32  ? 10.871  1.995   -5.257  1.00 0.00 ? 290 SER A N    4  
ATOM   6727  C  CA   . SER B 2 32  ? 10.809  0.755   -4.503  1.00 0.00 ? 290 SER A CA   4  
ATOM   6728  C  C    . SER B 2 32  ? 10.819  1.016   -3.012  1.00 0.00 ? 290 SER A C    4  
ATOM   6729  O  O    . SER B 2 32  ? 11.099  2.127   -2.575  1.00 0.00 ? 290 SER A O    4  
ATOM   6730  C  CB   . SER B 2 32  ? 11.967  -0.159  -4.886  1.00 0.00 ? 290 SER A CB   4  
ATOM   6731  O  OG   . SER B 2 32  ? 12.113  -0.238  -6.290  1.00 0.00 ? 290 SER A OG   4  
ATOM   6732  H  H    . SER B 2 32  ? 11.727  2.451   -5.370  1.00 0.00 ? 290 SER A H    4  
ATOM   6733  H  HA   . SER B 2 32  ? 9.888   0.268   -4.758  1.00 0.00 ? 290 SER A HA   4  
ATOM   6734  H  HB2  . SER B 2 32  ? 12.874  0.225   -4.467  1.00 0.00 ? 290 SER A HB2  4  
ATOM   6735  H  HB3  . SER B 2 32  ? 11.784  -1.150  -4.501  1.00 0.00 ? 290 SER A HB3  4  
ATOM   6736  H  HG   . SER B 2 32  ? 11.823  0.585   -6.689  1.00 0.00 ? 290 SER A HG   4  
ATOM   6737  N  N    . GLY B 2 33  ? 10.476  -0.008  -2.240  1.00 0.00 ? 291 GLY A N    4  
ATOM   6738  C  CA   . GLY B 2 33  ? 10.469  0.132   -0.789  1.00 0.00 ? 291 GLY A CA   4  
ATOM   6739  C  C    . GLY B 2 33  ? 10.501  -1.197  -0.070  1.00 0.00 ? 291 GLY A C    4  
ATOM   6740  O  O    . GLY B 2 33  ? 10.029  -2.195  -0.589  1.00 0.00 ? 291 GLY A O    4  
ATOM   6741  H  H    . GLY B 2 33  ? 10.196  -0.856  -2.662  1.00 0.00 ? 291 GLY A H    4  
ATOM   6742  H  HA2  . GLY B 2 33  ? 11.323  0.711   -0.486  1.00 0.00 ? 291 GLY A HA2  4  
ATOM   6743  H  HA3  . GLY B 2 33  ? 9.574   0.661   -0.499  1.00 0.00 ? 291 GLY A HA3  4  
ATOM   6744  N  N    . HIS B 2 34  ? 11.091  -1.247  1.115   1.00 0.00 ? 292 HIS A N    4  
ATOM   6745  C  CA   . HIS B 2 34  ? 11.073  -2.503  1.857   1.00 0.00 ? 292 HIS A CA   4  
ATOM   6746  C  C    . HIS B 2 34  ? 9.768   -2.543  2.628   1.00 0.00 ? 292 HIS A C    4  
ATOM   6747  O  O    . HIS B 2 34  ? 9.454   -1.595  3.335   1.00 0.00 ? 292 HIS A O    4  
ATOM   6748  C  CB   . HIS B 2 34  ? 12.264  -2.644  2.808   1.00 0.00 ? 292 HIS A CB   4  
ATOM   6749  C  CG   . HIS B 2 34  ? 13.597  -2.613  2.125   1.00 0.00 ? 292 HIS A CG   4  
ATOM   6750  N  ND1  . HIS B 2 34  ? 14.523  -1.609  2.322   1.00 0.00 ? 292 HIS A ND1  4  
ATOM   6751  C  CD2  . HIS B 2 34  ? 14.149  -3.456  1.222   1.00 0.00 ? 292 HIS A CD2  4  
ATOM   6752  C  CE1  . HIS B 2 34  ? 15.588  -1.845  1.575   1.00 0.00 ? 292 HIS A CE1  4  
ATOM   6753  N  NE2  . HIS B 2 34  ? 15.386  -2.960  0.906   1.00 0.00 ? 292 HIS A NE2  4  
ATOM   6754  H  H    . HIS B 2 34  ? 11.533  -0.441  1.490   1.00 0.00 ? 292 HIS A H    4  
ATOM   6755  H  HA   . HIS B 2 34  ? 11.078  -3.308  1.138   1.00 0.00 ? 292 HIS A HA   4  
ATOM   6756  H  HB2  . HIS B 2 34  ? 12.238  -1.842  3.523   1.00 0.00 ? 292 HIS A HB2  4  
ATOM   6757  H  HB3  . HIS B 2 34  ? 12.177  -3.586  3.328   1.00 0.00 ? 292 HIS A HB3  4  
ATOM   6758  H  HD2  . HIS B 2 34  ? 13.666  -4.297  0.752   1.00 0.00 ? 292 HIS A HD2  4  
ATOM   6759  H  HE1  . HIS B 2 34  ? 16.442  -1.198  1.472   1.00 0.00 ? 292 HIS A HE1  4  
ATOM   6760  H  HE2  . HIS B 2 34  ? 16.048  -3.403  0.337   1.00 0.00 ? 292 HIS A HE2  4  
ATOM   6761  N  N    . PRO B 2 35  ? 8.958   -3.612  2.491   1.00 0.00 ? 293 PRO A N    4  
ATOM   6762  C  CA   . PRO B 2 35  ? 7.650   -3.692  3.161   1.00 0.00 ? 293 PRO A CA   4  
ATOM   6763  C  C    . PRO B 2 35  ? 7.753   -3.529  4.674   1.00 0.00 ? 293 PRO A C    4  
ATOM   6764  O  O    . PRO B 2 35  ? 6.750   -3.313  5.354   1.00 0.00 ? 293 PRO A O    4  
ATOM   6765  C  CB   . PRO B 2 35  ? 7.135   -5.071  2.724   1.00 0.00 ? 293 PRO A CB   4  
ATOM   6766  C  CG   . PRO B 2 35  ? 7.822   -5.264  1.418   1.00 0.00 ? 293 PRO A CG   4  
ATOM   6767  C  CD   . PRO B 2 35  ? 9.216   -4.838  1.718   1.00 0.00 ? 293 PRO A CD   4  
ATOM   6768  H  HA   . PRO B 2 35  ? 6.984   -2.926  2.778   1.00 0.00 ? 293 PRO A HA   4  
ATOM   6769  H  HB2  . PRO B 2 35  ? 7.426   -5.819  3.444   1.00 0.00 ? 293 PRO A HB2  4  
ATOM   6770  H  HB3  . PRO B 2 35  ? 6.061   -5.052  2.612   1.00 0.00 ? 293 PRO A HB3  4  
ATOM   6771  H  HG2  . PRO B 2 35  ? 7.790   -6.287  1.107   1.00 0.00 ? 293 PRO A HG2  4  
ATOM   6772  H  HG3  . PRO B 2 35  ? 7.387   -4.627  0.669   1.00 0.00 ? 293 PRO A HG3  4  
ATOM   6773  H  HD2  . PRO B 2 35  ? 9.698   -5.582  2.332   1.00 0.00 ? 293 PRO A HD2  4  
ATOM   6774  H  HD3  . PRO B 2 35  ? 9.778   -4.647  0.816   1.00 0.00 ? 293 PRO A HD3  4  
ATOM   6775  N  N    . THR B 2 36  ? 8.970   -3.628  5.196   1.00 0.00 ? 294 THR A N    4  
ATOM   6776  C  CA   . THR B 2 36  ? 9.205   -3.417  6.618   1.00 0.00 ? 294 THR A CA   4  
ATOM   6777  C  C    . THR B 2 36  ? 9.328   -1.920  6.856   1.00 0.00 ? 294 THR A C    4  
ATOM   6778  O  O    . THR B 2 36  ? 8.983   -1.399  7.917   1.00 0.00 ? 294 THR A O    4  
ATOM   6779  C  CB   . THR B 2 36  ? 10.484  -4.105  7.106   1.00 0.00 ? 294 THR A CB   4  
ATOM   6780  O  OG1  . THR B 2 36  ? 10.532  -5.464  6.655   1.00 0.00 ? 294 THR A OG1  4  
ATOM   6781  C  CG2  . THR B 2 36  ? 10.530  -4.057  8.608   1.00 0.00 ? 294 THR A CG2  4  
ATOM   6782  H  H    . THR B 2 36  ? 9.726   -3.849  4.613   1.00 0.00 ? 294 THR A H    4  
ATOM   6783  H  HA   . THR B 2 36  ? 8.367   -3.798  7.181   1.00 0.00 ? 294 THR A HA   4  
ATOM   6784  H  HB   . THR B 2 36  ? 11.333  -3.566  6.726   1.00 0.00 ? 294 THR A HB   4  
ATOM   6785  H  HG1  . THR B 2 36  ? 10.892  -5.494  5.766   1.00 0.00 ? 294 THR A HG1  4  
ATOM   6786  H  HG21 . THR B 2 36  ? 10.065  -3.142  8.921   1.00 0.00 ? 294 THR A HG21 4  
ATOM   6787  H  HG22 . THR B 2 36  ? 11.557  -4.080  8.944   1.00 0.00 ? 294 THR A HG22 4  
ATOM   6788  H  HG23 . THR B 2 36  ? 9.992   -4.898  9.019   1.00 0.00 ? 294 THR A HG23 4  
ATOM   6789  N  N    . CYS B 2 37  ? 9.831   -1.252  5.828   1.00 0.00 ? 295 CYS A N    4  
ATOM   6790  C  CA   . CYS B 2 37  ? 10.014  0.190   5.821   1.00 0.00 ? 295 CYS A CA   4  
ATOM   6791  C  C    . CYS B 2 37  ? 8.719   0.875   5.424   1.00 0.00 ? 295 CYS A C    4  
ATOM   6792  O  O    . CYS B 2 37  ? 8.499   2.057   5.689   1.00 0.00 ? 295 CYS A O    4  
ATOM   6793  C  CB   . CYS B 2 37  ? 11.088  0.542   4.799   1.00 0.00 ? 295 CYS A CB   4  
ATOM   6794  S  SG   . CYS B 2 37  ? 12.683  -0.258  5.123   1.00 0.00 ? 295 CYS A SG   4  
ATOM   6795  H  H    . CYS B 2 37  ? 10.103  -1.758  5.037   1.00 0.00 ? 295 CYS A H    4  
ATOM   6796  H  HA   . CYS B 2 37  ? 10.321  0.509   6.803   1.00 0.00 ? 295 CYS A HA   4  
ATOM   6797  H  HB2  . CYS B 2 37  ? 10.759  0.230   3.824   1.00 0.00 ? 295 CYS A HB2  4  
ATOM   6798  H  HB3  . CYS B 2 37  ? 11.235  1.599   4.789   1.00 0.00 ? 295 CYS A HB3  4  
ATOM   6799  N  N    . LEU B 2 38  ? 7.877   0.092   4.783   1.00 0.00 ? 296 LEU A N    4  
ATOM   6800  C  CA   . LEU B 2 38  ? 6.593   0.543   4.279   1.00 0.00 ? 296 LEU A CA   4  
ATOM   6801  C  C    . LEU B 2 38  ? 5.503   0.312   5.302   1.00 0.00 ? 296 LEU A C    4  
ATOM   6802  O  O    . LEU B 2 38  ? 4.402   0.853   5.186   1.00 0.00 ? 296 LEU A O    4  
ATOM   6803  C  CB   . LEU B 2 38  ? 6.266   -0.223  3.005   1.00 0.00 ? 296 LEU A CB   4  
ATOM   6804  C  CG   . LEU B 2 38  ? 7.230   -0.010  1.845   1.00 0.00 ? 296 LEU A CG   4  
ATOM   6805  C  CD1  . LEU B 2 38  ? 7.354   -1.278  1.046   1.00 0.00 ? 296 LEU A CD1  4  
ATOM   6806  C  CD2  . LEU B 2 38  ? 6.763   1.118   0.951   1.00 0.00 ? 296 LEU A CD2  4  
ATOM   6807  H  H    . LEU B 2 38  ? 8.127   -0.844  4.656   1.00 0.00 ? 296 LEU A H    4  
ATOM   6808  H  HA   . LEU B 2 38  ? 6.659   1.596   4.058   1.00 0.00 ? 296 LEU A HA   4  
ATOM   6809  H  HB2  . LEU B 2 38  ? 6.258   -1.277  3.244   1.00 0.00 ? 296 LEU A HB2  4  
ATOM   6810  H  HB3  . LEU B 2 38  ? 5.278   0.055   2.679   1.00 0.00 ? 296 LEU A HB3  4  
ATOM   6811  H  HG   . LEU B 2 38  ? 8.206   0.239   2.223   1.00 0.00 ? 296 LEU A HG   4  
ATOM   6812  H  HD11 . LEU B 2 38  ? 7.711   -1.058  0.057   1.00 0.00 ? 296 LEU A HD11 4  
ATOM   6813  H  HD12 . LEU B 2 38  ? 6.395   -1.756  0.983   1.00 0.00 ? 296 LEU A HD12 4  
ATOM   6814  H  HD13 . LEU B 2 38  ? 8.045   -1.936  1.531   1.00 0.00 ? 296 LEU A HD13 4  
ATOM   6815  H  HD21 . LEU B 2 38  ? 7.073   0.910   -0.057  1.00 0.00 ? 296 LEU A HD21 4  
ATOM   6816  H  HD22 . LEU B 2 38  ? 7.203   2.048   1.282   1.00 0.00 ? 296 LEU A HD22 4  
ATOM   6817  H  HD23 . LEU B 2 38  ? 5.687   1.191   0.992   1.00 0.00 ? 296 LEU A HD23 4  
ATOM   6818  N  N    . GLN B 2 39  ? 5.819   -0.518  6.288   1.00 0.00 ? 297 GLN A N    4  
ATOM   6819  C  CA   . GLN B 2 39  ? 4.887   -0.844  7.356   1.00 0.00 ? 297 GLN A CA   4  
ATOM   6820  C  C    . GLN B 2 39  ? 3.831   -1.824  6.858   1.00 0.00 ? 297 GLN A C    4  
ATOM   6821  O  O    . GLN B 2 39  ? 2.737   -1.916  7.414   1.00 0.00 ? 297 GLN A O    4  
ATOM   6822  C  CB   . GLN B 2 39  ? 4.227   0.430   7.896   1.00 0.00 ? 297 GLN A CB   4  
ATOM   6823  C  CG   . GLN B 2 39  ? 4.192   0.513   9.402   1.00 0.00 ? 297 GLN A CG   4  
ATOM   6824  C  CD   . GLN B 2 39  ? 3.628   1.819   9.903   1.00 0.00 ? 297 GLN A CD   4  
ATOM   6825  O  OE1  . GLN B 2 39  ? 4.338   2.816   10.042  1.00 0.00 ? 297 GLN A OE1  4  
ATOM   6826  N  NE2  . GLN B 2 39  ? 2.348   1.803   10.187  1.00 0.00 ? 297 GLN A NE2  4  
ATOM   6827  H  H    . GLN B 2 39  ? 6.706   -0.938  6.290   1.00 0.00 ? 297 GLN A H    4  
ATOM   6828  H  HA   . GLN B 2 39  ? 5.456   -1.311  8.142   1.00 0.00 ? 297 GLN A HA   4  
ATOM   6829  H  HB2  . GLN B 2 39  ? 4.777   1.284   7.534   1.00 0.00 ? 297 GLN A HB2  4  
ATOM   6830  H  HB3  . GLN B 2 39  ? 3.212   0.481   7.528   1.00 0.00 ? 297 GLN A HB3  4  
ATOM   6831  H  HG2  . GLN B 2 39  ? 3.586   -0.294  9.785   1.00 0.00 ? 297 GLN A HG2  4  
ATOM   6832  H  HG3  . GLN B 2 39  ? 5.183   0.416   9.765   1.00 0.00 ? 297 GLN A HG3  4  
ATOM   6833  H  HE21 . GLN B 2 39  ? 1.876   0.961   10.056  1.00 0.00 ? 297 GLN A HE21 4  
ATOM   6834  H  HE22 . GLN B 2 39  ? 1.929   2.623   10.517  1.00 0.00 ? 297 GLN A HE22 4  
ATOM   6835  N  N    . PHE B 2 40  ? 4.177   -2.556  5.802   1.00 0.00 ? 298 PHE A N    4  
ATOM   6836  C  CA   . PHE B 2 40  ? 3.270   -3.530  5.206   1.00 0.00 ? 298 PHE A CA   4  
ATOM   6837  C  C    . PHE B 2 40  ? 3.069   -4.746  6.088   1.00 0.00 ? 298 PHE A C    4  
ATOM   6838  O  O    . PHE B 2 40  ? 3.707   -4.907  7.129   1.00 0.00 ? 298 PHE A O    4  
ATOM   6839  C  CB   . PHE B 2 40  ? 3.811   -4.033  3.862   1.00 0.00 ? 298 PHE A CB   4  
ATOM   6840  C  CG   . PHE B 2 40  ? 3.786   -3.036  2.743   1.00 0.00 ? 298 PHE A CG   4  
ATOM   6841  C  CD1  . PHE B 2 40  ? 3.262   -1.761  2.898   1.00 0.00 ? 298 PHE A CD1  4  
ATOM   6842  C  CD2  . PHE B 2 40  ? 4.298   -3.397  1.517   1.00 0.00 ? 298 PHE A CD2  4  
ATOM   6843  C  CE1  . PHE B 2 40  ? 3.260   -0.876  1.837   1.00 0.00 ? 298 PHE A CE1  4  
ATOM   6844  C  CE2  . PHE B 2 40  ? 4.298   -2.519  0.464   1.00 0.00 ? 298 PHE A CE2  4  
ATOM   6845  C  CZ   . PHE B 2 40  ? 3.784   -1.267  0.621   1.00 0.00 ? 298 PHE A CZ   4  
ATOM   6846  H  H    . PHE B 2 40  ? 5.066   -2.433  5.412   1.00 0.00 ? 298 PHE A H    4  
ATOM   6847  H  HA   . PHE B 2 40  ? 2.319   -3.050  5.043   1.00 0.00 ? 298 PHE A HA   4  
ATOM   6848  H  HB2  . PHE B 2 40  ? 4.840   -4.362  3.984   1.00 0.00 ? 298 PHE A HB2  4  
ATOM   6849  H  HB3  . PHE B 2 40  ? 3.214   -4.882  3.553   1.00 0.00 ? 298 PHE A HB3  4  
ATOM   6850  H  HD1  . PHE B 2 40  ? 2.853   -1.462  3.852   1.00 0.00 ? 298 PHE A HD1  4  
ATOM   6851  H  HD2  . PHE B 2 40  ? 4.699   -4.385  1.391   1.00 0.00 ? 298 PHE A HD2  4  
ATOM   6852  H  HE1  . PHE B 2 40  ? 2.853   0.118   1.960   1.00 0.00 ? 298 PHE A HE1  4  
ATOM   6853  H  HE2  . PHE B 2 40  ? 4.704   -2.808  -0.487  1.00 0.00 ? 298 PHE A HE2  4  
ATOM   6854  H  HZ   . PHE B 2 40  ? 3.801   -0.594  -0.210  1.00 0.00 ? 298 PHE A HZ   4  
ATOM   6855  N  N    . THR B 2 41  ? 2.163   -5.599  5.637   1.00 0.00 ? 299 THR A N    4  
ATOM   6856  C  CA   . THR B 2 41  ? 1.872   -6.853  6.295   1.00 0.00 ? 299 THR A CA   4  
ATOM   6857  C  C    . THR B 2 41  ? 2.503   -7.956  5.464   1.00 0.00 ? 299 THR A C    4  
ATOM   6858  O  O    . THR B 2 41  ? 2.997   -7.686  4.374   1.00 0.00 ? 299 THR A O    4  
ATOM   6859  C  CB   . THR B 2 41  ? 0.361   -7.102  6.417   1.00 0.00 ? 299 THR A CB   4  
ATOM   6860  O  OG1  . THR B 2 41  ? -0.331  -5.866  6.633   1.00 0.00 ? 299 THR A OG1  4  
ATOM   6861  C  CG2  . THR B 2 41  ? 0.081   -8.049  7.558   1.00 0.00 ? 299 THR A CG2  4  
ATOM   6862  H  H    . THR B 2 41  ? 1.668   -5.371  4.822   1.00 0.00 ? 299 THR A H    4  
ATOM   6863  H  HA   . THR B 2 41  ? 2.312   -6.845  7.283   1.00 0.00 ? 299 THR A HA   4  
ATOM   6864  H  HB   . THR B 2 41  ? 0.011   -7.556  5.505   1.00 0.00 ? 299 THR A HB   4  
ATOM   6865  H  HG1  . THR B 2 41  ? -0.043  -5.219  5.984   1.00 0.00 ? 299 THR A HG1  4  
ATOM   6866  H  HG21 . THR B 2 41  ? 0.691   -8.924  7.433   1.00 0.00 ? 299 THR A HG21 4  
ATOM   6867  H  HG22 . THR B 2 41  ? -0.962  -8.327  7.549   1.00 0.00 ? 299 THR A HG22 4  
ATOM   6868  H  HG23 . THR B 2 41  ? 0.323   -7.569  8.493   1.00 0.00 ? 299 THR A HG23 4  
ATOM   6869  N  N    . LEU B 2 42  ? 2.503   -9.187  5.946   1.00 0.00 ? 300 LEU A N    4  
ATOM   6870  C  CA   . LEU B 2 42  ? 3.107   -10.260 5.172   1.00 0.00 ? 300 LEU A CA   4  
ATOM   6871  C  C    . LEU B 2 42  ? 2.422   -10.423 3.829   1.00 0.00 ? 300 LEU A C    4  
ATOM   6872  O  O    . LEU B 2 42  ? 3.032   -10.181 2.792   1.00 0.00 ? 300 LEU A O    4  
ATOM   6873  C  CB   . LEU B 2 42  ? 3.099   -11.570 5.926   1.00 0.00 ? 300 LEU A CB   4  
ATOM   6874  C  CG   . LEU B 2 42  ? 4.438   -12.307 5.908   1.00 0.00 ? 300 LEU A CG   4  
ATOM   6875  C  CD1  . LEU B 2 42  ? 4.928   -12.496 4.484   1.00 0.00 ? 300 LEU A CD1  4  
ATOM   6876  C  CD2  . LEU B 2 42  ? 5.460   -11.541 6.725   1.00 0.00 ? 300 LEU A CD2  4  
ATOM   6877  H  H    . LEU B 2 42  ? 2.099   -9.376  6.819   1.00 0.00 ? 300 LEU A H    4  
ATOM   6878  H  HA   . LEU B 2 42  ? 4.127   -9.992  4.992   1.00 0.00 ? 300 LEU A HA   4  
ATOM   6879  H  HB2  . LEU B 2 42  ? 2.834   -11.367 6.946   1.00 0.00 ? 300 LEU A HB2  4  
ATOM   6880  H  HB3  . LEU B 2 42  ? 2.356   -12.204 5.486   1.00 0.00 ? 300 LEU A HB3  4  
ATOM   6881  H  HG   . LEU B 2 42  ? 4.313   -13.277 6.343   1.00 0.00 ? 300 LEU A HG   4  
ATOM   6882  H  HD11 . LEU B 2 42  ? 4.082   -12.646 3.836   1.00 0.00 ? 300 LEU A HD11 4  
ATOM   6883  H  HD12 . LEU B 2 42  ? 5.577   -13.358 4.437   1.00 0.00 ? 300 LEU A HD12 4  
ATOM   6884  H  HD13 . LEU B 2 42  ? 5.473   -11.617 4.170   1.00 0.00 ? 300 LEU A HD13 4  
ATOM   6885  H  HD21 . LEU B 2 42  ? 5.367   -10.487 6.504   1.00 0.00 ? 300 LEU A HD21 4  
ATOM   6886  H  HD22 . LEU B 2 42  ? 6.453   -11.878 6.470   1.00 0.00 ? 300 LEU A HD22 4  
ATOM   6887  H  HD23 . LEU B 2 42  ? 5.279   -11.705 7.777   1.00 0.00 ? 300 LEU A HD23 4  
ATOM   6888  N  N    . ASN B 2 43  ? 1.152   -10.818 3.845   1.00 0.00 ? 301 ASN A N    4  
ATOM   6889  C  CA   . ASN B 2 43  ? 0.410   -11.012 2.604   1.00 0.00 ? 301 ASN A CA   4  
ATOM   6890  C  C    . ASN B 2 43  ? 0.640   -9.837  1.658   1.00 0.00 ? 301 ASN A C    4  
ATOM   6891  O  O    . ASN B 2 43  ? 0.829   -10.033 0.463   1.00 0.00 ? 301 ASN A O    4  
ATOM   6892  C  CB   . ASN B 2 43  ? -1.076  -11.195 2.884   1.00 0.00 ? 301 ASN A CB   4  
ATOM   6893  C  CG   . ASN B 2 43  ? -1.804  -11.872 1.747   1.00 0.00 ? 301 ASN A CG   4  
ATOM   6894  O  OD1  . ASN B 2 43  ? -1.396  -11.787 0.589   1.00 0.00 ? 301 ASN A OD1  4  
ATOM   6895  N  ND2  . ASN B 2 43  ? -2.898  -12.546 2.074   1.00 0.00 ? 301 ASN A ND2  4  
ATOM   6896  H  H    . ASN B 2 43  ? 0.707   -10.982 4.703   1.00 0.00 ? 301 ASN A H    4  
ATOM   6897  H  HA   . ASN B 2 43  ? 0.795   -11.902 2.140   1.00 0.00 ? 301 ASN A HA   4  
ATOM   6898  H  HB2  . ASN B 2 43  ? -1.203  -11.794 3.771   1.00 0.00 ? 301 ASN A HB2  4  
ATOM   6899  H  HB3  . ASN B 2 43  ? -1.516  -10.234 3.039   1.00 0.00 ? 301 ASN A HB3  4  
ATOM   6900  H  HD21 . ASN B 2 43  ? -3.168  -12.569 3.017   1.00 0.00 ? 301 ASN A HD21 4  
ATOM   6901  H  HD22 . ASN B 2 43  ? -3.391  -12.991 1.361   1.00 0.00 ? 301 ASN A HD22 4  
ATOM   6902  N  N    . MET B 2 44  ? 0.605   -8.620  2.197   1.00 0.00 ? 302 MET A N    4  
ATOM   6903  C  CA   . MET B 2 44  ? 0.881   -7.420  1.407   1.00 0.00 ? 302 MET A CA   4  
ATOM   6904  C  C    . MET B 2 44  ? 2.213   -7.589  0.742   1.00 0.00 ? 302 MET A C    4  
ATOM   6905  O  O    . MET B 2 44  ? 2.303   -7.705  -0.466  1.00 0.00 ? 302 MET A O    4  
ATOM   6906  C  CB   . MET B 2 44  ? 0.953   -6.216  2.312   1.00 0.00 ? 302 MET A CB   4  
ATOM   6907  C  CG   . MET B 2 44  ? 1.374   -4.930  1.638   1.00 0.00 ? 302 MET A CG   4  
ATOM   6908  S  SD   . MET B 2 44  ? 0.177   -4.310  0.459   1.00 0.00 ? 302 MET A SD   4  
ATOM   6909  C  CE   . MET B 2 44  ? 0.618   -2.584  0.459   1.00 0.00 ? 302 MET A CE   4  
ATOM   6910  H  H    . MET B 2 44  ? 0.388   -8.525  3.148   1.00 0.00 ? 302 MET A H    4  
ATOM   6911  H  HA   . MET B 2 44  ? 0.113   -7.274  0.668   1.00 0.00 ? 302 MET A HA   4  
ATOM   6912  H  HB2  . MET B 2 44  ? -0.003  -6.062  2.750   1.00 0.00 ? 302 MET A HB2  4  
ATOM   6913  H  HB3  . MET B 2 44  ? 1.655   -6.428  3.083   1.00 0.00 ? 302 MET A HB3  4  
ATOM   6914  H  HG2  . MET B 2 44  ? 1.509   -4.184  2.401   1.00 0.00 ? 302 MET A HG2  4  
ATOM   6915  H  HG3  . MET B 2 44  ? 2.312   -5.091  1.126   1.00 0.00 ? 302 MET A HG3  4  
ATOM   6916  H  HE1  . MET B 2 44  ? 0.879   -2.293  1.459   1.00 0.00 ? 302 MET A HE1  4  
ATOM   6917  H  HE2  . MET B 2 44  ? -0.220  -1.994  0.118   1.00 0.00 ? 302 MET A HE2  4  
ATOM   6918  H  HE3  . MET B 2 44  ? 1.463   -2.426  -0.194  1.00 0.00 ? 302 MET A HE3  4  
ATOM   6919  N  N    . THR B 2 45  ? 3.236   -7.605  1.578   1.00 0.00 ? 303 THR A N    4  
ATOM   6920  C  CA   . THR B 2 45  ? 4.599   -7.789  1.145   1.00 0.00 ? 303 THR A CA   4  
ATOM   6921  C  C    . THR B 2 45  ? 4.650   -8.757  -0.031  1.00 0.00 ? 303 THR A C    4  
ATOM   6922  O  O    . THR B 2 45  ? 5.035   -8.389  -1.141  1.00 0.00 ? 303 THR A O    4  
ATOM   6923  C  CB   . THR B 2 45  ? 5.454   -8.326  2.323   1.00 0.00 ? 303 THR A CB   4  
ATOM   6924  O  OG1  . THR B 2 45  ? 5.358   -7.432  3.437   1.00 0.00 ? 303 THR A OG1  4  
ATOM   6925  C  CG2  . THR B 2 45  ? 6.906   -8.464  1.921   1.00 0.00 ? 303 THR A CG2  4  
ATOM   6926  H  H    . THR B 2 45  ? 3.065   -7.474  2.527   1.00 0.00 ? 303 THR A H    4  
ATOM   6927  H  HA   . THR B 2 45  ? 4.994   -6.831  0.841   1.00 0.00 ? 303 THR A HA   4  
ATOM   6928  H  HB   . THR B 2 45  ? 5.079   -9.303  2.625   1.00 0.00 ? 303 THR A HB   4  
ATOM   6929  H  HG1  . THR B 2 45  ? 6.236   -7.258  3.784   1.00 0.00 ? 303 THR A HG1  4  
ATOM   6930  H  HG21 . THR B 2 45  ? 7.135   -7.715  1.179   1.00 0.00 ? 303 THR A HG21 4  
ATOM   6931  H  HG22 . THR B 2 45  ? 7.076   -9.448  1.511   1.00 0.00 ? 303 THR A HG22 4  
ATOM   6932  H  HG23 . THR B 2 45  ? 7.536   -8.319  2.786   1.00 0.00 ? 303 THR A HG23 4  
ATOM   6933  N  N    . GLU B 2 46  ? 4.193   -9.973  0.213   1.00 0.00 ? 304 GLU A N    4  
ATOM   6934  C  CA   . GLU B 2 46  ? 4.187   -11.028 -0.793  1.00 0.00 ? 304 GLU A CA   4  
ATOM   6935  C  C    . GLU B 2 46  ? 3.381   -10.653 -2.039  1.00 0.00 ? 304 GLU A C    4  
ATOM   6936  O  O    . GLU B 2 46  ? 3.742   -11.025 -3.155  1.00 0.00 ? 304 GLU A O    4  
ATOM   6937  C  CB   . GLU B 2 46  ? 3.599   -12.295 -0.184  1.00 0.00 ? 304 GLU A CB   4  
ATOM   6938  C  CG   . GLU B 2 46  ? 4.119   -12.576 1.210   1.00 0.00 ? 304 GLU A CG   4  
ATOM   6939  C  CD   . GLU B 2 46  ? 3.873   -14.006 1.653   1.00 0.00 ? 304 GLU A CD   4  
ATOM   6940  O  OE1  . GLU B 2 46  ? 2.768   -14.288 2.163   1.00 0.00 ? 304 GLU A OE1  4  
ATOM   6941  O  OE2  . GLU B 2 46  ? 4.785   -14.844 1.488   1.00 0.00 ? 304 GLU A OE2  4  
ATOM   6942  H  H    . GLU B 2 46  ? 3.845   -10.174 1.105   1.00 0.00 ? 304 GLU A H    4  
ATOM   6943  H  HA   . GLU B 2 46  ? 5.210   -11.219 -1.075  1.00 0.00 ? 304 GLU A HA   4  
ATOM   6944  H  HB2  . GLU B 2 46  ? 2.523   -12.188 -0.129  1.00 0.00 ? 304 GLU A HB2  4  
ATOM   6945  H  HB3  . GLU B 2 46  ? 3.841   -13.136 -0.816  1.00 0.00 ? 304 GLU A HB3  4  
ATOM   6946  H  HG2  . GLU B 2 46  ? 5.176   -12.382 1.226   1.00 0.00 ? 304 GLU A HG2  4  
ATOM   6947  H  HG3  . GLU B 2 46  ? 3.629   -11.910 1.902   1.00 0.00 ? 304 GLU A HG3  4  
ATOM   6948  N  N    . ALA B 2 47  ? 2.294   -9.915  -1.842  1.00 0.00 ? 305 ALA A N    4  
ATOM   6949  C  CA   . ALA B 2 47  ? 1.413   -9.529  -2.947  1.00 0.00 ? 305 ALA A CA   4  
ATOM   6950  C  C    . ALA B 2 47  ? 1.951   -8.359  -3.759  1.00 0.00 ? 305 ALA A C    4  
ATOM   6951  O  O    . ALA B 2 47  ? 1.723   -8.276  -4.963  1.00 0.00 ? 305 ALA A O    4  
ATOM   6952  C  CB   . ALA B 2 47  ? 0.026   -9.176  -2.421  1.00 0.00 ? 305 ALA A CB   4  
ATOM   6953  H  H    . ALA B 2 47  ? 2.082   -9.613  -0.928  1.00 0.00 ? 305 ALA A H    4  
ATOM   6954  H  HA   . ALA B 2 47  ? 1.308   -10.383 -3.599  1.00 0.00 ? 305 ALA A HA   4  
ATOM   6955  H  HB1  . ALA B 2 47  ? -0.080  -8.094  -2.362  1.00 0.00 ? 305 ALA A HB1  4  
ATOM   6956  H  HB2  . ALA B 2 47  ? -0.105  -9.603  -1.439  1.00 0.00 ? 305 ALA A HB2  4  
ATOM   6957  H  HB3  . ALA B 2 47  ? -0.724  -9.574  -3.088  1.00 0.00 ? 305 ALA A HB3  4  
ATOM   6958  N  N    . VAL B 2 48  ? 2.675   -7.473  -3.100  1.00 0.00 ? 306 VAL A N    4  
ATOM   6959  C  CA   . VAL B 2 48  ? 3.193   -6.281  -3.744  1.00 0.00 ? 306 VAL A CA   4  
ATOM   6960  C  C    . VAL B 2 48  ? 4.514   -6.510  -4.476  1.00 0.00 ? 306 VAL A C    4  
ATOM   6961  O  O    . VAL B 2 48  ? 4.912   -5.695  -5.309  1.00 0.00 ? 306 VAL A O    4  
ATOM   6962  C  CB   . VAL B 2 48  ? 3.343   -5.136  -2.735  1.00 0.00 ? 306 VAL A CB   4  
ATOM   6963  C  CG1  . VAL B 2 48  ? 2.013   -4.499  -2.463  1.00 0.00 ? 306 VAL A CG1  4  
ATOM   6964  C  CG2  . VAL B 2 48  ? 3.959   -5.584  -1.431  1.00 0.00 ? 306 VAL A CG2  4  
ATOM   6965  H  H    . VAL B 2 48  ? 2.877   -7.629  -2.159  1.00 0.00 ? 306 VAL A H    4  
ATOM   6966  H  HA   . VAL B 2 48  ? 2.457   -5.969  -4.470  1.00 0.00 ? 306 VAL A HA   4  
ATOM   6967  H  HB   . VAL B 2 48  ? 3.982   -4.398  -3.163  1.00 0.00 ? 306 VAL A HB   4  
ATOM   6968  H  HG11 . VAL B 2 48  ? 2.186   -3.529  -2.030  1.00 0.00 ? 306 VAL A HG11 4  
ATOM   6969  H  HG12 . VAL B 2 48  ? 1.449   -5.112  -1.774  1.00 0.00 ? 306 VAL A HG12 4  
ATOM   6970  H  HG13 . VAL B 2 48  ? 1.465   -4.390  -3.386  1.00 0.00 ? 306 VAL A HG13 4  
ATOM   6971  H  HG21 . VAL B 2 48  ? 4.824   -4.977  -1.236  1.00 0.00 ? 306 VAL A HG21 4  
ATOM   6972  H  HG22 . VAL B 2 48  ? 4.247   -6.618  -1.499  1.00 0.00 ? 306 VAL A HG22 4  
ATOM   6973  H  HG23 . VAL B 2 48  ? 3.242   -5.454  -0.627  1.00 0.00 ? 306 VAL A HG23 4  
ATOM   6974  N  N    . LYS B 2 49  ? 5.194   -7.606  -4.169  1.00 0.00 ? 307 LYS A N    4  
ATOM   6975  C  CA   . LYS B 2 49  ? 6.461   -7.919  -4.824  1.00 0.00 ? 307 LYS A CA   4  
ATOM   6976  C  C    . LYS B 2 49  ? 6.241   -8.596  -6.168  1.00 0.00 ? 307 LYS A C    4  
ATOM   6977  O  O    . LYS B 2 49  ? 7.170   -8.736  -6.963  1.00 0.00 ? 307 LYS A O    4  
ATOM   6978  C  CB   . LYS B 2 49  ? 7.287   -8.833  -3.951  1.00 0.00 ? 307 LYS A CB   4  
ATOM   6979  C  CG   . LYS B 2 49  ? 7.987   -8.109  -2.820  1.00 0.00 ? 307 LYS A CG   4  
ATOM   6980  C  CD   . LYS B 2 49  ? 8.457   -9.083  -1.762  1.00 0.00 ? 307 LYS A CD   4  
ATOM   6981  C  CE   . LYS B 2 49  ? 7.298   -9.839  -1.161  1.00 0.00 ? 307 LYS A CE   4  
ATOM   6982  N  NZ   . LYS B 2 49  ? 7.602   -11.285 -0.976  1.00 0.00 ? 307 LYS A NZ   4  
ATOM   6983  H  H    . LYS B 2 49  ? 4.842   -8.214  -3.483  1.00 0.00 ? 307 LYS A H    4  
ATOM   6984  H  HA   . LYS B 2 49  ? 7.007   -7.005  -4.964  1.00 0.00 ? 307 LYS A HA   4  
ATOM   6985  H  HB2  . LYS B 2 49  ? 6.635   -9.574  -3.530  1.00 0.00 ? 307 LYS A HB2  4  
ATOM   6986  H  HB3  . LYS B 2 49  ? 8.031   -9.322  -4.559  1.00 0.00 ? 307 LYS A HB3  4  
ATOM   6987  H  HG2  . LYS B 2 49  ? 8.841   -7.581  -3.217  1.00 0.00 ? 307 LYS A HG2  4  
ATOM   6988  H  HG3  . LYS B 2 49  ? 7.300   -7.405  -2.376  1.00 0.00 ? 307 LYS A HG3  4  
ATOM   6989  H  HD2  . LYS B 2 49  ? 9.137   -9.789  -2.212  1.00 0.00 ? 307 LYS A HD2  4  
ATOM   6990  H  HD3  . LYS B 2 49  ? 8.961   -8.537  -0.979  1.00 0.00 ? 307 LYS A HD3  4  
ATOM   6991  H  HE2  . LYS B 2 49  ? 7.065   -9.403  -0.210  1.00 0.00 ? 307 LYS A HE2  4  
ATOM   6992  H  HE3  . LYS B 2 49  ? 6.444   -9.733  -1.813  1.00 0.00 ? 307 LYS A HE3  4  
ATOM   6993  H  HZ1  . LYS B 2 49  ? 8.415   -11.401 -0.337  1.00 0.00 ? 307 LYS A HZ1  4  
ATOM   6994  H  HZ2  . LYS B 2 49  ? 7.830   -11.722 -1.891  1.00 0.00 ? 307 LYS A HZ2  4  
ATOM   6995  H  HZ3  . LYS B 2 49  ? 6.780   -11.773 -0.567  1.00 0.00 ? 307 LYS A HZ3  4  
ATOM   6996  N  N    . THR B 2 50  ? 5.006   -9.015  -6.419  1.00 0.00 ? 308 THR A N    4  
ATOM   6997  C  CA   . THR B 2 50  ? 4.681   -9.712  -7.653  1.00 0.00 ? 308 THR A CA   4  
ATOM   6998  C  C    . THR B 2 50  ? 3.916   -8.835  -8.632  1.00 0.00 ? 308 THR A C    4  
ATOM   6999  O  O    . THR B 2 50  ? 4.292   -8.726  -9.799  1.00 0.00 ? 308 THR A O    4  
ATOM   7000  C  CB   . THR B 2 50  ? 3.853   -10.973 -7.368  1.00 0.00 ? 308 THR A CB   4  
ATOM   7001  O  OG1  . THR B 2 50  ? 2.498   -10.620 -7.064  1.00 0.00 ? 308 THR A OG1  4  
ATOM   7002  C  CG2  . THR B 2 50  ? 4.458   -11.724 -6.202  1.00 0.00 ? 308 THR A CG2  4  
ATOM   7003  H  H    . THR B 2 50  ? 4.300   -8.851  -5.759  1.00 0.00 ? 308 THR A H    4  
ATOM   7004  H  HA   . THR B 2 50  ? 5.608   -10.022 -8.107  1.00 0.00 ? 308 THR A HA   4  
ATOM   7005  H  HB   . THR B 2 50  ? 3.872   -11.611 -8.240  1.00 0.00 ? 308 THR A HB   4  
ATOM   7006  H  HG1  . THR B 2 50  ? 1.905   -11.272 -7.444  1.00 0.00 ? 308 THR A HG1  4  
ATOM   7007  H  HG21 . THR B 2 50  ? 4.958   -11.015 -5.558  1.00 0.00 ? 308 THR A HG21 4  
ATOM   7008  H  HG22 . THR B 2 50  ? 5.173   -12.448 -6.567  1.00 0.00 ? 308 THR A HG22 4  
ATOM   7009  H  HG23 . THR B 2 50  ? 3.679   -12.228 -5.650  1.00 0.00 ? 308 THR A HG23 4  
ATOM   7010  N  N    . TYR B 2 51  ? 2.844   -8.210  -8.160  1.00 0.00 ? 309 TYR A N    4  
ATOM   7011  C  CA   . TYR B 2 51  ? 2.032   -7.371  -9.029  1.00 0.00 ? 309 TYR A CA   4  
ATOM   7012  C  C    . TYR B 2 51  ? 2.402   -5.892  -8.901  1.00 0.00 ? 309 TYR A C    4  
ATOM   7013  O  O    . TYR B 2 51  ? 3.422   -5.544  -8.306  1.00 0.00 ? 309 TYR A O    4  
ATOM   7014  C  CB   . TYR B 2 51  ? 0.539   -7.632  -8.761  1.00 0.00 ? 309 TYR A CB   4  
ATOM   7015  C  CG   . TYR B 2 51  ? -0.181  -6.597  -7.933  1.00 0.00 ? 309 TYR A CG   4  
ATOM   7016  C  CD1  . TYR B 2 51  ? 0.234   -6.292  -6.651  1.00 0.00 ? 309 TYR A CD1  4  
ATOM   7017  C  CD2  . TYR B 2 51  ? -1.298  -5.941  -8.436  1.00 0.00 ? 309 TYR A CD2  4  
ATOM   7018  C  CE1  . TYR B 2 51  ? -0.437  -5.367  -5.892  1.00 0.00 ? 309 TYR A CE1  4  
ATOM   7019  C  CE2  . TYR B 2 51  ? -1.976  -5.005  -7.681  1.00 0.00 ? 309 TYR A CE2  4  
ATOM   7020  C  CZ   . TYR B 2 51  ? -1.540  -4.722  -6.406  1.00 0.00 ? 309 TYR A CZ   4  
ATOM   7021  O  OH   . TYR B 2 51  ? -2.210  -3.794  -5.643  1.00 0.00 ? 309 TYR A OH   4  
ATOM   7022  H  H    . TYR B 2 51  ? 2.595   -8.315  -7.214  1.00 0.00 ? 309 TYR A H    4  
ATOM   7023  H  HA   . TYR B 2 51  ? 2.248   -7.677  -10.043 1.00 0.00 ? 309 TYR A HA   4  
ATOM   7024  H  HB2  . TYR B 2 51  ? 0.029   -7.692  -9.702  1.00 0.00 ? 309 TYR A HB2  4  
ATOM   7025  H  HB3  . TYR B 2 51  ? 0.442   -8.583  -8.255  1.00 0.00 ? 309 TYR A HB3  4  
ATOM   7026  H  HD1  . TYR B 2 51  ? 1.104   -6.785  -6.248  1.00 0.00 ? 309 TYR A HD1  4  
ATOM   7027  H  HD2  . TYR B 2 51  ? -1.635  -6.170  -9.436  1.00 0.00 ? 309 TYR A HD2  4  
ATOM   7028  H  HE1  . TYR B 2 51  ? -0.096  -5.154  -4.900  1.00 0.00 ? 309 TYR A HE1  4  
ATOM   7029  H  HE2  . TYR B 2 51  ? -2.840  -4.504  -8.088  1.00 0.00 ? 309 TYR A HE2  4  
ATOM   7030  H  HH   . TYR B 2 51  ? -1.576  -3.229  -5.197  1.00 0.00 ? 309 TYR A HH   4  
ATOM   7031  N  N    . LYS B 2 52  ? 1.564   -5.034  -9.469  1.00 0.00 ? 310 LYS A N    4  
ATOM   7032  C  CA   . LYS B 2 52  ? 1.798   -3.600  -9.469  1.00 0.00 ? 310 LYS A CA   4  
ATOM   7033  C  C    . LYS B 2 52  ? 1.500   -2.985  -8.119  1.00 0.00 ? 310 LYS A C    4  
ATOM   7034  O  O    . LYS B 2 52  ? 0.385   -2.517  -7.884  1.00 0.00 ? 310 LYS A O    4  
ATOM   7035  C  CB   . LYS B 2 52  ? 0.929   -2.921  -10.509 1.00 0.00 ? 310 LYS A CB   4  
ATOM   7036  C  CG   . LYS B 2 52  ? 0.692   -3.763  -11.703 1.00 0.00 ? 310 LYS A CG   4  
ATOM   7037  C  CD   . LYS B 2 52  ? 1.539   -3.313  -12.833 1.00 0.00 ? 310 LYS A CD   4  
ATOM   7038  C  CE   . LYS B 2 52  ? 1.475   -4.271  -13.990 1.00 0.00 ? 310 LYS A CE   4  
ATOM   7039  N  NZ   . LYS B 2 52  ? 0.712   -3.715  -15.140 1.00 0.00 ? 310 LYS A NZ   4  
ATOM   7040  H  H    . LYS B 2 52  ? 0.752   -5.376  -9.876  1.00 0.00 ? 310 LYS A H    4  
ATOM   7041  H  HA   . LYS B 2 52  ? 2.819   -3.430  -9.729  1.00 0.00 ? 310 LYS A HA   4  
ATOM   7042  H  HB2  . LYS B 2 52  ? -0.001  -2.684  -10.080 1.00 0.00 ? 310 LYS A HB2  4  
ATOM   7043  H  HB3  . LYS B 2 52  ? 1.407   -2.024  -10.836 1.00 0.00 ? 310 LYS A HB3  4  
ATOM   7044  H  HG2  . LYS B 2 52  ? 0.971   -4.754  -11.452 1.00 0.00 ? 310 LYS A HG2  4  
ATOM   7045  H  HG3  . LYS B 2 52  ? -0.337  -3.711  -11.982 1.00 0.00 ? 310 LYS A HG3  4  
ATOM   7046  H  HD2  . LYS B 2 52  ? 1.220   -2.333  -13.156 1.00 0.00 ? 310 LYS A HD2  4  
ATOM   7047  H  HD3  . LYS B 2 52  ? 2.541   -3.273  -12.469 1.00 0.00 ? 310 LYS A HD3  4  
ATOM   7048  H  HE2  . LYS B 2 52  ? 2.480   -4.473  -14.294 1.00 0.00 ? 310 LYS A HE2  4  
ATOM   7049  H  HE3  . LYS B 2 52  ? 1.006   -5.186  -13.661 1.00 0.00 ? 310 LYS A HE3  4  
ATOM   7050  H  HZ1  . LYS B 2 52  ? 1.164   -2.844  -15.483 1.00 0.00 ? 310 LYS A HZ1  4  
ATOM   7051  H  HZ2  . LYS B 2 52  ? -0.263  -3.495  -14.850 1.00 0.00 ? 310 LYS A HZ2  4  
ATOM   7052  H  HZ3  . LYS B 2 52  ? 0.682   -4.407  -15.916 1.00 0.00 ? 310 LYS A HZ3  4  
ATOM   7053  N  N    . TRP B 2 53  ? 2.473   -2.990  -7.220  1.00 0.00 ? 311 TRP A N    4  
ATOM   7054  C  CA   . TRP B 2 53  ? 2.253   -2.387  -5.923  1.00 0.00 ? 311 TRP A CA   4  
ATOM   7055  C  C    . TRP B 2 53  ? 1.849   -0.934  -6.124  1.00 0.00 ? 311 TRP A C    4  
ATOM   7056  O  O    . TRP B 2 53  ? 1.105   -0.374  -5.323  1.00 0.00 ? 311 TRP A O    4  
ATOM   7057  C  CB   . TRP B 2 53  ? 3.490   -2.502  -5.027  1.00 0.00 ? 311 TRP A CB   4  
ATOM   7058  C  CG   . TRP B 2 53  ? 3.490   -1.526  -3.892  1.00 0.00 ? 311 TRP A CG   4  
ATOM   7059  C  CD1  . TRP B 2 53  ? 2.612   -1.477  -2.858  1.00 0.00 ? 311 TRP A CD1  4  
ATOM   7060  C  CD2  . TRP B 2 53  ? 4.408   -0.463  -3.680  1.00 0.00 ? 311 TRP A CD2  4  
ATOM   7061  N  NE1  . TRP B 2 53  ? 2.930   -0.456  -2.013  1.00 0.00 ? 311 TRP A NE1  4  
ATOM   7062  C  CE2  . TRP B 2 53  ? 4.035   0.181   -2.493  1.00 0.00 ? 311 TRP A CE2  4  
ATOM   7063  C  CE3  . TRP B 2 53  ? 5.512   0.002   -4.375  1.00 0.00 ? 311 TRP A CE3  4  
ATOM   7064  C  CZ2  . TRP B 2 53  ? 4.728   1.263   -1.982  1.00 0.00 ? 311 TRP A CZ2  4  
ATOM   7065  C  CZ3  . TRP B 2 53  ? 6.206   1.084   -3.870  1.00 0.00 ? 311 TRP A CZ3  4  
ATOM   7066  C  CH2  . TRP B 2 53  ? 5.813   1.702   -2.680  1.00 0.00 ? 311 TRP A CH2  4  
ATOM   7067  H  H    . TRP B 2 53  ? 3.338   -3.399  -7.432  1.00 0.00 ? 311 TRP A H    4  
ATOM   7068  H  HA   . TRP B 2 53  ? 1.429   -2.909  -5.456  1.00 0.00 ? 311 TRP A HA   4  
ATOM   7069  H  HB2  . TRP B 2 53  ? 3.518   -3.491  -4.613  1.00 0.00 ? 311 TRP A HB2  4  
ATOM   7070  H  HB3  . TRP B 2 53  ? 4.387   -2.342  -5.604  1.00 0.00 ? 311 TRP A HB3  4  
ATOM   7071  H  HD1  . TRP B 2 53  ? 1.791   -2.160  -2.731  1.00 0.00 ? 311 TRP A HD1  4  
ATOM   7072  H  HE1  . TRP B 2 53  ? 2.447   -0.222  -1.193  1.00 0.00 ? 311 TRP A HE1  4  
ATOM   7073  H  HE3  . TRP B 2 53  ? 5.821   -0.468  -5.293  1.00 0.00 ? 311 TRP A HE3  4  
ATOM   7074  H  HZ2  . TRP B 2 53  ? 4.440   1.734   -1.061  1.00 0.00 ? 311 TRP A HZ2  4  
ATOM   7075  H  HZ3  . TRP B 2 53  ? 7.068   1.458   -4.391  1.00 0.00 ? 311 TRP A HZ3  4  
ATOM   7076  H  HH2  . TRP B 2 53  ? 6.383   2.545   -2.321  1.00 0.00 ? 311 TRP A HH2  4  
ATOM   7077  N  N    . GLN B 2 54  ? 2.329   -0.355  -7.230  1.00 0.00 ? 312 GLN A N    4  
ATOM   7078  C  CA   . GLN B 2 54  ? 2.026   1.029   -7.588  1.00 0.00 ? 312 GLN A CA   4  
ATOM   7079  C  C    . GLN B 2 54  ? 2.135   1.949   -6.387  1.00 0.00 ? 312 GLN A C    4  
ATOM   7080  O  O    . GLN B 2 54  ? 1.265   1.947   -5.515  1.00 0.00 ? 312 GLN A O    4  
ATOM   7081  C  CB   . GLN B 2 54  ? 0.619   1.124   -8.186  1.00 0.00 ? 312 GLN A CB   4  
ATOM   7082  C  CG   . GLN B 2 54  ? 0.527   0.591   -9.608  1.00 0.00 ? 312 GLN A CG   4  
ATOM   7083  C  CD   . GLN B 2 54  ? -0.867  0.721   -10.194 1.00 0.00 ? 312 GLN A CD   4  
ATOM   7084  O  OE1  . GLN B 2 54  ? -1.281  -0.092  -11.021 1.00 0.00 ? 312 GLN A OE1  4  
ATOM   7085  N  NE2  . GLN B 2 54  ? -1.599  1.746   -9.773  1.00 0.00 ? 312 GLN A NE2  4  
ATOM   7086  H  H    . GLN B 2 54  ? 2.908   -0.878  -7.823  1.00 0.00 ? 312 GLN A H    4  
ATOM   7087  H  HA   . GLN B 2 54  ? 2.742   1.342   -8.333  1.00 0.00 ? 312 GLN A HA   4  
ATOM   7088  H  HB2  . GLN B 2 54  ? -0.060  0.557   -7.568  1.00 0.00 ? 312 GLN A HB2  4  
ATOM   7089  H  HB3  . GLN B 2 54  ? 0.310   2.159   -8.190  1.00 0.00 ? 312 GLN A HB3  4  
ATOM   7090  H  HG2  . GLN B 2 54  ? 1.214   1.144   -10.231 1.00 0.00 ? 312 GLN A HG2  4  
ATOM   7091  H  HG3  . GLN B 2 54  ? 0.806   -0.452  -9.606  1.00 0.00 ? 312 GLN A HG3  4  
ATOM   7092  H  HE21 . GLN B 2 54  ? -1.202  2.360   -9.114  1.00 0.00 ? 312 GLN A HE21 4  
ATOM   7093  H  HE22 . GLN B 2 54  ? -2.505  1.849   -10.137 1.00 0.00 ? 312 GLN A HE22 4  
ATOM   7094  N  N    . CYS B 2 55  ? 3.199   2.751   -6.346  1.00 0.00 ? 313 CYS A N    4  
ATOM   7095  C  CA   . CYS B 2 55  ? 3.399   3.665   -5.239  1.00 0.00 ? 313 CYS A CA   4  
ATOM   7096  C  C    . CYS B 2 55  ? 2.088   4.356   -4.908  1.00 0.00 ? 313 CYS A C    4  
ATOM   7097  O  O    . CYS B 2 55  ? 1.207   4.483   -5.755  1.00 0.00 ? 313 CYS A O    4  
ATOM   7098  C  CB   . CYS B 2 55  ? 4.514   4.678   -5.525  1.00 0.00 ? 313 CYS A CB   4  
ATOM   7099  S  SG   . CYS B 2 55  ? 4.009   6.153   -6.465  1.00 0.00 ? 313 CYS A SG   4  
ATOM   7100  H  H    . CYS B 2 55  ? 3.850   2.721   -7.070  1.00 0.00 ? 313 CYS A H    4  
ATOM   7101  H  HA   . CYS B 2 55  ? 3.687   3.069   -4.383  1.00 0.00 ? 313 CYS A HA   4  
ATOM   7102  H  HB2  . CYS B 2 55  ? 4.915   5.022   -4.584  1.00 0.00 ? 313 CYS A HB2  4  
ATOM   7103  H  HB3  . CYS B 2 55  ? 5.296   4.187   -6.074  1.00 0.00 ? 313 CYS A HB3  4  
ATOM   7104  N  N    . ILE B 2 56  ? 1.984   4.806   -3.678  1.00 0.00 ? 314 ILE A N    4  
ATOM   7105  C  CA   . ILE B 2 56  ? 0.772   5.419   -3.166  1.00 0.00 ? 314 ILE A CA   4  
ATOM   7106  C  C    . ILE B 2 56  ? 0.071   6.301   -4.131  1.00 0.00 ? 314 ILE A C    4  
ATOM   7107  O  O    . ILE B 2 56  ? -0.934  5.928   -4.671  1.00 0.00 ? 314 ILE A O    4  
ATOM   7108  C  CB   . ILE B 2 56  ? 1.063   6.184   -1.867  1.00 0.00 ? 314 ILE A CB   4  
ATOM   7109  C  CG1  . ILE B 2 56  ? 0.341   5.536   -0.741  1.00 0.00 ? 314 ILE A CG1  4  
ATOM   7110  C  CG2  . ILE B 2 56  ? 0.674   7.634   -1.862  1.00 0.00 ? 314 ILE A CG2  4  
ATOM   7111  C  CD1  . ILE B 2 56  ? -1.095  5.279   -1.030  1.00 0.00 ? 314 ILE A CD1  4  
ATOM   7112  H  H    . ILE B 2 56  ? 2.765   4.755   -3.097  1.00 0.00 ? 314 ILE A H    4  
ATOM   7113  H  HA   . ILE B 2 56  ? 0.085   4.636   -2.908  1.00 0.00 ? 314 ILE A HA   4  
ATOM   7114  H  HB   . ILE B 2 56  ? 2.097   6.112   -1.686  1.00 0.00 ? 314 ILE A HB   4  
ATOM   7115  H  HG12 . ILE B 2 56  ? 0.794   4.639   -0.553  1.00 0.00 ? 314 ILE A HG12 4  
ATOM   7116  H  HG13 . ILE B 2 56  ? 0.390   6.167   0.134   1.00 0.00 ? 314 ILE A HG13 4  
ATOM   7117  H  HG21 . ILE B 2 56  ? 0.233   7.824   -0.920  1.00 0.00 ? 314 ILE A HG21 4  
ATOM   7118  H  HG22 . ILE B 2 56  ? -0.046  7.837   -2.635  1.00 0.00 ? 314 ILE A HG22 4  
ATOM   7119  H  HG23 . ILE B 2 56  ? 1.546   8.255   -1.991  1.00 0.00 ? 314 ILE A HG23 4  
ATOM   7120  H  HD11 . ILE B 2 56  ? -1.569  6.211   -1.127  1.00 0.00 ? 314 ILE A HD11 4  
ATOM   7121  H  HD12 . ILE B 2 56  ? -1.542  4.734   -0.215  1.00 0.00 ? 314 ILE A HD12 4  
ATOM   7122  H  HD13 . ILE B 2 56  ? -1.197  4.717   -1.942  1.00 0.00 ? 314 ILE A HD13 4  
ATOM   7123  N  N    . GLU B 2 57  ? 0.632   7.431   -4.387  1.00 0.00 ? 315 GLU A N    4  
ATOM   7124  C  CA   . GLU B 2 57  ? -0.035  8.398   -5.215  1.00 0.00 ? 315 GLU A CA   4  
ATOM   7125  C  C    . GLU B 2 57  ? -0.620  7.760   -6.486  1.00 0.00 ? 315 GLU A C    4  
ATOM   7126  O  O    . GLU B 2 57  ? -1.545  8.300   -7.094  1.00 0.00 ? 315 GLU A O    4  
ATOM   7127  C  CB   . GLU B 2 57  ? 0.896   9.553   -5.549  1.00 0.00 ? 315 GLU A CB   4  
ATOM   7128  C  CG   . GLU B 2 57  ? 1.536   10.161  -4.314  1.00 0.00 ? 315 GLU A CG   4  
ATOM   7129  C  CD   . GLU B 2 57  ? 2.463   11.314  -4.644  1.00 0.00 ? 315 GLU A CD   4  
ATOM   7130  O  OE1  . GLU B 2 57  ? 1.982   12.465  -4.702  1.00 0.00 ? 315 GLU A OE1  4  
ATOM   7131  O  OE2  . GLU B 2 57  ? 3.670   11.065  -4.846  1.00 0.00 ? 315 GLU A OE2  4  
ATOM   7132  H  H    . GLU B 2 57  ? 1.498   7.625   -3.987  1.00 0.00 ? 315 GLU A H    4  
ATOM   7133  H  HA   . GLU B 2 57  ? -0.849  8.772   -4.587  1.00 0.00 ? 315 GLU A HA   4  
ATOM   7134  H  HB2  . GLU B 2 57  ? 1.679   9.198   -6.203  1.00 0.00 ? 315 GLU A HB2  4  
ATOM   7135  H  HB3  . GLU B 2 57  ? 0.329   10.321  -6.052  1.00 0.00 ? 315 GLU A HB3  4  
ATOM   7136  H  HG2  . GLU B 2 57  ? 0.753   10.521  -3.661  1.00 0.00 ? 315 GLU A HG2  4  
ATOM   7137  H  HG3  . GLU B 2 57  ? 2.098   9.395   -3.799  1.00 0.00 ? 315 GLU A HG3  4  
ATOM   7138  N  N    . CYS B 2 58  ? -0.067  6.607   -6.878  1.00 0.00 ? 316 CYS A N    4  
ATOM   7139  C  CA   . CYS B 2 58  ? -0.543  5.870   -8.059  1.00 0.00 ? 316 CYS A CA   4  
ATOM   7140  C  C    . CYS B 2 58  ? -1.521  4.762   -7.671  1.00 0.00 ? 316 CYS A C    4  
ATOM   7141  O  O    . CYS B 2 58  ? -2.331  4.330   -8.490  1.00 0.00 ? 316 CYS A O    4  
ATOM   7142  C  CB   . CYS B 2 58  ? 0.616   5.212   -8.803  1.00 0.00 ? 316 CYS A CB   4  
ATOM   7143  S  SG   . CYS B 2 58  ? 1.835   6.355   -9.503  1.00 0.00 ? 316 CYS A SG   4  
ATOM   7144  H  H    . CYS B 2 58  ? 0.686   6.245   -6.361  1.00 0.00 ? 316 CYS A H    4  
ATOM   7145  H  HA   . CYS B 2 58  ? -1.038  6.567   -8.717  1.00 0.00 ? 316 CYS A HA   4  
ATOM   7146  H  HB2  . CYS B 2 58  ? 1.140   4.560   -8.122  1.00 0.00 ? 316 CYS A HB2  4  
ATOM   7147  H  HB3  . CYS B 2 58  ? 0.216   4.623   -9.612  1.00 0.00 ? 316 CYS A HB3  4  
ATOM   7148  N  N    . LYS B 2 59  ? -1.411  4.297   -6.426  1.00 0.00 ? 317 LYS A N    4  
ATOM   7149  C  CA   . LYS B 2 59  ? -2.244  3.215   -5.905  1.00 0.00 ? 317 LYS A CA   4  
ATOM   7150  C  C    . LYS B 2 59  ? -3.660  3.223   -6.483  1.00 0.00 ? 317 LYS A C    4  
ATOM   7151  O  O    . LYS B 2 59  ? -4.199  2.163   -6.792  1.00 0.00 ? 317 LYS A O    4  
ATOM   7152  C  CB   . LYS B 2 59  ? -2.236  3.213   -4.346  1.00 0.00 ? 317 LYS A CB   4  
ATOM   7153  C  CG   . LYS B 2 59  ? -3.077  4.243   -3.619  1.00 0.00 ? 317 LYS A CG   4  
ATOM   7154  C  CD   . LYS B 2 59  ? -3.447  5.393   -4.472  1.00 0.00 ? 317 LYS A CD   4  
ATOM   7155  C  CE   . LYS B 2 59  ? -3.317  6.692   -3.758  1.00 0.00 ? 317 LYS A CE   4  
ATOM   7156  N  NZ   . LYS B 2 59  ? -4.426  7.601   -4.146  1.00 0.00 ? 317 LYS A NZ   4  
ATOM   7157  H  H    . LYS B 2 59  ? -0.732  4.684   -5.843  1.00 0.00 ? 317 LYS A H    4  
ATOM   7158  H  HA   . LYS B 2 59  ? -1.793  2.310   -6.226  1.00 0.00 ? 317 LYS A HA   4  
ATOM   7159  H  HB2  . LYS B 2 59  ? -2.575  2.258   -4.014  1.00 0.00 ? 317 LYS A HB2  4  
ATOM   7160  H  HB3  . LYS B 2 59  ? -1.223  3.356   -4.010  1.00 0.00 ? 317 LYS A HB3  4  
ATOM   7161  H  HG2  . LYS B 2 59  ? -3.962  3.783   -3.267  1.00 0.00 ? 317 LYS A HG2  4  
ATOM   7162  H  HG3  . LYS B 2 59  ? -2.524  4.611   -2.778  1.00 0.00 ? 317 LYS A HG3  4  
ATOM   7163  H  HD2  . LYS B 2 59  ? -2.795  5.414   -5.302  1.00 0.00 ? 317 LYS A HD2  4  
ATOM   7164  H  HD3  . LYS B 2 59  ? -4.452  5.258   -4.812  1.00 0.00 ? 317 LYS A HD3  4  
ATOM   7165  H  HE2  . LYS B 2 59  ? -3.309  6.506   -2.699  1.00 0.00 ? 317 LYS A HE2  4  
ATOM   7166  H  HE3  . LYS B 2 59  ? -2.377  7.131   -4.033  1.00 0.00 ? 317 LYS A HE3  4  
ATOM   7167  H  HZ1  . LYS B 2 59  ? -4.881  7.249   -5.012  1.00 0.00 ? 317 LYS A HZ1  4  
ATOM   7168  H  HZ2  . LYS B 2 59  ? -4.066  8.554   -4.328  1.00 0.00 ? 317 LYS A HZ2  4  
ATOM   7169  H  HZ3  . LYS B 2 59  ? -5.135  7.643   -3.393  1.00 0.00 ? 317 LYS A HZ3  4  
ATOM   7170  N  N    . SER B 2 60  ? -4.199  4.420   -6.700  1.00 0.00 ? 318 SER A N    4  
ATOM   7171  C  CA   . SER B 2 60  ? -5.554  4.617   -7.216  1.00 0.00 ? 318 SER A CA   4  
ATOM   7172  C  C    . SER B 2 60  ? -6.540  3.632   -6.635  1.00 0.00 ? 318 SER A C    4  
ATOM   7173  O  O    . SER B 2 60  ? -6.180  2.643   -6.001  1.00 0.00 ? 318 SER A O    4  
ATOM   7174  C  CB   . SER B 2 60  ? -5.586  4.518   -8.742  1.00 0.00 ? 318 SER A CB   4  
ATOM   7175  O  OG   . SER B 2 60  ? -4.700  3.518   -9.213  1.00 0.00 ? 318 SER A OG   4  
ATOM   7176  H  H    . SER B 2 60  ? -3.654  5.205   -6.517  1.00 0.00 ? 318 SER A H    4  
ATOM   7177  H  HA   . SER B 2 60  ? -5.875  5.603   -6.932  1.00 0.00 ? 318 SER A HA   4  
ATOM   7178  H  HB2  . SER B 2 60  ? -6.588  4.264   -9.053  1.00 0.00 ? 318 SER A HB2  4  
ATOM   7179  H  HB3  . SER B 2 60  ? -5.312  5.466   -9.174  1.00 0.00 ? 318 SER A HB3  4  
ATOM   7180  H  HG   . SER B 2 60  ? -5.080  2.651   -9.053  1.00 0.00 ? 318 SER A HG   4  
ATOM   7181  N  N    . CYS B 2 61  ? -7.803  3.929   -6.802  1.00 0.00 ? 319 CYS A N    4  
ATOM   7182  C  CA   . CYS B 2 61  ? -8.802  3.008   -6.354  1.00 0.00 ? 319 CYS A CA   4  
ATOM   7183  C  C    . CYS B 2 61  ? -8.666  1.763   -7.225  1.00 0.00 ? 319 CYS A C    4  
ATOM   7184  O  O    . CYS B 2 61  ? -7.803  1.693   -8.097  1.00 0.00 ? 319 CYS A O    4  
ATOM   7185  C  CB   . CYS B 2 61  ? -10.195 3.593   -6.528  1.00 0.00 ? 319 CYS A CB   4  
ATOM   7186  S  SG   . CYS B 2 61  ? -11.565 2.761   -5.629  1.00 0.00 ? 319 CYS A SG   4  
ATOM   7187  H  H    . CYS B 2 61  ? -8.060  4.782   -7.209  1.00 0.00 ? 319 CYS A H    4  
ATOM   7188  H  HA   . CYS B 2 61  ? -8.624  2.798   -5.318  1.00 0.00 ? 319 CYS A HA   4  
ATOM   7189  H  HB2  . CYS B 2 61  ? -10.174 4.616   -6.200  1.00 0.00 ? 319 CYS A HB2  4  
ATOM   7190  H  HB3  . CYS B 2 61  ? -10.436 3.564   -7.571  1.00 0.00 ? 319 CYS A HB3  4  
ATOM   7191  N  N    . ILE B 2 62  ? -9.482  0.791   -6.966  1.00 0.00 ? 320 ILE A N    4  
ATOM   7192  C  CA   . ILE B 2 62  ? -9.545  -0.416  -7.771  1.00 0.00 ? 320 ILE A CA   4  
ATOM   7193  C  C    . ILE B 2 62  ? -11.005 -0.554  -8.062  1.00 0.00 ? 320 ILE A C    4  
ATOM   7194  O  O    . ILE B 2 62  ? -11.441 -1.208  -9.012  1.00 0.00 ? 320 ILE A O    4  
ATOM   7195  C  CB   . ILE B 2 62  ? -8.996  -1.646  -7.024  1.00 0.00 ? 320 ILE A CB   4  
ATOM   7196  C  CG1  . ILE B 2 62  ? -9.755  -2.936  -7.372  1.00 0.00 ? 320 ILE A CG1  4  
ATOM   7197  C  CG2  . ILE B 2 62  ? -9.085  -1.370  -5.569  1.00 0.00 ? 320 ILE A CG2  4  
ATOM   7198  C  CD1  . ILE B 2 62  ? -9.702  -4.005  -6.302  1.00 0.00 ? 320 ILE A CD1  4  
ATOM   7199  H  H    . ILE B 2 62  ? -10.077 0.871   -6.191  1.00 0.00 ? 320 ILE A H    4  
ATOM   7200  H  HA   . ILE B 2 62  ? -8.994  -0.258  -8.690  1.00 0.00 ? 320 ILE A HA   4  
ATOM   7201  H  HB   . ILE B 2 62  ? -7.955  -1.763  -7.279  1.00 0.00 ? 320 ILE A HB   4  
ATOM   7202  H  HG12 . ILE B 2 62  ? -10.789 -2.699  -7.537  1.00 0.00 ? 320 ILE A HG12 4  
ATOM   7203  H  HG13 . ILE B 2 62  ? -9.334  -3.357  -8.265  1.00 0.00 ? 320 ILE A HG13 4  
ATOM   7204  H  HG21 . ILE B 2 62  ? -10.135 -1.253  -5.309  1.00 0.00 ? 320 ILE A HG21 4  
ATOM   7205  H  HG22 . ILE B 2 62  ? -8.544  -0.467  -5.343  1.00 0.00 ? 320 ILE A HG22 4  
ATOM   7206  H  HG23 . ILE B 2 62  ? -8.663  -2.192  -5.017  1.00 0.00 ? 320 ILE A HG23 4  
ATOM   7207  H  HD11 . ILE B 2 62  ? -8.734  -3.986  -5.826  1.00 0.00 ? 320 ILE A HD11 4  
ATOM   7208  H  HD12 . ILE B 2 62  ? -9.864  -4.973  -6.751  1.00 0.00 ? 320 ILE A HD12 4  
ATOM   7209  H  HD13 . ILE B 2 62  ? -10.469 -3.816  -5.567  1.00 0.00 ? 320 ILE A HD13 4  
ATOM   7210  N  N    . LEU B 2 63  ? -11.752 0.125   -7.197  1.00 0.00 ? 321 LEU A N    4  
ATOM   7211  C  CA   . LEU B 2 63  ? -13.174 0.188   -7.294  1.00 0.00 ? 321 LEU A CA   4  
ATOM   7212  C  C    . LEU B 2 63  ? -13.507 1.264   -8.319  1.00 0.00 ? 321 LEU A C    4  
ATOM   7213  O  O    . LEU B 2 63  ? -14.616 1.337   -8.847  1.00 0.00 ? 321 LEU A O    4  
ATOM   7214  C  CB   . LEU B 2 63  ? -13.759 0.478   -5.907  1.00 0.00 ? 321 LEU A CB   4  
ATOM   7215  C  CG   . LEU B 2 63  ? -13.272 -0.461  -4.787  1.00 0.00 ? 321 LEU A CG   4  
ATOM   7216  C  CD1  . LEU B 2 63  ? -14.407 -0.855  -3.869  1.00 0.00 ? 321 LEU A CD1  4  
ATOM   7217  C  CD2  . LEU B 2 63  ? -12.611 -1.697  -5.349  1.00 0.00 ? 321 LEU A CD2  4  
ATOM   7218  H  H    . LEU B 2 63  ? -11.314 0.591   -6.444  1.00 0.00 ? 321 LEU A H    4  
ATOM   7219  H  HA   . LEU B 2 63  ? -13.516 -0.768  -7.634  1.00 0.00 ? 321 LEU A HA   4  
ATOM   7220  H  HB2  . LEU B 2 63  ? -13.490 1.489   -5.635  1.00 0.00 ? 321 LEU A HB2  4  
ATOM   7221  H  HB3  . LEU B 2 63  ? -14.834 0.415   -5.955  1.00 0.00 ? 321 LEU A HB3  4  
ATOM   7222  H  HG   . LEU B 2 63  ? -12.530 0.058   -4.198  1.00 0.00 ? 321 LEU A HG   4  
ATOM   7223  H  HD11 . LEU B 2 63  ? -14.248 -0.407  -2.896  1.00 0.00 ? 321 LEU A HD11 4  
ATOM   7224  H  HD12 . LEU B 2 63  ? -14.435 -1.931  -3.771  1.00 0.00 ? 321 LEU A HD12 4  
ATOM   7225  H  HD13 . LEU B 2 63  ? -15.341 -0.505  -4.278  1.00 0.00 ? 321 LEU A HD13 4  
ATOM   7226  H  HD21 . LEU B 2 63  ? -11.707 -1.391  -5.842  1.00 0.00 ? 321 LEU A HD21 4  
ATOM   7227  H  HD22 . LEU B 2 63  ? -13.272 -2.175  -6.058  1.00 0.00 ? 321 LEU A HD22 4  
ATOM   7228  H  HD23 . LEU B 2 63  ? -12.377 -2.382  -4.549  1.00 0.00 ? 321 LEU A HD23 4  
ATOM   7229  N  N    . CYS B 2 64  ? -12.494 2.103   -8.580  1.00 0.00 ? 322 CYS A N    4  
ATOM   7230  C  CA   . CYS B 2 64  ? -12.576 3.166   -9.572  1.00 0.00 ? 322 CYS A CA   4  
ATOM   7231  C  C    . CYS B 2 64  ? -11.317 3.177   -10.425 1.00 0.00 ? 322 CYS A C    4  
ATOM   7232  O  O    . CYS B 2 64  ? -11.372 3.451   -11.625 1.00 0.00 ? 322 CYS A O    4  
ATOM   7233  C  CB   . CYS B 2 64  ? -12.715 4.539   -8.926  1.00 0.00 ? 322 CYS A CB   4  
ATOM   7234  S  SG   . CYS B 2 64  ? -14.092 4.708   -7.765  1.00 0.00 ? 322 CYS A SG   4  
ATOM   7235  H  H    . CYS B 2 64  ? -11.664 2.015   -8.065  1.00 0.00 ? 322 CYS A H    4  
ATOM   7236  H  HA   . CYS B 2 64  ? -13.428 2.977   -10.200 1.00 0.00 ? 322 CYS A HA   4  
ATOM   7237  H  HB2  . CYS B 2 64  ? -11.809 4.767   -8.387  1.00 0.00 ? 322 CYS A HB2  4  
ATOM   7238  H  HB3  . CYS B 2 64  ? -12.854 5.275   -9.704  1.00 0.00 ? 322 CYS A HB3  4  
ATOM   7239  N  N    . GLY B 2 65  ? -10.174 2.876   -9.801  1.00 0.00 ? 323 GLY A N    4  
ATOM   7240  C  CA   . GLY B 2 65  ? -8.918  2.896   -10.528 1.00 0.00 ? 323 GLY A CA   4  
ATOM   7241  C  C    . GLY B 2 65  ? -8.617  4.282   -11.052 1.00 0.00 ? 323 GLY A C    4  
ATOM   7242  O  O    . GLY B 2 65  ? -7.978  4.442   -12.093 1.00 0.00 ? 323 GLY A O    4  
ATOM   7243  H  H    . GLY B 2 65  ? -10.186 2.636   -8.841  1.00 0.00 ? 323 GLY A H    4  
ATOM   7244  H  HA2  . GLY B 2 65  ? -8.120  2.587   -9.872  1.00 0.00 ? 323 GLY A HA2  4  
ATOM   7245  H  HA3  . GLY B 2 65  ? -8.977  2.212   -11.359 1.00 0.00 ? 323 GLY A HA3  4  
ATOM   7246  N  N    . THR B 2 66  ? -9.087  5.284   -10.317 1.00 0.00 ? 324 THR A N    4  
ATOM   7247  C  CA   . THR B 2 66  ? -8.904  6.673   -10.700 1.00 0.00 ? 324 THR A CA   4  
ATOM   7248  C  C    . THR B 2 66  ? -8.293  7.495   -9.577  1.00 0.00 ? 324 THR A C    4  
ATOM   7249  O  O    . THR B 2 66  ? -7.818  8.609   -9.804  1.00 0.00 ? 324 THR A O    4  
ATOM   7250  C  CB   . THR B 2 66  ? -10.252 7.298   -11.049 1.00 0.00 ? 324 THR A CB   4  
ATOM   7251  O  OG1  . THR B 2 66  ? -10.071 8.644   -11.507 1.00 0.00 ? 324 THR A OG1  4  
ATOM   7252  C  CG2  . THR B 2 66  ? -11.171 7.284   -9.843  1.00 0.00 ? 324 THR A CG2  4  
ATOM   7253  H  H    . THR B 2 66  ? -9.580  5.082   -9.494  1.00 0.00 ? 324 THR A H    4  
ATOM   7254  H  HA   . THR B 2 66  ? -8.274  6.713   -11.572 1.00 0.00 ? 324 THR A HA   4  
ATOM   7255  H  HB   . THR B 2 66  ? -10.702 6.720   -11.824 1.00 0.00 ? 324 THR A HB   4  
ATOM   7256  H  HG1  . THR B 2 66  ? -10.815 9.181   -11.223 1.00 0.00 ? 324 THR A HG1  4  
ATOM   7257  H  HG21 . THR B 2 66  ? -11.091 6.338   -9.323  1.00 0.00 ? 324 THR A HG21 4  
ATOM   7258  H  HG22 . THR B 2 66  ? -12.191 7.430   -10.166 1.00 0.00 ? 324 THR A HG22 4  
ATOM   7259  H  HG23 . THR B 2 66  ? -10.890 8.080   -9.175  1.00 0.00 ? 324 THR A HG23 4  
ATOM   7260  N  N    . SER B 2 67  ? -8.329  6.942   -8.367  1.00 0.00 ? 325 SER A N    4  
ATOM   7261  C  CA   . SER B 2 67  ? -7.829  7.621   -7.183  1.00 0.00 ? 325 SER A CA   4  
ATOM   7262  C  C    . SER B 2 67  ? -8.808  8.710   -6.754  1.00 0.00 ? 325 SER A C    4  
ATOM   7263  O  O    . SER B 2 67  ? -8.812  9.127   -5.606  1.00 0.00 ? 325 SER A O    4  
ATOM   7264  C  CB   . SER B 2 67  ? -6.435  8.201   -7.431  1.00 0.00 ? 325 SER A CB   4  
ATOM   7265  O  OG   . SER B 2 67  ? -5.815  8.583   -6.216  1.00 0.00 ? 325 SER A OG   4  
ATOM   7266  H  H    . SER B 2 67  ? -8.690  6.041   -8.269  1.00 0.00 ? 325 SER A H    4  
ATOM   7267  H  HA   . SER B 2 67  ? -7.770  6.891   -6.395  1.00 0.00 ? 325 SER A HA   4  
ATOM   7268  H  HB2  . SER B 2 67  ? -5.824  7.455   -7.915  1.00 0.00 ? 325 SER A HB2  4  
ATOM   7269  H  HB3  . SER B 2 67  ? -6.515  9.069   -8.069  1.00 0.00 ? 325 SER A HB3  4  
ATOM   7270  H  HG   . SER B 2 67  ? -4.867  8.653   -6.349  1.00 0.00 ? 325 SER A HG   4  
ATOM   7271  N  N    . GLU B 2 68  ? -9.658  9.118   -7.698  1.00 0.00 ? 326 GLU A N    4  
ATOM   7272  C  CA   . GLU B 2 68  ? -10.682 10.146  -7.498  1.00 0.00 ? 326 GLU A CA   4  
ATOM   7273  C  C    . GLU B 2 68  ? -10.509 10.965  -6.216  1.00 0.00 ? 326 GLU A C    4  
ATOM   7274  O  O    . GLU B 2 68  ? -9.619  11.807  -6.124  1.00 0.00 ? 326 GLU A O    4  
ATOM   7275  C  CB   . GLU B 2 68  ? -12.038 9.492   -7.510  1.00 0.00 ? 326 GLU A CB   4  
ATOM   7276  C  CG   . GLU B 2 68  ? -12.799 9.696   -8.804  1.00 0.00 ? 326 GLU A CG   4  
ATOM   7277  C  CD   . GLU B 2 68  ? -13.979 10.634  -8.652  1.00 0.00 ? 326 GLU A CD   4  
ATOM   7278  O  OE1  . GLU B 2 68  ? -15.088 10.148  -8.344  1.00 0.00 ? 326 GLU A OE1  4  
ATOM   7279  O  OE2  . GLU B 2 68  ? -13.795 11.854  -8.840  1.00 0.00 ? 326 GLU A OE2  4  
ATOM   7280  H  H    . GLU B 2 68  ? -9.614  8.686   -8.571  1.00 0.00 ? 326 GLU A H    4  
ATOM   7281  H  HA   . GLU B 2 68  ? -10.638 10.811  -8.335  1.00 0.00 ? 326 GLU A HA   4  
ATOM   7282  H  HB2  . GLU B 2 68  ? -11.902 8.444   -7.345  1.00 0.00 ? 326 GLU A HB2  4  
ATOM   7283  H  HB3  . GLU B 2 68  ? -12.611 9.891   -6.720  1.00 0.00 ? 326 GLU A HB3  4  
ATOM   7284  H  HG2  . GLU B 2 68  ? -12.121 10.107  -9.531  1.00 0.00 ? 326 GLU A HG2  4  
ATOM   7285  H  HG3  . GLU B 2 68  ? -13.153 8.739   -9.152  1.00 0.00 ? 326 GLU A HG3  4  
ATOM   7286  N  N    . ASN B 2 69  ? -11.382 10.715  -5.233  1.00 0.00 ? 327 ASN A N    4  
ATOM   7287  C  CA   . ASN B 2 69  ? -11.343 11.433  -3.967  1.00 0.00 ? 327 ASN A CA   4  
ATOM   7288  C  C    . ASN B 2 69  ? -10.003 11.272  -3.287  1.00 0.00 ? 327 ASN A C    4  
ATOM   7289  O  O    . ASN B 2 69  ? -9.490  12.220  -2.689  1.00 0.00 ? 327 ASN A O    4  
ATOM   7290  C  CB   . ASN B 2 69  ? -12.458 10.952  -3.032  1.00 0.00 ? 327 ASN A CB   4  
ATOM   7291  C  CG   . ASN B 2 69  ? -13.816 11.468  -3.433  1.00 0.00 ? 327 ASN A CG   4  
ATOM   7292  O  OD1  . ASN B 2 69  ? -14.618 11.873  -2.591  1.00 0.00 ? 327 ASN A OD1  4  
ATOM   7293  N  ND2  . ASN B 2 69  ? -14.088 11.442  -4.726  1.00 0.00 ? 327 ASN A ND2  4  
ATOM   7294  H  H    . ASN B 2 69  ? -12.065 10.026  -5.363  1.00 0.00 ? 327 ASN A H    4  
ATOM   7295  H  HA   . ASN B 2 69  ? -11.501 12.468  -4.170  1.00 0.00 ? 327 ASN A HA   4  
ATOM   7296  H  HB2  . ASN B 2 69  ? -12.498 9.884   -3.056  1.00 0.00 ? 327 ASN A HB2  4  
ATOM   7297  H  HB3  . ASN B 2 69  ? -12.253 11.276  -2.025  1.00 0.00 ? 327 ASN A HB3  4  
ATOM   7298  H  HD21 . ASN B 2 69  ? -13.403 11.098  -5.337  1.00 0.00 ? 327 ASN A HD21 4  
ATOM   7299  H  HD22 . ASN B 2 69  ? -14.961 11.750  -5.015  1.00 0.00 ? 327 ASN A HD22 4  
ATOM   7300  N  N    . ASP B 2 70  ? -9.426  10.076  -3.398  1.00 0.00 ? 328 ASP A N    4  
ATOM   7301  C  CA   . ASP B 2 70  ? -8.152  9.770   -2.743  1.00 0.00 ? 328 ASP A CA   4  
ATOM   7302  C  C    . ASP B 2 70  ? -8.146  10.331  -1.329  1.00 0.00 ? 328 ASP A C    4  
ATOM   7303  O  O    . ASP B 2 70  ? -7.097  10.582  -0.742  1.00 0.00 ? 328 ASP A O    4  
ATOM   7304  C  CB   . ASP B 2 70  ? -6.926  10.271  -3.519  1.00 0.00 ? 328 ASP A CB   4  
ATOM   7305  C  CG   . ASP B 2 70  ? -7.245  11.196  -4.676  1.00 0.00 ? 328 ASP A CG   4  
ATOM   7306  O  OD1  . ASP B 2 70  ? -7.676  12.339  -4.423  1.00 0.00 ? 328 ASP A OD1  4  
ATOM   7307  O  OD2  . ASP B 2 70  ? -7.038  10.787  -5.834  1.00 0.00 ? 328 ASP A OD2  4  
ATOM   7308  H  H    . ASP B 2 70  ? -9.877  9.374   -3.934  1.00 0.00 ? 328 ASP A H    4  
ATOM   7309  H  HA   . ASP B 2 70  ? -8.091  8.696   -2.668  1.00 0.00 ? 328 ASP A HA   4  
ATOM   7310  H  HB2  . ASP B 2 70  ? -6.292  10.811  -2.837  1.00 0.00 ? 328 ASP A HB2  4  
ATOM   7311  H  HB3  . ASP B 2 70  ? -6.380  9.403   -3.897  1.00 0.00 ? 328 ASP A HB3  4  
ATOM   7312  N  N    . ASP B 2 71  ? -9.340  10.561  -0.813  1.00 0.00 ? 329 ASP A N    4  
ATOM   7313  C  CA   . ASP B 2 71  ? -9.519  11.045  0.535   1.00 0.00 ? 329 ASP A CA   4  
ATOM   7314  C  C    . ASP B 2 71  ? -10.260 9.979   1.309   1.00 0.00 ? 329 ASP A C    4  
ATOM   7315  O  O    . ASP B 2 71  ? -10.470 10.080  2.518   1.00 0.00 ? 329 ASP A O    4  
ATOM   7316  C  CB   . ASP B 2 71  ? -10.285 12.362  0.546   1.00 0.00 ? 329 ASP A CB   4  
ATOM   7317  C  CG   . ASP B 2 71  ? -10.679 12.795  1.944   1.00 0.00 ? 329 ASP A CG   4  
ATOM   7318  O  OD1  . ASP B 2 71  ? -9.784  13.200  2.715   1.00 0.00 ? 329 ASP A OD1  4  
ATOM   7319  O  OD2  . ASP B 2 71  ? -11.883 12.723  2.271   1.00 0.00 ? 329 ASP A OD2  4  
ATOM   7320  H  H    . ASP B 2 71  ? -10.134 10.408  -1.369  1.00 0.00 ? 329 ASP A H    4  
ATOM   7321  H  HA   . ASP B 2 71  ? -8.547  11.197  0.967   1.00 0.00 ? 329 ASP A HA   4  
ATOM   7322  H  HB2  . ASP B 2 71  ? -9.653  13.123  0.122   1.00 0.00 ? 329 ASP A HB2  4  
ATOM   7323  H  HB3  . ASP B 2 71  ? -11.179 12.262  -0.052  1.00 0.00 ? 329 ASP A HB3  4  
ATOM   7324  N  N    . GLN B 2 72  ? -10.647 8.940   0.573   1.00 0.00 ? 330 GLN A N    4  
ATOM   7325  C  CA   . GLN B 2 72  ? -11.364 7.822   1.130   1.00 0.00 ? 330 GLN A CA   4  
ATOM   7326  C  C    . GLN B 2 72  ? -10.662 6.542   0.733   1.00 0.00 ? 330 GLN A C    4  
ATOM   7327  O  O    . GLN B 2 72  ? -10.725 5.544   1.429   1.00 0.00 ? 330 GLN A O    4  
ATOM   7328  C  CB   . GLN B 2 72  ? -12.795 7.853   0.640   1.00 0.00 ? 330 GLN A CB   4  
ATOM   7329  C  CG   . GLN B 2 72  ? -13.347 9.249   0.730   1.00 0.00 ? 330 GLN A CG   4  
ATOM   7330  C  CD   . GLN B 2 72  ? -14.856 9.317   0.840   1.00 0.00 ? 330 GLN A CD   4  
ATOM   7331  O  OE1  . GLN B 2 72  ? -15.490 10.216  0.287   1.00 0.00 ? 330 GLN A OE1  4  
ATOM   7332  N  NE2  . GLN B 2 72  ? -15.441 8.379   1.579   1.00 0.00 ? 330 GLN A NE2  4  
ATOM   7333  H  H    . GLN B 2 72  ? -10.436 8.926   -0.390  1.00 0.00 ? 330 GLN A H    4  
ATOM   7334  H  HA   . GLN B 2 72  ? -11.367 7.922   2.196   1.00 0.00 ? 330 GLN A HA   4  
ATOM   7335  H  HB2  . GLN B 2 72  ? -12.821 7.535   -0.383  1.00 0.00 ? 330 GLN A HB2  4  
ATOM   7336  H  HB3  . GLN B 2 72  ? -13.405 7.199   1.239   1.00 0.00 ? 330 GLN A HB3  4  
ATOM   7337  H  HG2  . GLN B 2 72  ? -12.924 9.709   1.602   1.00 0.00 ? 330 GLN A HG2  4  
ATOM   7338  H  HG3  . GLN B 2 72  ? -13.023 9.784   -0.143  1.00 0.00 ? 330 GLN A HG3  4  
ATOM   7339  H  HE21 . GLN B 2 72  ? -14.873 7.705   2.005   1.00 0.00 ? 330 GLN A HE21 4  
ATOM   7340  H  HE22 . GLN B 2 72  ? -16.417 8.402   1.667   1.00 0.00 ? 330 GLN A HE22 4  
ATOM   7341  N  N    . LEU B 2 73  ? -9.948  6.591   -0.381  1.00 0.00 ? 331 LEU A N    4  
ATOM   7342  C  CA   . LEU B 2 73  ? -9.225  5.423   -0.853  1.00 0.00 ? 331 LEU A CA   4  
ATOM   7343  C  C    . LEU B 2 73  ? -8.677  4.642   0.317   1.00 0.00 ? 331 LEU A C    4  
ATOM   7344  O  O    . LEU B 2 73  ? -8.027  5.199   1.188   1.00 0.00 ? 331 LEU A O    4  
ATOM   7345  C  CB   . LEU B 2 73  ? -8.074  5.832   -1.744  1.00 0.00 ? 331 LEU A CB   4  
ATOM   7346  C  CG   . LEU B 2 73  ? -8.464  6.354   -3.118  1.00 0.00 ? 331 LEU A CG   4  
ATOM   7347  C  CD1  . LEU B 2 73  ? -7.232  6.717   -3.883  1.00 0.00 ? 331 LEU A CD1  4  
ATOM   7348  C  CD2  . LEU B 2 73  ? -9.240  5.315   -3.870  1.00 0.00 ? 331 LEU A CD2  4  
ATOM   7349  H  H    . LEU B 2 73  ? -9.892  7.431   -0.883  1.00 0.00 ? 331 LEU A H    4  
ATOM   7350  H  HA   . LEU B 2 73  ? -9.901  4.799   -1.419  1.00 0.00 ? 331 LEU A HA   4  
ATOM   7351  H  HB2  . LEU B 2 73  ? -7.523  6.592   -1.232  1.00 0.00 ? 331 LEU A HB2  4  
ATOM   7352  H  HB3  . LEU B 2 73  ? -7.431  4.975   -1.879  1.00 0.00 ? 331 LEU A HB3  4  
ATOM   7353  H  HG   . LEU B 2 73  ? -9.063  7.235   -3.014  1.00 0.00 ? 331 LEU A HG   4  
ATOM   7354  H  HD11 . LEU B 2 73  ? -6.417  6.694   -3.204  1.00 0.00 ? 331 LEU A HD11 4  
ATOM   7355  H  HD12 . LEU B 2 73  ? -7.338  7.708   -4.298  1.00 0.00 ? 331 LEU A HD12 4  
ATOM   7356  H  HD13 . LEU B 2 73  ? -7.069  6.001   -4.675  1.00 0.00 ? 331 LEU A HD13 4  
ATOM   7357  H  HD21 . LEU B 2 73  ? -8.621  4.453   -3.974  1.00 0.00 ? 331 LEU A HD21 4  
ATOM   7358  H  HD22 . LEU B 2 73  ? -9.500  5.693   -4.846  1.00 0.00 ? 331 LEU A HD22 4  
ATOM   7359  H  HD23 . LEU B 2 73  ? -10.135 5.058   -3.324  1.00 0.00 ? 331 LEU A HD23 4  
ATOM   7360  N  N    . LEU B 2 74  ? -9.037  3.385   0.394   1.00 0.00 ? 332 LEU A N    4  
ATOM   7361  C  CA   . LEU B 2 74  ? -8.520  2.525   1.436   1.00 0.00 ? 332 LEU A CA   4  
ATOM   7362  C  C    . LEU B 2 74  ? -7.409  1.679   0.890   1.00 0.00 ? 332 LEU A C    4  
ATOM   7363  O  O    . LEU B 2 74  ? -7.586  0.950   -0.079  1.00 0.00 ? 332 LEU A O    4  
ATOM   7364  C  CB   . LEU B 2 74  ? -9.605  1.642   2.015   1.00 0.00 ? 332 LEU A CB   4  
ATOM   7365  C  CG   . LEU B 2 74  ? -10.086 2.042   3.384   1.00 0.00 ? 332 LEU A CG   4  
ATOM   7366  C  CD1  . LEU B 2 74  ? -11.216 1.158   3.851   1.00 0.00 ? 332 LEU A CD1  4  
ATOM   7367  C  CD2  . LEU B 2 74  ? -8.977  2.018   4.393   1.00 0.00 ? 332 LEU A CD2  4  
ATOM   7368  H  H    . LEU B 2 74  ? -9.715  3.045   -0.227  1.00 0.00 ? 332 LEU A H    4  
ATOM   7369  H  HA   . LEU B 2 74  ? -8.109  3.156   2.205   1.00 0.00 ? 332 LEU A HA   4  
ATOM   7370  H  HB2  . LEU B 2 74  ? -10.448 1.653   1.345   1.00 0.00 ? 332 LEU A HB2  4  
ATOM   7371  H  HB3  . LEU B 2 74  ? -9.226  0.651   2.072   1.00 0.00 ? 332 LEU A HB3  4  
ATOM   7372  H  HG   . LEU B 2 74  ? -10.442 3.031   3.318   1.00 0.00 ? 332 LEU A HG   4  
ATOM   7373  H  HD11 . LEU B 2 74  ? -11.941 1.736   4.392   1.00 0.00 ? 332 LEU A HD11 4  
ATOM   7374  H  HD12 . LEU B 2 74  ? -10.820 0.396   4.502   1.00 0.00 ? 332 LEU A HD12 4  
ATOM   7375  H  HD13 . LEU B 2 74  ? -11.682 0.694   2.997   1.00 0.00 ? 332 LEU A HD13 4  
ATOM   7376  H  HD21 . LEU B 2 74  ? -9.419  2.092   5.378   1.00 0.00 ? 332 LEU A HD21 4  
ATOM   7377  H  HD22 . LEU B 2 74  ? -8.313  2.854   4.225   1.00 0.00 ? 332 LEU A HD22 4  
ATOM   7378  H  HD23 . LEU B 2 74  ? -8.429  1.092   4.311   1.00 0.00 ? 332 LEU A HD23 4  
ATOM   7379  N  N    . PHE B 2 75  ? -6.279  1.737   1.552   1.00 0.00 ? 333 PHE A N    4  
ATOM   7380  C  CA   . PHE B 2 75  ? -5.121  1.037   1.082   1.00 0.00 ? 333 PHE A CA   4  
ATOM   7381  C  C    . PHE B 2 75  ? -4.957  -0.281  1.771   1.00 0.00 ? 333 PHE A C    4  
ATOM   7382  O  O    . PHE B 2 75  ? -4.388  -0.370  2.859   1.00 0.00 ? 333 PHE A O    4  
ATOM   7383  C  CB   . PHE B 2 75  ? -3.919  1.947   1.289   1.00 0.00 ? 333 PHE A CB   4  
ATOM   7384  C  CG   . PHE B 2 75  ? -4.296  3.328   0.869   1.00 0.00 ? 333 PHE A CG   4  
ATOM   7385  C  CD1  . PHE B 2 75  ? -5.036  4.131   1.707   1.00 0.00 ? 333 PHE A CD1  4  
ATOM   7386  C  CD2  . PHE B 2 75  ? -4.029  3.767   -0.401  1.00 0.00 ? 333 PHE A CD2  4  
ATOM   7387  C  CE1  . PHE B 2 75  ? -5.483  5.347   1.282   1.00 0.00 ? 333 PHE A CE1  4  
ATOM   7388  C  CE2  . PHE B 2 75  ? -4.498  4.978   -0.853  1.00 0.00 ? 333 PHE A CE2  4  
ATOM   7389  C  CZ   . PHE B 2 75  ? -5.225  5.762   -0.004  1.00 0.00 ? 333 PHE A CZ   4  
ATOM   7390  H  H    . PHE B 2 75  ? -6.222  2.258   2.390   1.00 0.00 ? 333 PHE A H    4  
ATOM   7391  H  HA   . PHE B 2 75  ? -5.258  0.869   0.020   1.00 0.00 ? 333 PHE A HA   4  
ATOM   7392  H  HB2  . PHE B 2 75  ? -3.643  1.960   2.333   1.00 0.00 ? 333 PHE A HB2  4  
ATOM   7393  H  HB3  . PHE B 2 75  ? -3.084  1.607   0.685   1.00 0.00 ? 333 PHE A HB3  4  
ATOM   7394  H  HD1  . PHE B 2 75  ? -5.236  3.804   2.717   1.00 0.00 ? 333 PHE A HD1  4  
ATOM   7395  H  HD2  . PHE B 2 75  ? -3.455  3.154   -1.035  1.00 0.00 ? 333 PHE A HD2  4  
ATOM   7396  H  HE1  . PHE B 2 75  ? -6.058  5.975   1.947   1.00 0.00 ? 333 PHE A HE1  4  
ATOM   7397  H  HE2  . PHE B 2 75  ? -4.270  5.325   -1.868  1.00 0.00 ? 333 PHE A HE2  4  
ATOM   7398  H  HZ   . PHE B 2 75  ? -5.625  6.686   -0.353  1.00 0.00 ? 333 PHE A HZ   4  
ATOM   7399  N  N    . CYS B 2 76  ? -5.465  -1.312  1.125   1.00 0.00 ? 334 CYS A N    4  
ATOM   7400  C  CA   . CYS B 2 76  ? -5.348  -2.633  1.658   1.00 0.00 ? 334 CYS A CA   4  
ATOM   7401  C  C    . CYS B 2 76  ? -3.886  -2.977  1.746   1.00 0.00 ? 334 CYS A C    4  
ATOM   7402  O  O    . CYS B 2 76  ? -3.309  -3.409  0.755   1.00 0.00 ? 334 CYS A O    4  
ATOM   7403  C  CB   . CYS B 2 76  ? -6.051  -3.663  0.772   1.00 0.00 ? 334 CYS A CB   4  
ATOM   7404  S  SG   . CYS B 2 76  ? -5.516  -5.369  1.121   1.00 0.00 ? 334 CYS A SG   4  
ATOM   7405  H  H    . CYS B 2 76  ? -5.928  -1.170  0.273   1.00 0.00 ? 334 CYS A H    4  
ATOM   7406  H  HA   . CYS B 2 76  ? -5.781  -2.644  2.641   1.00 0.00 ? 334 CYS A HA   4  
ATOM   7407  H  HB2  . CYS B 2 76  ? -7.117  -3.607  0.939   1.00 0.00 ? 334 CYS A HB2  4  
ATOM   7408  H  HB3  . CYS B 2 76  ? -5.839  -3.451  -0.266  1.00 0.00 ? 334 CYS A HB3  4  
ATOM   7409  N  N    . ASP B 2 77  ? -3.251  -2.764  2.893   1.00 0.00 ? 335 ASP A N    4  
ATOM   7410  C  CA   . ASP B 2 77  ? -1.850  -3.111  2.961   1.00 0.00 ? 335 ASP A CA   4  
ATOM   7411  C  C    . ASP B 2 77  ? -1.706  -4.611  3.125   1.00 0.00 ? 335 ASP A C    4  
ATOM   7412  O  O    . ASP B 2 77  ? -1.000  -5.090  4.012   1.00 0.00 ? 335 ASP A O    4  
ATOM   7413  C  CB   . ASP B 2 77  ? -1.080  -2.369  4.046   1.00 0.00 ? 335 ASP A CB   4  
ATOM   7414  C  CG   . ASP B 2 77  ? -1.566  -2.689  5.446   1.00 0.00 ? 335 ASP A CG   4  
ATOM   7415  O  OD1  . ASP B 2 77  ? -2.784  -2.582  5.690   1.00 0.00 ? 335 ASP A OD1  4  
ATOM   7416  O  OD2  . ASP B 2 77  ? -0.727  -3.056  6.296   1.00 0.00 ? 335 ASP A OD2  4  
ATOM   7417  H  H    . ASP B 2 77  ? -3.720  -2.387  3.676   1.00 0.00 ? 335 ASP A H    4  
ATOM   7418  H  HA   . ASP B 2 77  ? -1.427  -2.839  2.002   1.00 0.00 ? 335 ASP A HA   4  
ATOM   7419  H  HB2  . ASP B 2 77  ? -0.035  -2.645  3.968   1.00 0.00 ? 335 ASP A HB2  4  
ATOM   7420  H  HB3  . ASP B 2 77  ? -1.170  -1.311  3.875   1.00 0.00 ? 335 ASP A HB3  4  
ATOM   7421  N  N    . ASP B 2 78  ? -2.466  -5.335  2.306   1.00 0.00 ? 336 ASP A N    4  
ATOM   7422  C  CA   . ASP B 2 78  ? -2.409  -6.777  2.246   1.00 0.00 ? 336 ASP A CA   4  
ATOM   7423  C  C    . ASP B 2 78  ? -2.140  -7.171  0.795   1.00 0.00 ? 336 ASP A C    4  
ATOM   7424  O  O    . ASP B 2 78  ? -2.149  -8.346  0.431   1.00 0.00 ? 336 ASP A O    4  
ATOM   7425  C  CB   . ASP B 2 78  ? -3.704  -7.409  2.757   1.00 0.00 ? 336 ASP A CB   4  
ATOM   7426  C  CG   . ASP B 2 78  ? -3.514  -8.845  3.206   1.00 0.00 ? 336 ASP A CG   4  
ATOM   7427  O  OD1  . ASP B 2 78  ? -3.069  -9.055  4.354   1.00 0.00 ? 336 ASP A OD1  4  
ATOM   7428  O  OD2  . ASP B 2 78  ? -3.806  -9.759  2.407   1.00 0.00 ? 336 ASP A OD2  4  
ATOM   7429  H  H    . ASP B 2 78  ? -3.118  -4.877  1.746   1.00 0.00 ? 336 ASP A H    4  
ATOM   7430  H  HA   . ASP B 2 78  ? -1.578  -7.095  2.858   1.00 0.00 ? 336 ASP A HA   4  
ATOM   7431  H  HB2  . ASP B 2 78  ? -4.071  -6.835  3.594   1.00 0.00 ? 336 ASP A HB2  4  
ATOM   7432  H  HB3  . ASP B 2 78  ? -4.439  -7.395  1.967   1.00 0.00 ? 336 ASP A HB3  4  
ATOM   7433  N  N    . CYS B 2 79  ? -1.894  -6.135  -0.019  1.00 0.00 ? 337 CYS A N    4  
ATOM   7434  C  CA   . CYS B 2 79  ? -1.573  -6.264  -1.429  1.00 0.00 ? 337 CYS A CA   4  
ATOM   7435  C  C    . CYS B 2 79  ? -1.444  -4.876  -2.041  1.00 0.00 ? 337 CYS A C    4  
ATOM   7436  O  O    . CYS B 2 79  ? -0.729  -4.691  -3.018  1.00 0.00 ? 337 CYS A O    4  
ATOM   7437  C  CB   . CYS B 2 79  ? -2.622  -7.037  -2.205  1.00 0.00 ? 337 CYS A CB   4  
ATOM   7438  S  SG   . CYS B 2 79  ? -4.197  -6.129  -2.383  1.00 0.00 ? 337 CYS A SG   4  
ATOM   7439  H  H    . CYS B 2 79  ? -1.916  -5.234  0.353   1.00 0.00 ? 337 CYS A H    4  
ATOM   7440  H  HA   . CYS B 2 79  ? -0.617  -6.768  -1.487  1.00 0.00 ? 337 CYS A HA   4  
ATOM   7441  H  HB2  . CYS B 2 79  ? -2.237  -7.222  -3.204  1.00 0.00 ? 337 CYS A HB2  4  
ATOM   7442  H  HB3  . CYS B 2 79  ? -2.812  -7.975  -1.714  1.00 0.00 ? 337 CYS A HB3  4  
ATOM   7443  N  N    . ASP B 2 80  ? -2.206  -3.928  -1.472  1.00 0.00 ? 338 ASP A N    4  
ATOM   7444  C  CA   . ASP B 2 80  ? -2.175  -2.512  -1.867  1.00 0.00 ? 338 ASP A CA   4  
ATOM   7445  C  C    . ASP B 2 80  ? -3.286  -2.108  -2.846  1.00 0.00 ? 338 ASP A C    4  
ATOM   7446  O  O    . ASP B 2 80  ? -3.020  -1.420  -3.832  1.00 0.00 ? 338 ASP A O    4  
ATOM   7447  C  CB   . ASP B 2 80  ? -0.812  -2.153  -2.447  1.00 0.00 ? 338 ASP A CB   4  
ATOM   7448  C  CG   . ASP B 2 80  ? -0.546  -0.663  -2.452  1.00 0.00 ? 338 ASP A CG   4  
ATOM   7449  O  OD1  . ASP B 2 80  ? -0.922  0.010   -3.435  1.00 0.00 ? 338 ASP A OD1  4  
ATOM   7450  O  OD2  . ASP B 2 80  ? 0.045   -0.170  -1.469  1.00 0.00 ? 338 ASP A OD2  4  
ATOM   7451  H  H    . ASP B 2 80  ? -2.830  -4.198  -0.772  1.00 0.00 ? 338 ASP A H    4  
ATOM   7452  H  HA   . ASP B 2 80  ? -2.311  -1.937  -0.964  1.00 0.00 ? 338 ASP A HA   4  
ATOM   7453  H  HB2  . ASP B 2 80  ? -0.044  -2.631  -1.860  1.00 0.00 ? 338 ASP A HB2  4  
ATOM   7454  H  HB3  . ASP B 2 80  ? -0.759  -2.520  -3.455  1.00 0.00 ? 338 ASP A HB3  4  
ATOM   7455  N  N    . ARG B 2 81  ? -4.525  -2.528  -2.589  1.00 0.00 ? 339 ARG A N    4  
ATOM   7456  C  CA   . ARG B 2 81  ? -5.638  -2.139  -3.446  1.00 0.00 ? 339 ARG A CA   4  
ATOM   7457  C  C    . ARG B 2 81  ? -6.452  -0.996  -2.823  1.00 0.00 ? 339 ARG A C    4  
ATOM   7458  O  O    . ARG B 2 81  ? -7.201  -1.200  -1.867  1.00 0.00 ? 339 ARG A O    4  
ATOM   7459  C  CB   . ARG B 2 81  ? -6.536  -3.339  -3.717  1.00 0.00 ? 339 ARG A CB   4  
ATOM   7460  C  CG   . ARG B 2 81  ? -5.903  -4.369  -4.632  1.00 0.00 ? 339 ARG A CG   4  
ATOM   7461  C  CD   . ARG B 2 81  ? -6.911  -5.420  -5.053  1.00 0.00 ? 339 ARG A CD   4  
ATOM   7462  N  NE   . ARG B 2 81  ? -6.902  -5.614  -6.501  1.00 0.00 ? 339 ARG A NE   4  
ATOM   7463  C  CZ   . ARG B 2 81  ? -5.937  -6.260  -7.150  1.00 0.00 ? 339 ARG A CZ   4  
ATOM   7464  N  NH1  . ARG B 2 81  ? -4.907  -6.766  -6.483  1.00 0.00 ? 339 ARG A NH1  4  
ATOM   7465  N  NH2  . ARG B 2 81  ? -6.001  -6.402  -8.467  1.00 0.00 ? 339 ARG A NH2  4  
ATOM   7466  H  H    . ARG B 2 81  ? -4.690  -3.145  -1.847  1.00 0.00 ? 339 ARG A H    4  
ATOM   7467  H  HA   . ARG B 2 81  ? -5.226  -1.796  -4.383  1.00 0.00 ? 339 ARG A HA   4  
ATOM   7468  H  HB2  . ARG B 2 81  ? -6.777  -3.817  -2.778  1.00 0.00 ? 339 ARG A HB2  4  
ATOM   7469  H  HB3  . ARG B 2 81  ? -7.444  -2.991  -4.179  1.00 0.00 ? 339 ARG A HB3  4  
ATOM   7470  H  HG2  . ARG B 2 81  ? -5.531  -3.869  -5.515  1.00 0.00 ? 339 ARG A HG2  4  
ATOM   7471  H  HG3  . ARG B 2 81  ? -5.086  -4.846  -4.117  1.00 0.00 ? 339 ARG A HG3  4  
ATOM   7472  H  HD2  . ARG B 2 81  ? -6.682  -6.357  -4.571  1.00 0.00 ? 339 ARG A HD2  4  
ATOM   7473  H  HD3  . ARG B 2 81  ? -7.891  -5.097  -4.742  1.00 0.00 ? 339 ARG A HD3  4  
ATOM   7474  H  HE   . ARG B 2 81  ? -7.653  -5.247  -7.013  1.00 0.00 ? 339 ARG A HE   4  
ATOM   7475  H  HH11 . ARG B 2 81  ? -4.855  -6.661  -5.491  1.00 0.00 ? 339 ARG A HH11 4  
ATOM   7476  H  HH12 . ARG B 2 81  ? -4.184  -7.251  -6.975  1.00 0.00 ? 339 ARG A HH12 4  
ATOM   7477  H  HH21 . ARG B 2 81  ? -6.775  -6.023  -8.974  1.00 0.00 ? 339 ARG A HH21 4  
ATOM   7478  H  HH22 . ARG B 2 81  ? -5.274  -6.889  -8.953  1.00 0.00 ? 339 ARG A HH22 4  
ATOM   7479  N  N    . GLY B 2 82  ? -6.291  0.207   -3.381  1.00 0.00 ? 340 GLY A N    4  
ATOM   7480  C  CA   . GLY B 2 82  ? -7.006  1.386   -2.895  1.00 0.00 ? 340 GLY A CA   4  
ATOM   7481  C  C    . GLY B 2 82  ? -8.500  1.338   -3.180  1.00 0.00 ? 340 GLY A C    4  
ATOM   7482  O  O    . GLY B 2 82  ? -8.907  1.118   -4.309  1.00 0.00 ? 340 GLY A O    4  
ATOM   7483  H  H    . GLY B 2 82  ? -5.675  0.299   -4.137  1.00 0.00 ? 340 GLY A H    4  
ATOM   7484  H  HA2  . GLY B 2 82  ? -6.848  1.507   -1.834  1.00 0.00 ? 340 GLY A HA2  4  
ATOM   7485  H  HA3  . GLY B 2 82  ? -6.600  2.252   -3.388  1.00 0.00 ? 340 GLY A HA3  4  
ATOM   7486  N  N    . TYR B 2 83  ? -9.323  1.542   -2.160  1.00 0.00 ? 341 TYR A N    4  
ATOM   7487  C  CA   . TYR B 2 83  ? -10.784 1.567   -2.361  1.00 0.00 ? 341 TYR A CA   4  
ATOM   7488  C  C    . TYR B 2 83  ? -11.346 2.772   -1.677  1.00 0.00 ? 341 TYR A C    4  
ATOM   7489  O  O    . TYR B 2 83  ? -11.417 2.762   -0.450  1.00 0.00 ? 341 TYR A O    4  
ATOM   7490  C  CB   . TYR B 2 83  ? -11.602 0.439   -1.710  1.00 0.00 ? 341 TYR A CB   4  
ATOM   7491  C  CG   . TYR B 2 83  ? -11.372 -1.007  -2.094  1.00 0.00 ? 341 TYR A CG   4  
ATOM   7492  C  CD1  . TYR B 2 83  ? -10.267 -1.428  -2.789  1.00 0.00 ? 341 TYR A CD1  4  
ATOM   7493  C  CD2  . TYR B 2 83  ? -12.318 -1.966  -1.734  1.00 0.00 ? 341 TYR A CD2  4  
ATOM   7494  C  CE1  . TYR B 2 83  ? -10.099 -2.761  -3.121  1.00 0.00 ? 341 TYR A CE1  4  
ATOM   7495  C  CE2  . TYR B 2 83  ? -12.159 -3.294  -2.060  1.00 0.00 ? 341 TYR A CE2  4  
ATOM   7496  C  CZ   . TYR B 2 83  ? -11.045 -3.685  -2.756  1.00 0.00 ? 341 TYR A CZ   4  
ATOM   7497  O  OH   . TYR B 2 83  ? -10.867 -5.007  -3.084  1.00 0.00 ? 341 TYR A OH   4  
ATOM   7498  H  H    . TYR B 2 83  ? -8.941  1.745   -1.275  1.00 0.00 ? 341 TYR A H    4  
ATOM   7499  H  HA   . TYR B 2 83  ? -10.996 1.610   -3.412  1.00 0.00 ? 341 TYR A HA   4  
ATOM   7500  H  HB2  . TYR B 2 83  ? -11.517 0.513   -0.640  1.00 0.00 ? 341 TYR A HB2  4  
ATOM   7501  H  HB3  . TYR B 2 83  ? -12.630 0.654   -1.945  1.00 0.00 ? 341 TYR A HB3  4  
ATOM   7502  H  HD1  . TYR B 2 83  ? -9.531  -0.705  -3.082  1.00 0.00 ? 341 TYR A HD1  4  
ATOM   7503  H  HD2  . TYR B 2 83  ? -13.195 -1.652  -1.185  1.00 0.00 ? 341 TYR A HD2  4  
ATOM   7504  H  HE1  . TYR B 2 83  ? -9.229  -3.068  -3.681  1.00 0.00 ? 341 TYR A HE1  4  
ATOM   7505  H  HE2  . TYR B 2 83  ? -12.906 -4.017  -1.770  1.00 0.00 ? 341 TYR A HE2  4  
ATOM   7506  H  HH   . TYR B 2 83  ? -9.944  -5.246  -2.963  1.00 0.00 ? 341 TYR A HH   4  
ATOM   7507  N  N    . HIS B 2 84  ? -11.817 3.777   -2.399  1.00 0.00 ? 342 HIS A N    4  
ATOM   7508  C  CA   . HIS B 2 84  ? -12.390 4.883   -1.686  1.00 0.00 ? 342 HIS A CA   4  
ATOM   7509  C  C    . HIS B 2 84  ? -13.290 4.247   -0.658  1.00 0.00 ? 342 HIS A C    4  
ATOM   7510  O  O    . HIS B 2 84  ? -14.128 3.434   -1.006  1.00 0.00 ? 342 HIS A O    4  
ATOM   7511  C  CB   . HIS B 2 84  ? -13.173 5.806   -2.590  1.00 0.00 ? 342 HIS A CB   4  
ATOM   7512  C  CG   . HIS B 2 84  ? -12.365 6.474   -3.651  1.00 0.00 ? 342 HIS A CG   4  
ATOM   7513  N  ND1  . HIS B 2 84  ? -12.348 6.035   -4.949  1.00 0.00 ? 342 HIS A ND1  4  
ATOM   7514  C  CD2  . HIS B 2 84  ? -11.539 7.544   -3.607  1.00 0.00 ? 342 HIS A CD2  4  
ATOM   7515  C  CE1  . HIS B 2 84  ? -11.555 6.798   -5.669  1.00 0.00 ? 342 HIS A CE1  4  
ATOM   7516  N  NE2  . HIS B 2 84  ? -11.052 7.732   -4.879  1.00 0.00 ? 342 HIS A NE2  4  
ATOM   7517  H  H    . HIS B 2 84  ? -11.822 3.748   -3.377  1.00 0.00 ? 342 HIS A H    4  
ATOM   7518  H  HA   . HIS B 2 84  ? -11.601 5.422   -1.189  1.00 0.00 ? 342 HIS A HA   4  
ATOM   7519  H  HB2  . HIS B 2 84  ? -13.939 5.242   -3.067  1.00 0.00 ? 342 HIS A HB2  4  
ATOM   7520  H  HB3  . HIS B 2 84  ? -13.620 6.559   -1.991  1.00 0.00 ? 342 HIS A HB3  4  
ATOM   7521  H  HD2  . HIS B 2 84  ? -11.251 8.096   -2.721  1.00 0.00 ? 342 HIS A HD2  4  
ATOM   7522  H  HE1  . HIS B 2 84  ? -11.306 6.644   -6.712  1.00 0.00 ? 342 HIS A HE1  4  
ATOM   7523  H  HE2  . HIS B 2 84  ? -10.584 8.534   -5.191  1.00 0.00 ? 342 HIS A HE2  4  
ATOM   7524  N  N    . MET B 2 85  ? -13.051 4.547   0.598   1.00 0.00 ? 343 MET A N    4  
ATOM   7525  C  CA   . MET B 2 85  ? -13.788 3.937   1.695   1.00 0.00 ? 343 MET A CA   4  
ATOM   7526  C  C    . MET B 2 85  ? -15.286 3.887   1.447   1.00 0.00 ? 343 MET A C    4  
ATOM   7527  O  O    . MET B 2 85  ? -16.016 3.288   2.221   1.00 0.00 ? 343 MET A O    4  
ATOM   7528  C  CB   . MET B 2 85  ? -13.495 4.646   3.001   1.00 0.00 ? 343 MET A CB   4  
ATOM   7529  C  CG   . MET B 2 85  ? -12.090 4.475   3.495   1.00 0.00 ? 343 MET A CG   4  
ATOM   7530  S  SD   . MET B 2 85  ? -11.233 6.013   3.906   1.00 0.00 ? 343 MET A SD   4  
ATOM   7531  C  CE   . MET B 2 85  ? -12.538 6.925   4.694   1.00 0.00 ? 343 MET A CE   4  
ATOM   7532  H  H    . MET B 2 85  ? -12.361 5.204   0.798   1.00 0.00 ? 343 MET A H    4  
ATOM   7533  H  HA   . MET B 2 85  ? -13.439 2.918   1.780   1.00 0.00 ? 343 MET A HA   4  
ATOM   7534  H  HB2  . MET B 2 85  ? -13.682 5.680   2.885   1.00 0.00 ? 343 MET A HB2  4  
ATOM   7535  H  HB3  . MET B 2 85  ? -14.141 4.249   3.743   1.00 0.00 ? 343 MET A HB3  4  
ATOM   7536  H  HG2  . MET B 2 85  ? -12.122 3.870   4.375   1.00 0.00 ? 343 MET A HG2  4  
ATOM   7537  H  HG3  . MET B 2 85  ? -11.542 3.963   2.734   1.00 0.00 ? 343 MET A HG3  4  
ATOM   7538  H  HE1  . MET B 2 85  ? -13.464 6.710   4.189   1.00 0.00 ? 343 MET A HE1  4  
ATOM   7539  H  HE2  . MET B 2 85  ? -12.329 7.983   4.635   1.00 0.00 ? 343 MET A HE2  4  
ATOM   7540  H  HE3  . MET B 2 85  ? -12.613 6.628   5.728   1.00 0.00 ? 343 MET A HE3  4  
ATOM   7541  N  N    . TYR B 2 86  ? -15.747 4.521   0.387   1.00 0.00 ? 344 TYR A N    4  
ATOM   7542  C  CA   . TYR B 2 86  ? -17.156 4.474   0.052   1.00 0.00 ? 344 TYR A CA   4  
ATOM   7543  C  C    . TYR B 2 86  ? -17.338 3.717   -1.253  1.00 0.00 ? 344 TYR A C    4  
ATOM   7544  O  O    . TYR B 2 86  ? -18.288 3.935   -2.004  1.00 0.00 ? 344 TYR A O    4  
ATOM   7545  C  CB   . TYR B 2 86  ? -17.779 5.872   -0.010  1.00 0.00 ? 344 TYR A CB   4  
ATOM   7546  C  CG   . TYR B 2 86  ? -17.216 6.797   -1.072  1.00 0.00 ? 344 TYR A CG   4  
ATOM   7547  C  CD1  . TYR B 2 86  ? -15.878 7.178   -1.073  1.00 0.00 ? 344 TYR A CD1  4  
ATOM   7548  C  CD2  . TYR B 2 86  ? -18.050 7.336   -2.044  1.00 0.00 ? 344 TYR A CD2  4  
ATOM   7549  C  CE1  . TYR B 2 86  ? -15.392 8.069   -2.015  1.00 0.00 ? 344 TYR A CE1  4  
ATOM   7550  C  CE2  . TYR B 2 86  ? -17.569 8.214   -2.994  1.00 0.00 ? 344 TYR A CE2  4  
ATOM   7551  C  CZ   . TYR B 2 86  ? -16.241 8.579   -2.974  1.00 0.00 ? 344 TYR A CZ   4  
ATOM   7552  O  OH   . TYR B 2 86  ? -15.762 9.464   -3.913  1.00 0.00 ? 344 TYR A OH   4  
ATOM   7553  H  H    . TYR B 2 86  ? -15.127 5.016   -0.185  1.00 0.00 ? 344 TYR A H    4  
ATOM   7554  H  HA   . TYR B 2 86  ? -17.643 3.906   0.839   1.00 0.00 ? 344 TYR A HA   4  
ATOM   7555  H  HB2  . TYR B 2 86  ? -18.835 5.771   -0.200  1.00 0.00 ? 344 TYR A HB2  4  
ATOM   7556  H  HB3  . TYR B 2 86  ? -17.643 6.353   0.949   1.00 0.00 ? 344 TYR A HB3  4  
ATOM   7557  H  HD1  . TYR B 2 86  ? -15.203 6.760   -0.331  1.00 0.00 ? 344 TYR A HD1  4  
ATOM   7558  H  HD2  . TYR B 2 86  ? -19.092 7.048   -2.058  1.00 0.00 ? 344 TYR A HD2  4  
ATOM   7559  H  HE1  . TYR B 2 86  ? -14.344 8.362   -1.992  1.00 0.00 ? 344 TYR A HE1  4  
ATOM   7560  H  HE2  . TYR B 2 86  ? -18.234 8.614   -3.745  1.00 0.00 ? 344 TYR A HE2  4  
ATOM   7561  H  HH   . TYR B 2 86  ? -16.369 10.202  -3.996  1.00 0.00 ? 344 TYR A HH   4  
ATOM   7562  N  N    . CYS B 2 87  ? -16.390 2.817   -1.495  1.00 0.00 ? 345 CYS A N    4  
ATOM   7563  C  CA   . CYS B 2 87  ? -16.388 1.964   -2.670  1.00 0.00 ? 345 CYS A CA   4  
ATOM   7564  C  C    . CYS B 2 87  ? -16.496 0.527   -2.215  1.00 0.00 ? 345 CYS A C    4  
ATOM   7565  O  O    . CYS B 2 87  ? -17.108 -0.310  -2.879  1.00 0.00 ? 345 CYS A O    4  
ATOM   7566  C  CB   . CYS B 2 87  ? -15.129 2.194   -3.533  1.00 0.00 ? 345 CYS A CB   4  
ATOM   7567  S  SG   . CYS B 2 87  ? -15.091 3.871   -4.212  1.00 0.00 ? 345 CYS A SG   4  
ATOM   7568  H  H    . CYS B 2 87  ? -15.669 2.719   -0.844  1.00 0.00 ? 345 CYS A H    4  
ATOM   7569  H  HA   . CYS B 2 87  ? -17.261 2.211   -3.247  1.00 0.00 ? 345 CYS A HA   4  
ATOM   7570  H  HB2  . CYS B 2 87  ? -14.235 2.045   -2.942  1.00 0.00 ? 345 CYS A HB2  4  
ATOM   7571  H  HB3  . CYS B 2 87  ? -15.127 1.501   -4.359  1.00 0.00 ? 345 CYS A HB3  4  
ATOM   7572  N  N    . LEU B 2 88  ? -15.887 0.258   -1.063  1.00 0.00 ? 346 LEU A N    4  
ATOM   7573  C  CA   . LEU B 2 88  ? -15.918 -1.068  -0.460  1.00 0.00 ? 346 LEU A CA   4  
ATOM   7574  C  C    . LEU B 2 88  ? -17.336 -1.608  -0.385  1.00 0.00 ? 346 LEU A C    4  
ATOM   7575  O  O    . LEU B 2 88  ? -18.302 -0.924  -0.725  1.00 0.00 ? 346 LEU A O    4  
ATOM   7576  C  CB   . LEU B 2 88  ? -15.344 -1.040  0.955   1.00 0.00 ? 346 LEU A CB   4  
ATOM   7577  C  CG   . LEU B 2 88  ? -14.652 0.248   1.392   1.00 0.00 ? 346 LEU A CG   4  
ATOM   7578  C  CD1  . LEU B 2 88  ? -14.115 0.120   2.786   1.00 0.00 ? 346 LEU A CD1  4  
ATOM   7579  C  CD2  . LEU B 2 88  ? -13.540 0.582   0.452   1.00 0.00 ? 346 LEU A CD2  4  
ATOM   7580  H  H    . LEU B 2 88  ? -15.374 0.974   -0.616  1.00 0.00 ? 346 LEU A H    4  
ATOM   7581  H  HA   . LEU B 2 88  ? -15.323 -1.728  -1.054  1.00 0.00 ? 346 LEU A HA   4  
ATOM   7582  H  HB2  . LEU B 2 88  ? -16.149 -1.228  1.626   1.00 0.00 ? 346 LEU A HB2  4  
ATOM   7583  H  HB3  . LEU B 2 88  ? -14.635 -1.847  1.046   1.00 0.00 ? 346 LEU A HB3  4  
ATOM   7584  H  HG   . LEU B 2 88  ? -15.344 1.065   1.386   1.00 0.00 ? 346 LEU A HG   4  
ATOM   7585  H  HD11 . LEU B 2 88  ? -13.294 0.806   2.885   1.00 0.00 ? 346 LEU A HD11 4  
ATOM   7586  H  HD12 . LEU B 2 88  ? -13.771 -0.890  2.953   1.00 0.00 ? 346 LEU A HD12 4  
ATOM   7587  H  HD13 . LEU B 2 88  ? -14.885 0.369   3.499   1.00 0.00 ? 346 LEU A HD13 4  
ATOM   7588  H  HD21 . LEU B 2 88  ? -13.788 0.197   -0.529  1.00 0.00 ? 346 LEU A HD21 4  
ATOM   7589  H  HD22 . LEU B 2 88  ? -12.623 0.130   0.798   1.00 0.00 ? 346 LEU A HD22 4  
ATOM   7590  H  HD23 . LEU B 2 88  ? -13.418 1.654   0.397   1.00 0.00 ? 346 LEU A HD23 4  
ATOM   7591  N  N    . ASN B 2 89  ? -17.450 -2.841  0.075   1.00 0.00 ? 347 ASN A N    4  
ATOM   7592  C  CA   . ASN B 2 89  ? -18.735 -3.478  0.248   1.00 0.00 ? 347 ASN A CA   4  
ATOM   7593  C  C    . ASN B 2 89  ? -19.295 -3.015  1.559   1.00 0.00 ? 347 ASN A C    4  
ATOM   7594  O  O    . ASN B 2 89  ? -20.493 -2.754  1.681   1.00 0.00 ? 347 ASN A O    4  
ATOM   7595  C  CB   . ASN B 2 89  ? -18.587 -4.985  0.218   1.00 0.00 ? 347 ASN A CB   4  
ATOM   7596  C  CG   . ASN B 2 89  ? -19.847 -5.690  -0.205  1.00 0.00 ? 347 ASN A CG   4  
ATOM   7597  O  OD1  . ASN B 2 89  ? -20.954 -5.302  0.169   1.00 0.00 ? 347 ASN A OD1  4  
ATOM   7598  N  ND2  . ASN B 2 89  ? -19.681 -6.726  -1.009  1.00 0.00 ? 347 ASN A ND2  4  
ATOM   7599  H  H    . ASN B 2 89  ? -16.646 -3.329  0.330   1.00 0.00 ? 347 ASN A H    4  
ATOM   7600  H  HA   . ASN B 2 89  ? -19.383 -3.142  -0.531  1.00 0.00 ? 347 ASN A HA   4  
ATOM   7601  H  HB2  . ASN B 2 89  ? -17.810 -5.239  -0.471  1.00 0.00 ? 347 ASN A HB2  4  
ATOM   7602  H  HB3  . ASN B 2 89  ? -18.310 -5.326  1.199   1.00 0.00 ? 347 ASN A HB3  4  
ATOM   7603  H  HD21 . ASN B 2 89  ? -18.768 -6.967  -1.272  1.00 0.00 ? 347 ASN A HD21 4  
ATOM   7604  H  HD22 . ASN B 2 89  ? -20.470 -7.199  -1.310  1.00 0.00 ? 347 ASN A HD22 4  
ATOM   7605  N  N    . PRO B 2 90  ? -18.434 -2.957  2.585   1.00 0.00 ? 348 PRO A N    4  
ATOM   7606  C  CA   . PRO B 2 90  ? -18.762 -2.414  3.853   1.00 0.00 ? 348 PRO A CA   4  
ATOM   7607  C  C    . PRO B 2 90  ? -18.037 -1.074  3.962   1.00 0.00 ? 348 PRO A C    4  
ATOM   7608  O  O    . PRO B 2 90  ? -17.186 -0.880  4.831   1.00 0.00 ? 348 PRO A O    4  
ATOM   7609  C  CB   . PRO B 2 90  ? -18.177 -3.460  4.788   1.00 0.00 ? 348 PRO A CB   4  
ATOM   7610  C  CG   . PRO B 2 90  ? -17.023 -4.046  4.055   1.00 0.00 ? 348 PRO A CG   4  
ATOM   7611  C  CD   . PRO B 2 90  ? -17.077 -3.512  2.652   1.00 0.00 ? 348 PRO A CD   4  
ATOM   7612  H  HA   . PRO B 2 90  ? -19.820 -2.313  3.987   1.00 0.00 ? 348 PRO A HA   4  
ATOM   7613  H  HB2  . PRO B 2 90  ? -17.857 -2.997  5.692   1.00 0.00 ? 348 PRO A HB2  4  
ATOM   7614  H  HB3  . PRO B 2 90  ? -18.925 -4.206  4.991   1.00 0.00 ? 348 PRO A HB3  4  
ATOM   7615  H  HG2  . PRO B 2 90  ? -16.096 -3.759  4.530   1.00 0.00 ? 348 PRO A HG2  4  
ATOM   7616  H  HG3  . PRO B 2 90  ? -17.124 -5.110  4.045   1.00 0.00 ? 348 PRO A HG3  4  
ATOM   7617  H  HD2  . PRO B 2 90  ? -16.332 -2.747  2.507   1.00 0.00 ? 348 PRO A HD2  4  
ATOM   7618  H  HD3  . PRO B 2 90  ? -16.950 -4.309  1.951   1.00 0.00 ? 348 PRO A HD3  4  
ATOM   7619  N  N    . PRO B 2 91  ? -18.380 -0.128  3.056   1.00 0.00 ? 349 PRO A N    4  
ATOM   7620  C  CA   . PRO B 2 91  ? -17.709 1.167   2.947   1.00 0.00 ? 349 PRO A CA   4  
ATOM   7621  C  C    . PRO B 2 91  ? -17.548 1.879   4.285   1.00 0.00 ? 349 PRO A C    4  
ATOM   7622  O  O    . PRO B 2 91  ? -18.488 1.937   5.077   1.00 0.00 ? 349 PRO A O    4  
ATOM   7623  C  CB   . PRO B 2 91  ? -18.611 1.969   2.002   1.00 0.00 ? 349 PRO A CB   4  
ATOM   7624  C  CG   . PRO B 2 91  ? -19.880 1.226   1.938   1.00 0.00 ? 349 PRO A CG   4  
ATOM   7625  C  CD   . PRO B 2 91  ? -19.516 -0.207  2.128   1.00 0.00 ? 349 PRO A CD   4  
ATOM   7626  H  HA   . PRO B 2 91  ? -16.746 1.054   2.478   1.00 0.00 ? 349 PRO A HA   4  
ATOM   7627  H  HB2  . PRO B 2 91  ? -18.754 2.953   2.389   1.00 0.00 ? 349 PRO A HB2  4  
ATOM   7628  H  HB3  . PRO B 2 91  ? -18.152 2.029   1.033   1.00 0.00 ? 349 PRO A HB3  4  
ATOM   7629  H  HG2  . PRO B 2 91  ? -20.531 1.558   2.723   1.00 0.00 ? 349 PRO A HG2  4  
ATOM   7630  H  HG3  . PRO B 2 91  ? -20.340 1.371   0.982   1.00 0.00 ? 349 PRO A HG3  4  
ATOM   7631  H  HD2  . PRO B 2 91  ? -20.342 -0.739  2.566   1.00 0.00 ? 349 PRO A HD2  4  
ATOM   7632  H  HD3  . PRO B 2 91  ? -19.221 -0.667  1.192   1.00 0.00 ? 349 PRO A HD3  4  
ATOM   7633  N  N    . VAL B 2 92  ? -16.352 2.424   4.540   1.00 0.00 ? 350 VAL A N    4  
ATOM   7634  C  CA   . VAL B 2 92  ? -16.098 3.123   5.764   1.00 0.00 ? 350 VAL A CA   4  
ATOM   7635  C  C    . VAL B 2 92  ? -16.077 4.614   5.479   1.00 0.00 ? 350 VAL A C    4  
ATOM   7636  O  O    . VAL B 2 92  ? -16.152 5.039   4.325   1.00 0.00 ? 350 VAL A O    4  
ATOM   7637  C  CB   . VAL B 2 92  ? -14.775 2.648   6.424   1.00 0.00 ? 350 VAL A CB   4  
ATOM   7638  C  CG1  . VAL B 2 92  ? -14.409 1.251   5.954   1.00 0.00 ? 350 VAL A CG1  4  
ATOM   7639  C  CG2  . VAL B 2 92  ? -13.622 3.598   6.167   1.00 0.00 ? 350 VAL A CG2  4  
ATOM   7640  H  H    . VAL B 2 92  ? -15.631 2.375   3.885   1.00 0.00 ? 350 VAL A H    4  
ATOM   7641  H  HA   . VAL B 2 92  ? -16.906 2.913   6.440   1.00 0.00 ? 350 VAL A HA   4  
ATOM   7642  H  HB   . VAL B 2 92  ? -14.930 2.600   7.486   1.00 0.00 ? 350 VAL A HB   4  
ATOM   7643  H  HG11 . VAL B 2 92  ? -13.670 1.321   5.167   1.00 0.00 ? 350 VAL A HG11 4  
ATOM   7644  H  HG12 . VAL B 2 92  ? -15.291 0.752   5.578   1.00 0.00 ? 350 VAL A HG12 4  
ATOM   7645  H  HG13 . VAL B 2 92  ? -14.002 0.687   6.780   1.00 0.00 ? 350 VAL A HG13 4  
ATOM   7646  H  HG21 . VAL B 2 92  ? -13.147 3.836   7.100   1.00 0.00 ? 350 VAL A HG21 4  
ATOM   7647  H  HG22 . VAL B 2 92  ? -13.976 4.501   5.701   1.00 0.00 ? 350 VAL A HG22 4  
ATOM   7648  H  HG23 . VAL B 2 92  ? -12.908 3.116   5.519   1.00 0.00 ? 350 VAL A HG23 4  
ATOM   7649  N  N    . ALA B 2 93  ? -15.989 5.399   6.523   1.00 0.00 ? 351 ALA A N    4  
ATOM   7650  C  CA   . ALA B 2 93  ? -15.966 6.848   6.385   1.00 0.00 ? 351 ALA A CA   4  
ATOM   7651  C  C    . ALA B 2 93  ? -14.655 7.422   6.853   1.00 0.00 ? 351 ALA A C    4  
ATOM   7652  O  O    . ALA B 2 93  ? -14.293 8.554   6.532   1.00 0.00 ? 351 ALA A O    4  
ATOM   7653  C  CB   . ALA B 2 93  ? -17.075 7.468   7.211   1.00 0.00 ? 351 ALA A CB   4  
ATOM   7654  H  H    . ALA B 2 93  ? -15.938 4.992   7.409   1.00 0.00 ? 351 ALA A H    4  
ATOM   7655  H  HA   . ALA B 2 93  ? -16.117 7.093   5.352   1.00 0.00 ? 351 ALA A HA   4  
ATOM   7656  H  HB1  . ALA B 2 93  ? -16.695 7.657   8.215   1.00 0.00 ? 351 ALA A HB1  4  
ATOM   7657  H  HB2  . ALA B 2 93  ? -17.914 6.789   7.259   1.00 0.00 ? 351 ALA A HB2  4  
ATOM   7658  H  HB3  . ALA B 2 93  ? -17.386 8.399   6.762   1.00 0.00 ? 351 ALA A HB3  4  
ATOM   7659  N  N    . GLU B 2 94  ? -13.953 6.616   7.616   1.00 0.00 ? 352 GLU A N    4  
ATOM   7660  C  CA   . GLU B 2 94  ? -12.696 7.011   8.228   1.00 0.00 ? 352 GLU A CA   4  
ATOM   7661  C  C    . GLU B 2 94  ? -11.991 5.780   8.800   1.00 0.00 ? 352 GLU A C    4  
ATOM   7662  O  O    . GLU B 2 94  ? -10.800 5.573   8.571   1.00 0.00 ? 352 GLU A O    4  
ATOM   7663  C  CB   . GLU B 2 94  ? -12.955 8.007   9.368   1.00 0.00 ? 352 GLU A CB   4  
ATOM   7664  C  CG   . GLU B 2 94  ? -14.406 8.413   9.538   1.00 0.00 ? 352 GLU A CG   4  
ATOM   7665  C  CD   . GLU B 2 94  ? -14.644 9.230   10.793  1.00 0.00 ? 352 GLU A CD   4  
ATOM   7666  O  OE1  . GLU B 2 94  ? -14.386 10.451  10.765  1.00 0.00 ? 352 GLU A OE1  4  
ATOM   7667  O  OE2  . GLU B 2 94  ? -15.086 8.646   11.807  1.00 0.00 ? 352 GLU A OE2  4  
ATOM   7668  H  H    . GLU B 2 94  ? -14.281 5.702   7.755   1.00 0.00 ? 352 GLU A H    4  
ATOM   7669  H  HA   . GLU B 2 94  ? -12.078 7.469   7.468   1.00 0.00 ? 352 GLU A HA   4  
ATOM   7670  H  HB2  . GLU B 2 94  ? -12.662 7.538   10.283  1.00 0.00 ? 352 GLU A HB2  4  
ATOM   7671  H  HB3  . GLU B 2 94  ? -12.362 8.895   9.212   1.00 0.00 ? 352 GLU A HB3  4  
ATOM   7672  H  HG2  . GLU B 2 94  ? -14.708 8.997   8.683   1.00 0.00 ? 352 GLU A HG2  4  
ATOM   7673  H  HG3  . GLU B 2 94  ? -15.001 7.510   9.591   1.00 0.00 ? 352 GLU A HG3  4  
ATOM   7674  N  N    . PRO B 2 95  ? -12.743 4.952   9.563   1.00 0.00 ? 353 PRO A N    4  
ATOM   7675  C  CA   . PRO B 2 95  ? -12.301 3.726   10.185  1.00 0.00 ? 353 PRO A CA   4  
ATOM   7676  C  C    . PRO B 2 95  ? -10.845 3.263   9.906   1.00 0.00 ? 353 PRO A C    4  
ATOM   7677  O  O    . PRO B 2 95  ? -9.936  3.740   10.587  1.00 0.00 ? 353 PRO A O    4  
ATOM   7678  C  CB   . PRO B 2 95  ? -13.405 2.854   9.613   1.00 0.00 ? 353 PRO A CB   4  
ATOM   7679  C  CG   . PRO B 2 95  ? -14.624 3.642   9.939   1.00 0.00 ? 353 PRO A CG   4  
ATOM   7680  C  CD   . PRO B 2 95  ? -14.183 5.084   9.881   1.00 0.00 ? 353 PRO A CD   4  
ATOM   7681  H  HA   . PRO B 2 95  ? -12.435 3.778   11.254  1.00 0.00 ? 353 PRO A HA   4  
ATOM   7682  H  HB2  . PRO B 2 95  ? -13.279 2.780   8.546   1.00 0.00 ? 353 PRO A HB2  4  
ATOM   7683  H  HB3  . PRO B 2 95  ? -13.406 1.878   10.053  1.00 0.00 ? 353 PRO A HB3  4  
ATOM   7684  H  HG2  . PRO B 2 95  ? -15.396 3.456   9.212   1.00 0.00 ? 353 PRO A HG2  4  
ATOM   7685  H  HG3  . PRO B 2 95  ? -14.964 3.402   10.923  1.00 0.00 ? 353 PRO A HG3  4  
ATOM   7686  H  HD2  . PRO B 2 95  ? -14.714 5.609   9.117   1.00 0.00 ? 353 PRO A HD2  4  
ATOM   7687  H  HD3  . PRO B 2 95  ? -14.327 5.556   10.830  1.00 0.00 ? 353 PRO A HD3  4  
ATOM   7688  N  N    . PRO B 2 96  ? -10.557 2.355   8.934   1.00 0.00 ? 354 PRO A N    4  
ATOM   7689  C  CA   . PRO B 2 96  ? -9.205  1.858   8.707   1.00 0.00 ? 354 PRO A CA   4  
ATOM   7690  C  C    . PRO B 2 96  ? -8.455  2.559   7.577   1.00 0.00 ? 354 PRO A C    4  
ATOM   7691  O  O    . PRO B 2 96  ? -7.775  1.906   6.789   1.00 0.00 ? 354 PRO A O    4  
ATOM   7692  C  CB   . PRO B 2 96  ? -9.544  0.457   8.284   1.00 0.00 ? 354 PRO A CB   4  
ATOM   7693  C  CG   . PRO B 2 96  ? -10.621 0.690   7.309   1.00 0.00 ? 354 PRO A CG   4  
ATOM   7694  C  CD   . PRO B 2 96  ? -11.470 1.722   7.961   1.00 0.00 ? 354 PRO A CD   4  
ATOM   7695  H  HA   . PRO B 2 96  ? -8.623  1.839   9.594   1.00 0.00 ? 354 PRO A HA   4  
ATOM   7696  H  HB2  . PRO B 2 96  ? -8.687  -0.008  7.851   1.00 0.00 ? 354 PRO A HB2  4  
ATOM   7697  H  HB3  . PRO B 2 96  ? -9.907  -0.111  9.113   1.00 0.00 ? 354 PRO A HB3  4  
ATOM   7698  H  HG2  . PRO B 2 96  ? -10.215 1.056   6.382   1.00 0.00 ? 354 PRO A HG2  4  
ATOM   7699  H  HG3  . PRO B 2 96  ? -11.188 -0.209  7.152   1.00 0.00 ? 354 PRO A HG3  4  
ATOM   7700  H  HD2  . PRO B 2 96  ? -11.805 2.432   7.246   1.00 0.00 ? 354 PRO A HD2  4  
ATOM   7701  H  HD3  . PRO B 2 96  ? -12.301 1.253   8.459   1.00 0.00 ? 354 PRO A HD3  4  
ATOM   7702  N  N    . GLU B 2 97  ? -8.532  3.876   7.553   1.00 0.00 ? 355 GLU A N    4  
ATOM   7703  C  CA   . GLU B 2 97  ? -7.935  4.691   6.500   1.00 0.00 ? 355 GLU A CA   4  
ATOM   7704  C  C    . GLU B 2 97  ? -6.622  4.145   5.931   1.00 0.00 ? 355 GLU A C    4  
ATOM   7705  O  O    . GLU B 2 97  ? -6.412  4.186   4.719   1.00 0.00 ? 355 GLU A O    4  
ATOM   7706  C  CB   . GLU B 2 97  ? -7.719  6.112   7.009   1.00 0.00 ? 355 GLU A CB   4  
ATOM   7707  C  CG   . GLU B 2 97  ? -7.025  6.157   8.349   1.00 0.00 ? 355 GLU A CG   4  
ATOM   7708  C  CD   . GLU B 2 97  ? -6.224  7.430   8.553   1.00 0.00 ? 355 GLU A CD   4  
ATOM   7709  O  OE1  . GLU B 2 97  ? -5.608  7.909   7.575   1.00 0.00 ? 355 GLU A OE1  4  
ATOM   7710  O  OE2  . GLU B 2 97  ? -6.215  7.949   9.689   1.00 0.00 ? 355 GLU A OE2  4  
ATOM   7711  H  H    . GLU B 2 97  ? -8.982  4.327   8.286   1.00 0.00 ? 355 GLU A H    4  
ATOM   7712  H  HA   . GLU B 2 97  ? -8.650  4.728   5.704   1.00 0.00 ? 355 GLU A HA   4  
ATOM   7713  H  HB2  . GLU B 2 97  ? -7.121  6.657   6.295   1.00 0.00 ? 355 GLU A HB2  4  
ATOM   7714  H  HB3  . GLU B 2 97  ? -8.677  6.596   7.113   1.00 0.00 ? 355 GLU A HB3  4  
ATOM   7715  H  HG2  . GLU B 2 97  ? -7.775  6.094   9.118   1.00 0.00 ? 355 GLU A HG2  4  
ATOM   7716  H  HG3  . GLU B 2 97  ? -6.365  5.308   8.425   1.00 0.00 ? 355 GLU A HG3  4  
ATOM   7717  N  N    . GLY B 2 98  ? -5.742  3.635   6.784   1.00 0.00 ? 356 GLY A N    4  
ATOM   7718  C  CA   . GLY B 2 98  ? -4.466  3.141   6.297   1.00 0.00 ? 356 GLY A CA   4  
ATOM   7719  C  C    . GLY B 2 98  ? -4.404  1.644   6.096   1.00 0.00 ? 356 GLY A C    4  
ATOM   7720  O  O    . GLY B 2 98  ? -4.308  1.170   4.965   1.00 0.00 ? 356 GLY A O    4  
ATOM   7721  H  H    . GLY B 2 98  ? -5.953  3.599   7.735   1.00 0.00 ? 356 GLY A H    4  
ATOM   7722  H  HA2  . GLY B 2 98  ? -4.261  3.619   5.361   1.00 0.00 ? 356 GLY A HA2  4  
ATOM   7723  H  HA3  . GLY B 2 98  ? -3.699  3.421   6.994   1.00 0.00 ? 356 GLY A HA3  4  
ATOM   7724  N  N    . SER B 2 99  ? -4.432  0.906   7.199   1.00 0.00 ? 357 SER A N    4  
ATOM   7725  C  CA   . SER B 2 99  ? -4.358  -0.556  7.164   1.00 0.00 ? 357 SER A CA   4  
ATOM   7726  C  C    . SER B 2 99  ? -5.511  -1.132  6.352   1.00 0.00 ? 357 SER A C    4  
ATOM   7727  O  O    . SER B 2 99  ? -5.661  -0.813  5.174   1.00 0.00 ? 357 SER A O    4  
ATOM   7728  C  CB   . SER B 2 99  ? -4.408  -1.103  8.581   1.00 0.00 ? 357 SER A CB   4  
ATOM   7729  O  OG   . SER B 2 99  ? -4.161  -2.499  8.603   1.00 0.00 ? 357 SER A OG   4  
ATOM   7730  H  H    . SER B 2 99  ? -4.522  1.358   8.063   1.00 0.00 ? 357 SER A H    4  
ATOM   7731  H  HA   . SER B 2 99  ? -3.424  -0.835  6.704   1.00 0.00 ? 357 SER A HA   4  
ATOM   7732  H  HB2  . SER B 2 99  ? -3.668  -0.606  9.189   1.00 0.00 ? 357 SER A HB2  4  
ATOM   7733  H  HB3  . SER B 2 99  ? -5.392  -0.917  8.979   1.00 0.00 ? 357 SER A HB3  4  
ATOM   7734  H  HG   . SER B 2 99  ? -4.586  -2.887  9.370   1.00 0.00 ? 357 SER A HG   4  
ATOM   7735  N  N    . TRP B 2 100 ? -6.312  -2.009  6.977   1.00 0.00 ? 358 TRP A N    4  
ATOM   7736  C  CA   . TRP B 2 100 ? -7.473  -2.571  6.315   1.00 0.00 ? 358 TRP A CA   4  
ATOM   7737  C  C    . TRP B 2 100 ? -7.094  -3.434  5.121   1.00 0.00 ? 358 TRP A C    4  
ATOM   7738  O  O    . TRP B 2 100 ? -6.115  -3.162  4.437   1.00 0.00 ? 358 TRP A O    4  
ATOM   7739  C  CB   . TRP B 2 100 ? -8.312  -1.386  5.890   1.00 0.00 ? 358 TRP A CB   4  
ATOM   7740  C  CG   . TRP B 2 100 ? -9.538  -1.670  5.131   1.00 0.00 ? 358 TRP A CG   4  
ATOM   7741  C  CD1  . TRP B 2 100 ? -10.770 -1.890  5.637   1.00 0.00 ? 358 TRP A CD1  4  
ATOM   7742  C  CD2  . TRP B 2 100 ? -9.665  -1.653  3.729   1.00 0.00 ? 358 TRP A CD2  4  
ATOM   7743  N  NE1  . TRP B 2 100 ? -11.675 -2.027  4.625   1.00 0.00 ? 358 TRP A NE1  4  
ATOM   7744  C  CE2  . TRP B 2 100 ? -11.015 -1.894  3.430   1.00 0.00 ? 358 TRP A CE2  4  
ATOM   7745  C  CE3  . TRP B 2 100 ? -8.763  -1.463  2.696   1.00 0.00 ? 358 TRP A CE3  4  
ATOM   7746  C  CZ2  . TRP B 2 100 ? -11.481 -1.938  2.126   1.00 0.00 ? 358 TRP A CZ2  4  
ATOM   7747  C  CZ3  . TRP B 2 100 ? -9.230  -1.499  1.409   1.00 0.00 ? 358 TRP A CZ3  4  
ATOM   7748  C  CH2  . TRP B 2 100 ? -10.574 -1.730  1.130   1.00 0.00 ? 358 TRP A CH2  4  
ATOM   7749  H  H    . TRP B 2 100 ? -6.123  -2.265  7.893   1.00 0.00 ? 358 TRP A H    4  
ATOM   7750  H  HA   . TRP B 2 100 ? -8.036  -3.156  7.026   1.00 0.00 ? 358 TRP A HA   4  
ATOM   7751  H  HB2  . TRP B 2 100 ? -8.609  -0.870  6.766   1.00 0.00 ? 358 TRP A HB2  4  
ATOM   7752  H  HB3  . TRP B 2 100 ? -7.708  -0.722  5.298   1.00 0.00 ? 358 TRP A HB3  4  
ATOM   7753  H  HD1  . TRP B 2 100 ? -10.986 -1.919  6.691   1.00 0.00 ? 358 TRP A HD1  4  
ATOM   7754  H  HE1  . TRP B 2 100 ? -12.629 -2.189  4.742   1.00 0.00 ? 358 TRP A HE1  4  
ATOM   7755  H  HE3  . TRP B 2 100 ? -7.713  -1.285  2.891   1.00 0.00 ? 358 TRP A HE3  4  
ATOM   7756  H  HZ2  . TRP B 2 100 ? -12.513 -2.107  1.893   1.00 0.00 ? 358 TRP A HZ2  4  
ATOM   7757  H  HZ3  . TRP B 2 100 ? -8.563  -1.301  0.607   1.00 0.00 ? 358 TRP A HZ3  4  
ATOM   7758  H  HH2  . TRP B 2 100 ? -10.890 -1.740  0.103   1.00 0.00 ? 358 TRP A HH2  4  
ATOM   7759  N  N    . SER B 2 101 ? -7.846  -4.506  4.909   1.00 0.00 ? 359 SER A N    4  
ATOM   7760  C  CA   . SER B 2 101 ? -7.611  -5.378  3.764   1.00 0.00 ? 359 SER A CA   4  
ATOM   7761  C  C    . SER B 2 101 ? -8.664  -5.111  2.713   1.00 0.00 ? 359 SER A C    4  
ATOM   7762  O  O    . SER B 2 101 ? -9.631  -4.396  2.956   1.00 0.00 ? 359 SER A O    4  
ATOM   7763  C  CB   . SER B 2 101 ? -7.639  -6.856  4.140   1.00 0.00 ? 359 SER A CB   4  
ATOM   7764  O  OG   . SER B 2 101 ? -7.701  -7.678  2.988   1.00 0.00 ? 359 SER A OG   4  
ATOM   7765  H  H    . SER B 2 101 ? -8.569  -4.715  5.535   1.00 0.00 ? 359 SER A H    4  
ATOM   7766  H  HA   . SER B 2 101 ? -6.644  -5.138  3.358   1.00 0.00 ? 359 SER A HA   4  
ATOM   7767  H  HB2  . SER B 2 101 ? -6.747  -7.103  4.680   1.00 0.00 ? 359 SER A HB2  4  
ATOM   7768  H  HB3  . SER B 2 101 ? -8.496  -7.049  4.747   1.00 0.00 ? 359 SER A HB3  4  
ATOM   7769  H  HG   . SER B 2 101 ? -6.872  -8.151  2.886   1.00 0.00 ? 359 SER A HG   4  
ATOM   7770  N  N    . CYS B 2 102 ? -8.493  -5.711  1.559   1.00 0.00 ? 360 CYS A N    4  
ATOM   7771  C  CA   . CYS B 2 102 ? -9.432  -5.516  0.472   1.00 0.00 ? 360 CYS A CA   4  
ATOM   7772  C  C    . CYS B 2 102 ? -10.249 -6.772  0.254   1.00 0.00 ? 360 CYS A C    4  
ATOM   7773  O  O    . CYS B 2 102 ? -9.981  -7.801  0.868   1.00 0.00 ? 360 CYS A O    4  
ATOM   7774  C  CB   . CYS B 2 102 ? -8.702  -5.144  -0.805  1.00 0.00 ? 360 CYS A CB   4  
ATOM   7775  S  SG   . CYS B 2 102 ? -7.869  -6.549  -1.609  1.00 0.00 ? 360 CYS A SG   4  
ATOM   7776  H  H    . CYS B 2 102 ? -7.739  -6.325  1.447   1.00 0.00 ? 360 CYS A H    4  
ATOM   7777  H  HA   . CYS B 2 102 ? -10.097 -4.706  0.747   1.00 0.00 ? 360 CYS A HA   4  
ATOM   7778  H  HB2  . CYS B 2 102 ? -9.412  -4.731  -1.497  1.00 0.00 ? 360 CYS A HB2  4  
ATOM   7779  H  HB3  . CYS B 2 102 ? -7.954  -4.400  -0.581  1.00 0.00 ? 360 CYS A HB3  4  
ATOM   7780  N  N    . HIS B 2 103 ? -11.218 -6.707  -0.643  1.00 0.00 ? 361 HIS A N    4  
ATOM   7781  C  CA   . HIS B 2 103 ? -12.069 -7.852  -0.888  1.00 0.00 ? 361 HIS A CA   4  
ATOM   7782  C  C    . HIS B 2 103 ? -11.300 -8.993  -1.544  1.00 0.00 ? 361 HIS A C    4  
ATOM   7783  O  O    . HIS B 2 103 ? -11.417 -10.137 -1.126  1.00 0.00 ? 361 HIS A O    4  
ATOM   7784  C  CB   . HIS B 2 103 ? -13.304 -7.453  -1.716  1.00 0.00 ? 361 HIS A CB   4  
ATOM   7785  C  CG   . HIS B 2 103 ? -13.012 -6.983  -3.114  1.00 0.00 ? 361 HIS A CG   4  
ATOM   7786  N  ND1  . HIS B 2 103 ? -13.427 -5.766  -3.618  1.00 0.00 ? 361 HIS A ND1  4  
ATOM   7787  C  CD2  . HIS B 2 103 ? -12.353 -7.583  -4.122  1.00 0.00 ? 361 HIS A CD2  4  
ATOM   7788  C  CE1  . HIS B 2 103 ? -13.026 -5.660  -4.878  1.00 0.00 ? 361 HIS A CE1  4  
ATOM   7789  N  NE2  . HIS B 2 103 ? -12.378 -6.748  -5.201  1.00 0.00 ? 361 HIS A NE2  4  
ATOM   7790  H  H    . HIS B 2 103 ? -11.349 -5.887  -1.158  1.00 0.00 ? 361 HIS A H    4  
ATOM   7791  H  HA   . HIS B 2 103 ? -12.405 -8.199  0.072   1.00 0.00 ? 361 HIS A HA   4  
ATOM   7792  H  HB2  . HIS B 2 103 ? -13.959 -8.305  -1.789  1.00 0.00 ? 361 HIS A HB2  4  
ATOM   7793  H  HB3  . HIS B 2 103 ? -13.823 -6.658  -1.200  1.00 0.00 ? 361 HIS A HB3  4  
ATOM   7794  H  HD1  . HIS B 2 103 ? -13.936 -5.085  -3.130  1.00 0.00 ? 361 HIS A HD1  4  
ATOM   7795  H  HD2  . HIS B 2 103 ? -11.848 -8.533  -4.074  1.00 0.00 ? 361 HIS A HD2  4  
ATOM   7796  H  HE1  . HIS B 2 103 ? -13.176 -4.819  -5.523  1.00 0.00 ? 361 HIS A HE1  4  
ATOM   7797  H  HE2  . HIS B 2 103 ? -12.064 -6.972  -6.101  1.00 0.00 ? 361 HIS A HE2  4  
ATOM   7798  N  N    . LEU B 2 104 ? -10.473 -8.673  -2.531  1.00 0.00 ? 362 LEU A N    4  
ATOM   7799  C  CA   . LEU B 2 104 ? -9.721  -9.692  -3.252  1.00 0.00 ? 362 LEU A CA   4  
ATOM   7800  C  C    . LEU B 2 104 ? -8.886  -10.542 -2.313  1.00 0.00 ? 362 LEU A C    4  
ATOM   7801  O  O    . LEU B 2 104 ? -8.748  -11.756 -2.499  1.00 0.00 ? 362 LEU A O    4  
ATOM   7802  C  CB   . LEU B 2 104 ? -8.828  -9.045  -4.321  1.00 0.00 ? 362 LEU A CB   4  
ATOM   7803  C  CG   . LEU B 2 104 ? -9.563  -8.481  -5.537  1.00 0.00 ? 362 LEU A CG   4  
ATOM   7804  C  CD1  . LEU B 2 104 ? -8.589  -8.132  -6.628  1.00 0.00 ? 362 LEU A CD1  4  
ATOM   7805  C  CD2  . LEU B 2 104 ? -10.609 -9.451  -6.047  1.00 0.00 ? 362 LEU A CD2  4  
ATOM   7806  H  H    . LEU B 2 104 ? -10.364 -7.731  -2.779  1.00 0.00 ? 362 LEU A H    4  
ATOM   7807  H  HA   . LEU B 2 104 ? -10.434 -10.327 -3.737  1.00 0.00 ? 362 LEU A HA   4  
ATOM   7808  H  HB2  . LEU B 2 104 ? -8.278  -8.238  -3.861  1.00 0.00 ? 362 LEU A HB2  4  
ATOM   7809  H  HB3  . LEU B 2 104 ? -8.123  -9.778  -4.671  1.00 0.00 ? 362 LEU A HB3  4  
ATOM   7810  H  HG   . LEU B 2 104 ? -10.064 -7.572  -5.249  1.00 0.00 ? 362 LEU A HG   4  
ATOM   7811  H  HD11 . LEU B 2 104 ? -7.984  -7.319  -6.288  1.00 0.00 ? 362 LEU A HD11 4  
ATOM   7812  H  HD12 . LEU B 2 104 ? -9.127  -7.838  -7.518  1.00 0.00 ? 362 LEU A HD12 4  
ATOM   7813  H  HD13 . LEU B 2 104 ? -7.963  -8.985  -6.845  1.00 0.00 ? 362 LEU A HD13 4  
ATOM   7814  H  HD21 . LEU B 2 104 ? -11.475 -9.382  -5.410  1.00 0.00 ? 362 LEU A HD21 4  
ATOM   7815  H  HD22 . LEU B 2 104 ? -10.215 -10.457 -6.020  1.00 0.00 ? 362 LEU A HD22 4  
ATOM   7816  H  HD23 . LEU B 2 104 ? -10.881 -9.194  -7.059  1.00 0.00 ? 362 LEU A HD23 4  
ATOM   7817  N  N    . CYS B 2 105 ? -8.388  -9.915  -1.270  1.00 0.00 ? 363 CYS A N    4  
ATOM   7818  C  CA   . CYS B 2 105 ? -7.531  -10.612 -0.320  1.00 0.00 ? 363 CYS A CA   4  
ATOM   7819  C  C    . CYS B 2 105 ? -8.272  -11.611 0.489   1.00 0.00 ? 363 CYS A C    4  
ATOM   7820  O  O    . CYS B 2 105 ? -7.767  -12.702 0.706   1.00 0.00 ? 363 CYS A O    4  
ATOM   7821  C  CB   . CYS B 2 105 ? -6.816  -9.670  0.618   1.00 0.00 ? 363 CYS A CB   4  
ATOM   7822  S  SG   . CYS B 2 105 ? -5.318  -8.924  -0.106  1.00 0.00 ? 363 CYS A SG   4  
ATOM   7823  H  H    . CYS B 2 105 ? -8.634  -8.978  -1.119  1.00 0.00 ? 363 CYS A H    4  
ATOM   7824  H  HA   . CYS B 2 105 ? -6.801  -11.152 -0.880  1.00 0.00 ? 363 CYS A HA   4  
ATOM   7825  H  HB2  . CYS B 2 105 ? -7.495  -8.897  0.921   1.00 0.00 ? 363 CYS A HB2  4  
ATOM   7826  H  HB3  . CYS B 2 105 ? -6.514  -10.226 1.490   1.00 0.00 ? 363 CYS A HB3  4  
ATOM   7827  N  N    . TRP B 2 106 ? -9.435  -11.259 0.980   1.00 0.00 ? 364 TRP A N    4  
ATOM   7828  C  CA   . TRP B 2 106 ? -10.139 -12.226 1.754   1.00 0.00 ? 364 TRP A CA   4  
ATOM   7829  C  C    . TRP B 2 106 ? -10.869 -13.209 0.919   1.00 0.00 ? 364 TRP A C    4  
ATOM   7830  O  O    . TRP B 2 106 ? -10.964 -14.357 1.285   1.00 0.00 ? 364 TRP A O    4  
ATOM   7831  C  CB   . TRP B 2 106 ? -11.074 -11.702 2.779   1.00 0.00 ? 364 TRP A CB   4  
ATOM   7832  C  CG   . TRP B 2 106 ? -11.234 -10.264 2.849   1.00 0.00 ? 364 TRP A CG   4  
ATOM   7833  C  CD1  . TRP B 2 106 ? -10.348 -9.353  3.272   1.00 0.00 ? 364 TRP A CD1  4  
ATOM   7834  C  CD2  . TRP B 2 106 ? -12.415 -9.607  2.550   1.00 0.00 ? 364 TRP A CD2  4  
ATOM   7835  N  NE1  . TRP B 2 106 ? -10.933 -8.107  3.237   1.00 0.00 ? 364 TRP A NE1  4  
ATOM   7836  C  CE2  . TRP B 2 106 ? -12.229 -8.258  2.783   1.00 0.00 ? 364 TRP A CE2  4  
ATOM   7837  C  CE3  . TRP B 2 106 ? -13.611 -10.074 2.089   1.00 0.00 ? 364 TRP A CE3  4  
ATOM   7838  C  CZ2  . TRP B 2 106 ? -13.251 -7.350  2.565   1.00 0.00 ? 364 TRP A CZ2  4  
ATOM   7839  C  CZ3  . TRP B 2 106 ? -14.632 -9.190  1.869   1.00 0.00 ? 364 TRP A CZ3  4  
ATOM   7840  C  CH2  . TRP B 2 106 ? -14.447 -7.836  2.108   1.00 0.00 ? 364 TRP A CH2  4  
ATOM   7841  H  H    . TRP B 2 106 ? -9.786  -10.366 0.841   1.00 0.00 ? 364 TRP A H    4  
ATOM   7842  H  HA   . TRP B 2 106 ? -9.381  -12.756 2.270   1.00 0.00 ? 364 TRP A HA   4  
ATOM   7843  H  HB2  . TRP B 2 106 ? -12.048 -12.126 2.612   1.00 0.00 ? 364 TRP A HB2  4  
ATOM   7844  H  HB3  . TRP B 2 106 ? -10.724 -12.022 3.708   1.00 0.00 ? 364 TRP A HB3  4  
ATOM   7845  H  HD1  . TRP B 2 106 ? -9.342  -9.596  3.579   1.00 0.00 ? 364 TRP A HD1  4  
ATOM   7846  H  HE1  . TRP B 2 106 ? -10.503 -7.268  3.487   1.00 0.00 ? 364 TRP A HE1  4  
ATOM   7847  H  HE3  . TRP B 2 106 ? -13.733 -11.129 1.914   1.00 0.00 ? 364 TRP A HE3  4  
ATOM   7848  H  HZ2  . TRP B 2 106 ? -13.129 -6.318  2.747   1.00 0.00 ? 364 TRP A HZ2  4  
ATOM   7849  H  HZ3  . TRP B 2 106 ? -15.585 -9.538  1.509   1.00 0.00 ? 364 TRP A HZ3  4  
ATOM   7850  H  HH2  . TRP B 2 106 ? -15.268 -7.176  1.928   1.00 0.00 ? 364 TRP A HH2  4  
ATOM   7851  N  N    . GLU B 2 107 ? -11.407 -12.811 -0.196  1.00 0.00 ? 365 GLU A N    4  
ATOM   7852  C  CA   . GLU B 2 107 ? -12.072 -13.789 -0.983  1.00 0.00 ? 365 GLU A CA   4  
ATOM   7853  C  C    . GLU B 2 107 ? -11.064 -14.894 -1.202  1.00 0.00 ? 365 GLU A C    4  
ATOM   7854  O  O    . GLU B 2 107 ? -11.396 -16.064 -1.360  1.00 0.00 ? 365 GLU A O    4  
ATOM   7855  C  CB   . GLU B 2 107 ? -12.495 -13.169 -2.282  1.00 0.00 ? 365 GLU A CB   4  
ATOM   7856  C  CG   . GLU B 2 107 ? -13.262 -11.894 -2.047  1.00 0.00 ? 365 GLU A CG   4  
ATOM   7857  C  CD   . GLU B 2 107 ? -14.750 -12.041 -2.305  1.00 0.00 ? 365 GLU A CD   4  
ATOM   7858  O  OE1  . GLU B 2 107 ? -15.155 -12.012 -3.486  1.00 0.00 ? 365 GLU A OE1  4  
ATOM   7859  O  OE2  . GLU B 2 107 ? -15.510 -12.185 -1.324  1.00 0.00 ? 365 GLU A OE2  4  
ATOM   7860  H  H    . GLU B 2 107 ? -11.335 -11.883 -0.507  1.00 0.00 ? 365 GLU A H    4  
ATOM   7861  H  HA   . GLU B 2 107 ? -12.925 -14.139 -0.410  1.00 0.00 ? 365 GLU A HA   4  
ATOM   7862  H  HB2  . GLU B 2 107 ? -11.597 -12.943 -2.849  1.00 0.00 ? 365 GLU A HB2  4  
ATOM   7863  H  HB3  . GLU B 2 107 ? -13.115 -13.859 -2.833  1.00 0.00 ? 365 GLU A HB3  4  
ATOM   7864  H  HG2  . GLU B 2 107 ? -13.111 -11.609 -1.008  1.00 0.00 ? 365 GLU A HG2  4  
ATOM   7865  H  HG3  . GLU B 2 107 ? -12.864 -11.125 -2.689  1.00 0.00 ? 365 GLU A HG3  4  
ATOM   7866  N  N    . LEU B 2 108 ? -9.807  -14.454 -1.128  1.00 0.00 ? 366 LEU A N    4  
ATOM   7867  C  CA   . LEU B 2 108 ? -8.638  -15.287 -1.271  1.00 0.00 ? 366 LEU A CA   4  
ATOM   7868  C  C    . LEU B 2 108 ? -8.259  -15.894 0.085   1.00 0.00 ? 366 LEU A C    4  
ATOM   7869  O  O    . LEU B 2 108 ? -7.732  -17.005 0.177   1.00 0.00 ? 366 LEU A O    4  
ATOM   7870  C  CB   . LEU B 2 108 ? -7.525  -14.404 -1.818  1.00 0.00 ? 366 LEU A CB   4  
ATOM   7871  C  CG   . LEU B 2 108 ? -6.153  -15.028 -1.946  1.00 0.00 ? 366 LEU A CG   4  
ATOM   7872  C  CD1  . LEU B 2 108 ? -5.414  -14.883 -0.639  1.00 0.00 ? 366 LEU A CD1  4  
ATOM   7873  C  CD2  . LEU B 2 108 ? -6.285  -16.471 -2.371  1.00 0.00 ? 366 LEU A CD2  4  
ATOM   7874  H  H    . LEU B 2 108 ? -9.665  -13.493 -0.959  1.00 0.00 ? 366 LEU A H    4  
ATOM   7875  H  HA   . LEU B 2 108 ? -8.843  -16.057 -1.974  1.00 0.00 ? 366 LEU A HA   4  
ATOM   7876  H  HB2  . LEU B 2 108 ? -7.821  -14.065 -2.786  1.00 0.00 ? 366 LEU A HB2  4  
ATOM   7877  H  HB3  . LEU B 2 108 ? -7.446  -13.553 -1.177  1.00 0.00 ? 366 LEU A HB3  4  
ATOM   7878  H  HG   . LEU B 2 108 ? -5.603  -14.504 -2.707  1.00 0.00 ? 366 LEU A HG   4  
ATOM   7879  H  HD11 . LEU B 2 108 ? -5.837  -14.041 -0.101  1.00 0.00 ? 366 LEU A HD11 4  
ATOM   7880  H  HD12 . LEU B 2 108 ? -4.365  -14.704 -0.830  1.00 0.00 ? 366 LEU A HD12 4  
ATOM   7881  H  HD13 . LEU B 2 108 ? -5.529  -15.781 -0.056  1.00 0.00 ? 366 LEU A HD13 4  
ATOM   7882  H  HD21 . LEU B 2 108 ? -7.262  -16.598 -2.816  1.00 0.00 ? 366 LEU A HD21 4  
ATOM   7883  H  HD22 . LEU B 2 108 ? -6.189  -17.116 -1.508  1.00 0.00 ? 366 LEU A HD22 4  
ATOM   7884  H  HD23 . LEU B 2 108 ? -5.522  -16.712 -3.095  1.00 0.00 ? 366 LEU A HD23 4  
ATOM   7885  N  N    . LEU B 2 109 ? -8.583  -15.145 1.128   1.00 0.00 ? 367 LEU A N    4  
ATOM   7886  C  CA   . LEU B 2 109 ? -8.313  -15.521 2.513   1.00 0.00 ? 367 LEU A CA   4  
ATOM   7887  C  C    . LEU B 2 109 ? -9.266  -16.616 2.901   1.00 0.00 ? 367 LEU A C    4  
ATOM   7888  O  O    . LEU B 2 109 ? -8.879  -17.742 3.199   1.00 0.00 ? 367 LEU A O    4  
ATOM   7889  C  CB   . LEU B 2 109 ? -8.573  -14.297 3.359   1.00 0.00 ? 367 LEU A CB   4  
ATOM   7890  C  CG   . LEU B 2 109 ? -8.026  -14.258 4.754   1.00 0.00 ? 367 LEU A CG   4  
ATOM   7891  C  CD1  . LEU B 2 109 ? -6.591  -13.770 4.708   1.00 0.00 ? 367 LEU A CD1  4  
ATOM   7892  C  CD2  . LEU B 2 109 ? -8.911  -13.336 5.595   1.00 0.00 ? 367 LEU A CD2  4  
ATOM   7893  H  H    . LEU B 2 109 ? -9.065  -14.300 0.964   1.00 0.00 ? 367 LEU A H    4  
ATOM   7894  H  HA   . LEU B 2 109 ? -7.293  -15.843 2.621   1.00 0.00 ? 367 LEU A HA   4  
ATOM   7895  H  HB2  . LEU B 2 109 ? -8.156  -13.455 2.833   1.00 0.00 ? 367 LEU A HB2  4  
ATOM   7896  H  HB3  . LEU B 2 109 ? -9.644  -14.161 3.419   1.00 0.00 ? 367 LEU A HB3  4  
ATOM   7897  H  HG   . LEU B 2 109 ? -8.042  -15.247 5.176   1.00 0.00 ? 367 LEU A HG   4  
ATOM   7898  H  HD11 . LEU B 2 109 ? -6.358  -13.470 3.690   1.00 0.00 ? 367 LEU A HD11 4  
ATOM   7899  H  HD12 . LEU B 2 109 ? -5.927  -14.565 5.014   1.00 0.00 ? 367 LEU A HD12 4  
ATOM   7900  H  HD13 . LEU B 2 109 ? -6.474  -12.924 5.369   1.00 0.00 ? 367 LEU A HD13 4  
ATOM   7901  H  HD21 . LEU B 2 109 ? -9.643  -12.830 4.945   1.00 0.00 ? 367 LEU A HD21 4  
ATOM   7902  H  HD22 . LEU B 2 109 ? -8.295  -12.597 6.086   1.00 0.00 ? 367 LEU A HD22 4  
ATOM   7903  H  HD23 . LEU B 2 109 ? -9.434  -13.919 6.337   1.00 0.00 ? 367 LEU A HD23 4  
ATOM   7904  N  N    . LYS B 2 110 ? -10.525 -16.239 2.913   1.00 0.00 ? 368 LYS A N    4  
ATOM   7905  C  CA   . LYS B 2 110 ? -11.598 -17.162 3.190   1.00 0.00 ? 368 LYS A CA   4  
ATOM   7906  C  C    . LYS B 2 110 ? -11.460 -18.357 2.255   1.00 0.00 ? 368 LYS A C    4  
ATOM   7907  O  O    . LYS B 2 110 ? -11.782 -19.487 2.621   1.00 0.00 ? 368 LYS A O    4  
ATOM   7908  C  CB   . LYS B 2 110 ? -12.952 -16.469 2.985   1.00 0.00 ? 368 LYS A CB   4  
ATOM   7909  C  CG   . LYS B 2 110 ? -12.951 -14.988 3.350   1.00 0.00 ? 368 LYS A CG   4  
ATOM   7910  C  CD   . LYS B 2 110 ? -14.271 -14.328 3.012   1.00 0.00 ? 368 LYS A CD   4  
ATOM   7911  C  CE   . LYS B 2 110 ? -14.314 -12.881 3.486   1.00 0.00 ? 368 LYS A CE   4  
ATOM   7912  N  NZ   . LYS B 2 110 ? -15.705 -12.350 3.515   1.00 0.00 ? 368 LYS A NZ   4  
ATOM   7913  H  H    . LYS B 2 110 ? -10.732 -15.285 2.744   1.00 0.00 ? 368 LYS A H    4  
ATOM   7914  H  HA   . LYS B 2 110 ? -11.502 -17.501 4.208   1.00 0.00 ? 368 LYS A HA   4  
ATOM   7915  H  HB2  . LYS B 2 110 ? -13.225 -16.553 1.944   1.00 0.00 ? 368 LYS A HB2  4  
ATOM   7916  H  HB3  . LYS B 2 110 ? -13.696 -16.969 3.587   1.00 0.00 ? 368 LYS A HB3  4  
ATOM   7917  H  HG2  . LYS B 2 110 ? -12.762 -14.880 4.405   1.00 0.00 ? 368 LYS A HG2  4  
ATOM   7918  H  HG3  . LYS B 2 110 ? -12.179 -14.494 2.786   1.00 0.00 ? 368 LYS A HG3  4  
ATOM   7919  H  HD2  . LYS B 2 110 ? -14.383 -14.344 1.943   1.00 0.00 ? 368 LYS A HD2  4  
ATOM   7920  H  HD3  . LYS B 2 110 ? -15.074 -14.880 3.476   1.00 0.00 ? 368 LYS A HD3  4  
ATOM   7921  H  HE2  . LYS B 2 110 ? -13.896 -12.828 4.481   1.00 0.00 ? 368 LYS A HE2  4  
ATOM   7922  H  HE3  . LYS B 2 110 ? -13.719 -12.265 2.807   1.00 0.00 ? 368 LYS A HE3  4  
ATOM   7923  H  HZ1  . LYS B 2 110 ? -16.281 -12.895 4.189   1.00 0.00 ? 368 LYS A HZ1  4  
ATOM   7924  H  HZ2  . LYS B 2 110 ? -16.135 -12.422 2.572   1.00 0.00 ? 368 LYS A HZ2  4  
ATOM   7925  H  HZ3  . LYS B 2 110 ? -15.701 -11.352 3.807   1.00 0.00 ? 368 LYS A HZ3  4  
ATOM   7926  N  N    . GLU B 2 111 ? -10.978 -18.091 1.037   1.00 0.00 ? 369 GLU A N    4  
ATOM   7927  C  CA   . GLU B 2 111 ? -10.760 -19.150 0.059   1.00 0.00 ? 369 GLU A CA   4  
ATOM   7928  C  C    . GLU B 2 111 ? -9.774  -20.176 0.589   1.00 0.00 ? 369 GLU A C    4  
ATOM   7929  O  O    . GLU B 2 111 ? -9.915  -21.371 0.327   1.00 0.00 ? 369 GLU A O    4  
ATOM   7930  C  CB   . GLU B 2 111 ? -10.215 -18.587 -1.251  1.00 0.00 ? 369 GLU A CB   4  
ATOM   7931  C  CG   . GLU B 2 111 ? -11.101 -18.871 -2.451  1.00 0.00 ? 369 GLU A CG   4  
ATOM   7932  C  CD   . GLU B 2 111 ? -10.547 -18.288 -3.737  1.00 0.00 ? 369 GLU A CD   4  
ATOM   7933  O  OE1  . GLU B 2 111 ? -9.660  -18.924 -4.343  1.00 0.00 ? 369 GLU A OE1  4  
ATOM   7934  O  OE2  . GLU B 2 111 ? -10.998 -17.193 -4.135  1.00 0.00 ? 369 GLU A OE2  4  
ATOM   7935  H  H    . GLU B 2 111 ? -10.789 -17.156 0.783   1.00 0.00 ? 369 GLU A H    4  
ATOM   7936  H  HA   . GLU B 2 111 ? -11.706 -19.635 -0.130  1.00 0.00 ? 369 GLU A HA   4  
ATOM   7937  H  HB2  . GLU B 2 111 ? -10.104 -17.521 -1.153  1.00 0.00 ? 369 GLU A HB2  4  
ATOM   7938  H  HB3  . GLU B 2 111 ? -9.244  -19.023 -1.435  1.00 0.00 ? 369 GLU A HB3  4  
ATOM   7939  H  HG2  . GLU B 2 111 ? -11.193 -19.940 -2.570  1.00 0.00 ? 369 GLU A HG2  4  
ATOM   7940  H  HG3  . GLU B 2 111 ? -12.076 -18.443 -2.270  1.00 0.00 ? 369 GLU A HG3  4  
ATOM   7941  N  N    . LYS B 2 112 ? -8.764  -19.707 1.330   1.00 0.00 ? 370 LYS A N    4  
ATOM   7942  C  CA   . LYS B 2 112 ? -7.758  -20.604 1.873   1.00 0.00 ? 370 LYS A CA   4  
ATOM   7943  C  C    . LYS B 2 112 ? -8.409  -21.787 2.580   1.00 0.00 ? 370 LYS A C    4  
ATOM   7944  O  O    . LYS B 2 112 ? -7.858  -22.889 2.615   1.00 0.00 ? 370 LYS A O    4  
ATOM   7945  C  CB   . LYS B 2 112 ? -6.852  -19.865 2.844   1.00 0.00 ? 370 LYS A CB   4  
ATOM   7946  C  CG   . LYS B 2 112 ? -5.813  -19.024 2.171   1.00 0.00 ? 370 LYS A CG   4  
ATOM   7947  C  CD   . LYS B 2 112 ? -5.526  -17.822 3.013   1.00 0.00 ? 370 LYS A CD   4  
ATOM   7948  C  CE   . LYS B 2 112 ? -4.726  -16.791 2.252   1.00 0.00 ? 370 LYS A CE   4  
ATOM   7949  N  NZ   . LYS B 2 112 ? -3.482  -17.366 1.669   1.00 0.00 ? 370 LYS A NZ   4  
ATOM   7950  H  H    . LYS B 2 112 ? -8.697  -18.737 1.516   1.00 0.00 ? 370 LYS A H    4  
ATOM   7951  H  HA   . LYS B 2 112 ? -7.166  -20.954 1.047   1.00 0.00 ? 370 LYS A HA   4  
ATOM   7952  H  HB2  . LYS B 2 112 ? -7.450  -19.204 3.439   1.00 0.00 ? 370 LYS A HB2  4  
ATOM   7953  H  HB3  . LYS B 2 112 ? -6.357  -20.575 3.484   1.00 0.00 ? 370 LYS A HB3  4  
ATOM   7954  H  HG2  . LYS B 2 112 ? -4.910  -19.598 2.029   1.00 0.00 ? 370 LYS A HG2  4  
ATOM   7955  H  HG3  . LYS B 2 112 ? -6.202  -18.696 1.231   1.00 0.00 ? 370 LYS A HG3  4  
ATOM   7956  H  HD2  . LYS B 2 112 ? -6.474  -17.400 3.286   1.00 0.00 ? 370 LYS A HD2  4  
ATOM   7957  H  HD3  . LYS B 2 112 ? -4.982  -18.122 3.898   1.00 0.00 ? 370 LYS A HD3  4  
ATOM   7958  H  HE2  . LYS B 2 112 ? -5.345  -16.412 1.458   1.00 0.00 ? 370 LYS A HE2  4  
ATOM   7959  H  HE3  . LYS B 2 112 ? -4.464  -15.986 2.923   1.00 0.00 ? 370 LYS A HE3  4  
ATOM   7960  H  HZ1  . LYS B 2 112 ? -3.721  -18.109 0.981   1.00 0.00 ? 370 LYS A HZ1  4  
ATOM   7961  H  HZ2  . LYS B 2 112 ? -2.895  -17.781 2.420   1.00 0.00 ? 370 LYS A HZ2  4  
ATOM   7962  H  HZ3  . LYS B 2 112 ? -2.936  -16.624 1.187   1.00 0.00 ? 370 LYS A HZ3  4  
ATOM   7963  N  N    . ALA B 2 113 ? -9.589  -21.542 3.143   1.00 0.00 ? 371 ALA A N    4  
ATOM   7964  C  CA   . ALA B 2 113 ? -10.337 -22.568 3.860   1.00 0.00 ? 371 ALA A CA   4  
ATOM   7965  C  C    . ALA B 2 113 ? -10.759 -23.701 2.943   1.00 0.00 ? 371 ALA A C    4  
ATOM   7966  O  O    . ALA B 2 113 ? -10.329 -23.791 1.792   1.00 0.00 ? 371 ALA A O    4  
ATOM   7967  C  CB   . ALA B 2 113 ? -11.565 -21.959 4.517   1.00 0.00 ? 371 ALA A CB   4  
ATOM   7968  H  H    . ALA B 2 113 ? -9.967  -20.640 3.075   1.00 0.00 ? 371 ALA A H    4  
ATOM   7969  H  HA   . ALA B 2 113 ? -9.706  -22.969 4.638   1.00 0.00 ? 371 ALA A HA   4  
ATOM   7970  H  HB1  . ALA B 2 113 ? -11.257 -21.269 5.283   1.00 0.00 ? 371 ALA A HB1  4  
ATOM   7971  H  HB2  . ALA B 2 113 ? -12.161 -22.743 4.960   1.00 0.00 ? 371 ALA A HB2  4  
ATOM   7972  H  HB3  . ALA B 2 113 ? -12.150 -21.437 3.776   1.00 0.00 ? 371 ALA A HB3  4  
ATOM   7973  N  N    . SER B 2 114 ? -11.609 -24.562 3.480   1.00 0.00 ? 372 SER A N    4  
ATOM   7974  C  CA   . SER B 2 114 ? -12.123 -25.712 2.742   1.00 0.00 ? 372 SER A CA   4  
ATOM   7975  C  C    . SER B 2 114 ? -10.985 -26.601 2.249   1.00 0.00 ? 372 SER A C    4  
ATOM   7976  O  O    . SER B 2 114 ? -10.515 -26.386 1.112   1.00 0.00 ? 372 SER A O    4  
ATOM   7977  C  CB   . SER B 2 114 ? -12.976 -25.247 1.560   1.00 0.00 ? 372 SER A CB   4  
ATOM   7978  O  OG   . SER B 2 114 ? -13.508 -26.351 0.847   1.00 0.00 ? 372 SER A OG   4  
ATOM   7979  O  OXT  . SER B 2 114 ? -10.573 -27.506 3.006   1.00 0.00 ? 372 SER A OXT  4  
ATOM   7980  H  H    . SER B 2 114 ? -11.900 -24.414 4.405   1.00 0.00 ? 372 SER A H    4  
ATOM   7981  H  HA   . SER B 2 114 ? -12.743 -26.284 3.415   1.00 0.00 ? 372 SER A HA   4  
ATOM   7982  H  HB2  . SER B 2 114 ? -13.793 -24.642 1.924   1.00 0.00 ? 372 SER A HB2  4  
ATOM   7983  H  HB3  . SER B 2 114 ? -12.366 -24.660 0.888   1.00 0.00 ? 372 SER A HB3  4  
ATOM   7984  H  HG   . SER B 2 114 ? -13.102 -27.161 1.163   1.00 0.00 ? 372 SER A HG   4  
HETATM 7985  ZN ZN   . ZN  C 3 .   ? 14.176  0.157   3.397   1.00 0.00 ? 501 ZN  A ZN   4  
HETATM 7986  ZN ZN   . ZN  D 3 .   ? 3.921   5.703   -8.743  1.00 0.00 ? 601 ZN  A ZN   4  
HETATM 7987  ZN ZN   . ZN  E 3 .   ? -5.725  -6.735  -0.745  1.00 0.00 ? 701 ZN  A ZN   4  
HETATM 7988  ZN ZN   . ZN  F 3 .   ? -13.299 4.299   -5.630  1.00 0.00 ? 801 ZN  A ZN   4  
HETATM 7989  C  C1A  . SAC A 1 1   ? 6.458   5.123   -1.566  1.00 0.00 ? 1   SAC B C1A  5  
HETATM 7990  C  C2A  . SAC A 1 1   ? 7.788   4.809   -2.258  1.00 0.00 ? 1   SAC B C2A  5  
HETATM 7991  O  OAC  . SAC A 1 1   ? 5.650   5.860   -2.132  1.00 0.00 ? 1   SAC B OAC  5  
HETATM 7992  N  N    . SAC A 1 1   ? 6.191   4.552   -0.396  1.00 0.00 ? 1   SAC B N    5  
HETATM 7993  C  CA   . SAC A 1 1   ? 4.847   4.587   0.180   1.00 0.00 ? 1   SAC B CA   5  
HETATM 7994  C  C    . SAC A 1 1   ? 4.476   6.004   0.587   1.00 0.00 ? 1   SAC B C    5  
HETATM 7995  O  O    . SAC A 1 1   ? 3.297   6.340   0.687   1.00 0.00 ? 1   SAC B O    5  
HETATM 7996  C  CB   . SAC A 1 1   ? 4.763   3.655   1.388   1.00 0.00 ? 1   SAC B CB   5  
HETATM 7997  O  OG   . SAC A 1 1   ? 5.692   4.028   2.387   1.00 0.00 ? 1   SAC B OG   5  
HETATM 7998  H  H1   . SAC A 1 1   ? 6.869   3.974   0.015   1.00 0.00 ? 1   SAC B H1   5  
HETATM 7999  H  H2A1 . SAC A 1 1   ? 7.633   4.754   -3.325  1.00 0.00 ? 1   SAC B H2A1 5  
HETATM 8000  H  H2A2 . SAC A 1 1   ? 8.163   3.863   -1.898  1.00 0.00 ? 1   SAC B H2A2 5  
HETATM 8001  H  H2A3 . SAC A 1 1   ? 8.501   5.588   -2.037  1.00 0.00 ? 1   SAC B H2A3 5  
HETATM 8002  H  HA   . SAC A 1 1   ? 4.146   4.251   -0.574  1.00 0.00 ? 1   SAC B HA   5  
HETATM 8003  H  HB2  . SAC A 1 1   ? 3.769   3.700   1.805   1.00 0.00 ? 1   SAC B HB2  5  
HETATM 8004  H  HB3  . SAC A 1 1   ? 4.974   2.645   1.075   1.00 0.00 ? 1   SAC B HB3  5  
HETATM 8005  H  HG   . SAC A 1 1   ? 5.951   4.944   2.259   1.00 0.00 ? 1   SAC B HG   5  
ATOM   8006  N  N    . GLY A 1 2   ? 5.485   6.832   0.827   1.00 0.00 ? 2   GLY B N    5  
ATOM   8007  C  CA   . GLY A 1 2   ? 5.232   8.207   1.203   1.00 0.00 ? 2   GLY B CA   5  
ATOM   8008  C  C    . GLY A 1 2   ? 4.993   9.079   -0.007  1.00 0.00 ? 2   GLY B C    5  
ATOM   8009  O  O    . GLY A 1 2   ? 5.919   9.365   -0.768  1.00 0.00 ? 2   GLY B O    5  
ATOM   8010  H  H    . GLY A 1 2   ? 6.406   6.506   0.750   1.00 0.00 ? 2   GLY B H    5  
ATOM   8011  H  HA2  . GLY A 1 2   ? 4.355   8.240   1.833   1.00 0.00 ? 2   GLY B HA2  5  
ATOM   8012  H  HA3  . GLY A 1 2   ? 6.080   8.588   1.752   1.00 0.00 ? 2   GLY B HA3  5  
ATOM   8013  N  N    . ARG A 1 3   ? 3.744   9.495   -0.190  1.00 0.00 ? 3   ARG B N    5  
ATOM   8014  C  CA   . ARG A 1 3   ? 3.374   10.327  -1.326  1.00 0.00 ? 3   ARG B CA   5  
ATOM   8015  C  C    . ARG A 1 3   ? 4.324   11.513  -1.477  1.00 0.00 ? 3   ARG B C    5  
ATOM   8016  O  O    . ARG A 1 3   ? 4.884   11.737  -2.550  1.00 0.00 ? 3   ARG B O    5  
ATOM   8017  C  CB   . ARG A 1 3   ? 1.929   10.819  -1.175  1.00 0.00 ? 3   ARG B CB   5  
ATOM   8018  C  CG   . ARG A 1 3   ? 1.570   11.992  -2.077  1.00 0.00 ? 3   ARG B CG   5  
ATOM   8019  C  CD   . ARG A 1 3   ? 0.093   12.337  -1.977  1.00 0.00 ? 3   ARG B CD   5  
ATOM   8020  N  NE   . ARG A 1 3   ? -0.279  13.426  -2.877  1.00 0.00 ? 3   ARG B NE   5  
ATOM   8021  C  CZ   . ARG A 1 3   ? -1.530  13.845  -3.053  1.00 0.00 ? 3   ARG B CZ   5  
ATOM   8022  N  NH1  . ARG A 1 3   ? -2.526  13.267  -2.395  1.00 0.00 ? 3   ARG B NH1  5  
ATOM   8023  N  NH2  . ARG A 1 3   ? -1.785  14.843  -3.888  1.00 0.00 ? 3   ARG B NH2  5  
ATOM   8024  H  H    . ARG A 1 3   ? 3.055   9.234   0.456   1.00 0.00 ? 3   ARG B H    5  
ATOM   8025  H  HA   . ARG A 1 3   ? 3.442   9.704   -2.209  1.00 0.00 ? 3   ARG B HA   5  
ATOM   8026  H  HB2  . ARG A 1 3   ? 1.258   10.004  -1.403  1.00 0.00 ? 3   ARG B HB2  5  
ATOM   8027  H  HB3  . ARG A 1 3   ? 1.770   11.121  -0.153  1.00 0.00 ? 3   ARG B HB3  5  
ATOM   8028  H  HG2  . ARG A 1 3   ? 2.152   12.852  -1.782  1.00 0.00 ? 3   ARG B HG2  5  
ATOM   8029  H  HG3  . ARG A 1 3   ? 1.802   11.732  -3.099  1.00 0.00 ? 3   ARG B HG3  5  
ATOM   8030  H  HD2  . ARG A 1 3   ? -0.487  11.462  -2.228  1.00 0.00 ? 3   ARG B HD2  5  
ATOM   8031  H  HD3  . ARG A 1 3   ? -0.126  12.632  -0.961  1.00 0.00 ? 3   ARG B HD3  5  
ATOM   8032  H  HE   . ARG A 1 3   ? 0.440   13.868  -3.376  1.00 0.00 ? 3   ARG B HE   5  
ATOM   8033  H  HH11 . ARG A 1 3   ? -2.339  12.513  -1.764  1.00 0.00 ? 3   ARG B HH11 5  
ATOM   8034  H  HH12 . ARG A 1 3   ? -3.465  13.585  -2.528  1.00 0.00 ? 3   ARG B HH12 5  
ATOM   8035  H  HH21 . ARG A 1 3   ? -1.038  15.281  -4.387  1.00 0.00 ? 3   ARG B HH21 5  
ATOM   8036  H  HH22 . ARG A 1 3   ? -2.726  15.157  -4.019  1.00 0.00 ? 3   ARG B HH22 5  
ATOM   8037  N  N    . GLY A 1 4   ? 4.501   12.268  -0.396  1.00 0.00 ? 4   GLY B N    5  
ATOM   8038  C  CA   . GLY A 1 4   ? 5.385   13.419  -0.435  1.00 0.00 ? 4   GLY B CA   5  
ATOM   8039  C  C    . GLY A 1 4   ? 5.333   14.244  0.837   1.00 0.00 ? 4   GLY B C    5  
ATOM   8040  O  O    . GLY A 1 4   ? 6.007   15.269  0.947   1.00 0.00 ? 4   GLY B O    5  
ATOM   8041  H  H    . GLY A 1 4   ? 4.029   12.043  0.433   1.00 0.00 ? 4   GLY B H    5  
ATOM   8042  H  HA2  . GLY A 1 4   ? 6.397   13.075  -0.585  1.00 0.00 ? 4   GLY B HA2  5  
ATOM   8043  H  HA3  . GLY A 1 4   ? 5.104   14.046  -1.268  1.00 0.00 ? 4   GLY B HA3  5  
ATOM   8044  N  N    . LYS A 1 5   ? 4.534   13.797  1.801   1.00 0.00 ? 5   LYS B N    5  
ATOM   8045  C  CA   . LYS A 1 5   ? 4.399   14.504  3.070   1.00 0.00 ? 5   LYS B CA   5  
ATOM   8046  C  C    . LYS A 1 5   ? 5.397   13.978  4.097   1.00 0.00 ? 5   LYS B C    5  
ATOM   8047  O  O    . LYS A 1 5   ? 5.285   12.843  4.561   1.00 0.00 ? 5   LYS B O    5  
ATOM   8048  C  CB   . LYS A 1 5   ? 2.973   14.366  3.606   1.00 0.00 ? 5   LYS B CB   5  
ATOM   8049  C  CG   . LYS A 1 5   ? 1.910   14.889  2.651   1.00 0.00 ? 5   LYS B CG   5  
ATOM   8050  C  CD   . LYS A 1 5   ? 2.039   16.389  2.434   1.00 0.00 ? 5   LYS B CD   5  
ATOM   8051  C  CE   . LYS A 1 5   ? 1.079   16.882  1.363   1.00 0.00 ? 5   LYS B CE   5  
ATOM   8052  N  NZ   . LYS A 1 5   ? -0.340  16.604  1.717   1.00 0.00 ? 5   LYS B NZ   5  
ATOM   8053  H  H    . LYS A 1 5   ? 4.022   12.973  1.655   1.00 0.00 ? 5   LYS B H    5  
ATOM   8054  H  HA   . LYS A 1 5   ? 4.606   15.548  2.889   1.00 0.00 ? 5   LYS B HA   5  
ATOM   8055  H  HB2  . LYS A 1 5   ? 2.771   13.321  3.796   1.00 0.00 ? 5   LYS B HB2  5  
ATOM   8056  H  HB3  . LYS A 1 5   ? 2.893   14.913  4.532   1.00 0.00 ? 5   LYS B HB3  5  
ATOM   8057  H  HG2  . LYS A 1 5   ? 2.018   14.388  1.700   1.00 0.00 ? 5   LYS B HG2  5  
ATOM   8058  H  HG3  . LYS A 1 5   ? 0.934   14.676  3.063   1.00 0.00 ? 5   LYS B HG3  5  
ATOM   8059  H  HD2  . LYS A 1 5   ? 1.820   16.897  3.360   1.00 0.00 ? 5   LYS B HD2  5  
ATOM   8060  H  HD3  . LYS A 1 5   ? 3.052   16.613  2.129   1.00 0.00 ? 5   LYS B HD3  5  
ATOM   8061  H  HE2  . LYS A 1 5   ? 1.210   17.947  1.244   1.00 0.00 ? 5   LYS B HE2  5  
ATOM   8062  H  HE3  . LYS A 1 5   ? 1.314   16.385  0.432   1.00 0.00 ? 5   LYS B HE3  5  
ATOM   8063  H  HZ1  . LYS A 1 5   ? -0.970  16.943  0.961   1.00 0.00 ? 5   LYS B HZ1  5  
ATOM   8064  H  HZ2  . LYS A 1 5   ? -0.589  17.087  2.603   1.00 0.00 ? 5   LYS B HZ2  5  
ATOM   8065  H  HZ3  . LYS A 1 5   ? -0.484  15.581  1.840   1.00 0.00 ? 5   LYS B HZ3  5  
ATOM   8066  N  N    . GLY A 1 6   ? 6.372   14.812  4.448   1.00 0.00 ? 6   GLY B N    5  
ATOM   8067  C  CA   . GLY A 1 6   ? 7.378   14.416  5.416   1.00 0.00 ? 6   GLY B CA   5  
ATOM   8068  C  C    . GLY A 1 6   ? 8.550   15.378  5.458   1.00 0.00 ? 6   GLY B C    5  
ATOM   8069  O  O    . GLY A 1 6   ? 9.461   15.291  4.634   1.00 0.00 ? 6   GLY B O    5  
ATOM   8070  H  H    . GLY A 1 6   ? 6.406   15.706  4.046   1.00 0.00 ? 6   GLY B H    5  
ATOM   8071  H  HA2  . GLY A 1 6   ? 6.924   14.375  6.395   1.00 0.00 ? 6   GLY B HA2  5  
ATOM   8072  H  HA3  . GLY A 1 6   ? 7.743   13.433  5.159   1.00 0.00 ? 6   GLY B HA3  5  
ATOM   8073  N  N    . GLY A 1 7   ? 8.526   16.294  6.420   1.00 0.00 ? 7   GLY B N    5  
ATOM   8074  C  CA   . GLY A 1 7   ? 9.598   17.265  6.548   1.00 0.00 ? 7   GLY B CA   5  
ATOM   8075  C  C    . GLY A 1 7   ? 10.453  17.027  7.777   1.00 0.00 ? 7   GLY B C    5  
ATOM   8076  O  O    . GLY A 1 7   ? 10.874  15.900  8.041   1.00 0.00 ? 7   GLY B O    5  
ATOM   8077  H  H    . GLY A 1 7   ? 7.773   16.312  7.049   1.00 0.00 ? 7   GLY B H    5  
ATOM   8078  H  HA2  . GLY A 1 7   ? 10.225  17.210  5.671   1.00 0.00 ? 7   GLY B HA2  5  
ATOM   8079  H  HA3  . GLY A 1 7   ? 9.168   18.254  6.610   1.00 0.00 ? 7   GLY B HA3  5  
ATOM   8080  N  N    . LYS A 1 8   ? 10.712  18.092  8.529   1.00 0.00 ? 8   LYS B N    5  
ATOM   8081  C  CA   . LYS A 1 8   ? 11.523  17.998  9.738   1.00 0.00 ? 8   LYS B CA   5  
ATOM   8082  C  C    . LYS A 1 8   ? 10.641  17.825  10.972  1.00 0.00 ? 8   LYS B C    5  
ATOM   8083  O  O    . LYS A 1 8   ? 10.234  18.805  11.599  1.00 0.00 ? 8   LYS B O    5  
ATOM   8084  C  CB   . LYS A 1 8   ? 12.395  19.247  9.891   1.00 0.00 ? 8   LYS B CB   5  
ATOM   8085  C  CG   . LYS A 1 8   ? 13.331  19.490  8.716   1.00 0.00 ? 8   LYS B CG   5  
ATOM   8086  C  CD   . LYS A 1 8   ? 14.421  18.432  8.639   1.00 0.00 ? 8   LYS B CD   5  
ATOM   8087  C  CE   . LYS A 1 8   ? 15.383  18.706  7.494   1.00 0.00 ? 8   LYS B CE   5  
ATOM   8088  N  NZ   . LYS A 1 8   ? 16.495  17.718  7.453   1.00 0.00 ? 8   LYS B NZ   5  
ATOM   8089  H  H    . LYS A 1 8   ? 10.348  18.963  8.265   1.00 0.00 ? 8   LYS B H    5  
ATOM   8090  H  HA   . LYS A 1 8   ? 12.161  17.133  9.642   1.00 0.00 ? 8   LYS B HA   5  
ATOM   8091  H  HB2  . LYS A 1 8   ? 11.753  20.109  9.993   1.00 0.00 ? 8   LYS B HB2  5  
ATOM   8092  H  HB3  . LYS A 1 8   ? 12.993  19.146  10.784  1.00 0.00 ? 8   LYS B HB3  5  
ATOM   8093  H  HG2  . LYS A 1 8   ? 12.758  19.467  7.801   1.00 0.00 ? 8   LYS B HG2  5  
ATOM   8094  H  HG3  . LYS A 1 8   ? 13.792  20.460  8.831   1.00 0.00 ? 8   LYS B HG3  5  
ATOM   8095  H  HD2  . LYS A 1 8   ? 14.974  18.429  9.567   1.00 0.00 ? 8   LYS B HD2  5  
ATOM   8096  H  HD3  . LYS A 1 8   ? 13.962  17.466  8.488   1.00 0.00 ? 8   LYS B HD3  5  
ATOM   8097  H  HE2  . LYS A 1 8   ? 14.837  18.660  6.563   1.00 0.00 ? 8   LYS B HE2  5  
ATOM   8098  H  HE3  . LYS A 1 8   ? 15.798  19.696  7.619   1.00 0.00 ? 8   LYS B HE3  5  
ATOM   8099  H  HZ1  . LYS A 1 8   ? 16.113  16.755  7.352   1.00 0.00 ? 8   LYS B HZ1  5  
ATOM   8100  H  HZ2  . LYS A 1 8   ? 17.052  17.768  8.329   1.00 0.00 ? 8   LYS B HZ2  5  
ATOM   8101  H  HZ3  . LYS A 1 8   ? 17.121  17.917  6.646   1.00 0.00 ? 8   LYS B HZ3  5  
ATOM   8102  N  N    . GLY A 1 9   ? 10.349  16.574  11.313  1.00 0.00 ? 9   GLY B N    5  
ATOM   8103  C  CA   . GLY A 1 9   ? 9.519   16.295  12.472  1.00 0.00 ? 9   GLY B CA   5  
ATOM   8104  C  C    . GLY A 1 9   ? 10.323  15.784  13.651  1.00 0.00 ? 9   GLY B C    5  
ATOM   8105  O  O    . GLY A 1 9   ? 11.306  16.407  14.055  1.00 0.00 ? 9   GLY B O    5  
ATOM   8106  H  H    . GLY A 1 9   ? 10.700  15.834  10.776  1.00 0.00 ? 9   GLY B H    5  
ATOM   8107  H  HA2  . GLY A 1 9   ? 9.009   17.202  12.763  1.00 0.00 ? 9   GLY B HA2  5  
ATOM   8108  H  HA3  . GLY A 1 9   ? 8.783   15.552  12.203  1.00 0.00 ? 9   GLY B HA3  5  
ATOM   8109  N  N    . LEU A 1 10  ? 9.905   14.651  14.205  1.00 0.00 ? 10  LEU B N    5  
ATOM   8110  C  CA   . LEU A 1 10  ? 10.594  14.057  15.344  1.00 0.00 ? 10  LEU B CA   5  
ATOM   8111  C  C    . LEU A 1 10  ? 10.302  12.564  15.441  1.00 0.00 ? 10  LEU B C    5  
ATOM   8112  O  O    . LEU A 1 10  ? 9.174   12.158  15.723  1.00 0.00 ? 10  LEU B O    5  
ATOM   8113  C  CB   . LEU A 1 10  ? 10.177  14.758  16.640  1.00 0.00 ? 10  LEU B CB   5  
ATOM   8114  C  CG   . LEU A 1 10  ? 10.900  14.280  17.901  1.00 0.00 ? 10  LEU B CG   5  
ATOM   8115  C  CD1  . LEU A 1 10  ? 12.388  14.585  17.814  1.00 0.00 ? 10  LEU B CD1  5  
ATOM   8116  C  CD2  . LEU A 1 10  ? 10.293  14.924  19.138  1.00 0.00 ? 10  LEU B CD2  5  
ATOM   8117  H  H    . LEU A 1 10  ? 9.114   14.202  13.838  1.00 0.00 ? 10  LEU B H    5  
ATOM   8118  H  HA   . LEU A 1 10  ? 11.655  14.196  15.198  1.00 0.00 ? 10  LEU B HA   5  
ATOM   8119  H  HB2  . LEU A 1 10  ? 10.359  15.817  16.526  1.00 0.00 ? 10  LEU B HB2  5  
ATOM   8120  H  HB3  . LEU A 1 10  ? 9.117   14.606  16.781  1.00 0.00 ? 10  LEU B HB3  5  
ATOM   8121  H  HG   . LEU A 1 10  ? 10.784  13.209  17.990  1.00 0.00 ? 10  LEU B HG   5  
ATOM   8122  H  HD11 . LEU A 1 10  ? 12.811  14.074  16.962  1.00 0.00 ? 10  LEU B HD11 5  
ATOM   8123  H  HD12 . LEU A 1 10  ? 12.878  14.247  18.715  1.00 0.00 ? 10  LEU B HD12 5  
ATOM   8124  H  HD13 . LEU A 1 10  ? 12.531  15.650  17.704  1.00 0.00 ? 10  LEU B HD13 5  
ATOM   8125  H  HD21 . LEU A 1 10  ? 10.814  14.577  20.018  1.00 0.00 ? 10  LEU B HD21 5  
ATOM   8126  H  HD22 . LEU A 1 10  ? 9.249   14.656  19.207  1.00 0.00 ? 10  LEU B HD22 5  
ATOM   8127  H  HD23 . LEU A 1 10  ? 10.384  15.998  19.066  1.00 0.00 ? 10  LEU B HD23 5  
ATOM   8128  N  N    . GLY A 1 11  ? 11.327  11.750  15.204  1.00 0.00 ? 11  GLY B N    5  
ATOM   8129  C  CA   . GLY A 1 11  ? 11.164  10.309  15.269  1.00 0.00 ? 11  GLY B CA   5  
ATOM   8130  C  C    . GLY A 1 11  ? 12.490  9.575   15.276  1.00 0.00 ? 11  GLY B C    5  
ATOM   8131  O  O    . GLY A 1 11  ? 13.541  10.179  15.058  1.00 0.00 ? 11  GLY B O    5  
ATOM   8132  H  H    . GLY A 1 11  ? 12.202  12.132  14.982  1.00 0.00 ? 11  GLY B H    5  
ATOM   8133  H  HA2  . GLY A 1 11  ? 10.622  10.060  16.169  1.00 0.00 ? 11  GLY B HA2  5  
ATOM   8134  H  HA3  . GLY A 1 11  ? 10.590  9.984   14.414  1.00 0.00 ? 11  GLY B HA3  5  
ATOM   8135  N  N    . LYS A 1 12  ? 12.441  8.271   15.524  1.00 0.00 ? 12  LYS B N    5  
ATOM   8136  C  CA   . LYS A 1 12  ? 13.648  7.455   15.559  1.00 0.00 ? 12  LYS B CA   5  
ATOM   8137  C  C    . LYS A 1 12  ? 13.955  6.883   14.179  1.00 0.00 ? 12  LYS B C    5  
ATOM   8138  O  O    . LYS A 1 12  ? 15.013  7.149   13.608  1.00 0.00 ? 12  LYS B O    5  
ATOM   8139  C  CB   . LYS A 1 12  ? 13.491  6.316   16.570  1.00 0.00 ? 12  LYS B CB   5  
ATOM   8140  C  CG   . LYS A 1 12  ? 14.754  5.490   16.757  1.00 0.00 ? 12  LYS B CG   5  
ATOM   8141  C  CD   . LYS A 1 12  ? 14.556  4.380   17.778  1.00 0.00 ? 12  LYS B CD   5  
ATOM   8142  C  CE   . LYS A 1 12  ? 13.929  3.142   17.152  1.00 0.00 ? 12  LYS B CE   5  
ATOM   8143  N  NZ   . LYS A 1 12  ? 12.563  3.408   16.624  1.00 0.00 ? 12  LYS B NZ   5  
ATOM   8144  H  H    . LYS A 1 12  ? 11.573  7.848   15.689  1.00 0.00 ? 12  LYS B H    5  
ATOM   8145  H  HA   . LYS A 1 12  ? 14.469  8.086   15.866  1.00 0.00 ? 12  LYS B HA   5  
ATOM   8146  H  HB2  . LYS A 1 12  ? 13.216  6.736   17.527  1.00 0.00 ? 12  LYS B HB2  5  
ATOM   8147  H  HB3  . LYS A 1 12  ? 12.703  5.659   16.235  1.00 0.00 ? 12  LYS B HB3  5  
ATOM   8148  H  HG2  . LYS A 1 12  ? 15.025  5.048   15.810  1.00 0.00 ? 12  LYS B HG2  5  
ATOM   8149  H  HG3  . LYS A 1 12  ? 15.550  6.138   17.094  1.00 0.00 ? 12  LYS B HG3  5  
ATOM   8150  H  HD2  . LYS A 1 12  ? 15.515  4.112   18.195  1.00 0.00 ? 12  LYS B HD2  5  
ATOM   8151  H  HD3  . LYS A 1 12  ? 13.908  4.741   18.564  1.00 0.00 ? 12  LYS B HD3  5  
ATOM   8152  H  HE2  . LYS A 1 12  ? 14.560  2.808   16.341  1.00 0.00 ? 12  LYS B HE2  5  
ATOM   8153  H  HE3  . LYS A 1 12  ? 13.871  2.367   17.903  1.00 0.00 ? 12  LYS B HE3  5  
ATOM   8154  H  HZ1  . LYS A 1 12  ? 12.153  2.534   16.239  1.00 0.00 ? 12  LYS B HZ1  5  
ATOM   8155  H  HZ2  . LYS A 1 12  ? 12.604  4.120   15.866  1.00 0.00 ? 12  LYS B HZ2  5  
ATOM   8156  H  HZ3  . LYS A 1 12  ? 11.948  3.763   17.384  1.00 0.00 ? 12  LYS B HZ3  5  
ATOM   8157  N  N    . GLY A 1 13  ? 13.021  6.099   13.649  1.00 0.00 ? 13  GLY B N    5  
ATOM   8158  C  CA   . GLY A 1 13  ? 13.208  5.502   12.340  1.00 0.00 ? 13  GLY B CA   5  
ATOM   8159  C  C    . GLY A 1 13  ? 11.895  5.140   11.674  1.00 0.00 ? 13  GLY B C    5  
ATOM   8160  O  O    . GLY A 1 13  ? 11.669  3.982   11.322  1.00 0.00 ? 13  GLY B O    5  
ATOM   8161  H  H    . GLY A 1 13  ? 12.198  5.925   14.152  1.00 0.00 ? 13  GLY B H    5  
ATOM   8162  H  HA2  . GLY A 1 13  ? 13.739  6.200   11.710  1.00 0.00 ? 13  GLY B HA2  5  
ATOM   8163  H  HA3  . GLY A 1 13  ? 13.803  4.606   12.447  1.00 0.00 ? 13  GLY B HA3  5  
ATOM   8164  N  N    . GLY A 1 14  ? 11.026  6.132   11.502  1.00 0.00 ? 14  GLY B N    5  
ATOM   8165  C  CA   . GLY A 1 14  ? 9.740   5.892   10.874  1.00 0.00 ? 14  GLY B CA   5  
ATOM   8166  C  C    . GLY A 1 14  ? 8.642   6.770   11.441  1.00 0.00 ? 14  GLY B C    5  
ATOM   8167  O  O    . GLY A 1 14  ? 8.582   6.998   12.650  1.00 0.00 ? 14  GLY B O    5  
ATOM   8168  H  H    . GLY A 1 14  ? 11.261  7.034   11.805  1.00 0.00 ? 14  GLY B H    5  
ATOM   8169  H  HA2  . GLY A 1 14  ? 9.829   6.086   9.815   1.00 0.00 ? 14  GLY B HA2  5  
ATOM   8170  H  HA3  . GLY A 1 14  ? 9.469   4.857   11.017  1.00 0.00 ? 14  GLY B HA3  5  
ATOM   8171  N  N    . ALA A 1 15  ? 7.771   7.261   10.567  1.00 0.00 ? 15  ALA B N    5  
ATOM   8172  C  CA   . ALA A 1 15  ? 6.668   8.118   10.983  1.00 0.00 ? 15  ALA B CA   5  
ATOM   8173  C  C    . ALA A 1 15  ? 5.486   7.989   10.029  1.00 0.00 ? 15  ALA B C    5  
ATOM   8174  O  O    . ALA A 1 15  ? 4.418   7.509   10.410  1.00 0.00 ? 15  ALA B O    5  
ATOM   8175  C  CB   . ALA A 1 15  ? 7.128   9.565   11.063  1.00 0.00 ? 15  ALA B CB   5  
ATOM   8176  H  H    . ALA A 1 15  ? 7.871   7.040   9.616   1.00 0.00 ? 15  ALA B H    5  
ATOM   8177  H  HA   . ALA A 1 15  ? 6.359   7.807   11.970  1.00 0.00 ? 15  ALA B HA   5  
ATOM   8178  H  HB1  . ALA A 1 15  ? 6.300   10.191  11.363  1.00 0.00 ? 15  ALA B HB1  5  
ATOM   8179  H  HB2  . ALA A 1 15  ? 7.488   9.883   10.097  1.00 0.00 ? 15  ALA B HB2  5  
ATOM   8180  H  HB3  . ALA A 1 15  ? 7.923   9.651   11.790  1.00 0.00 ? 15  ALA B HB3  5  
ATOM   8181  N  N    . LYS A 1 16  ? 5.684   8.421   8.788   1.00 0.00 ? 16  LYS B N    5  
ATOM   8182  C  CA   . LYS A 1 16  ? 4.634   8.355   7.779   1.00 0.00 ? 16  LYS B CA   5  
ATOM   8183  C  C    . LYS A 1 16  ? 5.119   7.606   6.542   1.00 0.00 ? 16  LYS B C    5  
ATOM   8184  O  O    . LYS A 1 16  ? 6.225   7.845   6.054   1.00 0.00 ? 16  LYS B O    5  
ATOM   8185  C  CB   . LYS A 1 16  ? 4.180   9.766   7.396   1.00 0.00 ? 16  LYS B CB   5  
ATOM   8186  C  CG   . LYS A 1 16  ? 2.854   9.801   6.647   1.00 0.00 ? 16  LYS B CG   5  
ATOM   8187  C  CD   . LYS A 1 16  ? 1.721   9.209   7.474   1.00 0.00 ? 16  LYS B CD   5  
ATOM   8188  C  CE   . LYS A 1 16  ? 1.481   10.001  8.752   1.00 0.00 ? 16  LYS B CE   5  
ATOM   8189  N  NZ   . LYS A 1 16  ? 0.525   9.311   9.661   1.00 0.00 ? 16  LYS B NZ   5  
ATOM   8190  H  H    . LYS A 1 16  ? 6.559   8.792   8.545   1.00 0.00 ? 16  LYS B H    5  
ATOM   8191  H  HA   . LYS A 1 16  ? 3.799   7.819   8.205   1.00 0.00 ? 16  LYS B HA   5  
ATOM   8192  H  HB2  . LYS A 1 16  ? 4.075   10.354  8.296   1.00 0.00 ? 16  LYS B HB2  5  
ATOM   8193  H  HB3  . LYS A 1 16  ? 4.935   10.216  6.769   1.00 0.00 ? 16  LYS B HB3  5  
ATOM   8194  H  HG2  . LYS A 1 16  ? 2.615   10.827  6.411   1.00 0.00 ? 16  LYS B HG2  5  
ATOM   8195  H  HG3  . LYS A 1 16  ? 2.955   9.235   5.733   1.00 0.00 ? 16  LYS B HG3  5  
ATOM   8196  H  HD2  . LYS A 1 16  ? 0.816   9.218   6.884   1.00 0.00 ? 16  LYS B HD2  5  
ATOM   8197  H  HD3  . LYS A 1 16  ? 1.971   8.191   7.733   1.00 0.00 ? 16  LYS B HD3  5  
ATOM   8198  H  HE2  . LYS A 1 16  ? 2.423   10.128  9.264   1.00 0.00 ? 16  LYS B HE2  5  
ATOM   8199  H  HE3  . LYS A 1 16  ? 1.081   10.969  8.491   1.00 0.00 ? 16  LYS B HE3  5  
ATOM   8200  H  HZ1  . LYS A 1 16  ? 0.895   8.375   9.925   1.00 0.00 ? 16  LYS B HZ1  5  
ATOM   8201  H  HZ2  . LYS A 1 16  ? -0.394  9.187   9.190   1.00 0.00 ? 16  LYS B HZ2  5  
ATOM   8202  H  HZ3  . LYS A 1 16  ? 0.386   9.872   10.525  1.00 0.00 ? 16  LYS B HZ3  5  
ATOM   8203  N  N    . ARG A 1 17  ? 4.286   6.700   6.039   1.00 0.00 ? 17  ARG B N    5  
ATOM   8204  C  CA   . ARG A 1 17  ? 4.633   5.913   4.862   1.00 0.00 ? 17  ARG B CA   5  
ATOM   8205  C  C    . ARG A 1 17  ? 3.496   5.923   3.836   1.00 0.00 ? 17  ARG B C    5  
ATOM   8206  O  O    . ARG A 1 17  ? 3.239   6.945   3.203   1.00 0.00 ? 17  ARG B O    5  
ATOM   8207  C  CB   . ARG A 1 17  ? 4.992   4.477   5.272   1.00 0.00 ? 17  ARG B CB   5  
ATOM   8208  C  CG   . ARG A 1 17  ? 4.417   4.053   6.619   1.00 0.00 ? 17  ARG B CG   5  
ATOM   8209  C  CD   . ARG A 1 17  ? 2.925   3.763   6.540   1.00 0.00 ? 17  ARG B CD   5  
ATOM   8210  N  NE   . ARG A 1 17  ? 2.641   2.572   5.743   1.00 0.00 ? 17  ARG B NE   5  
ATOM   8211  C  CZ   . ARG A 1 17  ? 1.497   1.891   5.806   1.00 0.00 ? 17  ARG B CZ   5  
ATOM   8212  N  NH1  . ARG A 1 17  ? 0.529   2.282   6.625   1.00 0.00 ? 17  ARG B NH1  5  
ATOM   8213  N  NH2  . ARG A 1 17  ? 1.322   0.820   5.046   1.00 0.00 ? 17  ARG B NH2  5  
ATOM   8214  H  H    . ARG A 1 17  ? 3.418   6.558   6.471   1.00 0.00 ? 17  ARG B H    5  
ATOM   8215  H  HA   . ARG A 1 17  ? 5.501   6.370   4.411   1.00 0.00 ? 17  ARG B HA   5  
ATOM   8216  H  HB2  . ARG A 1 17  ? 4.624   3.796   4.520   1.00 0.00 ? 17  ARG B HB2  5  
ATOM   8217  H  HB3  . ARG A 1 17  ? 6.067   4.391   5.323   1.00 0.00 ? 17  ARG B HB3  5  
ATOM   8218  H  HG2  . ARG A 1 17  ? 4.926   3.161   6.951   1.00 0.00 ? 17  ARG B HG2  5  
ATOM   8219  H  HG3  . ARG A 1 17  ? 4.582   4.847   7.334   1.00 0.00 ? 17  ARG B HG3  5  
ATOM   8220  H  HD2  . ARG A 1 17  ? 2.547   3.614   7.541   1.00 0.00 ? 17  ARG B HD2  5  
ATOM   8221  H  HD3  . ARG A 1 17  ? 2.430   4.611   6.092   1.00 0.00 ? 17  ARG B HD3  5  
ATOM   8222  H  HE   . ARG A 1 17  ? 3.339   2.260   5.131   1.00 0.00 ? 17  ARG B HE   5  
ATOM   8223  H  HH11 . ARG A 1 17  ? 0.656   3.090   7.201   1.00 0.00 ? 17  ARG B HH11 5  
ATOM   8224  H  HH12 . ARG A 1 17  ? -0.327  1.767   6.668   1.00 0.00 ? 17  ARG B HH12 5  
ATOM   8225  H  HH21 . ARG A 1 17  ? 2.048   0.522   4.426   1.00 0.00 ? 17  ARG B HH21 5  
ATOM   8226  H  HH22 . ARG A 1 17  ? 0.463   0.309   5.092   1.00 0.00 ? 17  ARG B HH22 5  
ATOM   8227  N  N    . HIS A 1 18  ? 2.820   4.785   3.680   1.00 0.00 ? 18  HIS B N    5  
ATOM   8228  C  CA   . HIS A 1 18  ? 1.709   4.656   2.739   1.00 0.00 ? 18  HIS B CA   5  
ATOM   8229  C  C    . HIS A 1 18  ? 0.662   5.721   2.953   1.00 0.00 ? 18  HIS B C    5  
ATOM   8230  O  O    . HIS A 1 18  ? 0.796   6.620   3.785   1.00 0.00 ? 18  HIS B O    5  
ATOM   8231  C  CB   . HIS A 1 18  ? 1.065   3.279   2.867   1.00 0.00 ? 18  HIS B CB   5  
ATOM   8232  C  CG   . HIS A 1 18  ? 0.607   2.716   1.561   1.00 0.00 ? 18  HIS B CG   5  
ATOM   8233  N  ND1  . HIS A 1 18  ? 1.422   2.626   0.453   1.00 0.00 ? 18  HIS B ND1  5  
ATOM   8234  C  CD2  . HIS A 1 18  ? -0.599  2.245   1.179   1.00 0.00 ? 18  HIS B CD2  5  
ATOM   8235  C  CE1  . HIS A 1 18  ? 0.741   2.132   -0.549  1.00 0.00 ? 18  HIS B CE1  5  
ATOM   8236  N  NE2  . HIS A 1 18  ? -0.490  1.887   -0.140  1.00 0.00 ? 18  HIS B NE2  5  
ATOM   8237  H  H    . HIS A 1 18  ? 3.077   4.004   4.211   1.00 0.00 ? 18  HIS B H    5  
ATOM   8238  H  HA   . HIS A 1 18  ? 2.076   4.772   1.722   1.00 0.00 ? 18  HIS B HA   5  
ATOM   8239  H  HB2  . HIS A 1 18  ? 1.774   2.591   3.301   1.00 0.00 ? 18  HIS B HB2  5  
ATOM   8240  H  HB3  . HIS A 1 18  ? 0.205   3.362   3.509   1.00 0.00 ? 18  HIS B HB3  5  
ATOM   8241  H  HD1  . HIS A 1 18  ? 2.366   2.887   0.414   1.00 0.00 ? 18  HIS B HD1  5  
ATOM   8242  H  HD2  . HIS A 1 18  ? -1.487  2.189   1.787   1.00 0.00 ? 18  HIS B HD2  5  
ATOM   8243  H  HE1  . HIS A 1 18  ? 1.118   1.973   -1.545  1.00 0.00 ? 18  HIS B HE1  5  
ATOM   8244  H  HE2  . HIS A 1 18  ? -1.227  1.582   -0.710  1.00 0.00 ? 18  HIS B HE2  5  
ATOM   8245  N  N    . ARG A 1 19  ? -0.389  5.573   2.189   1.00 0.00 ? 19  ARG B N    5  
ATOM   8246  C  CA   . ARG A 1 19  ? -1.489  6.493   2.173   1.00 0.00 ? 19  ARG B CA   5  
ATOM   8247  C  C    . ARG A 1 19  ? -1.041  7.871   1.762   1.00 0.00 ? 19  ARG B C    5  
ATOM   8248  O  O    . ARG A 1 19  ? -0.282  8.557   2.448   1.00 0.00 ? 19  ARG B O    5  
ATOM   8249  C  CB   . ARG A 1 19  ? -2.247  6.547   3.469   1.00 0.00 ? 19  ARG B CB   5  
ATOM   8250  C  CG   . ARG A 1 19  ? -3.684  6.942   3.208   1.00 0.00 ? 19  ARG B CG   5  
ATOM   8251  C  CD   . ARG A 1 19  ? -3.817  8.424   2.903   1.00 0.00 ? 19  ARG B CD   5  
ATOM   8252  N  NE   . ARG A 1 19  ? -5.210  8.835   2.729   1.00 0.00 ? 19  ARG B NE   5  
ATOM   8253  C  CZ   . ARG A 1 19  ? -5.922  9.463   3.665   1.00 0.00 ? 19  ARG B CZ   5  
ATOM   8254  N  NH1  . ARG A 1 19  ? -5.387  9.717   4.852   1.00 0.00 ? 19  ARG B NH1  5  
ATOM   8255  N  NH2  . ARG A 1 19  ? -7.174  9.832   3.415   1.00 0.00 ? 19  ARG B NH2  5  
ATOM   8256  H  H    . ARG A 1 19  ? -0.429  4.793   1.601   1.00 0.00 ? 19  ARG B H    5  
ATOM   8257  H  HA   . ARG A 1 19  ? -2.168  6.136   1.409   1.00 0.00 ? 19  ARG B HA   5  
ATOM   8258  H  HB2  . ARG A 1 19  ? -2.219  5.571   3.921   1.00 0.00 ? 19  ARG B HB2  5  
ATOM   8259  H  HB3  . ARG A 1 19  ? -1.798  7.273   4.128   1.00 0.00 ? 19  ARG B HB3  5  
ATOM   8260  H  HG2  . ARG A 1 19  ? -4.017  6.397   2.347   1.00 0.00 ? 19  ARG B HG2  5  
ATOM   8261  H  HG3  . ARG A 1 19  ? -4.298  6.688   4.042   1.00 0.00 ? 19  ARG B HG3  5  
ATOM   8262  H  HD2  . ARG A 1 19  ? -3.380  8.988   3.714   1.00 0.00 ? 19  ARG B HD2  5  
ATOM   8263  H  HD3  . ARG A 1 19  ? -3.273  8.626   1.984   1.00 0.00 ? 19  ARG B HD3  5  
ATOM   8264  H  HE   . ARG A 1 19  ? -5.634  8.645   1.867   1.00 0.00 ? 19  ARG B HE   5  
ATOM   8265  H  HH11 . ARG A 1 19  ? -4.447  9.438   5.048   1.00 0.00 ? 19  ARG B HH11 5  
ATOM   8266  H  HH12 . ARG A 1 19  ? -5.925  10.187  5.552   1.00 0.00 ? 19  ARG B HH12 5  
ATOM   8267  H  HH21 . ARG A 1 19  ? -7.584  9.638   2.523   1.00 0.00 ? 19  ARG B HH21 5  
ATOM   8268  H  HH22 . ARG A 1 19  ? -7.707  10.301  4.119   1.00 0.00 ? 19  ARG B HH22 5  
ATOM   8269  N  N    . LYS A 1 20  ? -1.546  8.237   0.615   1.00 0.00 ? 20  LYS B N    5  
ATOM   8270  C  CA   . LYS A 1 20  ? -1.292  9.502   -0.016  1.00 0.00 ? 20  LYS B CA   5  
ATOM   8271  C  C    . LYS A 1 20  ? -1.425  10.674  0.959   1.00 0.00 ? 20  LYS B C    5  
ATOM   8272  O  O    . LYS A 1 20  ? -0.379  11.231  1.354   1.00 0.00 ? 20  LYS B O    5  
ATOM   8273  C  CB   . LYS A 1 20  ? -2.291  9.597   -1.149  1.00 0.00 ? 20  LYS B CB   5  
ATOM   8274  C  CG   . LYS A 1 20  ? -3.724  9.315   -0.691  1.00 0.00 ? 20  LYS B CG   5  
ATOM   8275  C  CD   . LYS A 1 20  ? -4.764  9.680   -1.720  1.00 0.00 ? 20  LYS B CD   5  
ATOM   8276  C  CE   . LYS A 1 20  ? -4.482  9.042   -3.059  1.00 0.00 ? 20  LYS B CE   5  
ATOM   8277  N  NZ   . LYS A 1 20  ? -3.985  10.032  -4.056  1.00 0.00 ? 20  LYS B NZ   5  
ATOM   8278  O  OXT  . LYS A 1 20  ? -2.567  11.024  1.324   1.00 0.00 ? 20  LYS B OXT  5  
ATOM   8279  H  H    . LYS A 1 20  ? -2.140  7.607   0.155   1.00 0.00 ? 20  LYS B H    5  
ATOM   8280  H  HA   . LYS A 1 20  ? -0.295  9.486   -0.425  1.00 0.00 ? 20  LYS B HA   5  
ATOM   8281  H  HB2  . LYS A 1 20  ? -2.238  10.568  -1.602  1.00 0.00 ? 20  LYS B HB2  5  
ATOM   8282  H  HB3  . LYS A 1 20  ? -2.026  8.841   -1.878  1.00 0.00 ? 20  LYS B HB3  5  
ATOM   8283  H  HG2  . LYS A 1 20  ? -3.825  8.261   -0.492  1.00 0.00 ? 20  LYS B HG2  5  
ATOM   8284  H  HG3  . LYS A 1 20  ? -3.917  9.871   0.213   1.00 0.00 ? 20  LYS B HG3  5  
ATOM   8285  H  HD2  . LYS A 1 20  ? -5.722  9.318   -1.373  1.00 0.00 ? 20  LYS B HD2  5  
ATOM   8286  H  HD3  . LYS A 1 20  ? -4.795  10.754  -1.834  1.00 0.00 ? 20  LYS B HD3  5  
ATOM   8287  H  HE2  . LYS A 1 20  ? -3.734  8.276   -2.912  1.00 0.00 ? 20  LYS B HE2  5  
ATOM   8288  H  HE3  . LYS A 1 20  ? -5.391  8.591   -3.430  1.00 0.00 ? 20  LYS B HE3  5  
ATOM   8289  H  HZ1  . LYS A 1 20  ? -4.696  10.776  -4.207  1.00 0.00 ? 20  LYS B HZ1  5  
ATOM   8290  H  HZ2  . LYS A 1 20  ? -3.795  9.560   -4.963  1.00 0.00 ? 20  LYS B HZ2  5  
ATOM   8291  H  HZ3  . LYS A 1 20  ? -3.106  10.472  -3.716  1.00 0.00 ? 20  LYS B HZ3  5  
ATOM   8292  N  N    . GLY B 2 1   ? 17.102  -3.200  -10.891 1.00 0.00 ? 259 GLY A N    5  
ATOM   8293  C  CA   . GLY B 2 1   ? 17.032  -1.712  -10.874 1.00 0.00 ? 259 GLY A CA   5  
ATOM   8294  C  C    . GLY B 2 1   ? 16.273  -1.181  -9.674  1.00 0.00 ? 259 GLY A C    5  
ATOM   8295  O  O    . GLY B 2 1   ? 15.752  -1.954  -8.870  1.00 0.00 ? 259 GLY A O    5  
ATOM   8296  H  H1   . GLY B 2 1   ? 17.629  -3.523  -11.727 1.00 0.00 ? 259 GLY A H1   5  
ATOM   8297  H  H2   . GLY B 2 1   ? 16.145  -3.603  -10.921 1.00 0.00 ? 259 GLY A H2   5  
ATOM   8298  H  H3   . GLY B 2 1   ? 17.585  -3.544  -10.036 1.00 0.00 ? 259 GLY A H3   5  
ATOM   8299  H  HA2  . GLY B 2 1   ? 18.036  -1.316  -10.856 1.00 0.00 ? 259 GLY A HA2  5  
ATOM   8300  H  HA3  . GLY B 2 1   ? 16.538  -1.376  -11.775 1.00 0.00 ? 259 GLY A HA3  5  
ATOM   8301  N  N    . SER B 2 2   ? 16.218  0.142   -9.552  1.00 0.00 ? 260 SER A N    5  
ATOM   8302  C  CA   . SER B 2 2   ? 15.521  0.788   -8.445  1.00 0.00 ? 260 SER A CA   5  
ATOM   8303  C  C    . SER B 2 2   ? 16.057  0.349   -7.098  1.00 0.00 ? 260 SER A C    5  
ATOM   8304  O  O    . SER B 2 2   ? 17.062  -0.357  -7.004  1.00 0.00 ? 260 SER A O    5  
ATOM   8305  C  CB   . SER B 2 2   ? 14.032  0.500   -8.489  1.00 0.00 ? 260 SER A CB   5  
ATOM   8306  O  OG   . SER B 2 2   ? 13.413  1.157   -9.581  1.00 0.00 ? 260 SER A OG   5  
ATOM   8307  H  H    . SER B 2 2   ? 16.659  0.701   -10.227 1.00 0.00 ? 260 SER A H    5  
ATOM   8308  H  HA   . SER B 2 2   ? 15.658  1.850   -8.534  1.00 0.00 ? 260 SER A HA   5  
ATOM   8309  H  HB2  . SER B 2 2   ? 13.872  -0.564  -8.583  1.00 0.00 ? 260 SER A HB2  5  
ATOM   8310  H  HB3  . SER B 2 2   ? 13.592  0.856   -7.565  1.00 0.00 ? 260 SER A HB3  5  
ATOM   8311  H  HG   . SER B 2 2   ? 14.064  1.315   -10.270 1.00 0.00 ? 260 SER A HG   5  
ATOM   8312  N  N    . TYR B 2 3   ? 15.359  0.783   -6.058  1.00 0.00 ? 261 TYR A N    5  
ATOM   8313  C  CA   . TYR B 2 3   ? 15.719  0.469   -4.690  1.00 0.00 ? 261 TYR A CA   5  
ATOM   8314  C  C    . TYR B 2 3   ? 14.706  1.073   -3.727  1.00 0.00 ? 261 TYR A C    5  
ATOM   8315  O  O    . TYR B 2 3   ? 13.884  1.904   -4.113  1.00 0.00 ? 261 TYR A O    5  
ATOM   8316  C  CB   . TYR B 2 3   ? 17.114  1.000   -4.373  1.00 0.00 ? 261 TYR A CB   5  
ATOM   8317  C  CG   . TYR B 2 3   ? 17.414  2.326   -5.017  1.00 0.00 ? 261 TYR A CG   5  
ATOM   8318  C  CD1  . TYR B 2 3   ? 16.620  3.408   -4.745  1.00 0.00 ? 261 TYR A CD1  5  
ATOM   8319  C  CD2  . TYR B 2 3   ? 18.487  2.492   -5.885  1.00 0.00 ? 261 TYR A CD2  5  
ATOM   8320  C  CE1  . TYR B 2 3   ? 16.863  4.638   -5.309  1.00 0.00 ? 261 TYR A CE1  5  
ATOM   8321  C  CE2  . TYR B 2 3   ? 18.746  3.721   -6.462  1.00 0.00 ? 261 TYR A CE2  5  
ATOM   8322  C  CZ   . TYR B 2 3   ? 17.928  4.794   -6.170  1.00 0.00 ? 261 TYR A CZ   5  
ATOM   8323  O  OH   . TYR B 2 3   ? 18.178  6.021   -6.738  1.00 0.00 ? 261 TYR A OH   5  
ATOM   8324  H  H    . TYR B 2 3   ? 14.569  1.339   -6.220  1.00 0.00 ? 261 TYR A H    5  
ATOM   8325  H  HA   . TYR B 2 3   ? 15.715  -0.605  -4.580  1.00 0.00 ? 261 TYR A HA   5  
ATOM   8326  H  HB2  . TYR B 2 3   ? 17.208  1.119   -3.309  1.00 0.00 ? 261 TYR A HB2  5  
ATOM   8327  H  HB3  . TYR B 2 3   ? 17.840  0.306   -4.710  1.00 0.00 ? 261 TYR A HB3  5  
ATOM   8328  H  HD1  . TYR B 2 3   ? 15.792  3.272   -4.072  1.00 0.00 ? 261 TYR A HD1  5  
ATOM   8329  H  HD2  . TYR B 2 3   ? 19.120  1.646   -6.108  1.00 0.00 ? 261 TYR A HD2  5  
ATOM   8330  H  HE1  . TYR B 2 3   ? 16.223  5.468   -5.069  1.00 0.00 ? 261 TYR A HE1  5  
ATOM   8331  H  HE2  . TYR B 2 3   ? 19.582  3.837   -7.135  1.00 0.00 ? 261 TYR A HE2  5  
ATOM   8332  H  HH   . TYR B 2 3   ? 18.356  5.911   -7.675  1.00 0.00 ? 261 TYR A HH   5  
ATOM   8333  N  N    . CYS B 2 4   ? 14.773  0.648   -2.477  1.00 0.00 ? 262 CYS A N    5  
ATOM   8334  C  CA   . CYS B 2 4   ? 13.868  1.139   -1.445  1.00 0.00 ? 262 CYS A CA   5  
ATOM   8335  C  C    . CYS B 2 4   ? 13.967  2.647   -1.291  1.00 0.00 ? 262 CYS A C    5  
ATOM   8336  O  O    . CYS B 2 4   ? 15.045  3.194   -1.133  1.00 0.00 ? 262 CYS A O    5  
ATOM   8337  C  CB   . CYS B 2 4   ? 14.179  0.458   -0.130  1.00 0.00 ? 262 CYS A CB   5  
ATOM   8338  S  SG   . CYS B 2 4   ? 13.701  1.354   1.377   1.00 0.00 ? 262 CYS A SG   5  
ATOM   8339  H  H    . CYS B 2 4   ? 15.444  -0.025  -2.242  1.00 0.00 ? 262 CYS A H    5  
ATOM   8340  H  HA   . CYS B 2 4   ? 12.864  0.871   -1.735  1.00 0.00 ? 262 CYS A HA   5  
ATOM   8341  H  HB2  . CYS B 2 4   ? 13.665  -0.487  -0.103  1.00 0.00 ? 262 CYS A HB2  5  
ATOM   8342  H  HB3  . CYS B 2 4   ? 15.238  0.274   -0.084  1.00 0.00 ? 262 CYS A HB3  5  
ATOM   8343  N  N    . ASP B 2 5   ? 12.831  3.309   -1.326  1.00 0.00 ? 263 ASP A N    5  
ATOM   8344  C  CA   . ASP B 2 5   ? 12.775  4.759   -1.186  1.00 0.00 ? 263 ASP A CA   5  
ATOM   8345  C  C    . ASP B 2 5   ? 13.188  5.182   0.228   1.00 0.00 ? 263 ASP A C    5  
ATOM   8346  O  O    . ASP B 2 5   ? 13.235  6.367   0.558   1.00 0.00 ? 263 ASP A O    5  
ATOM   8347  C  CB   . ASP B 2 5   ? 11.356  5.208   -1.527  1.00 0.00 ? 263 ASP A CB   5  
ATOM   8348  C  CG   . ASP B 2 5   ? 10.756  6.227   -0.573  1.00 0.00 ? 263 ASP A CG   5  
ATOM   8349  O  OD1  . ASP B 2 5   ? 11.271  7.362   -0.509  1.00 0.00 ? 263 ASP A OD1  5  
ATOM   8350  O  OD2  . ASP B 2 5   ? 9.748   5.890   0.093   1.00 0.00 ? 263 ASP A OD2  5  
ATOM   8351  H  H    . ASP B 2 5   ? 11.998  2.809   -1.455  1.00 0.00 ? 263 ASP A H    5  
ATOM   8352  H  HA   . ASP B 2 5   ? 13.461  5.185   -1.898  1.00 0.00 ? 263 ASP A HA   5  
ATOM   8353  H  HB2  . ASP B 2 5   ? 11.351  5.632   -2.520  1.00 0.00 ? 263 ASP A HB2  5  
ATOM   8354  H  HB3  . ASP B 2 5   ? 10.737  4.332   -1.518  1.00 0.00 ? 263 ASP A HB3  5  
ATOM   8355  N  N    . PHE B 2 6   ? 13.523  4.189   1.040   1.00 0.00 ? 264 PHE A N    5  
ATOM   8356  C  CA   . PHE B 2 6   ? 13.926  4.419   2.432   1.00 0.00 ? 264 PHE A CA   5  
ATOM   8357  C  C    . PHE B 2 6   ? 15.409  4.080   2.677   1.00 0.00 ? 264 PHE A C    5  
ATOM   8358  O  O    . PHE B 2 6   ? 16.009  4.585   3.625   1.00 0.00 ? 264 PHE A O    5  
ATOM   8359  C  CB   . PHE B 2 6   ? 13.023  3.618   3.384   1.00 0.00 ? 264 PHE A CB   5  
ATOM   8360  C  CG   . PHE B 2 6   ? 11.557  3.840   3.138   1.00 0.00 ? 264 PHE A CG   5  
ATOM   8361  C  CD1  . PHE B 2 6   ? 10.929  3.231   2.065   1.00 0.00 ? 264 PHE A CD1  5  
ATOM   8362  C  CD2  . PHE B 2 6   ? 10.809  4.648   3.977   1.00 0.00 ? 264 PHE A CD2  5  
ATOM   8363  C  CE1  . PHE B 2 6   ? 9.583   3.424   1.829   1.00 0.00 ? 264 PHE A CE1  5  
ATOM   8364  C  CE2  . PHE B 2 6   ? 9.460   4.847   3.746   1.00 0.00 ? 264 PHE A CE2  5  
ATOM   8365  C  CZ   . PHE B 2 6   ? 8.846   4.233   2.670   1.00 0.00 ? 264 PHE A CZ   5  
ATOM   8366  H  H    . PHE B 2 6   ? 13.497  3.279   0.691   1.00 0.00 ? 264 PHE A H    5  
ATOM   8367  H  HA   . PHE B 2 6   ? 13.783  5.465   2.631   1.00 0.00 ? 264 PHE A HA   5  
ATOM   8368  H  HB2  . PHE B 2 6   ? 13.221  2.563   3.260   1.00 0.00 ? 264 PHE A HB2  5  
ATOM   8369  H  HB3  . PHE B 2 6   ? 13.237  3.900   4.402   1.00 0.00 ? 264 PHE A HB3  5  
ATOM   8370  H  HD1  . PHE B 2 6   ? 11.507  2.603   1.407   1.00 0.00 ? 264 PHE A HD1  5  
ATOM   8371  H  HD2  . PHE B 2 6   ? 11.288  5.128   4.819   1.00 0.00 ? 264 PHE A HD2  5  
ATOM   8372  H  HE1  . PHE B 2 6   ? 9.106   2.941   0.987   1.00 0.00 ? 264 PHE A HE1  5  
ATOM   8373  H  HE2  . PHE B 2 6   ? 8.886   5.481   4.406   1.00 0.00 ? 264 PHE A HE2  5  
ATOM   8374  H  HZ   . PHE B 2 6   ? 7.795   4.387   2.485   1.00 0.00 ? 264 PHE A HZ   5  
ATOM   8375  N  N    . CYS B 2 7   ? 15.994  3.220   1.832   1.00 0.00 ? 265 CYS A N    5  
ATOM   8376  C  CA   . CYS B 2 7   ? 17.417  2.850   1.957   1.00 0.00 ? 265 CYS A CA   5  
ATOM   8377  C  C    . CYS B 2 7   ? 18.127  3.052   0.649   1.00 0.00 ? 265 CYS A C    5  
ATOM   8378  O  O    . CYS B 2 7   ? 19.301  3.414   0.607   1.00 0.00 ? 265 CYS A O    5  
ATOM   8379  C  CB   . CYS B 2 7   ? 17.616  1.403   2.402   1.00 0.00 ? 265 CYS A CB   5  
ATOM   8380  S  SG   . CYS B 2 7   ? 16.617  0.895   3.825   1.00 0.00 ? 265 CYS A SG   5  
ATOM   8381  H  H    . CYS B 2 7   ? 15.462  2.830   1.109   1.00 0.00 ? 265 CYS A H    5  
ATOM   8382  H  HA   . CYS B 2 7   ? 17.871  3.494   2.669   1.00 0.00 ? 265 CYS A HA   5  
ATOM   8383  H  HB2  . CYS B 2 7   ? 17.382  0.751   1.593   1.00 0.00 ? 265 CYS A HB2  5  
ATOM   8384  H  HB3  . CYS B 2 7   ? 18.651  1.265   2.664   1.00 0.00 ? 265 CYS A HB3  5  
ATOM   8385  N  N    . LEU B 2 8   ? 17.391  2.823   -0.413  1.00 0.00 ? 266 LEU A N    5  
ATOM   8386  C  CA   . LEU B 2 8   ? 17.901  2.966   -1.745  1.00 0.00 ? 266 LEU A CA   5  
ATOM   8387  C  C    . LEU B 2 8   ? 19.003  1.955   -2.012  1.00 0.00 ? 266 LEU A C    5  
ATOM   8388  O  O    . LEU B 2 8   ? 19.956  2.226   -2.743  1.00 0.00 ? 266 LEU A O    5  
ATOM   8389  C  CB   . LEU B 2 8   ? 18.376  4.385   -1.966  1.00 0.00 ? 266 LEU A CB   5  
ATOM   8390  C  CG   . LEU B 2 8   ? 17.456  5.431   -1.371  1.00 0.00 ? 266 LEU A CG   5  
ATOM   8391  C  CD1  . LEU B 2 8   ? 18.154  6.769   -1.249  1.00 0.00 ? 266 LEU A CD1  5  
ATOM   8392  C  CD2  . LEU B 2 8   ? 16.213  5.537   -2.210  1.00 0.00 ? 266 LEU A CD2  5  
ATOM   8393  H  H    . LEU B 2 8   ? 16.464  2.555   -0.295  1.00 0.00 ? 266 LEU A H    5  
ATOM   8394  H  HA   . LEU B 2 8   ? 17.082  2.779   -2.409  1.00 0.00 ? 266 LEU A HA   5  
ATOM   8395  H  HB2  . LEU B 2 8   ? 19.354  4.495   -1.538  1.00 0.00 ? 266 LEU A HB2  5  
ATOM   8396  H  HB3  . LEU B 2 8   ? 18.425  4.552   -3.022  1.00 0.00 ? 266 LEU A HB3  5  
ATOM   8397  H  HG   . LEU B 2 8   ? 17.162  5.103   -0.397  1.00 0.00 ? 266 LEU A HG   5  
ATOM   8398  H  HD11 . LEU B 2 8   ? 19.214  6.623   -1.363  1.00 0.00 ? 266 LEU A HD11 5  
ATOM   8399  H  HD12 . LEU B 2 8   ? 17.951  7.196   -0.278  1.00 0.00 ? 266 LEU A HD12 5  
ATOM   8400  H  HD13 . LEU B 2 8   ? 17.796  7.436   -2.019  1.00 0.00 ? 266 LEU A HD13 5  
ATOM   8401  H  HD21 . LEU B 2 8   ? 15.898  4.537   -2.458  1.00 0.00 ? 266 LEU A HD21 5  
ATOM   8402  H  HD22 . LEU B 2 8   ? 16.427  6.089   -3.114  1.00 0.00 ? 266 LEU A HD22 5  
ATOM   8403  H  HD23 . LEU B 2 8   ? 15.436  6.035   -1.651  1.00 0.00 ? 266 LEU A HD23 5  
ATOM   8404  N  N    . GLY B 2 9   ? 18.847  0.777   -1.414  1.00 0.00 ? 267 GLY A N    5  
ATOM   8405  C  CA   . GLY B 2 9   ? 19.815  -0.283  -1.584  1.00 0.00 ? 267 GLY A CA   5  
ATOM   8406  C  C    . GLY B 2 9   ? 19.458  -1.190  -2.737  1.00 0.00 ? 267 GLY A C    5  
ATOM   8407  O  O    . GLY B 2 9   ? 19.750  -0.878  -3.891  1.00 0.00 ? 267 GLY A O    5  
ATOM   8408  H  H    . GLY B 2 9   ? 18.059  0.625   -0.852  1.00 0.00 ? 267 GLY A H    5  
ATOM   8409  H  HA2  . GLY B 2 9   ? 20.790  0.152   -1.758  1.00 0.00 ? 267 GLY A HA2  5  
ATOM   8410  H  HA3  . GLY B 2 9   ? 19.849  -0.868  -0.678  1.00 0.00 ? 267 GLY A HA3  5  
ATOM   8411  N  N    . GLY B 2 10  ? 18.823  -2.317  -2.430  1.00 0.00 ? 268 GLY A N    5  
ATOM   8412  C  CA   . GLY B 2 10  ? 18.433  -3.231  -3.502  1.00 0.00 ? 268 GLY A CA   5  
ATOM   8413  C  C    . GLY B 2 10  ? 17.864  -4.577  -3.057  1.00 0.00 ? 268 GLY A C    5  
ATOM   8414  O  O    . GLY B 2 10  ? 18.321  -5.617  -3.531  1.00 0.00 ? 268 GLY A O    5  
ATOM   8415  H  H    . GLY B 2 10  ? 18.632  -2.520  -1.484  1.00 0.00 ? 268 GLY A H    5  
ATOM   8416  H  HA2  . GLY B 2 10  ? 17.689  -2.740  -4.109  1.00 0.00 ? 268 GLY A HA2  5  
ATOM   8417  H  HA3  . GLY B 2 10  ? 19.301  -3.416  -4.119  1.00 0.00 ? 268 GLY A HA3  5  
ATOM   8418  N  N    . SER B 2 11  ? 16.863  -4.567  -2.170  1.00 0.00 ? 269 SER A N    5  
ATOM   8419  C  CA   . SER B 2 11  ? 16.224  -5.794  -1.701  1.00 0.00 ? 269 SER A CA   5  
ATOM   8420  C  C    . SER B 2 11  ? 17.246  -6.758  -1.128  1.00 0.00 ? 269 SER A C    5  
ATOM   8421  O  O    . SER B 2 11  ? 18.451  -6.570  -1.293  1.00 0.00 ? 269 SER A O    5  
ATOM   8422  C  CB   . SER B 2 11  ? 15.425  -6.452  -2.835  1.00 0.00 ? 269 SER A CB   5  
ATOM   8423  O  OG   . SER B 2 11  ? 16.259  -7.243  -3.663  1.00 0.00 ? 269 SER A OG   5  
ATOM   8424  H  H    . SER B 2 11  ? 16.553  -3.720  -1.810  1.00 0.00 ? 269 SER A H    5  
ATOM   8425  H  HA   . SER B 2 11  ? 15.539  -5.518  -0.913  1.00 0.00 ? 269 SER A HA   5  
ATOM   8426  H  HB2  . SER B 2 11  ? 14.649  -7.073  -2.419  1.00 0.00 ? 269 SER A HB2  5  
ATOM   8427  H  HB3  . SER B 2 11  ? 14.967  -5.687  -3.434  1.00 0.00 ? 269 SER A HB3  5  
ATOM   8428  H  HG   . SER B 2 11  ? 15.848  -8.098  -3.808  1.00 0.00 ? 269 SER A HG   5  
ATOM   8429  N  N    . ASN B 2 12  ? 16.757  -7.786  -0.440  1.00 0.00 ? 270 ASN A N    5  
ATOM   8430  C  CA   . ASN B 2 12  ? 17.639  -8.778  0.185   1.00 0.00 ? 270 ASN A CA   5  
ATOM   8431  C  C    . ASN B 2 12  ? 18.796  -8.065  0.852   1.00 0.00 ? 270 ASN A C    5  
ATOM   8432  O  O    . ASN B 2 12  ? 19.895  -8.599  0.988   1.00 0.00 ? 270 ASN A O    5  
ATOM   8433  C  CB   . ASN B 2 12  ? 18.131  -9.801  -0.823  1.00 0.00 ? 270 ASN A CB   5  
ATOM   8434  C  CG   . ASN B 2 12  ? 17.968  -9.348  -2.262  1.00 0.00 ? 270 ASN A CG   5  
ATOM   8435  O  OD1  . ASN B 2 12  ? 16.985  -9.688  -2.920  1.00 0.00 ? 270 ASN A OD1  5  
ATOM   8436  N  ND2  . ASN B 2 12  ? 18.922  -8.572  -2.757  1.00 0.00 ? 270 ASN A ND2  5  
ATOM   8437  H  H    . ASN B 2 12  ? 15.789  -7.862  -0.339  1.00 0.00 ? 270 ASN A H    5  
ATOM   8438  H  HA   . ASN B 2 12  ? 17.094  -9.296  0.948   1.00 0.00 ? 270 ASN A HA   5  
ATOM   8439  H  HB2  . ASN B 2 12  ? 19.162  -9.987  -0.625  1.00 0.00 ? 270 ASN A HB2  5  
ATOM   8440  H  HB3  . ASN B 2 12  ? 17.577  -10.718 -0.690  1.00 0.00 ? 270 ASN A HB3  5  
ATOM   8441  H  HD21 . ASN B 2 12  ? 19.678  -8.339  -2.178  1.00 0.00 ? 270 ASN A HD21 5  
ATOM   8442  H  HD22 . ASN B 2 12  ? 18.821  -8.248  -3.676  1.00 0.00 ? 270 ASN A HD22 5  
ATOM   8443  N  N    . MET B 2 13  ? 18.505  -6.834  1.258   1.00 0.00 ? 271 MET A N    5  
ATOM   8444  C  CA   . MET B 2 13  ? 19.454  -5.967  1.930   1.00 0.00 ? 271 MET A CA   5  
ATOM   8445  C  C    . MET B 2 13  ? 18.755  -4.647  2.263   1.00 0.00 ? 271 MET A C    5  
ATOM   8446  O  O    . MET B 2 13  ? 18.225  -3.979  1.375   1.00 0.00 ? 271 MET A O    5  
ATOM   8447  C  CB   . MET B 2 13  ? 20.675  -5.708  1.055   1.00 0.00 ? 271 MET A CB   5  
ATOM   8448  C  CG   . MET B 2 13  ? 22.004  -5.869  1.781   1.00 0.00 ? 271 MET A CG   5  
ATOM   8449  S  SD   . MET B 2 13  ? 22.635  -7.559  1.730   1.00 0.00 ? 271 MET A SD   5  
ATOM   8450  C  CE   . MET B 2 13  ? 21.802  -8.292  3.137   1.00 0.00 ? 271 MET A CE   5  
ATOM   8451  H  H    . MET B 2 13  ? 17.598  -6.491  1.086   1.00 0.00 ? 271 MET A H    5  
ATOM   8452  H  HA   . MET B 2 13  ? 19.761  -6.455  2.840   1.00 0.00 ? 271 MET A HA   5  
ATOM   8453  H  HB2  . MET B 2 13  ? 20.660  -6.392  0.220   1.00 0.00 ? 271 MET A HB2  5  
ATOM   8454  H  HB3  . MET B 2 13  ? 20.616  -4.703  0.687   1.00 0.00 ? 271 MET A HB3  5  
ATOM   8455  H  HG2  . MET B 2 13  ? 22.731  -5.217  1.320   1.00 0.00 ? 271 MET A HG2  5  
ATOM   8456  H  HG3  . MET B 2 13  ? 21.869  -5.581  2.813   1.00 0.00 ? 271 MET A HG3  5  
ATOM   8457  H  HE1  . MET B 2 13  ? 20.752  -8.040  3.105   1.00 0.00 ? 271 MET A HE1  5  
ATOM   8458  H  HE2  . MET B 2 13  ? 22.238  -7.916  4.049   1.00 0.00 ? 271 MET A HE2  5  
ATOM   8459  H  HE3  . MET B 2 13  ? 21.915  -9.366  3.102   1.00 0.00 ? 271 MET A HE3  5  
ATOM   8460  N  N    . ASN B 2 14  ? 18.758  -4.277  3.535   1.00 0.00 ? 272 ASN A N    5  
ATOM   8461  C  CA   . ASN B 2 14  ? 18.086  -3.066  3.992   1.00 0.00 ? 272 ASN A CA   5  
ATOM   8462  C  C    . ASN B 2 14  ? 19.069  -1.921  4.097   1.00 0.00 ? 272 ASN A C    5  
ATOM   8463  O  O    . ASN B 2 14  ? 18.950  -1.089  4.985   1.00 0.00 ? 272 ASN A O    5  
ATOM   8464  C  CB   . ASN B 2 14  ? 17.435  -3.319  5.357   1.00 0.00 ? 272 ASN A CB   5  
ATOM   8465  C  CG   . ASN B 2 14  ? 16.493  -2.211  5.771   1.00 0.00 ? 272 ASN A CG   5  
ATOM   8466  O  OD1  . ASN B 2 14  ? 16.412  -1.854  6.947   1.00 0.00 ? 272 ASN A OD1  5  
ATOM   8467  N  ND2  . ASN B 2 14  ? 15.765  -1.669  4.807   1.00 0.00 ? 272 ASN A ND2  5  
ATOM   8468  H  H    . ASN B 2 14  ? 19.240  -4.827  4.188   1.00 0.00 ? 272 ASN A H    5  
ATOM   8469  H  HA   . ASN B 2 14  ? 17.321  -2.814  3.276   1.00 0.00 ? 272 ASN A HA   5  
ATOM   8470  H  HB2  . ASN B 2 14  ? 16.877  -4.242  5.316   1.00 0.00 ? 272 ASN A HB2  5  
ATOM   8471  H  HB3  . ASN B 2 14  ? 18.210  -3.407  6.105   1.00 0.00 ? 272 ASN A HB3  5  
ATOM   8472  H  HD21 . ASN B 2 14  ? 15.873  -2.012  3.895   1.00 0.00 ? 272 ASN A HD21 5  
ATOM   8473  H  HD22 . ASN B 2 14  ? 15.156  -0.942  5.043   1.00 0.00 ? 272 ASN A HD22 5  
ATOM   8474  N  N    . LYS B 2 15  ? 19.991  -1.883  3.137   1.00 0.00 ? 273 LYS A N    5  
ATOM   8475  C  CA   . LYS B 2 15  ? 21.068  -0.903  3.057   1.00 0.00 ? 273 LYS A CA   5  
ATOM   8476  C  C    . LYS B 2 15  ? 21.278  -0.085  4.328   1.00 0.00 ? 273 LYS A C    5  
ATOM   8477  O  O    . LYS B 2 15  ? 22.324  -0.191  4.970   1.00 0.00 ? 273 LYS A O    5  
ATOM   8478  C  CB   . LYS B 2 15  ? 20.877  -0.017  1.850   1.00 0.00 ? 273 LYS A CB   5  
ATOM   8479  C  CG   . LYS B 2 15  ? 21.978  -0.278  0.845   1.00 0.00 ? 273 LYS A CG   5  
ATOM   8480  C  CD   . LYS B 2 15  ? 22.689  0.988   0.411   1.00 0.00 ? 273 LYS A CD   5  
ATOM   8481  C  CE   . LYS B 2 15  ? 21.708  1.985   -0.140  1.00 0.00 ? 273 LYS A CE   5  
ATOM   8482  N  NZ   . LYS B 2 15  ? 22.076  3.386   0.199   1.00 0.00 ? 273 LYS A NZ   5  
ATOM   8483  H  H    . LYS B 2 15  ? 19.918  -2.526  2.411   1.00 0.00 ? 273 LYS A H    5  
ATOM   8484  H  HA   . LYS B 2 15  ? 21.972  -1.462  2.887   1.00 0.00 ? 273 LYS A HA   5  
ATOM   8485  H  HB2  . LYS B 2 15  ? 19.912  -0.218  1.398   1.00 0.00 ? 273 LYS A HB2  5  
ATOM   8486  H  HB3  . LYS B 2 15  ? 20.911  1.002   2.139   1.00 0.00 ? 273 LYS A HB3  5  
ATOM   8487  H  HG2  . LYS B 2 15  ? 22.693  -0.926  1.313   1.00 0.00 ? 273 LYS A HG2  5  
ATOM   8488  H  HG3  . LYS B 2 15  ? 21.561  -0.767  -0.014  1.00 0.00 ? 273 LYS A HG3  5  
ATOM   8489  H  HD2  . LYS B 2 15  ? 23.182  1.418   1.262   1.00 0.00 ? 273 LYS A HD2  5  
ATOM   8490  H  HD3  . LYS B 2 15  ? 23.414  0.745   -0.351  1.00 0.00 ? 273 LYS A HD3  5  
ATOM   8491  H  HE2  . LYS B 2 15  ? 21.666  1.877   -1.214  1.00 0.00 ? 273 LYS A HE2  5  
ATOM   8492  H  HE3  . LYS B 2 15  ? 20.747  1.752   0.286   1.00 0.00 ? 273 LYS A HE3  5  
ATOM   8493  H  HZ1  . LYS B 2 15  ? 22.132  3.502   1.231   1.00 0.00 ? 273 LYS A HZ1  5  
ATOM   8494  H  HZ2  . LYS B 2 15  ? 21.361  4.043   -0.173  1.00 0.00 ? 273 LYS A HZ2  5  
ATOM   8495  H  HZ3  . LYS B 2 15  ? 22.999  3.625   -0.217  1.00 0.00 ? 273 LYS A HZ3  5  
ATOM   8496  N  N    . LYS B 2 16  ? 20.300  0.730   4.683   1.00 0.00 ? 274 LYS A N    5  
ATOM   8497  C  CA   . LYS B 2 16  ? 20.379  1.545   5.885   1.00 0.00 ? 274 LYS A CA   5  
ATOM   8498  C  C    . LYS B 2 16  ? 20.635  0.667   7.115   1.00 0.00 ? 274 LYS A C    5  
ATOM   8499  O  O    . LYS B 2 16  ? 20.910  1.164   8.207   1.00 0.00 ? 274 LYS A O    5  
ATOM   8500  C  CB   . LYS B 2 16  ? 19.086  2.343   6.027   1.00 0.00 ? 274 LYS A CB   5  
ATOM   8501  C  CG   . LYS B 2 16  ? 18.889  3.335   4.891   1.00 0.00 ? 274 LYS A CG   5  
ATOM   8502  C  CD   . LYS B 2 16  ? 19.404  4.715   5.271   1.00 0.00 ? 274 LYS A CD   5  
ATOM   8503  C  CE   . LYS B 2 16  ? 19.539  5.628   4.069   1.00 0.00 ? 274 LYS A CE   5  
ATOM   8504  N  NZ   . LYS B 2 16  ? 18.246  5.836   3.364   1.00 0.00 ? 274 LYS A NZ   5  
ATOM   8505  H  H    . LYS B 2 16  ? 19.498  0.778   4.131   1.00 0.00 ? 274 LYS A H    5  
ATOM   8506  H  HA   . LYS B 2 16  ? 21.206  2.230   5.768   1.00 0.00 ? 274 LYS A HA   5  
ATOM   8507  H  HB2  . LYS B 2 16  ? 18.249  1.660   6.032   1.00 0.00 ? 274 LYS A HB2  5  
ATOM   8508  H  HB3  . LYS B 2 16  ? 19.107  2.890   6.957   1.00 0.00 ? 274 LYS A HB3  5  
ATOM   8509  H  HG2  . LYS B 2 16  ? 19.436  2.982   4.027   1.00 0.00 ? 274 LYS A HG2  5  
ATOM   8510  H  HG3  . LYS B 2 16  ? 17.837  3.394   4.646   1.00 0.00 ? 274 LYS A HG3  5  
ATOM   8511  H  HD2  . LYS B 2 16  ? 18.724  5.165   5.977   1.00 0.00 ? 274 LYS A HD2  5  
ATOM   8512  H  HD3  . LYS B 2 16  ? 20.375  4.605   5.723   1.00 0.00 ? 274 LYS A HD3  5  
ATOM   8513  H  HE2  . LYS B 2 16  ? 19.913  6.584   4.401   1.00 0.00 ? 274 LYS A HE2  5  
ATOM   8514  H  HE3  . LYS B 2 16  ? 20.246  5.186   3.389   1.00 0.00 ? 274 LYS A HE3  5  
ATOM   8515  H  HZ1  . LYS B 2 16  ? 18.366  6.519   2.589   1.00 0.00 ? 274 LYS A HZ1  5  
ATOM   8516  H  HZ2  . LYS B 2 16  ? 17.533  6.203   4.026   1.00 0.00 ? 274 LYS A HZ2  5  
ATOM   8517  H  HZ3  . LYS B 2 16  ? 17.906  4.938   2.971   1.00 0.00 ? 274 LYS A HZ3  5  
ATOM   8518  N  N    . SER B 2 17  ? 20.538  -0.647  6.911   1.00 0.00 ? 275 SER A N    5  
ATOM   8519  C  CA   . SER B 2 17  ? 20.777  -1.633  7.942   1.00 0.00 ? 275 SER A CA   5  
ATOM   8520  C  C    . SER B 2 17  ? 21.428  -2.862  7.329   1.00 0.00 ? 275 SER A C    5  
ATOM   8521  O  O    . SER B 2 17  ? 21.773  -3.813  8.031   1.00 0.00 ? 275 SER A O    5  
ATOM   8522  C  CB   . SER B 2 17  ? 19.469  -2.043  8.614   1.00 0.00 ? 275 SER A CB   5  
ATOM   8523  O  OG   . SER B 2 17  ? 18.809  -0.927  9.185   1.00 0.00 ? 275 SER A OG   5  
ATOM   8524  H  H    . SER B 2 17  ? 20.288  -0.965  6.033   1.00 0.00 ? 275 SER A H    5  
ATOM   8525  H  HA   . SER B 2 17  ? 21.441  -1.208  8.671   1.00 0.00 ? 275 SER A HA   5  
ATOM   8526  H  HB2  . SER B 2 17  ? 18.818  -2.503  7.885   1.00 0.00 ? 275 SER A HB2  5  
ATOM   8527  H  HB3  . SER B 2 17  ? 19.685  -2.755  9.388   1.00 0.00 ? 275 SER A HB3  5  
ATOM   8528  H  HG   . SER B 2 17  ? 18.377  -1.193  10.000  1.00 0.00 ? 275 SER A HG   5  
ATOM   8529  N  N    . GLY B 2 18  ? 21.602  -2.827  6.006   1.00 0.00 ? 276 GLY A N    5  
ATOM   8530  C  CA   . GLY B 2 18  ? 22.193  -3.946  5.305   1.00 0.00 ? 276 GLY A CA   5  
ATOM   8531  C  C    . GLY B 2 18  ? 21.499  -5.252  5.606   1.00 0.00 ? 276 GLY A C    5  
ATOM   8532  O  O    . GLY B 2 18  ? 22.072  -6.324  5.426   1.00 0.00 ? 276 GLY A O    5  
ATOM   8533  H  H    . GLY B 2 18  ? 21.344  -2.021  5.504   1.00 0.00 ? 276 GLY A H    5  
ATOM   8534  H  HA2  . GLY B 2 18  ? 22.132  -3.761  4.247   1.00 0.00 ? 276 GLY A HA2  5  
ATOM   8535  H  HA3  . GLY B 2 18  ? 23.222  -4.028  5.592   1.00 0.00 ? 276 GLY A HA3  5  
ATOM   8536  N  N    . ARG B 2 19  ? 20.267  -5.158  6.076   1.00 0.00 ? 277 ARG A N    5  
ATOM   8537  C  CA   . ARG B 2 19  ? 19.491  -6.346  6.407   1.00 0.00 ? 277 ARG A CA   5  
ATOM   8538  C  C    . ARG B 2 19  ? 18.629  -6.829  5.252   1.00 0.00 ? 277 ARG A C    5  
ATOM   8539  O  O    . ARG B 2 19  ? 17.934  -6.068  4.598   1.00 0.00 ? 277 ARG A O    5  
ATOM   8540  C  CB   . ARG B 2 19  ? 18.622  -6.122  7.604   1.00 0.00 ? 277 ARG A CB   5  
ATOM   8541  C  CG   . ARG B 2 19  ? 19.423  -5.699  8.788   1.00 0.00 ? 277 ARG A CG   5  
ATOM   8542  C  CD   . ARG B 2 19  ? 18.994  -6.454  10.001  1.00 0.00 ? 277 ARG A CD   5  
ATOM   8543  N  NE   . ARG B 2 19  ? 17.594  -6.213  10.342  1.00 0.00 ? 277 ARG A NE   5  
ATOM   8544  C  CZ   . ARG B 2 19  ? 16.868  -7.025  11.106  1.00 0.00 ? 277 ARG A CZ   5  
ATOM   8545  N  NH1  . ARG B 2 19  ? 17.404  -8.132  11.603  1.00 0.00 ? 277 ARG A NH1  5  
ATOM   8546  N  NH2  . ARG B 2 19  ? 15.603  -6.730  11.373  1.00 0.00 ? 277 ARG A NH2  5  
ATOM   8547  H  H    . ARG B 2 19  ? 19.887  -4.272  6.219   1.00 0.00 ? 277 ARG A H    5  
ATOM   8548  H  HA   . ARG B 2 19  ? 20.197  -7.121  6.666   1.00 0.00 ? 277 ARG A HA   5  
ATOM   8549  H  HB2  . ARG B 2 19  ? 17.886  -5.386  7.378   1.00 0.00 ? 277 ARG A HB2  5  
ATOM   8550  H  HB3  . ARG B 2 19  ? 18.140  -7.053  7.848   1.00 0.00 ? 277 ARG A HB3  5  
ATOM   8551  H  HG2  . ARG B 2 19  ? 20.442  -5.956  8.581   1.00 0.00 ? 277 ARG A HG2  5  
ATOM   8552  H  HG3  . ARG B 2 19  ? 19.317  -4.638  8.953   1.00 0.00 ? 277 ARG A HG3  5  
ATOM   8553  H  HD2  . ARG B 2 19  ? 19.133  -7.489  9.770   1.00 0.00 ? 277 ARG A HD2  5  
ATOM   8554  H  HD3  . ARG B 2 19  ? 19.623  -6.175  10.835  1.00 0.00 ? 277 ARG A HD3  5  
ATOM   8555  H  HE   . ARG B 2 19  ? 17.174  -5.404  9.984   1.00 0.00 ? 277 ARG A HE   5  
ATOM   8556  H  HH11 . ARG B 2 19  ? 18.358  -8.360  11.404  1.00 0.00 ? 277 ARG A HH11 5  
ATOM   8557  H  HH12 . ARG B 2 19  ? 16.855  -8.738  12.177  1.00 0.00 ? 277 ARG A HH12 5  
ATOM   8558  H  HH21 . ARG B 2 19  ? 15.194  -5.897  10.999  1.00 0.00 ? 277 ARG A HH21 5  
ATOM   8559  H  HH22 . ARG B 2 19  ? 15.057  -7.340  11.947  1.00 0.00 ? 277 ARG A HH22 5  
ATOM   8560  N  N    . PRO B 2 20  ? 18.592  -8.134  5.075   1.00 0.00 ? 278 PRO A N    5  
ATOM   8561  C  CA   . PRO B 2 20  ? 17.859  -8.769  3.990   1.00 0.00 ? 278 PRO A CA   5  
ATOM   8562  C  C    . PRO B 2 20  ? 16.358  -8.541  4.051   1.00 0.00 ? 278 PRO A C    5  
ATOM   8563  O  O    . PRO B 2 20  ? 15.728  -8.686  5.099   1.00 0.00 ? 278 PRO A O    5  
ATOM   8564  C  CB   . PRO B 2 20  ? 18.178  -10.248 4.130   1.00 0.00 ? 278 PRO A CB   5  
ATOM   8565  C  CG   . PRO B 2 20  ? 19.285  -10.340 5.128   1.00 0.00 ? 278 PRO A CG   5  
ATOM   8566  C  CD   . PRO B 2 20  ? 19.229  -9.089  5.964   1.00 0.00 ? 278 PRO A CD   5  
ATOM   8567  H  HA   . PRO B 2 20  ? 18.217  -8.429  3.038   1.00 0.00 ? 278 PRO A HA   5  
ATOM   8568  H  HB2  . PRO B 2 20  ? 17.300  -10.774 4.457   1.00 0.00 ? 278 PRO A HB2  5  
ATOM   8569  H  HB3  . PRO B 2 20  ? 18.493  -10.621 3.169   1.00 0.00 ? 278 PRO A HB3  5  
ATOM   8570  H  HG2  . PRO B 2 20  ? 19.152  -11.214 5.747   1.00 0.00 ? 278 PRO A HG2  5  
ATOM   8571  H  HG3  . PRO B 2 20  ? 20.223  -10.391 4.597   1.00 0.00 ? 278 PRO A HG3  5  
ATOM   8572  H  HD2  . PRO B 2 20  ? 18.638  -9.217  6.862   1.00 0.00 ? 278 PRO A HD2  5  
ATOM   8573  H  HD3  . PRO B 2 20  ? 20.219  -8.750  6.225   1.00 0.00 ? 278 PRO A HD3  5  
ATOM   8574  N  N    . GLU B 2 21  ? 15.801  -8.186  2.900   1.00 0.00 ? 279 GLU A N    5  
ATOM   8575  C  CA   . GLU B 2 21  ? 14.381  -7.935  2.759   1.00 0.00 ? 279 GLU A CA   5  
ATOM   8576  C  C    . GLU B 2 21  ? 13.957  -8.244  1.325   1.00 0.00 ? 279 GLU A C    5  
ATOM   8577  O  O    . GLU B 2 21  ? 14.393  -9.235  0.739   1.00 0.00 ? 279 GLU A O    5  
ATOM   8578  C  CB   . GLU B 2 21  ? 14.067  -6.480  3.101   1.00 0.00 ? 279 GLU A CB   5  
ATOM   8579  C  CG   . GLU B 2 21  ? 12.956  -6.331  4.122   1.00 0.00 ? 279 GLU A CG   5  
ATOM   8580  C  CD   . GLU B 2 21  ? 13.399  -6.696  5.525   1.00 0.00 ? 279 GLU A CD   5  
ATOM   8581  O  OE1  . GLU B 2 21  ? 13.904  -5.804  6.239   1.00 0.00 ? 279 GLU A OE1  5  
ATOM   8582  O  OE2  . GLU B 2 21  ? 13.242  -7.873  5.911   1.00 0.00 ? 279 GLU A OE2  5  
ATOM   8583  H  H    . GLU B 2 21  ? 16.372  -8.084  2.112   1.00 0.00 ? 279 GLU A H    5  
ATOM   8584  H  HA   . GLU B 2 21  ? 13.849  -8.583  3.437   1.00 0.00 ? 279 GLU A HA   5  
ATOM   8585  H  HB2  . GLU B 2 21  ? 14.956  -6.011  3.491   1.00 0.00 ? 279 GLU A HB2  5  
ATOM   8586  H  HB3  . GLU B 2 21  ? 13.770  -5.965  2.203   1.00 0.00 ? 279 GLU A HB3  5  
ATOM   8587  H  HG2  . GLU B 2 21  ? 12.620  -5.311  4.119   1.00 0.00 ? 279 GLU A HG2  5  
ATOM   8588  H  HG3  . GLU B 2 21  ? 12.138  -6.978  3.840   1.00 0.00 ? 279 GLU A HG3  5  
ATOM   8589  N  N    . GLU B 2 22  ? 13.109  -7.391  0.772   1.00 0.00 ? 280 GLU A N    5  
ATOM   8590  C  CA   . GLU B 2 22  ? 12.634  -7.545  -0.594  1.00 0.00 ? 280 GLU A CA   5  
ATOM   8591  C  C    . GLU B 2 22  ? 11.819  -6.343  -0.997  1.00 0.00 ? 280 GLU A C    5  
ATOM   8592  O  O    . GLU B 2 22  ? 10.641  -6.221  -0.662  1.00 0.00 ? 280 GLU A O    5  
ATOM   8593  C  CB   . GLU B 2 22  ? 11.806  -8.799  -0.764  1.00 0.00 ? 280 GLU A CB   5  
ATOM   8594  C  CG   . GLU B 2 22  ? 11.773  -9.253  -2.203  1.00 0.00 ? 280 GLU A CG   5  
ATOM   8595  C  CD   . GLU B 2 22  ? 13.048  -9.958  -2.625  1.00 0.00 ? 280 GLU A CD   5  
ATOM   8596  O  OE1  . GLU B 2 22  ? 13.139  -11.188 -2.429  1.00 0.00 ? 280 GLU A OE1  5  
ATOM   8597  O  OE2  . GLU B 2 22  ? 13.955  -9.279  -3.151  1.00 0.00 ? 280 GLU A OE2  5  
ATOM   8598  H  H    . GLU B 2 22  ? 12.796  -6.630  1.299   1.00 0.00 ? 280 GLU A H    5  
ATOM   8599  H  HA   . GLU B 2 22  ? 13.492  -7.604  -1.254  1.00 0.00 ? 280 GLU A HA   5  
ATOM   8600  H  HB2  . GLU B 2 22  ? 12.222  -9.590  -0.156  1.00 0.00 ? 280 GLU A HB2  5  
ATOM   8601  H  HB3  . GLU B 2 22  ? 10.793  -8.597  -0.450  1.00 0.00 ? 280 GLU A HB3  5  
ATOM   8602  H  HG2  . GLU B 2 22  ? 10.948  -9.922  -2.329  1.00 0.00 ? 280 GLU A HG2  5  
ATOM   8603  H  HG3  . GLU B 2 22  ? 11.634  -8.382  -2.829  1.00 0.00 ? 280 GLU A HG3  5  
ATOM   8604  N  N    . LEU B 2 23  ? 12.474  -5.464  -1.723  1.00 0.00 ? 281 LEU A N    5  
ATOM   8605  C  CA   . LEU B 2 23  ? 11.870  -4.233  -2.195  1.00 0.00 ? 281 LEU A CA   5  
ATOM   8606  C  C    . LEU B 2 23  ? 10.512  -4.417  -2.853  1.00 0.00 ? 281 LEU A C    5  
ATOM   8607  O  O    . LEU B 2 23  ? 10.022  -5.529  -3.052  1.00 0.00 ? 281 LEU A O    5  
ATOM   8608  C  CB   . LEU B 2 23  ? 12.781  -3.593  -3.210  1.00 0.00 ? 281 LEU A CB   5  
ATOM   8609  C  CG   . LEU B 2 23  ? 14.171  -3.293  -2.716  1.00 0.00 ? 281 LEU A CG   5  
ATOM   8610  C  CD1  . LEU B 2 23  ? 15.055  -2.990  -3.890  1.00 0.00 ? 281 LEU A CD1  5  
ATOM   8611  C  CD2  . LEU B 2 23  ? 14.137  -2.129  -1.765  1.00 0.00 ? 281 LEU A CD2  5  
ATOM   8612  H  H    . LEU B 2 23  ? 13.419  -5.644  -1.942  1.00 0.00 ? 281 LEU A H    5  
ATOM   8613  H  HA   . LEU B 2 23  ? 11.770  -3.565  -1.355  1.00 0.00 ? 281 LEU A HA   5  
ATOM   8614  H  HB2  . LEU B 2 23  ? 12.855  -4.248  -4.065  1.00 0.00 ? 281 LEU A HB2  5  
ATOM   8615  H  HB3  . LEU B 2 23  ? 12.336  -2.671  -3.521  1.00 0.00 ? 281 LEU A HB3  5  
ATOM   8616  H  HG   . LEU B 2 23  ? 14.559  -4.146  -2.199  1.00 0.00 ? 281 LEU A HG   5  
ATOM   8617  H  HD11 . LEU B 2 23  ? 14.451  -2.533  -4.643  1.00 0.00 ? 281 LEU A HD11 5  
ATOM   8618  H  HD12 . LEU B 2 23  ? 15.486  -3.906  -4.270  1.00 0.00 ? 281 LEU A HD12 5  
ATOM   8619  H  HD13 . LEU B 2 23  ? 15.841  -2.312  -3.591  1.00 0.00 ? 281 LEU A HD13 5  
ATOM   8620  H  HD21 . LEU B 2 23  ? 13.675  -1.280  -2.252  1.00 0.00 ? 281 LEU A HD21 5  
ATOM   8621  H  HD22 . LEU B 2 23  ? 15.144  -1.872  -1.472  1.00 0.00 ? 281 LEU A HD22 5  
ATOM   8622  H  HD23 . LEU B 2 23  ? 13.563  -2.395  -0.891  1.00 0.00 ? 281 LEU A HD23 5  
ATOM   8623  N  N    . VAL B 2 24  ? 9.936   -3.276  -3.201  1.00 0.00 ? 282 VAL A N    5  
ATOM   8624  C  CA   . VAL B 2 24  ? 8.650   -3.204  -3.888  1.00 0.00 ? 282 VAL A CA   5  
ATOM   8625  C  C    . VAL B 2 24  ? 8.624   -1.939  -4.716  1.00 0.00 ? 282 VAL A C    5  
ATOM   8626  O  O    . VAL B 2 24  ? 8.478   -0.847  -4.173  1.00 0.00 ? 282 VAL A O    5  
ATOM   8627  C  CB   . VAL B 2 24  ? 7.470   -3.147  -2.905  1.00 0.00 ? 282 VAL A CB   5  
ATOM   8628  C  CG1  . VAL B 2 24  ? 7.076   -4.505  -2.396  1.00 0.00 ? 282 VAL A CG1  5  
ATOM   8629  C  CG2  . VAL B 2 24  ? 7.807   -2.298  -1.746  1.00 0.00 ? 282 VAL A CG2  5  
ATOM   8630  H  H    . VAL B 2 24  ? 10.409  -2.430  -2.983  1.00 0.00 ? 282 VAL A H    5  
ATOM   8631  H  HA   . VAL B 2 24  ? 8.543   -4.067  -4.530  1.00 0.00 ? 282 VAL A HA   5  
ATOM   8632  H  HB   . VAL B 2 24  ? 6.627   -2.701  -3.381  1.00 0.00 ? 282 VAL A HB   5  
ATOM   8633  H  HG11 . VAL B 2 24  ? 6.499   -4.364  -1.482  1.00 0.00 ? 282 VAL A HG11 5  
ATOM   8634  H  HG12 . VAL B 2 24  ? 7.961   -5.088  -2.186  1.00 0.00 ? 282 VAL A HG12 5  
ATOM   8635  H  HG13 . VAL B 2 24  ? 6.469   -5.010  -3.132  1.00 0.00 ? 282 VAL A HG13 5  
ATOM   8636  H  HG21 . VAL B 2 24  ? 7.956   -2.942  -0.893  1.00 0.00 ? 282 VAL A HG21 5  
ATOM   8637  H  HG22 . VAL B 2 24  ? 6.995   -1.613  -1.550  1.00 0.00 ? 282 VAL A HG22 5  
ATOM   8638  H  HG23 . VAL B 2 24  ? 8.711   -1.746  -1.949  1.00 0.00 ? 282 VAL A HG23 5  
ATOM   8639  N  N    . SER B 2 25  ? 8.712   -2.085  -6.024  1.00 0.00 ? 283 SER A N    5  
ATOM   8640  C  CA   . SER B 2 25  ? 8.739   -0.930  -6.899  1.00 0.00 ? 283 SER A CA   5  
ATOM   8641  C  C    . SER B 2 25  ? 7.343   -0.591  -7.408  1.00 0.00 ? 283 SER A C    5  
ATOM   8642  O  O    . SER B 2 25  ? 6.442   -1.430  -7.371  1.00 0.00 ? 283 SER A O    5  
ATOM   8643  C  CB   . SER B 2 25  ? 9.693   -1.191  -8.062  1.00 0.00 ? 283 SER A CB   5  
ATOM   8644  O  OG   . SER B 2 25  ? 9.267   -2.299  -8.836  1.00 0.00 ? 283 SER A OG   5  
ATOM   8645  H  H    . SER B 2 25  ? 8.760   -2.985  -6.409  1.00 0.00 ? 283 SER A H    5  
ATOM   8646  H  HA   . SER B 2 25  ? 9.121   -0.100  -6.319  1.00 0.00 ? 283 SER A HA   5  
ATOM   8647  H  HB2  . SER B 2 25  ? 9.735   -0.318  -8.696  1.00 0.00 ? 283 SER A HB2  5  
ATOM   8648  H  HB3  . SER B 2 25  ? 10.680  -1.400  -7.666  1.00 0.00 ? 283 SER A HB3  5  
ATOM   8649  H  HG   . SER B 2 25  ? 9.202   -3.075  -8.276  1.00 0.00 ? 283 SER A HG   5  
ATOM   8650  N  N    . CYS B 2 26  ? 7.165   0.640   -7.883  1.00 0.00 ? 284 CYS A N    5  
ATOM   8651  C  CA   . CYS B 2 26  ? 5.875   1.066   -8.400  1.00 0.00 ? 284 CYS A CA   5  
ATOM   8652  C  C    . CYS B 2 26  ? 5.812   0.738   -9.889  1.00 0.00 ? 284 CYS A C    5  
ATOM   8653  O  O    . CYS B 2 26  ? 6.742   1.043   -10.633 1.00 0.00 ? 284 CYS A O    5  
ATOM   8654  C  CB   . CYS B 2 26  ? 5.661   2.573   -8.143  1.00 0.00 ? 284 CYS A CB   5  
ATOM   8655  S  SG   . CYS B 2 26  ? 4.218   3.285   -9.008  1.00 0.00 ? 284 CYS A SG   5  
ATOM   8656  H  H    . CYS B 2 26  ? 7.919   1.260   -7.913  1.00 0.00 ? 284 CYS A H    5  
ATOM   8657  H  HA   . CYS B 2 26  ? 5.111   0.505   -7.885  1.00 0.00 ? 284 CYS A HA   5  
ATOM   8658  H  HB2  . CYS B 2 26  ? 5.510   2.725   -7.085  1.00 0.00 ? 284 CYS A HB2  5  
ATOM   8659  H  HB3  . CYS B 2 26  ? 6.536   3.120   -8.452  1.00 0.00 ? 284 CYS A HB3  5  
ATOM   8660  N  N    . ALA B 2 27  ? 4.723   0.112   -10.326 1.00 0.00 ? 285 ALA A N    5  
ATOM   8661  C  CA   . ALA B 2 27  ? 4.590   -0.263  -11.729 1.00 0.00 ? 285 ALA A CA   5  
ATOM   8662  C  C    . ALA B 2 27  ? 4.419   0.958   -12.616 1.00 0.00 ? 285 ALA A C    5  
ATOM   8663  O  O    . ALA B 2 27  ? 4.253   0.843   -13.831 1.00 0.00 ? 285 ALA A O    5  
ATOM   8664  C  CB   . ALA B 2 27  ? 3.430   -1.217  -11.906 1.00 0.00 ? 285 ALA A CB   5  
ATOM   8665  H  H    . ALA B 2 27  ? 3.997   -0.105  -9.698  1.00 0.00 ? 285 ALA A H    5  
ATOM   8666  H  HA   . ALA B 2 27  ? 5.495   -0.779  -12.019 1.00 0.00 ? 285 ALA A HA   5  
ATOM   8667  H  HB1  . ALA B 2 27  ? 2.505   -0.701  -11.701 1.00 0.00 ? 285 ALA A HB1  5  
ATOM   8668  H  HB2  . ALA B 2 27  ? 3.540   -2.047  -11.225 1.00 0.00 ? 285 ALA A HB2  5  
ATOM   8669  H  HB3  . ALA B 2 27  ? 3.421   -1.584  -12.922 1.00 0.00 ? 285 ALA A HB3  5  
ATOM   8670  N  N    . ASP B 2 28  ? 4.461   2.127   -11.998 1.00 0.00 ? 286 ASP A N    5  
ATOM   8671  C  CA   . ASP B 2 28  ? 4.316   3.383   -12.716 1.00 0.00 ? 286 ASP A CA   5  
ATOM   8672  C  C    . ASP B 2 28  ? 5.583   4.219   -12.595 1.00 0.00 ? 286 ASP A C    5  
ATOM   8673  O  O    . ASP B 2 28  ? 6.069   4.784   -13.576 1.00 0.00 ? 286 ASP A O    5  
ATOM   8674  C  CB   . ASP B 2 28  ? 3.140   4.171   -12.151 1.00 0.00 ? 286 ASP A CB   5  
ATOM   8675  C  CG   . ASP B 2 28  ? 2.814   5.400   -12.978 1.00 0.00 ? 286 ASP A CG   5  
ATOM   8676  O  OD1  . ASP B 2 28  ? 2.076   5.265   -13.976 1.00 0.00 ? 286 ASP A OD1  5  
ATOM   8677  O  OD2  . ASP B 2 28  ? 3.298   6.497   -12.628 1.00 0.00 ? 286 ASP A OD2  5  
ATOM   8678  H  H    . ASP B 2 28  ? 4.587   2.143   -11.028 1.00 0.00 ? 286 ASP A H    5  
ATOM   8679  H  HA   . ASP B 2 28  ? 4.130   3.159   -13.753 1.00 0.00 ? 286 ASP A HA   5  
ATOM   8680  H  HB2  . ASP B 2 28  ? 2.271   3.536   -12.120 1.00 0.00 ? 286 ASP A HB2  5  
ATOM   8681  H  HB3  . ASP B 2 28  ? 3.385   4.490   -11.147 1.00 0.00 ? 286 ASP A HB3  5  
ATOM   8682  N  N    . CYS B 2 29  ? 6.104   4.288   -11.379 1.00 0.00 ? 287 CYS A N    5  
ATOM   8683  C  CA   . CYS B 2 29  ? 7.305   5.063   -11.093 1.00 0.00 ? 287 CYS A CA   5  
ATOM   8684  C  C    . CYS B 2 29  ? 8.541   4.183   -11.052 1.00 0.00 ? 287 CYS A C    5  
ATOM   8685  O  O    . CYS B 2 29  ? 9.595   4.540   -11.580 1.00 0.00 ? 287 CYS A O    5  
ATOM   8686  C  CB   . CYS B 2 29  ? 7.162   5.755   -9.751  1.00 0.00 ? 287 CYS A CB   5  
ATOM   8687  S  SG   . CYS B 2 29  ? 5.675   6.782   -9.594  1.00 0.00 ? 287 CYS A SG   5  
ATOM   8688  H  H    . CYS B 2 29  ? 5.666   3.800   -10.648 1.00 0.00 ? 287 CYS A H    5  
ATOM   8689  H  HA   . CYS B 2 29  ? 7.421   5.804   -11.853 1.00 0.00 ? 287 CYS A HA   5  
ATOM   8690  H  HB2  . CYS B 2 29  ? 7.120   5.005   -8.990  1.00 0.00 ? 287 CYS A HB2  5  
ATOM   8691  H  HB3  . CYS B 2 29  ? 8.022   6.387   -9.582  1.00 0.00 ? 287 CYS A HB3  5  
ATOM   8692  N  N    . GLY B 2 30  ? 8.396   3.032   -10.421 1.00 0.00 ? 288 GLY A N    5  
ATOM   8693  C  CA   . GLY B 2 30  ? 9.506   2.116   -10.278 1.00 0.00 ? 288 GLY A CA   5  
ATOM   8694  C  C    . GLY B 2 30  ? 10.148  2.250   -8.914  1.00 0.00 ? 288 GLY A C    5  
ATOM   8695  O  O    . GLY B 2 30  ? 11.077  1.517   -8.579  1.00 0.00 ? 288 GLY A O    5  
ATOM   8696  H  H    . GLY B 2 30  ? 7.518   2.795   -10.053 1.00 0.00 ? 288 GLY A H    5  
ATOM   8697  H  HA2  . GLY B 2 30  ? 9.149   1.104   -10.405 1.00 0.00 ? 288 GLY A HA2  5  
ATOM   8698  H  HA3  . GLY B 2 30  ? 10.243  2.330   -11.037 1.00 0.00 ? 288 GLY A HA3  5  
ATOM   8699  N  N    . ARG B 2 31  ? 9.638   3.192   -8.122  1.00 0.00 ? 289 ARG A N    5  
ATOM   8700  C  CA   . ARG B 2 31  ? 10.162  3.430   -6.783  1.00 0.00 ? 289 ARG A CA   5  
ATOM   8701  C  C    . ARG B 2 31  ? 9.965   2.212   -5.908  1.00 0.00 ? 289 ARG A C    5  
ATOM   8702  O  O    . ARG B 2 31  ? 8.849   1.897   -5.498  1.00 0.00 ? 289 ARG A O    5  
ATOM   8703  C  CB   . ARG B 2 31  ? 9.482   4.619   -6.130  1.00 0.00 ? 289 ARG A CB   5  
ATOM   8704  C  CG   . ARG B 2 31  ? 9.965   5.958   -6.633  1.00 0.00 ? 289 ARG A CG   5  
ATOM   8705  C  CD   . ARG B 2 31  ? 9.888   6.978   -5.523  1.00 0.00 ? 289 ARG A CD   5  
ATOM   8706  N  NE   . ARG B 2 31  ? 10.595  8.212   -5.853  1.00 0.00 ? 289 ARG A NE   5  
ATOM   8707  C  CZ   . ARG B 2 31  ? 10.512  9.326   -5.131  1.00 0.00 ? 289 ARG A CZ   5  
ATOM   8708  N  NH1  . ARG B 2 31  ? 9.759   9.360   -4.041  1.00 0.00 ? 289 ARG A NH1  5  
ATOM   8709  N  NH2  . ARG B 2 31  ? 11.185  10.408  -5.500  1.00 0.00 ? 289 ARG A NH2  5  
ATOM   8710  H  H    . ARG B 2 31  ? 8.888   3.734   -8.444  1.00 0.00 ? 289 ARG A H    5  
ATOM   8711  H  HA   . ARG B 2 31  ? 11.217  3.632   -6.868  1.00 0.00 ? 289 ARG A HA   5  
ATOM   8712  H  HB2  . ARG B 2 31  ? 8.427   4.555   -6.307  1.00 0.00 ? 289 ARG A HB2  5  
ATOM   8713  H  HB3  . ARG B 2 31  ? 9.660   4.577   -5.066  1.00 0.00 ? 289 ARG A HB3  5  
ATOM   8714  H  HG2  . ARG B 2 31  ? 10.991  5.867   -6.963  1.00 0.00 ? 289 ARG A HG2  5  
ATOM   8715  H  HG3  . ARG B 2 31  ? 9.341   6.278   -7.454  1.00 0.00 ? 289 ARG A HG3  5  
ATOM   8716  H  HD2  . ARG B 2 31  ? 8.848   7.205   -5.335  1.00 0.00 ? 289 ARG A HD2  5  
ATOM   8717  H  HD3  . ARG B 2 31  ? 10.329  6.540   -4.638  1.00 0.00 ? 289 ARG A HD3  5  
ATOM   8718  H  HE   . ARG B 2 31  ? 11.158  8.212   -6.655  1.00 0.00 ? 289 ARG A HE   5  
ATOM   8719  H  HH11 . ARG B 2 31  ? 9.251   8.545   -3.759  1.00 0.00 ? 289 ARG A HH11 5  
ATOM   8720  H  HH12 . ARG B 2 31  ? 9.700   10.199  -3.499  1.00 0.00 ? 289 ARG A HH12 5  
ATOM   8721  H  HH21 . ARG B 2 31  ? 11.754  10.388  -6.321  1.00 0.00 ? 289 ARG A HH21 5  
ATOM   8722  H  HH22 . ARG B 2 31  ? 11.122  11.245  -4.956  1.00 0.00 ? 289 ARG A HH22 5  
ATOM   8723  N  N    . SER B 2 32  ? 11.059  1.564   -5.576  1.00 0.00 ? 290 SER A N    5  
ATOM   8724  C  CA   . SER B 2 32  ? 10.994  0.363   -4.768  1.00 0.00 ? 290 SER A CA   5  
ATOM   8725  C  C    . SER B 2 32  ? 11.076  0.694   -3.290  1.00 0.00 ? 290 SER A C    5  
ATOM   8726  O  O    . SER B 2 32  ? 11.453  1.803   -2.921  1.00 0.00 ? 290 SER A O    5  
ATOM   8727  C  CB   . SER B 2 32  ? 12.101  -0.605  -5.163  1.00 0.00 ? 290 SER A CB   5  
ATOM   8728  O  OG   . SER B 2 32  ? 12.253  -0.662  -6.566  1.00 0.00 ? 290 SER A OG   5  
ATOM   8729  H  H    . SER B 2 32  ? 11.925  1.915   -5.862  1.00 0.00 ? 290 SER A H    5  
ATOM   8730  H  HA   . SER B 2 32  ? 10.048  -0.100  -4.960  1.00 0.00 ? 290 SER A HA   5  
ATOM   8731  H  HB2  . SER B 2 32  ? 13.024  -0.281  -4.729  1.00 0.00 ? 290 SER A HB2  5  
ATOM   8732  H  HB3  . SER B 2 32  ? 11.855  -1.589  -4.803  1.00 0.00 ? 290 SER A HB3  5  
ATOM   8733  H  HG   . SER B 2 32  ? 11.848  0.110   -6.965  1.00 0.00 ? 290 SER A HG   5  
ATOM   8734  N  N    . GLY B 2 33  ? 10.678  -0.259  -2.452  1.00 0.00 ? 291 GLY A N    5  
ATOM   8735  C  CA   . GLY B 2 33  ? 10.726  -0.046  -1.008  1.00 0.00 ? 291 GLY A CA   5  
ATOM   8736  C  C    . GLY B 2 33  ? 10.740  -1.336  -0.217  1.00 0.00 ? 291 GLY A C    5  
ATOM   8737  O  O    . GLY B 2 33  ? 10.194  -2.337  -0.652  1.00 0.00 ? 291 GLY A O    5  
ATOM   8738  H  H    . GLY B 2 33  ? 10.321  -1.104  -2.819  1.00 0.00 ? 291 GLY A H    5  
ATOM   8739  H  HA2  . GLY B 2 33  ? 11.606  0.519   -0.764  1.00 0.00 ? 291 GLY A HA2  5  
ATOM   8740  H  HA3  . GLY B 2 33  ? 9.857   0.526   -0.716  1.00 0.00 ? 291 GLY A HA3  5  
ATOM   8741  N  N    . HIS B 2 34  ? 11.387  -1.349  0.941   1.00 0.00 ? 292 HIS A N    5  
ATOM   8742  C  CA   . HIS B 2 34  ? 11.371  -2.568  1.744   1.00 0.00 ? 292 HIS A CA   5  
ATOM   8743  C  C    . HIS B 2 34  ? 10.086  -2.576  2.557   1.00 0.00 ? 292 HIS A C    5  
ATOM   8744  O  O    . HIS B 2 34  ? 9.776   -1.592  3.215   1.00 0.00 ? 292 HIS A O    5  
ATOM   8745  C  CB   . HIS B 2 34  ? 12.588  -2.677  2.667   1.00 0.00 ? 292 HIS A CB   5  
ATOM   8746  C  CG   . HIS B 2 34  ? 13.900  -2.716  1.947   1.00 0.00 ? 292 HIS A CG   5  
ATOM   8747  N  ND1  . HIS B 2 34  ? 14.854  -1.733  2.080   1.00 0.00 ? 292 HIS A ND1  5  
ATOM   8748  C  CD2  . HIS B 2 34  ? 14.412  -3.614  1.068   1.00 0.00 ? 292 HIS A CD2  5  
ATOM   8749  C  CE1  . HIS B 2 34  ? 15.897  -2.029  1.322   1.00 0.00 ? 292 HIS A CE1  5  
ATOM   8750  N  NE2  . HIS B 2 34  ? 15.655  -3.167  0.707   1.00 0.00 ? 292 HIS A NE2  5  
ATOM   8751  H  H    . HIS B 2 34  ? 11.867  -0.542  1.256   1.00 0.00 ? 292 HIS A H    5  
ATOM   8752  H  HA   . HIS B 2 34  ? 11.355  -3.405  1.063   1.00 0.00 ? 292 HIS A HA   5  
ATOM   8753  H  HB2  . HIS B 2 34  ? 12.600  -1.830  3.328   1.00 0.00 ? 292 HIS A HB2  5  
ATOM   8754  H  HB3  . HIS B 2 34  ? 12.501  -3.581  3.252   1.00 0.00 ? 292 HIS A HB3  5  
ATOM   8755  H  HD2  . HIS B 2 34  ? 13.896  -4.459  0.644   1.00 0.00 ? 292 HIS A HD2  5  
ATOM   8756  H  HE1  . HIS B 2 34  ? 16.756  -1.402  1.162   1.00 0.00 ? 292 HIS A HE1  5  
ATOM   8757  H  HE2  . HIS B 2 34  ? 16.295  -3.654  0.148   1.00 0.00 ? 292 HIS A HE2  5  
ATOM   8758  N  N    . PRO B 2 35  ? 9.298   -3.670  2.512   1.00 0.00 ? 293 PRO A N    5  
ATOM   8759  C  CA   . PRO B 2 35  ? 8.020   -3.755  3.226   1.00 0.00 ? 293 PRO A CA   5  
ATOM   8760  C  C    . PRO B 2 35  ? 8.179   -3.512  4.723   1.00 0.00 ? 293 PRO A C    5  
ATOM   8761  O  O    . PRO B 2 35  ? 7.203   -3.273  5.428   1.00 0.00 ? 293 PRO A O    5  
ATOM   8762  C  CB   . PRO B 2 35  ? 7.537   -5.178  2.913   1.00 0.00 ? 293 PRO A CB   5  
ATOM   8763  C  CG   . PRO B 2 35  ? 8.240   -5.523  1.654   1.00 0.00 ? 293 PRO A CG   5  
ATOM   8764  C  CD   . PRO B 2 35  ? 9.588   -4.922  1.808   1.00 0.00 ? 293 PRO A CD   5  
ATOM   8765  H  HA   . PRO B 2 35  ? 7.312   -3.035  2.826   1.00 0.00 ? 293 PRO A HA   5  
ATOM   8766  H  HB2  . PRO B 2 35  ? 7.819   -5.847  3.706   1.00 0.00 ? 293 PRO A HB2  5  
ATOM   8767  H  HB3  . PRO B 2 35  ? 6.465   -5.184  2.782   1.00 0.00 ? 293 PRO A HB3  5  
ATOM   8768  H  HG2  . PRO B 2 35  ? 8.324   -6.588  1.555   1.00 0.00 ? 293 PRO A HG2  5  
ATOM   8769  H  HG3  . PRO B 2 35  ? 7.726   -5.100  0.807   1.00 0.00 ? 293 PRO A HG3  5  
ATOM   8770  H  HD2  . PRO B 2 35  ? 10.199  -5.562  2.415   1.00 0.00 ? 293 PRO A HD2  5  
ATOM   8771  H  HD3  . PRO B 2 35  ? 10.038  -4.744  0.848   1.00 0.00 ? 293 PRO A HD3  5  
ATOM   8772  N  N    . THR B 2 36  ? 9.415   -3.584  5.203   1.00 0.00 ? 294 THR A N    5  
ATOM   8773  C  CA   . THR B 2 36  ? 9.702   -3.307  6.604   1.00 0.00 ? 294 THR A CA   5  
ATOM   8774  C  C    . THR B 2 36  ? 9.841   -1.805  6.772   1.00 0.00 ? 294 THR A C    5  
ATOM   8775  O  O    . THR B 2 36  ? 9.549   -1.239  7.825   1.00 0.00 ? 294 THR A O    5  
ATOM   8776  C  CB   . THR B 2 36  ? 10.994  -3.982  7.079   1.00 0.00 ? 294 THR A CB   5  
ATOM   8777  O  OG1  . THR B 2 36  ? 11.019  -5.358  6.683   1.00 0.00 ? 294 THR A OG1  5  
ATOM   8778  C  CG2  . THR B 2 36  ? 11.083  -3.874  8.577   1.00 0.00 ? 294 THR A CG2  5  
ATOM   8779  H  H    . THR B 2 36  ? 10.150  -3.831  4.603   1.00 0.00 ? 294 THR A H    5  
ATOM   8780  H  HA   . THR B 2 36  ? 8.884   -3.657  7.213   1.00 0.00 ? 294 THR A HA   5  
ATOM   8781  H  HB   . THR B 2 36  ? 11.833  -3.465  6.653   1.00 0.00 ? 294 THR A HB   5  
ATOM   8782  H  HG1  . THR B 2 36  ? 10.987  -5.416  5.725   1.00 0.00 ? 294 THR A HG1  5  
ATOM   8783  H  HG21 . THR B 2 36  ? 10.649  -2.934  8.864   1.00 0.00 ? 294 THR A HG21 5  
ATOM   8784  H  HG22 . THR B 2 36  ? 12.118  -3.909  8.884   1.00 0.00 ? 294 THR A HG22 5  
ATOM   8785  H  HG23 . THR B 2 36  ? 10.536  -4.683  9.037   1.00 0.00 ? 294 THR A HG23 5  
ATOM   8786  N  N    . CYS B 2 37  ? 10.298  -1.182  5.697   1.00 0.00 ? 295 CYS A N    5  
ATOM   8787  C  CA   . CYS B 2 37  ? 10.480  0.257   5.627   1.00 0.00 ? 295 CYS A CA   5  
ATOM   8788  C  C    . CYS B 2 37  ? 9.156   0.922   5.292   1.00 0.00 ? 295 CYS A C    5  
ATOM   8789  O  O    . CYS B 2 37  ? 8.936   2.105   5.546   1.00 0.00 ? 295 CYS A O    5  
ATOM   8790  C  CB   . CYS B 2 37  ? 11.509  0.562   4.546   1.00 0.00 ? 295 CYS A CB   5  
ATOM   8791  S  SG   . CYS B 2 37  ? 13.120  -0.207  4.872   1.00 0.00 ? 295 CYS A SG   5  
ATOM   8792  H  H    . CYS B 2 37  ? 10.531  -1.719  4.913   1.00 0.00 ? 295 CYS A H    5  
ATOM   8793  H  HA   . CYS B 2 37  ? 10.837  0.606   6.582   1.00 0.00 ? 295 CYS A HA   5  
ATOM   8794  H  HB2  . CYS B 2 37  ? 11.150  0.190   3.602   1.00 0.00 ? 295 CYS A HB2  5  
ATOM   8795  H  HB3  . CYS B 2 37  ? 11.646  1.618   4.472   1.00 0.00 ? 295 CYS A HB3  5  
ATOM   8796  N  N    . LEU B 2 38  ? 8.289   0.113   4.716   1.00 0.00 ? 296 LEU A N    5  
ATOM   8797  C  CA   . LEU B 2 38  ? 6.955   0.520   4.305   1.00 0.00 ? 296 LEU A CA   5  
ATOM   8798  C  C    . LEU B 2 38  ? 5.958   0.209   5.409   1.00 0.00 ? 296 LEU A C    5  
ATOM   8799  O  O    . LEU B 2 38  ? 4.821   0.683   5.397   1.00 0.00 ? 296 LEU A O    5  
ATOM   8800  C  CB   . LEU B 2 38  ? 6.571   -0.256  3.053   1.00 0.00 ? 296 LEU A CB   5  
ATOM   8801  C  CG   . LEU B 2 38  ? 7.486   -0.051  1.854   1.00 0.00 ? 296 LEU A CG   5  
ATOM   8802  C  CD1  . LEU B 2 38  ? 7.594   -1.331  1.069   1.00 0.00 ? 296 LEU A CD1  5  
ATOM   8803  C  CD2  . LEU B 2 38  ? 6.970   1.054   0.964   1.00 0.00 ? 296 LEU A CD2  5  
ATOM   8804  H  H    . LEU B 2 38  ? 8.562   -0.813  4.560   1.00 0.00 ? 296 LEU A H    5  
ATOM   8805  H  HA   . LEU B 2 38  ? 6.958   1.579   4.088   1.00 0.00 ? 296 LEU A HA   5  
ATOM   8806  H  HB2  . LEU B 2 38  ? 6.571   -1.308  3.299   1.00 0.00 ? 296 LEU A HB2  5  
ATOM   8807  H  HB3  . LEU B 2 38  ? 5.571   0.023   2.767   1.00 0.00 ? 296 LEU A HB3  5  
ATOM   8808  H  HG   . LEU B 2 38  ? 8.474   0.216   2.192   1.00 0.00 ? 296 LEU A HG   5  
ATOM   8809  H  HD11 . LEU B 2 38  ? 7.977   -1.123  0.083   1.00 0.00 ? 296 LEU A HD11 5  
ATOM   8810  H  HD12 . LEU B 2 38  ? 6.624   -1.782  0.988   1.00 0.00 ? 296 LEU A HD12 5  
ATOM   8811  H  HD13 . LEU B 2 38  ? 8.257   -2.005  1.572   1.00 0.00 ? 296 LEU A HD13 5  
ATOM   8812  H  HD21 . LEU B 2 38  ? 7.171   0.792   -0.060  1.00 0.00 ? 296 LEU A HD21 5  
ATOM   8813  H  HD22 . LEU B 2 38  ? 7.469   1.980   1.207   1.00 0.00 ? 296 LEU A HD22 5  
ATOM   8814  H  HD23 . LEU B 2 38  ? 5.906   1.166   1.106   1.00 0.00 ? 296 LEU A HD23 5  
ATOM   8815  N  N    . GLN B 2 39  ? 6.411   -0.609  6.356   1.00 0.00 ? 297 GLN A N    5  
ATOM   8816  C  CA   . GLN B 2 39  ? 5.597   -1.041  7.482   1.00 0.00 ? 297 GLN A CA   5  
ATOM   8817  C  C    . GLN B 2 39  ? 4.483   -1.969  7.010   1.00 0.00 ? 297 GLN A C    5  
ATOM   8818  O  O    . GLN B 2 39  ? 3.462   -2.127  7.679   1.00 0.00 ? 297 GLN A O    5  
ATOM   8819  C  CB   . GLN B 2 39  ? 5.015   0.152   8.242   1.00 0.00 ? 297 GLN A CB   5  
ATOM   8820  C  CG   . GLN B 2 39  ? 6.069   1.068   8.831   1.00 0.00 ? 297 GLN A CG   5  
ATOM   8821  C  CD   . GLN B 2 39  ? 5.471   2.228   9.602   1.00 0.00 ? 297 GLN A CD   5  
ATOM   8822  O  OE1  . GLN B 2 39  ? 4.367   2.685   9.306   1.00 0.00 ? 297 GLN A OE1  5  
ATOM   8823  N  NE2  . GLN B 2 39  ? 6.200   2.712   10.601  1.00 0.00 ? 297 GLN A NE2  5  
ATOM   8824  H  H    . GLN B 2 39  ? 7.334   -0.935  6.293   1.00 0.00 ? 297 GLN A H    5  
ATOM   8825  H  HA   . GLN B 2 39  ? 6.241   -1.591  8.145   1.00 0.00 ? 297 GLN A HA   5  
ATOM   8826  H  HB2  . GLN B 2 39  ? 4.401   0.727   7.570   1.00 0.00 ? 297 GLN A HB2  5  
ATOM   8827  H  HB3  . GLN B 2 39  ? 4.407   -0.217  9.053   1.00 0.00 ? 297 GLN A HB3  5  
ATOM   8828  H  HG2  . GLN B 2 39  ? 6.680   0.489   9.503   1.00 0.00 ? 297 GLN A HG2  5  
ATOM   8829  H  HG3  . GLN B 2 39  ? 6.681   1.460   8.031   1.00 0.00 ? 297 GLN A HG3  5  
ATOM   8830  H  HE21 . GLN B 2 39  ? 7.071   2.299   10.781  1.00 0.00 ? 297 GLN A HE21 5  
ATOM   8831  H  HE22 . GLN B 2 39  ? 5.839   3.462   11.117  1.00 0.00 ? 297 GLN A HE22 5  
ATOM   8832  N  N    . PHE B 2 40  ? 4.697   -2.583  5.848   1.00 0.00 ? 298 PHE A N    5  
ATOM   8833  C  CA   . PHE B 2 40  ? 3.726   -3.505  5.269   1.00 0.00 ? 298 PHE A CA   5  
ATOM   8834  C  C    . PHE B 2 40  ? 3.498   -4.715  6.152   1.00 0.00 ? 298 PHE A C    5  
ATOM   8835  O  O    . PHE B 2 40  ? 4.177   -4.920  7.158   1.00 0.00 ? 298 PHE A O    5  
ATOM   8836  C  CB   . PHE B 2 40  ? 4.196   -4.027  3.905   1.00 0.00 ? 298 PHE A CB   5  
ATOM   8837  C  CG   . PHE B 2 40  ? 4.113   -3.043  2.776   1.00 0.00 ? 298 PHE A CG   5  
ATOM   8838  C  CD1  . PHE B 2 40  ? 3.576   -1.774  2.938   1.00 0.00 ? 298 PHE A CD1  5  
ATOM   8839  C  CD2  . PHE B 2 40  ? 4.584   -3.410  1.535   1.00 0.00 ? 298 PHE A CD2  5  
ATOM   8840  C  CE1  . PHE B 2 40  ? 3.520   -0.900  1.870   1.00 0.00 ? 298 PHE A CE1  5  
ATOM   8841  C  CE2  . PHE B 2 40  ? 4.530   -2.542  0.473   1.00 0.00 ? 298 PHE A CE2  5  
ATOM   8842  C  CZ   . PHE B 2 40  ? 4.005   -1.296  0.639   1.00 0.00 ? 298 PHE A CZ   5  
ATOM   8843  H  H    . PHE B 2 40  ? 5.528   -2.405  5.362   1.00 0.00 ? 298 PHE A H    5  
ATOM   8844  H  HA   . PHE B 2 40  ? 2.793   -2.978  5.142   1.00 0.00 ? 298 PHE A HA   5  
ATOM   8845  H  HB2  . PHE B 2 40  ? 5.229   -4.359  3.974   1.00 0.00 ? 298 PHE A HB2  5  
ATOM   8846  H  HB3  . PHE B 2 40  ? 3.582   -4.876  3.637   1.00 0.00 ? 298 PHE A HB3  5  
ATOM   8847  H  HD1  . PHE B 2 40  ? 3.200   -1.472  3.904   1.00 0.00 ? 298 PHE A HD1  5  
ATOM   8848  H  HD2  . PHE B 2 40  ? 4.997   -4.391  1.402   1.00 0.00 ? 298 PHE A HD2  5  
ATOM   8849  H  HE1  . PHE B 2 40  ? 3.104   0.089   1.999   1.00 0.00 ? 298 PHE A HE1  5  
ATOM   8850  H  HE2  . PHE B 2 40  ? 4.903   -2.835  -0.490  1.00 0.00 ? 298 PHE A HE2  5  
ATOM   8851  H  HZ   . PHE B 2 40  ? 3.980   -0.631  -0.197  1.00 0.00 ? 298 PHE A HZ   5  
ATOM   8852  N  N    . THR B 2 41  ? 2.521   -5.507  5.746   1.00 0.00 ? 299 THR A N    5  
ATOM   8853  C  CA   . THR B 2 41  ? 2.198   -6.748  6.414   1.00 0.00 ? 299 THR A CA   5  
ATOM   8854  C  C    . THR B 2 41  ? 2.697   -7.875  5.529   1.00 0.00 ? 299 THR A C    5  
ATOM   8855  O  O    . THR B 2 41  ? 2.929   -7.656  4.343   1.00 0.00 ? 299 THR A O    5  
ATOM   8856  C  CB   . THR B 2 41  ? 0.690   -6.903  6.646   1.00 0.00 ? 299 THR A CB   5  
ATOM   8857  O  OG1  . THR B 2 41  ? 0.098   -5.635  6.956   1.00 0.00 ? 299 THR A OG1  5  
ATOM   8858  C  CG2  . THR B 2 41  ? 0.442   -7.873  7.776   1.00 0.00 ? 299 THR A CG2  5  
ATOM   8859  H  H    . THR B 2 41  ? 1.994   -5.243  4.963   1.00 0.00 ? 299 THR A H    5  
ATOM   8860  H  HA   . THR B 2 41  ? 2.710   -6.781  7.365   1.00 0.00 ? 299 THR A HA   5  
ATOM   8861  H  HB   . THR B 2 41  ? 0.240   -7.303  5.753   1.00 0.00 ? 299 THR A HB   5  
ATOM   8862  H  HG1  . THR B 2 41  ? 0.070   -5.093  6.164   1.00 0.00 ? 299 THR A HG1  5  
ATOM   8863  H  HG21 . THR B 2 41  ? 0.986   -8.777  7.576   1.00 0.00 ? 299 THR A HG21 5  
ATOM   8864  H  HG22 . THR B 2 41  ? -0.613  -8.089  7.844   1.00 0.00 ? 299 THR A HG22 5  
ATOM   8865  H  HG23 . THR B 2 41  ? 0.786   -7.441  8.705   1.00 0.00 ? 299 THR A HG23 5  
ATOM   8866  N  N    . LEU B 2 42  ? 2.874   -9.067  6.075   1.00 0.00 ? 300 LEU A N    5  
ATOM   8867  C  CA   . LEU B 2 42  ? 3.372   -10.171 5.268   1.00 0.00 ? 300 LEU A CA   5  
ATOM   8868  C  C    . LEU B 2 42  ? 2.620   -10.292 3.954   1.00 0.00 ? 300 LEU A C    5  
ATOM   8869  O  O    . LEU B 2 42  ? 3.210   -10.139 2.892   1.00 0.00 ? 300 LEU A O    5  
ATOM   8870  C  CB   . LEU B 2 42  ? 3.314   -11.480 6.022   1.00 0.00 ? 300 LEU A CB   5  
ATOM   8871  C  CG   . LEU B 2 42  ? 4.603   -12.296 5.955   1.00 0.00 ? 300 LEU A CG   5  
ATOM   8872  C  CD1  . LEU B 2 42  ? 5.029   -12.512 4.515   1.00 0.00 ? 300 LEU A CD1  5  
ATOM   8873  C  CD2  . LEU B 2 42  ? 5.698   -11.594 6.736   1.00 0.00 ? 300 LEU A CD2  5  
ATOM   8874  H  H    . LEU B 2 42  ? 2.672   -9.205  7.024   1.00 0.00 ? 300 LEU A H    5  
ATOM   8875  H  HA   . LEU B 2 42  ? 4.399   -9.970  5.045   1.00 0.00 ? 300 LEU A HA   5  
ATOM   8876  H  HB2  . LEU B 2 42  ? 3.100   -11.262 7.052   1.00 0.00 ? 300 LEU A HB2  5  
ATOM   8877  H  HB3  . LEU B 2 42  ? 2.518   -12.068 5.612   1.00 0.00 ? 300 LEU A HB3  5  
ATOM   8878  H  HG   . LEU B 2 42  ? 4.436   -13.259 6.396   1.00 0.00 ? 300 LEU A HG   5  
ATOM   8879  H  HD11 . LEU B 2 42  ? 4.150   -12.618 3.899   1.00 0.00 ? 300 LEU A HD11 5  
ATOM   8880  H  HD12 . LEU B 2 42  ? 5.628   -13.409 4.445   1.00 0.00 ? 300 LEU A HD12 5  
ATOM   8881  H  HD13 . LEU B 2 42  ? 5.606   -11.665 4.178   1.00 0.00 ? 300 LEU A HD13 5  
ATOM   8882  H  HD21 . LEU B 2 42  ? 5.655   -10.535 6.524   1.00 0.00 ? 300 LEU A HD21 5  
ATOM   8883  H  HD22 . LEU B 2 42  ? 6.661   -11.984 6.438   1.00 0.00 ? 300 LEU A HD22 5  
ATOM   8884  H  HD23 . LEU B 2 42  ? 5.552   -11.757 7.792   1.00 0.00 ? 300 LEU A HD23 5  
ATOM   8885  N  N    . ASN B 2 43  ? 1.320   -10.546 4.022   1.00 0.00 ? 301 ASN A N    5  
ATOM   8886  C  CA   . ASN B 2 43  ? 0.524   -10.689 2.809   1.00 0.00 ? 301 ASN A CA   5  
ATOM   8887  C  C    . ASN B 2 43  ? 0.796   -9.546  1.833   1.00 0.00 ? 301 ASN A C    5  
ATOM   8888  O  O    . ASN B 2 43  ? 1.073   -9.797  0.669   1.00 0.00 ? 301 ASN A O    5  
ATOM   8889  C  CB   . ASN B 2 43  ? -0.957  -10.776 3.139   1.00 0.00 ? 301 ASN A CB   5  
ATOM   8890  C  CG   . ASN B 2 43  ? -1.350  -12.111 3.727   1.00 0.00 ? 301 ASN A CG   5  
ATOM   8891  O  OD1  . ASN B 2 43  ? -0.535  -12.803 4.337   1.00 0.00 ? 301 ASN A OD1  5  
ATOM   8892  N  ND2  . ASN B 2 43  ? -2.612  -12.475 3.550   1.00 0.00 ? 301 ASN A ND2  5  
ATOM   8893  H  H    . ASN B 2 43  ? 0.889   -10.641 4.897   1.00 0.00 ? 301 ASN A H    5  
ATOM   8894  H  HA   . ASN B 2 43  ? 0.832   -11.609 2.341   1.00 0.00 ? 301 ASN A HA   5  
ATOM   8895  H  HB2  . ASN B 2 43  ? -1.193  -10.016 3.852   1.00 0.00 ? 301 ASN A HB2  5  
ATOM   8896  H  HB3  . ASN B 2 43  ? -1.533  -10.617 2.241   1.00 0.00 ? 301 ASN A HB3  5  
ATOM   8897  H  HD21 . ASN B 2 43  ? -3.203  -11.869 3.056   1.00 0.00 ? 301 ASN A HD21 5  
ATOM   8898  H  HD22 . ASN B 2 43  ? -2.901  -13.327 3.922   1.00 0.00 ? 301 ASN A HD22 5  
ATOM   8899  N  N    . MET B 2 44  ? 0.692   -8.296  2.298   1.00 0.00 ? 302 MET A N    5  
ATOM   8900  C  CA   . MET B 2 44  ? 1.001   -7.141  1.443   1.00 0.00 ? 302 MET A CA   5  
ATOM   8901  C  C    . MET B 2 44  ? 2.320   -7.388  0.782   1.00 0.00 ? 302 MET A C    5  
ATOM   8902  O  O    . MET B 2 44  ? 2.410   -7.517  -0.424  1.00 0.00 ? 302 MET A O    5  
ATOM   8903  C  CB   . MET B 2 44  ? 1.134   -5.889  2.275   1.00 0.00 ? 302 MET A CB   5  
ATOM   8904  C  CG   . MET B 2 44  ? 1.459   -4.629  1.494   1.00 0.00 ? 302 MET A CG   5  
ATOM   8905  S  SD   . MET B 2 44  ? 0.095   -4.037  0.500   1.00 0.00 ? 302 MET A SD   5  
ATOM   8906  C  CE   . MET B 2 44  ? 0.537   -2.320  0.374   1.00 0.00 ? 302 MET A CE   5  
ATOM   8907  H  H    . MET B 2 44  ? 0.406   -8.148  3.224   1.00 0.00 ? 302 MET A H    5  
ATOM   8908  H  HA   . MET B 2 44  ? 0.230   -7.007  0.703   1.00 0.00 ? 302 MET A HA   5  
ATOM   8909  H  HB2  . MET B 2 44  ? 0.227   -5.728  2.808   1.00 0.00 ? 302 MET A HB2  5  
ATOM   8910  H  HB3  . MET B 2 44  ? 1.920   -6.048  2.973   1.00 0.00 ? 302 MET A HB3  5  
ATOM   8911  H  HG2  . MET B 2 44  ? 1.709   -3.863  2.202   1.00 0.00 ? 302 MET A HG2  5  
ATOM   8912  H  HG3  . MET B 2 44  ? 2.307   -4.814  0.841   1.00 0.00 ? 302 MET A HG3  5  
ATOM   8913  H  HE1  . MET B 2 44  ? 0.892   -1.991  1.330   1.00 0.00 ? 302 MET A HE1  5  
ATOM   8914  H  HE2  . MET B 2 44  ? -0.328  -1.741  0.088   1.00 0.00 ? 302 MET A HE2  5  
ATOM   8915  H  HE3  . MET B 2 44  ? 1.317   -2.198  -0.364  1.00 0.00 ? 302 MET A HE3  5  
ATOM   8916  N  N    . THR B 2 45  ? 3.336   -7.453  1.624   1.00 0.00 ? 303 THR A N    5  
ATOM   8917  C  CA   . THR B 2 45  ? 4.690   -7.710  1.207   1.00 0.00 ? 303 THR A CA   5  
ATOM   8918  C  C    . THR B 2 45  ? 4.712   -8.687  0.038   1.00 0.00 ? 303 THR A C    5  
ATOM   8919  O  O    . THR B 2 45  ? 5.146   -8.349  -1.059  1.00 0.00 ? 303 THR A O    5  
ATOM   8920  C  CB   . THR B 2 45  ? 5.500   -8.276  2.402   1.00 0.00 ? 303 THR A CB   5  
ATOM   8921  O  OG1  . THR B 2 45  ? 5.450   -7.357  3.499   1.00 0.00 ? 303 THR A OG1  5  
ATOM   8922  C  CG2  . THR B 2 45  ? 6.940   -8.515  2.019   1.00 0.00 ? 303 THR A CG2  5  
ATOM   8923  H  H    . THR B 2 45  ? 3.163   -7.310  2.572   1.00 0.00 ? 303 THR A H    5  
ATOM   8924  H  HA   . THR B 2 45  ? 5.136   -6.773  0.899   1.00 0.00 ? 303 THR A HA   5  
ATOM   8925  H  HB   . THR B 2 45  ? 5.063   -9.221  2.719   1.00 0.00 ? 303 THR A HB   5  
ATOM   8926  H  HG1  . THR B 2 45  ? 5.261   -6.475  3.169   1.00 0.00 ? 303 THR A HG1  5  
ATOM   8927  H  HG21 . THR B 2 45  ? 7.258   -7.724  1.359   1.00 0.00 ? 303 THR A HG21 5  
ATOM   8928  H  HG22 . THR B 2 45  ? 7.028   -9.467  1.517   1.00 0.00 ? 303 THR A HG22 5  
ATOM   8929  H  HG23 . THR B 2 45  ? 7.555   -8.515  2.906   1.00 0.00 ? 303 THR A HG23 5  
ATOM   8930  N  N    . GLU B 2 46  ? 4.182   -9.876  0.272   1.00 0.00 ? 304 GLU A N    5  
ATOM   8931  C  CA   . GLU B 2 46  ? 4.143   -10.931 -0.735  1.00 0.00 ? 304 GLU A CA   5  
ATOM   8932  C  C    . GLU B 2 46  ? 3.316   -10.546 -1.964  1.00 0.00 ? 304 GLU A C    5  
ATOM   8933  O  O    . GLU B 2 46  ? 3.636   -10.940 -3.086  1.00 0.00 ? 304 GLU A O    5  
ATOM   8934  C  CB   . GLU B 2 46  ? 3.544   -12.188 -0.112  1.00 0.00 ? 304 GLU A CB   5  
ATOM   8935  C  CG   . GLU B 2 46  ? 4.109   -12.499 1.257   1.00 0.00 ? 304 GLU A CG   5  
ATOM   8936  C  CD   . GLU B 2 46  ? 3.883   -13.940 1.674   1.00 0.00 ? 304 GLU A CD   5  
ATOM   8937  O  OE1  . GLU B 2 46  ? 2.794   -14.240 2.206   1.00 0.00 ? 304 GLU A OE1  5  
ATOM   8938  O  OE2  . GLU B 2 46  ? 4.796   -14.767 1.469   1.00 0.00 ? 304 GLU A OE2  5  
ATOM   8939  H  H    . GLU B 2 46  ? 3.802   -10.055 1.154   1.00 0.00 ? 304 GLU A H    5  
ATOM   8940  H  HA   . GLU B 2 46  ? 5.158   -11.139 -1.036  1.00 0.00 ? 304 GLU A HA   5  
ATOM   8941  H  HB2  . GLU B 2 46  ? 2.474   -12.049 -0.011  1.00 0.00 ? 304 GLU A HB2  5  
ATOM   8942  H  HB3  . GLU B 2 46  ? 3.734   -13.030 -0.762  1.00 0.00 ? 304 GLU A HB3  5  
ATOM   8943  H  HG2  . GLU B 2 46  ? 5.163   -12.301 1.247   1.00 0.00 ? 304 GLU A HG2  5  
ATOM   8944  H  HG3  . GLU B 2 46  ? 3.636   -11.853 1.978   1.00 0.00 ? 304 GLU A HG3  5  
ATOM   8945  N  N    . ALA B 2 47  ? 2.258   -9.779  -1.742  1.00 0.00 ? 305 ALA A N    5  
ATOM   8946  C  CA   . ALA B 2 47  ? 1.350   -9.374  -2.819  1.00 0.00 ? 305 ALA A CA   5  
ATOM   8947  C  C    . ALA B 2 47  ? 1.888   -8.217  -3.642  1.00 0.00 ? 305 ALA A C    5  
ATOM   8948  O  O    . ALA B 2 47  ? 1.545   -8.071  -4.811  1.00 0.00 ? 305 ALA A O    5  
ATOM   8949  C  CB   . ALA B 2 47  ? -0.008  -8.984  -2.242  1.00 0.00 ? 305 ALA A CB   5  
ATOM   8950  H  H    . ALA B 2 47  ? 2.084   -9.467  -0.826  1.00 0.00 ? 305 ALA A H    5  
ATOM   8951  H  HA   . ALA B 2 47  ? 1.201   -10.225 -3.467  1.00 0.00 ? 305 ALA A HA   5  
ATOM   8952  H  HB1  . ALA B 2 47  ? -0.106  -7.897  -2.236  1.00 0.00 ? 305 ALA A HB1  5  
ATOM   8953  H  HB2  . ALA B 2 47  ? -0.091  -9.358  -1.232  1.00 0.00 ? 305 ALA A HB2  5  
ATOM   8954  H  HB3  . ALA B 2 47  ? -0.793  -9.410  -2.849  1.00 0.00 ? 305 ALA A HB3  5  
ATOM   8955  N  N    . VAL B 2 48  ? 2.744   -7.419  -3.036  1.00 0.00 ? 306 VAL A N    5  
ATOM   8956  C  CA   . VAL B 2 48  ? 3.277   -6.238  -3.682  1.00 0.00 ? 306 VAL A CA   5  
ATOM   8957  C  C    . VAL B 2 48  ? 4.591   -6.492  -4.426  1.00 0.00 ? 306 VAL A C    5  
ATOM   8958  O  O    . VAL B 2 48  ? 4.965   -5.718  -5.308  1.00 0.00 ? 306 VAL A O    5  
ATOM   8959  C  CB   . VAL B 2 48  ? 3.454   -5.114  -2.653  1.00 0.00 ? 306 VAL A CB   5  
ATOM   8960  C  CG1  . VAL B 2 48  ? 2.121   -4.590  -2.194  1.00 0.00 ? 306 VAL A CG1  5  
ATOM   8961  C  CG2  . VAL B 2 48  ? 4.262   -5.557  -1.471  1.00 0.00 ? 306 VAL A CG2  5  
ATOM   8962  H  H    . VAL B 2 48  ? 3.035   -7.636  -2.128  1.00 0.00 ? 306 VAL A H    5  
ATOM   8963  H  HA   . VAL B 2 48  ? 2.542   -5.904  -4.399  1.00 0.00 ? 306 VAL A HA   5  
ATOM   8964  H  HB   . VAL B 2 48  ? 3.977   -4.310  -3.110  1.00 0.00 ? 306 VAL A HB   5  
ATOM   8965  H  HG11 . VAL B 2 48  ? 2.257   -3.583  -1.833  1.00 0.00 ? 306 VAL A HG11 5  
ATOM   8966  H  HG12 . VAL B 2 48  ? 1.736   -5.215  -1.401  1.00 0.00 ? 306 VAL A HG12 5  
ATOM   8967  H  HG13 . VAL B 2 48  ? 1.431   -4.587  -3.023  1.00 0.00 ? 306 VAL A HG13 5  
ATOM   8968  H  HG21 . VAL B 2 48  ? 4.997   -4.800  -1.282  1.00 0.00 ? 306 VAL A HG21 5  
ATOM   8969  H  HG22 . VAL B 2 48  ? 4.748   -6.493  -1.691  1.00 0.00 ? 306 VAL A HG22 5  
ATOM   8970  H  HG23 . VAL B 2 48  ? 3.622   -5.665  -0.606  1.00 0.00 ? 306 VAL A HG23 5  
ATOM   8971  N  N    . LYS B 2 49  ? 5.286   -7.568  -4.078  1.00 0.00 ? 307 LYS A N    5  
ATOM   8972  C  CA   . LYS B 2 49  ? 6.544   -7.911  -4.742  1.00 0.00 ? 307 LYS A CA   5  
ATOM   8973  C  C    . LYS B 2 49  ? 6.286   -8.601  -6.072  1.00 0.00 ? 307 LYS A C    5  
ATOM   8974  O  O    . LYS B 2 49  ? 7.204   -8.811  -6.864  1.00 0.00 ? 307 LYS A O    5  
ATOM   8975  C  CB   . LYS B 2 49  ? 7.365   -8.834  -3.871  1.00 0.00 ? 307 LYS A CB   5  
ATOM   8976  C  CG   . LYS B 2 49  ? 8.079   -8.120  -2.742  1.00 0.00 ? 307 LYS A CG   5  
ATOM   8977  C  CD   . LYS B 2 49  ? 8.540   -9.098  -1.678  1.00 0.00 ? 307 LYS A CD   5  
ATOM   8978  C  CE   . LYS B 2 49  ? 7.377   -9.881  -1.112  1.00 0.00 ? 307 LYS A CE   5  
ATOM   8979  N  NZ   . LYS B 2 49  ? 7.648   -11.344 -1.069  1.00 0.00 ? 307 LYS A NZ   5  
ATOM   8980  H  H    . LYS B 2 49  ? 4.950   -8.145  -3.359  1.00 0.00 ? 307 LYS A H    5  
ATOM   8981  H  HA   . LYS B 2 49  ? 7.106   -7.009  -4.900  1.00 0.00 ? 307 LYS A HA   5  
ATOM   8982  H  HB2  . LYS B 2 49  ? 6.707   -9.568  -3.449  1.00 0.00 ? 307 LYS A HB2  5  
ATOM   8983  H  HB3  . LYS B 2 49  ? 8.100   -9.333  -4.483  1.00 0.00 ? 307 LYS A HB3  5  
ATOM   8984  H  HG2  . LYS B 2 49  ? 8.939   -7.605  -3.144  1.00 0.00 ? 307 LYS A HG2  5  
ATOM   8985  H  HG3  . LYS B 2 49  ? 7.403   -7.406  -2.299  1.00 0.00 ? 307 LYS A HG3  5  
ATOM   8986  H  HD2  . LYS B 2 49  ? 9.244   -9.788  -2.116  1.00 0.00 ? 307 LYS A HD2  5  
ATOM   8987  H  HD3  . LYS B 2 49  ? 9.016   -8.551  -0.878  1.00 0.00 ? 307 LYS A HD3  5  
ATOM   8988  H  HE2  . LYS B 2 49  ? 7.179   -9.528  -0.118  1.00 0.00 ? 307 LYS A HE2  5  
ATOM   8989  H  HE3  . LYS B 2 49  ? 6.508   -9.697  -1.728  1.00 0.00 ? 307 LYS A HE3  5  
ATOM   8990  H  HZ1  . LYS B 2 49  ? 7.801   -11.708 -2.031  1.00 0.00 ? 307 LYS A HZ1  5  
ATOM   8991  H  HZ2  . LYS B 2 49  ? 6.843   -11.845 -0.644  1.00 0.00 ? 307 LYS A HZ2  5  
ATOM   8992  H  HZ3  . LYS B 2 49  ? 8.499   -11.533 -0.499  1.00 0.00 ? 307 LYS A HZ3  5  
ATOM   8993  N  N    . THR B 2 50  ? 5.026   -8.951  -6.311  1.00 0.00 ? 308 THR A N    5  
ATOM   8994  C  CA   . THR B 2 50  ? 4.652   -9.660  -7.527  1.00 0.00 ? 308 THR A CA   5  
ATOM   8995  C  C    . THR B 2 50  ? 3.877   -8.785  -8.501  1.00 0.00 ? 308 THR A C    5  
ATOM   8996  O  O    . THR B 2 50  ? 4.261   -8.654  -9.663  1.00 0.00 ? 308 THR A O    5  
ATOM   8997  C  CB   . THR B 2 50  ? 3.804   -10.897 -7.192  1.00 0.00 ? 308 THR A CB   5  
ATOM   8998  O  OG1  . THR B 2 50  ? 2.471   -10.505 -6.842  1.00 0.00 ? 308 THR A OG1  5  
ATOM   8999  C  CG2  . THR B 2 50  ? 4.433   -11.648 -6.039  1.00 0.00 ? 308 THR A CG2  5  
ATOM   9000  H  H    . THR B 2 50  ? 4.334   -8.726  -5.655  1.00 0.00 ? 308 THR A H    5  
ATOM   9001  H  HA   . THR B 2 50  ? 5.558   -9.999  -7.999  1.00 0.00 ? 308 THR A HA   5  
ATOM   9002  H  HB   . THR B 2 50  ? 3.773   -11.545 -8.056  1.00 0.00 ? 308 THR A HB   5  
ATOM   9003  H  HG1  . THR B 2 50  ? 2.493   -9.976  -6.041  1.00 0.00 ? 308 THR A HG1  5  
ATOM   9004  H  HG21 . THR B 2 50  ? 4.966   -10.943 -5.420  1.00 0.00 ? 308 THR A HG21 5  
ATOM   9005  H  HG22 . THR B 2 50  ? 5.119   -12.390 -6.421  1.00 0.00 ? 308 THR A HG22 5  
ATOM   9006  H  HG23 . THR B 2 50  ? 3.662   -12.130 -5.456  1.00 0.00 ? 308 THR A HG23 5  
ATOM   9007  N  N    . TYR B 2 51  ? 2.785   -8.189  -8.032  1.00 0.00 ? 309 TYR A N    5  
ATOM   9008  C  CA   . TYR B 2 51  ? 1.960   -7.363  -8.900  1.00 0.00 ? 309 TYR A CA   5  
ATOM   9009  C  C    . TYR B 2 51  ? 2.334   -5.882  -8.810  1.00 0.00 ? 309 TYR A C    5  
ATOM   9010  O  O    . TYR B 2 51  ? 3.364   -5.519  -8.241  1.00 0.00 ? 309 TYR A O    5  
ATOM   9011  C  CB   . TYR B 2 51  ? 0.470   -7.608  -8.601  1.00 0.00 ? 309 TYR A CB   5  
ATOM   9012  C  CG   . TYR B 2 51  ? -0.224  -6.559  -7.762  1.00 0.00 ? 309 TYR A CG   5  
ATOM   9013  C  CD1  . TYR B 2 51  ? 0.288   -6.167  -6.540  1.00 0.00 ? 309 TYR A CD1  5  
ATOM   9014  C  CD2  . TYR B 2 51  ? -1.407  -5.974  -8.196  1.00 0.00 ? 309 TYR A CD2  5  
ATOM   9015  C  CE1  . TYR B 2 51  ? -0.350  -5.224  -5.771  1.00 0.00 ? 309 TYR A CE1  5  
ATOM   9016  C  CE2  . TYR B 2 51  ? -2.055  -5.023  -7.432  1.00 0.00 ? 309 TYR A CE2  5  
ATOM   9017  C  CZ   . TYR B 2 51  ? -1.521  -4.651  -6.218  1.00 0.00 ? 309 TYR A CZ   5  
ATOM   9018  O  OH   . TYR B 2 51  ? -2.161  -3.707  -5.447  1.00 0.00 ? 309 TYR A OH   5  
ATOM   9019  H  H    . TYR B 2 51  ? 2.533   -8.307  -7.088  1.00 0.00 ? 309 TYR A H    5  
ATOM   9020  H  HA   . TYR B 2 51  ? 2.154   -7.687  -9.913  1.00 0.00 ? 309 TYR A HA   5  
ATOM   9021  H  HB2  . TYR B 2 51  ? -0.061  -7.667  -9.530  1.00 0.00 ? 309 TYR A HB2  5  
ATOM   9022  H  HB3  . TYR B 2 51  ? 0.373   -8.554  -8.087  1.00 0.00 ? 309 TYR A HB3  5  
ATOM   9023  H  HD1  . TYR B 2 51  ? 1.208   -6.607  -6.193  1.00 0.00 ? 309 TYR A HD1  5  
ATOM   9024  H  HD2  . TYR B 2 51  ? -1.821  -6.270  -9.149  1.00 0.00 ? 309 TYR A HD2  5  
ATOM   9025  H  HE1  . TYR B 2 51  ? 0.068   -4.942  -4.825  1.00 0.00 ? 309 TYR A HE1  5  
ATOM   9026  H  HE2  . TYR B 2 51  ? -2.973  -4.577  -7.785  1.00 0.00 ? 309 TYR A HE2  5  
ATOM   9027  H  HH   . TYR B 2 51  ? -1.519  -3.073  -5.118  1.00 0.00 ? 309 TYR A HH   5  
ATOM   9028  N  N    . LYS B 2 52  ? 1.481   -5.042  -9.379  1.00 0.00 ? 310 LYS A N    5  
ATOM   9029  C  CA   . LYS B 2 52  ? 1.701   -3.605  -9.414  1.00 0.00 ? 310 LYS A CA   5  
ATOM   9030  C  C    . LYS B 2 52  ? 1.400   -2.966  -8.070  1.00 0.00 ? 310 LYS A C    5  
ATOM   9031  O  O    . LYS B 2 52  ? 0.316   -2.413  -7.876  1.00 0.00 ? 310 LYS A O    5  
ATOM   9032  C  CB   . LYS B 2 52  ? 0.817   -2.974  -10.476 1.00 0.00 ? 310 LYS A CB   5  
ATOM   9033  C  CG   . LYS B 2 52  ? 0.527   -3.905  -11.606 1.00 0.00 ? 310 LYS A CG   5  
ATOM   9034  C  CD   . LYS B 2 52  ? 1.314   -3.572  -12.824 1.00 0.00 ? 310 LYS A CD   5  
ATOM   9035  C  CE   . LYS B 2 52  ? 0.760   -2.347  -13.483 1.00 0.00 ? 310 LYS A CE   5  
ATOM   9036  N  NZ   . LYS B 2 52  ? 1.638   -1.839  -14.573 1.00 0.00 ? 310 LYS A NZ   5  
ATOM   9037  H  H    . LYS B 2 52  ? 0.666   -5.400  -9.769  1.00 0.00 ? 310 LYS A H    5  
ATOM   9038  H  HA   . LYS B 2 52  ? 2.718   -3.434  -9.682  1.00 0.00 ? 310 LYS A HA   5  
ATOM   9039  H  HB2  . LYS B 2 52  ? -0.102  -2.684  -10.029 1.00 0.00 ? 310 LYS A HB2  5  
ATOM   9040  H  HB3  . LYS B 2 52  ? 1.302   -2.114  -10.877 1.00 0.00 ? 310 LYS A HB3  5  
ATOM   9041  H  HG2  . LYS B 2 52  ? 0.814   -4.855  -11.296 1.00 0.00 ? 310 LYS A HG2  5  
ATOM   9042  H  HG3  . LYS B 2 52  ? -0.514  -3.874  -11.835 1.00 0.00 ? 310 LYS A HG3  5  
ATOM   9043  H  HD2  . LYS B 2 52  ? 2.311   -3.380  -12.506 1.00 0.00 ? 310 LYS A HD2  5  
ATOM   9044  H  HD3  . LYS B 2 52  ? 1.290   -4.402  -13.514 1.00 0.00 ? 310 LYS A HD3  5  
ATOM   9045  H  HE2  . LYS B 2 52  ? -0.215  -2.576  -13.887 1.00 0.00 ? 310 LYS A HE2  5  
ATOM   9046  H  HE3  . LYS B 2 52  ? 0.671   -1.605  -12.719 1.00 0.00 ? 310 LYS A HE3  5  
ATOM   9047  H  HZ1  . LYS B 2 52  ? 1.191   -1.022  -15.040 1.00 0.00 ? 310 LYS A HZ1  5  
ATOM   9048  H  HZ2  . LYS B 2 52  ? 1.795   -2.584  -15.282 1.00 0.00 ? 310 LYS A HZ2  5  
ATOM   9049  H  HZ3  . LYS B 2 52  ? 2.556   -1.545  -14.187 1.00 0.00 ? 310 LYS A HZ3  5  
ATOM   9050  N  N    . TRP B 2 53  ? 2.340   -3.044  -7.134  1.00 0.00 ? 311 TRP A N    5  
ATOM   9051  C  CA   . TRP B 2 53  ? 2.123   -2.441  -5.829  1.00 0.00 ? 311 TRP A CA   5  
ATOM   9052  C  C    . TRP B 2 53  ? 1.735   -0.985  -6.003  1.00 0.00 ? 311 TRP A C    5  
ATOM   9053  O  O    . TRP B 2 53  ? 0.982   -0.439  -5.202  1.00 0.00 ? 311 TRP A O    5  
ATOM   9054  C  CB   . TRP B 2 53  ? 3.357   -2.582  -4.927  1.00 0.00 ? 311 TRP A CB   5  
ATOM   9055  C  CG   . TRP B 2 53  ? 3.402   -1.585  -3.806  1.00 0.00 ? 311 TRP A CG   5  
ATOM   9056  C  CD1  . TRP B 2 53  ? 2.550   -1.507  -2.751  1.00 0.00 ? 311 TRP A CD1  5  
ATOM   9057  C  CD2  . TRP B 2 53  ? 4.352   -0.531  -3.626  1.00 0.00 ? 311 TRP A CD2  5  
ATOM   9058  N  NE1  . TRP B 2 53  ? 2.900   -0.470  -1.932  1.00 0.00 ? 311 TRP A NE1  5  
ATOM   9059  C  CE2  . TRP B 2 53  ? 4.008   0.142   -2.444  1.00 0.00 ? 311 TRP A CE2  5  
ATOM   9060  C  CE3  . TRP B 2 53  ? 5.456   -0.096  -4.346  1.00 0.00 ? 311 TRP A CE3  5  
ATOM   9061  C  CZ2  . TRP B 2 53  ? 4.731   1.225   -1.963  1.00 0.00 ? 311 TRP A CZ2  5  
ATOM   9062  C  CZ3  . TRP B 2 53  ? 6.179   0.985   -3.869  1.00 0.00 ? 311 TRP A CZ3  5  
ATOM   9063  C  CH2  . TRP B 2 53  ? 5.813   1.633   -2.683  1.00 0.00 ? 311 TRP A CH2  5  
ATOM   9064  H  H    . TRP B 2 53  ? 3.182   -3.510  -7.324  1.00 0.00 ? 311 TRP A H    5  
ATOM   9065  H  HA   . TRP B 2 53  ? 1.295   -2.960  -5.369  1.00 0.00 ? 311 TRP A HA   5  
ATOM   9066  H  HB2  . TRP B 2 53  ? 3.340   -3.560  -4.495  1.00 0.00 ? 311 TRP A HB2  5  
ATOM   9067  H  HB3  . TRP B 2 53  ? 4.258   -2.479  -5.504  1.00 0.00 ? 311 TRP A HB3  5  
ATOM   9068  H  HD1  . TRP B 2 53  ? 1.724   -2.179  -2.594  1.00 0.00 ? 311 TRP A HD1  5  
ATOM   9069  H  HE1  . TRP B 2 53  ? 2.435   -0.213  -1.108  1.00 0.00 ? 311 TRP A HE1  5  
ATOM   9070  H  HE3  . TRP B 2 53  ? 5.746   -0.588  -5.260  1.00 0.00 ? 311 TRP A HE3  5  
ATOM   9071  H  HZ2  . TRP B 2 53  ? 4.465   1.729   -1.050  1.00 0.00 ? 311 TRP A HZ2  5  
ATOM   9072  H  HZ3  . TRP B 2 53  ? 7.041   1.337   -4.411  1.00 0.00 ? 311 TRP A HZ3  5  
ATOM   9073  H  HH2  . TRP B 2 53  ? 6.406   2.469   -2.340  1.00 0.00 ? 311 TRP A HH2  5  
ATOM   9074  N  N    . GLN B 2 54  ? 2.234   -0.376  -7.078  1.00 0.00 ? 312 GLN A N    5  
ATOM   9075  C  CA   . GLN B 2 54  ? 1.933   1.016   -7.386  1.00 0.00 ? 312 GLN A CA   5  
ATOM   9076  C  C    . GLN B 2 54  ? 2.104   1.899   -6.162  1.00 0.00 ? 312 GLN A C    5  
ATOM   9077  O  O    . GLN B 2 54  ? 1.251   1.907   -5.275  1.00 0.00 ? 312 GLN A O    5  
ATOM   9078  C  CB   . GLN B 2 54  ? 0.502   1.141   -7.916  1.00 0.00 ? 312 GLN A CB   5  
ATOM   9079  C  CG   . GLN B 2 54  ? 0.342   0.682   -9.356  1.00 0.00 ? 312 GLN A CG   5  
ATOM   9080  C  CD   . GLN B 2 54  ? -1.066  0.884   -9.884  1.00 0.00 ? 312 GLN A CD   5  
ATOM   9081  O  OE1  . GLN B 2 54  ? -1.541  0.120   -10.726 1.00 0.00 ? 312 GLN A OE1  5  
ATOM   9082  N  NE2  . GLN B 2 54  ? -1.742  1.919   -9.397  1.00 0.00 ? 312 GLN A NE2  5  
ATOM   9083  H  H    . GLN B 2 54  ? 2.821   -0.879  -7.681  1.00 0.00 ? 312 GLN A H    5  
ATOM   9084  H  HA   . GLN B 2 54  ? 2.620   1.344   -8.152  1.00 0.00 ? 312 GLN A HA   5  
ATOM   9085  H  HB2  . GLN B 2 54  ? -0.149  0.542   -7.296  1.00 0.00 ? 312 GLN A HB2  5  
ATOM   9086  H  HB3  . GLN B 2 54  ? 0.192   2.175   -7.851  1.00 0.00 ? 312 GLN A HB3  5  
ATOM   9087  H  HG2  . GLN B 2 54  ? 1.025   1.242   -9.976  1.00 0.00 ? 312 GLN A HG2  5  
ATOM   9088  H  HG3  . GLN B 2 54  ? 0.585   -0.369  -9.414  1.00 0.00 ? 312 GLN A HG3  5  
ATOM   9089  H  HE21 . GLN B 2 54  ? -1.299  2.490   -8.731  1.00 0.00 ? 312 GLN A HE21 5  
ATOM   9090  H  HE22 . GLN B 2 54  ? -2.656  2.071   -9.724  1.00 0.00 ? 312 GLN A HE22 5  
ATOM   9091  N  N    . CYS B 2 55  ? 3.206   2.644   -6.119  1.00 0.00 ? 313 CYS A N    5  
ATOM   9092  C  CA   . CYS B 2 55  ? 3.468   3.534   -5.000  1.00 0.00 ? 313 CYS A CA   5  
ATOM   9093  C  C    . CYS B 2 55  ? 2.191   4.270   -4.630  1.00 0.00 ? 313 CYS A C    5  
ATOM   9094  O  O    . CYS B 2 55  ? 1.290   4.413   -5.456  1.00 0.00 ? 313 CYS A O    5  
ATOM   9095  C  CB   . CYS B 2 55  ? 4.576   4.534   -5.337  1.00 0.00 ? 313 CYS A CB   5  
ATOM   9096  S  SG   . CYS B 2 55  ? 4.017   5.991   -6.276  1.00 0.00 ? 313 CYS A SG   5  
ATOM   9097  H  H    . CYS B 2 55  ? 3.850   2.591   -6.851  1.00 0.00 ? 313 CYS A H    5  
ATOM   9098  H  HA   . CYS B 2 55  ? 3.779   2.929   -4.160  1.00 0.00 ? 313 CYS A HA   5  
ATOM   9099  H  HB2  . CYS B 2 55  ? 5.014   4.892   -4.417  1.00 0.00 ? 313 CYS A HB2  5  
ATOM   9100  H  HB3  . CYS B 2 55  ? 5.336   4.038   -5.914  1.00 0.00 ? 313 CYS A HB3  5  
ATOM   9101  N  N    . ILE B 2 56  ? 2.123   4.745   -3.399  1.00 0.00 ? 314 ILE A N    5  
ATOM   9102  C  CA   . ILE B 2 56  ? 0.948   5.432   -2.919  1.00 0.00 ? 314 ILE A CA   5  
ATOM   9103  C  C    . ILE B 2 56  ? 0.452   6.437   -3.959  1.00 0.00 ? 314 ILE A C    5  
ATOM   9104  O  O    . ILE B 2 56  ? -0.582  6.211   -4.547  1.00 0.00 ? 314 ILE A O    5  
ATOM   9105  C  CB   . ILE B 2 56  ? 1.219   6.057   -1.516  1.00 0.00 ? 314 ILE A CB   5  
ATOM   9106  C  CG1  . ILE B 2 56  ? -0.019  6.132   -0.664  1.00 0.00 ? 314 ILE A CG1  5  
ATOM   9107  C  CG2  . ILE B 2 56  ? 1.723   7.466   -1.589  1.00 0.00 ? 314 ILE A CG2  5  
ATOM   9108  C  CD1  . ILE B 2 56  ? -0.954  4.981   -0.711  1.00 0.00 ? 314 ILE A CD1  5  
ATOM   9109  H  H    . ILE B 2 56  ? 2.897   4.670   -2.816  1.00 0.00 ? 314 ILE A H    5  
ATOM   9110  H  HA   . ILE B 2 56  ? 0.152   4.700   -2.788  1.00 0.00 ? 314 ILE A HA   5  
ATOM   9111  H  HB   . ILE B 2 56  ? 1.943   5.457   -1.013  1.00 0.00 ? 314 ILE A HB   5  
ATOM   9112  H  HG12 . ILE B 2 56  ? 0.249   6.263   0.363   1.00 0.00 ? 314 ILE A HG12 5  
ATOM   9113  H  HG13 . ILE B 2 56  ? -0.559  6.993   -0.984  1.00 0.00 ? 314 ILE A HG13 5  
ATOM   9114  H  HG21 . ILE B 2 56  ? 0.863   8.113   -1.431  1.00 0.00 ? 314 ILE A HG21 5  
ATOM   9115  H  HG22 . ILE B 2 56  ? 2.164   7.656   -2.554  1.00 0.00 ? 314 ILE A HG22 5  
ATOM   9116  H  HG23 . ILE B 2 56  ? 2.452   7.637   -0.810  1.00 0.00 ? 314 ILE A HG23 5  
ATOM   9117  H  HD11 . ILE B 2 56  ? -1.929  5.400   -0.762  1.00 0.00 ? 314 ILE A HD11 5  
ATOM   9118  H  HD12 . ILE B 2 56  ? -0.853  4.392   0.184   1.00 0.00 ? 314 ILE A HD12 5  
ATOM   9119  H  HD13 . ILE B 2 56  ? -0.769  4.371   -1.578  1.00 0.00 ? 314 ILE A HD13 5  
ATOM   9120  N  N    . GLU B 2 57  ? 1.227   7.447   -4.303  1.00 0.00 ? 315 GLU A N    5  
ATOM   9121  C  CA   . GLU B 2 57  ? 0.764   8.469   -5.239  1.00 0.00 ? 315 GLU A CA   5  
ATOM   9122  C  C    . GLU B 2 57  ? -0.045  7.880   -6.403  1.00 0.00 ? 315 GLU A C    5  
ATOM   9123  O  O    . GLU B 2 57  ? -0.958  8.521   -6.925  1.00 0.00 ? 315 GLU A O    5  
ATOM   9124  C  CB   . GLU B 2 57  ? 1.951   9.261   -5.784  1.00 0.00 ? 315 GLU A CB   5  
ATOM   9125  C  CG   . GLU B 2 57  ? 2.841   9.840   -4.699  1.00 0.00 ? 315 GLU A CG   5  
ATOM   9126  C  CD   . GLU B 2 57  ? 4.008   10.630  -5.256  1.00 0.00 ? 315 GLU A CD   5  
ATOM   9127  O  OE1  . GLU B 2 57  ? 3.788   11.772  -5.712  1.00 0.00 ? 315 GLU A OE1  5  
ATOM   9128  O  OE2  . GLU B 2 57  ? 5.142   10.109  -5.234  1.00 0.00 ? 315 GLU A OE2  5  
ATOM   9129  H  H    . GLU B 2 57  ? 2.135   7.490   -3.964  1.00 0.00 ? 315 GLU A H    5  
ATOM   9130  H  HA   . GLU B 2 57  ? 0.126   9.133   -4.678  1.00 0.00 ? 315 GLU A HA   5  
ATOM   9131  H  HB2  . GLU B 2 57  ? 2.552   8.610   -6.402  1.00 0.00 ? 315 GLU A HB2  5  
ATOM   9132  H  HB3  . GLU B 2 57  ? 1.580   10.076  -6.388  1.00 0.00 ? 315 GLU A HB3  5  
ATOM   9133  H  HG2  . GLU B 2 57  ? 2.247   10.491  -4.078  1.00 0.00 ? 315 GLU A HG2  5  
ATOM   9134  H  HG3  . GLU B 2 57  ? 3.226   9.028   -4.098  1.00 0.00 ? 315 GLU A HG3  5  
ATOM   9135  N  N    . CYS B 2 58  ? 0.298   6.660   -6.792  1.00 0.00 ? 316 CYS A N    5  
ATOM   9136  C  CA   . CYS B 2 58  ? -0.379  5.974   -7.904  1.00 0.00 ? 316 CYS A CA   5  
ATOM   9137  C  C    . CYS B 2 58  ? -1.437  4.974   -7.428  1.00 0.00 ? 316 CYS A C    5  
ATOM   9138  O  O    . CYS B 2 58  ? -2.323  4.585   -8.190  1.00 0.00 ? 316 CYS A O    5  
ATOM   9139  C  CB   . CYS B 2 58  ? 0.643   5.234   -8.759  1.00 0.00 ? 316 CYS A CB   5  
ATOM   9140  S  SG   . CYS B 2 58  ? 1.965   6.289   -9.422  1.00 0.00 ? 316 CYS A SG   5  
ATOM   9141  H  H    . CYS B 2 58  ? 1.011   6.198   -6.303  1.00 0.00 ? 316 CYS A H    5  
ATOM   9142  H  HA   . CYS B 2 58  ? -0.860  6.725   -8.512  1.00 0.00 ? 316 CYS A HA   5  
ATOM   9143  H  HB2  . CYS B 2 58  ? 1.109   4.463   -8.163  1.00 0.00 ? 316 CYS A HB2  5  
ATOM   9144  H  HB3  . CYS B 2 58  ? 0.137   4.777   -9.592  1.00 0.00 ? 316 CYS A HB3  5  
ATOM   9145  N  N    . LYS B 2 59  ? -1.322  4.567   -6.172  1.00 0.00 ? 317 LYS A N    5  
ATOM   9146  C  CA   . LYS B 2 59  ? -2.203  3.591   -5.556  1.00 0.00 ? 317 LYS A CA   5  
ATOM   9147  C  C    . LYS B 2 59  ? -3.649  3.682   -6.055  1.00 0.00 ? 317 LYS A C    5  
ATOM   9148  O  O    . LYS B 2 59  ? -4.208  2.684   -6.512  1.00 0.00 ? 317 LYS A O    5  
ATOM   9149  C  CB   . LYS B 2 59  ? -2.117  3.753   -4.026  1.00 0.00 ? 317 LYS A CB   5  
ATOM   9150  C  CG   . LYS B 2 59  ? -3.228  4.539   -3.394  1.00 0.00 ? 317 LYS A CG   5  
ATOM   9151  C  CD   . LYS B 2 59  ? -3.216  6.005   -3.747  1.00 0.00 ? 317 LYS A CD   5  
ATOM   9152  C  CE   . LYS B 2 59  ? -2.279  6.778   -2.871  1.00 0.00 ? 317 LYS A CE   5  
ATOM   9153  N  NZ   . LYS B 2 59  ? -1.761  7.998   -3.567  1.00 0.00 ? 317 LYS A NZ   5  
ATOM   9154  H  H    . LYS B 2 59  ? -0.616  4.942   -5.625  1.00 0.00 ? 317 LYS A H    5  
ATOM   9155  H  HA   . LYS B 2 59  ? -1.825  2.619   -5.810  1.00 0.00 ? 317 LYS A HA   5  
ATOM   9156  H  HB2  . LYS B 2 59  ? -2.129  2.783   -3.574  1.00 0.00 ? 317 LYS A HB2  5  
ATOM   9157  H  HB3  . LYS B 2 59  ? -1.194  4.239   -3.782  1.00 0.00 ? 317 LYS A HB3  5  
ATOM   9158  H  HG2  . LYS B 2 59  ? -4.131  4.125   -3.723  1.00 0.00 ? 317 LYS A HG2  5  
ATOM   9159  H  HG3  . LYS B 2 59  ? -3.152  4.443   -2.330  1.00 0.00 ? 317 LYS A HG3  5  
ATOM   9160  H  HD2  . LYS B 2 59  ? -2.902  6.114   -4.761  1.00 0.00 ? 317 LYS A HD2  5  
ATOM   9161  H  HD3  . LYS B 2 59  ? -4.211  6.396   -3.635  1.00 0.00 ? 317 LYS A HD3  5  
ATOM   9162  H  HE2  . LYS B 2 59  ? -2.794  7.068   -1.972  1.00 0.00 ? 317 LYS A HE2  5  
ATOM   9163  H  HE3  . LYS B 2 59  ? -1.450  6.146   -2.621  1.00 0.00 ? 317 LYS A HE3  5  
ATOM   9164  H  HZ1  . LYS B 2 59  ? -2.387  8.806   -3.396  1.00 0.00 ? 317 LYS A HZ1  5  
ATOM   9165  H  HZ2  . LYS B 2 59  ? -1.709  7.829   -4.591  1.00 0.00 ? 317 LYS A HZ2  5  
ATOM   9166  H  HZ3  . LYS B 2 59  ? -0.809  8.231   -3.218  1.00 0.00 ? 317 LYS A HZ3  5  
ATOM   9167  N  N    . SER B 2 60  ? -4.218  4.883   -6.014  1.00 0.00 ? 318 SER A N    5  
ATOM   9168  C  CA   . SER B 2 60  ? -5.601  5.125   -6.415  1.00 0.00 ? 318 SER A CA   5  
ATOM   9169  C  C    . SER B 2 60  ? -6.524  4.006   -5.990  1.00 0.00 ? 318 SER A C    5  
ATOM   9170  O  O    . SER B 2 60  ? -6.144  3.099   -5.249  1.00 0.00 ? 318 SER A O    5  
ATOM   9171  C  CB   . SER B 2 60  ? -5.693  5.340   -7.912  1.00 0.00 ? 318 SER A CB   5  
ATOM   9172  O  OG   . SER B 2 60  ? -4.810  6.362   -8.343  1.00 0.00 ? 318 SER A OG   5  
ATOM   9173  H  H    . SER B 2 60  ? -3.679  5.639   -5.731  1.00 0.00 ? 318 SER A H    5  
ATOM   9174  H  HA   . SER B 2 60  ? -5.935  6.005   -5.929  1.00 0.00 ? 318 SER A HA   5  
ATOM   9175  H  HB2  . SER B 2 60  ? -5.432  4.430   -8.399  1.00 0.00 ? 318 SER A HB2  5  
ATOM   9176  H  HB3  . SER B 2 60  ? -6.702  5.615   -8.176  1.00 0.00 ? 318 SER A HB3  5  
ATOM   9177  H  HG   . SER B 2 60  ? -4.243  6.023   -9.040  1.00 0.00 ? 318 SER A HG   5  
ATOM   9178  N  N    . CYS B 2 61  ? -7.761  4.103   -6.421  1.00 0.00 ? 319 CYS A N    5  
ATOM   9179  C  CA   . CYS B 2 61  ? -8.723  3.083   -6.108  1.00 0.00 ? 319 CYS A CA   5  
ATOM   9180  C  C    . CYS B 2 61  ? -8.439  1.878   -6.997  1.00 0.00 ? 319 CYS A C    5  
ATOM   9181  O  O    . CYS B 2 61  ? -7.405  1.794   -7.659  1.00 0.00 ? 319 CYS A O    5  
ATOM   9182  C  CB   . CYS B 2 61  ? -10.137 3.595   -6.368  1.00 0.00 ? 319 CYS A CB   5  
ATOM   9183  S  SG   . CYS B 2 61  ? -11.529 2.713   -5.553  1.00 0.00 ? 319 CYS A SG   5  
ATOM   9184  H  H    . CYS B 2 61  ? -8.029  4.875   -6.961  1.00 0.00 ? 319 CYS A H    5  
ATOM   9185  H  HA   . CYS B 2 61  ? -8.620  2.847   -5.069  1.00 0.00 ? 319 CYS A HA   5  
ATOM   9186  H  HB2  . CYS B 2 61  ? -10.187 4.614   -6.039  1.00 0.00 ? 319 CYS A HB2  5  
ATOM   9187  H  HB3  . CYS B 2 61  ? -10.313 3.560   -7.422  1.00 0.00 ? 319 CYS A HB3  5  
ATOM   9188  N  N    . ILE B 2 62  ? -9.357  0.961   -6.978  1.00 0.00 ? 320 ILE A N    5  
ATOM   9189  C  CA   . ILE B 2 62  ? -9.344  -0.225  -7.814  1.00 0.00 ? 320 ILE A CA   5  
ATOM   9190  C  C    . ILE B 2 62  ? -10.785 -0.391  -8.171  1.00 0.00 ? 320 ILE A C    5  
ATOM   9191  O  O    . ILE B 2 62  ? -11.162 -0.974  -9.187  1.00 0.00 ? 320 ILE A O    5  
ATOM   9192  C  CB   . ILE B 2 62  ? -8.805  -1.465  -7.076  1.00 0.00 ? 320 ILE A CB   5  
ATOM   9193  C  CG1  . ILE B 2 62  ? -9.549  -2.751  -7.471  1.00 0.00 ? 320 ILE A CG1  5  
ATOM   9194  C  CG2  . ILE B 2 62  ? -8.936  -1.217  -5.618  1.00 0.00 ? 320 ILE A CG2  5  
ATOM   9195  C  CD1  . ILE B 2 62  ? -9.320  -3.926  -6.537  1.00 0.00 ? 320 ILE A CD1  5  
ATOM   9196  H  H    . ILE B 2 62  ? -10.101 1.074   -6.353  1.00 0.00 ? 320 ILE A H    5  
ATOM   9197  H  HA   . ILE B 2 62  ? -8.758  -0.031  -8.703  1.00 0.00 ? 320 ILE A HA   5  
ATOM   9198  H  HB   . ILE B 2 62  ? -7.760  -1.571  -7.306  1.00 0.00 ? 320 ILE A HB   5  
ATOM   9199  H  HG12 . ILE B 2 62  ? -10.606 -2.552  -7.484  1.00 0.00 ? 320 ILE A HG12 5  
ATOM   9200  H  HG13 . ILE B 2 62  ? -9.232  -3.050  -8.450  1.00 0.00 ? 320 ILE A HG13 5  
ATOM   9201  H  HG21 . ILE B 2 62  ? -9.986  -1.054  -5.388  1.00 0.00 ? 320 ILE A HG21 5  
ATOM   9202  H  HG22 . ILE B 2 62  ? -8.359  -0.346  -5.353  1.00 0.00 ? 320 ILE A HG22 5  
ATOM   9203  H  HG23 . ILE B 2 62  ? -8.573  -2.069  -5.073  1.00 0.00 ? 320 ILE A HG23 5  
ATOM   9204  H  HD11 . ILE B 2 62  ? -8.270  -4.007  -6.303  1.00 0.00 ? 320 ILE A HD11 5  
ATOM   9205  H  HD12 . ILE B 2 62  ? -9.652  -4.835  -7.016  1.00 0.00 ? 320 ILE A HD12 5  
ATOM   9206  H  HD13 . ILE B 2 62  ? -9.881  -3.776  -5.627  1.00 0.00 ? 320 ILE A HD13 5  
ATOM   9207  N  N    . LEU B 2 63  ? -11.587 0.173   -7.270  1.00 0.00 ? 321 LEU A N    5  
ATOM   9208  C  CA   . LEU B 2 63  ? -13.002 0.212   -7.428  1.00 0.00 ? 321 LEU A CA   5  
ATOM   9209  C  C    . LEU B 2 63  ? -13.283 1.328   -8.423  1.00 0.00 ? 321 LEU A C    5  
ATOM   9210  O  O    . LEU B 2 63  ? -14.376 1.453   -8.976  1.00 0.00 ? 321 LEU A O    5  
ATOM   9211  C  CB   . LEU B 2 63  ? -13.663 0.442   -6.062  1.00 0.00 ? 321 LEU A CB   5  
ATOM   9212  C  CG   . LEU B 2 63  ? -13.188 -0.511  -4.945  1.00 0.00 ? 321 LEU A CG   5  
ATOM   9213  C  CD1  . LEU B 2 63  ? -14.344 -0.984  -4.086  1.00 0.00 ? 321 LEU A CD1  5  
ATOM   9214  C  CD2  . LEU B 2 63  ? -12.458 -1.698  -5.521  1.00 0.00 ? 321 LEU A CD2  5  
ATOM   9215  H  H    . LEU B 2 63  ? -11.196 0.560   -6.450  1.00 0.00 ? 321 LEU A H    5  
ATOM   9216  H  HA   . LEU B 2 63  ? -13.311 -0.732  -7.828  1.00 0.00 ? 321 LEU A HA   5  
ATOM   9217  H  HB2  . LEU B 2 63  ? -13.446 1.454   -5.754  1.00 0.00 ? 321 LEU A HB2  5  
ATOM   9218  H  HB3  . LEU B 2 63  ? -14.730 0.338   -6.162  1.00 0.00 ? 321 LEU A HB3  5  
ATOM   9219  H  HG   . LEU B 2 63  ? -12.490 0.017   -4.306  1.00 0.00 ? 321 LEU A HG   5  
ATOM   9220  H  HD11 . LEU B 2 63  ? -14.247 -0.570  -3.088  1.00 0.00 ? 321 LEU A HD11 5  
ATOM   9221  H  HD12 . LEU B 2 63  ? -14.334 -2.062  -4.032  1.00 0.00 ? 321 LEU A HD12 5  
ATOM   9222  H  HD13 . LEU B 2 63  ? -15.274 -0.654  -4.524  1.00 0.00 ? 321 LEU A HD13 5  
ATOM   9223  H  HD21 . LEU B 2 63  ? -11.515 -1.351  -5.905  1.00 0.00 ? 321 LEU A HD21 5  
ATOM   9224  H  HD22 . LEU B 2 63  ? -13.041 -2.132  -6.322  1.00 0.00 ? 321 LEU A HD22 5  
ATOM   9225  H  HD23 . LEU B 2 63  ? -12.291 -2.433  -4.755  1.00 0.00 ? 321 LEU A HD23 5  
ATOM   9226  N  N    . CYS B 2 64  ? -12.234 2.143   -8.627  1.00 0.00 ? 322 CYS A N    5  
ATOM   9227  C  CA   . CYS B 2 64  ? -12.245 3.238   -9.578  1.00 0.00 ? 322 CYS A CA   5  
ATOM   9228  C  C    . CYS B 2 64  ? -10.899 3.321   -10.288 1.00 0.00 ? 322 CYS A C    5  
ATOM   9229  O  O    . CYS B 2 64  ? -10.842 3.583   -11.489 1.00 0.00 ? 322 CYS A O    5  
ATOM   9230  C  CB   . CYS B 2 64  ? -12.510 4.575   -8.898  1.00 0.00 ? 322 CYS A CB   5  
ATOM   9231  S  SG   . CYS B 2 64  ? -13.972 4.611   -7.837  1.00 0.00 ? 322 CYS A SG   5  
ATOM   9232  H  H    . CYS B 2 64  ? -11.425 2.010   -8.095  1.00 0.00 ? 322 CYS A H    5  
ATOM   9233  H  HA   . CYS B 2 64  ? -13.016 3.045   -10.301 1.00 0.00 ? 322 CYS A HA   5  
ATOM   9234  H  HB2  . CYS B 2 64  ? -11.660 4.832   -8.287  1.00 0.00 ? 322 CYS A HB2  5  
ATOM   9235  H  HB3  . CYS B 2 64  ? -12.640 5.331   -9.658  1.00 0.00 ? 322 CYS A HB3  5  
ATOM   9236  N  N    . GLY B 2 65  ? -9.809  3.095   -9.541  1.00 0.00 ? 323 GLY A N    5  
ATOM   9237  C  CA   . GLY B 2 65  ? -8.489  3.187   -10.136 1.00 0.00 ? 323 GLY A CA   5  
ATOM   9238  C  C    . GLY B 2 65  ? -8.255  4.570   -10.698 1.00 0.00 ? 323 GLY A C    5  
ATOM   9239  O  O    . GLY B 2 65  ? -7.591  4.740   -11.721 1.00 0.00 ? 323 GLY A O    5  
ATOM   9240  H  H    . GLY B 2 65  ? -9.903  2.871   -8.582  1.00 0.00 ? 323 GLY A H    5  
ATOM   9241  H  HA2  . GLY B 2 65  ? -7.744  2.977   -9.385  1.00 0.00 ? 323 GLY A HA2  5  
ATOM   9242  H  HA3  . GLY B 2 65  ? -8.406  2.463   -10.933 1.00 0.00 ? 323 GLY A HA3  5  
ATOM   9243  N  N    . THR B 2 66  ? -8.818  5.559   -10.014 1.00 0.00 ? 324 THR A N    5  
ATOM   9244  C  CA   . THR B 2 66  ? -8.721  6.948   -10.433 1.00 0.00 ? 324 THR A CA   5  
ATOM   9245  C  C    . THR B 2 66  ? -8.222  7.843   -9.313  1.00 0.00 ? 324 THR A C    5  
ATOM   9246  O  O    . THR B 2 66  ? -7.846  8.992   -9.550  1.00 0.00 ? 324 THR A O    5  
ATOM   9247  C  CB   . THR B 2 66  ? -10.098 7.460   -10.844 1.00 0.00 ? 324 THR A CB   5  
ATOM   9248  O  OG1  . THR B 2 66  ? -10.010 8.813   -11.306 1.00 0.00 ? 324 THR A OG1  5  
ATOM   9249  C  CG2  . THR B 2 66  ? -11.059 7.376   -9.673  1.00 0.00 ? 324 THR A CG2  5  
ATOM   9250  H  H    . THR B 2 66  ? -9.323  5.345   -9.202  1.00 0.00 ? 324 THR A H    5  
ATOM   9251  H  HA   . THR B 2 66  ? -8.064  7.014   -11.283 1.00 0.00 ? 324 THR A HA   5  
ATOM   9252  H  HB   . THR B 2 66  ? -10.469 6.842   -11.628 1.00 0.00 ? 324 THR A HB   5  
ATOM   9253  H  HG1  . THR B 2 66  ? -10.742 8.998   -11.899 1.00 0.00 ? 324 THR A HG1  5  
ATOM   9254  H  HG21 . THR B 2 66  ? -10.939 6.430   -9.159  1.00 0.00 ? 324 THR A HG21 5  
ATOM   9255  H  HG22 . THR B 2 66  ? -12.074 7.460   -10.033 1.00 0.00 ? 324 THR A HG22 5  
ATOM   9256  H  HG23 . THR B 2 66  ? -10.855 8.181   -8.989  1.00 0.00 ? 324 THR A HG23 5  
ATOM   9257  N  N    . SER B 2 67  ? -8.245  7.312   -8.095  1.00 0.00 ? 325 SER A N    5  
ATOM   9258  C  CA   . SER B 2 67  ? -7.849  8.052   -6.912  1.00 0.00 ? 325 SER A CA   5  
ATOM   9259  C  C    . SER B 2 67  ? -8.958  9.018   -6.511  1.00 0.00 ? 325 SER A C    5  
ATOM   9260  O  O    . SER B 2 67  ? -9.081  9.375   -5.349  1.00 0.00 ? 325 SER A O    5  
ATOM   9261  C  CB   . SER B 2 67  ? -6.531  8.793   -7.139  1.00 0.00 ? 325 SER A CB   5  
ATOM   9262  O  OG   . SER B 2 67  ? -5.898  9.102   -5.909  1.00 0.00 ? 325 SER A OG   5  
ATOM   9263  H  H    . SER B 2 67  ? -8.526  6.383   -7.991  1.00 0.00 ? 325 SER A H    5  
ATOM   9264  H  HA   . SER B 2 67  ? -7.720  7.340   -6.121  1.00 0.00 ? 325 SER A HA   5  
ATOM   9265  H  HB2  . SER B 2 67  ? -5.871  8.171   -7.724  1.00 0.00 ? 325 SER A HB2  5  
ATOM   9266  H  HB3  . SER B 2 67  ? -6.725  9.713   -7.671  1.00 0.00 ? 325 SER A HB3  5  
ATOM   9267  H  HG   . SER B 2 67  ? -5.561  8.296   -5.512  1.00 0.00 ? 325 SER A HG   5  
ATOM   9268  N  N    . GLU B 2 68  ? -9.783  9.382   -7.491  1.00 0.00 ? 326 GLU A N    5  
ATOM   9269  C  CA   . GLU B 2 68  ? -10.908 10.301  -7.311  1.00 0.00 ? 326 GLU A CA   5  
ATOM   9270  C  C    . GLU B 2 68  ? -10.865 11.091  -5.999  1.00 0.00 ? 326 GLU A C    5  
ATOM   9271  O  O    . GLU B 2 68  ? -10.044 11.995  -5.837  1.00 0.00 ? 326 GLU A O    5  
ATOM   9272  C  CB   . GLU B 2 68  ? -12.197 9.527   -7.416  1.00 0.00 ? 326 GLU A CB   5  
ATOM   9273  C  CG   . GLU B 2 68  ? -12.893 9.697   -8.750  1.00 0.00 ? 326 GLU A CG   5  
ATOM   9274  C  CD   . GLU B 2 68  ? -14.133 10.564  -8.662  1.00 0.00 ? 326 GLU A CD   5  
ATOM   9275  O  OE1  . GLU B 2 68  ? -13.997 11.803  -8.733  1.00 0.00 ? 326 GLU A OE1  5  
ATOM   9276  O  OE2  . GLU B 2 68  ? -15.241 10.003  -8.520  1.00 0.00 ? 326 GLU A OE2  5  
ATOM   9277  H  H    . GLU B 2 68  ? -9.650  8.988   -8.374  1.00 0.00 ? 326 GLU A H    5  
ATOM   9278  H  HA   . GLU B 2 68  ? -10.886 10.995  -8.126  1.00 0.00 ? 326 GLU A HA   5  
ATOM   9279  H  HB2  . GLU B 2 68  ? -11.978 8.489   -7.266  1.00 0.00 ? 326 GLU A HB2  5  
ATOM   9280  H  HB3  . GLU B 2 68  ? -12.851 9.853   -6.655  1.00 0.00 ? 326 GLU A HB3  5  
ATOM   9281  H  HG2  . GLU B 2 68  ? -12.201 10.152  -9.435  1.00 0.00 ? 326 GLU A HG2  5  
ATOM   9282  H  HG3  . GLU B 2 68  ? -13.171 8.724   -9.121  1.00 0.00 ? 326 GLU A HG3  5  
ATOM   9283  N  N    . ASN B 2 69  ? -11.759 10.746  -5.065  1.00 0.00 ? 327 ASN A N    5  
ATOM   9284  C  CA   . ASN B 2 69  ? -11.830 11.433  -3.779  1.00 0.00 ? 327 ASN A CA   5  
ATOM   9285  C  C    . ASN B 2 69  ? -10.537 11.281  -3.000  1.00 0.00 ? 327 ASN A C    5  
ATOM   9286  O  O    . ASN B 2 69  ? -10.100 12.210  -2.320  1.00 0.00 ? 327 ASN A O    5  
ATOM   9287  C  CB   . ASN B 2 69  ? -13.001 10.905  -2.945  1.00 0.00 ? 327 ASN A CB   5  
ATOM   9288  C  CG   . ASN B 2 69  ? -14.338 11.354  -3.474  1.00 0.00 ? 327 ASN A CG   5  
ATOM   9289  O  OD1  . ASN B 2 69  ? -15.221 11.754  -2.715  1.00 0.00 ? 327 ASN A OD1  5  
ATOM   9290  N  ND2  . ASN B 2 69  ? -14.502 11.272  -4.784  1.00 0.00 ? 327 ASN A ND2  5  
ATOM   9291  H  H    . ASN B 2 69  ? -12.379 10.012  -5.244  1.00 0.00 ? 327 ASN A H    5  
ATOM   9292  H  HA   . ASN B 2 69  ? -11.996 12.472  -3.974  1.00 0.00 ? 327 ASN A HA   5  
ATOM   9293  H  HB2  . ASN B 2 69  ? -12.986 9.838   -2.959  1.00 0.00 ? 327 ASN A HB2  5  
ATOM   9294  H  HB3  . ASN B 2 69  ? -12.904 11.246  -1.927  1.00 0.00 ? 327 ASN A HB3  5  
ATOM   9295  H  HD21 . ASN B 2 69  ? -13.758 10.935  -5.324  1.00 0.00 ? 327 ASN A HD21 5  
ATOM   9296  H  HD22 . ASN B 2 69  ? -15.359 11.539  -5.154  1.00 0.00 ? 327 ASN A HD22 5  
ATOM   9297  N  N    . ASP B 2 70  ? -9.926  10.102  -3.125  1.00 0.00 ? 328 ASP A N    5  
ATOM   9298  C  CA   . ASP B 2 70  ? -8.688  9.763   -2.420  1.00 0.00 ? 328 ASP A CA   5  
ATOM   9299  C  C    . ASP B 2 70  ? -8.724  10.127  -0.944  1.00 0.00 ? 328 ASP A C    5  
ATOM   9300  O  O    . ASP B 2 70  ? -7.731  9.950   -0.236  1.00 0.00 ? 328 ASP A O    5  
ATOM   9301  C  CB   . ASP B 2 70  ? -7.437  10.352  -3.068  1.00 0.00 ? 328 ASP A CB   5  
ATOM   9302  C  CG   . ASP B 2 70  ? -7.691  11.386  -4.151  1.00 0.00 ? 328 ASP A CG   5  
ATOM   9303  O  OD1  . ASP B 2 70  ? -8.198  12.479  -3.827  1.00 0.00 ? 328 ASP A OD1  5  
ATOM   9304  O  OD2  . ASP B 2 70  ? -7.349  11.115  -5.320  1.00 0.00 ? 328 ASP A OD2  5  
ATOM   9305  H  H    . ASP B 2 70  ? -10.321 9.426   -3.727  1.00 0.00 ? 328 ASP A H    5  
ATOM   9306  H  HA   . ASP B 2 70  ? -8.603  8.694   -2.471  1.00 0.00 ? 328 ASP A HA   5  
ATOM   9307  H  HB2  . ASP B 2 70  ? -6.846  10.824  -2.299  1.00 0.00 ? 328 ASP A HB2  5  
ATOM   9308  H  HB3  . ASP B 2 70  ? -6.867  9.526   -3.493  1.00 0.00 ? 328 ASP A HB3  5  
ATOM   9309  N  N    . ASP B 2 71  ? -9.853  10.628  -0.476  1.00 0.00 ? 329 ASP A N    5  
ATOM   9310  C  CA   . ASP B 2 71  ? -9.998  10.960  0.918   1.00 0.00 ? 329 ASP A CA   5  
ATOM   9311  C  C    . ASP B 2 71  ? -10.752 9.835   1.581   1.00 0.00 ? 329 ASP A C    5  
ATOM   9312  O  O    . ASP B 2 71  ? -10.980 9.828   2.790   1.00 0.00 ? 329 ASP A O    5  
ATOM   9313  C  CB   . ASP B 2 71  ? -10.712 12.288  1.108   1.00 0.00 ? 329 ASP A CB   5  
ATOM   9314  C  CG   . ASP B 2 71  ? -10.902 12.629  2.572   1.00 0.00 ? 329 ASP A CG   5  
ATOM   9315  O  OD1  . ASP B 2 71  ? -9.983  12.341  3.370   1.00 0.00 ? 329 ASP A OD1  5  
ATOM   9316  O  OD2  . ASP B 2 71  ? -11.971 13.173  2.923   1.00 0.00 ? 329 ASP A OD2  5  
ATOM   9317  H  H    . ASP B 2 71  ? -10.609 10.762  -1.079  1.00 0.00 ? 329 ASP A H    5  
ATOM   9318  H  HA   . ASP B 2 71  ? -9.013  11.029  1.342   1.00 0.00 ? 329 ASP A HA   5  
ATOM   9319  H  HB2  . ASP B 2 71  ? -10.114 13.060  0.657   1.00 0.00 ? 329 ASP A HB2  5  
ATOM   9320  H  HB3  . ASP B 2 71  ? -11.680 12.251  0.629   1.00 0.00 ? 329 ASP A HB3  5  
ATOM   9321  N  N    . GLN B 2 72  ? -11.133 8.871   0.748   1.00 0.00 ? 330 GLN A N    5  
ATOM   9322  C  CA   . GLN B 2 72  ? -11.846 7.712   1.195   1.00 0.00 ? 330 GLN A CA   5  
ATOM   9323  C  C    . GLN B 2 72  ? -11.066 6.493   0.773   1.00 0.00 ? 330 GLN A C    5  
ATOM   9324  O  O    . GLN B 2 72  ? -11.121 5.459   1.414   1.00 0.00 ? 330 GLN A O    5  
ATOM   9325  C  CB   . GLN B 2 72  ? -13.246 7.714   0.623   1.00 0.00 ? 330 GLN A CB   5  
ATOM   9326  C  CG   . GLN B 2 72  ? -13.873 9.071   0.777   1.00 0.00 ? 330 GLN A CG   5  
ATOM   9327  C  CD   . GLN B 2 72  ? -15.385 9.054   0.830   1.00 0.00 ? 330 GLN A CD   5  
ATOM   9328  O  OE1  . GLN B 2 72  ? -16.048 9.945   0.299   1.00 0.00 ? 330 GLN A OE1  5  
ATOM   9329  N  NE2  . GLN B 2 72  ? -15.941 8.048   1.498   1.00 0.00 ? 330 GLN A NE2  5  
ATOM   9330  H  H    . GLN B 2 72  ? -10.910 8.938   -0.211  1.00 0.00 ? 330 GLN A H    5  
ATOM   9331  H  HA   . GLN B 2 72  ? -11.912 7.752   2.262   1.00 0.00 ? 330 GLN A HA   5  
ATOM   9332  H  HB2  . GLN B 2 72  ? -13.197 7.470   -0.421  1.00 0.00 ? 330 GLN A HB2  5  
ATOM   9333  H  HB3  . GLN B 2 72  ? -13.854 6.990   1.138   1.00 0.00 ? 330 GLN A HB3  5  
ATOM   9334  H  HG2  . GLN B 2 72  ? -13.508 9.494   1.693   1.00 0.00 ? 330 GLN A HG2  5  
ATOM   9335  H  HG3  . GLN B 2 72  ? -13.546 9.677   -0.045  1.00 0.00 ? 330 GLN A HG3  5  
ATOM   9336  H  HE21 . GLN B 2 72  ? -15.350 7.386   1.913   1.00 0.00 ? 330 GLN A HE21 5  
ATOM   9337  H  HE22 . GLN B 2 72  ? -16.920 8.009   1.547   1.00 0.00 ? 330 GLN A HE22 5  
ATOM   9338  N  N    . LEU B 2 73  ? -10.295 6.632   -0.298  1.00 0.00 ? 331 LEU A N    5  
ATOM   9339  C  CA   . LEU B 2 73  ? -9.491  5.520   -0.765  1.00 0.00 ? 331 LEU A CA   5  
ATOM   9340  C  C    . LEU B 2 73  ? -8.992  4.748   0.428   1.00 0.00 ? 331 LEU A C    5  
ATOM   9341  O  O    . LEU B 2 73  ? -8.467  5.317   1.377   1.00 0.00 ? 331 LEU A O    5  
ATOM   9342  C  CB   . LEU B 2 73  ? -8.319  5.990   -1.599  1.00 0.00 ? 331 LEU A CB   5  
ATOM   9343  C  CG   . LEU B 2 73  ? -8.671  6.440   -3.010  1.00 0.00 ? 331 LEU A CG   5  
ATOM   9344  C  CD1  . LEU B 2 73  ? -7.427  6.836   -3.747  1.00 0.00 ? 331 LEU A CD1  5  
ATOM   9345  C  CD2  . LEU B 2 73  ? -9.373  5.341   -3.749  1.00 0.00 ? 331 LEU A CD2  5  
ATOM   9346  H  H    . LEU B 2 73  ? -10.259 7.494   -0.766  1.00 0.00 ? 331 LEU A H    5  
ATOM   9347  H  HA   . LEU B 2 73  ? -10.116 4.875   -1.365  1.00 0.00 ? 331 LEU A HA   5  
ATOM   9348  H  HB2  . LEU B 2 73  ? -7.858  6.806   -1.082  1.00 0.00 ? 331 LEU A HB2  5  
ATOM   9349  H  HB3  . LEU B 2 73  ? -7.608  5.182   -1.669  1.00 0.00 ? 331 LEU A HB3  5  
ATOM   9350  H  HG   . LEU B 2 73  ? -9.314  7.294   -2.965  1.00 0.00 ? 331 LEU A HG   5  
ATOM   9351  H  HD11 . LEU B 2 73  ? -6.651  6.943   -3.035  1.00 0.00 ? 331 LEU A HD11 5  
ATOM   9352  H  HD12 . LEU B 2 73  ? -7.589  7.775   -4.256  1.00 0.00 ? 331 LEU A HD12 5  
ATOM   9353  H  HD13 . LEU B 2 73  ? -7.166  6.072   -4.461  1.00 0.00 ? 331 LEU A HD13 5  
ATOM   9354  H  HD21 . LEU B 2 73  ? -8.722  4.501   -3.797  1.00 0.00 ? 331 LEU A HD21 5  
ATOM   9355  H  HD22 . LEU B 2 73  ? -9.611  5.671   -4.748  1.00 0.00 ? 331 LEU A HD22 5  
ATOM   9356  H  HD23 . LEU B 2 73  ? -10.279 5.070   -3.228  1.00 0.00 ? 331 LEU A HD23 5  
ATOM   9357  N  N    . LEU B 2 74  ? -9.256  3.476   0.416   1.00 0.00 ? 332 LEU A N    5  
ATOM   9358  C  CA   . LEU B 2 74  ? -8.852  2.604   1.482   1.00 0.00 ? 332 LEU A CA   5  
ATOM   9359  C  C    . LEU B 2 74  ? -7.719  1.741   1.003   1.00 0.00 ? 332 LEU A C    5  
ATOM   9360  O  O    . LEU B 2 74  ? -7.886  0.881   0.145   1.00 0.00 ? 332 LEU A O    5  
ATOM   9361  C  CB   . LEU B 2 74  ? -10.063 1.779   1.887   1.00 0.00 ? 332 LEU A CB   5  
ATOM   9362  C  CG   . LEU B 2 74  ? -10.310 1.528   3.367   1.00 0.00 ? 332 LEU A CG   5  
ATOM   9363  C  CD1  . LEU B 2 74  ? -9.815  2.640   4.267   1.00 0.00 ? 332 LEU A CD1  5  
ATOM   9364  C  CD2  . LEU B 2 74  ? -11.778 1.275   3.559   1.00 0.00 ? 332 LEU A CD2  5  
ATOM   9365  H  H    . LEU B 2 74  ? -9.784  3.111   -0.319  1.00 0.00 ? 332 LEU A H    5  
ATOM   9366  H  HA   . LEU B 2 74  ? -8.499  3.218   2.292   1.00 0.00 ? 332 LEU A HA   5  
ATOM   9367  H  HB2  . LEU B 2 74  ? -10.937 2.274   1.499   1.00 0.00 ? 332 LEU A HB2  5  
ATOM   9368  H  HB3  . LEU B 2 74  ? -9.983  0.822   1.400   1.00 0.00 ? 332 LEU A HB3  5  
ATOM   9369  H  HG   . LEU B 2 74  ? -9.810  0.652   3.659   1.00 0.00 ? 332 LEU A HG   5  
ATOM   9370  H  HD11 . LEU B 2 74  ? -9.991  2.349   5.296   1.00 0.00 ? 332 LEU A HD11 5  
ATOM   9371  H  HD12 . LEU B 2 74  ? -10.340 3.553   4.049   1.00 0.00 ? 332 LEU A HD12 5  
ATOM   9372  H  HD13 . LEU B 2 74  ? -8.757  2.785   4.112   1.00 0.00 ? 332 LEU A HD13 5  
ATOM   9373  H  HD21 . LEU B 2 74  ? -12.071 1.567   4.533   1.00 0.00 ? 332 LEU A HD21 5  
ATOM   9374  H  HD22 . LEU B 2 74  ? -11.984 0.229   3.427   1.00 0.00 ? 332 LEU A HD22 5  
ATOM   9375  H  HD23 . LEU B 2 74  ? -12.338 1.840   2.830   1.00 0.00 ? 332 LEU A HD23 5  
ATOM   9376  N  N    . PHE B 2 75  ? -6.586  1.934   1.621   1.00 0.00 ? 333 PHE A N    5  
ATOM   9377  C  CA   . PHE B 2 75  ? -5.384  1.276   1.195   1.00 0.00 ? 333 PHE A CA   5  
ATOM   9378  C  C    . PHE B 2 75  ? -5.174  -0.040  1.888   1.00 0.00 ? 333 PHE A C    5  
ATOM   9379  O  O    . PHE B 2 75  ? -4.617  -0.109  2.981   1.00 0.00 ? 333 PHE A O    5  
ATOM   9380  C  CB   . PHE B 2 75  ? -4.240  2.249   1.430   1.00 0.00 ? 333 PHE A CB   5  
ATOM   9381  C  CG   . PHE B 2 75  ? -4.665  3.627   1.006   1.00 0.00 ? 333 PHE A CG   5  
ATOM   9382  C  CD1  . PHE B 2 75  ? -5.452  4.407   1.832   1.00 0.00 ? 333 PHE A CD1  5  
ATOM   9383  C  CD2  . PHE B 2 75  ? -4.346  4.103   -0.239  1.00 0.00 ? 333 PHE A CD2  5  
ATOM   9384  C  CE1  . PHE B 2 75  ? -5.901  5.638   1.414   1.00 0.00 ? 333 PHE A CE1  5  
ATOM   9385  C  CE2  . PHE B 2 75  ? -4.802  5.334   -0.678  1.00 0.00 ? 333 PHE A CE2  5  
ATOM   9386  C  CZ   . PHE B 2 75  ? -5.585  6.098   0.159   1.00 0.00 ? 333 PHE A CZ   5  
ATOM   9387  H  H    . PHE B 2 75  ? -6.560  2.511   2.415   1.00 0.00 ? 333 PHE A H    5  
ATOM   9388  H  HA   . PHE B 2 75  ? -5.470  1.097   0.135   1.00 0.00 ? 333 PHE A HA   5  
ATOM   9389  H  HB2  . PHE B 2 75  ? -3.986  2.270   2.478   1.00 0.00 ? 333 PHE A HB2  5  
ATOM   9390  H  HB3  . PHE B 2 75  ? -3.378  1.951   0.846   1.00 0.00 ? 333 PHE A HB3  5  
ATOM   9391  H  HD1  . PHE B 2 75  ? -5.703  4.049   2.819   1.00 0.00 ? 333 PHE A HD1  5  
ATOM   9392  H  HD2  . PHE B 2 75  ? -3.751  3.498   -0.876  1.00 0.00 ? 333 PHE A HD2  5  
ATOM   9393  H  HE1  . PHE B 2 75  ? -6.514  6.239   2.069   1.00 0.00 ? 333 PHE A HE1  5  
ATOM   9394  H  HE2  . PHE B 2 75  ? -4.525  5.705   -1.670  1.00 0.00 ? 333 PHE A HE2  5  
ATOM   9395  H  HZ   . PHE B 2 75  ? -5.971  7.039   -0.174  1.00 0.00 ? 333 PHE A HZ   5  
ATOM   9396  N  N    . CYS B 2 76  ? -5.622  -1.090  1.222   1.00 0.00 ? 334 CYS A N    5  
ATOM   9397  C  CA   . CYS B 2 76  ? -5.453  -2.417  1.742   1.00 0.00 ? 334 CYS A CA   5  
ATOM   9398  C  C    . CYS B 2 76  ? -3.977  -2.712  1.786   1.00 0.00 ? 334 CYS A C    5  
ATOM   9399  O  O    . CYS B 2 76  ? -3.408  -3.104  0.773   1.00 0.00 ? 334 CYS A O    5  
ATOM   9400  C  CB   . CYS B 2 76  ? -6.152  -3.462  0.860   1.00 0.00 ? 334 CYS A CB   5  
ATOM   9401  S  SG   . CYS B 2 76  ? -5.502  -5.150  1.111   1.00 0.00 ? 334 CYS A SG   5  
ATOM   9402  H  H    . CYS B 2 76  ? -6.076  -0.961  0.363   1.00 0.00 ? 334 CYS A H    5  
ATOM   9403  H  HA   . CYS B 2 76  ? -5.859  -2.449  2.738   1.00 0.00 ? 334 CYS A HA   5  
ATOM   9404  H  HB2  . CYS B 2 76  ? -7.206  -3.474  1.095   1.00 0.00 ? 334 CYS A HB2  5  
ATOM   9405  H  HB3  . CYS B 2 76  ? -6.021  -3.204  -0.183  1.00 0.00 ? 334 CYS A HB3  5  
ATOM   9406  N  N    . ASP B 2 77  ? -3.322  -2.505  2.925   1.00 0.00 ? 335 ASP A N    5  
ATOM   9407  C  CA   . ASP B 2 77  ? -1.903  -2.796  2.952   1.00 0.00 ? 335 ASP A CA   5  
ATOM   9408  C  C    . ASP B 2 77  ? -1.686  -4.289  3.083   1.00 0.00 ? 335 ASP A C    5  
ATOM   9409  O  O    . ASP B 2 77  ? -0.912  -4.747  3.921   1.00 0.00 ? 335 ASP A O    5  
ATOM   9410  C  CB   . ASP B 2 77  ? -1.131  -2.041  4.030   1.00 0.00 ? 335 ASP A CB   5  
ATOM   9411  C  CG   . ASP B 2 77  ? -2.027  -1.389  5.061   1.00 0.00 ? 335 ASP A CG   5  
ATOM   9412  O  OD1  . ASP B 2 77  ? -2.810  -2.117  5.707   1.00 0.00 ? 335 ASP A OD1  5  
ATOM   9413  O  OD2  . ASP B 2 77  ? -1.938  -0.154  5.231   1.00 0.00 ? 335 ASP A OD2  5  
ATOM   9414  H  H    . ASP B 2 77  ? -3.793  -2.183  3.734   1.00 0.00 ? 335 ASP A H    5  
ATOM   9415  H  HA   . ASP B 2 77  ? -1.518  -2.486  1.987   1.00 0.00 ? 335 ASP A HA   5  
ATOM   9416  H  HB2  . ASP B 2 77  ? -0.472  -2.734  4.534   1.00 0.00 ? 335 ASP A HB2  5  
ATOM   9417  H  HB3  . ASP B 2 77  ? -0.531  -1.277  3.546   1.00 0.00 ? 335 ASP A HB3  5  
ATOM   9418  N  N    . ASP B 2 78  ? -2.455  -5.038  2.297   1.00 0.00 ? 336 ASP A N    5  
ATOM   9419  C  CA   . ASP B 2 78  ? -2.329  -6.475  2.224   1.00 0.00 ? 336 ASP A CA   5  
ATOM   9420  C  C    . ASP B 2 78  ? -2.030  -6.841  0.772   1.00 0.00 ? 336 ASP A C    5  
ATOM   9421  O  O    . ASP B 2 78  ? -1.921  -8.012  0.408   1.00 0.00 ? 336 ASP A O    5  
ATOM   9422  C  CB   . ASP B 2 78  ? -3.601  -7.164  2.721   1.00 0.00 ? 336 ASP A CB   5  
ATOM   9423  C  CG   . ASP B 2 78  ? -3.376  -8.615  3.091   1.00 0.00 ? 336 ASP A CG   5  
ATOM   9424  O  OD1  . ASP B 2 78  ? -3.520  -9.483  2.205   1.00 0.00 ? 336 ASP A OD1  5  
ATOM   9425  O  OD2  . ASP B 2 78  ? -3.061  -8.884  4.270   1.00 0.00 ? 336 ASP A OD2  5  
ATOM   9426  H  H    . ASP B 2 78  ? -3.156  -4.608  1.774   1.00 0.00 ? 336 ASP A H    5  
ATOM   9427  H  HA   . ASP B 2 78  ? -1.487  -6.756  2.839   1.00 0.00 ? 336 ASP A HA   5  
ATOM   9428  H  HB2  . ASP B 2 78  ? -3.969  -6.644  3.591   1.00 0.00 ? 336 ASP A HB2  5  
ATOM   9429  H  HB3  . ASP B 2 78  ? -4.348  -7.126  1.943   1.00 0.00 ? 336 ASP A HB3  5  
ATOM   9430  N  N    . CYS B 2 79  ? -1.901  -5.788  -0.040  1.00 0.00 ? 337 CYS A N    5  
ATOM   9431  C  CA   . CYS B 2 79  ? -1.568  -5.885  -1.448  1.00 0.00 ? 337 CYS A CA   5  
ATOM   9432  C  C    . CYS B 2 79  ? -1.420  -4.474  -2.025  1.00 0.00 ? 337 CYS A C    5  
ATOM   9433  O  O    . CYS B 2 79  ? -0.655  -4.274  -2.960  1.00 0.00 ? 337 CYS A O    5  
ATOM   9434  C  CB   . CYS B 2 79  ? -2.610  -6.655  -2.243  1.00 0.00 ? 337 CYS A CB   5  
ATOM   9435  S  SG   . CYS B 2 79  ? -4.194  -5.765  -2.421  1.00 0.00 ? 337 CYS A SG   5  
ATOM   9436  H  H    . CYS B 2 79  ? -2.023  -4.899  0.330   1.00 0.00 ? 337 CYS A H    5  
ATOM   9437  H  HA   . CYS B 2 79  ? -0.608  -6.390  -1.503  1.00 0.00 ? 337 CYS A HA   5  
ATOM   9438  H  HB2  . CYS B 2 79  ? -2.219  -6.831  -3.238  1.00 0.00 ? 337 CYS A HB2  5  
ATOM   9439  H  HB3  . CYS B 2 79  ? -2.799  -7.600  -1.760  1.00 0.00 ? 337 CYS A HB3  5  
ATOM   9440  N  N    . ASP B 2 80  ? -2.210  -3.524  -1.466  1.00 0.00 ? 338 ASP A N    5  
ATOM   9441  C  CA   . ASP B 2 80  ? -2.163  -2.085  -1.820  1.00 0.00 ? 338 ASP A CA   5  
ATOM   9442  C  C    . ASP B 2 80  ? -3.423  -1.553  -2.527  1.00 0.00 ? 338 ASP A C    5  
ATOM   9443  O  O    . ASP B 2 80  ? -3.603  -0.338  -2.613  1.00 0.00 ? 338 ASP A O    5  
ATOM   9444  C  CB   . ASP B 2 80  ? -0.923  -1.753  -2.647  1.00 0.00 ? 338 ASP A CB   5  
ATOM   9445  C  CG   . ASP B 2 80  ? -0.858  -0.298  -3.062  1.00 0.00 ? 338 ASP A CG   5  
ATOM   9446  O  OD1  . ASP B 2 80  ? -1.464  0.054   -4.098  1.00 0.00 ? 338 ASP A OD1  5  
ATOM   9447  O  OD2  . ASP B 2 80  ? -0.199  0.491   -2.355  1.00 0.00 ? 338 ASP A OD2  5  
ATOM   9448  H  H    . ASP B 2 80  ? -2.864  -3.809  -0.799  1.00 0.00 ? 338 ASP A H    5  
ATOM   9449  H  HA   . ASP B 2 80  ? -2.079  -1.551  -0.885  1.00 0.00 ? 338 ASP A HA   5  
ATOM   9450  H  HB2  . ASP B 2 80  ? -0.042  -1.976  -2.060  1.00 0.00 ? 338 ASP A HB2  5  
ATOM   9451  H  HB3  . ASP B 2 80  ? -0.922  -2.365  -3.532  1.00 0.00 ? 338 ASP A HB3  5  
ATOM   9452  N  N    . ARG B 2 81  ? -4.297  -2.427  -3.022  1.00 0.00 ? 339 ARG A N    5  
ATOM   9453  C  CA   . ARG B 2 81  ? -5.509  -1.975  -3.710  1.00 0.00 ? 339 ARG A CA   5  
ATOM   9454  C  C    . ARG B 2 81  ? -6.297  -0.937  -2.891  1.00 0.00 ? 339 ARG A C    5  
ATOM   9455  O  O    . ARG B 2 81  ? -6.927  -1.283  -1.892  1.00 0.00 ? 339 ARG A O    5  
ATOM   9456  C  CB   . ARG B 2 81  ? -6.410  -3.176  -4.000  1.00 0.00 ? 339 ARG A CB   5  
ATOM   9457  C  CG   . ARG B 2 81  ? -5.752  -4.239  -4.858  1.00 0.00 ? 339 ARG A CG   5  
ATOM   9458  C  CD   . ARG B 2 81  ? -6.603  -5.495  -4.934  1.00 0.00 ? 339 ARG A CD   5  
ATOM   9459  N  NE   . ARG B 2 81  ? -5.787  -6.706  -4.976  1.00 0.00 ? 339 ARG A NE   5  
ATOM   9460  C  CZ   . ARG B 2 81  ? -5.309  -7.239  -6.097  1.00 0.00 ? 339 ARG A CZ   5  
ATOM   9461  N  NH1  . ARG B 2 81  ? -5.561  -6.667  -7.267  1.00 0.00 ? 339 ARG A NH1  5  
ATOM   9462  N  NH2  . ARG B 2 81  ? -4.578  -8.343  -6.047  1.00 0.00 ? 339 ARG A NH2  5  
ATOM   9463  H  H    . ARG B 2 81  ? -4.129  -3.391  -2.938  1.00 0.00 ? 339 ARG A H    5  
ATOM   9464  H  HA   . ARG B 2 81  ? -5.213  -1.528  -4.646  1.00 0.00 ? 339 ARG A HA   5  
ATOM   9465  H  HB2  . ARG B 2 81  ? -6.699  -3.629  -3.064  1.00 0.00 ? 339 ARG A HB2  5  
ATOM   9466  H  HB3  . ARG B 2 81  ? -7.293  -2.831  -4.509  1.00 0.00 ? 339 ARG A HB3  5  
ATOM   9467  H  HG2  . ARG B 2 81  ? -5.617  -3.848  -5.856  1.00 0.00 ? 339 ARG A HG2  5  
ATOM   9468  H  HG3  . ARG B 2 81  ? -4.791  -4.489  -4.437  1.00 0.00 ? 339 ARG A HG3  5  
ATOM   9469  H  HD2  . ARG B 2 81  ? -7.254  -5.538  -4.075  1.00 0.00 ? 339 ARG A HD2  5  
ATOM   9470  H  HD3  . ARG B 2 81  ? -7.200  -5.447  -5.821  1.00 0.00 ? 339 ARG A HD3  5  
ATOM   9471  H  HE   . ARG B 2 81  ? -5.586  -7.147  -4.124  1.00 0.00 ? 339 ARG A HE   5  
ATOM   9472  H  HH11 . ARG B 2 81  ? -6.113  -5.834  -7.309  1.00 0.00 ? 339 ARG A HH11 5  
ATOM   9473  H  HH12 . ARG B 2 81  ? -5.201  -7.070  -8.108  1.00 0.00 ? 339 ARG A HH12 5  
ATOM   9474  H  HH21 . ARG B 2 81  ? -4.385  -8.776  -5.166  1.00 0.00 ? 339 ARG A HH21 5  
ATOM   9475  H  HH22 . ARG B 2 81  ? -4.218  -8.744  -6.890  1.00 0.00 ? 339 ARG A HH22 5  
ATOM   9476  N  N    . GLY B 2 82  ? -6.261  0.335   -3.319  1.00 0.00 ? 340 GLY A N    5  
ATOM   9477  C  CA   . GLY B 2 82  ? -7.014  1.374   -2.614  1.00 0.00 ? 340 GLY A CA   5  
ATOM   9478  C  C    . GLY B 2 82  ? -8.483  1.319   -2.980  1.00 0.00 ? 340 GLY A C    5  
ATOM   9479  O  O    . GLY B 2 82  ? -8.829  1.060   -4.120  1.00 0.00 ? 340 GLY A O    5  
ATOM   9480  H  H    . GLY B 2 82  ? -5.727  0.566   -4.108  1.00 0.00 ? 340 GLY A H    5  
ATOM   9481  H  HA2  . GLY B 2 82  ? -6.911  1.213   -1.553  1.00 0.00 ? 340 GLY A HA2  5  
ATOM   9482  H  HA3  . GLY B 2 82  ? -6.626  2.357   -2.854  1.00 0.00 ? 340 GLY A HA3  5  
ATOM   9483  N  N    . TYR B 2 83  ? -9.349  1.588   -2.025  1.00 0.00 ? 341 TYR A N    5  
ATOM   9484  C  CA   . TYR B 2 83  ? -10.784 1.517   -2.243  1.00 0.00 ? 341 TYR A CA   5  
ATOM   9485  C  C    . TYR B 2 83  ? -11.453 2.696   -1.607  1.00 0.00 ? 341 TYR A C    5  
ATOM   9486  O  O    . TYR B 2 83  ? -11.567 2.706   -0.387  1.00 0.00 ? 341 TYR A O    5  
ATOM   9487  C  CB   . TYR B 2 83  ? -11.347 0.330   -1.474  1.00 0.00 ? 341 TYR A CB   5  
ATOM   9488  C  CG   . TYR B 2 83  ? -11.283 -1.049  -2.086  1.00 0.00 ? 341 TYR A CG   5  
ATOM   9489  C  CD1  . TYR B 2 83  ? -10.204 -1.439  -2.818  1.00 0.00 ? 341 TYR A CD1  5  
ATOM   9490  C  CD2  . TYR B 2 83  ? -12.282 -1.988  -1.836  1.00 0.00 ? 341 TYR A CD2  5  
ATOM   9491  C  CE1  . TYR B 2 83  ? -10.090 -2.726  -3.306  1.00 0.00 ? 341 TYR A CE1  5  
ATOM   9492  C  CE2  . TYR B 2 83  ? -12.190 -3.275  -2.332  1.00 0.00 ? 341 TYR A CE2  5  
ATOM   9493  C  CZ   . TYR B 2 83  ? -11.083 -3.636  -3.065  1.00 0.00 ? 341 TYR A CZ   5  
ATOM   9494  O  OH   . TYR B 2 83  ? -10.955 -4.915  -3.544  1.00 0.00 ? 341 TYR A OH   5  
ATOM   9495  H  H    . TYR B 2 83  ? -9.023  1.881   -1.149  1.00 0.00 ? 341 TYR A H    5  
ATOM   9496  H  HA   . TYR B 2 83  ? -11.017 1.446   -3.294  1.00 0.00 ? 341 TYR A HA   5  
ATOM   9497  H  HB2  . TYR B 2 83  ? -10.807 0.280   -0.560  1.00 0.00 ? 341 TYR A HB2  5  
ATOM   9498  H  HB3  . TYR B 2 83  ? -12.361 0.540   -1.234  1.00 0.00 ? 341 TYR A HB3  5  
ATOM   9499  H  HD1  . TYR B 2 83  ? -9.447  -0.716  -3.024  1.00 0.00 ? 341 TYR A HD1  5  
ATOM   9500  H  HD2  . TYR B 2 83  ? -13.147 -1.694  -1.259  1.00 0.00 ? 341 TYR A HD2  5  
ATOM   9501  H  HE1  . TYR B 2 83  ? -9.221  -3.007  -3.887  1.00 0.00 ? 341 TYR A HE1  5  
ATOM   9502  H  HE2  . TYR B 2 83  ? -12.978 -3.987  -2.139  1.00 0.00 ? 341 TYR A HE2  5  
ATOM   9503  H  HH   . TYR B 2 83  ? -10.052 -5.213  -3.421  1.00 0.00 ? 341 TYR A HH   5  
ATOM   9504  N  N    . HIS B 2 84  ? -11.955 3.655   -2.357  1.00 0.00 ? 342 HIS A N    5  
ATOM   9505  C  CA   . HIS B 2 84  ? -12.624 4.732   -1.676  1.00 0.00 ? 342 HIS A CA   5  
ATOM   9506  C  C    . HIS B 2 84  ? -13.560 4.043   -0.718  1.00 0.00 ? 342 HIS A C    5  
ATOM   9507  O  O    . HIS B 2 84  ? -14.400 3.272   -1.141  1.00 0.00 ? 342 HIS A O    5  
ATOM   9508  C  CB   . HIS B 2 84  ? -13.392 5.641   -2.607  1.00 0.00 ? 342 HIS A CB   5  
ATOM   9509  C  CG   . HIS B 2 84  ? -12.561 6.369   -3.605  1.00 0.00 ? 342 HIS A CG   5  
ATOM   9510  N  ND1  . HIS B 2 84  ? -12.461 5.960   -4.906  1.00 0.00 ? 342 HIS A ND1  5  
ATOM   9511  C  CD2  . HIS B 2 84  ? -11.788 7.477   -3.495  1.00 0.00 ? 342 HIS A CD2  5  
ATOM   9512  C  CE1  . HIS B 2 84  ? -11.672 6.775   -5.570  1.00 0.00 ? 342 HIS A CE1  5  
ATOM   9513  N  NE2  . HIS B 2 84  ? -11.250 7.714   -4.739  1.00 0.00 ? 342 HIS A NE2  5  
ATOM   9514  H  H    . HIS B 2 84  ? -11.911 3.614   -3.328  1.00 0.00 ? 342 HIS A H    5  
ATOM   9515  H  HA   . HIS B 2 84  ? -11.893 5.297   -1.119  1.00 0.00 ? 342 HIS A HA   5  
ATOM   9516  H  HB2  . HIS B 2 84  ? -14.103 5.057   -3.140  1.00 0.00 ? 342 HIS A HB2  5  
ATOM   9517  H  HB3  . HIS B 2 84  ? -13.908 6.361   -2.019  1.00 0.00 ? 342 HIS A HB3  5  
ATOM   9518  H  HD2  . HIS B 2 84  ? -11.572 8.026   -2.586  1.00 0.00 ? 342 HIS A HD2  5  
ATOM   9519  H  HE1  . HIS B 2 84  ? -11.364 6.653   -6.599  1.00 0.00 ? 342 HIS A HE1  5  
ATOM   9520  H  HE2  . HIS B 2 84  ? -10.799 8.539   -5.010  1.00 0.00 ? 342 HIS A HE2  5  
ATOM   9521  N  N    . MET B 2 85  ? -13.341 4.255   0.561   1.00 0.00 ? 343 MET A N    5  
ATOM   9522  C  CA   . MET B 2 85  ? -14.108 3.602   1.607   1.00 0.00 ? 343 MET A CA   5  
ATOM   9523  C  C    . MET B 2 85  ? -15.597 3.524   1.297   1.00 0.00 ? 343 MET A C    5  
ATOM   9524  O  O    . MET B 2 85  ? -16.332 2.852   2.003   1.00 0.00 ? 343 MET A O    5  
ATOM   9525  C  CB   . MET B 2 85  ? -13.883 4.297   2.927   1.00 0.00 ? 343 MET A CB   5  
ATOM   9526  C  CG   . MET B 2 85  ? -12.471 4.219   3.434   1.00 0.00 ? 343 MET A CG   5  
ATOM   9527  S  SD   . MET B 2 85  ? -11.708 5.803   3.864   1.00 0.00 ? 343 MET A SD   5  
ATOM   9528  C  CE   . MET B 2 85  ? -13.089 6.675   4.564   1.00 0.00 ? 343 MET A CE   5  
ATOM   9529  H  H    . MET B 2 85  ? -12.644 4.883   0.813   1.00 0.00 ? 343 MET A H    5  
ATOM   9530  H  HA   . MET B 2 85  ? -13.732 2.589   1.700   1.00 0.00 ? 343 MET A HA   5  
ATOM   9531  H  HB2  . MET B 2 85  ? -14.158 5.314   2.839   1.00 0.00 ? 343 MET A HB2  5  
ATOM   9532  H  HB3  . MET B 2 85  ? -14.497 3.822   3.647   1.00 0.00 ? 343 MET A HB3  5  
ATOM   9533  H  HG2  . MET B 2 85  ? -12.480 3.609   4.311   1.00 0.00 ? 343 MET A HG2  5  
ATOM   9534  H  HG3  . MET B 2 85  ? -11.879 3.737   2.681   1.00 0.00 ? 343 MET A HG3  5  
ATOM   9535  H  HE1  . MET B 2 85  ? -13.990 6.335   4.086   1.00 0.00 ? 343 MET A HE1  5  
ATOM   9536  H  HE2  . MET B 2 85  ? -12.969 7.736   4.398   1.00 0.00 ? 343 MET A HE2  5  
ATOM   9537  H  HE3  . MET B 2 85  ? -13.142 6.477   5.621   1.00 0.00 ? 343 MET A HE3  5  
ATOM   9538  N  N    . TYR B 2 86  ? -16.046 4.216   0.261   1.00 0.00 ? 344 TYR A N    5  
ATOM   9539  C  CA   . TYR B 2 86  ? -17.444 4.153   -0.126  1.00 0.00 ? 344 TYR A CA   5  
ATOM   9540  C  C    . TYR B 2 86  ? -17.564 3.442   -1.467  1.00 0.00 ? 344 TYR A C    5  
ATOM   9541  O  O    . TYR B 2 86  ? -18.487 3.676   -2.248  1.00 0.00 ? 344 TYR A O    5  
ATOM   9542  C  CB   . TYR B 2 86  ? -18.089 5.541   -0.159  1.00 0.00 ? 344 TYR A CB   5  
ATOM   9543  C  CG   . TYR B 2 86  ? -17.540 6.497   -1.200  1.00 0.00 ? 344 TYR A CG   5  
ATOM   9544  C  CD1  . TYR B 2 86  ? -16.211 6.910   -1.186  1.00 0.00 ? 344 TYR A CD1  5  
ATOM   9545  C  CD2  . TYR B 2 86  ? -18.380 7.029   -2.170  1.00 0.00 ? 344 TYR A CD2  5  
ATOM   9546  C  CE1  . TYR B 2 86  ? -15.739 7.825   -2.112  1.00 0.00 ? 344 TYR A CE1  5  
ATOM   9547  C  CE2  . TYR B 2 86  ? -17.913 7.933   -3.103  1.00 0.00 ? 344 TYR A CE2  5  
ATOM   9548  C  CZ   . TYR B 2 86  ? -16.594 8.330   -3.069  1.00 0.00 ? 344 TYR A CZ   5  
ATOM   9549  O  OH   . TYR B 2 86  ? -16.132 9.237   -3.993  1.00 0.00 ? 344 TYR A OH   5  
ATOM   9550  H  H    . TYR B 2 86  ? -15.424 4.765   -0.260  1.00 0.00 ? 344 TYR A H    5  
ATOM   9551  H  HA   . TYR B 2 86  ? -17.947 3.547   0.621   1.00 0.00 ? 344 TYR A HA   5  
ATOM   9552  H  HB2  . TYR B 2 86  ? -19.144 5.427   -0.351  1.00 0.00 ? 344 TYR A HB2  5  
ATOM   9553  H  HB3  . TYR B 2 86  ? -17.962 6.003   0.810   1.00 0.00 ? 344 TYR A HB3  5  
ATOM   9554  H  HD1  . TYR B 2 86  ? -15.532 6.499   -0.443  1.00 0.00 ? 344 TYR A HD1  5  
ATOM   9555  H  HD2  . TYR B 2 86  ? -19.414 6.718   -2.195  1.00 0.00 ? 344 TYR A HD2  5  
ATOM   9556  H  HE1  . TYR B 2 86  ? -14.700 8.143   -2.079  1.00 0.00 ? 344 TYR A HE1  5  
ATOM   9557  H  HE2  . TYR B 2 86  ? -18.583 8.328   -3.854  1.00 0.00 ? 344 TYR A HE2  5  
ATOM   9558  H  HH   . TYR B 2 86  ? -15.305 8.922   -4.366  1.00 0.00 ? 344 TYR A HH   5  
ATOM   9559  N  N    . CYS B 2 87  ? -16.595 2.567   -1.700  1.00 0.00 ? 345 CYS A N    5  
ATOM   9560  C  CA   . CYS B 2 87  ? -16.520 1.750   -2.903  1.00 0.00 ? 345 CYS A CA   5  
ATOM   9561  C  C    . CYS B 2 87  ? -16.609 0.296   -2.497  1.00 0.00 ? 345 CYS A C    5  
ATOM   9562  O  O    . CYS B 2 87  ? -17.063 -0.561  -3.255  1.00 0.00 ? 345 CYS A O    5  
ATOM   9563  C  CB   . CYS B 2 87  ? -15.221 2.026   -3.704  1.00 0.00 ? 345 CYS A CB   5  
ATOM   9564  S  SG   . CYS B 2 87  ? -15.184 3.708   -4.370  1.00 0.00 ? 345 CYS A SG   5  
ATOM   9565  H  H    . CYS B 2 87  ? -15.908 2.458   -1.019  1.00 0.00 ? 345 CYS A H    5  
ATOM   9566  H  HA   . CYS B 2 87  ? -17.369 1.997   -3.512  1.00 0.00 ? 345 CYS A HA   5  
ATOM   9567  H  HB2  . CYS B 2 87  ? -14.353 1.891   -3.075  1.00 0.00 ? 345 CYS A HB2  5  
ATOM   9568  H  HB3  . CYS B 2 87  ? -15.155 1.340   -4.533  1.00 0.00 ? 345 CYS A HB3  5  
ATOM   9569  N  N    . LEU B 2 88  ? -16.194 0.044   -1.262  1.00 0.00 ? 346 LEU A N    5  
ATOM   9570  C  CA   . LEU B 2 88  ? -16.202 -1.296  -0.696  1.00 0.00 ? 346 LEU A CA   5  
ATOM   9571  C  C    . LEU B 2 88  ? -17.603 -1.877  -0.657  1.00 0.00 ? 346 LEU A C    5  
ATOM   9572  O  O    . LEU B 2 88  ? -18.576 -1.232  -1.047  1.00 0.00 ? 346 LEU A O    5  
ATOM   9573  C  CB   . LEU B 2 88  ? -15.638 -1.293  0.724   1.00 0.00 ? 346 LEU A CB   5  
ATOM   9574  C  CG   . LEU B 2 88  ? -14.999 0.008   1.212   1.00 0.00 ? 346 LEU A CG   5  
ATOM   9575  C  CD1  . LEU B 2 88  ? -14.420 -0.173  2.580   1.00 0.00 ? 346 LEU A CD1  5  
ATOM   9576  C  CD2  . LEU B 2 88  ? -13.920 0.458   0.267   1.00 0.00 ? 346 LEU A CD2  5  
ATOM   9577  H  H    . LEU B 2 88  ? -15.868 0.793   -0.709  1.00 0.00 ? 346 LEU A H    5  
ATOM   9578  H  HA   . LEU B 2 88  ? -15.583 -1.924  -1.302  1.00 0.00 ? 346 LEU A HA   5  
ATOM   9579  H  HB2  . LEU B 2 88  ? -16.440 -1.534  1.382   1.00 0.00 ? 346 LEU A HB2  5  
ATOM   9580  H  HB3  . LEU B 2 88  ? -14.899 -2.073  0.792   1.00 0.00 ? 346 LEU A HB3  5  
ATOM   9581  H  HG   . LEU B 2 88  ? -15.734 0.789   1.279   1.00 0.00 ? 346 LEU A HG   5  
ATOM   9582  H  HD11 . LEU B 2 88  ? -13.645 0.559   2.702   1.00 0.00 ? 346 LEU A HD11 5  
ATOM   9583  H  HD12 . LEU B 2 88  ? -14.007 -1.166  2.675   1.00 0.00 ? 346 LEU A HD12 5  
ATOM   9584  H  HD13 . LEU B 2 88  ? -15.186 -0.020  3.326   1.00 0.00 ? 346 LEU A HD13 5  
ATOM   9585  H  HD21 . LEU B 2 88  ? -14.025 -0.072  -0.669  1.00 0.00 ? 346 LEU A HD21 5  
ATOM   9586  H  HD22 . LEU B 2 88  ? -12.953 0.246   0.697   1.00 0.00 ? 346 LEU A HD22 5  
ATOM   9587  H  HD23 . LEU B 2 88  ? -14.012 1.518   0.092   1.00 0.00 ? 346 LEU A HD23 5  
ATOM   9588  N  N    . ASN B 2 89  ? -17.686 -3.110  -0.181  1.00 0.00 ? 347 ASN A N    5  
ATOM   9589  C  CA   . ASN B 2 89  ? -18.950 -3.794  -0.033  1.00 0.00 ? 347 ASN A CA   5  
ATOM   9590  C  C    . ASN B 2 89  ? -19.550 -3.366  1.274   1.00 0.00 ? 347 ASN A C    5  
ATOM   9591  O  O    . ASN B 2 89  ? -20.756 -3.138  1.373   1.00 0.00 ? 347 ASN A O    5  
ATOM   9592  C  CB   . ASN B 2 89  ? -18.744 -5.295  -0.073  1.00 0.00 ? 347 ASN A CB   5  
ATOM   9593  C  CG   . ASN B 2 89  ? -19.970 -6.044  -0.519  1.00 0.00 ? 347 ASN A CG   5  
ATOM   9594  O  OD1  . ASN B 2 89  ? -21.098 -5.690  -0.175  1.00 0.00 ? 347 ASN A OD1  5  
ATOM   9595  N  ND2  . ASN B 2 89  ? -19.750 -7.083  -1.304  1.00 0.00 ? 347 ASN A ND2  5  
ATOM   9596  H  H    . ASN B 2 89  ? -16.871 -3.565  0.099   1.00 0.00 ? 347 ASN A H    5  
ATOM   9597  H  HA   . ASN B 2 89  ? -19.597 -3.477  -0.822  1.00 0.00 ? 347 ASN A HA   5  
ATOM   9598  H  HB2  . ASN B 2 89  ? -17.949 -5.514  -0.751  1.00 0.00 ? 347 ASN A HB2  5  
ATOM   9599  H  HB3  . ASN B 2 89  ? -18.469 -5.633  0.911   1.00 0.00 ? 347 ASN A HB3  5  
ATOM   9600  H  HD21 . ASN B 2 89  ? -18.823 -7.299  -1.540  1.00 0.00 ? 347 ASN A HD21 5  
ATOM   9601  H  HD22 . ASN B 2 89  ? -20.515 -7.584  -1.622  1.00 0.00 ? 347 ASN A HD22 5  
ATOM   9602  N  N    . PRO B 2 90  ? -18.711 -3.300  2.319   1.00 0.00 ? 348 PRO A N    5  
ATOM   9603  C  CA   . PRO B 2 90  ? -19.081 -2.784  3.589   1.00 0.00 ? 348 PRO A CA   5  
ATOM   9604  C  C    . PRO B 2 90  ? -18.388 -1.431  3.729   1.00 0.00 ? 348 PRO A C    5  
ATOM   9605  O  O    . PRO B 2 90  ? -17.568 -1.226  4.624   1.00 0.00 ? 348 PRO A O    5  
ATOM   9606  C  CB   . PRO B 2 90  ? -18.487 -3.824  4.520   1.00 0.00 ? 348 PRO A CB   5  
ATOM   9607  C  CG   . PRO B 2 90  ? -17.283 -4.338  3.815   1.00 0.00 ? 348 PRO A CG   5  
ATOM   9608  C  CD   . PRO B 2 90  ? -17.340 -3.816  2.407   1.00 0.00 ? 348 PRO A CD   5  
ATOM   9609  H  HA   . PRO B 2 90  ? -20.142 -2.710  3.703   1.00 0.00 ? 348 PRO A HA   5  
ATOM   9610  H  HB2  . PRO B 2 90  ? -18.219 -3.370  5.446   1.00 0.00 ? 348 PRO A HB2  5  
ATOM   9611  H  HB3  . PRO B 2 90  ? -19.207 -4.608  4.681   1.00 0.00 ? 348 PRO A HB3  5  
ATOM   9612  H  HG2  . PRO B 2 90  ? -16.388 -3.990  4.308   1.00 0.00 ? 348 PRO A HG2  5  
ATOM   9613  H  HG3  . PRO B 2 90  ? -17.315 -5.406  3.811   1.00 0.00 ? 348 PRO A HG3  5  
ATOM   9614  H  HD2  . PRO B 2 90  ? -16.615 -3.031  2.262   1.00 0.00 ? 348 PRO A HD2  5  
ATOM   9615  H  HD3  . PRO B 2 90  ? -17.183 -4.614  1.712   1.00 0.00 ? 348 PRO A HD3  5  
ATOM   9616  N  N    . PRO B 2 91  ? -18.725 -0.488  2.821   1.00 0.00 ? 349 PRO A N    5  
ATOM   9617  C  CA   . PRO B 2 91  ? -18.075 0.819   2.736   1.00 0.00 ? 349 PRO A CA   5  
ATOM   9618  C  C    . PRO B 2 91  ? -17.965 1.537   4.074   1.00 0.00 ? 349 PRO A C    5  
ATOM   9619  O  O    . PRO B 2 91  ? -18.940 1.625   4.820   1.00 0.00 ? 349 PRO A O    5  
ATOM   9620  C  CB   . PRO B 2 91  ? -18.956 1.605   1.759   1.00 0.00 ? 349 PRO A CB   5  
ATOM   9621  C  CG   . PRO B 2 91  ? -20.216 0.849   1.671   1.00 0.00 ? 349 PRO A CG   5  
ATOM   9622  C  CD   . PRO B 2 91  ? -19.833 -0.580  1.862   1.00 0.00 ? 349 PRO A CD   5  
ATOM   9623  H  HA   . PRO B 2 91  ? -17.096 0.725   2.300   1.00 0.00 ? 349 PRO A HA   5  
ATOM   9624  H  HB2  . PRO B 2 91  ? -19.116 2.592   2.131   1.00 0.00 ? 349 PRO A HB2  5  
ATOM   9625  H  HB3  . PRO B 2 91  ? -18.474 1.656   0.802   1.00 0.00 ? 349 PRO A HB3  5  
ATOM   9626  H  HG2  . PRO B 2 91  ? -20.883 1.168   2.448   1.00 0.00 ? 349 PRO A HG2  5  
ATOM   9627  H  HG3  . PRO B 2 91  ? -20.662 0.991   0.708   1.00 0.00 ? 349 PRO A HG3  5  
ATOM   9628  H  HD2  . PRO B 2 91  ? -20.661 -1.129  2.274   1.00 0.00 ? 349 PRO A HD2  5  
ATOM   9629  H  HD3  . PRO B 2 91  ? -19.505 -1.027  0.930   1.00 0.00 ? 349 PRO A HD3  5  
ATOM   9630  N  N    . VAL B 2 92  ? -16.768 2.051   4.380   1.00 0.00 ? 350 VAL A N    5  
ATOM   9631  C  CA   . VAL B 2 92  ? -16.550 2.761   5.605   1.00 0.00 ? 350 VAL A CA   5  
ATOM   9632  C  C    . VAL B 2 92  ? -16.572 4.249   5.311   1.00 0.00 ? 350 VAL A C    5  
ATOM   9633  O  O    . VAL B 2 92  ? -16.644 4.662   4.153   1.00 0.00 ? 350 VAL A O    5  
ATOM   9634  C  CB   . VAL B 2 92  ? -15.221 2.332   6.288   1.00 0.00 ? 350 VAL A CB   5  
ATOM   9635  C  CG1  . VAL B 2 92  ? -14.794 0.953   5.817   1.00 0.00 ? 350 VAL A CG1  5  
ATOM   9636  C  CG2  . VAL B 2 92  ? -14.101 3.327   6.059   1.00 0.00 ? 350 VAL A CG2  5  
ATOM   9637  H  H    . VAL B 2 92  ? -16.021 1.972   3.757   1.00 0.00 ? 350 VAL A H    5  
ATOM   9638  H  HA   . VAL B 2 92  ? -17.361 2.529   6.269   1.00 0.00 ? 350 VAL A HA   5  
ATOM   9639  H  HB   . VAL B 2 92  ? -15.393 2.270   7.347   1.00 0.00 ? 350 VAL A HB   5  
ATOM   9640  H  HG11 . VAL B 2 92  ? -14.013 1.056   5.080   1.00 0.00 ? 350 VAL A HG11 5  
ATOM   9641  H  HG12 . VAL B 2 92  ? -15.640 0.442   5.380   1.00 0.00 ? 350 VAL A HG12 5  
ATOM   9642  H  HG13 . VAL B 2 92  ? -14.424 0.385   6.657   1.00 0.00 ? 350 VAL A HG13 5  
ATOM   9643  H  HG21 . VAL B 2 92  ? -13.679 3.611   7.007   1.00 0.00 ? 350 VAL A HG21 5  
ATOM   9644  H  HG22 . VAL B 2 92  ? -14.473 4.203   5.555   1.00 0.00 ? 350 VAL A HG22 5  
ATOM   9645  H  HG23 . VAL B 2 92  ? -13.336 2.865   5.456   1.00 0.00 ? 350 VAL A HG23 5  
ATOM   9646  N  N    . ALA B 2 93  ? -16.516 5.041   6.350   1.00 0.00 ? 351 ALA A N    5  
ATOM   9647  C  CA   . ALA B 2 93  ? -16.539 6.491   6.200   1.00 0.00 ? 351 ALA A CA   5  
ATOM   9648  C  C    . ALA B 2 93  ? -15.250 7.108   6.674   1.00 0.00 ? 351 ALA A C    5  
ATOM   9649  O  O    . ALA B 2 93  ? -14.917 8.245   6.341   1.00 0.00 ? 351 ALA A O    5  
ATOM   9650  C  CB   . ALA B 2 93  ? -17.673 7.085   7.009   1.00 0.00 ? 351 ALA A CB   5  
ATOM   9651  H  H    . ALA B 2 93  ? -16.453 4.642   7.240   1.00 0.00 ? 351 ALA A H    5  
ATOM   9652  H  HA   . ALA B 2 93  ? -16.688 6.724   5.161   1.00 0.00 ? 351 ALA A HA   5  
ATOM   9653  H  HB1  . ALA B 2 93  ? -17.310 7.296   8.013   1.00 0.00 ? 351 ALA A HB1  5  
ATOM   9654  H  HB2  . ALA B 2 93  ? -18.491 6.380   7.058   1.00 0.00 ? 351 ALA A HB2  5  
ATOM   9655  H  HB3  . ALA B 2 93  ? -18.010 8.001   6.547   1.00 0.00 ? 351 ALA A HB3  5  
ATOM   9656  N  N    . GLU B 2 94  ? -14.537 6.335   7.459   1.00 0.00 ? 352 GLU A N    5  
ATOM   9657  C  CA   . GLU B 2 94  ? -13.299 6.775   8.078   1.00 0.00 ? 352 GLU A CA   5  
ATOM   9658  C  C    . GLU B 2 94  ? -12.544 5.578   8.662   1.00 0.00 ? 352 GLU A C    5  
ATOM   9659  O  O    . GLU B 2 94  ? -11.345 5.424   8.437   1.00 0.00 ? 352 GLU A O    5  
ATOM   9660  C  CB   . GLU B 2 94  ? -13.606 7.760   9.216   1.00 0.00 ? 352 GLU A CB   5  
ATOM   9661  C  CG   . GLU B 2 94  ? -15.070 8.128   9.357   1.00 0.00 ? 352 GLU A CG   5  
ATOM   9662  C  CD   . GLU B 2 94  ? -15.347 8.975   10.583  1.00 0.00 ? 352 GLU A CD   5  
ATOM   9663  O  OE1  . GLU B 2 94  ? -15.564 8.397   11.668  1.00 0.00 ? 352 GLU A OE1  5  
ATOM   9664  O  OE2  . GLU B 2 94  ? -15.348 10.218  10.457  1.00 0.00 ? 352 GLU A OE2  5  
ATOM   9665  H  H    . GLU B 2 94  ? -14.844 5.415   7.611   1.00 0.00 ? 352 GLU A H    5  
ATOM   9666  H  HA   . GLU B 2 94  ? -12.695 7.259   7.325   1.00 0.00 ? 352 GLU A HA   5  
ATOM   9667  H  HB2  . GLU B 2 94  ? -13.318 7.296   10.136  1.00 0.00 ? 352 GLU A HB2  5  
ATOM   9668  H  HB3  . GLU B 2 94  ? -13.034 8.664   9.071   1.00 0.00 ? 352 GLU A HB3  5  
ATOM   9669  H  HG2  . GLU B 2 94  ? -15.379 8.676   8.480   1.00 0.00 ? 352 GLU A HG2  5  
ATOM   9670  H  HG3  . GLU B 2 94  ? -15.639 7.208   9.430   1.00 0.00 ? 352 GLU A HG3  5  
ATOM   9671  N  N    . PRO B 2 95  ? -13.259 4.720   9.424   1.00 0.00 ? 353 PRO A N    5  
ATOM   9672  C  CA   . PRO B 2 95  ? -12.757 3.530   10.067  1.00 0.00 ? 353 PRO A CA   5  
ATOM   9673  C  C    . PRO B 2 95  ? -11.277 3.138   9.814   1.00 0.00 ? 353 PRO A C    5  
ATOM   9674  O  O    . PRO B 2 95  ? -10.445 3.455   10.666  1.00 0.00 ? 353 PRO A O    5  
ATOM   9675  C  CB   . PRO B 2 95  ? -13.815 2.575   9.539   1.00 0.00 ? 353 PRO A CB   5  
ATOM   9676  C  CG   . PRO B 2 95  ? -15.077 3.320   9.833   1.00 0.00 ? 353 PRO A CG   5  
ATOM   9677  C  CD   . PRO B 2 95  ? -14.707 4.781   9.728   1.00 0.00 ? 353 PRO A CD   5  
ATOM   9678  H  HA   . PRO B 2 95  ? -12.891 3.609   11.136  1.00 0.00 ? 353 PRO A HA   5  
ATOM   9679  H  HB2  . PRO B 2 95  ? -13.695 2.454   8.484   1.00 0.00 ? 353 PRO A HB2  5  
ATOM   9680  H  HB3  . PRO B 2 95  ? -13.769 1.625   10.034  1.00 0.00 ? 353 PRO A HB3  5  
ATOM   9681  H  HG2  . PRO B 2 95  ? -15.832 3.075   9.105   1.00 0.00 ? 353 PRO A HG2  5  
ATOM   9682  H  HG3  . PRO B 2 95  ? -15.423 3.100   10.823  1.00 0.00 ? 353 PRO A HG3  5  
ATOM   9683  H  HD2  . PRO B 2 95  ? -15.259 5.253   8.945   1.00 0.00 ? 353 PRO A HD2  5  
ATOM   9684  H  HD3  . PRO B 2 95  ? -14.885 5.276   10.660  1.00 0.00 ? 353 PRO A HD3  5  
ATOM   9685  N  N    . PRO B 2 96  ? -10.864 2.471   8.700   1.00 0.00 ? 354 PRO A N    5  
ATOM   9686  C  CA   . PRO B 2 96  ? -9.493  2.065   8.519   1.00 0.00 ? 354 PRO A CA   5  
ATOM   9687  C  C    . PRO B 2 96  ? -8.799  2.814   7.386   1.00 0.00 ? 354 PRO A C    5  
ATOM   9688  O  O    . PRO B 2 96  ? -8.162  2.202   6.528   1.00 0.00 ? 354 PRO A O    5  
ATOM   9689  C  CB   . PRO B 2 96  ? -9.758  0.653   8.105   1.00 0.00 ? 354 PRO A CB   5  
ATOM   9690  C  CG   . PRO B 2 96  ? -10.804 0.835   7.068   1.00 0.00 ? 354 PRO A CG   5  
ATOM   9691  C  CD   . PRO B 2 96  ? -11.615 1.994   7.526   1.00 0.00 ? 354 PRO A CD   5  
ATOM   9692  H  HA   . PRO B 2 96  ? -8.927  2.085   9.419   1.00 0.00 ? 354 PRO A HA   5  
ATOM   9693  H  HB2  . PRO B 2 96  ? -8.861  0.218   7.718   1.00 0.00 ? 354 PRO A HB2  5  
ATOM   9694  H  HB3  . PRO B 2 96  ? -10.131 0.081   8.933   1.00 0.00 ? 354 PRO A HB3  5  
ATOM   9695  H  HG2  . PRO B 2 96  ? -10.352 1.041   6.114   1.00 0.00 ? 354 PRO A HG2  5  
ATOM   9696  H  HG3  . PRO B 2 96  ? -11.426 -0.025  7.006   1.00 0.00 ? 354 PRO A HG3  5  
ATOM   9697  H  HD2  . PRO B 2 96  ? -11.665 2.725   6.754   1.00 0.00 ? 354 PRO A HD2  5  
ATOM   9698  H  HD3  . PRO B 2 96  ? -12.569 1.655   7.786   1.00 0.00 ? 354 PRO A HD3  5  
ATOM   9699  N  N    . GLU B 2 97  ? -8.922  4.128   7.407   1.00 0.00 ? 355 GLU A N    5  
ATOM   9700  C  CA   . GLU B 2 97  ? -8.379  4.998   6.377   1.00 0.00 ? 355 GLU A CA   5  
ATOM   9701  C  C    . GLU B 2 97  ? -6.989  4.595   5.897   1.00 0.00 ? 355 GLU A C    5  
ATOM   9702  O  O    . GLU B 2 97  ? -6.574  4.979   4.803   1.00 0.00 ? 355 GLU A O    5  
ATOM   9703  C  CB   . GLU B 2 97  ? -8.335  6.419   6.911   1.00 0.00 ? 355 GLU A CB   5  
ATOM   9704  C  CG   . GLU B 2 97  ? -7.723  6.482   8.287   1.00 0.00 ? 355 GLU A CG   5  
ATOM   9705  C  CD   . GLU B 2 97  ? -7.283  7.880   8.675   1.00 0.00 ? 355 GLU A CD   5  
ATOM   9706  O  OE1  . GLU B 2 97  ? -6.216  8.320   8.196   1.00 0.00 ? 355 GLU A OE1  5  
ATOM   9707  O  OE2  . GLU B 2 97  ? -8.003  8.534   9.458   1.00 0.00 ? 355 GLU A OE2  5  
ATOM   9708  H  H    . GLU B 2 97  ? -9.382  4.541   8.159   1.00 0.00 ? 355 GLU A H    5  
ATOM   9709  H  HA   . GLU B 2 97  ? -9.052  4.960   5.550   1.00 0.00 ? 355 GLU A HA   5  
ATOM   9710  H  HB2  . GLU B 2 97  ? -7.755  7.036   6.241   1.00 0.00 ? 355 GLU A HB2  5  
ATOM   9711  H  HB3  . GLU B 2 97  ? -9.340  6.803   6.975   1.00 0.00 ? 355 GLU A HB3  5  
ATOM   9712  H  HG2  . GLU B 2 97  ? -8.458  6.138   8.991   1.00 0.00 ? 355 GLU A HG2  5  
ATOM   9713  H  HG3  . GLU B 2 97  ? -6.874  5.823   8.312   1.00 0.00 ? 355 GLU A HG3  5  
ATOM   9714  N  N    . GLY B 2 98  ? -6.273  3.831   6.703   1.00 0.00 ? 356 GLY A N    5  
ATOM   9715  C  CA   . GLY B 2 98  ? -4.933  3.437   6.317   1.00 0.00 ? 356 GLY A CA   5  
ATOM   9716  C  C    . GLY B 2 98  ? -4.739  1.946   6.135   1.00 0.00 ? 356 GLY A C    5  
ATOM   9717  O  O    . GLY B 2 98  ? -4.551  1.474   5.016   1.00 0.00 ? 356 GLY A O    5  
ATOM   9718  H  H    . GLY B 2 98  ? -6.656  3.538   7.552   1.00 0.00 ? 356 GLY A H    5  
ATOM   9719  H  HA2  . GLY B 2 98  ? -4.699  3.923   5.393   1.00 0.00 ? 356 GLY A HA2  5  
ATOM   9720  H  HA3  . GLY B 2 98  ? -4.248  3.782   7.064   1.00 0.00 ? 356 GLY A HA3  5  
ATOM   9721  N  N    . SER B 2 99  ? -4.762  1.213   7.242   1.00 0.00 ? 357 SER A N    5  
ATOM   9722  C  CA   . SER B 2 99  ? -4.567  -0.241  7.217   1.00 0.00 ? 357 SER A CA   5  
ATOM   9723  C  C    . SER B 2 99  ? -5.659  -0.900  6.387   1.00 0.00 ? 357 SER A C    5  
ATOM   9724  O  O    . SER B 2 99  ? -5.776  -0.630  5.193   1.00 0.00 ? 357 SER A O    5  
ATOM   9725  C  CB   . SER B 2 99  ? -4.604  -0.784  8.637   1.00 0.00 ? 357 SER A CB   5  
ATOM   9726  O  OG   . SER B 2 99  ? -4.222  -2.149  8.676   1.00 0.00 ? 357 SER A OG   5  
ATOM   9727  H  H    . SER B 2 99  ? -4.936  1.658   8.096   1.00 0.00 ? 357 SER A H    5  
ATOM   9728  H  HA   . SER B 2 99  ? -3.605  -0.448  6.777   1.00 0.00 ? 357 SER A HA   5  
ATOM   9729  H  HB2  . SER B 2 99  ? -3.935  -0.213  9.262   1.00 0.00 ? 357 SER A HB2  5  
ATOM   9730  H  HB3  . SER B 2 99  ? -5.614  -0.695  9.006   1.00 0.00 ? 357 SER A HB3  5  
ATOM   9731  H  HG   . SER B 2 99  ? -4.958  -2.696  8.394   1.00 0.00 ? 357 SER A HG   5  
ATOM   9732  N  N    . TRP B 2 100 ? -6.439  -1.795  7.011   1.00 0.00 ? 358 TRP A N    5  
ATOM   9733  C  CA   . TRP B 2 100 ? -7.553  -2.417  6.329   1.00 0.00 ? 358 TRP A CA   5  
ATOM   9734  C  C    . TRP B 2 100 ? -7.117  -3.300  5.172   1.00 0.00 ? 358 TRP A C    5  
ATOM   9735  O  O    . TRP B 2 100 ? -6.052  -3.112  4.590   1.00 0.00 ? 358 TRP A O    5  
ATOM   9736  C  CB   . TRP B 2 100 ? -8.413  -1.270  5.853   1.00 0.00 ? 358 TRP A CB   5  
ATOM   9737  C  CG   . TRP B 2 100 ? -9.633  -1.604  5.100   1.00 0.00 ? 358 TRP A CG   5  
ATOM   9738  C  CD1  . TRP B 2 100 ? -10.859 -1.861  5.609   1.00 0.00 ? 358 TRP A CD1  5  
ATOM   9739  C  CD2  . TRP B 2 100 ? -9.762  -1.611  3.699   1.00 0.00 ? 358 TRP A CD2  5  
ATOM   9740  N  NE1  . TRP B 2 100 ? -11.756 -2.052  4.597   1.00 0.00 ? 358 TRP A NE1  5  
ATOM   9741  C  CE2  . TRP B 2 100 ? -11.097 -1.910  3.404   1.00 0.00 ? 358 TRP A CE2  5  
ATOM   9742  C  CE3  . TRP B 2 100 ? -8.865  -1.396  2.664   1.00 0.00 ? 358 TRP A CE3  5  
ATOM   9743  C  CZ2  . TRP B 2 100 ? -11.560 -1.992  2.103   1.00 0.00 ? 358 TRP A CZ2  5  
ATOM   9744  C  CZ3  . TRP B 2 100 ? -9.323  -1.472  1.378   1.00 0.00 ? 358 TRP A CZ3  5  
ATOM   9745  C  CH2  . TRP B 2 100 ? -10.660 -1.766  1.103   1.00 0.00 ? 358 TRP A CH2  5  
ATOM   9746  H  H    . TRP B 2 100 ? -6.265  -2.027  7.933   1.00 0.00 ? 358 TRP A H    5  
ATOM   9747  H  HA   . TRP B 2 100 ? -8.119  -3.006  7.038   1.00 0.00 ? 358 TRP A HA   5  
ATOM   9748  H  HB2  . TRP B 2 100 ? -8.721  -0.723  6.706   1.00 0.00 ? 358 TRP A HB2  5  
ATOM   9749  H  HB3  . TRP B 2 100 ? -7.811  -0.626  5.238   1.00 0.00 ? 358 TRP A HB3  5  
ATOM   9750  H  HD1  . TRP B 2 100 ? -11.077 -1.881  6.663   1.00 0.00 ? 358 TRP A HD1  5  
ATOM   9751  H  HE1  . TRP B 2 100 ? -12.704 -2.253  4.710   1.00 0.00 ? 358 TRP A HE1  5  
ATOM   9752  H  HE3  . TRP B 2 100 ? -7.828  -1.165  2.860   1.00 0.00 ? 358 TRP A HE3  5  
ATOM   9753  H  HZ2  . TRP B 2 100 ? -12.587 -2.206  1.876   1.00 0.00 ? 358 TRP A HZ2  5  
ATOM   9754  H  HZ3  . TRP B 2 100 ? -8.654  -1.274  0.570   1.00 0.00 ? 358 TRP A HZ3  5  
ATOM   9755  H  HH2  . TRP B 2 100 ? -10.974 -1.808  0.076   1.00 0.00 ? 358 TRP A HH2  5  
ATOM   9756  N  N    . SER B 2 101 ? -7.943  -4.289  4.885   1.00 0.00 ? 359 SER A N    5  
ATOM   9757  C  CA   . SER B 2 101 ? -7.701  -5.206  3.782   1.00 0.00 ? 359 SER A CA   5  
ATOM   9758  C  C    . SER B 2 101 ? -8.771  -4.990  2.721   1.00 0.00 ? 359 SER A C    5  
ATOM   9759  O  O    . SER B 2 101 ? -9.857  -4.501  3.024   1.00 0.00 ? 359 SER A O    5  
ATOM   9760  C  CB   . SER B 2 101 ? -7.737  -6.652  4.265   1.00 0.00 ? 359 SER A CB   5  
ATOM   9761  O  OG   . SER B 2 101 ? -7.078  -6.794  5.512   1.00 0.00 ? 359 SER A OG   5  
ATOM   9762  H  H    . SER B 2 101 ? -8.739  -4.410  5.441   1.00 0.00 ? 359 SER A H    5  
ATOM   9763  H  HA   . SER B 2 101 ? -6.729  -4.991  3.364   1.00 0.00 ? 359 SER A HA   5  
ATOM   9764  H  HB2  . SER B 2 101 ? -8.759  -6.954  4.372   1.00 0.00 ? 359 SER A HB2  5  
ATOM   9765  H  HB3  . SER B 2 101 ? -7.252  -7.286  3.540   1.00 0.00 ? 359 SER A HB3  5  
ATOM   9766  H  HG   . SER B 2 101 ? -7.588  -7.377  6.079   1.00 0.00 ? 359 SER A HG   5  
ATOM   9767  N  N    . CYS B 2 102 ? -8.481  -5.368  1.489   1.00 0.00 ? 360 CYS A N    5  
ATOM   9768  C  CA   . CYS B 2 102 ? -9.433  -5.174  0.404   1.00 0.00 ? 360 CYS A CA   5  
ATOM   9769  C  C    . CYS B 2 102 ? -10.321 -6.396  0.229   1.00 0.00 ? 360 CYS A C    5  
ATOM   9770  O  O    . CYS B 2 102 ? -10.295 -7.307  1.056   1.00 0.00 ? 360 CYS A O    5  
ATOM   9771  C  CB   . CYS B 2 102 ? -8.707  -4.854  -0.897  1.00 0.00 ? 360 CYS A CB   5  
ATOM   9772  S  SG   . CYS B 2 102 ? -7.865  -6.278  -1.655  1.00 0.00 ? 360 CYS A SG   5  
ATOM   9773  H  H    . CYS B 2 102 ? -7.626  -5.805  1.311   1.00 0.00 ? 360 CYS A H    5  
ATOM   9774  H  HA   . CYS B 2 102 ? -10.058 -4.333  0.667   1.00 0.00 ? 360 CYS A HA   5  
ATOM   9775  H  HB2  . CYS B 2 102 ? -9.423  -4.478  -1.605  1.00 0.00 ? 360 CYS A HB2  5  
ATOM   9776  H  HB3  . CYS B 2 102 ? -7.965  -4.094  -0.709  1.00 0.00 ? 360 CYS A HB3  5  
ATOM   9777  N  N    . HIS B 2 103 ? -11.104 -6.425  -0.848  1.00 0.00 ? 361 HIS A N    5  
ATOM   9778  C  CA   . HIS B 2 103 ? -11.994 -7.550  -1.079  1.00 0.00 ? 361 HIS A CA   5  
ATOM   9779  C  C    . HIS B 2 103 ? -11.274 -8.704  -1.761  1.00 0.00 ? 361 HIS A C    5  
ATOM   9780  O  O    . HIS B 2 103 ? -11.521 -9.858  -1.442  1.00 0.00 ? 361 HIS A O    5  
ATOM   9781  C  CB   . HIS B 2 103 ? -13.248 -7.132  -1.872  1.00 0.00 ? 361 HIS A CB   5  
ATOM   9782  C  CG   . HIS B 2 103 ? -13.023 -6.825  -3.328  1.00 0.00 ? 361 HIS A CG   5  
ATOM   9783  N  ND1  . HIS B 2 103 ? -13.457 -5.665  -3.939  1.00 0.00 ? 361 HIS A ND1  5  
ATOM   9784  C  CD2  . HIS B 2 103 ? -12.426 -7.544  -4.302  1.00 0.00 ? 361 HIS A CD2  5  
ATOM   9785  C  CE1  . HIS B 2 103 ? -13.130 -5.699  -5.223  1.00 0.00 ? 361 HIS A CE1  5  
ATOM   9786  N  NE2  . HIS B 2 103 ? -12.508 -6.829  -5.462  1.00 0.00 ? 361 HIS A NE2  5  
ATOM   9787  H  H    . HIS B 2 103 ? -11.078 -5.686  -1.491  1.00 0.00 ? 361 HIS A H    5  
ATOM   9788  H  HA   . HIS B 2 103 ? -12.310 -7.894  -0.110  1.00 0.00 ? 361 HIS A HA   5  
ATOM   9789  H  HB2  . HIS B 2 103 ? -13.970 -7.932  -1.821  1.00 0.00 ? 361 HIS A HB2  5  
ATOM   9790  H  HB3  . HIS B 2 103 ? -13.668 -6.253  -1.407  1.00 0.00 ? 361 HIS A HB3  5  
ATOM   9791  H  HD1  . HIS B 2 103 ? -13.933 -4.929  -3.500  1.00 0.00 ? 361 HIS A HD1  5  
ATOM   9792  H  HD2  . HIS B 2 103 ? -11.933 -8.494  -4.178  1.00 0.00 ? 361 HIS A HD2  5  
ATOM   9793  H  HE1  . HIS B 2 103 ? -13.313 -4.928  -5.946  1.00 0.00 ? 361 HIS A HE1  5  
ATOM   9794  H  HE2  . HIS B 2 103 ? -12.083 -7.071  -6.311  1.00 0.00 ? 361 HIS A HE2  5  
ATOM   9795  N  N    . LEU B 2 104 ? -10.369 -8.400  -2.683  1.00 0.00 ? 362 LEU A N    5  
ATOM   9796  C  CA   . LEU B 2 104 ? -9.649  -9.448  -3.390  1.00 0.00 ? 362 LEU A CA   5  
ATOM   9797  C  C    . LEU B 2 104 ? -8.862  -10.302 -2.414  1.00 0.00 ? 362 LEU A C    5  
ATOM   9798  O  O    . LEU B 2 104 ? -8.773  -11.525 -2.556  1.00 0.00 ? 362 LEU A O    5  
ATOM   9799  C  CB   . LEU B 2 104 ? -8.740  -8.836  -4.461  1.00 0.00 ? 362 LEU A CB   5  
ATOM   9800  C  CG   . LEU B 2 104 ? -9.474  -8.249  -5.667  1.00 0.00 ? 362 LEU A CG   5  
ATOM   9801  C  CD1  . LEU B 2 104 ? -8.496  -7.793  -6.711  1.00 0.00 ? 362 LEU A CD1  5  
ATOM   9802  C  CD2  . LEU B 2 104 ? -10.451 -9.250  -6.251  1.00 0.00 ? 362 LEU A CD2  5  
ATOM   9803  H  H    . LEU B 2 104 ? -10.184 -7.457  -2.893  1.00 0.00 ? 362 LEU A H    5  
ATOM   9804  H  HA   . LEU B 2 104 ? -10.378 -10.070 -3.865  1.00 0.00 ? 362 LEU A HA   5  
ATOM   9805  H  HB2  . LEU B 2 104 ? -8.160  -8.048  -4.003  1.00 0.00 ? 362 LEU A HB2  5  
ATOM   9806  H  HB3  . LEU B 2 104 ? -8.064  -9.591  -4.820  1.00 0.00 ? 362 LEU A HB3  5  
ATOM   9807  H  HG   . LEU B 2 104 ? -10.033 -7.386  -5.346  1.00 0.00 ? 362 LEU A HG   5  
ATOM   9808  H  HD11 . LEU B 2 104 ? -7.919  -6.996  -6.299  1.00 0.00 ? 362 LEU A HD11 5  
ATOM   9809  H  HD12 . LEU B 2 104 ? -9.029  -7.445  -7.584  1.00 0.00 ? 362 LEU A HD12 5  
ATOM   9810  H  HD13 . LEU B 2 104 ? -7.844  -8.610  -6.984  1.00 0.00 ? 362 LEU A HD13 5  
ATOM   9811  H  HD21 . LEU B 2 104 ? -11.310 -9.308  -5.606  1.00 0.00 ? 362 LEU A HD21 5  
ATOM   9812  H  HD22 . LEU B 2 104 ? -9.980  -10.219 -6.317  1.00 0.00 ? 362 LEU A HD22 5  
ATOM   9813  H  HD23 . LEU B 2 104 ? -10.756 -8.926  -7.234  1.00 0.00 ? 362 LEU A HD23 5  
ATOM   9814  N  N    . CYS B 2 105 ? -8.354  -9.653  -1.389  1.00 0.00 ? 363 CYS A N    5  
ATOM   9815  C  CA   . CYS B 2 105 ? -7.569  -10.334 -0.367  1.00 0.00 ? 363 CYS A CA   5  
ATOM   9816  C  C    . CYS B 2 105 ? -8.450  -11.134 0.526   1.00 0.00 ? 363 CYS A C    5  
ATOM   9817  O  O    . CYS B 2 105 ? -8.030  -12.120 1.115   1.00 0.00 ? 363 CYS A O    5  
ATOM   9818  C  CB   . CYS B 2 105 ? -6.811  -9.347  0.498   1.00 0.00 ? 363 CYS A CB   5  
ATOM   9819  S  SG   . CYS B 2 105 ? -5.303  -8.666  -0.259  1.00 0.00 ? 363 CYS A SG   5  
ATOM   9820  H  H    . CYS B 2 105 ? -8.545  -8.698  -1.299  1.00 0.00 ? 363 CYS A H    5  
ATOM   9821  H  HA   . CYS B 2 105 ? -6.889  -10.992 -0.844  1.00 0.00 ? 363 CYS A HA   5  
ATOM   9822  H  HB2  . CYS B 2 105 ? -7.461  -8.523  0.722   1.00 0.00 ? 363 CYS A HB2  5  
ATOM   9823  H  HB3  . CYS B 2 105 ? -6.541  -9.839  1.421   1.00 0.00 ? 363 CYS A HB3  5  
ATOM   9824  N  N    . TRP B 2 106 ? -9.667  -10.687 0.619   1.00 0.00 ? 364 TRP A N    5  
ATOM   9825  C  CA   . TRP B 2 106 ? -10.635 -11.307 1.466   1.00 0.00 ? 364 TRP A CA   5  
ATOM   9826  C  C    . TRP B 2 106 ? -11.239 -12.518 0.863   1.00 0.00 ? 364 TRP A C    5  
ATOM   9827  O  O    . TRP B 2 106 ? -11.284 -13.563 1.477   1.00 0.00 ? 364 TRP A O    5  
ATOM   9828  C  CB   . TRP B 2 106 ? -11.695 -10.318 1.784   1.00 0.00 ? 364 TRP A CB   5  
ATOM   9829  C  CG   . TRP B 2 106 ? -11.601 -9.944  3.173   1.00 0.00 ? 364 TRP A CG   5  
ATOM   9830  C  CD1  . TRP B 2 106 ? -10.472 -9.631  3.815   1.00 0.00 ? 364 TRP A CD1  5  
ATOM   9831  C  CD2  . TRP B 2 106 ? -12.647 -9.886  4.085   1.00 0.00 ? 364 TRP A CD2  5  
ATOM   9832  N  NE1  . TRP B 2 106 ? -10.735 -9.357  5.112   1.00 0.00 ? 364 TRP A NE1  5  
ATOM   9833  C  CE2  . TRP B 2 106 ? -12.101 -9.508  5.314   1.00 0.00 ? 364 TRP A CE2  5  
ATOM   9834  C  CE3  . TRP B 2 106 ? -14.000 -10.118 3.963   1.00 0.00 ? 364 TRP A CE3  5  
ATOM   9835  C  CZ2  . TRP B 2 106 ? -12.896 -9.359  6.441   1.00 0.00 ? 364 TRP A CZ2  5  
ATOM   9836  C  CZ3  . TRP B 2 106 ? -14.795 -9.970  5.078   1.00 0.00 ? 364 TRP A CZ3  5  
ATOM   9837  C  CH2  . TRP B 2 106 ? -14.240 -9.593  6.307   1.00 0.00 ? 364 TRP A CH2  5  
ATOM   9838  H  H    . TRP B 2 106 ? -9.925  -9.904  0.099   1.00 0.00 ? 364 TRP A H    5  
ATOM   9839  H  HA   . TRP B 2 106 ? -10.140 -11.587 2.385   1.00 0.00 ? 364 TRP A HA   5  
ATOM   9840  H  HB2  . TRP B 2 106 ? -11.539 -9.444  1.197   1.00 0.00 ? 364 TRP A HB2  5  
ATOM   9841  H  HB3  . TRP B 2 106 ? -12.671 -10.734 1.597   1.00 0.00 ? 364 TRP A HB3  5  
ATOM   9842  H  HD1  . TRP B 2 106 ? -9.509  -9.616  3.340   1.00 0.00 ? 364 TRP A HD1  5  
ATOM   9843  H  HE1  . TRP B 2 106 ? -10.065 -9.098  5.766   1.00 0.00 ? 364 TRP A HE1  5  
ATOM   9844  H  HE3  . TRP B 2 106 ? -14.419 -10.417 2.999   1.00 0.00 ? 364 TRP A HE3  5  
ATOM   9845  H  HZ2  . TRP B 2 106 ? -12.491 -9.080  7.385   1.00 0.00 ? 364 TRP A HZ2  5  
ATOM   9846  H  HZ3  . TRP B 2 106 ? -15.855 -10.144 5.014   1.00 0.00 ? 364 TRP A HZ3  5  
ATOM   9847  H  HH2  . TRP B 2 106 ? -14.894 -9.489  7.158   1.00 0.00 ? 364 TRP A HH2  5  
ATOM   9848  N  N    . GLU B 2 107 ? -11.737 -12.381 -0.323  1.00 0.00 ? 365 GLU A N    5  
ATOM   9849  C  CA   . GLU B 2 107 ? -12.312 -13.492 -0.975  1.00 0.00 ? 365 GLU A CA   5  
ATOM   9850  C  C    . GLU B 2 107 ? -11.241 -14.559 -1.058  1.00 0.00 ? 365 GLU A C    5  
ATOM   9851  O  O    . GLU B 2 107 ? -11.514 -15.757 -1.125  1.00 0.00 ? 365 GLU A O    5  
ATOM   9852  C  CB   . GLU B 2 107 ? -12.762 -13.023 -2.323  1.00 0.00 ? 365 GLU A CB   5  
ATOM   9853  C  CG   . GLU B 2 107 ? -13.565 -11.757 -2.165  1.00 0.00 ? 365 GLU A CG   5  
ATOM   9854  C  CD   . GLU B 2 107 ? -13.647 -10.925 -3.430  1.00 0.00 ? 365 GLU A CD   5  
ATOM   9855  O  OE1  . GLU B 2 107 ? -12.730 -11.031 -4.271  1.00 0.00 ? 365 GLU A OE1  5  
ATOM   9856  O  OE2  . GLU B 2 107 ? -14.628 -10.167 -3.580  1.00 0.00 ? 365 GLU A OE2  5  
ATOM   9857  H  H    . GLU B 2 107 ? -11.716 -11.519 -0.775  1.00 0.00 ? 365 GLU A H    5  
ATOM   9858  H  HA   . GLU B 2 107 ? -13.159 -13.812 -0.377  1.00 0.00 ? 365 GLU A HA   5  
ATOM   9859  H  HB2  . GLU B 2 107 ? -11.883 -12.818 -2.931  1.00 0.00 ? 365 GLU A HB2  5  
ATOM   9860  H  HB3  . GLU B 2 107 ? -13.375 -13.777 -2.794  1.00 0.00 ? 365 GLU A HB3  5  
ATOM   9861  H  HG2  . GLU B 2 107 ? -14.547 -12.022 -1.853  1.00 0.00 ? 365 GLU A HG2  5  
ATOM   9862  H  HG3  . GLU B 2 107 ? -13.111 -11.173 -1.377  1.00 0.00 ? 365 GLU A HG3  5  
ATOM   9863  N  N    . LEU B 2 108 ? -9.999  -14.068 -1.021  1.00 0.00 ? 366 LEU A N    5  
ATOM   9864  C  CA   . LEU B 2 108 ? -8.822  -14.900 -1.049  1.00 0.00 ? 366 LEU A CA   5  
ATOM   9865  C  C    . LEU B 2 108 ? -8.507  -15.363 0.372   1.00 0.00 ? 366 LEU A C    5  
ATOM   9866  O  O    . LEU B 2 108 ? -7.864  -16.388 0.592   1.00 0.00 ? 366 LEU A O    5  
ATOM   9867  C  CB   . LEU B 2 108 ? -7.682  -14.098 -1.651  1.00 0.00 ? 366 LEU A CB   5  
ATOM   9868  C  CG   . LEU B 2 108 ? -6.343  -14.799 -1.768  1.00 0.00 ? 366 LEU A CG   5  
ATOM   9869  C  CD1  . LEU B 2 108 ? -5.575  -14.636 -0.479  1.00 0.00 ? 366 LEU A CD1  5  
ATOM   9870  C  CD2  . LEU B 2 108 ? -6.556  -16.252 -2.126  1.00 0.00 ? 366 LEU A CD2  5  
ATOM   9871  H  H    . LEU B 2 108 ? -9.875  -13.088 -0.971  1.00 0.00 ? 366 LEU A H    5  
ATOM   9872  H  HA   . LEU B 2 108 ? -9.014  -15.742 -1.668  1.00 0.00 ? 366 LEU A HA   5  
ATOM   9873  H  HB2  . LEU B 2 108 ? -7.981  -13.804 -2.635  1.00 0.00 ? 366 LEU A HB2  5  
ATOM   9874  H  HB3  . LEU B 2 108 ? -7.554  -13.218 -1.056  1.00 0.00 ? 366 LEU A HB3  5  
ATOM   9875  H  HG   . LEU B 2 108 ? -5.776  -14.341 -2.560  1.00 0.00 ? 366 LEU A HG   5  
ATOM   9876  H  HD11 . LEU B 2 108 ? -5.922  -13.735 0.012   1.00 0.00 ? 366 LEU A HD11 5  
ATOM   9877  H  HD12 . LEU B 2 108 ? -4.519  -14.553 -0.693  1.00 0.00 ? 366 LEU A HD12 5  
ATOM   9878  H  HD13 . LEU B 2 108 ? -5.751  -15.487 0.159   1.00 0.00 ? 366 LEU A HD13 5  
ATOM   9879  H  HD21 . LEU B 2 108 ? -7.499  -16.331 -2.650  1.00 0.00 ? 366 LEU A HD21 5  
ATOM   9880  H  HD22 . LEU B 2 108 ? -6.585  -16.850 -1.227  1.00 0.00 ? 366 LEU A HD22 5  
ATOM   9881  H  HD23 . LEU B 2 108 ? -5.755  -16.592 -2.766  1.00 0.00 ? 366 LEU A HD23 5  
ATOM   9882  N  N    . LEU B 2 109 ? -8.997  -14.576 1.323   1.00 0.00 ? 367 LEU A N    5  
ATOM   9883  C  CA   . LEU B 2 109 ? -8.844  -14.837 2.748   1.00 0.00 ? 367 LEU A CA   5  
ATOM   9884  C  C    . LEU B 2 109 ? -9.671  -16.039 3.110   1.00 0.00 ? 367 LEU A C    5  
ATOM   9885  O  O    . LEU B 2 109 ? -9.184  -17.046 3.617   1.00 0.00 ? 367 LEU A O    5  
ATOM   9886  C  CB   . LEU B 2 109 ? -9.375  -13.643 3.516   1.00 0.00 ? 367 LEU A CB   5  
ATOM   9887  C  CG   . LEU B 2 109 ? -8.520  -13.131 4.652   1.00 0.00 ? 367 LEU A CG   5  
ATOM   9888  C  CD1  . LEU B 2 109 ? -7.571  -12.089 4.109   1.00 0.00 ? 367 LEU A CD1  5  
ATOM   9889  C  CD2  . LEU B 2 109 ? -9.399  -12.556 5.754   1.00 0.00 ? 367 LEU A CD2  5  
ATOM   9890  H  H    . LEU B 2 109 ? -9.496  -13.779 1.051   1.00 0.00 ? 367 LEU A H    5  
ATOM   9891  H  HA   . LEU B 2 109 ? -7.815  -14.991 2.982   1.00 0.00 ? 367 LEU A HA   5  
ATOM   9892  H  HB2  . LEU B 2 109 ? -9.474  -12.851 2.811   1.00 0.00 ? 367 LEU A HB2  5  
ATOM   9893  H  HB3  . LEU B 2 109 ? -10.352 -13.885 3.899   1.00 0.00 ? 367 LEU A HB3  5  
ATOM   9894  H  HG   . LEU B 2 109 ? -7.943  -13.938 5.057   1.00 0.00 ? 367 LEU A HG   5  
ATOM   9895  H  HD11 . LEU B 2 109 ? -7.828  -11.902 3.074   1.00 0.00 ? 367 LEU A HD11 5  
ATOM   9896  H  HD12 . LEU B 2 109 ? -6.555  -12.452 4.174   1.00 0.00 ? 367 LEU A HD12 5  
ATOM   9897  H  HD13 . LEU B 2 109 ? -7.668  -11.175 4.677   1.00 0.00 ? 367 LEU A HD13 5  
ATOM   9898  H  HD21 . LEU B 2 109 ? -10.229 -12.023 5.309   1.00 0.00 ? 367 LEU A HD21 5  
ATOM   9899  H  HD22 . LEU B 2 109 ? -8.817  -11.876 6.361   1.00 0.00 ? 367 LEU A HD22 5  
ATOM   9900  H  HD23 . LEU B 2 109 ? -9.775  -13.358 6.371   1.00 0.00 ? 367 LEU A HD23 5  
ATOM   9901  N  N    . LYS B 2 110 ? -10.949 -15.882 2.843   1.00 0.00 ? 368 LYS A N    5  
ATOM   9902  C  CA   . LYS B 2 110 ? -11.924 -16.911 3.085   1.00 0.00 ? 368 LYS A CA   5  
ATOM   9903  C  C    . LYS B 2 110 ? -11.549 -18.145 2.286   1.00 0.00 ? 368 LYS A C    5  
ATOM   9904  O  O    . LYS B 2 110 ? -11.777 -19.276 2.715   1.00 0.00 ? 368 LYS A O    5  
ATOM   9905  C  CB   . LYS B 2 110 ? -13.308 -16.394 2.690   1.00 0.00 ? 368 LYS A CB   5  
ATOM   9906  C  CG   . LYS B 2 110 ? -13.481 -14.909 2.973   1.00 0.00 ? 368 LYS A CG   5  
ATOM   9907  C  CD   . LYS B 2 110 ? -14.830 -14.397 2.535   1.00 0.00 ? 368 LYS A CD   5  
ATOM   9908  C  CE   . LYS B 2 110 ? -15.084 -13.011 3.091   1.00 0.00 ? 368 LYS A CE   5  
ATOM   9909  N  NZ   . LYS B 2 110 ? -16.234 -12.345 2.422   1.00 0.00 ? 368 LYS A NZ   5  
ATOM   9910  H  H    . LYS B 2 110 ? -11.244 -15.024 2.469   1.00 0.00 ? 368 LYS A H    5  
ATOM   9911  H  HA   . LYS B 2 110 ? -11.906 -17.146 4.132   1.00 0.00 ? 368 LYS A HA   5  
ATOM   9912  H  HB2  . LYS B 2 110 ? -13.452 -16.554 1.631   1.00 0.00 ? 368 LYS A HB2  5  
ATOM   9913  H  HB3  . LYS B 2 110 ? -14.061 -16.938 3.239   1.00 0.00 ? 368 LYS A HB3  5  
ATOM   9914  H  HG2  . LYS B 2 110 ? -13.365 -14.733 4.030   1.00 0.00 ? 368 LYS A HG2  5  
ATOM   9915  H  HG3  . LYS B 2 110 ? -12.723 -14.362 2.427   1.00 0.00 ? 368 LYS A HG3  5  
ATOM   9916  H  HD2  . LYS B 2 110 ? -14.836 -14.346 1.461   1.00 0.00 ? 368 LYS A HD2  5  
ATOM   9917  H  HD3  . LYS B 2 110 ? -15.599 -15.070 2.881   1.00 0.00 ? 368 LYS A HD3  5  
ATOM   9918  H  HE2  . LYS B 2 110 ? -15.293 -13.094 4.147   1.00 0.00 ? 368 LYS A HE2  5  
ATOM   9919  H  HE3  . LYS B 2 110 ? -14.190 -12.411 2.946   1.00 0.00 ? 368 LYS A HE3  5  
ATOM   9920  H  HZ1  . LYS B 2 110 ? -16.052 -12.255 1.402   1.00 0.00 ? 368 LYS A HZ1  5  
ATOM   9921  H  HZ2  . LYS B 2 110 ? -16.380 -11.395 2.821   1.00 0.00 ? 368 LYS A HZ2  5  
ATOM   9922  H  HZ3  . LYS B 2 110 ? -17.101 -12.903 2.560   1.00 0.00 ? 368 LYS A HZ3  5  
ATOM   9923  N  N    . GLU B 2 111 ? -10.971 -17.912 1.111   1.00 0.00 ? 369 GLU A N    5  
ATOM   9924  C  CA   . GLU B 2 111 ? -10.518 -18.994 0.263   1.00 0.00 ? 369 GLU A CA   5  
ATOM   9925  C  C    . GLU B 2 111 ? -9.383  -19.744 0.942   1.00 0.00 ? 369 GLU A C    5  
ATOM   9926  O  O    . GLU B 2 111 ? -9.251  -20.958 0.786   1.00 0.00 ? 369 GLU A O    5  
ATOM   9927  C  CB   . GLU B 2 111 ? -10.047 -18.463 -1.084  1.00 0.00 ? 369 GLU A CB   5  
ATOM   9928  C  CG   . GLU B 2 111 ? -10.669 -19.193 -2.256  1.00 0.00 ? 369 GLU A CG   5  
ATOM   9929  C  CD   . GLU B 2 111 ? -10.271 -20.655 -2.315  1.00 0.00 ? 369 GLU A CD   5  
ATOM   9930  O  OE1  . GLU B 2 111 ? -10.974 -21.487 -1.702  1.00 0.00 ? 369 GLU A OE1  5  
ATOM   9931  O  OE2  . GLU B 2 111 ? -9.257  -20.969 -2.972  1.00 0.00 ? 369 GLU A OE2  5  
ATOM   9932  H  H    . GLU B 2 111 ? -10.868 -16.985 0.800   1.00 0.00 ? 369 GLU A H    5  
ATOM   9933  H  HA   . GLU B 2 111 ? -11.344 -19.670 0.103   1.00 0.00 ? 369 GLU A HA   5  
ATOM   9934  H  HB2  . GLU B 2 111 ? -10.305 -17.420 -1.158  1.00 0.00 ? 369 GLU A HB2  5  
ATOM   9935  H  HB3  . GLU B 2 111 ? -8.975  -18.569 -1.146  1.00 0.00 ? 369 GLU A HB3  5  
ATOM   9936  H  HG2  . GLU B 2 111 ? -11.741 -19.130 -2.170  1.00 0.00 ? 369 GLU A HG2  5  
ATOM   9937  H  HG3  . GLU B 2 111 ? -10.355 -18.713 -3.164  1.00 0.00 ? 369 GLU A HG3  5  
ATOM   9938  N  N    . LYS B 2 112 ? -8.555  -19.016 1.702   1.00 0.00 ? 370 LYS A N    5  
ATOM   9939  C  CA   . LYS B 2 112 ? -7.438  -19.633 2.392   1.00 0.00 ? 370 LYS A CA   5  
ATOM   9940  C  C    . LYS B 2 112 ? -7.898  -20.692 3.392   1.00 0.00 ? 370 LYS A C    5  
ATOM   9941  O  O    . LYS B 2 112 ? -7.087  -21.466 3.904   1.00 0.00 ? 370 LYS A O    5  
ATOM   9942  C  CB   . LYS B 2 112 ? -6.606  -18.567 3.081   1.00 0.00 ? 370 LYS A CB   5  
ATOM   9943  C  CG   . LYS B 2 112 ? -5.650  -17.895 2.141   1.00 0.00 ? 370 LYS A CG   5  
ATOM   9944  C  CD   . LYS B 2 112 ? -5.477  -16.443 2.485   1.00 0.00 ? 370 LYS A CD   5  
ATOM   9945  C  CE   . LYS B 2 112 ? -5.066  -16.234 3.930   1.00 0.00 ? 370 LYS A CE   5  
ATOM   9946  N  NZ   . LYS B 2 112 ? -3.998  -17.183 4.352   1.00 0.00 ? 370 LYS A NZ   5  
ATOM   9947  H  H    . LYS B 2 112 ? -8.686  -18.037 1.786   1.00 0.00 ? 370 LYS A H    5  
ATOM   9948  H  HA   . LYS B 2 112 ? -6.830  -20.101 1.641   1.00 0.00 ? 370 LYS A HA   5  
ATOM   9949  H  HB2  . LYS B 2 112 ? -7.262  -17.815 3.473   1.00 0.00 ? 370 LYS A HB2  5  
ATOM   9950  H  HB3  . LYS B 2 112 ? -6.044  -19.005 3.882   1.00 0.00 ? 370 LYS A HB3  5  
ATOM   9951  H  HG2  . LYS B 2 112 ? -4.693  -18.392 2.172   1.00 0.00 ? 370 LYS A HG2  5  
ATOM   9952  H  HG3  . LYS B 2 112 ? -6.070  -17.960 1.161   1.00 0.00 ? 370 LYS A HG3  5  
ATOM   9953  H  HD2  . LYS B 2 112 ? -4.732  -16.008 1.837   1.00 0.00 ? 370 LYS A HD2  5  
ATOM   9954  H  HD3  . LYS B 2 112 ? -6.424  -15.971 2.319   1.00 0.00 ? 370 LYS A HD3  5  
ATOM   9955  H  HE2  . LYS B 2 112 ? -4.705  -15.224 4.047   1.00 0.00 ? 370 LYS A HE2  5  
ATOM   9956  H  HE3  . LYS B 2 112 ? -5.935  -16.380 4.551   1.00 0.00 ? 370 LYS A HE3  5  
ATOM   9957  H  HZ1  . LYS B 2 112 ? -4.357  -18.159 4.329   1.00 0.00 ? 370 LYS A HZ1  5  
ATOM   9958  H  HZ2  . LYS B 2 112 ? -3.685  -16.963 5.319   1.00 0.00 ? 370 LYS A HZ2  5  
ATOM   9959  H  HZ3  . LYS B 2 112 ? -3.182  -17.109 3.711   1.00 0.00 ? 370 LYS A HZ3  5  
ATOM   9960  N  N    . ALA B 2 113 ? -9.199  -20.724 3.668   1.00 0.00 ? 371 ALA A N    5  
ATOM   9961  C  CA   . ALA B 2 113 ? -9.762  -21.691 4.600   1.00 0.00 ? 371 ALA A CA   5  
ATOM   9962  C  C    . ALA B 2 113 ? -9.672  -23.107 4.061   1.00 0.00 ? 371 ALA A C    5  
ATOM   9963  O  O    . ALA B 2 113 ? -9.085  -23.357 3.009   1.00 0.00 ? 371 ALA A O    5  
ATOM   9964  C  CB   . ALA B 2 113 ? -11.208 -21.347 4.904   1.00 0.00 ? 371 ALA A CB   5  
ATOM   9965  H  H    . ALA B 2 113 ? -9.796  -20.075 3.239   1.00 0.00 ? 371 ALA A H    5  
ATOM   9966  H  HA   . ALA B 2 113 ? -9.205  -21.634 5.523   1.00 0.00 ? 371 ALA A HA   5  
ATOM   9967  H  HB1  . ALA B 2 113 ? -11.240 -20.470 5.523   1.00 0.00 ? 371 ALA A HB1  5  
ATOM   9968  H  HB2  . ALA B 2 113 ? -11.674 -22.171 5.423   1.00 0.00 ? 371 ALA A HB2  5  
ATOM   9969  H  HB3  . ALA B 2 113 ? -11.735 -21.158 3.981   1.00 0.00 ? 371 ALA A HB3  5  
ATOM   9970  N  N    . SER B 2 114 ? -10.273 -24.029 4.800   1.00 0.00 ? 372 SER A N    5  
ATOM   9971  C  CA   . SER B 2 114 ? -10.278 -25.437 4.423   1.00 0.00 ? 372 SER A CA   5  
ATOM   9972  C  C    . SER B 2 114 ? -11.303 -25.703 3.323   1.00 0.00 ? 372 SER A C    5  
ATOM   9973  O  O    . SER B 2 114 ? -12.472 -25.987 3.658   1.00 0.00 ? 372 SER A O    5  
ATOM   9974  C  CB   . SER B 2 114 ? -10.580 -26.312 5.642   1.00 0.00 ? 372 SER A CB   5  
ATOM   9975  O  OG   . SER B 2 114 ? -10.575 -27.686 5.296   1.00 0.00 ? 372 SER A OG   5  
ATOM   9976  O  OXT  . SER B 2 114 ? -10.926 -25.626 2.134   1.00 0.00 ? 372 SER A OXT  5  
ATOM   9977  H  H    . SER B 2 114 ? -10.723 -23.749 5.624   1.00 0.00 ? 372 SER A H    5  
ATOM   9978  H  HA   . SER B 2 114 ? -9.297  -25.681 4.050   1.00 0.00 ? 372 SER A HA   5  
ATOM   9979  H  HB2  . SER B 2 114 ? -9.830  -26.142 6.399   1.00 0.00 ? 372 SER A HB2  5  
ATOM   9980  H  HB3  . SER B 2 114 ? -11.553 -26.056 6.034   1.00 0.00 ? 372 SER A HB3  5  
ATOM   9981  H  HG   . SER B 2 114 ? -9.787  -27.884 4.785   1.00 0.00 ? 372 SER A HG   5  
HETATM 9982  ZN ZN   . ZN  C 3 .   ? 14.573  0.086   3.085   1.00 0.00 ? 501 ZN  A ZN   5  
HETATM 9983  ZN ZN   . ZN  D 3 .   ? 3.991   5.564   -8.563  1.00 0.00 ? 601 ZN  A ZN   5  
HETATM 9984  ZN ZN   . ZN  E 3 .   ? -5.711  -6.451  -0.806  1.00 0.00 ? 701 ZN  A ZN   5  
HETATM 9985  ZN ZN   . ZN  F 3 .   ? -13.308 4.200   -5.658  1.00 0.00 ? 801 ZN  A ZN   5  
HETATM 9986  C  C1A  . SAC A 1 1   ? 6.265   5.066   -0.959  1.00 0.00 ? 1   SAC B C1A  6  
HETATM 9987  C  C2A  . SAC A 1 1   ? 7.414   4.486   -1.788  1.00 0.00 ? 1   SAC B C2A  6  
HETATM 9988  O  OAC  . SAC A 1 1   ? 5.385   5.709   -1.531  1.00 0.00 ? 1   SAC B OAC  6  
HETATM 9989  N  N    . SAC A 1 1   ? 6.186   4.760   0.332   1.00 0.00 ? 1   SAC B N    6  
HETATM 9990  C  CA   . SAC A 1 1   ? 4.922   4.876   1.052   1.00 0.00 ? 1   SAC B CA   6  
HETATM 9991  C  C    . SAC A 1 1   ? 4.756   6.284   1.614   1.00 0.00 ? 1   SAC B C    6  
HETATM 9992  O  O    . SAC A 1 1   ? 5.691   7.085   1.595   1.00 0.00 ? 1   SAC B O    6  
HETATM 9993  C  CB   . SAC A 1 1   ? 4.855   3.847   2.183   1.00 0.00 ? 1   SAC B CB   6  
HETATM 9994  O  OG   . SAC A 1 1   ? 5.505   4.322   3.349   1.00 0.00 ? 1   SAC B OG   6  
HETATM 9995  H  H1   . SAC A 1 1   ? 6.915   4.246   0.740   1.00 0.00 ? 1   SAC B H1   6  
HETATM 9996  H  H2A1 . SAC A 1 1   ? 7.413   3.410   -1.702  1.00 0.00 ? 1   SAC B H2A1 6  
HETATM 9997  H  H2A2 . SAC A 1 1   ? 8.349   4.875   -1.422  1.00 0.00 ? 1   SAC B H2A2 6  
HETATM 9998  H  H2A3 . SAC A 1 1   ? 7.288   4.765   -2.823  1.00 0.00 ? 1   SAC B H2A3 6  
HETATM 9999  H  HA   . SAC A 1 1   ? 4.121   4.680   0.351   1.00 0.00 ? 1   SAC B HA   6  
HETATM 10000 H  HB2  . SAC A 1 1   ? 3.823   3.644   2.421   1.00 0.00 ? 1   SAC B HB2  6  
HETATM 10001 H  HB3  . SAC A 1 1   ? 5.336   2.934   1.863   1.00 0.00 ? 1   SAC B HB3  6  
HETATM 10002 H  HG   . SAC A 1 1   ? 6.017   5.105   3.135   1.00 0.00 ? 1   SAC B HG   6  
ATOM   10003 N  N    . GLY A 1 2   ? 3.562   6.579   2.116   1.00 0.00 ? 2   GLY B N    6  
ATOM   10004 C  CA   . GLY A 1 2   ? 3.292   7.893   2.674   1.00 0.00 ? 2   GLY B CA   6  
ATOM   10005 C  C    . GLY A 1 2   ? 3.388   8.986   1.637   1.00 0.00 ? 2   GLY B C    6  
ATOM   10006 O  O    . GLY A 1 2   ? 3.576   10.157  1.970   1.00 0.00 ? 2   GLY B O    6  
ATOM   10007 H  H    . GLY A 1 2   ? 2.856   5.902   2.102   1.00 0.00 ? 2   GLY B H    6  
ATOM   10008 H  HA2  . GLY A 1 2   ? 2.292   7.895   3.081   1.00 0.00 ? 2   GLY B HA2  6  
ATOM   10009 H  HA3  . GLY A 1 2   ? 3.999   8.093   3.466   1.00 0.00 ? 2   GLY B HA3  6  
ATOM   10010 N  N    . ARG A 1 3   ? 3.270   8.590   0.376   1.00 0.00 ? 3   ARG B N    6  
ATOM   10011 C  CA   . ARG A 1 3   ? 3.323   9.520   -0.742  1.00 0.00 ? 3   ARG B CA   6  
ATOM   10012 C  C    . ARG A 1 3   ? 4.732   10.097  -0.929  1.00 0.00 ? 3   ARG B C    6  
ATOM   10013 O  O    . ARG A 1 3   ? 5.012   10.763  -1.927  1.00 0.00 ? 3   ARG B O    6  
ATOM   10014 C  CB   . ARG A 1 3   ? 2.262   10.621  -0.563  1.00 0.00 ? 3   ARG B CB   6  
ATOM   10015 C  CG   . ARG A 1 3   ? 2.777   12.045  -0.684  1.00 0.00 ? 3   ARG B CG   6  
ATOM   10016 C  CD   . ARG A 1 3   ? 1.626   13.037  -0.673  1.00 0.00 ? 3   ARG B CD   6  
ATOM   10017 N  NE   . ARG A 1 3   ? 0.956   13.075  0.624   1.00 0.00 ? 3   ARG B NE   6  
ATOM   10018 C  CZ   . ARG A 1 3   ? 0.202   14.088  1.038   1.00 0.00 ? 3   ARG B CZ   6  
ATOM   10019 N  NH1  . ARG A 1 3   ? 0.016   15.144  0.257   1.00 0.00 ? 3   ARG B NH1  6  
ATOM   10020 N  NH2  . ARG A 1 3   ? -0.369  14.046  2.234   1.00 0.00 ? 3   ARG B NH2  6  
ATOM   10021 H  H    . ARG A 1 3   ? 3.143   7.636   0.191   1.00 0.00 ? 3   ARG B H    6  
ATOM   10022 H  HA   . ARG A 1 3   ? 3.070   8.953   -1.628  1.00 0.00 ? 3   ARG B HA   6  
ATOM   10023 H  HB2  . ARG A 1 3   ? 1.500   10.483  -1.314  1.00 0.00 ? 3   ARG B HB2  6  
ATOM   10024 H  HB3  . ARG A 1 3   ? 1.807   10.506  0.406   1.00 0.00 ? 3   ARG B HB3  6  
ATOM   10025 H  HG2  . ARG A 1 3   ? 3.430   12.256  0.151   1.00 0.00 ? 3   ARG B HG2  6  
ATOM   10026 H  HG3  . ARG A 1 3   ? 3.322   12.147  -1.609  1.00 0.00 ? 3   ARG B HG3  6  
ATOM   10027 H  HD2  . ARG A 1 3   ? 2.011   14.020  -0.902  1.00 0.00 ? 3   ARG B HD2  6  
ATOM   10028 H  HD3  . ARG A 1 3   ? 0.910   12.741  -1.432  1.00 0.00 ? 3   ARG B HD3  6  
ATOM   10029 H  HE   . ARG A 1 3   ? 1.075   12.304  1.217   1.00 0.00 ? 3   ARG B HE   6  
ATOM   10030 H  HH11 . ARG A 1 3   ? 0.443   15.180  -0.646  1.00 0.00 ? 3   ARG B HH11 6  
ATOM   10031 H  HH12 . ARG A 1 3   ? -0.552  15.904  0.572   1.00 0.00 ? 3   ARG B HH12 6  
ATOM   10032 H  HH21 . ARG A 1 3   ? -0.232  13.250  2.824   1.00 0.00 ? 3   ARG B HH21 6  
ATOM   10033 H  HH22 . ARG A 1 3   ? -0.936  14.807  2.545   1.00 0.00 ? 3   ARG B HH22 6  
ATOM   10034 N  N    . GLY A 1 4   ? 5.621   9.826   0.023   1.00 0.00 ? 4   GLY B N    6  
ATOM   10035 C  CA   . GLY A 1 4   ? 6.986   10.313  -0.077  1.00 0.00 ? 4   GLY B CA   6  
ATOM   10036 C  C    . GLY A 1 4   ? 7.289   11.449  0.881   1.00 0.00 ? 4   GLY B C    6  
ATOM   10037 O  O    . GLY A 1 4   ? 6.401   12.218  1.249   1.00 0.00 ? 4   GLY B O    6  
ATOM   10038 H  H    . GLY A 1 4   ? 5.351   9.288   0.797   1.00 0.00 ? 4   GLY B H    6  
ATOM   10039 H  HA2  . GLY A 1 4   ? 7.662   9.497   0.130   1.00 0.00 ? 4   GLY B HA2  6  
ATOM   10040 H  HA3  . GLY A 1 4   ? 7.157   10.657  -1.087  1.00 0.00 ? 4   GLY B HA3  6  
ATOM   10041 N  N    . LYS A 1 5   ? 8.556   11.549  1.281   1.00 0.00 ? 5   LYS B N    6  
ATOM   10042 C  CA   . LYS A 1 5   ? 9.004   12.594  2.196   1.00 0.00 ? 5   LYS B CA   6  
ATOM   10043 C  C    . LYS A 1 5   ? 8.172   12.606  3.476   1.00 0.00 ? 5   LYS B C    6  
ATOM   10044 O  O    . LYS A 1 5   ? 7.980   13.657  4.089   1.00 0.00 ? 5   LYS B O    6  
ATOM   10045 C  CB   . LYS A 1 5   ? 8.937   13.962  1.514   1.00 0.00 ? 5   LYS B CB   6  
ATOM   10046 C  CG   . LYS A 1 5   ? 9.788   14.056  0.255   1.00 0.00 ? 5   LYS B CG   6  
ATOM   10047 C  CD   . LYS A 1 5   ? 9.698   15.434  -0.380  1.00 0.00 ? 5   LYS B CD   6  
ATOM   10048 C  CE   . LYS A 1 5   ? 10.410  16.486  0.457   1.00 0.00 ? 5   LYS B CE   6  
ATOM   10049 N  NZ   . LYS A 1 5   ? 11.875  16.236  0.534   1.00 0.00 ? 5   LYS B NZ   6  
ATOM   10050 H  H    . LYS A 1 5   ? 9.210   10.897  0.948   1.00 0.00 ? 5   LYS B H    6  
ATOM   10051 H  HA   . LYS A 1 5   ? 10.032  12.385  2.455   1.00 0.00 ? 5   LYS B HA   6  
ATOM   10052 H  HB2  . LYS A 1 5   ? 7.912   14.168  1.245   1.00 0.00 ? 5   LYS B HB2  6  
ATOM   10053 H  HB3  . LYS A 1 5   ? 9.277   14.715  2.208   1.00 0.00 ? 5   LYS B HB3  6  
ATOM   10054 H  HG2  . LYS A 1 5   ? 10.817  13.856  0.513   1.00 0.00 ? 5   LYS B HG2  6  
ATOM   10055 H  HG3  . LYS A 1 5   ? 9.443   13.318  -0.456  1.00 0.00 ? 5   LYS B HG3  6  
ATOM   10056 H  HD2  . LYS A 1 5   ? 10.154  15.399  -1.359  1.00 0.00 ? 5   LYS B HD2  6  
ATOM   10057 H  HD3  . LYS A 1 5   ? 8.657   15.708  -0.477  1.00 0.00 ? 5   LYS B HD3  6  
ATOM   10058 H  HE2  . LYS A 1 5   ? 10.243  17.456  0.012   1.00 0.00 ? 5   LYS B HE2  6  
ATOM   10059 H  HE3  . LYS A 1 5   ? 9.997   16.473  1.455   1.00 0.00 ? 5   LYS B HE3  6  
ATOM   10060 H  HZ1  . LYS A 1 5   ? 12.057  15.304  0.958   1.00 0.00 ? 5   LYS B HZ1  6  
ATOM   10061 H  HZ2  . LYS A 1 5   ? 12.333  16.966  1.118   1.00 0.00 ? 5   LYS B HZ2  6  
ATOM   10062 H  HZ3  . LYS A 1 5   ? 12.293  16.259  -0.419  1.00 0.00 ? 5   LYS B HZ3  6  
ATOM   10063 N  N    . GLY A 1 6   ? 7.687   11.434  3.875   1.00 0.00 ? 6   GLY B N    6  
ATOM   10064 C  CA   . GLY A 1 6   ? 6.883   11.334  5.080   1.00 0.00 ? 6   GLY B CA   6  
ATOM   10065 C  C    . GLY A 1 6   ? 5.670   12.241  5.043   1.00 0.00 ? 6   GLY B C    6  
ATOM   10066 O  O    . GLY A 1 6   ? 4.639   11.888  4.470   1.00 0.00 ? 6   GLY B O    6  
ATOM   10067 H  H    . GLY A 1 6   ? 7.879   10.630  3.347   1.00 0.00 ? 6   GLY B H    6  
ATOM   10068 H  HA2  . GLY A 1 6   ? 6.551   10.312  5.194   1.00 0.00 ? 6   GLY B HA2  6  
ATOM   10069 H  HA3  . GLY A 1 6   ? 7.493   11.599  5.930   1.00 0.00 ? 6   GLY B HA3  6  
ATOM   10070 N  N    . GLY A 1 7   ? 5.793   13.416  5.657   1.00 0.00 ? 7   GLY B N    6  
ATOM   10071 C  CA   . GLY A 1 7   ? 4.692   14.361  5.676   1.00 0.00 ? 7   GLY B CA   6  
ATOM   10072 C  C    . GLY A 1 7   ? 4.665   15.201  6.938   1.00 0.00 ? 7   GLY B C    6  
ATOM   10073 O  O    . GLY A 1 7   ? 3.684   15.181  7.682   1.00 0.00 ? 7   GLY B O    6  
ATOM   10074 H  H    . GLY A 1 7   ? 6.638   13.641  6.099   1.00 0.00 ? 7   GLY B H    6  
ATOM   10075 H  HA2  . GLY A 1 7   ? 4.782   15.018  4.823   1.00 0.00 ? 7   GLY B HA2  6  
ATOM   10076 H  HA3  . GLY A 1 7   ? 3.764   13.816  5.600   1.00 0.00 ? 7   GLY B HA3  6  
ATOM   10077 N  N    . LYS A 1 8   ? 5.743   15.942  7.182   1.00 0.00 ? 8   LYS B N    6  
ATOM   10078 C  CA   . LYS A 1 8   ? 5.831   16.794  8.363   1.00 0.00 ? 8   LYS B CA   6  
ATOM   10079 C  C    . LYS A 1 8   ? 5.237   18.170  8.083   1.00 0.00 ? 8   LYS B C    6  
ATOM   10080 O  O    . LYS A 1 8   ? 5.584   18.817  7.095   1.00 0.00 ? 8   LYS B O    6  
ATOM   10081 C  CB   . LYS A 1 8   ? 7.286   16.939  8.815   1.00 0.00 ? 8   LYS B CB   6  
ATOM   10082 C  CG   . LYS A 1 8   ? 7.910   15.637  9.294   1.00 0.00 ? 8   LYS B CG   6  
ATOM   10083 C  CD   . LYS A 1 8   ? 9.304   15.861  9.863   1.00 0.00 ? 8   LYS B CD   6  
ATOM   10084 C  CE   . LYS A 1 8   ? 10.287  16.298  8.787   1.00 0.00 ? 8   LYS B CE   6  
ATOM   10085 N  NZ   . LYS A 1 8   ? 11.624  16.623  9.357   1.00 0.00 ? 8   LYS B NZ   6  
ATOM   10086 H  H    . LYS A 1 8   ? 6.495   15.913  6.555   1.00 0.00 ? 8   LYS B H    6  
ATOM   10087 H  HA   . LYS A 1 8   ? 5.264   16.325  9.152   1.00 0.00 ? 8   LYS B HA   6  
ATOM   10088 H  HB2  . LYS A 1 8   ? 7.872   17.310  7.987   1.00 0.00 ? 8   LYS B HB2  6  
ATOM   10089 H  HB3  . LYS A 1 8   ? 7.329   17.653  9.624   1.00 0.00 ? 8   LYS B HB3  6  
ATOM   10090 H  HG2  . LYS A 1 8   ? 7.283   15.211  10.063  1.00 0.00 ? 8   LYS B HG2  6  
ATOM   10091 H  HG3  . LYS A 1 8   ? 7.976   14.953  8.461   1.00 0.00 ? 8   LYS B HG3  6  
ATOM   10092 H  HD2  . LYS A 1 8   ? 9.253   16.627  10.621  1.00 0.00 ? 8   LYS B HD2  6  
ATOM   10093 H  HD3  . LYS A 1 8   ? 9.652   14.939  10.303  1.00 0.00 ? 8   LYS B HD3  6  
ATOM   10094 H  HE2  . LYS A 1 8   ? 10.396  15.497  8.071   1.00 0.00 ? 8   LYS B HE2  6  
ATOM   10095 H  HE3  . LYS A 1 8   ? 9.893   17.172  8.291   1.00 0.00 ? 8   LYS B HE3  6  
ATOM   10096 H  HZ1  . LYS A 1 8   ? 12.276  16.907  8.597   1.00 0.00 ? 8   LYS B HZ1  6  
ATOM   10097 H  HZ2  . LYS A 1 8   ? 12.017  15.794  9.845   1.00 0.00 ? 8   LYS B HZ2  6  
ATOM   10098 H  HZ3  . LYS A 1 8   ? 11.541  17.405  10.038  1.00 0.00 ? 8   LYS B HZ3  6  
ATOM   10099 N  N    . GLY A 1 9   ? 4.340   18.609  8.960   1.00 0.00 ? 9   GLY B N    6  
ATOM   10100 C  CA   . GLY A 1 9   ? 3.709   19.905  8.794   1.00 0.00 ? 9   GLY B CA   6  
ATOM   10101 C  C    . GLY A 1 9   ? 3.488   20.613  10.115  1.00 0.00 ? 9   GLY B C    6  
ATOM   10102 O  O    . GLY A 1 9   ? 3.586   21.837  10.195  1.00 0.00 ? 9   GLY B O    6  
ATOM   10103 H  H    . GLY A 1 9   ? 4.104   18.047  9.728   1.00 0.00 ? 9   GLY B H    6  
ATOM   10104 H  HA2  . GLY A 1 9   ? 4.339   20.521  8.168   1.00 0.00 ? 9   GLY B HA2  6  
ATOM   10105 H  HA3  . GLY A 1 9   ? 2.756   19.769  8.305   1.00 0.00 ? 9   GLY B HA3  6  
ATOM   10106 N  N    . LEU A 1 10  ? 3.190   19.840  11.155  1.00 0.00 ? 10  LEU B N    6  
ATOM   10107 C  CA   . LEU A 1 10  ? 2.954   20.399  12.481  1.00 0.00 ? 10  LEU B CA   6  
ATOM   10108 C  C    . LEU A 1 10  ? 3.343   19.400  13.568  1.00 0.00 ? 10  LEU B C    6  
ATOM   10109 O  O    . LEU A 1 10  ? 3.028   19.592  14.742  1.00 0.00 ? 10  LEU B O    6  
ATOM   10110 C  CB   . LEU A 1 10  ? 1.484   20.804  12.642  1.00 0.00 ? 10  LEU B CB   6  
ATOM   10111 C  CG   . LEU A 1 10  ? 0.489   19.645  12.768  1.00 0.00 ? 10  LEU B CG   6  
ATOM   10112 C  CD1  . LEU A 1 10  ? -0.873  20.160  13.203  1.00 0.00 ? 10  LEU B CD1  6  
ATOM   10113 C  CD2  . LEU A 1 10  ? 0.374   18.888  11.452  1.00 0.00 ? 10  LEU B CD2  6  
ATOM   10114 H  H    . LEU A 1 10  ? 3.128   18.870  11.027  1.00 0.00 ? 10  LEU B H    6  
ATOM   10115 H  HA   . LEU A 1 10  ? 3.572   21.278  12.583  1.00 0.00 ? 10  LEU B HA   6  
ATOM   10116 H  HB2  . LEU A 1 10  ? 1.399   21.419  13.527  1.00 0.00 ? 10  LEU B HB2  6  
ATOM   10117 H  HB3  . LEU A 1 10  ? 1.202   21.398  11.786  1.00 0.00 ? 10  LEU B HB3  6  
ATOM   10118 H  HG   . LEU A 1 10  ? 0.842   18.955  13.522  1.00 0.00 ? 10  LEU B HG   6  
ATOM   10119 H  HD11 . LEU A 1 10  ? -1.567  19.335  13.270  1.00 0.00 ? 10  LEU B HD11 6  
ATOM   10120 H  HD12 . LEU A 1 10  ? -1.235  20.878  12.481  1.00 0.00 ? 10  LEU B HD12 6  
ATOM   10121 H  HD13 . LEU A 1 10  ? -0.785  20.636  14.169  1.00 0.00 ? 10  LEU B HD13 6  
ATOM   10122 H  HD21 . LEU A 1 10  ? -0.326  18.073  11.567  1.00 0.00 ? 10  LEU B HD21 6  
ATOM   10123 H  HD22 . LEU A 1 10  ? 1.341   18.495  11.176  1.00 0.00 ? 10  LEU B HD22 6  
ATOM   10124 H  HD23 . LEU A 1 10  ? 0.023   19.558  10.681  1.00 0.00 ? 10  LEU B HD23 6  
ATOM   10125 N  N    . GLY A 1 11  ? 4.028   18.335  13.165  1.00 0.00 ? 11  GLY B N    6  
ATOM   10126 C  CA   . GLY A 1 11  ? 4.450   17.321  14.114  1.00 0.00 ? 11  GLY B CA   6  
ATOM   10127 C  C    . GLY A 1 11  ? 3.925   15.943  13.761  1.00 0.00 ? 11  GLY B C    6  
ATOM   10128 O  O    . GLY A 1 11  ? 4.044   15.501  12.618  1.00 0.00 ? 11  GLY B O    6  
ATOM   10129 H  H    . GLY A 1 11  ? 4.248   18.236  12.215  1.00 0.00 ? 11  GLY B H    6  
ATOM   10130 H  HA2  . GLY A 1 11  ? 5.529   17.289  14.133  1.00 0.00 ? 11  GLY B HA2  6  
ATOM   10131 H  HA3  . GLY A 1 11  ? 4.089   17.589  15.095  1.00 0.00 ? 11  GLY B HA3  6  
ATOM   10132 N  N    . LYS A 1 12  ? 3.343   15.264  14.747  1.00 0.00 ? 12  LYS B N    6  
ATOM   10133 C  CA   . LYS A 1 12  ? 2.792   13.926  14.547  1.00 0.00 ? 12  LYS B CA   6  
ATOM   10134 C  C    . LYS A 1 12  ? 3.860   12.955  14.056  1.00 0.00 ? 12  LYS B C    6  
ATOM   10135 O  O    . LYS A 1 12  ? 5.042   13.294  13.984  1.00 0.00 ? 12  LYS B O    6  
ATOM   10136 C  CB   . LYS A 1 12  ? 1.629   13.969  13.551  1.00 0.00 ? 12  LYS B CB   6  
ATOM   10137 C  CG   . LYS A 1 12  ? 0.433   14.767  14.046  1.00 0.00 ? 12  LYS B CG   6  
ATOM   10138 C  CD   . LYS A 1 12  ? -0.723  14.718  13.058  1.00 0.00 ? 12  LYS B CD   6  
ATOM   10139 C  CE   . LYS A 1 12  ? -1.274  13.307  12.905  1.00 0.00 ? 12  LYS B CE   6  
ATOM   10140 N  NZ   . LYS A 1 12  ? -1.714  12.737  14.208  1.00 0.00 ? 12  LYS B NZ   6  
ATOM   10141 H  H    . LYS A 1 12  ? 3.283   15.674  15.636  1.00 0.00 ? 12  LYS B H    6  
ATOM   10142 H  HA   . LYS A 1 12  ? 2.420   13.579  15.499  1.00 0.00 ? 12  LYS B HA   6  
ATOM   10143 H  HB2  . LYS A 1 12  ? 1.976   14.415  12.630  1.00 0.00 ? 12  LYS B HB2  6  
ATOM   10144 H  HB3  . LYS A 1 12  ? 1.305   12.959  13.352  1.00 0.00 ? 12  LYS B HB3  6  
ATOM   10145 H  HG2  . LYS A 1 12  ? 0.104   14.355  14.989  1.00 0.00 ? 12  LYS B HG2  6  
ATOM   10146 H  HG3  . LYS A 1 12  ? 0.732   15.796  14.186  1.00 0.00 ? 12  LYS B HG3  6  
ATOM   10147 H  HD2  . LYS A 1 12  ? -1.513  15.364  13.412  1.00 0.00 ? 12  LYS B HD2  6  
ATOM   10148 H  HD3  . LYS A 1 12  ? -0.376  15.066  12.096  1.00 0.00 ? 12  LYS B HD3  6  
ATOM   10149 H  HE2  . LYS A 1 12  ? -2.118  13.336  12.232  1.00 0.00 ? 12  LYS B HE2  6  
ATOM   10150 H  HE3  . LYS A 1 12  ? -0.503  12.677  12.487  1.00 0.00 ? 12  LYS B HE3  6  
ATOM   10151 H  HZ1  . LYS A 1 12  ? -0.909  12.687  14.866  1.00 0.00 ? 12  LYS B HZ1  6  
ATOM   10152 H  HZ2  . LYS A 1 12  ? -2.094  11.780  14.070  1.00 0.00 ? 12  LYS B HZ2  6  
ATOM   10153 H  HZ3  . LYS A 1 12  ? -2.454  13.335  14.629  1.00 0.00 ? 12  LYS B HZ3  6  
ATOM   10154 N  N    . GLY A 1 13  ? 3.432   11.742  13.721  1.00 0.00 ? 13  GLY B N    6  
ATOM   10155 C  CA   . GLY A 1 13  ? 4.354   10.731  13.241  1.00 0.00 ? 13  GLY B CA   6  
ATOM   10156 C  C    . GLY A 1 13  ? 3.654   9.433   12.893  1.00 0.00 ? 13  GLY B C    6  
ATOM   10157 O  O    . GLY A 1 13  ? 4.301   8.407   12.680  1.00 0.00 ? 13  GLY B O    6  
ATOM   10158 H  H    . GLY A 1 13  ? 2.478   11.531  13.803  1.00 0.00 ? 13  GLY B H    6  
ATOM   10159 H  HA2  . GLY A 1 13  ? 4.855   11.105  12.359  1.00 0.00 ? 13  GLY B HA2  6  
ATOM   10160 H  HA3  . GLY A 1 13  ? 5.091   10.537  14.006  1.00 0.00 ? 13  GLY B HA3  6  
ATOM   10161 N  N    . GLY A 1 14  ? 2.326   9.480   12.837  1.00 0.00 ? 14  GLY B N    6  
ATOM   10162 C  CA   . GLY A 1 14  ? 1.552   8.296   12.513  1.00 0.00 ? 14  GLY B CA   6  
ATOM   10163 C  C    . GLY A 1 14  ? 0.111   8.621   12.171  1.00 0.00 ? 14  GLY B C    6  
ATOM   10164 O  O    . GLY A 1 14  ? -0.194  9.731   11.735  1.00 0.00 ? 14  GLY B O    6  
ATOM   10165 H  H    . GLY A 1 14  ? 1.867   10.327  13.016  1.00 0.00 ? 14  GLY B H    6  
ATOM   10166 H  HA2  . GLY A 1 14  ? 2.009   7.801   11.668  1.00 0.00 ? 14  GLY B HA2  6  
ATOM   10167 H  HA3  . GLY A 1 14  ? 1.568   7.626   13.360  1.00 0.00 ? 14  GLY B HA3  6  
ATOM   10168 N  N    . ALA A 1 15  ? -0.775  7.646   12.368  1.00 0.00 ? 15  ALA B N    6  
ATOM   10169 C  CA   . ALA A 1 15  ? -2.196  7.822   12.081  1.00 0.00 ? 15  ALA B CA   6  
ATOM   10170 C  C    . ALA A 1 15  ? -2.434  8.093   10.598  1.00 0.00 ? 15  ALA B C    6  
ATOM   10171 O  O    . ALA A 1 15  ? -3.538  8.460   10.193  1.00 0.00 ? 15  ALA B O    6  
ATOM   10172 C  CB   . ALA A 1 15  ? -2.776  8.944   12.928  1.00 0.00 ? 15  ALA B CB   6  
ATOM   10173 H  H    . ALA A 1 15  ? -0.463  6.785   12.717  1.00 0.00 ? 15  ALA B H    6  
ATOM   10174 H  HA   . ALA A 1 15  ? -2.701  6.905   12.350  1.00 0.00 ? 15  ALA B HA   6  
ATOM   10175 H  HB1  . ALA A 1 15  ? -2.557  8.760   13.970  1.00 0.00 ? 15  ALA B HB1  6  
ATOM   10176 H  HB2  . ALA A 1 15  ? -3.847  8.985   12.788  1.00 0.00 ? 15  ALA B HB2  6  
ATOM   10177 H  HB3  . ALA A 1 15  ? -2.339  9.885   12.629  1.00 0.00 ? 15  ALA B HB3  6  
ATOM   10178 N  N    . LYS A 1 16  ? -1.392  7.910   9.792   1.00 0.00 ? 16  LYS B N    6  
ATOM   10179 C  CA   . LYS A 1 16  ? -1.486  8.125   8.352   1.00 0.00 ? 16  LYS B CA   6  
ATOM   10180 C  C    . LYS A 1 16  ? -0.676  7.072   7.601   1.00 0.00 ? 16  LYS B C    6  
ATOM   10181 O  O    . LYS A 1 16  ? 0.300   7.385   6.919   1.00 0.00 ? 16  LYS B O    6  
ATOM   10182 C  CB   . LYS A 1 16  ? -1.001  9.533   7.987   1.00 0.00 ? 16  LYS B CB   6  
ATOM   10183 C  CG   . LYS A 1 16  ? 0.381   9.869   8.528   1.00 0.00 ? 16  LYS B CG   6  
ATOM   10184 C  CD   . LYS A 1 16  ? 0.799   11.280  8.145   1.00 0.00 ? 16  LYS B CD   6  
ATOM   10185 C  CE   . LYS A 1 16  ? 2.188   11.610  8.665   1.00 0.00 ? 16  LYS B CE   6  
ATOM   10186 N  NZ   . LYS A 1 16  ? 2.252   11.558  10.152  1.00 0.00 ? 16  LYS B NZ   6  
ATOM   10187 H  H    . LYS A 1 16  ? -0.539  7.621   10.175  1.00 0.00 ? 16  LYS B H    6  
ATOM   10188 H  HA   . LYS A 1 16  ? -2.524  8.028   8.071   1.00 0.00 ? 16  LYS B HA   6  
ATOM   10189 H  HB2  . LYS A 1 16  ? -0.970  9.621   6.911   1.00 0.00 ? 16  LYS B HB2  6  
ATOM   10190 H  HB3  . LYS A 1 16  ? -1.702  10.255  8.378   1.00 0.00 ? 16  LYS B HB3  6  
ATOM   10191 H  HG2  . LYS A 1 16  ? 0.364   9.790   9.604   1.00 0.00 ? 16  LYS B HG2  6  
ATOM   10192 H  HG3  . LYS A 1 16  ? 1.096   9.168   8.124   1.00 0.00 ? 16  LYS B HG3  6  
ATOM   10193 H  HD2  . LYS A 1 16  ? 0.799   11.364  7.068   1.00 0.00 ? 16  LYS B HD2  6  
ATOM   10194 H  HD3  . LYS A 1 16  ? 0.091   11.981  8.562   1.00 0.00 ? 16  LYS B HD3  6  
ATOM   10195 H  HE2  . LYS A 1 16  ? 2.890   10.898  8.259   1.00 0.00 ? 16  LYS B HE2  6  
ATOM   10196 H  HE3  . LYS A 1 16  ? 2.455   12.604  8.336   1.00 0.00 ? 16  LYS B HE3  6  
ATOM   10197 H  HZ1  . LYS A 1 16  ? 1.607   12.265  10.562  1.00 0.00 ? 16  LYS B HZ1  6  
ATOM   10198 H  HZ2  . LYS A 1 16  ? 3.219   11.759  10.477  1.00 0.00 ? 16  LYS B HZ2  6  
ATOM   10199 H  HZ3  . LYS A 1 16  ? 1.973   10.615  10.489  1.00 0.00 ? 16  LYS B HZ3  6  
ATOM   10200 N  N    . ARG A 1 17  ? -1.096  5.817   7.732   1.00 0.00 ? 17  ARG B N    6  
ATOM   10201 C  CA   . ARG A 1 17  ? -0.413  4.705   7.081   1.00 0.00 ? 17  ARG B CA   6  
ATOM   10202 C  C    . ARG A 1 17  ? -0.432  4.838   5.561   1.00 0.00 ? 17  ARG B C    6  
ATOM   10203 O  O    . ARG A 1 17  ? -1.420  4.489   4.920   1.00 0.00 ? 17  ARG B O    6  
ATOM   10204 C  CB   . ARG A 1 17  ? -1.053  3.375   7.487   1.00 0.00 ? 17  ARG B CB   6  
ATOM   10205 C  CG   . ARG A 1 17  ? -0.578  2.849   8.833   1.00 0.00 ? 17  ARG B CG   6  
ATOM   10206 C  CD   . ARG A 1 17  ? -1.128  1.459   9.107   1.00 0.00 ? 17  ARG B CD   6  
ATOM   10207 N  NE   . ARG A 1 17  ? -0.520  0.846   10.285  1.00 0.00 ? 17  ARG B NE   6  
ATOM   10208 C  CZ   . ARG A 1 17  ? -0.640  -0.444  10.588  1.00 0.00 ? 17  ARG B CZ   6  
ATOM   10209 N  NH1  . ARG A 1 17  ? -1.343  -1.250  9.803   1.00 0.00 ? 17  ARG B NH1  6  
ATOM   10210 N  NH2  . ARG A 1 17  ? -0.058  -0.929  11.677  1.00 0.00 ? 17  ARG B NH2  6  
ATOM   10211 H  H    . ARG A 1 17  ? -1.888  5.635   8.280   1.00 0.00 ? 17  ARG B H    6  
ATOM   10212 H  HA   . ARG A 1 17  ? 0.613   4.711   7.413   1.00 0.00 ? 17  ARG B HA   6  
ATOM   10213 H  HB2  . ARG A 1 17  ? -2.124  3.505   7.536   1.00 0.00 ? 17  ARG B HB2  6  
ATOM   10214 H  HB3  . ARG A 1 17  ? -0.823  2.634   6.735   1.00 0.00 ? 17  ARG B HB3  6  
ATOM   10215 H  HG2  . ARG A 1 17  ? 0.502   2.804   8.831   1.00 0.00 ? 17  ARG B HG2  6  
ATOM   10216 H  HG3  . ARG A 1 17  ? -0.912  3.521   9.610   1.00 0.00 ? 17  ARG B HG3  6  
ATOM   10217 H  HD2  . ARG A 1 17  ? -2.194  1.534   9.265   1.00 0.00 ? 17  ARG B HD2  6  
ATOM   10218 H  HD3  . ARG A 1 17  ? -0.935  0.834   8.247   1.00 0.00 ? 17  ARG B HD3  6  
ATOM   10219 H  HE   . ARG A 1 17  ? 0.004   1.423   10.879  1.00 0.00 ? 17  ARG B HE   6  
ATOM   10220 H  HH11 . ARG A 1 17  ? -1.784  -0.889  8.981   1.00 0.00 ? 17  ARG B HH11 6  
ATOM   10221 H  HH12 . ARG A 1 17  ? -1.433  -2.219  10.034  1.00 0.00 ? 17  ARG B HH12 6  
ATOM   10222 H  HH21 . ARG A 1 17  ? 0.473   -0.324  12.271  1.00 0.00 ? 17  ARG B HH21 6  
ATOM   10223 H  HH22 . ARG A 1 17  ? -0.151  -1.898  11.904  1.00 0.00 ? 17  ARG B HH22 6  
ATOM   10224 N  N    . HIS A 1 18  ? 0.670   5.350   5.010   1.00 0.00 ? 18  HIS B N    6  
ATOM   10225 C  CA   . HIS A 1 18  ? 0.842   5.524   3.562   1.00 0.00 ? 18  HIS B CA   6  
ATOM   10226 C  C    . HIS A 1 18  ? -0.421  5.994   2.857   1.00 0.00 ? 18  HIS B C    6  
ATOM   10227 O  O    . HIS A 1 18  ? -1.391  5.256   2.682   1.00 0.00 ? 18  HIS B O    6  
ATOM   10228 C  CB   . HIS A 1 18  ? 1.431   4.231   2.945   1.00 0.00 ? 18  HIS B CB   6  
ATOM   10229 C  CG   . HIS A 1 18  ? 0.441   3.219   2.445   1.00 0.00 ? 18  HIS B CG   6  
ATOM   10230 N  ND1  . HIS A 1 18  ? 0.319   2.905   1.110   1.00 0.00 ? 18  HIS B ND1  6  
ATOM   10231 C  CD2  . HIS A 1 18  ? -0.483  2.466   3.086   1.00 0.00 ? 18  HIS B CD2  6  
ATOM   10232 C  CE1  . HIS A 1 18  ? -0.640  2.027   0.949   1.00 0.00 ? 18  HIS B CE1  6  
ATOM   10233 N  NE2  . HIS A 1 18  ? -1.143  1.736   2.132   1.00 0.00 ? 18  HIS B NE2  6  
ATOM   10234 H  H    . HIS A 1 18  ? 1.402   5.623   5.601   1.00 0.00 ? 18  HIS B H    6  
ATOM   10235 H  HA   . HIS A 1 18  ? 1.562   6.310   3.410   1.00 0.00 ? 18  HIS B HA   6  
ATOM   10236 H  HB2  . HIS A 1 18  ? 2.055   4.505   2.109   1.00 0.00 ? 18  HIS B HB2  6  
ATOM   10237 H  HB3  . HIS A 1 18  ? 2.046   3.747   3.690   1.00 0.00 ? 18  HIS B HB3  6  
ATOM   10238 H  HD1  . HIS A 1 18  ? 0.874   3.263   0.389   1.00 0.00 ? 18  HIS B HD1  6  
ATOM   10239 H  HD2  . HIS A 1 18  ? -0.657  2.434   4.147   1.00 0.00 ? 18  HIS B HD2  6  
ATOM   10240 H  HE1  . HIS A 1 18  ? -0.991  1.656   0.001   1.00 0.00 ? 18  HIS B HE1  6  
ATOM   10241 H  HE2  . HIS A 1 18  ? -1.803  1.033   2.308   1.00 0.00 ? 18  HIS B HE2  6  
ATOM   10242 N  N    . ARG A 1 19  ? -0.392  7.264   2.449   1.00 0.00 ? 19  ARG B N    6  
ATOM   10243 C  CA   . ARG A 1 19  ? -1.496  7.842   1.715   1.00 0.00 ? 19  ARG B CA   6  
ATOM   10244 C  C    . ARG A 1 19  ? -1.120  9.089   0.950   1.00 0.00 ? 19  ARG B C    6  
ATOM   10245 O  O    . ARG A 1 19  ? -0.298  9.902   1.371   1.00 0.00 ? 19  ARG B O    6  
ATOM   10246 C  CB   . ARG A 1 19  ? -2.703  8.109   2.573   1.00 0.00 ? 19  ARG B CB   6  
ATOM   10247 C  CG   . ARG A 1 19  ? -3.787  8.832   1.799   1.00 0.00 ? 19  ARG B CG   6  
ATOM   10248 C  CD   . ARG A 1 19  ? -5.131  8.211   2.024   1.00 0.00 ? 19  ARG B CD   6  
ATOM   10249 N  NE   . ARG A 1 19  ? -6.175  9.209   2.238   1.00 0.00 ? 19  ARG B NE   6  
ATOM   10250 C  CZ   . ARG A 1 19  ? -6.709  9.467   3.429   1.00 0.00 ? 19  ARG B CZ   6  
ATOM   10251 N  NH1  . ARG A 1 19  ? -6.302  8.801   4.502   1.00 0.00 ? 19  ARG B NH1  6  
ATOM   10252 N  NH2  . ARG A 1 19  ? -7.649  10.395  3.550   1.00 0.00 ? 19  ARG B NH2  6  
ATOM   10253 H  H    . ARG A 1 19  ? 0.393   7.814   2.650   1.00 0.00 ? 19  ARG B H    6  
ATOM   10254 H  HA   . ARG A 1 19  ? -1.787  7.113   0.988   1.00 0.00 ? 19  ARG B HA   6  
ATOM   10255 H  HB2  . ARG A 1 19  ? -3.089  7.159   2.895   1.00 0.00 ? 19  ARG B HB2  6  
ATOM   10256 H  HB3  . ARG A 1 19  ? -2.422  8.705   3.428   1.00 0.00 ? 19  ARG B HB3  6  
ATOM   10257 H  HG2  . ARG A 1 19  ? -3.819  9.860   2.096   1.00 0.00 ? 19  ARG B HG2  6  
ATOM   10258 H  HG3  . ARG A 1 19  ? -3.558  8.762   0.741   1.00 0.00 ? 19  ARG B HG3  6  
ATOM   10259 H  HD2  . ARG A 1 19  ? -5.360  7.630   1.142   1.00 0.00 ? 19  ARG B HD2  6  
ATOM   10260 H  HD3  . ARG A 1 19  ? -5.078  7.559   2.884   1.00 0.00 ? 19  ARG B HD3  6  
ATOM   10261 H  HE   . ARG A 1 19  ? -6.490  9.712   1.459   1.00 0.00 ? 19  ARG B HE   6  
ATOM   10262 H  HH11 . ARG A 1 19  ? -5.591  8.102   4.417   1.00 0.00 ? 19  ARG B HH11 6  
ATOM   10263 H  HH12 . ARG A 1 19  ? -6.705  8.996   5.396   1.00 0.00 ? 19  ARG B HH12 6  
ATOM   10264 H  HH21 . ARG A 1 19  ? -7.957  10.901  2.744   1.00 0.00 ? 19  ARG B HH21 6  
ATOM   10265 H  HH22 . ARG A 1 19  ? -8.051  10.586  4.445   1.00 0.00 ? 19  ARG B HH22 6  
ATOM   10266 N  N    . LYS A 1 20  ? -1.764  9.194   -0.193  1.00 0.00 ? 20  LYS B N    6  
ATOM   10267 C  CA   . LYS A 1 20  ? -1.583  10.277  -1.122  1.00 0.00 ? 20  LYS B CA   6  
ATOM   10268 C  C    . LYS A 1 20  ? -2.322  11.535  -0.666  1.00 0.00 ? 20  LYS B C    6  
ATOM   10269 O  O    . LYS A 1 20  ? -1.662  12.584  -0.518  1.00 0.00 ? 20  LYS B O    6  
ATOM   10270 C  CB   . LYS A 1 20  ? -2.094  9.805   -2.474  1.00 0.00 ? 20  LYS B CB   6  
ATOM   10271 C  CG   . LYS A 1 20  ? -3.545  9.328   -2.454  1.00 0.00 ? 20  LYS B CG   6  
ATOM   10272 C  CD   . LYS A 1 20  ? -3.651  7.851   -2.743  1.00 0.00 ? 20  LYS B CD   6  
ATOM   10273 C  CE   . LYS A 1 20  ? -3.915  7.586   -4.206  1.00 0.00 ? 20  LYS B CE   6  
ATOM   10274 N  NZ   . LYS A 1 20  ? -3.464  8.708   -5.078  1.00 0.00 ? 20  LYS B NZ   6  
ATOM   10275 O  OXT  . LYS A 1 20  ? -3.551  11.460  -0.455  1.00 0.00 ? 20  LYS B OXT  6  
ATOM   10276 H  H    . LYS A 1 20  ? -2.407  8.491   -0.427  1.00 0.00 ? 20  LYS B H    6  
ATOM   10277 H  HA   . LYS A 1 20  ? -0.529  10.489  -1.196  1.00 0.00 ? 20  LYS B HA   6  
ATOM   10278 H  HB2  . LYS A 1 20  ? -2.000  10.602  -3.180  1.00 0.00 ? 20  LYS B HB2  6  
ATOM   10279 H  HB3  . LYS A 1 20  ? -1.481  8.978   -2.796  1.00 0.00 ? 20  LYS B HB3  6  
ATOM   10280 H  HG2  . LYS A 1 20  ? -3.971  9.501   -1.484  1.00 0.00 ? 20  LYS B HG2  6  
ATOM   10281 H  HG3  . LYS A 1 20  ? -4.103  9.872   -3.201  1.00 0.00 ? 20  LYS B HG3  6  
ATOM   10282 H  HD2  . LYS A 1 20  ? -2.725  7.371   -2.462  1.00 0.00 ? 20  LYS B HD2  6  
ATOM   10283 H  HD3  . LYS A 1 20  ? -4.462  7.439   -2.160  1.00 0.00 ? 20  LYS B HD3  6  
ATOM   10284 H  HE2  . LYS A 1 20  ? -3.389  6.693   -4.476  1.00 0.00 ? 20  LYS B HE2  6  
ATOM   10285 H  HE3  . LYS A 1 20  ? -4.973  7.437   -4.345  1.00 0.00 ? 20  LYS B HE3  6  
ATOM   10286 H  HZ1  . LYS A 1 20  ? -2.455  8.906   -4.912  1.00 0.00 ? 20  LYS B HZ1  6  
ATOM   10287 H  HZ2  . LYS A 1 20  ? -4.012  9.566   -4.870  1.00 0.00 ? 20  LYS B HZ2  6  
ATOM   10288 H  HZ3  . LYS A 1 20  ? -3.597  8.458   -6.079  1.00 0.00 ? 20  LYS B HZ3  6  
ATOM   10289 N  N    . GLY B 2 1   ? 16.446  1.977   -13.072 1.00 0.00 ? 259 GLY A N    6  
ATOM   10290 C  CA   . GLY B 2 1   ? 16.196  1.086   -11.906 1.00 0.00 ? 259 GLY A CA   6  
ATOM   10291 C  C    . GLY B 2 1   ? 15.500  1.803   -10.765 1.00 0.00 ? 259 GLY A C    6  
ATOM   10292 O  O    . GLY B 2 1   ? 14.969  2.899   -10.945 1.00 0.00 ? 259 GLY A O    6  
ATOM   10293 H  H1   . GLY B 2 1   ? 15.547  2.360   -13.427 1.00 0.00 ? 259 GLY A H1   6  
ATOM   10294 H  H2   . GLY B 2 1   ? 16.910  1.446   -13.836 1.00 0.00 ? 259 GLY A H2   6  
ATOM   10295 H  H3   . GLY B 2 1   ? 17.060  2.768   -12.791 1.00 0.00 ? 259 GLY A H3   6  
ATOM   10296 H  HA2  . GLY B 2 1   ? 15.581  0.258   -12.225 1.00 0.00 ? 259 GLY A HA2  6  
ATOM   10297 H  HA3  . GLY B 2 1   ? 17.142  0.701   -11.552 1.00 0.00 ? 259 GLY A HA3  6  
ATOM   10298 N  N    . SER B 2 2   ? 15.504  1.182   -9.590  1.00 0.00 ? 260 SER A N    6  
ATOM   10299 C  CA   . SER B 2 2   ? 14.868  1.766   -8.415  1.00 0.00 ? 260 SER A CA   6  
ATOM   10300 C  C    . SER B 2 2   ? 15.465  1.230   -7.128  1.00 0.00 ? 260 SER A C    6  
ATOM   10301 O  O    . SER B 2 2   ? 16.462  0.508   -7.134  1.00 0.00 ? 260 SER A O    6  
ATOM   10302 C  CB   . SER B 2 2   ? 13.375  1.493   -8.414  1.00 0.00 ? 260 SER A CB   6  
ATOM   10303 O  OG   . SER B 2 2   ? 12.715  2.226   -9.431  1.00 0.00 ? 260 SER A OG   6  
ATOM   10304 H  H    . SER B 2 2   ? 15.945  0.310   -9.511  1.00 0.00 ? 260 SER A H    6  
ATOM   10305 H  HA   . SER B 2 2   ? 15.015  2.831   -8.440  1.00 0.00 ? 260 SER A HA   6  
ATOM   10306 H  HB2  . SER B 2 2   ? 13.201  0.439   -8.573  1.00 0.00 ? 260 SER A HB2  6  
ATOM   10307 H  HB3  . SER B 2 2   ? 12.977  1.786   -7.451  1.00 0.00 ? 260 SER A HB3  6  
ATOM   10308 H  HG   . SER B 2 2   ? 12.474  1.636   -10.147 1.00 0.00 ? 260 SER A HG   6  
ATOM   10309 N  N    . TYR B 2 3   ? 14.827  1.600   -6.028  1.00 0.00 ? 261 TYR A N    6  
ATOM   10310 C  CA   . TYR B 2 3   ? 15.253  1.192   -4.705  1.00 0.00 ? 261 TYR A CA   6  
ATOM   10311 C  C    . TYR B 2 3   ? 14.261  1.680   -3.655  1.00 0.00 ? 261 TYR A C    6  
ATOM   10312 O  O    . TYR B 2 3   ? 13.408  2.524   -3.934  1.00 0.00 ? 261 TYR A O    6  
ATOM   10313 C  CB   . TYR B 2 3   ? 16.638  1.754   -4.406  1.00 0.00 ? 261 TYR A CB   6  
ATOM   10314 C  CG   . TYR B 2 3   ? 16.857  3.131   -4.967  1.00 0.00 ? 261 TYR A CG   6  
ATOM   10315 C  CD1  . TYR B 2 3   ? 16.054  4.162   -4.558  1.00 0.00 ? 261 TYR A CD1  6  
ATOM   10316 C  CD2  . TYR B 2 3   ? 17.856  3.395   -5.895  1.00 0.00 ? 261 TYR A CD2  6  
ATOM   10317 C  CE1  . TYR B 2 3   ? 16.219  5.437   -5.045  1.00 0.00 ? 261 TYR A CE1  6  
ATOM   10318 C  CE2  . TYR B 2 3   ? 18.036  4.671   -6.396  1.00 0.00 ? 261 TYR A CE2  6  
ATOM   10319 C  CZ   . TYR B 2 3   ? 17.213  5.691   -5.967  1.00 0.00 ? 261 TYR A CZ   6  
ATOM   10320 O  OH   . TYR B 2 3   ? 17.385  6.964   -6.458  1.00 0.00 ? 261 TYR A OH   6  
ATOM   10321 H  H    . TYR B 2 3   ? 14.040  2.171   -6.111  1.00 0.00 ? 261 TYR A H    6  
ATOM   10322 H  HA   . TYR B 2 3   ? 15.293  0.116   -4.681  1.00 0.00 ? 261 TYR A HA   6  
ATOM   10323 H  HB2  . TYR B 2 3   ? 16.773  1.805   -3.338  1.00 0.00 ? 261 TYR A HB2  6  
ATOM   10324 H  HB3  . TYR B 2 3   ? 17.375  1.114   -4.818  1.00 0.00 ? 261 TYR A HB3  6  
ATOM   10325 H  HD1  . TYR B 2 3   ? 15.282  3.948   -3.839  1.00 0.00 ? 261 TYR A HD1  6  
ATOM   10326 H  HD2  . TYR B 2 3   ? 18.494  2.589   -6.226  1.00 0.00 ? 261 TYR A HD2  6  
ATOM   10327 H  HE1  . TYR B 2 3   ? 15.575  6.225   -4.699  1.00 0.00 ? 261 TYR A HE1  6  
ATOM   10328 H  HE2  . TYR B 2 3   ? 18.817  4.863   -7.117  1.00 0.00 ? 261 TYR A HE2  6  
ATOM   10329 H  HH   . TYR B 2 3   ? 17.505  6.928   -7.410  1.00 0.00 ? 261 TYR A HH   6  
ATOM   10330 N  N    . CYS B 2 4   ? 14.380  1.142   -2.454  1.00 0.00 ? 262 CYS A N    6  
ATOM   10331 C  CA   . CYS B 2 4   ? 13.501  1.509   -1.348  1.00 0.00 ? 262 CYS A CA   6  
ATOM   10332 C  C    . CYS B 2 4   ? 13.556  3.003   -1.078  1.00 0.00 ? 262 CYS A C    6  
ATOM   10333 O  O    . CYS B 2 4   ? 14.618  3.562   -0.857  1.00 0.00 ? 262 CYS A O    6  
ATOM   10334 C  CB   . CYS B 2 4   ? 13.904  0.743   -0.104  1.00 0.00 ? 262 CYS A CB   6  
ATOM   10335 S  SG   . CYS B 2 4   ? 13.533  1.528   1.498   1.00 0.00 ? 262 CYS A SG   6  
ATOM   10336 H  H    . CYS B 2 4   ? 15.078  0.472   -2.305  1.00 0.00 ? 262 CYS A H    6  
ATOM   10337 H  HA   . CYS B 2 4   ? 12.494  1.217   -1.617  1.00 0.00 ? 262 CYS A HA   6  
ATOM   10338 H  HB2  . CYS B 2 4   ? 13.400  -0.206  -0.108  1.00 0.00 ? 262 CYS A HB2  6  
ATOM   10339 H  HB3  . CYS B 2 4   ? 14.963  0.564   -0.146  1.00 0.00 ? 262 CYS A HB3  6  
ATOM   10340 N  N    . ASP B 2 5   ? 12.405  3.639   -1.088  1.00 0.00 ? 263 ASP A N    6  
ATOM   10341 C  CA   . ASP B 2 5   ? 12.314  5.073   -0.836  1.00 0.00 ? 263 ASP A CA   6  
ATOM   10342 C  C    . ASP B 2 5   ? 12.793  5.420   0.579   1.00 0.00 ? 263 ASP A C    6  
ATOM   10343 O  O    . ASP B 2 5   ? 12.821  6.584   0.978   1.00 0.00 ? 263 ASP A O    6  
ATOM   10344 C  CB   . ASP B 2 5   ? 10.869  5.506   -1.054  1.00 0.00 ? 263 ASP A CB   6  
ATOM   10345 C  CG   . ASP B 2 5   ? 10.434  6.683   -0.201  1.00 0.00 ? 263 ASP A CG   6  
ATOM   10346 O  OD1  . ASP B 2 5   ? 10.995  7.785   -0.377  1.00 0.00 ? 263 ASP A OD1  6  
ATOM   10347 O  OD2  . ASP B 2 5   ? 9.523   6.501   0.637   1.00 0.00 ? 263 ASP A OD2  6  
ATOM   10348 H  H    . ASP B 2 5   ? 11.586  3.133   -1.274  1.00 0.00 ? 263 ASP A H    6  
ATOM   10349 H  HA   . ASP B 2 5   ? 12.938  5.572   -1.551  1.00 0.00 ? 263 ASP A HA   6  
ATOM   10350 H  HB2  . ASP B 2 5   ? 10.734  5.773   -2.090  1.00 0.00 ? 263 ASP A HB2  6  
ATOM   10351 H  HB3  . ASP B 2 5   ? 10.243  4.670   -0.822  1.00 0.00 ? 263 ASP A HB3  6  
ATOM   10352 N  N    . PHE B 2 6   ? 13.196  4.394   1.322   1.00 0.00 ? 264 PHE A N    6  
ATOM   10353 C  CA   . PHE B 2 6   ? 13.654  4.568   2.701   1.00 0.00 ? 264 PHE A CA   6  
ATOM   10354 C  C    . PHE B 2 6   ? 15.160  4.296   2.868   1.00 0.00 ? 264 PHE A C    6  
ATOM   10355 O  O    . PHE B 2 6   ? 15.789  4.844   3.772   1.00 0.00 ? 264 PHE A O    6  
ATOM   10356 C  CB   . PHE B 2 6   ? 12.814  3.687   3.633   1.00 0.00 ? 264 PHE A CB   6  
ATOM   10357 C  CG   . PHE B 2 6   ? 11.341  3.917   3.457   1.00 0.00 ? 264 PHE A CG   6  
ATOM   10358 C  CD1  . PHE B 2 6   ? 10.673  3.349   2.387   1.00 0.00 ? 264 PHE A CD1  6  
ATOM   10359 C  CD2  . PHE B 2 6   ? 10.629  4.706   4.345   1.00 0.00 ? 264 PHE A CD2  6  
ATOM   10360 C  CE1  . PHE B 2 6   ? 9.322   3.562   2.199   1.00 0.00 ? 264 PHE A CE1  6  
ATOM   10361 C  CE2  . PHE B 2 6   ? 9.274   4.922   4.165   1.00 0.00 ? 264 PHE A CE2  6  
ATOM   10362 C  CZ   . PHE B 2 6   ? 8.622   4.349   3.089   1.00 0.00 ? 264 PHE A CZ   6  
ATOM   10363 H  H    . PHE B 2 6   ? 13.178  3.500   0.933   1.00 0.00 ? 264 PHE A H    6  
ATOM   10364 H  HA   . PHE B 2 6   ? 13.474  5.596   2.959   1.00 0.00 ? 264 PHE A HA   6  
ATOM   10365 H  HB2  . PHE B 2 6   ? 13.013  2.646   3.424   1.00 0.00 ? 264 PHE A HB2  6  
ATOM   10366 H  HB3  . PHE B 2 6   ? 13.065  3.901   4.660   1.00 0.00 ? 264 PHE A HB3  6  
ATOM   10367 H  HD1  . PHE B 2 6   ? 11.222  2.736   1.690   1.00 0.00 ? 264 PHE A HD1  6  
ATOM   10368 H  HD2  . PHE B 2 6   ? 11.140  5.153   5.185   1.00 0.00 ? 264 PHE A HD2  6  
ATOM   10369 H  HE1  . PHE B 2 6   ? 8.812   3.109   1.358   1.00 0.00 ? 264 PHE A HE1  6  
ATOM   10370 H  HE2  . PHE B 2 6   ? 8.728   5.539   4.864   1.00 0.00 ? 264 PHE A HE2  6  
ATOM   10371 H  HZ   . PHE B 2 6   ? 7.567   4.519   2.941   1.00 0.00 ? 264 PHE A HZ   6  
ATOM   10372 N  N    . CYS B 2 7   ? 15.738  3.452   2.005   1.00 0.00 ? 265 CYS A N    6  
ATOM   10373 C  CA   . CYS B 2 7   ? 17.183  3.166   2.062   1.00 0.00 ? 265 CYS A CA   6  
ATOM   10374 C  C    . CYS B 2 7   ? 17.815  3.508   0.738   1.00 0.00 ? 265 CYS A C    6  
ATOM   10375 O  O    . CYS B 2 7   ? 18.965  3.944   0.666   1.00 0.00 ? 265 CYS A O    6  
ATOM   10376 C  CB   . CYS B 2 7   ? 17.513  1.698   2.377   1.00 0.00 ? 265 CYS A CB   6  
ATOM   10377 S  SG   . CYS B 2 7   ? 16.597  0.941   3.751   1.00 0.00 ? 265 CYS A SG   6  
ATOM   10378 H  H    . CYS B 2 7   ? 15.194  3.033   1.310   1.00 0.00 ? 265 CYS A H    6  
ATOM   10379 H  HA   . CYS B 2 7   ? 17.615  3.799   2.808   1.00 0.00 ? 265 CYS A HA   6  
ATOM   10380 H  HB2  . CYS B 2 7   ? 17.336  1.106   1.507   1.00 0.00 ? 265 CYS A HB2  6  
ATOM   10381 H  HB3  . CYS B 2 7   ? 18.564  1.635   2.622   1.00 0.00 ? 265 CYS A HB3  6  
ATOM   10382 N  N    . LEU B 2 8   ? 17.041  3.295   -0.308  1.00 0.00 ? 266 LEU A N    6  
ATOM   10383 C  CA   . LEU B 2 8   ? 17.465  3.561   -1.655  1.00 0.00 ? 266 LEU A CA   6  
ATOM   10384 C  C    . LEU B 2 8   ? 18.589  2.626   -2.070  1.00 0.00 ? 266 LEU A C    6  
ATOM   10385 O  O    . LEU B 2 8   ? 19.466  2.991   -2.852  1.00 0.00 ? 266 LEU A O    6  
ATOM   10386 C  CB   . LEU B 2 8   ? 17.863  5.012   -1.795  1.00 0.00 ? 266 LEU A CB   6  
ATOM   10387 C  CG   . LEU B 2 8   ? 16.925  5.972   -1.094  1.00 0.00 ? 266 LEU A CG   6  
ATOM   10388 C  CD1  . LEU B 2 8   ? 17.553  7.342   -0.947  1.00 0.00 ? 266 LEU A CD1  6  
ATOM   10389 C  CD2  . LEU B 2 8   ? 15.628  6.045   -1.852  1.00 0.00 ? 266 LEU A CD2  6  
ATOM   10390 H  H    . LEU B 2 8   ? 16.142  2.951   -0.164  1.00 0.00 ? 266 LEU A H    6  
ATOM   10391 H  HA   . LEU B 2 8   ? 16.618  3.386   -2.284  1.00 0.00 ? 266 LEU A HA   6  
ATOM   10392 H  HB2  . LEU B 2 8   ? 18.853  5.141   -1.401  1.00 0.00 ? 266 LEU A HB2  6  
ATOM   10393 H  HB3  . LEU B 2 8   ? 17.859  5.250   -2.836  1.00 0.00 ? 266 LEU A HB3  6  
ATOM   10394 H  HG   . LEU B 2 8   ? 16.707  5.581   -0.122  1.00 0.00 ? 266 LEU A HG   6  
ATOM   10395 H  HD11 . LEU B 2 8   ? 18.623  7.246   -1.018  1.00 0.00 ? 266 LEU A HD11 6  
ATOM   10396 H  HD12 . LEU B 2 8   ? 17.291  7.757   0.015   1.00 0.00 ? 266 LEU A HD12 6  
ATOM   10397 H  HD13 . LEU B 2 8   ? 17.195  7.990   -1.732  1.00 0.00 ? 266 LEU A HD13 6  
ATOM   10398 H  HD21 . LEU B 2 8   ? 15.370  5.046   -2.159  1.00 0.00 ? 266 LEU A HD21 6  
ATOM   10399 H  HD22 . LEU B 2 8   ? 15.749  6.678   -2.720  1.00 0.00 ? 266 LEU A HD22 6  
ATOM   10400 H  HD23 . LEU B 2 8   ? 14.852  6.442   -1.214  1.00 0.00 ? 266 LEU A HD23 6  
ATOM   10401 N  N    . GLY B 2 9   ? 18.534  1.406   -1.545  1.00 0.00 ? 267 GLY A N    6  
ATOM   10402 C  CA   . GLY B 2 9   ? 19.535  0.408   -1.852  1.00 0.00 ? 267 GLY A CA   6  
ATOM   10403 C  C    . GLY B 2 9   ? 19.067  -0.567  -2.911  1.00 0.00 ? 267 GLY A C    6  
ATOM   10404 O  O    . GLY B 2 9   ? 19.123  -0.280  -4.108  1.00 0.00 ? 267 GLY A O    6  
ATOM   10405 H  H    . GLY B 2 9   ? 17.797  1.181   -0.939  1.00 0.00 ? 267 GLY A H    6  
ATOM   10406 H  HA2  . GLY B 2 9   ? 20.441  0.901   -2.182  1.00 0.00 ? 267 GLY A HA2  6  
ATOM   10407 H  HA3  . GLY B 2 9   ? 19.751  -0.145  -0.951  1.00 0.00 ? 267 GLY A HA3  6  
ATOM   10408 N  N    . GLY B 2 10  ? 18.603  -1.727  -2.458  1.00 0.00 ? 268 GLY A N    6  
ATOM   10409 C  CA   . GLY B 2 10  ? 18.110  -2.748  -3.369  1.00 0.00 ? 268 GLY A CA   6  
ATOM   10410 C  C    . GLY B 2 10  ? 17.314  -3.823  -2.648  1.00 0.00 ? 268 GLY A C    6  
ATOM   10411 O  O    . GLY B 2 10  ? 17.286  -3.858  -1.421  1.00 0.00 ? 268 GLY A O    6  
ATOM   10412 H  H    . GLY B 2 10  ? 18.598  -1.890  -1.488  1.00 0.00 ? 268 GLY A H    6  
ATOM   10413 H  HA2  . GLY B 2 10  ? 17.473  -2.277  -4.106  1.00 0.00 ? 268 GLY A HA2  6  
ATOM   10414 H  HA3  . GLY B 2 10  ? 18.945  -3.207  -3.871  1.00 0.00 ? 268 GLY A HA3  6  
ATOM   10415 N  N    . SER B 2 11  ? 16.676  -4.712  -3.408  1.00 0.00 ? 269 SER A N    6  
ATOM   10416 C  CA   . SER B 2 11  ? 15.860  -5.773  -2.819  1.00 0.00 ? 269 SER A CA   6  
ATOM   10417 C  C    . SER B 2 11  ? 16.718  -6.851  -2.158  1.00 0.00 ? 269 SER A C    6  
ATOM   10418 O  O    . SER B 2 11  ? 16.519  -7.174  -0.988  1.00 0.00 ? 269 SER A O    6  
ATOM   10419 C  CB   . SER B 2 11  ? 14.946  -6.394  -3.875  1.00 0.00 ? 269 SER A CB   6  
ATOM   10420 O  OG   . SER B 2 11  ? 15.532  -7.543  -4.463  1.00 0.00 ? 269 SER A OG   6  
ATOM   10421 H  H    . SER B 2 11  ? 16.756  -4.653  -4.383  1.00 0.00 ? 269 SER A H    6  
ATOM   10422 H  HA   . SER B 2 11  ? 15.244  -5.319  -2.058  1.00 0.00 ? 269 SER A HA   6  
ATOM   10423 H  HB2  . SER B 2 11  ? 14.012  -6.666  -3.420  1.00 0.00 ? 269 SER A HB2  6  
ATOM   10424 H  HB3  . SER B 2 11  ? 14.753  -5.673  -4.642  1.00 0.00 ? 269 SER A HB3  6  
ATOM   10425 H  HG   . SER B 2 11  ? 14.863  -8.029  -4.950  1.00 0.00 ? 269 SER A HG   6  
ATOM   10426 N  N    . ASN B 2 12  ? 17.671  -7.408  -2.903  1.00 0.00 ? 270 ASN A N    6  
ATOM   10427 C  CA   . ASN B 2 12  ? 18.556  -8.441  -2.362  1.00 0.00 ? 270 ASN A CA   6  
ATOM   10428 C  C    . ASN B 2 12  ? 19.637  -7.819  -1.497  1.00 0.00 ? 270 ASN A C    6  
ATOM   10429 O  O    . ASN B 2 12  ? 20.717  -8.384  -1.324  1.00 0.00 ? 270 ASN A O    6  
ATOM   10430 C  CB   . ASN B 2 12  ? 19.191  -9.250  -3.488  1.00 0.00 ? 270 ASN A CB   6  
ATOM   10431 C  CG   . ASN B 2 12  ? 19.511  -8.403  -4.703  1.00 0.00 ? 270 ASN A CG   6  
ATOM   10432 O  OD1  . ASN B 2 12  ? 20.636  -7.932  -4.867  1.00 0.00 ? 270 ASN A OD1  6  
ATOM   10433 N  ND2  . ASN B 2 12  ? 18.514  -8.193  -5.556  1.00 0.00 ? 270 ASN A ND2  6  
ATOM   10434 H  H    . ASN B 2 12  ? 17.783  -7.119  -3.833  1.00 0.00 ? 270 ASN A H    6  
ATOM   10435 H  HA   . ASN B 2 12  ? 17.962  -9.103  -1.748  1.00 0.00 ? 270 ASN A HA   6  
ATOM   10436 H  HB2  . ASN B 2 12  ? 20.109  -9.690  -3.128  1.00 0.00 ? 270 ASN A HB2  6  
ATOM   10437 H  HB3  . ASN B 2 12  ? 18.515  -10.035 -3.779  1.00 0.00 ? 270 ASN A HB3  6  
ATOM   10438 H  HD21 . ASN B 2 12  ? 17.642  -8.591  -5.354  1.00 0.00 ? 270 ASN A HD21 6  
ATOM   10439 H  HD22 . ASN B 2 12  ? 18.693  -7.649  -6.351  1.00 0.00 ? 270 ASN A HD22 6  
ATOM   10440 N  N    . MET B 2 13  ? 19.328  -6.650  -0.957  1.00 0.00 ? 271 MET A N    6  
ATOM   10441 C  CA   . MET B 2 13  ? 20.247  -5.925  -0.094  1.00 0.00 ? 271 MET A CA   6  
ATOM   10442 C  C    . MET B 2 13  ? 19.613  -4.633  0.352   1.00 0.00 ? 271 MET A C    6  
ATOM   10443 O  O    . MET B 2 13  ? 19.601  -3.647  -0.387  1.00 0.00 ? 271 MET A O    6  
ATOM   10444 C  CB   . MET B 2 13  ? 21.533  -5.596  -0.808  1.00 0.00 ? 271 MET A CB   6  
ATOM   10445 C  CG   . MET B 2 13  ? 22.653  -5.133  0.114   1.00 0.00 ? 271 MET A CG   6  
ATOM   10446 S  SD   . MET B 2 13  ? 24.164  -6.096  -0.084  1.00 0.00 ? 271 MET A SD   6  
ATOM   10447 C  CE   . MET B 2 13  ? 23.641  -7.673  0.581   1.00 0.00 ? 271 MET A CE   6  
ATOM   10448 H  H    . MET B 2 13  ? 18.444  -6.258  -1.145  1.00 0.00 ? 271 MET A H    6  
ATOM   10449 H  HA   . MET B 2 13  ? 20.465  -6.530  0.762   1.00 0.00 ? 271 MET A HA   6  
ATOM   10450 H  HB2  . MET B 2 13  ? 21.871  -6.456  -1.365  1.00 0.00 ? 271 MET A HB2  6  
ATOM   10451 H  HB3  . MET B 2 13  ? 21.311  -4.803  -1.477  1.00 0.00 ? 271 MET A HB3  6  
ATOM   10452 H  HG2  . MET B 2 13  ? 22.874  -4.099  -0.104  1.00 0.00 ? 271 MET A HG2  6  
ATOM   10453 H  HG3  . MET B 2 13  ? 22.318  -5.219  1.137   1.00 0.00 ? 271 MET A HG3  6  
ATOM   10454 H  HE1  . MET B 2 13  ? 22.673  -7.927  0.178   1.00 0.00 ? 271 MET A HE1  6  
ATOM   10455 H  HE2  . MET B 2 13  ? 23.578  -7.605  1.657   1.00 0.00 ? 271 MET A HE2  6  
ATOM   10456 H  HE3  . MET B 2 13  ? 24.356  -8.434  0.308   1.00 0.00 ? 271 MET A HE3  6  
ATOM   10457 N  N    . ASN B 2 14  ? 19.103  -4.629  1.556   1.00 0.00 ? 272 ASN A N    6  
ATOM   10458 C  CA   . ASN B 2 14  ? 18.467  -3.440  2.080   1.00 0.00 ? 272 ASN A CA   6  
ATOM   10459 C  C    . ASN B 2 14  ? 19.520  -2.493  2.592   1.00 0.00 ? 272 ASN A C    6  
ATOM   10460 O  O    . ASN B 2 14  ? 20.202  -2.782  3.573   1.00 0.00 ? 272 ASN A O    6  
ATOM   10461 C  CB   . ASN B 2 14  ? 17.500  -3.781  3.200   1.00 0.00 ? 272 ASN A CB   6  
ATOM   10462 C  CG   . ASN B 2 14  ? 16.269  -4.510  2.713   1.00 0.00 ? 272 ASN A CG   6  
ATOM   10463 O  OD1  . ASN B 2 14  ? 16.294  -5.170  1.674   1.00 0.00 ? 272 ASN A OD1  6  
ATOM   10464 N  ND2  . ASN B 2 14  ? 15.184  -4.401  3.471   1.00 0.00 ? 272 ASN A ND2  6  
ATOM   10465 H  H    . ASN B 2 14  ? 19.185  -5.431  2.114   1.00 0.00 ? 272 ASN A H    6  
ATOM   10466 H  HA   . ASN B 2 14  ? 17.929  -2.967  1.274   1.00 0.00 ? 272 ASN A HA   6  
ATOM   10467 H  HB2  . ASN B 2 14  ? 18.009  -4.409  3.912   1.00 0.00 ? 272 ASN A HB2  6  
ATOM   10468 H  HB3  . ASN B 2 14  ? 17.189  -2.870  3.689   1.00 0.00 ? 272 ASN A HB3  6  
ATOM   10469 H  HD21 . ASN B 2 14  ? 15.243  -3.865  4.289   1.00 0.00 ? 272 ASN A HD21 6  
ATOM   10470 H  HD22 . ASN B 2 14  ? 14.368  -4.857  3.180   1.00 0.00 ? 272 ASN A HD22 6  
ATOM   10471 N  N    . LYS B 2 15  ? 19.674  -1.372  1.916   1.00 0.00 ? 273 LYS A N    6  
ATOM   10472 C  CA   . LYS B 2 15  ? 20.652  -0.400  2.334   1.00 0.00 ? 273 LYS A CA   6  
ATOM   10473 C  C    . LYS B 2 15  ? 20.337  0.091   3.732   1.00 0.00 ? 273 LYS A C    6  
ATOM   10474 O  O    . LYS B 2 15  ? 19.243  -0.151  4.240   1.00 0.00 ? 273 LYS A O    6  
ATOM   10475 C  CB   . LYS B 2 15  ? 20.732  0.738   1.344   1.00 0.00 ? 273 LYS A CB   6  
ATOM   10476 C  CG   . LYS B 2 15  ? 21.889  0.544   0.386   1.00 0.00 ? 273 LYS A CG   6  
ATOM   10477 C  CD   . LYS B 2 15  ? 22.504  1.856   -0.054  1.00 0.00 ? 273 LYS A CD   6  
ATOM   10478 C  CE   . LYS B 2 15  ? 21.455  2.759   -0.635  1.00 0.00 ? 273 LYS A CE   6  
ATOM   10479 N  NZ   . LYS B 2 15  ? 21.716  4.195   -0.344  1.00 0.00 ? 273 LYS A NZ   6  
ATOM   10480 H  H    . LYS B 2 15  ? 19.119  -1.198  1.127   1.00 0.00 ? 273 LYS A H    6  
ATOM   10481 H  HA   . LYS B 2 15  ? 21.608  -0.892  2.352   1.00 0.00 ? 273 LYS A HA   6  
ATOM   10482 H  HB2  . LYS B 2 15  ? 19.810  0.785   0.780   1.00 0.00 ? 273 LYS A HB2  6  
ATOM   10483 H  HB3  . LYS B 2 15  ? 20.870  1.659   1.865   1.00 0.00 ? 273 LYS A HB3  6  
ATOM   10484 H  HG2  . LYS B 2 15  ? 22.637  -0.042  0.879   1.00 0.00 ? 273 LYS A HG2  6  
ATOM   10485 H  HG3  . LYS B 2 15  ? 21.531  0.017   -0.475  1.00 0.00 ? 273 LYS A HG3  6  
ATOM   10486 H  HD2  . LYS B 2 15  ? 22.946  2.337   0.795   1.00 0.00 ? 273 LYS A HD2  6  
ATOM   10487 H  HD3  . LYS B 2 15  ? 23.259  1.662   -0.802  1.00 0.00 ? 273 LYS A HD3  6  
ATOM   10488 H  HE2  . LYS B 2 15  ? 21.420  2.614   -1.705  1.00 0.00 ? 273 LYS A HE2  6  
ATOM   10489 H  HE3  . LYS B 2 15  ? 20.512  2.470   -0.201  1.00 0.00 ? 273 LYS A HE3  6  
ATOM   10490 H  HZ1  . LYS B 2 15  ? 22.628  4.483   -0.757  1.00 0.00 ? 273 LYS A HZ1  6  
ATOM   10491 H  HZ2  . LYS B 2 15  ? 21.749  4.352   0.682   1.00 0.00 ? 273 LYS A HZ2  6  
ATOM   10492 H  HZ3  . LYS B 2 15  ? 20.962  4.785   -0.750  1.00 0.00 ? 273 LYS A HZ3  6  
ATOM   10493 N  N    . LYS B 2 16  ? 21.310  0.746   4.354   1.00 0.00 ? 274 LYS A N    6  
ATOM   10494 C  CA   . LYS B 2 16  ? 21.157  1.257   5.710   1.00 0.00 ? 274 LYS A CA   6  
ATOM   10495 C  C    . LYS B 2 16  ? 21.314  0.100   6.681   1.00 0.00 ? 274 LYS A C    6  
ATOM   10496 O  O    . LYS B 2 16  ? 21.008  0.202   7.868   1.00 0.00 ? 274 LYS A O    6  
ATOM   10497 C  CB   . LYS B 2 16  ? 19.798  1.932   5.884   1.00 0.00 ? 274 LYS A CB   6  
ATOM   10498 C  CG   . LYS B 2 16  ? 19.523  3.004   4.842   1.00 0.00 ? 274 LYS A CG   6  
ATOM   10499 C  CD   . LYS B 2 16  ? 20.174  4.326   5.212   1.00 0.00 ? 274 LYS A CD   6  
ATOM   10500 C  CE   . LYS B 2 16  ? 19.818  5.411   4.221   1.00 0.00 ? 274 LYS A CE   6  
ATOM   10501 N  NZ   . LYS B 2 16  ? 18.350  5.646   4.151   1.00 0.00 ? 274 LYS A NZ   6  
ATOM   10502 H  H    . LYS B 2 16  ? 22.164  0.858   3.900   1.00 0.00 ? 274 LYS A H    6  
ATOM   10503 H  HA   . LYS B 2 16  ? 21.942  1.978   5.886   1.00 0.00 ? 274 LYS A HA   6  
ATOM   10504 H  HB2  . LYS B 2 16  ? 19.022  1.184   5.812   1.00 0.00 ? 274 LYS A HB2  6  
ATOM   10505 H  HB3  . LYS B 2 16  ? 19.765  2.383   6.856   1.00 0.00 ? 274 LYS A HB3  6  
ATOM   10506 H  HG2  . LYS B 2 16  ? 19.925  2.675   3.897   1.00 0.00 ? 274 LYS A HG2  6  
ATOM   10507 H  HG3  . LYS B 2 16  ? 18.454  3.143   4.749   1.00 0.00 ? 274 LYS A HG3  6  
ATOM   10508 H  HD2  . LYS B 2 16  ? 19.844  4.624   6.195   1.00 0.00 ? 274 LYS A HD2  6  
ATOM   10509 H  HD3  . LYS B 2 16  ? 21.243  4.198   5.209   1.00 0.00 ? 274 LYS A HD3  6  
ATOM   10510 H  HE2  . LYS B 2 16  ? 20.308  6.328   4.516   1.00 0.00 ? 274 LYS A HE2  6  
ATOM   10511 H  HE3  . LYS B 2 16  ? 20.176  5.109   3.252   1.00 0.00 ? 274 LYS A HE3  6  
ATOM   10512 H  HZ1  . LYS B 2 16  ? 18.129  6.300   3.372   1.00 0.00 ? 274 LYS A HZ1  6  
ATOM   10513 H  HZ2  . LYS B 2 16  ? 18.012  6.061   5.043   1.00 0.00 ? 274 LYS A HZ2  6  
ATOM   10514 H  HZ3  . LYS B 2 16  ? 17.853  4.748   3.989   1.00 0.00 ? 274 LYS A HZ3  6  
ATOM   10515 N  N    . SER B 2 17  ? 21.778  -1.005  6.109   1.00 0.00 ? 275 SER A N    6  
ATOM   10516 C  CA   . SER B 2 17  ? 22.018  -2.267  6.799   1.00 0.00 ? 275 SER A CA   6  
ATOM   10517 C  C    . SER B 2 17  ? 20.708  -2.941  7.102   1.00 0.00 ? 275 SER A C    6  
ATOM   10518 O  O    . SER B 2 17  ? 20.514  -3.524  8.168   1.00 0.00 ? 275 SER A O    6  
ATOM   10519 C  CB   . SER B 2 17  ? 22.857  -2.134  8.067   1.00 0.00 ? 275 SER A CB   6  
ATOM   10520 O  OG   . SER B 2 17  ? 22.154  -1.472  9.104   1.00 0.00 ? 275 SER A OG   6  
ATOM   10521 H  H    . SER B 2 17  ? 21.931  -0.977  5.149   1.00 0.00 ? 275 SER A H    6  
ATOM   10522 H  HA   . SER B 2 17  ? 22.556  -2.899  6.106   1.00 0.00 ? 275 SER A HA   6  
ATOM   10523 H  HB2  . SER B 2 17  ? 23.121  -3.129  8.406   1.00 0.00 ? 275 SER A HB2  6  
ATOM   10524 H  HB3  . SER B 2 17  ? 23.755  -1.586  7.840   1.00 0.00 ? 275 SER A HB3  6  
ATOM   10525 H  HG   . SER B 2 17  ? 21.212  -1.626  9.002   1.00 0.00 ? 275 SER A HG   6  
ATOM   10526 N  N    . GLY B 2 18  ? 19.794  -2.816  6.158   1.00 0.00 ? 276 GLY A N    6  
ATOM   10527 C  CA   . GLY B 2 18  ? 18.510  -3.462  6.297   1.00 0.00 ? 276 GLY A CA   6  
ATOM   10528 C  C    . GLY B 2 18  ? 18.614  -4.924  5.918   1.00 0.00 ? 276 GLY A C    6  
ATOM   10529 O  O    . GLY B 2 18  ? 17.845  -5.769  6.378   1.00 0.00 ? 276 GLY A O    6  
ATOM   10530 H  H    . GLY B 2 18  ? 19.994  -2.260  5.360   1.00 0.00 ? 276 GLY A H    6  
ATOM   10531 H  HA2  . GLY B 2 18  ? 18.182  -3.381  7.316   1.00 0.00 ? 276 GLY A HA2  6  
ATOM   10532 H  HA3  . GLY B 2 18  ? 17.805  -2.974  5.648   1.00 0.00 ? 276 GLY A HA3  6  
ATOM   10533 N  N    . ARG B 2 19  ? 19.581  -5.178  5.045   1.00 0.00 ? 277 ARG A N    6  
ATOM   10534 C  CA   . ARG B 2 19  ? 19.909  -6.512  4.536   1.00 0.00 ? 277 ARG A CA   6  
ATOM   10535 C  C    . ARG B 2 19  ? 18.912  -7.000  3.492   1.00 0.00 ? 277 ARG A C    6  
ATOM   10536 O  O    . ARG B 2 19  ? 17.758  -6.591  3.463   1.00 0.00 ? 277 ARG A O    6  
ATOM   10537 C  CB   . ARG B 2 19  ? 20.017  -7.542  5.650   1.00 0.00 ? 277 ARG A CB   6  
ATOM   10538 C  CG   . ARG B 2 19  ? 21.265  -7.407  6.506   1.00 0.00 ? 277 ARG A CG   6  
ATOM   10539 C  CD   . ARG B 2 19  ? 21.227  -6.152  7.318   1.00 0.00 ? 277 ARG A CD   6  
ATOM   10540 N  NE   . ARG B 2 19  ? 20.091  -6.120  8.238   1.00 0.00 ? 277 ARG A NE   6  
ATOM   10541 C  CZ   . ARG B 2 19  ? 20.203  -6.265  9.555   1.00 0.00 ? 277 ARG A CZ   6  
ATOM   10542 N  NH1  . ARG B 2 19  ? 21.393  -6.456  10.107  1.00 0.00 ? 277 ARG A NH1  6  
ATOM   10543 N  NH2  . ARG B 2 19  ? 19.121  -6.221  10.322  1.00 0.00 ? 277 ARG A NH2  6  
ATOM   10544 H  H    . ARG B 2 19  ? 20.087  -4.418  4.708   1.00 0.00 ? 277 ARG A H    6  
ATOM   10545 H  HA   . ARG B 2 19  ? 20.875  -6.432  4.058   1.00 0.00 ? 277 ARG A HA   6  
ATOM   10546 H  HB2  . ARG B 2 19  ? 19.159  -7.439  6.267   1.00 0.00 ? 277 ARG A HB2  6  
ATOM   10547 H  HB3  . ARG B 2 19  ? 20.016  -8.527  5.214   1.00 0.00 ? 277 ARG A HB3  6  
ATOM   10548 H  HG2  . ARG B 2 19  ? 21.345  -8.255  7.167   1.00 0.00 ? 277 ARG A HG2  6  
ATOM   10549 H  HG3  . ARG B 2 19  ? 22.128  -7.357  5.865   1.00 0.00 ? 277 ARG A HG3  6  
ATOM   10550 H  HD2  . ARG B 2 19  ? 22.145  -6.067  7.880   1.00 0.00 ? 277 ARG A HD2  6  
ATOM   10551 H  HD3  . ARG B 2 19  ? 21.148  -5.338  6.622   1.00 0.00 ? 277 ARG A HD3  6  
ATOM   10552 H  HE   . ARG B 2 19  ? 19.201  -5.983  7.853   1.00 0.00 ? 277 ARG A HE   6  
ATOM   10553 H  HH11 . ARG B 2 19  ? 22.211  -6.491  9.533   1.00 0.00 ? 277 ARG A HH11 6  
ATOM   10554 H  HH12 . ARG B 2 19  ? 21.474  -6.564  11.098  1.00 0.00 ? 277 ARG A HH12 6  
ATOM   10555 H  HH21 . ARG B 2 19  ? 18.222  -6.080  9.910   1.00 0.00 ? 277 ARG A HH21 6  
ATOM   10556 H  HH22 . ARG B 2 19  ? 19.207  -6.332  11.312  1.00 0.00 ? 277 ARG A HH22 6  
ATOM   10557 N  N    . PRO B 2 20  ? 19.371  -7.937  2.659   1.00 0.00 ? 278 PRO A N    6  
ATOM   10558 C  CA   . PRO B 2 20  ? 18.590  -8.507  1.559   1.00 0.00 ? 278 PRO A CA   6  
ATOM   10559 C  C    . PRO B 2 20  ? 17.162  -8.889  1.930   1.00 0.00 ? 278 PRO A C    6  
ATOM   10560 O  O    . PRO B 2 20  ? 16.919  -9.917  2.562   1.00 0.00 ? 278 PRO A O    6  
ATOM   10561 C  CB   . PRO B 2 20  ? 19.386  -9.739  1.157   1.00 0.00 ? 278 PRO A CB   6  
ATOM   10562 C  CG   . PRO B 2 20  ? 20.791  -9.440  1.556   1.00 0.00 ? 278 PRO A CG   6  
ATOM   10563 C  CD   . PRO B 2 20  ? 20.709  -8.533  2.759   1.00 0.00 ? 278 PRO A CD   6  
ATOM   10564 H  HA   . PRO B 2 20  ? 18.557  -7.835  0.725   1.00 0.00 ? 278 PRO A HA   6  
ATOM   10565 H  HB2  . PRO B 2 20  ? 18.996  -10.593 1.670   1.00 0.00 ? 278 PRO A HB2  6  
ATOM   10566 H  HB3  . PRO B 2 20  ? 19.306  -9.890  0.090   1.00 0.00 ? 278 PRO A HB3  6  
ATOM   10567 H  HG2  . PRO B 2 20  ? 21.303  -10.356 1.813   1.00 0.00 ? 278 PRO A HG2  6  
ATOM   10568 H  HG3  . PRO B 2 20  ? 21.298  -8.942  0.743   1.00 0.00 ? 278 PRO A HG3  6  
ATOM   10569 H  HD2  . PRO B 2 20  ? 20.802  -9.093  3.679   1.00 0.00 ? 278 PRO A HD2  6  
ATOM   10570 H  HD3  . PRO B 2 20  ? 21.464  -7.763  2.727   1.00 0.00 ? 278 PRO A HD3  6  
ATOM   10571 N  N    . GLU B 2 21  ? 16.226  -8.038  1.524   1.00 0.00 ? 279 GLU A N    6  
ATOM   10572 C  CA   . GLU B 2 21  ? 14.807  -8.268  1.753   1.00 0.00 ? 279 GLU A CA   6  
ATOM   10573 C  C    . GLU B 2 21  ? 14.110  -8.482  0.416   1.00 0.00 ? 279 GLU A C    6  
ATOM   10574 O  O    . GLU B 2 21  ? 14.194  -9.566  -0.160  1.00 0.00 ? 279 GLU A O    6  
ATOM   10575 C  CB   . GLU B 2 21  ? 14.179  -7.102  2.497   1.00 0.00 ? 279 GLU A CB   6  
ATOM   10576 C  CG   . GLU B 2 21  ? 12.746  -7.377  2.890   1.00 0.00 ? 279 GLU A CG   6  
ATOM   10577 C  CD   . GLU B 2 21  ? 12.615  -8.533  3.862   1.00 0.00 ? 279 GLU A CD   6  
ATOM   10578 O  OE1  . GLU B 2 21  ? 12.677  -8.291  5.085   1.00 0.00 ? 279 GLU A OE1  6  
ATOM   10579 O  OE2  . GLU B 2 21  ? 12.450  -9.682  3.399   1.00 0.00 ? 279 GLU A OE2  6  
ATOM   10580 H  H    . GLU B 2 21  ? 16.502  -7.224  1.054   1.00 0.00 ? 279 GLU A H    6  
ATOM   10581 H  HA   . GLU B 2 21  ? 14.686  -9.153  2.350   1.00 0.00 ? 279 GLU A HA   6  
ATOM   10582 H  HB2  . GLU B 2 21  ? 14.750  -6.906  3.393   1.00 0.00 ? 279 GLU A HB2  6  
ATOM   10583 H  HB3  . GLU B 2 21  ? 14.198  -6.227  1.865   1.00 0.00 ? 279 GLU A HB3  6  
ATOM   10584 H  HG2  . GLU B 2 21  ? 12.343  -6.497  3.347   1.00 0.00 ? 279 GLU A HG2  6  
ATOM   10585 H  HG3  . GLU B 2 21  ? 12.187  -7.612  1.998   1.00 0.00 ? 279 GLU A HG3  6  
ATOM   10586 N  N    . GLU B 2 22  ? 13.447  -7.437  -0.080  1.00 0.00 ? 280 GLU A N    6  
ATOM   10587 C  CA   . GLU B 2 22  ? 12.746  -7.496  -1.358  1.00 0.00 ? 280 GLU A CA   6  
ATOM   10588 C  C    . GLU B 2 22  ? 11.922  -6.243  -1.566  1.00 0.00 ? 280 GLU A C    6  
ATOM   10589 O  O    . GLU B 2 22  ? 10.781  -6.150  -1.113  1.00 0.00 ? 280 GLU A O    6  
ATOM   10590 C  CB   . GLU B 2 22  ? 11.827  -8.707  -1.427  1.00 0.00 ? 280 GLU A CB   6  
ATOM   10591 C  CG   . GLU B 2 22  ? 11.666  -9.248  -2.832  1.00 0.00 ? 280 GLU A CG   6  
ATOM   10592 C  CD   . GLU B 2 22  ? 12.765  -10.220 -3.214  1.00 0.00 ? 280 GLU A CD   6  
ATOM   10593 O  OE1  . GLU B 2 22  ? 12.641  -11.418 -2.882  1.00 0.00 ? 280 GLU A OE1  6  
ATOM   10594 O  OE2  . GLU B 2 22  ? 13.751  -9.783  -3.846  1.00 0.00 ? 280 GLU A OE2  6  
ATOM   10595 H  H    . GLU B 2 22  ? 13.424  -6.601  0.432   1.00 0.00 ? 280 GLU A H    6  
ATOM   10596 H  HA   . GLU B 2 22  ? 13.484  -7.560  -2.155  1.00 0.00 ? 280 GLU A HA   6  
ATOM   10597 H  HB2  . GLU B 2 22  ? 12.221  -9.492  -0.801  1.00 0.00 ? 280 GLU A HB2  6  
ATOM   10598 H  HB3  . GLU B 2 22  ? 10.853  -8.420  -1.063  1.00 0.00 ? 280 GLU A HB3  6  
ATOM   10599 H  HG2  . GLU B 2 22  ? 10.717  -9.752  -2.898  1.00 0.00 ? 280 GLU A HG2  6  
ATOM   10600 H  HG3  . GLU B 2 22  ? 11.683  -8.418  -3.523  1.00 0.00 ? 280 GLU A HG3  6  
ATOM   10601 N  N    . LEU B 2 23  ? 12.518  -5.281  -2.241  1.00 0.00 ? 281 LEU A N    6  
ATOM   10602 C  CA   . LEU B 2 23  ? 11.859  -4.023  -2.537  1.00 0.00 ? 281 LEU A CA   6  
ATOM   10603 C  C    . LEU B 2 23  ? 10.486  -4.214  -3.158  1.00 0.00 ? 281 LEU A C    6  
ATOM   10604 O  O    . LEU B 2 23  ? 10.054  -5.328  -3.454  1.00 0.00 ? 281 LEU A O    6  
ATOM   10605 C  CB   . LEU B 2 23  ? 12.695  -3.228  -3.514  1.00 0.00 ? 281 LEU A CB   6  
ATOM   10606 C  CG   . LEU B 2 23  ? 14.042  -2.787  -3.000  1.00 0.00 ? 281 LEU A CG   6  
ATOM   10607 C  CD1  . LEU B 2 23  ? 14.871  -2.301  -4.154  1.00 0.00 ? 281 LEU A CD1  6  
ATOM   10608 C  CD2  . LEU B 2 23  ? 13.865  -1.695  -1.976  1.00 0.00 ? 281 LEU A CD2  6  
ATOM   10609 H  H    . LEU B 2 23  ? 13.447  -5.412  -2.537  1.00 0.00 ? 281 LEU A H    6  
ATOM   10610 H  HA   . LEU B 2 23  ? 11.762  -3.459  -1.624  1.00 0.00 ? 281 LEU A HA   6  
ATOM   10611 H  HB2  . LEU B 2 23  ? 12.846  -3.822  -4.400  1.00 0.00 ? 281 LEU A HB2  6  
ATOM   10612 H  HB3  . LEU B 2 23  ? 12.145  -2.347  -3.784  1.00 0.00 ? 281 LEU A HB3  6  
ATOM   10613 H  HG   . LEU B 2 23  ? 14.541  -3.618  -2.539  1.00 0.00 ? 281 LEU A HG   6  
ATOM   10614 H  HD11 . LEU B 2 23  ? 14.208  -1.874  -4.879  1.00 0.00 ? 281 LEU A HD11 6  
ATOM   10615 H  HD12 . LEU B 2 23  ? 15.408  -3.130  -4.593  1.00 0.00 ? 281 LEU A HD12 6  
ATOM   10616 H  HD13 . LEU B 2 23  ? 15.569  -1.552  -3.813  1.00 0.00 ? 281 LEU A HD13 6  
ATOM   10617 H  HD21 . LEU B 2 23  ? 13.392  -0.835  -2.433  1.00 0.00 ? 281 LEU A HD21 6  
ATOM   10618 H  HD22 . LEU B 2 23  ? 14.830  -1.409  -1.585  1.00 0.00 ? 281 LEU A HD22 6  
ATOM   10619 H  HD23 . LEU B 2 23  ? 13.243  -2.057  -1.173  1.00 0.00 ? 281 LEU A HD23 6  
ATOM   10620 N  N    . VAL B 2 24  ? 9.823   -3.090  -3.360  1.00 0.00 ? 282 VAL A N    6  
ATOM   10621 C  CA   . VAL B 2 24  ? 8.509   -3.058  -3.992  1.00 0.00 ? 282 VAL A CA   6  
ATOM   10622 C  C    . VAL B 2 24  ? 8.394   -1.755  -4.742  1.00 0.00 ? 282 VAL A C    6  
ATOM   10623 O  O    . VAL B 2 24  ? 8.180   -0.708  -4.134  1.00 0.00 ? 282 VAL A O    6  
ATOM   10624 C  CB   . VAL B 2 24  ? 7.367   -3.120  -2.954  1.00 0.00 ? 282 VAL A CB   6  
ATOM   10625 C  CG1  . VAL B 2 24  ? 7.011   -4.522  -2.557  1.00 0.00 ? 282 VAL A CG1  6  
ATOM   10626 C  CG2  . VAL B 2 24  ? 7.745   -2.375  -1.736  1.00 0.00 ? 282 VAL A CG2  6  
ATOM   10627 H  H    . VAL B 2 24  ? 10.245  -2.234  -3.075  1.00 0.00 ? 282 VAL A H    6  
ATOM   10628 H  HA   . VAL B 2 24  ? 8.422   -3.889  -4.676  1.00 0.00 ? 282 VAL A HA   6  
ATOM   10629 H  HB   . VAL B 2 24  ? 6.489   -2.649  -3.345  1.00 0.00 ? 282 VAL A HB   6  
ATOM   10630 H  HG11 . VAL B 2 24  ? 6.431   -4.462  -1.640  1.00 0.00 ? 282 VAL A HG11 6  
ATOM   10631 H  HG12 . VAL B 2 24  ? 7.912   -5.094  -2.387  1.00 0.00 ? 282 VAL A HG12 6  
ATOM   10632 H  HG13 . VAL B 2 24  ? 6.420   -4.985  -3.333  1.00 0.00 ? 282 VAL A HG13 6  
ATOM   10633 H  HG21 . VAL B 2 24  ? 7.958   -3.089  -0.949  1.00 0.00 ? 282 VAL A HG21 6  
ATOM   10634 H  HG22 . VAL B 2 24  ? 6.926   -1.736  -1.436  1.00 0.00 ? 282 VAL A HG22 6  
ATOM   10635 H  HG23 . VAL B 2 24  ? 8.620   -1.778  -1.933  1.00 0.00 ? 282 VAL A HG23 6  
ATOM   10636 N  N    . SER B 2 25  ? 8.482   -1.815  -6.059  1.00 0.00 ? 283 SER A N    6  
ATOM   10637 C  CA   . SER B 2 25  ? 8.412   -0.605  -6.848  1.00 0.00 ? 283 SER A CA   6  
ATOM   10638 C  C    . SER B 2 25  ? 6.996   -0.321  -7.266  1.00 0.00 ? 283 SER A C    6  
ATOM   10639 O  O    . SER B 2 25  ? 6.109   -1.164  -7.134  1.00 0.00 ? 283 SER A O    6  
ATOM   10640 C  CB   . SER B 2 25  ? 9.301   -0.685  -8.085  1.00 0.00 ? 283 SER A CB   6  
ATOM   10641 O  OG   . SER B 2 25  ? 8.977   -1.816  -8.876  1.00 0.00 ? 283 SER A OG   6  
ATOM   10642 H  H    . SER B 2 25  ? 8.594   -2.681  -6.502  1.00 0.00 ? 283 SER A H    6  
ATOM   10643 H  HA   . SER B 2 25  ? 8.762   0.205   -6.224  1.00 0.00 ? 283 SER A HA   6  
ATOM   10644 H  HB2  . SER B 2 25  ? 9.160   0.215   -8.681  1.00 0.00 ? 283 SER A HB2  6  
ATOM   10645 H  HB3  . SER B 2 25  ? 10.336  -0.759  -7.772  1.00 0.00 ? 283 SER A HB3  6  
ATOM   10646 H  HG   . SER B 2 25  ? 9.630   -1.916  -9.573  1.00 0.00 ? 283 SER A HG   6  
ATOM   10647 N  N    . CYS B 2 26  ? 6.793   0.874   -7.775  1.00 0.00 ? 284 CYS A N    6  
ATOM   10648 C  CA   . CYS B 2 26  ? 5.491   1.279   -8.224  1.00 0.00 ? 284 CYS A CA   6  
ATOM   10649 C  C    . CYS B 2 26  ? 5.434   1.130   -9.733  1.00 0.00 ? 284 CYS A C    6  
ATOM   10650 O  O    . CYS B 2 26  ? 6.314   1.613   -10.447 1.00 0.00 ? 284 CYS A O    6  
ATOM   10651 C  CB   . CYS B 2 26  ? 5.251   2.717   -7.764  1.00 0.00 ? 284 CYS A CB   6  
ATOM   10652 S  SG   . CYS B 2 26  ? 3.754   3.528   -8.395  1.00 0.00 ? 284 CYS A SG   6  
ATOM   10653 H  H    . CYS B 2 26  ? 7.545   1.494   -7.865  1.00 0.00 ? 284 CYS A H    6  
ATOM   10654 H  HA   . CYS B 2 26  ? 4.762   0.626   -7.774  1.00 0.00 ? 284 CYS A HA   6  
ATOM   10655 H  HB2  . CYS B 2 26  ? 5.181   2.722   -6.689  1.00 0.00 ? 284 CYS A HB2  6  
ATOM   10656 H  HB3  . CYS B 2 26  ? 6.090   3.324   -8.051  1.00 0.00 ? 284 CYS A HB3  6  
ATOM   10657 N  N    . ALA B 2 27  ? 4.397   0.462   -10.216 1.00 0.00 ? 285 ALA A N    6  
ATOM   10658 C  CA   . ALA B 2 27  ? 4.255   0.230   -11.641 1.00 0.00 ? 285 ALA A CA   6  
ATOM   10659 C  C    . ALA B 2 27  ? 3.618   1.416   -12.324 1.00 0.00 ? 285 ALA A C    6  
ATOM   10660 O  O    . ALA B 2 27  ? 3.109   1.304   -13.440 1.00 0.00 ? 285 ALA A O    6  
ATOM   10661 C  CB   . ALA B 2 27  ? 3.444   -1.020  -11.889 1.00 0.00 ? 285 ALA A CB   6  
ATOM   10662 H  H    . ALA B 2 27  ? 3.715   0.116   -9.601  1.00 0.00 ? 285 ALA A H    6  
ATOM   10663 H  HA   . ALA B 2 27  ? 5.242   0.077   -12.054 1.00 0.00 ? 285 ALA A HA   6  
ATOM   10664 H  HB1  . ALA B 2 27  ? 2.455   -0.894  -11.470 1.00 0.00 ? 285 ALA A HB1  6  
ATOM   10665 H  HB2  . ALA B 2 27  ? 3.930   -1.864  -11.422 1.00 0.00 ? 285 ALA A HB2  6  
ATOM   10666 H  HB3  . ALA B 2 27  ? 3.364   -1.193  -12.952 1.00 0.00 ? 285 ALA A HB3  6  
ATOM   10667 N  N    . ASP B 2 28  ? 3.648   2.554   -11.653 1.00 0.00 ? 286 ASP A N    6  
ATOM   10668 C  CA   . ASP B 2 28  ? 3.085   3.751   -12.204 1.00 0.00 ? 286 ASP A CA   6  
ATOM   10669 C  C    . ASP B 2 28  ? 4.176   4.778   -12.358 1.00 0.00 ? 286 ASP A C    6  
ATOM   10670 O  O    . ASP B 2 28  ? 4.174   5.571   -13.300 1.00 0.00 ? 286 ASP A O    6  
ATOM   10671 C  CB   . ASP B 2 28  ? 1.996   4.292   -11.291 1.00 0.00 ? 286 ASP A CB   6  
ATOM   10672 C  CG   . ASP B 2 28  ? 1.070   5.258   -12.005 1.00 0.00 ? 286 ASP A CG   6  
ATOM   10673 O  OD1  . ASP B 2 28  ? 1.489   6.409   -12.250 1.00 0.00 ? 286 ASP A OD1  6  
ATOM   10674 O  OD2  . ASP B 2 28  ? -0.071  4.863   -12.321 1.00 0.00 ? 286 ASP A OD2  6  
ATOM   10675 H  H    . ASP B 2 28  ? 4.073   2.594   -10.770 1.00 0.00 ? 286 ASP A H    6  
ATOM   10676 H  HA   . ASP B 2 28  ? 2.665   3.512   -13.169 1.00 0.00 ? 286 ASP A HA   6  
ATOM   10677 H  HB2  . ASP B 2 28  ? 1.412   3.469   -10.912 1.00 0.00 ? 286 ASP A HB2  6  
ATOM   10678 H  HB3  . ASP B 2 28  ? 2.461   4.810   -10.464 1.00 0.00 ? 286 ASP A HB3  6  
ATOM   10679 N  N    . CYS B 2 29  ? 5.122   4.761   -11.420 1.00 0.00 ? 287 CYS A N    6  
ATOM   10680 C  CA   . CYS B 2 29  ? 6.208   5.716   -11.468 1.00 0.00 ? 287 CYS A CA   6  
ATOM   10681 C  C    . CYS B 2 29  ? 7.590   5.097   -11.225 1.00 0.00 ? 287 CYS A C    6  
ATOM   10682 O  O    . CYS B 2 29  ? 8.562   5.503   -11.864 1.00 0.00 ? 287 CYS A O    6  
ATOM   10683 C  CB   . CYS B 2 29  ? 5.884   6.838   -10.505 1.00 0.00 ? 287 CYS A CB   6  
ATOM   10684 S  SG   . CYS B 2 29  ? 6.054   6.460   -8.740  1.00 0.00 ? 287 CYS A SG   6  
ATOM   10685 H  H    . CYS B 2 29  ? 5.056   4.127   -10.662 1.00 0.00 ? 287 CYS A H    6  
ATOM   10686 H  HA   . CYS B 2 29  ? 6.211   6.130   -12.465 1.00 0.00 ? 287 CYS A HA   6  
ATOM   10687 H  HB2  . CYS B 2 29  ? 6.508   7.682   -10.719 1.00 0.00 ? 287 CYS A HB2  6  
ATOM   10688 H  HB3  . CYS B 2 29  ? 4.850   7.092   -10.670 1.00 0.00 ? 287 CYS A HB3  6  
ATOM   10689 N  N    . GLY B 2 30  ? 7.695   4.129   -10.318 1.00 0.00 ? 288 GLY A N    6  
ATOM   10690 C  CA   . GLY B 2 30  ? 8.984   3.490   -10.089 1.00 0.00 ? 288 GLY A CA   6  
ATOM   10691 C  C    . GLY B 2 30  ? 9.546   3.695   -8.693  1.00 0.00 ? 288 GLY A C    6  
ATOM   10692 O  O    . GLY B 2 30  ? 10.760  3.799   -8.522  1.00 0.00 ? 288 GLY A O    6  
ATOM   10693 H  H    . GLY B 2 30  ? 6.909   3.852   -9.804  1.00 0.00 ? 288 GLY A H    6  
ATOM   10694 H  HA2  . GLY B 2 30  ? 8.875   2.430   -10.260 1.00 0.00 ? 288 GLY A HA2  6  
ATOM   10695 H  HA3  . GLY B 2 30  ? 9.692   3.881   -10.806 1.00 0.00 ? 288 GLY A HA3  6  
ATOM   10696 N  N    . ARG B 2 31  ? 8.674   3.752   -7.699  1.00 0.00 ? 289 ARG A N    6  
ATOM   10697 C  CA   . ARG B 2 31  ? 9.106   3.921   -6.317  1.00 0.00 ? 289 ARG A CA   6  
ATOM   10698 C  C    . ARG B 2 31  ? 9.171   2.590   -5.600  1.00 0.00 ? 289 ARG A C    6  
ATOM   10699 O  O    . ARG B 2 31  ? 8.142   2.015   -5.254  1.00 0.00 ? 289 ARG A O    6  
ATOM   10700 C  CB   . ARG B 2 31  ? 8.156   4.821   -5.552  1.00 0.00 ? 289 ARG A CB   6  
ATOM   10701 C  CG   . ARG B 2 31  ? 8.319   6.288   -5.844  1.00 0.00 ? 289 ARG A CG   6  
ATOM   10702 C  CD   . ARG B 2 31  ? 8.099   7.080   -4.580  1.00 0.00 ? 289 ARG A CD   6  
ATOM   10703 N  NE   . ARG B 2 31  ? 6.700   7.082   -4.163  1.00 0.00 ? 289 ARG A NE   6  
ATOM   10704 C  CZ   . ARG B 2 31  ? 6.054   8.170   -3.754  1.00 0.00 ? 289 ARG A CZ   6  
ATOM   10705 N  NH1  . ARG B 2 31  ? 6.678   9.340   -3.718  1.00 0.00 ? 289 ARG A NH1  6  
ATOM   10706 N  NH2  . ARG B 2 31  ? 4.784   8.088   -3.382  1.00 0.00 ? 289 ARG A NH2  6  
ATOM   10707 H  H    . ARG B 2 31  ? 7.723   3.688   -7.896  1.00 0.00 ? 289 ARG A H    6  
ATOM   10708 H  HA   . ARG B 2 31  ? 10.087  4.368   -6.324  1.00 0.00 ? 289 ARG A HA   6  
ATOM   10709 H  HB2  . ARG B 2 31  ? 7.152   4.543   -5.790  1.00 0.00 ? 289 ARG A HB2  6  
ATOM   10710 H  HB3  . ARG B 2 31  ? 8.317   4.671   -4.495  1.00 0.00 ? 289 ARG A HB3  6  
ATOM   10711 H  HG2  . ARG B 2 31  ? 9.319   6.469   -6.211  1.00 0.00 ? 289 ARG A HG2  6  
ATOM   10712 H  HG3  . ARG B 2 31  ? 7.593   6.589   -6.584  1.00 0.00 ? 289 ARG A HG3  6  
ATOM   10713 H  HD2  . ARG B 2 31  ? 8.692   6.626   -3.800  1.00 0.00 ? 289 ARG A HD2  6  
ATOM   10714 H  HD3  . ARG B 2 31  ? 8.419   8.091   -4.743  1.00 0.00 ? 289 ARG A HD3  6  
ATOM   10715 H  HE   . ARG B 2 31  ? 6.220   6.230   -4.185  1.00 0.00 ? 289 ARG A HE   6  
ATOM   10716 H  HH11 . ARG B 2 31  ? 7.636   9.405   -3.998  1.00 0.00 ? 289 ARG A HH11 6  
ATOM   10717 H  HH12 . ARG B 2 31  ? 6.191   10.157  -3.413  1.00 0.00 ? 289 ARG A HH12 6  
ATOM   10718 H  HH21 . ARG B 2 31  ? 4.311   7.208   -3.407  1.00 0.00 ? 289 ARG A HH21 6  
ATOM   10719 H  HH22 . ARG B 2 31  ? 4.300   8.908   -3.074  1.00 0.00 ? 289 ARG A HH22 6  
ATOM   10720 N  N    . SER B 2 32  ? 10.373  2.115   -5.346  1.00 0.00 ? 290 SER A N    6  
ATOM   10721 C  CA   . SER B 2 32  ? 10.534  0.846   -4.656  1.00 0.00 ? 290 SER A CA   6  
ATOM   10722 C  C    . SER B 2 32  ? 10.631  1.070   -3.162  1.00 0.00 ? 290 SER A C    6  
ATOM   10723 O  O    . SER B 2 32  ? 10.938  2.171   -2.715  1.00 0.00 ? 290 SER A O    6  
ATOM   10724 C  CB   . SER B 2 32  ? 11.752  0.077   -5.157  1.00 0.00 ? 290 SER A CB   6  
ATOM   10725 O  OG   . SER B 2 32  ? 11.802  0.060   -6.568  1.00 0.00 ? 290 SER A OG   6  
ATOM   10726 H  H    . SER B 2 32  ? 11.157  2.637   -5.605  1.00 0.00 ? 290 SER A H    6  
ATOM   10727 H  HA   . SER B 2 32  ? 9.656   0.261   -4.853  1.00 0.00 ? 290 SER A HA   6  
ATOM   10728 H  HB2  . SER B 2 32  ? 12.643  0.537   -4.781  1.00 0.00 ? 290 SER A HB2  6  
ATOM   10729 H  HB3  . SER B 2 32  ? 11.700  -0.939  -4.802  1.00 0.00 ? 290 SER A HB3  6  
ATOM   10730 H  HG   . SER B 2 32  ? 11.859  -0.847  -6.876  1.00 0.00 ? 290 SER A HG   6  
ATOM   10731 N  N    . GLY B 2 33  ? 10.340  0.030   -2.392  1.00 0.00 ? 291 GLY A N    6  
ATOM   10732 C  CA   . GLY B 2 33  ? 10.406  0.149   -0.945  1.00 0.00 ? 291 GLY A CA   6  
ATOM   10733 C  C    . GLY B 2 33  ? 10.562  -1.183  -0.258  1.00 0.00 ? 291 GLY A C    6  
ATOM   10734 O  O    . GLY B 2 33  ? 10.218  -2.215  -0.813  1.00 0.00 ? 291 GLY A O    6  
ATOM   10735 H  H    . GLY B 2 33  ? 10.062  -0.821  -2.812  1.00 0.00 ? 291 GLY A H    6  
ATOM   10736 H  HA2  . GLY B 2 33  ? 11.239  0.777   -0.680  1.00 0.00 ? 291 GLY A HA2  6  
ATOM   10737 H  HA3  . GLY B 2 33  ? 9.497   0.615   -0.594  1.00 0.00 ? 291 GLY A HA3  6  
ATOM   10738 N  N    . HIS B 2 34  ? 11.130  -1.194  0.932   1.00 0.00 ? 292 HIS A N    6  
ATOM   10739 C  CA   . HIS B 2 34  ? 11.245  -2.457  1.648   1.00 0.00 ? 292 HIS A CA   6  
ATOM   10740 C  C    . HIS B 2 34  ? 10.054  -2.636  2.566   1.00 0.00 ? 292 HIS A C    6  
ATOM   10741 O  O    . HIS B 2 34  ? 9.868   -1.842  3.477   1.00 0.00 ? 292 HIS A O    6  
ATOM   10742 C  CB   . HIS B 2 34  ? 12.505  -2.490  2.491   1.00 0.00 ? 292 HIS A CB   6  
ATOM   10743 C  CG   . HIS B 2 34  ? 13.753  -2.508  1.686   1.00 0.00 ? 292 HIS A CG   6  
ATOM   10744 N  ND1  . HIS B 2 34  ? 14.749  -1.578  1.846   1.00 0.00 ? 292 HIS A ND1  6  
ATOM   10745 C  CD2  . HIS B 2 34  ? 14.146  -3.328  0.694   1.00 0.00 ? 292 HIS A CD2  6  
ATOM   10746 C  CE1  . HIS B 2 34  ? 15.722  -1.830  0.989   1.00 0.00 ? 292 HIS A CE1  6  
ATOM   10747 N  NE2  . HIS B 2 34  ? 15.382  -2.894  0.280   1.00 0.00 ? 292 HIS A NE2  6  
ATOM   10748 H  H    . HIS B 2 34  ? 11.498  -0.360  1.314   1.00 0.00 ? 292 HIS A H    6  
ATOM   10749 H  HA   . HIS B 2 34  ? 11.273  -3.258  0.927   1.00 0.00 ? 292 HIS A HA   6  
ATOM   10750 H  HB2  . HIS B 2 34  ? 12.526  -1.610  3.124   1.00 0.00 ? 292 HIS A HB2  6  
ATOM   10751 H  HB3  . HIS B 2 34  ? 12.488  -3.377  3.108   1.00 0.00 ? 292 HIS A HB3  6  
ATOM   10752 H  HD2  . HIS B 2 34  ? 13.542  -4.101  0.230   1.00 0.00 ? 292 HIS A HD2  6  
ATOM   10753 H  HE1  . HIS B 2 34  ? 16.599  -1.224  0.831   1.00 0.00 ? 292 HIS A HE1  6  
ATOM   10754 H  HE2  . HIS B 2 34  ? 15.836  -3.189  -0.535  1.00 0.00 ? 292 HIS A HE2  6  
ATOM   10755 N  N    . PRO B 2 35  ? 9.230   -3.678  2.339   1.00 0.00 ? 293 PRO A N    6  
ATOM   10756 C  CA   . PRO B 2 35  ? 8.073   -3.968  3.175   1.00 0.00 ? 293 PRO A CA   6  
ATOM   10757 C  C    . PRO B 2 35  ? 8.308   -3.666  4.657   1.00 0.00 ? 293 PRO A C    6  
ATOM   10758 O  O    . PRO B 2 35  ? 7.365   -3.368  5.389   1.00 0.00 ? 293 PRO A O    6  
ATOM   10759 C  CB   . PRO B 2 35  ? 7.847   -5.463  2.941   1.00 0.00 ? 293 PRO A CB   6  
ATOM   10760 C  CG   . PRO B 2 35  ? 8.550   -5.805  1.659   1.00 0.00 ? 293 PRO A CG   6  
ATOM   10761 C  CD   . PRO B 2 35  ? 9.254   -4.573  1.173   1.00 0.00 ? 293 PRO A CD   6  
ATOM   10762 H  HA   . PRO B 2 35  ? 7.207   -3.411  2.833   1.00 0.00 ? 293 PRO A HA   6  
ATOM   10763 H  HB2  . PRO B 2 35  ? 8.259   -6.021  3.765   1.00 0.00 ? 293 PRO A HB2  6  
ATOM   10764 H  HB3  . PRO B 2 35  ? 6.787   -5.656  2.867   1.00 0.00 ? 293 PRO A HB3  6  
ATOM   10765 H  HG2  . PRO B 2 35  ? 9.268   -6.591  1.838   1.00 0.00 ? 293 PRO A HG2  6  
ATOM   10766 H  HG3  . PRO B 2 35  ? 7.824   -6.127  0.927   1.00 0.00 ? 293 PRO A HG3  6  
ATOM   10767 H  HD2  . PRO B 2 35  ? 10.247  -4.804  0.860   1.00 0.00 ? 293 PRO A HD2  6  
ATOM   10768 H  HD3  . PRO B 2 35  ? 8.713   -4.140  0.359   1.00 0.00 ? 293 PRO A HD3  6  
ATOM   10769 N  N    . THR B 2 36  ? 9.560   -3.758  5.100   1.00 0.00 ? 294 THR A N    6  
ATOM   10770 C  CA   . THR B 2 36  ? 9.900   -3.450  6.485   1.00 0.00 ? 294 THR A CA   6  
ATOM   10771 C  C    . THR B 2 36  ? 9.875   -1.940  6.694   1.00 0.00 ? 294 THR A C    6  
ATOM   10772 O  O    . THR B 2 36  ? 9.220   -1.433  7.605   1.00 0.00 ? 294 THR A O    6  
ATOM   10773 C  CB   . THR B 2 36  ? 11.286  -3.983  6.867   1.00 0.00 ? 294 THR A CB   6  
ATOM   10774 O  OG1  . THR B 2 36  ? 11.502  -5.279  6.297   1.00 0.00 ? 294 THR A OG1  6  
ATOM   10775 C  CG2  . THR B 2 36  ? 11.399  -4.053  8.367   1.00 0.00 ? 294 THR A CG2  6  
ATOM   10776 H  H    . THR B 2 36  ? 10.267  -4.039  4.483   1.00 0.00 ? 294 THR A H    6  
ATOM   10777 H  HA   . THR B 2 36  ? 9.168   -3.907  7.135   1.00 0.00 ? 294 THR A HA   6  
ATOM   10778 H  HB   . THR B 2 36  ? 12.032  -3.298  6.505   1.00 0.00 ? 294 THR A HB   6  
ATOM   10779 H  HG1  . THR B 2 36  ? 11.102  -5.316  5.426   1.00 0.00 ? 294 THR A HG1  6  
ATOM   10780 H  HG21 . THR B 2 36  ? 10.895  -3.199  8.780   1.00 0.00 ? 294 THR A HG21 6  
ATOM   10781 H  HG22 . THR B 2 36  ? 12.439  -4.040  8.657   1.00 0.00 ? 294 THR A HG22 6  
ATOM   10782 H  HG23 . THR B 2 36  ? 10.931  -4.959  8.727   1.00 0.00 ? 294 THR A HG23 6  
ATOM   10783 N  N    . CYS B 2 37  ? 10.605  -1.236  5.837   1.00 0.00 ? 295 CYS A N    6  
ATOM   10784 C  CA   . CYS B 2 37  ? 10.668  0.220   5.871   1.00 0.00 ? 295 CYS A CA   6  
ATOM   10785 C  C    . CYS B 2 37  ? 9.321   0.802   5.461   1.00 0.00 ? 295 CYS A C    6  
ATOM   10786 O  O    . CYS B 2 37  ? 9.064   1.998   5.606   1.00 0.00 ? 295 CYS A O    6  
ATOM   10787 C  CB   . CYS B 2 37  ? 11.755  0.708   4.923   1.00 0.00 ? 295 CYS A CB   6  
ATOM   10788 S  SG   . CYS B 2 37  ? 13.198  -0.389  4.850   1.00 0.00 ? 295 CYS A SG   6  
ATOM   10789 H  H    . CYS B 2 37  ? 11.121  -1.713  5.154   1.00 0.00 ? 295 CYS A H    6  
ATOM   10790 H  HA   . CYS B 2 37  ? 10.903  0.528   6.868   1.00 0.00 ? 295 CYS A HA   6  
ATOM   10791 H  HB2  . CYS B 2 37  ? 11.346  0.788   3.941   1.00 0.00 ? 295 CYS A HB2  6  
ATOM   10792 H  HB3  . CYS B 2 37  ? 12.098  1.671   5.239   1.00 0.00 ? 295 CYS A HB3  6  
ATOM   10793 N  N    . LEU B 2 38  ? 8.475   -0.078  4.947   1.00 0.00 ? 296 LEU A N    6  
ATOM   10794 C  CA   . LEU B 2 38  ? 7.152   0.278   4.465   1.00 0.00 ? 296 LEU A CA   6  
ATOM   10795 C  C    . LEU B 2 38  ? 6.104   0.061   5.545   1.00 0.00 ? 296 LEU A C    6  
ATOM   10796 O  O    . LEU B 2 38  ? 5.016   0.635   5.496   1.00 0.00 ? 296 LEU A O    6  
ATOM   10797 C  CB   . LEU B 2 38  ? 6.819   -0.605  3.276   1.00 0.00 ? 296 LEU A CB   6  
ATOM   10798 C  CG   . LEU B 2 38  ? 7.694   -0.417  2.049   1.00 0.00 ? 296 LEU A CG   6  
ATOM   10799 C  CD1  . LEU B 2 38  ? 7.434   -1.522  1.070   1.00 0.00 ? 296 LEU A CD1  6  
ATOM   10800 C  CD2  . LEU B 2 38  ? 7.433   0.916   1.394   1.00 0.00 ? 296 LEU A CD2  6  
ATOM   10801 H  H    . LEU B 2 38  ? 8.743   -1.021  4.910   1.00 0.00 ? 296 LEU A H    6  
ATOM   10802 H  HA   . LEU B 2 38  ? 7.154   1.313   4.149   1.00 0.00 ? 296 LEU A HA   6  
ATOM   10803 H  HB2  . LEU B 2 38  ? 6.899   -1.635  3.590   1.00 0.00 ? 296 LEU A HB2  6  
ATOM   10804 H  HB3  . LEU B 2 38  ? 5.803   -0.418  2.992   1.00 0.00 ? 296 LEU A HB3  6  
ATOM   10805 H  HG   . LEU B 2 38  ? 8.727   -0.463  2.327   1.00 0.00 ? 296 LEU A HG   6  
ATOM   10806 H  HD11 . LEU B 2 38  ? 7.820   -1.246  0.105   1.00 0.00 ? 296 LEU A HD11 6  
ATOM   10807 H  HD12 . LEU B 2 38  ? 6.380   -1.688  0.996   1.00 0.00 ? 296 LEU A HD12 6  
ATOM   10808 H  HD13 . LEU B 2 38  ? 7.916   -2.419  1.400   1.00 0.00 ? 296 LEU A HD13 6  
ATOM   10809 H  HD21 . LEU B 2 38  ? 6.950   0.743   0.451   1.00 0.00 ? 296 LEU A HD21 6  
ATOM   10810 H  HD22 . LEU B 2 38  ? 8.367   1.430   1.234   1.00 0.00 ? 296 LEU A HD22 6  
ATOM   10811 H  HD23 . LEU B 2 38  ? 6.792   1.513   2.026   1.00 0.00 ? 296 LEU A HD23 6  
ATOM   10812 N  N    . GLN B 2 39  ? 6.451   -0.795  6.505   1.00 0.00 ? 297 GLN A N    6  
ATOM   10813 C  CA   . GLN B 2 39  ? 5.568   -1.140  7.613   1.00 0.00 ? 297 GLN A CA   6  
ATOM   10814 C  C    . GLN B 2 39  ? 4.451   -2.070  7.144   1.00 0.00 ? 297 GLN A C    6  
ATOM   10815 O  O    . GLN B 2 39  ? 3.385   -2.139  7.756   1.00 0.00 ? 297 GLN A O    6  
ATOM   10816 C  CB   . GLN B 2 39  ? 4.980   0.113   8.263   1.00 0.00 ? 297 GLN A CB   6  
ATOM   10817 C  CG   . GLN B 2 39  ? 6.031   1.109   8.721   1.00 0.00 ? 297 GLN A CG   6  
ATOM   10818 C  CD   . GLN B 2 39  ? 5.442   2.466   9.052   1.00 0.00 ? 297 GLN A CD   6  
ATOM   10819 O  OE1  . GLN B 2 39  ? 5.350   3.341   8.191   1.00 0.00 ? 297 GLN A OE1  6  
ATOM   10820 N  NE2  . GLN B 2 39  ? 5.043   2.650   10.304  1.00 0.00 ? 297 GLN A NE2  6  
ATOM   10821 H  H    . GLN B 2 39  ? 7.339   -1.208  6.466   1.00 0.00 ? 297 GLN A H    6  
ATOM   10822 H  HA   . GLN B 2 39  ? 6.163   -1.661  8.341   1.00 0.00 ? 297 GLN A HA   6  
ATOM   10823 H  HB2  . GLN B 2 39  ? 4.336   0.603   7.551   1.00 0.00 ? 297 GLN A HB2  6  
ATOM   10824 H  HB3  . GLN B 2 39  ? 4.398   -0.181  9.123   1.00 0.00 ? 297 GLN A HB3  6  
ATOM   10825 H  HG2  . GLN B 2 39  ? 6.510   0.718   9.605   1.00 0.00 ? 297 GLN A HG2  6  
ATOM   10826 H  HG3  . GLN B 2 39  ? 6.763   1.229   7.937   1.00 0.00 ? 297 GLN A HG3  6  
ATOM   10827 H  HE21 . GLN B 2 39  ? 5.146   1.909   10.937  1.00 0.00 ? 297 GLN A HE21 6  
ATOM   10828 H  HE22 . GLN B 2 39  ? 4.660   3.520   10.545  1.00 0.00 ? 297 GLN A HE22 6  
ATOM   10829 N  N    . PHE B 2 40  ? 4.711   -2.788  6.052   1.00 0.00 ? 298 PHE A N    6  
ATOM   10830 C  CA   . PHE B 2 40  ? 3.740   -3.724  5.487   1.00 0.00 ? 298 PHE A CA   6  
ATOM   10831 C  C    . PHE B 2 40  ? 3.533   -4.935  6.367   1.00 0.00 ? 298 PHE A C    6  
ATOM   10832 O  O    . PHE B 2 40  ? 4.300   -5.201  7.293   1.00 0.00 ? 298 PHE A O    6  
ATOM   10833 C  CB   . PHE B 2 40  ? 4.197   -4.241  4.122   1.00 0.00 ? 298 PHE A CB   6  
ATOM   10834 C  CG   . PHE B 2 40  ? 4.158   -3.238  3.011   1.00 0.00 ? 298 PHE A CG   6  
ATOM   10835 C  CD1  . PHE B 2 40  ? 3.838   -1.905  3.234   1.00 0.00 ? 298 PHE A CD1  6  
ATOM   10836 C  CD2  . PHE B 2 40  ? 4.413   -3.653  1.722   1.00 0.00 ? 298 PHE A CD2  6  
ATOM   10837 C  CE1  . PHE B 2 40  ? 3.786   -1.017  2.178   1.00 0.00 ? 298 PHE A CE1  6  
ATOM   10838 C  CE2  . PHE B 2 40  ? 4.359   -2.772  0.678   1.00 0.00 ? 298 PHE A CE2  6  
ATOM   10839 C  CZ   . PHE B 2 40  ? 4.051   -1.464  0.902   1.00 0.00 ? 298 PHE A CZ   6  
ATOM   10840 H  H    . PHE B 2 40  ? 5.579   -2.682  5.611   1.00 0.00 ? 298 PHE A H    6  
ATOM   10841 H  HA   . PHE B 2 40  ? 2.794   -3.213  5.361   1.00 0.00 ? 298 PHE A HA   6  
ATOM   10842 H  HB2  . PHE B 2 40  ? 5.199   -4.626  4.184   1.00 0.00 ? 298 PHE A HB2  6  
ATOM   10843 H  HB3  . PHE B 2 40  ? 3.539   -5.053  3.846   1.00 0.00 ? 298 PHE A HB3  6  
ATOM   10844 H  HD1  . PHE B 2 40  ? 3.633   -1.564  4.237   1.00 0.00 ? 298 PHE A HD1  6  
ATOM   10845 H  HD2  . PHE B 2 40  ? 4.661   -4.682  1.539   1.00 0.00 ? 298 PHE A HD2  6  
ATOM   10846 H  HE1  . PHE B 2 40  ? 3.544   0.021   2.352   1.00 0.00 ? 298 PHE A HE1  6  
ATOM   10847 H  HE2  . PHE B 2 40  ? 4.553   -3.104  -0.319  1.00 0.00 ? 298 PHE A HE2  6  
ATOM   10848 H  HZ   . PHE B 2 40  ? 4.028   -0.793  0.073   1.00 0.00 ? 298 PHE A HZ   6  
ATOM   10849 N  N    . THR B 2 41  ? 2.475   -5.664  6.052   1.00 0.00 ? 299 THR A N    6  
ATOM   10850 C  CA   . THR B 2 41  ? 2.162   -6.898  6.731   1.00 0.00 ? 299 THR A CA   6  
ATOM   10851 C  C    . THR B 2 41  ? 2.740   -8.024  5.894   1.00 0.00 ? 299 THR A C    6  
ATOM   10852 O  O    . THR B 2 41  ? 3.204   -7.773  4.786   1.00 0.00 ? 299 THR A O    6  
ATOM   10853 C  CB   . THR B 2 41  ? 0.648   -7.100  6.888   1.00 0.00 ? 299 THR A CB   6  
ATOM   10854 O  OG1  . THR B 2 41  ? -0.009  -5.837  7.046   1.00 0.00 ? 299 THR A OG1  6  
ATOM   10855 C  CG2  . THR B 2 41  ? 0.369   -7.973  8.087   1.00 0.00 ? 299 THR A CG2  6  
ATOM   10856 H  H    . THR B 2 41  ? 1.884   -5.356  5.333   1.00 0.00 ? 299 THR A H    6  
ATOM   10857 H  HA   . THR B 2 41  ? 2.626   -6.895  7.707   1.00 0.00 ? 299 THR A HA   6  
ATOM   10858 H  HB   . THR B 2 41  ? 0.271   -7.596  6.010   1.00 0.00 ? 299 THR A HB   6  
ATOM   10859 H  HG1  . THR B 2 41  ? -0.677  -5.735  6.364   1.00 0.00 ? 299 THR A HG1  6  
ATOM   10860 H  HG21 . THR B 2 41  ? 0.931   -8.882  7.985   1.00 0.00 ? 299 THR A HG21 6  
ATOM   10861 H  HG22 . THR B 2 41  ? -0.686  -8.197  8.132   1.00 0.00 ? 299 THR A HG22 6  
ATOM   10862 H  HG23 . THR B 2 41  ? 0.672   -7.457  8.985   1.00 0.00 ? 299 THR A HG23 6  
ATOM   10863 N  N    . LEU B 2 42  ? 2.727   -9.249  6.384   1.00 0.00 ? 300 LEU A N    6  
ATOM   10864 C  CA   . LEU B 2 42  ? 3.287   -10.336 5.601   1.00 0.00 ? 300 LEU A CA   6  
ATOM   10865 C  C    . LEU B 2 42  ? 2.551   -10.506 4.284   1.00 0.00 ? 300 LEU A C    6  
ATOM   10866 O  O    . LEU B 2 42  ? 3.108   -10.225 3.228   1.00 0.00 ? 300 LEU A O    6  
ATOM   10867 C  CB   . LEU B 2 42  ? 3.298   -11.637 6.369   1.00 0.00 ? 300 LEU A CB   6  
ATOM   10868 C  CG   . LEU B 2 42  ? 4.644   -12.359 6.355   1.00 0.00 ? 300 LEU A CG   6  
ATOM   10869 C  CD1  . LEU B 2 42  ? 5.147   -12.535 4.933   1.00 0.00 ? 300 LEU A CD1  6  
ATOM   10870 C  CD2  . LEU B 2 42  ? 5.651   -11.588 7.187   1.00 0.00 ? 300 LEU A CD2  6  
ATOM   10871 H  H    . LEU B 2 42  ? 2.343   -9.424  7.269   1.00 0.00 ? 300 LEU A H    6  
ATOM   10872 H  HA   . LEU B 2 42  ? 4.303   -10.080 5.380   1.00 0.00 ? 300 LEU A HA   6  
ATOM   10873 H  HB2  . LEU B 2 42  ? 3.034   -11.425 7.389   1.00 0.00 ? 300 LEU A HB2  6  
ATOM   10874 H  HB3  . LEU B 2 42  ? 2.560   -12.286 5.941   1.00 0.00 ? 300 LEU A HB3  6  
ATOM   10875 H  HG   . LEU B 2 42  ? 4.527   -13.333 6.784   1.00 0.00 ? 300 LEU A HG   6  
ATOM   10876 H  HD11 . LEU B 2 42  ? 4.314   -12.751 4.285   1.00 0.00 ? 300 LEU A HD11 6  
ATOM   10877 H  HD12 . LEU B 2 42  ? 5.852   -13.351 4.898   1.00 0.00 ? 300 LEU A HD12 6  
ATOM   10878 H  HD13 . LEU B 2 42  ? 5.632   -11.625 4.606   1.00 0.00 ? 300 LEU A HD13 6  
ATOM   10879 H  HD21 . LEU B 2 42  ? 5.550   -10.533 6.971   1.00 0.00 ? 300 LEU A HD21 6  
ATOM   10880 H  HD22 . LEU B 2 42  ? 6.651   -11.913 6.937   1.00 0.00 ? 300 LEU A HD22 6  
ATOM   10881 H  HD23 . LEU B 2 42  ? 5.464   -11.761 8.235   1.00 0.00 ? 300 LEU A HD23 6  
ATOM   10882 N  N    . ASN B 2 43  ? 1.297   -10.946 4.349   1.00 0.00 ? 301 ASN A N    6  
ATOM   10883 C  CA   . ASN B 2 43  ? 0.501   -11.156 3.142   1.00 0.00 ? 301 ASN A CA   6  
ATOM   10884 C  C    . ASN B 2 43  ? 0.723   -10.044 2.129   1.00 0.00 ? 301 ASN A C    6  
ATOM   10885 O  O    . ASN B 2 43  ? 1.004   -10.314 0.966   1.00 0.00 ? 301 ASN A O    6  
ATOM   10886 C  CB   . ASN B 2 43  ? -0.982  -11.249 3.480   1.00 0.00 ? 301 ASN A CB   6  
ATOM   10887 C  CG   . ASN B 2 43  ? -1.431  -12.645 3.841   1.00 0.00 ? 301 ASN A CG   6  
ATOM   10888 O  OD1  . ASN B 2 43  ? -0.642  -13.473 4.297   1.00 0.00 ? 301 ASN A OD1  6  
ATOM   10889 N  ND2  . ASN B 2 43  ? -2.717  -12.907 3.643   1.00 0.00 ? 301 ASN A ND2  6  
ATOM   10890 H  H    . ASN B 2 43  ? 0.899   -11.133 5.225   1.00 0.00 ? 301 ASN A H    6  
ATOM   10891 H  HA   . ASN B 2 43  ? 0.823   -12.085 2.704   1.00 0.00 ? 301 ASN A HA   6  
ATOM   10892 H  HB2  . ASN B 2 43  ? -1.185  -10.609 4.313   1.00 0.00 ? 301 ASN A HB2  6  
ATOM   10893 H  HB3  . ASN B 2 43  ? -1.560  -10.917 2.630   1.00 0.00 ? 301 ASN A HB3  6  
ATOM   10894 H  HD21 . ASN B 2 43  ? -3.283  -12.194 3.281   1.00 0.00 ? 301 ASN A HD21 6  
ATOM   10895 H  HD22 . ASN B 2 43  ? -3.047  -13.796 3.868   1.00 0.00 ? 301 ASN A HD22 6  
ATOM   10896 N  N    . MET B 2 44  ? 0.580   -8.794  2.566   1.00 0.00 ? 302 MET A N    6  
ATOM   10897 C  CA   . MET B 2 44  ? 0.795   -7.660  1.677   1.00 0.00 ? 302 MET A CA   6  
ATOM   10898 C  C    . MET B 2 44  ? 2.194   -7.717  1.122   1.00 0.00 ? 302 MET A C    6  
ATOM   10899 O  O    . MET B 2 44  ? 2.374   -7.743  -0.078  1.00 0.00 ? 302 MET A O    6  
ATOM   10900 C  CB   . MET B 2 44  ? 0.555   -6.347  2.405   1.00 0.00 ? 302 MET A CB   6  
ATOM   10901 C  CG   . MET B 2 44  ? 1.671   -5.356  2.348   1.00 0.00 ? 302 MET A CG   6  
ATOM   10902 S  SD   . MET B 2 44  ? 1.240   -3.848  3.231   1.00 0.00 ? 302 MET A SD   6  
ATOM   10903 C  CE   . MET B 2 44  ? 0.994   -2.718  1.875   1.00 0.00 ? 302 MET A CE   6  
ATOM   10904 H  H    . MET B 2 44  ? 0.327   -8.636  3.500   1.00 0.00 ? 302 MET A H    6  
ATOM   10905 H  HA   . MET B 2 44  ? 0.096   -7.737  0.861   1.00 0.00 ? 302 MET A HA   6  
ATOM   10906 H  HB2  . MET B 2 44  ? -0.300  -5.867  1.988   1.00 0.00 ? 302 MET A HB2  6  
ATOM   10907 H  HB3  . MET B 2 44  ? 0.358   -6.566  3.435   1.00 0.00 ? 302 MET A HB3  6  
ATOM   10908 H  HG2  . MET B 2 44  ? 2.526   -5.802  2.815   1.00 0.00 ? 302 MET A HG2  6  
ATOM   10909 H  HG3  . MET B 2 44  ? 1.896   -5.114  1.308   1.00 0.00 ? 302 MET A HG3  6  
ATOM   10910 H  HE1  . MET B 2 44  ? -0.005  -2.820  1.517   1.00 0.00 ? 302 MET A HE1  6  
ATOM   10911 H  HE2  . MET B 2 44  ? 1.687   -2.948  1.080   1.00 0.00 ? 302 MET A HE2  6  
ATOM   10912 H  HE3  . MET B 2 44  ? 1.155   -1.705  2.214   1.00 0.00 ? 302 MET A HE3  6  
ATOM   10913 N  N    . THR B 2 45  ? 3.182   -7.722  2.007   1.00 0.00 ? 303 THR A N    6  
ATOM   10914 C  CA   . THR B 2 45  ? 4.563   -7.814  1.594   1.00 0.00 ? 303 THR A CA   6  
ATOM   10915 C  C    . THR B 2 45  ? 4.688   -8.793  0.434   1.00 0.00 ? 303 THR A C    6  
ATOM   10916 O  O    . THR B 2 45  ? 5.220   -8.463  -0.621  1.00 0.00 ? 303 THR A O    6  
ATOM   10917 C  CB   . THR B 2 45  ? 5.468   -8.274  2.760   1.00 0.00 ? 303 THR A CB   6  
ATOM   10918 O  OG1  . THR B 2 45  ? 5.483   -7.278  3.790   1.00 0.00 ? 303 THR A OG1  6  
ATOM   10919 C  CG2  . THR B 2 45  ? 6.882   -8.509  2.268   1.00 0.00 ? 303 THR A CG2  6  
ATOM   10920 H  H    . THR B 2 45  ? 2.974   -7.632  2.954   1.00 0.00 ? 303 THR A H    6  
ATOM   10921 H  HA   . THR B 2 45  ? 4.887   -6.835  1.270   1.00 0.00 ? 303 THR A HA   6  
ATOM   10922 H  HB   . THR B 2 45  ? 5.083   -9.205  3.174   1.00 0.00 ? 303 THR A HB   6  
ATOM   10923 H  HG1  . THR B 2 45  ? 5.071   -6.474  3.465   1.00 0.00 ? 303 THR A HG1  6  
ATOM   10924 H  HG21 . THR B 2 45  ? 7.145   -7.729  1.562   1.00 0.00 ? 303 THR A HG21 6  
ATOM   10925 H  HG22 . THR B 2 45  ? 6.941   -9.472  1.784   1.00 0.00 ? 303 THR A HG22 6  
ATOM   10926 H  HG23 . THR B 2 45  ? 7.565   -8.483  3.105   1.00 0.00 ? 303 THR A HG23 6  
ATOM   10927 N  N    . GLU B 2 46  ? 4.123   -9.974  0.631   1.00 0.00 ? 304 GLU A N    6  
ATOM   10928 C  CA   . GLU B 2 46  ? 4.163   -11.040 -0.358  1.00 0.00 ? 304 GLU A CA   6  
ATOM   10929 C  C    . GLU B 2 46  ? 3.365   -10.703 -1.619  1.00 0.00 ? 304 GLU A C    6  
ATOM   10930 O  O    . GLU B 2 46  ? 3.761   -11.063 -2.726  1.00 0.00 ? 304 GLU A O    6  
ATOM   10931 C  CB   . GLU B 2 46  ? 3.602   -12.318 0.263   1.00 0.00 ? 304 GLU A CB   6  
ATOM   10932 C  CG   . GLU B 2 46  ? 4.144   -12.590 1.651   1.00 0.00 ? 304 GLU A CG   6  
ATOM   10933 C  CD   . GLU B 2 46  ? 3.914   -14.020 2.100   1.00 0.00 ? 304 GLU A CD   6  
ATOM   10934 O  OE1  . GLU B 2 46  ? 2.782   -14.334 2.524   1.00 0.00 ? 304 GLU A OE1  6  
ATOM   10935 O  OE2  . GLU B 2 46  ? 4.865   -14.826 2.027   1.00 0.00 ? 304 GLU A OE2  6  
ATOM   10936 H  H    . GLU B 2 46  ? 3.657   -10.136 1.475   1.00 0.00 ? 304 GLU A H    6  
ATOM   10937 H  HA   . GLU B 2 46  ? 5.198   -11.204 -0.623  1.00 0.00 ? 304 GLU A HA   6  
ATOM   10938 H  HB2  . GLU B 2 46  ? 2.525   -12.226 0.337   1.00 0.00 ? 304 GLU A HB2  6  
ATOM   10939 H  HB3  . GLU B 2 46  ? 3.846   -13.156 -0.371  1.00 0.00 ? 304 GLU A HB3  6  
ATOM   10940 H  HG2  . GLU B 2 46  ? 5.198   -12.388 1.653   1.00 0.00 ? 304 GLU A HG2  6  
ATOM   10941 H  HG3  . GLU B 2 46  ? 3.657   -11.928 2.345   1.00 0.00 ? 304 GLU A HG3  6  
ATOM   10942 N  N    . ALA B 2 47  ? 2.245   -10.010 -1.444  1.00 0.00 ? 305 ALA A N    6  
ATOM   10943 C  CA   . ALA B 2 47  ? 1.370   -9.662  -2.568  1.00 0.00 ? 305 ALA A CA   6  
ATOM   10944 C  C    . ALA B 2 47  ? 1.917   -8.509  -3.395  1.00 0.00 ? 305 ALA A C    6  
ATOM   10945 O  O    . ALA B 2 47  ? 1.747   -8.469  -4.611  1.00 0.00 ? 305 ALA A O    6  
ATOM   10946 C  CB   . ALA B 2 47  ? -0.024  -9.307  -2.058  1.00 0.00 ? 305 ALA A CB   6  
ATOM   10947 H  H    . ALA B 2 47  ? 2.006   -9.713  -0.536  1.00 0.00 ? 305 ALA A H    6  
ATOM   10948 H  HA   . ALA B 2 47  ? 1.279   -10.531 -3.200  1.00 0.00 ? 305 ALA A HA   6  
ATOM   10949 H  HB1  . ALA B 2 47  ? -0.130  -8.225  -1.998  1.00 0.00 ? 305 ALA A HB1  6  
ATOM   10950 H  HB2  . ALA B 2 47  ? -0.168  -9.736  -1.077  1.00 0.00 ? 305 ALA A HB2  6  
ATOM   10951 H  HB3  . ALA B 2 47  ? -0.766  -9.703  -2.735  1.00 0.00 ? 305 ALA A HB3  6  
ATOM   10952 N  N    . VAL B 2 48  ? 2.594   -7.598  -2.725  1.00 0.00 ? 306 VAL A N    6  
ATOM   10953 C  CA   . VAL B 2 48  ? 3.135   -6.406  -3.345  1.00 0.00 ? 306 VAL A CA   6  
ATOM   10954 C  C    . VAL B 2 48  ? 4.380   -6.681  -4.183  1.00 0.00 ? 306 VAL A C    6  
ATOM   10955 O  O    . VAL B 2 48  ? 4.602   -6.031  -5.204  1.00 0.00 ? 306 VAL A O    6  
ATOM   10956 C  CB   . VAL B 2 48  ? 3.445   -5.351  -2.274  1.00 0.00 ? 306 VAL A CB   6  
ATOM   10957 C  CG1  . VAL B 2 48  ? 2.192   -4.919  -1.571  1.00 0.00 ? 306 VAL A CG1  6  
ATOM   10958 C  CG2  . VAL B 2 48  ? 4.452   -5.848  -1.269  1.00 0.00 ? 306 VAL A CG2  6  
ATOM   10959 H  H    . VAL B 2 48  ? 2.751   -7.739  -1.776  1.00 0.00 ? 306 VAL A H    6  
ATOM   10960 H  HA   . VAL B 2 48  ? 2.375   -5.999  -3.987  1.00 0.00 ? 306 VAL A HA   6  
ATOM   10961 H  HB   . VAL B 2 48  ? 3.850   -4.490  -2.751  1.00 0.00 ? 306 VAL A HB   6  
ATOM   10962 H  HG11 . VAL B 2 48  ? 2.260   -3.857  -1.404  1.00 0.00 ? 306 VAL A HG11 6  
ATOM   10963 H  HG12 . VAL B 2 48  ? 2.107   -5.434  -0.625  1.00 0.00 ? 306 VAL A HG12 6  
ATOM   10964 H  HG13 . VAL B 2 48  ? 1.334   -5.136  -2.186  1.00 0.00 ? 306 VAL A HG13 6  
ATOM   10965 H  HG21 . VAL B 2 48  ? 5.020   -5.009  -0.911  1.00 0.00 ? 306 VAL A HG21 6  
ATOM   10966 H  HG22 . VAL B 2 48  ? 5.113   -6.562  -1.735  1.00 0.00 ? 306 VAL A HG22 6  
ATOM   10967 H  HG23 . VAL B 2 48  ? 3.938   -6.313  -0.440  1.00 0.00 ? 306 VAL A HG23 6  
ATOM   10968 N  N    . LYS B 2 49  ? 5.190   -7.638  -3.755  1.00 0.00 ? 307 LYS A N    6  
ATOM   10969 C  CA   . LYS B 2 49  ? 6.406   -7.988  -4.482  1.00 0.00 ? 307 LYS A CA   6  
ATOM   10970 C  C    . LYS B 2 49  ? 6.090   -8.631  -5.823  1.00 0.00 ? 307 LYS A C    6  
ATOM   10971 O  O    . LYS B 2 49  ? 6.768   -8.385  -6.822  1.00 0.00 ? 307 LYS A O    6  
ATOM   10972 C  CB   . LYS B 2 49  ? 7.240   -8.952  -3.666  1.00 0.00 ? 307 LYS A CB   6  
ATOM   10973 C  CG   . LYS B 2 49  ? 8.070   -8.279  -2.591  1.00 0.00 ? 307 LYS A CG   6  
ATOM   10974 C  CD   . LYS B 2 49  ? 8.559   -9.287  -1.566  1.00 0.00 ? 307 LYS A CD   6  
ATOM   10975 C  CE   . LYS B 2 49  ? 7.404   -9.974  -0.873  1.00 0.00 ? 307 LYS A CE   6  
ATOM   10976 N  NZ   . LYS B 2 49  ? 7.647   -11.430 -0.677  1.00 0.00 ? 307 LYS A NZ   6  
ATOM   10977 H  H    . LYS B 2 49  ? 4.971   -8.118  -2.926  1.00 0.00 ? 307 LYS A H    6  
ATOM   10978 H  HA   . LYS B 2 49  ? 6.974   -7.091  -4.638  1.00 0.00 ? 307 LYS A HA   6  
ATOM   10979 H  HB2  . LYS B 2 49  ? 6.576   -9.648  -3.193  1.00 0.00 ? 307 LYS A HB2  6  
ATOM   10980 H  HB3  . LYS B 2 49  ? 7.901   -9.490  -4.326  1.00 0.00 ? 307 LYS A HB3  6  
ATOM   10981 H  HG2  . LYS B 2 49  ? 8.922   -7.803  -3.054  1.00 0.00 ? 307 LYS A HG2  6  
ATOM   10982 H  HG3  . LYS B 2 49  ? 7.464   -7.535  -2.096  1.00 0.00 ? 307 LYS A HG3  6  
ATOM   10983 H  HD2  . LYS B 2 49  ? 9.163   -10.032 -2.062  1.00 0.00 ? 307 LYS A HD2  6  
ATOM   10984 H  HD3  . LYS B 2 49  ? 9.153   -8.774  -0.825  1.00 0.00 ? 307 LYS A HD3  6  
ATOM   10985 H  HE2  . LYS B 2 49  ? 7.254   -9.507  0.084   1.00 0.00 ? 307 LYS A HE2  6  
ATOM   10986 H  HE3  . LYS B 2 49  ? 6.514   -9.837  -1.470  1.00 0.00 ? 307 LYS A HE3  6  
ATOM   10987 H  HZ1  . LYS B 2 49  ? 6.851   -11.860 -0.162  1.00 0.00 ? 307 LYS A HZ1  6  
ATOM   10988 H  HZ2  . LYS B 2 49  ? 8.519   -11.576 -0.129  1.00 0.00 ? 307 LYS A HZ2  6  
ATOM   10989 H  HZ3  . LYS B 2 49  ? 7.745   -11.902 -1.598  1.00 0.00 ? 307 LYS A HZ3  6  
ATOM   10990 N  N    . THR B 2 50  ? 5.054   -9.455  -5.831  1.00 0.00 ? 308 THR A N    6  
ATOM   10991 C  CA   . THR B 2 50  ? 4.652   -10.177 -7.028  1.00 0.00 ? 308 THR A CA   6  
ATOM   10992 C  C    . THR B 2 50  ? 3.972   -9.276  -8.042  1.00 0.00 ? 308 THR A C    6  
ATOM   10993 O  O    . THR B 2 50  ? 4.295   -9.313  -9.228  1.00 0.00 ? 308 THR A O    6  
ATOM   10994 C  CB   . THR B 2 50  ? 3.704   -11.331 -6.678  1.00 0.00 ? 308 THR A CB   6  
ATOM   10995 O  OG1  . THR B 2 50  ? 2.393   -10.827 -6.391  1.00 0.00 ? 308 THR A OG1  6  
ATOM   10996 C  CG2  . THR B 2 50  ? 4.240   -12.075 -5.476  1.00 0.00 ? 308 THR A CG2  6  
ATOM   10997 H  H    . THR B 2 50  ? 4.540   -9.579  -5.006  1.00 0.00 ? 308 THR A H    6  
ATOM   10998 H  HA   . THR B 2 50  ? 5.540   -10.600 -7.469  1.00 0.00 ? 308 THR A HA   6  
ATOM   10999 H  HB   . THR B 2 50  ? 3.653   -12.011 -7.516  1.00 0.00 ? 308 THR A HB   6  
ATOM   11000 H  HG1  . THR B 2 50  ? 1.783   -11.111 -7.076  1.00 0.00 ? 308 THR A HG1  6  
ATOM   11001 H  HG21 . THR B 2 50  ? 4.794   -11.381 -4.861  1.00 0.00 ? 308 THR A HG21 6  
ATOM   11002 H  HG22 . THR B 2 50  ? 4.894   -12.872 -5.804  1.00 0.00 ? 308 THR A HG22 6  
ATOM   11003 H  HG23 . THR B 2 50  ? 3.420   -12.489 -4.909  1.00 0.00 ? 308 THR A HG23 6  
ATOM   11004 N  N    . TYR B 2 51  ? 3.030   -8.466  -7.575  1.00 0.00 ? 309 TYR A N    6  
ATOM   11005 C  CA   . TYR B 2 51  ? 2.302   -7.586  -8.473  1.00 0.00 ? 309 TYR A CA   6  
ATOM   11006 C  C    . TYR B 2 51  ? 2.745   -6.125  -8.342  1.00 0.00 ? 309 TYR A C    6  
ATOM   11007 O  O    . TYR B 2 51  ? 3.771   -5.821  -7.736  1.00 0.00 ? 309 TYR A O    6  
ATOM   11008 C  CB   . TYR B 2 51  ? 0.785   -7.779  -8.278  1.00 0.00 ? 309 TYR A CB   6  
ATOM   11009 C  CG   . TYR B 2 51  ? 0.059   -6.696  -7.516  1.00 0.00 ? 309 TYR A CG   6  
ATOM   11010 C  CD1  . TYR B 2 51  ? 0.398   -6.388  -6.216  1.00 0.00 ? 309 TYR A CD1  6  
ATOM   11011 C  CD2  . TYR B 2 51  ? -0.995  -6.003  -8.103  1.00 0.00 ? 309 TYR A CD2  6  
ATOM   11012 C  CE1  . TYR B 2 51  ? -0.283  -5.424  -5.514  1.00 0.00 ? 309 TYR A CE1  6  
ATOM   11013 C  CE2  . TYR B 2 51  ? -1.680  -5.028  -7.409  1.00 0.00 ? 309 TYR A CE2  6  
ATOM   11014 C  CZ   . TYR B 2 51  ? -1.320  -4.742  -6.111  1.00 0.00 ? 309 TYR A CZ   6  
ATOM   11015 O  OH   . TYR B 2 51  ? -2.002  -3.776  -5.407  1.00 0.00 ? 309 TYR A OH   6  
ATOM   11016 H  H    . TYR B 2 51  ? 2.821   -8.467  -6.615  1.00 0.00 ? 309 TYR A H    6  
ATOM   11017 H  HA   . TYR B 2 51  ? 2.546   -7.904  -9.477  1.00 0.00 ? 309 TYR A HA   6  
ATOM   11018 H  HB2  . TYR B 2 51  ? 0.324   -7.843  -9.242  1.00 0.00 ? 309 TYR A HB2  6  
ATOM   11019 H  HB3  . TYR B 2 51  ? 0.623   -8.710  -7.755  1.00 0.00 ? 309 TYR A HB3  6  
ATOM   11020 H  HD1  . TYR B 2 51  ? 1.215   -6.912  -5.752  1.00 0.00 ? 309 TYR A HD1  6  
ATOM   11021 H  HD2  . TYR B 2 51  ? -1.272  -6.234  -9.122  1.00 0.00 ? 309 TYR A HD2  6  
ATOM   11022 H  HE1  . TYR B 2 51  ? -0.002  -5.208  -4.503  1.00 0.00 ? 309 TYR A HE1  6  
ATOM   11023 H  HE2  . TYR B 2 51  ? -2.493  -4.497  -7.881  1.00 0.00 ? 309 TYR A HE2  6  
ATOM   11024 H  HH   . TYR B 2 51  ? -2.946  -3.892  -5.534  1.00 0.00 ? 309 TYR A HH   6  
ATOM   11025 N  N    . LYS B 2 52  ? 1.953   -5.241  -8.928  1.00 0.00 ? 310 LYS A N    6  
ATOM   11026 C  CA   . LYS B 2 52  ? 2.231   -3.812  -8.971  1.00 0.00 ? 310 LYS A CA   6  
ATOM   11027 C  C    . LYS B 2 52  ? 2.548   -3.189  -7.618  1.00 0.00 ? 310 LYS A C    6  
ATOM   11028 O  O    . LYS B 2 52  ? 3.670   -2.744  -7.374  1.00 0.00 ? 310 LYS A O    6  
ATOM   11029 C  CB   . LYS B 2 52  ? 1.029   -3.094  -9.555  1.00 0.00 ? 310 LYS A CB   6  
ATOM   11030 C  CG   . LYS B 2 52  ? 0.508   -3.739  -10.794 1.00 0.00 ? 310 LYS A CG   6  
ATOM   11031 C  CD   . LYS B 2 52  ? 1.061   -3.067  -12.007 1.00 0.00 ? 310 LYS A CD   6  
ATOM   11032 C  CE   . LYS B 2 52  ? 0.720   -3.803  -13.284 1.00 0.00 ? 310 LYS A CE   6  
ATOM   11033 N  NZ   . LYS B 2 52  ? -0.566  -4.548  -13.182 1.00 0.00 ? 310 LYS A NZ   6  
ATOM   11034 H  H    . LYS B 2 52  ? 1.126   -5.561  -9.336  1.00 0.00 ? 310 LYS A H    6  
ATOM   11035 H  HA   . LYS B 2 52  ? 3.054   -3.660  -9.631  1.00 0.00 ? 310 LYS A HA   6  
ATOM   11036 H  HB2  . LYS B 2 52  ? 0.251   -3.082  -8.831  1.00 0.00 ? 310 LYS A HB2  6  
ATOM   11037 H  HB3  . LYS B 2 52  ? 1.303   -2.093  -9.802  1.00 0.00 ? 310 LYS A HB3  6  
ATOM   11038 H  HG2  . LYS B 2 52  ? 0.833   -4.749  -10.790 1.00 0.00 ? 310 LYS A HG2  6  
ATOM   11039 H  HG3  . LYS B 2 52  ? -0.558  -3.681  -10.809 1.00 0.00 ? 310 LYS A HG3  6  
ATOM   11040 H  HD2  . LYS B 2 52  ? 0.681   -2.059  -12.064 1.00 0.00 ? 310 LYS A HD2  6  
ATOM   11041 H  HD3  . LYS B 2 52  ? 2.121   -3.051  -11.889 1.00 0.00 ? 310 LYS A HD3  6  
ATOM   11042 H  HE2  . LYS B 2 52  ? 0.649   -3.087  -14.089 1.00 0.00 ? 310 LYS A HE2  6  
ATOM   11043 H  HE3  . LYS B 2 52  ? 1.517   -4.495  -13.491 1.00 0.00 ? 310 LYS A HE3  6  
ATOM   11044 H  HZ1  . LYS B 2 52  ? -0.506  -5.265  -12.431 1.00 0.00 ? 310 LYS A HZ1  6  
ATOM   11045 H  HZ2  . LYS B 2 52  ? -0.777  -5.022  -14.082 1.00 0.00 ? 310 LYS A HZ2  6  
ATOM   11046 H  HZ3  . LYS B 2 52  ? -1.342  -3.892  -12.958 1.00 0.00 ? 310 LYS A HZ3  6  
ATOM   11047 N  N    . TRP B 2 53  ? 1.537   -3.166  -6.759  1.00 0.00 ? 311 TRP A N    6  
ATOM   11048 C  CA   . TRP B 2 53  ? 1.607   -2.528  -5.449  1.00 0.00 ? 311 TRP A CA   6  
ATOM   11049 C  C    . TRP B 2 53  ? 1.450   -1.030  -5.640  1.00 0.00 ? 311 TRP A C    6  
ATOM   11050 O  O    . TRP B 2 53  ? 0.566   -0.413  -5.047  1.00 0.00 ? 311 TRP A O    6  
ATOM   11051 C  CB   . TRP B 2 53  ? 2.893   -2.826  -4.649  1.00 0.00 ? 311 TRP A CB   6  
ATOM   11052 C  CG   . TRP B 2 53  ? 3.068   -1.866  -3.511  1.00 0.00 ? 311 TRP A CG   6  
ATOM   11053 C  CD1  . TRP B 2 53  ? 2.362   -1.864  -2.353  1.00 0.00 ? 311 TRP A CD1  6  
ATOM   11054 C  CD2  . TRP B 2 53  ? 3.982   -0.764  -3.418  1.00 0.00 ? 311 TRP A CD2  6  
ATOM   11055 N  NE1  . TRP B 2 53  ? 2.778   -0.855  -1.539  1.00 0.00 ? 311 TRP A NE1  6  
ATOM   11056 C  CE2  . TRP B 2 53  ? 3.776   -0.167  -2.161  1.00 0.00 ? 311 TRP A CE2  6  
ATOM   11057 C  CE3  . TRP B 2 53  ? 4.959   -0.228  -4.256  1.00 0.00 ? 311 TRP A CE3  6  
ATOM   11058 C  CZ2  . TRP B 2 53  ? 4.505   0.926   -1.719  1.00 0.00 ? 311 TRP A CZ2  6  
ATOM   11059 C  CZ3  . TRP B 2 53  ? 5.686   0.866   -3.810  1.00 0.00 ? 311 TRP A CZ3  6  
ATOM   11060 C  CH2  . TRP B 2 53  ? 5.457   1.427   -2.547  1.00 0.00 ? 311 TRP A CH2  6  
ATOM   11061 H  H    . TRP B 2 53  ? 0.698   -3.603  -7.019  1.00 0.00 ? 311 TRP A H    6  
ATOM   11062 H  HA   . TRP B 2 53  ? 0.756   -2.881  -4.882  1.00 0.00 ? 311 TRP A HA   6  
ATOM   11063 H  HB2  . TRP B 2 53  ? 2.822   -3.819  -4.234  1.00 0.00 ? 311 TRP A HB2  6  
ATOM   11064 H  HB3  . TRP B 2 53  ? 3.771   -2.770  -5.273  1.00 0.00 ? 311 TRP A HB3  6  
ATOM   11065 H  HD1  . TRP B 2 53  ? 1.593   -2.578  -2.118  1.00 0.00 ? 311 TRP A HD1  6  
ATOM   11066 H  HE1  . TRP B 2 53  ? 2.422   -0.661  -0.647  1.00 0.00 ? 311 TRP A HE1  6  
ATOM   11067 H  HE3  . TRP B 2 53  ? 5.139   -0.637  -5.239  1.00 0.00 ? 311 TRP A HE3  6  
ATOM   11068 H  HZ2  . TRP B 2 53  ? 4.341   1.363   -0.747  1.00 0.00 ? 311 TRP A HZ2  6  
ATOM   11069 H  HZ3  . TRP B 2 53  ? 6.450   1.287   -4.435  1.00 0.00 ? 311 TRP A HZ3  6  
ATOM   11070 H  HH2  . TRP B 2 53  ? 6.051   2.275   -2.234  1.00 0.00 ? 311 TRP A HH2  6  
ATOM   11071 N  N    . GLN B 2 54  ? 2.299   -0.462  -6.495  1.00 0.00 ? 312 GLN A N    6  
ATOM   11072 C  CA   . GLN B 2 54  ? 2.265   0.964   -6.785  1.00 0.00 ? 312 GLN A CA   6  
ATOM   11073 C  C    . GLN B 2 54  ? 2.464   1.780   -5.511  1.00 0.00 ? 312 GLN A C    6  
ATOM   11074 O  O    . GLN B 2 54  ? 1.926   1.444   -4.457  1.00 0.00 ? 312 GLN A O    6  
ATOM   11075 C  CB   . GLN B 2 54  ? 0.935   1.342   -7.442  1.00 0.00 ? 312 GLN A CB   6  
ATOM   11076 C  CG   . GLN B 2 54  ? 0.689   0.641   -8.769  1.00 0.00 ? 312 GLN A CG   6  
ATOM   11077 C  CD   . GLN B 2 54  ? -0.641  1.018   -9.395  1.00 0.00 ? 312 GLN A CD   6  
ATOM   11078 O  OE1  . GLN B 2 54  ? -1.262  0.215   -10.091 1.00 0.00 ? 312 GLN A OE1  6  
ATOM   11079 N  NE2  . GLN B 2 54  ? -1.083  2.248   -9.157  1.00 0.00 ? 312 GLN A NE2  6  
ATOM   11080 H  H    . GLN B 2 54  ? 2.967   -1.020  -6.943  1.00 0.00 ? 312 GLN A H    6  
ATOM   11081 H  HA   . GLN B 2 54  ? 3.064   1.179   -7.477  1.00 0.00 ? 312 GLN A HA   6  
ATOM   11082 H  HB2  . GLN B 2 54  ? 0.130   1.086   -6.772  1.00 0.00 ? 312 GLN A HB2  6  
ATOM   11083 H  HB3  . GLN B 2 54  ? 0.922   2.408   -7.615  1.00 0.00 ? 312 GLN A HB3  6  
ATOM   11084 H  HG2  . GLN B 2 54  ? 1.480   0.909   -9.454  1.00 0.00 ? 312 GLN A HG2  6  
ATOM   11085 H  HG3  . GLN B 2 54  ? 0.703   -0.427  -8.606  1.00 0.00 ? 312 GLN A HG3  6  
ATOM   11086 H  HE21 . GLN B 2 54  ? -0.532  2.839   -8.598  1.00 0.00 ? 312 GLN A HE21 6  
ATOM   11087 H  HE22 . GLN B 2 54  ? -1.942  2.515   -9.551  1.00 0.00 ? 312 GLN A HE22 6  
ATOM   11088 N  N    . CYS B 2 55  ? 3.245   2.849   -5.595  1.00 0.00 ? 313 CYS A N    6  
ATOM   11089 C  CA   . CYS B 2 55  ? 3.468   3.694   -4.443  1.00 0.00 ? 313 CYS A CA   6  
ATOM   11090 C  C    . CYS B 2 55  ? 2.123   4.280   -4.025  1.00 0.00 ? 313 CYS A C    6  
ATOM   11091 O  O    . CYS B 2 55  ? 1.108   3.997   -4.660  1.00 0.00 ? 313 CYS A O    6  
ATOM   11092 C  CB   . CYS B 2 55  ? 4.511   4.783   -4.735  1.00 0.00 ? 313 CYS A CB   6  
ATOM   11093 S  SG   . CYS B 2 55  ? 3.867   6.203   -5.654  1.00 0.00 ? 313 CYS A SG   6  
ATOM   11094 H  H    . CYS B 2 55  ? 3.665   3.072   -6.437  1.00 0.00 ? 313 CYS A H    6  
ATOM   11095 H  HA   . CYS B 2 55  ? 3.829   3.064   -3.643  1.00 0.00 ? 313 CYS A HA   6  
ATOM   11096 H  HB2  . CYS B 2 55  ? 4.898   5.154   -3.797  1.00 0.00 ? 313 CYS A HB2  6  
ATOM   11097 H  HB3  . CYS B 2 55  ? 5.332   4.363   -5.312  1.00 0.00 ? 313 CYS A HB3  6  
ATOM   11098 N  N    . ILE B 2 56  ? 2.096   5.106   -2.996  1.00 0.00 ? 314 ILE A N    6  
ATOM   11099 C  CA   . ILE B 2 56  ? 0.825   5.622   -2.502  1.00 0.00 ? 314 ILE A CA   6  
ATOM   11100 C  C    . ILE B 2 56  ? 0.145   6.653   -3.407  1.00 0.00 ? 314 ILE A C    6  
ATOM   11101 O  O    . ILE B 2 56  ? -1.059  6.609   -3.636  1.00 0.00 ? 314 ILE A O    6  
ATOM   11102 C  CB   . ILE B 2 56  ? 0.973   6.152   -1.081  1.00 0.00 ? 314 ILE A CB   6  
ATOM   11103 C  CG1  . ILE B 2 56  ? 0.056   5.395   -0.150  1.00 0.00 ? 314 ILE A CG1  6  
ATOM   11104 C  CG2  . ILE B 2 56  ? 0.723   7.626   -0.965  1.00 0.00 ? 314 ILE A CG2  6  
ATOM   11105 C  CD1  . ILE B 2 56  ? -1.411  5.495   -0.392  1.00 0.00 ? 314 ILE A CD1  6  
ATOM   11106 H  H    . ILE B 2 56  ? 2.934   5.373   -2.563  1.00 0.00 ? 314 ILE A H    6  
ATOM   11107 H  HA   . ILE B 2 56  ? 0.177   4.775   -2.440  1.00 0.00 ? 314 ILE A HA   6  
ATOM   11108 H  HB   . ILE B 2 56  ? 1.976   5.953   -0.784  1.00 0.00 ? 314 ILE A HB   6  
ATOM   11109 H  HG12 . ILE B 2 56  ? 0.294   4.388   -0.236  1.00 0.00 ? 314 ILE A HG12 6  
ATOM   11110 H  HG13 . ILE B 2 56  ? 0.225   5.723   0.839   1.00 0.00 ? 314 ILE A HG13 6  
ATOM   11111 H  HG21 . ILE B 2 56  ? -0.333  7.778   -0.927  1.00 0.00 ? 314 ILE A HG21 6  
ATOM   11112 H  HG22 . ILE B 2 56  ? 1.141   8.140   -1.816  1.00 0.00 ? 314 ILE A HG22 6  
ATOM   11113 H  HG23 . ILE B 2 56  ? 1.174   7.998   -0.053  1.00 0.00 ? 314 ILE A HG23 6  
ATOM   11114 H  HD11 . ILE B 2 56  ? -1.599  6.268   -1.078  1.00 0.00 ? 314 ILE A HD11 6  
ATOM   11115 H  HD12 . ILE B 2 56  ? -1.917  5.701   0.536   1.00 0.00 ? 314 ILE A HD12 6  
ATOM   11116 H  HD13 . ILE B 2 56  ? -1.773  4.567   -0.785  1.00 0.00 ? 314 ILE A HD13 6  
ATOM   11117 N  N    . GLU B 2 57  ? 0.897   7.583   -3.894  1.00 0.00 ? 315 GLU A N    6  
ATOM   11118 C  CA   . GLU B 2 57  ? 0.352   8.618   -4.745  1.00 0.00 ? 315 GLU A CA   6  
ATOM   11119 C  C    . GLU B 2 57  ? -0.281  8.086   -6.040  1.00 0.00 ? 315 GLU A C    6  
ATOM   11120 O  O    . GLU B 2 57  ? -1.199  8.708   -6.574  1.00 0.00 ? 315 GLU A O    6  
ATOM   11121 C  CB   . GLU B 2 57  ? 1.436   9.627   -5.041  1.00 0.00 ? 315 GLU A CB   6  
ATOM   11122 C  CG   . GLU B 2 57  ? 2.033   10.166  -3.763  1.00 0.00 ? 315 GLU A CG   6  
ATOM   11123 C  CD   . GLU B 2 57  ? 3.104   11.209  -4.008  1.00 0.00 ? 315 GLU A CD   6  
ATOM   11124 O  OE1  . GLU B 2 57  ? 4.222   10.829  -4.417  1.00 0.00 ? 315 GLU A OE1  6  
ATOM   11125 O  OE2  . GLU B 2 57  ? 2.825   12.408  -3.799  1.00 0.00 ? 315 GLU A OE2  6  
ATOM   11126 H  H    . GLU B 2 57  ? 1.828   7.610   -3.639  1.00 0.00 ? 315 GLU A H    6  
ATOM   11127 H  HA   . GLU B 2 57  ? -0.406  9.119   -4.172  1.00 0.00 ? 315 GLU A HA   6  
ATOM   11128 H  HB2  . GLU B 2 57  ? 2.216   9.155   -5.622  1.00 0.00 ? 315 GLU A HB2  6  
ATOM   11129 H  HB3  . GLU B 2 57  ? 1.016   10.450  -5.598  1.00 0.00 ? 315 GLU A HB3  6  
ATOM   11130 H  HG2  . GLU B 2 57  ? 1.239   10.605  -3.176  1.00 0.00 ? 315 GLU A HG2  6  
ATOM   11131 H  HG3  . GLU B 2 57  ? 2.457   9.341   -3.204  1.00 0.00 ? 315 GLU A HG3  6  
ATOM   11132 N  N    . CYS B 2 58  ? 0.200   6.949