data_2KXL
# 
_entry.id   2KXL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KXL         
RCSB  RCSB101699   
WWPDB D_1000101699 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 16628 BMRB 'Resonance assignments of the nucleotide-free wildtype MloK1 cyclic nucleotide-binding domain' 
unspecified 2K0G  PDB  
'Solution Structure of a Bacterial Cyclic Nucleotide-Activated K+ Channel Binding Domain in Complex with cAMP' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KXL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-05-10 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schunke, S.'  1 
'Stoldt, M.'   2 
'Willbold, D.' 3 
# 
_citation.id                        primary 
_citation.title                     
;Structural insights into conformational changes of a cyclic nucleotide-binding domain in solution from Mesorhizobium loti K1 channel.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            108 
_citation.page_first                6121 
_citation.page_last                 6126 
_citation.year                      2011 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21430265 
_citation.pdbx_database_id_DOI      10.1073/pnas.1015890108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Schunke, S.'  1 
primary 'Stoldt, M.'   2 
primary 'Lecher, J.'   3 
primary 'Kaupp, U.B.'  4 
primary 'Willbold, D.' 5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Cyclic nucleotide-gated potassium channel mll3241' 
_entity.formula_weight             14983.222 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP Residues 216-355' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MlotiK1 channel' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPG
AFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPG
AFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   GLU n 
1 5   VAL n 
1 6   ARG n 
1 7   ARG n 
1 8   GLY n 
1 9   ASP n 
1 10  PHE n 
1 11  VAL n 
1 12  ARG n 
1 13  ASN n 
1 14  TRP n 
1 15  GLN n 
1 16  LEU n 
1 17  VAL n 
1 18  ALA n 
1 19  ALA n 
1 20  VAL n 
1 21  PRO n 
1 22  LEU n 
1 23  PHE n 
1 24  GLN n 
1 25  LYS n 
1 26  LEU n 
1 27  GLY n 
1 28  PRO n 
1 29  ALA n 
1 30  VAL n 
1 31  LEU n 
1 32  VAL n 
1 33  GLU n 
1 34  ILE n 
1 35  VAL n 
1 36  ARG n 
1 37  ALA n 
1 38  LEU n 
1 39  ARG n 
1 40  ALA n 
1 41  ARG n 
1 42  THR n 
1 43  VAL n 
1 44  PRO n 
1 45  ALA n 
1 46  GLY n 
1 47  ALA n 
1 48  VAL n 
1 49  ILE n 
1 50  CYS n 
1 51  ARG n 
1 52  ILE n 
1 53  GLY n 
1 54  GLU n 
1 55  PRO n 
1 56  GLY n 
1 57  ASP n 
1 58  ARG n 
1 59  MET n 
1 60  PHE n 
1 61  PHE n 
1 62  VAL n 
1 63  VAL n 
1 64  GLU n 
1 65  GLY n 
1 66  SER n 
1 67  VAL n 
1 68  SER n 
1 69  VAL n 
1 70  ALA n 
1 71  THR n 
1 72  PRO n 
1 73  ASN n 
1 74  PRO n 
1 75  VAL n 
1 76  GLU n 
1 77  LEU n 
1 78  GLY n 
1 79  PRO n 
1 80  GLY n 
1 81  ALA n 
1 82  PHE n 
1 83  PHE n 
1 84  GLY n 
1 85  GLU n 
1 86  MET n 
1 87  ALA n 
1 88  LEU n 
1 89  ILE n 
1 90  SER n 
1 91  GLY n 
1 92  GLU n 
1 93  PRO n 
1 94  ARG n 
1 95  SER n 
1 96  ALA n 
1 97  THR n 
1 98  VAL n 
1 99  SER n 
1 100 ALA n 
1 101 ALA n 
1 102 THR n 
1 103 THR n 
1 104 VAL n 
1 105 SER n 
1 106 LEU n 
1 107 LEU n 
1 108 SER n 
1 109 LEU n 
1 110 HIS n 
1 111 SER n 
1 112 ALA n 
1 113 ASP n 
1 114 PHE n 
1 115 GLN n 
1 116 MET n 
1 117 LEU n 
1 118 CYS n 
1 119 SER n 
1 120 SER n 
1 121 SER n 
1 122 PRO n 
1 123 GLU n 
1 124 ILE n 
1 125 ALA n 
1 126 GLU n 
1 127 ILE n 
1 128 PHE n 
1 129 ARG n 
1 130 LYS n 
1 131 THR n 
1 132 ALA n 
1 133 LEU n 
1 134 GLU n 
1 135 ARG n 
1 136 ARG n 
1 137 GLY n 
1 138 ALA n 
1 139 ALA n 
1 140 ALA n 
1 141 SER n 
1 142 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 mll3241 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mesorhizobium loti' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     381 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysE' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pGEX-2T 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CNGK1_RHILO 
_struct_ref.pdbx_db_accession          Q98GN8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAF
FGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
;
_struct_ref.pdbx_align_begin           216 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KXL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 142 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q98GN8 
_struct_ref_seq.db_align_beg                  216 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  355 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       216 
_struct_ref_seq.pdbx_auth_seq_align_end       355 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KXL GLY A 1 ? UNP Q98GN8 ? ? 'EXPRESSION TAG' 214 1 
1 2KXL SER A 2 ? UNP Q98GN8 ? ? 'EXPRESSION TAG' 215 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  2 '2D 1H-13C HSQC'  
1 3  2 '3D HNCACB'       
1 4  2 '3D HNCO'         
1 5  2 '3D HNHA'         
1 6  2 '3D HCCH-TOCSY'   
1 7  2 '3D HCCH-COSY'    
1 8  1 '3D 1H-15N NOESY' 
1 9  2 '3D 1H-13C NOESY' 
1 10 2 '2D 1H-1H NOESY'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.5 mM [U-15N] MloK1 CNBD, 10 mM [U-99% 2H] TRIS, 100 mM sodium chloride, 0.02 % sodium azide, 5 % [U-100% 2H] D2O, 95 % H2O, 200 uM EDTA, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.5 mM [U-13C; U-15N] MloK1 CNBD, 10 mM [U-99% 2H] TRIS, 100 mM sodium chloride, 0.02 % sodium azide, 5 % [U-100% 2H] D2O, 95 % H2O, 200 uM EDTA, 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker INOVA 1 'Bruker INOVA' 
600 Bruker INOVA 2 'Bruker INOVA' 
# 
_pdbx_nmr_refine.entry_id           2KXL 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KXL 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.17 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KXL 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Varian                                              collection                  VNMRJ   ?   1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe ?   2 
'Keller and Wuthrich'                               'peak picking'              CARA    ?   3 
'Keller and Wuthrich'                               'chemical shift assignment' CARA    ?   4 
'Keller and Wuthrich'                               'data analysis'             CARA    ?   5 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA   1.1 6 
'Guntert, Mumenthaler and Wuthrich'                 refinement                  CYANA   1.1 7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KXL 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KXL 
_struct.title                     
'Solution structure of a bacterial cyclic nucleotide-activated K+ channel binding domain in the unliganded state' 
_struct.pdbx_descriptor           'Cyclic nucleotide-gated potassium channel mll3241' 
_struct.pdbx_model_details        'fewest violations, model 15' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KXL 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
;Cyclic Nucleotide Binding Domain (CNBD), Ion Channel, Protein Phosphate Binding Cassette in the Apo State, helical portion, beta barrel core, MEMBRANE PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 9   ? ALA A 18  ? ASP A 222 ALA A 231 1 ? 10 
HELX_P HELX_P2 2 PRO A 28  ? ALA A 37  ? PRO A 241 ALA A 250 1 ? 10 
HELX_P HELX_P3 3 GLU A 85  ? SER A 90  ? GLU A 298 SER A 303 1 ? 6  
HELX_P HELX_P4 4 SER A 111 ? SER A 120 ? SER A 324 SER A 333 1 ? 10 
HELX_P HELX_P5 5 PRO A 122 ? GLY A 137 ? PRO A 335 GLY A 350 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 39  ? VAL A 43  ? ARG A 252 VAL A 256 
A 2 VAL A 104 ? HIS A 110 ? VAL A 317 HIS A 323 
A 3 ARG A 58  ? GLU A 64  ? ARG A 271 GLU A 277 
A 4 PHE A 82  ? PHE A 83  ? PHE A 295 PHE A 296 
B 1 VAL A 48  ? CYS A 50  ? VAL A 261 CYS A 263 
B 2 VAL A 98  ? ALA A 100 ? VAL A 311 ALA A 313 
B 3 VAL A 67  ? VAL A 69  ? VAL A 280 VAL A 282 
B 4 VAL A 75  ? LEU A 77  ? VAL A 288 LEU A 290 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 39  ? N ARG A 252 O SER A 108 ? O SER A 321 
A 2 3 O SER A 105 ? O SER A 318 N VAL A 63  ? N VAL A 276 
A 3 4 N PHE A 60  ? N PHE A 273 O PHE A 83  ? O PHE A 296 
B 1 2 N CYS A 50  ? N CYS A 263 O VAL A 98  ? O VAL A 311 
B 2 3 O SER A 99  ? O SER A 312 N SER A 68  ? N SER A 281 
B 3 4 N VAL A 69  ? N VAL A 282 O VAL A 75  ? O VAL A 288 
# 
_atom_sites.entry_id                    2KXL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -25.502 7.626   -12.656 1.00 0.00 ?  214 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -24.139 7.942   -13.046 1.00 0.00 ?  214 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -23.138 7.427   -12.010 1.00 0.00 ?  214 GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -22.797 6.245   -12.005 1.00 0.00 ?  214 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -25.602 7.255   -11.733 1.00 0.00 ?  214 GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -23.922 7.498   -14.018 1.00 0.00 ?  214 GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -24.030 9.021   -13.157 1.00 0.00 ?  214 GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -22.696 8.339   -11.157 1.00 0.00 ?  215 SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -21.741 7.992   -10.118 1.00 0.00 ?  215 SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -22.441 7.948   -8.758  1.00 0.00 ?  215 SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -23.523 8.510   -8.594  1.00 0.00 ?  215 SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -20.578 8.986   -10.084 1.00 0.00 ?  215 SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -19.329 8.355   -10.352 1.00 0.00 ?  215 SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -22.979 9.299   -11.168 1.00 0.00 ?  215 SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -21.367 7.005   -10.388 1.00 0.00 ?  215 SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -20.753 9.773   -10.818 1.00 0.00 ?  215 SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -20.540 9.466   -9.106  1.00 0.00 ?  215 SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -19.063 8.515   -11.303 1.00 0.00 ?  215 SER A HG   1  
ATOM 19    N N    . GLN A 1 3   ? -21.795 7.274   -7.818  1.00 0.00 ?  216 GLN A N    1  
ATOM 20    C CA   . GLN A 1 3   ? -22.342 7.148   -6.478  1.00 0.00 ?  216 GLN A CA   1  
ATOM 21    C C    . GLN A 1 3   ? -21.214 6.982   -5.457  1.00 0.00 ?  216 GLN A C    1  
ATOM 22    O O    . GLN A 1 3   ? -20.053 6.816   -5.831  1.00 0.00 ?  216 GLN A O    1  
ATOM 23    C CB   . GLN A 1 3   ? -23.331 5.984   -6.395  1.00 0.00 ?  216 GLN A CB   1  
ATOM 24    C CG   . GLN A 1 3   ? -24.588 6.273   -7.218  1.00 0.00 ?  216 GLN A CG   1  
ATOM 25    C CD   . GLN A 1 3   ? -25.615 5.149   -7.064  1.00 0.00 ?  216 GLN A CD   1  
ATOM 26    O OE1  . GLN A 1 3   ? -25.569 4.134   -7.740  1.00 0.00 ?  216 GLN A OE1  1  
ATOM 27    N NE2  . GLN A 1 3   ? -26.541 5.385   -6.139  1.00 0.00 ?  216 GLN A NE2  1  
ATOM 28    H H    . GLN A 1 3   ? -20.916 6.819   -7.960  1.00 0.00 ?  216 GLN A H    1  
ATOM 29    H HA   . GLN A 1 3   ? -22.873 8.082   -6.293  1.00 0.00 ?  216 GLN A HA   1  
ATOM 30    H HB2  . GLN A 1 3   ? -22.856 5.072   -6.759  1.00 0.00 ?  216 GLN A HB2  1  
ATOM 31    H HB3  . GLN A 1 3   ? -23.605 5.807   -5.355  1.00 0.00 ?  216 GLN A HB3  1  
ATOM 32    H HG2  . GLN A 1 3   ? -25.027 7.218   -6.898  1.00 0.00 ?  216 GLN A HG2  1  
ATOM 33    H HG3  . GLN A 1 3   ? -24.321 6.385   -8.269  1.00 0.00 ?  216 GLN A HG3  1  
ATOM 34    H HE21 . GLN A 1 3   ? -26.521 6.239   -5.619  1.00 0.00 ?  216 GLN A HE21 1  
ATOM 35    H HE22 . GLN A 1 3   ? -27.257 4.709   -5.964  1.00 0.00 ?  216 GLN A HE22 1  
ATOM 36    N N    . GLU A 1 4   ? -21.594 7.033   -4.189  1.00 0.00 ?  217 GLU A N    1  
ATOM 37    C CA   . GLU A 1 4   ? -20.628 6.890   -3.112  1.00 0.00 ?  217 GLU A CA   1  
ATOM 38    C C    . GLU A 1 4   ? -20.957 5.660   -2.264  1.00 0.00 ?  217 GLU A C    1  
ATOM 39    O O    . GLU A 1 4   ? -22.032 5.078   -2.400  1.00 0.00 ?  217 GLU A O    1  
ATOM 40    C CB   . GLU A 1 4   ? -20.578 8.153   -2.251  1.00 0.00 ?  217 GLU A CB   1  
ATOM 41    C CG   . GLU A 1 4   ? -19.149 8.692   -2.150  1.00 0.00 ?  217 GLU A CG   1  
ATOM 42    C CD   . GLU A 1 4   ? -18.853 9.673   -3.287  1.00 0.00 ?  217 GLU A CD   1  
ATOM 43    O OE1  . GLU A 1 4   ? -18.675 9.251   -4.439  1.00 0.00 ?  217 GLU A OE1  1  
ATOM 44    O OE2  . GLU A 1 4   ? -18.810 10.915  -2.938  1.00 0.00 -1 217 GLU A OE2  1  
ATOM 45    H H    . GLU A 1 4   ? -22.539 7.168   -3.894  1.00 0.00 ?  217 GLU A H    1  
ATOM 46    H HA   . GLU A 1 4   ? -19.665 6.754   -3.603  1.00 0.00 ?  217 GLU A HA   1  
ATOM 47    H HB2  . GLU A 1 4   ? -21.229 8.916   -2.678  1.00 0.00 ?  217 GLU A HB2  1  
ATOM 48    H HB3  . GLU A 1 4   ? -20.958 7.933   -1.253  1.00 0.00 ?  217 GLU A HB3  1  
ATOM 49    H HG2  . GLU A 1 4   ? -19.011 9.190   -1.190  1.00 0.00 ?  217 GLU A HG2  1  
ATOM 50    H HG3  . GLU A 1 4   ? -18.441 7.864   -2.186  1.00 0.00 ?  217 GLU A HG3  1  
ATOM 51    H HE2  . GLU A 1 4   ? -17.880 11.162  -2.666  1.00 0.00 ?  217 GLU A HE2  1  
ATOM 52    N N    . VAL A 1 5   ? -20.012 5.301   -1.408  1.00 0.00 ?  218 VAL A N    1  
ATOM 53    C CA   . VAL A 1 5   ? -20.187 4.151   -0.538  1.00 0.00 ?  218 VAL A CA   1  
ATOM 54    C C    . VAL A 1 5   ? -19.665 4.490   0.860   1.00 0.00 ?  218 VAL A C    1  
ATOM 55    O O    . VAL A 1 5   ? -18.613 5.111   1.000   1.00 0.00 ?  218 VAL A O    1  
ATOM 56    C CB   . VAL A 1 5   ? -19.507 2.924   -1.149  1.00 0.00 ?  218 VAL A CB   1  
ATOM 57    C CG1  . VAL A 1 5   ? -18.029 2.865   -0.757  1.00 0.00 ?  218 VAL A CG1  1  
ATOM 58    C CG2  . VAL A 1 5   ? -20.233 1.639   -0.748  1.00 0.00 ?  218 VAL A CG2  1  
ATOM 59    H H    . VAL A 1 5   ? -19.140 5.781   -1.304  1.00 0.00 ?  218 VAL A H    1  
ATOM 60    H HA   . VAL A 1 5   ? -21.256 3.947   -0.473  1.00 0.00 ?  218 VAL A HA   1  
ATOM 61    H HB   . VAL A 1 5   ? -19.563 3.016   -2.234  1.00 0.00 ?  218 VAL A HB   1  
ATOM 62    H HG11 . VAL A 1 5   ? -17.626 3.876   -0.706  1.00 0.00 ?  218 VAL A HG11 1  
ATOM 63    H HG12 . VAL A 1 5   ? -17.930 2.384   0.216   1.00 0.00 ?  218 VAL A HG12 1  
ATOM 64    H HG13 . VAL A 1 5   ? -17.479 2.292   -1.504  1.00 0.00 ?  218 VAL A HG13 1  
ATOM 65    H HG21 . VAL A 1 5   ? -20.241 0.948   -1.591  1.00 0.00 ?  218 VAL A HG21 1  
ATOM 66    H HG22 . VAL A 1 5   ? -19.717 1.178   0.095   1.00 0.00 ?  218 VAL A HG22 1  
ATOM 67    H HG23 . VAL A 1 5   ? -21.258 1.874   -0.461  1.00 0.00 ?  218 VAL A HG23 1  
ATOM 68    N N    . ARG A 1 6   ? -20.425 4.067   1.859   1.00 0.00 ?  219 ARG A N    1  
ATOM 69    C CA   . ARG A 1 6   ? -20.053 4.317   3.241   1.00 0.00 ?  219 ARG A CA   1  
ATOM 70    C C    . ARG A 1 6   ? -18.744 3.599   3.577   1.00 0.00 ?  219 ARG A C    1  
ATOM 71    O O    . ARG A 1 6   ? -18.209 2.859   2.753   1.00 0.00 ?  219 ARG A O    1  
ATOM 72    C CB   . ARG A 1 6   ? -21.147 3.846   4.201   1.00 0.00 ?  219 ARG A CB   1  
ATOM 73    C CG   . ARG A 1 6   ? -22.174 4.952   4.448   1.00 0.00 ?  219 ARG A CG   1  
ATOM 74    C CD   . ARG A 1 6   ? -23.512 4.617   3.785   1.00 0.00 ?  219 ARG A CD   1  
ATOM 75    N NE   . ARG A 1 6   ? -24.107 3.421   4.421   1.00 0.00 ?  219 ARG A NE   1  
ATOM 76    C CZ   . ARG A 1 6   ? -25.312 2.926   4.111   1.00 0.00 ?  219 ARG A CZ   1  
ATOM 77    N NH1  . ARG A 1 6   ? -26.059 3.521   3.171   1.00 0.00 ?  219 ARG A NH1  1  
ATOM 78    N NH2  . ARG A 1 6   ? -25.772 1.836   4.741   1.00 0.00 1  219 ARG A NH2  1  
ATOM 79    H H    . ARG A 1 6   ? -21.280 3.562   1.737   1.00 0.00 ?  219 ARG A H    1  
ATOM 80    H HA   . ARG A 1 6   ? -19.934 5.399   3.306   1.00 0.00 ?  219 ARG A HA   1  
ATOM 81    H HB2  . ARG A 1 6   ? -21.644 2.968   3.788   1.00 0.00 ?  219 ARG A HB2  1  
ATOM 82    H HB3  . ARG A 1 6   ? -20.699 3.542   5.147   1.00 0.00 ?  219 ARG A HB3  1  
ATOM 83    H HG2  . ARG A 1 6   ? -22.319 5.086   5.520   1.00 0.00 ?  219 ARG A HG2  1  
ATOM 84    H HG3  . ARG A 1 6   ? -21.797 5.897   4.057   1.00 0.00 ?  219 ARG A HG3  1  
ATOM 85    H HD2  . ARG A 1 6   ? -24.193 5.463   3.873   1.00 0.00 ?  219 ARG A HD2  1  
ATOM 86    H HD3  . ARG A 1 6   ? -23.364 4.437   2.720   1.00 0.00 ?  219 ARG A HD3  1  
ATOM 87    H HE   . ARG A 1 6   ? -23.575 2.953   5.128   1.00 0.00 ?  219 ARG A HE   1  
ATOM 88    H HH11 . ARG A 1 6   ? -25.716 4.335   2.701   1.00 0.00 ?  219 ARG A HH11 1  
ATOM 89    H HH12 . ARG A 1 6   ? -26.959 3.152   2.939   1.00 0.00 ?  219 ARG A HH12 1  
ATOM 90    H HH21 . ARG A 1 6   ? -25.215 1.392   5.442   1.00 0.00 ?  219 ARG A HH21 1  
ATOM 91    H HH22 . ARG A 1 6   ? -26.672 1.467   4.509   1.00 0.00 ?  219 ARG A HH22 1  
ATOM 92    N N    . ARG A 1 7   ? -18.267 3.842   4.788   1.00 0.00 ?  220 ARG A N    1  
ATOM 93    C CA   . ARG A 1 7   ? -17.031 3.227   5.243   1.00 0.00 ?  220 ARG A CA   1  
ATOM 94    C C    . ARG A 1 7   ? -17.105 2.934   6.743   1.00 0.00 ?  220 ARG A C    1  
ATOM 95    O O    . ARG A 1 7   ? -17.440 3.813   7.536   1.00 0.00 ?  220 ARG A O    1  
ATOM 96    C CB   . ARG A 1 7   ? -15.831 4.135   4.967   1.00 0.00 ?  220 ARG A CB   1  
ATOM 97    C CG   . ARG A 1 7   ? -14.890 3.501   3.939   1.00 0.00 ?  220 ARG A CG   1  
ATOM 98    C CD   . ARG A 1 7   ? -14.929 4.268   2.615   1.00 0.00 ?  220 ARG A CD   1  
ATOM 99    N NE   . ARG A 1 7   ? -13.556 4.626   2.198   1.00 0.00 ?  220 ARG A NE   1  
ATOM 100   C CZ   . ARG A 1 7   ? -13.259 5.262   1.056   1.00 0.00 ?  220 ARG A CZ   1  
ATOM 101   N NH1  . ARG A 1 7   ? -14.238 5.613   0.211   1.00 0.00 ?  220 ARG A NH1  1  
ATOM 102   N NH2  . ARG A 1 7   ? -11.984 5.547   0.759   1.00 0.00 1  220 ARG A NH2  1  
ATOM 103   H H    . ARG A 1 7   ? -18.709 4.445   5.453   1.00 0.00 ?  220 ARG A H    1  
ATOM 104   H HA   . ARG A 1 7   ? -16.950 2.306   4.667   1.00 0.00 ?  220 ARG A HA   1  
ATOM 105   H HB2  . ARG A 1 7   ? -16.177 5.101   4.601   1.00 0.00 ?  220 ARG A HB2  1  
ATOM 106   H HB3  . ARG A 1 7   ? -15.289 4.320   5.894   1.00 0.00 ?  220 ARG A HB3  1  
ATOM 107   H HG2  . ARG A 1 7   ? -13.873 3.493   4.329   1.00 0.00 ?  220 ARG A HG2  1  
ATOM 108   H HG3  . ARG A 1 7   ? -15.176 2.463   3.771   1.00 0.00 ?  220 ARG A HG3  1  
ATOM 109   H HD2  . ARG A 1 7   ? -15.405 3.658   1.847   1.00 0.00 ?  220 ARG A HD2  1  
ATOM 110   H HD3  . ARG A 1 7   ? -15.532 5.169   2.725   1.00 0.00 ?  220 ARG A HD3  1  
ATOM 111   H HE   . ARG A 1 7   ? -12.801 4.379   2.806   1.00 0.00 ?  220 ARG A HE   1  
ATOM 112   H HH11 . ARG A 1 7   ? -15.190 5.400   0.432   1.00 0.00 ?  220 ARG A HH11 1  
ATOM 113   H HH12 . ARG A 1 7   ? -14.017 6.087   -0.641  1.00 0.00 ?  220 ARG A HH12 1  
ATOM 114   H HH21 . ARG A 1 7   ? -11.253 5.285   1.389   1.00 0.00 ?  220 ARG A HH21 1  
ATOM 115   H HH22 . ARG A 1 7   ? -11.763 6.021   -0.093  1.00 0.00 ?  220 ARG A HH22 1  
ATOM 116   N N    . GLY A 1 8   ? -16.788 1.694   7.087   1.00 0.00 ?  221 GLY A N    1  
ATOM 117   C CA   . GLY A 1 8   ? -16.814 1.274   8.478   1.00 0.00 ?  221 GLY A CA   1  
ATOM 118   C C    . GLY A 1 8   ? -15.401 0.983   8.989   1.00 0.00 ?  221 GLY A C    1  
ATOM 119   O O    . GLY A 1 8   ? -15.113 1.176   10.169  1.00 0.00 ?  221 GLY A O    1  
ATOM 120   H H    . GLY A 1 8   ? -16.517 0.985   6.436   1.00 0.00 ?  221 GLY A H    1  
ATOM 121   H HA2  . GLY A 1 8   ? -17.273 2.052   9.088   1.00 0.00 ?  221 GLY A HA2  1  
ATOM 122   H HA3  . GLY A 1 8   ? -17.432 0.382   8.580   1.00 0.00 ?  221 GLY A HA3  1  
ATOM 123   N N    . ASP A 1 9   ? -14.559 0.524   8.076   1.00 0.00 ?  222 ASP A N    1  
ATOM 124   C CA   . ASP A 1 9   ? -13.183 0.205   8.420   1.00 0.00 ?  222 ASP A CA   1  
ATOM 125   C C    . ASP A 1 9   ? -12.306 1.438   8.193   1.00 0.00 ?  222 ASP A C    1  
ATOM 126   O O    . ASP A 1 9   ? -11.087 1.323   8.074   1.00 0.00 ?  222 ASP A O    1  
ATOM 127   C CB   . ASP A 1 9   ? -12.645 -0.927  7.542   1.00 0.00 ?  222 ASP A CB   1  
ATOM 128   C CG   . ASP A 1 9   ? -12.798 -0.706  6.036   1.00 0.00 ?  222 ASP A CG   1  
ATOM 129   O OD1  . ASP A 1 9   ? -12.366 0.322   5.494   1.00 0.00 ?  222 ASP A OD1  1  
ATOM 130   O OD2  . ASP A 1 9   ? -13.400 -1.657  5.404   1.00 0.00 -1 222 ASP A OD2  1  
ATOM 131   H H    . ASP A 1 9   ? -14.801 0.370   7.118   1.00 0.00 ?  222 ASP A H    1  
ATOM 132   H HA   . ASP A 1 9   ? -13.213 -0.099  9.466   1.00 0.00 ?  222 ASP A HA   1  
ATOM 133   H HB2  . ASP A 1 9   ? -11.588 -1.069  7.767   1.00 0.00 ?  222 ASP A HB2  1  
ATOM 134   H HB3  . ASP A 1 9   ? -13.155 -1.851  7.813   1.00 0.00 ?  222 ASP A HB3  1  
ATOM 135   H HD2  . ASP A 1 9   ? -13.129 -1.653  4.442   1.00 0.00 ?  222 ASP A HD2  1  
ATOM 136   N N    . PHE A 1 10  ? -12.960 2.588   8.140   1.00 0.00 ?  223 PHE A N    1  
ATOM 137   C CA   . PHE A 1 10  ? -12.255 3.841   7.930   1.00 0.00 ?  223 PHE A CA   1  
ATOM 138   C C    . PHE A 1 10  ? -11.126 4.012   8.948   1.00 0.00 ?  223 PHE A C    1  
ATOM 139   O O    . PHE A 1 10  ? -10.047 4.496   8.608   1.00 0.00 ?  223 PHE A O    1  
ATOM 140   C CB   . PHE A 1 10  ? -13.274 4.966   8.123   1.00 0.00 ?  223 PHE A CB   1  
ATOM 141   C CG   . PHE A 1 10  ? -12.875 6.288   7.464   1.00 0.00 ?  223 PHE A CG   1  
ATOM 142   C CD1  . PHE A 1 10  ? -12.134 7.195   8.155   1.00 0.00 ?  223 PHE A CD1  1  
ATOM 143   C CD2  . PHE A 1 10  ? -13.261 6.555   6.187   1.00 0.00 ?  223 PHE A CD2  1  
ATOM 144   C CE1  . PHE A 1 10  ? -11.763 8.422   7.543   1.00 0.00 ?  223 PHE A CE1  1  
ATOM 145   C CE2  . PHE A 1 10  ? -12.890 7.782   5.576   1.00 0.00 ?  223 PHE A CE2  1  
ATOM 146   C CZ   . PHE A 1 10  ? -12.149 8.689   6.266   1.00 0.00 ?  223 PHE A CZ   1  
ATOM 147   H H    . PHE A 1 10  ? -13.952 2.673   8.238   1.00 0.00 ?  223 PHE A H    1  
ATOM 148   H HA   . PHE A 1 10  ? -11.835 3.811   6.925   1.00 0.00 ?  223 PHE A HA   1  
ATOM 149   H HB2  . PHE A 1 10  ? -14.235 4.646   7.718   1.00 0.00 ?  223 PHE A HB2  1  
ATOM 150   H HB3  . PHE A 1 10  ? -13.418 5.133   9.191   1.00 0.00 ?  223 PHE A HB3  1  
ATOM 151   H HD1  . PHE A 1 10  ? -11.825 6.981   9.178   1.00 0.00 ?  223 PHE A HD1  1  
ATOM 152   H HD2  . PHE A 1 10  ? -13.854 5.828   5.634   1.00 0.00 ?  223 PHE A HD2  1  
ATOM 153   H HE1  . PHE A 1 10  ? -11.169 9.149   8.096   1.00 0.00 ?  223 PHE A HE1  1  
ATOM 154   H HE2  . PHE A 1 10  ? -13.199 7.996   4.553   1.00 0.00 ?  223 PHE A HE2  1  
ATOM 155   H HZ   . PHE A 1 10  ? -11.864 9.631   5.797   1.00 0.00 ?  223 PHE A HZ   1  
ATOM 156   N N    . VAL A 1 11  ? -11.413 3.606   10.176  1.00 0.00 ?  224 VAL A N    1  
ATOM 157   C CA   . VAL A 1 11  ? -10.435 3.708   11.246  1.00 0.00 ?  224 VAL A CA   1  
ATOM 158   C C    . VAL A 1 11  ? -9.329  2.675   11.021  1.00 0.00 ?  224 VAL A C    1  
ATOM 159   O O    . VAL A 1 11  ? -8.149  2.978   11.182  1.00 0.00 ?  224 VAL A O    1  
ATOM 160   C CB   . VAL A 1 11  ? -11.126 3.559   12.603  1.00 0.00 ?  224 VAL A CB   1  
ATOM 161   C CG1  . VAL A 1 11  ? -10.818 2.197   13.228  1.00 0.00 ?  224 VAL A CG1  1  
ATOM 162   C CG2  . VAL A 1 11  ? -10.732 4.697   13.547  1.00 0.00 ?  224 VAL A CG2  1  
ATOM 163   H H    . VAL A 1 11  ? -12.293 3.215   10.444  1.00 0.00 ?  224 VAL A H    1  
ATOM 164   H HA   . VAL A 1 11  ? -9.998  4.706   11.198  1.00 0.00 ?  224 VAL A HA   1  
ATOM 165   H HB   . VAL A 1 11  ? -12.202 3.617   12.439  1.00 0.00 ?  224 VAL A HB   1  
ATOM 166   H HG11 . VAL A 1 11  ? -11.198 1.406   12.580  1.00 0.00 ?  224 VAL A HG11 1  
ATOM 167   H HG12 . VAL A 1 11  ? -9.740  2.085   13.343  1.00 0.00 ?  224 VAL A HG12 1  
ATOM 168   H HG13 . VAL A 1 11  ? -11.297 2.128   14.204  1.00 0.00 ?  224 VAL A HG13 1  
ATOM 169   H HG21 . VAL A 1 11  ? -10.886 5.653   13.047  1.00 0.00 ?  224 VAL A HG21 1  
ATOM 170   H HG22 . VAL A 1 11  ? -11.348 4.653   14.445  1.00 0.00 ?  224 VAL A HG22 1  
ATOM 171   H HG23 . VAL A 1 11  ? -9.682  4.595   13.821  1.00 0.00 ?  224 VAL A HG23 1  
ATOM 172   N N    . ARG A 1 12  ? -9.752  1.475   10.651  1.00 0.00 ?  225 ARG A N    1  
ATOM 173   C CA   . ARG A 1 12  ? -8.813  0.395   10.402  1.00 0.00 ?  225 ARG A CA   1  
ATOM 174   C C    . ARG A 1 12  ? -7.943  0.717   9.185   1.00 0.00 ?  225 ARG A C    1  
ATOM 175   O O    . ARG A 1 12  ? -6.800  0.272   9.100   1.00 0.00 ?  225 ARG A O    1  
ATOM 176   C CB   . ARG A 1 12  ? -9.545  -0.927  10.161  1.00 0.00 ?  225 ARG A CB   1  
ATOM 177   C CG   . ARG A 1 12  ? -8.810  -2.091  10.830  1.00 0.00 ?  225 ARG A CG   1  
ATOM 178   C CD   . ARG A 1 12  ? -7.451  -2.333  10.171  1.00 0.00 ?  225 ARG A CD   1  
ATOM 179   N NE   . ARG A 1 12  ? -7.080  -3.761  10.286  1.00 0.00 ?  225 ARG A NE   1  
ATOM 180   C CZ   . ARG A 1 12  ? -6.579  -4.320  11.396  1.00 0.00 ?  225 ARG A CZ   1  
ATOM 181   N NH1  . ARG A 1 12  ? -6.385  -3.575  12.492  1.00 0.00 ?  225 ARG A NH1  1  
ATOM 182   N NH2  . ARG A 1 12  ? -6.271  -5.624  11.409  1.00 0.00 1  225 ARG A NH2  1  
ATOM 183   H H    . ARG A 1 12  ? -10.714 1.236   10.522  1.00 0.00 ?  225 ARG A H    1  
ATOM 184   H HA   . ARG A 1 12  ? -8.211  0.333   11.309  1.00 0.00 ?  225 ARG A HA   1  
ATOM 185   H HB2  . ARG A 1 12  ? -10.560 -0.861  10.550  1.00 0.00 ?  225 ARG A HB2  1  
ATOM 186   H HB3  . ARG A 1 12  ? -9.626  -1.112  9.089   1.00 0.00 ?  225 ARG A HB3  1  
ATOM 187   H HG2  . ARG A 1 12  ? -8.672  -1.877  11.890  1.00 0.00 ?  225 ARG A HG2  1  
ATOM 188   H HG3  . ARG A 1 12  ? -9.417  -2.994  10.764  1.00 0.00 ?  225 ARG A HG3  1  
ATOM 189   H HD2  . ARG A 1 12  ? -7.490  -2.042  9.121   1.00 0.00 ?  225 ARG A HD2  1  
ATOM 190   H HD3  . ARG A 1 12  ? -6.691  -1.712  10.646  1.00 0.00 ?  225 ARG A HD3  1  
ATOM 191   H HE   . ARG A 1 12  ? -7.212  -4.346  9.486   1.00 0.00 ?  225 ARG A HE   1  
ATOM 192   H HH11 . ARG A 1 12  ? -6.615  -2.602  12.483  1.00 0.00 ?  225 ARG A HH11 1  
ATOM 193   H HH12 . ARG A 1 12  ? -6.011  -3.992  13.321  1.00 0.00 ?  225 ARG A HH12 1  
ATOM 194   H HH21 . ARG A 1 12  ? -6.416  -6.181  10.591  1.00 0.00 ?  225 ARG A HH21 1  
ATOM 195   H HH22 . ARG A 1 12  ? -5.897  -6.042  12.237  1.00 0.00 ?  225 ARG A HH22 1  
ATOM 196   N N    . ASN A 1 13  ? -8.518  1.490   8.275   1.00 0.00 ?  226 ASN A N    1  
ATOM 197   C CA   . ASN A 1 13  ? -7.809  1.877   7.067   1.00 0.00 ?  226 ASN A CA   1  
ATOM 198   C C    . ASN A 1 13  ? -6.857  3.031   7.388   1.00 0.00 ?  226 ASN A C    1  
ATOM 199   O O    . ASN A 1 13  ? -5.807  3.167   6.761   1.00 0.00 ?  226 ASN A O    1  
ATOM 200   C CB   . ASN A 1 13  ? -8.782  2.353   5.987   1.00 0.00 ?  226 ASN A CB   1  
ATOM 201   C CG   . ASN A 1 13  ? -8.300  1.941   4.595   1.00 0.00 ?  226 ASN A CG   1  
ATOM 202   O OD1  . ASN A 1 13  ? -7.250  1.344   4.425   1.00 0.00 ?  226 ASN A OD1  1  
ATOM 203   N ND2  . ASN A 1 13  ? -9.124  2.291   3.611   1.00 0.00 ?  226 ASN A ND2  1  
ATOM 204   H H    . ASN A 1 13  ? -9.448  1.848   8.353   1.00 0.00 ?  226 ASN A H    1  
ATOM 205   H HA   . ASN A 1 13  ? -7.282  0.980   6.744   1.00 0.00 ?  226 ASN A HA   1  
ATOM 206   H HB2  . ASN A 1 13  ? -9.771  1.934   6.172   1.00 0.00 ?  226 ASN A HB2  1  
ATOM 207   H HB3  . ASN A 1 13  ? -8.882  3.438   6.035   1.00 0.00 ?  226 ASN A HB3  1  
ATOM 208   H HD21 . ASN A 1 13  ? -9.971  2.780   3.819   1.00 0.00 ?  226 ASN A HD21 1  
ATOM 209   H HD22 . ASN A 1 13  ? -8.896  2.065   2.664   1.00 0.00 ?  226 ASN A HD22 1  
ATOM 210   N N    . TRP A 1 14  ? -7.258  3.833   8.364   1.00 0.00 ?  227 TRP A N    1  
ATOM 211   C CA   . TRP A 1 14  ? -6.453  4.971   8.775   1.00 0.00 ?  227 TRP A CA   1  
ATOM 212   C C    . TRP A 1 14  ? -5.181  4.436   9.435   1.00 0.00 ?  227 TRP A C    1  
ATOM 213   O O    . TRP A 1 14  ? -4.086  4.931   9.172   1.00 0.00 ?  227 TRP A O    1  
ATOM 214   C CB   . TRP A 1 14  ? -7.252  5.907   9.685   1.00 0.00 ?  227 TRP A CB   1  
ATOM 215   C CG   . TRP A 1 14  ? -6.792  7.365   9.636   1.00 0.00 ?  227 TRP A CG   1  
ATOM 216   C CD1  . TRP A 1 14  ? -5.539  7.833   9.563   1.00 0.00 ?  227 TRP A CD1  1  
ATOM 217   C CD2  . TRP A 1 14  ? -7.638  8.534   9.659   1.00 0.00 ?  227 TRP A CD2  1  
ATOM 218   N NE1  . TRP A 1 14  ? -5.514  9.213   9.537   1.00 0.00 ?  227 TRP A NE1  1  
ATOM 219   C CE2  . TRP A 1 14  ? -6.832  9.652   9.598   1.00 0.00 ?  227 TRP A CE2  1  
ATOM 220   C CE3  . TRP A 1 14  ? -9.038  8.643   9.729   1.00 0.00 ?  227 TRP A CE3  1  
ATOM 221   C CZ2  . TRP A 1 14  ? -7.332  10.960  9.600   1.00 0.00 ?  227 TRP A CZ2  1  
ATOM 222   C CZ3  . TRP A 1 14  ? -9.523  9.957   9.731   1.00 0.00 ?  227 TRP A CZ3  1  
ATOM 223   C CH2  . TRP A 1 14  ? -8.724  11.093  9.670   1.00 0.00 ?  227 TRP A CH2  1  
ATOM 224   H H    . TRP A 1 14  ? -8.113  3.716   8.868   1.00 0.00 ?  227 TRP A H    1  
ATOM 225   H HA   . TRP A 1 14  ? -6.199  5.540   7.881   1.00 0.00 ?  227 TRP A HA   1  
ATOM 226   H HB2  . TRP A 1 14  ? -8.304  5.858   9.406   1.00 0.00 ?  227 TRP A HB2  1  
ATOM 227   H HB3  . TRP A 1 14  ? -7.178  5.548   10.712  1.00 0.00 ?  227 TRP A HB3  1  
ATOM 228   H HD1  . TRP A 1 14  ? -4.650  7.203   9.528   1.00 0.00 ?  227 TRP A HD1  1  
ATOM 229   H HE1  . TRP A 1 14  ? -4.626  9.841   9.480   1.00 0.00 ?  227 TRP A HE1  1  
ATOM 230   H HE3  . TRP A 1 14  ? -9.696  7.776   9.779   1.00 0.00 ?  227 TRP A HE3  1  
ATOM 231   H HZ2  . TRP A 1 14  ? -6.674  11.827  9.551   1.00 0.00 ?  227 TRP A HZ2  1  
ATOM 232   H HZ3  . TRP A 1 14  ? -10.602 10.098  9.785   1.00 0.00 ?  227 TRP A HZ3  1  
ATOM 233   H HH2  . TRP A 1 14  ? -9.180  12.083  9.676   1.00 0.00 ?  227 TRP A HH2  1  
ATOM 234   N N    . GLN A 1 15  ? -5.368  3.434   10.281  1.00 0.00 ?  228 GLN A N    1  
ATOM 235   C CA   . GLN A 1 15  ? -4.249  2.826   10.981  1.00 0.00 ?  228 GLN A CA   1  
ATOM 236   C C    . GLN A 1 15  ? -3.388  2.020   10.007  1.00 0.00 ?  228 GLN A C    1  
ATOM 237   O O    . GLN A 1 15  ? -2.164  1.995   10.129  1.00 0.00 ?  228 GLN A O    1  
ATOM 238   C CB   . GLN A 1 15  ? -4.735  1.951   12.137  1.00 0.00 ?  228 GLN A CB   1  
ATOM 239   C CG   . GLN A 1 15  ? -5.581  0.784   11.623  1.00 0.00 ?  228 GLN A CG   1  
ATOM 240   C CD   . GLN A 1 15  ? -6.070  -0.090  12.780  1.00 0.00 ?  228 GLN A CD   1  
ATOM 241   O OE1  . GLN A 1 15  ? -5.478  -1.101  13.122  1.00 0.00 ?  228 GLN A OE1  1  
ATOM 242   N NE2  . GLN A 1 15  ? -7.181  0.354   13.361  1.00 0.00 ?  228 GLN A NE2  1  
ATOM 243   H H    . GLN A 1 15  ? -6.262  3.037   10.490  1.00 0.00 ?  228 GLN A H    1  
ATOM 244   H HA   . GLN A 1 15  ? -3.672  3.660   11.382  1.00 0.00 ?  228 GLN A HA   1  
ATOM 245   H HB2  . GLN A 1 15  ? -3.880  1.567   12.693  1.00 0.00 ?  228 GLN A HB2  1  
ATOM 246   H HB3  . GLN A 1 15  ? -5.323  2.552   12.831  1.00 0.00 ?  228 GLN A HB3  1  
ATOM 247   H HG2  . GLN A 1 15  ? -6.435  1.167   11.065  1.00 0.00 ?  228 GLN A HG2  1  
ATOM 248   H HG3  . GLN A 1 15  ? -4.992  0.181   10.931  1.00 0.00 ?  228 GLN A HG3  1  
ATOM 249   H HE21 . GLN A 1 15  ? -7.617  1.191   13.031  1.00 0.00 ?  228 GLN A HE21 1  
ATOM 250   H HE22 . GLN A 1 15  ? -7.579  -0.149  14.128  1.00 0.00 ?  228 GLN A HE22 1  
ATOM 251   N N    . LEU A 1 16  ? -4.061  1.380   9.062   1.00 0.00 ?  229 LEU A N    1  
ATOM 252   C CA   . LEU A 1 16  ? -3.373  0.575   8.067   1.00 0.00 ?  229 LEU A CA   1  
ATOM 253   C C    . LEU A 1 16  ? -2.424  1.466   7.263   1.00 0.00 ?  229 LEU A C    1  
ATOM 254   O O    . LEU A 1 16  ? -1.261  1.118   7.062   1.00 0.00 ?  229 LEU A O    1  
ATOM 255   C CB   . LEU A 1 16  ? -4.381  -0.186  7.203   1.00 0.00 ?  229 LEU A CB   1  
ATOM 256   C CG   . LEU A 1 16  ? -4.364  -1.710  7.338   1.00 0.00 ?  229 LEU A CG   1  
ATOM 257   C CD1  . LEU A 1 16  ? -3.011  -2.283  6.911   1.00 0.00 ?  229 LEU A CD1  1  
ATOM 258   C CD2  . LEU A 1 16  ? -4.746  -2.139  8.756   1.00 0.00 ?  229 LEU A CD2  1  
ATOM 259   H H    . LEU A 1 16  ? -5.057  1.406   8.970   1.00 0.00 ?  229 LEU A H    1  
ATOM 260   H HA   . LEU A 1 16  ? -2.780  -0.168  8.601   1.00 0.00 ?  229 LEU A HA   1  
ATOM 261   H HB2  . LEU A 1 16  ? -5.382  0.169   7.449   1.00 0.00 ?  229 LEU A HB2  1  
ATOM 262   H HB3  . LEU A 1 16  ? -4.200  0.068   6.159   1.00 0.00 ?  229 LEU A HB3  1  
ATOM 263   H HG   . LEU A 1 16  ? -5.115  -2.122  6.664   1.00 0.00 ?  229 LEU A HG   1  
ATOM 264   H HD11 . LEU A 1 16  ? -3.011  -3.363  7.059   1.00 0.00 ?  229 LEU A HD11 1  
ATOM 265   H HD12 . LEU A 1 16  ? -2.838  -2.061  5.858   1.00 0.00 ?  229 LEU A HD12 1  
ATOM 266   H HD13 . LEU A 1 16  ? -2.220  -1.834  7.512   1.00 0.00 ?  229 LEU A HD13 1  
ATOM 267   H HD21 . LEU A 1 16  ? -5.320  -3.065  8.713   1.00 0.00 ?  229 LEU A HD21 1  
ATOM 268   H HD22 . LEU A 1 16  ? -3.842  -2.300  9.344   1.00 0.00 ?  229 LEU A HD22 1  
ATOM 269   H HD23 . LEU A 1 16  ? -5.348  -1.359  9.222   1.00 0.00 ?  229 LEU A HD23 1  
ATOM 270   N N    . VAL A 1 17  ? -2.955  2.598   6.825   1.00 0.00 ?  230 VAL A N    1  
ATOM 271   C CA   . VAL A 1 17  ? -2.170  3.542   6.048   1.00 0.00 ?  230 VAL A CA   1  
ATOM 272   C C    . VAL A 1 17  ? -1.176  4.252   6.969   1.00 0.00 ?  230 VAL A C    1  
ATOM 273   O O    . VAL A 1 17  ? -0.008  4.417   6.619   1.00 0.00 ?  230 VAL A O    1  
ATOM 274   C CB   . VAL A 1 17  ? -3.096  4.509   5.308   1.00 0.00 ?  230 VAL A CB   1  
ATOM 275   C CG1  . VAL A 1 17  ? -2.291  5.517   4.485   1.00 0.00 ?  230 VAL A CG1  1  
ATOM 276   C CG2  . VAL A 1 17  ? -4.090  3.751   4.427   1.00 0.00 ?  230 VAL A CG2  1  
ATOM 277   H H    . VAL A 1 17  ? -3.902  2.873   6.993   1.00 0.00 ?  230 VAL A H    1  
ATOM 278   H HA   . VAL A 1 17  ? -1.613  2.972   5.304   1.00 0.00 ?  230 VAL A HA   1  
ATOM 279   H HB   . VAL A 1 17  ? -3.665  5.064   6.054   1.00 0.00 ?  230 VAL A HB   1  
ATOM 280   H HG11 . VAL A 1 17  ? -2.112  5.112   3.489   1.00 0.00 ?  230 VAL A HG11 1  
ATOM 281   H HG12 . VAL A 1 17  ? -2.852  6.448   4.402   1.00 0.00 ?  230 VAL A HG12 1  
ATOM 282   H HG13 . VAL A 1 17  ? -1.338  5.709   4.977   1.00 0.00 ?  230 VAL A HG13 1  
ATOM 283   H HG21 . VAL A 1 17  ? -4.076  2.693   4.691   1.00 0.00 ?  230 VAL A HG21 1  
ATOM 284   H HG22 . VAL A 1 17  ? -5.092  4.150   4.583   1.00 0.00 ?  230 VAL A HG22 1  
ATOM 285   H HG23 . VAL A 1 17  ? -3.811  3.868   3.380   1.00 0.00 ?  230 VAL A HG23 1  
ATOM 286   N N    . ALA A 1 18  ? -1.676  4.654   8.129   1.00 0.00 ?  231 ALA A N    1  
ATOM 287   C CA   . ALA A 1 18  ? -0.846  5.343   9.103   1.00 0.00 ?  231 ALA A CA   1  
ATOM 288   C C    . ALA A 1 18  ? 0.192   4.368   9.662   1.00 0.00 ?  231 ALA A C    1  
ATOM 289   O O    . ALA A 1 18  ? 1.156   4.783   10.303  1.00 0.00 ?  231 ALA A O    1  
ATOM 290   C CB   . ALA A 1 18  ? -1.733  5.941   10.197  1.00 0.00 ?  231 ALA A CB   1  
ATOM 291   H H    . ALA A 1 18  ? -2.627  4.516   8.405   1.00 0.00 ?  231 ALA A H    1  
ATOM 292   H HA   . ALA A 1 18  ? -0.331  6.153   8.586   1.00 0.00 ?  231 ALA A HA   1  
ATOM 293   H HB1  . ALA A 1 18  ? -1.107  6.344   10.992  1.00 0.00 ?  231 ALA A HB1  1  
ATOM 294   H HB2  . ALA A 1 18  ? -2.343  6.739   9.774   1.00 0.00 ?  231 ALA A HB2  1  
ATOM 295   H HB3  . ALA A 1 18  ? -2.381  5.165   10.603  1.00 0.00 ?  231 ALA A HB3  1  
ATOM 296   N N    . ALA A 1 19  ? -0.040  3.091   9.398   1.00 0.00 ?  232 ALA A N    1  
ATOM 297   C CA   . ALA A 1 19  ? 0.864   2.054   9.867   1.00 0.00 ?  232 ALA A CA   1  
ATOM 298   C C    . ALA A 1 19  ? 2.055   1.952   8.912   1.00 0.00 ?  232 ALA A C    1  
ATOM 299   O O    . ALA A 1 19  ? 3.133   1.508   9.305   1.00 0.00 ?  232 ALA A O    1  
ATOM 300   C CB   . ALA A 1 19  ? 0.103   0.732   9.993   1.00 0.00 ?  232 ALA A CB   1  
ATOM 301   H H    . ALA A 1 19  ? -0.826  2.761   8.876   1.00 0.00 ?  232 ALA A H    1  
ATOM 302   H HA   . ALA A 1 19  ? 1.223   2.348   10.853  1.00 0.00 ?  232 ALA A HA   1  
ATOM 303   H HB1  . ALA A 1 19  ? -0.517  0.754   10.890  1.00 0.00 ?  232 ALA A HB1  1  
ATOM 304   H HB2  . ALA A 1 19  ? -0.530  0.592   9.117   1.00 0.00 ?  232 ALA A HB2  1  
ATOM 305   H HB3  . ALA A 1 19  ? 0.814   -0.091  10.063  1.00 0.00 ?  232 ALA A HB3  1  
ATOM 306   N N    . VAL A 1 20  ? 1.821   2.370   7.677   1.00 0.00 ?  233 VAL A N    1  
ATOM 307   C CA   . VAL A 1 20  ? 2.861   2.331   6.664   1.00 0.00 ?  233 VAL A CA   1  
ATOM 308   C C    . VAL A 1 20  ? 3.989   3.285   7.060   1.00 0.00 ?  233 VAL A C    1  
ATOM 309   O O    . VAL A 1 20  ? 3.735   4.416   7.474   1.00 0.00 ?  233 VAL A O    1  
ATOM 310   C CB   . VAL A 1 20  ? 2.265   2.647   5.290   1.00 0.00 ?  233 VAL A CB   1  
ATOM 311   C CG1  . VAL A 1 20  ? 3.351   2.662   4.212   1.00 0.00 ?  233 VAL A CG1  1  
ATOM 312   C CG2  . VAL A 1 20  ? 1.153   1.659   4.935   1.00 0.00 ?  233 VAL A CG2  1  
ATOM 313   H H    . VAL A 1 20  ? 0.941   2.730   7.367   1.00 0.00 ?  233 VAL A H    1  
ATOM 314   H HA   . VAL A 1 20  ? 3.255   1.315   6.635   1.00 0.00 ?  233 VAL A HA   1  
ATOM 315   H HB   . VAL A 1 20  ? 1.826   3.644   5.337   1.00 0.00 ?  233 VAL A HB   1  
ATOM 316   H HG11 . VAL A 1 20  ? 3.407   1.681   3.740   1.00 0.00 ?  233 VAL A HG11 1  
ATOM 317   H HG12 . VAL A 1 20  ? 3.108   3.413   3.462   1.00 0.00 ?  233 VAL A HG12 1  
ATOM 318   H HG13 . VAL A 1 20  ? 4.312   2.901   4.668   1.00 0.00 ?  233 VAL A HG13 1  
ATOM 319   H HG21 . VAL A 1 20  ? 0.370   2.178   4.380   1.00 0.00 ?  233 VAL A HG21 1  
ATOM 320   H HG22 . VAL A 1 20  ? 1.562   0.857   4.321   1.00 0.00 ?  233 VAL A HG22 1  
ATOM 321   H HG23 . VAL A 1 20  ? 0.733   1.240   5.849   1.00 0.00 ?  233 VAL A HG23 1  
ATOM 322   N N    . PRO A 1 21  ? 5.245   2.783   6.916   1.00 0.00 ?  234 PRO A N    1  
ATOM 323   C CA   . PRO A 1 21  ? 6.413   3.578   7.255   1.00 0.00 ?  234 PRO A CA   1  
ATOM 324   C C    . PRO A 1 21  ? 6.679   4.642   6.189   1.00 0.00 ?  234 PRO A C    1  
ATOM 325   O O    . PRO A 1 21  ? 7.028   5.777   6.512   1.00 0.00 ?  234 PRO A O    1  
ATOM 326   C CB   . PRO A 1 21  ? 7.546   2.575   7.389   1.00 0.00 ?  234 PRO A CB   1  
ATOM 327   C CG   . PRO A 1 21  ? 7.079   1.320   6.669   1.00 0.00 ?  234 PRO A CG   1  
ATOM 328   C CD   . PRO A 1 21  ? 5.584   1.449   6.429   1.00 0.00 ?  234 PRO A CD   1  
ATOM 329   H HA   . PRO A 1 21  ? 6.257   4.078   8.107   1.00 0.00 ?  234 PRO A HA   1  
ATOM 330   H HB2  . PRO A 1 21  ? 8.464   2.961   6.945   1.00 0.00 ?  234 PRO A HB2  1  
ATOM 331   H HB3  . PRO A 1 21  ? 7.762   2.367   8.437   1.00 0.00 ?  234 PRO A HB3  1  
ATOM 332   H HG2  . PRO A 1 21  ? 7.609   1.202   5.724   1.00 0.00 ?  234 PRO A HG2  1  
ATOM 333   H HG3  . PRO A 1 21  ? 7.295   0.434   7.268   1.00 0.00 ?  234 PRO A HG3  1  
ATOM 334   H HD2  . PRO A 1 21  ? 5.342   1.340   5.372   1.00 0.00 ?  234 PRO A HD2  1  
ATOM 335   H HD3  . PRO A 1 21  ? 5.029   0.679   6.964   1.00 0.00 ?  234 PRO A HD3  1  
ATOM 336   N N    . LEU A 1 22  ? 6.504   4.239   4.939   1.00 0.00 ?  235 LEU A N    1  
ATOM 337   C CA   . LEU A 1 22  ? 6.721   5.144   3.823   1.00 0.00 ?  235 LEU A CA   1  
ATOM 338   C C    . LEU A 1 22  ? 5.715   6.293   3.901   1.00 0.00 ?  235 LEU A C    1  
ATOM 339   O O    . LEU A 1 22  ? 5.870   7.306   3.220   1.00 0.00 ?  235 LEU A O    1  
ATOM 340   C CB   . LEU A 1 22  ? 6.681   4.380   2.498   1.00 0.00 ?  235 LEU A CB   1  
ATOM 341   C CG   . LEU A 1 22  ? 7.910   4.530   1.599   1.00 0.00 ?  235 LEU A CG   1  
ATOM 342   C CD1  . LEU A 1 22  ? 9.140   3.885   2.241   1.00 0.00 ?  235 LEU A CD1  1  
ATOM 343   C CD2  . LEU A 1 22  ? 7.637   3.976   0.199   1.00 0.00 ?  235 LEU A CD2  1  
ATOM 344   H H    . LEU A 1 22  ? 6.220   3.315   4.684   1.00 0.00 ?  235 LEU A H    1  
ATOM 345   H HA   . LEU A 1 22  ? 7.725   5.556   3.927   1.00 0.00 ?  235 LEU A HA   1  
ATOM 346   H HB2  . LEU A 1 22  ? 6.542   3.321   2.716   1.00 0.00 ?  235 LEU A HB2  1  
ATOM 347   H HB3  . LEU A 1 22  ? 5.805   4.708   1.939   1.00 0.00 ?  235 LEU A HB3  1  
ATOM 348   H HG   . LEU A 1 22  ? 8.125   5.593   1.489   1.00 0.00 ?  235 LEU A HG   1  
ATOM 349   H HD11 . LEU A 1 22  ? 10.026  4.472   1.999   1.00 0.00 ?  235 LEU A HD11 1  
ATOM 350   H HD12 . LEU A 1 22  ? 9.010   3.851   3.323   1.00 0.00 ?  235 LEU A HD12 1  
ATOM 351   H HD13 . LEU A 1 22  ? 9.260   2.871   1.858   1.00 0.00 ?  235 LEU A HD13 1  
ATOM 352   H HD21 . LEU A 1 22  ? 8.419   4.309   -0.482  1.00 0.00 ?  235 LEU A HD21 1  
ATOM 353   H HD22 . LEU A 1 22  ? 7.627   2.886   0.235   1.00 0.00 ?  235 LEU A HD22 1  
ATOM 354   H HD23 . LEU A 1 22  ? 6.670   4.337   -0.152  1.00 0.00 ?  235 LEU A HD23 1  
ATOM 355   N N    . PHE A 1 23  ? 4.705   6.098   4.736   1.00 0.00 ?  236 PHE A N    1  
ATOM 356   C CA   . PHE A 1 23  ? 3.673   7.106   4.911   1.00 0.00 ?  236 PHE A CA   1  
ATOM 357   C C    . PHE A 1 23  ? 3.720   7.699   6.321   1.00 0.00 ?  236 PHE A C    1  
ATOM 358   O O    . PHE A 1 23  ? 2.862   8.499   6.691   1.00 0.00 ?  236 PHE A O    1  
ATOM 359   C CB   . PHE A 1 23  ? 2.327   6.408   4.709   1.00 0.00 ?  236 PHE A CB   1  
ATOM 360   C CG   . PHE A 1 23  ? 2.111   5.872   3.292   1.00 0.00 ?  236 PHE A CG   1  
ATOM 361   C CD1  . PHE A 1 23  ? 2.983   6.199   2.301   1.00 0.00 ?  236 PHE A CD1  1  
ATOM 362   C CD2  . PHE A 1 23  ? 1.047   5.068   3.025   1.00 0.00 ?  236 PHE A CD2  1  
ATOM 363   C CE1  . PHE A 1 23  ? 2.782   5.701   0.986   1.00 0.00 ?  236 PHE A CE1  1  
ATOM 364   C CE2  . PHE A 1 23  ? 0.846   4.571   1.710   1.00 0.00 ?  236 PHE A CE2  1  
ATOM 365   C CZ   . PHE A 1 23  ? 1.718   4.898   0.718   1.00 0.00 ?  236 PHE A CZ   1  
ATOM 366   H H    . PHE A 1 23  ? 4.586   5.271   5.285   1.00 0.00 ?  236 PHE A H    1  
ATOM 367   H HA   . PHE A 1 23  ? 3.863   7.893   4.182   1.00 0.00 ?  236 PHE A HA   1  
ATOM 368   H HB2  . PHE A 1 23  ? 2.248   5.582   5.415   1.00 0.00 ?  236 PHE A HB2  1  
ATOM 369   H HB3  . PHE A 1 23  ? 1.527   7.109   4.947   1.00 0.00 ?  236 PHE A HB3  1  
ATOM 370   H HD1  . PHE A 1 23  ? 3.836   6.843   2.516   1.00 0.00 ?  236 PHE A HD1  1  
ATOM 371   H HD2  . PHE A 1 23  ? 0.348   4.806   3.819   1.00 0.00 ?  236 PHE A HD2  1  
ATOM 372   H HE1  . PHE A 1 23  ? 3.481   5.963   0.192   1.00 0.00 ?  236 PHE A HE1  1  
ATOM 373   H HE2  . PHE A 1 23  ? -0.006  3.926   1.495   1.00 0.00 ?  236 PHE A HE2  1  
ATOM 374   H HZ   . PHE A 1 23  ? 1.564   4.516   -0.291  1.00 0.00 ?  236 PHE A HZ   1  
ATOM 375   N N    . GLN A 1 24  ? 4.731   7.283   7.070   1.00 0.00 ?  237 GLN A N    1  
ATOM 376   C CA   . GLN A 1 24  ? 4.901   7.763   8.431   1.00 0.00 ?  237 GLN A CA   1  
ATOM 377   C C    . GLN A 1 24  ? 5.401   9.209   8.426   1.00 0.00 ?  237 GLN A C    1  
ATOM 378   O O    . GLN A 1 24  ? 5.116   9.971   9.348   1.00 0.00 ?  237 GLN A O    1  
ATOM 379   C CB   . GLN A 1 24  ? 5.851   6.857   9.217   1.00 0.00 ?  237 GLN A CB   1  
ATOM 380   C CG   . GLN A 1 24  ? 5.554   6.921   10.717  1.00 0.00 ?  237 GLN A CG   1  
ATOM 381   C CD   . GLN A 1 24  ? 6.459   7.940   11.412  1.00 0.00 ?  237 GLN A CD   1  
ATOM 382   O OE1  . GLN A 1 24  ? 6.045   9.026   11.783  1.00 0.00 ?  237 GLN A OE1  1  
ATOM 383   N NE2  . GLN A 1 24  ? 7.715   7.531   11.567  1.00 0.00 ?  237 GLN A NE2  1  
ATOM 384   H H    . GLN A 1 24  ? 5.425   6.632   6.762   1.00 0.00 ?  237 GLN A H    1  
ATOM 385   H HA   . GLN A 1 24  ? 3.909   7.716   8.881   1.00 0.00 ?  237 GLN A HA   1  
ATOM 386   H HB2  . GLN A 1 24  ? 5.753   5.830   8.867   1.00 0.00 ?  237 GLN A HB2  1  
ATOM 387   H HB3  . GLN A 1 24  ? 6.882   7.159   9.034   1.00 0.00 ?  237 GLN A HB3  1  
ATOM 388   H HG2  . GLN A 1 24  ? 4.510   7.190   10.873  1.00 0.00 ?  237 GLN A HG2  1  
ATOM 389   H HG3  . GLN A 1 24  ? 5.700   5.937   11.162  1.00 0.00 ?  237 GLN A HG3  1  
ATOM 390   H HE21 . GLN A 1 24  ? 7.991   6.628   11.239  1.00 0.00 ?  237 GLN A HE21 1  
ATOM 391   H HE22 . GLN A 1 24  ? 8.384   8.127   12.011  1.00 0.00 ?  237 GLN A HE22 1  
ATOM 392   N N    . LYS A 1 25  ? 6.138   9.543   7.376   1.00 0.00 ?  238 LYS A N    1  
ATOM 393   C CA   . LYS A 1 25  ? 6.680   10.884  7.238   1.00 0.00 ?  238 LYS A CA   1  
ATOM 394   C C    . LYS A 1 25  ? 5.670   11.764  6.499   1.00 0.00 ?  238 LYS A C    1  
ATOM 395   O O    . LYS A 1 25  ? 5.971   12.906  6.156   1.00 0.00 ?  238 LYS A O    1  
ATOM 396   C CB   . LYS A 1 25  ? 8.058   10.839  6.575   1.00 0.00 ?  238 LYS A CB   1  
ATOM 397   C CG   . LYS A 1 25  ? 8.955   9.796   7.244   1.00 0.00 ?  238 LYS A CG   1  
ATOM 398   C CD   . LYS A 1 25  ? 8.883   8.457   6.507   1.00 0.00 ?  238 LYS A CD   1  
ATOM 399   C CE   . LYS A 1 25  ? 10.148  7.631   6.746   1.00 0.00 ?  238 LYS A CE   1  
ATOM 400   N NZ   . LYS A 1 25  ? 10.722  7.179   5.458   1.00 0.00 1  238 LYS A NZ   1  
ATOM 401   H H    . LYS A 1 25  ? 6.365   8.916   6.630   1.00 0.00 ?  238 LYS A H    1  
ATOM 402   H HA   . LYS A 1 25  ? 6.818   11.285  8.242   1.00 0.00 ?  238 LYS A HA   1  
ATOM 403   H HB2  . LYS A 1 25  ? 7.949   10.605  5.516   1.00 0.00 ?  238 LYS A HB2  1  
ATOM 404   H HB3  . LYS A 1 25  ? 8.527   11.821  6.637   1.00 0.00 ?  238 LYS A HB3  1  
ATOM 405   H HG2  . LYS A 1 25  ? 9.985   10.152  7.258   1.00 0.00 ?  238 LYS A HG2  1  
ATOM 406   H HG3  . LYS A 1 25  ? 8.650   9.661   8.282   1.00 0.00 ?  238 LYS A HG3  1  
ATOM 407   H HD2  . LYS A 1 25  ? 8.010   7.898   6.846   1.00 0.00 ?  238 LYS A HD2  1  
ATOM 408   H HD3  . LYS A 1 25  ? 8.754   8.632   5.439   1.00 0.00 ?  238 LYS A HD3  1  
ATOM 409   H HE2  . LYS A 1 25  ? 10.882  8.227   7.288   1.00 0.00 ?  238 LYS A HE2  1  
ATOM 410   H HE3  . LYS A 1 25  ? 9.914   6.768   7.369   1.00 0.00 ?  238 LYS A HE3  1  
ATOM 411   H HZ1  . LYS A 1 25  ? 11.195  7.942   5.018   1.00 0.00 ?  238 LYS A HZ1  1  
ATOM 412   H HZ2  . LYS A 1 25  ? 11.371  6.436   5.625   1.00 0.00 ?  238 LYS A HZ2  1  
ATOM 413   H HZ3  . LYS A 1 25  ? 9.988   6.853   4.862   1.00 0.00 ?  238 LYS A HZ3  1  
ATOM 414   N N    . LEU A 1 26  ? 4.492   11.199  6.276   1.00 0.00 ?  239 LEU A N    1  
ATOM 415   C CA   . LEU A 1 26  ? 3.436   11.918  5.584   1.00 0.00 ?  239 LEU A CA   1  
ATOM 416   C C    . LEU A 1 26  ? 2.655   12.762  6.593   1.00 0.00 ?  239 LEU A C    1  
ATOM 417   O O    . LEU A 1 26  ? 2.922   12.708  7.792   1.00 0.00 ?  239 LEU A O    1  
ATOM 418   C CB   . LEU A 1 26  ? 2.563   10.949  4.785   1.00 0.00 ?  239 LEU A CB   1  
ATOM 419   C CG   . LEU A 1 26  ? 3.201   10.348  3.531   1.00 0.00 ?  239 LEU A CG   1  
ATOM 420   C CD1  . LEU A 1 26  ? 2.277   9.312   2.888   1.00 0.00 ?  239 LEU A CD1  1  
ATOM 421   C CD2  . LEU A 1 26  ? 3.609   11.443  2.544   1.00 0.00 ?  239 LEU A CD2  1  
ATOM 422   H H    . LEU A 1 26  ? 4.256   10.269  6.558   1.00 0.00 ?  239 LEU A H    1  
ATOM 423   H HA   . LEU A 1 26  ? 3.912   12.588  4.868   1.00 0.00 ?  239 LEU A HA   1  
ATOM 424   H HB2  . LEU A 1 26  ? 2.264   10.133  5.443   1.00 0.00 ?  239 LEU A HB2  1  
ATOM 425   H HB3  . LEU A 1 26  ? 1.652   11.470  4.490   1.00 0.00 ?  239 LEU A HB3  1  
ATOM 426   H HG   . LEU A 1 26  ? 4.112   9.827   3.828   1.00 0.00 ?  239 LEU A HG   1  
ATOM 427   H HD11 . LEU A 1 26  ? 1.352   9.795   2.575   1.00 0.00 ?  239 LEU A HD11 1  
ATOM 428   H HD12 . LEU A 1 26  ? 2.771   8.874   2.020   1.00 0.00 ?  239 LEU A HD12 1  
ATOM 429   H HD13 . LEU A 1 26  ? 2.051   8.528   3.611   1.00 0.00 ?  239 LEU A HD13 1  
ATOM 430   H HD21 . LEU A 1 26  ? 3.498   11.074  1.525   1.00 0.00 ?  239 LEU A HD21 1  
ATOM 431   H HD22 . LEU A 1 26  ? 2.971   12.316  2.686   1.00 0.00 ?  239 LEU A HD22 1  
ATOM 432   H HD23 . LEU A 1 26  ? 4.649   11.721  2.719   1.00 0.00 ?  239 LEU A HD23 1  
ATOM 433   N N    . GLY A 1 27  ? 1.704   13.522  6.069   1.00 0.00 ?  240 GLY A N    1  
ATOM 434   C CA   . GLY A 1 27  ? 0.881   14.376  6.909   1.00 0.00 ?  240 GLY A CA   1  
ATOM 435   C C    . GLY A 1 27  ? -0.487  13.741  7.164   1.00 0.00 ?  240 GLY A C    1  
ATOM 436   O O    . GLY A 1 27  ? -0.792  12.679  6.623   1.00 0.00 ?  240 GLY A O    1  
ATOM 437   H H    . GLY A 1 27  ? 1.493   13.560  5.092   1.00 0.00 ?  240 GLY A H    1  
ATOM 438   H HA2  . GLY A 1 27  ? 1.386   14.554  7.858   1.00 0.00 ?  240 GLY A HA2  1  
ATOM 439   H HA3  . GLY A 1 27  ? 0.752   15.347  6.430   1.00 0.00 ?  240 GLY A HA3  1  
ATOM 440   N N    . PRO A 1 28  ? -1.295  14.435  8.009   1.00 0.00 ?  241 PRO A N    1  
ATOM 441   C CA   . PRO A 1 28  ? -2.623  13.950  8.342   1.00 0.00 ?  241 PRO A CA   1  
ATOM 442   C C    . PRO A 1 28  ? -3.594  14.168  7.179   1.00 0.00 ?  241 PRO A C    1  
ATOM 443   O O    . PRO A 1 28  ? -4.469  13.339  6.933   1.00 0.00 ?  241 PRO A O    1  
ATOM 444   C CB   . PRO A 1 28  ? -3.018  14.713  9.596   1.00 0.00 ?  241 PRO A CB   1  
ATOM 445   C CG   . PRO A 1 28  ? -2.101  15.924  9.653   1.00 0.00 ?  241 PRO A CG   1  
ATOM 446   C CD   . PRO A 1 28  ? -0.966  15.697  8.667   1.00 0.00 ?  241 PRO A CD   1  
ATOM 447   H HA   . PRO A 1 28  ? -2.603  12.963  8.500   1.00 0.00 ?  241 PRO A HA   1  
ATOM 448   H HB2  . PRO A 1 28  ? -4.064  15.017  9.555   1.00 0.00 ?  241 PRO A HB2  1  
ATOM 449   H HB3  . PRO A 1 28  ? -2.901  14.093  10.484  1.00 0.00 ?  241 PRO A HB3  1  
ATOM 450   H HG2  . PRO A 1 28  ? -2.650  16.831  9.400   1.00 0.00 ?  241 PRO A HG2  1  
ATOM 451   H HG3  . PRO A 1 28  ? -1.709  16.059  10.661  1.00 0.00 ?  241 PRO A HG3  1  
ATOM 452   H HD2  . PRO A 1 28  ? -0.897  16.512  7.947   1.00 0.00 ?  241 PRO A HD2  1  
ATOM 453   H HD3  . PRO A 1 28  ? -0.005  15.639  9.176   1.00 0.00 ?  241 PRO A HD3  1  
ATOM 454   N N    . ALA A 1 29  ? -3.406  15.287  6.495   1.00 0.00 ?  242 ALA A N    1  
ATOM 455   C CA   . ALA A 1 29  ? -4.255  15.624  5.365   1.00 0.00 ?  242 ALA A CA   1  
ATOM 456   C C    . ALA A 1 29  ? -3.963  14.664  4.210   1.00 0.00 ?  242 ALA A C    1  
ATOM 457   O O    . ALA A 1 29  ? -4.866  14.295  3.461   1.00 0.00 ?  242 ALA A O    1  
ATOM 458   C CB   . ALA A 1 29  ? -4.032  17.087  4.977   1.00 0.00 ?  242 ALA A CB   1  
ATOM 459   H H    . ALA A 1 29  ? -2.692  15.956  6.702   1.00 0.00 ?  242 ALA A H    1  
ATOM 460   H HA   . ALA A 1 29  ? -5.291  15.498  5.678   1.00 0.00 ?  242 ALA A HA   1  
ATOM 461   H HB1  . ALA A 1 29  ? -4.897  17.453  4.424   1.00 0.00 ?  242 ALA A HB1  1  
ATOM 462   H HB2  . ALA A 1 29  ? -3.897  17.686  5.878   1.00 0.00 ?  242 ALA A HB2  1  
ATOM 463   H HB3  . ALA A 1 29  ? -3.142  17.166  4.353   1.00 0.00 ?  242 ALA A HB3  1  
ATOM 464   N N    . VAL A 1 30  ? -2.697  14.287  4.101   1.00 0.00 ?  243 VAL A N    1  
ATOM 465   C CA   . VAL A 1 30  ? -2.275  13.377  3.050   1.00 0.00 ?  243 VAL A CA   1  
ATOM 466   C C    . VAL A 1 30  ? -2.768  11.966  3.375   1.00 0.00 ?  243 VAL A C    1  
ATOM 467   O O    . VAL A 1 30  ? -3.208  11.238  2.486   1.00 0.00 ?  243 VAL A O    1  
ATOM 468   C CB   . VAL A 1 30  ? -0.757  13.454  2.869   1.00 0.00 ?  243 VAL A CB   1  
ATOM 469   C CG1  . VAL A 1 30  ? -0.260  12.350  1.934   1.00 0.00 ?  243 VAL A CG1  1  
ATOM 470   C CG2  . VAL A 1 30  ? -0.335  14.834  2.363   1.00 0.00 ?  243 VAL A CG2  1  
ATOM 471   H H    . VAL A 1 30  ? -1.968  14.592  4.714   1.00 0.00 ?  243 VAL A H    1  
ATOM 472   H HA   . VAL A 1 30  ? -2.742  13.707  2.122   1.00 0.00 ?  243 VAL A HA   1  
ATOM 473   H HB   . VAL A 1 30  ? -0.296  13.300  3.845   1.00 0.00 ?  243 VAL A HB   1  
ATOM 474   H HG11 . VAL A 1 30  ? -1.035  12.117  1.204   1.00 0.00 ?  243 VAL A HG11 1  
ATOM 475   H HG12 . VAL A 1 30  ? 0.637   12.690  1.416   1.00 0.00 ?  243 VAL A HG12 1  
ATOM 476   H HG13 . VAL A 1 30  ? -0.029  11.458  2.516   1.00 0.00 ?  243 VAL A HG13 1  
ATOM 477   H HG21 . VAL A 1 30  ? -1.194  15.504  2.374   1.00 0.00 ?  243 VAL A HG21 1  
ATOM 478   H HG22 . VAL A 1 30  ? 0.447   15.235  3.009   1.00 0.00 ?  243 VAL A HG22 1  
ATOM 479   H HG23 . VAL A 1 30  ? 0.045   14.747  1.345   1.00 0.00 ?  243 VAL A HG23 1  
ATOM 480   N N    . LEU A 1 31  ? -2.678  11.621  4.651   1.00 0.00 ?  244 LEU A N    1  
ATOM 481   C CA   . LEU A 1 31  ? -3.108  10.310  5.104   1.00 0.00 ?  244 LEU A CA   1  
ATOM 482   C C    . LEU A 1 31  ? -4.628  10.200  4.962   1.00 0.00 ?  244 LEU A C    1  
ATOM 483   O O    . LEU A 1 31  ? -5.147  9.141   4.610   1.00 0.00 ?  244 LEU A O    1  
ATOM 484   C CB   . LEU A 1 31  ? -2.603  10.040  6.523   1.00 0.00 ?  244 LEU A CB   1  
ATOM 485   C CG   . LEU A 1 31  ? -1.268  9.300   6.630   1.00 0.00 ?  244 LEU A CG   1  
ATOM 486   C CD1  . LEU A 1 31  ? -1.427  7.825   6.258   1.00 0.00 ?  244 LEU A CD1  1  
ATOM 487   C CD2  . LEU A 1 31  ? -0.190  9.989   5.790   1.00 0.00 ?  244 LEU A CD2  1  
ATOM 488   H H    . LEU A 1 31  ? -2.318  12.219  5.368   1.00 0.00 ?  244 LEU A H    1  
ATOM 489   H HA   . LEU A 1 31  ? -2.646  9.570   4.451   1.00 0.00 ?  244 LEU A HA   1  
ATOM 490   H HB2  . LEU A 1 31  ? -2.509  10.994  7.041   1.00 0.00 ?  244 LEU A HB2  1  
ATOM 491   H HB3  . LEU A 1 31  ? -3.359  9.462   7.053   1.00 0.00 ?  244 LEU A HB3  1  
ATOM 492   H HG   . LEU A 1 31  ? -0.939  9.336   7.668   1.00 0.00 ?  244 LEU A HG   1  
ATOM 493   H HD11 . LEU A 1 31  ? -2.434  7.493   6.512   1.00 0.00 ?  244 LEU A HD11 1  
ATOM 494   H HD12 . LEU A 1 31  ? -1.263  7.700   5.187   1.00 0.00 ?  244 LEU A HD12 1  
ATOM 495   H HD13 . LEU A 1 31  ? -0.699  7.230   6.809   1.00 0.00 ?  244 LEU A HD13 1  
ATOM 496   H HD21 . LEU A 1 31  ? 0.287   9.257   5.140   1.00 0.00 ?  244 LEU A HD21 1  
ATOM 497   H HD22 . LEU A 1 31  ? -0.647  10.771  5.184   1.00 0.00 ?  244 LEU A HD22 1  
ATOM 498   H HD23 . LEU A 1 31  ? 0.557   10.431  6.450   1.00 0.00 ?  244 LEU A HD23 1  
ATOM 499   N N    . VAL A 1 32  ? -5.298  11.307  5.243   1.00 0.00 ?  245 VAL A N    1  
ATOM 500   C CA   . VAL A 1 32  ? -6.748  11.348  5.150   1.00 0.00 ?  245 VAL A CA   1  
ATOM 501   C C    . VAL A 1 32  ? -7.167  11.171  3.689   1.00 0.00 ?  245 VAL A C    1  
ATOM 502   O O    . VAL A 1 32  ? -8.072  10.395  3.389   1.00 0.00 ?  245 VAL A O    1  
ATOM 503   C CB   . VAL A 1 32  ? -7.275  12.644  5.770   1.00 0.00 ?  245 VAL A CB   1  
ATOM 504   C CG1  . VAL A 1 32  ? -8.779  12.793  5.532   1.00 0.00 ?  245 VAL A CG1  1  
ATOM 505   C CG2  . VAL A 1 32  ? -6.947  12.710  7.263   1.00 0.00 ?  245 VAL A CG2  1  
ATOM 506   H H    . VAL A 1 32  ? -4.869  12.164  5.528   1.00 0.00 ?  245 VAL A H    1  
ATOM 507   H HA   . VAL A 1 32  ? -7.138  10.513  5.731   1.00 0.00 ?  245 VAL A HA   1  
ATOM 508   H HB   . VAL A 1 32  ? -6.774  13.478  5.280   1.00 0.00 ?  245 VAL A HB   1  
ATOM 509   H HG11 . VAL A 1 32  ? -9.324  12.368  6.374   1.00 0.00 ?  245 VAL A HG11 1  
ATOM 510   H HG12 . VAL A 1 32  ? -9.028  13.850  5.434   1.00 0.00 ?  245 VAL A HG12 1  
ATOM 511   H HG13 . VAL A 1 32  ? -9.056  12.268  4.618   1.00 0.00 ?  245 VAL A HG13 1  
ATOM 512   H HG21 . VAL A 1 32  ? -6.619  13.718  7.519   1.00 0.00 ?  245 VAL A HG21 1  
ATOM 513   H HG22 . VAL A 1 32  ? -7.837  12.460  7.842   1.00 0.00 ?  245 VAL A HG22 1  
ATOM 514   H HG23 . VAL A 1 32  ? -6.153  12.000  7.493   1.00 0.00 ?  245 VAL A HG23 1  
ATOM 515   N N    . GLU A 1 33  ? -6.487  11.903  2.819   1.00 0.00 ?  246 GLU A N    1  
ATOM 516   C CA   . GLU A 1 33  ? -6.778  11.837  1.397   1.00 0.00 ?  246 GLU A CA   1  
ATOM 517   C C    . GLU A 1 33  ? -6.457  10.443  0.855   1.00 0.00 ?  246 GLU A C    1  
ATOM 518   O O    . GLU A 1 33  ? -7.205  9.902   0.042   1.00 0.00 ?  246 GLU A O    1  
ATOM 519   C CB   . GLU A 1 33  ? -6.009  12.914  0.629   1.00 0.00 ?  246 GLU A CB   1  
ATOM 520   C CG   . GLU A 1 33  ? -6.799  13.387  -0.592  1.00 0.00 ?  246 GLU A CG   1  
ATOM 521   C CD   . GLU A 1 33  ? -8.084  14.102  -0.170  1.00 0.00 ?  246 GLU A CD   1  
ATOM 522   O OE1  . GLU A 1 33  ? -9.187  13.594  -0.419  1.00 0.00 ?  246 GLU A OE1  1  
ATOM 523   O OE2  . GLU A 1 33  ? -7.908  15.226  0.438   1.00 0.00 -1 246 GLU A OE2  1  
ATOM 524   H H    . GLU A 1 33  ? -5.752  12.533  3.071   1.00 0.00 ?  246 GLU A H    1  
ATOM 525   H HA   . GLU A 1 33  ? -7.847  12.031  1.310   1.00 0.00 ?  246 GLU A HA   1  
ATOM 526   H HB2  . GLU A 1 33  ? -5.807  13.760  1.287   1.00 0.00 ?  246 GLU A HB2  1  
ATOM 527   H HB3  . GLU A 1 33  ? -5.043  12.521  0.312   1.00 0.00 ?  246 GLU A HB3  1  
ATOM 528   H HG2  . GLU A 1 33  ? -6.184  14.059  -1.190  1.00 0.00 ?  246 GLU A HG2  1  
ATOM 529   H HG3  . GLU A 1 33  ? -7.045  12.533  -1.224  1.00 0.00 ?  246 GLU A HG3  1  
ATOM 530   H HE2  . GLU A 1 33  ? -7.901  15.083  1.427   1.00 0.00 ?  246 GLU A HE2  1  
ATOM 531   N N    . ILE A 1 34  ? -5.343  9.901   1.325   1.00 0.00 ?  247 ILE A N    1  
ATOM 532   C CA   . ILE A 1 34  ? -4.914  8.581   0.898   1.00 0.00 ?  247 ILE A CA   1  
ATOM 533   C C    . ILE A 1 34  ? -5.965  7.549   1.312   1.00 0.00 ?  247 ILE A C    1  
ATOM 534   O O    . ILE A 1 34  ? -6.372  6.713   0.505   1.00 0.00 ?  247 ILE A O    1  
ATOM 535   C CB   . ILE A 1 34  ? -3.511  8.275   1.426   1.00 0.00 ?  247 ILE A CB   1  
ATOM 536   C CG1  . ILE A 1 34  ? -2.461  9.140   0.726   1.00 0.00 ?  247 ILE A CG1  1  
ATOM 537   C CG2  . ILE A 1 34  ? -3.195  6.783   1.311   1.00 0.00 ?  247 ILE A CG2  1  
ATOM 538   C CD1  . ILE A 1 34  ? -1.204  9.281   1.586   1.00 0.00 ?  247 ILE A CD1  1  
ATOM 539   H H    . ILE A 1 34  ? -4.740  10.348  1.986   1.00 0.00 ?  247 ILE A H    1  
ATOM 540   H HA   . ILE A 1 34  ? -4.853  8.594   -0.191  1.00 0.00 ?  247 ILE A HA   1  
ATOM 541   H HB   . ILE A 1 34  ? -3.483  8.530   2.486   1.00 0.00 ?  247 ILE A HB   1  
ATOM 542   H HG12 . ILE A 1 34  ? -2.201  8.695   -0.235  1.00 0.00 ?  247 ILE A HG12 1  
ATOM 543   H HG13 . ILE A 1 34  ? -2.877  10.126  0.518   1.00 0.00 ?  247 ILE A HG13 1  
ATOM 544   H HG21 . ILE A 1 34  ? -2.194  6.593   1.701   1.00 0.00 ?  247 ILE A HG21 1  
ATOM 545   H HG22 . ILE A 1 34  ? -3.923  6.212   1.886   1.00 0.00 ?  247 ILE A HG22 1  
ATOM 546   H HG23 . ILE A 1 34  ? -3.240  6.482   0.265   1.00 0.00 ?  247 ILE A HG23 1  
ATOM 547   H HD11 . ILE A 1 34  ? -1.489  9.532   2.608   1.00 0.00 ?  247 ILE A HD11 1  
ATOM 548   H HD12 . ILE A 1 34  ? -0.655  8.340   1.584   1.00 0.00 ?  247 ILE A HD12 1  
ATOM 549   H HD13 . ILE A 1 34  ? -0.573  10.071  1.181   1.00 0.00 ?  247 ILE A HD13 1  
ATOM 550   N N    . VAL A 1 35  ? -6.375  7.640   2.568   1.00 0.00 ?  248 VAL A N    1  
ATOM 551   C CA   . VAL A 1 35  ? -7.371  6.725   3.099   1.00 0.00 ?  248 VAL A CA   1  
ATOM 552   C C    . VAL A 1 35  ? -8.678  6.894   2.322   1.00 0.00 ?  248 VAL A C    1  
ATOM 553   O O    . VAL A 1 35  ? -9.406  5.926   2.106   1.00 0.00 ?  248 VAL A O    1  
ATOM 554   C CB   . VAL A 1 35  ? -7.537  6.948   4.604   1.00 0.00 ?  248 VAL A CB   1  
ATOM 555   C CG1  . VAL A 1 35  ? -8.818  6.287   5.118   1.00 0.00 ?  248 VAL A CG1  1  
ATOM 556   C CG2  . VAL A 1 35  ? -6.313  6.442   5.371   1.00 0.00 ?  248 VAL A CG2  1  
ATOM 557   H H    . VAL A 1 35  ? -6.040  8.322   3.218   1.00 0.00 ?  248 VAL A H    1  
ATOM 558   H HA   . VAL A 1 35  ? -7.001  5.712   2.946   1.00 0.00 ?  248 VAL A HA   1  
ATOM 559   H HB   . VAL A 1 35  ? -7.621  8.021   4.777   1.00 0.00 ?  248 VAL A HB   1  
ATOM 560   H HG11 . VAL A 1 35  ? -8.777  6.211   6.204   1.00 0.00 ?  248 VAL A HG11 1  
ATOM 561   H HG12 . VAL A 1 35  ? -9.679  6.889   4.828   1.00 0.00 ?  248 VAL A HG12 1  
ATOM 562   H HG13 . VAL A 1 35  ? -8.910  5.290   4.687   1.00 0.00 ?  248 VAL A HG13 1  
ATOM 563   H HG21 . VAL A 1 35  ? -6.384  5.362   5.497   1.00 0.00 ?  248 VAL A HG21 1  
ATOM 564   H HG22 . VAL A 1 35  ? -5.409  6.684   4.812   1.00 0.00 ?  248 VAL A HG22 1  
ATOM 565   H HG23 . VAL A 1 35  ? -6.275  6.921   6.349   1.00 0.00 ?  248 VAL A HG23 1  
ATOM 566   N N    . ARG A 1 36  ? -8.937  8.131   1.923   1.00 0.00 ?  249 ARG A N    1  
ATOM 567   C CA   . ARG A 1 36  ? -10.144 8.439   1.175   1.00 0.00 ?  249 ARG A CA   1  
ATOM 568   C C    . ARG A 1 36  ? -9.974  8.043   -0.293  1.00 0.00 ?  249 ARG A C    1  
ATOM 569   O O    . ARG A 1 36  ? -10.947 7.997   -1.044  1.00 0.00 ?  249 ARG A O    1  
ATOM 570   C CB   . ARG A 1 36  ? -10.478 9.930   1.259   1.00 0.00 ?  249 ARG A CB   1  
ATOM 571   C CG   . ARG A 1 36  ? -10.840 10.331  2.690   1.00 0.00 ?  249 ARG A CG   1  
ATOM 572   C CD   . ARG A 1 36  ? -12.349 10.530  2.839   1.00 0.00 ?  249 ARG A CD   1  
ATOM 573   N NE   . ARG A 1 36  ? -12.636 11.908  3.298   1.00 0.00 ?  249 ARG A NE   1  
ATOM 574   C CZ   . ARG A 1 36  ? -13.861 12.450  3.328   1.00 0.00 ?  249 ARG A CZ   1  
ATOM 575   N NH1  . ARG A 1 36  ? -14.920 11.735  2.926   1.00 0.00 ?  249 ARG A NH1  1  
ATOM 576   N NH2  . ARG A 1 36  ? -14.026 13.708  3.760   1.00 0.00 1  249 ARG A NH2  1  
ATOM 577   H H    . ARG A 1 36  ? -8.340  8.913   2.103   1.00 0.00 ?  249 ARG A H    1  
ATOM 578   H HA   . ARG A 1 36  ? -10.926 7.849   1.653   1.00 0.00 ?  249 ARG A HA   1  
ATOM 579   H HB2  . ARG A 1 36  ? -9.625  10.517  0.917   1.00 0.00 ?  249 ARG A HB2  1  
ATOM 580   H HB3  . ARG A 1 36  ? -11.309 10.158  0.592   1.00 0.00 ?  249 ARG A HB3  1  
ATOM 581   H HG2  . ARG A 1 36  ? -10.501 9.562   3.384   1.00 0.00 ?  249 ARG A HG2  1  
ATOM 582   H HG3  . ARG A 1 36  ? -10.320 11.252  2.956   1.00 0.00 ?  249 ARG A HG3  1  
ATOM 583   H HD2  . ARG A 1 36  ? -12.844 10.346  1.885   1.00 0.00 ?  249 ARG A HD2  1  
ATOM 584   H HD3  . ARG A 1 36  ? -12.751 9.810   3.551   1.00 0.00 ?  249 ARG A HD3  1  
ATOM 585   H HE   . ARG A 1 36  ? -11.867 12.469  3.605   1.00 0.00 ?  249 ARG A HE   1  
ATOM 586   H HH11 . ARG A 1 36  ? -14.797 10.797  2.604   1.00 0.00 ?  249 ARG A HH11 1  
ATOM 587   H HH12 . ARG A 1 36  ? -15.834 12.140  2.949   1.00 0.00 ?  249 ARG A HH12 1  
ATOM 588   H HH21 . ARG A 1 36  ? -13.235 14.242  4.060   1.00 0.00 ?  249 ARG A HH21 1  
ATOM 589   H HH22 . ARG A 1 36  ? -14.940 14.113  3.783   1.00 0.00 ?  249 ARG A HH22 1  
ATOM 590   N N    . ALA A 1 37  ? -8.731  7.768   -0.658  1.00 0.00 ?  250 ALA A N    1  
ATOM 591   C CA   . ALA A 1 37  ? -8.421  7.377   -2.023  1.00 0.00 ?  250 ALA A CA   1  
ATOM 592   C C    . ALA A 1 37  ? -8.281  5.855   -2.094  1.00 0.00 ?  250 ALA A C    1  
ATOM 593   O O    . ALA A 1 37  ? -8.145  5.291   -3.179  1.00 0.00 ?  250 ALA A O    1  
ATOM 594   C CB   . ALA A 1 37  ? -7.155  8.101   -2.487  1.00 0.00 ?  250 ALA A CB   1  
ATOM 595   H H    . ALA A 1 37  ? -7.944  7.807   -0.041  1.00 0.00 ?  250 ALA A H    1  
ATOM 596   H HA   . ALA A 1 37  ? -9.254  7.687   -2.654  1.00 0.00 ?  250 ALA A HA   1  
ATOM 597   H HB1  . ALA A 1 37  ? -6.885  7.757   -3.485  1.00 0.00 ?  250 ALA A HB1  1  
ATOM 598   H HB2  . ALA A 1 37  ? -7.340  9.175   -2.510  1.00 0.00 ?  250 ALA A HB2  1  
ATOM 599   H HB3  . ALA A 1 37  ? -6.340  7.888   -1.795  1.00 0.00 ?  250 ALA A HB3  1  
ATOM 600   N N    . LEU A 1 38  ? -8.318  5.234   -0.924  1.00 0.00 ?  251 LEU A N    1  
ATOM 601   C CA   . LEU A 1 38  ? -8.196  3.789   -0.840  1.00 0.00 ?  251 LEU A CA   1  
ATOM 602   C C    . LEU A 1 38  ? -9.511  3.144   -1.285  1.00 0.00 ?  251 LEU A C    1  
ATOM 603   O O    . LEU A 1 38  ? -10.585 3.698   -1.060  1.00 0.00 ?  251 LEU A O    1  
ATOM 604   C CB   . LEU A 1 38  ? -7.749  3.369   0.561   1.00 0.00 ?  251 LEU A CB   1  
ATOM 605   C CG   . LEU A 1 38  ? -6.258  3.068   0.728   1.00 0.00 ?  251 LEU A CG   1  
ATOM 606   C CD1  . LEU A 1 38  ? -5.409  4.284   0.354   1.00 0.00 ?  251 LEU A CD1  1  
ATOM 607   C CD2  . LEU A 1 38  ? -5.954  2.570   2.143   1.00 0.00 ?  251 LEU A CD2  1  
ATOM 608   H H    . LEU A 1 38  ? -8.428  5.701   -0.047  1.00 0.00 ?  251 LEU A H    1  
ATOM 609   H HA   . LEU A 1 38  ? -7.411  3.486   -1.533  1.00 0.00 ?  251 LEU A HA   1  
ATOM 610   H HB2  . LEU A 1 38  ? -8.020  4.161   1.260   1.00 0.00 ?  251 LEU A HB2  1  
ATOM 611   H HB3  . LEU A 1 38  ? -8.313  2.482   0.851   1.00 0.00 ?  251 LEU A HB3  1  
ATOM 612   H HG   . LEU A 1 38  ? -5.993  2.266   0.040   1.00 0.00 ?  251 LEU A HG   1  
ATOM 613   H HD11 . LEU A 1 38  ? -5.883  4.819   -0.469  1.00 0.00 ?  251 LEU A HD11 1  
ATOM 614   H HD12 . LEU A 1 38  ? -5.322  4.946   1.216   1.00 0.00 ?  251 LEU A HD12 1  
ATOM 615   H HD13 . LEU A 1 38  ? -4.416  3.954   0.049   1.00 0.00 ?  251 LEU A HD13 1  
ATOM 616   H HD21 . LEU A 1 38  ? -6.449  1.612   2.304   1.00 0.00 ?  251 LEU A HD21 1  
ATOM 617   H HD22 . LEU A 1 38  ? -4.878  2.448   2.261   1.00 0.00 ?  251 LEU A HD22 1  
ATOM 618   H HD23 . LEU A 1 38  ? -6.320  3.295   2.870   1.00 0.00 ?  251 LEU A HD23 1  
ATOM 619   N N    . ARG A 1 39  ? -9.382  1.983   -1.909  1.00 0.00 ?  252 ARG A N    1  
ATOM 620   C CA   . ARG A 1 39  ? -10.546 1.257   -2.388  1.00 0.00 ?  252 ARG A CA   1  
ATOM 621   C C    . ARG A 1 39  ? -10.673 -0.083  -1.660  1.00 0.00 ?  252 ARG A C    1  
ATOM 622   O O    . ARG A 1 39  ? -9.830  -0.964  -1.822  1.00 0.00 ?  252 ARG A O    1  
ATOM 623   C CB   . ARG A 1 39  ? -10.456 1.004   -3.895  1.00 0.00 ?  252 ARG A CB   1  
ATOM 624   C CG   . ARG A 1 39  ? -11.791 0.499   -4.446  1.00 0.00 ?  252 ARG A CG   1  
ATOM 625   C CD   . ARG A 1 39  ? -12.808 1.638   -4.547  1.00 0.00 ?  252 ARG A CD   1  
ATOM 626   N NE   . ARG A 1 39  ? -13.621 1.483   -5.774  1.00 0.00 ?  252 ARG A NE   1  
ATOM 627   C CZ   . ARG A 1 39  ? -14.648 2.280   -6.100  1.00 0.00 ?  252 ARG A CZ   1  
ATOM 628   N NH1  . ARG A 1 39  ? -14.993 3.293   -5.293  1.00 0.00 ?  252 ARG A NH1  1  
ATOM 629   N NH2  . ARG A 1 39  ? -15.329 2.065   -7.234  1.00 0.00 1  252 ARG A NH2  1  
ATOM 630   H H    . ARG A 1 39  ? -8.504  1.539   -2.089  1.00 0.00 ?  252 ARG A H    1  
ATOM 631   H HA   . ARG A 1 39  ? -11.391 1.907   -2.164  1.00 0.00 ?  252 ARG A HA   1  
ATOM 632   H HB2  . ARG A 1 39  ? -10.172 1.924   -4.405  1.00 0.00 ?  252 ARG A HB2  1  
ATOM 633   H HB3  . ARG A 1 39  ? -9.674  0.272   -4.098  1.00 0.00 ?  252 ARG A HB3  1  
ATOM 634   H HG2  . ARG A 1 39  ? -11.638 0.056   -5.430  1.00 0.00 ?  252 ARG A HG2  1  
ATOM 635   H HG3  . ARG A 1 39  ? -12.182 -0.286  -3.800  1.00 0.00 ?  252 ARG A HG3  1  
ATOM 636   H HD2  . ARG A 1 39  ? -13.455 1.637   -3.669  1.00 0.00 ?  252 ARG A HD2  1  
ATOM 637   H HD3  . ARG A 1 39  ? -12.292 2.598   -4.561  1.00 0.00 ?  252 ARG A HD3  1  
ATOM 638   H HE   . ARG A 1 39  ? -13.390 0.737   -6.398  1.00 0.00 ?  252 ARG A HE   1  
ATOM 639   H HH11 . ARG A 1 39  ? -14.484 3.453   -4.447  1.00 0.00 ?  252 ARG A HH11 1  
ATOM 640   H HH12 . ARG A 1 39  ? -15.759 3.888   -5.537  1.00 0.00 ?  252 ARG A HH12 1  
ATOM 641   H HH21 . ARG A 1 39  ? -15.072 1.310   -7.836  1.00 0.00 ?  252 ARG A HH21 1  
ATOM 642   H HH22 . ARG A 1 39  ? -16.095 2.660   -7.477  1.00 0.00 ?  252 ARG A HH22 1  
ATOM 643   N N    . ALA A 1 40  ? -11.733 -0.194  -0.873  1.00 0.00 ?  253 ALA A N    1  
ATOM 644   C CA   . ALA A 1 40  ? -11.981 -1.411  -0.119  1.00 0.00 ?  253 ALA A CA   1  
ATOM 645   C C    . ALA A 1 40  ? -12.613 -2.456  -1.041  1.00 0.00 ?  253 ALA A C    1  
ATOM 646   O O    . ALA A 1 40  ? -13.620 -2.187  -1.693  1.00 0.00 ?  253 ALA A O    1  
ATOM 647   C CB   . ALA A 1 40  ? -12.862 -1.092  1.090   1.00 0.00 ?  253 ALA A CB   1  
ATOM 648   H H    . ALA A 1 40  ? -12.414 0.528   -0.747  1.00 0.00 ?  253 ALA A H    1  
ATOM 649   H HA   . ALA A 1 40  ? -11.020 -1.784  0.235   1.00 0.00 ?  253 ALA A HA   1  
ATOM 650   H HB1  . ALA A 1 40  ? -12.646 -1.796  1.893   1.00 0.00 ?  253 ALA A HB1  1  
ATOM 651   H HB2  . ALA A 1 40  ? -12.657 -0.077  1.431   1.00 0.00 ?  253 ALA A HB2  1  
ATOM 652   H HB3  . ALA A 1 40  ? -13.912 -1.175  0.807   1.00 0.00 ?  253 ALA A HB3  1  
ATOM 653   N N    . ARG A 1 41  ? -11.995 -3.628  -1.065  1.00 0.00 ?  254 ARG A N    1  
ATOM 654   C CA   . ARG A 1 41  ? -12.484 -4.715  -1.896  1.00 0.00 ?  254 ARG A CA   1  
ATOM 655   C C    . ARG A 1 41  ? -12.393 -6.043  -1.141  1.00 0.00 ?  254 ARG A C    1  
ATOM 656   O O    . ARG A 1 41  ? -11.400 -6.311  -0.466  1.00 0.00 ?  254 ARG A O    1  
ATOM 657   C CB   . ARG A 1 41  ? -11.682 -4.820  -3.195  1.00 0.00 ?  254 ARG A CB   1  
ATOM 658   C CG   . ARG A 1 41  ? -10.239 -5.247  -2.916  1.00 0.00 ?  254 ARG A CG   1  
ATOM 659   C CD   . ARG A 1 41  ? -9.391  -5.178  -4.187  1.00 0.00 ?  254 ARG A CD   1  
ATOM 660   N NE   . ARG A 1 41  ? -9.158  -6.541  -4.715  1.00 0.00 ?  254 ARG A NE   1  
ATOM 661   C CZ   . ARG A 1 41  ? -8.650  -6.800  -5.927  1.00 0.00 ?  254 ARG A CZ   1  
ATOM 662   N NH1  . ARG A 1 41  ? -8.318  -5.791  -6.745  1.00 0.00 ?  254 ARG A NH1  1  
ATOM 663   N NH2  . ARG A 1 41  ? -8.473  -8.068  -6.323  1.00 0.00 1  254 ARG A NH2  1  
ATOM 664   H H    . ARG A 1 41  ? -11.176 -3.839  -0.531  1.00 0.00 ?  254 ARG A H    1  
ATOM 665   H HA   . ARG A 1 41  ? -13.520 -4.457  -2.111  1.00 0.00 ?  254 ARG A HA   1  
ATOM 666   H HB2  . ARG A 1 41  ? -12.155 -5.540  -3.862  1.00 0.00 ?  254 ARG A HB2  1  
ATOM 667   H HB3  . ARG A 1 41  ? -11.687 -3.858  -3.708  1.00 0.00 ?  254 ARG A HB3  1  
ATOM 668   H HG2  . ARG A 1 41  ? -9.807  -4.603  -2.150  1.00 0.00 ?  254 ARG A HG2  1  
ATOM 669   H HG3  . ARG A 1 41  ? -10.227 -6.263  -2.521  1.00 0.00 ?  254 ARG A HG3  1  
ATOM 670   H HD2  . ARG A 1 41  ? -9.895  -4.569  -4.938  1.00 0.00 ?  254 ARG A HD2  1  
ATOM 671   H HD3  . ARG A 1 41  ? -8.438  -4.694  -3.972  1.00 0.00 ?  254 ARG A HD3  1  
ATOM 672   H HE   . ARG A 1 41  ? -9.395  -7.317  -4.130  1.00 0.00 ?  254 ARG A HE   1  
ATOM 673   H HH11 . ARG A 1 41  ? -8.450  -4.845  -6.449  1.00 0.00 ?  254 ARG A HH11 1  
ATOM 674   H HH12 . ARG A 1 41  ? -7.939  -5.984  -7.649  1.00 0.00 ?  254 ARG A HH12 1  
ATOM 675   H HH21 . ARG A 1 41  ? -8.721  -8.821  -5.713  1.00 0.00 ?  254 ARG A HH21 1  
ATOM 676   H HH22 . ARG A 1 41  ? -8.094  -8.261  -7.228  1.00 0.00 ?  254 ARG A HH22 1  
ATOM 677   N N    . THR A 1 42  ? -13.443 -6.839  -1.279  1.00 0.00 ?  255 THR A N    1  
ATOM 678   C CA   . THR A 1 42  ? -13.495 -8.132  -0.618  1.00 0.00 ?  255 THR A CA   1  
ATOM 679   C C    . THR A 1 42  ? -12.921 -9.219  -1.528  1.00 0.00 ?  255 THR A C    1  
ATOM 680   O O    . THR A 1 42  ? -13.386 -9.402  -2.652  1.00 0.00 ?  255 THR A O    1  
ATOM 681   C CB   . THR A 1 42  ? -14.943 -8.391  -0.200  1.00 0.00 ?  255 THR A CB   1  
ATOM 682   O OG1  . THR A 1 42  ? -15.128 -7.561  0.943   1.00 0.00 ?  255 THR A OG1  1  
ATOM 683   C CG2  . THR A 1 42  ? -15.153 -9.810  0.333   1.00 0.00 ?  255 THR A CG2  1  
ATOM 684   H H    . THR A 1 42  ? -14.247 -6.613  -1.830  1.00 0.00 ?  255 THR A H    1  
ATOM 685   H HA   . THR A 1 42  ? -12.861 -8.090  0.268   1.00 0.00 ?  255 THR A HA   1  
ATOM 686   H HB   . THR A 1 42  ? -15.629 -8.177  -1.019  1.00 0.00 ?  255 THR A HB   1  
ATOM 687   H HG1  . THR A 1 42  ? -16.032 -7.721  1.340   1.00 0.00 ?  255 THR A HG1  1  
ATOM 688   H HG21 . THR A 1 42  ? -16.066 -9.844  0.928   1.00 0.00 ?  255 THR A HG21 1  
ATOM 689   H HG22 . THR A 1 42  ? -15.240 -10.503 -0.504  1.00 0.00 ?  255 THR A HG22 1  
ATOM 690   H HG23 . THR A 1 42  ? -14.304 -10.095 0.954   1.00 0.00 ?  255 THR A HG23 1  
ATOM 691   N N    . VAL A 1 43  ? -11.918 -9.913  -1.009  1.00 0.00 ?  256 VAL A N    1  
ATOM 692   C CA   . VAL A 1 43  ? -11.276 -10.977 -1.761  1.00 0.00 ?  256 VAL A CA   1  
ATOM 693   C C    . VAL A 1 43  ? -11.695 -12.330 -1.181  1.00 0.00 ?  256 VAL A C    1  
ATOM 694   O O    . VAL A 1 43  ? -11.336 -12.663 -0.052  1.00 0.00 ?  256 VAL A O    1  
ATOM 695   C CB   . VAL A 1 43  ? -9.760  -10.773 -1.767  1.00 0.00 ?  256 VAL A CB   1  
ATOM 696   C CG1  . VAL A 1 43  ? -9.031  -12.088 -2.052  1.00 0.00 ?  256 VAL A CG1  1  
ATOM 697   C CG2  . VAL A 1 43  ? -9.356  -9.693  -2.772  1.00 0.00 ?  256 VAL A CG2  1  
ATOM 698   H H    . VAL A 1 43  ? -11.546 -9.758  -0.094  1.00 0.00 ?  256 VAL A H    1  
ATOM 699   H HA   . VAL A 1 43  ? -11.629 -10.913 -2.790  1.00 0.00 ?  256 VAL A HA   1  
ATOM 700   H HB   . VAL A 1 43  ? -9.464  -10.435 -0.774  1.00 0.00 ?  256 VAL A HB   1  
ATOM 701   H HG11 . VAL A 1 43  ? -9.243  -12.406 -3.073  1.00 0.00 ?  256 VAL A HG11 1  
ATOM 702   H HG12 . VAL A 1 43  ? -7.957  -11.941 -1.933  1.00 0.00 ?  256 VAL A HG12 1  
ATOM 703   H HG13 . VAL A 1 43  ? -9.373  -12.852 -1.354  1.00 0.00 ?  256 VAL A HG13 1  
ATOM 704   H HG21 . VAL A 1 43  ? -9.404  -10.099 -3.781  1.00 0.00 ?  256 VAL A HG21 1  
ATOM 705   H HG22 . VAL A 1 43  ? -10.038 -8.846  -2.688  1.00 0.00 ?  256 VAL A HG22 1  
ATOM 706   H HG23 . VAL A 1 43  ? -8.339  -9.362  -2.561  1.00 0.00 ?  256 VAL A HG23 1  
ATOM 707   N N    . PRO A 1 44  ? -12.469 -13.092 -2.000  1.00 0.00 ?  257 PRO A N    1  
ATOM 708   C CA   . PRO A 1 44  ? -12.940 -14.400 -1.579  1.00 0.00 ?  257 PRO A CA   1  
ATOM 709   C C    . PRO A 1 44  ? -11.811 -15.432 -1.629  1.00 0.00 ?  257 PRO A C    1  
ATOM 710   O O    . PRO A 1 44  ? -10.741 -15.161 -2.172  1.00 0.00 ?  257 PRO A O    1  
ATOM 711   C CB   . PRO A 1 44  ? -14.086 -14.727 -2.523  1.00 0.00 ?  257 PRO A CB   1  
ATOM 712   C CG   . PRO A 1 44  ? -13.913 -13.809 -3.722  1.00 0.00 ?  257 PRO A CG   1  
ATOM 713   C CD   . PRO A 1 44  ? -12.913 -12.729 -3.342  1.00 0.00 ?  257 PRO A CD   1  
ATOM 714   H HA   . PRO A 1 44  ? -13.242 -14.371 -0.626  1.00 0.00 ?  257 PRO A HA   1  
ATOM 715   H HB2  . PRO A 1 44  ? -14.056 -15.774 -2.826  1.00 0.00 ?  257 PRO A HB2  1  
ATOM 716   H HB3  . PRO A 1 44  ? -15.049 -14.563 -2.041  1.00 0.00 ?  257 PRO A HB3  1  
ATOM 717   H HG2  . PRO A 1 44  ? -13.558 -14.371 -4.586  1.00 0.00 ?  257 PRO A HG2  1  
ATOM 718   H HG3  . PRO A 1 44  ? -14.868 -13.364 -4.003  1.00 0.00 ?  257 PRO A HG3  1  
ATOM 719   H HD2  . PRO A 1 44  ? -12.078 -12.699 -4.041  1.00 0.00 ?  257 PRO A HD2  1  
ATOM 720   H HD3  . PRO A 1 44  ? -13.374 -11.741 -3.353  1.00 0.00 ?  257 PRO A HD3  1  
ATOM 721   N N    . ALA A 1 45  ? -12.088 -16.593 -1.055  1.00 0.00 ?  258 ALA A N    1  
ATOM 722   C CA   . ALA A 1 45  ? -11.110 -17.667 -1.027  1.00 0.00 ?  258 ALA A CA   1  
ATOM 723   C C    . ALA A 1 45  ? -10.835 -18.139 -2.456  1.00 0.00 ?  258 ALA A C    1  
ATOM 724   O O    . ALA A 1 45  ? -11.763 -18.471 -3.193  1.00 0.00 ?  258 ALA A O    1  
ATOM 725   C CB   . ALA A 1 45  ? -11.616 -18.796 -0.127  1.00 0.00 ?  258 ALA A CB   1  
ATOM 726   H H    . ALA A 1 45  ? -12.961 -16.806 -0.615  1.00 0.00 ?  258 ALA A H    1  
ATOM 727   H HA   . ALA A 1 45  ? -10.189 -17.266 -0.603  1.00 0.00 ?  258 ALA A HA   1  
ATOM 728   H HB1  . ALA A 1 45  ? -12.315 -19.419 -0.684  1.00 0.00 ?  258 ALA A HB1  1  
ATOM 729   H HB2  . ALA A 1 45  ? -10.773 -19.403 0.203   1.00 0.00 ?  258 ALA A HB2  1  
ATOM 730   H HB3  . ALA A 1 45  ? -12.120 -18.371 0.741   1.00 0.00 ?  258 ALA A HB3  1  
ATOM 731   N N    . GLY A 1 46  ? -9.557  -18.153 -2.806  1.00 0.00 ?  259 GLY A N    1  
ATOM 732   C CA   . GLY A 1 46  ? -9.150  -18.578 -4.134  1.00 0.00 ?  259 GLY A CA   1  
ATOM 733   C C    . GLY A 1 46  ? -8.855  -17.373 -5.029  1.00 0.00 ?  259 GLY A C    1  
ATOM 734   O O    . GLY A 1 46  ? -8.086  -17.478 -5.984  1.00 0.00 ?  259 GLY A O    1  
ATOM 735   H H    . GLY A 1 46  ? -8.809  -17.881 -2.201  1.00 0.00 ?  259 GLY A H    1  
ATOM 736   H HA2  . GLY A 1 46  ? -8.263  -19.208 -4.061  1.00 0.00 ?  259 GLY A HA2  1  
ATOM 737   H HA3  . GLY A 1 46  ? -9.936  -19.186 -4.582  1.00 0.00 ?  259 GLY A HA3  1  
ATOM 738   N N    . ALA A 1 47  ? -9.482  -16.257 -4.690  1.00 0.00 ?  260 ALA A N    1  
ATOM 739   C CA   . ALA A 1 47  ? -9.297  -15.033 -5.451  1.00 0.00 ?  260 ALA A CA   1  
ATOM 740   C C    . ALA A 1 47  ? -7.863  -14.533 -5.264  1.00 0.00 ?  260 ALA A C    1  
ATOM 741   O O    . ALA A 1 47  ? -7.376  -14.442 -4.138  1.00 0.00 ?  260 ALA A O    1  
ATOM 742   C CB   . ALA A 1 47  ? -10.337 -13.999 -5.016  1.00 0.00 ?  260 ALA A CB   1  
ATOM 743   H H    . ALA A 1 47  ? -10.106 -16.180 -3.912  1.00 0.00 ?  260 ALA A H    1  
ATOM 744   H HA   . ALA A 1 47  ? -9.456  -15.270 -6.503  1.00 0.00 ?  260 ALA A HA   1  
ATOM 745   H HB1  . ALA A 1 47  ? -10.131 -13.048 -5.508  1.00 0.00 ?  260 ALA A HB1  1  
ATOM 746   H HB2  . ALA A 1 47  ? -11.332 -14.344 -5.296  1.00 0.00 ?  260 ALA A HB2  1  
ATOM 747   H HB3  . ALA A 1 47  ? -10.288 -13.867 -3.935  1.00 0.00 ?  260 ALA A HB3  1  
ATOM 748   N N    . VAL A 1 48  ? -7.228  -14.222 -6.384  1.00 0.00 ?  261 VAL A N    1  
ATOM 749   C CA   . VAL A 1 48  ? -5.860  -13.733 -6.358  1.00 0.00 ?  261 VAL A CA   1  
ATOM 750   C C    . VAL A 1 48  ? -5.869  -12.212 -6.191  1.00 0.00 ?  261 VAL A C    1  
ATOM 751   O O    . VAL A 1 48  ? -6.644  -11.517 -6.846  1.00 0.00 ?  261 VAL A O    1  
ATOM 752   C CB   . VAL A 1 48  ? -5.116  -14.192 -7.614  1.00 0.00 ?  261 VAL A CB   1  
ATOM 753   C CG1  . VAL A 1 48  ? -5.914  -13.858 -8.876  1.00 0.00 ?  261 VAL A CG1  1  
ATOM 754   C CG2  . VAL A 1 48  ? -3.714  -13.582 -7.674  1.00 0.00 ?  261 VAL A CG2  1  
ATOM 755   H H    . VAL A 1 48  ? -7.632  -14.298 -7.296  1.00 0.00 ?  261 VAL A H    1  
ATOM 756   H HA   . VAL A 1 48  ? -5.369  -14.178 -5.493  1.00 0.00 ?  261 VAL A HA   1  
ATOM 757   H HB   . VAL A 1 48  ? -5.008  -15.275 -7.563  1.00 0.00 ?  261 VAL A HB   1  
ATOM 758   H HG11 . VAL A 1 48  ? -6.587  -13.026 -8.671  1.00 0.00 ?  261 VAL A HG11 1  
ATOM 759   H HG12 . VAL A 1 48  ? -5.228  -13.581 -9.677  1.00 0.00 ?  261 VAL A HG12 1  
ATOM 760   H HG13 . VAL A 1 48  ? -6.495  -14.729 -9.180  1.00 0.00 ?  261 VAL A HG13 1  
ATOM 761   H HG21 . VAL A 1 48  ? -3.436  -13.413 -8.714  1.00 0.00 ?  261 VAL A HG21 1  
ATOM 762   H HG22 . VAL A 1 48  ? -3.707  -12.634 -7.137  1.00 0.00 ?  261 VAL A HG22 1  
ATOM 763   H HG23 . VAL A 1 48  ? -3.001  -14.266 -7.214  1.00 0.00 ?  261 VAL A HG23 1  
ATOM 764   N N    . ILE A 1 49  ? -5.000  -11.741 -5.309  1.00 0.00 ?  262 ILE A N    1  
ATOM 765   C CA   . ILE A 1 49  ? -4.898  -10.315 -5.047  1.00 0.00 ?  262 ILE A CA   1  
ATOM 766   C C    . ILE A 1 49  ? -4.017  -9.666  -6.117  1.00 0.00 ?  262 ILE A C    1  
ATOM 767   O O    . ILE A 1 49  ? -4.351  -8.604  -6.640  1.00 0.00 ?  262 ILE A O    1  
ATOM 768   C CB   . ILE A 1 49  ? -4.414  -10.066 -3.618  1.00 0.00 ?  262 ILE A CB   1  
ATOM 769   C CG1  . ILE A 1 49  ? -5.231  -10.881 -2.612  1.00 0.00 ?  262 ILE A CG1  1  
ATOM 770   C CG2  . ILE A 1 49  ? -4.424  -8.572  -3.287  1.00 0.00 ?  262 ILE A CG2  1  
ATOM 771   C CD1  . ILE A 1 49  ? -4.596  -10.830 -1.221  1.00 0.00 ?  262 ILE A CD1  1  
ATOM 772   H H    . ILE A 1 49  ? -4.373  -12.313 -4.780  1.00 0.00 ?  262 ILE A H    1  
ATOM 773   H HA   . ILE A 1 49  ? -5.901  -9.896  -5.125  1.00 0.00 ?  262 ILE A HA   1  
ATOM 774   H HB   . ILE A 1 49  ? -3.381  -10.405 -3.543  1.00 0.00 ?  262 ILE A HB   1  
ATOM 775   H HG12 . ILE A 1 49  ? -6.248  -10.493 -2.566  1.00 0.00 ?  262 ILE A HG12 1  
ATOM 776   H HG13 . ILE A 1 49  ? -5.299  -11.916 -2.948  1.00 0.00 ?  262 ILE A HG13 1  
ATOM 777   H HG21 . ILE A 1 49  ? -4.908  -8.025  -4.096  1.00 0.00 ?  262 ILE A HG21 1  
ATOM 778   H HG22 . ILE A 1 49  ? -4.972  -8.409  -2.360  1.00 0.00 ?  262 ILE A HG22 1  
ATOM 779   H HG23 . ILE A 1 49  ? -3.400  -8.219  -3.171  1.00 0.00 ?  262 ILE A HG23 1  
ATOM 780   H HD11 . ILE A 1 49  ? -4.971  -11.659 -0.620  1.00 0.00 ?  262 ILE A HD11 1  
ATOM 781   H HD12 . ILE A 1 49  ? -3.512  -10.909 -1.313  1.00 0.00 ?  262 ILE A HD12 1  
ATOM 782   H HD13 . ILE A 1 49  ? -4.851  -9.887  -0.739  1.00 0.00 ?  262 ILE A HD13 1  
ATOM 783   N N    . CYS A 1 50  ? -2.910  -10.332 -6.410  1.00 0.00 ?  263 CYS A N    1  
ATOM 784   C CA   . CYS A 1 50  ? -1.978  -9.833  -7.407  1.00 0.00 ?  263 CYS A CA   1  
ATOM 785   C C    . CYS A 1 50  ? -1.247  -11.028 -8.021  1.00 0.00 ?  263 CYS A C    1  
ATOM 786   O O    . CYS A 1 50  ? -1.000  -12.024 -7.344  1.00 0.00 ?  263 CYS A O    1  
ATOM 787   C CB   . CYS A 1 50  ? -1.006  -8.812  -6.812  1.00 0.00 ?  263 CYS A CB   1  
ATOM 788   S SG   . CYS A 1 50  ? 0.320   -9.675  -5.891  1.00 0.00 ?  263 CYS A SG   1  
ATOM 789   H H    . CYS A 1 50  ? -2.646  -11.195 -5.979  1.00 0.00 ?  263 CYS A H    1  
ATOM 790   H HA   . CYS A 1 50  ? -2.573  -9.314  -8.159  1.00 0.00 ?  263 CYS A HA   1  
ATOM 791   H HB2  . CYS A 1 50  ? -0.572  -8.205  -7.607  1.00 0.00 ?  263 CYS A HB2  1  
ATOM 792   H HB3  . CYS A 1 50  ? -1.540  -8.133  -6.147  1.00 0.00 ?  263 CYS A HB3  1  
ATOM 793   H HG   . CYS A 1 50  ? 1.223   -9.622  -6.865  1.00 0.00 ?  263 CYS A HG   1  
ATOM 794   N N    . ARG A 1 51  ? -0.921  -10.889 -9.298  1.00 0.00 ?  264 ARG A N    1  
ATOM 795   C CA   . ARG A 1 51  ? -0.223  -11.944 -10.012 1.00 0.00 ?  264 ARG A CA   1  
ATOM 796   C C    . ARG A 1 51  ? 1.288   -11.819 -9.800  1.00 0.00 ?  264 ARG A C    1  
ATOM 797   O O    . ARG A 1 51  ? 1.747   -10.916 -9.103  1.00 0.00 ?  264 ARG A O    1  
ATOM 798   C CB   . ARG A 1 51  ? -0.527  -11.891 -11.510 1.00 0.00 ?  264 ARG A CB   1  
ATOM 799   C CG   . ARG A 1 51  ? -1.925  -12.439 -11.806 1.00 0.00 ?  264 ARG A CG   1  
ATOM 800   C CD   . ARG A 1 51  ? -1.861  -13.911 -12.218 1.00 0.00 ?  264 ARG A CD   1  
ATOM 801   N NE   . ARG A 1 51  ? -2.784  -14.160 -13.348 1.00 0.00 ?  264 ARG A NE   1  
ATOM 802   C CZ   . ARG A 1 51  ? -4.094  -14.405 -13.207 1.00 0.00 ?  264 ARG A CZ   1  
ATOM 803   N NH1  . ARG A 1 51  ? -4.643  -14.435 -11.985 1.00 0.00 ?  264 ARG A NH1  1  
ATOM 804   N NH2  . ARG A 1 51  ? -4.855  -14.620 -14.289 1.00 0.00 1  264 ARG A NH2  1  
ATOM 805   H H    . ARG A 1 51  ? -1.125  -10.075 -9.842  1.00 0.00 ?  264 ARG A H    1  
ATOM 806   H HA   . ARG A 1 51  ? -0.604  -12.870 -9.581  1.00 0.00 ?  264 ARG A HA   1  
ATOM 807   H HB2  . ARG A 1 51  ? -0.454  -10.862 -11.863 1.00 0.00 ?  264 ARG A HB2  1  
ATOM 808   H HB3  . ARG A 1 51  ? 0.217   -12.470 -12.057 1.00 0.00 ?  264 ARG A HB3  1  
ATOM 809   H HG2  . ARG A 1 51  ? -2.555  -12.332 -10.923 1.00 0.00 ?  264 ARG A HG2  1  
ATOM 810   H HG3  . ARG A 1 51  ? -2.388  -11.854 -12.601 1.00 0.00 ?  264 ARG A HG3  1  
ATOM 811   H HD2  . ARG A 1 51  ? -0.843  -14.172 -12.505 1.00 0.00 ?  264 ARG A HD2  1  
ATOM 812   H HD3  . ARG A 1 51  ? -2.127  -14.546 -11.373 1.00 0.00 ?  264 ARG A HD3  1  
ATOM 813   H HE   . ARG A 1 51  ? -2.407  -14.145 -14.274 1.00 0.00 ?  264 ARG A HE   1  
ATOM 814   H HH11 . ARG A 1 51  ? -4.075  -14.275 -11.178 1.00 0.00 ?  264 ARG A HH11 1  
ATOM 815   H HH12 . ARG A 1 51  ? -5.620  -14.618 -11.881 1.00 0.00 ?  264 ARG A HH12 1  
ATOM 816   H HH21 . ARG A 1 51  ? -4.446  -14.598 -15.201 1.00 0.00 ?  264 ARG A HH21 1  
ATOM 817   H HH22 . ARG A 1 51  ? -5.833  -14.803 -14.184 1.00 0.00 ?  264 ARG A HH22 1  
ATOM 818   N N    . ILE A 1 52  ? 2.017   -12.738 -10.415 1.00 0.00 ?  265 ILE A N    1  
ATOM 819   C CA   . ILE A 1 52  ? 3.466   -12.742 -10.303 1.00 0.00 ?  265 ILE A CA   1  
ATOM 820   C C    . ILE A 1 52  ? 4.046   -11.655 -11.210 1.00 0.00 ?  265 ILE A C    1  
ATOM 821   O O    . ILE A 1 52  ? 3.637   -11.519 -12.363 1.00 0.00 ?  265 ILE A O    1  
ATOM 822   C CB   . ILE A 1 52  ? 4.021   -14.139 -10.585 1.00 0.00 ?  265 ILE A CB   1  
ATOM 823   C CG1  . ILE A 1 52  ? 4.186   -14.371 -12.088 1.00 0.00 ?  265 ILE A CG1  1  
ATOM 824   C CG2  . ILE A 1 52  ? 3.154   -15.216 -9.931  1.00 0.00 ?  265 ILE A CG2  1  
ATOM 825   C CD1  . ILE A 1 52  ? 2.836   -14.307 -12.805 1.00 0.00 ?  265 ILE A CD1  1  
ATOM 826   H H    . ILE A 1 52  ? 1.635   -13.469 -10.981 1.00 0.00 ?  265 ILE A H    1  
ATOM 827   H HA   . ILE A 1 52  ? 3.714   -12.498 -9.270  1.00 0.00 ?  265 ILE A HA   1  
ATOM 828   H HB   . ILE A 1 52  ? 5.013   -14.209 -10.138 1.00 0.00 ?  265 ILE A HB   1  
ATOM 829   H HG12 . ILE A 1 52  ? 4.858   -13.620 -12.504 1.00 0.00 ?  265 ILE A HG12 1  
ATOM 830   H HG13 . ILE A 1 52  ? 4.648   -15.343 -12.261 1.00 0.00 ?  265 ILE A HG13 1  
ATOM 831   H HG21 . ILE A 1 52  ? 3.623   -16.191 -10.064 1.00 0.00 ?  265 ILE A HG21 1  
ATOM 832   H HG22 . ILE A 1 52  ? 3.052   -15.004 -8.867  1.00 0.00 ?  265 ILE A HG22 1  
ATOM 833   H HG23 . ILE A 1 52  ? 2.168   -15.221 -10.396 1.00 0.00 ?  265 ILE A HG23 1  
ATOM 834   H HD11 . ILE A 1 52  ? 2.148   -15.019 -12.348 1.00 0.00 ?  265 ILE A HD11 1  
ATOM 835   H HD12 . ILE A 1 52  ? 2.427   -13.300 -12.719 1.00 0.00 ?  265 ILE A HD12 1  
ATOM 836   H HD13 . ILE A 1 52  ? 2.971   -14.556 -13.857 1.00 0.00 ?  265 ILE A HD13 1  
ATOM 837   N N    . GLY A 1 53  ? 4.990   -10.909 -10.657 1.00 0.00 ?  266 GLY A N    1  
ATOM 838   C CA   . GLY A 1 53  ? 5.631   -9.838  -11.402 1.00 0.00 ?  266 GLY A CA   1  
ATOM 839   C C    . GLY A 1 53  ? 4.596   -8.842  -11.929 1.00 0.00 ?  266 GLY A C    1  
ATOM 840   O O    . GLY A 1 53  ? 4.587   -8.521  -13.117 1.00 0.00 ?  266 GLY A O    1  
ATOM 841   H H    . GLY A 1 53  ? 5.317   -11.025 -9.719  1.00 0.00 ?  266 GLY A H    1  
ATOM 842   H HA2  . GLY A 1 53  ? 6.345   -9.321  -10.761 1.00 0.00 ?  266 GLY A HA2  1  
ATOM 843   H HA3  . GLY A 1 53  ? 6.195   -10.257 -12.235 1.00 0.00 ?  266 GLY A HA3  1  
ATOM 844   N N    . GLU A 1 54  ? 3.750   -8.379  -11.020 1.00 0.00 ?  267 GLU A N    1  
ATOM 845   C CA   . GLU A 1 54  ? 2.714   -7.426  -11.379 1.00 0.00 ?  267 GLU A CA   1  
ATOM 846   C C    . GLU A 1 54  ? 3.332   -6.061  -11.686 1.00 0.00 ?  267 GLU A C    1  
ATOM 847   O O    . GLU A 1 54  ? 4.493   -5.814  -11.364 1.00 0.00 ?  267 GLU A O    1  
ATOM 848   C CB   . GLU A 1 54  ? 1.663   -7.316  -10.272 1.00 0.00 ?  267 GLU A CB   1  
ATOM 849   C CG   . GLU A 1 54  ? 0.497   -8.274  -10.526 1.00 0.00 ?  267 GLU A CG   1  
ATOM 850   C CD   . GLU A 1 54  ? -0.841  -7.533  -10.480 1.00 0.00 ?  267 GLU A CD   1  
ATOM 851   O OE1  . GLU A 1 54  ? -1.641  -7.638  -11.422 1.00 0.00 ?  267 GLU A OE1  1  
ATOM 852   O OE2  . GLU A 1 54  ? -1.038  -6.829  -9.418  1.00 0.00 -1 267 GLU A OE2  1  
ATOM 853   H H    . GLU A 1 54  ? 3.765   -8.645  -10.056 1.00 0.00 ?  267 GLU A H    1  
ATOM 854   H HA   . GLU A 1 54  ? 2.246   -7.831  -12.277 1.00 0.00 ?  267 GLU A HA   1  
ATOM 855   H HB2  . GLU A 1 54  ? 2.120   -7.541  -9.309  1.00 0.00 ?  267 GLU A HB2  1  
ATOM 856   H HB3  . GLU A 1 54  ? 1.292   -6.293  -10.218 1.00 0.00 ?  267 GLU A HB3  1  
ATOM 857   H HG2  . GLU A 1 54  ? 0.619   -8.751  -11.498 1.00 0.00 ?  267 GLU A HG2  1  
ATOM 858   H HG3  . GLU A 1 54  ? 0.504   -9.067  -9.779  1.00 0.00 ?  267 GLU A HG3  1  
ATOM 859   H HE2  . GLU A 1 54  ? -1.803  -6.200  -9.560  1.00 0.00 ?  267 GLU A HE2  1  
ATOM 860   N N    . PRO A 1 55  ? 2.507   -5.186  -12.321 1.00 0.00 ?  268 PRO A N    1  
ATOM 861   C CA   . PRO A 1 55  ? 2.960   -3.852  -12.675 1.00 0.00 ?  268 PRO A CA   1  
ATOM 862   C C    . PRO A 1 55  ? 3.024   -2.949  -11.441 1.00 0.00 ?  268 PRO A C    1  
ATOM 863   O O    . PRO A 1 55  ? 2.095   -2.188  -11.176 1.00 0.00 ?  268 PRO A O    1  
ATOM 864   C CB   . PRO A 1 55  ? 1.968   -3.363  -13.718 1.00 0.00 ?  268 PRO A CB   1  
ATOM 865   C CG   . PRO A 1 55  ? 0.739   -4.245  -13.571 1.00 0.00 ?  268 PRO A CG   1  
ATOM 866   C CD   . PRO A 1 55  ? 1.125   -5.443  -12.718 1.00 0.00 ?  268 PRO A CD   1  
ATOM 867   H HA   . PRO A 1 55  ? 3.892   -3.886  -13.037 1.00 0.00 ?  268 PRO A HA   1  
ATOM 868   H HB2  . PRO A 1 55  ? 1.718   -2.314  -13.558 1.00 0.00 ?  268 PRO A HB2  1  
ATOM 869   H HB3  . PRO A 1 55  ? 2.387   -3.441  -14.722 1.00 0.00 ?  268 PRO A HB3  1  
ATOM 870   H HG2  . PRO A 1 55  ? -0.075  -3.691  -13.104 1.00 0.00 ?  268 PRO A HG2  1  
ATOM 871   H HG3  . PRO A 1 55  ? 0.384   -4.571  -14.548 1.00 0.00 ?  268 PRO A HG3  1  
ATOM 872   H HD2  . PRO A 1 55  ? 0.475   -5.536  -11.849 1.00 0.00 ?  268 PRO A HD2  1  
ATOM 873   H HD3  . PRO A 1 55  ? 1.041   -6.373  -13.280 1.00 0.00 ?  268 PRO A HD3  1  
ATOM 874   N N    . GLY A 1 56  ? 4.130   -3.064  -10.720 1.00 0.00 ?  269 GLY A N    1  
ATOM 875   C CA   . GLY A 1 56  ? 4.327   -2.267  -9.521  1.00 0.00 ?  269 GLY A CA   1  
ATOM 876   C C    . GLY A 1 56  ? 3.777   -0.852  -9.707  1.00 0.00 ?  269 GLY A C    1  
ATOM 877   O O    . GLY A 1 56  ? 4.476   0.030   -10.204 1.00 0.00 ?  269 GLY A O    1  
ATOM 878   H H    . GLY A 1 56  ? 4.881   -3.685  -10.944 1.00 0.00 ?  269 GLY A H    1  
ATOM 879   H HA2  . GLY A 1 56  ? 3.832   -2.746  -8.677  1.00 0.00 ?  269 GLY A HA2  1  
ATOM 880   H HA3  . GLY A 1 56  ? 5.389   -2.220  -9.283  1.00 0.00 ?  269 GLY A HA3  1  
ATOM 881   N N    . ASP A 1 57  ? 2.529   -0.678  -9.296  1.00 0.00 ?  270 ASP A N    1  
ATOM 882   C CA   . ASP A 1 57  ? 1.876   0.615   -9.411  1.00 0.00 ?  270 ASP A CA   1  
ATOM 883   C C    . ASP A 1 57  ? 0.536   0.572   -8.675  1.00 0.00 ?  270 ASP A C    1  
ATOM 884   O O    . ASP A 1 57  ? -0.445  1.161   -9.129  1.00 0.00 ?  270 ASP A O    1  
ATOM 885   C CB   . ASP A 1 57  ? 1.601   0.966   -10.874 1.00 0.00 ?  270 ASP A CB   1  
ATOM 886   C CG   . ASP A 1 57  ? 2.614   1.918   -11.513 1.00 0.00 ?  270 ASP A CG   1  
ATOM 887   O OD1  . ASP A 1 57  ? 3.412   1.517   -12.374 1.00 0.00 ?  270 ASP A OD1  1  
ATOM 888   O OD2  . ASP A 1 57  ? 2.563   3.134   -11.087 1.00 0.00 -1 270 ASP A OD2  1  
ATOM 889   H H    . ASP A 1 57  ? 1.967   -1.400  -8.893  1.00 0.00 ?  270 ASP A H    1  
ATOM 890   H HA   . ASP A 1 57  ? 2.573   1.327   -8.968  1.00 0.00 ?  270 ASP A HA   1  
ATOM 891   H HB2  . ASP A 1 57  ? 1.576   0.043   -11.455 1.00 0.00 ?  270 ASP A HB2  1  
ATOM 892   H HB3  . ASP A 1 57  ? 0.610   1.414   -10.945 1.00 0.00 ?  270 ASP A HB3  1  
ATOM 893   H HD2  . ASP A 1 57  ? 2.409   3.759   -11.852 1.00 0.00 ?  270 ASP A HD2  1  
ATOM 894   N N    . ARG A 1 58  ? 0.536   -0.130  -7.551  1.00 0.00 ?  271 ARG A N    1  
ATOM 895   C CA   . ARG A 1 58  ? -0.668  -0.257  -6.748  1.00 0.00 ?  271 ARG A CA   1  
ATOM 896   C C    . ARG A 1 58  ? -0.339  -0.894  -5.396  1.00 0.00 ?  271 ARG A C    1  
ATOM 897   O O    . ARG A 1 58  ? 0.566   -1.721  -5.300  1.00 0.00 ?  271 ARG A O    1  
ATOM 898   C CB   . ARG A 1 58  ? -1.720  -1.107  -7.463  1.00 0.00 ?  271 ARG A CB   1  
ATOM 899   C CG   . ARG A 1 58  ? -3.004  -0.309  -7.697  1.00 0.00 ?  271 ARG A CG   1  
ATOM 900   C CD   . ARG A 1 58  ? -4.173  -1.237  -8.034  1.00 0.00 ?  271 ARG A CD   1  
ATOM 901   N NE   . ARG A 1 58  ? -5.179  -0.511  -8.841  1.00 0.00 ?  271 ARG A NE   1  
ATOM 902   C CZ   . ARG A 1 58  ? -6.194  -1.103  -9.484  1.00 0.00 ?  271 ARG A CZ   1  
ATOM 903   N NH1  . ARG A 1 58  ? -6.344  -2.433  -9.420  1.00 0.00 ?  271 ARG A NH1  1  
ATOM 904   N NH2  . ARG A 1 58  ? -7.059  -0.364  -10.193 1.00 0.00 1  271 ARG A NH2  1  
ATOM 905   H H    . ARG A 1 58  ? 1.338   -0.605  -7.189  1.00 0.00 ?  271 ARG A H    1  
ATOM 906   H HA   . ARG A 1 58  ? -1.028  0.764   -6.623  1.00 0.00 ?  271 ARG A HA   1  
ATOM 907   H HB2  . ARG A 1 58  ? -1.324  -1.455  -8.417  1.00 0.00 ?  271 ARG A HB2  1  
ATOM 908   H HB3  . ARG A 1 58  ? -1.941  -1.994  -6.868  1.00 0.00 ?  271 ARG A HB3  1  
ATOM 909   H HG2  . ARG A 1 58  ? -3.242  0.273   -6.806  1.00 0.00 ?  271 ARG A HG2  1  
ATOM 910   H HG3  . ARG A 1 58  ? -2.852  0.401   -8.510  1.00 0.00 ?  271 ARG A HG3  1  
ATOM 911   H HD2  . ARG A 1 58  ? -3.811  -2.106  -8.584  1.00 0.00 ?  271 ARG A HD2  1  
ATOM 912   H HD3  . ARG A 1 58  ? -4.629  -1.608  -7.116  1.00 0.00 ?  271 ARG A HD3  1  
ATOM 913   H HE   . ARG A 1 58  ? -5.096  0.483   -8.910  1.00 0.00 ?  271 ARG A HE   1  
ATOM 914   H HH11 . ARG A 1 58  ? -5.699  -2.984  -8.891  1.00 0.00 ?  271 ARG A HH11 1  
ATOM 915   H HH12 . ARG A 1 58  ? -7.102  -2.874  -9.900  1.00 0.00 ?  271 ARG A HH12 1  
ATOM 916   H HH21 . ARG A 1 58  ? -6.947  0.628   -10.241 1.00 0.00 ?  271 ARG A HH21 1  
ATOM 917   H HH22 . ARG A 1 58  ? -7.817  -0.806  -10.673 1.00 0.00 ?  271 ARG A HH22 1  
ATOM 918   N N    . MET A 1 59  ? -1.092  -0.484  -4.386  1.00 0.00 ?  272 MET A N    1  
ATOM 919   C CA   . MET A 1 59  ? -0.892  -1.005  -3.044  1.00 0.00 ?  272 MET A CA   1  
ATOM 920   C C    . MET A 1 59  ? -2.140  -1.741  -2.550  1.00 0.00 ?  272 MET A C    1  
ATOM 921   O O    . MET A 1 59  ? -3.245  -1.484  -3.024  1.00 0.00 ?  272 MET A O    1  
ATOM 922   C CB   . MET A 1 59  ? -0.569  0.148   -2.092  1.00 0.00 ?  272 MET A CB   1  
ATOM 923   C CG   . MET A 1 59  ? -0.301  -0.368  -0.677  1.00 0.00 ?  272 MET A CG   1  
ATOM 924   S SD   . MET A 1 59  ? 0.791   0.751   0.184   1.00 0.00 ?  272 MET A SD   1  
ATOM 925   C CE   . MET A 1 59  ? 2.176   -0.335  0.481   1.00 0.00 ?  272 MET A CE   1  
ATOM 926   H H    . MET A 1 59  ? -1.826  0.189   -4.473  1.00 0.00 ?  272 MET A H    1  
ATOM 927   H HA   . MET A 1 59  ? -0.058  -1.702  -3.122  1.00 0.00 ?  272 MET A HA   1  
ATOM 928   H HB2  . MET A 1 59  ? 0.303   0.692   -2.456  1.00 0.00 ?  272 MET A HB2  1  
ATOM 929   H HB3  . MET A 1 59  ? -1.400  0.854   -2.074  1.00 0.00 ?  272 MET A HB3  1  
ATOM 930   H HG2  . MET A 1 59  ? -1.240  -0.465  -0.132  1.00 0.00 ?  272 MET A HG2  1  
ATOM 931   H HG3  . MET A 1 59  ? 0.145   -1.362  -0.722  1.00 0.00 ?  272 MET A HG3  1  
ATOM 932   H HE1  . MET A 1 59  ? 2.209   -1.102  -0.292  1.00 0.00 ?  272 MET A HE1  1  
ATOM 933   H HE2  . MET A 1 59  ? 3.101   0.242   0.460   1.00 0.00 ?  272 MET A HE2  1  
ATOM 934   H HE3  . MET A 1 59  ? 2.066   -0.807  1.457   1.00 0.00 ?  272 MET A HE3  1  
ATOM 935   N N    . PHE A 1 60  ? -1.920  -2.642  -1.604  1.00 0.00 ?  273 PHE A N    1  
ATOM 936   C CA   . PHE A 1 60  ? -3.012  -3.417  -1.040  1.00 0.00 ?  273 PHE A CA   1  
ATOM 937   C C    . PHE A 1 60  ? -2.769  -3.710  0.442   1.00 0.00 ?  273 PHE A C    1  
ATOM 938   O O    . PHE A 1 60  ? -1.657  -4.063  0.834   1.00 0.00 ?  273 PHE A O    1  
ATOM 939   C CB   . PHE A 1 60  ? -3.066  -4.739  -1.808  1.00 0.00 ?  273 PHE A CB   1  
ATOM 940   C CG   . PHE A 1 60  ? -3.773  -4.644  -3.162  1.00 0.00 ?  273 PHE A CG   1  
ATOM 941   C CD1  . PHE A 1 60  ? -3.140  -4.073  -4.221  1.00 0.00 ?  273 PHE A CD1  1  
ATOM 942   C CD2  . PHE A 1 60  ? -5.035  -5.131  -3.305  1.00 0.00 ?  273 PHE A CD2  1  
ATOM 943   C CE1  . PHE A 1 60  ? -3.796  -3.986  -5.478  1.00 0.00 ?  273 PHE A CE1  1  
ATOM 944   C CE2  . PHE A 1 60  ? -5.691  -5.043  -4.561  1.00 0.00 ?  273 PHE A CE2  1  
ATOM 945   C CZ   . PHE A 1 60  ? -5.058  -4.472  -5.621  1.00 0.00 ?  273 PHE A CZ   1  
ATOM 946   H H    . PHE A 1 60  ? -1.018  -2.845  -1.224  1.00 0.00 ?  273 PHE A H    1  
ATOM 947   H HA   . PHE A 1 60  ? -3.920  -2.821  -1.146  1.00 0.00 ?  273 PHE A HA   1  
ATOM 948   H HB2  . PHE A 1 60  ? -2.048  -5.097  -1.966  1.00 0.00 ?  273 PHE A HB2  1  
ATOM 949   H HB3  . PHE A 1 60  ? -3.574  -5.483  -1.195  1.00 0.00 ?  273 PHE A HB3  1  
ATOM 950   H HD1  . PHE A 1 60  ? -2.128  -3.683  -4.106  1.00 0.00 ?  273 PHE A HD1  1  
ATOM 951   H HD2  . PHE A 1 60  ? -5.542  -5.588  -2.456  1.00 0.00 ?  273 PHE A HD2  1  
ATOM 952   H HE1  . PHE A 1 60  ? -3.289  -3.528  -6.327  1.00 0.00 ?  273 PHE A HE1  1  
ATOM 953   H HE2  . PHE A 1 60  ? -6.702  -5.433  -4.676  1.00 0.00 ?  273 PHE A HE2  1  
ATOM 954   H HZ   . PHE A 1 60  ? -5.562  -4.405  -6.585  1.00 0.00 ?  273 PHE A HZ   1  
ATOM 955   N N    . PHE A 1 61  ? -3.826  -3.554  1.224   1.00 0.00 ?  274 PHE A N    1  
ATOM 956   C CA   . PHE A 1 61  ? -3.741  -3.799  2.654   1.00 0.00 ?  274 PHE A CA   1  
ATOM 957   C C    . PHE A 1 61  ? -4.806  -4.802  3.103   1.00 0.00 ?  274 PHE A C    1  
ATOM 958   O O    . PHE A 1 61  ? -5.954  -4.732  2.666   1.00 0.00 ?  274 PHE A O    1  
ATOM 959   C CB   . PHE A 1 61  ? -3.992  -2.461  3.352   1.00 0.00 ?  274 PHE A CB   1  
ATOM 960   C CG   . PHE A 1 61  ? -2.889  -1.425  3.126   1.00 0.00 ?  274 PHE A CG   1  
ATOM 961   C CD1  . PHE A 1 61  ? -1.604  -1.829  2.938   1.00 0.00 ?  274 PHE A CD1  1  
ATOM 962   C CD2  . PHE A 1 61  ? -3.194  -0.099  3.112   1.00 0.00 ?  274 PHE A CD2  1  
ATOM 963   C CE1  . PHE A 1 61  ? -0.581  -0.867  2.728   1.00 0.00 ?  274 PHE A CE1  1  
ATOM 964   C CE2  . PHE A 1 61  ? -2.171  0.863   2.902   1.00 0.00 ?  274 PHE A CE2  1  
ATOM 965   C CZ   . PHE A 1 61  ? -0.886  0.458   2.714   1.00 0.00 ?  274 PHE A CZ   1  
ATOM 966   H H    . PHE A 1 61  ? -4.727  -3.267  0.897   1.00 0.00 ?  274 PHE A H    1  
ATOM 967   H HA   . PHE A 1 61  ? -2.751  -4.209  2.854   1.00 0.00 ?  274 PHE A HA   1  
ATOM 968   H HB2  . PHE A 1 61  ? -4.939  -2.051  3.002   1.00 0.00 ?  274 PHE A HB2  1  
ATOM 969   H HB3  . PHE A 1 61  ? -4.097  -2.636  4.423   1.00 0.00 ?  274 PHE A HB3  1  
ATOM 970   H HD1  . PHE A 1 61  ? -1.360  -2.891  2.949   1.00 0.00 ?  274 PHE A HD1  1  
ATOM 971   H HD2  . PHE A 1 61  ? -4.224  0.225   3.263   1.00 0.00 ?  274 PHE A HD2  1  
ATOM 972   H HE1  . PHE A 1 61  ? 0.449   -1.191  2.577   1.00 0.00 ?  274 PHE A HE1  1  
ATOM 973   H HE2  . PHE A 1 61  ? -2.415  1.925   2.891   1.00 0.00 ?  274 PHE A HE2  1  
ATOM 974   H HZ   . PHE A 1 61  ? -0.100  1.196   2.553   1.00 0.00 ?  274 PHE A HZ   1  
ATOM 975   N N    . VAL A 1 62  ? -4.388  -5.712  3.970   1.00 0.00 ?  275 VAL A N    1  
ATOM 976   C CA   . VAL A 1 62  ? -5.290  -6.728  4.483   1.00 0.00 ?  275 VAL A CA   1  
ATOM 977   C C    . VAL A 1 62  ? -5.887  -6.252  5.809   1.00 0.00 ?  275 VAL A C    1  
ATOM 978   O O    . VAL A 1 62  ? -5.172  -5.732  6.665   1.00 0.00 ?  275 VAL A O    1  
ATOM 979   C CB   . VAL A 1 62  ? -4.559  -8.066  4.604   1.00 0.00 ?  275 VAL A CB   1  
ATOM 980   C CG1  . VAL A 1 62  ? -5.254  -8.983  5.613   1.00 0.00 ?  275 VAL A CG1  1  
ATOM 981   C CG2  . VAL A 1 62  ? -4.433  -8.748  3.240   1.00 0.00 ?  275 VAL A CG2  1  
ATOM 982   H H    . VAL A 1 62  ? -3.452  -5.762  4.321   1.00 0.00 ?  275 VAL A H    1  
ATOM 983   H HA   . VAL A 1 62  ? -6.096  -6.848  3.759   1.00 0.00 ?  275 VAL A HA   1  
ATOM 984   H HB   . VAL A 1 62  ? -3.552  -7.866  4.972   1.00 0.00 ?  275 VAL A HB   1  
ATOM 985   H HG11 . VAL A 1 62  ? -6.234  -9.266  5.230   1.00 0.00 ?  275 VAL A HG11 1  
ATOM 986   H HG12 . VAL A 1 62  ? -4.651  -9.878  5.766   1.00 0.00 ?  275 VAL A HG12 1  
ATOM 987   H HG13 . VAL A 1 62  ? -5.371  -8.457  6.560   1.00 0.00 ?  275 VAL A HG13 1  
ATOM 988   H HG21 . VAL A 1 62  ? -5.041  -9.652  3.228   1.00 0.00 ?  275 VAL A HG21 1  
ATOM 989   H HG22 . VAL A 1 62  ? -4.779  -8.068  2.461   1.00 0.00 ?  275 VAL A HG22 1  
ATOM 990   H HG23 . VAL A 1 62  ? -3.391  -9.008  3.058   1.00 0.00 ?  275 VAL A HG23 1  
ATOM 991   N N    . VAL A 1 63  ? -7.192  -6.446  5.938   1.00 0.00 ?  276 VAL A N    1  
ATOM 992   C CA   . VAL A 1 63  ? -7.893  -6.042  7.145   1.00 0.00 ?  276 VAL A CA   1  
ATOM 993   C C    . VAL A 1 63  ? -8.314  -7.289  7.925   1.00 0.00 ?  276 VAL A C    1  
ATOM 994   O O    . VAL A 1 63  ? -8.079  -7.381  9.129   1.00 0.00 ?  276 VAL A O    1  
ATOM 995   C CB   . VAL A 1 63  ? -9.071  -5.134  6.787   1.00 0.00 ?  276 VAL A CB   1  
ATOM 996   C CG1  . VAL A 1 63  ? -9.760  -4.608  8.048   1.00 0.00 ?  276 VAL A CG1  1  
ATOM 997   C CG2  . VAL A 1 63  ? -8.621  -3.982  5.887   1.00 0.00 ?  276 VAL A CG2  1  
ATOM 998   H H    . VAL A 1 63  ? -7.766  -6.869  5.237   1.00 0.00 ?  276 VAL A H    1  
ATOM 999   H HA   . VAL A 1 63  ? -7.195  -5.467  7.753   1.00 0.00 ?  276 VAL A HA   1  
ATOM 1000  H HB   . VAL A 1 63  ? -9.796  -5.729  6.232   1.00 0.00 ?  276 VAL A HB   1  
ATOM 1001  H HG11 . VAL A 1 63  ? -9.736  -3.518  8.047   1.00 0.00 ?  276 VAL A HG11 1  
ATOM 1002  H HG12 . VAL A 1 63  ? -10.796 -4.948  8.065   1.00 0.00 ?  276 VAL A HG12 1  
ATOM 1003  H HG13 . VAL A 1 63  ? -9.240  -4.983  8.930   1.00 0.00 ?  276 VAL A HG13 1  
ATOM 1004  H HG21 . VAL A 1 63  ? -7.536  -3.893  5.925   1.00 0.00 ?  276 VAL A HG21 1  
ATOM 1005  H HG22 . VAL A 1 63  ? -8.934  -4.179  4.861   1.00 0.00 ?  276 VAL A HG22 1  
ATOM 1006  H HG23 . VAL A 1 63  ? -9.074  -3.053  6.232   1.00 0.00 ?  276 VAL A HG23 1  
ATOM 1007  N N    . GLU A 1 64  ? -8.930  -8.217  7.208   1.00 0.00 ?  277 GLU A N    1  
ATOM 1008  C CA   . GLU A 1 64  ? -9.387  -9.454  7.818   1.00 0.00 ?  277 GLU A CA   1  
ATOM 1009  C C    . GLU A 1 64  ? -9.176  -10.628 6.859   1.00 0.00 ?  277 GLU A C    1  
ATOM 1010  O O    . GLU A 1 64  ? -9.522  -10.543 5.682   1.00 0.00 ?  277 GLU A O    1  
ATOM 1011  C CB   . GLU A 1 64  ? -10.853 -9.348  8.242   1.00 0.00 ?  277 GLU A CB   1  
ATOM 1012  C CG   . GLU A 1 64  ? -11.166 -7.955  8.791   1.00 0.00 ?  277 GLU A CG   1  
ATOM 1013  C CD   . GLU A 1 64  ? -12.514 -7.941  9.513   1.00 0.00 ?  277 GLU A CD   1  
ATOM 1014  O OE1  . GLU A 1 64  ? -13.514 -7.469  8.951   1.00 0.00 ?  277 GLU A OE1  1  
ATOM 1015  O OE2  . GLU A 1 64  ? -12.502 -8.444  10.701  1.00 0.00 -1 277 GLU A OE2  1  
ATOM 1016  H H    . GLU A 1 64  ? -9.118  -8.134  6.229   1.00 0.00 ?  277 GLU A H    1  
ATOM 1017  H HA   . GLU A 1 64  ? -8.767  -9.585  8.705   1.00 0.00 ?  277 GLU A HA   1  
ATOM 1018  H HB2  . GLU A 1 64  ? -11.498 -9.560  7.389   1.00 0.00 ?  277 GLU A HB2  1  
ATOM 1019  H HB3  . GLU A 1 64  ? -11.071 -10.100 9.000   1.00 0.00 ?  277 GLU A HB3  1  
ATOM 1020  H HG2  . GLU A 1 64  ? -10.378 -7.646  9.477   1.00 0.00 ?  277 GLU A HG2  1  
ATOM 1021  H HG3  . GLU A 1 64  ? -11.179 -7.233  7.974   1.00 0.00 ?  277 GLU A HG3  1  
ATOM 1022  H HE2  . GLU A 1 64  ? -11.629 -8.247  11.146  1.00 0.00 ?  277 GLU A HE2  1  
ATOM 1023  N N    . GLY A 1 65  ? -8.610  -11.697 7.399   1.00 0.00 ?  278 GLY A N    1  
ATOM 1024  C CA   . GLY A 1 65  ? -8.349  -12.887 6.606   1.00 0.00 ?  278 GLY A CA   1  
ATOM 1025  C C    . GLY A 1 65  ? -6.858  -13.229 6.604   1.00 0.00 ?  278 GLY A C    1  
ATOM 1026  O O    . GLY A 1 65  ? -6.065  -12.570 7.276   1.00 0.00 ?  278 GLY A O    1  
ATOM 1027  H H    . GLY A 1 65  ? -8.331  -11.759 8.357   1.00 0.00 ?  278 GLY A H    1  
ATOM 1028  H HA2  . GLY A 1 65  ? -8.918  -13.726 7.006   1.00 0.00 ?  278 GLY A HA2  1  
ATOM 1029  H HA3  . GLY A 1 65  ? -8.691  -12.729 5.584   1.00 0.00 ?  278 GLY A HA3  1  
ATOM 1030  N N    . SER A 1 66  ? -6.521  -14.258 5.842   1.00 0.00 ?  279 SER A N    1  
ATOM 1031  C CA   . SER A 1 66  ? -5.138  -14.695 5.743   1.00 0.00 ?  279 SER A CA   1  
ATOM 1032  C C    . SER A 1 66  ? -4.748  -14.871 4.274   1.00 0.00 ?  279 SER A C    1  
ATOM 1033  O O    . SER A 1 66  ? -5.337  -15.686 3.565   1.00 0.00 ?  279 SER A O    1  
ATOM 1034  C CB   . SER A 1 66  ? -4.917  -16.000 6.511   1.00 0.00 ?  279 SER A CB   1  
ATOM 1035  O OG   . SER A 1 66  ? -3.541  -16.218 6.808   1.00 0.00 ?  279 SER A OG   1  
ATOM 1036  H H    . SER A 1 66  ? -7.171  -14.789 5.299   1.00 0.00 ?  279 SER A H    1  
ATOM 1037  H HA   . SER A 1 66  ? -4.551  -13.900 6.202   1.00 0.00 ?  279 SER A HA   1  
ATOM 1038  H HB2  . SER A 1 66  ? -5.489  -15.977 7.438   1.00 0.00 ?  279 SER A HB2  1  
ATOM 1039  H HB3  . SER A 1 66  ? -5.298  -16.835 5.923   1.00 0.00 ?  279 SER A HB3  1  
ATOM 1040  H HG   . SER A 1 66  ? -3.020  -16.323 5.960   1.00 0.00 ?  279 SER A HG   1  
ATOM 1041  N N    . VAL A 1 67  ? -3.759  -14.093 3.860   1.00 0.00 ?  280 VAL A N    1  
ATOM 1042  C CA   . VAL A 1 67  ? -3.284  -14.152 2.489   1.00 0.00 ?  280 VAL A CA   1  
ATOM 1043  C C    . VAL A 1 67  ? -2.030  -15.027 2.425   1.00 0.00 ?  280 VAL A C    1  
ATOM 1044  O O    . VAL A 1 67  ? -1.393  -15.280 3.447   1.00 0.00 ?  280 VAL A O    1  
ATOM 1045  C CB   . VAL A 1 67  ? -3.054  -12.738 1.953   1.00 0.00 ?  280 VAL A CB   1  
ATOM 1046  C CG1  . VAL A 1 67  ? -4.381  -12.001 1.761   1.00 0.00 ?  280 VAL A CG1  1  
ATOM 1047  C CG2  . VAL A 1 67  ? -2.117  -11.949 2.870   1.00 0.00 ?  280 VAL A CG2  1  
ATOM 1048  H H    . VAL A 1 67  ? -3.286  -13.432 4.443   1.00 0.00 ?  280 VAL A H    1  
ATOM 1049  H HA   . VAL A 1 67  ? -4.066  -14.617 1.889   1.00 0.00 ?  280 VAL A HA   1  
ATOM 1050  H HB   . VAL A 1 67  ? -2.574  -12.822 0.978   1.00 0.00 ?  280 VAL A HB   1  
ATOM 1051  H HG11 . VAL A 1 67  ? -4.220  -11.116 1.147   1.00 0.00 ?  280 VAL A HG11 1  
ATOM 1052  H HG12 . VAL A 1 67  ? -5.095  -12.661 1.268   1.00 0.00 ?  280 VAL A HG12 1  
ATOM 1053  H HG13 . VAL A 1 67  ? -4.774  -11.703 2.733   1.00 0.00 ?  280 VAL A HG13 1  
ATOM 1054  H HG21 . VAL A 1 67  ? -2.669  -11.137 3.342   1.00 0.00 ?  280 VAL A HG21 1  
ATOM 1055  H HG22 . VAL A 1 67  ? -1.718  -12.612 3.639   1.00 0.00 ?  280 VAL A HG22 1  
ATOM 1056  H HG23 . VAL A 1 67  ? -1.295  -11.538 2.284   1.00 0.00 ?  280 VAL A HG23 1  
ATOM 1057  N N    . SER A 1 68  ? -1.712  -15.464 1.215   1.00 0.00 ?  281 SER A N    1  
ATOM 1058  C CA   . SER A 1 68  ? -0.546  -16.305 1.006   1.00 0.00 ?  281 SER A CA   1  
ATOM 1059  C C    . SER A 1 68  ? 0.334   -15.713 -0.097  1.00 0.00 ?  281 SER A C    1  
ATOM 1060  O O    . SER A 1 68  ? -0.155  -14.999 -0.971  1.00 0.00 ?  281 SER A O    1  
ATOM 1061  C CB   . SER A 1 68  ? -0.956  -17.735 0.647   1.00 0.00 ?  281 SER A CB   1  
ATOM 1062  O OG   . SER A 1 68  ? 0.167   -18.539 0.296   1.00 0.00 ?  281 SER A OG   1  
ATOM 1063  H H    . SER A 1 68  ? -2.236  -15.253 0.390   1.00 0.00 ?  281 SER A H    1  
ATOM 1064  H HA   . SER A 1 68  ? -0.017  -16.307 1.958   1.00 0.00 ?  281 SER A HA   1  
ATOM 1065  H HB2  . SER A 1 68  ? -1.474  -18.186 1.494   1.00 0.00 ?  281 SER A HB2  1  
ATOM 1066  H HB3  . SER A 1 68  ? -1.661  -17.713 -0.183  1.00 0.00 ?  281 SER A HB3  1  
ATOM 1067  H HG   . SER A 1 68  ? -0.135  -19.464 0.063   1.00 0.00 ?  281 SER A HG   1  
ATOM 1068  N N    . VAL A 1 69  ? 1.618   -16.031 -0.020  1.00 0.00 ?  282 VAL A N    1  
ATOM 1069  C CA   . VAL A 1 69  ? 2.571   -15.540 -1.000  1.00 0.00 ?  282 VAL A CA   1  
ATOM 1070  C C    . VAL A 1 69  ? 3.171   -16.724 -1.760  1.00 0.00 ?  282 VAL A C    1  
ATOM 1071  O O    . VAL A 1 69  ? 3.642   -17.683 -1.151  1.00 0.00 ?  282 VAL A O    1  
ATOM 1072  C CB   . VAL A 1 69  ? 3.628   -14.672 -0.314  1.00 0.00 ?  282 VAL A CB   1  
ATOM 1073  C CG1  . VAL A 1 69  ? 4.032   -13.494 -1.202  1.00 0.00 ?  282 VAL A CG1  1  
ATOM 1074  C CG2  . VAL A 1 69  ? 3.137   -14.187 1.051   1.00 0.00 ?  282 VAL A CG2  1  
ATOM 1075  H H    . VAL A 1 69  ? 2.008   -16.612 0.695   1.00 0.00 ?  282 VAL A H    1  
ATOM 1076  H HA   . VAL A 1 69  ? 2.025   -14.912 -1.704  1.00 0.00 ?  282 VAL A HA   1  
ATOM 1077  H HB   . VAL A 1 69  ? 4.513   -15.289 -0.151  1.00 0.00 ?  282 VAL A HB   1  
ATOM 1078  H HG11 . VAL A 1 69  ? 4.579   -12.762 -0.608  1.00 0.00 ?  282 VAL A HG11 1  
ATOM 1079  H HG12 . VAL A 1 69  ? 4.668   -13.852 -2.013  1.00 0.00 ?  282 VAL A HG12 1  
ATOM 1080  H HG13 . VAL A 1 69  ? 3.139   -13.030 -1.619  1.00 0.00 ?  282 VAL A HG13 1  
ATOM 1081  H HG21 . VAL A 1 69  ? 2.167   -13.702 0.937   1.00 0.00 ?  282 VAL A HG21 1  
ATOM 1082  H HG22 . VAL A 1 69  ? 3.040   -15.037 1.726   1.00 0.00 ?  282 VAL A HG22 1  
ATOM 1083  H HG23 . VAL A 1 69  ? 3.852   -13.475 1.463   1.00 0.00 ?  282 VAL A HG23 1  
ATOM 1084  N N    . ALA A 1 70  ? 3.134   -16.619 -3.080  1.00 0.00 ?  283 ALA A N    1  
ATOM 1085  C CA   . ALA A 1 70  ? 3.668   -17.670 -3.930  1.00 0.00 ?  283 ALA A CA   1  
ATOM 1086  C C    . ALA A 1 70  ? 5.194   -17.564 -3.967  1.00 0.00 ?  283 ALA A C    1  
ATOM 1087  O O    . ALA A 1 70  ? 5.743   -16.720 -4.673  1.00 0.00 ?  283 ALA A O    1  
ATOM 1088  C CB   . ALA A 1 70  ? 3.042   -17.568 -5.322  1.00 0.00 ?  283 ALA A CB   1  
ATOM 1089  H H    . ALA A 1 70  ? 2.748   -15.836 -3.569  1.00 0.00 ?  283 ALA A H    1  
ATOM 1090  H HA   . ALA A 1 70  ? 3.389   -18.627 -3.489  1.00 0.00 ?  283 ALA A HA   1  
ATOM 1091  H HB1  . ALA A 1 70  ? 3.761   -17.126 -6.012  1.00 0.00 ?  283 ALA A HB1  1  
ATOM 1092  H HB2  . ALA A 1 70  ? 2.769   -18.564 -5.671  1.00 0.00 ?  283 ALA A HB2  1  
ATOM 1093  H HB3  . ALA A 1 70  ? 2.151   -16.943 -5.276  1.00 0.00 ?  283 ALA A HB3  1  
ATOM 1094  N N    . THR A 1 71  ? 5.834   -18.432 -3.198  1.00 0.00 ?  284 THR A N    1  
ATOM 1095  C CA   . THR A 1 71  ? 7.286   -18.446 -3.135  1.00 0.00 ?  284 THR A CA   1  
ATOM 1096  C C    . THR A 1 71  ? 7.795   -19.866 -2.881  1.00 0.00 ?  284 THR A C    1  
ATOM 1097  O O    . THR A 1 71  ? 7.034   -20.828 -2.972  1.00 0.00 ?  284 THR A O    1  
ATOM 1098  C CB   . THR A 1 71  ? 7.722   -17.444 -2.064  1.00 0.00 ?  284 THR A CB   1  
ATOM 1099  O OG1  . THR A 1 71  ? 7.836   -18.228 -0.880  1.00 0.00 ?  284 THR A OG1  1  
ATOM 1100  C CG2  . THR A 1 71  ? 6.627   -16.427 -1.733  1.00 0.00 ?  284 THR A CG2  1  
ATOM 1101  H H    . THR A 1 71  ? 5.380   -19.115 -2.627  1.00 0.00 ?  284 THR A H    1  
ATOM 1102  H HA   . THR A 1 71  ? 7.676   -18.135 -4.104  1.00 0.00 ?  284 THR A HA   1  
ATOM 1103  H HB   . THR A 1 71  ? 8.645   -16.942 -2.353  1.00 0.00 ?  284 THR A HB   1  
ATOM 1104  H HG1  . THR A 1 71  ? 8.012   -17.637 -0.093  1.00 0.00 ?  284 THR A HG1  1  
ATOM 1105  H HG21 . THR A 1 71  ? 5.730   -16.952 -1.407  1.00 0.00 ?  284 THR A HG21 1  
ATOM 1106  H HG22 . THR A 1 71  ? 6.973   -15.768 -0.936  1.00 0.00 ?  284 THR A HG22 1  
ATOM 1107  H HG23 . THR A 1 71  ? 6.400   -15.836 -2.620  1.00 0.00 ?  284 THR A HG23 1  
ATOM 1108  N N    . PRO A 1 72  ? 9.113   -19.955 -2.558  1.00 0.00 ?  285 PRO A N    1  
ATOM 1109  C CA   . PRO A 1 72  ? 9.733   -21.242 -2.291  1.00 0.00 ?  285 PRO A CA   1  
ATOM 1110  C C    . PRO A 1 72  ? 9.325   -21.771 -0.914  1.00 0.00 ?  285 PRO A C    1  
ATOM 1111  O O    . PRO A 1 72  ? 9.815   -22.810 -0.474  1.00 0.00 ?  285 PRO A O    1  
ATOM 1112  C CB   . PRO A 1 72  ? 11.227  -20.992 -2.412  1.00 0.00 ?  285 PRO A CB   1  
ATOM 1113  C CG   . PRO A 1 72  ? 11.410  -19.488 -2.283  1.00 0.00 ?  285 PRO A CG   1  
ATOM 1114  C CD   . PRO A 1 72  ? 10.045  -18.837 -2.441  1.00 0.00 ?  285 PRO A CD   1  
ATOM 1115  H HA   . PRO A 1 72  ? 9.416   -21.923 -2.950  1.00 0.00 ?  285 PRO A HA   1  
ATOM 1116  H HB2  . PRO A 1 72  ? 11.776  -21.520 -1.633  1.00 0.00 ?  285 PRO A HB2  1  
ATOM 1117  H HB3  . PRO A 1 72  ? 11.607  -21.351 -3.369  1.00 0.00 ?  285 PRO A HB3  1  
ATOM 1118  H HG2  . PRO A 1 72  ? 11.843  -19.238 -1.315  1.00 0.00 ?  285 PRO A HG2  1  
ATOM 1119  H HG3  . PRO A 1 72  ? 12.098  -19.121 -3.045  1.00 0.00 ?  285 PRO A HG3  1  
ATOM 1120  H HD2  . PRO A 1 72  ? 9.804   -18.210 -1.583  1.00 0.00 ?  285 PRO A HD2  1  
ATOM 1121  H HD3  . PRO A 1 72  ? 10.011  -18.198 -3.323  1.00 0.00 ?  285 PRO A HD3  1  
ATOM 1122  N N    . ASN A 1 73  ? 8.431   -21.032 -0.273  1.00 0.00 ?  286 ASN A N    1  
ATOM 1123  C CA   . ASN A 1 73  ? 7.952   -21.414 1.045   1.00 0.00 ?  286 ASN A CA   1  
ATOM 1124  C C    . ASN A 1 73  ? 6.530   -20.885 1.238   1.00 0.00 ?  286 ASN A C    1  
ATOM 1125  O O    . ASN A 1 73  ? 6.127   -19.924 0.584   1.00 0.00 ?  286 ASN A O    1  
ATOM 1126  C CB   . ASN A 1 73  ? 8.832   -20.818 2.145   1.00 0.00 ?  286 ASN A CB   1  
ATOM 1127  C CG   . ASN A 1 73  ? 10.255  -21.376 2.072   1.00 0.00 ?  286 ASN A CG   1  
ATOM 1128  O OD1  . ASN A 1 73  ? 11.081  -20.941 1.287   1.00 0.00 ?  286 ASN A OD1  1  
ATOM 1129  N ND2  . ASN A 1 73  ? 10.494  -22.362 2.932   1.00 0.00 ?  286 ASN A ND2  1  
ATOM 1130  H H    . ASN A 1 73  ? 8.038   -20.189 -0.638  1.00 0.00 ?  286 ASN A H    1  
ATOM 1131  H HA   . ASN A 1 73  ? 7.998   -22.503 1.061   1.00 0.00 ?  286 ASN A HA   1  
ATOM 1132  H HB2  . ASN A 1 73  ? 8.858   -19.733 2.047   1.00 0.00 ?  286 ASN A HB2  1  
ATOM 1133  H HB3  . ASN A 1 73  ? 8.400   -21.040 3.121   1.00 0.00 ?  286 ASN A HB3  1  
ATOM 1134  H HD21 . ASN A 1 73  ? 9.771   -22.673 3.550   1.00 0.00 ?  286 ASN A HD21 1  
ATOM 1135  H HD22 . ASN A 1 73  ? 11.396  -22.793 2.961   1.00 0.00 ?  286 ASN A HD22 1  
ATOM 1136  N N    . PRO A 1 74  ? 5.789   -21.553 2.163   1.00 0.00 ?  287 PRO A N    1  
ATOM 1137  C CA   . PRO A 1 74  ? 4.420   -21.160 2.451   1.00 0.00 ?  287 PRO A CA   1  
ATOM 1138  C C    . PRO A 1 74  ? 4.382   -19.882 3.291   1.00 0.00 ?  287 PRO A C    1  
ATOM 1139  O O    . PRO A 1 74  ? 4.473   -19.938 4.517   1.00 0.00 ?  287 PRO A O    1  
ATOM 1140  C CB   . PRO A 1 74  ? 3.808   -22.356 3.161   1.00 0.00 ?  287 PRO A CB   1  
ATOM 1141  C CG   . PRO A 1 74  ? 4.978   -23.190 3.656   1.00 0.00 ?  287 PRO A CG   1  
ATOM 1142  C CD   . PRO A 1 74  ? 6.233   -22.695 2.956   1.00 0.00 ?  287 PRO A CD   1  
ATOM 1143  H HA   . PRO A 1 74  ? 3.935   -20.944 1.603   1.00 0.00 ?  287 PRO A HA   1  
ATOM 1144  H HB2  . PRO A 1 74  ? 3.176   -22.038 3.990   1.00 0.00 ?  287 PRO A HB2  1  
ATOM 1145  H HB3  . PRO A 1 74  ? 3.178   -22.932 2.483   1.00 0.00 ?  287 PRO A HB3  1  
ATOM 1146  H HG2  . PRO A 1 74  ? 5.082   -23.097 4.738   1.00 0.00 ?  287 PRO A HG2  1  
ATOM 1147  H HG3  . PRO A 1 74  ? 4.813   -24.246 3.442   1.00 0.00 ?  287 PRO A HG3  1  
ATOM 1148  H HD2  . PRO A 1 74  ? 6.999   -22.404 3.675   1.00 0.00 ?  287 PRO A HD2  1  
ATOM 1149  H HD3  . PRO A 1 74  ? 6.667   -23.471 2.325   1.00 0.00 ?  287 PRO A HD3  1  
ATOM 1150  N N    . VAL A 1 75  ? 4.246   -18.760 2.599   1.00 0.00 ?  288 VAL A N    1  
ATOM 1151  C CA   . VAL A 1 75  ? 4.194   -17.471 3.267   1.00 0.00 ?  288 VAL A CA   1  
ATOM 1152  C C    . VAL A 1 75  ? 2.735   -17.036 3.415   1.00 0.00 ?  288 VAL A C    1  
ATOM 1153  O O    . VAL A 1 75  ? 2.032   -16.860 2.421   1.00 0.00 ?  288 VAL A O    1  
ATOM 1154  C CB   . VAL A 1 75  ? 5.047   -16.453 2.507   1.00 0.00 ?  288 VAL A CB   1  
ATOM 1155  C CG1  . VAL A 1 75  ? 5.082   -15.110 3.239   1.00 0.00 ?  288 VAL A CG1  1  
ATOM 1156  C CG2  . VAL A 1 75  ? 6.462   -16.988 2.274   1.00 0.00 ?  288 VAL A CG2  1  
ATOM 1157  H H    . VAL A 1 75  ? 4.172   -18.723 1.603   1.00 0.00 ?  288 VAL A H    1  
ATOM 1158  H HA   . VAL A 1 75  ? 4.625   -17.597 4.260   1.00 0.00 ?  288 VAL A HA   1  
ATOM 1159  H HB   . VAL A 1 75  ? 4.586   -16.291 1.532   1.00 0.00 ?  288 VAL A HB   1  
ATOM 1160  H HG11 . VAL A 1 75  ? 5.815   -15.155 4.045   1.00 0.00 ?  288 VAL A HG11 1  
ATOM 1161  H HG12 . VAL A 1 75  ? 5.359   -14.322 2.540   1.00 0.00 ?  288 VAL A HG12 1  
ATOM 1162  H HG13 . VAL A 1 75  ? 4.097   -14.898 3.655   1.00 0.00 ?  288 VAL A HG13 1  
ATOM 1163  H HG21 . VAL A 1 75  ? 6.744   -16.828 1.234   1.00 0.00 ?  288 VAL A HG21 1  
ATOM 1164  H HG22 . VAL A 1 75  ? 7.160   -16.463 2.926   1.00 0.00 ?  288 VAL A HG22 1  
ATOM 1165  H HG23 . VAL A 1 75  ? 6.488   -18.055 2.498   1.00 0.00 ?  288 VAL A HG23 1  
ATOM 1166  N N    . GLU A 1 76  ? 2.322   -16.875 4.664   1.00 0.00 ?  289 GLU A N    1  
ATOM 1167  C CA   . GLU A 1 76  ? 0.959   -16.464 4.955   1.00 0.00 ?  289 GLU A CA   1  
ATOM 1168  C C    . GLU A 1 76  ? 0.959   -15.214 5.836   1.00 0.00 ?  289 GLU A C    1  
ATOM 1169  O O    . GLU A 1 76  ? 1.733   -15.120 6.787   1.00 0.00 ?  289 GLU A O    1  
ATOM 1170  C CB   . GLU A 1 76  ? 0.173   -17.599 5.612   1.00 0.00 ?  289 GLU A CB   1  
ATOM 1171  C CG   . GLU A 1 76  ? -0.421  -18.537 4.559   1.00 0.00 ?  289 GLU A CG   1  
ATOM 1172  C CD   . GLU A 1 76  ? -0.819  -19.878 5.181   1.00 0.00 ?  289 GLU A CD   1  
ATOM 1173  O OE1  . GLU A 1 76  ? -1.971  -20.046 5.606   1.00 0.00 ?  289 GLU A OE1  1  
ATOM 1174  O OE2  . GLU A 1 76  ? 0.118   -20.764 5.212   1.00 0.00 -1 289 GLU A OE2  1  
ATOM 1175  H H    . GLU A 1 76  ? 2.900   -17.020 5.467   1.00 0.00 ?  289 GLU A H    1  
ATOM 1176  H HA   . GLU A 1 76  ? 0.513   -16.235 3.987   1.00 0.00 ?  289 GLU A HA   1  
ATOM 1177  H HB2  . GLU A 1 76  ? 0.827   -18.162 6.278   1.00 0.00 ?  289 GLU A HB2  1  
ATOM 1178  H HB3  . GLU A 1 76  ? -0.626  -17.185 6.227   1.00 0.00 ?  289 GLU A HB3  1  
ATOM 1179  H HG2  . GLU A 1 76  ? -1.294  -18.071 4.102   1.00 0.00 ?  289 GLU A HG2  1  
ATOM 1180  H HG3  . GLU A 1 76  ? 0.305   -18.703 3.763   1.00 0.00 ?  289 GLU A HG3  1  
ATOM 1181  H HE2  . GLU A 1 76  ? -0.264  -21.658 5.441   1.00 0.00 ?  289 GLU A HE2  1  
ATOM 1182  N N    . LEU A 1 77  ? 0.080   -14.284 5.489   1.00 0.00 ?  290 LEU A N    1  
ATOM 1183  C CA   . LEU A 1 77  ? -0.032  -13.044 6.237   1.00 0.00 ?  290 LEU A CA   1  
ATOM 1184  C C    . LEU A 1 77  ? -1.427  -12.952 6.858   1.00 0.00 ?  290 LEU A C    1  
ATOM 1185  O O    . LEU A 1 77  ? -2.417  -13.310 6.224   1.00 0.00 ?  290 LEU A O    1  
ATOM 1186  C CB   . LEU A 1 77  ? 0.327   -11.849 5.351   1.00 0.00 ?  290 LEU A CB   1  
ATOM 1187  C CG   . LEU A 1 77  ? 1.788   -11.395 5.396   1.00 0.00 ?  290 LEU A CG   1  
ATOM 1188  C CD1  . LEU A 1 77  ? 2.151   -10.853 6.780   1.00 0.00 ?  290 LEU A CD1  1  
ATOM 1189  C CD2  . LEU A 1 77  ? 2.726   -12.522 4.958   1.00 0.00 ?  290 LEU A CD2  1  
ATOM 1190  H H    . LEU A 1 77  ? -0.546  -14.368 4.715   1.00 0.00 ?  290 LEU A H    1  
ATOM 1191  H HA   . LEU A 1 77  ? 0.703   -13.080 7.042   1.00 0.00 ?  290 LEU A HA   1  
ATOM 1192  H HB2  . LEU A 1 77  ? 0.077   -12.099 4.320   1.00 0.00 ?  290 LEU A HB2  1  
ATOM 1193  H HB3  . LEU A 1 77  ? -0.303  -11.008 5.637   1.00 0.00 ?  290 LEU A HB3  1  
ATOM 1194  H HG   . LEU A 1 77  ? 1.913   -10.578 4.687   1.00 0.00 ?  290 LEU A HG   1  
ATOM 1195  H HD11 . LEU A 1 77  ? 1.241   -10.701 7.361   1.00 0.00 ?  290 LEU A HD11 1  
ATOM 1196  H HD12 . LEU A 1 77  ? 2.795   -11.567 7.293   1.00 0.00 ?  290 LEU A HD12 1  
ATOM 1197  H HD13 . LEU A 1 77  ? 2.675   -9.903  6.672   1.00 0.00 ?  290 LEU A HD13 1  
ATOM 1198  H HD21 . LEU A 1 77  ? 3.760   -12.202 5.083   1.00 0.00 ?  290 LEU A HD21 1  
ATOM 1199  H HD22 . LEU A 1 77  ? 2.542   -13.406 5.569   1.00 0.00 ?  290 LEU A HD22 1  
ATOM 1200  H HD23 . LEU A 1 77  ? 2.543   -12.760 3.910   1.00 0.00 ?  290 LEU A HD23 1  
ATOM 1201  N N    . GLY A 1 78  ? -1.460  -12.469 8.092   1.00 0.00 ?  291 GLY A N    1  
ATOM 1202  C CA   . GLY A 1 78  ? -2.717  -12.325 8.806   1.00 0.00 ?  291 GLY A CA   1  
ATOM 1203  C C    . GLY A 1 78  ? -3.329  -10.943 8.566   1.00 0.00 ?  291 GLY A C    1  
ATOM 1204  O O    . GLY A 1 78  ? -2.984  -10.267 7.598   1.00 0.00 ?  291 GLY A O    1  
ATOM 1205  H H    . GLY A 1 78  ? -0.649  -12.180 8.601   1.00 0.00 ?  291 GLY A H    1  
ATOM 1206  H HA2  . GLY A 1 78  ? -3.415  -13.097 8.480   1.00 0.00 ?  291 GLY A HA2  1  
ATOM 1207  H HA3  . GLY A 1 78  ? -2.553  -12.474 9.873   1.00 0.00 ?  291 GLY A HA3  1  
ATOM 1208  N N    . PRO A 1 79  ? -4.250  -10.555 9.489   1.00 0.00 ?  292 PRO A N    1  
ATOM 1209  C CA   . PRO A 1 79  ? -4.912  -9.266  9.387   1.00 0.00 ?  292 PRO A CA   1  
ATOM 1210  C C    . PRO A 1 79  ? -3.971  -8.131  9.798   1.00 0.00 ?  292 PRO A C    1  
ATOM 1211  O O    . PRO A 1 79  ? -3.108  -8.316  10.655  1.00 0.00 ?  292 PRO A O    1  
ATOM 1212  C CB   . PRO A 1 79  ? -6.133  -9.379  10.286  1.00 0.00 ?  292 PRO A CB   1  
ATOM 1213  C CG   . PRO A 1 79  ? -5.861  -10.552 11.213  1.00 0.00 ?  292 PRO A CG   1  
ATOM 1214  C CD   . PRO A 1 79  ? -4.683  -11.329 10.648  1.00 0.00 ?  292 PRO A CD   1  
ATOM 1215  H HA   . PRO A 1 79  ? -5.167  -9.080  8.438   1.00 0.00 ?  292 PRO A HA   1  
ATOM 1216  H HB2  . PRO A 1 79  ? -6.288  -8.461  10.852  1.00 0.00 ?  292 PRO A HB2  1  
ATOM 1217  H HB3  . PRO A 1 79  ? -7.036  -9.547  9.698   1.00 0.00 ?  292 PRO A HB3  1  
ATOM 1218  H HG2  . PRO A 1 79  ? -5.637  -10.199 12.220  1.00 0.00 ?  292 PRO A HG2  1  
ATOM 1219  H HG3  . PRO A 1 79  ? -6.740  -11.192 11.287  1.00 0.00 ?  292 PRO A HG3  1  
ATOM 1220  H HD2  . PRO A 1 79  ? -3.882  -11.424 11.382  1.00 0.00 ?  292 PRO A HD2  1  
ATOM 1221  H HD3  . PRO A 1 79  ? -4.975  -12.339 10.363  1.00 0.00 ?  292 PRO A HD3  1  
ATOM 1222  N N    . GLY A 1 80  ? -4.170  -6.983  9.167   1.00 0.00 ?  293 GLY A N    1  
ATOM 1223  C CA   . GLY A 1 80  ? -3.349  -5.819  9.457   1.00 0.00 ?  293 GLY A CA   1  
ATOM 1224  C C    . GLY A 1 80  ? -2.041  -5.860  8.665   1.00 0.00 ?  293 GLY A C    1  
ATOM 1225  O O    . GLY A 1 80  ? -1.179  -5.000  8.838   1.00 0.00 ?  293 GLY A O    1  
ATOM 1226  H H    . GLY A 1 80  ? -4.874  -6.841  8.472   1.00 0.00 ?  293 GLY A H    1  
ATOM 1227  H HA2  . GLY A 1 80  ? -3.900  -4.911  9.210   1.00 0.00 ?  293 GLY A HA2  1  
ATOM 1228  H HA3  . GLY A 1 80  ? -3.132  -5.779  10.524  1.00 0.00 ?  293 GLY A HA3  1  
ATOM 1229  N N    . ALA A 1 81  ? -1.934  -6.868  7.812   1.00 0.00 ?  294 ALA A N    1  
ATOM 1230  C CA   . ALA A 1 81  ? -0.745  -7.032  6.992   1.00 0.00 ?  294 ALA A CA   1  
ATOM 1231  C C    . ALA A 1 81  ? -0.891  -6.199  5.718   1.00 0.00 ?  294 ALA A C    1  
ATOM 1232  O O    . ALA A 1 81  ? -1.914  -6.271  5.038   1.00 0.00 ?  294 ALA A O    1  
ATOM 1233  C CB   . ALA A 1 81  ? -0.530  -8.518  6.696   1.00 0.00 ?  294 ALA A CB   1  
ATOM 1234  H H    . ALA A 1 81  ? -2.640  -7.563  7.676   1.00 0.00 ?  294 ALA A H    1  
ATOM 1235  H HA   . ALA A 1 81  ? 0.105   -6.661  7.564   1.00 0.00 ?  294 ALA A HA   1  
ATOM 1236  H HB1  . ALA A 1 81  ? -0.609  -9.088  7.622   1.00 0.00 ?  294 ALA A HB1  1  
ATOM 1237  H HB2  . ALA A 1 81  ? -1.288  -8.861  5.992   1.00 0.00 ?  294 ALA A HB2  1  
ATOM 1238  H HB3  . ALA A 1 81  ? 0.460   -8.662  6.264   1.00 0.00 ?  294 ALA A HB3  1  
ATOM 1239  N N    . PHE A 1 82  ? 0.148   -5.427  5.432   1.00 0.00 ?  295 PHE A N    1  
ATOM 1240  C CA   . PHE A 1 82  ? 0.148   -4.581  4.250   1.00 0.00 ?  295 PHE A CA   1  
ATOM 1241  C C    . PHE A 1 82  ? 1.244   -5.007  3.271   1.00 0.00 ?  295 PHE A C    1  
ATOM 1242  O O    . PHE A 1 82  ? 2.259   -5.571  3.677   1.00 0.00 ?  295 PHE A O    1  
ATOM 1243  C CB   . PHE A 1 82  ? 0.431   -3.153  4.723   1.00 0.00 ?  295 PHE A CB   1  
ATOM 1244  C CG   . PHE A 1 82  ? 1.329   -3.073  5.959   1.00 0.00 ?  295 PHE A CG   1  
ATOM 1245  C CD1  . PHE A 1 82  ? 0.796   -3.234  7.199   1.00 0.00 ?  295 PHE A CD1  1  
ATOM 1246  C CD2  . PHE A 1 82  ? 2.662   -2.841  5.817   1.00 0.00 ?  295 PHE A CD2  1  
ATOM 1247  C CE1  . PHE A 1 82  ? 1.630   -3.160  8.346   1.00 0.00 ?  295 PHE A CE1  1  
ATOM 1248  C CE2  . PHE A 1 82  ? 3.496   -2.767  6.963   1.00 0.00 ?  295 PHE A CE2  1  
ATOM 1249  C CZ   . PHE A 1 82  ? 2.962   -2.928  8.204   1.00 0.00 ?  295 PHE A CZ   1  
ATOM 1250  H H    . PHE A 1 82  ? 0.976   -5.374  5.990   1.00 0.00 ?  295 PHE A H    1  
ATOM 1251  H HA   . PHE A 1 82  ? -0.826  -4.690  3.773   1.00 0.00 ?  295 PHE A HA   1  
ATOM 1252  H HB2  . PHE A 1 82  ? 0.898   -2.598  3.910   1.00 0.00 ?  295 PHE A HB2  1  
ATOM 1253  H HB3  . PHE A 1 82  ? -0.516  -2.660  4.943   1.00 0.00 ?  295 PHE A HB3  1  
ATOM 1254  H HD1  . PHE A 1 82  ? -0.272  -3.421  7.313   1.00 0.00 ?  295 PHE A HD1  1  
ATOM 1255  H HD2  . PHE A 1 82  ? 3.090   -2.712  4.822   1.00 0.00 ?  295 PHE A HD2  1  
ATOM 1256  H HE1  . PHE A 1 82  ? 1.202   -3.289  9.340   1.00 0.00 ?  295 PHE A HE1  1  
ATOM 1257  H HE2  . PHE A 1 82  ? 4.564   -2.581  6.850   1.00 0.00 ?  295 PHE A HE2  1  
ATOM 1258  H HZ   . PHE A 1 82  ? 3.602   -2.871  9.084   1.00 0.00 ?  295 PHE A HZ   1  
ATOM 1259  N N    . PHE A 1 83  ? 1.001   -4.721  2.000   1.00 0.00 ?  296 PHE A N    1  
ATOM 1260  C CA   . PHE A 1 83  ? 1.954   -5.068  0.960   1.00 0.00 ?  296 PHE A CA   1  
ATOM 1261  C C    . PHE A 1 83  ? 1.722   -4.229  -0.298  1.00 0.00 ?  296 PHE A C    1  
ATOM 1262  O O    . PHE A 1 83  ? 0.586   -3.884  -0.618  1.00 0.00 ?  296 PHE A O    1  
ATOM 1263  C CB   . PHE A 1 83  ? 1.730   -6.544  0.622   1.00 0.00 ?  296 PHE A CB   1  
ATOM 1264  C CG   . PHE A 1 83  ? 0.326   -6.856  0.099   1.00 0.00 ?  296 PHE A CG   1  
ATOM 1265  C CD1  . PHE A 1 83  ? -0.703  -7.025  0.973   1.00 0.00 ?  296 PHE A CD1  1  
ATOM 1266  C CD2  . PHE A 1 83  ? 0.108   -6.966  -1.238  1.00 0.00 ?  296 PHE A CD2  1  
ATOM 1267  C CE1  . PHE A 1 83  ? -2.005  -7.315  0.487   1.00 0.00 ?  296 PHE A CE1  1  
ATOM 1268  C CE2  . PHE A 1 83  ? -1.195  -7.257  -1.723  1.00 0.00 ?  296 PHE A CE2  1  
ATOM 1269  C CZ   . PHE A 1 83  ? -2.224  -7.425  -0.850  1.00 0.00 ?  296 PHE A CZ   1  
ATOM 1270  H H    . PHE A 1 83  ? 0.172   -4.263  1.679   1.00 0.00 ?  296 PHE A H    1  
ATOM 1271  H HA   . PHE A 1 83  ? 2.950   -4.864  1.352   1.00 0.00 ?  296 PHE A HA   1  
ATOM 1272  H HB2  . PHE A 1 83  ? 2.462   -6.850  -0.126  1.00 0.00 ?  296 PHE A HB2  1  
ATOM 1273  H HB3  . PHE A 1 83  ? 1.916   -7.142  1.514   1.00 0.00 ?  296 PHE A HB3  1  
ATOM 1274  H HD1  . PHE A 1 83  ? -0.527  -6.936  2.045   1.00 0.00 ?  296 PHE A HD1  1  
ATOM 1275  H HD2  . PHE A 1 83  ? 0.932   -6.832  -1.938  1.00 0.00 ?  296 PHE A HD2  1  
ATOM 1276  H HE1  . PHE A 1 83  ? -2.830  -7.450  1.188   1.00 0.00 ?  296 PHE A HE1  1  
ATOM 1277  H HE2  . PHE A 1 83  ? -1.370  -7.345  -2.796  1.00 0.00 ?  296 PHE A HE2  1  
ATOM 1278  H HZ   . PHE A 1 83  ? -3.224  -7.648  -1.223  1.00 0.00 ?  296 PHE A HZ   1  
ATOM 1279  N N    . GLY A 1 84  ? 2.818   -3.923  -0.977  1.00 0.00 ?  297 GLY A N    1  
ATOM 1280  C CA   . GLY A 1 84  ? 2.749   -3.130  -2.192  1.00 0.00 ?  297 GLY A CA   1  
ATOM 1281  C C    . GLY A 1 84  ? 3.707   -1.939  -2.125  1.00 0.00 ?  297 GLY A C    1  
ATOM 1282  O O    . GLY A 1 84  ? 3.885   -1.225  -3.111  1.00 0.00 ?  297 GLY A O    1  
ATOM 1283  H H    . GLY A 1 84  ? 3.739   -4.207  -0.709  1.00 0.00 ?  297 GLY A H    1  
ATOM 1284  H HA2  . GLY A 1 84  ? 2.997   -3.753  -3.052  1.00 0.00 ?  297 GLY A HA2  1  
ATOM 1285  H HA3  . GLY A 1 84  ? 1.730   -2.774  -2.341  1.00 0.00 ?  297 GLY A HA3  1  
ATOM 1286  N N    . GLU A 1 85  ? 4.298   -1.761  -0.953  1.00 0.00 ?  298 GLU A N    1  
ATOM 1287  C CA   . GLU A 1 85  ? 5.233   -0.669  -0.745  1.00 0.00 ?  298 GLU A CA   1  
ATOM 1288  C C    . GLU A 1 85  ? 6.316   -0.683  -1.826  1.00 0.00 ?  298 GLU A C    1  
ATOM 1289  O O    . GLU A 1 85  ? 6.604   0.346   -2.434  1.00 0.00 ?  298 GLU A O    1  
ATOM 1290  C CB   . GLU A 1 85  ? 5.853   -0.736  0.653   1.00 0.00 ?  298 GLU A CB   1  
ATOM 1291  C CG   . GLU A 1 85  ? 6.528   -2.089  0.888   1.00 0.00 ?  298 GLU A CG   1  
ATOM 1292  C CD   . GLU A 1 85  ? 6.606   -2.410  2.382   1.00 0.00 ?  298 GLU A CD   1  
ATOM 1293  O OE1  . GLU A 1 85  ? 7.388   -1.782  3.111   1.00 0.00 ?  298 GLU A OE1  1  
ATOM 1294  O OE2  . GLU A 1 85  ? 5.815   -3.349  2.780   1.00 0.00 -1 298 GLU A OE2  1  
ATOM 1295  H H    . GLU A 1 85  ? 4.148   -2.347  -0.157  1.00 0.00 ?  298 GLU A H    1  
ATOM 1296  H HA   . GLU A 1 85  ? 4.639   0.241   -0.828  1.00 0.00 ?  298 GLU A HA   1  
ATOM 1297  H HB2  . GLU A 1 85  ? 6.583   0.064   0.770   1.00 0.00 ?  298 GLU A HB2  1  
ATOM 1298  H HB3  . GLU A 1 85  ? 5.080   -0.575  1.405   1.00 0.00 ?  298 GLU A HB3  1  
ATOM 1299  H HG2  . GLU A 1 85  ? 5.971   -2.872  0.373   1.00 0.00 ?  298 GLU A HG2  1  
ATOM 1300  H HG3  . GLU A 1 85  ? 7.531   -2.078  0.463   1.00 0.00 ?  298 GLU A HG3  1  
ATOM 1301  H HE2  . GLU A 1 85  ? 5.072   -2.962  3.326   1.00 0.00 ?  298 GLU A HE2  1  
ATOM 1302  N N    . MET A 1 86  ? 6.886   -1.861  -2.031  1.00 0.00 ?  299 MET A N    1  
ATOM 1303  C CA   . MET A 1 86  ? 7.931   -2.023  -3.028  1.00 0.00 ?  299 MET A CA   1  
ATOM 1304  C C    . MET A 1 86  ? 7.515   -1.404  -4.364  1.00 0.00 ?  299 MET A C    1  
ATOM 1305  O O    . MET A 1 86  ? 8.332   -0.792  -5.050  1.00 0.00 ?  299 MET A O    1  
ATOM 1306  C CB   . MET A 1 86  ? 8.223   -3.513  -3.224  1.00 0.00 ?  299 MET A CB   1  
ATOM 1307  C CG   . MET A 1 86  ? 8.768   -4.138  -1.938  1.00 0.00 ?  299 MET A CG   1  
ATOM 1308  S SD   . MET A 1 86  ? 10.552  -4.117  -1.957  1.00 0.00 ?  299 MET A SD   1  
ATOM 1309  C CE   . MET A 1 86  ? 10.845  -2.387  -1.625  1.00 0.00 ?  299 MET A CE   1  
ATOM 1310  H H    . MET A 1 86  ? 6.646   -2.694  -1.532  1.00 0.00 ?  299 MET A H    1  
ATOM 1311  H HA   . MET A 1 86  ? 8.799   -1.498  -2.630  1.00 0.00 ?  299 MET A HA   1  
ATOM 1312  H HB2  . MET A 1 86  ? 7.312   -4.029  -3.527  1.00 0.00 ?  299 MET A HB2  1  
ATOM 1313  H HB3  . MET A 1 86  ? 8.946   -3.642  -4.030  1.00 0.00 ?  299 MET A HB3  1  
ATOM 1314  H HG2  . MET A 1 86  ? 8.398   -3.590  -1.072  1.00 0.00 ?  299 MET A HG2  1  
ATOM 1315  H HG3  . MET A 1 86  ? 8.409   -5.163  -1.843  1.00 0.00 ?  299 MET A HG3  1  
ATOM 1316  H HE1  . MET A 1 86  ? 9.990   -1.970  -1.093  1.00 0.00 ?  299 MET A HE1  1  
ATOM 1317  H HE2  . MET A 1 86  ? 11.741  -2.281  -1.014  1.00 0.00 ?  299 MET A HE2  1  
ATOM 1318  H HE3  . MET A 1 86  ? 10.982  -1.855  -2.567  1.00 0.00 ?  299 MET A HE3  1  
ATOM 1319  N N    . ALA A 1 87  ? 6.245   -1.585  -4.693  1.00 0.00 ?  300 ALA A N    1  
ATOM 1320  C CA   . ALA A 1 87  ? 5.710   -1.052  -5.935  1.00 0.00 ?  300 ALA A CA   1  
ATOM 1321  C C    . ALA A 1 87  ? 5.690   0.477   -5.861  1.00 0.00 ?  300 ALA A C    1  
ATOM 1322  O O    . ALA A 1 87  ? 5.951   1.153   -6.855  1.00 0.00 ?  300 ALA A O    1  
ATOM 1323  C CB   . ALA A 1 87  ? 4.322   -1.641  -6.188  1.00 0.00 ?  300 ALA A CB   1  
ATOM 1324  H H    . ALA A 1 87  ? 5.587   -2.084  -4.130  1.00 0.00 ?  300 ALA A H    1  
ATOM 1325  H HA   . ALA A 1 87  ? 6.375   -1.359  -6.742  1.00 0.00 ?  300 ALA A HA   1  
ATOM 1326  H HB1  . ALA A 1 87  ? 3.805   -1.045  -6.940  1.00 0.00 ?  300 ALA A HB1  1  
ATOM 1327  H HB2  . ALA A 1 87  ? 4.422   -2.667  -6.544  1.00 0.00 ?  300 ALA A HB2  1  
ATOM 1328  H HB3  . ALA A 1 87  ? 3.749   -1.633  -5.261  1.00 0.00 ?  300 ALA A HB3  1  
ATOM 1329  N N    . LEU A 1 88  ? 5.377   0.976   -4.675  1.00 0.00 ?  301 LEU A N    1  
ATOM 1330  C CA   . LEU A 1 88  ? 5.319   2.412   -4.458  1.00 0.00 ?  301 LEU A CA   1  
ATOM 1331  C C    . LEU A 1 88  ? 6.739   2.954   -4.284  1.00 0.00 ?  301 LEU A C    1  
ATOM 1332  O O    . LEU A 1 88  ? 6.945   4.167   -4.252  1.00 0.00 ?  301 LEU A O    1  
ATOM 1333  C CB   . LEU A 1 88  ? 4.387   2.741   -3.291  1.00 0.00 ?  301 LEU A CB   1  
ATOM 1334  C CG   . LEU A 1 88  ? 2.925   2.321   -3.461  1.00 0.00 ?  301 LEU A CG   1  
ATOM 1335  C CD1  . LEU A 1 88  ? 2.272   2.047   -2.104  1.00 0.00 ?  301 LEU A CD1  1  
ATOM 1336  C CD2  . LEU A 1 88  ? 2.147   3.358   -4.273  1.00 0.00 ?  301 LEU A CD2  1  
ATOM 1337  H H    . LEU A 1 88  ? 5.166   0.419   -3.871  1.00 0.00 ?  301 LEU A H    1  
ATOM 1338  H HA   . LEU A 1 88  ? 4.886   2.860   -5.353  1.00 0.00 ?  301 LEU A HA   1  
ATOM 1339  H HB2  . LEU A 1 88  ? 4.779   2.264   -2.393  1.00 0.00 ?  301 LEU A HB2  1  
ATOM 1340  H HB3  . LEU A 1 88  ? 4.417   3.817   -3.120  1.00 0.00 ?  301 LEU A HB3  1  
ATOM 1341  H HG   . LEU A 1 88  ? 2.901   1.387   -4.023  1.00 0.00 ?  301 LEU A HG   1  
ATOM 1342  H HD11 . LEU A 1 88  ? 1.244   2.408   -2.117  1.00 0.00 ?  301 LEU A HD11 1  
ATOM 1343  H HD12 . LEU A 1 88  ? 2.279   0.975   -1.907  1.00 0.00 ?  301 LEU A HD12 1  
ATOM 1344  H HD13 . LEU A 1 88  ? 2.829   2.564   -1.322  1.00 0.00 ?  301 LEU A HD13 1  
ATOM 1345  H HD21 . LEU A 1 88  ? 2.807   3.807   -5.015  1.00 0.00 ?  301 LEU A HD21 1  
ATOM 1346  H HD22 . LEU A 1 88  ? 1.312   2.873   -4.776  1.00 0.00 ?  301 LEU A HD22 1  
ATOM 1347  H HD23 . LEU A 1 88  ? 1.770   4.133   -3.606  1.00 0.00 ?  301 LEU A HD23 1  
ATOM 1348  N N    . ILE A 1 89  ? 7.682   2.030   -4.174  1.00 0.00 ?  302 ILE A N    1  
ATOM 1349  C CA   . ILE A 1 89  ? 9.077   2.401   -4.003  1.00 0.00 ?  302 ILE A CA   1  
ATOM 1350  C C    . ILE A 1 89  ? 9.685   2.725   -5.369  1.00 0.00 ?  302 ILE A C    1  
ATOM 1351  O O    . ILE A 1 89  ? 10.249  3.801   -5.562  1.00 0.00 ?  302 ILE A O    1  
ATOM 1352  C CB   . ILE A 1 89  ? 9.830   1.312   -3.237  1.00 0.00 ?  302 ILE A CB   1  
ATOM 1353  C CG1  . ILE A 1 89  ? 9.370   1.249   -1.779  1.00 0.00 ?  302 ILE A CG1  1  
ATOM 1354  C CG2  . ILE A 1 89  ? 11.343  1.507   -3.352  1.00 0.00 ?  302 ILE A CG2  1  
ATOM 1355  C CD1  . ILE A 1 89  ? 10.199  2.189   -0.901  1.00 0.00 ?  302 ILE A CD1  1  
ATOM 1356  H H    . ILE A 1 89  ? 7.507   1.046   -4.201  1.00 0.00 ?  302 ILE A H    1  
ATOM 1357  H HA   . ILE A 1 89  ? 9.102   3.302   -3.391  1.00 0.00 ?  302 ILE A HA   1  
ATOM 1358  H HB   . ILE A 1 89  ? 9.594   0.349   -3.691  1.00 0.00 ?  302 ILE A HB   1  
ATOM 1359  H HG12 . ILE A 1 89  ? 8.316   1.520   -1.714  1.00 0.00 ?  302 ILE A HG12 1  
ATOM 1360  H HG13 . ILE A 1 89  ? 9.459   0.228   -1.409  1.00 0.00 ?  302 ILE A HG13 1  
ATOM 1361  H HG21 . ILE A 1 89  ? 11.702  1.035   -4.267  1.00 0.00 ?  302 ILE A HG21 1  
ATOM 1362  H HG22 . ILE A 1 89  ? 11.571  2.573   -3.380  1.00 0.00 ?  302 ILE A HG22 1  
ATOM 1363  H HG23 . ILE A 1 89  ? 11.835  1.053   -2.492  1.00 0.00 ?  302 ILE A HG23 1  
ATOM 1364  H HD11 . ILE A 1 89  ? 11.031  1.639   -0.463  1.00 0.00 ?  302 ILE A HD11 1  
ATOM 1365  H HD12 . ILE A 1 89  ? 10.585  3.008   -1.509  1.00 0.00 ?  302 ILE A HD12 1  
ATOM 1366  H HD13 . ILE A 1 89  ? 9.571   2.592   -0.106  1.00 0.00 ?  302 ILE A HD13 1  
ATOM 1367  N N    . SER A 1 90  ? 9.551   1.773   -6.281  1.00 0.00 ?  303 SER A N    1  
ATOM 1368  C CA   . SER A 1 90  ? 10.081  1.944   -7.624  1.00 0.00 ?  303 SER A CA   1  
ATOM 1369  C C    . SER A 1 90  ? 9.281   1.095   -8.614  1.00 0.00 ?  303 SER A C    1  
ATOM 1370  O O    . SER A 1 90  ? 9.855   0.449   -9.489  1.00 0.00 ?  303 SER A O    1  
ATOM 1371  C CB   . SER A 1 90  ? 11.564  1.571   -7.682  1.00 0.00 ?  303 SER A CB   1  
ATOM 1372  O OG   . SER A 1 90  ? 12.407  2.707   -7.509  1.00 0.00 ?  303 SER A OG   1  
ATOM 1373  H H    . SER A 1 90  ? 9.092   0.901   -6.116  1.00 0.00 ?  303 SER A H    1  
ATOM 1374  H HA   . SER A 1 90  ? 9.964   3.004   -7.848  1.00 0.00 ?  303 SER A HA   1  
ATOM 1375  H HB2  . SER A 1 90  ? 11.783  0.835   -6.909  1.00 0.00 ?  303 SER A HB2  1  
ATOM 1376  H HB3  . SER A 1 90  ? 11.782  1.101   -8.641  1.00 0.00 ?  303 SER A HB3  1  
ATOM 1377  H HG   . SER A 1 90  ? 12.162  3.189   -6.668  1.00 0.00 ?  303 SER A HG   1  
ATOM 1378  N N    . GLY A 1 91  ? 7.967   1.123   -8.442  1.00 0.00 ?  304 GLY A N    1  
ATOM 1379  C CA   . GLY A 1 91  ? 7.083   0.364   -9.309  1.00 0.00 ?  304 GLY A CA   1  
ATOM 1380  C C    . GLY A 1 91  ? 7.714   -0.973  -9.702  1.00 0.00 ?  304 GLY A C    1  
ATOM 1381  O O    . GLY A 1 91  ? 7.632   -1.388  -10.857 1.00 0.00 ?  304 GLY A O    1  
ATOM 1382  H H    . GLY A 1 91  ? 7.508   1.650   -7.727  1.00 0.00 ?  304 GLY A H    1  
ATOM 1383  H HA2  . GLY A 1 91  ? 6.134   0.188   -8.803  1.00 0.00 ?  304 GLY A HA2  1  
ATOM 1384  H HA3  . GLY A 1 91  ? 6.862   0.943   -10.206 1.00 0.00 ?  304 GLY A HA3  1  
ATOM 1385  N N    . GLU A 1 92  ? 8.330   -1.612  -8.718  1.00 0.00 ?  305 GLU A N    1  
ATOM 1386  C CA   . GLU A 1 92  ? 8.975   -2.894  -8.945  1.00 0.00 ?  305 GLU A CA   1  
ATOM 1387  C C    . GLU A 1 92  ? 7.928   -4.005  -9.038  1.00 0.00 ?  305 GLU A C    1  
ATOM 1388  O O    . GLU A 1 92  ? 6.818   -3.862  -8.527  1.00 0.00 ?  305 GLU A O    1  
ATOM 1389  C CB   . GLU A 1 92  ? 9.999   -3.195  -7.849  1.00 0.00 ?  305 GLU A CB   1  
ATOM 1390  C CG   . GLU A 1 92  ? 9.305   -3.578  -6.541  1.00 0.00 ?  305 GLU A CG   1  
ATOM 1391  C CD   . GLU A 1 92  ? 9.732   -4.973  -6.081  1.00 0.00 ?  305 GLU A CD   1  
ATOM 1392  O OE1  . GLU A 1 92  ? 8.879   -5.853  -5.893  1.00 0.00 ?  305 GLU A OE1  1  
ATOM 1393  O OE2  . GLU A 1 92  ? 11.003  -5.129  -5.921  1.00 0.00 -1 305 GLU A OE2  1  
ATOM 1394  H H    . GLU A 1 92  ? 8.393   -1.268  -7.781  1.00 0.00 ?  305 GLU A H    1  
ATOM 1395  H HA   . GLU A 1 92  ? 9.492   -2.792  -9.899  1.00 0.00 ?  305 GLU A HA   1  
ATOM 1396  H HB2  . GLU A 1 92  ? 10.652  -4.006  -8.170  1.00 0.00 ?  305 GLU A HB2  1  
ATOM 1397  H HB3  . GLU A 1 92  ? 10.632  -2.322  -7.687  1.00 0.00 ?  305 GLU A HB3  1  
ATOM 1398  H HG2  . GLU A 1 92  ? 9.547   -2.847  -5.769  1.00 0.00 ?  305 GLU A HG2  1  
ATOM 1399  H HG3  . GLU A 1 92  ? 8.224   -3.551  -6.677  1.00 0.00 ?  305 GLU A HG3  1  
ATOM 1400  H HE2  . GLU A 1 92  ? 11.406  -4.291  -5.554  1.00 0.00 ?  305 GLU A HE2  1  
ATOM 1401  N N    . PRO A 1 93  ? 8.329   -5.118  -9.710  1.00 0.00 ?  306 PRO A N    1  
ATOM 1402  C CA   . PRO A 1 93  ? 7.437   -6.253  -9.876  1.00 0.00 ?  306 PRO A CA   1  
ATOM 1403  C C    . PRO A 1 93  ? 7.310   -7.045  -8.573  1.00 0.00 ?  306 PRO A C    1  
ATOM 1404  O O    . PRO A 1 93  ? 8.312   -7.365  -7.936  1.00 0.00 ?  306 PRO A O    1  
ATOM 1405  C CB   . PRO A 1 93  ? 8.043   -7.066  -11.009 1.00 0.00 ?  306 PRO A CB   1  
ATOM 1406  C CG   . PRO A 1 93  ? 9.489   -6.611  -11.122 1.00 0.00 ?  306 PRO A CG   1  
ATOM 1407  C CD   . PRO A 1 93  ? 9.635   -5.322  -10.328 1.00 0.00 ?  306 PRO A CD   1  
ATOM 1408  H HA   . PRO A 1 93  ? 6.514   -5.940  -10.098 1.00 0.00 ?  306 PRO A HA   1  
ATOM 1409  H HB2  . PRO A 1 93  ? 7.986   -8.134  -10.797 1.00 0.00 ?  306 PRO A HB2  1  
ATOM 1410  H HB3  . PRO A 1 93  ? 7.506   -6.897  -11.942 1.00 0.00 ?  306 PRO A HB3  1  
ATOM 1411  H HG2  . PRO A 1 93  ? 10.162  -7.376  -10.735 1.00 0.00 ?  306 PRO A HG2  1  
ATOM 1412  H HG3  . PRO A 1 93  ? 9.757   -6.449  -12.166 1.00 0.00 ?  306 PRO A HG3  1  
ATOM 1413  H HD2  . PRO A 1 93  ? 10.420  -5.408  -9.577  1.00 0.00 ?  306 PRO A HD2  1  
ATOM 1414  H HD3  . PRO A 1 93  ? 9.903   -4.487  -10.975 1.00 0.00 ?  306 PRO A HD3  1  
ATOM 1415  N N    . ARG A 1 94  ? 6.068   -7.338  -8.216  1.00 0.00 ?  307 ARG A N    1  
ATOM 1416  C CA   . ARG A 1 94  ? 5.797   -8.087  -7.000  1.00 0.00 ?  307 ARG A CA   1  
ATOM 1417  C C    . ARG A 1 94  ? 6.757   -9.271  -6.880  1.00 0.00 ?  307 ARG A C    1  
ATOM 1418  O O    . ARG A 1 94  ? 7.288   -9.539  -5.803  1.00 0.00 ?  307 ARG A O    1  
ATOM 1419  C CB   . ARG A 1 94  ? 4.356   -8.603  -6.981  1.00 0.00 ?  307 ARG A CB   1  
ATOM 1420  C CG   . ARG A 1 94  ? 3.544   -7.921  -5.879  1.00 0.00 ?  307 ARG A CG   1  
ATOM 1421  C CD   . ARG A 1 94  ? 2.951   -6.599  -6.373  1.00 0.00 ?  307 ARG A CD   1  
ATOM 1422  N NE   . ARG A 1 94  ? 1.824   -6.194  -5.504  1.00 0.00 ?  307 ARG A NE   1  
ATOM 1423  C CZ   . ARG A 1 94  ? 1.207   -5.007  -5.578  1.00 0.00 ?  307 ARG A CZ   1  
ATOM 1424  N NH1  . ARG A 1 94  ? 1.605   -4.101  -6.481  1.00 0.00 ?  307 ARG A NH1  1  
ATOM 1425  N NH2  . ARG A 1 94  ? 0.193   -4.726  -4.749  1.00 0.00 1  307 ARG A NH2  1  
ATOM 1426  H H    . ARG A 1 94  ? 5.258   -7.074  -8.739  1.00 0.00 ?  307 ARG A H    1  
ATOM 1427  H HA   . ARG A 1 94  ? 5.953   -7.372  -6.192  1.00 0.00 ?  307 ARG A HA   1  
ATOM 1428  H HB2  . ARG A 1 94  ? 3.889   -8.421  -7.949  1.00 0.00 ?  307 ARG A HB2  1  
ATOM 1429  H HB3  . ARG A 1 94  ? 4.355   -9.682  -6.825  1.00 0.00 ?  307 ARG A HB3  1  
ATOM 1430  H HG2  . ARG A 1 94  ? 2.743   -8.582  -5.551  1.00 0.00 ?  307 ARG A HG2  1  
ATOM 1431  H HG3  . ARG A 1 94  ? 4.181   -7.737  -5.014  1.00 0.00 ?  307 ARG A HG3  1  
ATOM 1432  H HD2  . ARG A 1 94  ? 3.718   -5.825  -6.372  1.00 0.00 ?  307 ARG A HD2  1  
ATOM 1433  H HD3  . ARG A 1 94  ? 2.608   -6.707  -7.402  1.00 0.00 ?  307 ARG A HD3  1  
ATOM 1434  H HE   . ARG A 1 94  ? 1.502   -6.847  -4.818  1.00 0.00 ?  307 ARG A HE   1  
ATOM 1435  H HH11 . ARG A 1 94  ? 2.362   -4.310  -7.100  1.00 0.00 ?  307 ARG A HH11 1  
ATOM 1436  H HH12 . ARG A 1 94  ? 1.145   -3.215  -6.537  1.00 0.00 ?  307 ARG A HH12 1  
ATOM 1437  H HH21 . ARG A 1 94  ? -0.104  -5.402  -4.075  1.00 0.00 ?  307 ARG A HH21 1  
ATOM 1438  H HH22 . ARG A 1 94  ? -0.268  -3.840  -4.804  1.00 0.00 ?  307 ARG A HH22 1  
ATOM 1439  N N    . SER A 1 95  ? 6.952   -9.950  -8.002  1.00 0.00 ?  308 SER A N    1  
ATOM 1440  C CA   . SER A 1 95  ? 7.840   -11.100 -8.036  1.00 0.00 ?  308 SER A CA   1  
ATOM 1441  C C    . SER A 1 95  ? 7.245   -12.245 -7.213  1.00 0.00 ?  308 SER A C    1  
ATOM 1442  O O    . SER A 1 95  ? 7.968   -12.950 -6.511  1.00 0.00 ?  308 SER A O    1  
ATOM 1443  C CB   . SER A 1 95  ? 9.231   -10.738 -7.513  1.00 0.00 ?  308 SER A CB   1  
ATOM 1444  O OG   . SER A 1 95  ? 9.798   -9.639  -8.221  1.00 0.00 ?  308 SER A OG   1  
ATOM 1445  H H    . SER A 1 95  ? 6.516   -9.726  -8.873  1.00 0.00 ?  308 SER A H    1  
ATOM 1446  H HA   . SER A 1 95  ? 7.909   -11.380 -9.087  1.00 0.00 ?  308 SER A HA   1  
ATOM 1447  H HB2  . SER A 1 95  ? 9.167   -10.492 -6.453  1.00 0.00 ?  308 SER A HB2  1  
ATOM 1448  H HB3  . SER A 1 95  ? 9.888   -11.603 -7.601  1.00 0.00 ?  308 SER A HB3  1  
ATOM 1449  H HG   . SER A 1 95  ? 10.785  -9.767  -8.318  1.00 0.00 ?  308 SER A HG   1  
ATOM 1450  N N    . ALA A 1 96  ? 5.933   -12.394 -7.328  1.00 0.00 ?  309 ALA A N    1  
ATOM 1451  C CA   . ALA A 1 96  ? 5.233   -13.441 -6.603  1.00 0.00 ?  309 ALA A CA   1  
ATOM 1452  C C    . ALA A 1 96  ? 3.725   -13.270 -6.798  1.00 0.00 ?  309 ALA A C    1  
ATOM 1453  O O    . ALA A 1 96  ? 3.261   -12.189 -7.158  1.00 0.00 ?  309 ALA A O    1  
ATOM 1454  C CB   . ALA A 1 96  ? 5.639   -13.401 -5.128  1.00 0.00 ?  309 ALA A CB   1  
ATOM 1455  H H    . ALA A 1 96  ? 5.353   -11.816 -7.901  1.00 0.00 ?  309 ALA A H    1  
ATOM 1456  H HA   . ALA A 1 96  ? 5.539   -14.398 -7.026  1.00 0.00 ?  309 ALA A HA   1  
ATOM 1457  H HB1  . ALA A 1 96  ? 6.154   -12.463 -4.919  1.00 0.00 ?  309 ALA A HB1  1  
ATOM 1458  H HB2  . ALA A 1 96  ? 4.748   -13.473 -4.504  1.00 0.00 ?  309 ALA A HB2  1  
ATOM 1459  H HB3  . ALA A 1 96  ? 6.304   -14.237 -4.912  1.00 0.00 ?  309 ALA A HB3  1  
ATOM 1460  N N    . THR A 1 97  ? 3.002   -14.352 -6.551  1.00 0.00 ?  310 THR A N    1  
ATOM 1461  C CA   . THR A 1 97  ? 1.556   -14.334 -6.694  1.00 0.00 ?  310 THR A CA   1  
ATOM 1462  C C    . THR A 1 97  ? 0.884   -14.302 -5.321  1.00 0.00 ?  310 THR A C    1  
ATOM 1463  O O    . THR A 1 97  ? 1.106   -15.188 -4.496  1.00 0.00 ?  310 THR A O    1  
ATOM 1464  C CB   . THR A 1 97  ? 1.151   -15.543 -7.541  1.00 0.00 ?  310 THR A CB   1  
ATOM 1465  O OG1  . THR A 1 97  ? 0.737   -14.975 -8.781  1.00 0.00 ?  310 THR A OG1  1  
ATOM 1466  C CG2  . THR A 1 97  ? -0.107  -16.234 -7.010  1.00 0.00 ?  310 THR A CG2  1  
ATOM 1467  H H    . THR A 1 97  ? 3.387   -15.227 -6.258  1.00 0.00 ?  310 THR A H    1  
ATOM 1468  H HA   . THR A 1 97  ? 1.273   -13.417 -7.210  1.00 0.00 ?  310 THR A HA   1  
ATOM 1469  H HB   . THR A 1 97  ? 1.976   -16.249 -7.631  1.00 0.00 ?  310 THR A HB   1  
ATOM 1470  H HG1  . THR A 1 97  ? -0.170  -14.566 -8.684  1.00 0.00 ?  310 THR A HG1  1  
ATOM 1471  H HG21 . THR A 1 97  ? -0.500  -16.908 -7.771  1.00 0.00 ?  310 THR A HG21 1  
ATOM 1472  H HG22 . THR A 1 97  ? 0.142   -16.803 -6.115  1.00 0.00 ?  310 THR A HG22 1  
ATOM 1473  H HG23 . THR A 1 97  ? -0.859  -15.484 -6.766  1.00 0.00 ?  310 THR A HG23 1  
ATOM 1474  N N    . VAL A 1 98  ? 0.076   -13.272 -5.117  1.00 0.00 ?  311 VAL A N    1  
ATOM 1475  C CA   . VAL A 1 98  ? -0.630  -13.113 -3.857  1.00 0.00 ?  311 VAL A CA   1  
ATOM 1476  C C    . VAL A 1 98  ? -2.090  -13.537 -4.038  1.00 0.00 ?  311 VAL A C    1  
ATOM 1477  O O    . VAL A 1 98  ? -2.766  -13.069 -4.952  1.00 0.00 ?  311 VAL A O    1  
ATOM 1478  C CB   . VAL A 1 98  ? -0.483  -11.676 -3.352  1.00 0.00 ?  311 VAL A CB   1  
ATOM 1479  C CG1  . VAL A 1 98  ? -1.203  -11.488 -2.015  1.00 0.00 ?  311 VAL A CG1  1  
ATOM 1480  C CG2  . VAL A 1 98  ? 0.991   -11.282 -3.241  1.00 0.00 ?  311 VAL A CG2  1  
ATOM 1481  H H    . VAL A 1 98  ? -0.099  -12.556 -5.793  1.00 0.00 ?  311 VAL A H    1  
ATOM 1482  H HA   . VAL A 1 98  ? -0.160  -13.776 -3.130  1.00 0.00 ?  311 VAL A HA   1  
ATOM 1483  H HB   . VAL A 1 98  ? -0.952  -11.015 -4.081  1.00 0.00 ?  311 VAL A HB   1  
ATOM 1484  H HG11 . VAL A 1 98  ? -2.072  -12.146 -1.975  1.00 0.00 ?  311 VAL A HG11 1  
ATOM 1485  H HG12 . VAL A 1 98  ? -0.524  -11.732 -1.199  1.00 0.00 ?  311 VAL A HG12 1  
ATOM 1486  H HG13 . VAL A 1 98  ? -1.528  -10.452 -1.920  1.00 0.00 ?  311 VAL A HG13 1  
ATOM 1487  H HG21 . VAL A 1 98  ? 1.461   -11.855 -2.441  1.00 0.00 ?  311 VAL A HG21 1  
ATOM 1488  H HG22 . VAL A 1 98  ? 1.496   -11.494 -4.184  1.00 0.00 ?  311 VAL A HG22 1  
ATOM 1489  H HG23 . VAL A 1 98  ? 1.067   -10.218 -3.019  1.00 0.00 ?  311 VAL A HG23 1  
ATOM 1490  N N    . SER A 1 99  ? -2.531  -14.417 -3.152  1.00 0.00 ?  312 SER A N    1  
ATOM 1491  C CA   . SER A 1 99  ? -3.897  -14.909 -3.202  1.00 0.00 ?  312 SER A CA   1  
ATOM 1492  C C    . SER A 1 99  ? -4.454  -15.055 -1.784  1.00 0.00 ?  312 SER A C    1  
ATOM 1493  O O    . SER A 1 99  ? -3.694  -15.193 -0.827  1.00 0.00 ?  312 SER A O    1  
ATOM 1494  C CB   . SER A 1 99  ? -3.975  -16.245 -3.943  1.00 0.00 ?  312 SER A CB   1  
ATOM 1495  O OG   . SER A 1 99  ? -2.958  -17.150 -3.520  1.00 0.00 ?  312 SER A OG   1  
ATOM 1496  H H    . SER A 1 99  ? -1.974  -14.793 -2.411  1.00 0.00 ?  312 SER A H    1  
ATOM 1497  H HA   . SER A 1 99  ? -4.455  -14.154 -3.756  1.00 0.00 ?  312 SER A HA   1  
ATOM 1498  H HB2  . SER A 1 99  ? -4.953  -16.696 -3.776  1.00 0.00 ?  312 SER A HB2  1  
ATOM 1499  H HB3  . SER A 1 99  ? -3.882  -16.072 -5.015  1.00 0.00 ?  312 SER A HB3  1  
ATOM 1500  H HG   . SER A 1 99  ? -2.203  -17.147 -4.176  1.00 0.00 ?  312 SER A HG   1  
ATOM 1501  N N    . ALA A 1 100 ? -5.775  -15.020 -1.695  1.00 0.00 ?  313 ALA A N    1  
ATOM 1502  C CA   . ALA A 1 100 ? -6.442  -15.147 -0.410  1.00 0.00 ?  313 ALA A CA   1  
ATOM 1503  C C    . ALA A 1 100 ? -6.730  -16.624 -0.134  1.00 0.00 ?  313 ALA A C    1  
ATOM 1504  O O    . ALA A 1 100 ? -7.372  -17.297 -0.939  1.00 0.00 ?  313 ALA A O    1  
ATOM 1505  C CB   . ALA A 1 100 ? -7.713  -14.295 -0.408  1.00 0.00 ?  313 ALA A CB   1  
ATOM 1506  H H    . ALA A 1 100 ? -6.386  -14.908 -2.479  1.00 0.00 ?  313 ALA A H    1  
ATOM 1507  H HA   . ALA A 1 100 ? -5.764  -14.768 0.354   1.00 0.00 ?  313 ALA A HA   1  
ATOM 1508  H HB1  . ALA A 1 100 ? -8.313  -14.535 -1.286  1.00 0.00 ?  313 ALA A HB1  1  
ATOM 1509  H HB2  . ALA A 1 100 ? -8.289  -14.504 0.493   1.00 0.00 ?  313 ALA A HB2  1  
ATOM 1510  H HB3  . ALA A 1 100 ? -7.443  -13.239 -0.430  1.00 0.00 ?  313 ALA A HB3  1  
ATOM 1511  N N    . ALA A 1 101 ? -6.240  -17.086 1.008   1.00 0.00 ?  314 ALA A N    1  
ATOM 1512  C CA   . ALA A 1 101 ? -6.437  -18.471 1.401   1.00 0.00 ?  314 ALA A CA   1  
ATOM 1513  C C    . ALA A 1 101 ? -7.907  -18.689 1.765   1.00 0.00 ?  314 ALA A C    1  
ATOM 1514  O O    . ALA A 1 101 ? -8.417  -19.804 1.661   1.00 0.00 ?  314 ALA A O    1  
ATOM 1515  C CB   . ALA A 1 101 ? -5.493  -18.813 2.555   1.00 0.00 ?  314 ALA A CB   1  
ATOM 1516  H H    . ALA A 1 101 ? -5.719  -16.532 1.657   1.00 0.00 ?  314 ALA A H    1  
ATOM 1517  H HA   . ALA A 1 101 ? -6.186  -19.097 0.545   1.00 0.00 ?  314 ALA A HA   1  
ATOM 1518  H HB1  . ALA A 1 101 ? -5.673  -19.837 2.880   1.00 0.00 ?  314 ALA A HB1  1  
ATOM 1519  H HB2  . ALA A 1 101 ? -4.460  -18.714 2.221   1.00 0.00 ?  314 ALA A HB2  1  
ATOM 1520  H HB3  . ALA A 1 101 ? -5.673  -18.131 3.386   1.00 0.00 ?  314 ALA A HB3  1  
ATOM 1521  N N    . THR A 1 102 ? -8.546  -17.608 2.185   1.00 0.00 ?  315 THR A N    1  
ATOM 1522  C CA   . THR A 1 102 ? -9.947  -17.667 2.566   1.00 0.00 ?  315 THR A CA   1  
ATOM 1523  C C    . THR A 1 102 ? -10.613 -16.304 2.364   1.00 0.00 ?  315 THR A C    1  
ATOM 1524  O O    . THR A 1 102 ? -10.027 -15.406 1.762   1.00 0.00 ?  315 THR A O    1  
ATOM 1525  C CB   . THR A 1 102 ? -10.025 -18.174 4.007   1.00 0.00 ?  315 THR A CB   1  
ATOM 1526  O OG1  . THR A 1 102 ? -11.390 -18.548 4.171   1.00 0.00 ?  315 THR A OG1  1  
ATOM 1527  C CG2  . THR A 1 102 ? -9.819  -17.056 5.032   1.00 0.00 ?  315 THR A CG2  1  
ATOM 1528  H H    . THR A 1 102 ? -8.124  -16.705 2.267   1.00 0.00 ?  315 THR A H    1  
ATOM 1529  H HA   . THR A 1 102 ? -10.454 -18.371 1.905   1.00 0.00 ?  315 THR A HA   1  
ATOM 1530  H HB   . THR A 1 102 ? -9.319  -18.988 4.172   1.00 0.00 ?  315 THR A HB   1  
ATOM 1531  H HG1  . THR A 1 102 ? -11.646 -19.220 3.476   1.00 0.00 ?  315 THR A HG1  1  
ATOM 1532  H HG21 . THR A 1 102 ? -10.770 -16.559 5.223   1.00 0.00 ?  315 THR A HG21 1  
ATOM 1533  H HG22 . THR A 1 102 ? -9.438  -17.481 5.961   1.00 0.00 ?  315 THR A HG22 1  
ATOM 1534  H HG23 . THR A 1 102 ? -9.102  -16.334 4.643   1.00 0.00 ?  315 THR A HG23 1  
ATOM 1535  N N    . THR A 1 103 ? -11.829 -16.194 2.878   1.00 0.00 ?  316 THR A N    1  
ATOM 1536  C CA   . THR A 1 103 ? -12.581 -14.956 2.762   1.00 0.00 ?  316 THR A CA   1  
ATOM 1537  C C    . THR A 1 103 ? -11.809 -13.801 3.402   1.00 0.00 ?  316 THR A C    1  
ATOM 1538  O O    . THR A 1 103 ? -12.026 -13.474 4.567   1.00 0.00 ?  316 THR A O    1  
ATOM 1539  C CB   . THR A 1 103 ? -13.961 -15.181 3.382   1.00 0.00 ?  316 THR A CB   1  
ATOM 1540  O OG1  . THR A 1 103 ? -14.519 -16.244 2.613   1.00 0.00 ?  316 THR A OG1  1  
ATOM 1541  C CG2  . THR A 1 103 ? -14.912 -14.007 3.139   1.00 0.00 ?  316 THR A CG2  1  
ATOM 1542  H H    . THR A 1 103 ? -12.300 -16.930 3.365   1.00 0.00 ?  316 THR A H    1  
ATOM 1543  H HA   . THR A 1 103 ? -12.692 -14.719 1.704   1.00 0.00 ?  316 THR A HA   1  
ATOM 1544  H HB   . THR A 1 103 ? -13.879 -15.401 4.447   1.00 0.00 ?  316 THR A HB   1  
ATOM 1545  H HG1  . THR A 1 103 ? -15.426 -16.478 2.961   1.00 0.00 ?  316 THR A HG1  1  
ATOM 1546  H HG21 . THR A 1 103 ? -15.060 -13.876 2.067   1.00 0.00 ?  316 THR A HG21 1  
ATOM 1547  H HG22 . THR A 1 103 ? -15.870 -14.210 3.616   1.00 0.00 ?  316 THR A HG22 1  
ATOM 1548  H HG23 . THR A 1 103 ? -14.481 -13.098 3.560   1.00 0.00 ?  316 THR A HG23 1  
ATOM 1549  N N    . VAL A 1 104 ? -10.922 -13.214 2.611   1.00 0.00 ?  317 VAL A N    1  
ATOM 1550  C CA   . VAL A 1 104 ? -10.115 -12.103 3.086   1.00 0.00 ?  317 VAL A CA   1  
ATOM 1551  C C    . VAL A 1 104 ? -10.640 -10.801 2.476   1.00 0.00 ?  317 VAL A C    1  
ATOM 1552  O O    . VAL A 1 104 ? -11.327 -10.822 1.456   1.00 0.00 ?  317 VAL A O    1  
ATOM 1553  C CB   . VAL A 1 104 ? -8.639  -12.356 2.774   1.00 0.00 ?  317 VAL A CB   1  
ATOM 1554  C CG1  . VAL A 1 104 ? -7.761  -11.231 3.326   1.00 0.00 ?  317 VAL A CG1  1  
ATOM 1555  C CG2  . VAL A 1 104 ? -8.191  -13.716 3.313   1.00 0.00 ?  317 VAL A CG2  1  
ATOM 1556  H H    . VAL A 1 104 ? -10.751 -13.486 1.664   1.00 0.00 ?  317 VAL A H    1  
ATOM 1557  H HA   . VAL A 1 104 ? -10.228 -12.053 4.169   1.00 0.00 ?  317 VAL A HA   1  
ATOM 1558  H HB   . VAL A 1 104 ? -8.523  -12.371 1.690   1.00 0.00 ?  317 VAL A HB   1  
ATOM 1559  H HG11 . VAL A 1 104 ? -8.082  -10.279 2.904   1.00 0.00 ?  317 VAL A HG11 1  
ATOM 1560  H HG12 . VAL A 1 104 ? -7.854  -11.197 4.412   1.00 0.00 ?  317 VAL A HG12 1  
ATOM 1561  H HG13 . VAL A 1 104 ? -6.721  -11.416 3.056   1.00 0.00 ?  317 VAL A HG13 1  
ATOM 1562  H HG21 . VAL A 1 104 ? -8.889  -14.051 4.080   1.00 0.00 ?  317 VAL A HG21 1  
ATOM 1563  H HG22 . VAL A 1 104 ? -8.171  -14.441 2.499   1.00 0.00 ?  317 VAL A HG22 1  
ATOM 1564  H HG23 . VAL A 1 104 ? -7.194  -13.626 3.744   1.00 0.00 ?  317 VAL A HG23 1  
ATOM 1565  N N    . SER A 1 105 ? -10.296 -9.699  3.127   1.00 0.00 ?  318 SER A N    1  
ATOM 1566  C CA   . SER A 1 105 ? -10.724 -8.391  2.662   1.00 0.00 ?  318 SER A CA   1  
ATOM 1567  C C    . SER A 1 105 ? -9.562  -7.399  2.749   1.00 0.00 ?  318 SER A C    1  
ATOM 1568  O O    . SER A 1 105 ? -8.984  -7.206  3.818   1.00 0.00 ?  318 SER A O    1  
ATOM 1569  C CB   . SER A 1 105 ? -11.918 -7.882  3.472   1.00 0.00 ?  318 SER A CB   1  
ATOM 1570  O OG   . SER A 1 105 ? -13.037 -8.759  3.383   1.00 0.00 ?  318 SER A OG   1  
ATOM 1571  H H    . SER A 1 105 ? -9.737  -9.691  3.957   1.00 0.00 ?  318 SER A H    1  
ATOM 1572  H HA   . SER A 1 105 ? -11.025 -8.537  1.625   1.00 0.00 ?  318 SER A HA   1  
ATOM 1573  H HB2  . SER A 1 105 ? -11.626 -7.771  4.517   1.00 0.00 ?  318 SER A HB2  1  
ATOM 1574  H HB3  . SER A 1 105 ? -12.203 -6.893  3.115   1.00 0.00 ?  318 SER A HB3  1  
ATOM 1575  H HG   . SER A 1 105 ? -13.383 -8.966  4.298   1.00 0.00 ?  318 SER A HG   1  
ATOM 1576  N N    . LEU A 1 106 ? -9.254  -6.797  1.610   1.00 0.00 ?  319 LEU A N    1  
ATOM 1577  C CA   . LEU A 1 106 ? -8.171  -5.830  1.544   1.00 0.00 ?  319 LEU A CA   1  
ATOM 1578  C C    . LEU A 1 106 ? -8.635  -4.605  0.753   1.00 0.00 ?  319 LEU A C    1  
ATOM 1579  O O    . LEU A 1 106 ? -9.702  -4.624  0.141   1.00 0.00 ?  319 LEU A O    1  
ATOM 1580  C CB   . LEU A 1 106 ? -6.905  -6.481  0.984   1.00 0.00 ?  319 LEU A CB   1  
ATOM 1581  C CG   . LEU A 1 106 ? -7.116  -7.731  0.127   1.00 0.00 ?  319 LEU A CG   1  
ATOM 1582  C CD1  . LEU A 1 106 ? -7.513  -8.928  0.992   1.00 0.00 ?  319 LEU A CD1  1  
ATOM 1583  C CD2  . LEU A 1 106 ? -8.131  -7.467  -0.987  1.00 0.00 ?  319 LEU A CD2  1  
ATOM 1584  H H    . LEU A 1 106 ? -9.729  -6.959  0.745   1.00 0.00 ?  319 LEU A H    1  
ATOM 1585  H HA   . LEU A 1 106 ? -7.949  -5.518  2.564   1.00 0.00 ?  319 LEU A HA   1  
ATOM 1586  H HB2  . LEU A 1 106 ? -6.373  -5.740  0.386   1.00 0.00 ?  319 LEU A HB2  1  
ATOM 1587  H HB3  . LEU A 1 106 ? -6.255  -6.743  1.819   1.00 0.00 ?  319 LEU A HB3  1  
ATOM 1588  H HG   . LEU A 1 106 ? -6.170  -7.980  -0.353  1.00 0.00 ?  319 LEU A HG   1  
ATOM 1589  H HD11 . LEU A 1 106 ? -8.598  -8.959  1.095   1.00 0.00 ?  319 LEU A HD11 1  
ATOM 1590  H HD12 . LEU A 1 106 ? -7.167  -9.848  0.520   1.00 0.00 ?  319 LEU A HD12 1  
ATOM 1591  H HD13 . LEU A 1 106 ? -7.058  -8.831  1.978   1.00 0.00 ?  319 LEU A HD13 1  
ATOM 1592  H HD21 . LEU A 1 106 ? -8.960  -8.169  -0.897  1.00 0.00 ?  319 LEU A HD21 1  
ATOM 1593  H HD22 . LEU A 1 106 ? -8.508  -6.447  -0.901  1.00 0.00 ?  319 LEU A HD22 1  
ATOM 1594  H HD23 . LEU A 1 106 ? -7.649  -7.596  -1.956  1.00 0.00 ?  319 LEU A HD23 1  
ATOM 1595  N N    . LEU A 1 107 ? -7.809  -3.569  0.789   1.00 0.00 ?  320 LEU A N    1  
ATOM 1596  C CA   . LEU A 1 107 ? -8.121  -2.338  0.083   1.00 0.00 ?  320 LEU A CA   1  
ATOM 1597  C C    . LEU A 1 107 ? -6.971  -1.994  -0.866  1.00 0.00 ?  320 LEU A C    1  
ATOM 1598  O O    . LEU A 1 107 ? -5.807  -2.016  -0.469  1.00 0.00 ?  320 LEU A O    1  
ATOM 1599  C CB   . LEU A 1 107 ? -8.456  -1.222  1.075   1.00 0.00 ?  320 LEU A CB   1  
ATOM 1600  C CG   . LEU A 1 107 ? -8.996  -1.671  2.434   1.00 0.00 ?  320 LEU A CG   1  
ATOM 1601  C CD1  . LEU A 1 107 ? -7.859  -1.854  3.442   1.00 0.00 ?  320 LEU A CD1  1  
ATOM 1602  C CD2  . LEU A 1 107 ? -10.066 -0.705  2.945   1.00 0.00 ?  320 LEU A CD2  1  
ATOM 1603  H H    . LEU A 1 107 ? -6.943  -3.562  1.289   1.00 0.00 ?  320 LEU A H    1  
ATOM 1604  H HA   . LEU A 1 107 ? -9.017  -2.521  -0.511  1.00 0.00 ?  320 LEU A HA   1  
ATOM 1605  H HB2  . LEU A 1 107 ? -7.556  -0.630  1.241   1.00 0.00 ?  320 LEU A HB2  1  
ATOM 1606  H HB3  . LEU A 1 107 ? -9.191  -0.562  0.614   1.00 0.00 ?  320 LEU A HB3  1  
ATOM 1607  H HG   . LEU A 1 107 ? -9.473  -2.643  2.308   1.00 0.00 ?  320 LEU A HG   1  
ATOM 1608  H HD11 . LEU A 1 107 ? -8.273  -2.159  4.404   1.00 0.00 ?  320 LEU A HD11 1  
ATOM 1609  H HD12 . LEU A 1 107 ? -7.173  -2.621  3.082   1.00 0.00 ?  320 LEU A HD12 1  
ATOM 1610  H HD13 . LEU A 1 107 ? -7.323  -0.913  3.559   1.00 0.00 ?  320 LEU A HD13 1  
ATOM 1611  H HD21 . LEU A 1 107 ? -9.652  -0.097  3.750   1.00 0.00 ?  320 LEU A HD21 1  
ATOM 1612  H HD22 . LEU A 1 107 ? -10.390 -0.058  2.130   1.00 0.00 ?  320 LEU A HD22 1  
ATOM 1613  H HD23 . LEU A 1 107 ? -10.918 -1.272  3.320   1.00 0.00 ?  320 LEU A HD23 1  
ATOM 1614  N N    . SER A 1 108 ? -7.338  -1.685  -2.101  1.00 0.00 ?  321 SER A N    1  
ATOM 1615  C CA   . SER A 1 108 ? -6.351  -1.337  -3.109  1.00 0.00 ?  321 SER A CA   1  
ATOM 1616  C C    . SER A 1 108 ? -6.101  0.172   -3.098  1.00 0.00 ?  321 SER A C    1  
ATOM 1617  O O    . SER A 1 108 ? -6.934  0.939   -2.616  1.00 0.00 ?  321 SER A O    1  
ATOM 1618  C CB   . SER A 1 108 ? -6.802  -1.790  -4.500  1.00 0.00 ?  321 SER A CB   1  
ATOM 1619  O OG   . SER A 1 108 ? -7.883  -1.004  -4.993  1.00 0.00 ?  321 SER A OG   1  
ATOM 1620  H H    . SER A 1 108 ? -8.287  -1.670  -2.415  1.00 0.00 ?  321 SER A H    1  
ATOM 1621  H HA   . SER A 1 108 ? -5.448  -1.877  -2.827  1.00 0.00 ?  321 SER A HA   1  
ATOM 1622  H HB2  . SER A 1 108 ? -5.962  -1.726  -5.191  1.00 0.00 ?  321 SER A HB2  1  
ATOM 1623  H HB3  . SER A 1 108 ? -7.103  -2.837  -4.460  1.00 0.00 ?  321 SER A HB3  1  
ATOM 1624  H HG   . SER A 1 108 ? -7.661  -0.032  -4.919  1.00 0.00 ?  321 SER A HG   1  
ATOM 1625  N N    . LEU A 1 109 ? -4.951  0.553   -3.633  1.00 0.00 ?  322 LEU A N    1  
ATOM 1626  C CA   . LEU A 1 109 ? -4.580  1.957   -3.691  1.00 0.00 ?  322 LEU A CA   1  
ATOM 1627  C C    . LEU A 1 109 ? -3.670  2.191   -4.898  1.00 0.00 ?  322 LEU A C    1  
ATOM 1628  O O    . LEU A 1 109 ? -2.494  1.831   -4.872  1.00 0.00 ?  322 LEU A O    1  
ATOM 1629  C CB   . LEU A 1 109 ? -3.967  2.404   -2.362  1.00 0.00 ?  322 LEU A CB   1  
ATOM 1630  C CG   . LEU A 1 109 ? -3.239  3.749   -2.378  1.00 0.00 ?  322 LEU A CG   1  
ATOM 1631  C CD1  . LEU A 1 109 ? -1.892  3.636   -3.095  1.00 0.00 ?  322 LEU A CD1  1  
ATOM 1632  C CD2  . LEU A 1 109 ? -4.121  4.842   -2.986  1.00 0.00 ?  322 LEU A CD2  1  
ATOM 1633  H H    . LEU A 1 109 ? -4.279  -0.078  -4.022  1.00 0.00 ?  322 LEU A H    1  
ATOM 1634  H HA   . LEU A 1 109 ? -5.496  2.531   -3.832  1.00 0.00 ?  322 LEU A HA   1  
ATOM 1635  H HB2  . LEU A 1 109 ? -4.760  2.451   -1.616  1.00 0.00 ?  322 LEU A HB2  1  
ATOM 1636  H HB3  . LEU A 1 109 ? -3.265  1.637   -2.033  1.00 0.00 ?  322 LEU A HB3  1  
ATOM 1637  H HG   . LEU A 1 109 ? -3.033  4.039   -1.348  1.00 0.00 ?  322 LEU A HG   1  
ATOM 1638  H HD11 . LEU A 1 109 ? -1.541  2.605   -3.046  1.00 0.00 ?  322 LEU A HD11 1  
ATOM 1639  H HD12 . LEU A 1 109 ? -2.009  3.931   -4.137  1.00 0.00 ?  322 LEU A HD12 1  
ATOM 1640  H HD13 . LEU A 1 109 ? -1.167  4.290   -2.611  1.00 0.00 ?  322 LEU A HD13 1  
ATOM 1641  H HD21 . LEU A 1 109 ? -5.131  4.759   -2.584  1.00 0.00 ?  322 LEU A HD21 1  
ATOM 1642  H HD22 . LEU A 1 109 ? -3.711  5.821   -2.737  1.00 0.00 ?  322 LEU A HD22 1  
ATOM 1643  H HD23 . LEU A 1 109 ? -4.150  4.725   -4.069  1.00 0.00 ?  322 LEU A HD23 1  
ATOM 1644  N N    . HIS A 1 110 ? -4.249  2.792   -5.927  1.00 0.00 ?  323 HIS A N    1  
ATOM 1645  C CA   . HIS A 1 110 ? -3.505  3.078   -7.141  1.00 0.00 ?  323 HIS A CA   1  
ATOM 1646  C C    . HIS A 1 110 ? -2.289  3.944   -6.806  1.00 0.00 ?  323 HIS A C    1  
ATOM 1647  O O    . HIS A 1 110 ? -2.412  4.950   -6.109  1.00 0.00 ?  323 HIS A O    1  
ATOM 1648  C CB   . HIS A 1 110 ? -4.412  3.713   -8.198  1.00 0.00 ?  323 HIS A CB   1  
ATOM 1649  C CG   . HIS A 1 110 ? -5.176  4.919   -7.706  1.00 0.00 ?  323 HIS A CG   1  
ATOM 1650  N ND1  . HIS A 1 110 ? -4.856  6.213   -8.078  1.00 0.00 ?  323 HIS A ND1  1  
ATOM 1651  C CD2  . HIS A 1 110 ? -6.250  5.013   -6.870  1.00 0.00 ?  323 HIS A CD2  1  
ATOM 1652  C CE1  . HIS A 1 110 ? -5.704  7.040   -7.485  1.00 0.00 ?  323 HIS A CE1  1  
ATOM 1653  N NE2  . HIS A 1 110 ? -6.567  6.295   -6.737  1.00 0.00 ?  323 HIS A NE2  1  
ATOM 1654  H H    . HIS A 1 110 ? -5.206  3.081   -5.940  1.00 0.00 ?  323 HIS A H    1  
ATOM 1655  H HA   . HIS A 1 110 ? -3.161  2.120   -7.531  1.00 0.00 ?  323 HIS A HA   1  
ATOM 1656  H HB2  . HIS A 1 110 ? -3.805  4.005   -9.055  1.00 0.00 ?  323 HIS A HB2  1  
ATOM 1657  H HB3  . HIS A 1 110 ? -5.121  2.964   -8.550  1.00 0.00 ?  323 HIS A HB3  1  
ATOM 1658  H HD1  . HIS A 1 110 ? -4.110  6.478   -8.689  1.00 0.00 ?  323 HIS A HD1  1  
ATOM 1659  H HD2  . HIS A 1 110 ? -6.761  4.177   -6.392  1.00 0.00 ?  323 HIS A HD2  1  
ATOM 1660  H HE1  . HIS A 1 110 ? -5.711  8.126   -7.580  1.00 0.00 ?  323 HIS A HE1  1  
ATOM 1661  H HE2  . HIS A 1 110 ? -7.350  6.650   -6.226  1.00 0.00 ?  323 HIS A HE2  1  
ATOM 1662  N N    . SER A 1 111 ? -1.142  3.522   -7.319  1.00 0.00 ?  324 SER A N    1  
ATOM 1663  C CA   . SER A 1 111 ? 0.095   4.247   -7.082  1.00 0.00 ?  324 SER A CA   1  
ATOM 1664  C C    . SER A 1 111 ? -0.032  5.681   -7.599  1.00 0.00 ?  324 SER A C    1  
ATOM 1665  O O    . SER A 1 111 ? 0.762   6.548   -7.237  1.00 0.00 ?  324 SER A O    1  
ATOM 1666  C CB   . SER A 1 111 ? 1.280   3.545   -7.749  1.00 0.00 ?  324 SER A CB   1  
ATOM 1667  O OG   . SER A 1 111 ? 2.523   4.146   -7.396  1.00 0.00 ?  324 SER A OG   1  
ATOM 1668  H H    . SER A 1 111 ? -1.051  2.703   -7.885  1.00 0.00 ?  324 SER A H    1  
ATOM 1669  H HA   . SER A 1 111 ? 0.231   4.241   -6.001  1.00 0.00 ?  324 SER A HA   1  
ATOM 1670  H HB2  . SER A 1 111 ? 1.290   2.495   -7.458  1.00 0.00 ?  324 SER A HB2  1  
ATOM 1671  H HB3  . SER A 1 111 ? 1.157   3.575   -8.831  1.00 0.00 ?  324 SER A HB3  1  
ATOM 1672  H HG   . SER A 1 111 ? 2.446   5.142   -7.440  1.00 0.00 ?  324 SER A HG   1  
ATOM 1673  N N    . ALA A 1 112 ? -1.036  5.888   -8.439  1.00 0.00 ?  325 ALA A N    1  
ATOM 1674  C CA   . ALA A 1 112 ? -1.277  7.202   -9.009  1.00 0.00 ?  325 ALA A CA   1  
ATOM 1675  C C    . ALA A 1 112 ? -1.706  8.164   -7.899  1.00 0.00 ?  325 ALA A C    1  
ATOM 1676  O O    . ALA A 1 112 ? -1.418  9.358   -7.963  1.00 0.00 ?  325 ALA A O    1  
ATOM 1677  C CB   . ALA A 1 112 ? -2.322  7.092   -10.121 1.00 0.00 ?  325 ALA A CB   1  
ATOM 1678  H H    . ALA A 1 112 ? -1.677  5.177   -8.729  1.00 0.00 ?  325 ALA A H    1  
ATOM 1679  H HA   . ALA A 1 112 ? -0.340  7.553   -9.441  1.00 0.00 ?  325 ALA A HA   1  
ATOM 1680  H HB1  . ALA A 1 112 ? -3.095  7.845   -9.969  1.00 0.00 ?  325 ALA A HB1  1  
ATOM 1681  H HB2  . ALA A 1 112 ? -1.843  7.255   -11.087 1.00 0.00 ?  325 ALA A HB2  1  
ATOM 1682  H HB3  . ALA A 1 112 ? -2.771  6.100   -10.101 1.00 0.00 ?  325 ALA A HB3  1  
ATOM 1683  N N    . ASP A 1 113 ? -2.387  7.608   -6.909  1.00 0.00 ?  326 ASP A N    1  
ATOM 1684  C CA   . ASP A 1 113 ? -2.858  8.402   -5.786  1.00 0.00 ?  326 ASP A CA   1  
ATOM 1685  C C    . ASP A 1 113 ? -1.657  8.928   -5.000  1.00 0.00 ?  326 ASP A C    1  
ATOM 1686  O O    . ASP A 1 113 ? -1.596  10.112  -4.670  1.00 0.00 ?  326 ASP A O    1  
ATOM 1687  C CB   . ASP A 1 113 ? -3.713  7.560   -4.837  1.00 0.00 ?  326 ASP A CB   1  
ATOM 1688  C CG   . ASP A 1 113 ? -4.463  8.355   -3.765  1.00 0.00 ?  326 ASP A CG   1  
ATOM 1689  O OD1  . ASP A 1 113 ? -5.244  9.267   -4.076  1.00 0.00 ?  326 ASP A OD1  1  
ATOM 1690  O OD2  . ASP A 1 113 ? -4.215  8.000   -2.550  1.00 0.00 -1 326 ASP A OD2  1  
ATOM 1691  H H    . ASP A 1 113 ? -2.618  6.636   -6.865  1.00 0.00 ?  326 ASP A H    1  
ATOM 1692  H HA   . ASP A 1 113 ? -3.450  9.203   -6.230  1.00 0.00 ?  326 ASP A HA   1  
ATOM 1693  H HB2  . ASP A 1 113 ? -4.439  6.999   -5.426  1.00 0.00 ?  326 ASP A HB2  1  
ATOM 1694  H HB3  . ASP A 1 113 ? -3.071  6.831   -4.344  1.00 0.00 ?  326 ASP A HB3  1  
ATOM 1695  H HD2  . ASP A 1 113 ? -3.966  8.799   -2.004  1.00 0.00 ?  326 ASP A HD2  1  
ATOM 1696  N N    . PHE A 1 114 ? -0.729  8.024   -4.722  1.00 0.00 ?  327 PHE A N    1  
ATOM 1697  C CA   . PHE A 1 114 ? 0.467   8.382   -3.980  1.00 0.00 ?  327 PHE A CA   1  
ATOM 1698  C C    . PHE A 1 114 ? 1.334   9.360   -4.776  1.00 0.00 ?  327 PHE A C    1  
ATOM 1699  O O    . PHE A 1 114 ? 1.957   10.252  -4.202  1.00 0.00 ?  327 PHE A O    1  
ATOM 1700  C CB   . PHE A 1 114 ? 1.256   7.091   -3.751  1.00 0.00 ?  327 PHE A CB   1  
ATOM 1701  C CG   . PHE A 1 114 ? 2.720   7.315   -3.370  1.00 0.00 ?  327 PHE A CG   1  
ATOM 1702  C CD1  . PHE A 1 114 ? 3.061   8.353   -2.560  1.00 0.00 ?  327 PHE A CD1  1  
ATOM 1703  C CD2  . PHE A 1 114 ? 3.682   6.476   -3.842  1.00 0.00 ?  327 PHE A CD2  1  
ATOM 1704  C CE1  . PHE A 1 114 ? 4.421   8.561   -2.207  1.00 0.00 ?  327 PHE A CE1  1  
ATOM 1705  C CE2  . PHE A 1 114 ? 5.041   6.684   -3.489  1.00 0.00 ?  327 PHE A CE2  1  
ATOM 1706  C CZ   . PHE A 1 114 ? 5.382   7.722   -2.679  1.00 0.00 ?  327 PHE A CZ   1  
ATOM 1707  H H    . PHE A 1 114 ? -0.786  7.063   -4.993  1.00 0.00 ?  327 PHE A H    1  
ATOM 1708  H HA   . PHE A 1 114 ? 0.144   8.857   -3.054  1.00 0.00 ?  327 PHE A HA   1  
ATOM 1709  H HB2  . PHE A 1 114 ? 0.770   6.516   -2.962  1.00 0.00 ?  327 PHE A HB2  1  
ATOM 1710  H HB3  . PHE A 1 114 ? 1.215   6.487   -4.657  1.00 0.00 ?  327 PHE A HB3  1  
ATOM 1711  H HD1  . PHE A 1 114 ? 2.291   9.025   -2.182  1.00 0.00 ?  327 PHE A HD1  1  
ATOM 1712  H HD2  . PHE A 1 114 ? 3.408   5.645   -4.491  1.00 0.00 ?  327 PHE A HD2  1  
ATOM 1713  H HE1  . PHE A 1 114 ? 4.694   9.393   -1.558  1.00 0.00 ?  327 PHE A HE1  1  
ATOM 1714  H HE2  . PHE A 1 114 ? 5.811   6.012   -3.866  1.00 0.00 ?  327 PHE A HE2  1  
ATOM 1715  H HZ   . PHE A 1 114 ? 6.426   7.882   -2.407  1.00 0.00 ?  327 PHE A HZ   1  
ATOM 1716  N N    . GLN A 1 115 ? 1.345   9.160   -6.086  1.00 0.00 ?  328 GLN A N    1  
ATOM 1717  C CA   . GLN A 1 115 ? 2.125   10.013  -6.966  1.00 0.00 ?  328 GLN A CA   1  
ATOM 1718  C C    . GLN A 1 115 ? 1.491   11.402  -7.057  1.00 0.00 ?  328 GLN A C    1  
ATOM 1719  O O    . GLN A 1 115 ? 2.193   12.400  -7.213  1.00 0.00 ?  328 GLN A O    1  
ATOM 1720  C CB   . GLN A 1 115 ? 2.268   9.383   -8.354  1.00 0.00 ?  328 GLN A CB   1  
ATOM 1721  C CG   . GLN A 1 115 ? 3.189   8.163   -8.310  1.00 0.00 ?  328 GLN A CG   1  
ATOM 1722  C CD   . GLN A 1 115 ? 3.420   7.599   -9.714  1.00 0.00 ?  328 GLN A CD   1  
ATOM 1723  O OE1  . GLN A 1 115 ? 4.073   8.198   -10.552 1.00 0.00 ?  328 GLN A OE1  1  
ATOM 1724  N NE2  . GLN A 1 115 ? 2.847   6.417   -9.922  1.00 0.00 ?  328 GLN A NE2  1  
ATOM 1725  H H    . GLN A 1 115 ? 0.835   8.432   -6.544  1.00 0.00 ?  328 GLN A H    1  
ATOM 1726  H HA   . GLN A 1 115 ? 3.109   10.084  -6.504  1.00 0.00 ?  328 GLN A HA   1  
ATOM 1727  H HB2  . GLN A 1 115 ? 1.286   9.089   -8.726  1.00 0.00 ?  328 GLN A HB2  1  
ATOM 1728  H HB3  . GLN A 1 115 ? 2.666   10.120  -9.052  1.00 0.00 ?  328 GLN A HB3  1  
ATOM 1729  H HG2  . GLN A 1 115 ? 4.144   8.440   -7.864  1.00 0.00 ?  328 GLN A HG2  1  
ATOM 1730  H HG3  . GLN A 1 115 ? 2.751   7.394   -7.673  1.00 0.00 ?  328 GLN A HG3  1  
ATOM 1731  H HE21 . GLN A 1 115 ? 2.324   5.979   -9.192  1.00 0.00 ?  328 GLN A HE21 1  
ATOM 1732  H HE22 . GLN A 1 115 ? 2.941   5.966   -10.810 1.00 0.00 ?  328 GLN A HE22 1  
ATOM 1733  N N    . MET A 1 116 ? 0.170   11.423  -6.957  1.00 0.00 ?  329 MET A N    1  
ATOM 1734  C CA   . MET A 1 116 ? -0.566  12.674  -7.026  1.00 0.00 ?  329 MET A CA   1  
ATOM 1735  C C    . MET A 1 116 ? -0.288  13.542  -5.797  1.00 0.00 ?  329 MET A C    1  
ATOM 1736  O O    . MET A 1 116 ? -0.060  14.744  -5.921  1.00 0.00 ?  329 MET A O    1  
ATOM 1737  C CB   . MET A 1 116 ? -2.065  12.380  -7.114  1.00 0.00 ?  329 MET A CB   1  
ATOM 1738  C CG   . MET A 1 116 ? -2.881  13.674  -7.080  1.00 0.00 ?  329 MET A CG   1  
ATOM 1739  S SD   . MET A 1 116 ? -3.215  14.139  -5.389  1.00 0.00 ?  329 MET A SD   1  
ATOM 1740  C CE   . MET A 1 116 ? -4.579  13.046  -5.030  1.00 0.00 ?  329 MET A CE   1  
ATOM 1741  H H    . MET A 1 116 ? -0.394  10.607  -6.830  1.00 0.00 ?  329 MET A H    1  
ATOM 1742  H HA   . MET A 1 116 ? -0.206  13.176  -7.923  1.00 0.00 ?  329 MET A HA   1  
ATOM 1743  H HB2  . MET A 1 116 ? -2.279  11.835  -8.034  1.00 0.00 ?  329 MET A HB2  1  
ATOM 1744  H HB3  . MET A 1 116 ? -2.363  11.736  -6.287  1.00 0.00 ?  329 MET A HB3  1  
ATOM 1745  H HG2  . MET A 1 116 ? -2.335  14.471  -7.584  1.00 0.00 ?  329 MET A HG2  1  
ATOM 1746  H HG3  . MET A 1 116 ? -3.817  13.538  -7.620  1.00 0.00 ?  329 MET A HG3  1  
ATOM 1747  H HE1  . MET A 1 116 ? -4.955  13.250  -4.028  1.00 0.00 ?  329 MET A HE1  1  
ATOM 1748  H HE2  . MET A 1 116 ? -5.375  13.207  -5.757  1.00 0.00 ?  329 MET A HE2  1  
ATOM 1749  H HE3  . MET A 1 116 ? -4.240  12.011  -5.087  1.00 0.00 ?  329 MET A HE3  1  
ATOM 1750  N N    . LEU A 1 117 ? -0.316  12.899  -4.639  1.00 0.00 ?  330 LEU A N    1  
ATOM 1751  C CA   . LEU A 1 117 ? -0.069  13.597  -3.389  1.00 0.00 ?  330 LEU A CA   1  
ATOM 1752  C C    . LEU A 1 117 ? 1.423   13.914  -3.272  1.00 0.00 ?  330 LEU A C    1  
ATOM 1753  O O    . LEU A 1 117 ? 1.803   14.924  -2.681  1.00 0.00 ?  330 LEU A O    1  
ATOM 1754  C CB   . LEU A 1 117 ? -0.622  12.795  -2.209  1.00 0.00 ?  330 LEU A CB   1  
ATOM 1755  C CG   . LEU A 1 117 ? -2.088  12.373  -2.313  1.00 0.00 ?  330 LEU A CG   1  
ATOM 1756  C CD1  . LEU A 1 117 ? -2.297  10.969  -1.741  1.00 0.00 ?  330 LEU A CD1  1  
ATOM 1757  C CD2  . LEU A 1 117 ? -3.005  13.403  -1.651  1.00 0.00 ?  330 LEU A CD2  1  
ATOM 1758  H H    . LEU A 1 117 ? -0.502  11.921  -4.547  1.00 0.00 ?  330 LEU A H    1  
ATOM 1759  H HA   . LEU A 1 117 ? -0.620  14.537  -3.426  1.00 0.00 ?  330 LEU A HA   1  
ATOM 1760  H HB2  . LEU A 1 117 ? -0.013  11.899  -2.088  1.00 0.00 ?  330 LEU A HB2  1  
ATOM 1761  H HB3  . LEU A 1 117 ? -0.499  13.389  -1.303  1.00 0.00 ?  330 LEU A HB3  1  
ATOM 1762  H HG   . LEU A 1 117 ? -2.358  12.333  -3.368  1.00 0.00 ?  330 LEU A HG   1  
ATOM 1763  H HD11 . LEU A 1 117 ? -1.549  10.776  -0.971  1.00 0.00 ?  330 LEU A HD11 1  
ATOM 1764  H HD12 . LEU A 1 117 ? -3.293  10.898  -1.306  1.00 0.00 ?  330 LEU A HD12 1  
ATOM 1765  H HD13 . LEU A 1 117 ? -2.195  10.233  -2.538  1.00 0.00 ?  330 LEU A HD13 1  
ATOM 1766  H HD21 . LEU A 1 117 ? -4.002  12.980  -1.531  1.00 0.00 ?  330 LEU A HD21 1  
ATOM 1767  H HD22 . LEU A 1 117 ? -2.604  13.671  -0.673  1.00 0.00 ?  330 LEU A HD22 1  
ATOM 1768  H HD23 . LEU A 1 117 ? -3.061  14.294  -2.276  1.00 0.00 ?  330 LEU A HD23 1  
ATOM 1769  N N    . CYS A 1 118 ? 2.229   13.033  -3.846  1.00 0.00 ?  331 CYS A N    1  
ATOM 1770  C CA   . CYS A 1 118 ? 3.671   13.206  -3.814  1.00 0.00 ?  331 CYS A CA   1  
ATOM 1771  C C    . CYS A 1 118 ? 4.033   14.393  -4.709  1.00 0.00 ?  331 CYS A C    1  
ATOM 1772  O O    . CYS A 1 118 ? 4.927   15.172  -4.383  1.00 0.00 ?  331 CYS A O    1  
ATOM 1773  C CB   . CYS A 1 118 ? 4.404   11.930  -4.234  1.00 0.00 ?  331 CYS A CB   1  
ATOM 1774  S SG   . CYS A 1 118 ? 6.197   12.260  -4.391  1.00 0.00 ?  331 CYS A SG   1  
ATOM 1775  H H    . CYS A 1 118 ? 1.912   12.214  -4.325  1.00 0.00 ?  331 CYS A H    1  
ATOM 1776  H HA   . CYS A 1 118 ? 3.939   13.408  -2.777  1.00 0.00 ?  331 CYS A HA   1  
ATOM 1777  H HB2  . CYS A 1 118 ? 4.233   11.144  -3.498  1.00 0.00 ?  331 CYS A HB2  1  
ATOM 1778  H HB3  . CYS A 1 118 ? 4.008   11.569  -5.183  1.00 0.00 ?  331 CYS A HB3  1  
ATOM 1779  H HG   . CYS A 1 118 ? 6.217   13.310  -3.574  1.00 0.00 ?  331 CYS A HG   1  
ATOM 1780  N N    . SER A 1 119 ? 3.319   14.493  -5.821  1.00 0.00 ?  332 SER A N    1  
ATOM 1781  C CA   . SER A 1 119 ? 3.554   15.571  -6.766  1.00 0.00 ?  332 SER A CA   1  
ATOM 1782  C C    . SER A 1 119 ? 2.939   16.870  -6.241  1.00 0.00 ?  332 SER A C    1  
ATOM 1783  O O    . SER A 1 119 ? 3.425   17.958  -6.545  1.00 0.00 ?  332 SER A O    1  
ATOM 1784  C CB   . SER A 1 119 ? 2.980   15.231  -8.143  1.00 0.00 ?  332 SER A CB   1  
ATOM 1785  O OG   . SER A 1 119 ? 3.420   16.144  -9.145  1.00 0.00 ?  332 SER A OG   1  
ATOM 1786  H H    . SER A 1 119 ? 2.594   13.855  -6.079  1.00 0.00 ?  332 SER A H    1  
ATOM 1787  H HA   . SER A 1 119 ? 4.637   15.662  -6.837  1.00 0.00 ?  332 SER A HA   1  
ATOM 1788  H HB2  . SER A 1 119 ? 3.276   14.219  -8.420  1.00 0.00 ?  332 SER A HB2  1  
ATOM 1789  H HB3  . SER A 1 119 ? 1.891   15.243  -8.095  1.00 0.00 ?  332 SER A HB3  1  
ATOM 1790  H HG   . SER A 1 119 ? 3.900   16.912  -8.721  1.00 0.00 ?  332 SER A HG   1  
ATOM 1791  N N    . SER A 1 120 ? 1.879   16.713  -5.462  1.00 0.00 ?  333 SER A N    1  
ATOM 1792  C CA   . SER A 1 120 ? 1.192   17.860  -4.892  1.00 0.00 ?  333 SER A CA   1  
ATOM 1793  C C    . SER A 1 120 ? 2.060   18.504  -3.809  1.00 0.00 ?  333 SER A C    1  
ATOM 1794  O O    . SER A 1 120 ? 2.106   19.727  -3.691  1.00 0.00 ?  333 SER A O    1  
ATOM 1795  C CB   . SER A 1 120 ? -0.166  17.457  -4.314  1.00 0.00 ?  333 SER A CB   1  
ATOM 1796  O OG   . SER A 1 120 ? -1.248  17.961  -5.092  1.00 0.00 ?  333 SER A OG   1  
ATOM 1797  H H    . SER A 1 120 ? 1.489   15.824  -5.220  1.00 0.00 ?  333 SER A H    1  
ATOM 1798  H HA   . SER A 1 120 ? 1.043   18.549  -5.723  1.00 0.00 ?  333 SER A HA   1  
ATOM 1799  H HB2  . SER A 1 120 ? -0.231  16.370  -4.263  1.00 0.00 ?  333 SER A HB2  1  
ATOM 1800  H HB3  . SER A 1 120 ? -0.250  17.829  -3.293  1.00 0.00 ?  333 SER A HB3  1  
ATOM 1801  H HG   . SER A 1 120 ? -1.181  17.622  -6.031  1.00 0.00 ?  333 SER A HG   1  
ATOM 1802  N N    . SER A 1 121 ? 2.728   17.651  -3.046  1.00 0.00 ?  334 SER A N    1  
ATOM 1803  C CA   . SER A 1 121 ? 3.592   18.121  -1.976  1.00 0.00 ?  334 SER A CA   1  
ATOM 1804  C C    . SER A 1 121 ? 5.052   17.808  -2.307  1.00 0.00 ?  334 SER A C    1  
ATOM 1805  O O    . SER A 1 121 ? 5.404   16.655  -2.552  1.00 0.00 ?  334 SER A O    1  
ATOM 1806  C CB   . SER A 1 121 ? 3.204   17.491  -0.637  1.00 0.00 ?  334 SER A CB   1  
ATOM 1807  O OG   . SER A 1 121 ? 3.106   18.462  0.401   1.00 0.00 ?  334 SER A OG   1  
ATOM 1808  H H    . SER A 1 121 ? 2.686   16.657  -3.148  1.00 0.00 ?  334 SER A H    1  
ATOM 1809  H HA   . SER A 1 121 ? 3.433   19.199  -1.930  1.00 0.00 ?  334 SER A HA   1  
ATOM 1810  H HB2  . SER A 1 121 ? 2.250   16.975  -0.742  1.00 0.00 ?  334 SER A HB2  1  
ATOM 1811  H HB3  . SER A 1 121 ? 3.944   16.740  -0.362  1.00 0.00 ?  334 SER A HB3  1  
ATOM 1812  H HG   . SER A 1 121 ? 2.256   18.332  0.911   1.00 0.00 ?  334 SER A HG   1  
ATOM 1813  N N    . PRO A 1 122 ? 5.886   18.882  -2.304  1.00 0.00 ?  335 PRO A N    1  
ATOM 1814  C CA   . PRO A 1 122 ? 7.301   18.733  -2.601  1.00 0.00 ?  335 PRO A CA   1  
ATOM 1815  C C    . PRO A 1 122 ? 8.046   18.108  -1.420  1.00 0.00 ?  335 PRO A C    1  
ATOM 1816  O O    . PRO A 1 122 ? 9.065   17.445  -1.605  1.00 0.00 ?  335 PRO A O    1  
ATOM 1817  C CB   . PRO A 1 122 ? 7.783   20.136  -2.932  1.00 0.00 ?  335 PRO A CB   1  
ATOM 1818  C CG   . PRO A 1 122 ? 6.740   21.082  -2.360  1.00 0.00 ?  335 PRO A CG   1  
ATOM 1819  C CD   . PRO A 1 122 ? 5.505   20.263  -2.019  1.00 0.00 ?  335 PRO A CD   1  
ATOM 1820  H HA   . PRO A 1 122 ? 7.430   18.106  -3.369  1.00 0.00 ?  335 PRO A HA   1  
ATOM 1821  H HB2  . PRO A 1 122 ? 8.763   20.325  -2.495  1.00 0.00 ?  335 PRO A HB2  1  
ATOM 1822  H HB3  . PRO A 1 122 ? 7.883   20.270  -4.009  1.00 0.00 ?  335 PRO A HB3  1  
ATOM 1823  H HG2  . PRO A 1 122 ? 7.124   21.581  -1.471  1.00 0.00 ?  335 PRO A HG2  1  
ATOM 1824  H HG3  . PRO A 1 122 ? 6.493   21.860  -3.082  1.00 0.00 ?  335 PRO A HG3  1  
ATOM 1825  H HD2  . PRO A 1 122 ? 5.224   20.388  -0.973  1.00 0.00 ?  335 PRO A HD2  1  
ATOM 1826  H HD3  . PRO A 1 122 ? 4.649   20.569  -2.619  1.00 0.00 ?  335 PRO A HD3  1  
ATOM 1827  N N    . GLU A 1 123 ? 7.508   18.341  -0.232  1.00 0.00 ?  336 GLU A N    1  
ATOM 1828  C CA   . GLU A 1 123 ? 8.109   17.809  0.979   1.00 0.00 ?  336 GLU A CA   1  
ATOM 1829  C C    . GLU A 1 123 ? 7.961   16.287  1.021   1.00 0.00 ?  336 GLU A C    1  
ATOM 1830  O O    . GLU A 1 123 ? 8.825   15.590  1.551   1.00 0.00 ?  336 GLU A O    1  
ATOM 1831  C CB   . GLU A 1 123 ? 7.497   18.454  2.224   1.00 0.00 ?  336 GLU A CB   1  
ATOM 1832  C CG   . GLU A 1 123 ? 8.432   18.320  3.428   1.00 0.00 ?  336 GLU A CG   1  
ATOM 1833  C CD   . GLU A 1 123 ? 9.018   19.677  3.821   1.00 0.00 ?  336 GLU A CD   1  
ATOM 1834  O OE1  . GLU A 1 123 ? 8.324   20.494  4.445   1.00 0.00 ?  336 GLU A OE1  1  
ATOM 1835  O OE2  . GLU A 1 123 ? 10.240  19.870  3.457   1.00 0.00 -1 336 GLU A OE2  1  
ATOM 1836  H H    . GLU A 1 123 ? 6.678   18.881  -0.090  1.00 0.00 ?  336 GLU A H    1  
ATOM 1837  H HA   . GLU A 1 123 ? 9.164   18.077  0.921   1.00 0.00 ?  336 GLU A HA   1  
ATOM 1838  H HB2  . GLU A 1 123 ? 7.296   19.508  2.031   1.00 0.00 ?  336 GLU A HB2  1  
ATOM 1839  H HB3  . GLU A 1 123 ? 6.539   17.983  2.449   1.00 0.00 ?  336 GLU A HB3  1  
ATOM 1840  H HG2  . GLU A 1 123 ? 7.886   17.896  4.271   1.00 0.00 ?  336 GLU A HG2  1  
ATOM 1841  H HG3  . GLU A 1 123 ? 9.239   17.626  3.190   1.00 0.00 ?  336 GLU A HG3  1  
ATOM 1842  H HE2  . GLU A 1 123 ? 10.534  20.788  3.720   1.00 0.00 ?  336 GLU A HE2  1  
ATOM 1843  N N    . ILE A 1 124 ? 6.859   15.816  0.456   1.00 0.00 ?  337 ILE A N    1  
ATOM 1844  C CA   . ILE A 1 124 ? 6.587   14.389  0.422   1.00 0.00 ?  337 ILE A CA   1  
ATOM 1845  C C    . ILE A 1 124 ? 7.478   13.729  -0.632  1.00 0.00 ?  337 ILE A C    1  
ATOM 1846  O O    . ILE A 1 124 ? 7.890   12.581  -0.472  1.00 0.00 ?  337 ILE A O    1  
ATOM 1847  C CB   . ILE A 1 124 ? 5.093   14.133  0.211   1.00 0.00 ?  337 ILE A CB   1  
ATOM 1848  C CG1  . ILE A 1 124 ? 4.291   14.520  1.456   1.00 0.00 ?  337 ILE A CG1  1  
ATOM 1849  C CG2  . ILE A 1 124 ? 4.839   12.684  -0.207  1.00 0.00 ?  337 ILE A CG2  1  
ATOM 1850  C CD1  . ILE A 1 124 ? 2.788   14.392  1.200   1.00 0.00 ?  337 ILE A CD1  1  
ATOM 1851  H H    . ILE A 1 124 ? 6.161   16.389  0.027   1.00 0.00 ?  337 ILE A H    1  
ATOM 1852  H HA   . ILE A 1 124 ? 6.849   13.983  1.399   1.00 0.00 ?  337 ILE A HA   1  
ATOM 1853  H HB   . ILE A 1 124 ? 4.750   14.769  -0.604  1.00 0.00 ?  337 ILE A HB   1  
ATOM 1854  H HG12 . ILE A 1 124 ? 4.577   13.880  2.290   1.00 0.00 ?  337 ILE A HG12 1  
ATOM 1855  H HG13 . ILE A 1 124 ? 4.529   15.544  1.742   1.00 0.00 ?  337 ILE A HG13 1  
ATOM 1856  H HG21 . ILE A 1 124 ? 3.798   12.571  -0.512  1.00 0.00 ?  337 ILE A HG21 1  
ATOM 1857  H HG22 . ILE A 1 124 ? 5.491   12.427  -1.042  1.00 0.00 ?  337 ILE A HG22 1  
ATOM 1858  H HG23 . ILE A 1 124 ? 5.046   12.021  0.633   1.00 0.00 ?  337 ILE A HG23 1  
ATOM 1859  H HD11 . ILE A 1 124 ? 2.240   14.691  2.093   1.00 0.00 ?  337 ILE A HD11 1  
ATOM 1860  H HD12 . ILE A 1 124 ? 2.505   15.037  0.368   1.00 0.00 ?  337 ILE A HD12 1  
ATOM 1861  H HD13 . ILE A 1 124 ? 2.547   13.357  0.955   1.00 0.00 ?  337 ILE A HD13 1  
ATOM 1862  N N    . ALA A 1 125 ? 7.750   14.483  -1.688  1.00 0.00 ?  338 ALA A N    1  
ATOM 1863  C CA   . ALA A 1 125 ? 8.584   13.986  -2.768  1.00 0.00 ?  338 ALA A CA   1  
ATOM 1864  C C    . ALA A 1 125 ? 10.042  13.944  -2.303  1.00 0.00 ?  338 ALA A C    1  
ATOM 1865  O O    . ALA A 1 125 ? 10.795  13.053  -2.691  1.00 0.00 ?  338 ALA A O    1  
ATOM 1866  C CB   . ALA A 1 125 ? 8.392   14.863  -4.007  1.00 0.00 ?  338 ALA A CB   1  
ATOM 1867  H H    . ALA A 1 125 ? 7.411   15.416  -1.810  1.00 0.00 ?  338 ALA A H    1  
ATOM 1868  H HA   . ALA A 1 125 ? 8.257   12.973  -3.001  1.00 0.00 ?  338 ALA A HA   1  
ATOM 1869  H HB1  . ALA A 1 125 ? 8.177   15.886  -3.698  1.00 0.00 ?  338 ALA A HB1  1  
ATOM 1870  H HB2  . ALA A 1 125 ? 9.302   14.848  -4.607  1.00 0.00 ?  338 ALA A HB2  1  
ATOM 1871  H HB3  . ALA A 1 125 ? 7.561   14.479  -4.598  1.00 0.00 ?  338 ALA A HB3  1  
ATOM 1872  N N    . GLU A 1 126 ? 10.395  14.920  -1.479  1.00 0.00 ?  339 GLU A N    1  
ATOM 1873  C CA   . GLU A 1 126 ? 11.748  15.006  -0.958  1.00 0.00 ?  339 GLU A CA   1  
ATOM 1874  C C    . GLU A 1 126 ? 11.977  13.930  0.105   1.00 0.00 ?  339 GLU A C    1  
ATOM 1875  O O    . GLU A 1 126 ? 13.020  13.279  0.120   1.00 0.00 ?  339 GLU A O    1  
ATOM 1876  C CB   . GLU A 1 126 ? 12.031  16.401  -0.396  1.00 0.00 ?  339 GLU A CB   1  
ATOM 1877  C CG   . GLU A 1 126 ? 12.184  17.425  -1.523  1.00 0.00 ?  339 GLU A CG   1  
ATOM 1878  C CD   . GLU A 1 126 ? 13.215  16.958  -2.552  1.00 0.00 ?  339 GLU A CD   1  
ATOM 1879  O OE1  . GLU A 1 126 ? 14.409  17.266  -2.417  1.00 0.00 ?  339 GLU A OE1  1  
ATOM 1880  O OE2  . GLU A 1 126 ? 12.738  16.251  -3.519  1.00 0.00 -1 339 GLU A OE2  1  
ATOM 1881  H H    . GLU A 1 126 ? 9.775   15.641  -1.169  1.00 0.00 ?  339 GLU A H    1  
ATOM 1882  H HA   . GLU A 1 126 ? 12.400  14.826  -1.813  1.00 0.00 ?  339 GLU A HA   1  
ATOM 1883  H HB2  . GLU A 1 126 ? 11.220  16.702  0.266   1.00 0.00 ?  339 GLU A HB2  1  
ATOM 1884  H HB3  . GLU A 1 126 ? 12.941  16.377  0.204   1.00 0.00 ?  339 GLU A HB3  1  
ATOM 1885  H HG2  . GLU A 1 126 ? 11.222  17.580  -2.011  1.00 0.00 ?  339 GLU A HG2  1  
ATOM 1886  H HG3  . GLU A 1 126 ? 12.489  18.385  -1.107  1.00 0.00 ?  339 GLU A HG3  1  
ATOM 1887  H HE2  . GLU A 1 126 ? 11.994  16.744  -3.970  1.00 0.00 ?  339 GLU A HE2  1  
ATOM 1888  N N    . ILE A 1 127 ? 10.984  13.777  0.969   1.00 0.00 ?  340 ILE A N    1  
ATOM 1889  C CA   . ILE A 1 127 ? 11.064  12.790  2.033   1.00 0.00 ?  340 ILE A CA   1  
ATOM 1890  C C    . ILE A 1 127 ? 10.932  11.389  1.435   1.00 0.00 ?  340 ILE A C    1  
ATOM 1891  O O    . ILE A 1 127 ? 11.601  10.456  1.876   1.00 0.00 ?  340 ILE A O    1  
ATOM 1892  C CB   . ILE A 1 127 ? 10.033  13.093  3.123   1.00 0.00 ?  340 ILE A CB   1  
ATOM 1893  C CG1  . ILE A 1 127 ? 10.330  14.431  3.802   1.00 0.00 ?  340 ILE A CG1  1  
ATOM 1894  C CG2  . ILE A 1 127 ? 9.948   11.945  4.131   1.00 0.00 ?  340 ILE A CG2  1  
ATOM 1895  C CD1  . ILE A 1 127 ? 9.189   14.837  4.737   1.00 0.00 ?  340 ILE A CD1  1  
ATOM 1896  H H    . ILE A 1 127 ? 10.139  14.311  0.951   1.00 0.00 ?  340 ILE A H    1  
ATOM 1897  H HA   . ILE A 1 127 ? 12.050  12.880  2.489   1.00 0.00 ?  340 ILE A HA   1  
ATOM 1898  H HB   . ILE A 1 127 ? 9.054   13.181  2.652   1.00 0.00 ?  340 ILE A HB   1  
ATOM 1899  H HG12 . ILE A 1 127 ? 11.260  14.358  4.367   1.00 0.00 ?  340 ILE A HG12 1  
ATOM 1900  H HG13 . ILE A 1 127 ? 10.477  15.203  3.046   1.00 0.00 ?  340 ILE A HG13 1  
ATOM 1901  H HG21 . ILE A 1 127 ? 10.831  11.957  4.770   1.00 0.00 ?  340 ILE A HG21 1  
ATOM 1902  H HG22 . ILE A 1 127 ? 9.054   12.066  4.744   1.00 0.00 ?  340 ILE A HG22 1  
ATOM 1903  H HG23 . ILE A 1 127 ? 9.898   10.996  3.597   1.00 0.00 ?  340 ILE A HG23 1  
ATOM 1904  H HD11 . ILE A 1 127 ? 8.234   14.662  4.242   1.00 0.00 ?  340 ILE A HD11 1  
ATOM 1905  H HD12 . ILE A 1 127 ? 9.240   14.244  5.650   1.00 0.00 ?  340 ILE A HD12 1  
ATOM 1906  H HD13 . ILE A 1 127 ? 9.281   15.895  4.985   1.00 0.00 ?  340 ILE A HD13 1  
ATOM 1907  N N    . PHE A 1 128 ? 10.065  11.285  0.438   1.00 0.00 ?  341 PHE A N    1  
ATOM 1908  C CA   . PHE A 1 128 ? 9.837   10.013  -0.226  1.00 0.00 ?  341 PHE A CA   1  
ATOM 1909  C C    . PHE A 1 128 ? 11.079  9.567   -1.000  1.00 0.00 ?  341 PHE A C    1  
ATOM 1910  O O    . PHE A 1 128 ? 11.415  8.384   -1.014  1.00 0.00 ?  341 PHE A O    1  
ATOM 1911  C CB   . PHE A 1 128 ? 8.685   10.222  -1.211  1.00 0.00 ?  341 PHE A CB   1  
ATOM 1912  C CG   . PHE A 1 128 ? 8.468   9.053   -2.173  1.00 0.00 ?  341 PHE A CG   1  
ATOM 1913  C CD1  . PHE A 1 128 ? 8.682   7.777   -1.752  1.00 0.00 ?  341 PHE A CD1  1  
ATOM 1914  C CD2  . PHE A 1 128 ? 8.060   9.288   -3.449  1.00 0.00 ?  341 PHE A CD2  1  
ATOM 1915  C CE1  . PHE A 1 128 ? 8.481   6.692   -2.645  1.00 0.00 ?  341 PHE A CE1  1  
ATOM 1916  C CE2  . PHE A 1 128 ? 7.859   8.202   -4.342  1.00 0.00 ?  341 PHE A CE2  1  
ATOM 1917  C CZ   . PHE A 1 128 ? 8.073   6.927   -3.921  1.00 0.00 ?  341 PHE A CZ   1  
ATOM 1918  H H    . PHE A 1 128 ? 9.525   12.049  0.085   1.00 0.00 ?  341 PHE A H    1  
ATOM 1919  H HA   . PHE A 1 128 ? 9.611   9.280   0.548   1.00 0.00 ?  341 PHE A HA   1  
ATOM 1920  H HB2  . PHE A 1 128 ? 7.766   10.393  -0.649  1.00 0.00 ?  341 PHE A HB2  1  
ATOM 1921  H HB3  . PHE A 1 128 ? 8.876   11.125  -1.791  1.00 0.00 ?  341 PHE A HB3  1  
ATOM 1922  H HD1  . PHE A 1 128 ? 9.009   7.588   -0.729  1.00 0.00 ?  341 PHE A HD1  1  
ATOM 1923  H HD2  . PHE A 1 128 ? 7.888   10.310  -3.786  1.00 0.00 ?  341 PHE A HD2  1  
ATOM 1924  H HE1  . PHE A 1 128 ? 8.653   5.670   -2.307  1.00 0.00 ?  341 PHE A HE1  1  
ATOM 1925  H HE2  . PHE A 1 128 ? 7.532   8.391   -5.364  1.00 0.00 ?  341 PHE A HE2  1  
ATOM 1926  H HZ   . PHE A 1 128 ? 7.919   6.094   -4.606  1.00 0.00 ?  341 PHE A HZ   1  
ATOM 1927  N N    . ARG A 1 129 ? 11.728  10.539  -1.624  1.00 0.00 ?  342 ARG A N    1  
ATOM 1928  C CA   . ARG A 1 129 ? 12.926  10.262  -2.398  1.00 0.00 ?  342 ARG A CA   1  
ATOM 1929  C C    . ARG A 1 129 ? 14.095  9.935   -1.468  1.00 0.00 ?  342 ARG A C    1  
ATOM 1930  O O    . ARG A 1 129 ? 14.935  9.097   -1.792  1.00 0.00 ?  342 ARG A O    1  
ATOM 1931  C CB   . ARG A 1 129 ? 13.302  11.457  -3.278  1.00 0.00 ?  342 ARG A CB   1  
ATOM 1932  C CG   . ARG A 1 129 ? 14.630  11.212  -3.997  1.00 0.00 ?  342 ARG A CG   1  
ATOM 1933  C CD   . ARG A 1 129 ? 14.613  11.816  -5.402  1.00 0.00 ?  342 ARG A CD   1  
ATOM 1934  N NE   . ARG A 1 129 ? 15.507  12.994  -5.458  1.00 0.00 ?  342 ARG A NE   1  
ATOM 1935  C CZ   . ARG A 1 129 ? 15.776  13.680  -6.577  1.00 0.00 ?  342 ARG A CZ   1  
ATOM 1936  N NH1  . ARG A 1 129 ? 15.222  13.310  -7.740  1.00 0.00 ?  342 ARG A NH1  1  
ATOM 1937  N NH2  . ARG A 1 129 ? 16.599  14.736  -6.533  1.00 0.00 1  342 ARG A NH2  1  
ATOM 1938  H H    . ARG A 1 129 ? 11.448  11.499  -1.607  1.00 0.00 ?  342 ARG A H    1  
ATOM 1939  H HA   . ARG A 1 129 ? 12.665  9.404   -3.018  1.00 0.00 ?  342 ARG A HA   1  
ATOM 1940  H HB2  . ARG A 1 129 ? 12.515  11.635  -4.011  1.00 0.00 ?  342 ARG A HB2  1  
ATOM 1941  H HB3  . ARG A 1 129 ? 13.376  12.355  -2.665  1.00 0.00 ?  342 ARG A HB3  1  
ATOM 1942  H HG2  . ARG A 1 129 ? 15.446  11.648  -3.420  1.00 0.00 ?  342 ARG A HG2  1  
ATOM 1943  H HG3  . ARG A 1 129 ? 14.821  10.140  -4.060  1.00 0.00 ?  342 ARG A HG3  1  
ATOM 1944  H HD2  . ARG A 1 129 ? 14.932  11.071  -6.131  1.00 0.00 ?  342 ARG A HD2  1  
ATOM 1945  H HD3  . ARG A 1 129 ? 13.597  12.107  -5.669  1.00 0.00 ?  342 ARG A HD3  1  
ATOM 1946  H HE   . ARG A 1 129 ? 15.937  13.297  -4.608  1.00 0.00 ?  342 ARG A HE   1  
ATOM 1947  H HH11 . ARG A 1 129 ? 14.607  12.522  -7.772  1.00 0.00 ?  342 ARG A HH11 1  
ATOM 1948  H HH12 . ARG A 1 129 ? 15.423  13.822  -8.575  1.00 0.00 ?  342 ARG A HH12 1  
ATOM 1949  H HH21 . ARG A 1 129 ? 17.013  15.013  -5.665  1.00 0.00 ?  342 ARG A HH21 1  
ATOM 1950  H HH22 . ARG A 1 129 ? 16.800  15.249  -7.368  1.00 0.00 ?  342 ARG A HH22 1  
ATOM 1951  N N    . LYS A 1 130 ? 14.113  10.613  -0.330  1.00 0.00 ?  343 LYS A N    1  
ATOM 1952  C CA   . LYS A 1 130 ? 15.165  10.405  0.650   1.00 0.00 ?  343 LYS A CA   1  
ATOM 1953  C C    . LYS A 1 130 ? 15.078  8.976   1.190   1.00 0.00 ?  343 LYS A C    1  
ATOM 1954  O O    . LYS A 1 130 ? 16.089  8.284   1.290   1.00 0.00 ?  343 LYS A O    1  
ATOM 1955  C CB   . LYS A 1 130 ? 15.104  11.479  1.738   1.00 0.00 ?  343 LYS A CB   1  
ATOM 1956  C CG   . LYS A 1 130 ? 16.303  12.424  1.643   1.00 0.00 ?  343 LYS A CG   1  
ATOM 1957  C CD   . LYS A 1 130 ? 15.933  13.706  0.893   1.00 0.00 ?  343 LYS A CD   1  
ATOM 1958  C CE   . LYS A 1 130 ? 15.307  14.733  1.838   1.00 0.00 ?  343 LYS A CE   1  
ATOM 1959  N NZ   . LYS A 1 130 ? 16.357  15.559  2.475   1.00 0.00 1  343 LYS A NZ   1  
ATOM 1960  H H    . LYS A 1 130 ? 13.425  11.293  -0.074  1.00 0.00 ?  343 LYS A H    1  
ATOM 1961  H HA   . LYS A 1 130 ? 16.119  10.522  0.135   1.00 0.00 ?  343 LYS A HA   1  
ATOM 1962  H HB2  . LYS A 1 130 ? 14.179  12.047  1.642   1.00 0.00 ?  343 LYS A HB2  1  
ATOM 1963  H HB3  . LYS A 1 130 ? 15.086  11.006  2.720   1.00 0.00 ?  343 LYS A HB3  1  
ATOM 1964  H HG2  . LYS A 1 130 ? 16.655  12.674  2.644   1.00 0.00 ?  343 LYS A HG2  1  
ATOM 1965  H HG3  . LYS A 1 130 ? 17.126  11.924  1.132   1.00 0.00 ?  343 LYS A HG3  1  
ATOM 1966  H HD2  . LYS A 1 130 ? 16.823  14.129  0.428   1.00 0.00 ?  343 LYS A HD2  1  
ATOM 1967  H HD3  . LYS A 1 130 ? 15.234  13.472  0.090   1.00 0.00 ?  343 LYS A HD3  1  
ATOM 1968  H HE2  . LYS A 1 130 ? 14.618  15.371  1.286   1.00 0.00 ?  343 LYS A HE2  1  
ATOM 1969  H HE3  . LYS A 1 130 ? 14.723  14.222  2.604   1.00 0.00 ?  343 LYS A HE3  1  
ATOM 1970  H HZ1  . LYS A 1 130 ? 16.213  16.520  2.238   1.00 0.00 ?  343 LYS A HZ1  1  
ATOM 1971  H HZ2  . LYS A 1 130 ? 16.311  15.450  3.468   1.00 0.00 ?  343 LYS A HZ2  1  
ATOM 1972  H HZ3  . LYS A 1 130 ? 17.255  15.266  2.148   1.00 0.00 ?  343 LYS A HZ3  1  
ATOM 1973  N N    . THR A 1 131 ? 13.859  8.578   1.524   1.00 0.00 ?  344 THR A N    1  
ATOM 1974  C CA   . THR A 1 131 ? 13.627  7.244   2.052   1.00 0.00 ?  344 THR A CA   1  
ATOM 1975  C C    . THR A 1 131 ? 13.799  6.197   0.950   1.00 0.00 ?  344 THR A C    1  
ATOM 1976  O O    . THR A 1 131 ? 14.258  5.086   1.210   1.00 0.00 ?  344 THR A O    1  
ATOM 1977  C CB   . THR A 1 131 ? 12.239  7.226   2.696   1.00 0.00 ?  344 THR A CB   1  
ATOM 1978  O OG1  . THR A 1 131 ? 12.235  6.034   3.477   1.00 0.00 ?  344 THR A OG1  1  
ATOM 1979  C CG2  . THR A 1 131 ? 11.122  7.005   1.673   1.00 0.00 ?  344 THR A CG2  1  
ATOM 1980  H H    . THR A 1 131 ? 13.042  9.147   1.440   1.00 0.00 ?  344 THR A H    1  
ATOM 1981  H HA   . THR A 1 131 ? 14.382  7.038   2.810   1.00 0.00 ?  344 THR A HA   1  
ATOM 1982  H HB   . THR A 1 131 ? 12.065  8.134   3.272   1.00 0.00 ?  344 THR A HB   1  
ATOM 1983  H HG1  . THR A 1 131 ? 12.295  5.234   2.881   1.00 0.00 ?  344 THR A HG1  1  
ATOM 1984  H HG21 . THR A 1 131 ? 10.202  6.737   2.193   1.00 0.00 ?  344 THR A HG21 1  
ATOM 1985  H HG22 . THR A 1 131 ? 10.965  7.920   1.104   1.00 0.00 ?  344 THR A HG22 1  
ATOM 1986  H HG23 . THR A 1 131 ? 11.404  6.199   0.996   1.00 0.00 ?  344 THR A HG23 1  
ATOM 1987  N N    . ALA A 1 132 ? 13.422  6.588   -0.258  1.00 0.00 ?  345 ALA A N    1  
ATOM 1988  C CA   . ALA A 1 132 ? 13.530  5.698   -1.401  1.00 0.00 ?  345 ALA A CA   1  
ATOM 1989  C C    . ALA A 1 132 ? 15.006  5.501   -1.753  1.00 0.00 ?  345 ALA A C    1  
ATOM 1990  O O    . ALA A 1 132 ? 15.416  4.407   -2.136  1.00 0.00 ?  345 ALA A O    1  
ATOM 1991  C CB   . ALA A 1 132 ? 12.723  6.267   -2.570  1.00 0.00 ?  345 ALA A CB   1  
ATOM 1992  H H    . ALA A 1 132 ? 13.050  7.494   -0.462  1.00 0.00 ?  345 ALA A H    1  
ATOM 1993  H HA   . ALA A 1 132 ? 13.102  4.737   -1.114  1.00 0.00 ?  345 ALA A HA   1  
ATOM 1994  H HB1  . ALA A 1 132 ? 11.717  6.514   -2.231  1.00 0.00 ?  345 ALA A HB1  1  
ATOM 1995  H HB2  . ALA A 1 132 ? 13.211  7.167   -2.945  1.00 0.00 ?  345 ALA A HB2  1  
ATOM 1996  H HB3  . ALA A 1 132 ? 12.666  5.526   -3.367  1.00 0.00 ?  345 ALA A HB3  1  
ATOM 1997  N N    . LEU A 1 133 ? 15.764  6.579   -1.609  1.00 0.00 ?  346 LEU A N    1  
ATOM 1998  C CA   . LEU A 1 133 ? 17.185  6.538   -1.907  1.00 0.00 ?  346 LEU A CA   1  
ATOM 1999  C C    . LEU A 1 133 ? 17.904  5.723   -0.830  1.00 0.00 ?  346 LEU A C    1  
ATOM 2000  O O    . LEU A 1 133 ? 18.849  4.993   -1.126  1.00 0.00 ?  346 LEU A O    1  
ATOM 2001  C CB   . LEU A 1 133 ? 17.737  7.955   -2.077  1.00 0.00 ?  346 LEU A CB   1  
ATOM 2002  C CG   . LEU A 1 133 ? 17.636  8.550   -3.483  1.00 0.00 ?  346 LEU A CG   1  
ATOM 2003  C CD1  . LEU A 1 133 ? 18.289  9.933   -3.542  1.00 0.00 ?  346 LEU A CD1  1  
ATOM 2004  C CD2  . LEU A 1 133 ? 18.221  7.596   -4.526  1.00 0.00 ?  346 LEU A CD2  1  
ATOM 2005  H H    . LEU A 1 133 ? 15.422  7.465   -1.297  1.00 0.00 ?  346 LEU A H    1  
ATOM 2006  H HA   . LEU A 1 133 ? 17.305  6.029   -2.863  1.00 0.00 ?  346 LEU A HA   1  
ATOM 2007  H HB2  . LEU A 1 133 ? 17.211  8.614   -1.386  1.00 0.00 ?  346 LEU A HB2  1  
ATOM 2008  H HB3  . LEU A 1 133 ? 18.786  7.953   -1.779  1.00 0.00 ?  346 LEU A HB3  1  
ATOM 2009  H HG   . LEU A 1 133 ? 16.581  8.682   -3.723  1.00 0.00 ?  346 LEU A HG   1  
ATOM 2010  H HD11 . LEU A 1 133 ? 17.564  10.690  -3.242  1.00 0.00 ?  346 LEU A HD11 1  
ATOM 2011  H HD12 . LEU A 1 133 ? 19.143  9.960   -2.865  1.00 0.00 ?  346 LEU A HD12 1  
ATOM 2012  H HD13 . LEU A 1 133 ? 18.624  10.133  -4.559  1.00 0.00 ?  346 LEU A HD13 1  
ATOM 2013  H HD21 . LEU A 1 133 ? 18.411  8.140   -5.451  1.00 0.00 ?  346 LEU A HD21 1  
ATOM 2014  H HD22 . LEU A 1 133 ? 19.155  7.177   -4.152  1.00 0.00 ?  346 LEU A HD22 1  
ATOM 2015  H HD23 . LEU A 1 133 ? 17.513  6.789   -4.718  1.00 0.00 ?  346 LEU A HD23 1  
ATOM 2016  N N    . GLU A 1 134 ? 17.430  5.876   0.398   1.00 0.00 ?  347 GLU A N    1  
ATOM 2017  C CA   . GLU A 1 134 ? 18.016  5.163   1.520   1.00 0.00 ?  347 GLU A CA   1  
ATOM 2018  C C    . GLU A 1 134 ? 17.643  3.680   1.461   1.00 0.00 ?  347 GLU A C    1  
ATOM 2019  O O    . GLU A 1 134 ? 18.456  2.819   1.792   1.00 0.00 ?  347 GLU A O    1  
ATOM 2020  C CB   . GLU A 1 134 ? 17.584  5.784   2.850   1.00 0.00 ?  347 GLU A CB   1  
ATOM 2021  C CG   . GLU A 1 134 ? 18.498  6.950   3.234   1.00 0.00 ?  347 GLU A CG   1  
ATOM 2022  C CD   . GLU A 1 134 ? 19.594  6.492   4.198   1.00 0.00 ?  347 GLU A CD   1  
ATOM 2023  O OE1  . GLU A 1 134 ? 20.762  6.379   3.800   1.00 0.00 ?  347 GLU A OE1  1  
ATOM 2024  O OE2  . GLU A 1 134 ? 19.196  6.252   5.402   1.00 0.00 -1 347 GLU A OE2  1  
ATOM 2025  H H    . GLU A 1 134 ? 16.662  6.472   0.630   1.00 0.00 ?  347 GLU A H    1  
ATOM 2026  H HA   . GLU A 1 134 ? 19.094  5.279   1.406   1.00 0.00 ?  347 GLU A HA   1  
ATOM 2027  H HB2  . GLU A 1 134 ? 16.554  6.134   2.774   1.00 0.00 ?  347 GLU A HB2  1  
ATOM 2028  H HB3  . GLU A 1 134 ? 17.606  5.027   3.634   1.00 0.00 ?  347 GLU A HB3  1  
ATOM 2029  H HG2  . GLU A 1 134 ? 18.951  7.372   2.337   1.00 0.00 ?  347 GLU A HG2  1  
ATOM 2030  H HG3  . GLU A 1 134 ? 17.908  7.742   3.696   1.00 0.00 ?  347 GLU A HG3  1  
ATOM 2031  H HE2  . GLU A 1 134 ? 19.154  5.265   5.557   1.00 0.00 ?  347 GLU A HE2  1  
ATOM 2032  N N    . ARG A 1 135 ? 16.414  3.429   1.036   1.00 0.00 ?  348 ARG A N    1  
ATOM 2033  C CA   . ARG A 1 135 ? 15.923  2.065   0.929   1.00 0.00 ?  348 ARG A CA   1  
ATOM 2034  C C    . ARG A 1 135 ? 16.583  1.356   -0.255  1.00 0.00 ?  348 ARG A C    1  
ATOM 2035  O O    . ARG A 1 135 ? 16.936  0.181   -0.161  1.00 0.00 ?  348 ARG A O    1  
ATOM 2036  C CB   . ARG A 1 135 ? 14.404  2.039   0.748   1.00 0.00 ?  348 ARG A CB   1  
ATOM 2037  C CG   . ARG A 1 135 ? 13.694  1.926   2.099   1.00 0.00 ?  348 ARG A CG   1  
ATOM 2038  C CD   . ARG A 1 135 ? 12.487  0.989   2.006   1.00 0.00 ?  348 ARG A CD   1  
ATOM 2039  N NE   . ARG A 1 135 ? 12.196  0.406   3.335   1.00 0.00 ?  348 ARG A NE   1  
ATOM 2040  C CZ   . ARG A 1 135 ? 11.062  -0.240  3.639   1.00 0.00 ?  348 ARG A CZ   1  
ATOM 2041  N NH1  . ARG A 1 135 ? 10.106  -0.390  2.712   1.00 0.00 ?  348 ARG A NH1  1  
ATOM 2042  N NH2  . ARG A 1 135 ? 10.885  -0.737  4.871   1.00 0.00 1  348 ARG A NH2  1  
ATOM 2043  H H    . ARG A 1 135 ? 15.759  4.136   0.769   1.00 0.00 ?  348 ARG A H    1  
ATOM 2044  H HA   . ARG A 1 135 ? 16.200  1.595   1.872   1.00 0.00 ?  348 ARG A HA   1  
ATOM 2045  H HB2  . ARG A 1 135 ? 14.079  2.945   0.237   1.00 0.00 ?  348 ARG A HB2  1  
ATOM 2046  H HB3  . ARG A 1 135 ? 14.124  1.198   0.114   1.00 0.00 ?  348 ARG A HB3  1  
ATOM 2047  H HG2  . ARG A 1 135 ? 14.390  1.554   2.850   1.00 0.00 ?  348 ARG A HG2  1  
ATOM 2048  H HG3  . ARG A 1 135 ? 13.368  2.913   2.426   1.00 0.00 ?  348 ARG A HG3  1  
ATOM 2049  H HD2  . ARG A 1 135 ? 11.618  1.538   1.642   1.00 0.00 ?  348 ARG A HD2  1  
ATOM 2050  H HD3  . ARG A 1 135 ? 12.687  0.195   1.287   1.00 0.00 ?  348 ARG A HD3  1  
ATOM 2051  H HE   . ARG A 1 135 ? 12.889  0.500   4.050   1.00 0.00 ?  348 ARG A HE   1  
ATOM 2052  H HH11 . ARG A 1 135 ? 10.239  -0.019  1.793   1.00 0.00 ?  348 ARG A HH11 1  
ATOM 2053  H HH12 . ARG A 1 135 ? 9.261   -0.873  2.940   1.00 0.00 ?  348 ARG A HH12 1  
ATOM 2054  H HH21 . ARG A 1 135 ? 11.598  -0.626  5.563   1.00 0.00 ?  348 ARG A HH21 1  
ATOM 2055  H HH22 . ARG A 1 135 ? 10.039  -1.220  5.099   1.00 0.00 ?  348 ARG A HH22 1  
ATOM 2056  N N    . ARG A 1 136 ? 16.730  2.099   -1.342  1.00 0.00 ?  349 ARG A N    1  
ATOM 2057  C CA   . ARG A 1 136 ? 17.341  1.555   -2.543  1.00 0.00 ?  349 ARG A CA   1  
ATOM 2058  C C    . ARG A 1 136 ? 18.844  1.358   -2.332  1.00 0.00 ?  349 ARG A C    1  
ATOM 2059  O O    . ARG A 1 136 ? 19.430  0.412   -2.856  1.00 0.00 ?  349 ARG A O    1  
ATOM 2060  C CB   . ARG A 1 136 ? 17.119  2.480   -3.741  1.00 0.00 ?  349 ARG A CB   1  
ATOM 2061  C CG   . ARG A 1 136 ? 18.022  2.087   -4.912  1.00 0.00 ?  349 ARG A CG   1  
ATOM 2062  C CD   . ARG A 1 136 ? 17.891  0.597   -5.231  1.00 0.00 ?  349 ARG A CD   1  
ATOM 2063  N NE   . ARG A 1 136 ? 17.634  0.409   -6.676  1.00 0.00 ?  349 ARG A NE   1  
ATOM 2064  C CZ   . ARG A 1 136 ? 17.649  -0.781  -7.293  1.00 0.00 ?  349 ARG A CZ   1  
ATOM 2065  N NH1  . ARG A 1 136 ? 17.908  -1.895  -6.595  1.00 0.00 ?  349 ARG A NH1  1  
ATOM 2066  N NH2  . ARG A 1 136 ? 17.404  -0.856  -8.608  1.00 0.00 1  349 ARG A NH2  1  
ATOM 2067  H H    . ARG A 1 136 ? 16.441  3.053   -1.410  1.00 0.00 ?  349 ARG A H    1  
ATOM 2068  H HA   . ARG A 1 136 ? 16.840  0.601   -2.704  1.00 0.00 ?  349 ARG A HA   1  
ATOM 2069  H HB2  . ARG A 1 136 ? 16.075  2.434   -4.052  1.00 0.00 ?  349 ARG A HB2  1  
ATOM 2070  H HB3  . ARG A 1 136 ? 17.320  3.511   -3.452  1.00 0.00 ?  349 ARG A HB3  1  
ATOM 2071  H HG2  . ARG A 1 136 ? 17.760  2.675   -5.792  1.00 0.00 ?  349 ARG A HG2  1  
ATOM 2072  H HG3  . ARG A 1 136 ? 19.059  2.321   -4.670  1.00 0.00 ?  349 ARG A HG3  1  
ATOM 2073  H HD2  . ARG A 1 136 ? 18.803  0.073   -4.944  1.00 0.00 ?  349 ARG A HD2  1  
ATOM 2074  H HD3  . ARG A 1 136 ? 17.078  0.163   -4.649  1.00 0.00 ?  349 ARG A HD3  1  
ATOM 2075  H HE   . ARG A 1 136 ? 17.438  1.220   -7.226  1.00 0.00 ?  349 ARG A HE   1  
ATOM 2076  H HH11 . ARG A 1 136 ? 18.090  -1.838  -5.613  1.00 0.00 ?  349 ARG A HH11 1  
ATOM 2077  H HH12 . ARG A 1 136 ? 17.919  -2.782  -7.055  1.00 0.00 ?  349 ARG A HH12 1  
ATOM 2078  H HH21 . ARG A 1 136 ? 17.211  -0.025  -9.130  1.00 0.00 ?  349 ARG A HH21 1  
ATOM 2079  H HH22 . ARG A 1 136 ? 17.415  -1.744  -9.069  1.00 0.00 ?  349 ARG A HH22 1  
ATOM 2080  N N    . GLY A 1 137 ? 19.425  2.268   -1.563  1.00 0.00 ?  350 GLY A N    1  
ATOM 2081  C CA   . GLY A 1 137 ? 20.848  2.207   -1.276  1.00 0.00 ?  350 GLY A CA   1  
ATOM 2082  C C    . GLY A 1 137 ? 21.280  0.775   -0.950  1.00 0.00 ?  350 GLY A C    1  
ATOM 2083  O O    . GLY A 1 137 ? 22.290  0.296   -1.464  1.00 0.00 ?  350 GLY A O    1  
ATOM 2084  H H    . GLY A 1 137 ? 18.942  3.035   -1.141  1.00 0.00 ?  350 GLY A H    1  
ATOM 2085  H HA2  . GLY A 1 137 ? 21.412  2.574   -2.133  1.00 0.00 ?  350 GLY A HA2  1  
ATOM 2086  H HA3  . GLY A 1 137 ? 21.082  2.861   -0.436  1.00 0.00 ?  350 GLY A HA3  1  
ATOM 2087  N N    . ALA A 1 138 ? 20.495  0.134   -0.098  1.00 0.00 ?  351 ALA A N    1  
ATOM 2088  C CA   . ALA A 1 138 ? 20.784  -1.233  0.303   1.00 0.00 ?  351 ALA A CA   1  
ATOM 2089  C C    . ALA A 1 138 ? 19.486  -1.917  0.738   1.00 0.00 ?  351 ALA A C    1  
ATOM 2090  O O    . ALA A 1 138 ? 18.817  -1.457  1.662   1.00 0.00 ?  351 ALA A O    1  
ATOM 2091  C CB   . ALA A 1 138 ? 21.840  -1.228  1.410   1.00 0.00 ?  351 ALA A CB   1  
ATOM 2092  H H    . ALA A 1 138 ? 19.675  0.531   0.316   1.00 0.00 ?  351 ALA A H    1  
ATOM 2093  H HA   . ALA A 1 138 ? 21.187  -1.755  -0.565  1.00 0.00 ?  351 ALA A HA   1  
ATOM 2094  H HB1  . ALA A 1 138 ? 22.384  -2.172  1.397   1.00 0.00 ?  351 ALA A HB1  1  
ATOM 2095  H HB2  . ALA A 1 138 ? 22.536  -0.405  1.244   1.00 0.00 ?  351 ALA A HB2  1  
ATOM 2096  H HB3  . ALA A 1 138 ? 21.352  -1.102  2.377   1.00 0.00 ?  351 ALA A HB3  1  
ATOM 2097  N N    . ALA A 1 139 ? 19.170  -3.006  0.052   1.00 0.00 ?  352 ALA A N    1  
ATOM 2098  C CA   . ALA A 1 139 ? 17.965  -3.758  0.356   1.00 0.00 ?  352 ALA A CA   1  
ATOM 2099  C C    . ALA A 1 139 ? 18.088  -4.367  1.754   1.00 0.00 ?  352 ALA A C    1  
ATOM 2100  O O    . ALA A 1 139 ? 19.144  -4.286  2.379   1.00 0.00 ?  352 ALA A O    1  
ATOM 2101  C CB   . ALA A 1 139 ? 17.739  -4.819  -0.724  1.00 0.00 ?  352 ALA A CB   1  
ATOM 2102  H H    . ALA A 1 139 ? 19.720  -3.373  -0.698  1.00 0.00 ?  352 ALA A H    1  
ATOM 2103  H HA   . ALA A 1 139 ? 17.127  -3.062  0.344   1.00 0.00 ?  352 ALA A HA   1  
ATOM 2104  H HB1  . ALA A 1 139 ? 17.345  -4.344  -1.623  1.00 0.00 ?  352 ALA A HB1  1  
ATOM 2105  H HB2  . ALA A 1 139 ? 18.685  -5.308  -0.956  1.00 0.00 ?  352 ALA A HB2  1  
ATOM 2106  H HB3  . ALA A 1 139 ? 17.026  -5.559  -0.362  1.00 0.00 ?  352 ALA A HB3  1  
ATOM 2107  N N    . ALA A 1 140 ? 16.994  -4.963  2.204   1.00 0.00 ?  353 ALA A N    1  
ATOM 2108  C CA   . ALA A 1 140 ? 16.966  -5.585  3.516   1.00 0.00 ?  353 ALA A CA   1  
ATOM 2109  C C    . ALA A 1 140 ? 16.645  -7.074  3.364   1.00 0.00 ?  353 ALA A C    1  
ATOM 2110  O O    . ALA A 1 140 ? 15.591  -7.435  2.843   1.00 0.00 ?  353 ALA A O    1  
ATOM 2111  C CB   . ALA A 1 140 ? 15.954  -4.859  4.404   1.00 0.00 ?  353 ALA A CB   1  
ATOM 2112  H H    . ALA A 1 140 ? 16.139  -5.025  1.688   1.00 0.00 ?  353 ALA A H    1  
ATOM 2113  H HA   . ALA A 1 140 ? 17.958  -5.479  3.955   1.00 0.00 ?  353 ALA A HA   1  
ATOM 2114  H HB1  . ALA A 1 140 ? 16.006  -5.259  5.417   1.00 0.00 ?  353 ALA A HB1  1  
ATOM 2115  H HB2  . ALA A 1 140 ? 16.185  -3.793  4.423   1.00 0.00 ?  353 ALA A HB2  1  
ATOM 2116  H HB3  . ALA A 1 140 ? 14.950  -5.005  4.006   1.00 0.00 ?  353 ALA A HB3  1  
ATOM 2117  N N    . SER A 1 141 ? 17.573  -7.897  3.828   1.00 0.00 ?  354 SER A N    1  
ATOM 2118  C CA   . SER A 1 141 ? 17.403  -9.338  3.750   1.00 0.00 ?  354 SER A CA   1  
ATOM 2119  C C    . SER A 1 141 ? 18.227  -10.022 4.842   1.00 0.00 ?  354 SER A C    1  
ATOM 2120  O O    . SER A 1 141 ? 19.010  -9.372  5.533   1.00 0.00 ?  354 SER A O    1  
ATOM 2121  C CB   . SER A 1 141 ? 17.804  -9.866  2.372   1.00 0.00 ?  354 SER A CB   1  
ATOM 2122  O OG   . SER A 1 141 ? 17.036  -9.273  1.328   1.00 0.00 ?  354 SER A OG   1  
ATOM 2123  H H    . SER A 1 141 ? 18.428  -7.595  4.251   1.00 0.00 ?  354 SER A H    1  
ATOM 2124  H HA   . SER A 1 141 ? 16.338  -9.511  3.909   1.00 0.00 ?  354 SER A HA   1  
ATOM 2125  H HB2  . SER A 1 141 ? 18.863  -9.667  2.201   1.00 0.00 ?  354 SER A HB2  1  
ATOM 2126  H HB3  . SER A 1 141 ? 17.676  -10.948 2.347   1.00 0.00 ?  354 SER A HB3  1  
ATOM 2127  H HG   . SER A 1 141 ? 16.940  -9.915  0.567   1.00 0.00 ?  354 SER A HG   1  
ATOM 2128  N N    . ALA A 1 142 ? 18.023  -11.326 4.964   1.00 0.00 ?  355 ALA A N    1  
ATOM 2129  C CA   . ALA A 1 142 ? 18.738  -12.105 5.960   1.00 0.00 ?  355 ALA A CA   1  
ATOM 2130  C C    . ALA A 1 142 ? 18.364  -11.606 7.357   1.00 0.00 ?  355 ALA A C    1  
ATOM 2131  O O    . ALA A 1 142 ? 17.454  -10.792 7.506   1.00 0.00 ?  355 ALA A O    1  
ATOM 2132  C CB   . ALA A 1 142 ? 20.242  -12.019 5.693   1.00 0.00 ?  355 ALA A CB   1  
ATOM 2133  H H    . ALA A 1 142 ? 17.384  -11.847 4.398   1.00 0.00 ?  355 ALA A H    1  
ATOM 2134  H HA   . ALA A 1 142 ? 18.422  -13.144 5.857   1.00 0.00 ?  355 ALA A HA   1  
ATOM 2135  H HB1  . ALA A 1 142 ? 20.786  -12.185 6.623   1.00 0.00 ?  355 ALA A HB1  1  
ATOM 2136  H HB2  . ALA A 1 142 ? 20.526  -12.778 4.965   1.00 0.00 ?  355 ALA A HB2  1  
ATOM 2137  H HB3  . ALA A 1 142 ? 20.485  -11.031 5.301   1.00 0.00 ?  355 ALA A HB3  1  
ATOM 2138  N N    . GLY A 1 1   ? -22.201 9.913   -13.652 1.00 0.00 ?  214 GLY A N    2  
ATOM 2139  C CA   . GLY A 1 1   ? -20.755 9.929   -13.796 1.00 0.00 ?  214 GLY A CA   2  
ATOM 2140  C C    . GLY A 1 1   ? -20.086 9.091   -12.704 1.00 0.00 ?  214 GLY A C    2  
ATOM 2141  O O    . GLY A 1 1   ? -19.629 7.979   -12.962 1.00 0.00 ?  214 GLY A O    2  
ATOM 2142  H H1   . GLY A 1 1   ? -22.539 9.444   -12.836 1.00 0.00 ?  214 GLY A H1   2  
ATOM 2143  H HA2  . GLY A 1 1   ? -20.479 9.541   -14.776 1.00 0.00 ?  214 GLY A HA2  2  
ATOM 2144  H HA3  . GLY A 1 1   ? -20.392 10.955  -13.745 1.00 0.00 ?  214 GLY A HA3  2  
ATOM 2145  N N    . SER A 1 2   ? -20.050 9.658   -11.506 1.00 0.00 ?  215 SER A N    2  
ATOM 2146  C CA   . SER A 1 2   ? -19.445 8.977   -10.374 1.00 0.00 ?  215 SER A CA   2  
ATOM 2147  C C    . SER A 1 2   ? -20.535 8.429   -9.450  1.00 0.00 ?  215 SER A C    2  
ATOM 2148  O O    . SER A 1 2   ? -21.697 8.818   -9.556  1.00 0.00 ?  215 SER A O    2  
ATOM 2149  C CB   . SER A 1 2   ? -18.515 9.914   -9.601  1.00 0.00 ?  215 SER A CB   2  
ATOM 2150  O OG   . SER A 1 2   ? -17.148 9.530   -9.723  1.00 0.00 ?  215 SER A OG   2  
ATOM 2151  H H    . SER A 1 2   ? -20.425 10.563  -11.305 1.00 0.00 ?  215 SER A H    2  
ATOM 2152  H HA   . SER A 1 2   ? -18.864 8.162   -10.805 1.00 0.00 ?  215 SER A HA   2  
ATOM 2153  H HB2  . SER A 1 2   ? -18.640 10.933  -9.969  1.00 0.00 ?  215 SER A HB2  2  
ATOM 2154  H HB3  . SER A 1 2   ? -18.798 9.918   -8.548  1.00 0.00 ?  215 SER A HB3  2  
ATOM 2155  H HG   . SER A 1 2   ? -17.017 8.995   -10.558 1.00 0.00 ?  215 SER A HG   2  
ATOM 2156  N N    . GLN A 1 3   ? -20.120 7.535   -8.564  1.00 0.00 ?  216 GLN A N    2  
ATOM 2157  C CA   . GLN A 1 3   ? -21.046 6.930   -7.622  1.00 0.00 ?  216 GLN A CA   2  
ATOM 2158  C C    . GLN A 1 3   ? -20.505 7.048   -6.196  1.00 0.00 ?  216 GLN A C    2  
ATOM 2159  O O    . GLN A 1 3   ? -19.355 7.436   -5.994  1.00 0.00 ?  216 GLN A O    2  
ATOM 2160  C CB   . GLN A 1 3   ? -21.321 5.469   -7.985  1.00 0.00 ?  216 GLN A CB   2  
ATOM 2161  C CG   . GLN A 1 3   ? -22.638 5.333   -8.751  1.00 0.00 ?  216 GLN A CG   2  
ATOM 2162  C CD   . GLN A 1 3   ? -23.301 3.983   -8.467  1.00 0.00 ?  216 GLN A CD   2  
ATOM 2163  O OE1  . GLN A 1 3   ? -22.803 3.166   -7.711  1.00 0.00 ?  216 GLN A OE1  2  
ATOM 2164  N NE2  . GLN A 1 3   ? -24.448 3.797   -9.114  1.00 0.00 ?  216 GLN A NE2  2  
ATOM 2165  H H    . GLN A 1 3   ? -19.173 7.224   -8.485  1.00 0.00 ?  216 GLN A H    2  
ATOM 2166  H HA   . GLN A 1 3   ? -21.970 7.501   -7.716  1.00 0.00 ?  216 GLN A HA   2  
ATOM 2167  H HB2  . GLN A 1 3   ? -20.502 5.081   -8.590  1.00 0.00 ?  216 GLN A HB2  2  
ATOM 2168  H HB3  . GLN A 1 3   ? -21.360 4.867   -7.077  1.00 0.00 ?  216 GLN A HB3  2  
ATOM 2169  H HG2  . GLN A 1 3   ? -23.313 6.141   -8.467  1.00 0.00 ?  216 GLN A HG2  2  
ATOM 2170  H HG3  . GLN A 1 3   ? -22.453 5.433   -9.820  1.00 0.00 ?  216 GLN A HG3  2  
ATOM 2171  H HE21 . GLN A 1 3   ? -24.802 4.510   -9.720  1.00 0.00 ?  216 GLN A HE21 2  
ATOM 2172  H HE22 . GLN A 1 3   ? -24.957 2.945   -8.993  1.00 0.00 ?  216 GLN A HE22 2  
ATOM 2173  N N    . GLU A 1 4   ? -21.360 6.707   -5.243  1.00 0.00 ?  217 GLU A N    2  
ATOM 2174  C CA   . GLU A 1 4   ? -20.982 6.770   -3.841  1.00 0.00 ?  217 GLU A CA   2  
ATOM 2175  C C    . GLU A 1 4   ? -20.336 5.453   -3.405  1.00 0.00 ?  217 GLU A C    2  
ATOM 2176  O O    . GLU A 1 4   ? -20.605 4.404   -3.987  1.00 0.00 ?  217 GLU A O    2  
ATOM 2177  C CB   . GLU A 1 4   ? -22.189 7.106   -2.962  1.00 0.00 ?  217 GLU A CB   2  
ATOM 2178  C CG   . GLU A 1 4   ? -22.178 8.582   -2.558  1.00 0.00 ?  217 GLU A CG   2  
ATOM 2179  C CD   . GLU A 1 4   ? -23.548 9.015   -2.030  1.00 0.00 ?  217 GLU A CD   2  
ATOM 2180  O OE1  . GLU A 1 4   ? -23.935 8.627   -0.918  1.00 0.00 ?  217 GLU A OE1  2  
ATOM 2181  O OE2  . GLU A 1 4   ? -24.217 9.784   -2.821  1.00 0.00 -1 217 GLU A OE2  2  
ATOM 2182  H H    . GLU A 1 4   ? -22.293 6.393   -5.415  1.00 0.00 ?  217 GLU A H    2  
ATOM 2183  H HA   . GLU A 1 4   ? -20.255 7.579   -3.773  1.00 0.00 ?  217 GLU A HA   2  
ATOM 2184  H HB2  . GLU A 1 4   ? -23.109 6.880   -3.501  1.00 0.00 ?  217 GLU A HB2  2  
ATOM 2185  H HB3  . GLU A 1 4   ? -22.179 6.480   -2.070  1.00 0.00 ?  217 GLU A HB3  2  
ATOM 2186  H HG2  . GLU A 1 4   ? -21.421 8.747   -1.791  1.00 0.00 ?  217 GLU A HG2  2  
ATOM 2187  H HG3  . GLU A 1 4   ? -21.903 9.196   -3.415  1.00 0.00 ?  217 GLU A HG3  2  
ATOM 2188  H HE2  . GLU A 1 4   ? -23.608 10.457  -3.240  1.00 0.00 ?  217 GLU A HE2  2  
ATOM 2189  N N    . VAL A 1 5   ? -19.497 5.552   -2.385  1.00 0.00 ?  218 VAL A N    2  
ATOM 2190  C CA   . VAL A 1 5   ? -18.811 4.381   -1.865  1.00 0.00 ?  218 VAL A CA   2  
ATOM 2191  C C    . VAL A 1 5   ? -18.806 4.436   -0.336  1.00 0.00 ?  218 VAL A C    2  
ATOM 2192  O O    . VAL A 1 5   ? -18.517 5.478   0.251   1.00 0.00 ?  218 VAL A O    2  
ATOM 2193  C CB   . VAL A 1 5   ? -17.406 4.289   -2.464  1.00 0.00 ?  218 VAL A CB   2  
ATOM 2194  C CG1  . VAL A 1 5   ? -16.586 3.197   -1.774  1.00 0.00 ?  218 VAL A CG1  2  
ATOM 2195  C CG2  . VAL A 1 5   ? -17.469 4.055   -3.975  1.00 0.00 ?  218 VAL A CG2  2  
ATOM 2196  H H    . VAL A 1 5   ? -19.283 6.409   -1.917  1.00 0.00 ?  218 VAL A H    2  
ATOM 2197  H HA   . VAL A 1 5   ? -19.372 3.503   -2.183  1.00 0.00 ?  218 VAL A HA   2  
ATOM 2198  H HB   . VAL A 1 5   ? -16.905 5.242   -2.294  1.00 0.00 ?  218 VAL A HB   2  
ATOM 2199  H HG11 . VAL A 1 5   ? -16.013 3.635   -0.957  1.00 0.00 ?  218 VAL A HG11 2  
ATOM 2200  H HG12 . VAL A 1 5   ? -17.257 2.434   -1.379  1.00 0.00 ?  218 VAL A HG12 2  
ATOM 2201  H HG13 . VAL A 1 5   ? -15.904 2.744   -2.494  1.00 0.00 ?  218 VAL A HG13 2  
ATOM 2202  H HG21 . VAL A 1 5   ? -16.535 4.382   -4.432  1.00 0.00 ?  218 VAL A HG21 2  
ATOM 2203  H HG22 . VAL A 1 5   ? -17.617 2.993   -4.173  1.00 0.00 ?  218 VAL A HG22 2  
ATOM 2204  H HG23 . VAL A 1 5   ? -18.298 4.622   -4.396  1.00 0.00 ?  218 VAL A HG23 2  
ATOM 2205  N N    . ARG A 1 6   ? -19.128 3.300   0.266   1.00 0.00 ?  219 ARG A N    2  
ATOM 2206  C CA   . ARG A 1 6   ? -19.165 3.206   1.715   1.00 0.00 ?  219 ARG A CA   2  
ATOM 2207  C C    . ARG A 1 6   ? -17.792 2.801   2.256   1.00 0.00 ?  219 ARG A C    2  
ATOM 2208  O O    . ARG A 1 6   ? -16.950 2.302   1.510   1.00 0.00 ?  219 ARG A O    2  
ATOM 2209  C CB   . ARG A 1 6   ? -20.208 2.185   2.175   1.00 0.00 ?  219 ARG A CB   2  
ATOM 2210  C CG   . ARG A 1 6   ? -21.519 2.874   2.557   1.00 0.00 ?  219 ARG A CG   2  
ATOM 2211  C CD   . ARG A 1 6   ? -22.105 3.636   1.366   1.00 0.00 ?  219 ARG A CD   2  
ATOM 2212  N NE   . ARG A 1 6   ? -23.577 3.722   1.495   1.00 0.00 ?  219 ARG A NE   2  
ATOM 2213  C CZ   . ARG A 1 6   ? -24.369 4.377   0.635   1.00 0.00 ?  219 ARG A CZ   2  
ATOM 2214  N NH1  . ARG A 1 6   ? -23.837 5.005   -0.421  1.00 0.00 ?  219 ARG A NH1  2  
ATOM 2215  N NH2  . ARG A 1 6   ? -25.695 4.402   0.832   1.00 0.00 1  219 ARG A NH2  2  
ATOM 2216  H H    . ARG A 1 6   ? -19.361 2.457   -0.219  1.00 0.00 ?  219 ARG A H    2  
ATOM 2217  H HA   . ARG A 1 6   ? -19.440 4.205   2.053   1.00 0.00 ?  219 ARG A HA   2  
ATOM 2218  H HB2  . ARG A 1 6   ? -20.391 1.464   1.378   1.00 0.00 ?  219 ARG A HB2  2  
ATOM 2219  H HB3  . ARG A 1 6   ? -19.824 1.627   3.028   1.00 0.00 ?  219 ARG A HB3  2  
ATOM 2220  H HG2  . ARG A 1 6   ? -22.236 2.132   2.906   1.00 0.00 ?  219 ARG A HG2  2  
ATOM 2221  H HG3  . ARG A 1 6   ? -21.345 3.563   3.383   1.00 0.00 ?  219 ARG A HG3  2  
ATOM 2222  H HD2  . ARG A 1 6   ? -21.677 4.638   1.318   1.00 0.00 ?  219 ARG A HD2  2  
ATOM 2223  H HD3  . ARG A 1 6   ? -21.842 3.132   0.436   1.00 0.00 ?  219 ARG A HD3  2  
ATOM 2224  H HE   . ARG A 1 6   ? -24.007 3.264   2.273   1.00 0.00 ?  219 ARG A HE   2  
ATOM 2225  H HH11 . ARG A 1 6   ? -22.848 4.987   -0.568  1.00 0.00 ?  219 ARG A HH11 2  
ATOM 2226  H HH12 . ARG A 1 6   ? -24.428 5.494   -1.063  1.00 0.00 ?  219 ARG A HH12 2  
ATOM 2227  H HH21 . ARG A 1 6   ? -26.092 3.932   1.620   1.00 0.00 ?  219 ARG A HH21 2  
ATOM 2228  H HH22 . ARG A 1 6   ? -26.286 4.890   0.190   1.00 0.00 ?  219 ARG A HH22 2  
ATOM 2229  N N    . ARG A 1 7   ? -17.609 3.030   3.548   1.00 0.00 ?  220 ARG A N    2  
ATOM 2230  C CA   . ARG A 1 7   ? -16.352 2.695   4.196   1.00 0.00 ?  220 ARG A CA   2  
ATOM 2231  C C    . ARG A 1 7   ? -16.581 2.416   5.683   1.00 0.00 ?  220 ARG A C    2  
ATOM 2232  O O    . ARG A 1 7   ? -17.053 3.284   6.416   1.00 0.00 ?  220 ARG A O    2  
ATOM 2233  C CB   . ARG A 1 7   ? -15.336 3.829   4.048   1.00 0.00 ?  220 ARG A CB   2  
ATOM 2234  C CG   . ARG A 1 7   ? -15.903 5.147   4.579   1.00 0.00 ?  220 ARG A CG   2  
ATOM 2235  C CD   . ARG A 1 7   ? -15.966 6.203   3.473   1.00 0.00 ?  220 ARG A CD   2  
ATOM 2236  N NE   . ARG A 1 7   ? -17.335 6.272   2.917   1.00 0.00 ?  220 ARG A NE   2  
ATOM 2237  C CZ   . ARG A 1 7   ? -18.419 6.612   3.628   1.00 0.00 ?  220 ARG A CZ   2  
ATOM 2238  N NH1  . ARG A 1 7   ? -18.299 6.914   4.928   1.00 0.00 ?  220 ARG A NH1  2  
ATOM 2239  N NH2  . ARG A 1 7   ? -19.622 6.649   3.040   1.00 0.00 1  220 ARG A NH2  2  
ATOM 2240  H H    . ARG A 1 7   ? -18.299 3.437   4.147   1.00 0.00 ?  220 ARG A H    2  
ATOM 2241  H HA   . ARG A 1 7   ? -16.001 1.803   3.679   1.00 0.00 ?  220 ARG A HA   2  
ATOM 2242  H HB2  . ARG A 1 7   ? -14.424 3.578   4.588   1.00 0.00 ?  220 ARG A HB2  2  
ATOM 2243  H HB3  . ARG A 1 7   ? -15.064 3.943   2.998   1.00 0.00 ?  220 ARG A HB3  2  
ATOM 2244  H HG2  . ARG A 1 7   ? -16.901 4.981   4.984   1.00 0.00 ?  220 ARG A HG2  2  
ATOM 2245  H HG3  . ARG A 1 7   ? -15.283 5.510   5.398   1.00 0.00 ?  220 ARG A HG3  2  
ATOM 2246  H HD2  . ARG A 1 7   ? -15.676 7.175   3.870   1.00 0.00 ?  220 ARG A HD2  2  
ATOM 2247  H HD3  . ARG A 1 7   ? -15.256 5.956   2.683   1.00 0.00 ?  220 ARG A HD3  2  
ATOM 2248  H HE   . ARG A 1 7   ? -17.460 6.053   1.949   1.00 0.00 ?  220 ARG A HE   2  
ATOM 2249  H HH11 . ARG A 1 7   ? -17.401 6.887   5.367   1.00 0.00 ?  220 ARG A HH11 2  
ATOM 2250  H HH12 . ARG A 1 7   ? -19.107 7.167   5.459   1.00 0.00 ?  220 ARG A HH12 2  
ATOM 2251  H HH21 . ARG A 1 7   ? -19.712 6.423   2.070   1.00 0.00 ?  220 ARG A HH21 2  
ATOM 2252  H HH22 . ARG A 1 7   ? -20.431 6.902   3.571   1.00 0.00 ?  220 ARG A HH22 2  
ATOM 2253  N N    . GLY A 1 8   ? -16.235 1.202   6.085   1.00 0.00 ?  221 GLY A N    2  
ATOM 2254  C CA   . GLY A 1 8   ? -16.397 0.798   7.471   1.00 0.00 ?  221 GLY A CA   2  
ATOM 2255  C C    . GLY A 1 8   ? -15.039 0.556   8.133   1.00 0.00 ?  221 GLY A C    2  
ATOM 2256  O O    . GLY A 1 8   ? -14.877 0.791   9.330   1.00 0.00 ?  221 GLY A O    2  
ATOM 2257  H H    . GLY A 1 8   ? -15.852 0.502   5.482   1.00 0.00 ?  221 GLY A H    2  
ATOM 2258  H HA2  . GLY A 1 8   ? -16.940 1.569   8.017   1.00 0.00 ?  221 GLY A HA2  2  
ATOM 2259  H HA3  . GLY A 1 8   ? -16.997 -0.111  7.521   1.00 0.00 ?  221 GLY A HA3  2  
ATOM 2260  N N    . ASP A 1 9   ? -14.098 0.090   7.326   1.00 0.00 ?  222 ASP A N    2  
ATOM 2261  C CA   . ASP A 1 9   ? -12.759 -0.186  7.819   1.00 0.00 ?  222 ASP A CA   2  
ATOM 2262  C C    . ASP A 1 9   ? -11.889 1.061   7.647   1.00 0.00 ?  222 ASP A C    2  
ATOM 2263  O O    . ASP A 1 9   ? -10.663 0.978   7.696   1.00 0.00 ?  222 ASP A O    2  
ATOM 2264  C CB   . ASP A 1 9   ? -12.108 -1.328  7.035   1.00 0.00 ?  222 ASP A CB   2  
ATOM 2265  C CG   . ASP A 1 9   ? -12.802 -2.685  7.173   1.00 0.00 ?  222 ASP A CG   2  
ATOM 2266  O OD1  . ASP A 1 9   ? -13.142 -3.119  8.283   1.00 0.00 ?  222 ASP A OD1  2  
ATOM 2267  O OD2  . ASP A 1 9   ? -12.995 -3.313  6.063   1.00 0.00 -1 222 ASP A OD2  2  
ATOM 2268  H H    . ASP A 1 9   ? -14.237 -0.099  6.354   1.00 0.00 ?  222 ASP A H    2  
ATOM 2269  H HA   . ASP A 1 9   ? -12.890 -0.463  8.865   1.00 0.00 ?  222 ASP A HA   2  
ATOM 2270  H HB2  . ASP A 1 9   ? -12.081 -1.056  5.980   1.00 0.00 ?  222 ASP A HB2  2  
ATOM 2271  H HB3  . ASP A 1 9   ? -11.074 -1.431  7.364   1.00 0.00 ?  222 ASP A HB3  2  
ATOM 2272  H HD2  . ASP A 1 9   ? -13.152 -2.660  5.322   1.00 0.00 ?  222 ASP A HD2  2  
ATOM 2273  N N    . PHE A 1 10  ? -12.559 2.187   7.449   1.00 0.00 ?  223 PHE A N    2  
ATOM 2274  C CA   . PHE A 1 10  ? -11.862 3.450   7.270   1.00 0.00 ?  223 PHE A CA   2  
ATOM 2275  C C    . PHE A 1 10  ? -10.875 3.698   8.412   1.00 0.00 ?  223 PHE A C    2  
ATOM 2276  O O    . PHE A 1 10  ? -9.775  4.202   8.188   1.00 0.00 ?  223 PHE A O    2  
ATOM 2277  C CB   . PHE A 1 10  ? -12.924 4.551   7.280   1.00 0.00 ?  223 PHE A CB   2  
ATOM 2278  C CG   . PHE A 1 10  ? -12.421 5.905   6.774   1.00 0.00 ?  223 PHE A CG   2  
ATOM 2279  C CD1  . PHE A 1 10  ? -11.796 6.760   7.627   1.00 0.00 ?  223 PHE A CD1  2  
ATOM 2280  C CD2  . PHE A 1 10  ? -12.600 6.253   5.472   1.00 0.00 ?  223 PHE A CD2  2  
ATOM 2281  C CE1  . PHE A 1 10  ? -11.329 8.016   7.157   1.00 0.00 ?  223 PHE A CE1  2  
ATOM 2282  C CE2  . PHE A 1 10  ? -12.133 7.509   5.002   1.00 0.00 ?  223 PHE A CE2  2  
ATOM 2283  C CZ   . PHE A 1 10  ? -11.508 8.364   5.854   1.00 0.00 ?  223 PHE A CZ   2  
ATOM 2284  H H    . PHE A 1 10  ? -13.556 2.245   7.411   1.00 0.00 ?  223 PHE A H    2  
ATOM 2285  H HA   . PHE A 1 10  ? -11.317 3.387   6.328   1.00 0.00 ?  223 PHE A HA   2  
ATOM 2286  H HB2  . PHE A 1 10  ? -13.767 4.235   6.666   1.00 0.00 ?  223 PHE A HB2  2  
ATOM 2287  H HB3  . PHE A 1 10  ? -13.298 4.671   8.297   1.00 0.00 ?  223 PHE A HB3  2  
ATOM 2288  H HD1  . PHE A 1 10  ? -11.652 6.481   8.671   1.00 0.00 ?  223 PHE A HD1  2  
ATOM 2289  H HD2  . PHE A 1 10  ? -13.101 5.567   4.788   1.00 0.00 ?  223 PHE A HD2  2  
ATOM 2290  H HE1  . PHE A 1 10  ? -10.828 8.701   7.840   1.00 0.00 ?  223 PHE A HE1  2  
ATOM 2291  H HE2  . PHE A 1 10  ? -12.276 7.787   3.958   1.00 0.00 ?  223 PHE A HE2  2  
ATOM 2292  H HZ   . PHE A 1 10  ? -11.149 9.328   5.494   1.00 0.00 ?  223 PHE A HZ   2  
ATOM 2293  N N    . VAL A 1 11  ? -11.303 3.333   9.612   1.00 0.00 ?  224 VAL A N    2  
ATOM 2294  C CA   . VAL A 1 11  ? -10.470 3.510   10.789  1.00 0.00 ?  224 VAL A CA   2  
ATOM 2295  C C    . VAL A 1 11  ? -9.355  2.463   10.782  1.00 0.00 ?  224 VAL A C    2  
ATOM 2296  O O    . VAL A 1 11  ? -8.214  2.764   11.130  1.00 0.00 ?  224 VAL A O    2  
ATOM 2297  C CB   . VAL A 1 11  ? -11.332 3.458   12.052  1.00 0.00 ?  224 VAL A CB   2  
ATOM 2298  C CG1  . VAL A 1 11  ? -11.138 2.134   12.794  1.00 0.00 ?  224 VAL A CG1  2  
ATOM 2299  C CG2  . VAL A 1 11  ? -11.037 4.647   12.968  1.00 0.00 ?  224 VAL A CG2  2  
ATOM 2300  H H    . VAL A 1 11  ? -12.199 2.924   9.785   1.00 0.00 ?  224 VAL A H    2  
ATOM 2301  H HA   . VAL A 1 11  ? -10.021 4.502   10.728  1.00 0.00 ?  224 VAL A HA   2  
ATOM 2302  H HB   . VAL A 1 11  ? -12.377 3.521   11.748  1.00 0.00 ?  224 VAL A HB   2  
ATOM 2303  H HG11 . VAL A 1 11  ? -11.860 2.063   13.607  1.00 0.00 ?  224 VAL A HG11 2  
ATOM 2304  H HG12 . VAL A 1 11  ? -11.288 1.304   12.102  1.00 0.00 ?  224 VAL A HG12 2  
ATOM 2305  H HG13 . VAL A 1 11  ? -10.127 2.090   13.200  1.00 0.00 ?  224 VAL A HG13 2  
ATOM 2306  H HG21 . VAL A 1 11  ? -11.155 5.575   12.408  1.00 0.00 ?  224 VAL A HG21 2  
ATOM 2307  H HG22 . VAL A 1 11  ? -11.730 4.639   13.809  1.00 0.00 ?  224 VAL A HG22 2  
ATOM 2308  H HG23 . VAL A 1 11  ? -10.015 4.575   13.339  1.00 0.00 ?  224 VAL A HG23 2  
ATOM 2309  N N    . ARG A 1 12  ? -9.724  1.255   10.383  1.00 0.00 ?  225 ARG A N    2  
ATOM 2310  C CA   . ARG A 1 12  ? -8.769  0.162   10.326  1.00 0.00 ?  225 ARG A CA   2  
ATOM 2311  C C    . ARG A 1 12  ? -7.710  0.436   9.255   1.00 0.00 ?  225 ARG A C    2  
ATOM 2312  O O    . ARG A 1 12  ? -6.560  0.025   9.395   1.00 0.00 ?  225 ARG A O    2  
ATOM 2313  C CB   . ARG A 1 12  ? -9.467  -1.164  10.015  1.00 0.00 ?  225 ARG A CB   2  
ATOM 2314  C CG   . ARG A 1 12  ? -9.076  -2.240  11.030  1.00 0.00 ?  225 ARG A CG   2  
ATOM 2315  C CD   . ARG A 1 12  ? -7.814  -2.982  10.583  1.00 0.00 ?  225 ARG A CD   2  
ATOM 2316  N NE   . ARG A 1 12  ? -6.874  -3.111  11.719  1.00 0.00 ?  225 ARG A NE   2  
ATOM 2317  C CZ   . ARG A 1 12  ? -7.012  -4.000  12.712  1.00 0.00 ?  225 ARG A CZ   2  
ATOM 2318  N NH1  . ARG A 1 12  ? -8.053  -4.844  12.715  1.00 0.00 ?  225 ARG A NH1  2  
ATOM 2319  N NH2  . ARG A 1 12  ? -6.110  -4.044  13.701  1.00 0.00 1  225 ARG A NH2  2  
ATOM 2320  H H    . ARG A 1 12  ? -10.654 1.019   10.102  1.00 0.00 ?  225 ARG A H    2  
ATOM 2321  H HA   . ARG A 1 12  ? -8.322  0.130   11.320  1.00 0.00 ?  225 ARG A HA   2  
ATOM 2322  H HB2  . ARG A 1 12  ? -10.547 -1.022  10.028  1.00 0.00 ?  225 ARG A HB2  2  
ATOM 2323  H HB3  . ARG A 1 12  ? -9.201  -1.492  9.010   1.00 0.00 ?  225 ARG A HB3  2  
ATOM 2324  H HG2  . ARG A 1 12  ? -8.907  -1.783  12.004  1.00 0.00 ?  225 ARG A HG2  2  
ATOM 2325  H HG3  . ARG A 1 12  ? -9.896  -2.949  11.148  1.00 0.00 ?  225 ARG A HG3  2  
ATOM 2326  H HD2  . ARG A 1 12  ? -8.078  -3.970  10.205  1.00 0.00 ?  225 ARG A HD2  2  
ATOM 2327  H HD3  . ARG A 1 12  ? -7.337  -2.445  9.764   1.00 0.00 ?  225 ARG A HD3  2  
ATOM 2328  H HE   . ARG A 1 12  ? -6.087  -2.495  11.747  1.00 0.00 ?  225 ARG A HE   2  
ATOM 2329  H HH11 . ARG A 1 12  ? -8.726  -4.811  11.976  1.00 0.00 ?  225 ARG A HH11 2  
ATOM 2330  H HH12 . ARG A 1 12  ? -8.155  -5.508  13.456  1.00 0.00 ?  225 ARG A HH12 2  
ATOM 2331  H HH21 . ARG A 1 12  ? -5.333  -3.414  13.699  1.00 0.00 ?  225 ARG A HH21 2  
ATOM 2332  H HH22 . ARG A 1 12  ? -6.213  -4.708  14.443  1.00 0.00 ?  225 ARG A HH22 2  
ATOM 2333  N N    . ASN A 1 13  ? -8.138  1.130   8.210   1.00 0.00 ?  226 ASN A N    2  
ATOM 2334  C CA   . ASN A 1 13  ? -7.242  1.464   7.117   1.00 0.00 ?  226 ASN A CA   2  
ATOM 2335  C C    . ASN A 1 13  ? -6.400  2.681   7.506   1.00 0.00 ?  226 ASN A C    2  
ATOM 2336  O O    . ASN A 1 13  ? -5.258  2.816   7.069   1.00 0.00 ?  226 ASN A O    2  
ATOM 2337  C CB   . ASN A 1 13  ? -8.025  1.817   5.851   1.00 0.00 ?  226 ASN A CB   2  
ATOM 2338  C CG   . ASN A 1 13  ? -7.242  1.427   4.595   1.00 0.00 ?  226 ASN A CG   2  
ATOM 2339  O OD1  . ASN A 1 13  ? -6.222  0.761   4.650   1.00 0.00 ?  226 ASN A OD1  2  
ATOM 2340  N ND2  . ASN A 1 13  ? -7.775  1.879   3.464   1.00 0.00 ?  226 ASN A ND2  2  
ATOM 2341  H H    . ASN A 1 13  ? -9.075  1.461   8.105   1.00 0.00 ?  226 ASN A H    2  
ATOM 2342  H HA   . ASN A 1 13  ? -6.636  0.571   6.960   1.00 0.00 ?  226 ASN A HA   2  
ATOM 2343  H HB2  . ASN A 1 13  ? -8.986  1.303   5.859   1.00 0.00 ?  226 ASN A HB2  2  
ATOM 2344  H HB3  . ASN A 1 13  ? -8.236  2.886   5.835   1.00 0.00 ?  226 ASN A HB3  2  
ATOM 2345  H HD21 . ASN A 1 13  ? -8.615  2.421   3.488   1.00 0.00 ?  226 ASN A HD21 2  
ATOM 2346  H HD22 . ASN A 1 13  ? -7.336  1.677   2.588   1.00 0.00 ?  226 ASN A HD22 2  
ATOM 2347  N N    . TRP A 1 14  ? -6.996  3.535   8.325   1.00 0.00 ?  227 TRP A N    2  
ATOM 2348  C CA   . TRP A 1 14  ? -6.316  4.736   8.779   1.00 0.00 ?  227 TRP A CA   2  
ATOM 2349  C C    . TRP A 1 14  ? -5.156  4.310   9.681   1.00 0.00 ?  227 TRP A C    2  
ATOM 2350  O O    . TRP A 1 14  ? -4.057  4.855   9.585   1.00 0.00 ?  227 TRP A O    2  
ATOM 2351  C CB   . TRP A 1 14  ? -7.291  5.691   9.470   1.00 0.00 ?  227 TRP A CB   2  
ATOM 2352  C CG   . TRP A 1 14  ? -6.843  7.154   9.458   1.00 0.00 ?  227 TRP A CG   2  
ATOM 2353  C CD1  . TRP A 1 14  ? -5.598  7.634   9.336   1.00 0.00 ?  227 TRP A CD1  2  
ATOM 2354  C CD2  . TRP A 1 14  ? -7.692  8.314   9.579   1.00 0.00 ?  227 TRP A CD2  2  
ATOM 2355  N NE1  . TRP A 1 14  ? -5.583  9.014   9.370   1.00 0.00 ?  227 TRP A NE1  2  
ATOM 2356  C CE2  . TRP A 1 14  ? -6.897  9.441   9.522   1.00 0.00 ?  227 TRP A CE2  2  
ATOM 2357  C CE3  . TRP A 1 14  ? -9.087  8.409   9.732   1.00 0.00 ?  227 TRP A CE3  2  
ATOM 2358  C CZ2  . TRP A 1 14  ? -7.404  10.742  9.610   1.00 0.00 ?  227 TRP A CZ2  2  
ATOM 2359  C CZ3  . TRP A 1 14  ? -9.578  9.717   9.819   1.00 0.00 ?  227 TRP A CZ3  2  
ATOM 2360  C CH2  . TRP A 1 14  ? -8.790  10.861  9.763   1.00 0.00 ?  227 TRP A CH2  2  
ATOM 2361  H H    . TRP A 1 14  ? -7.925  3.417   8.677   1.00 0.00 ?  227 TRP A H    2  
ATOM 2362  H HA   . TRP A 1 14  ? -5.933  5.254   7.899   1.00 0.00 ?  227 TRP A HA   2  
ATOM 2363  H HB2  . TRP A 1 14  ? -8.263  5.616   8.983   1.00 0.00 ?  227 TRP A HB2  2  
ATOM 2364  H HB3  . TRP A 1 14  ? -7.426  5.371   10.503  1.00 0.00 ?  227 TRP A HB3  2  
ATOM 2365  H HD1  . TRP A 1 14  ? -4.709  7.014   9.225   1.00 0.00 ?  227 TRP A HD1  2  
ATOM 2366  H HE1  . TRP A 1 14  ? -4.702  9.652   9.291   1.00 0.00 ?  227 TRP A HE1  2  
ATOM 2367  H HE3  . TRP A 1 14  ? -9.736  7.535   9.780   1.00 0.00 ?  227 TRP A HE3  2  
ATOM 2368  H HZ2  . TRP A 1 14  ? -6.754  11.616  9.562   1.00 0.00 ?  227 TRP A HZ2  2  
ATOM 2369  H HZ3  . TRP A 1 14  ? -10.653 9.848   9.938   1.00 0.00 ?  227 TRP A HZ3  2  
ATOM 2370  H HH2  . TRP A 1 14  ? -9.250  11.847  9.837   1.00 0.00 ?  227 TRP A HH2  2  
ATOM 2371  N N    . GLN A 1 15  ? -5.440  3.340   10.538  1.00 0.00 ?  228 GLN A N    2  
ATOM 2372  C CA   . GLN A 1 15  ? -4.434  2.835   11.456  1.00 0.00 ?  228 GLN A CA   2  
ATOM 2373  C C    . GLN A 1 15  ? -3.379  2.028   10.697  1.00 0.00 ?  228 GLN A C    2  
ATOM 2374  O O    . GLN A 1 15  ? -2.187  2.133   10.983  1.00 0.00 ?  228 GLN A O    2  
ATOM 2375  C CB   . GLN A 1 15  ? -5.075  1.995   12.563  1.00 0.00 ?  228 GLN A CB   2  
ATOM 2376  C CG   . GLN A 1 15  ? -5.792  0.775   11.980  1.00 0.00 ?  228 GLN A CG   2  
ATOM 2377  C CD   . GLN A 1 15  ? -6.377  -0.099  13.091  1.00 0.00 ?  228 GLN A CD   2  
ATOM 2378  O OE1  . GLN A 1 15  ? -5.798  -1.089  13.507  1.00 0.00 ?  228 GLN A OE1  2  
ATOM 2379  N NE2  . GLN A 1 15  ? -7.554  0.320   13.547  1.00 0.00 ?  228 GLN A NE2  2  
ATOM 2380  H H    . GLN A 1 15  ? -6.336  2.902   10.610  1.00 0.00 ?  228 GLN A H    2  
ATOM 2381  H HA   . GLN A 1 15  ? -3.975  3.719   11.899  1.00 0.00 ?  228 GLN A HA   2  
ATOM 2382  H HB2  . GLN A 1 15  ? -4.309  1.669   13.267  1.00 0.00 ?  228 GLN A HB2  2  
ATOM 2383  H HB3  . GLN A 1 15  ? -5.783  2.605   13.123  1.00 0.00 ?  228 GLN A HB3  2  
ATOM 2384  H HG2  . GLN A 1 15  ? -6.589  1.102   11.313  1.00 0.00 ?  228 GLN A HG2  2  
ATOM 2385  H HG3  . GLN A 1 15  ? -5.094  0.190   11.382  1.00 0.00 ?  228 GLN A HG3  2  
ATOM 2386  H HE21 . GLN A 1 15  ? -7.975  1.142   13.162  1.00 0.00 ?  228 GLN A HE21 2  
ATOM 2387  H HE22 . GLN A 1 15  ? -8.017  -0.185  14.274  1.00 0.00 ?  228 GLN A HE22 2  
ATOM 2388  N N    . LEU A 1 16  ? -3.855  1.240   9.744   1.00 0.00 ?  229 LEU A N    2  
ATOM 2389  C CA   . LEU A 1 16  ? -2.968  0.416   8.941   1.00 0.00 ?  229 LEU A CA   2  
ATOM 2390  C C    . LEU A 1 16  ? -2.006  1.317   8.164   1.00 0.00 ?  229 LEU A C    2  
ATOM 2391  O O    . LEU A 1 16  ? -0.797  1.087   8.165   1.00 0.00 ?  229 LEU A O    2  
ATOM 2392  C CB   . LEU A 1 16  ? -3.775  -0.532  8.053   1.00 0.00 ?  229 LEU A CB   2  
ATOM 2393  C CG   . LEU A 1 16  ? -3.726  -2.013  8.434   1.00 0.00 ?  229 LEU A CG   2  
ATOM 2394  C CD1  . LEU A 1 16  ? -5.100  -2.509  8.887   1.00 0.00 ?  229 LEU A CD1  2  
ATOM 2395  C CD2  . LEU A 1 16  ? -3.162  -2.856  7.288   1.00 0.00 ?  229 LEU A CD2  2  
ATOM 2396  H H    . LEU A 1 16  ? -4.826  1.161   9.517   1.00 0.00 ?  229 LEU A H    2  
ATOM 2397  H HA   . LEU A 1 16  ? -2.386  -0.201  9.626   1.00 0.00 ?  229 LEU A HA   2  
ATOM 2398  H HB2  . LEU A 1 16  ? -4.816  -0.210  8.062   1.00 0.00 ?  229 LEU A HB2  2  
ATOM 2399  H HB3  . LEU A 1 16  ? -3.419  -0.429  7.028   1.00 0.00 ?  229 LEU A HB3  2  
ATOM 2400  H HG   . LEU A 1 16  ? -3.048  -2.126  9.280   1.00 0.00 ?  229 LEU A HG   2  
ATOM 2401  H HD11 . LEU A 1 16  ? -5.274  -2.204  9.919   1.00 0.00 ?  229 LEU A HD11 2  
ATOM 2402  H HD12 . LEU A 1 16  ? -5.871  -2.080  8.246   1.00 0.00 ?  229 LEU A HD12 2  
ATOM 2403  H HD13 . LEU A 1 16  ? -5.135  -3.596  8.819   1.00 0.00 ?  229 LEU A HD13 2  
ATOM 2404  H HD21 . LEU A 1 16  ? -2.617  -3.707  7.697   1.00 0.00 ?  229 LEU A HD21 2  
ATOM 2405  H HD22 . LEU A 1 16  ? -3.980  -3.215  6.664   1.00 0.00 ?  229 LEU A HD22 2  
ATOM 2406  H HD23 . LEU A 1 16  ? -2.486  -2.247  6.687   1.00 0.00 ?  229 LEU A HD23 2  
ATOM 2407  N N    . VAL A 1 17  ? -2.578  2.323   7.519   1.00 0.00 ?  230 VAL A N    2  
ATOM 2408  C CA   . VAL A 1 17  ? -1.786  3.260   6.740   1.00 0.00 ?  230 VAL A CA   2  
ATOM 2409  C C    . VAL A 1 17  ? -0.917  4.094   7.683   1.00 0.00 ?  230 VAL A C    2  
ATOM 2410  O O    . VAL A 1 17  ? 0.241   4.377   7.378   1.00 0.00 ?  230 VAL A O    2  
ATOM 2411  C CB   . VAL A 1 17  ? -2.702  4.112   5.859   1.00 0.00 ?  230 VAL A CB   2  
ATOM 2412  C CG1  . VAL A 1 17  ? -3.425  5.175   6.688   1.00 0.00 ?  230 VAL A CG1  2  
ATOM 2413  C CG2  . VAL A 1 17  ? -1.918  4.752   4.712   1.00 0.00 ?  230 VAL A CG2  2  
ATOM 2414  H H    . VAL A 1 17  ? -3.562  2.503   7.524   1.00 0.00 ?  230 VAL A H    2  
ATOM 2415  H HA   . VAL A 1 17  ? -1.136  2.677   6.087   1.00 0.00 ?  230 VAL A HA   2  
ATOM 2416  H HB   . VAL A 1 17  ? -3.455  3.456   5.425   1.00 0.00 ?  230 VAL A HB   2  
ATOM 2417  H HG11 . VAL A 1 17  ? -2.694  5.770   7.235   1.00 0.00 ?  230 VAL A HG11 2  
ATOM 2418  H HG12 . VAL A 1 17  ? -3.999  5.824   6.026   1.00 0.00 ?  230 VAL A HG12 2  
ATOM 2419  H HG13 . VAL A 1 17  ? -4.099  4.689   7.394   1.00 0.00 ?  230 VAL A HG13 2  
ATOM 2420  H HG21 . VAL A 1 17  ? -0.863  4.811   4.981   1.00 0.00 ?  230 VAL A HG21 2  
ATOM 2421  H HG22 . VAL A 1 17  ? -2.030  4.145   3.813   1.00 0.00 ?  230 VAL A HG22 2  
ATOM 2422  H HG23 . VAL A 1 17  ? -2.302  5.755   4.523   1.00 0.00 ?  230 VAL A HG23 2  
ATOM 2423  N N    . ALA A 1 18  ? -1.508  4.464   8.809   1.00 0.00 ?  231 ALA A N    2  
ATOM 2424  C CA   . ALA A 1 18  ? -0.802  5.261   9.799   1.00 0.00 ?  231 ALA A CA   2  
ATOM 2425  C C    . ALA A 1 18  ? 0.246   4.390   10.494  1.00 0.00 ?  231 ALA A C    2  
ATOM 2426  O O    . ALA A 1 18  ? 1.156   4.905   11.141  1.00 0.00 ?  231 ALA A O    2  
ATOM 2427  C CB   . ALA A 1 18  ? -1.808  5.861   10.783  1.00 0.00 ?  231 ALA A CB   2  
ATOM 2428  H H    . ALA A 1 18  ? -2.450  4.230   9.050   1.00 0.00 ?  231 ALA A H    2  
ATOM 2429  H HA   . ALA A 1 18  ? -0.298  6.072   9.273   1.00 0.00 ?  231 ALA A HA   2  
ATOM 2430  H HB1  . ALA A 1 18  ? -1.272  6.368   11.586  1.00 0.00 ?  231 ALA A HB1  2  
ATOM 2431  H HB2  . ALA A 1 18  ? -2.443  6.577   10.262  1.00 0.00 ?  231 ALA A HB2  2  
ATOM 2432  H HB3  . ALA A 1 18  ? -2.424  5.066   11.203  1.00 0.00 ?  231 ALA A HB3  2  
ATOM 2433  N N    . ALA A 1 19  ? 0.083   3.084   10.337  1.00 0.00 ?  232 ALA A N    2  
ATOM 2434  C CA   . ALA A 1 19  ? 1.004   2.137   10.943  1.00 0.00 ?  232 ALA A CA   2  
ATOM 2435  C C    . ALA A 1 19  ? 2.252   2.014   10.066  1.00 0.00 ?  232 ALA A C    2  
ATOM 2436  O O    . ALA A 1 19  ? 3.246   1.418   10.476  1.00 0.00 ?  232 ALA A O    2  
ATOM 2437  C CB   . ALA A 1 19  ? 0.297   0.795   11.142  1.00 0.00 ?  232 ALA A CB   2  
ATOM 2438  H H    . ALA A 1 19  ? -0.660  2.673   9.809   1.00 0.00 ?  232 ALA A H    2  
ATOM 2439  H HA   . ALA A 1 19  ? 1.292   2.531   11.917  1.00 0.00 ?  232 ALA A HA   2  
ATOM 2440  H HB1  . ALA A 1 19  ? 1.023   0.046   11.458  1.00 0.00 ?  232 ALA A HB1  2  
ATOM 2441  H HB2  . ALA A 1 19  ? -0.473  0.899   11.907  1.00 0.00 ?  232 ALA A HB2  2  
ATOM 2442  H HB3  . ALA A 1 19  ? -0.162  0.483   10.204  1.00 0.00 ?  232 ALA A HB3  2  
ATOM 2443  N N    . VAL A 1 20  ? 2.158   2.589   8.876   1.00 0.00 ?  233 VAL A N    2  
ATOM 2444  C CA   . VAL A 1 20  ? 3.267   2.551   7.938   1.00 0.00 ?  233 VAL A CA   2  
ATOM 2445  C C    . VAL A 1 20  ? 4.282   3.634   8.311   1.00 0.00 ?  233 VAL A C    2  
ATOM 2446  O O    . VAL A 1 20  ? 3.948   4.817   8.347   1.00 0.00 ?  233 VAL A O    2  
ATOM 2447  C CB   . VAL A 1 20  ? 2.746   2.688   6.506   1.00 0.00 ?  233 VAL A CB   2  
ATOM 2448  C CG1  . VAL A 1 20  ? 3.830   2.320   5.490   1.00 0.00 ?  233 VAL A CG1  2  
ATOM 2449  C CG2  . VAL A 1 20  ? 1.489   1.842   6.296   1.00 0.00 ?  233 VAL A CG2  2  
ATOM 2450  H H    . VAL A 1 20  ? 1.346   3.072   8.550   1.00 0.00 ?  233 VAL A H    2  
ATOM 2451  H HA   . VAL A 1 20  ? 3.744   1.575   8.031   1.00 0.00 ?  233 VAL A HA   2  
ATOM 2452  H HB   . VAL A 1 20  ? 2.478   3.732   6.345   1.00 0.00 ?  233 VAL A HB   2  
ATOM 2453  H HG11 . VAL A 1 20  ? 3.883   3.090   4.720   1.00 0.00 ?  233 VAL A HG11 2  
ATOM 2454  H HG12 . VAL A 1 20  ? 4.793   2.247   5.997   1.00 0.00 ?  233 VAL A HG12 2  
ATOM 2455  H HG13 . VAL A 1 20  ? 3.588   1.362   5.030   1.00 0.00 ?  233 VAL A HG13 2  
ATOM 2456  H HG21 . VAL A 1 20  ? 1.236   1.824   5.236   1.00 0.00 ?  233 VAL A HG21 2  
ATOM 2457  H HG22 . VAL A 1 20  ? 1.674   0.825   6.643   1.00 0.00 ?  233 VAL A HG22 2  
ATOM 2458  H HG23 . VAL A 1 20  ? 0.662   2.274   6.860   1.00 0.00 ?  233 VAL A HG23 2  
ATOM 2459  N N    . PRO A 1 21  ? 5.534   3.178   8.586   1.00 0.00 ?  234 PRO A N    2  
ATOM 2460  C CA   . PRO A 1 21  ? 6.599   4.094   8.955   1.00 0.00 ?  234 PRO A CA   2  
ATOM 2461  C C    . PRO A 1 21  ? 7.110   4.862   7.734   1.00 0.00 ?  234 PRO A C    2  
ATOM 2462  O O    . PRO A 1 21  ? 7.754   5.900   7.874   1.00 0.00 ?  234 PRO A O    2  
ATOM 2463  C CB   . PRO A 1 21  ? 7.665   3.220   9.595   1.00 0.00 ?  234 PRO A CB   2  
ATOM 2464  C CG   . PRO A 1 21  ? 7.366   1.799   9.144   1.00 0.00 ?  234 PRO A CG   2  
ATOM 2465  C CD   . PRO A 1 21  ? 5.966   1.784   8.553   1.00 0.00 ?  234 PRO A CD   2  
ATOM 2466  H HA   . PRO A 1 21  ? 6.257   4.787   9.590   1.00 0.00 ?  234 PRO A HA   2  
ATOM 2467  H HB2  . PRO A 1 21  ? 8.663   3.527   9.281   1.00 0.00 ?  234 PRO A HB2  2  
ATOM 2468  H HB3  . PRO A 1 21  ? 7.635   3.299   10.682  1.00 0.00 ?  234 PRO A HB3  2  
ATOM 2469  H HG2  . PRO A 1 21  ? 8.096   1.471   8.405   1.00 0.00 ?  234 PRO A HG2  2  
ATOM 2470  H HG3  . PRO A 1 21  ? 7.432   1.110   9.986   1.00 0.00 ?  234 PRO A HG3  2  
ATOM 2471  H HD2  . PRO A 1 21  ? 5.970   1.394   7.535   1.00 0.00 ?  234 PRO A HD2  2  
ATOM 2472  H HD3  . PRO A 1 21  ? 5.297   1.148   9.134   1.00 0.00 ?  234 PRO A HD3  2  
ATOM 2473  N N    . LEU A 1 22  ? 6.803   4.321   6.564   1.00 0.00 ?  235 LEU A N    2  
ATOM 2474  C CA   . LEU A 1 22  ? 7.223   4.942   5.319   1.00 0.00 ?  235 LEU A CA   2  
ATOM 2475  C C    . LEU A 1 22  ? 6.338   6.157   5.037   1.00 0.00 ?  235 LEU A C    2  
ATOM 2476  O O    . LEU A 1 22  ? 6.722   7.047   4.279   1.00 0.00 ?  235 LEU A O    2  
ATOM 2477  C CB   . LEU A 1 22  ? 7.237   3.914   4.186   1.00 0.00 ?  235 LEU A CB   2  
ATOM 2478  C CG   . LEU A 1 22  ? 8.243   4.168   3.062   1.00 0.00 ?  235 LEU A CG   2  
ATOM 2479  C CD1  . LEU A 1 22  ? 9.656   3.763   3.489   1.00 0.00 ?  235 LEU A CD1  2  
ATOM 2480  C CD2  . LEU A 1 22  ? 7.812   3.469   1.771   1.00 0.00 ?  235 LEU A CD2  2  
ATOM 2481  H H    . LEU A 1 22  ? 6.279   3.475   6.459   1.00 0.00 ?  235 LEU A H    2  
ATOM 2482  H HA   . LEU A 1 22  ? 8.249   5.285   5.455   1.00 0.00 ?  235 LEU A HA   2  
ATOM 2483  H HB2  . LEU A 1 22  ? 7.440   2.933   4.614   1.00 0.00 ?  235 LEU A HB2  2  
ATOM 2484  H HB3  . LEU A 1 22  ? 6.239   3.871   3.749   1.00 0.00 ?  235 LEU A HB3  2  
ATOM 2485  H HG   . LEU A 1 22  ? 8.264   5.239   2.857   1.00 0.00 ?  235 LEU A HG   2  
ATOM 2486  H HD11 . LEU A 1 22  ? 9.960   4.359   4.350   1.00 0.00 ?  235 LEU A HD11 2  
ATOM 2487  H HD12 . LEU A 1 22  ? 9.665   2.706   3.757   1.00 0.00 ?  235 LEU A HD12 2  
ATOM 2488  H HD13 . LEU A 1 22  ? 10.348  3.935   2.665   1.00 0.00 ?  235 LEU A HD13 2  
ATOM 2489  H HD21 . LEU A 1 22  ? 6.775   3.721   1.551   1.00 0.00 ?  235 LEU A HD21 2  
ATOM 2490  H HD22 . LEU A 1 22  ? 8.448   3.799   0.950   1.00 0.00 ?  235 LEU A HD22 2  
ATOM 2491  H HD23 . LEU A 1 22  ? 7.907   2.390   1.893   1.00 0.00 ?  235 LEU A HD23 2  
ATOM 2492  N N    . PHE A 1 23  ? 5.170   6.156   5.662   1.00 0.00 ?  236 PHE A N    2  
ATOM 2493  C CA   . PHE A 1 23  ? 4.227   7.248   5.487   1.00 0.00 ?  236 PHE A CA   2  
ATOM 2494  C C    . PHE A 1 23  ? 4.133   8.100   6.755   1.00 0.00 ?  236 PHE A C    2  
ATOM 2495  O O    . PHE A 1 23  ? 3.271   8.970   6.859   1.00 0.00 ?  236 PHE A O    2  
ATOM 2496  C CB   . PHE A 1 23  ? 2.860   6.619   5.208   1.00 0.00 ?  236 PHE A CB   2  
ATOM 2497  C CG   . PHE A 1 23  ? 2.648   6.213   3.748   1.00 0.00 ?  236 PHE A CG   2  
ATOM 2498  C CD1  . PHE A 1 23  ? 3.651   5.606   3.058   1.00 0.00 ?  236 PHE A CD1  2  
ATOM 2499  C CD2  . PHE A 1 23  ? 1.458   6.461   3.139   1.00 0.00 ?  236 PHE A CD2  2  
ATOM 2500  C CE1  . PHE A 1 23  ? 3.455   5.230   1.703   1.00 0.00 ?  236 PHE A CE1  2  
ATOM 2501  C CE2  . PHE A 1 23  ? 1.261   6.085   1.784   1.00 0.00 ?  236 PHE A CE2  2  
ATOM 2502  C CZ   . PHE A 1 23  ? 2.264   5.477   1.095   1.00 0.00 ?  236 PHE A CZ   2  
ATOM 2503  H H    . PHE A 1 23  ? 4.865   5.429   6.276   1.00 0.00 ?  236 PHE A H    2  
ATOM 2504  H HA   . PHE A 1 23  ? 4.592   7.863   4.665   1.00 0.00 ?  236 PHE A HA   2  
ATOM 2505  H HB2  . PHE A 1 23  ? 2.741   5.738   5.839   1.00 0.00 ?  236 PHE A HB2  2  
ATOM 2506  H HB3  . PHE A 1 23  ? 2.081   7.325   5.495   1.00 0.00 ?  236 PHE A HB3  2  
ATOM 2507  H HD1  . PHE A 1 23  ? 4.606   5.407   3.546   1.00 0.00 ?  236 PHE A HD1  2  
ATOM 2508  H HD2  . PHE A 1 23  ? 0.654   6.948   3.692   1.00 0.00 ?  236 PHE A HD2  2  
ATOM 2509  H HE1  . PHE A 1 23  ? 4.258   4.743   1.151   1.00 0.00 ?  236 PHE A HE1  2  
ATOM 2510  H HE2  . PHE A 1 23  ? 0.307   6.283   1.296   1.00 0.00 ?  236 PHE A HE2  2  
ATOM 2511  H HZ   . PHE A 1 23  ? 2.113   5.189   0.054   1.00 0.00 ?  236 PHE A HZ   2  
ATOM 2512  N N    . GLN A 1 24  ? 5.033   7.818   7.686   1.00 0.00 ?  237 GLN A N    2  
ATOM 2513  C CA   . GLN A 1 24  ? 5.063   8.548   8.942   1.00 0.00 ?  237 GLN A CA   2  
ATOM 2514  C C    . GLN A 1 24  ? 5.470   10.003  8.701   1.00 0.00 ?  237 GLN A C    2  
ATOM 2515  O O    . GLN A 1 24  ? 5.212   10.869  9.536   1.00 0.00 ?  237 GLN A O    2  
ATOM 2516  C CB   . GLN A 1 24  ? 6.002   7.874   9.945   1.00 0.00 ?  237 GLN A CB   2  
ATOM 2517  C CG   . GLN A 1 24  ? 5.314   7.685   11.299  1.00 0.00 ?  237 GLN A CG   2  
ATOM 2518  C CD   . GLN A 1 24  ? 6.334   7.357   12.391  1.00 0.00 ?  237 GLN A CD   2  
ATOM 2519  O OE1  . GLN A 1 24  ? 6.330   6.288   12.978  1.00 0.00 ?  237 GLN A OE1  2  
ATOM 2520  N NE2  . GLN A 1 24  ? 7.205   8.334   12.628  1.00 0.00 ?  237 GLN A NE2  2  
ATOM 2521  H H    . GLN A 1 24  ? 5.731   7.109   7.593   1.00 0.00 ?  237 GLN A H    2  
ATOM 2522  H HA   . GLN A 1 24  ? 4.043   8.507   9.325   1.00 0.00 ?  237 GLN A HA   2  
ATOM 2523  H HB2  . GLN A 1 24  ? 6.321   6.907   9.557   1.00 0.00 ?  237 GLN A HB2  2  
ATOM 2524  H HB3  . GLN A 1 24  ? 6.900   8.479   10.070  1.00 0.00 ?  237 GLN A HB3  2  
ATOM 2525  H HG2  . GLN A 1 24  ? 4.771   8.592   11.564  1.00 0.00 ?  237 GLN A HG2  2  
ATOM 2526  H HG3  . GLN A 1 24  ? 4.580   6.883   11.229  1.00 0.00 ?  237 GLN A HG3  2  
ATOM 2527  H HE21 . GLN A 1 24  ? 7.153   9.187   12.110  1.00 0.00 ?  237 GLN A HE21 2  
ATOM 2528  H HE22 . GLN A 1 24  ? 7.912   8.214   13.325  1.00 0.00 ?  237 GLN A HE22 2  
ATOM 2529  N N    . LYS A 1 25  ? 6.098   10.227  7.557   1.00 0.00 ?  238 LYS A N    2  
ATOM 2530  C CA   . LYS A 1 25  ? 6.543   11.562  7.196   1.00 0.00 ?  238 LYS A CA   2  
ATOM 2531  C C    . LYS A 1 25  ? 5.362   12.354  6.634   1.00 0.00 ?  238 LYS A C    2  
ATOM 2532  O O    . LYS A 1 25  ? 5.407   13.582  6.570   1.00 0.00 ?  238 LYS A O    2  
ATOM 2533  C CB   . LYS A 1 25  ? 7.742   11.489  6.248   1.00 0.00 ?  238 LYS A CB   2  
ATOM 2534  C CG   . LYS A 1 25  ? 8.824   10.560  6.801   1.00 0.00 ?  238 LYS A CG   2  
ATOM 2535  C CD   . LYS A 1 25  ? 9.462   11.149  8.061   1.00 0.00 ?  238 LYS A CD   2  
ATOM 2536  C CE   . LYS A 1 25  ? 10.484  10.183  8.662   1.00 0.00 ?  238 LYS A CE   2  
ATOM 2537  N NZ   . LYS A 1 25  ? 11.288  10.860  9.703   1.00 0.00 1  238 LYS A NZ   2  
ATOM 2538  H H    . LYS A 1 25  ? 6.304   9.516   6.884   1.00 0.00 ?  238 LYS A H    2  
ATOM 2539  H HA   . LYS A 1 25  ? 6.884   12.050  8.109   1.00 0.00 ?  238 LYS A HA   2  
ATOM 2540  H HB2  . LYS A 1 25  ? 7.417   11.133  5.271   1.00 0.00 ?  238 LYS A HB2  2  
ATOM 2541  H HB3  . LYS A 1 25  ? 8.155   12.487  6.101   1.00 0.00 ?  238 LYS A HB3  2  
ATOM 2542  H HG2  . LYS A 1 25  ? 8.389   9.587   7.031   1.00 0.00 ?  238 LYS A HG2  2  
ATOM 2543  H HG3  . LYS A 1 25  ? 9.590   10.396  6.044   1.00 0.00 ?  238 LYS A HG3  2  
ATOM 2544  H HD2  . LYS A 1 25  ? 9.948   12.094  7.818   1.00 0.00 ?  238 LYS A HD2  2  
ATOM 2545  H HD3  . LYS A 1 25  ? 8.687   11.369  8.796   1.00 0.00 ?  238 LYS A HD3  2  
ATOM 2546  H HE2  . LYS A 1 25  ? 9.970   9.323   9.093   1.00 0.00 ?  238 LYS A HE2  2  
ATOM 2547  H HE3  . LYS A 1 25  ? 11.139  9.803   7.878   1.00 0.00 ?  238 LYS A HE3  2  
ATOM 2548  H HZ1  . LYS A 1 25  ? 11.058  10.483  10.601  1.00 0.00 ?  238 LYS A HZ1  2  
ATOM 2549  H HZ2  . LYS A 1 25  ? 12.261  10.715  9.520   1.00 0.00 ?  238 LYS A HZ2  2  
ATOM 2550  H HZ3  . LYS A 1 25  ? 11.090  11.840  9.692   1.00 0.00 ?  238 LYS A HZ3  2  
ATOM 2551  N N    . LEU A 1 26  ? 4.331   11.620  6.241   1.00 0.00 ?  239 LEU A N    2  
ATOM 2552  C CA   . LEU A 1 26  ? 3.139   12.239  5.686   1.00 0.00 ?  239 LEU A CA   2  
ATOM 2553  C C    . LEU A 1 26  ? 2.388   12.975  6.797   1.00 0.00 ?  239 LEU A C    2  
ATOM 2554  O O    . LEU A 1 26  ? 2.746   12.869  7.969   1.00 0.00 ?  239 LEU A O    2  
ATOM 2555  C CB   . LEU A 1 26  ? 2.288   11.200  4.952   1.00 0.00 ?  239 LEU A CB   2  
ATOM 2556  C CG   . LEU A 1 26  ? 2.896   10.616  3.675   1.00 0.00 ?  239 LEU A CG   2  
ATOM 2557  C CD1  . LEU A 1 26  ? 1.946   9.606   3.029   1.00 0.00 ?  239 LEU A CD1  2  
ATOM 2558  C CD2  . LEU A 1 26  ? 3.301   11.726  2.703   1.00 0.00 ?  239 LEU A CD2  2  
ATOM 2559  H H    . LEU A 1 26  ? 4.303   10.622  6.296   1.00 0.00 ?  239 LEU A H    2  
ATOM 2560  H HA   . LEU A 1 26  ? 3.465   12.969  4.946   1.00 0.00 ?  239 LEU A HA   2  
ATOM 2561  H HB2  . LEU A 1 26  ? 2.079   10.380  5.639   1.00 0.00 ?  239 LEU A HB2  2  
ATOM 2562  H HB3  . LEU A 1 26  ? 1.331   11.656  4.700   1.00 0.00 ?  239 LEU A HB3  2  
ATOM 2563  H HG   . LEU A 1 26  ? 3.804   10.077  3.945   1.00 0.00 ?  239 LEU A HG   2  
ATOM 2564  H HD11 . LEU A 1 26  ? 1.692   9.939   2.022   1.00 0.00 ?  239 LEU A HD11 2  
ATOM 2565  H HD12 . LEU A 1 26  ? 2.433   8.632   2.977   1.00 0.00 ?  239 LEU A HD12 2  
ATOM 2566  H HD13 . LEU A 1 26  ? 1.038   9.527   3.626   1.00 0.00 ?  239 LEU A HD13 2  
ATOM 2567  H HD21 . LEU A 1 26  ? 4.358   11.956  2.834   1.00 0.00 ?  239 LEU A HD21 2  
ATOM 2568  H HD22 . LEU A 1 26  ? 3.125   11.395  1.680   1.00 0.00 ?  239 LEU A HD22 2  
ATOM 2569  H HD23 . LEU A 1 26  ? 2.708   12.619  2.904   1.00 0.00 ?  239 LEU A HD23 2  
ATOM 2570  N N    . GLY A 1 27  ? 1.361   13.706  6.389   1.00 0.00 ?  240 GLY A N    2  
ATOM 2571  C CA   . GLY A 1 27  ? 0.556   14.459  7.335   1.00 0.00 ?  240 GLY A CA   2  
ATOM 2572  C C    . GLY A 1 27  ? -0.817  13.813  7.525   1.00 0.00 ?  240 GLY A C    2  
ATOM 2573  O O    . GLY A 1 27  ? -1.067  12.719  7.021   1.00 0.00 ?  240 GLY A O    2  
ATOM 2574  H H    . GLY A 1 27  ? 1.076   13.786  5.434   1.00 0.00 ?  240 GLY A H    2  
ATOM 2575  H HA2  . GLY A 1 27  ? 1.072   14.514  8.294   1.00 0.00 ?  240 GLY A HA2  2  
ATOM 2576  H HA3  . GLY A 1 27  ? 0.435   15.483  6.980   1.00 0.00 ?  240 GLY A HA3  2  
ATOM 2577  N N    . PRO A 1 28  ? -1.695  14.536  8.271   1.00 0.00 ?  241 PRO A N    2  
ATOM 2578  C CA   . PRO A 1 28  ? -3.037  14.044  8.533   1.00 0.00 ?  241 PRO A CA   2  
ATOM 2579  C C    . PRO A 1 28  ? -3.923  14.183  7.294   1.00 0.00 ?  241 PRO A C    2  
ATOM 2580  O O    . PRO A 1 28  ? -4.781  13.338  7.042   1.00 0.00 ?  241 PRO A O    2  
ATOM 2581  C CB   . PRO A 1 28  ? -3.533  14.864  9.713   1.00 0.00 ?  241 PRO A CB   2  
ATOM 2582  C CG   . PRO A 1 28  ? -2.640  16.093  9.771   1.00 0.00 ?  241 PRO A CG   2  
ATOM 2583  C CD   . PRO A 1 28  ? -1.434  15.835  8.883   1.00 0.00 ?  241 PRO A CD   2  
ATOM 2584  H HA   . PRO A 1 28  ? -3.013  13.067  8.744   1.00 0.00 ?  241 PRO A HA   2  
ATOM 2585  H HB2  . PRO A 1 28  ? -4.577  15.146  9.581   1.00 0.00 ?  241 PRO A HB2  2  
ATOM 2586  H HB3  . PRO A 1 28  ? -3.471  14.292  10.639  1.00 0.00 ?  241 PRO A HB3  2  
ATOM 2587  H HG2  . PRO A 1 28  ? -3.183  16.975  9.432   1.00 0.00 ?  241 PRO A HG2  2  
ATOM 2588  H HG3  . PRO A 1 28  ? -2.325  16.287  10.797  1.00 0.00 ?  241 PRO A HG3  2  
ATOM 2589  H HD2  . PRO A 1 28  ? -1.324  16.614  8.128   1.00 0.00 ?  241 PRO A HD2  2  
ATOM 2590  H HD3  . PRO A 1 28  ? -0.511  15.821  9.463   1.00 0.00 ?  241 PRO A HD3  2  
ATOM 2591  N N    . ALA A 1 29  ? -3.686  15.255  6.553   1.00 0.00 ?  242 ALA A N    2  
ATOM 2592  C CA   . ALA A 1 29  ? -4.452  15.516  5.346   1.00 0.00 ?  242 ALA A CA   2  
ATOM 2593  C C    . ALA A 1 29  ? -4.081  14.485  4.279   1.00 0.00 ?  242 ALA A C    2  
ATOM 2594  O O    . ALA A 1 29  ? -4.926  14.080  3.482   1.00 0.00 ?  242 ALA A O    2  
ATOM 2595  C CB   . ALA A 1 29  ? -4.201  16.952  4.882   1.00 0.00 ?  242 ALA A CB   2  
ATOM 2596  H H    . ALA A 1 29  ? -2.986  15.938  6.765   1.00 0.00 ?  242 ALA A H    2  
ATOM 2597  H HA   . ALA A 1 29  ? -5.508  15.406  5.594   1.00 0.00 ?  242 ALA A HA   2  
ATOM 2598  H HB1  . ALA A 1 29  ? -4.099  17.602  5.751   1.00 0.00 ?  242 ALA A HB1  2  
ATOM 2599  H HB2  . ALA A 1 29  ? -3.286  16.988  4.292   1.00 0.00 ?  242 ALA A HB2  2  
ATOM 2600  H HB3  . ALA A 1 29  ? -5.040  17.289  4.273   1.00 0.00 ?  242 ALA A HB3  2  
ATOM 2601  N N    . VAL A 1 30  ? -2.817  14.089  4.298   1.00 0.00 ?  243 VAL A N    2  
ATOM 2602  C CA   . VAL A 1 30  ? -2.323  13.113  3.342   1.00 0.00 ?  243 VAL A CA   2  
ATOM 2603  C C    . VAL A 1 30  ? -2.828  11.723  3.732   1.00 0.00 ?  243 VAL A C    2  
ATOM 2604  O O    . VAL A 1 30  ? -3.213  10.934  2.871   1.00 0.00 ?  243 VAL A O    2  
ATOM 2605  C CB   . VAL A 1 30  ? -0.798  13.193  3.253   1.00 0.00 ?  243 VAL A CB   2  
ATOM 2606  C CG1  . VAL A 1 30  ? -0.209  11.875  2.743   1.00 0.00 ?  243 VAL A CG1  2  
ATOM 2607  C CG2  . VAL A 1 30  ? -0.360  14.365  2.373   1.00 0.00 ?  243 VAL A CG2  2  
ATOM 2608  H H    . VAL A 1 30  ? -2.136  14.424  4.950   1.00 0.00 ?  243 VAL A H    2  
ATOM 2609  H HA   . VAL A 1 30  ? -2.732  13.373  2.365   1.00 0.00 ?  243 VAL A HA   2  
ATOM 2610  H HB   . VAL A 1 30  ? -0.412  13.365  4.258   1.00 0.00 ?  243 VAL A HB   2  
ATOM 2611  H HG11 . VAL A 1 30  ? -0.776  11.536  1.876   1.00 0.00 ?  243 VAL A HG11 2  
ATOM 2612  H HG12 . VAL A 1 30  ? 0.832   12.028  2.460   1.00 0.00 ?  243 VAL A HG12 2  
ATOM 2613  H HG13 . VAL A 1 30  ? -0.265  11.124  3.531   1.00 0.00 ?  243 VAL A HG13 2  
ATOM 2614  H HG21 . VAL A 1 30  ? 0.451   14.904  2.863   1.00 0.00 ?  243 VAL A HG21 2  
ATOM 2615  H HG22 . VAL A 1 30  ? -0.017  13.989  1.410   1.00 0.00 ?  243 VAL A HG22 2  
ATOM 2616  H HG23 . VAL A 1 30  ? -1.203  15.039  2.220   1.00 0.00 ?  243 VAL A HG23 2  
ATOM 2617  N N    . LEU A 1 31  ? -2.810  11.465  5.032   1.00 0.00 ?  244 LEU A N    2  
ATOM 2618  C CA   . LEU A 1 31  ? -3.260  10.183  5.547   1.00 0.00 ?  244 LEU A CA   2  
ATOM 2619  C C    . LEU A 1 31  ? -4.755  10.022  5.264   1.00 0.00 ?  244 LEU A C    2  
ATOM 2620  O O    . LEU A 1 31  ? -5.210  8.937   4.906   1.00 0.00 ?  244 LEU A O    2  
ATOM 2621  C CB   . LEU A 1 31  ? -2.896  10.042  7.026   1.00 0.00 ?  244 LEU A CB   2  
ATOM 2622  C CG   . LEU A 1 31  ? -1.527  9.425   7.323   1.00 0.00 ?  244 LEU A CG   2  
ATOM 2623  C CD1  . LEU A 1 31  ? -1.622  7.901   7.421   1.00 0.00 ?  244 LEU A CD1  2  
ATOM 2624  C CD2  . LEU A 1 31  ? -0.489  9.870   6.291   1.00 0.00 ?  244 LEU A CD2  2  
ATOM 2625  H H    . LEU A 1 31  ? -2.495  12.112  5.726   1.00 0.00 ?  244 LEU A H    2  
ATOM 2626  H HA   . LEU A 1 31  ? -2.721  9.406   5.006   1.00 0.00 ?  244 LEU A HA   2  
ATOM 2627  H HB2  . LEU A 1 31  ? -2.934  11.030  7.485   1.00 0.00 ?  244 LEU A HB2  2  
ATOM 2628  H HB3  . LEU A 1 31  ? -3.659  9.434   7.511   1.00 0.00 ?  244 LEU A HB3  2  
ATOM 2629  H HG   . LEU A 1 31  ? -1.192  9.790   8.294   1.00 0.00 ?  244 LEU A HG   2  
ATOM 2630  H HD11 . LEU A 1 31  ? -0.733  7.513   7.916   1.00 0.00 ?  244 LEU A HD11 2  
ATOM 2631  H HD12 . LEU A 1 31  ? -2.507  7.628   7.996   1.00 0.00 ?  244 LEU A HD12 2  
ATOM 2632  H HD13 . LEU A 1 31  ? -1.695  7.477   6.419   1.00 0.00 ?  244 LEU A HD13 2  
ATOM 2633  H HD21 . LEU A 1 31  ? 0.490   9.934   6.765   1.00 0.00 ?  244 LEU A HD21 2  
ATOM 2634  H HD22 . LEU A 1 31  ? -0.453  9.146   5.477   1.00 0.00 ?  244 LEU A HD22 2  
ATOM 2635  H HD23 . LEU A 1 31  ? -0.766  10.848  5.896   1.00 0.00 ?  244 LEU A HD23 2  
ATOM 2636  N N    . VAL A 1 32  ? -5.479  11.119  5.436   1.00 0.00 ?  245 VAL A N    2  
ATOM 2637  C CA   . VAL A 1 32  ? -6.913  11.113  5.204   1.00 0.00 ?  245 VAL A CA   2  
ATOM 2638  C C    . VAL A 1 32  ? -7.182  10.990  3.702   1.00 0.00 ?  245 VAL A C    2  
ATOM 2639  O O    . VAL A 1 32  ? -8.072  10.249  3.286   1.00 0.00 ?  245 VAL A O    2  
ATOM 2640  C CB   . VAL A 1 32  ? -7.549  12.359  5.824   1.00 0.00 ?  245 VAL A CB   2  
ATOM 2641  C CG1  . VAL A 1 32  ? -9.061  12.376  5.592   1.00 0.00 ?  245 VAL A CG1  2  
ATOM 2642  C CG2  . VAL A 1 32  ? -7.222  12.456  7.316   1.00 0.00 ?  245 VAL A CG2  2  
ATOM 2643  H H    . VAL A 1 32  ? -5.102  11.998  5.727   1.00 0.00 ?  245 VAL A H    2  
ATOM 2644  H HA   . VAL A 1 32  ? -7.324  10.238  5.707   1.00 0.00 ?  245 VAL A HA   2  
ATOM 2645  H HB   . VAL A 1 32  ? -7.125  13.233  5.330   1.00 0.00 ?  245 VAL A HB   2  
ATOM 2646  H HG11 . VAL A 1 32  ? -9.351  13.333  5.158   1.00 0.00 ?  245 VAL A HG11 2  
ATOM 2647  H HG12 . VAL A 1 32  ? -9.334  11.570  4.911   1.00 0.00 ?  245 VAL A HG12 2  
ATOM 2648  H HG13 . VAL A 1 32  ? -9.576  12.237  6.543   1.00 0.00 ?  245 VAL A HG13 2  
ATOM 2649  H HG21 . VAL A 1 32  ? -6.912  13.474  7.554   1.00 0.00 ?  245 VAL A HG21 2  
ATOM 2650  H HG22 . VAL A 1 32  ? -8.106  12.199  7.899   1.00 0.00 ?  245 VAL A HG22 2  
ATOM 2651  H HG23 . VAL A 1 32  ? -6.414  11.765  7.556   1.00 0.00 ?  245 VAL A HG23 2  
ATOM 2652  N N    . GLU A 1 33  ? -6.397  11.726  2.930   1.00 0.00 ?  246 GLU A N    2  
ATOM 2653  C CA   . GLU A 1 33  ? -6.539  11.709  1.484   1.00 0.00 ?  246 GLU A CA   2  
ATOM 2654  C C    . GLU A 1 33  ? -6.197  10.322  0.934   1.00 0.00 ?  246 GLU A C    2  
ATOM 2655  O O    . GLU A 1 33  ? -6.809  9.865   -0.029  1.00 0.00 ?  246 GLU A O    2  
ATOM 2656  C CB   . GLU A 1 33  ? -5.669  12.786  0.835   1.00 0.00 ?  246 GLU A CB   2  
ATOM 2657  C CG   . GLU A 1 33  ? -6.173  13.125  -0.570  1.00 0.00 ?  246 GLU A CG   2  
ATOM 2658  C CD   . GLU A 1 33  ? -7.404  14.031  -0.506  1.00 0.00 ?  246 GLU A CD   2  
ATOM 2659  O OE1  . GLU A 1 33  ? -8.459  13.609  -0.010  1.00 0.00 ?  246 GLU A OE1  2  
ATOM 2660  O OE2  . GLU A 1 33  ? -7.237  15.213  -0.995  1.00 0.00 -1 246 GLU A OE2  2  
ATOM 2661  H H    . GLU A 1 33  ? -5.675  12.326  3.277   1.00 0.00 ?  246 GLU A H    2  
ATOM 2662  H HA   . GLU A 1 33  ? -7.588  11.934  1.294   1.00 0.00 ?  246 GLU A HA   2  
ATOM 2663  H HB2  . GLU A 1 33  ? -5.673  13.684  1.453   1.00 0.00 ?  246 GLU A HB2  2  
ATOM 2664  H HB3  . GLU A 1 33  ? -4.636  12.441  0.781   1.00 0.00 ?  246 GLU A HB3  2  
ATOM 2665  H HG2  . GLU A 1 33  ? -5.382  13.619  -1.134  1.00 0.00 ?  246 GLU A HG2  2  
ATOM 2666  H HG3  . GLU A 1 33  ? -6.419  12.207  -1.103  1.00 0.00 ?  246 GLU A HG3  2  
ATOM 2667  H HE2  . GLU A 1 33  ? -7.685  15.281  -1.887  1.00 0.00 ?  246 GLU A HE2  2  
ATOM 2668  N N    . ILE A 1 34  ? -5.220  9.693   1.571   1.00 0.00 ?  247 ILE A N    2  
ATOM 2669  C CA   . ILE A 1 34  ? -4.790  8.368   1.157   1.00 0.00 ?  247 ILE A CA   2  
ATOM 2670  C C    . ILE A 1 34  ? -5.865  7.347   1.532   1.00 0.00 ?  247 ILE A C    2  
ATOM 2671  O O    . ILE A 1 34  ? -6.211  6.481   0.729   1.00 0.00 ?  247 ILE A O    2  
ATOM 2672  C CB   . ILE A 1 34  ? -3.410  8.048   1.736   1.00 0.00 ?  247 ILE A CB   2  
ATOM 2673  C CG1  . ILE A 1 34  ? -2.315  8.829   1.006   1.00 0.00 ?  247 ILE A CG1  2  
ATOM 2674  C CG2  . ILE A 1 34  ? -3.145  6.541   1.722   1.00 0.00 ?  247 ILE A CG2  2  
ATOM 2675  C CD1  . ILE A 1 34  ? -1.061  8.957   1.874   1.00 0.00 ?  247 ILE A CD1  2  
ATOM 2676  H H    . ILE A 1 34  ? -4.727  10.072  2.354   1.00 0.00 ?  247 ILE A H    2  
ATOM 2677  H HA   . ILE A 1 34  ? -4.689  8.381   0.072   1.00 0.00 ?  247 ILE A HA   2  
ATOM 2678  H HB   . ILE A 1 34  ? -3.394  8.369   2.777   1.00 0.00 ?  247 ILE A HB   2  
ATOM 2679  H HG12 . ILE A 1 34  ? -2.065  8.325   0.072   1.00 0.00 ?  247 ILE A HG12 2  
ATOM 2680  H HG13 . ILE A 1 34  ? -2.683  9.821   0.744   1.00 0.00 ?  247 ILE A HG13 2  
ATOM 2681  H HG21 . ILE A 1 34  ? -2.207  6.332   2.237   1.00 0.00 ?  247 ILE A HG21 2  
ATOM 2682  H HG22 . ILE A 1 34  ? -3.961  6.025   2.230   1.00 0.00 ?  247 ILE A HG22 2  
ATOM 2683  H HG23 . ILE A 1 34  ? -3.080  6.193   0.692   1.00 0.00 ?  247 ILE A HG23 2  
ATOM 2684  H HD11 . ILE A 1 34  ? -1.317  9.455   2.809   1.00 0.00 ?  247 ILE A HD11 2  
ATOM 2685  H HD12 . ILE A 1 34  ? -0.664  7.965   2.087   1.00 0.00 ?  247 ILE A HD12 2  
ATOM 2686  H HD13 . ILE A 1 34  ? -0.310  9.543   1.343   1.00 0.00 ?  247 ILE A HD13 2  
ATOM 2687  N N    . VAL A 1 35  ? -6.365  7.481   2.752   1.00 0.00 ?  248 VAL A N    2  
ATOM 2688  C CA   . VAL A 1 35  ? -7.394  6.581   3.243   1.00 0.00 ?  248 VAL A CA   2  
ATOM 2689  C C    . VAL A 1 35  ? -8.691  6.825   2.468   1.00 0.00 ?  248 VAL A C    2  
ATOM 2690  O O    . VAL A 1 35  ? -9.472  5.900   2.251   1.00 0.00 ?  248 VAL A O    2  
ATOM 2691  C CB   . VAL A 1 35  ? -7.560  6.750   4.754   1.00 0.00 ?  248 VAL A CB   2  
ATOM 2692  C CG1  . VAL A 1 35  ? -8.669  5.842   5.289   1.00 0.00 ?  248 VAL A CG1  2  
ATOM 2693  C CG2  . VAL A 1 35  ? -6.240  6.492   5.483   1.00 0.00 ?  248 VAL A CG2  2  
ATOM 2694  H H    . VAL A 1 35  ? -6.078  8.188   3.398   1.00 0.00 ?  248 VAL A H    2  
ATOM 2695  H HA   . VAL A 1 35  ? -7.058  5.562   3.052   1.00 0.00 ?  248 VAL A HA   2  
ATOM 2696  H HB   . VAL A 1 35  ? -7.851  7.783   4.946   1.00 0.00 ?  248 VAL A HB   2  
ATOM 2697  H HG11 . VAL A 1 35  ? -8.919  6.136   6.309   1.00 0.00 ?  248 VAL A HG11 2  
ATOM 2698  H HG12 . VAL A 1 35  ? -9.552  5.936   4.657   1.00 0.00 ?  248 VAL A HG12 2  
ATOM 2699  H HG13 . VAL A 1 35  ? -8.325  4.807   5.283   1.00 0.00 ?  248 VAL A HG13 2  
ATOM 2700  H HG21 . VAL A 1 35  ? -6.114  7.225   6.279   1.00 0.00 ?  248 VAL A HG21 2  
ATOM 2701  H HG22 . VAL A 1 35  ? -6.251  5.489   5.911   1.00 0.00 ?  248 VAL A HG22 2  
ATOM 2702  H HG23 . VAL A 1 35  ? -5.413  6.576   4.777   1.00 0.00 ?  248 VAL A HG23 2  
ATOM 2703  N N    . ARG A 1 36  ? -8.880  8.075   2.072   1.00 0.00 ?  249 ARG A N    2  
ATOM 2704  C CA   . ARG A 1 36  ? -10.068 8.453   1.326   1.00 0.00 ?  249 ARG A CA   2  
ATOM 2705  C C    . ARG A 1 36  ? -9.924  8.050   -0.142  1.00 0.00 ?  249 ARG A C    2  
ATOM 2706  O O    . ARG A 1 36  ? -10.918 7.903   -0.850  1.00 0.00 ?  249 ARG A O    2  
ATOM 2707  C CB   . ARG A 1 36  ? -10.318 9.960   1.413   1.00 0.00 ?  249 ARG A CB   2  
ATOM 2708  C CG   . ARG A 1 36  ? -11.013 10.326  2.726   1.00 0.00 ?  249 ARG A CG   2  
ATOM 2709  C CD   . ARG A 1 36  ? -12.533 10.330  2.558   1.00 0.00 ?  249 ARG A CD   2  
ATOM 2710  N NE   . ARG A 1 36  ? -13.062 11.697  2.768   1.00 0.00 ?  249 ARG A NE   2  
ATOM 2711  C CZ   . ARG A 1 36  ? -14.345 12.042  2.589   1.00 0.00 ?  249 ARG A CZ   2  
ATOM 2712  N NH1  . ARG A 1 36  ? -15.237 11.123  2.197   1.00 0.00 ?  249 ARG A NH1  2  
ATOM 2713  N NH2  . ARG A 1 36  ? -14.734 13.306  2.802   1.00 0.00 1  249 ARG A NH2  2  
ATOM 2714  H H    . ARG A 1 36  ? -8.239  8.822   2.253   1.00 0.00 ?  249 ARG A H    2  
ATOM 2715  H HA   . ARG A 1 36  ? -10.882 7.907   1.804   1.00 0.00 ?  249 ARG A HA   2  
ATOM 2716  H HB2  . ARG A 1 36  ? -9.370  10.494  1.338   1.00 0.00 ?  249 ARG A HB2  2  
ATOM 2717  H HB3  . ARG A 1 36  ? -10.931 10.280  0.571   1.00 0.00 ?  249 ARG A HB3  2  
ATOM 2718  H HG2  . ARG A 1 36  ? -10.730 9.615   3.502   1.00 0.00 ?  249 ARG A HG2  2  
ATOM 2719  H HG3  . ARG A 1 36  ? -10.677 11.309  3.057   1.00 0.00 ?  249 ARG A HG3  2  
ATOM 2720  H HD2  . ARG A 1 36  ? -12.799 9.978   1.562   1.00 0.00 ?  249 ARG A HD2  2  
ATOM 2721  H HD3  . ARG A 1 36  ? -12.988 9.643   3.271   1.00 0.00 ?  249 ARG A HD3  2  
ATOM 2722  H HE   . ARG A 1 36  ? -12.422 12.407  3.060   1.00 0.00 ?  249 ARG A HE   2  
ATOM 2723  H HH11 . ARG A 1 36  ? -14.946 10.179  2.038   1.00 0.00 ?  249 ARG A HH11 2  
ATOM 2724  H HH12 . ARG A 1 36  ? -16.194 11.380  2.064   1.00 0.00 ?  249 ARG A HH12 2  
ATOM 2725  H HH21 . ARG A 1 36  ? -14.068 13.992  3.095   1.00 0.00 ?  249 ARG A HH21 2  
ATOM 2726  H HH22 . ARG A 1 36  ? -15.691 13.563  2.669   1.00 0.00 ?  249 ARG A HH22 2  
ATOM 2727  N N    . ALA A 1 37  ? -8.676  7.884   -0.557  1.00 0.00 ?  250 ALA A N    2  
ATOM 2728  C CA   . ALA A 1 37  ? -8.388  7.502   -1.929  1.00 0.00 ?  250 ALA A CA   2  
ATOM 2729  C C    . ALA A 1 37  ? -8.350  5.976   -2.031  1.00 0.00 ?  250 ALA A C    2  
ATOM 2730  O O    . ALA A 1 37  ? -8.513  5.418   -3.116  1.00 0.00 ?  250 ALA A O    2  
ATOM 2731  C CB   . ALA A 1 37  ? -7.075  8.149   -2.375  1.00 0.00 ?  250 ALA A CB   2  
ATOM 2732  H H    . ALA A 1 37  ? -7.872  8.007   0.025   1.00 0.00 ?  250 ALA A H    2  
ATOM 2733  H HA   . ALA A 1 37  ? -9.196  7.880   -2.556  1.00 0.00 ?  250 ALA A HA   2  
ATOM 2734  H HB1  . ALA A 1 37  ? -6.393  8.209   -1.526  1.00 0.00 ?  250 ALA A HB1  2  
ATOM 2735  H HB2  . ALA A 1 37  ? -6.622  7.546   -3.163  1.00 0.00 ?  250 ALA A HB2  2  
ATOM 2736  H HB3  . ALA A 1 37  ? -7.274  9.151   -2.753  1.00 0.00 ?  250 ALA A HB3  2  
ATOM 2737  N N    . LEU A 1 38  ? -8.135  5.343   -0.887  1.00 0.00 ?  251 LEU A N    2  
ATOM 2738  C CA   . LEU A 1 38  ? -8.074  3.892   -0.834  1.00 0.00 ?  251 LEU A CA   2  
ATOM 2739  C C    . LEU A 1 38  ? -9.457  3.316   -1.144  1.00 0.00 ?  251 LEU A C    2  
ATOM 2740  O O    . LEU A 1 38  ? -10.475 3.943   -0.852  1.00 0.00 ?  251 LEU A O    2  
ATOM 2741  C CB   . LEU A 1 38  ? -7.501  3.429   0.507   1.00 0.00 ?  251 LEU A CB   2  
ATOM 2742  C CG   . LEU A 1 38  ? -6.068  2.895   0.475   1.00 0.00 ?  251 LEU A CG   2  
ATOM 2743  C CD1  . LEU A 1 38  ? -5.295  3.325   1.723   1.00 0.00 ?  251 LEU A CD1  2  
ATOM 2744  C CD2  . LEU A 1 38  ? -6.053  1.377   0.286   1.00 0.00 ?  251 LEU A CD2  2  
ATOM 2745  H H    . LEU A 1 38  ? -8.005  5.804   -0.009  1.00 0.00 ?  251 LEU A H    2  
ATOM 2746  H HA   . LEU A 1 38  ? -7.382  3.566   -1.610  1.00 0.00 ?  251 LEU A HA   2  
ATOM 2747  H HB2  . LEU A 1 38  ? -7.541  4.265   1.205   1.00 0.00 ?  251 LEU A HB2  2  
ATOM 2748  H HB3  . LEU A 1 38  ? -8.150  2.649   0.906   1.00 0.00 ?  251 LEU A HB3  2  
ATOM 2749  H HG   . LEU A 1 38  ? -5.560  3.332   -0.385  1.00 0.00 ?  251 LEU A HG   2  
ATOM 2750  H HD11 . LEU A 1 38  ? -4.238  3.427   1.479   1.00 0.00 ?  251 LEU A HD11 2  
ATOM 2751  H HD12 . LEU A 1 38  ? -5.680  4.281   2.078   1.00 0.00 ?  251 LEU A HD12 2  
ATOM 2752  H HD13 . LEU A 1 38  ? -5.416  2.572   2.503   1.00 0.00 ?  251 LEU A HD13 2  
ATOM 2753  H HD21 . LEU A 1 38  ? -6.169  1.141   -0.772  1.00 0.00 ?  251 LEU A HD21 2  
ATOM 2754  H HD22 . LEU A 1 38  ? -5.105  0.975   0.645   1.00 0.00 ?  251 LEU A HD22 2  
ATOM 2755  H HD23 . LEU A 1 38  ? -6.872  0.932   0.850   1.00 0.00 ?  251 LEU A HD23 2  
ATOM 2756  N N    . ARG A 1 39  ? -9.451  2.129   -1.732  1.00 0.00 ?  252 ARG A N    2  
ATOM 2757  C CA   . ARG A 1 39  ? -10.692 1.461   -2.084  1.00 0.00 ?  252 ARG A CA   2  
ATOM 2758  C C    . ARG A 1 39  ? -10.780 0.102   -1.388  1.00 0.00 ?  252 ARG A C    2  
ATOM 2759  O O    . ARG A 1 39  ? -9.934  -0.764  -1.600  1.00 0.00 ?  252 ARG A O    2  
ATOM 2760  C CB   . ARG A 1 39  ? -10.798 1.259   -3.597  1.00 0.00 ?  252 ARG A CB   2  
ATOM 2761  C CG   . ARG A 1 39  ? -12.133 0.612   -3.971  1.00 0.00 ?  252 ARG A CG   2  
ATOM 2762  C CD   . ARG A 1 39  ? -13.297 1.573   -3.725  1.00 0.00 ?  252 ARG A CD   2  
ATOM 2763  N NE   . ARG A 1 39  ? -14.473 1.161   -4.524  1.00 0.00 ?  252 ARG A NE   2  
ATOM 2764  C CZ   . ARG A 1 39  ? -14.552 1.274   -5.857  1.00 0.00 ?  252 ARG A CZ   2  
ATOM 2765  N NH1  . ARG A 1 39  ? -13.525 1.787   -6.548  1.00 0.00 ?  252 ARG A NH1  2  
ATOM 2766  N NH2  . ARG A 1 39  ? -15.658 0.873   -6.499  1.00 0.00 1  252 ARG A NH2  2  
ATOM 2767  H H    . ARG A 1 39  ? -8.619  1.626   -1.966  1.00 0.00 ?  252 ARG A H    2  
ATOM 2768  H HA   . ARG A 1 39  ? -11.478 2.132   -1.736  1.00 0.00 ?  252 ARG A HA   2  
ATOM 2769  H HB2  . ARG A 1 39  ? -10.701 2.220   -4.104  1.00 0.00 ?  252 ARG A HB2  2  
ATOM 2770  H HB3  . ARG A 1 39  ? -9.976  0.632   -3.943  1.00 0.00 ?  252 ARG A HB3  2  
ATOM 2771  H HG2  . ARG A 1 39  ? -12.117 0.316   -5.021  1.00 0.00 ?  252 ARG A HG2  2  
ATOM 2772  H HG3  . ARG A 1 39  ? -12.277 -0.297  -3.387  1.00 0.00 ?  252 ARG A HG3  2  
ATOM 2773  H HD2  . ARG A 1 39  ? -13.553 1.583   -2.665  1.00 0.00 ?  252 ARG A HD2  2  
ATOM 2774  H HD3  . ARG A 1 39  ? -13.004 2.588   -3.991  1.00 0.00 ?  252 ARG A HD3  2  
ATOM 2775  H HE   . ARG A 1 39  ? -15.257 0.773   -4.039  1.00 0.00 ?  252 ARG A HE   2  
ATOM 2776  H HH11 . ARG A 1 39  ? -12.700 2.086   -6.069  1.00 0.00 ?  252 ARG A HH11 2  
ATOM 2777  H HH12 . ARG A 1 39  ? -13.584 1.872   -7.543  1.00 0.00 ?  252 ARG A HH12 2  
ATOM 2778  H HH21 . ARG A 1 39  ? -16.424 0.490   -5.983  1.00 0.00 ?  252 ARG A HH21 2  
ATOM 2779  H HH22 . ARG A 1 39  ? -15.717 0.958   -7.493  1.00 0.00 ?  252 ARG A HH22 2  
ATOM 2780  N N    . ALA A 1 40  ? -11.813 -0.042  -0.570  1.00 0.00 ?  253 ALA A N    2  
ATOM 2781  C CA   . ALA A 1 40  ? -12.023 -1.281  0.159   1.00 0.00 ?  253 ALA A CA   2  
ATOM 2782  C C    . ALA A 1 40  ? -12.695 -2.302  -0.761  1.00 0.00 ?  253 ALA A C    2  
ATOM 2783  O O    . ALA A 1 40  ? -13.770 -2.043  -1.301  1.00 0.00 ?  253 ALA A O    2  
ATOM 2784  C CB   . ALA A 1 40  ? -12.846 -1.000  1.418   1.00 0.00 ?  253 ALA A CB   2  
ATOM 2785  H H    . ALA A 1 40  ? -12.497 0.667   -0.403  1.00 0.00 ?  253 ALA A H    2  
ATOM 2786  H HA   . ALA A 1 40  ? -11.045 -1.661  0.456   1.00 0.00 ?  253 ALA A HA   2  
ATOM 2787  H HB1  . ALA A 1 40  ? -13.895 -1.226  1.224   1.00 0.00 ?  253 ALA A HB1  2  
ATOM 2788  H HB2  . ALA A 1 40  ? -12.485 -1.625  2.235   1.00 0.00 ?  253 ALA A HB2  2  
ATOM 2789  H HB3  . ALA A 1 40  ? -12.744 0.050   1.691   1.00 0.00 ?  253 ALA A HB3  2  
ATOM 2790  N N    . ARG A 1 41  ? -12.034 -3.441  -0.912  1.00 0.00 ?  254 ARG A N    2  
ATOM 2791  C CA   . ARG A 1 41  ? -12.554 -4.501  -1.758  1.00 0.00 ?  254 ARG A CA   2  
ATOM 2792  C C    . ARG A 1 41  ? -12.476 -5.846  -1.032  1.00 0.00 ?  254 ARG A C    2  
ATOM 2793  O O    . ARG A 1 41  ? -11.520 -6.107  -0.303  1.00 0.00 ?  254 ARG A O    2  
ATOM 2794  C CB   . ARG A 1 41  ? -11.774 -4.592  -3.071  1.00 0.00 ?  254 ARG A CB   2  
ATOM 2795  C CG   . ARG A 1 41  ? -10.404 -5.237  -2.851  1.00 0.00 ?  254 ARG A CG   2  
ATOM 2796  C CD   . ARG A 1 41  ? -9.360  -4.646  -3.801  1.00 0.00 ?  254 ARG A CD   2  
ATOM 2797  N NE   . ARG A 1 41  ? -9.204  -5.518  -4.987  1.00 0.00 ?  254 ARG A NE   2  
ATOM 2798  C CZ   . ARG A 1 41  ? -9.976  -5.444  -6.080  1.00 0.00 ?  254 ARG A CZ   2  
ATOM 2799  N NH1  . ARG A 1 41  ? -10.962 -4.540  -6.144  1.00 0.00 ?  254 ARG A NH1  2  
ATOM 2800  N NH2  . ARG A 1 41  ? -9.761  -6.276  -7.108  1.00 0.00 1  254 ARG A NH2  2  
ATOM 2801  H H    . ARG A 1 41  ? -11.160 -3.643  -0.470  1.00 0.00 ?  254 ARG A H    2  
ATOM 2802  H HA   . ARG A 1 41  ? -13.589 -4.220  -1.953  1.00 0.00 ?  254 ARG A HA   2  
ATOM 2803  H HB2  . ARG A 1 41  ? -12.342 -5.174  -3.796  1.00 0.00 ?  254 ARG A HB2  2  
ATOM 2804  H HB3  . ARG A 1 41  ? -11.646 -3.595  -3.492  1.00 0.00 ?  254 ARG A HB3  2  
ATOM 2805  H HG2  . ARG A 1 41  ? -10.088 -5.086  -1.819  1.00 0.00 ?  254 ARG A HG2  2  
ATOM 2806  H HG3  . ARG A 1 41  ? -10.475 -6.313  -3.008  1.00 0.00 ?  254 ARG A HG3  2  
ATOM 2807  H HD2  . ARG A 1 41  ? -9.664  -3.646  -4.112  1.00 0.00 ?  254 ARG A HD2  2  
ATOM 2808  H HD3  . ARG A 1 41  ? -8.405  -4.543  -3.287  1.00 0.00 ?  254 ARG A HD3  2  
ATOM 2809  H HE   . ARG A 1 41  ? -8.477  -6.204  -4.972  1.00 0.00 ?  254 ARG A HE   2  
ATOM 2810  H HH11 . ARG A 1 41  ? -11.123 -3.919  -5.377  1.00 0.00 ?  254 ARG A HH11 2  
ATOM 2811  H HH12 . ARG A 1 41  ? -11.538 -4.485  -6.960  1.00 0.00 ?  254 ARG A HH12 2  
ATOM 2812  H HH21 . ARG A 1 41  ? -9.026  -6.952  -7.060  1.00 0.00 ?  254 ARG A HH21 2  
ATOM 2813  H HH22 . ARG A 1 41  ? -10.338 -6.222  -7.924  1.00 0.00 ?  254 ARG A HH22 2  
ATOM 2814  N N    . THR A 1 42  ? -13.493 -6.664  -1.257  1.00 0.00 ?  255 THR A N    2  
ATOM 2815  C CA   . THR A 1 42  ? -13.552 -7.975  -0.633  1.00 0.00 ?  255 THR A CA   2  
ATOM 2816  C C    . THR A 1 42  ? -12.966 -9.036  -1.567  1.00 0.00 ?  255 THR A C    2  
ATOM 2817  O O    . THR A 1 42  ? -13.395 -9.165  -2.712  1.00 0.00 ?  255 THR A O    2  
ATOM 2818  C CB   . THR A 1 42  ? -15.005 -8.247  -0.239  1.00 0.00 ?  255 THR A CB   2  
ATOM 2819  O OG1  . THR A 1 42  ? -15.149 -7.603  1.023   1.00 0.00 ?  255 THR A OG1  2  
ATOM 2820  C CG2  . THR A 1 42  ? -15.262 -9.724  0.065   1.00 0.00 ?  255 THR A CG2  2  
ATOM 2821  H H    . THR A 1 42  ? -14.267 -6.444  -1.851  1.00 0.00 ?  255 THR A H    2  
ATOM 2822  H HA   . THR A 1 42  ? -12.929 -7.957  0.262   1.00 0.00 ?  255 THR A HA   2  
ATOM 2823  H HB   . THR A 1 42  ? -15.690 -7.882  -1.004  1.00 0.00 ?  255 THR A HB   2  
ATOM 2824  H HG1  . THR A 1 42  ? -16.108 -7.616  1.306   1.00 0.00 ?  255 THR A HG1  2  
ATOM 2825  H HG21 . THR A 1 42  ? -16.095 -9.812  0.762   1.00 0.00 ?  255 THR A HG21 2  
ATOM 2826  H HG22 . THR A 1 42  ? -15.505 -10.249 -0.859  1.00 0.00 ?  255 THR A HG22 2  
ATOM 2827  H HG23 . THR A 1 42  ? -14.369 -10.165 0.508   1.00 0.00 ?  255 THR A HG23 2  
ATOM 2828  N N    . VAL A 1 43  ? -11.994 -9.768  -1.042  1.00 0.00 ?  256 VAL A N    2  
ATOM 2829  C CA   . VAL A 1 43  ? -11.345 -10.814 -1.814  1.00 0.00 ?  256 VAL A CA   2  
ATOM 2830  C C    . VAL A 1 43  ? -11.804 -12.180 -1.302  1.00 0.00 ?  256 VAL A C    2  
ATOM 2831  O O    . VAL A 1 43  ? -11.483 -12.566 -0.179  1.00 0.00 ?  256 VAL A O    2  
ATOM 2832  C CB   . VAL A 1 43  ? -9.826  -10.636 -1.763  1.00 0.00 ?  256 VAL A CB   2  
ATOM 2833  C CG1  . VAL A 1 43  ? -9.122  -11.682 -2.630  1.00 0.00 ?  256 VAL A CG1  2  
ATOM 2834  C CG2  . VAL A 1 43  ? -9.426  -9.219  -2.181  1.00 0.00 ?  256 VAL A CG2  2  
ATOM 2835  H H    . VAL A 1 43  ? -11.650 -9.656  -0.110  1.00 0.00 ?  256 VAL A H    2  
ATOM 2836  H HA   . VAL A 1 43  ? -11.663 -10.703 -2.851  1.00 0.00 ?  256 VAL A HA   2  
ATOM 2837  H HB   . VAL A 1 43  ? -9.506  -10.784 -0.732  1.00 0.00 ?  256 VAL A HB   2  
ATOM 2838  H HG11 . VAL A 1 43  ? -8.068  -11.732 -2.355  1.00 0.00 ?  256 VAL A HG11 2  
ATOM 2839  H HG12 . VAL A 1 43  ? -9.585  -12.656 -2.471  1.00 0.00 ?  256 VAL A HG12 2  
ATOM 2840  H HG13 . VAL A 1 43  ? -9.211  -11.404 -3.680  1.00 0.00 ?  256 VAL A HG13 2  
ATOM 2841  H HG21 . VAL A 1 43  ? -8.407  -9.229  -2.568  1.00 0.00 ?  256 VAL A HG21 2  
ATOM 2842  H HG22 . VAL A 1 43  ? -10.105 -8.863  -2.955  1.00 0.00 ?  256 VAL A HG22 2  
ATOM 2843  H HG23 . VAL A 1 43  ? -9.480  -8.557  -1.317  1.00 0.00 ?  256 VAL A HG23 2  
ATOM 2844  N N    . PRO A 1 44  ? -12.568 -12.893 -2.172  1.00 0.00 ?  257 PRO A N    2  
ATOM 2845  C CA   . PRO A 1 44  ? -13.075 -14.209 -1.818  1.00 0.00 ?  257 PRO A CA   2  
ATOM 2846  C C    . PRO A 1 44  ? -11.964 -15.259 -1.879  1.00 0.00 ?  257 PRO A C    2  
ATOM 2847  O O    . PRO A 1 44  ? -10.861 -14.975 -2.346  1.00 0.00 ?  257 PRO A O    2  
ATOM 2848  C CB   . PRO A 1 44  ? -14.199 -14.475 -2.806  1.00 0.00 ?  257 PRO A CB   2  
ATOM 2849  C CG   . PRO A 1 44  ? -13.976 -13.513 -3.961  1.00 0.00 ?  257 PRO A CG   2  
ATOM 2850  C CD   . PRO A 1 44  ? -12.969 -12.468 -3.510  1.00 0.00 ?  257 PRO A CD   2  
ATOM 2851  H HA   . PRO A 1 44  ? -13.402 -14.212 -0.874  1.00 0.00 ?  257 PRO A HA   2  
ATOM 2852  H HB2  . PRO A 1 44  ? -14.180 -15.509 -3.150  1.00 0.00 ?  257 PRO A HB2  2  
ATOM 2853  H HB3  . PRO A 1 44  ? -15.172 -14.312 -2.343  1.00 0.00 ?  257 PRO A HB3  2  
ATOM 2854  H HG2  . PRO A 1 44  ? -13.607 -14.046 -4.837  1.00 0.00 ?  257 PRO A HG2  2  
ATOM 2855  H HG3  . PRO A 1 44  ? -14.915 -13.039 -4.249  1.00 0.00 ?  257 PRO A HG3  2  
ATOM 2856  H HD2  . PRO A 1 44  ? -12.113 -12.426 -4.184  1.00 0.00 ?  257 PRO A HD2  2  
ATOM 2857  H HD3  . PRO A 1 44  ? -13.411 -11.472 -3.493  1.00 0.00 ?  257 PRO A HD3  2  
ATOM 2858  N N    . ALA A 1 45  ? -12.292 -16.450 -1.401  1.00 0.00 ?  258 ALA A N    2  
ATOM 2859  C CA   . ALA A 1 45  ? -11.336 -17.544 -1.396  1.00 0.00 ?  258 ALA A CA   2  
ATOM 2860  C C    . ALA A 1 45  ? -11.019 -17.946 -2.837  1.00 0.00 ?  258 ALA A C    2  
ATOM 2861  O O    . ALA A 1 45  ? -11.926 -18.159 -3.640  1.00 0.00 ?  258 ALA A O    2  
ATOM 2862  C CB   . ALA A 1 45  ? -11.896 -18.708 -0.576  1.00 0.00 ?  258 ALA A CB   2  
ATOM 2863  H H    . ALA A 1 45  ? -13.191 -16.672 -1.024  1.00 0.00 ?  258 ALA A H    2  
ATOM 2864  H HA   . ALA A 1 45  ? -10.424 -17.185 -0.918  1.00 0.00 ?  258 ALA A HA   2  
ATOM 2865  H HB1  . ALA A 1 45  ? -12.335 -18.325 0.346   1.00 0.00 ?  258 ALA A HB1  2  
ATOM 2866  H HB2  . ALA A 1 45  ? -12.662 -19.225 -1.155  1.00 0.00 ?  258 ALA A HB2  2  
ATOM 2867  H HB3  . ALA A 1 45  ? -11.092 -19.402 -0.335  1.00 0.00 ?  258 ALA A HB3  2  
ATOM 2868  N N    . GLY A 1 46  ? -9.728  -18.037 -3.122  1.00 0.00 ?  259 GLY A N    2  
ATOM 2869  C CA   . GLY A 1 46  ? -9.280  -18.409 -4.453  1.00 0.00 ?  259 GLY A CA   2  
ATOM 2870  C C    . GLY A 1 46  ? -8.980  -17.169 -5.298  1.00 0.00 ?  259 GLY A C    2  
ATOM 2871  O O    . GLY A 1 46  ? -8.187  -17.230 -6.236  1.00 0.00 ?  259 GLY A O    2  
ATOM 2872  H H    . GLY A 1 46  ? -8.996  -17.861 -2.464  1.00 0.00 ?  259 GLY A H    2  
ATOM 2873  H HA2  . GLY A 1 46  ? -8.386  -19.028 -4.380  1.00 0.00 ?  259 GLY A HA2  2  
ATOM 2874  H HA3  . GLY A 1 46  ? -10.045 -19.011 -4.944  1.00 0.00 ?  259 GLY A HA3  2  
ATOM 2875  N N    . ALA A 1 47  ? -9.630  -16.073 -4.934  1.00 0.00 ?  260 ALA A N    2  
ATOM 2876  C CA   . ALA A 1 47  ? -9.443  -14.821 -5.647  1.00 0.00 ?  260 ALA A CA   2  
ATOM 2877  C C    . ALA A 1 47  ? -7.999  -14.348 -5.468  1.00 0.00 ?  260 ALA A C    2  
ATOM 2878  O O    . ALA A 1 47  ? -7.553  -14.116 -4.346  1.00 0.00 ?  260 ALA A O    2  
ATOM 2879  C CB   . ALA A 1 47  ? -10.460 -13.792 -5.147  1.00 0.00 ?  260 ALA A CB   2  
ATOM 2880  H H    . ALA A 1 47  ? -10.274 -16.033 -4.170  1.00 0.00 ?  260 ALA A H    2  
ATOM 2881  H HA   . ALA A 1 47  ? -9.627  -15.010 -6.705  1.00 0.00 ?  260 ALA A HA   2  
ATOM 2882  H HB1  . ALA A 1 47  ? -10.290 -13.599 -4.088  1.00 0.00 ?  260 ALA A HB1  2  
ATOM 2883  H HB2  . ALA A 1 47  ? -10.345 -12.866 -5.709  1.00 0.00 ?  260 ALA A HB2  2  
ATOM 2884  H HB3  . ALA A 1 47  ? -11.468 -14.180 -5.288  1.00 0.00 ?  260 ALA A HB3  2  
ATOM 2885  N N    . VAL A 1 48  ? -7.309  -14.220 -6.592  1.00 0.00 ?  261 VAL A N    2  
ATOM 2886  C CA   . VAL A 1 48  ? -5.924  -13.779 -6.573  1.00 0.00 ?  261 VAL A CA   2  
ATOM 2887  C C    . VAL A 1 48  ? -5.880  -12.259 -6.405  1.00 0.00 ?  261 VAL A C    2  
ATOM 2888  O O    . VAL A 1 48  ? -6.640  -11.537 -7.048  1.00 0.00 ?  261 VAL A O    2  
ATOM 2889  C CB   . VAL A 1 48  ? -5.204  -14.262 -7.834  1.00 0.00 ?  261 VAL A CB   2  
ATOM 2890  C CG1  . VAL A 1 48  ? -5.899  -13.742 -9.095  1.00 0.00 ?  261 VAL A CG1  2  
ATOM 2891  C CG2  . VAL A 1 48  ? -3.730  -13.856 -7.813  1.00 0.00 ?  261 VAL A CG2  2  
ATOM 2892  H H    . VAL A 1 48  ? -7.679  -14.411 -7.501  1.00 0.00 ?  261 VAL A H    2  
ATOM 2893  H HA   . VAL A 1 48  ? -5.443  -14.242 -5.712  1.00 0.00 ?  261 VAL A HA   2  
ATOM 2894  H HB   . VAL A 1 48  ? -5.252  -15.351 -7.851  1.00 0.00 ?  261 VAL A HB   2  
ATOM 2895  H HG11 . VAL A 1 48  ? -6.149  -12.690 -8.964  1.00 0.00 ?  261 VAL A HG11 2  
ATOM 2896  H HG12 . VAL A 1 48  ? -5.231  -13.853 -9.949  1.00 0.00 ?  261 VAL A HG12 2  
ATOM 2897  H HG13 . VAL A 1 48  ? -6.810  -14.314 -9.269  1.00 0.00 ?  261 VAL A HG13 2  
ATOM 2898  H HG21 . VAL A 1 48  ? -3.120  -14.716 -7.537  1.00 0.00 ?  261 VAL A HG21 2  
ATOM 2899  H HG22 . VAL A 1 48  ? -3.436  -13.504 -8.802  1.00 0.00 ?  261 VAL A HG22 2  
ATOM 2900  H HG23 . VAL A 1 48  ? -3.583  -13.058 -7.085  1.00 0.00 ?  261 VAL A HG23 2  
ATOM 2901  N N    . ILE A 1 49  ? -4.982  -11.818 -5.536  1.00 0.00 ?  262 ILE A N    2  
ATOM 2902  C CA   . ILE A 1 49  ? -4.828  -10.397 -5.275  1.00 0.00 ?  262 ILE A CA   2  
ATOM 2903  C C    . ILE A 1 49  ? -3.948  -9.775  -6.361  1.00 0.00 ?  262 ILE A C    2  
ATOM 2904  O O    . ILE A 1 49  ? -4.331  -8.787  -6.985  1.00 0.00 ?  262 ILE A O    2  
ATOM 2905  C CB   . ILE A 1 49  ? -4.308  -10.166 -3.854  1.00 0.00 ?  262 ILE A CB   2  
ATOM 2906  C CG1  . ILE A 1 49  ? -5.207  -10.851 -2.823  1.00 0.00 ?  262 ILE A CG1  2  
ATOM 2907  C CG2  . ILE A 1 49  ? -4.141  -8.673  -3.567  1.00 0.00 ?  262 ILE A CG2  2  
ATOM 2908  C CD1  . ILE A 1 49  ? -4.481  -11.017 -1.487  1.00 0.00 ?  262 ILE A CD1  2  
ATOM 2909  H H    . ILE A 1 49  ? -4.367  -12.412 -5.017  1.00 0.00 ?  262 ILE A H    2  
ATOM 2910  H HA   . ILE A 1 49  ? -5.819  -9.945  -5.333  1.00 0.00 ?  262 ILE A HA   2  
ATOM 2911  H HB   . ILE A 1 49  ? -3.321  -10.622 -3.774  1.00 0.00 ?  262 ILE A HB   2  
ATOM 2912  H HG12 . ILE A 1 49  ? -6.114  -10.264 -2.679  1.00 0.00 ?  262 ILE A HG12 2  
ATOM 2913  H HG13 . ILE A 1 49  ? -5.517  -11.828 -3.197  1.00 0.00 ?  262 ILE A HG13 2  
ATOM 2914  H HG21 . ILE A 1 49  ? -3.419  -8.536  -2.762  1.00 0.00 ?  262 ILE A HG21 2  
ATOM 2915  H HG22 . ILE A 1 49  ? -3.784  -8.168  -4.465  1.00 0.00 ?  262 ILE A HG22 2  
ATOM 2916  H HG23 . ILE A 1 49  ? -5.101  -8.251  -3.271  1.00 0.00 ?  262 ILE A HG23 2  
ATOM 2917  H HD11 . ILE A 1 49  ? -5.210  -11.203 -0.698  1.00 0.00 ?  262 ILE A HD11 2  
ATOM 2918  H HD12 . ILE A 1 49  ? -3.792  -11.859 -1.550  1.00 0.00 ?  262 ILE A HD12 2  
ATOM 2919  H HD13 . ILE A 1 49  ? -3.925  -10.107 -1.260  1.00 0.00 ?  262 ILE A HD13 2  
ATOM 2920  N N    . CYS A 1 50  ? -2.784  -10.380 -6.553  1.00 0.00 ?  263 CYS A N    2  
ATOM 2921  C CA   . CYS A 1 50  ? -1.847  -9.898  -7.552  1.00 0.00 ?  263 CYS A CA   2  
ATOM 2922  C C    . CYS A 1 50  ? -1.088  -11.100 -8.118  1.00 0.00 ?  263 CYS A C    2  
ATOM 2923  O O    . CYS A 1 50  ? -0.821  -12.064 -7.401  1.00 0.00 ?  263 CYS A O    2  
ATOM 2924  C CB   . CYS A 1 50  ? -0.898  -8.844  -6.977  1.00 0.00 ?  263 CYS A CB   2  
ATOM 2925  S SG   . CYS A 1 50  ? 0.313   -9.636  -5.856  1.00 0.00 ?  263 CYS A SG   2  
ATOM 2926  H H    . CYS A 1 50  ? -2.481  -11.183 -6.040  1.00 0.00 ?  263 CYS A H    2  
ATOM 2927  H HA   . CYS A 1 50  ? -2.438  -9.414  -8.329  1.00 0.00 ?  263 CYS A HA   2  
ATOM 2928  H HB2  . CYS A 1 50  ? -0.377  -8.332  -7.785  1.00 0.00 ?  263 CYS A HB2  2  
ATOM 2929  H HB3  . CYS A 1 50  ? -1.467  -8.089  -6.435  1.00 0.00 ?  263 CYS A HB3  2  
ATOM 2930  H HG   . CYS A 1 50  ? 1.260   -9.806  -6.774  1.00 0.00 ?  263 CYS A HG   2  
ATOM 2931  N N    . ARG A 1 51  ? -0.761  -11.004 -9.398  1.00 0.00 ?  264 ARG A N    2  
ATOM 2932  C CA   . ARG A 1 51  ? -0.038  -12.072 -10.068 1.00 0.00 ?  264 ARG A CA   2  
ATOM 2933  C C    . ARG A 1 51  ? 1.464   -11.939 -9.810  1.00 0.00 ?  264 ARG A C    2  
ATOM 2934  O O    . ARG A 1 51  ? 1.896   -11.044 -9.085  1.00 0.00 ?  264 ARG A O    2  
ATOM 2935  C CB   . ARG A 1 51  ? -0.294  -12.048 -11.577 1.00 0.00 ?  264 ARG A CB   2  
ATOM 2936  C CG   . ARG A 1 51  ? -1.667  -12.635 -11.910 1.00 0.00 ?  264 ARG A CG   2  
ATOM 2937  C CD   . ARG A 1 51  ? -1.534  -14.047 -12.484 1.00 0.00 ?  264 ARG A CD   2  
ATOM 2938  N NE   . ARG A 1 51  ? -2.872  -14.664 -12.625 1.00 0.00 ?  264 ARG A NE   2  
ATOM 2939  C CZ   . ARG A 1 51  ? -3.087  -15.881 -13.143 1.00 0.00 ?  264 ARG A CZ   2  
ATOM 2940  N NH1  . ARG A 1 51  ? -2.054  -16.618 -13.573 1.00 0.00 ?  264 ARG A NH1  2  
ATOM 2941  N NH2  . ARG A 1 51  ? -4.335  -16.360 -13.231 1.00 0.00 1  264 ARG A NH2  2  
ATOM 2942  H H    . ARG A 1 51  ? -0.982  -10.217 -9.974  1.00 0.00 ?  264 ARG A H    2  
ATOM 2943  H HA   . ARG A 1 51  ? -0.431  -12.991 -9.633  1.00 0.00 ?  264 ARG A HA   2  
ATOM 2944  H HB2  . ARG A 1 51  ? -0.234  -11.023 -11.943 1.00 0.00 ?  264 ARG A HB2  2  
ATOM 2945  H HB3  . ARG A 1 51  ? 0.483   -12.615 -12.090 1.00 0.00 ?  264 ARG A HB3  2  
ATOM 2946  H HG2  . ARG A 1 51  ? -2.283  -12.661 -11.011 1.00 0.00 ?  264 ARG A HG2  2  
ATOM 2947  H HG3  . ARG A 1 51  ? -2.176  -11.993 -12.628 1.00 0.00 ?  264 ARG A HG3  2  
ATOM 2948  H HD2  . ARG A 1 51  ? -1.038  -14.009 -13.454 1.00 0.00 ?  264 ARG A HD2  2  
ATOM 2949  H HD3  . ARG A 1 51  ? -0.910  -14.657 -11.832 1.00 0.00 ?  264 ARG A HD3  2  
ATOM 2950  H HE   . ARG A 1 51  ? -3.665  -14.140 -12.313 1.00 0.00 ?  264 ARG A HE   2  
ATOM 2951  H HH11 . ARG A 1 51  ? -1.123  -16.261 -13.508 1.00 0.00 ?  264 ARG A HH11 2  
ATOM 2952  H HH12 . ARG A 1 51  ? -2.215  -17.526 -13.960 1.00 0.00 ?  264 ARG A HH12 2  
ATOM 2953  H HH21 . ARG A 1 51  ? -5.106  -15.810 -12.910 1.00 0.00 ?  264 ARG A HH21 2  
ATOM 2954  H HH22 . ARG A 1 51  ? -4.496  -17.268 -13.618 1.00 0.00 ?  264 ARG A HH22 2  
ATOM 2955  N N    . ILE A 1 52  ? 2.219   -12.843 -10.418 1.00 0.00 ?  265 ILE A N    2  
ATOM 2956  C CA   . ILE A 1 52  ? 3.663   -12.838 -10.263 1.00 0.00 ?  265 ILE A CA   2  
ATOM 2957  C C    . ILE A 1 52  ? 4.259   -11.714 -11.113 1.00 0.00 ?  265 ILE A C    2  
ATOM 2958  O O    . ILE A 1 52  ? 3.902   -11.557 -12.280 1.00 0.00 ?  265 ILE A O    2  
ATOM 2959  C CB   . ILE A 1 52  ? 4.241   -14.219 -10.578 1.00 0.00 ?  265 ILE A CB   2  
ATOM 2960  C CG1  . ILE A 1 52  ? 3.789   -14.701 -11.958 1.00 0.00 ?  265 ILE A CG1  2  
ATOM 2961  C CG2  . ILE A 1 52  ? 3.892   -15.223 -9.477  1.00 0.00 ?  265 ILE A CG2  2  
ATOM 2962  C CD1  . ILE A 1 52  ? 2.762   -15.829 -11.836 1.00 0.00 ?  265 ILE A CD1  2  
ATOM 2963  H H    . ILE A 1 52  ? 1.859   -13.567 -11.006 1.00 0.00 ?  265 ILE A H    2  
ATOM 2964  H HA   . ILE A 1 52  ? 3.879   -12.630 -9.215  1.00 0.00 ?  265 ILE A HA   2  
ATOM 2965  H HB   . ILE A 1 52  ? 5.327   -14.137 -10.606 1.00 0.00 ?  265 ILE A HB   2  
ATOM 2966  H HG12 . ILE A 1 52  ? 3.356   -13.869 -12.514 1.00 0.00 ?  265 ILE A HG12 2  
ATOM 2967  H HG13 . ILE A 1 52  ? 4.651   -15.049 -12.526 1.00 0.00 ?  265 ILE A HG13 2  
ATOM 2968  H HG21 . ILE A 1 52  ? 2.824   -15.441 -9.510  1.00 0.00 ?  265 ILE A HG21 2  
ATOM 2969  H HG22 . ILE A 1 52  ? 4.455   -16.143 -9.633  1.00 0.00 ?  265 ILE A HG22 2  
ATOM 2970  H HG23 . ILE A 1 52  ? 4.147   -14.801 -8.506  1.00 0.00 ?  265 ILE A HG23 2  
ATOM 2971  H HD11 . ILE A 1 52  ? 3.194   -16.654 -11.270 1.00 0.00 ?  265 ILE A HD11 2  
ATOM 2972  H HD12 . ILE A 1 52  ? 1.876   -15.459 -11.320 1.00 0.00 ?  265 ILE A HD12 2  
ATOM 2973  H HD13 . ILE A 1 52  ? 2.484   -16.177 -12.831 1.00 0.00 ?  265 ILE A HD13 2  
ATOM 2974  N N    . GLY A 1 53  ? 5.157   -10.960 -10.495 1.00 0.00 ?  266 GLY A N    2  
ATOM 2975  C CA   . GLY A 1 53  ? 5.806   -9.856  -11.181 1.00 0.00 ?  266 GLY A CA   2  
ATOM 2976  C C    . GLY A 1 53  ? 4.773   -8.882  -11.751 1.00 0.00 ?  266 GLY A C    2  
ATOM 2977  O O    . GLY A 1 53  ? 4.796   -8.573  -12.941 1.00 0.00 ?  266 GLY A O    2  
ATOM 2978  H H    . GLY A 1 53  ? 5.442   -11.095 -9.546  1.00 0.00 ?  266 GLY A H    2  
ATOM 2979  H HA2  . GLY A 1 53  ? 6.464   -9.330  -10.489 1.00 0.00 ?  266 GLY A HA2  2  
ATOM 2980  H HA3  . GLY A 1 53  ? 6.432   -10.240 -11.986 1.00 0.00 ?  266 GLY A HA3  2  
ATOM 2981  N N    . GLU A 1 54  ? 3.891   -8.424  -10.874 1.00 0.00 ?  267 GLU A N    2  
ATOM 2982  C CA   . GLU A 1 54  ? 2.852   -7.491  -11.275 1.00 0.00 ?  267 GLU A CA   2  
ATOM 2983  C C    . GLU A 1 54  ? 3.458   -6.120  -11.579 1.00 0.00 ?  267 GLU A C    2  
ATOM 2984  O O    . GLU A 1 54  ? 4.606   -5.853  -11.227 1.00 0.00 ?  267 GLU A O    2  
ATOM 2985  C CB   . GLU A 1 54  ? 1.766   -7.386  -10.203 1.00 0.00 ?  267 GLU A CB   2  
ATOM 2986  C CG   . GLU A 1 54  ? 0.610   -8.345  -10.495 1.00 0.00 ?  267 GLU A CG   2  
ATOM 2987  C CD   . GLU A 1 54  ? -0.632  -7.581  -10.957 1.00 0.00 ?  267 GLU A CD   2  
ATOM 2988  O OE1  . GLU A 1 54  ? -1.220  -6.822  -10.173 1.00 0.00 ?  267 GLU A OE1  2  
ATOM 2989  O OE2  . GLU A 1 54  ? -0.982  -7.798  -12.180 1.00 0.00 -1 267 GLU A OE2  2  
ATOM 2990  H H    . GLU A 1 54  ? 3.879   -8.680  -9.908  1.00 0.00 ?  267 GLU A H    2  
ATOM 2991  H HA   . GLU A 1 54  ? 2.418   -7.913  -12.182 1.00 0.00 ?  267 GLU A HA   2  
ATOM 2992  H HB2  . GLU A 1 54  ? 2.192   -7.612  -9.225  1.00 0.00 ?  267 GLU A HB2  2  
ATOM 2993  H HB3  . GLU A 1 54  ? 1.392   -6.363  -10.158 1.00 0.00 ?  267 GLU A HB3  2  
ATOM 2994  H HG2  . GLU A 1 54  ? 0.910   -9.057  -11.264 1.00 0.00 ?  267 GLU A HG2  2  
ATOM 2995  H HG3  . GLU A 1 54  ? 0.376   -8.921  -9.600  1.00 0.00 ?  267 GLU A HG3  2  
ATOM 2996  H HE2  . GLU A 1 54  ? -1.962  -7.628  -12.290 1.00 0.00 ?  267 GLU A HE2  2  
ATOM 2997  N N    . PRO A 1 55  ? 2.638   -5.264  -12.247 1.00 0.00 ?  268 PRO A N    2  
ATOM 2998  C CA   . PRO A 1 55  ? 3.081   -3.927  -12.603 1.00 0.00 ?  268 PRO A CA   2  
ATOM 2999  C C    . PRO A 1 55  ? 3.096   -3.011  -11.377 1.00 0.00 ?  268 PRO A C    2  
ATOM 3000  O O    . PRO A 1 55  ? 2.118   -2.317  -11.105 1.00 0.00 ?  268 PRO A O    2  
ATOM 3001  C CB   . PRO A 1 55  ? 2.113   -3.465  -13.679 1.00 0.00 ?  268 PRO A CB   2  
ATOM 3002  C CG   . PRO A 1 55  ? 0.894   -4.364  -13.557 1.00 0.00 ?  268 PRO A CG   2  
ATOM 3003  C CD   . PRO A 1 55  ? 1.273   -5.547  -12.680 1.00 0.00 ?  268 PRO A CD   2  
ATOM 3004  H HA   . PRO A 1 55  ? 4.024   -3.951  -12.937 1.00 0.00 ?  268 PRO A HA   2  
ATOM 3005  H HB2  . PRO A 1 55  ? 1.842   -2.418  -13.537 1.00 0.00 ?  268 PRO A HB2  2  
ATOM 3006  H HB3  . PRO A 1 55  ? 2.561   -3.546  -14.669 1.00 0.00 ?  268 PRO A HB3  2  
ATOM 3007  H HG2  . PRO A 1 55  ? 0.058   -3.817  -13.120 1.00 0.00 ?  268 PRO A HG2  2  
ATOM 3008  H HG3  . PRO A 1 55  ? 0.571   -4.706  -14.540 1.00 0.00 ?  268 PRO A HG3  2  
ATOM 3009  H HD2  . PRO A 1 55  ? 0.599   -5.641  -11.829 1.00 0.00 ?  268 PRO A HD2  2  
ATOM 3010  H HD3  . PRO A 1 55  ? 1.219   -6.484  -13.235 1.00 0.00 ?  268 PRO A HD3  2  
ATOM 3011  N N    . GLY A 1 56  ? 4.217   -3.038  -10.671 1.00 0.00 ?  269 GLY A N    2  
ATOM 3012  C CA   . GLY A 1 56  ? 4.372   -2.219  -9.482  1.00 0.00 ?  269 GLY A CA   2  
ATOM 3013  C C    . GLY A 1 56  ? 3.756   -0.833  -9.686  1.00 0.00 ?  269 GLY A C    2  
ATOM 3014  O O    . GLY A 1 56  ? 4.414   0.073   -10.195 1.00 0.00 ?  269 GLY A O    2  
ATOM 3015  H H    . GLY A 1 56  ? 5.008   -3.606  -10.900 1.00 0.00 ?  269 GLY A H    2  
ATOM 3016  H HA2  . GLY A 1 56  ? 3.897   -2.710  -8.633  1.00 0.00 ?  269 GLY A HA2  2  
ATOM 3017  H HA3  . GLY A 1 56  ? 5.430   -2.118  -9.240  1.00 0.00 ?  269 GLY A HA3  2  
ATOM 3018  N N    . ASP A 1 57  ? 2.501   -0.712  -9.279  1.00 0.00 ?  270 ASP A N    2  
ATOM 3019  C CA   . ASP A 1 57  ? 1.790   0.548   -9.412  1.00 0.00 ?  270 ASP A CA   2  
ATOM 3020  C C    . ASP A 1 57  ? 0.460   0.459   -8.660  1.00 0.00 ?  270 ASP A C    2  
ATOM 3021  O O    . ASP A 1 57  ? -0.555  0.977   -9.123  1.00 0.00 ?  270 ASP A O    2  
ATOM 3022  C CB   . ASP A 1 57  ? 1.484   0.856   -10.879 1.00 0.00 ?  270 ASP A CB   2  
ATOM 3023  C CG   . ASP A 1 57  ? 0.642   -0.199  -11.599 1.00 0.00 ?  270 ASP A CG   2  
ATOM 3024  O OD1  . ASP A 1 57  ? 0.834   -0.460  -12.796 1.00 0.00 ?  270 ASP A OD1  2  
ATOM 3025  O OD2  . ASP A 1 57  ? -0.256  -0.771  -10.870 1.00 0.00 -1 270 ASP A OD2  2  
ATOM 3026  H H    . ASP A 1 57  ? 1.974   -1.455  -8.866  1.00 0.00 ?  270 ASP A H    2  
ATOM 3027  H HA   . ASP A 1 57  ? 2.457   1.299   -8.990  1.00 0.00 ?  270 ASP A HA   2  
ATOM 3028  H HB2  . ASP A 1 57  ? 0.965   1.813   -10.932 1.00 0.00 ?  270 ASP A HB2  2  
ATOM 3029  H HB3  . ASP A 1 57  ? 2.426   0.975   -11.413 1.00 0.00 ?  270 ASP A HB3  2  
ATOM 3030  H HD2  . ASP A 1 57  ? -1.022  -0.147  -10.720 1.00 0.00 ?  270 ASP A HD2  2  
ATOM 3031  N N    . ARG A 1 58  ? 0.508   -0.203  -7.513  1.00 0.00 ?  271 ARG A N    2  
ATOM 3032  C CA   . ARG A 1 58  ? -0.680  -0.366  -6.693  1.00 0.00 ?  271 ARG A CA   2  
ATOM 3033  C C    . ARG A 1 58  ? -0.305  -0.931  -5.321  1.00 0.00 ?  271 ARG A C    2  
ATOM 3034  O O    . ARG A 1 58  ? 0.716   -1.602  -5.180  1.00 0.00 ?  271 ARG A O    2  
ATOM 3035  C CB   . ARG A 1 58  ? -1.688  -1.302  -7.364  1.00 0.00 ?  271 ARG A CB   2  
ATOM 3036  C CG   . ARG A 1 58  ? -2.893  -0.522  -7.892  1.00 0.00 ?  271 ARG A CG   2  
ATOM 3037  C CD   . ARG A 1 58  ? -3.806  -1.422  -8.727  1.00 0.00 ?  271 ARG A CD   2  
ATOM 3038  N NE   . ARG A 1 58  ? -4.719  -0.596  -9.548  1.00 0.00 ?  271 ARG A NE   2  
ATOM 3039  C CZ   . ARG A 1 58  ? -5.602  -1.096  -10.423 1.00 0.00 ?  271 ARG A CZ   2  
ATOM 3040  N NH1  . ARG A 1 58  ? -5.697  -2.421  -10.597 1.00 0.00 ?  271 ARG A NH1  2  
ATOM 3041  N NH2  . ARG A 1 58  ? -6.391  -0.270  -11.124 1.00 0.00 1  271 ARG A NH2  2  
ATOM 3042  H H    . ARG A 1 58  ? 1.338   -0.621  -7.143  1.00 0.00 ?  271 ARG A H    2  
ATOM 3043  H HA   . ARG A 1 58  ? -1.097  0.637   -6.604  1.00 0.00 ?  271 ARG A HA   2  
ATOM 3044  H HB2  . ARG A 1 58  ? -1.205  -1.833  -8.184  1.00 0.00 ?  271 ARG A HB2  2  
ATOM 3045  H HB3  . ARG A 1 58  ? -2.022  -2.055  -6.650  1.00 0.00 ?  271 ARG A HB3  2  
ATOM 3046  H HG2  . ARG A 1 58  ? -3.455  -0.103  -7.057  1.00 0.00 ?  271 ARG A HG2  2  
ATOM 3047  H HG3  . ARG A 1 58  ? -2.551  0.317   -8.498  1.00 0.00 ?  271 ARG A HG3  2  
ATOM 3048  H HD2  . ARG A 1 58  ? -3.206  -2.065  -9.371  1.00 0.00 ?  271 ARG A HD2  2  
ATOM 3049  H HD3  . ARG A 1 58  ? -4.383  -2.076  -8.073  1.00 0.00 ?  271 ARG A HD3  2  
ATOM 3050  H HE   . ARG A 1 58  ? -4.674  0.398   -9.443  1.00 0.00 ?  271 ARG A HE   2  
ATOM 3051  H HH11 . ARG A 1 58  ? -5.108  -3.037  -10.073 1.00 0.00 ?  271 ARG A HH11 2  
ATOM 3052  H HH12 . ARG A 1 58  ? -6.356  -2.794  -11.250 1.00 0.00 ?  271 ARG A HH12 2  
ATOM 3053  H HH21 . ARG A 1 58  ? -6.320  0.719   -10.995 1.00 0.00 ?  271 ARG A HH21 2  
ATOM 3054  H HH22 . ARG A 1 58  ? -7.050  -0.643  -11.778 1.00 0.00 ?  271 ARG A HH22 2  
ATOM 3055  N N    . MET A 1 59  ? -1.151  -0.638  -4.345  1.00 0.00 ?  272 MET A N    2  
ATOM 3056  C CA   . MET A 1 59  ? -0.921  -1.108  -2.989  1.00 0.00 ?  272 MET A CA   2  
ATOM 3057  C C    . MET A 1 59  ? -2.140  -1.864  -2.457  1.00 0.00 ?  272 MET A C    2  
ATOM 3058  O O    . MET A 1 59  ? -3.272  -1.570  -2.838  1.00 0.00 ?  272 MET A O    2  
ATOM 3059  C CB   . MET A 1 59  ? -0.622  0.085   -2.079  1.00 0.00 ?  272 MET A CB   2  
ATOM 3060  C CG   . MET A 1 59  ? 0.585   -0.199  -1.183  1.00 0.00 ?  272 MET A CG   2  
ATOM 3061  S SD   . MET A 1 59  ? 0.810   1.137   -0.021  1.00 0.00 ?  272 MET A SD   2  
ATOM 3062  C CE   . MET A 1 59  ? 2.080   0.433   1.018   1.00 0.00 ?  272 MET A CE   2  
ATOM 3063  H H    . MET A 1 59  ? -1.980  -0.092  -4.468  1.00 0.00 ?  272 MET A H    2  
ATOM 3064  H HA   . MET A 1 59  ? -0.067  -1.782  -3.054  1.00 0.00 ?  272 MET A HA   2  
ATOM 3065  H HB2  . MET A 1 59  ? -0.429  0.970   -2.685  1.00 0.00 ?  272 MET A HB2  2  
ATOM 3066  H HB3  . MET A 1 59  ? -1.493  0.304   -1.462  1.00 0.00 ?  272 MET A HB3  2  
ATOM 3067  H HG2  . MET A 1 59  ? 0.439   -1.137  -0.647  1.00 0.00 ?  272 MET A HG2  2  
ATOM 3068  H HG3  . MET A 1 59  ? 1.482   -0.317  -1.792  1.00 0.00 ?  272 MET A HG3  2  
ATOM 3069  H HE1  . MET A 1 59  ? 1.765   -0.552  1.360   1.00 0.00 ?  272 MET A HE1  2  
ATOM 3070  H HE2  . MET A 1 59  ? 3.006   0.343   0.450   1.00 0.00 ?  272 MET A HE2  2  
ATOM 3071  H HE3  . MET A 1 59  ? 2.244   1.081   1.880   1.00 0.00 ?  272 MET A HE3  2  
ATOM 3072  N N    . PHE A 1 60  ? -1.868  -2.822  -1.583  1.00 0.00 ?  273 PHE A N    2  
ATOM 3073  C CA   . PHE A 1 60  ? -2.928  -3.622  -0.995  1.00 0.00 ?  273 PHE A CA   2  
ATOM 3074  C C    . PHE A 1 60  ? -2.717  -3.789  0.512   1.00 0.00 ?  273 PHE A C    2  
ATOM 3075  O O    . PHE A 1 60  ? -1.595  -4.010  0.964   1.00 0.00 ?  273 PHE A O    2  
ATOM 3076  C CB   . PHE A 1 60  ? -2.873  -4.998  -1.661  1.00 0.00 ?  273 PHE A CB   2  
ATOM 3077  C CG   . PHE A 1 60  ? -3.724  -5.111  -2.928  1.00 0.00 ?  273 PHE A CG   2  
ATOM 3078  C CD1  . PHE A 1 60  ? -5.053  -5.385  -2.832  1.00 0.00 ?  273 PHE A CD1  2  
ATOM 3079  C CD2  . PHE A 1 60  ? -3.152  -4.937  -4.149  1.00 0.00 ?  273 PHE A CD2  2  
ATOM 3080  C CE1  . PHE A 1 60  ? -5.842  -5.490  -4.008  1.00 0.00 ?  273 PHE A CE1  2  
ATOM 3081  C CE2  . PHE A 1 60  ? -3.942  -5.041  -5.324  1.00 0.00 ?  273 PHE A CE2  2  
ATOM 3082  C CZ   . PHE A 1 60  ? -5.270  -5.316  -5.229  1.00 0.00 ?  273 PHE A CZ   2  
ATOM 3083  H H    . PHE A 1 60  ? -0.944  -3.055  -1.279  1.00 0.00 ?  273 PHE A H    2  
ATOM 3084  H HA   . PHE A 1 60  ? -3.866  -3.096  -1.172  1.00 0.00 ?  273 PHE A HA   2  
ATOM 3085  H HB2  . PHE A 1 60  ? -1.837  -5.229  -1.910  1.00 0.00 ?  273 PHE A HB2  2  
ATOM 3086  H HB3  . PHE A 1 60  ? -3.204  -5.751  -0.945  1.00 0.00 ?  273 PHE A HB3  2  
ATOM 3087  H HD1  . PHE A 1 60  ? -5.511  -5.525  -1.853  1.00 0.00 ?  273 PHE A HD1  2  
ATOM 3088  H HD2  . PHE A 1 60  ? -2.087  -4.717  -4.226  1.00 0.00 ?  273 PHE A HD2  2  
ATOM 3089  H HE1  . PHE A 1 60  ? -6.907  -5.710  -3.931  1.00 0.00 ?  273 PHE A HE1  2  
ATOM 3090  H HE2  . PHE A 1 60  ? -3.483  -4.901  -6.303  1.00 0.00 ?  273 PHE A HE2  2  
ATOM 3091  H HZ   . PHE A 1 60  ? -5.876  -5.396  -6.131  1.00 0.00 ?  273 PHE A HZ   2  
ATOM 3092  N N    . PHE A 1 61  ? -3.814  -3.677  1.246   1.00 0.00 ?  274 PHE A N    2  
ATOM 3093  C CA   . PHE A 1 61  ? -3.763  -3.812  2.692   1.00 0.00 ?  274 PHE A CA   2  
ATOM 3094  C C    . PHE A 1 61  ? -4.796  -4.828  3.184   1.00 0.00 ?  274 PHE A C    2  
ATOM 3095  O O    . PHE A 1 61  ? -5.981  -4.713  2.875   1.00 0.00 ?  274 PHE A O    2  
ATOM 3096  C CB   . PHE A 1 61  ? -4.093  -2.440  3.282   1.00 0.00 ?  274 PHE A CB   2  
ATOM 3097  C CG   . PHE A 1 61  ? -3.039  -1.369  2.994   1.00 0.00 ?  274 PHE A CG   2  
ATOM 3098  C CD1  . PHE A 1 61  ? -1.722  -1.704  2.954   1.00 0.00 ?  274 PHE A CD1  2  
ATOM 3099  C CD2  . PHE A 1 61  ? -3.420  -0.081  2.778   1.00 0.00 ?  274 PHE A CD2  2  
ATOM 3100  C CE1  . PHE A 1 61  ? -0.744  -0.710  2.687   1.00 0.00 ?  274 PHE A CE1  2  
ATOM 3101  C CE2  . PHE A 1 61  ? -2.442  0.913   2.510   1.00 0.00 ?  274 PHE A CE2  2  
ATOM 3102  C CZ   . PHE A 1 61  ? -1.124  0.577   2.470   1.00 0.00 ?  274 PHE A CZ   2  
ATOM 3103  H H    . PHE A 1 61  ? -4.723  -3.497  0.871   1.00 0.00 ?  274 PHE A H    2  
ATOM 3104  H HA   . PHE A 1 61  ? -2.763  -4.161  2.950   1.00 0.00 ?  274 PHE A HA   2  
ATOM 3105  H HB2  . PHE A 1 61  ? -5.053  -2.107  2.886   1.00 0.00 ?  274 PHE A HB2  2  
ATOM 3106  H HB3  . PHE A 1 61  ? -4.210  -2.538  4.361   1.00 0.00 ?  274 PHE A HB3  2  
ATOM 3107  H HD1  . PHE A 1 61  ? -1.417  -2.736  3.127   1.00 0.00 ?  274 PHE A HD1  2  
ATOM 3108  H HD2  . PHE A 1 61  ? -4.476  0.188   2.810   1.00 0.00 ?  274 PHE A HD2  2  
ATOM 3109  H HE1  . PHE A 1 61  ? 0.312   -0.979  2.655   1.00 0.00 ?  274 PHE A HE1  2  
ATOM 3110  H HE2  . PHE A 1 61  ? -2.747  1.945   2.337   1.00 0.00 ?  274 PHE A HE2  2  
ATOM 3111  H HZ   . PHE A 1 61  ? -0.374  1.341   2.265   1.00 0.00 ?  274 PHE A HZ   2  
ATOM 3112  N N    . VAL A 1 62  ? -4.310  -5.799  3.942   1.00 0.00 ?  275 VAL A N    2  
ATOM 3113  C CA   . VAL A 1 62  ? -5.176  -6.834  4.480   1.00 0.00 ?  275 VAL A CA   2  
ATOM 3114  C C    . VAL A 1 62  ? -5.796  -6.344  5.790   1.00 0.00 ?  275 VAL A C    2  
ATOM 3115  O O    . VAL A 1 62  ? -5.089  -5.869  6.677   1.00 0.00 ?  275 VAL A O    2  
ATOM 3116  C CB   . VAL A 1 62  ? -4.395  -8.140  4.641   1.00 0.00 ?  275 VAL A CB   2  
ATOM 3117  C CG1  . VAL A 1 62  ? -5.174  -9.145  5.492   1.00 0.00 ?  275 VAL A CG1  2  
ATOM 3118  C CG2  . VAL A 1 62  ? -4.038  -8.736  3.278   1.00 0.00 ?  275 VAL A CG2  2  
ATOM 3119  H H    . VAL A 1 62  ? -3.345  -5.886  4.189   1.00 0.00 ?  275 VAL A H    2  
ATOM 3120  H HA   . VAL A 1 62  ? -5.973  -7.005  3.757   1.00 0.00 ?  275 VAL A HA   2  
ATOM 3121  H HB   . VAL A 1 62  ? -3.464  -7.912  5.160   1.00 0.00 ?  275 VAL A HB   2  
ATOM 3122  H HG11 . VAL A 1 62  ? -6.097  -9.416  4.978   1.00 0.00 ?  275 VAL A HG11 2  
ATOM 3123  H HG12 . VAL A 1 62  ? -4.568  -10.037 5.646   1.00 0.00 ?  275 VAL A HG12 2  
ATOM 3124  H HG13 . VAL A 1 62  ? -5.414  -8.696  6.455   1.00 0.00 ?  275 VAL A HG13 2  
ATOM 3125  H HG21 . VAL A 1 62  ? -4.483  -9.727  3.187   1.00 0.00 ?  275 VAL A HG21 2  
ATOM 3126  H HG22 . VAL A 1 62  ? -4.421  -8.091  2.487   1.00 0.00 ?  275 VAL A HG22 2  
ATOM 3127  H HG23 . VAL A 1 62  ? -2.954  -8.815  3.188   1.00 0.00 ?  275 VAL A HG23 2  
ATOM 3128  N N    . VAL A 1 63  ? -7.112  -6.476  5.870   1.00 0.00 ?  276 VAL A N    2  
ATOM 3129  C CA   . VAL A 1 63  ? -7.836  -6.053  7.057   1.00 0.00 ?  276 VAL A CA   2  
ATOM 3130  C C    . VAL A 1 63  ? -8.247  -7.285  7.865   1.00 0.00 ?  276 VAL A C    2  
ATOM 3131  O O    . VAL A 1 63  ? -8.063  -7.324  9.081   1.00 0.00 ?  276 VAL A O    2  
ATOM 3132  C CB   . VAL A 1 63  ? -9.024  -5.175  6.660   1.00 0.00 ?  276 VAL A CB   2  
ATOM 3133  C CG1  . VAL A 1 63  ? -9.754  -4.646  7.897   1.00 0.00 ?  276 VAL A CG1  2  
ATOM 3134  C CG2  . VAL A 1 63  ? -8.578  -4.025  5.754   1.00 0.00 ?  276 VAL A CG2  2  
ATOM 3135  H H    . VAL A 1 63  ? -7.681  -6.864  5.145   1.00 0.00 ?  276 VAL A H    2  
ATOM 3136  H HA   . VAL A 1 63  ? -7.157  -5.449  7.659   1.00 0.00 ?  276 VAL A HA   2  
ATOM 3137  H HB   . VAL A 1 63  ? -9.724  -5.792  6.097   1.00 0.00 ?  276 VAL A HB   2  
ATOM 3138  H HG11 . VAL A 1 63  ? -9.421  -3.630  8.108   1.00 0.00 ?  276 VAL A HG11 2  
ATOM 3139  H HG12 . VAL A 1 63  ? -10.828 -4.646  7.713   1.00 0.00 ?  276 VAL A HG12 2  
ATOM 3140  H HG13 . VAL A 1 63  ? -9.531  -5.287  8.751   1.00 0.00 ?  276 VAL A HG13 2  
ATOM 3141  H HG21 . VAL A 1 63  ? -8.642  -3.085  6.302   1.00 0.00 ?  276 VAL A HG21 2  
ATOM 3142  H HG22 . VAL A 1 63  ? -7.548  -4.191  5.437   1.00 0.00 ?  276 VAL A HG22 2  
ATOM 3143  H HG23 . VAL A 1 63  ? -9.226  -3.980  4.878   1.00 0.00 ?  276 VAL A HG23 2  
ATOM 3144  N N    . GLU A 1 64  ? -8.797  -8.261  7.158   1.00 0.00 ?  277 GLU A N    2  
ATOM 3145  C CA   . GLU A 1 64  ? -9.235  -9.491  7.794   1.00 0.00 ?  277 GLU A CA   2  
ATOM 3146  C C    . GLU A 1 64  ? -9.089  -10.670 6.829   1.00 0.00 ?  277 GLU A C    2  
ATOM 3147  O O    . GLU A 1 64  ? -9.364  -10.538 5.638   1.00 0.00 ?  277 GLU A O    2  
ATOM 3148  C CB   . GLU A 1 64  ? -10.676 -9.367  8.293   1.00 0.00 ?  277 GLU A CB   2  
ATOM 3149  C CG   . GLU A 1 64  ? -11.295 -8.038  7.856   1.00 0.00 ?  277 GLU A CG   2  
ATOM 3150  C CD   . GLU A 1 64  ? -12.680 -7.847  8.477   1.00 0.00 ?  277 GLU A CD   2  
ATOM 3151  O OE1  . GLU A 1 64  ? -12.786 -7.421  9.637   1.00 0.00 ?  277 GLU A OE1  2  
ATOM 3152  O OE2  . GLU A 1 64  ? -13.670 -8.157  7.710   1.00 0.00 -1 277 GLU A OE2  2  
ATOM 3153  H H    . GLU A 1 64  ? -8.943  -8.221  6.169   1.00 0.00 ?  277 GLU A H    2  
ATOM 3154  H HA   . GLU A 1 64  ? -8.572  -9.628  8.648   1.00 0.00 ?  277 GLU A HA   2  
ATOM 3155  H HB2  . GLU A 1 64  ? -11.271 -10.194 7.907   1.00 0.00 ?  277 GLU A HB2  2  
ATOM 3156  H HB3  . GLU A 1 64  ? -10.696 -9.441  9.381   1.00 0.00 ?  277 GLU A HB3  2  
ATOM 3157  H HG2  . GLU A 1 64  ? -10.644 -7.215  8.150   1.00 0.00 ?  277 GLU A HG2  2  
ATOM 3158  H HG3  . GLU A 1 64  ? -11.373 -8.009  6.769   1.00 0.00 ?  277 GLU A HG3  2  
ATOM 3159  H HE2  . GLU A 1 64  ? -14.464 -7.592  7.931   1.00 0.00 ?  277 GLU A HE2  2  
ATOM 3160  N N    . GLY A 1 65  ? -8.657  -11.794 7.380   1.00 0.00 ?  278 GLY A N    2  
ATOM 3161  C CA   . GLY A 1 65  ? -8.471  -12.995 6.583   1.00 0.00 ?  278 GLY A CA   2  
ATOM 3162  C C    . GLY A 1 65  ? -7.000  -13.416 6.561   1.00 0.00 ?  278 GLY A C    2  
ATOM 3163  O O    . GLY A 1 65  ? -6.247  -13.105 7.483   1.00 0.00 ?  278 GLY A O    2  
ATOM 3164  H H    . GLY A 1 65  ? -8.435  -11.893 8.350   1.00 0.00 ?  278 GLY A H    2  
ATOM 3165  H HA2  . GLY A 1 65  ? -9.078  -13.803 6.990   1.00 0.00 ?  278 GLY A HA2  2  
ATOM 3166  H HA3  . GLY A 1 65  ? -8.817  -12.817 5.565   1.00 0.00 ?  278 GLY A HA3  2  
ATOM 3167  N N    . SER A 1 66  ? -6.634  -14.117 5.498   1.00 0.00 ?  279 SER A N    2  
ATOM 3168  C CA   . SER A 1 66  ? -5.267  -14.584 5.344   1.00 0.00 ?  279 SER A CA   2  
ATOM 3169  C C    . SER A 1 66  ? -4.891  -14.620 3.861   1.00 0.00 ?  279 SER A C    2  
ATOM 3170  O O    . SER A 1 66  ? -5.637  -15.152 3.040   1.00 0.00 ?  279 SER A O    2  
ATOM 3171  C CB   . SER A 1 66  ? -5.083  -15.967 5.972   1.00 0.00 ?  279 SER A CB   2  
ATOM 3172  O OG   . SER A 1 66  ? -4.888  -15.891 7.381   1.00 0.00 ?  279 SER A OG   2  
ATOM 3173  H H    . SER A 1 66  ? -7.252  -14.366 4.753   1.00 0.00 ?  279 SER A H    2  
ATOM 3174  H HA   . SER A 1 66  ? -4.652  -13.859 5.877   1.00 0.00 ?  279 SER A HA   2  
ATOM 3175  H HB2  . SER A 1 66  ? -5.958  -16.581 5.760   1.00 0.00 ?  279 SER A HB2  2  
ATOM 3176  H HB3  . SER A 1 66  ? -4.228  -16.463 5.513   1.00 0.00 ?  279 SER A HB3  2  
ATOM 3177  H HG   . SER A 1 66  ? -4.087  -15.328 7.586   1.00 0.00 ?  279 SER A HG   2  
ATOM 3178  N N    . VAL A 1 67  ? -3.733  -14.049 3.563   1.00 0.00 ?  280 VAL A N    2  
ATOM 3179  C CA   . VAL A 1 67  ? -3.248  -14.009 2.194   1.00 0.00 ?  280 VAL A CA   2  
ATOM 3180  C C    . VAL A 1 67  ? -1.940  -14.796 2.097   1.00 0.00 ?  280 VAL A C    2  
ATOM 3181  O O    . VAL A 1 67  ? -1.065  -14.660 2.950   1.00 0.00 ?  280 VAL A O    2  
ATOM 3182  C CB   . VAL A 1 67  ? -3.108  -12.557 1.731   1.00 0.00 ?  280 VAL A CB   2  
ATOM 3183  C CG1  . VAL A 1 67  ? -4.434  -11.806 1.871   1.00 0.00 ?  280 VAL A CG1  2  
ATOM 3184  C CG2  . VAL A 1 67  ? -1.990  -11.844 2.493   1.00 0.00 ?  280 VAL A CG2  2  
ATOM 3185  H H    . VAL A 1 67  ? -3.132  -13.619 4.237   1.00 0.00 ?  280 VAL A H    2  
ATOM 3186  H HA   . VAL A 1 67  ? -3.997  -14.493 1.566   1.00 0.00 ?  280 VAL A HA   2  
ATOM 3187  H HB   . VAL A 1 67  ? -2.839  -12.567 0.674   1.00 0.00 ?  280 VAL A HB   2  
ATOM 3188  H HG11 . VAL A 1 67  ? -4.721  -11.771 2.922   1.00 0.00 ?  280 VAL A HG11 2  
ATOM 3189  H HG12 . VAL A 1 67  ? -4.318  -10.791 1.492   1.00 0.00 ?  280 VAL A HG12 2  
ATOM 3190  H HG13 . VAL A 1 67  ? -5.206  -12.322 1.300   1.00 0.00 ?  280 VAL A HG13 2  
ATOM 3191  H HG21 . VAL A 1 67  ? -1.907  -10.816 2.140   1.00 0.00 ?  280 VAL A HG21 2  
ATOM 3192  H HG22 . VAL A 1 67  ? -2.220  -11.844 3.559   1.00 0.00 ?  280 VAL A HG22 2  
ATOM 3193  H HG23 . VAL A 1 67  ? -1.047  -12.364 2.325   1.00 0.00 ?  280 VAL A HG23 2  
ATOM 3194  N N    . SER A 1 68  ? -1.849  -15.603 1.050   1.00 0.00 ?  281 SER A N    2  
ATOM 3195  C CA   . SER A 1 68  ? -0.662  -16.413 0.831   1.00 0.00 ?  281 SER A CA   2  
ATOM 3196  C C    . SER A 1 68  ? 0.208   -15.782 -0.258  1.00 0.00 ?  281 SER A C    2  
ATOM 3197  O O    . SER A 1 68  ? -0.304  -15.128 -1.165  1.00 0.00 ?  281 SER A O    2  
ATOM 3198  C CB   . SER A 1 68  ? -1.036  -17.846 0.447   1.00 0.00 ?  281 SER A CB   2  
ATOM 3199  O OG   . SER A 1 68  ? 0.108   -18.624 0.108   1.00 0.00 ?  281 SER A OG   2  
ATOM 3200  H H    . SER A 1 68  ? -2.565  -15.708 0.361   1.00 0.00 ?  281 SER A H    2  
ATOM 3201  H HA   . SER A 1 68  ? -0.136  -16.418 1.786   1.00 0.00 ?  281 SER A HA   2  
ATOM 3202  H HB2  . SER A 1 68  ? -1.562  -18.318 1.278   1.00 0.00 ?  281 SER A HB2  2  
ATOM 3203  H HB3  . SER A 1 68  ? -1.726  -17.827 -0.397  1.00 0.00 ?  281 SER A HB3  2  
ATOM 3204  H HG   . SER A 1 68  ? 0.699   -18.731 0.908   1.00 0.00 ?  281 SER A HG   2  
ATOM 3205  N N    . VAL A 1 69  ? 1.508   -16.000 -0.132  1.00 0.00 ?  282 VAL A N    2  
ATOM 3206  C CA   . VAL A 1 69  ? 2.454   -15.461 -1.094  1.00 0.00 ?  282 VAL A CA   2  
ATOM 3207  C C    . VAL A 1 69  ? 3.101   -16.613 -1.867  1.00 0.00 ?  282 VAL A C    2  
ATOM 3208  O O    . VAL A 1 69  ? 3.579   -17.575 -1.269  1.00 0.00 ?  282 VAL A O    2  
ATOM 3209  C CB   . VAL A 1 69  ? 3.475   -14.572 -0.382  1.00 0.00 ?  282 VAL A CB   2  
ATOM 3210  C CG1  . VAL A 1 69  ? 3.901   -13.403 -1.274  1.00 0.00 ?  282 VAL A CG1  2  
ATOM 3211  C CG2  . VAL A 1 69  ? 2.927   -14.069 0.955   1.00 0.00 ?  282 VAL A CG2  2  
ATOM 3212  H H    . VAL A 1 69  ? 1.917   -16.534 0.609   1.00 0.00 ?  282 VAL A H    2  
ATOM 3213  H HA   . VAL A 1 69  ? 1.895   -14.840 -1.793  1.00 0.00 ?  282 VAL A HA   2  
ATOM 3214  H HB   . VAL A 1 69  ? 4.359   -15.175 -0.176  1.00 0.00 ?  282 VAL A HB   2  
ATOM 3215  H HG11 . VAL A 1 69  ? 4.341   -12.619 -0.659  1.00 0.00 ?  282 VAL A HG11 2  
ATOM 3216  H HG12 . VAL A 1 69  ? 4.635   -13.750 -2.001  1.00 0.00 ?  282 VAL A HG12 2  
ATOM 3217  H HG13 . VAL A 1 69  ? 3.030   -13.009 -1.797  1.00 0.00 ?  282 VAL A HG13 2  
ATOM 3218  H HG21 . VAL A 1 69  ? 1.892   -13.751 0.826   1.00 0.00 ?  282 VAL A HG21 2  
ATOM 3219  H HG22 . VAL A 1 69  ? 2.971   -14.872 1.690   1.00 0.00 ?  282 VAL A HG22 2  
ATOM 3220  H HG23 . VAL A 1 69  ? 3.526   -13.227 1.300   1.00 0.00 ?  282 VAL A HG23 2  
ATOM 3221  N N    . ALA A 1 70  ? 3.095   -16.475 -3.185  1.00 0.00 ?  283 ALA A N    2  
ATOM 3222  C CA   . ALA A 1 70  ? 3.675   -17.492 -4.046  1.00 0.00 ?  283 ALA A CA   2  
ATOM 3223  C C    . ALA A 1 70  ? 5.199   -17.370 -4.017  1.00 0.00 ?  283 ALA A C    2  
ATOM 3224  O O    . ALA A 1 70  ? 5.768   -16.495 -4.669  1.00 0.00 ?  283 ALA A O    2  
ATOM 3225  C CB   . ALA A 1 70  ? 3.105   -17.350 -5.459  1.00 0.00 ?  283 ALA A CB   2  
ATOM 3226  H H    . ALA A 1 70  ? 2.704   -15.689 -3.664  1.00 0.00 ?  283 ALA A H    2  
ATOM 3227  H HA   . ALA A 1 70  ? 3.389   -18.466 -3.649  1.00 0.00 ?  283 ALA A HA   2  
ATOM 3228  H HB1  . ALA A 1 70  ? 2.171   -16.790 -5.420  1.00 0.00 ?  283 ALA A HB1  2  
ATOM 3229  H HB2  . ALA A 1 70  ? 3.820   -16.819 -6.088  1.00 0.00 ?  283 ALA A HB2  2  
ATOM 3230  H HB3  . ALA A 1 70  ? 2.919   -18.339 -5.877  1.00 0.00 ?  283 ALA A HB3  2  
ATOM 3231  N N    . THR A 1 71  ? 5.818   -18.259 -3.255  1.00 0.00 ?  284 THR A N    2  
ATOM 3232  C CA   . THR A 1 71  ? 7.266   -18.262 -3.132  1.00 0.00 ?  284 THR A CA   2  
ATOM 3233  C C    . THR A 1 71  ? 7.779   -19.684 -2.898  1.00 0.00 ?  284 THR A C    2  
ATOM 3234  O O    . THR A 1 71  ? 7.030   -20.649 -3.043  1.00 0.00 ?  284 THR A O    2  
ATOM 3235  C CB   . THR A 1 71  ? 7.648   -17.287 -2.016  1.00 0.00 ?  284 THR A CB   2  
ATOM 3236  O OG1  . THR A 1 71  ? 7.720   -18.104 -0.851  1.00 0.00 ?  284 THR A OG1  2  
ATOM 3237  C CG2  . THR A 1 71  ? 6.531   -16.289 -1.703  1.00 0.00 ?  284 THR A CG2  2  
ATOM 3238  H H    . THR A 1 71  ? 5.348   -18.967 -2.728  1.00 0.00 ?  284 THR A H    2  
ATOM 3239  H HA   . THR A 1 71  ? 7.691   -17.920 -4.075  1.00 0.00 ?  284 THR A HA   2  
ATOM 3240  H HB   . THR A 1 71  ? 8.577   -16.769 -2.253  1.00 0.00 ?  284 THR A HB   2  
ATOM 3241  H HG1  . THR A 1 71  ? 7.975   -17.548 -0.059  1.00 0.00 ?  284 THR A HG1  2  
ATOM 3242  H HG21 . THR A 1 71  ? 6.267   -15.743 -2.608  1.00 0.00 ?  284 THR A HG21 2  
ATOM 3243  H HG22 . THR A 1 71  ? 5.657   -16.826 -1.335  1.00 0.00 ?  284 THR A HG22 2  
ATOM 3244  H HG23 . THR A 1 71  ? 6.873   -15.587 -0.942  1.00 0.00 ?  284 THR A HG23 2  
ATOM 3245  N N    . PRO A 1 72  ? 9.085   -19.770 -2.530  1.00 0.00 ?  285 PRO A N    2  
ATOM 3246  C CA   . PRO A 1 72  ? 9.707   -21.059 -2.274  1.00 0.00 ?  285 PRO A CA   2  
ATOM 3247  C C    . PRO A 1 72  ? 9.254   -21.628 -0.928  1.00 0.00 ?  285 PRO A C    2  
ATOM 3248  O O    . PRO A 1 72  ? 9.729   -22.681 -0.505  1.00 0.00 ?  285 PRO A O    2  
ATOM 3249  C CB   . PRO A 1 72  ? 11.202  -20.793 -2.334  1.00 0.00 ?  285 PRO A CB   2  
ATOM 3250  C CG   . PRO A 1 72  ? 11.366  -19.291 -2.159  1.00 0.00 ?  285 PRO A CG   2  
ATOM 3251  C CD   . PRO A 1 72  ? 10.002  -18.649 -2.348  1.00 0.00 ?  285 PRO A CD   2  
ATOM 3252  H HA   . PRO A 1 72  ? 9.421   -21.725 -2.963  1.00 0.00 ?  285 PRO A HA   2  
ATOM 3253  H HB2  . PRO A 1 72  ? 11.727  -21.337 -1.549  1.00 0.00 ?  285 PRO A HB2  2  
ATOM 3254  H HB3  . PRO A 1 72  ? 11.620  -21.122 -3.285  1.00 0.00 ?  285 PRO A HB3  2  
ATOM 3255  H HG2  . PRO A 1 72  ? 11.761  -19.064 -1.168  1.00 0.00 ?  285 PRO A HG2  2  
ATOM 3256  H HG3  . PRO A 1 72  ? 12.078  -18.898 -2.884  1.00 0.00 ?  285 PRO A HG3  2  
ATOM 3257  H HD2  . PRO A 1 72  ? 9.724   -18.046 -1.483  1.00 0.00 ?  285 PRO A HD2  2  
ATOM 3258  H HD3  . PRO A 1 72  ? 9.993   -17.986 -3.214  1.00 0.00 ?  285 PRO A HD3  2  
ATOM 3259  N N    . ASN A 1 73  ? 8.342   -20.907 -0.293  1.00 0.00 ?  286 ASN A N    2  
ATOM 3260  C CA   . ASN A 1 73  ? 7.820   -21.327 0.996   1.00 0.00 ?  286 ASN A CA   2  
ATOM 3261  C C    . ASN A 1 73  ? 6.397   -20.791 1.165   1.00 0.00 ?  286 ASN A C    2  
ATOM 3262  O O    . ASN A 1 73  ? 6.017   -19.816 0.519   1.00 0.00 ?  286 ASN A O    2  
ATOM 3263  C CB   . ASN A 1 73  ? 8.672   -20.776 2.141   1.00 0.00 ?  286 ASN A CB   2  
ATOM 3264  C CG   . ASN A 1 73  ? 10.116  -21.272 2.039   1.00 0.00 ?  286 ASN A CG   2  
ATOM 3265  O OD1  . ASN A 1 73  ? 11.046  -20.514 1.820   1.00 0.00 ?  286 ASN A OD1  2  
ATOM 3266  N ND2  . ASN A 1 73  ? 10.250  -22.584 2.209   1.00 0.00 ?  286 ASN A ND2  2  
ATOM 3267  H H    . ASN A 1 73  ? 7.962   -20.052 -0.644  1.00 0.00 ?  286 ASN A H    2  
ATOM 3268  H HA   . ASN A 1 73  ? 7.856   -22.416 0.979   1.00 0.00 ?  286 ASN A HA   2  
ATOM 3269  H HB2  . ASN A 1 73  ? 8.656   -19.687 2.120   1.00 0.00 ?  286 ASN A HB2  2  
ATOM 3270  H HB3  . ASN A 1 73  ? 8.246   -21.082 3.097   1.00 0.00 ?  286 ASN A HB3  2  
ATOM 3271  H HD21 . ASN A 1 73  ? 9.445   -23.151 2.386   1.00 0.00 ?  286 ASN A HD21 2  
ATOM 3272  H HD22 . ASN A 1 73  ? 11.156  -23.005 2.160   1.00 0.00 ?  286 ASN A HD22 2  
ATOM 3273  N N    . PRO A 1 74  ? 5.630   -21.469 2.061   1.00 0.00 ?  287 PRO A N    2  
ATOM 3274  C CA   . PRO A 1 74  ? 4.258   -21.071 2.322   1.00 0.00 ?  287 PRO A CA   2  
ATOM 3275  C C    . PRO A 1 74  ? 4.208   -19.807 3.184   1.00 0.00 ?  287 PRO A C    2  
ATOM 3276  O O    . PRO A 1 74  ? 4.229   -19.887 4.411   1.00 0.00 ?  287 PRO A O    2  
ATOM 3277  C CB   . PRO A 1 74  ? 3.621   -22.275 2.997   1.00 0.00 ?  287 PRO A CB   2  
ATOM 3278  C CG   . PRO A 1 74  ? 4.773   -23.125 3.506   1.00 0.00 ?  287 PRO A CG   2  
ATOM 3279  C CD   . PRO A 1 74  ? 6.048   -22.628 2.844   1.00 0.00 ?  287 PRO A CD   2  
ATOM 3280  H HA   . PRO A 1 74  ? 3.795   -20.837 1.468   1.00 0.00 ?  287 PRO A HA   2  
ATOM 3281  H HB2  . PRO A 1 74  ? 2.972   -21.966 3.816   1.00 0.00 ?  287 PRO A HB2  2  
ATOM 3282  H HB3  . PRO A 1 74  ? 3.003   -22.834 2.295   1.00 0.00 ?  287 PRO A HB3  2  
ATOM 3283  H HG2  . PRO A 1 74  ? 4.852   -23.051 4.591   1.00 0.00 ?  287 PRO A HG2  2  
ATOM 3284  H HG3  . PRO A 1 74  ? 4.605   -24.176 3.270   1.00 0.00 ?  287 PRO A HG3  2  
ATOM 3285  H HD2  . PRO A 1 74  ? 6.798   -22.355 3.586   1.00 0.00 ?  287 PRO A HD2  2  
ATOM 3286  H HD3  . PRO A 1 74  ? 6.491   -23.396 2.210   1.00 0.00 ?  287 PRO A HD3  2  
ATOM 3287  N N    . VAL A 1 75  ? 4.143   -18.670 2.507   1.00 0.00 ?  288 VAL A N    2  
ATOM 3288  C CA   . VAL A 1 75  ? 4.091   -17.392 3.195   1.00 0.00 ?  288 VAL A CA   2  
ATOM 3289  C C    . VAL A 1 75  ? 2.632   -16.951 3.334   1.00 0.00 ?  288 VAL A C    2  
ATOM 3290  O O    . VAL A 1 75  ? 1.940   -16.759 2.335   1.00 0.00 ?  288 VAL A O    2  
ATOM 3291  C CB   . VAL A 1 75  ? 4.958   -16.366 2.462   1.00 0.00 ?  288 VAL A CB   2  
ATOM 3292  C CG1  . VAL A 1 75  ? 5.044   -15.058 3.250   1.00 0.00 ?  288 VAL A CG1  2  
ATOM 3293  C CG2  . VAL A 1 75  ? 6.352   -16.929 2.178   1.00 0.00 ?  288 VAL A CG2  2  
ATOM 3294  H H    . VAL A 1 75  ? 4.127   -18.614 1.509   1.00 0.00 ?  288 VAL A H    2  
ATOM 3295  H HA   . VAL A 1 75  ? 4.510   -17.537 4.191   1.00 0.00 ?  288 VAL A HA   2  
ATOM 3296  H HB   . VAL A 1 75  ? 4.483   -16.150 1.504   1.00 0.00 ?  288 VAL A HB   2  
ATOM 3297  H HG11 . VAL A 1 75  ? 5.085   -14.218 2.556   1.00 0.00 ?  288 VAL A HG11 2  
ATOM 3298  H HG12 . VAL A 1 75  ? 4.167   -14.959 3.889   1.00 0.00 ?  288 VAL A HG12 2  
ATOM 3299  H HG13 . VAL A 1 75  ? 5.944   -15.063 3.865   1.00 0.00 ?  288 VAL A HG13 2  
ATOM 3300  H HG21 . VAL A 1 75  ? 6.259   -17.894 1.679   1.00 0.00 ?  288 VAL A HG21 2  
ATOM 3301  H HG22 . VAL A 1 75  ? 6.899   -16.238 1.537   1.00 0.00 ?  288 VAL A HG22 2  
ATOM 3302  H HG23 . VAL A 1 75  ? 6.890   -17.057 3.118   1.00 0.00 ?  288 VAL A HG23 2  
ATOM 3303  N N    . GLU A 1 76  ? 2.207   -16.805 4.580   1.00 0.00 ?  289 GLU A N    2  
ATOM 3304  C CA   . GLU A 1 76  ? 0.843   -16.391 4.862   1.00 0.00 ?  289 GLU A CA   2  
ATOM 3305  C C    . GLU A 1 76  ? 0.839   -15.140 5.742   1.00 0.00 ?  289 GLU A C    2  
ATOM 3306  O O    . GLU A 1 76  ? 1.630   -15.033 6.679   1.00 0.00 ?  289 GLU A O    2  
ATOM 3307  C CB   . GLU A 1 76  ? 0.050   -17.524 5.516   1.00 0.00 ?  289 GLU A CB   2  
ATOM 3308  C CG   . GLU A 1 76  ? -0.542  -18.459 4.460   1.00 0.00 ?  289 GLU A CG   2  
ATOM 3309  C CD   . GLU A 1 76  ? -0.960  -19.794 5.081   1.00 0.00 ?  289 GLU A CD   2  
ATOM 3310  O OE1  . GLU A 1 76  ? -0.230  -20.789 4.960   1.00 0.00 ?  289 GLU A OE1  2  
ATOM 3311  O OE2  . GLU A 1 76  ? -2.086  -19.774 5.710   1.00 0.00 -1 289 GLU A OE2  2  
ATOM 3312  H H    . GLU A 1 76  ? 2.776   -16.963 5.387   1.00 0.00 ?  289 GLU A H    2  
ATOM 3313  H HA   . GLU A 1 76  ? 0.404   -16.161 3.891   1.00 0.00 ?  289 GLU A HA   2  
ATOM 3314  H HB2  . GLU A 1 76  ? 0.701   -18.089 6.184   1.00 0.00 ?  289 GLU A HB2  2  
ATOM 3315  H HB3  . GLU A 1 76  ? -0.750  -17.107 6.128   1.00 0.00 ?  289 GLU A HB3  2  
ATOM 3316  H HG2  . GLU A 1 76  ? -1.406  -17.985 3.993   1.00 0.00 ?  289 GLU A HG2  2  
ATOM 3317  H HG3  . GLU A 1 76  ? 0.190   -18.634 3.672   1.00 0.00 ?  289 GLU A HG3  2  
ATOM 3318  H HE2  . GLU A 1 76  ? -2.352  -20.704 5.964   1.00 0.00 ?  289 GLU A HE2  2  
ATOM 3319  N N    . LEU A 1 77  ? -0.060  -14.224 5.411   1.00 0.00 ?  290 LEU A N    2  
ATOM 3320  C CA   . LEU A 1 77  ? -0.177  -12.985 6.160   1.00 0.00 ?  290 LEU A CA   2  
ATOM 3321  C C    . LEU A 1 77  ? -1.595  -12.865 6.721   1.00 0.00 ?  290 LEU A C    2  
ATOM 3322  O O    . LEU A 1 77  ? -2.564  -13.220 6.051   1.00 0.00 ?  290 LEU A O    2  
ATOM 3323  C CB   . LEU A 1 77  ? 0.245   -11.795 5.297   1.00 0.00 ?  290 LEU A CB   2  
ATOM 3324  C CG   . LEU A 1 77  ? 1.744   -11.489 5.262   1.00 0.00 ?  290 LEU A CG   2  
ATOM 3325  C CD1  . LEU A 1 77  ? 2.235   -10.996 6.625   1.00 0.00 ?  290 LEU A CD1  2  
ATOM 3326  C CD2  . LEU A 1 77  ? 2.539   -12.700 4.770   1.00 0.00 ?  290 LEU A CD2  2  
ATOM 3327  H H    . LEU A 1 77  ? -0.699  -14.319 4.649   1.00 0.00 ?  290 LEU A H    2  
ATOM 3328  H HA   . LEU A 1 77  ? 0.521   -13.041 6.996   1.00 0.00 ?  290 LEU A HA   2  
ATOM 3329  H HB2  . LEU A 1 77  ? -0.093  -11.974 4.276   1.00 0.00 ?  290 LEU A HB2  2  
ATOM 3330  H HB3  . LEU A 1 77  ? -0.278  -10.908 5.654   1.00 0.00 ?  290 LEU A HB3  2  
ATOM 3331  H HG   . LEU A 1 77  ? 1.912   -10.683 4.548   1.00 0.00 ?  290 LEU A HG   2  
ATOM 3332  H HD11 . LEU A 1 77  ? 3.281   -10.699 6.548   1.00 0.00 ?  290 LEU A HD11 2  
ATOM 3333  H HD12 . LEU A 1 77  ? 1.636   -10.142 6.939   1.00 0.00 ?  290 LEU A HD12 2  
ATOM 3334  H HD13 . LEU A 1 77  ? 2.137   -11.797 7.357   1.00 0.00 ?  290 LEU A HD13 2  
ATOM 3335  H HD21 . LEU A 1 77  ? 2.866   -13.292 5.625   1.00 0.00 ?  290 LEU A HD21 2  
ATOM 3336  H HD22 . LEU A 1 77  ? 1.908   -13.312 4.125   1.00 0.00 ?  290 LEU A HD22 2  
ATOM 3337  H HD23 . LEU A 1 77  ? 3.410   -12.360 4.209   1.00 0.00 ?  290 LEU A HD23 2  
ATOM 3338  N N    . GLY A 1 78  ? -1.673  -12.364 7.945   1.00 0.00 ?  291 GLY A N    2  
ATOM 3339  C CA   . GLY A 1 78  ? -2.957  -12.193 8.604   1.00 0.00 ?  291 GLY A CA   2  
ATOM 3340  C C    . GLY A 1 78  ? -3.458  -10.754 8.463   1.00 0.00 ?  291 GLY A C    2  
ATOM 3341  O O    . GLY A 1 78  ? -3.085  -10.052 7.525   1.00 0.00 ?  291 GLY A O    2  
ATOM 3342  H H    . GLY A 1 78  ? -0.880  -12.078 8.484   1.00 0.00 ?  291 GLY A H    2  
ATOM 3343  H HA2  . GLY A 1 78  ? -3.685  -12.879 8.172   1.00 0.00 ?  291 GLY A HA2  2  
ATOM 3344  H HA3  . GLY A 1 78  ? -2.865  -12.448 9.660   1.00 0.00 ?  291 GLY A HA3  2  
ATOM 3345  N N    . PRO A 1 79  ? -4.319  -10.348 9.434   1.00 0.00 ?  292 PRO A N    2  
ATOM 3346  C CA   . PRO A 1 79  ? -4.875  -9.005  9.428   1.00 0.00 ?  292 PRO A CA   2  
ATOM 3347  C C    . PRO A 1 79  ? -3.833  -7.978  9.873   1.00 0.00 ?  292 PRO A C    2  
ATOM 3348  O O    . PRO A 1 79  ? -2.978  -8.276  10.705  1.00 0.00 ?  292 PRO A O    2  
ATOM 3349  C CB   . PRO A 1 79  ? -6.077  -9.073  10.356  1.00 0.00 ?  292 PRO A CB   2  
ATOM 3350  C CG   . PRO A 1 79  ? -5.878  -10.317 11.206  1.00 0.00 ?  292 PRO A CG   2  
ATOM 3351  C CD   . PRO A 1 79  ? -4.783  -11.152 10.561  1.00 0.00 ?  292 PRO A CD   2  
ATOM 3352  H HA   . PRO A 1 79  ? -5.138  -8.743  8.499   1.00 0.00 ?  292 PRO A HA   2  
ATOM 3353  H HB2  . PRO A 1 79  ? -6.140  -8.181  10.979  1.00 0.00 ?  292 PRO A HB2  2  
ATOM 3354  H HB3  . PRO A 1 79  ? -7.006  -9.132  9.789   1.00 0.00 ?  292 PRO A HB3  2  
ATOM 3355  H HG2  . PRO A 1 79  ? -5.599  -10.044 12.224  1.00 0.00 ?  292 PRO A HG2  2  
ATOM 3356  H HG3  . PRO A 1 79  ? -6.804  -10.887 11.271  1.00 0.00 ?  292 PRO A HG3  2  
ATOM 3357  H HD2  . PRO A 1 79  ? -3.974  -11.355 11.263  1.00 0.00 ?  292 PRO A HD2  2  
ATOM 3358  H HD3  . PRO A 1 79  ? -5.166  -12.117 10.227  1.00 0.00 ?  292 PRO A HD3  2  
ATOM 3359  N N    . GLY A 1 80  ? -3.938  -6.788  9.298   1.00 0.00 ?  293 GLY A N    2  
ATOM 3360  C CA   . GLY A 1 80  ? -3.015  -5.715  9.625   1.00 0.00 ?  293 GLY A CA   2  
ATOM 3361  C C    . GLY A 1 80  ? -1.743  -5.809  8.780   1.00 0.00 ?  293 GLY A C    2  
ATOM 3362  O O    . GLY A 1 80  ? -0.798  -5.050  8.988   1.00 0.00 ?  293 GLY A O    2  
ATOM 3363  H H    . GLY A 1 80  ? -4.636  -6.554  8.622   1.00 0.00 ?  293 GLY A H    2  
ATOM 3364  H HA2  . GLY A 1 80  ? -3.498  -4.752  9.457   1.00 0.00 ?  293 GLY A HA2  2  
ATOM 3365  H HA3  . GLY A 1 80  ? -2.758  -5.761  10.683  1.00 0.00 ?  293 GLY A HA3  2  
ATOM 3366  N N    . ALA A 1 81  ? -1.760  -6.747  7.845   1.00 0.00 ?  294 ALA A N    2  
ATOM 3367  C CA   . ALA A 1 81  ? -0.620  -6.950  6.967   1.00 0.00 ?  294 ALA A CA   2  
ATOM 3368  C C    . ALA A 1 81  ? -0.783  -6.083  5.717   1.00 0.00 ?  294 ALA A C    2  
ATOM 3369  O O    . ALA A 1 81  ? -1.767  -6.214  4.991   1.00 0.00 ?  294 ALA A O    2  
ATOM 3370  C CB   . ALA A 1 81  ? -0.492  -8.438  6.633   1.00 0.00 ?  294 ALA A CB   2  
ATOM 3371  H H    . ALA A 1 81  ? -2.533  -7.360  7.682   1.00 0.00 ?  294 ALA A H    2  
ATOM 3372  H HA   . ALA A 1 81  ? 0.273   -6.633  7.505   1.00 0.00 ?  294 ALA A HA   2  
ATOM 3373  H HB1  . ALA A 1 81  ? -1.433  -8.800  6.221   1.00 0.00 ?  294 ALA A HB1  2  
ATOM 3374  H HB2  . ALA A 1 81  ? 0.304   -8.578  5.901   1.00 0.00 ?  294 ALA A HB2  2  
ATOM 3375  H HB3  . ALA A 1 81  ? -0.254  -8.994  7.539   1.00 0.00 ?  294 ALA A HB3  2  
ATOM 3376  N N    . PHE A 1 82  ? 0.197   -5.217  5.505   1.00 0.00 ?  295 PHE A N    2  
ATOM 3377  C CA   . PHE A 1 82  ? 0.174   -4.329  4.355   1.00 0.00 ?  295 PHE A CA   2  
ATOM 3378  C C    . PHE A 1 82  ? 1.342   -4.624  3.411   1.00 0.00 ?  295 PHE A C    2  
ATOM 3379  O O    . PHE A 1 82  ? 2.385   -5.114  3.842   1.00 0.00 ?  295 PHE A O    2  
ATOM 3380  C CB   . PHE A 1 82  ? 0.313   -2.902  4.889   1.00 0.00 ?  295 PHE A CB   2  
ATOM 3381  C CG   . PHE A 1 82  ? 1.173   -2.791  6.149   1.00 0.00 ?  295 PHE A CG   2  
ATOM 3382  C CD1  . PHE A 1 82  ? 2.517   -2.611  6.042   1.00 0.00 ?  295 PHE A CD1  2  
ATOM 3383  C CD2  . PHE A 1 82  ? 0.594   -2.871  7.377   1.00 0.00 ?  295 PHE A CD2  2  
ATOM 3384  C CE1  . PHE A 1 82  ? 3.315   -2.507  7.212   1.00 0.00 ?  295 PHE A CE1  2  
ATOM 3385  C CE2  . PHE A 1 82  ? 1.392   -2.768  8.547   1.00 0.00 ?  295 PHE A CE2  2  
ATOM 3386  C CZ   . PHE A 1 82  ? 2.736   -2.588  8.440   1.00 0.00 ?  295 PHE A CZ   2  
ATOM 3387  H H    . PHE A 1 82  ? 0.994   -5.117  6.100   1.00 0.00 ?  295 PHE A H    2  
ATOM 3388  H HA   . PHE A 1 82  ? -0.766  -4.502  3.831   1.00 0.00 ?  295 PHE A HA   2  
ATOM 3389  H HB2  . PHE A 1 82  ? 0.745   -2.274  4.110   1.00 0.00 ?  295 PHE A HB2  2  
ATOM 3390  H HB3  . PHE A 1 82  ? -0.680  -2.507  5.103   1.00 0.00 ?  295 PHE A HB3  2  
ATOM 3391  H HD1  . PHE A 1 82  ? 2.982   -2.547  5.058   1.00 0.00 ?  295 PHE A HD1  2  
ATOM 3392  H HD2  . PHE A 1 82  ? -0.483  -3.015  7.463   1.00 0.00 ?  295 PHE A HD2  2  
ATOM 3393  H HE1  . PHE A 1 82  ? 4.392   -2.364  7.126   1.00 0.00 ?  295 PHE A HE1  2  
ATOM 3394  H HE2  . PHE A 1 82  ? 0.928   -2.832  9.531   1.00 0.00 ?  295 PHE A HE2  2  
ATOM 3395  H HZ   . PHE A 1 82  ? 3.349   -2.509  9.338   1.00 0.00 ?  295 PHE A HZ   2  
ATOM 3396  N N    . PHE A 1 83  ? 1.128   -4.313  2.141   1.00 0.00 ?  296 PHE A N    2  
ATOM 3397  C CA   . PHE A 1 83  ? 2.150   -4.538  1.133   1.00 0.00 ?  296 PHE A CA   2  
ATOM 3398  C C    . PHE A 1 83  ? 1.844   -3.753  -0.143  1.00 0.00 ?  296 PHE A C    2  
ATOM 3399  O O    . PHE A 1 83  ? 0.680   -3.528  -0.474  1.00 0.00 ?  296 PHE A O    2  
ATOM 3400  C CB   . PHE A 1 83  ? 2.140   -6.034  0.812   1.00 0.00 ?  296 PHE A CB   2  
ATOM 3401  C CG   . PHE A 1 83  ? 0.802   -6.546  0.274   1.00 0.00 ?  296 PHE A CG   2  
ATOM 3402  C CD1  . PHE A 1 83  ? -0.221  -6.809  1.132   1.00 0.00 ?  296 PHE A CD1  2  
ATOM 3403  C CD2  . PHE A 1 83  ? 0.635   -6.737  -1.062  1.00 0.00 ?  296 PHE A CD2  2  
ATOM 3404  C CE1  . PHE A 1 83  ? -1.462  -7.284  0.632   1.00 0.00 ?  296 PHE A CE1  2  
ATOM 3405  C CE2  . PHE A 1 83  ? -0.607  -7.212  -1.562  1.00 0.00 ?  296 PHE A CE2  2  
ATOM 3406  C CZ   . PHE A 1 83  ? -1.629  -7.475  -0.704  1.00 0.00 ?  296 PHE A CZ   2  
ATOM 3407  H H    . PHE A 1 83  ? 0.277   -3.915  1.799   1.00 0.00 ?  296 PHE A H    2  
ATOM 3408  H HA   . PHE A 1 83  ? 3.097   -4.196  1.550   1.00 0.00 ?  296 PHE A HA   2  
ATOM 3409  H HB2  . PHE A 1 83  ? 2.918   -6.244  0.079   1.00 0.00 ?  296 PHE A HB2  2  
ATOM 3410  H HB3  . PHE A 1 83  ? 2.393   -6.591  1.714   1.00 0.00 ?  296 PHE A HB3  2  
ATOM 3411  H HD1  . PHE A 1 83  ? -0.087  -6.655  2.202   1.00 0.00 ?  296 PHE A HD1  2  
ATOM 3412  H HD2  . PHE A 1 83  ? 1.454   -6.527  -1.749  1.00 0.00 ?  296 PHE A HD2  2  
ATOM 3413  H HE1  . PHE A 1 83  ? -2.281  -7.494  1.319   1.00 0.00 ?  296 PHE A HE1  2  
ATOM 3414  H HE2  . PHE A 1 83  ? -0.740  -7.366  -2.632  1.00 0.00 ?  296 PHE A HE2  2  
ATOM 3415  H HZ   . PHE A 1 83  ? -2.582  -7.840  -1.088  1.00 0.00 ?  296 PHE A HZ   2  
ATOM 3416  N N    . GLY A 1 84  ? 2.908   -3.357  -0.827  1.00 0.00 ?  297 GLY A N    2  
ATOM 3417  C CA   . GLY A 1 84  ? 2.767   -2.602  -2.060  1.00 0.00 ?  297 GLY A CA   2  
ATOM 3418  C C    . GLY A 1 84  ? 3.701   -1.390  -2.070  1.00 0.00 ?  297 GLY A C    2  
ATOM 3419  O O    . GLY A 1 84  ? 3.885   -0.751  -3.105  1.00 0.00 ?  297 GLY A O    2  
ATOM 3420  H H    . GLY A 1 84  ? 3.851   -3.544  -0.551  1.00 0.00 ?  297 GLY A H    2  
ATOM 3421  H HA2  . GLY A 1 84  ? 2.990   -3.244  -2.912  1.00 0.00 ?  297 GLY A HA2  2  
ATOM 3422  H HA3  . GLY A 1 84  ? 1.735   -2.270  -2.171  1.00 0.00 ?  297 GLY A HA3  2  
ATOM 3423  N N    . GLU A 1 85  ? 4.268   -1.110  -0.905  1.00 0.00 ?  298 GLU A N    2  
ATOM 3424  C CA   . GLU A 1 85  ? 5.178   0.014   -0.767  1.00 0.00 ?  298 GLU A CA   2  
ATOM 3425  C C    . GLU A 1 85  ? 6.284   -0.066  -1.821  1.00 0.00 ?  298 GLU A C    2  
ATOM 3426  O O    . GLU A 1 85  ? 6.614   0.934   -2.458  1.00 0.00 ?  298 GLU A O    2  
ATOM 3427  C CB   . GLU A 1 85  ? 5.769   0.071   0.643   1.00 0.00 ?  298 GLU A CB   2  
ATOM 3428  C CG   . GLU A 1 85  ? 6.424   -1.261  1.018   1.00 0.00 ?  298 GLU A CG   2  
ATOM 3429  C CD   . GLU A 1 85  ? 6.298   -1.531  2.518   1.00 0.00 ?  298 GLU A CD   2  
ATOM 3430  O OE1  . GLU A 1 85  ? 5.576   -2.455  2.923   1.00 0.00 ?  298 GLU A OE1  2  
ATOM 3431  O OE2  . GLU A 1 85  ? 6.983   -0.742  3.274   1.00 0.00 -1 298 GLU A OE2  2  
ATOM 3432  H H    . GLU A 1 85  ? 4.113   -1.634  -0.068  1.00 0.00 ?  298 GLU A H    2  
ATOM 3433  H HA   . GLU A 1 85  ? 4.570   0.902   -0.935  1.00 0.00 ?  298 GLU A HA   2  
ATOM 3434  H HB2  . GLU A 1 85  ? 6.507   0.871   0.701   1.00 0.00 ?  298 GLU A HB2  2  
ATOM 3435  H HB3  . GLU A 1 85  ? 4.984   0.308   1.361   1.00 0.00 ?  298 GLU A HB3  2  
ATOM 3436  H HG2  . GLU A 1 85  ? 5.955   -2.070  0.458   1.00 0.00 ?  298 GLU A HG2  2  
ATOM 3437  H HG3  . GLU A 1 85  ? 7.476   -1.245  0.734   1.00 0.00 ?  298 GLU A HG3  2  
ATOM 3438  H HE2  . GLU A 1 85  ? 6.369   -0.176  3.824   1.00 0.00 ?  298 GLU A HE2  2  
ATOM 3439  N N    . MET A 1 86  ? 6.826   -1.265  -1.975  1.00 0.00 ?  299 MET A N    2  
ATOM 3440  C CA   . MET A 1 86  ? 7.888   -1.489  -2.941  1.00 0.00 ?  299 MET A CA   2  
ATOM 3441  C C    . MET A 1 86  ? 7.491   -0.964  -4.323  1.00 0.00 ?  299 MET A C    2  
ATOM 3442  O O    . MET A 1 86  ? 8.316   -0.395  -5.035  1.00 0.00 ?  299 MET A O    2  
ATOM 3443  C CB   . MET A 1 86  ? 8.190   -2.986  -3.031  1.00 0.00 ?  299 MET A CB   2  
ATOM 3444  C CG   . MET A 1 86  ? 9.578   -3.300  -2.471  1.00 0.00 ?  299 MET A CG   2  
ATOM 3445  S SD   . MET A 1 86  ? 9.525   -3.324  -0.687  1.00 0.00 ?  299 MET A SD   2  
ATOM 3446  C CE   . MET A 1 86  ? 10.564  -1.917  -0.327  1.00 0.00 ?  299 MET A CE   2  
ATOM 3447  H H    . MET A 1 86  ? 6.552   -2.074  -1.453  1.00 0.00 ?  299 MET A H    2  
ATOM 3448  H HA   . MET A 1 86  ? 8.747   -0.932  -2.567  1.00 0.00 ?  299 MET A HA   2  
ATOM 3449  H HB2  . MET A 1 86  ? 7.435   -3.546  -2.479  1.00 0.00 ?  299 MET A HB2  2  
ATOM 3450  H HB3  . MET A 1 86  ? 8.131   -3.311  -4.070  1.00 0.00 ?  299 MET A HB3  2  
ATOM 3451  H HG2  . MET A 1 86  ? 9.921   -4.264  -2.846  1.00 0.00 ?  299 MET A HG2  2  
ATOM 3452  H HG3  . MET A 1 86  ? 10.295  -2.552  -2.812  1.00 0.00 ?  299 MET A HG3  2  
ATOM 3453  H HE1  . MET A 1 86  ? 10.418  -1.153  -1.091  1.00 0.00 ?  299 MET A HE1  2  
ATOM 3454  H HE2  . MET A 1 86  ? 10.299  -1.510  0.649   1.00 0.00 ?  299 MET A HE2  2  
ATOM 3455  H HE3  . MET A 1 86  ? 11.608  -2.229  -0.319  1.00 0.00 ?  299 MET A HE3  2  
ATOM 3456  N N    . ALA A 1 87  ? 6.226   -1.173  -4.659  1.00 0.00 ?  300 ALA A N    2  
ATOM 3457  C CA   . ALA A 1 87  ? 5.710   -0.728  -5.942  1.00 0.00 ?  300 ALA A CA   2  
ATOM 3458  C C    . ALA A 1 87  ? 5.667   0.801   -5.967  1.00 0.00 ?  300 ALA A C    2  
ATOM 3459  O O    . ALA A 1 87  ? 5.967   1.417   -6.988  1.00 0.00 ?  300 ALA A O    2  
ATOM 3460  C CB   . ALA A 1 87  ? 4.335   -1.355  -6.184  1.00 0.00 ?  300 ALA A CB   2  
ATOM 3461  H H    . ALA A 1 87  ? 5.561   -1.637  -4.074  1.00 0.00 ?  300 ALA A H    2  
ATOM 3462  H HA   . ALA A 1 87  ? 6.396   -1.077  -6.715  1.00 0.00 ?  300 ALA A HA   2  
ATOM 3463  H HB1  . ALA A 1 87  ? 3.834   -1.510  -5.229  1.00 0.00 ?  300 ALA A HB1  2  
ATOM 3464  H HB2  . ALA A 1 87  ? 3.737   -0.688  -6.805  1.00 0.00 ?  300 ALA A HB2  2  
ATOM 3465  H HB3  . ALA A 1 87  ? 4.457   -2.312  -6.692  1.00 0.00 ?  300 ALA A HB3  2  
ATOM 3466  N N    . LEU A 1 88  ? 5.290   1.369   -4.831  1.00 0.00 ?  301 LEU A N    2  
ATOM 3467  C CA   . LEU A 1 88  ? 5.204   2.814   -4.709  1.00 0.00 ?  301 LEU A CA   2  
ATOM 3468  C C    . LEU A 1 88  ? 6.611   3.394   -4.558  1.00 0.00 ?  301 LEU A C    2  
ATOM 3469  O O    . LEU A 1 88  ? 6.793   4.610   -4.599  1.00 0.00 ?  301 LEU A O    2  
ATOM 3470  C CB   . LEU A 1 88  ? 4.254   3.200   -3.574  1.00 0.00 ?  301 LEU A CB   2  
ATOM 3471  C CG   . LEU A 1 88  ? 2.792   2.787   -3.752  1.00 0.00 ?  301 LEU A CG   2  
ATOM 3472  C CD1  . LEU A 1 88  ? 2.102   2.611   -2.398  1.00 0.00 ?  301 LEU A CD1  2  
ATOM 3473  C CD2  . LEU A 1 88  ? 2.048   3.778   -4.650  1.00 0.00 ?  301 LEU A CD2  2  
ATOM 3474  H H    . LEU A 1 88  ? 5.048   0.860   -4.005  1.00 0.00 ?  301 LEU A H    2  
ATOM 3475  H HA   . LEU A 1 88  ? 4.771   3.194   -5.635  1.00 0.00 ?  301 LEU A HA   2  
ATOM 3476  H HB2  . LEU A 1 88  ? 4.626   2.758   -2.649  1.00 0.00 ?  301 LEU A HB2  2  
ATOM 3477  H HB3  . LEU A 1 88  ? 4.292   4.282   -3.447  1.00 0.00 ?  301 LEU A HB3  2  
ATOM 3478  H HG   . LEU A 1 88  ? 2.769   1.819   -4.253  1.00 0.00 ?  301 LEU A HG   2  
ATOM 3479  H HD11 . LEU A 1 88  ? 2.492   1.720   -1.905  1.00 0.00 ?  301 LEU A HD11 2  
ATOM 3480  H HD12 . LEU A 1 88  ? 2.295   3.485   -1.776  1.00 0.00 ?  301 LEU A HD12 2  
ATOM 3481  H HD13 . LEU A 1 88  ? 1.028   2.502   -2.548  1.00 0.00 ?  301 LEU A HD13 2  
ATOM 3482  H HD21 . LEU A 1 88  ? 0.998   3.815   -4.358  1.00 0.00 ?  301 LEU A HD21 2  
ATOM 3483  H HD22 . LEU A 1 88  ? 2.490   4.768   -4.542  1.00 0.00 ?  301 LEU A HD22 2  
ATOM 3484  H HD23 . LEU A 1 88  ? 2.125   3.456   -5.688  1.00 0.00 ?  301 LEU A HD23 2  
ATOM 3485  N N    . ILE A 1 89  ? 7.571   2.497   -4.385  1.00 0.00 ?  302 ILE A N    2  
ATOM 3486  C CA   . ILE A 1 89  ? 8.957   2.905   -4.228  1.00 0.00 ?  302 ILE A CA   2  
ATOM 3487  C C    . ILE A 1 89  ? 9.590   3.090   -5.608  1.00 0.00 ?  302 ILE A C    2  
ATOM 3488  O O    . ILE A 1 89  ? 10.162  4.140   -5.897  1.00 0.00 ?  302 ILE A O    2  
ATOM 3489  C CB   . ILE A 1 89  ? 9.708   1.915   -3.334  1.00 0.00 ?  302 ILE A CB   2  
ATOM 3490  C CG1  . ILE A 1 89  ? 9.356   2.131   -1.861  1.00 0.00 ?  302 ILE A CG1  2  
ATOM 3491  C CG2  . ILE A 1 89  ? 11.216  1.990   -3.580  1.00 0.00 ?  302 ILE A CG2  2  
ATOM 3492  C CD1  . ILE A 1 89  ? 10.082  3.353   -1.297  1.00 0.00 ?  302 ILE A CD1  2  
ATOM 3493  H H    . ILE A 1 89  ? 7.415   1.510   -4.353  1.00 0.00 ?  302 ILE A H    2  
ATOM 3494  H HA   . ILE A 1 89  ? 8.958   3.867   -3.715  1.00 0.00 ?  302 ILE A HA   2  
ATOM 3495  H HB   . ILE A 1 89  ? 9.389   0.907   -3.598  1.00 0.00 ?  302 ILE A HB   2  
ATOM 3496  H HG12 . ILE A 1 89  ? 8.279   2.262   -1.756  1.00 0.00 ?  302 ILE A HG12 2  
ATOM 3497  H HG13 . ILE A 1 89  ? 9.626   1.245   -1.286  1.00 0.00 ?  302 ILE A HG13 2  
ATOM 3498  H HG21 . ILE A 1 89  ? 11.743  1.510   -2.756  1.00 0.00 ?  302 ILE A HG21 2  
ATOM 3499  H HG22 . ILE A 1 89  ? 11.458  1.480   -4.512  1.00 0.00 ?  302 ILE A HG22 2  
ATOM 3500  H HG23 . ILE A 1 89  ? 11.522  3.034   -3.648  1.00 0.00 ?  302 ILE A HG23 2  
ATOM 3501  H HD11 . ILE A 1 89  ? 9.622   4.261   -1.686  1.00 0.00 ?  302 ILE A HD11 2  
ATOM 3502  H HD12 . ILE A 1 89  ? 10.011  3.348   -0.209  1.00 0.00 ?  302 ILE A HD12 2  
ATOM 3503  H HD13 . ILE A 1 89  ? 11.131  3.322   -1.593  1.00 0.00 ?  302 ILE A HD13 2  
ATOM 3504  N N    . SER A 1 90  ? 9.466   2.054   -6.424  1.00 0.00 ?  303 SER A N    2  
ATOM 3505  C CA   . SER A 1 90  ? 10.020  2.089   -7.767  1.00 0.00 ?  303 SER A CA   2  
ATOM 3506  C C    . SER A 1 90  ? 9.232   1.149   -8.682  1.00 0.00 ?  303 SER A C    2  
ATOM 3507  O O    . SER A 1 90  ? 9.816   0.442   -9.502  1.00 0.00 ?  303 SER A O    2  
ATOM 3508  C CB   . SER A 1 90  ? 11.501  1.708   -7.763  1.00 0.00 ?  303 SER A CB   2  
ATOM 3509  O OG   . SER A 1 90  ? 12.347  2.855   -7.794  1.00 0.00 ?  303 SER A OG   2  
ATOM 3510  H H    . SER A 1 90  ? 9.000   1.203   -6.181  1.00 0.00 ?  303 SER A H    2  
ATOM 3511  H HA   . SER A 1 90  ? 9.912   3.123   -8.097  1.00 0.00 ?  303 SER A HA   2  
ATOM 3512  H HB2  . SER A 1 90  ? 11.722  1.119   -6.873  1.00 0.00 ?  303 SER A HB2  2  
ATOM 3513  H HB3  . SER A 1 90  ? 11.716  1.076   -8.625  1.00 0.00 ?  303 SER A HB3  2  
ATOM 3514  H HG   . SER A 1 90  ? 13.216  2.627   -8.233  1.00 0.00 ?  303 SER A HG   2  
ATOM 3515  N N    . GLY A 1 91  ? 7.919   1.171   -8.511  1.00 0.00 ?  304 GLY A N    2  
ATOM 3516  C CA   . GLY A 1 91  ? 7.045   0.329   -9.312  1.00 0.00 ?  304 GLY A CA   2  
ATOM 3517  C C    . GLY A 1 91  ? 7.695   -1.028  -9.588  1.00 0.00 ?  304 GLY A C    2  
ATOM 3518  O O    . GLY A 1 91  ? 7.531   -1.590  -10.669 1.00 0.00 ?  304 GLY A O    2  
ATOM 3519  H H    . GLY A 1 91  ? 7.452   1.750   -7.843  1.00 0.00 ?  304 GLY A H    2  
ATOM 3520  H HA2  . GLY A 1 91  ? 6.098   0.184   -8.792  1.00 0.00 ?  304 GLY A HA2  2  
ATOM 3521  H HA3  . GLY A 1 91  ? 6.819   0.827   -10.255 1.00 0.00 ?  304 GLY A HA3  2  
ATOM 3522  N N    . GLU A 1 92  ? 8.419   -1.515  -8.591  1.00 0.00 ?  305 GLU A N    2  
ATOM 3523  C CA   . GLU A 1 92  ? 9.095   -2.796  -8.713  1.00 0.00 ?  305 GLU A CA   2  
ATOM 3524  C C    . GLU A 1 92  ? 8.070   -3.928  -8.826  1.00 0.00 ?  305 GLU A C    2  
ATOM 3525  O O    . GLU A 1 92  ? 6.933   -3.787  -8.378  1.00 0.00 ?  305 GLU A O    2  
ATOM 3526  C CB   . GLU A 1 92  ? 10.043  -3.030  -7.536  1.00 0.00 ?  305 GLU A CB   2  
ATOM 3527  C CG   . GLU A 1 92  ? 9.266   -3.400  -6.271  1.00 0.00 ?  305 GLU A CG   2  
ATOM 3528  C CD   . GLU A 1 92  ? 9.655   -4.795  -5.776  1.00 0.00 ?  305 GLU A CD   2  
ATOM 3529  O OE1  . GLU A 1 92  ? 10.851  -5.099  -5.657  1.00 0.00 ?  305 GLU A OE1  2  
ATOM 3530  O OE2  . GLU A 1 92  ? 8.662   -5.575  -5.511  1.00 0.00 -1 305 GLU A OE2  2  
ATOM 3531  H H    . GLU A 1 92  ? 8.548   -1.052  -7.715  1.00 0.00 ?  305 GLU A H    2  
ATOM 3532  H HA   . GLU A 1 92  ? 9.676   -2.731  -9.633  1.00 0.00 ?  305 GLU A HA   2  
ATOM 3533  H HB2  . GLU A 1 92  ? 10.744  -3.828  -7.782  1.00 0.00 ?  305 GLU A HB2  2  
ATOM 3534  H HB3  . GLU A 1 92  ? 10.633  -2.132  -7.355  1.00 0.00 ?  305 GLU A HB3  2  
ATOM 3535  H HG2  . GLU A 1 92  ? 9.465   -2.665  -5.490  1.00 0.00 ?  305 GLU A HG2  2  
ATOM 3536  H HG3  . GLU A 1 92  ? 8.196   -3.368  -6.474  1.00 0.00 ?  305 GLU A HG3  2  
ATOM 3537  H HE2  . GLU A 1 92  ? 8.968   -6.527  -5.505  1.00 0.00 ?  305 GLU A HE2  2  
ATOM 3538  N N    . PRO A 1 93  ? 8.522   -5.053  -9.442  1.00 0.00 ?  306 PRO A N    2  
ATOM 3539  C CA   . PRO A 1 93  ? 7.658   -6.207  -9.619  1.00 0.00 ?  306 PRO A CA   2  
ATOM 3540  C C    . PRO A 1 93  ? 7.474   -6.962  -8.300  1.00 0.00 ?  306 PRO A C    2  
ATOM 3541  O O    . PRO A 1 93  ? 8.448   -7.263  -7.612  1.00 0.00 ?  306 PRO A O    2  
ATOM 3542  C CB   . PRO A 1 93  ? 8.334   -7.044  -10.693 1.00 0.00 ?  306 PRO A CB   2  
ATOM 3543  C CG   . PRO A 1 93  ? 9.777   -6.568  -10.745 1.00 0.00 ?  306 PRO A CG   2  
ATOM 3544  C CD   . PRO A 1 93  ? 9.862   -5.255  -9.985  1.00 0.00 ?  306 PRO A CD   2  
ATOM 3545  H HA   . PRO A 1 93  ? 6.742   -5.916  -9.897  1.00 0.00 ?  306 PRO A HA   2  
ATOM 3546  H HB2  . PRO A 1 93  ? 8.282   -8.106  -10.451 1.00 0.00 ?  306 PRO A HB2  2  
ATOM 3547  H HB3  . PRO A 1 93  ? 7.844   -6.912  -11.657 1.00 0.00 ?  306 PRO A HB3  2  
ATOM 3548  H HG2  . PRO A 1 93  ? 10.440  -7.310  -10.300 1.00 0.00 ?  306 PRO A HG2  2  
ATOM 3549  H HG3  . PRO A 1 93  ? 10.097  -6.433  -11.778 1.00 0.00 ?  306 PRO A HG3  2  
ATOM 3550  H HD2  . PRO A 1 93  ? 10.608  -5.304  -9.191  1.00 0.00 ?  306 PRO A HD2  2  
ATOM 3551  H HD3  . PRO A 1 93  ? 10.151  -4.434  -10.642 1.00 0.00 ?  306 PRO A HD3  2  
ATOM 3552  N N    . ARG A 1 94  ? 6.218   -7.245  -7.988  1.00 0.00 ?  307 ARG A N    2  
ATOM 3553  C CA   . ARG A 1 94  ? 5.894   -7.958  -6.764  1.00 0.00 ?  307 ARG A CA   2  
ATOM 3554  C C    . ARG A 1 94  ? 6.836   -9.150  -6.579  1.00 0.00 ?  307 ARG A C    2  
ATOM 3555  O O    . ARG A 1 94  ? 7.150   -9.528  -5.452  1.00 0.00 ?  307 ARG A O    2  
ATOM 3556  C CB   . ARG A 1 94  ? 4.448   -8.458  -6.784  1.00 0.00 ?  307 ARG A CB   2  
ATOM 3557  C CG   . ARG A 1 94  ? 3.603   -7.735  -5.734  1.00 0.00 ?  307 ARG A CG   2  
ATOM 3558  C CD   . ARG A 1 94  ? 2.994   -6.454  -6.308  1.00 0.00 ?  307 ARG A CD   2  
ATOM 3559  N NE   . ARG A 1 94  ? 1.805   -6.062  -5.519  1.00 0.00 ?  307 ARG A NE   2  
ATOM 3560  C CZ   . ARG A 1 94  ? 1.212   -4.863  -5.600  1.00 0.00 ?  307 ARG A CZ   2  
ATOM 3561  N NH1  . ARG A 1 94  ? 1.693   -3.932  -6.435  1.00 0.00 ?  307 ARG A NH1  2  
ATOM 3562  N NH2  . ARG A 1 94  ? 0.137   -4.595  -4.846  1.00 0.00 1  307 ARG A NH2  2  
ATOM 3563  H H    . ARG A 1 94  ? 5.431   -6.996  -8.553  1.00 0.00 ?  307 ARG A H    2  
ATOM 3564  H HA   . ARG A 1 94  ? 6.029   -7.225  -5.970  1.00 0.00 ?  307 ARG A HA   2  
ATOM 3565  H HB2  . ARG A 1 94  ? 4.019   -8.300  -7.774  1.00 0.00 ?  307 ARG A HB2  2  
ATOM 3566  H HB3  . ARG A 1 94  ? 4.428   -9.532  -6.596  1.00 0.00 ?  307 ARG A HB3  2  
ATOM 3567  H HG2  . ARG A 1 94  ? 2.809   -8.394  -5.384  1.00 0.00 ?  307 ARG A HG2  2  
ATOM 3568  H HG3  . ARG A 1 94  ? 4.221   -7.492  -4.870  1.00 0.00 ?  307 ARG A HG3  2  
ATOM 3569  H HD2  . ARG A 1 94  ? 3.731   -5.652  -6.293  1.00 0.00 ?  307 ARG A HD2  2  
ATOM 3570  H HD3  . ARG A 1 94  ? 2.713   -6.610  -7.350  1.00 0.00 ?  307 ARG A HD3  2  
ATOM 3571  H HE   . ARG A 1 94  ? 1.420   -6.733  -4.886  1.00 0.00 ?  307 ARG A HE   2  
ATOM 3572  H HH11 . ARG A 1 94  ? 2.495   -4.132  -6.997  1.00 0.00 ?  307 ARG A HH11 2  
ATOM 3573  H HH12 . ARG A 1 94  ? 1.251   -3.037  -6.495  1.00 0.00 ?  307 ARG A HH12 2  
ATOM 3574  H HH21 . ARG A 1 94  ? -0.222  -5.289  -4.222  1.00 0.00 ?  307 ARG A HH21 2  
ATOM 3575  H HH22 . ARG A 1 94  ? -0.305  -3.700  -4.905  1.00 0.00 ?  307 ARG A HH22 2  
ATOM 3576  N N    . SER A 1 95  ? 7.261   -9.708  -7.703  1.00 0.00 ?  308 SER A N    2  
ATOM 3577  C CA   . SER A 1 95  ? 8.160   -10.849 -7.679  1.00 0.00 ?  308 SER A CA   2  
ATOM 3578  C C    . SER A 1 95  ? 7.514   -12.009 -6.920  1.00 0.00 ?  308 SER A C    2  
ATOM 3579  O O    . SER A 1 95  ? 8.204   -12.786 -6.262  1.00 0.00 ?  308 SER A O    2  
ATOM 3580  C CB   . SER A 1 95  ? 9.501   -10.479 -7.042  1.00 0.00 ?  308 SER A CB   2  
ATOM 3581  O OG   . SER A 1 95  ? 10.424  -9.966  -7.999  1.00 0.00 ?  308 SER A OG   2  
ATOM 3582  H H    . SER A 1 95  ? 7.000   -9.394  -8.616  1.00 0.00 ?  308 SER A H    2  
ATOM 3583  H HA   . SER A 1 95  ? 8.316   -11.115 -8.725  1.00 0.00 ?  308 SER A HA   2  
ATOM 3584  H HB2  . SER A 1 95  ? 9.339   -9.737  -6.260  1.00 0.00 ?  308 SER A HB2  2  
ATOM 3585  H HB3  . SER A 1 95  ? 9.929   -11.359 -6.562  1.00 0.00 ?  308 SER A HB3  2  
ATOM 3586  H HG   . SER A 1 95  ? 9.931   -9.616  -8.796  1.00 0.00 ?  308 SER A HG   2  
ATOM 3587  N N    . ALA A 1 96  ? 6.197   -12.090 -7.037  1.00 0.00 ?  309 ALA A N    2  
ATOM 3588  C CA   . ALA A 1 96  ? 5.449   -13.143 -6.370  1.00 0.00 ?  309 ALA A CA   2  
ATOM 3589  C C    . ALA A 1 96  ? 3.953   -12.931 -6.610  1.00 0.00 ?  309 ALA A C    2  
ATOM 3590  O O    . ALA A 1 96  ? 3.526   -11.831 -6.959  1.00 0.00 ?  309 ALA A O    2  
ATOM 3591  C CB   . ALA A 1 96  ? 5.805   -13.157 -4.882  1.00 0.00 ?  309 ALA A CB   2  
ATOM 3592  H H    . ALA A 1 96  ? 5.643   -11.454 -7.575  1.00 0.00 ?  309 ALA A H    2  
ATOM 3593  H HA   . ALA A 1 96  ? 5.748   -14.093 -6.812  1.00 0.00 ?  309 ALA A HA   2  
ATOM 3594  H HB1  . ALA A 1 96  ? 6.653   -13.822 -4.718  1.00 0.00 ?  309 ALA A HB1  2  
ATOM 3595  H HB2  . ALA A 1 96  ? 6.066   -12.149 -4.562  1.00 0.00 ?  309 ALA A HB2  2  
ATOM 3596  H HB3  . ALA A 1 96  ? 4.949   -13.511 -4.308  1.00 0.00 ?  309 ALA A HB3  2  
ATOM 3597  N N    . THR A 1 97  ? 3.197   -14.001 -6.414  1.00 0.00 ?  310 THR A N    2  
ATOM 3598  C CA   . THR A 1 97  ? 1.758   -13.946 -6.604  1.00 0.00 ?  310 THR A CA   2  
ATOM 3599  C C    . THR A 1 97  ? 1.038   -14.051 -5.258  1.00 0.00 ?  310 THR A C    2  
ATOM 3600  O O    . THR A 1 97  ? 1.286   -14.976 -4.488  1.00 0.00 ?  310 THR A O    2  
ATOM 3601  C CB   . THR A 1 97  ? 1.369   -15.050 -7.589  1.00 0.00 ?  310 THR A CB   2  
ATOM 3602  O OG1  . THR A 1 97  ? 1.083   -14.351 -8.798  1.00 0.00 ?  310 THR A OG1  2  
ATOM 3603  C CG2  . THR A 1 97  ? 0.042   -15.720 -7.224  1.00 0.00 ?  310 THR A CG2  2  
ATOM 3604  H H    . THR A 1 97  ? 3.552   -14.892 -6.130  1.00 0.00 ?  310 THR A H    2  
ATOM 3605  H HA   . THR A 1 97  ? 1.504   -12.974 -7.028  1.00 0.00 ?  310 THR A HA   2  
ATOM 3606  H HB   . THR A 1 97  ? 2.165   -15.788 -7.681  1.00 0.00 ?  310 THR A HB   2  
ATOM 3607  H HG1  . THR A 1 97  ? 0.676   -14.975 -9.465  1.00 0.00 ?  310 THR A HG1  2  
ATOM 3608  H HG21 . THR A 1 97  ? -0.305  -16.321 -8.065  1.00 0.00 ?  310 THR A HG21 2  
ATOM 3609  H HG22 . THR A 1 97  ? 0.186   -16.360 -6.354  1.00 0.00 ?  310 THR A HG22 2  
ATOM 3610  H HG23 . THR A 1 97  ? -0.699  -14.955 -6.993  1.00 0.00 ?  310 THR A HG23 2  
ATOM 3611  N N    . VAL A 1 98  ? 0.159   -13.089 -5.017  1.00 0.00 ?  311 VAL A N    2  
ATOM 3612  C CA   . VAL A 1 98  ? -0.599  -13.061 -3.778  1.00 0.00 ?  311 VAL A CA   2  
ATOM 3613  C C    . VAL A 1 98  ? -2.050  -13.452 -4.064  1.00 0.00 ?  311 VAL A C    2  
ATOM 3614  O O    . VAL A 1 98  ? -2.667  -12.927 -4.990  1.00 0.00 ?  311 VAL A O    2  
ATOM 3615  C CB   . VAL A 1 98  ? -0.469  -11.688 -3.115  1.00 0.00 ?  311 VAL A CB   2  
ATOM 3616  C CG1  . VAL A 1 98  ? -1.248  -11.638 -1.800  1.00 0.00 ?  311 VAL A CG1  2  
ATOM 3617  C CG2  . VAL A 1 98  ? 1.000   -11.322 -2.897  1.00 0.00 ?  311 VAL A CG2  2  
ATOM 3618  H H    . VAL A 1 98  ? -0.037  -12.339 -5.649  1.00 0.00 ?  311 VAL A H    2  
ATOM 3619  H HA   . VAL A 1 98  ? -0.162  -13.802 -3.108  1.00 0.00 ?  311 VAL A HA   2  
ATOM 3620  H HB   . VAL A 1 98  ? -0.902  -10.949 -3.789  1.00 0.00 ?  311 VAL A HB   2  
ATOM 3621  H HG11 . VAL A 1 98  ? -1.987  -10.837 -1.845  1.00 0.00 ?  311 VAL A HG11 2  
ATOM 3622  H HG12 . VAL A 1 98  ? -1.755  -12.590 -1.641  1.00 0.00 ?  311 VAL A HG12 2  
ATOM 3623  H HG13 . VAL A 1 98  ? -0.559  -11.451 -0.976  1.00 0.00 ?  311 VAL A HG13 2  
ATOM 3624  H HG21 . VAL A 1 98  ? 1.577   -11.591 -3.781  1.00 0.00 ?  311 VAL A HG21 2  
ATOM 3625  H HG22 . VAL A 1 98  ? 1.084   -10.249 -2.720  1.00 0.00 ?  311 VAL A HG22 2  
ATOM 3626  H HG23 . VAL A 1 98  ? 1.385   -11.863 -2.033  1.00 0.00 ?  311 VAL A HG23 2  
ATOM 3627  N N    . SER A 1 99  ? -2.554  -14.369 -3.252  1.00 0.00 ?  312 SER A N    2  
ATOM 3628  C CA   . SER A 1 99  ? -3.921  -14.836 -3.406  1.00 0.00 ?  312 SER A CA   2  
ATOM 3629  C C    . SER A 1 99  ? -4.595  -14.945 -2.037  1.00 0.00 ?  312 SER A C    2  
ATOM 3630  O O    . SER A 1 99  ? -3.930  -15.191 -1.032  1.00 0.00 ?  312 SER A O    2  
ATOM 3631  C CB   . SER A 1 99  ? -3.964  -16.185 -4.128  1.00 0.00 ?  312 SER A CB   2  
ATOM 3632  O OG   . SER A 1 99  ? -2.855  -17.010 -3.784  1.00 0.00 ?  312 SER A OG   2  
ATOM 3633  H H    . SER A 1 99  ? -2.046  -14.791 -2.501  1.00 0.00 ?  312 SER A H    2  
ATOM 3634  H HA   . SER A 1 99  ? -4.416  -14.082 -4.018  1.00 0.00 ?  312 SER A HA   2  
ATOM 3635  H HB2  . SER A 1 99  ? -4.891  -16.701 -3.876  1.00 0.00 ?  312 SER A HB2  2  
ATOM 3636  H HB3  . SER A 1 99  ? -3.974  -16.020 -5.205  1.00 0.00 ?  312 SER A HB3  2  
ATOM 3637  H HG   . SER A 1 99  ? -3.068  -17.968 -3.977  1.00 0.00 ?  312 SER A HG   2  
ATOM 3638  N N    . ALA A 1 100 ? -5.906  -14.757 -2.042  1.00 0.00 ?  313 ALA A N    2  
ATOM 3639  C CA   . ALA A 1 100 ? -6.677  -14.830 -0.812  1.00 0.00 ?  313 ALA A CA   2  
ATOM 3640  C C    . ALA A 1 100 ? -6.935  -16.297 -0.464  1.00 0.00 ?  313 ALA A C    2  
ATOM 3641  O O    . ALA A 1 100 ? -7.686  -16.981 -1.157  1.00 0.00 ?  313 ALA A O    2  
ATOM 3642  C CB   . ALA A 1 100 ? -7.973  -14.033 -0.974  1.00 0.00 ?  313 ALA A CB   2  
ATOM 3643  H H    . ALA A 1 100 ? -6.440  -14.557 -2.864  1.00 0.00 ?  313 ALA A H    2  
ATOM 3644  H HA   . ALA A 1 100 ? -6.082  -14.376 -0.020  1.00 0.00 ?  313 ALA A HA   2  
ATOM 3645  H HB1  . ALA A 1 100 ? -7.774  -12.976 -0.798  1.00 0.00 ?  313 ALA A HB1  2  
ATOM 3646  H HB2  . ALA A 1 100 ? -8.359  -14.167 -1.984  1.00 0.00 ?  313 ALA A HB2  2  
ATOM 3647  H HB3  . ALA A 1 100 ? -8.710  -14.389 -0.254  1.00 0.00 ?  313 ALA A HB3  2  
ATOM 3648  N N    . ALA A 1 101 ? -6.297  -16.738 0.610   1.00 0.00 ?  314 ALA A N    2  
ATOM 3649  C CA   . ALA A 1 101 ? -6.447  -18.112 1.059   1.00 0.00 ?  314 ALA A CA   2  
ATOM 3650  C C    . ALA A 1 101 ? -7.924  -18.391 1.348   1.00 0.00 ?  314 ALA A C    2  
ATOM 3651  O O    . ALA A 1 101 ? -8.372  -19.533 1.263   1.00 0.00 ?  314 ALA A O    2  
ATOM 3652  C CB   . ALA A 1 101 ? -5.559  -18.350 2.282   1.00 0.00 ?  314 ALA A CB   2  
ATOM 3653  H H    . ALA A 1 101 ? -5.688  -16.176 1.169   1.00 0.00 ?  314 ALA A H    2  
ATOM 3654  H HA   . ALA A 1 101 ? -6.115  -18.764 0.251   1.00 0.00 ?  314 ALA A HA   2  
ATOM 3655  H HB1  . ALA A 1 101 ? -5.877  -19.261 2.790   1.00 0.00 ?  314 ALA A HB1  2  
ATOM 3656  H HB2  . ALA A 1 101 ? -4.522  -18.455 1.962   1.00 0.00 ?  314 ALA A HB2  2  
ATOM 3657  H HB3  . ALA A 1 101 ? -5.645  -17.505 2.964   1.00 0.00 ?  314 ALA A HB3  2  
ATOM 3658  N N    . THR A 1 102 ? -8.639  -17.327 1.684   1.00 0.00 ?  315 THR A N    2  
ATOM 3659  C CA   . THR A 1 102 ? -10.056 -17.443 1.986   1.00 0.00 ?  315 THR A CA   2  
ATOM 3660  C C    . THR A 1 102 ? -10.741 -16.081 1.859   1.00 0.00 ?  315 THR A C    2  
ATOM 3661  O O    . THR A 1 102 ? -10.186 -15.155 1.270   1.00 0.00 ?  315 THR A O    2  
ATOM 3662  C CB   . THR A 1 102 ? -10.193 -18.066 3.376   1.00 0.00 ?  315 THR A CB   2  
ATOM 3663  O OG1  . THR A 1 102 ? -11.600 -18.203 3.558   1.00 0.00 ?  315 THR A OG1  2  
ATOM 3664  C CG2  . THR A 1 102 ? -9.765  -17.109 4.491   1.00 0.00 ?  315 THR A CG2  2  
ATOM 3665  H H    . THR A 1 102 ? -8.267  -16.401 1.750   1.00 0.00 ?  315 THR A H    2  
ATOM 3666  H HA   . THR A 1 102 ? -10.512 -18.100 1.246   1.00 0.00 ?  315 THR A HA   2  
ATOM 3667  H HB   . THR A 1 102 ? -9.645  -19.006 3.438   1.00 0.00 ?  315 THR A HB   2  
ATOM 3668  H HG1  . THR A 1 102 ? -11.831 -19.159 3.735   1.00 0.00 ?  315 THR A HG1  2  
ATOM 3669  H HG21 . THR A 1 102 ? -9.372  -16.192 4.052   1.00 0.00 ?  315 THR A HG21 2  
ATOM 3670  H HG22 . THR A 1 102 ? -10.625 -16.873 5.118   1.00 0.00 ?  315 THR A HG22 2  
ATOM 3671  H HG23 . THR A 1 102 ? -8.992  -17.581 5.098   1.00 0.00 ?  315 THR A HG23 2  
ATOM 3672  N N    . THR A 1 103 ? -11.937 -16.002 2.423   1.00 0.00 ?  316 THR A N    2  
ATOM 3673  C CA   . THR A 1 103 ? -12.704 -14.768 2.381   1.00 0.00 ?  316 THR A CA   2  
ATOM 3674  C C    . THR A 1 103 ? -11.978 -13.662 3.149   1.00 0.00 ?  316 THR A C    2  
ATOM 3675  O O    . THR A 1 103 ? -12.377 -13.305 4.256   1.00 0.00 ?  316 THR A O    2  
ATOM 3676  C CB   . THR A 1 103 ? -14.105 -15.064 2.921   1.00 0.00 ?  316 THR A CB   2  
ATOM 3677  O OG1  . THR A 1 103 ? -14.647 -15.995 1.988   1.00 0.00 ?  316 THR A OG1  2  
ATOM 3678  C CG2  . THR A 1 103 ? -15.037 -13.854 2.824   1.00 0.00 ?  316 THR A CG2  2  
ATOM 3679  H H    . THR A 1 103 ? -12.382 -16.759 2.901   1.00 0.00 ?  316 THR A H    2  
ATOM 3680  H HA   . THR A 1 103 ? -12.775 -14.443 1.343   1.00 0.00 ?  316 THR A HA   2  
ATOM 3681  H HB   . THR A 1 103 ? -14.057 -15.438 3.943   1.00 0.00 ?  316 THR A HB   2  
ATOM 3682  H HG1  . THR A 1 103 ? -14.069 -16.809 1.943   1.00 0.00 ?  316 THR A HG1  2  
ATOM 3683  H HG21 . THR A 1 103 ? -15.967 -14.069 3.350   1.00 0.00 ?  316 THR A HG21 2  
ATOM 3684  H HG22 . THR A 1 103 ? -14.556 -12.988 3.277   1.00 0.00 ?  316 THR A HG22 2  
ATOM 3685  H HG23 . THR A 1 103 ? -15.252 -13.644 1.777   1.00 0.00 ?  316 THR A HG23 2  
ATOM 3686  N N    . VAL A 1 104 ? -10.924 -13.150 2.530   1.00 0.00 ?  317 VAL A N    2  
ATOM 3687  C CA   . VAL A 1 104 ? -10.139 -12.092 3.142   1.00 0.00 ?  317 VAL A CA   2  
ATOM 3688  C C    . VAL A 1 104 ? -10.474 -10.759 2.469   1.00 0.00 ?  317 VAL A C    2  
ATOM 3689  O O    . VAL A 1 104 ? -10.603 -10.692 1.248   1.00 0.00 ?  317 VAL A O    2  
ATOM 3690  C CB   . VAL A 1 104 ? -8.650  -12.438 3.072   1.00 0.00 ?  317 VAL A CB   2  
ATOM 3691  C CG1  . VAL A 1 104 ? -8.247  -12.844 1.653   1.00 0.00 ?  317 VAL A CG1  2  
ATOM 3692  C CG2  . VAL A 1 104 ? -7.792  -11.275 3.575   1.00 0.00 ?  317 VAL A CG2  2  
ATOM 3693  H H    . VAL A 1 104 ? -10.606 -13.446 1.630   1.00 0.00 ?  317 VAL A H    2  
ATOM 3694  H HA   . VAL A 1 104 ? -10.423 -12.036 4.193   1.00 0.00 ?  317 VAL A HA   2  
ATOM 3695  H HB   . VAL A 1 104 ? -8.473  -13.292 3.727   1.00 0.00 ?  317 VAL A HB   2  
ATOM 3696  H HG11 . VAL A 1 104 ? -9.029  -12.546 0.955   1.00 0.00 ?  317 VAL A HG11 2  
ATOM 3697  H HG12 . VAL A 1 104 ? -7.313  -12.350 1.385   1.00 0.00 ?  317 VAL A HG12 2  
ATOM 3698  H HG13 . VAL A 1 104 ? -8.112  -13.924 1.608   1.00 0.00 ?  317 VAL A HG13 2  
ATOM 3699  H HG21 . VAL A 1 104 ? -7.583  -11.410 4.636   1.00 0.00 ?  317 VAL A HG21 2  
ATOM 3700  H HG22 . VAL A 1 104 ? -6.854  -11.250 3.020   1.00 0.00 ?  317 VAL A HG22 2  
ATOM 3701  H HG23 . VAL A 1 104 ? -8.328  -10.338 3.426   1.00 0.00 ?  317 VAL A HG23 2  
ATOM 3702  N N    . SER A 1 105 ? -10.606 -9.732  3.296   1.00 0.00 ?  318 SER A N    2  
ATOM 3703  C CA   . SER A 1 105 ? -10.925 -8.406  2.796   1.00 0.00 ?  318 SER A CA   2  
ATOM 3704  C C    . SER A 1 105 ? -9.686  -7.510  2.863   1.00 0.00 ?  318 SER A C    2  
ATOM 3705  O O    . SER A 1 105 ? -8.979  -7.497  3.870   1.00 0.00 ?  318 SER A O    2  
ATOM 3706  C CB   . SER A 1 105 ? -12.075 -7.780  3.588   1.00 0.00 ?  318 SER A CB   2  
ATOM 3707  O OG   . SER A 1 105 ? -13.290 -8.509  3.430   1.00 0.00 ?  318 SER A OG   2  
ATOM 3708  H H    . SER A 1 105 ? -10.500 -9.796  4.288   1.00 0.00 ?  318 SER A H    2  
ATOM 3709  H HA   . SER A 1 105 ? -11.235 -8.553  1.762   1.00 0.00 ?  318 SER A HA   2  
ATOM 3710  H HB2  . SER A 1 105 ? -11.810 -7.743  4.645   1.00 0.00 ?  318 SER A HB2  2  
ATOM 3711  H HB3  . SER A 1 105 ? -12.224 -6.752  3.260   1.00 0.00 ?  318 SER A HB3  2  
ATOM 3712  H HG   . SER A 1 105 ? -13.183 -9.201  2.716   1.00 0.00 ?  318 SER A HG   2  
ATOM 3713  N N    . LEU A 1 106 ? -9.461  -6.784  1.778   1.00 0.00 ?  319 LEU A N    2  
ATOM 3714  C CA   . LEU A 1 106 ? -8.320  -5.887  1.701   1.00 0.00 ?  319 LEU A CA   2  
ATOM 3715  C C    . LEU A 1 106 ? -8.731  -4.607  0.972   1.00 0.00 ?  319 LEU A C    2  
ATOM 3716  O O    . LEU A 1 106 ? -9.847  -4.509  0.464   1.00 0.00 ?  319 LEU A O    2  
ATOM 3717  C CB   . LEU A 1 106 ? -7.122  -6.598  1.069   1.00 0.00 ?  319 LEU A CB   2  
ATOM 3718  C CG   . LEU A 1 106 ? -7.361  -8.039  0.614   1.00 0.00 ?  319 LEU A CG   2  
ATOM 3719  C CD1  . LEU A 1 106 ? -6.511  -8.375  -0.614  1.00 0.00 ?  319 LEU A CD1  2  
ATOM 3720  C CD2  . LEU A 1 106 ? -7.124  -9.023  1.761   1.00 0.00 ?  319 LEU A CD2  2  
ATOM 3721  H H    . LEU A 1 106 ? -10.041 -6.800  0.964   1.00 0.00 ?  319 LEU A H    2  
ATOM 3722  H HA   . LEU A 1 106 ? -8.039  -5.628  2.722   1.00 0.00 ?  319 LEU A HA   2  
ATOM 3723  H HB2  . LEU A 1 106 ? -6.793  -6.016  0.208   1.00 0.00 ?  319 LEU A HB2  2  
ATOM 3724  H HB3  . LEU A 1 106 ? -6.303  -6.596  1.787   1.00 0.00 ?  319 LEU A HB3  2  
ATOM 3725  H HG   . LEU A 1 106 ? -8.406  -8.136  0.318   1.00 0.00 ?  319 LEU A HG   2  
ATOM 3726  H HD11 . LEU A 1 106 ? -6.664  -9.419  -0.887  1.00 0.00 ?  319 LEU A HD11 2  
ATOM 3727  H HD12 . LEU A 1 106 ? -6.806  -7.735  -1.446  1.00 0.00 ?  319 LEU A HD12 2  
ATOM 3728  H HD13 . LEU A 1 106 ? -5.459  -8.209  -0.384  1.00 0.00 ?  319 LEU A HD13 2  
ATOM 3729  H HD21 . LEU A 1 106 ? -7.676  -9.943  1.571   1.00 0.00 ?  319 LEU A HD21 2  
ATOM 3730  H HD22 . LEU A 1 106 ? -6.059  -9.246  1.834   1.00 0.00 ?  319 LEU A HD22 2  
ATOM 3731  H HD23 . LEU A 1 106 ? -7.467  -8.580  2.696   1.00 0.00 ?  319 LEU A HD23 2  
ATOM 3732  N N    . LEU A 1 107 ? -7.807  -3.658  0.943   1.00 0.00 ?  320 LEU A N    2  
ATOM 3733  C CA   . LEU A 1 107 ? -8.060  -2.387  0.284   1.00 0.00 ?  320 LEU A CA   2  
ATOM 3734  C C    . LEU A 1 107 ? -6.968  -2.132  -0.757  1.00 0.00 ?  320 LEU A C    2  
ATOM 3735  O O    . LEU A 1 107 ? -5.784  -2.309  -0.475  1.00 0.00 ?  320 LEU A O    2  
ATOM 3736  C CB   . LEU A 1 107 ? -8.200  -1.267  1.316   1.00 0.00 ?  320 LEU A CB   2  
ATOM 3737  C CG   . LEU A 1 107 ? -8.914  -1.639  2.617   1.00 0.00 ?  320 LEU A CG   2  
ATOM 3738  C CD1  . LEU A 1 107 ? -7.912  -2.065  3.691   1.00 0.00 ?  320 LEU A CD1  2  
ATOM 3739  C CD2  . LEU A 1 107 ? -9.814  -0.496  3.095   1.00 0.00 ?  320 LEU A CD2  2  
ATOM 3740  H H    . LEU A 1 107 ? -6.902  -3.745  1.359   1.00 0.00 ?  320 LEU A H    2  
ATOM 3741  H HA   . LEU A 1 107 ? -9.016  -2.471  -0.232  1.00 0.00 ?  320 LEU A HA   2  
ATOM 3742  H HB2  . LEU A 1 107 ? -7.203  -0.901  1.564   1.00 0.00 ?  320 LEU A HB2  2  
ATOM 3743  H HB3  . LEU A 1 107 ? -8.737  -0.439  0.854   1.00 0.00 ?  320 LEU A HB3  2  
ATOM 3744  H HG   . LEU A 1 107 ? -9.559  -2.495  2.420   1.00 0.00 ?  320 LEU A HG   2  
ATOM 3745  H HD11 . LEU A 1 107 ? -7.684  -3.125  3.575   1.00 0.00 ?  320 LEU A HD11 2  
ATOM 3746  H HD12 . LEU A 1 107 ? -6.996  -1.483  3.585   1.00 0.00 ?  320 LEU A HD12 2  
ATOM 3747  H HD13 . LEU A 1 107 ? -8.340  -1.892  4.678   1.00 0.00 ?  320 LEU A HD13 2  
ATOM 3748  H HD21 . LEU A 1 107 ? -9.829  -0.477  4.184   1.00 0.00 ?  320 LEU A HD21 2  
ATOM 3749  H HD22 . LEU A 1 107 ? -9.427  0.452   2.720   1.00 0.00 ?  320 LEU A HD22 2  
ATOM 3750  H HD23 . LEU A 1 107 ? -10.826 -0.650  2.720   1.00 0.00 ?  320 LEU A HD23 2  
ATOM 3751  N N    . SER A 1 108 ? -7.405  -1.719  -1.937  1.00 0.00 ?  321 SER A N    2  
ATOM 3752  C CA   . SER A 1 108 ? -6.480  -1.438  -3.022  1.00 0.00 ?  321 SER A CA   2  
ATOM 3753  C C    . SER A 1 108 ? -6.201  0.065   -3.095  1.00 0.00 ?  321 SER A C    2  
ATOM 3754  O O    . SER A 1 108 ? -7.076  0.877   -2.799  1.00 0.00 ?  321 SER A O    2  
ATOM 3755  C CB   . SER A 1 108 ? -7.028  -1.941  -4.358  1.00 0.00 ?  321 SER A CB   2  
ATOM 3756  O OG   . SER A 1 108 ? -6.199  -1.559  -5.453  1.00 0.00 ?  321 SER A OG   2  
ATOM 3757  H H    . SER A 1 108 ? -8.370  -1.577  -2.158  1.00 0.00 ?  321 SER A H    2  
ATOM 3758  H HA   . SER A 1 108 ? -5.570  -1.984  -2.773  1.00 0.00 ?  321 SER A HA   2  
ATOM 3759  H HB2  . SER A 1 108 ? -7.112  -3.028  -4.330  1.00 0.00 ?  321 SER A HB2  2  
ATOM 3760  H HB3  . SER A 1 108 ? -8.033  -1.548  -4.509  1.00 0.00 ?  321 SER A HB3  2  
ATOM 3761  H HG   . SER A 1 108 ? -5.396  -1.067  -5.118  1.00 0.00 ?  321 SER A HG   2  
ATOM 3762  N N    . LEU A 1 109 ? -4.979  0.389   -3.490  1.00 0.00 ?  322 LEU A N    2  
ATOM 3763  C CA   . LEU A 1 109 ? -4.574  1.780   -3.606  1.00 0.00 ?  322 LEU A CA   2  
ATOM 3764  C C    . LEU A 1 109 ? -3.756  1.964   -4.886  1.00 0.00 ?  322 LEU A C    2  
ATOM 3765  O O    . LEU A 1 109 ? -2.592  1.571   -4.945  1.00 0.00 ?  322 LEU A O    2  
ATOM 3766  C CB   . LEU A 1 109 ? -3.843  2.232   -2.339  1.00 0.00 ?  322 LEU A CB   2  
ATOM 3767  C CG   . LEU A 1 109 ? -3.553  3.731   -2.231  1.00 0.00 ?  322 LEU A CG   2  
ATOM 3768  C CD1  . LEU A 1 109 ? -2.205  4.075   -2.866  1.00 0.00 ?  322 LEU A CD1  2  
ATOM 3769  C CD2  . LEU A 1 109 ? -4.695  4.554   -2.829  1.00 0.00 ?  322 LEU A CD2  2  
ATOM 3770  H H    . LEU A 1 109 ? -4.273  -0.278  -3.729  1.00 0.00 ?  322 LEU A H    2  
ATOM 3771  H HA   . LEU A 1 109 ? -5.481  2.379   -3.685  1.00 0.00 ?  322 LEU A HA   2  
ATOM 3772  H HB2  . LEU A 1 109 ? -4.437  1.934   -1.475  1.00 0.00 ?  322 LEU A HB2  2  
ATOM 3773  H HB3  . LEU A 1 109 ? -2.897  1.694   -2.277  1.00 0.00 ?  322 LEU A HB3  2  
ATOM 3774  H HG   . LEU A 1 109 ? -3.487  3.990   -1.175  1.00 0.00 ?  322 LEU A HG   2  
ATOM 3775  H HD11 . LEU A 1 109 ? -1.652  4.743   -2.205  1.00 0.00 ?  322 LEU A HD11 2  
ATOM 3776  H HD12 . LEU A 1 109 ? -1.631  3.161   -3.021  1.00 0.00 ?  322 LEU A HD12 2  
ATOM 3777  H HD13 . LEU A 1 109 ? -2.369  4.567   -3.825  1.00 0.00 ?  322 LEU A HD13 2  
ATOM 3778  H HD21 . LEU A 1 109 ? -4.576  5.600   -2.546  1.00 0.00 ?  322 LEU A HD21 2  
ATOM 3779  H HD22 . LEU A 1 109 ? -4.676  4.468   -3.915  1.00 0.00 ?  322 LEU A HD22 2  
ATOM 3780  H HD23 . LEU A 1 109 ? -5.648  4.182   -2.452  1.00 0.00 ?  322 LEU A HD23 2  
ATOM 3781  N N    . HIS A 1 110 ? -4.399  2.561   -5.879  1.00 0.00 ?  323 HIS A N    2  
ATOM 3782  C CA   . HIS A 1 110 ? -3.746  2.802   -7.154  1.00 0.00 ?  323 HIS A CA   2  
ATOM 3783  C C    . HIS A 1 110 ? -2.573  3.765   -6.957  1.00 0.00 ?  323 HIS A C    2  
ATOM 3784  O O    . HIS A 1 110 ? -2.708  4.782   -6.279  1.00 0.00 ?  323 HIS A O    2  
ATOM 3785  C CB   . HIS A 1 110 ? -4.752  3.299   -8.195  1.00 0.00 ?  323 HIS A CB   2  
ATOM 3786  C CG   . HIS A 1 110 ? -5.729  4.321   -7.665  1.00 0.00 ?  323 HIS A CG   2  
ATOM 3787  N ND1  . HIS A 1 110 ? -5.542  5.684   -7.811  1.00 0.00 ?  323 HIS A ND1  2  
ATOM 3788  C CD2  . HIS A 1 110 ? -6.904  4.164   -6.989  1.00 0.00 ?  323 HIS A CD2  2  
ATOM 3789  C CE1  . HIS A 1 110 ? -6.563  6.310   -7.245  1.00 0.00 ?  323 HIS A CE1  2  
ATOM 3790  N NE2  . HIS A 1 110 ? -7.406  5.366   -6.735  1.00 0.00 ?  323 HIS A NE2  2  
ATOM 3791  H H    . HIS A 1 110 ? -5.346  2.877   -5.822  1.00 0.00 ?  323 HIS A H    2  
ATOM 3792  H HA   . HIS A 1 110 ? -3.362  1.841   -7.496  1.00 0.00 ?  323 HIS A HA   2  
ATOM 3793  H HB2  . HIS A 1 110 ? -4.208  3.732   -9.033  1.00 0.00 ?  323 HIS A HB2  2  
ATOM 3794  H HB3  . HIS A 1 110 ? -5.309  2.446   -8.583  1.00 0.00 ?  323 HIS A HB3  2  
ATOM 3795  H HD1  . HIS A 1 110 ? -4.767  6.122   -8.267  1.00 0.00 ?  323 HIS A HD1  2  
ATOM 3796  H HD2  . HIS A 1 110 ? -7.354  3.212   -6.705  1.00 0.00 ?  323 HIS A HD2  2  
ATOM 3797  H HE1  . HIS A 1 110 ? -6.705  7.390   -7.195  1.00 0.00 ?  323 HIS A HE1  2  
ATOM 3798  H HE2  . HIS A 1 110 ? -8.288  5.548   -6.301  1.00 0.00 ?  323 HIS A HE2  2  
ATOM 3799  N N    . SER A 1 111 ? -1.450  3.410   -7.563  1.00 0.00 ?  324 SER A N    2  
ATOM 3800  C CA   . SER A 1 111 ? -0.254  4.229   -7.462  1.00 0.00 ?  324 SER A CA   2  
ATOM 3801  C C    . SER A 1 111 ? -0.557  5.656   -7.924  1.00 0.00 ?  324 SER A C    2  
ATOM 3802  O O    . SER A 1 111 ? 0.187   6.585   -7.613  1.00 0.00 ?  324 SER A O    2  
ATOM 3803  C CB   . SER A 1 111 ? 0.891   3.637   -8.286  1.00 0.00 ?  324 SER A CB   2  
ATOM 3804  O OG   . SER A 1 111 ? 0.570   3.568   -9.673  1.00 0.00 ?  324 SER A OG   2  
ATOM 3805  H H    . SER A 1 111 ? -1.349  2.581   -8.113  1.00 0.00 ?  324 SER A H    2  
ATOM 3806  H HA   . SER A 1 111 ? 0.016   4.218   -6.406  1.00 0.00 ?  324 SER A HA   2  
ATOM 3807  H HB2  . SER A 1 111 ? 1.786   4.244   -8.151  1.00 0.00 ?  324 SER A HB2  2  
ATOM 3808  H HB3  . SER A 1 111 ? 1.124   2.638   -7.918  1.00 0.00 ?  324 SER A HB3  2  
ATOM 3809  H HG   . SER A 1 111 ? 1.355   3.858   -10.220 1.00 0.00 ?  324 SER A HG   2  
ATOM 3810  N N    . ALA A 1 112 ? -1.652  5.786   -8.658  1.00 0.00 ?  325 ALA A N    2  
ATOM 3811  C CA   . ALA A 1 112 ? -2.063  7.084   -9.166  1.00 0.00 ?  325 ALA A CA   2  
ATOM 3812  C C    . ALA A 1 112 ? -2.259  8.047   -7.993  1.00 0.00 ?  325 ALA A C    2  
ATOM 3813  O O    . ALA A 1 112 ? -1.942  9.231   -8.098  1.00 0.00 ?  325 ALA A O    2  
ATOM 3814  C CB   . ALA A 1 112 ? -3.331  6.926   -10.007 1.00 0.00 ?  325 ALA A CB   2  
ATOM 3815  H H    . ALA A 1 112 ? -2.253  5.026   -8.907  1.00 0.00 ?  325 ALA A H    2  
ATOM 3816  H HA   . ALA A 1 112 ? -1.263  7.460   -9.804  1.00 0.00 ?  325 ALA A HA   2  
ATOM 3817  H HB1  . ALA A 1 112 ? -3.134  7.256   -11.027 1.00 0.00 ?  325 ALA A HB1  2  
ATOM 3818  H HB2  . ALA A 1 112 ? -3.632  5.878   -10.016 1.00 0.00 ?  325 ALA A HB2  2  
ATOM 3819  H HB3  . ALA A 1 112 ? -4.130  7.530   -9.577  1.00 0.00 ?  325 ALA A HB3  2  
ATOM 3820  N N    . ASP A 1 113 ? -2.779  7.503   -6.902  1.00 0.00 ?  326 ASP A N    2  
ATOM 3821  C CA   . ASP A 1 113 ? -3.020  8.299   -5.711  1.00 0.00 ?  326 ASP A CA   2  
ATOM 3822  C C    . ASP A 1 113 ? -1.683  8.780   -5.145  1.00 0.00 ?  326 ASP A C    2  
ATOM 3823  O O    . ASP A 1 113 ? -1.573  9.912   -4.677  1.00 0.00 ?  326 ASP A O    2  
ATOM 3824  C CB   . ASP A 1 113 ? -3.722  7.474   -4.630  1.00 0.00 ?  326 ASP A CB   2  
ATOM 3825  C CG   . ASP A 1 113 ? -4.301  8.287   -3.470  1.00 0.00 ?  326 ASP A CG   2  
ATOM 3826  O OD1  . ASP A 1 113 ? -4.298  7.840   -2.314  1.00 0.00 ?  326 ASP A OD1  2  
ATOM 3827  O OD2  . ASP A 1 113 ? -4.775  9.442   -3.797  1.00 0.00 -1 326 ASP A OD2  2  
ATOM 3828  H H    . ASP A 1 113 ? -3.033  6.539   -6.825  1.00 0.00 ?  326 ASP A H    2  
ATOM 3829  H HA   . ASP A 1 113 ? -3.654  9.123   -6.040  1.00 0.00 ?  326 ASP A HA   2  
ATOM 3830  H HB2  . ASP A 1 113 ? -4.529  6.907   -5.095  1.00 0.00 ?  326 ASP A HB2  2  
ATOM 3831  H HB3  . ASP A 1 113 ? -3.013  6.750   -4.229  1.00 0.00 ?  326 ASP A HB3  2  
ATOM 3832  H HD2  . ASP A 1 113 ? -4.113  10.158  -3.575  1.00 0.00 ?  326 ASP A HD2  2  
ATOM 3833  N N    . PHE A 1 114 ? -0.699  7.894   -5.205  1.00 0.00 ?  327 PHE A N    2  
ATOM 3834  C CA   . PHE A 1 114 ? 0.627   8.214   -4.703  1.00 0.00 ?  327 PHE A CA   2  
ATOM 3835  C C    . PHE A 1 114 ? 1.304   9.271   -5.578  1.00 0.00 ?  327 PHE A C    2  
ATOM 3836  O O    . PHE A 1 114 ? 2.034   10.123  -5.075  1.00 0.00 ?  327 PHE A O    2  
ATOM 3837  C CB   . PHE A 1 114 ? 1.448   6.924   -4.755  1.00 0.00 ?  327 PHE A CB   2  
ATOM 3838  C CG   . PHE A 1 114 ? 2.941   7.125   -4.485  1.00 0.00 ?  327 PHE A CG   2  
ATOM 3839  C CD1  . PHE A 1 114 ? 3.763   7.541   -5.486  1.00 0.00 ?  327 PHE A CD1  2  
ATOM 3840  C CD2  . PHE A 1 114 ? 3.445   6.888   -3.245  1.00 0.00 ?  327 PHE A CD2  2  
ATOM 3841  C CE1  . PHE A 1 114 ? 5.148   7.727   -5.235  1.00 0.00 ?  327 PHE A CE1  2  
ATOM 3842  C CE2  . PHE A 1 114 ? 4.830   7.074   -2.994  1.00 0.00 ?  327 PHE A CE2  2  
ATOM 3843  C CZ   . PHE A 1 114 ? 5.653   7.490   -3.994  1.00 0.00 ?  327 PHE A CZ   2  
ATOM 3844  H H    . PHE A 1 114 ? -0.796  6.975   -5.586  1.00 0.00 ?  327 PHE A H    2  
ATOM 3845  H HA   . PHE A 1 114 ? 0.506   8.605   -3.693  1.00 0.00 ?  327 PHE A HA   2  
ATOM 3846  H HB2  . PHE A 1 114 ? 1.049   6.221   -4.025  1.00 0.00 ?  327 PHE A HB2  2  
ATOM 3847  H HB3  . PHE A 1 114 ? 1.326   6.467   -5.737  1.00 0.00 ?  327 PHE A HB3  2  
ATOM 3848  H HD1  . PHE A 1 114 ? 3.359   7.731   -6.480  1.00 0.00 ?  327 PHE A HD1  2  
ATOM 3849  H HD2  . PHE A 1 114 ? 2.786   6.555   -2.443  1.00 0.00 ?  327 PHE A HD2  2  
ATOM 3850  H HE1  . PHE A 1 114 ? 5.807   8.060   -6.037  1.00 0.00 ?  327 PHE A HE1  2  
ATOM 3851  H HE2  . PHE A 1 114 ? 5.235   6.884   -2.000  1.00 0.00 ?  327 PHE A HE2  2  
ATOM 3852  H HZ   . PHE A 1 114 ? 6.716   7.633   -3.802  1.00 0.00 ?  327 PHE A HZ   2  
ATOM 3853  N N    . GLN A 1 115 ? 1.037   9.181   -6.873  1.00 0.00 ?  328 GLN A N    2  
ATOM 3854  C CA   . GLN A 1 115 ? 1.611   10.119  -7.822  1.00 0.00 ?  328 GLN A CA   2  
ATOM 3855  C C    . GLN A 1 115 ? 1.003   11.509  -7.629  1.00 0.00 ?  328 GLN A C    2  
ATOM 3856  O O    . GLN A 1 115 ? 1.681   12.519  -7.816  1.00 0.00 ?  328 GLN A O    2  
ATOM 3857  C CB   . GLN A 1 115 ? 1.418   9.631   -9.260  1.00 0.00 ?  328 GLN A CB   2  
ATOM 3858  C CG   . GLN A 1 115 ? 2.195   8.336   -9.509  1.00 0.00 ?  328 GLN A CG   2  
ATOM 3859  C CD   . GLN A 1 115 ? 1.945   7.810   -10.923 1.00 0.00 ?  328 GLN A CD   2  
ATOM 3860  O OE1  . GLN A 1 115 ? 2.138   8.498   -11.912 1.00 0.00 ?  328 GLN A OE1  2  
ATOM 3861  N NE2  . GLN A 1 115 ? 1.506   6.556   -10.964 1.00 0.00 ?  328 GLN A NE2  2  
ATOM 3862  H H    . GLN A 1 115 ? 0.442   8.485   -7.274  1.00 0.00 ?  328 GLN A H    2  
ATOM 3863  H HA   . GLN A 1 115 ? 2.677   10.146  -7.595  1.00 0.00 ?  328 GLN A HA   2  
ATOM 3864  H HB2  . GLN A 1 115 ? 0.358   9.466   -9.452  1.00 0.00 ?  328 GLN A HB2  2  
ATOM 3865  H HB3  . GLN A 1 115 ? 1.753   10.400  -9.956  1.00 0.00 ?  328 GLN A HB3  2  
ATOM 3866  H HG2  . GLN A 1 115 ? 3.261   8.514   -9.366  1.00 0.00 ?  328 GLN A HG2  2  
ATOM 3867  H HG3  . GLN A 1 115 ? 1.897   7.584   -8.779  1.00 0.00 ?  328 GLN A HG3  2  
ATOM 3868  H HE21 . GLN A 1 115 ? 1.368   6.046   -10.115 1.00 0.00 ?  328 GLN A HE21 2  
ATOM 3869  H HE22 . GLN A 1 115 ? 1.313   6.122   -11.845 1.00 0.00 ?  328 GLN A HE22 2  
ATOM 3870  N N    . MET A 1 116 ? -0.268  11.518  -7.256  1.00 0.00 ?  329 MET A N    2  
ATOM 3871  C CA   . MET A 1 116 ? -0.975  12.768  -7.035  1.00 0.00 ?  329 MET A CA   2  
ATOM 3872  C C    . MET A 1 116 ? -0.470  13.467  -5.772  1.00 0.00 ?  329 MET A C    2  
ATOM 3873  O O    . MET A 1 116 ? -0.266  14.680  -5.769  1.00 0.00 ?  329 MET A O    2  
ATOM 3874  C CB   . MET A 1 116 ? -2.474  12.490  -6.900  1.00 0.00 ?  329 MET A CB   2  
ATOM 3875  C CG   . MET A 1 116 ? -3.282  13.785  -6.997  1.00 0.00 ?  329 MET A CG   2  
ATOM 3876  S SD   . MET A 1 116 ? -4.928  13.527  -6.357  1.00 0.00 ?  329 MET A SD   2  
ATOM 3877  C CE   . MET A 1 116 ? -4.556  13.296  -4.627  1.00 0.00 ?  329 MET A CE   2  
ATOM 3878  H H    . MET A 1 116 ? -0.812  10.692  -7.106  1.00 0.00 ?  329 MET A H    2  
ATOM 3879  H HA   . MET A 1 116 ? -0.762  13.383  -7.909  1.00 0.00 ?  329 MET A HA   2  
ATOM 3880  H HB2  . MET A 1 116 ? -2.791  11.800  -7.682  1.00 0.00 ?  329 MET A HB2  2  
ATOM 3881  H HB3  . MET A 1 116 ? -2.672  12.003  -5.945  1.00 0.00 ?  329 MET A HB3  2  
ATOM 3882  H HG2  . MET A 1 116 ? -2.785  14.576  -6.436  1.00 0.00 ?  329 MET A HG2  2  
ATOM 3883  H HG3  . MET A 1 116 ? -3.334  14.115  -8.035  1.00 0.00 ?  329 MET A HG3  2  
ATOM 3884  H HE1  . MET A 1 116 ? -4.120  12.308  -4.477  1.00 0.00 ?  329 MET A HE1  2  
ATOM 3885  H HE2  . MET A 1 116 ? -3.847  14.059  -4.303  1.00 0.00 ?  329 MET A HE2  2  
ATOM 3886  H HE3  . MET A 1 116 ? -5.473  13.381  -4.043  1.00 0.00 ?  329 MET A HE3  2  
ATOM 3887  N N    . LEU A 1 117 ? -0.282  12.673  -4.728  1.00 0.00 ?  330 LEU A N    2  
ATOM 3888  C CA   . LEU A 1 117 ? 0.196   13.200  -3.462  1.00 0.00 ?  330 LEU A CA   2  
ATOM 3889  C C    . LEU A 1 117 ? 1.663   13.609  -3.605  1.00 0.00 ?  330 LEU A C    2  
ATOM 3890  O O    . LEU A 1 117 ? 2.103   14.583  -2.996  1.00 0.00 ?  330 LEU A O    2  
ATOM 3891  C CB   . LEU A 1 117 ? -0.056  12.197  -2.334  1.00 0.00 ?  330 LEU A CB   2  
ATOM 3892  C CG   . LEU A 1 117 ? -1.476  11.636  -2.241  1.00 0.00 ?  330 LEU A CG   2  
ATOM 3893  C CD1  . LEU A 1 117 ? -1.459  10.172  -1.796  1.00 0.00 ?  330 LEU A CD1  2  
ATOM 3894  C CD2  . LEU A 1 117 ? -2.350  12.501  -1.330  1.00 0.00 ?  330 LEU A CD2  2  
ATOM 3895  H H    . LEU A 1 117 ? -0.450  11.687  -4.739  1.00 0.00 ?  330 LEU A H    2  
ATOM 3896  H HA   . LEU A 1 117 ? -0.391  14.092  -3.237  1.00 0.00 ?  330 LEU A HA   2  
ATOM 3897  H HB2  . LEU A 1 117 ? 0.636   11.364  -2.455  1.00 0.00 ?  330 LEU A HB2  2  
ATOM 3898  H HB3  . LEU A 1 117 ? 0.186   12.678  -1.386  1.00 0.00 ?  330 LEU A HB3  2  
ATOM 3899  H HG   . LEU A 1 117 ? -1.921  11.665  -3.236  1.00 0.00 ?  330 LEU A HG   2  
ATOM 3900  H HD11 . LEU A 1 117 ? -0.788  9.604   -2.441  1.00 0.00 ?  330 LEU A HD11 2  
ATOM 3901  H HD12 . LEU A 1 117 ? -1.111  10.110  -0.765  1.00 0.00 ?  330 LEU A HD12 2  
ATOM 3902  H HD13 . LEU A 1 117 ? -2.466  9.759   -1.865  1.00 0.00 ?  330 LEU A HD13 2  
ATOM 3903  H HD21 . LEU A 1 117 ? -3.335  12.623  -1.780  1.00 0.00 ?  330 LEU A HD21 2  
ATOM 3904  H HD22 . LEU A 1 117 ? -2.451  12.018  -0.358  1.00 0.00 ?  330 LEU A HD22 2  
ATOM 3905  H HD23 . LEU A 1 117 ? -1.885  13.479  -1.204  1.00 0.00 ?  330 LEU A HD23 2  
ATOM 3906  N N    . CYS A 1 118 ? 2.381   12.843  -4.414  1.00 0.00 ?  331 CYS A N    2  
ATOM 3907  C CA   . CYS A 1 118 ? 3.790   13.113  -4.645  1.00 0.00 ?  331 CYS A CA   2  
ATOM 3908  C C    . CYS A 1 118 ? 3.902   14.352  -5.535  1.00 0.00 ?  331 CYS A C    2  
ATOM 3909  O O    . CYS A 1 118 ? 4.722   15.232  -5.279  1.00 0.00 ?  331 CYS A O    2  
ATOM 3910  C CB   . CYS A 1 118 ? 4.504   11.905  -5.255  1.00 0.00 ?  331 CYS A CB   2  
ATOM 3911  S SG   . CYS A 1 118 ? 5.314   10.926  -3.938  1.00 0.00 ?  331 CYS A SG   2  
ATOM 3912  H H    . CYS A 1 118 ? 2.016   12.052  -4.905  1.00 0.00 ?  331 CYS A H    2  
ATOM 3913  H HA   . CYS A 1 118 ? 4.238   13.296  -3.668  1.00 0.00 ?  331 CYS A HA   2  
ATOM 3914  H HB2  . CYS A 1 118 ? 3.790   11.284  -5.795  1.00 0.00 ?  331 CYS A HB2  2  
ATOM 3915  H HB3  . CYS A 1 118 ? 5.247   12.240  -5.980  1.00 0.00 ?  331 CYS A HB3  2  
ATOM 3916  H HG   . CYS A 1 118 ? 5.810   9.992   -4.745  1.00 0.00 ?  331 CYS A HG   2  
ATOM 3917  N N    . SER A 1 119 ? 3.065   14.381  -6.562  1.00 0.00 ?  332 SER A N    2  
ATOM 3918  C CA   . SER A 1 119 ? 3.060   15.498  -7.491  1.00 0.00 ?  332 SER A CA   2  
ATOM 3919  C C    . SER A 1 119 ? 2.432   16.727  -6.830  1.00 0.00 ?  332 SER A C    2  
ATOM 3920  O O    . SER A 1 119 ? 2.760   17.860  -7.179  1.00 0.00 ?  332 SER A O    2  
ATOM 3921  C CB   . SER A 1 119 ? 2.306   15.143  -8.774  1.00 0.00 ?  332 SER A CB   2  
ATOM 3922  O OG   . SER A 1 119 ? 2.591   16.056  -9.831  1.00 0.00 ?  332 SER A OG   2  
ATOM 3923  H H    . SER A 1 119 ? 2.401   13.661  -6.763  1.00 0.00 ?  332 SER A H    2  
ATOM 3924  H HA   . SER A 1 119 ? 4.108   15.683  -7.726  1.00 0.00 ?  332 SER A HA   2  
ATOM 3925  H HB2  . SER A 1 119 ? 2.575   14.134  -9.086  1.00 0.00 ?  332 SER A HB2  2  
ATOM 3926  H HB3  . SER A 1 119 ? 1.234   15.141  -8.577  1.00 0.00 ?  332 SER A HB3  2  
ATOM 3927  H HG   . SER A 1 119 ? 2.409   16.993  -9.531  1.00 0.00 ?  332 SER A HG   2  
ATOM 3928  N N    . SER A 1 120 ? 1.542   16.460  -5.885  1.00 0.00 ?  333 SER A N    2  
ATOM 3929  C CA   . SER A 1 120 ? 0.866   17.530  -5.171  1.00 0.00 ?  333 SER A CA   2  
ATOM 3930  C C    . SER A 1 120 ? 1.827   18.186  -4.178  1.00 0.00 ?  333 SER A C    2  
ATOM 3931  O O    . SER A 1 120 ? 1.805   19.403  -3.998  1.00 0.00 ?  333 SER A O    2  
ATOM 3932  C CB   . SER A 1 120 ? -0.375  17.009  -4.444  1.00 0.00 ?  333 SER A CB   2  
ATOM 3933  O OG   . SER A 1 120 ? -0.863  17.942  -3.485  1.00 0.00 ?  333 SER A OG   2  
ATOM 3934  H H    . SER A 1 120 ? 1.282   15.536  -5.607  1.00 0.00 ?  333 SER A H    2  
ATOM 3935  H HA   . SER A 1 120 ? 0.564   18.243  -5.939  1.00 0.00 ?  333 SER A HA   2  
ATOM 3936  H HB2  . SER A 1 120 ? -1.158  16.793  -5.171  1.00 0.00 ?  333 SER A HB2  2  
ATOM 3937  H HB3  . SER A 1 120 ? -0.135  16.069  -3.946  1.00 0.00 ?  333 SER A HB3  2  
ATOM 3938  H HG   . SER A 1 120 ? -0.190  18.069  -2.756  1.00 0.00 ?  333 SER A HG   2  
ATOM 3939  N N    . SER A 1 121 ? 2.648   17.351  -3.559  1.00 0.00 ?  334 SER A N    2  
ATOM 3940  C CA   . SER A 1 121 ? 3.615   17.834  -2.588  1.00 0.00 ?  334 SER A CA   2  
ATOM 3941  C C    . SER A 1 121 ? 5.016   17.338  -2.954  1.00 0.00 ?  334 SER A C    2  
ATOM 3942  O O    . SER A 1 121 ? 5.253   16.134  -3.027  1.00 0.00 ?  334 SER A O    2  
ATOM 3943  C CB   . SER A 1 121 ? 3.246   17.385  -1.173  1.00 0.00 ?  334 SER A CB   2  
ATOM 3944  O OG   . SER A 1 121 ? 2.948   18.490  -0.323  1.00 0.00 ?  334 SER A OG   2  
ATOM 3945  H H    . SER A 1 121 ? 2.659   16.362  -3.710  1.00 0.00 ?  334 SER A H    2  
ATOM 3946  H HA   . SER A 1 121 ? 3.566   18.921  -2.648  1.00 0.00 ?  334 SER A HA   2  
ATOM 3947  H HB2  . SER A 1 121 ? 2.385   16.719  -1.216  1.00 0.00 ?  334 SER A HB2  2  
ATOM 3948  H HB3  . SER A 1 121 ? 4.071   16.813  -0.747  1.00 0.00 ?  334 SER A HB3  2  
ATOM 3949  H HG   . SER A 1 121 ? 3.632   19.209  -0.444  1.00 0.00 ?  334 SER A HG   2  
ATOM 3950  N N    . PRO A 1 122 ? 5.931   18.318  -3.179  1.00 0.00 ?  335 PRO A N    2  
ATOM 3951  C CA   . PRO A 1 122 ? 7.302   17.994  -3.535  1.00 0.00 ?  335 PRO A CA   2  
ATOM 3952  C C    . PRO A 1 122 ? 8.083   17.498  -2.317  1.00 0.00 ?  335 PRO A C    2  
ATOM 3953  O O    . PRO A 1 122 ? 9.075   16.785  -2.459  1.00 0.00 ?  335 PRO A O    2  
ATOM 3954  C CB   . PRO A 1 122 ? 7.870   19.276  -4.122  1.00 0.00 ?  335 PRO A CB   2  
ATOM 3955  C CG   . PRO A 1 122 ? 6.953   20.393  -3.649  1.00 0.00 ?  335 PRO A CG   2  
ATOM 3956  C CD   . PRO A 1 122 ? 5.687   19.756  -3.101  1.00 0.00 ?  335 PRO A CD   2  
ATOM 3957  H HA   . PRO A 1 122 ? 7.321   17.244  -4.196  1.00 0.00 ?  335 PRO A HA   2  
ATOM 3958  H HB2  . PRO A 1 122 ? 8.893   19.441  -3.784  1.00 0.00 ?  335 PRO A HB2  2  
ATOM 3959  H HB3  . PRO A 1 122 ? 7.898   19.229  -5.211  1.00 0.00 ?  335 PRO A HB3  2  
ATOM 3960  H HG2  . PRO A 1 122 ? 7.444   20.989  -2.880  1.00 0.00 ?  335 PRO A HG2  2  
ATOM 3961  H HG3  . PRO A 1 122 ? 6.716   21.067  -4.473  1.00 0.00 ?  335 PRO A HG3  2  
ATOM 3962  H HD2  . PRO A 1 122 ? 5.497   20.070  -2.075  1.00 0.00 ?  335 PRO A HD2  2  
ATOM 3963  H HD3  . PRO A 1 122 ? 4.814   20.041  -3.688  1.00 0.00 ?  335 PRO A HD3  2  
ATOM 3964  N N    . GLU A 1 123 ? 7.605   17.894  -1.146  1.00 0.00 ?  336 GLU A N    2  
ATOM 3965  C CA   . GLU A 1 123 ? 8.245   17.499  0.097   1.00 0.00 ?  336 GLU A CA   2  
ATOM 3966  C C    . GLU A 1 123 ? 7.986   16.017  0.379   1.00 0.00 ?  336 GLU A C    2  
ATOM 3967  O O    . GLU A 1 123 ? 8.837   15.332  0.944   1.00 0.00 ?  336 GLU A O    2  
ATOM 3968  C CB   . GLU A 1 123 ? 7.770   18.370  1.260   1.00 0.00 ?  336 GLU A CB   2  
ATOM 3969  C CG   . GLU A 1 123 ? 8.751   19.515  1.525   1.00 0.00 ?  336 GLU A CG   2  
ATOM 3970  C CD   . GLU A 1 123 ? 8.008   20.793  1.920   1.00 0.00 ?  336 GLU A CD   2  
ATOM 3971  O OE1  . GLU A 1 123 ? 7.995   21.161  3.104   1.00 0.00 ?  336 GLU A OE1  2  
ATOM 3972  O OE2  . GLU A 1 123 ? 7.432   21.412  0.947   1.00 0.00 -1 336 GLU A OE2  2  
ATOM 3973  H H    . GLU A 1 123 ? 6.797   18.474  -1.039  1.00 0.00 ?  336 GLU A H    2  
ATOM 3974  H HA   . GLU A 1 123 ? 9.311   17.664  -0.061  1.00 0.00 ?  336 GLU A HA   2  
ATOM 3975  H HB2  . GLU A 1 123 ? 6.784   18.777  1.036   1.00 0.00 ?  336 GLU A HB2  2  
ATOM 3976  H HB3  . GLU A 1 123 ? 7.666   17.761  2.158   1.00 0.00 ?  336 GLU A HB3  2  
ATOM 3977  H HG2  . GLU A 1 123 ? 9.441   19.230  2.319   1.00 0.00 ?  336 GLU A HG2  2  
ATOM 3978  H HG3  . GLU A 1 123 ? 9.349   19.699  0.633   1.00 0.00 ?  336 GLU A HG3  2  
ATOM 3979  H HE2  . GLU A 1 123 ? 7.007   20.753  0.326   1.00 0.00 ?  336 GLU A HE2  2  
ATOM 3980  N N    . ILE A 1 124 ? 6.808   15.568  -0.026  1.00 0.00 ?  337 ILE A N    2  
ATOM 3981  C CA   . ILE A 1 124 ? 6.426   14.181  0.176   1.00 0.00 ?  337 ILE A CA   2  
ATOM 3982  C C    . ILE A 1 124 ? 7.245   13.289  -0.758  1.00 0.00 ?  337 ILE A C    2  
ATOM 3983  O O    . ILE A 1 124 ? 7.685   12.210  -0.365  1.00 0.00 ?  337 ILE A O    2  
ATOM 3984  C CB   . ILE A 1 124 ? 4.913   14.013  0.017   1.00 0.00 ?  337 ILE A CB   2  
ATOM 3985  C CG1  . ILE A 1 124 ? 4.161   14.721  1.146   1.00 0.00 ?  337 ILE A CG1  2  
ATOM 3986  C CG2  . ILE A 1 124 ? 4.533   12.534  -0.085  1.00 0.00 ?  337 ILE A CG2  2  
ATOM 3987  C CD1  . ILE A 1 124 ? 2.677   14.873  0.806   1.00 0.00 ?  337 ILE A CD1  2  
ATOM 3988  H H    . ILE A 1 124 ? 6.121   16.132  -0.485  1.00 0.00 ?  337 ILE A H    2  
ATOM 3989  H HA   . ILE A 1 124 ? 6.672   13.921  1.206   1.00 0.00 ?  337 ILE A HA   2  
ATOM 3990  H HB   . ILE A 1 124 ? 4.613   14.488  -0.917  1.00 0.00 ?  337 ILE A HB   2  
ATOM 3991  H HG12 . ILE A 1 124 ? 4.270   14.155  2.071   1.00 0.00 ?  337 ILE A HG12 2  
ATOM 3992  H HG13 . ILE A 1 124 ? 4.600   15.703  1.320   1.00 0.00 ?  337 ILE A HG13 2  
ATOM 3993  H HG21 . ILE A 1 124 ? 4.852   12.143  -1.051  1.00 0.00 ?  337 ILE A HG21 2  
ATOM 3994  H HG22 . ILE A 1 124 ? 5.025   11.977  0.713   1.00 0.00 ?  337 ILE A HG22 2  
ATOM 3995  H HG23 . ILE A 1 124 ? 3.453   12.429  0.011   1.00 0.00 ?  337 ILE A HG23 2  
ATOM 3996  H HD11 . ILE A 1 124 ? 2.078   14.361  1.559   1.00 0.00 ?  337 ILE A HD11 2  
ATOM 3997  H HD12 . ILE A 1 124 ? 2.414   15.930  0.789   1.00 0.00 ?  337 ILE A HD12 2  
ATOM 3998  H HD13 . ILE A 1 124 ? 2.482   14.434  -0.173  1.00 0.00 ?  337 ILE A HD13 2  
ATOM 3999  N N    . ALA A 1 125 ? 7.425   13.772  -1.979  1.00 0.00 ?  338 ALA A N    2  
ATOM 4000  C CA   . ALA A 1 125 ? 8.184   13.032  -2.973  1.00 0.00 ?  338 ALA A CA   2  
ATOM 4001  C C    . ALA A 1 125 ? 9.671   13.091  -2.620  1.00 0.00 ?  338 ALA A C    2  
ATOM 4002  O O    . ALA A 1 125 ? 10.419  12.160  -2.915  1.00 0.00 ?  338 ALA A O    2  
ATOM 4003  C CB   . ALA A 1 125 ? 7.892   13.599  -4.364  1.00 0.00 ?  338 ALA A CB   2  
ATOM 4004  H H    . ALA A 1 125 ? 7.063   14.651  -2.291  1.00 0.00 ?  338 ALA A H    2  
ATOM 4005  H HA   . ALA A 1 125 ? 7.851   11.995  -2.939  1.00 0.00 ?  338 ALA A HA   2  
ATOM 4006  H HB1  . ALA A 1 125 ? 8.655   13.256  -5.063  1.00 0.00 ?  338 ALA A HB1  2  
ATOM 4007  H HB2  . ALA A 1 125 ? 6.912   13.256  -4.698  1.00 0.00 ?  338 ALA A HB2  2  
ATOM 4008  H HB3  . ALA A 1 125 ? 7.900   14.688  -4.322  1.00 0.00 ?  338 ALA A HB3  2  
ATOM 4009  N N    . GLU A 1 126 ? 10.055  14.193  -1.994  1.00 0.00 ?  339 GLU A N    2  
ATOM 4010  C CA   . GLU A 1 126 ? 11.440  14.385  -1.598  1.00 0.00 ?  339 GLU A CA   2  
ATOM 4011  C C    . GLU A 1 126 ? 11.789  13.466  -0.425  1.00 0.00 ?  339 GLU A C    2  
ATOM 4012  O O    . GLU A 1 126 ? 12.898  12.938  -0.355  1.00 0.00 ?  339 GLU A O    2  
ATOM 4013  C CB   . GLU A 1 126 ? 11.712  15.849  -1.246  1.00 0.00 ?  339 GLU A CB   2  
ATOM 4014  C CG   . GLU A 1 126 ? 12.151  16.637  -2.482  1.00 0.00 ?  339 GLU A CG   2  
ATOM 4015  C CD   . GLU A 1 126 ? 13.488  17.340  -2.237  1.00 0.00 ?  339 GLU A CD   2  
ATOM 4016  O OE1  . GLU A 1 126 ? 14.492  16.676  -1.942  1.00 0.00 ?  339 GLU A OE1  2  
ATOM 4017  O OE2  . GLU A 1 126 ? 13.460  18.623  -2.365  1.00 0.00 -1 339 GLU A OE2  2  
ATOM 4018  H H    . GLU A 1 126 ? 9.440   14.945  -1.758  1.00 0.00 ?  339 GLU A H    2  
ATOM 4019  H HA   . GLU A 1 126 ? 12.032  14.111  -2.471  1.00 0.00 ?  339 GLU A HA   2  
ATOM 4020  H HB2  . GLU A 1 126 ? 10.813  16.298  -0.824  1.00 0.00 ?  339 GLU A HB2  2  
ATOM 4021  H HB3  . GLU A 1 126 ? 12.486  15.905  -0.481  1.00 0.00 ?  339 GLU A HB3  2  
ATOM 4022  H HG2  . GLU A 1 126 ? 12.241  15.963  -3.334  1.00 0.00 ?  339 GLU A HG2  2  
ATOM 4023  H HG3  . GLU A 1 126 ? 11.389  17.374  -2.737  1.00 0.00 ?  339 GLU A HG3  2  
ATOM 4024  H HE2  . GLU A 1 126 ? 12.587  18.981  -2.033  1.00 0.00 ?  339 GLU A HE2  2  
ATOM 4025  N N    . ILE A 1 127 ? 10.822  13.302  0.465   1.00 0.00 ?  340 ILE A N    2  
ATOM 4026  C CA   . ILE A 1 127 ? 11.013  12.456  1.631   1.00 0.00 ?  340 ILE A CA   2  
ATOM 4027  C C    . ILE A 1 127 ? 11.004  10.989  1.198   1.00 0.00 ?  340 ILE A C    2  
ATOM 4028  O O    . ILE A 1 127 ? 11.855  10.208  1.620   1.00 0.00 ?  340 ILE A O    2  
ATOM 4029  C CB   . ILE A 1 127 ? 9.977   12.786  2.708   1.00 0.00 ?  340 ILE A CB   2  
ATOM 4030  C CG1  . ILE A 1 127 ? 10.116  14.236  3.177   1.00 0.00 ?  340 ILE A CG1  2  
ATOM 4031  C CG2  . ILE A 1 127 ? 10.063  11.796  3.872   1.00 0.00 ?  340 ILE A CG2  2  
ATOM 4032  C CD1  . ILE A 1 127 ? 8.785   14.769  3.711   1.00 0.00 ?  340 ILE A CD1  2  
ATOM 4033  H H    . ILE A 1 127 ? 9.923   13.735  0.400   1.00 0.00 ?  340 ILE A H    2  
ATOM 4034  H HA   . ILE A 1 127 ? 11.994  12.688  2.046   1.00 0.00 ?  340 ILE A HA   2  
ATOM 4035  H HB   . ILE A 1 127 ? 8.985   12.682  2.270   1.00 0.00 ?  340 ILE A HB   2  
ATOM 4036  H HG12 . ILE A 1 127 ? 10.876  14.298  3.956   1.00 0.00 ?  340 ILE A HG12 2  
ATOM 4037  H HG13 . ILE A 1 127 ? 10.456  14.858  2.349   1.00 0.00 ?  340 ILE A HG13 2  
ATOM 4038  H HG21 . ILE A 1 127 ? 9.062   11.604  4.259   1.00 0.00 ?  340 ILE A HG21 2  
ATOM 4039  H HG22 . ILE A 1 127 ? 10.503  10.862  3.523   1.00 0.00 ?  340 ILE A HG22 2  
ATOM 4040  H HG23 . ILE A 1 127 ? 10.684  12.218  4.662   1.00 0.00 ?  340 ILE A HG23 2  
ATOM 4041  H HD11 . ILE A 1 127 ? 7.965   14.342  3.133   1.00 0.00 ?  340 ILE A HD11 2  
ATOM 4042  H HD12 . ILE A 1 127 ? 8.676   14.490  4.758   1.00 0.00 ?  340 ILE A HD12 2  
ATOM 4043  H HD13 . ILE A 1 127 ? 8.767   15.855  3.620   1.00 0.00 ?  340 ILE A HD13 2  
ATOM 4044  N N    . PHE A 1 128 ? 10.032  10.658  0.360   1.00 0.00 ?  341 PHE A N    2  
ATOM 4045  C CA   . PHE A 1 128 ? 9.900   9.299   -0.135  1.00 0.00 ?  341 PHE A CA   2  
ATOM 4046  C C    . PHE A 1 128 ? 11.067  8.935   -1.056  1.00 0.00 ?  341 PHE A C    2  
ATOM 4047  O O    . PHE A 1 128 ? 11.471  7.775   -1.124  1.00 0.00 ?  341 PHE A O    2  
ATOM 4048  C CB   . PHE A 1 128 ? 8.598   9.238   -0.935  1.00 0.00 ?  341 PHE A CB   2  
ATOM 4049  C CG   . PHE A 1 128 ? 7.858   7.904   -0.819  1.00 0.00 ?  341 PHE A CG   2  
ATOM 4050  C CD1  . PHE A 1 128 ? 6.981   7.699   0.201   1.00 0.00 ?  341 PHE A CD1  2  
ATOM 4051  C CD2  . PHE A 1 128 ? 8.077   6.922   -1.734  1.00 0.00 ?  341 PHE A CD2  2  
ATOM 4052  C CE1  . PHE A 1 128 ? 6.295   6.460   0.309   1.00 0.00 ?  341 PHE A CE1  2  
ATOM 4053  C CE2  . PHE A 1 128 ? 7.390   5.684   -1.626  1.00 0.00 ?  341 PHE A CE2  2  
ATOM 4054  C CZ   . PHE A 1 128 ? 6.514   5.479   -0.607  1.00 0.00 ?  341 PHE A CZ   2  
ATOM 4055  H H    . PHE A 1 128 ? 9.343   11.300  0.021   1.00 0.00 ?  341 PHE A H    2  
ATOM 4056  H HA   . PHE A 1 128 ? 9.904   8.637   0.731   1.00 0.00 ?  341 PHE A HA   2  
ATOM 4057  H HB2  . PHE A 1 128 ? 7.938   10.038  -0.598  1.00 0.00 ?  341 PHE A HB2  2  
ATOM 4058  H HB3  . PHE A 1 128 ? 8.819   9.428   -1.985  1.00 0.00 ?  341 PHE A HB3  2  
ATOM 4059  H HD1  . PHE A 1 128 ? 6.805   8.485   0.935   1.00 0.00 ?  341 PHE A HD1  2  
ATOM 4060  H HD2  . PHE A 1 128 ? 8.780   7.086   -2.551  1.00 0.00 ?  341 PHE A HD2  2  
ATOM 4061  H HE1  . PHE A 1 128 ? 5.592   6.297   1.126   1.00 0.00 ?  341 PHE A HE1  2  
ATOM 4062  H HE2  . PHE A 1 128 ? 7.566   4.897   -2.360  1.00 0.00 ?  341 PHE A HE2  2  
ATOM 4063  H HZ   . PHE A 1 128 ? 5.987   4.529   -0.524  1.00 0.00 ?  341 PHE A HZ   2  
ATOM 4064  N N    . ARG A 1 129 ? 11.577  9.949   -1.740  1.00 0.00 ?  342 ARG A N    2  
ATOM 4065  C CA   . ARG A 1 129 ? 12.690  9.751   -2.654  1.00 0.00 ?  342 ARG A CA   2  
ATOM 4066  C C    . ARG A 1 129 ? 13.981  9.504   -1.871  1.00 0.00 ?  342 ARG A C    2  
ATOM 4067  O O    . ARG A 1 129 ? 14.753  8.607   -2.208  1.00 0.00 ?  342 ARG A O    2  
ATOM 4068  C CB   . ARG A 1 129 ? 12.878  10.965  -3.564  1.00 0.00 ?  342 ARG A CB   2  
ATOM 4069  C CG   . ARG A 1 129 ? 14.049  10.754  -4.526  1.00 0.00 ?  342 ARG A CG   2  
ATOM 4070  C CD   . ARG A 1 129 ? 13.725  11.308  -5.915  1.00 0.00 ?  342 ARG A CD   2  
ATOM 4071  N NE   . ARG A 1 129 ? 14.932  11.271  -6.769  1.00 0.00 ?  342 ARG A NE   2  
ATOM 4072  C CZ   . ARG A 1 129 ? 15.392  10.167  -7.373  1.00 0.00 ?  342 ARG A CZ   2  
ATOM 4073  N NH1  . ARG A 1 129 ? 14.747  9.002   -7.221  1.00 0.00 ?  342 ARG A NH1  2  
ATOM 4074  N NH2  . ARG A 1 129 ? 16.496  10.227  -8.130  1.00 0.00 1  342 ARG A NH2  2  
ATOM 4075  H H    . ARG A 1 129 ? 11.243  10.889  -1.679  1.00 0.00 ?  342 ARG A H    2  
ATOM 4076  H HA   . ARG A 1 129 ? 12.415  8.876   -3.242  1.00 0.00 ?  342 ARG A HA   2  
ATOM 4077  H HB2  . ARG A 1 129 ? 11.964  11.144  -4.131  1.00 0.00 ?  342 ARG A HB2  2  
ATOM 4078  H HB3  . ARG A 1 129 ? 13.056  11.854  -2.959  1.00 0.00 ?  342 ARG A HB3  2  
ATOM 4079  H HG2  . ARG A 1 129 ? 14.940  11.243  -4.134  1.00 0.00 ?  342 ARG A HG2  2  
ATOM 4080  H HG3  . ARG A 1 129 ? 14.276  9.690   -4.600  1.00 0.00 ?  342 ARG A HG3  2  
ATOM 4081  H HD2  . ARG A 1 129 ? 12.927  10.723  -6.373  1.00 0.00 ?  342 ARG A HD2  2  
ATOM 4082  H HD3  . ARG A 1 129 ? 13.360  12.332  -5.830  1.00 0.00 ?  342 ARG A HD3  2  
ATOM 4083  H HE   . ARG A 1 129 ? 15.438  12.123  -6.904  1.00 0.00 ?  342 ARG A HE   2  
ATOM 4084  H HH11 . ARG A 1 129 ? 13.923  8.957   -6.656  1.00 0.00 ?  342 ARG A HH11 2  
ATOM 4085  H HH12 . ARG A 1 129 ? 15.089  8.178   -7.672  1.00 0.00 ?  342 ARG A HH12 2  
ATOM 4086  H HH21 . ARG A 1 129 ? 16.977  11.096  -8.244  1.00 0.00 ?  342 ARG A HH21 2  
ATOM 4087  H HH22 . ARG A 1 129 ? 16.839  9.403   -8.581  1.00 0.00 ?  342 ARG A HH22 2  
ATOM 4088  N N    . LYS A 1 130 ? 14.176  10.315  -0.842  1.00 0.00 ?  343 LYS A N    2  
ATOM 4089  C CA   . LYS A 1 130 ? 15.360  10.195  -0.009  1.00 0.00 ?  343 LYS A CA   2  
ATOM 4090  C C    . LYS A 1 130 ? 15.305  8.876   0.764   1.00 0.00 ?  343 LYS A C    2  
ATOM 4091  O O    . LYS A 1 130 ? 16.297  8.153   0.837   1.00 0.00 ?  343 LYS A O    2  
ATOM 4092  C CB   . LYS A 1 130 ? 15.512  11.427  0.887   1.00 0.00 ?  343 LYS A CB   2  
ATOM 4093  C CG   . LYS A 1 130 ? 16.528  12.409  0.301   1.00 0.00 ?  343 LYS A CG   2  
ATOM 4094  C CD   . LYS A 1 130 ? 15.825  13.540  -0.454  1.00 0.00 ?  343 LYS A CD   2  
ATOM 4095  C CE   . LYS A 1 130 ? 15.132  14.499  0.516   1.00 0.00 ?  343 LYS A CE   2  
ATOM 4096  N NZ   . LYS A 1 130 ? 16.132  15.305  1.251   1.00 0.00 1  343 LYS A NZ   2  
ATOM 4097  H H    . LYS A 1 130 ? 13.543  11.041  -0.574  1.00 0.00 ?  343 LYS A H    2  
ATOM 4098  H HA   . LYS A 1 130 ? 16.225  10.171  -0.672  1.00 0.00 ?  343 LYS A HA   2  
ATOM 4099  H HB2  . LYS A 1 130 ? 14.546  11.920  1.000   1.00 0.00 ?  343 LYS A HB2  2  
ATOM 4100  H HB3  . LYS A 1 130 ? 15.830  11.119  1.883   1.00 0.00 ?  343 LYS A HB3  2  
ATOM 4101  H HG2  . LYS A 1 130 ? 17.139  12.827  1.102   1.00 0.00 ?  343 LYS A HG2  2  
ATOM 4102  H HG3  . LYS A 1 130 ? 17.203  11.882  -0.372  1.00 0.00 ?  343 LYS A HG3  2  
ATOM 4103  H HD2  . LYS A 1 130 ? 16.552  14.087  -1.055  1.00 0.00 ?  343 LYS A HD2  2  
ATOM 4104  H HD3  . LYS A 1 130 ? 15.092  13.121  -1.143  1.00 0.00 ?  343 LYS A HD3  2  
ATOM 4105  H HE2  . LYS A 1 130 ? 14.458  15.156  -0.033  1.00 0.00 ?  343 LYS A HE2  2  
ATOM 4106  H HE3  . LYS A 1 130 ? 14.522  13.934  1.221   1.00 0.00 ?  343 LYS A HE3  2  
ATOM 4107  H HZ1  . LYS A 1 130 ? 15.677  15.818  1.979   1.00 0.00 ?  343 LYS A HZ1  2  
ATOM 4108  H HZ2  . LYS A 1 130 ? 16.820  14.699  1.651   1.00 0.00 ?  343 LYS A HZ2  2  
ATOM 4109  H HZ3  . LYS A 1 130 ? 16.575  15.943  0.621   1.00 0.00 ?  343 LYS A HZ3  2  
ATOM 4110  N N    . THR A 1 131 ? 14.134  8.603   1.321   1.00 0.00 ?  344 THR A N    2  
ATOM 4111  C CA   . THR A 1 131 ? 13.936  7.383   2.086   1.00 0.00 ?  344 THR A CA   2  
ATOM 4112  C C    . THR A 1 131 ? 14.055  6.158   1.177   1.00 0.00 ?  344 THR A C    2  
ATOM 4113  O O    . THR A 1 131 ? 14.633  5.145   1.567   1.00 0.00 ?  344 THR A O    2  
ATOM 4114  C CB   . THR A 1 131 ? 12.585  7.484   2.796   1.00 0.00 ?  344 THR A CB   2  
ATOM 4115  O OG1  . THR A 1 131 ? 12.906  8.002   4.083   1.00 0.00 ?  344 THR A OG1  2  
ATOM 4116  C CG2  . THR A 1 131 ? 11.973  6.113   3.088   1.00 0.00 ?  344 THR A CG2  2  
ATOM 4117  H H    . THR A 1 131 ? 13.332  9.196   1.257   1.00 0.00 ?  344 THR A H    2  
ATOM 4118  H HA   . THR A 1 131 ? 14.732  7.309   2.827   1.00 0.00 ?  344 THR A HA   2  
ATOM 4119  H HB   . THR A 1 131 ? 11.893  8.106   2.228   1.00 0.00 ?  344 THR A HB   2  
ATOM 4120  H HG1  . THR A 1 131 ? 12.382  8.836   4.258   1.00 0.00 ?  344 THR A HG1  2  
ATOM 4121  H HG21 . THR A 1 131 ? 11.033  6.241   3.625   1.00 0.00 ?  344 THR A HG21 2  
ATOM 4122  H HG22 . THR A 1 131 ? 11.786  5.590   2.150   1.00 0.00 ?  344 THR A HG22 2  
ATOM 4123  H HG23 . THR A 1 131 ? 12.663  5.529   3.698   1.00 0.00 ?  344 THR A HG23 2  
ATOM 4124  N N    . ALA A 1 132 ? 13.499  6.292   -0.018  1.00 0.00 ?  345 ALA A N    2  
ATOM 4125  C CA   . ALA A 1 132 ? 13.535  5.209   -0.986  1.00 0.00 ?  345 ALA A CA   2  
ATOM 4126  C C    . ALA A 1 132 ? 14.972  5.016   -1.475  1.00 0.00 ?  345 ALA A C    2  
ATOM 4127  O O    . ALA A 1 132 ? 15.383  3.896   -1.776  1.00 0.00 ?  345 ALA A O    2  
ATOM 4128  C CB   . ALA A 1 132 ? 12.566  5.514   -2.131  1.00 0.00 ?  345 ALA A CB   2  
ATOM 4129  H H    . ALA A 1 132 ? 13.031  7.120   -0.328  1.00 0.00 ?  345 ALA A H    2  
ATOM 4130  H HA   . ALA A 1 132 ? 13.206  4.301   -0.481  1.00 0.00 ?  345 ALA A HA   2  
ATOM 4131  H HB1  . ALA A 1 132 ? 12.649  4.740   -2.893  1.00 0.00 ?  345 ALA A HB1  2  
ATOM 4132  H HB2  . ALA A 1 132 ? 11.547  5.539   -1.747  1.00 0.00 ?  345 ALA A HB2  2  
ATOM 4133  H HB3  . ALA A 1 132 ? 12.813  6.482   -2.568  1.00 0.00 ?  345 ALA A HB3  2  
ATOM 4134  N N    . LEU A 1 133 ? 15.696  6.123   -1.538  1.00 0.00 ?  346 LEU A N    2  
ATOM 4135  C CA   . LEU A 1 133 ? 17.078  6.089   -1.985  1.00 0.00 ?  346 LEU A CA   2  
ATOM 4136  C C    . LEU A 1 133 ? 17.950  5.476   -0.887  1.00 0.00 ?  346 LEU A C    2  
ATOM 4137  O O    . LEU A 1 133 ? 18.956  4.830   -1.177  1.00 0.00 ?  346 LEU A O    2  
ATOM 4138  C CB   . LEU A 1 133 ? 17.534  7.482   -2.425  1.00 0.00 ?  346 LEU A CB   2  
ATOM 4139  C CG   . LEU A 1 133 ? 17.232  7.859   -3.877  1.00 0.00 ?  346 LEU A CG   2  
ATOM 4140  C CD1  . LEU A 1 133 ? 17.801  9.239   -4.215  1.00 0.00 ?  346 LEU A CD1  2  
ATOM 4141  C CD2  . LEU A 1 133 ? 17.734  6.780   -4.839  1.00 0.00 ?  346 LEU A CD2  2  
ATOM 4142  H H    . LEU A 1 133 ? 15.354  7.030   -1.292  1.00 0.00 ?  346 LEU A H    2  
ATOM 4143  H HA   . LEU A 1 133 ? 17.122  5.444   -2.862  1.00 0.00 ?  346 LEU A HA   2  
ATOM 4144  H HB2  . LEU A 1 133 ? 17.063  8.219   -1.774  1.00 0.00 ?  346 LEU A HB2  2  
ATOM 4145  H HB3  . LEU A 1 133 ? 18.609  7.558   -2.266  1.00 0.00 ?  346 LEU A HB3  2  
ATOM 4146  H HG   . LEU A 1 133 ? 16.150  7.919   -3.997  1.00 0.00 ?  346 LEU A HG   2  
ATOM 4147  H HD11 . LEU A 1 133 ? 18.276  9.662   -3.330  1.00 0.00 ?  346 LEU A HD11 2  
ATOM 4148  H HD12 . LEU A 1 133 ? 18.538  9.142   -5.012  1.00 0.00 ?  346 LEU A HD12 2  
ATOM 4149  H HD13 . LEU A 1 133 ? 16.995  9.894   -4.543  1.00 0.00 ?  346 LEU A HD13 2  
ATOM 4150  H HD21 . LEU A 1 133 ? 17.861  7.210   -5.832  1.00 0.00 ?  346 LEU A HD21 2  
ATOM 4151  H HD22 . LEU A 1 133 ? 18.690  6.395   -4.485  1.00 0.00 ?  346 LEU A HD22 2  
ATOM 4152  H HD23 . LEU A 1 133 ? 17.009  5.968   -4.884  1.00 0.00 ?  346 LEU A HD23 2  
ATOM 4153  N N    . GLU A 1 134 ? 17.531  5.698   0.350   1.00 0.00 ?  347 GLU A N    2  
ATOM 4154  C CA   . GLU A 1 134 ? 18.260  5.175   1.492   1.00 0.00 ?  347 GLU A CA   2  
ATOM 4155  C C    . GLU A 1 134 ? 18.065  3.662   1.600   1.00 0.00 ?  347 GLU A C    2  
ATOM 4156  O O    . GLU A 1 134 ? 19.007  2.930   1.899   1.00 0.00 ?  347 GLU A O    2  
ATOM 4157  C CB   . GLU A 1 134 ? 17.833  5.876   2.784   1.00 0.00 ?  347 GLU A CB   2  
ATOM 4158  C CG   . GLU A 1 134 ? 18.620  7.172   2.990   1.00 0.00 ?  347 GLU A CG   2  
ATOM 4159  C CD   . GLU A 1 134 ? 19.865  6.928   3.845   1.00 0.00 ?  347 GLU A CD   2  
ATOM 4160  O OE1  . GLU A 1 134 ? 20.907  6.510   3.318   1.00 0.00 ?  347 GLU A OE1  2  
ATOM 4161  O OE2  . GLU A 1 134 ? 19.724  7.189   5.100   1.00 0.00 -1 347 GLU A OE2  2  
ATOM 4162  H H    . GLU A 1 134 ? 16.711  6.224   0.577   1.00 0.00 ?  347 GLU A H    2  
ATOM 4163  H HA   . GLU A 1 134 ? 19.309  5.399   1.294   1.00 0.00 ?  347 GLU A HA   2  
ATOM 4164  H HB2  . GLU A 1 134 ? 16.766  6.096   2.746   1.00 0.00 ?  347 GLU A HB2  2  
ATOM 4165  H HB3  . GLU A 1 134 ? 17.992  5.211   3.632   1.00 0.00 ?  347 GLU A HB3  2  
ATOM 4166  H HG2  . GLU A 1 134 ? 18.913  7.582   2.023   1.00 0.00 ?  347 GLU A HG2  2  
ATOM 4167  H HG3  . GLU A 1 134 ? 17.984  7.915   3.471   1.00 0.00 ?  347 GLU A HG3  2  
ATOM 4168  H HE2  . GLU A 1 134 ? 20.548  6.921   5.600   1.00 0.00 ?  347 GLU A HE2  2  
ATOM 4169  N N    . ARG A 1 135 ? 16.835  3.237   1.350   1.00 0.00 ?  348 ARG A N    2  
ATOM 4170  C CA   . ARG A 1 135 ? 16.503  1.824   1.415   1.00 0.00 ?  348 ARG A CA   2  
ATOM 4171  C C    . ARG A 1 135 ? 17.161  1.071   0.257   1.00 0.00 ?  348 ARG A C    2  
ATOM 4172  O O    . ARG A 1 135 ? 17.667  -0.035  0.439   1.00 0.00 ?  348 ARG A O    2  
ATOM 4173  C CB   . ARG A 1 135 ? 14.989  1.610   1.359   1.00 0.00 ?  348 ARG A CB   2  
ATOM 4174  C CG   . ARG A 1 135 ? 14.355  1.811   2.737   1.00 0.00 ?  348 ARG A CG   2  
ATOM 4175  C CD   . ARG A 1 135 ? 13.069  2.634   2.634   1.00 0.00 ?  348 ARG A CD   2  
ATOM 4176  N NE   . ARG A 1 135 ? 12.029  2.057   3.515   1.00 0.00 ?  348 ARG A NE   2  
ATOM 4177  C CZ   . ARG A 1 135 ? 11.991  2.227   4.843   1.00 0.00 ?  348 ARG A CZ   2  
ATOM 4178  N NH1  . ARG A 1 135 ? 12.935  2.957   5.453   1.00 0.00 ?  348 ARG A NH1  2  
ATOM 4179  N NH2  . ARG A 1 135 ? 11.008  1.667   5.563   1.00 0.00 1  348 ARG A NH2  2  
ATOM 4180  H H    . ARG A 1 135 ? 16.074  3.839   1.108   1.00 0.00 ?  348 ARG A H    2  
ATOM 4181  H HA   . ARG A 1 135 ? 16.897  1.489   2.375   1.00 0.00 ?  348 ARG A HA   2  
ATOM 4182  H HB2  . ARG A 1 135 ? 14.546  2.306   0.646   1.00 0.00 ?  348 ARG A HB2  2  
ATOM 4183  H HB3  . ARG A 1 135 ? 14.773  0.604   0.999   1.00 0.00 ?  348 ARG A HB3  2  
ATOM 4184  H HG2  . ARG A 1 135 ? 14.137  0.842   3.185   1.00 0.00 ?  348 ARG A HG2  2  
ATOM 4185  H HG3  . ARG A 1 135 ? 15.062  2.315   3.396   1.00 0.00 ?  348 ARG A HG3  2  
ATOM 4186  H HD2  . ARG A 1 135 ? 13.265  3.667   2.918   1.00 0.00 ?  348 ARG A HD2  2  
ATOM 4187  H HD3  . ARG A 1 135 ? 12.718  2.647   1.603   1.00 0.00 ?  348 ARG A HD3  2  
ATOM 4188  H HE   . ARG A 1 135 ? 11.309  1.507   3.092   1.00 0.00 ?  348 ARG A HE   2  
ATOM 4189  H HH11 . ARG A 1 135 ? 13.668  3.375   4.916   1.00 0.00 ?  348 ARG A HH11 2  
ATOM 4190  H HH12 . ARG A 1 135 ? 12.906  3.083   6.445   1.00 0.00 ?  348 ARG A HH12 2  
ATOM 4191  H HH21 . ARG A 1 135 ? 10.304  1.122   5.108   1.00 0.00 ?  348 ARG A HH21 2  
ATOM 4192  H HH22 . ARG A 1 135 ? 10.980  1.793   6.554   1.00 0.00 ?  348 ARG A HH22 2  
ATOM 4193  N N    . ARG A 1 136 ? 17.132  1.700   -0.909  1.00 0.00 ?  349 ARG A N    2  
ATOM 4194  C CA   . ARG A 1 136 ? 17.719  1.103   -2.096  1.00 0.00 ?  349 ARG A CA   2  
ATOM 4195  C C    . ARG A 1 136 ? 19.246  1.149   -2.014  1.00 0.00 ?  349 ARG A C    2  
ATOM 4196  O O    . ARG A 1 136 ? 19.924  0.237   -2.485  1.00 0.00 ?  349 ARG A O    2  
ATOM 4197  C CB   . ARG A 1 136 ? 17.261  1.830   -3.362  1.00 0.00 ?  349 ARG A CB   2  
ATOM 4198  C CG   . ARG A 1 136 ? 16.792  0.836   -4.426  1.00 0.00 ?  349 ARG A CG   2  
ATOM 4199  C CD   . ARG A 1 136 ? 17.962  -0.002  -4.947  1.00 0.00 ?  349 ARG A CD   2  
ATOM 4200  N NE   . ARG A 1 136 ? 17.467  -1.035  -5.884  1.00 0.00 ?  349 ARG A NE   2  
ATOM 4201  C CZ   . ARG A 1 136 ? 17.087  -0.785  -7.145  1.00 0.00 ?  349 ARG A CZ   2  
ATOM 4202  N NH1  . ARG A 1 136 ? 17.143  0.464   -7.627  1.00 0.00 ?  349 ARG A NH1  2  
ATOM 4203  N NH2  . ARG A 1 136 ? 16.652  -1.785  -7.924  1.00 0.00 1  349 ARG A NH2  2  
ATOM 4204  H H    . ARG A 1 136 ? 16.718  2.600   -1.048  1.00 0.00 ?  349 ARG A H    2  
ATOM 4205  H HA   . ARG A 1 136 ? 17.357  0.075   -2.099  1.00 0.00 ?  349 ARG A HA   2  
ATOM 4206  H HB2  . ARG A 1 136 ? 16.450  2.517   -3.118  1.00 0.00 ?  349 ARG A HB2  2  
ATOM 4207  H HB3  . ARG A 1 136 ? 18.080  2.432   -3.757  1.00 0.00 ?  349 ARG A HB3  2  
ATOM 4208  H HG2  . ARG A 1 136 ? 16.029  0.181   -4.006  1.00 0.00 ?  349 ARG A HG2  2  
ATOM 4209  H HG3  . ARG A 1 136 ? 16.330  1.375   -5.254  1.00 0.00 ?  349 ARG A HG3  2  
ATOM 4210  H HD2  . ARG A 1 136 ? 18.685  0.641   -5.449  1.00 0.00 ?  349 ARG A HD2  2  
ATOM 4211  H HD3  . ARG A 1 136 ? 18.481  -0.474  -4.113  1.00 0.00 ?  349 ARG A HD3  2  
ATOM 4212  H HE   . ARG A 1 136 ? 17.413  -1.978  -5.556  1.00 0.00 ?  349 ARG A HE   2  
ATOM 4213  H HH11 . ARG A 1 136 ? 17.469  1.210   -7.045  1.00 0.00 ?  349 ARG A HH11 2  
ATOM 4214  H HH12 . ARG A 1 136 ? 16.860  0.650   -8.567  1.00 0.00 ?  349 ARG A HH12 2  
ATOM 4215  H HH21 . ARG A 1 136 ? 16.610  -2.717  -7.564  1.00 0.00 ?  349 ARG A HH21 2  
ATOM 4216  H HH22 . ARG A 1 136 ? 16.368  -1.598  -8.864  1.00 0.00 ?  349 ARG A HH22 2  
ATOM 4217  N N    . GLY A 1 137 ? 19.742  2.220   -1.412  1.00 0.00 ?  350 GLY A N    2  
ATOM 4218  C CA   . GLY A 1 137 ? 21.177  2.397   -1.262  1.00 0.00 ?  350 GLY A CA   2  
ATOM 4219  C C    . GLY A 1 137 ? 21.868  1.061   -0.984  1.00 0.00 ?  350 GLY A C    2  
ATOM 4220  O O    . GLY A 1 137 ? 22.882  0.742   -1.602  1.00 0.00 ?  350 GLY A O    2  
ATOM 4221  H H    . GLY A 1 137 ? 19.183  2.957   -1.032  1.00 0.00 ?  350 GLY A H    2  
ATOM 4222  H HA2  . GLY A 1 137 ? 21.588  2.842   -2.168  1.00 0.00 ?  350 GLY A HA2  2  
ATOM 4223  H HA3  . GLY A 1 137 ? 21.378  3.091   -0.447  1.00 0.00 ?  350 GLY A HA3  2  
ATOM 4224  N N    . ALA A 1 138 ? 21.291  0.315   -0.053  1.00 0.00 ?  351 ALA A N    2  
ATOM 4225  C CA   . ALA A 1 138 ? 21.838  -0.980  0.315   1.00 0.00 ?  351 ALA A CA   2  
ATOM 4226  C C    . ALA A 1 138 ? 20.722  -1.859  0.880   1.00 0.00 ?  351 ALA A C    2  
ATOM 4227  O O    . ALA A 1 138 ? 20.078  -1.495  1.864   1.00 0.00 ?  351 ALA A O    2  
ATOM 4228  C CB   . ALA A 1 138 ? 22.987  -0.785  1.307   1.00 0.00 ?  351 ALA A CB   2  
ATOM 4229  H H    . ALA A 1 138 ? 20.466  0.582   0.445   1.00 0.00 ?  351 ALA A H    2  
ATOM 4230  H HA   . ALA A 1 138 ? 22.231  -1.443  -0.590  1.00 0.00 ?  351 ALA A HA   2  
ATOM 4231  H HB1  . ALA A 1 138 ? 23.877  -1.293  0.936   1.00 0.00 ?  351 ALA A HB1  2  
ATOM 4232  H HB2  . ALA A 1 138 ? 23.195  0.279   1.418   1.00 0.00 ?  351 ALA A HB2  2  
ATOM 4233  H HB3  . ALA A 1 138 ? 22.706  -1.203  2.274   1.00 0.00 ?  351 ALA A HB3  2  
ATOM 4234  N N    . ALA A 1 139 ? 20.526  -2.999  0.235   1.00 0.00 ?  352 ALA A N    2  
ATOM 4235  C CA   . ALA A 1 139 ? 19.498  -3.933  0.662   1.00 0.00 ?  352 ALA A CA   2  
ATOM 4236  C C    . ALA A 1 139 ? 19.822  -4.434  2.071   1.00 0.00 ?  352 ALA A C    2  
ATOM 4237  O O    . ALA A 1 139 ? 20.931  -4.234  2.564   1.00 0.00 ?  352 ALA A O    2  
ATOM 4238  C CB   . ALA A 1 139 ? 19.392  -5.074  -0.352  1.00 0.00 ?  352 ALA A CB   2  
ATOM 4239  H H    . ALA A 1 139 ? 21.054  -3.288  -0.564  1.00 0.00 ?  352 ALA A H    2  
ATOM 4240  H HA   . ALA A 1 139 ? 18.550  -3.396  0.685   1.00 0.00 ?  352 ALA A HA   2  
ATOM 4241  H HB1  . ALA A 1 139 ? 18.342  -5.267  -0.574  1.00 0.00 ?  352 ALA A HB1  2  
ATOM 4242  H HB2  . ALA A 1 139 ? 19.912  -4.795  -1.269  1.00 0.00 ?  352 ALA A HB2  2  
ATOM 4243  H HB3  . ALA A 1 139 ? 19.846  -5.974  0.064   1.00 0.00 ?  352 ALA A HB3  2  
ATOM 4244  N N    . ALA A 1 140 ? 18.834  -5.074  2.679   1.00 0.00 ?  353 ALA A N    2  
ATOM 4245  C CA   . ALA A 1 140 ? 19.001  -5.604  4.021   1.00 0.00 ?  353 ALA A CA   2  
ATOM 4246  C C    . ALA A 1 140 ? 19.221  -7.116  3.944   1.00 0.00 ?  353 ALA A C    2  
ATOM 4247  O O    . ALA A 1 140 ? 18.373  -7.845  3.432   1.00 0.00 ?  353 ALA A O    2  
ATOM 4248  C CB   . ALA A 1 140 ? 17.783  -5.235  4.871   1.00 0.00 ?  353 ALA A CB   2  
ATOM 4249  H H    . ALA A 1 140 ? 17.935  -5.232  2.271   1.00 0.00 ?  353 ALA A H    2  
ATOM 4250  H HA   . ALA A 1 140 ? 19.886  -5.138  4.455   1.00 0.00 ?  353 ALA A HA   2  
ATOM 4251  H HB1  . ALA A 1 140 ? 16.998  -5.977  4.723   1.00 0.00 ?  353 ALA A HB1  2  
ATOM 4252  H HB2  . ALA A 1 140 ? 18.067  -5.213  5.923   1.00 0.00 ?  353 ALA A HB2  2  
ATOM 4253  H HB3  . ALA A 1 140 ? 17.416  -4.253  4.573   1.00 0.00 ?  353 ALA A HB3  2  
ATOM 4254  N N    . SER A 1 141 ? 20.364  -7.543  4.460   1.00 0.00 ?  354 SER A N    2  
ATOM 4255  C CA   . SER A 1 141 ? 20.707  -8.955  4.456   1.00 0.00 ?  354 SER A CA   2  
ATOM 4256  C C    . SER A 1 141 ? 19.715  -9.736  5.319   1.00 0.00 ?  354 SER A C    2  
ATOM 4257  O O    . SER A 1 141 ? 19.332  -9.283  6.396   1.00 0.00 ?  354 SER A O    2  
ATOM 4258  C CB   . SER A 1 141 ? 22.136  -9.177  4.957   1.00 0.00 ?  354 SER A CB   2  
ATOM 4259  O OG   . SER A 1 141 ? 23.067  -8.311  4.314   1.00 0.00 ?  354 SER A OG   2  
ATOM 4260  H H    . SER A 1 141 ? 21.049  -6.943  4.875   1.00 0.00 ?  354 SER A H    2  
ATOM 4261  H HA   . SER A 1 141 ? 20.636  -9.266  3.414   1.00 0.00 ?  354 SER A HA   2  
ATOM 4262  H HB2  . SER A 1 141 ? 22.172  -9.012  6.034   1.00 0.00 ?  354 SER A HB2  2  
ATOM 4263  H HB3  . SER A 1 141 ? 22.424  -10.213 4.783   1.00 0.00 ?  354 SER A HB3  2  
ATOM 4264  H HG   . SER A 1 141 ? 23.748  -7.992  4.972   1.00 0.00 ?  354 SER A HG   2  
ATOM 4265  N N    . ALA A 1 142 ? 19.326  -10.898 4.813   1.00 0.00 ?  355 ALA A N    2  
ATOM 4266  C CA   . ALA A 1 142 ? 18.386  -11.747 5.525   1.00 0.00 ?  355 ALA A CA   2  
ATOM 4267  C C    . ALA A 1 142 ? 18.764  -13.213 5.307   1.00 0.00 ?  355 ALA A C    2  
ATOM 4268  O O    . ALA A 1 142 ? 19.104  -13.612 4.194   1.00 0.00 ?  355 ALA A O    2  
ATOM 4269  C CB   . ALA A 1 142 ? 16.963  -11.436 5.057   1.00 0.00 ?  355 ALA A CB   2  
ATOM 4270  H H    . ALA A 1 142 ? 19.643  -11.260 3.936   1.00 0.00 ?  355 ALA A H    2  
ATOM 4271  H HA   . ALA A 1 142 ? 18.465  -11.514 6.587   1.00 0.00 ?  355 ALA A HA   2  
ATOM 4272  H HB1  . ALA A 1 142 ? 16.734  -12.028 4.171   1.00 0.00 ?  355 ALA A HB1  2  
ATOM 4273  H HB2  . ALA A 1 142 ? 16.258  -11.683 5.851   1.00 0.00 ?  355 ALA A HB2  2  
ATOM 4274  H HB3  . ALA A 1 142 ? 16.883  -10.376 4.817   1.00 0.00 ?  355 ALA A HB3  2  
ATOM 4275  N N    . GLY A 1 1   ? -24.729 10.459  -12.614 1.00 0.00 ?  214 GLY A N    3  
ATOM 4276  C CA   . GLY A 1 1   ? -24.661 9.036   -12.902 1.00 0.00 ?  214 GLY A CA   3  
ATOM 4277  C C    . GLY A 1 1   ? -23.832 8.302   -11.845 1.00 0.00 ?  214 GLY A C    3  
ATOM 4278  O O    . GLY A 1 1   ? -24.358 7.473   -11.104 1.00 0.00 ?  214 GLY A O    3  
ATOM 4279  H H1   . GLY A 1 1   ? -24.132 10.770  -11.874 1.00 0.00 ?  214 GLY A H1   3  
ATOM 4280  H HA2  . GLY A 1 1   ? -25.667 8.620   -12.933 1.00 0.00 ?  214 GLY A HA2  3  
ATOM 4281  H HA3  . GLY A 1 1   ? -24.221 8.881   -13.886 1.00 0.00 ?  214 GLY A HA3  3  
ATOM 4282  N N    . SER A 1 2   ? -22.550 8.634   -11.810 1.00 0.00 ?  215 SER A N    3  
ATOM 4283  C CA   . SER A 1 2   ? -21.643 8.017   -10.857 1.00 0.00 ?  215 SER A CA   3  
ATOM 4284  C C    . SER A 1 2   ? -22.106 8.311   -9.428  1.00 0.00 ?  215 SER A C    3  
ATOM 4285  O O    . SER A 1 2   ? -22.554 9.418   -9.133  1.00 0.00 ?  215 SER A O    3  
ATOM 4286  C CB   . SER A 1 2   ? -20.209 8.509   -11.062 1.00 0.00 ?  215 SER A CB   3  
ATOM 4287  O OG   . SER A 1 2   ? -20.132 9.932   -11.093 1.00 0.00 ?  215 SER A OG   3  
ATOM 4288  H H    . SER A 1 2   ? -22.130 9.310   -12.416 1.00 0.00 ?  215 SER A H    3  
ATOM 4289  H HA   . SER A 1 2   ? -21.693 6.947   -11.062 1.00 0.00 ?  215 SER A HA   3  
ATOM 4290  H HB2  . SER A 1 2   ? -19.577 8.129   -10.260 1.00 0.00 ?  215 SER A HB2  3  
ATOM 4291  H HB3  . SER A 1 2   ? -19.817 8.105   -11.996 1.00 0.00 ?  215 SER A HB3  3  
ATOM 4292  H HG   . SER A 1 2   ? -20.250 10.300  -10.171 1.00 0.00 ?  215 SER A HG   3  
ATOM 4293  N N    . GLN A 1 3   ? -21.981 7.301   -8.580  1.00 0.00 ?  216 GLN A N    3  
ATOM 4294  C CA   . GLN A 1 3   ? -22.381 7.438   -7.190  1.00 0.00 ?  216 GLN A CA   3  
ATOM 4295  C C    . GLN A 1 3   ? -21.184 7.200   -6.268  1.00 0.00 ?  216 GLN A C    3  
ATOM 4296  O O    . GLN A 1 3   ? -20.110 6.814   -6.726  1.00 0.00 ?  216 GLN A O    3  
ATOM 4297  C CB   . GLN A 1 3   ? -23.530 6.484   -6.854  1.00 0.00 ?  216 GLN A CB   3  
ATOM 4298  C CG   . GLN A 1 3   ? -24.860 7.236   -6.775  1.00 0.00 ?  216 GLN A CG   3  
ATOM 4299  C CD   . GLN A 1 3   ? -25.323 7.380   -5.324  1.00 0.00 ?  216 GLN A CD   3  
ATOM 4300  O OE1  . GLN A 1 3   ? -25.351 8.462   -4.759  1.00 0.00 ?  216 GLN A OE1  3  
ATOM 4301  N NE2  . GLN A 1 3   ? -25.684 6.234   -4.754  1.00 0.00 ?  216 GLN A NE2  3  
ATOM 4302  H H    . GLN A 1 3   ? -21.616 6.404   -8.829  1.00 0.00 ?  216 GLN A H    3  
ATOM 4303  H HA   . GLN A 1 3   ? -22.729 8.466   -7.088  1.00 0.00 ?  216 GLN A HA   3  
ATOM 4304  H HB2  . GLN A 1 3   ? -23.593 5.704   -7.611  1.00 0.00 ?  216 GLN A HB2  3  
ATOM 4305  H HB3  . GLN A 1 3   ? -23.330 5.990   -5.903  1.00 0.00 ?  216 GLN A HB3  3  
ATOM 4306  H HG2  . GLN A 1 3   ? -24.753 8.222   -7.226  1.00 0.00 ?  216 GLN A HG2  3  
ATOM 4307  H HG3  . GLN A 1 3   ? -25.617 6.703   -7.350  1.00 0.00 ?  216 GLN A HG3  3  
ATOM 4308  H HE21 . GLN A 1 3   ? -25.637 5.381   -5.273  1.00 0.00 ?  216 GLN A HE21 3  
ATOM 4309  H HE22 . GLN A 1 3   ? -26.001 6.225   -3.805  1.00 0.00 ?  216 GLN A HE22 3  
ATOM 4310  N N    . GLU A 1 4   ? -21.409 7.442   -4.984  1.00 0.00 ?  217 GLU A N    3  
ATOM 4311  C CA   . GLU A 1 4   ? -20.362 7.260   -3.994  1.00 0.00 ?  217 GLU A CA   3  
ATOM 4312  C C    . GLU A 1 4   ? -20.683 6.063   -3.096  1.00 0.00 ?  217 GLU A C    3  
ATOM 4313  O O    . GLU A 1 4   ? -21.785 5.519   -3.151  1.00 0.00 ?  217 GLU A O    3  
ATOM 4314  C CB   . GLU A 1 4   ? -20.165 8.530   -3.164  1.00 0.00 ?  217 GLU A CB   3  
ATOM 4315  C CG   . GLU A 1 4   ? -18.937 9.310   -3.639  1.00 0.00 ?  217 GLU A CG   3  
ATOM 4316  C CD   . GLU A 1 4   ? -18.819 10.647  -2.905  1.00 0.00 ?  217 GLU A CD   3  
ATOM 4317  O OE1  . GLU A 1 4   ? -19.406 10.815  -1.826  1.00 0.00 ?  217 GLU A OE1  3  
ATOM 4318  O OE2  . GLU A 1 4   ? -18.084 11.529  -3.493  1.00 0.00 -1 217 GLU A OE2  3  
ATOM 4319  H H    . GLU A 1 4   ? -22.285 7.756   -4.620  1.00 0.00 ?  217 GLU A H    3  
ATOM 4320  H HA   . GLU A 1 4   ? -19.454 7.061   -4.564  1.00 0.00 ?  217 GLU A HA   3  
ATOM 4321  H HB2  . GLU A 1 4   ? -21.051 9.159   -3.240  1.00 0.00 ?  217 GLU A HB2  3  
ATOM 4322  H HB3  . GLU A 1 4   ? -20.049 8.268   -2.112  1.00 0.00 ?  217 GLU A HB3  3  
ATOM 4323  H HG2  . GLU A 1 4   ? -18.038 8.717   -3.470  1.00 0.00 ?  217 GLU A HG2  3  
ATOM 4324  H HG3  . GLU A 1 4   ? -19.006 9.485   -4.713  1.00 0.00 ?  217 GLU A HG3  3  
ATOM 4325  H HE2  . GLU A 1 4   ? -18.340 12.446  -3.187  1.00 0.00 ?  217 GLU A HE2  3  
ATOM 4326  N N    . VAL A 1 5   ? -19.701 5.688   -2.289  1.00 0.00 ?  218 VAL A N    3  
ATOM 4327  C CA   . VAL A 1 5   ? -19.865 4.566   -1.381  1.00 0.00 ?  218 VAL A CA   3  
ATOM 4328  C C    . VAL A 1 5   ? -19.396 4.974   0.017   1.00 0.00 ?  218 VAL A C    3  
ATOM 4329  O O    . VAL A 1 5   ? -18.750 6.008   0.182   1.00 0.00 ?  218 VAL A O    3  
ATOM 4330  C CB   . VAL A 1 5   ? -19.128 3.341   -1.925  1.00 0.00 ?  218 VAL A CB   3  
ATOM 4331  C CG1  . VAL A 1 5   ? -19.719 2.894   -3.264  1.00 0.00 ?  218 VAL A CG1  3  
ATOM 4332  C CG2  . VAL A 1 5   ? -17.628 3.614   -2.052  1.00 0.00 ?  218 VAL A CG2  3  
ATOM 4333  H H    . VAL A 1 5   ? -18.808 6.136   -2.250  1.00 0.00 ?  218 VAL A H    3  
ATOM 4334  H HA   . VAL A 1 5   ? -20.928 4.330   -1.340  1.00 0.00 ?  218 VAL A HA   3  
ATOM 4335  H HB   . VAL A 1 5   ? -19.261 2.526   -1.212  1.00 0.00 ?  218 VAL A HB   3  
ATOM 4336  H HG11 . VAL A 1 5   ? -19.966 3.771   -3.862  1.00 0.00 ?  218 VAL A HG11 3  
ATOM 4337  H HG12 . VAL A 1 5   ? -18.991 2.284   -3.797  1.00 0.00 ?  218 VAL A HG12 3  
ATOM 4338  H HG13 . VAL A 1 5   ? -20.622 2.310   -3.085  1.00 0.00 ?  218 VAL A HG13 3  
ATOM 4339  H HG21 . VAL A 1 5   ? -17.107 2.684   -2.278  1.00 0.00 ?  218 VAL A HG21 3  
ATOM 4340  H HG22 . VAL A 1 5   ? -17.456 4.331   -2.855  1.00 0.00 ?  218 VAL A HG22 3  
ATOM 4341  H HG23 . VAL A 1 5   ? -17.253 4.023   -1.113  1.00 0.00 ?  218 VAL A HG23 3  
ATOM 4342  N N    . ARG A 1 6   ? -19.740 4.141   0.988   1.00 0.00 ?  219 ARG A N    3  
ATOM 4343  C CA   . ARG A 1 6   ? -19.363 4.402   2.367   1.00 0.00 ?  219 ARG A CA   3  
ATOM 4344  C C    . ARG A 1 6   ? -18.263 3.434   2.808   1.00 0.00 ?  219 ARG A C    3  
ATOM 4345  O O    . ARG A 1 6   ? -17.943 2.486   2.094   1.00 0.00 ?  219 ARG A O    3  
ATOM 4346  C CB   . ARG A 1 6   ? -20.564 4.260   3.303   1.00 0.00 ?  219 ARG A CB   3  
ATOM 4347  C CG   . ARG A 1 6   ? -21.515 5.451   3.161   1.00 0.00 ?  219 ARG A CG   3  
ATOM 4348  C CD   . ARG A 1 6   ? -22.507 5.502   4.324   1.00 0.00 ?  219 ARG A CD   3  
ATOM 4349  N NE   . ARG A 1 6   ? -22.706 6.903   4.758   1.00 0.00 ?  219 ARG A NE   3  
ATOM 4350  C CZ   . ARG A 1 6   ? -23.736 7.318   5.509   1.00 0.00 ?  219 ARG A CZ   3  
ATOM 4351  N NH1  . ARG A 1 6   ? -24.666 6.442   5.913   1.00 0.00 ?  219 ARG A NH1  3  
ATOM 4352  N NH2  . ARG A 1 6   ? -23.835 8.608   5.855   1.00 0.00 1  219 ARG A NH2  3  
ATOM 4353  H H    . ARG A 1 6   ? -20.266 3.303   0.846   1.00 0.00 ?  219 ARG A H    3  
ATOM 4354  H HA   . ARG A 1 6   ? -19.003 5.431   2.367   1.00 0.00 ?  219 ARG A HA   3  
ATOM 4355  H HB2  . ARG A 1 6   ? -21.097 3.336   3.079   1.00 0.00 ?  219 ARG A HB2  3  
ATOM 4356  H HB3  . ARG A 1 6   ? -20.219 4.187   4.335   1.00 0.00 ?  219 ARG A HB3  3  
ATOM 4357  H HG2  . ARG A 1 6   ? -20.940 6.377   3.127   1.00 0.00 ?  219 ARG A HG2  3  
ATOM 4358  H HG3  . ARG A 1 6   ? -22.057 5.377   2.218   1.00 0.00 ?  219 ARG A HG3  3  
ATOM 4359  H HD2  . ARG A 1 6   ? -23.460 5.069   4.019   1.00 0.00 ?  219 ARG A HD2  3  
ATOM 4360  H HD3  . ARG A 1 6   ? -22.136 4.904   5.156   1.00 0.00 ?  219 ARG A HD3  3  
ATOM 4361  H HE   . ARG A 1 6   ? -22.030 7.582   4.473   1.00 0.00 ?  219 ARG A HE   3  
ATOM 4362  H HH11 . ARG A 1 6   ? -24.591 5.479   5.655   1.00 0.00 ?  219 ARG A HH11 3  
ATOM 4363  H HH12 . ARG A 1 6   ? -25.434 6.752   6.474   1.00 0.00 ?  219 ARG A HH12 3  
ATOM 4364  H HH21 . ARG A 1 6   ? -23.141 9.262   5.553   1.00 0.00 ?  219 ARG A HH21 3  
ATOM 4365  H HH22 . ARG A 1 6   ? -24.603 8.918   6.416   1.00 0.00 ?  219 ARG A HH22 3  
ATOM 4366  N N    . ARG A 1 7   ? -17.715 3.708   3.983   1.00 0.00 ?  220 ARG A N    3  
ATOM 4367  C CA   . ARG A 1 7   ? -16.659 2.873   4.529   1.00 0.00 ?  220 ARG A CA   3  
ATOM 4368  C C    . ARG A 1 7   ? -16.864 2.671   6.031   1.00 0.00 ?  220 ARG A C    3  
ATOM 4369  O O    . ARG A 1 7   ? -17.198 3.613   6.748   1.00 0.00 ?  220 ARG A O    3  
ATOM 4370  C CB   . ARG A 1 7   ? -15.283 3.499   4.289   1.00 0.00 ?  220 ARG A CB   3  
ATOM 4371  C CG   . ARG A 1 7   ? -14.919 3.470   2.803   1.00 0.00 ?  220 ARG A CG   3  
ATOM 4372  C CD   . ARG A 1 7   ? -14.503 4.858   2.313   1.00 0.00 ?  220 ARG A CD   3  
ATOM 4373  N NE   . ARG A 1 7   ? -15.525 5.396   1.388   1.00 0.00 ?  220 ARG A NE   3  
ATOM 4374  C CZ   . ARG A 1 7   ? -15.396 6.546   0.713   1.00 0.00 ?  220 ARG A CZ   3  
ATOM 4375  N NH1  . ARG A 1 7   ? -14.289 7.287   0.856   1.00 0.00 ?  220 ARG A NH1  3  
ATOM 4376  N NH2  . ARG A 1 7   ? -16.375 6.957   -0.105  1.00 0.00 1  220 ARG A NH2  3  
ATOM 4377  H H    . ARG A 1 7   ? -17.982 4.482   4.558   1.00 0.00 ?  220 ARG A H    3  
ATOM 4378  H HA   . ARG A 1 7   ? -16.743 1.929   3.990   1.00 0.00 ?  220 ARG A HA   3  
ATOM 4379  H HB2  . ARG A 1 7   ? -15.280 4.528   4.648   1.00 0.00 ?  220 ARG A HB2  3  
ATOM 4380  H HB3  . ARG A 1 7   ? -14.529 2.960   4.862   1.00 0.00 ?  220 ARG A HB3  3  
ATOM 4381  H HG2  . ARG A 1 7   ? -14.106 2.763   2.638   1.00 0.00 ?  220 ARG A HG2  3  
ATOM 4382  H HG3  . ARG A 1 7   ? -15.771 3.116   2.223   1.00 0.00 ?  220 ARG A HG3  3  
ATOM 4383  H HD2  . ARG A 1 7   ? -14.379 5.530   3.162   1.00 0.00 ?  220 ARG A HD2  3  
ATOM 4384  H HD3  . ARG A 1 7   ? -13.538 4.801   1.809   1.00 0.00 ?  220 ARG A HD3  3  
ATOM 4385  H HE   . ARG A 1 7   ? -16.364 4.868   1.259   1.00 0.00 ?  220 ARG A HE   3  
ATOM 4386  H HH11 . ARG A 1 7   ? -13.558 6.981   1.466   1.00 0.00 ?  220 ARG A HH11 3  
ATOM 4387  H HH12 . ARG A 1 7   ? -14.192 8.145   0.352   1.00 0.00 ?  220 ARG A HH12 3  
ATOM 4388  H HH21 . ARG A 1 7   ? -17.202 6.404   -0.211  1.00 0.00 ?  220 ARG A HH21 3  
ATOM 4389  H HH22 . ARG A 1 7   ? -16.279 7.815   -0.609  1.00 0.00 ?  220 ARG A HH22 3  
ATOM 4390  N N    . GLY A 1 8   ? -16.656 1.435   6.463   1.00 0.00 ?  221 GLY A N    3  
ATOM 4391  C CA   . GLY A 1 8   ? -16.815 1.097   7.867   1.00 0.00 ?  221 GLY A CA   3  
ATOM 4392  C C    . GLY A 1 8   ? -15.462 0.792   8.514   1.00 0.00 ?  221 GLY A C    3  
ATOM 4393  O O    . GLY A 1 8   ? -15.297 0.953   9.722   1.00 0.00 ?  221 GLY A O    3  
ATOM 4394  H H    . GLY A 1 8   ? -16.385 0.675   5.873   1.00 0.00 ?  221 GLY A H    3  
ATOM 4395  H HA2  . GLY A 1 8   ? -17.294 1.923   8.392   1.00 0.00 ?  221 GLY A HA2  3  
ATOM 4396  H HA3  . GLY A 1 8   ? -17.471 0.233   7.965   1.00 0.00 ?  221 GLY A HA3  3  
ATOM 4397  N N    . ASP A 1 9   ? -14.528 0.358   7.680   1.00 0.00 ?  222 ASP A N    3  
ATOM 4398  C CA   . ASP A 1 9   ? -13.195 0.029   8.155   1.00 0.00 ?  222 ASP A CA   3  
ATOM 4399  C C    . ASP A 1 9   ? -12.254 1.202   7.873   1.00 0.00 ?  222 ASP A C    3  
ATOM 4400  O O    . ASP A 1 9   ? -11.034 1.043   7.894   1.00 0.00 ?  222 ASP A O    3  
ATOM 4401  C CB   . ASP A 1 9   ? -12.643 -1.204  7.437   1.00 0.00 ?  222 ASP A CB   3  
ATOM 4402  C CG   . ASP A 1 9   ? -13.410 -2.501  7.698   1.00 0.00 ?  222 ASP A CG   3  
ATOM 4403  O OD1  . ASP A 1 9   ? -14.254 -2.574  8.604   1.00 0.00 ?  222 ASP A OD1  3  
ATOM 4404  O OD2  . ASP A 1 9   ? -13.107 -3.480  6.914   1.00 0.00 -1 222 ASP A OD2  3  
ATOM 4405  H H    . ASP A 1 9   ? -14.670 0.231   6.699   1.00 0.00 ?  222 ASP A H    3  
ATOM 4406  H HA   . ASP A 1 9   ? -13.311 -0.165  9.222   1.00 0.00 ?  222 ASP A HA   3  
ATOM 4407  H HB2  . ASP A 1 9   ? -12.640 -1.010  6.365   1.00 0.00 ?  222 ASP A HB2  3  
ATOM 4408  H HB3  . ASP A 1 9   ? -11.605 -1.346  7.738   1.00 0.00 ?  222 ASP A HB3  3  
ATOM 4409  H HD2  . ASP A 1 9   ? -13.513 -3.334  6.012   1.00 0.00 ?  222 ASP A HD2  3  
ATOM 4410  N N    . PHE A 1 10  ? -12.856 2.354   7.616   1.00 0.00 ?  223 PHE A N    3  
ATOM 4411  C CA   . PHE A 1 10  ? -12.087 3.553   7.329   1.00 0.00 ?  223 PHE A CA   3  
ATOM 4412  C C    . PHE A 1 10  ? -11.065 3.826   8.435   1.00 0.00 ?  223 PHE A C    3  
ATOM 4413  O O    . PHE A 1 10  ? -9.936  4.226   8.157   1.00 0.00 ?  223 PHE A O    3  
ATOM 4414  C CB   . PHE A 1 10  ? -13.078 4.716   7.269   1.00 0.00 ?  223 PHE A CB   3  
ATOM 4415  C CG   . PHE A 1 10  ? -12.453 6.046   6.841   1.00 0.00 ?  223 PHE A CG   3  
ATOM 4416  C CD1  . PHE A 1 10  ? -12.295 6.330   5.521   1.00 0.00 ?  223 PHE A CD1  3  
ATOM 4417  C CD2  . PHE A 1 10  ? -12.054 6.943   7.782   1.00 0.00 ?  223 PHE A CD2  3  
ATOM 4418  C CE1  . PHE A 1 10  ? -11.714 7.564   5.124   1.00 0.00 ?  223 PHE A CE1  3  
ATOM 4419  C CE2  . PHE A 1 10  ? -11.473 8.177   7.386   1.00 0.00 ?  223 PHE A CE2  3  
ATOM 4420  C CZ   . PHE A 1 10  ? -11.316 8.461   6.065   1.00 0.00 ?  223 PHE A CZ   3  
ATOM 4421  H H    . PHE A 1 10  ? -13.848 2.475   7.601   1.00 0.00 ?  223 PHE A H    3  
ATOM 4422  H HA   . PHE A 1 10  ? -11.564 3.385   6.388   1.00 0.00 ?  223 PHE A HA   3  
ATOM 4423  H HB2  . PHE A 1 10  ? -13.878 4.463   6.573   1.00 0.00 ?  223 PHE A HB2  3  
ATOM 4424  H HB3  . PHE A 1 10  ? -13.537 4.841   8.250   1.00 0.00 ?  223 PHE A HB3  3  
ATOM 4425  H HD1  . PHE A 1 10  ? -12.615 5.611   4.767   1.00 0.00 ?  223 PHE A HD1  3  
ATOM 4426  H HD2  . PHE A 1 10  ? -12.180 6.715   8.841   1.00 0.00 ?  223 PHE A HD2  3  
ATOM 4427  H HE1  . PHE A 1 10  ? -11.588 7.791   4.066   1.00 0.00 ?  223 PHE A HE1  3  
ATOM 4428  H HE2  . PHE A 1 10  ? -11.153 8.896   8.140   1.00 0.00 ?  223 PHE A HE2  3  
ATOM 4429  H HZ   . PHE A 1 10  ? -10.870 9.408   5.761   1.00 0.00 ?  223 PHE A HZ   3  
ATOM 4430  N N    . VAL A 1 11  ? -11.498 3.599   9.666   1.00 0.00 ?  224 VAL A N    3  
ATOM 4431  C CA   . VAL A 1 11  ? -10.636 3.815   10.815  1.00 0.00 ?  224 VAL A CA   3  
ATOM 4432  C C    . VAL A 1 11  ? -9.503  2.787   10.798  1.00 0.00 ?  224 VAL A C    3  
ATOM 4433  O O    . VAL A 1 11  ? -8.361  3.111   11.120  1.00 0.00 ?  224 VAL A O    3  
ATOM 4434  C CB   . VAL A 1 11  ? -11.460 3.775   12.104  1.00 0.00 ?  224 VAL A CB   3  
ATOM 4435  C CG1  . VAL A 1 11  ? -11.172 2.500   12.899  1.00 0.00 ?  224 VAL A CG1  3  
ATOM 4436  C CG2  . VAL A 1 11  ? -11.208 5.021   12.955  1.00 0.00 ?  224 VAL A CG2  3  
ATOM 4437  H H    . VAL A 1 11  ? -12.419 3.273   9.884   1.00 0.00 ?  224 VAL A H    3  
ATOM 4438  H HA   . VAL A 1 11  ? -10.206 4.812   10.720  1.00 0.00 ?  224 VAL A HA   3  
ATOM 4439  H HB   . VAL A 1 11  ? -12.514 3.767   11.827  1.00 0.00 ?  224 VAL A HB   3  
ATOM 4440  H HG11 . VAL A 1 11  ? -11.326 1.631   12.260  1.00 0.00 ?  224 VAL A HG11 3  
ATOM 4441  H HG12 . VAL A 1 11  ? -10.140 2.516   13.249  1.00 0.00 ?  224 VAL A HG12 3  
ATOM 4442  H HG13 . VAL A 1 11  ? -11.845 2.446   13.755  1.00 0.00 ?  224 VAL A HG13 3  
ATOM 4443  H HG21 . VAL A 1 11  ? -11.752 4.936   13.895  1.00 0.00 ?  224 VAL A HG21 3  
ATOM 4444  H HG22 . VAL A 1 11  ? -10.141 5.111   13.160  1.00 0.00 ?  224 VAL A HG22 3  
ATOM 4445  H HG23 . VAL A 1 11  ? -11.550 5.905   12.416  1.00 0.00 ?  224 VAL A HG23 3  
ATOM 4446  N N    . ARG A 1 12  ? -9.859  1.568   10.419  1.00 0.00 ?  225 ARG A N    3  
ATOM 4447  C CA   . ARG A 1 12  ? -8.887  0.490   10.356  1.00 0.00 ?  225 ARG A CA   3  
ATOM 4448  C C    . ARG A 1 12  ? -7.875  0.753   9.239   1.00 0.00 ?  225 ARG A C    3  
ATOM 4449  O O    . ARG A 1 12  ? -6.701  0.407   9.366   1.00 0.00 ?  225 ARG A O    3  
ATOM 4450  C CB   . ARG A 1 12  ? -9.571  -0.855  10.108  1.00 0.00 ?  225 ARG A CB   3  
ATOM 4451  C CG   . ARG A 1 12  ? -9.045  -1.924  11.068  1.00 0.00 ?  225 ARG A CG   3  
ATOM 4452  C CD   . ARG A 1 12  ? -7.566  -2.218  10.803  1.00 0.00 ?  225 ARG A CD   3  
ATOM 4453  N NE   . ARG A 1 12  ? -7.252  -3.613  11.184  1.00 0.00 ?  225 ARG A NE   3  
ATOM 4454  C CZ   . ARG A 1 12  ? -6.008  -4.088  11.335  1.00 0.00 ?  225 ARG A CZ   3  
ATOM 4455  N NH1  . ARG A 1 12  ? -4.955  -3.283  11.140  1.00 0.00 ?  225 ARG A NH1  3  
ATOM 4456  N NH2  . ARG A 1 12  ? -5.818  -5.368  11.682  1.00 0.00 1  225 ARG A NH2  3  
ATOM 4457  H H    . ARG A 1 12  ? -10.790 1.313   10.160  1.00 0.00 ?  225 ARG A H    3  
ATOM 4458  H HA   . ARG A 1 12  ? -8.403  0.493   11.333  1.00 0.00 ?  225 ARG A HA   3  
ATOM 4459  H HB2  . ARG A 1 12  ? -10.649 -0.748  10.233  1.00 0.00 ?  225 ARG A HB2  3  
ATOM 4460  H HB3  . ARG A 1 12  ? -9.400  -1.170  9.078   1.00 0.00 ?  225 ARG A HB3  3  
ATOM 4461  H HG2  . ARG A 1 12  ? -9.174  -1.589  12.097  1.00 0.00 ?  225 ARG A HG2  3  
ATOM 4462  H HG3  . ARG A 1 12  ? -9.627  -2.839  10.954  1.00 0.00 ?  225 ARG A HG3  3  
ATOM 4463  H HD2  . ARG A 1 12  ? -7.338  -2.059  9.749   1.00 0.00 ?  225 ARG A HD2  3  
ATOM 4464  H HD3  . ARG A 1 12  ? -6.943  -1.528  11.372  1.00 0.00 ?  225 ARG A HD3  3  
ATOM 4465  H HE   . ARG A 1 12  ? -8.015  -4.241  11.337  1.00 0.00 ?  225 ARG A HE   3  
ATOM 4466  H HH11 . ARG A 1 12  ? -5.097  -2.328  10.881  1.00 0.00 ?  225 ARG A HH11 3  
ATOM 4467  H HH12 . ARG A 1 12  ? -4.027  -3.638  11.253  1.00 0.00 ?  225 ARG A HH12 3  
ATOM 4468  H HH21 . ARG A 1 12  ? -6.604  -5.969  11.828  1.00 0.00 ?  225 ARG A HH21 3  
ATOM 4469  H HH22 . ARG A 1 12  ? -4.890  -5.723  11.796  1.00 0.00 ?  225 ARG A HH22 3  
ATOM 4470  N N    . ASN A 1 13  ? -8.366  1.363   8.171   1.00 0.00 ?  226 ASN A N    3  
ATOM 4471  C CA   . ASN A 1 13  ? -7.519  1.677   7.032   1.00 0.00 ?  226 ASN A CA   3  
ATOM 4472  C C    . ASN A 1 13  ? -6.695  2.928   7.345   1.00 0.00 ?  226 ASN A C    3  
ATOM 4473  O O    . ASN A 1 13  ? -5.577  3.078   6.853   1.00 0.00 ?  226 ASN A O    3  
ATOM 4474  C CB   . ASN A 1 13  ? -8.357  1.962   5.784   1.00 0.00 ?  226 ASN A CB   3  
ATOM 4475  C CG   . ASN A 1 13  ? -7.465  2.335   4.599   1.00 0.00 ?  226 ASN A CG   3  
ATOM 4476  O OD1  . ASN A 1 13  ? -6.265  2.111   4.596   1.00 0.00 ?  226 ASN A OD1  3  
ATOM 4477  N ND2  . ASN A 1 13  ? -8.115  2.915   3.594   1.00 0.00 ?  226 ASN A ND2  3  
ATOM 4478  H H    . ASN A 1 13  ? -9.322  1.642   8.076   1.00 0.00 ?  226 ASN A H    3  
ATOM 4479  H HA   . ASN A 1 13  ? -6.897  0.794   6.886   1.00 0.00 ?  226 ASN A HA   3  
ATOM 4480  H HB2  . ASN A 1 13  ? -8.952  1.084   5.534   1.00 0.00 ?  226 ASN A HB2  3  
ATOM 4481  H HB3  . ASN A 1 13  ? -9.055  2.773   5.988   1.00 0.00 ?  226 ASN A HB3  3  
ATOM 4482  H HD21 . ASN A 1 13  ? -9.101  3.070   3.660   1.00 0.00 ?  226 ASN A HD21 3  
ATOM 4483  H HD22 . ASN A 1 13  ? -7.619  3.196   2.773   1.00 0.00 ?  226 ASN A HD22 3  
ATOM 4484  N N    . TRP A 1 14  ? -7.279  3.794   8.160   1.00 0.00 ?  227 TRP A N    3  
ATOM 4485  C CA   . TRP A 1 14  ? -6.612  5.027   8.543   1.00 0.00 ?  227 TRP A CA   3  
ATOM 4486  C C    . TRP A 1 14  ? -5.400  4.662   9.402   1.00 0.00 ?  227 TRP A C    3  
ATOM 4487  O O    . TRP A 1 14  ? -4.314  5.208   9.214   1.00 0.00 ?  227 TRP A O    3  
ATOM 4488  C CB   . TRP A 1 14  ? -7.581  5.976   9.250   1.00 0.00 ?  227 TRP A CB   3  
ATOM 4489  C CG   . TRP A 1 14  ? -7.075  7.417   9.355   1.00 0.00 ?  227 TRP A CG   3  
ATOM 4490  C CD1  . TRP A 1 14  ? -5.879  7.899   8.993   1.00 0.00 ?  227 TRP A CD1  3  
ATOM 4491  C CD2  . TRP A 1 14  ? -7.806  8.549   9.873   1.00 0.00 ?  227 TRP A CD2  3  
ATOM 4492  N NE1  . TRP A 1 14  ? -5.785  9.254   9.239   1.00 0.00 ?  227 TRP A NE1  3  
ATOM 4493  C CE2  . TRP A 1 14  ? -6.994  9.661   9.791   1.00 0.00 ?  227 TRP A CE2  3  
ATOM 4494  C CE3  . TRP A 1 14  ? -9.109  8.630   10.394  1.00 0.00 ?  227 TRP A CE3  3  
ATOM 4495  C CZ2  . TRP A 1 14  ? -7.394  10.935  10.212  1.00 0.00 ?  227 TRP A CZ2  3  
ATOM 4496  C CZ3  . TRP A 1 14  ? -9.494  9.910   10.810  1.00 0.00 ?  227 TRP A CZ3  3  
ATOM 4497  C CH2  . TRP A 1 14  ? -8.689  11.040  10.734  1.00 0.00 ?  227 TRP A CH2  3  
ATOM 4498  H H    . TRP A 1 14  ? -8.188  3.664   8.555   1.00 0.00 ?  227 TRP A H    3  
ATOM 4499  H HA   . TRP A 1 14  ? -6.286  5.527   7.631   1.00 0.00 ?  227 TRP A HA   3  
ATOM 4500  H HB2  . TRP A 1 14  ? -8.531  5.974   8.716   1.00 0.00 ?  227 TRP A HB2  3  
ATOM 4501  H HB3  . TRP A 1 14  ? -7.779  5.598   10.253  1.00 0.00 ?  227 TRP A HB3  3  
ATOM 4502  H HD1  . TRP A 1 14  ? -5.080  7.298   8.559   1.00 0.00 ?  227 TRP A HD1  3  
ATOM 4503  H HE1  . TRP A 1 14  ? -4.921  9.888   9.038   1.00 0.00 ?  227 TRP A HE1  3  
ATOM 4504  H HE3  . TRP A 1 14  ? -9.770  7.766   10.469  1.00 0.00 ?  227 TRP A HE3  3  
ATOM 4505  H HZ2  . TRP A 1 14  ? -6.733  11.799  10.137  1.00 0.00 ?  227 TRP A HZ2  3  
ATOM 4506  H HZ3  . TRP A 1 14  ? -10.496 10.028  11.222  1.00 0.00 ?  227 TRP A HZ3  3  
ATOM 4507  H HH2  . TRP A 1 14  ? -9.063  12.004  11.080  1.00 0.00 ?  227 TRP A HH2  3  
ATOM 4508  N N    . GLN A 1 15  ? -5.625  3.740   10.326  1.00 0.00 ?  228 GLN A N    3  
ATOM 4509  C CA   . GLN A 1 15  ? -4.565  3.295   11.214  1.00 0.00 ?  228 GLN A CA   3  
ATOM 4510  C C    . GLN A 1 15  ? -3.554  2.439   10.448  1.00 0.00 ?  228 GLN A C    3  
ATOM 4511  O O    . GLN A 1 15  ? -2.360  2.471   10.741  1.00 0.00 ?  228 GLN A O    3  
ATOM 4512  C CB   . GLN A 1 15  ? -5.135  2.530   12.410  1.00 0.00 ?  228 GLN A CB   3  
ATOM 4513  C CG   . GLN A 1 15  ? -5.847  1.255   11.956  1.00 0.00 ?  228 GLN A CG   3  
ATOM 4514  C CD   . GLN A 1 15  ? -6.341  0.445   13.157  1.00 0.00 ?  228 GLN A CD   3  
ATOM 4515  O OE1  . GLN A 1 15  ? -5.655  -0.415  13.683  1.00 0.00 ?  228 GLN A OE1  3  
ATOM 4516  N NE2  . GLN A 1 15  ? -7.567  0.768   13.560  1.00 0.00 ?  228 GLN A NE2  3  
ATOM 4517  H H    . GLN A 1 15  ? -6.511  3.300   10.473  1.00 0.00 ?  228 GLN A H    3  
ATOM 4518  H HA   . GLN A 1 15  ? -4.083  4.206   11.570  1.00 0.00 ?  228 GLN A HA   3  
ATOM 4519  H HB2  . GLN A 1 15  ? -4.332  2.276   13.101  1.00 0.00 ?  228 GLN A HB2  3  
ATOM 4520  H HB3  . GLN A 1 15  ? -5.834  3.167   12.954  1.00 0.00 ?  228 GLN A HB3  3  
ATOM 4521  H HG2  . GLN A 1 15  ? -6.690  1.513   11.316  1.00 0.00 ?  228 GLN A HG2  3  
ATOM 4522  H HG3  . GLN A 1 15  ? -5.167  0.647   11.359  1.00 0.00 ?  228 GLN A HG3  3  
ATOM 4523  H HE21 . GLN A 1 15  ? -8.077  1.485   13.085  1.00 0.00 ?  228 GLN A HE21 3  
ATOM 4524  H HE22 . GLN A 1 15  ? -7.978  0.295   14.339  1.00 0.00 ?  228 GLN A HE22 3  
ATOM 4525  N N    . LEU A 1 16  ? -4.071  1.694   9.481   1.00 0.00 ?  229 LEU A N    3  
ATOM 4526  C CA   . LEU A 1 16  ? -3.229  0.831   8.671   1.00 0.00 ?  229 LEU A CA   3  
ATOM 4527  C C    . LEU A 1 16  ? -2.273  1.691   7.841   1.00 0.00 ?  229 LEU A C    3  
ATOM 4528  O O    . LEU A 1 16  ? -1.058  1.514   7.906   1.00 0.00 ?  229 LEU A O    3  
ATOM 4529  C CB   . LEU A 1 16  ? -4.086  -0.119  7.832   1.00 0.00 ?  229 LEU A CB   3  
ATOM 4530  C CG   . LEU A 1 16  ? -4.151  -1.569  8.318   1.00 0.00 ?  229 LEU A CG   3  
ATOM 4531  C CD1  . LEU A 1 16  ? -5.517  -2.188  8.014   1.00 0.00 ?  229 LEU A CD1  3  
ATOM 4532  C CD2  . LEU A 1 16  ? -3.004  -2.395  7.734   1.00 0.00 ?  229 LEU A CD2  3  
ATOM 4533  H H    . LEU A 1 16  ? -5.043  1.675   9.250   1.00 0.00 ?  229 LEU A H    3  
ATOM 4534  H HA   . LEU A 1 16  ? -2.639  0.218   9.351   1.00 0.00 ?  229 LEU A HA   3  
ATOM 4535  H HB2  . LEU A 1 16  ? -5.101  0.276   7.794   1.00 0.00 ?  229 LEU A HB2  3  
ATOM 4536  H HB3  . LEU A 1 16  ? -3.704  -0.116  6.811   1.00 0.00 ?  229 LEU A HB3  3  
ATOM 4537  H HG   . LEU A 1 16  ? -4.031  -1.571  9.402   1.00 0.00 ?  229 LEU A HG   3  
ATOM 4538  H HD11 . LEU A 1 16  ? -5.725  -2.979  8.734   1.00 0.00 ?  229 LEU A HD11 3  
ATOM 4539  H HD12 . LEU A 1 16  ? -6.287  -1.421  8.084   1.00 0.00 ?  229 LEU A HD12 3  
ATOM 4540  H HD13 . LEU A 1 16  ? -5.510  -2.605  7.007   1.00 0.00 ?  229 LEU A HD13 3  
ATOM 4541  H HD21 . LEU A 1 16  ? -2.588  -1.879  6.869   1.00 0.00 ?  229 LEU A HD21 3  
ATOM 4542  H HD22 . LEU A 1 16  ? -2.228  -2.523  8.489   1.00 0.00 ?  229 LEU A HD22 3  
ATOM 4543  H HD23 . LEU A 1 16  ? -3.378  -3.372  7.429   1.00 0.00 ?  229 LEU A HD23 3  
ATOM 4544  N N    . VAL A 1 17  ? -2.859  2.605   7.081   1.00 0.00 ?  230 VAL A N    3  
ATOM 4545  C CA   . VAL A 1 17  ? -2.075  3.493   6.239   1.00 0.00 ?  230 VAL A CA   3  
ATOM 4546  C C    . VAL A 1 17  ? -1.224  4.407   7.123   1.00 0.00 ?  230 VAL A C    3  
ATOM 4547  O O    . VAL A 1 17  ? -0.100  4.752   6.765   1.00 0.00 ?  230 VAL A O    3  
ATOM 4548  C CB   . VAL A 1 17  ? -2.996  4.265   5.292   1.00 0.00 ?  230 VAL A CB   3  
ATOM 4549  C CG1  . VAL A 1 17  ? -4.064  5.034   6.072   1.00 0.00 ?  230 VAL A CG1  3  
ATOM 4550  C CG2  . VAL A 1 17  ? -2.192  5.204   4.391   1.00 0.00 ?  230 VAL A CG2  3  
ATOM 4551  H H    . VAL A 1 17  ? -3.849  2.742   7.034   1.00 0.00 ?  230 VAL A H    3  
ATOM 4552  H HA   . VAL A 1 17  ? -1.412  2.873   5.635   1.00 0.00 ?  230 VAL A HA   3  
ATOM 4553  H HB   . VAL A 1 17  ? -3.503  3.541   4.654   1.00 0.00 ?  230 VAL A HB   3  
ATOM 4554  H HG11 . VAL A 1 17  ? -4.090  4.677   7.102   1.00 0.00 ?  230 VAL A HG11 3  
ATOM 4555  H HG12 . VAL A 1 17  ? -3.825  6.098   6.063   1.00 0.00 ?  230 VAL A HG12 3  
ATOM 4556  H HG13 . VAL A 1 17  ? -5.037  4.876   5.608   1.00 0.00 ?  230 VAL A HG13 3  
ATOM 4557  H HG21 . VAL A 1 17  ? -1.178  5.300   4.778   1.00 0.00 ?  230 VAL A HG21 3  
ATOM 4558  H HG22 . VAL A 1 17  ? -2.158  4.796   3.380   1.00 0.00 ?  230 VAL A HG22 3  
ATOM 4559  H HG23 . VAL A 1 17  ? -2.668  6.184   4.371   1.00 0.00 ?  230 VAL A HG23 3  
ATOM 4560  N N    . ALA A 1 18  ? -1.794  4.773   8.262   1.00 0.00 ?  231 ALA A N    3  
ATOM 4561  C CA   . ALA A 1 18  ? -1.103  5.640   9.200   1.00 0.00 ?  231 ALA A CA   3  
ATOM 4562  C C    . ALA A 1 18  ? -0.028  4.836   9.934   1.00 0.00 ?  231 ALA A C    3  
ATOM 4563  O O    . ALA A 1 18  ? 0.898   5.409   10.508  1.00 0.00 ?  231 ALA A O    3  
ATOM 4564  C CB   . ALA A 1 18  ? -2.117  6.268   10.158  1.00 0.00 ?  231 ALA A CB   3  
ATOM 4565  H H    . ALA A 1 18  ? -2.710  4.488   8.546   1.00 0.00 ?  231 ALA A H    3  
ATOM 4566  H HA   . ALA A 1 18  ? -0.623  6.434   8.627   1.00 0.00 ?  231 ALA A HA   3  
ATOM 4567  H HB1  . ALA A 1 18  ? -1.593  6.883   10.891  1.00 0.00 ?  231 ALA A HB1  3  
ATOM 4568  H HB2  . ALA A 1 18  ? -2.813  6.889   9.595   1.00 0.00 ?  231 ALA A HB2  3  
ATOM 4569  H HB3  . ALA A 1 18  ? -2.667  5.480   10.672  1.00 0.00 ?  231 ALA A HB3  3  
ATOM 4570  N N    . ALA A 1 19  ? -0.185  3.521   9.892   1.00 0.00 ?  232 ALA A N    3  
ATOM 4571  C CA   . ALA A 1 19  ? 0.760   2.633   10.546  1.00 0.00 ?  232 ALA A CA   3  
ATOM 4572  C C    . ALA A 1 19  ? 1.988   2.454   9.650   1.00 0.00 ?  232 ALA A C    3  
ATOM 4573  O O    . ALA A 1 19  ? 3.055   2.066   10.124  1.00 0.00 ?  232 ALA A O    3  
ATOM 4574  C CB   . ALA A 1 19  ? 0.074   1.304   10.867  1.00 0.00 ?  232 ALA A CB   3  
ATOM 4575  H H    . ALA A 1 19  ? -0.941  3.063   9.423   1.00 0.00 ?  232 ALA A H    3  
ATOM 4576  H HA   . ALA A 1 19  ? 1.068   3.104   11.479  1.00 0.00 ?  232 ALA A HA   3  
ATOM 4577  H HB1  . ALA A 1 19  ? 0.811   0.500   10.849  1.00 0.00 ?  232 ALA A HB1  3  
ATOM 4578  H HB2  . ALA A 1 19  ? -0.379  1.359   11.857  1.00 0.00 ?  232 ALA A HB2  3  
ATOM 4579  H HB3  . ALA A 1 19  ? -0.699  1.105   10.124  1.00 0.00 ?  232 ALA A HB3  3  
ATOM 4580  N N    . VAL A 1 20  ? 1.796   2.744   8.372   1.00 0.00 ?  233 VAL A N    3  
ATOM 4581  C CA   . VAL A 1 20  ? 2.874   2.620   7.406   1.00 0.00 ?  233 VAL A CA   3  
ATOM 4582  C C    . VAL A 1 20  ? 3.997   3.591   7.774   1.00 0.00 ?  233 VAL A C    3  
ATOM 4583  O O    . VAL A 1 20  ? 3.753   4.780   7.977   1.00 0.00 ?  233 VAL A O    3  
ATOM 4584  C CB   . VAL A 1 20  ? 2.336   2.836   5.990   1.00 0.00 ?  233 VAL A CB   3  
ATOM 4585  C CG1  . VAL A 1 20  ? 3.453   2.705   4.953   1.00 0.00 ?  233 VAL A CG1  3  
ATOM 4586  C CG2  . VAL A 1 20  ? 1.189   1.871   5.686   1.00 0.00 ?  233 VAL A CG2  3  
ATOM 4587  H H    . VAL A 1 20  ? 0.925   3.059   7.995   1.00 0.00 ?  233 VAL A H    3  
ATOM 4588  H HA   . VAL A 1 20  ? 3.256   1.601   7.469   1.00 0.00 ?  233 VAL A HA   3  
ATOM 4589  H HB   . VAL A 1 20  ? 1.943   3.852   5.933   1.00 0.00 ?  233 VAL A HB   3  
ATOM 4590  H HG11 . VAL A 1 20  ? 3.517   1.671   4.616   1.00 0.00 ?  233 VAL A HG11 3  
ATOM 4591  H HG12 . VAL A 1 20  ? 3.237   3.352   4.102   1.00 0.00 ?  233 VAL A HG12 3  
ATOM 4592  H HG13 . VAL A 1 20  ? 4.402   3.000   5.402   1.00 0.00 ?  233 VAL A HG13 3  
ATOM 4593  H HG21 . VAL A 1 20  ? 0.339   2.102   6.328   1.00 0.00 ?  233 VAL A HG21 3  
ATOM 4594  H HG22 . VAL A 1 20  ? 0.895   1.974   4.641   1.00 0.00 ?  233 VAL A HG22 3  
ATOM 4595  H HG23 . VAL A 1 20  ? 1.516   0.848   5.871   1.00 0.00 ?  233 VAL A HG23 3  
ATOM 4596  N N    . PRO A 1 21  ? 5.236   3.035   7.851   1.00 0.00 ?  234 PRO A N    3  
ATOM 4597  C CA   . PRO A 1 21  ? 6.397   3.840   8.190   1.00 0.00 ?  234 PRO A CA   3  
ATOM 4598  C C    . PRO A 1 21  ? 6.825   4.713   7.009   1.00 0.00 ?  234 PRO A C    3  
ATOM 4599  O O    . PRO A 1 21  ? 7.266   5.846   7.197   1.00 0.00 ?  234 PRO A O    3  
ATOM 4600  C CB   . PRO A 1 21  ? 7.463   2.837   8.604   1.00 0.00 ?  234 PRO A CB   3  
ATOM 4601  C CG   . PRO A 1 21  ? 7.016   1.498   8.039   1.00 0.00 ?  234 PRO A CG   3  
ATOM 4602  C CD   . PRO A 1 21  ? 5.563   1.632   7.616   1.00 0.00 ?  234 PRO A CD   3  
ATOM 4603  H HA   . PRO A 1 21  ? 6.176   4.473   8.932   1.00 0.00 ?  234 PRO A HA   3  
ATOM 4604  H HB2  . PRO A 1 21  ? 8.439   3.121   8.211   1.00 0.00 ?  234 PRO A HB2  3  
ATOM 4605  H HB3  . PRO A 1 21  ? 7.557   2.792   9.689   1.00 0.00 ?  234 PRO A HB3  3  
ATOM 4606  H HG2  . PRO A 1 21  ? 7.637   1.217   7.189   1.00 0.00 ?  234 PRO A HG2  3  
ATOM 4607  H HG3  . PRO A 1 21  ? 7.126   0.713   8.787   1.00 0.00 ?  234 PRO A HG3  3  
ATOM 4608  H HD2  . PRO A 1 21  ? 5.429   1.364   6.568   1.00 0.00 ?  234 PRO A HD2  3  
ATOM 4609  H HD3  . PRO A 1 21  ? 4.919   0.973   8.199   1.00 0.00 ?  234 PRO A HD3  3  
ATOM 4610  N N    . LEU A 1 22  ? 6.678   4.153   5.817   1.00 0.00 ?  235 LEU A N    3  
ATOM 4611  C CA   . LEU A 1 22  ? 7.043   4.867   4.605   1.00 0.00 ?  235 LEU A CA   3  
ATOM 4612  C C    . LEU A 1 22  ? 6.147   6.097   4.453   1.00 0.00 ?  235 LEU A C    3  
ATOM 4613  O O    . LEU A 1 22  ? 6.483   7.028   3.723   1.00 0.00 ?  235 LEU A O    3  
ATOM 4614  C CB   . LEU A 1 22  ? 7.006   3.927   3.398   1.00 0.00 ?  235 LEU A CB   3  
ATOM 4615  C CG   . LEU A 1 22  ? 7.863   4.340   2.200   1.00 0.00 ?  235 LEU A CG   3  
ATOM 4616  C CD1  . LEU A 1 22  ? 9.216   3.626   2.220   1.00 0.00 ?  235 LEU A CD1  3  
ATOM 4617  C CD2  . LEU A 1 22  ? 7.114   4.111   0.885   1.00 0.00 ?  235 LEU A CD2  3  
ATOM 4618  H H    . LEU A 1 22  ? 6.318   3.231   5.673   1.00 0.00 ?  235 LEU A H    3  
ATOM 4619  H HA   . LEU A 1 22  ? 8.073   5.202   4.721   1.00 0.00 ?  235 LEU A HA   3  
ATOM 4620  H HB2  . LEU A 1 22  ? 7.326   2.937   3.724   1.00 0.00 ?  235 LEU A HB2  3  
ATOM 4621  H HB3  . LEU A 1 22  ? 5.973   3.834   3.066   1.00 0.00 ?  235 LEU A HB3  3  
ATOM 4622  H HG   . LEU A 1 22  ? 8.062   5.409   2.275   1.00 0.00 ?  235 LEU A HG   3  
ATOM 4623  H HD11 . LEU A 1 22  ? 9.086   2.592   1.901   1.00 0.00 ?  235 LEU A HD11 3  
ATOM 4624  H HD12 . LEU A 1 22  ? 9.904   4.132   1.543   1.00 0.00 ?  235 LEU A HD12 3  
ATOM 4625  H HD13 . LEU A 1 22  ? 9.622   3.646   3.232   1.00 0.00 ?  235 LEU A HD13 3  
ATOM 4626  H HD21 . LEU A 1 22  ? 6.046   4.024   1.086   1.00 0.00 ?  235 LEU A HD21 3  
ATOM 4627  H HD22 . LEU A 1 22  ? 7.290   4.953   0.215   1.00 0.00 ?  235 LEU A HD22 3  
ATOM 4628  H HD23 . LEU A 1 22  ? 7.472   3.194   0.418   1.00 0.00 ?  235 LEU A HD23 3  
ATOM 4629  N N    . PHE A 1 23  ? 5.023   6.062   5.155   1.00 0.00 ?  236 PHE A N    3  
ATOM 4630  C CA   . PHE A 1 23  ? 4.076   7.162   5.107   1.00 0.00 ?  236 PHE A CA   3  
ATOM 4631  C C    . PHE A 1 23  ? 3.976   7.859   6.466   1.00 0.00 ?  236 PHE A C    3  
ATOM 4632  O O    . PHE A 1 23  ? 3.115   8.713   6.668   1.00 0.00 ?  236 PHE A O    3  
ATOM 4633  C CB   . PHE A 1 23  ? 2.713   6.565   4.753   1.00 0.00 ?  236 PHE A CB   3  
ATOM 4634  C CG   . PHE A 1 23  ? 2.464   6.432   3.249   1.00 0.00 ?  236 PHE A CG   3  
ATOM 4635  C CD1  . PHE A 1 23  ? 3.504   6.519   2.377   1.00 0.00 ?  236 PHE A CD1  3  
ATOM 4636  C CD2  . PHE A 1 23  ? 1.202   6.227   2.784   1.00 0.00 ?  236 PHE A CD2  3  
ATOM 4637  C CE1  . PHE A 1 23  ? 3.272   6.396   0.981   1.00 0.00 ?  236 PHE A CE1  3  
ATOM 4638  C CE2  . PHE A 1 23  ? 0.971   6.104   1.389   1.00 0.00 ?  236 PHE A CE2  3  
ATOM 4639  C CZ   . PHE A 1 23  ? 2.011   6.191   0.516   1.00 0.00 ?  236 PHE A CZ   3  
ATOM 4640  H H    . PHE A 1 23  ? 4.757   5.300   5.746   1.00 0.00 ?  236 PHE A H    3  
ATOM 4641  H HA   . PHE A 1 23  ? 4.441   7.871   4.363   1.00 0.00 ?  236 PHE A HA   3  
ATOM 4642  H HB2  . PHE A 1 23  ? 2.628   5.580   5.213   1.00 0.00 ?  236 PHE A HB2  3  
ATOM 4643  H HB3  . PHE A 1 23  ? 1.930   7.187   5.186   1.00 0.00 ?  236 PHE A HB3  3  
ATOM 4644  H HD1  . PHE A 1 23  ? 4.515   6.684   2.749   1.00 0.00 ?  236 PHE A HD1  3  
ATOM 4645  H HD2  . PHE A 1 23  ? 0.368   6.157   3.483   1.00 0.00 ?  236 PHE A HD2  3  
ATOM 4646  H HE1  . PHE A 1 23  ? 4.106   6.466   0.282   1.00 0.00 ?  236 PHE A HE1  3  
ATOM 4647  H HE2  . PHE A 1 23  ? -0.041  5.940   1.016   1.00 0.00 ?  236 PHE A HE2  3  
ATOM 4648  H HZ   . PHE A 1 23  ? 1.833   6.097   -0.555  1.00 0.00 ?  236 PHE A HZ   3  
ATOM 4649  N N    . GLN A 1 24  ? 4.870   7.468   7.362   1.00 0.00 ?  237 GLN A N    3  
ATOM 4650  C CA   . GLN A 1 24  ? 4.894   8.045   8.696   1.00 0.00 ?  237 GLN A CA   3  
ATOM 4651  C C    . GLN A 1 24  ? 5.397   9.488   8.641   1.00 0.00 ?  237 GLN A C    3  
ATOM 4652  O O    . GLN A 1 24  ? 5.119   10.281  9.540   1.00 0.00 ?  237 GLN A O    3  
ATOM 4653  C CB   . GLN A 1 24  ? 5.749   7.201   9.643   1.00 0.00 ?  237 GLN A CB   3  
ATOM 4654  C CG   . GLN A 1 24  ? 4.881   6.504   10.692  1.00 0.00 ?  237 GLN A CG   3  
ATOM 4655  C CD   . GLN A 1 24  ? 5.746   5.790   11.733  1.00 0.00 ?  237 GLN A CD   3  
ATOM 4656  O OE1  . GLN A 1 24  ? 5.670   4.588   11.922  1.00 0.00 ?  237 GLN A OE1  3  
ATOM 4657  N NE2  . GLN A 1 24  ? 6.570   6.597   12.396  1.00 0.00 ?  237 GLN A NE2  3  
ATOM 4658  H H    . GLN A 1 24  ? 5.568   6.773   7.190   1.00 0.00 ?  237 GLN A H    3  
ATOM 4659  H HA   . GLN A 1 24  ? 3.859   8.027   9.037   1.00 0.00 ?  237 GLN A HA   3  
ATOM 4660  H HB2  . GLN A 1 24  ? 6.304   6.456   9.072   1.00 0.00 ?  237 GLN A HB2  3  
ATOM 4661  H HB3  . GLN A 1 24  ? 6.485   7.835   10.137  1.00 0.00 ?  237 GLN A HB3  3  
ATOM 4662  H HG2  . GLN A 1 24  ? 4.242   7.237   11.185  1.00 0.00 ?  237 GLN A HG2  3  
ATOM 4663  H HG3  . GLN A 1 24  ? 4.223   5.784   10.206  1.00 0.00 ?  237 GLN A HG3  3  
ATOM 4664  H HE21 . GLN A 1 24  ? 6.583   7.576   12.193  1.00 0.00 ?  237 GLN A HE21 3  
ATOM 4665  H HE22 . GLN A 1 24  ? 7.177   6.224   13.098  1.00 0.00 ?  237 GLN A HE22 3  
ATOM 4666  N N    . LYS A 1 25  ? 6.130   9.786   7.578   1.00 0.00 ?  238 LYS A N    3  
ATOM 4667  C CA   . LYS A 1 25  ? 6.676   11.120  7.395   1.00 0.00 ?  238 LYS A CA   3  
ATOM 4668  C C    . LYS A 1 25  ? 5.610   12.020  6.765   1.00 0.00 ?  238 LYS A C    3  
ATOM 4669  O O    . LYS A 1 25  ? 5.704   13.244  6.838   1.00 0.00 ?  238 LYS A O    3  
ATOM 4670  C CB   . LYS A 1 25  ? 7.980   11.061  6.598   1.00 0.00 ?  238 LYS A CB   3  
ATOM 4671  C CG   . LYS A 1 25  ? 8.883   9.935   7.106   1.00 0.00 ?  238 LYS A CG   3  
ATOM 4672  C CD   . LYS A 1 25  ? 9.521   10.306  8.446   1.00 0.00 ?  238 LYS A CD   3  
ATOM 4673  C CE   . LYS A 1 25  ? 10.373  9.155   8.984   1.00 0.00 ?  238 LYS A CE   3  
ATOM 4674  N NZ   . LYS A 1 25  ? 11.134  9.587   10.178  1.00 0.00 1  238 LYS A NZ   3  
ATOM 4675  H H    . LYS A 1 25  ? 6.353   9.135   6.852   1.00 0.00 ?  238 LYS A H    3  
ATOM 4676  H HA   . LYS A 1 25  ? 6.919   11.512  8.383   1.00 0.00 ?  238 LYS A HA   3  
ATOM 4677  H HB2  . LYS A 1 25  ? 7.759   10.907  5.542   1.00 0.00 ?  238 LYS A HB2  3  
ATOM 4678  H HB3  . LYS A 1 25  ? 8.503   12.015  6.678   1.00 0.00 ?  238 LYS A HB3  3  
ATOM 4679  H HG2  . LYS A 1 25  ? 8.300   9.020   7.217   1.00 0.00 ?  238 LYS A HG2  3  
ATOM 4680  H HG3  . LYS A 1 25  ? 9.662   9.729   6.372   1.00 0.00 ?  238 LYS A HG3  3  
ATOM 4681  H HD2  . LYS A 1 25  ? 10.140  11.195  8.324   1.00 0.00 ?  238 LYS A HD2  3  
ATOM 4682  H HD3  . LYS A 1 25  ? 8.743   10.555  9.167   1.00 0.00 ?  238 LYS A HD3  3  
ATOM 4683  H HE2  . LYS A 1 25  ? 9.734   8.310   9.240   1.00 0.00 ?  238 LYS A HE2  3  
ATOM 4684  H HE3  . LYS A 1 25  ? 11.062  8.812   8.212   1.00 0.00 ?  238 LYS A HE3  3  
ATOM 4685  H HZ1  . LYS A 1 25  ? 10.611  10.280  10.674  1.00 0.00 ?  238 LYS A HZ1  3  
ATOM 4686  H HZ2  . LYS A 1 25  ? 11.294  8.801   10.774  1.00 0.00 ?  238 LYS A HZ2  3  
ATOM 4687  H HZ3  . LYS A 1 25  ? 12.011  9.973   9.892   1.00 0.00 ?  238 LYS A HZ3  3  
ATOM 4688  N N    . LEU A 1 26  ? 4.622   11.377  6.160   1.00 0.00 ?  239 LEU A N    3  
ATOM 4689  C CA   . LEU A 1 26  ? 3.540   12.104  5.517   1.00 0.00 ?  239 LEU A CA   3  
ATOM 4690  C C    . LEU A 1 26  ? 2.764   12.894  6.573   1.00 0.00 ?  239 LEU A C    3  
ATOM 4691  O O    . LEU A 1 26  ? 3.096   12.847  7.757   1.00 0.00 ?  239 LEU A O    3  
ATOM 4692  C CB   . LEU A 1 26  ? 2.667   11.151  4.698   1.00 0.00 ?  239 LEU A CB   3  
ATOM 4693  C CG   . LEU A 1 26  ? 3.277   10.638  3.392   1.00 0.00 ?  239 LEU A CG   3  
ATOM 4694  C CD1  . LEU A 1 26  ? 2.461   9.475   2.825   1.00 0.00 ?  239 LEU A CD1  3  
ATOM 4695  C CD2  . LEU A 1 26  ? 3.438   11.774  2.379   1.00 0.00 ?  239 LEU A CD2  3  
ATOM 4696  H H    . LEU A 1 26  ? 4.553   10.381  6.105   1.00 0.00 ?  239 LEU A H    3  
ATOM 4697  H HA   . LEU A 1 26  ? 3.990   12.810  4.819   1.00 0.00 ?  239 LEU A HA   3  
ATOM 4698  H HB2  . LEU A 1 26  ? 2.417   10.293  5.321   1.00 0.00 ?  239 LEU A HB2  3  
ATOM 4699  H HB3  . LEU A 1 26  ? 1.731   11.658  4.464   1.00 0.00 ?  239 LEU A HB3  3  
ATOM 4700  H HG   . LEU A 1 26  ? 4.275   10.256  3.608   1.00 0.00 ?  239 LEU A HG   3  
ATOM 4701  H HD11 . LEU A 1 26  ? 1.641   9.867   2.223   1.00 0.00 ?  239 LEU A HD11 3  
ATOM 4702  H HD12 . LEU A 1 26  ? 3.102   8.850   2.204   1.00 0.00 ?  239 LEU A HD12 3  
ATOM 4703  H HD13 . LEU A 1 26  ? 2.057   8.881   3.645   1.00 0.00 ?  239 LEU A HD13 3  
ATOM 4704  H HD21 . LEU A 1 26  ? 3.174   11.413  1.385   1.00 0.00 ?  239 LEU A HD21 3  
ATOM 4705  H HD22 . LEU A 1 26  ? 2.781   12.600  2.652   1.00 0.00 ?  239 LEU A HD22 3  
ATOM 4706  H HD23 . LEU A 1 26  ? 4.473   12.116  2.378   1.00 0.00 ?  239 LEU A HD23 3  
ATOM 4707  N N    . GLY A 1 27  ? 1.746   13.602  6.107   1.00 0.00 ?  240 GLY A N    3  
ATOM 4708  C CA   . GLY A 1 27  ? 0.920   14.401  6.996   1.00 0.00 ?  240 GLY A CA   3  
ATOM 4709  C C    . GLY A 1 27  ? -0.425  13.720  7.256   1.00 0.00 ?  240 GLY A C    3  
ATOM 4710  O O    . GLY A 1 27  ? -0.700  12.653  6.710   1.00 0.00 ?  240 GLY A O    3  
ATOM 4711  H H    . GLY A 1 27  ? 1.483   13.635  5.143   1.00 0.00 ?  240 GLY A H    3  
ATOM 4712  H HA2  . GLY A 1 27  ? 1.442   14.556  7.941   1.00 0.00 ?  240 GLY A HA2  3  
ATOM 4713  H HA3  . GLY A 1 27  ? 0.755   15.386  6.558   1.00 0.00 ?  240 GLY A HA3  3  
ATOM 4714  N N    . PRO A 1 28  ? -1.249  14.382  8.111   1.00 0.00 ?  241 PRO A N    3  
ATOM 4715  C CA   . PRO A 1 28  ? -2.558  13.852  8.450   1.00 0.00 ?  241 PRO A CA   3  
ATOM 4716  C C    . PRO A 1 28  ? -3.544  14.046  7.296   1.00 0.00 ?  241 PRO A C    3  
ATOM 4717  O O    . PRO A 1 28  ? -4.415  13.208  7.071   1.00 0.00 ?  241 PRO A O    3  
ATOM 4718  C CB   . PRO A 1 28  ? -2.969  14.593  9.712   1.00 0.00 ?  241 PRO A CB   3  
ATOM 4719  C CG   . PRO A 1 28  ? -2.091  15.833  9.772   1.00 0.00 ?  241 PRO A CG   3  
ATOM 4720  C CD   . PRO A 1 28  ? -0.956  15.649  8.777   1.00 0.00 ?  241 PRO A CD   3  
ATOM 4721  H HA   . PRO A 1 28  ? -2.505  12.865  8.601   1.00 0.00 ?  241 PRO A HA   3  
ATOM 4722  H HB2  . PRO A 1 28  ? -4.024  14.863  9.681   1.00 0.00 ?  241 PRO A HB2  3  
ATOM 4723  H HB3  . PRO A 1 28  ? -2.825  13.970  10.595  1.00 0.00 ?  241 PRO A HB3  3  
ATOM 4724  H HG2  . PRO A 1 28  ? -2.671  16.723  9.530   1.00 0.00 ?  241 PRO A HG2  3  
ATOM 4725  H HG3  . PRO A 1 28  ? -1.696  15.973  10.778  1.00 0.00 ?  241 PRO A HG3  3  
ATOM 4726  H HD2  . PRO A 1 28  ? -0.919  16.471  8.063   1.00 0.00 ?  241 PRO A HD2  3  
ATOM 4727  H HD3  . PRO A 1 28  ? 0.010   15.618  9.279   1.00 0.00 ?  241 PRO A HD3  3  
ATOM 4728  N N    . ALA A 1 29  ? -3.373  15.158  6.595   1.00 0.00 ?  242 ALA A N    3  
ATOM 4729  C CA   . ALA A 1 29  ? -4.236  15.473  5.469   1.00 0.00 ?  242 ALA A CA   3  
ATOM 4730  C C    . ALA A 1 29  ? -3.909  14.538  4.303   1.00 0.00 ?  242 ALA A C    3  
ATOM 4731  O O    . ALA A 1 29  ? -4.800  14.137  3.556   1.00 0.00 ?  242 ALA A O    3  
ATOM 4732  C CB   . ALA A 1 29  ? -4.072  16.948  5.098   1.00 0.00 ?  242 ALA A CB   3  
ATOM 4733  H H    . ALA A 1 29  ? -2.662  15.835  6.784   1.00 0.00 ?  242 ALA A H    3  
ATOM 4734  H HA   . ALA A 1 29  ? -5.266  15.302  5.783   1.00 0.00 ?  242 ALA A HA   3  
ATOM 4735  H HB1  . ALA A 1 29  ? -3.909  17.534  6.001   1.00 0.00 ?  242 ALA A HB1  3  
ATOM 4736  H HB2  . ALA A 1 29  ? -3.217  17.062  4.431   1.00 0.00 ?  242 ALA A HB2  3  
ATOM 4737  H HB3  . ALA A 1 29  ? -4.974  17.298  4.595   1.00 0.00 ?  242 ALA A HB3  3  
ATOM 4738  N N    . VAL A 1 30  ? -2.629  14.217  4.185   1.00 0.00 ?  243 VAL A N    3  
ATOM 4739  C CA   . VAL A 1 30  ? -2.173  13.337  3.123   1.00 0.00 ?  243 VAL A CA   3  
ATOM 4740  C C    . VAL A 1 30  ? -2.615  11.904  3.429   1.00 0.00 ?  243 VAL A C    3  
ATOM 4741  O O    . VAL A 1 30  ? -3.037  11.176  2.531   1.00 0.00 ?  243 VAL A O    3  
ATOM 4742  C CB   . VAL A 1 30  ? -0.659  13.470  2.947   1.00 0.00 ?  243 VAL A CB   3  
ATOM 4743  C CG1  . VAL A 1 30  ? -0.132  12.443  1.942   1.00 0.00 ?  243 VAL A CG1  3  
ATOM 4744  C CG2  . VAL A 1 30  ? -0.278  14.892  2.529   1.00 0.00 ?  243 VAL A CG2  3  
ATOM 4745  H H    . VAL A 1 30  ? -1.911  14.548  4.797   1.00 0.00 ?  243 VAL A H    3  
ATOM 4746  H HA   . VAL A 1 30  ? -2.650  13.662  2.199   1.00 0.00 ?  243 VAL A HA   3  
ATOM 4747  H HB   . VAL A 1 30  ? -0.190  13.267  3.910   1.00 0.00 ?  243 VAL A HB   3  
ATOM 4748  H HG11 . VAL A 1 30  ? -0.809  12.388  1.090   1.00 0.00 ?  243 VAL A HG11 3  
ATOM 4749  H HG12 . VAL A 1 30  ? 0.858   12.745  1.599   1.00 0.00 ?  243 VAL A HG12 3  
ATOM 4750  H HG13 . VAL A 1 30  ? -0.068  11.466  2.420   1.00 0.00 ?  243 VAL A HG13 3  
ATOM 4751  H HG21 . VAL A 1 30  ? -1.057  15.584  2.847   1.00 0.00 ?  243 VAL A HG21 3  
ATOM 4752  H HG22 . VAL A 1 30  ? 0.666   15.167  2.998   1.00 0.00 ?  243 VAL A HG22 3  
ATOM 4753  H HG23 . VAL A 1 30  ? -0.172  14.936  1.445   1.00 0.00 ?  243 VAL A HG23 3  
ATOM 4754  N N    . LEU A 1 31  ? -2.505  11.543  4.698   1.00 0.00 ?  244 LEU A N    3  
ATOM 4755  C CA   . LEU A 1 31  ? -2.889  10.211  5.133   1.00 0.00 ?  244 LEU A CA   3  
ATOM 4756  C C    . LEU A 1 31  ? -4.409  10.065  5.034   1.00 0.00 ?  244 LEU A C    3  
ATOM 4757  O O    . LEU A 1 31  ? -4.910  9.020   4.622   1.00 0.00 ?  244 LEU A O    3  
ATOM 4758  C CB   . LEU A 1 31  ? -2.333  9.922   6.529   1.00 0.00 ?  244 LEU A CB   3  
ATOM 4759  C CG   . LEU A 1 31  ? -0.970  9.229   6.579   1.00 0.00 ?  244 LEU A CG   3  
ATOM 4760  C CD1  . LEU A 1 31  ? -1.074  7.781   6.096   1.00 0.00 ?  244 LEU A CD1  3  
ATOM 4761  C CD2  . LEU A 1 31  ? 0.077   10.021  5.793   1.00 0.00 ?  244 LEU A CD2  3  
ATOM 4762  H H    . LEU A 1 31  ? -2.162  12.142  5.422   1.00 0.00 ?  244 LEU A H    3  
ATOM 4763  H HA   . LEU A 1 31  ? -2.428  9.498   4.449   1.00 0.00 ?  244 LEU A HA   3  
ATOM 4764  H HB2  . LEU A 1 31  ? -2.259  10.865  7.071   1.00 0.00 ?  244 LEU A HB2  3  
ATOM 4765  H HB3  . LEU A 1 31  ? -3.053  9.303   7.064   1.00 0.00 ?  244 LEU A HB3  3  
ATOM 4766  H HG   . LEU A 1 31  ? -0.639  9.199   7.617   1.00 0.00 ?  244 LEU A HG   3  
ATOM 4767  H HD11 . LEU A 1 31  ? -1.509  7.165   6.884   1.00 0.00 ?  244 LEU A HD11 3  
ATOM 4768  H HD12 . LEU A 1 31  ? -1.708  7.738   5.210   1.00 0.00 ?  244 LEU A HD12 3  
ATOM 4769  H HD13 . LEU A 1 31  ? -0.080  7.407   5.850   1.00 0.00 ?  244 LEU A HD13 3  
ATOM 4770  H HD21 . LEU A 1 31  ? -0.413  10.824  5.242   1.00 0.00 ?  244 LEU A HD21 3  
ATOM 4771  H HD22 . LEU A 1 31  ? 0.804   10.446  6.485   1.00 0.00 ?  244 LEU A HD22 3  
ATOM 4772  H HD23 . LEU A 1 31  ? 0.585   9.357   5.094   1.00 0.00 ?  244 LEU A HD23 3  
ATOM 4773  N N    . VAL A 1 32  ? -5.100  11.127  5.419   1.00 0.00 ?  245 VAL A N    3  
ATOM 4774  C CA   . VAL A 1 32  ? -6.552  11.130  5.379   1.00 0.00 ?  245 VAL A CA   3  
ATOM 4775  C C    . VAL A 1 32  ? -7.018  11.056  3.923   1.00 0.00 ?  245 VAL A C    3  
ATOM 4776  O O    . VAL A 1 32  ? -8.016  10.404  3.620   1.00 0.00 ?  245 VAL A O    3  
ATOM 4777  C CB   . VAL A 1 32  ? -7.094  12.356  6.118   1.00 0.00 ?  245 VAL A CB   3  
ATOM 4778  C CG1  . VAL A 1 32  ? -8.553  12.621  5.743   1.00 0.00 ?  245 VAL A CG1  3  
ATOM 4779  C CG2  . VAL A 1 32  ? -6.937  12.197  7.631   1.00 0.00 ?  245 VAL A CG2  3  
ATOM 4780  H H    . VAL A 1 32  ? -4.685  11.973  5.753   1.00 0.00 ?  245 VAL A H    3  
ATOM 4781  H HA   . VAL A 1 32  ? -6.898  10.239  5.904   1.00 0.00 ?  245 VAL A HA   3  
ATOM 4782  H HB   . VAL A 1 32  ? -6.506  13.220  5.809   1.00 0.00 ?  245 VAL A HB   3  
ATOM 4783  H HG11 . VAL A 1 32  ? -8.985  11.722  5.303   1.00 0.00 ?  245 VAL A HG11 3  
ATOM 4784  H HG12 . VAL A 1 32  ? -9.114  12.893  6.637   1.00 0.00 ?  245 VAL A HG12 3  
ATOM 4785  H HG13 . VAL A 1 32  ? -8.600  13.437  5.022   1.00 0.00 ?  245 VAL A HG13 3  
ATOM 4786  H HG21 . VAL A 1 32  ? -5.939  11.818  7.855   1.00 0.00 ?  245 VAL A HG21 3  
ATOM 4787  H HG22 . VAL A 1 32  ? -7.074  13.164  8.114   1.00 0.00 ?  245 VAL A HG22 3  
ATOM 4788  H HG23 . VAL A 1 32  ? -7.684  11.496  8.003   1.00 0.00 ?  245 VAL A HG23 3  
ATOM 4789  N N    . GLU A 1 33  ? -6.273  11.733  3.062   1.00 0.00 ?  246 GLU A N    3  
ATOM 4790  C CA   . GLU A 1 33  ? -6.597  11.752  1.646   1.00 0.00 ?  246 GLU A CA   3  
ATOM 4791  C C    . GLU A 1 33  ? -6.233  10.413  1.000   1.00 0.00 ?  246 GLU A C    3  
ATOM 4792  O O    . GLU A 1 33  ? -6.878  9.986   0.044   1.00 0.00 ?  246 GLU A O    3  
ATOM 4793  C CB   . GLU A 1 33  ? -5.893  12.911  0.938   1.00 0.00 ?  246 GLU A CB   3  
ATOM 4794  C CG   . GLU A 1 33  ? -6.513  13.171  -0.437  1.00 0.00 ?  246 GLU A CG   3  
ATOM 4795  C CD   . GLU A 1 33  ? -7.761  14.047  -0.319  1.00 0.00 ?  246 GLU A CD   3  
ATOM 4796  O OE1  . GLU A 1 33  ? -8.873  13.523  -0.152  1.00 0.00 ?  246 GLU A OE1  3  
ATOM 4797  O OE2  . GLU A 1 33  ? -7.547  15.316  -0.405  1.00 0.00 -1 246 GLU A OE2  3  
ATOM 4798  H H    . GLU A 1 33  ? -5.463  12.261  3.317   1.00 0.00 ?  246 GLU A H    3  
ATOM 4799  H HA   . GLU A 1 33  ? -7.675  11.905  1.597   1.00 0.00 ?  246 GLU A HA   3  
ATOM 4800  H HB2  . GLU A 1 33  ? -5.963  13.811  1.548   1.00 0.00 ?  246 GLU A HB2  3  
ATOM 4801  H HB3  . GLU A 1 33  ? -4.833  12.684  0.826   1.00 0.00 ?  246 GLU A HB3  3  
ATOM 4802  H HG2  . GLU A 1 33  ? -5.782  13.659  -1.083  1.00 0.00 ?  246 GLU A HG2  3  
ATOM 4803  H HG3  . GLU A 1 33  ? -6.772  12.223  -0.908  1.00 0.00 ?  246 GLU A HG3  3  
ATOM 4804  H HE2  . GLU A 1 33  ? -7.000  15.625  0.373   1.00 0.00 ?  246 GLU A HE2  3  
ATOM 4805  N N    . ILE A 1 34  ? -5.202  9.789   1.549   1.00 0.00 ?  247 ILE A N    3  
ATOM 4806  C CA   . ILE A 1 34  ? -4.745  8.508   1.038   1.00 0.00 ?  247 ILE A CA   3  
ATOM 4807  C C    . ILE A 1 34  ? -5.771  7.428   1.389   1.00 0.00 ?  247 ILE A C    3  
ATOM 4808  O O    . ILE A 1 34  ? -6.171  6.645   0.529   1.00 0.00 ?  247 ILE A O    3  
ATOM 4809  C CB   . ILE A 1 34  ? -3.333  8.202   1.545   1.00 0.00 ?  247 ILE A CB   3  
ATOM 4810  C CG1  . ILE A 1 34  ? -2.294  9.062   0.823   1.00 0.00 ?  247 ILE A CG1  3  
ATOM 4811  C CG2  . ILE A 1 34  ? -3.021  6.708   1.430   1.00 0.00 ?  247 ILE A CG2  3  
ATOM 4812  C CD1  . ILE A 1 34  ? -0.990  9.130   1.621   1.00 0.00 ?  247 ILE A CD1  3  
ATOM 4813  H H    . ILE A 1 34  ? -4.683  10.144  2.326   1.00 0.00 ?  247 ILE A H    3  
ATOM 4814  H HA   . ILE A 1 34  ? -4.687  8.590   -0.047  1.00 0.00 ?  247 ILE A HA   3  
ATOM 4815  H HB   . ILE A 1 34  ? -3.287  8.460   2.602   1.00 0.00 ?  247 ILE A HB   3  
ATOM 4816  H HG12 . ILE A 1 34  ? -2.098  8.648   -0.166  1.00 0.00 ?  247 ILE A HG12 3  
ATOM 4817  H HG13 . ILE A 1 34  ? -2.687  10.067  0.676   1.00 0.00 ?  247 ILE A HG13 3  
ATOM 4818  H HG21 . ILE A 1 34  ? -3.223  6.372   0.413   1.00 0.00 ?  247 ILE A HG21 3  
ATOM 4819  H HG22 . ILE A 1 34  ? -1.971  6.537   1.667   1.00 0.00 ?  247 ILE A HG22 3  
ATOM 4820  H HG23 . ILE A 1 34  ? -3.647  6.152   2.128   1.00 0.00 ?  247 ILE A HG23 3  
ATOM 4821  H HD11 . ILE A 1 34  ? -1.211  9.387   2.657   1.00 0.00 ?  247 ILE A HD11 3  
ATOM 4822  H HD12 . ILE A 1 34  ? -0.491  8.162   1.585   1.00 0.00 ?  247 ILE A HD12 3  
ATOM 4823  H HD13 . ILE A 1 34  ? -0.339  9.891   1.189   1.00 0.00 ?  247 ILE A HD13 3  
ATOM 4824  N N    . VAL A 1 35  ? -6.168  7.422   2.653   1.00 0.00 ?  248 VAL A N    3  
ATOM 4825  C CA   . VAL A 1 35  ? -7.139  6.452   3.128   1.00 0.00 ?  248 VAL A CA   3  
ATOM 4826  C C    . VAL A 1 35  ? -8.484  6.706   2.443   1.00 0.00 ?  248 VAL A C    3  
ATOM 4827  O O    . VAL A 1 35  ? -9.213  5.766   2.131   1.00 0.00 ?  248 VAL A O    3  
ATOM 4828  C CB   . VAL A 1 35  ? -7.228  6.504   4.654   1.00 0.00 ?  248 VAL A CB   3  
ATOM 4829  C CG1  . VAL A 1 35  ? -7.760  7.858   5.128   1.00 0.00 ?  248 VAL A CG1  3  
ATOM 4830  C CG2  . VAL A 1 35  ? -8.087  5.358   5.193   1.00 0.00 ?  248 VAL A CG2  3  
ATOM 4831  H H    . VAL A 1 35  ? -5.837  8.063   3.346   1.00 0.00 ?  248 VAL A H    3  
ATOM 4832  H HA   . VAL A 1 35  ? -6.782  5.463   2.844   1.00 0.00 ?  248 VAL A HA   3  
ATOM 4833  H HB   . VAL A 1 35  ? -6.220  6.382   5.053   1.00 0.00 ?  248 VAL A HB   3  
ATOM 4834  H HG11 . VAL A 1 35  ? -7.139  8.655   4.719   1.00 0.00 ?  248 VAL A HG11 3  
ATOM 4835  H HG12 . VAL A 1 35  ? -8.787  7.985   4.784   1.00 0.00 ?  248 VAL A HG12 3  
ATOM 4836  H HG13 . VAL A 1 35  ? -7.733  7.899   6.216   1.00 0.00 ?  248 VAL A HG13 3  
ATOM 4837  H HG21 . VAL A 1 35  ? -7.441  4.555   5.547   1.00 0.00 ?  248 VAL A HG21 3  
ATOM 4838  H HG22 . VAL A 1 35  ? -8.701  5.721   6.017   1.00 0.00 ?  248 VAL A HG22 3  
ATOM 4839  H HG23 . VAL A 1 35  ? -8.731  4.982   4.398   1.00 0.00 ?  248 VAL A HG23 3  
ATOM 4840  N N    . ARG A 1 36  ? -8.771  7.982   2.228   1.00 0.00 ?  249 ARG A N    3  
ATOM 4841  C CA   . ARG A 1 36  ? -10.014 8.371   1.586   1.00 0.00 ?  249 ARG A CA   3  
ATOM 4842  C C    . ARG A 1 36  ? -9.972  8.028   0.096   1.00 0.00 ?  249 ARG A C    3  
ATOM 4843  O O    . ARG A 1 36  ? -11.013 7.834   -0.530  1.00 0.00 ?  249 ARG A O    3  
ATOM 4844  C CB   . ARG A 1 36  ? -10.273 9.870   1.750   1.00 0.00 ?  249 ARG A CB   3  
ATOM 4845  C CG   . ARG A 1 36  ? -10.591 10.216  3.206   1.00 0.00 ?  249 ARG A CG   3  
ATOM 4846  C CD   . ARG A 1 36  ? -12.102 10.268  3.440   1.00 0.00 ?  249 ARG A CD   3  
ATOM 4847  N NE   . ARG A 1 36  ? -12.538 11.670  3.625   1.00 0.00 ?  249 ARG A NE   3  
ATOM 4848  C CZ   . ARG A 1 36  ? -13.803 12.037  3.870   1.00 0.00 ?  249 ARG A CZ   3  
ATOM 4849  N NH1  . ARG A 1 36  ? -14.764 11.109  3.961   1.00 0.00 ?  249 ARG A NH1  3  
ATOM 4850  N NH2  . ARG A 1 36  ? -14.106 13.334  4.024   1.00 0.00 1  249 ARG A NH2  3  
ATOM 4851  H H    . ARG A 1 36  ? -8.172  8.741   2.485   1.00 0.00 ?  249 ARG A H    3  
ATOM 4852  H HA   . ARG A 1 36  ? -10.785 7.796   2.099   1.00 0.00 ?  249 ARG A HA   3  
ATOM 4853  H HB2  . ARG A 1 36  ? -9.399  10.432  1.421   1.00 0.00 ?  249 ARG A HB2  3  
ATOM 4854  H HB3  . ARG A 1 36  ? -11.104 10.172  1.111   1.00 0.00 ?  249 ARG A HB3  3  
ATOM 4855  H HG2  . ARG A 1 36  ? -10.142 9.473   3.866   1.00 0.00 ?  249 ARG A HG2  3  
ATOM 4856  H HG3  . ARG A 1 36  ? -10.146 11.178  3.461   1.00 0.00 ?  249 ARG A HG3  3  
ATOM 4857  H HD2  . ARG A 1 36  ? -12.625 9.825   2.593   1.00 0.00 ?  249 ARG A HD2  3  
ATOM 4858  H HD3  . ARG A 1 36  ? -12.363 9.678   4.319   1.00 0.00 ?  249 ARG A HD3  3  
ATOM 4859  H HE   . ARG A 1 36  ? -11.845 12.388  3.564   1.00 0.00 ?  249 ARG A HE   3  
ATOM 4860  H HH11 . ARG A 1 36  ? -14.538 10.142  3.846   1.00 0.00 ?  249 ARG A HH11 3  
ATOM 4861  H HH12 . ARG A 1 36  ? -15.709 11.383  4.144   1.00 0.00 ?  249 ARG A HH12 3  
ATOM 4862  H HH21 . ARG A 1 36  ? -13.388 14.027  3.957   1.00 0.00 ?  249 ARG A HH21 3  
ATOM 4863  H HH22 . ARG A 1 36  ? -15.050 13.608  4.207   1.00 0.00 ?  249 ARG A HH22 3  
ATOM 4864  N N    . ALA A 1 37  ? -8.757  7.963   -0.430  1.00 0.00 ?  250 ALA A N    3  
ATOM 4865  C CA   . ALA A 1 37  ? -8.566  7.647   -1.835  1.00 0.00 ?  250 ALA A CA   3  
ATOM 4866  C C    . ALA A 1 37  ? -8.399  6.134   -1.994  1.00 0.00 ?  250 ALA A C    3  
ATOM 4867  O O    . ALA A 1 37  ? -8.217  5.640   -3.106  1.00 0.00 ?  250 ALA A O    3  
ATOM 4868  C CB   . ALA A 1 37  ? -7.365  8.426   -2.375  1.00 0.00 ?  250 ALA A CB   3  
ATOM 4869  H H    . ALA A 1 37  ? -7.916  8.122   0.086   1.00 0.00 ?  250 ALA A H    3  
ATOM 4870  H HA   . ALA A 1 37  ? -9.460  7.964   -2.372  1.00 0.00 ?  250 ALA A HA   3  
ATOM 4871  H HB1  . ALA A 1 37  ? -6.607  8.511   -1.596  1.00 0.00 ?  250 ALA A HB1  3  
ATOM 4872  H HB2  . ALA A 1 37  ? -6.946  7.899   -3.233  1.00 0.00 ?  250 ALA A HB2  3  
ATOM 4873  H HB3  . ALA A 1 37  ? -7.685  9.421   -2.680  1.00 0.00 ?  250 ALA A HB3  3  
ATOM 4874  N N    . LEU A 1 38  ? -8.466  5.441   -0.867  1.00 0.00 ?  251 LEU A N    3  
ATOM 4875  C CA   . LEU A 1 38  ? -8.325  3.995   -0.867  1.00 0.00 ?  251 LEU A CA   3  
ATOM 4876  C C    . LEU A 1 38  ? -9.676  3.356   -1.194  1.00 0.00 ?  251 LEU A C    3  
ATOM 4877  O O    . LEU A 1 38  ? -10.725 3.930   -0.906  1.00 0.00 ?  251 LEU A O    3  
ATOM 4878  C CB   . LEU A 1 38  ? -7.721  3.516   0.454   1.00 0.00 ?  251 LEU A CB   3  
ATOM 4879  C CG   . LEU A 1 38  ? -6.301  2.950   0.376   1.00 0.00 ?  251 LEU A CG   3  
ATOM 4880  C CD1  . LEU A 1 38  ? -5.403  3.576   1.444   1.00 0.00 ?  251 LEU A CD1  3  
ATOM 4881  C CD2  . LEU A 1 38  ? -6.314  1.423   0.461   1.00 0.00 ?  251 LEU A CD2  3  
ATOM 4882  H H    . LEU A 1 38  ? -8.614  5.851   0.033   1.00 0.00 ?  251 LEU A H    3  
ATOM 4883  H HA   . LEU A 1 38  ? -7.620  3.736   -1.657  1.00 0.00 ?  251 LEU A HA   3  
ATOM 4884  H HB2  . LEU A 1 38  ? -7.721  4.351   1.155   1.00 0.00 ?  251 LEU A HB2  3  
ATOM 4885  H HB3  . LEU A 1 38  ? -8.374  2.749   0.872   1.00 0.00 ?  251 LEU A HB3  3  
ATOM 4886  H HG   . LEU A 1 38  ? -5.881  3.215   -0.594  1.00 0.00 ?  251 LEU A HG   3  
ATOM 4887  H HD11 . LEU A 1 38  ? -4.358  3.380   1.201   1.00 0.00 ?  251 LEU A HD11 3  
ATOM 4888  H HD12 . LEU A 1 38  ? -5.572  4.652   1.477   1.00 0.00 ?  251 LEU A HD12 3  
ATOM 4889  H HD13 . LEU A 1 38  ? -5.637  3.142   2.416   1.00 0.00 ?  251 LEU A HD13 3  
ATOM 4890  H HD21 . LEU A 1 38  ? -7.108  1.030   -0.174  1.00 0.00 ?  251 LEU A HD21 3  
ATOM 4891  H HD22 . LEU A 1 38  ? -5.353  1.032   0.126   1.00 0.00 ?  251 LEU A HD22 3  
ATOM 4892  H HD23 . LEU A 1 38  ? -6.491  1.118   1.493   1.00 0.00 ?  251 LEU A HD23 3  
ATOM 4893  N N    . ARG A 1 39  ? -9.607  2.175   -1.791  1.00 0.00 ?  252 ARG A N    3  
ATOM 4894  C CA   . ARG A 1 39  ? -10.811 1.451   -2.160  1.00 0.00 ?  252 ARG A CA   3  
ATOM 4895  C C    . ARG A 1 39  ? -10.839 0.083   -1.474  1.00 0.00 ?  252 ARG A C    3  
ATOM 4896  O O    . ARG A 1 39  ? -9.900  -0.700  -1.604  1.00 0.00 ?  252 ARG A O    3  
ATOM 4897  C CB   . ARG A 1 39  ? -10.894 1.255   -3.675  1.00 0.00 ?  252 ARG A CB   3  
ATOM 4898  C CG   . ARG A 1 39  ? -12.213 0.590   -4.071  1.00 0.00 ?  252 ARG A CG   3  
ATOM 4899  C CD   . ARG A 1 39  ? -11.965 -0.758  -4.750  1.00 0.00 ?  252 ARG A CD   3  
ATOM 4900  N NE   . ARG A 1 39  ? -12.771 -0.857  -5.988  1.00 0.00 ?  252 ARG A NE   3  
ATOM 4901  C CZ   . ARG A 1 39  ? -12.786 -1.930  -6.791  1.00 0.00 ?  252 ARG A CZ   3  
ATOM 4902  N NH1  . ARG A 1 39  ? -12.040 -3.002  -6.491  1.00 0.00 ?  252 ARG A NH1  3  
ATOM 4903  N NH2  . ARG A 1 39  ? -13.547 -1.931  -7.894  1.00 0.00 1  252 ARG A NH2  3  
ATOM 4904  H H    . ARG A 1 39  ? -8.749  1.714   -2.022  1.00 0.00 ?  252 ARG A H    3  
ATOM 4905  H HA   . ARG A 1 39  ? -11.631 2.080   -1.815  1.00 0.00 ?  252 ARG A HA   3  
ATOM 4906  H HB2  . ARG A 1 39  ? -10.804 2.220   -4.175  1.00 0.00 ?  252 ARG A HB2  3  
ATOM 4907  H HB3  . ARG A 1 39  ? -10.058 0.643   -4.013  1.00 0.00 ?  252 ARG A HB3  3  
ATOM 4908  H HG2  . ARG A 1 39  ? -12.832 0.446   -3.185  1.00 0.00 ?  252 ARG A HG2  3  
ATOM 4909  H HG3  . ARG A 1 39  ? -12.767 1.244   -4.744  1.00 0.00 ?  252 ARG A HG3  3  
ATOM 4910  H HD2  . ARG A 1 39  ? -10.907 -0.867  -4.986  1.00 0.00 ?  252 ARG A HD2  3  
ATOM 4911  H HD3  . ARG A 1 39  ? -12.226 -1.571  -4.072  1.00 0.00 ?  252 ARG A HD3  3  
ATOM 4912  H HE   . ARG A 1 39  ? -13.339 -0.074  -6.242  1.00 0.00 ?  252 ARG A HE   3  
ATOM 4913  H HH11 . ARG A 1 39  ? -11.472 -3.001  -5.668  1.00 0.00 ?  252 ARG A HH11 3  
ATOM 4914  H HH12 . ARG A 1 39  ? -12.051 -3.803  -7.090  1.00 0.00 ?  252 ARG A HH12 3  
ATOM 4915  H HH21 . ARG A 1 39  ? -14.104 -1.131  -8.118  1.00 0.00 ?  252 ARG A HH21 3  
ATOM 4916  H HH22 . ARG A 1 39  ? -13.559 -2.731  -8.493  1.00 0.00 ?  252 ARG A HH22 3  
ATOM 4917  N N    . ALA A 1 40  ? -11.928 -0.162  -0.759  1.00 0.00 ?  253 ALA A N    3  
ATOM 4918  C CA   . ALA A 1 40  ? -12.091 -1.421  -0.052  1.00 0.00 ?  253 ALA A CA   3  
ATOM 4919  C C    . ALA A 1 40  ? -12.621 -2.479  -1.021  1.00 0.00 ?  253 ALA A C    3  
ATOM 4920  O O    . ALA A 1 40  ? -13.675 -2.298  -1.629  1.00 0.00 ?  253 ALA A O    3  
ATOM 4921  C CB   . ALA A 1 40  ? -13.015 -1.216  1.150   1.00 0.00 ?  253 ALA A CB   3  
ATOM 4922  H H    . ALA A 1 40  ? -12.687 0.481   -0.658  1.00 0.00 ?  253 ALA A H    3  
ATOM 4923  H HA   . ALA A 1 40  ? -11.109 -1.729  0.308   1.00 0.00 ?  253 ALA A HA   3  
ATOM 4924  H HB1  . ALA A 1 40  ? -13.860 -0.593  0.857   1.00 0.00 ?  253 ALA A HB1  3  
ATOM 4925  H HB2  . ALA A 1 40  ? -13.379 -2.183  1.497   1.00 0.00 ?  253 ALA A HB2  3  
ATOM 4926  H HB3  . ALA A 1 40  ? -12.463 -0.726  1.952   1.00 0.00 ?  253 ALA A HB3  3  
ATOM 4927  N N    . ARG A 1 41  ? -11.866 -3.562  -1.136  1.00 0.00 ?  254 ARG A N    3  
ATOM 4928  C CA   . ARG A 1 41  ? -12.247 -4.650  -2.021  1.00 0.00 ?  254 ARG A CA   3  
ATOM 4929  C C    . ARG A 1 41  ? -12.237 -5.979  -1.262  1.00 0.00 ?  254 ARG A C    3  
ATOM 4930  O O    . ARG A 1 41  ? -11.344 -6.231  -0.455  1.00 0.00 ?  254 ARG A O    3  
ATOM 4931  C CB   . ARG A 1 41  ? -11.297 -4.746  -3.216  1.00 0.00 ?  254 ARG A CB   3  
ATOM 4932  C CG   . ARG A 1 41  ? -9.952  -5.344  -2.801  1.00 0.00 ?  254 ARG A CG   3  
ATOM 4933  C CD   . ARG A 1 41  ? -8.870  -5.032  -3.837  1.00 0.00 ?  254 ARG A CD   3  
ATOM 4934  N NE   . ARG A 1 41  ? -8.288  -6.289  -4.357  1.00 0.00 ?  254 ARG A NE   3  
ATOM 4935  C CZ   . ARG A 1 41  ? -8.837  -7.022  -5.335  1.00 0.00 ?  254 ARG A CZ   3  
ATOM 4936  N NH1  . ARG A 1 41  ? -9.984  -6.628  -5.905  1.00 0.00 ?  254 ARG A NH1  3  
ATOM 4937  N NH2  . ARG A 1 41  ? -8.240  -8.150  -5.743  1.00 0.00 1  254 ARG A NH2  3  
ATOM 4938  H H    . ARG A 1 41  ? -11.010 -3.703  -0.638  1.00 0.00 ?  254 ARG A H    3  
ATOM 4939  H HA   . ARG A 1 41  ? -13.253 -4.397  -2.356  1.00 0.00 ?  254 ARG A HA   3  
ATOM 4940  H HB2  . ARG A 1 41  ? -11.748 -5.361  -3.995  1.00 0.00 ?  254 ARG A HB2  3  
ATOM 4941  H HB3  . ARG A 1 41  ? -11.143 -3.755  -3.643  1.00 0.00 ?  254 ARG A HB3  3  
ATOM 4942  H HG2  . ARG A 1 41  ? -9.657  -4.946  -1.830  1.00 0.00 ?  254 ARG A HG2  3  
ATOM 4943  H HG3  . ARG A 1 41  ? -10.049 -6.424  -2.686  1.00 0.00 ?  254 ARG A HG3  3  
ATOM 4944  H HD2  . ARG A 1 41  ? -9.295  -4.452  -4.655  1.00 0.00 ?  254 ARG A HD2  3  
ATOM 4945  H HD3  . ARG A 1 41  ? -8.088  -4.420  -3.385  1.00 0.00 ?  254 ARG A HD3  3  
ATOM 4946  H HE   . ARG A 1 41  ? -7.433  -6.612  -3.953  1.00 0.00 ?  254 ARG A HE   3  
ATOM 4947  H HH11 . ARG A 1 41  ? -10.430 -5.786  -5.600  1.00 0.00 ?  254 ARG A HH11 3  
ATOM 4948  H HH12 . ARG A 1 41  ? -10.394 -7.175  -6.635  1.00 0.00 ?  254 ARG A HH12 3  
ATOM 4949  H HH21 . ARG A 1 41  ? -7.384  -8.445  -5.318  1.00 0.00 ?  254 ARG A HH21 3  
ATOM 4950  H HH22 . ARG A 1 41  ? -8.649  -8.697  -6.473  1.00 0.00 ?  254 ARG A HH22 3  
ATOM 4951  N N    . THR A 1 42  ? -13.241 -6.795  -1.549  1.00 0.00 ?  255 THR A N    3  
ATOM 4952  C CA   . THR A 1 42  ? -13.360 -8.092  -0.905  1.00 0.00 ?  255 THR A CA   3  
ATOM 4953  C C    . THR A 1 42  ? -12.743 -9.182  -1.783  1.00 0.00 ?  255 THR A C    3  
ATOM 4954  O O    . THR A 1 42  ? -13.073 -9.295  -2.963  1.00 0.00 ?  255 THR A O    3  
ATOM 4955  C CB   . THR A 1 42  ? -14.838 -8.330  -0.589  1.00 0.00 ?  255 THR A CB   3  
ATOM 4956  O OG1  . THR A 1 42  ? -15.096 -7.478  0.524   1.00 0.00 ?  255 THR A OG1  3  
ATOM 4957  C CG2  . THR A 1 42  ? -15.102 -9.737  -0.050  1.00 0.00 ?  255 THR A CG2  3  
ATOM 4958  H H    . THR A 1 42  ? -13.964 -6.582  -2.207  1.00 0.00 ?  255 THR A H    3  
ATOM 4959  H HA   . THR A 1 42  ? -12.788 -8.067  0.023   1.00 0.00 ?  255 THR A HA   3  
ATOM 4960  H HB   . THR A 1 42  ? -15.460 -8.123  -1.459  1.00 0.00 ?  255 THR A HB   3  
ATOM 4961  H HG1  . THR A 1 42  ? -15.019 -6.520  0.247   1.00 0.00 ?  255 THR A HG1  3  
ATOM 4962  H HG21 . THR A 1 42  ? -15.505 -9.669  0.961   1.00 0.00 ?  255 THR A HG21 3  
ATOM 4963  H HG22 . THR A 1 42  ? -15.820 -10.244 -0.694  1.00 0.00 ?  255 THR A HG22 3  
ATOM 4964  H HG23 . THR A 1 42  ? -14.169 -10.300 -0.032  1.00 0.00 ?  255 THR A HG23 3  
ATOM 4965  N N    . VAL A 1 43  ? -11.858 -9.957  -1.175  1.00 0.00 ?  256 VAL A N    3  
ATOM 4966  C CA   . VAL A 1 43  ? -11.191 -11.034 -1.887  1.00 0.00 ?  256 VAL A CA   3  
ATOM 4967  C C    . VAL A 1 43  ? -11.766 -12.376 -1.426  1.00 0.00 ?  256 VAL A C    3  
ATOM 4968  O O    . VAL A 1 43  ? -11.625 -12.749 -0.263  1.00 0.00 ?  256 VAL A O    3  
ATOM 4969  C CB   . VAL A 1 43  ? -9.677  -10.934 -1.691  1.00 0.00 ?  256 VAL A CB   3  
ATOM 4970  C CG1  . VAL A 1 43  ? -8.942  -11.940 -2.577  1.00 0.00 ?  256 VAL A CG1  3  
ATOM 4971  C CG2  . VAL A 1 43  ? -9.184  -9.509  -1.952  1.00 0.00 ?  256 VAL A CG2  3  
ATOM 4972  H H    . VAL A 1 43  ? -11.594 -9.859  -0.215  1.00 0.00 ?  256 VAL A H    3  
ATOM 4973  H HA   . VAL A 1 43  ? -11.404 -10.908 -2.948  1.00 0.00 ?  256 VAL A HA   3  
ATOM 4974  H HB   . VAL A 1 43  ? -9.457  -11.179 -0.652  1.00 0.00 ?  256 VAL A HB   3  
ATOM 4975  H HG11 . VAL A 1 43  ? -7.866  -11.816 -2.453  1.00 0.00 ?  256 VAL A HG11 3  
ATOM 4976  H HG12 . VAL A 1 43  ? -9.226  -12.953 -2.291  1.00 0.00 ?  256 VAL A HG12 3  
ATOM 4977  H HG13 . VAL A 1 43  ? -9.209  -11.770 -3.620  1.00 0.00 ?  256 VAL A HG13 3  
ATOM 4978  H HG21 . VAL A 1 43  ? -8.095  -9.494  -1.942  1.00 0.00 ?  256 VAL A HG21 3  
ATOM 4979  H HG22 . VAL A 1 43  ? -9.543  -9.174  -2.926  1.00 0.00 ?  256 VAL A HG22 3  
ATOM 4980  H HG23 . VAL A 1 43  ? -9.565  -8.845  -1.177  1.00 0.00 ?  256 VAL A HG23 3  
ATOM 4981  N N    . PRO A 1 44  ? -12.418 -13.082 -2.388  1.00 0.00 ?  257 PRO A N    3  
ATOM 4982  C CA   . PRO A 1 44  ? -13.014 -14.374 -2.094  1.00 0.00 ?  257 PRO A CA   3  
ATOM 4983  C C    . PRO A 1 44  ? -11.942 -15.459 -1.975  1.00 0.00 ?  257 PRO A C    3  
ATOM 4984  O O    . PRO A 1 44  ? -10.863 -15.336 -2.554  1.00 0.00 ?  257 PRO A O    3  
ATOM 4985  C CB   . PRO A 1 44  ? -13.990 -14.626 -3.231  1.00 0.00 ?  257 PRO A CB   3  
ATOM 4986  C CG   . PRO A 1 44  ? -13.569 -13.693 -4.356  1.00 0.00 ?  257 PRO A CG   3  
ATOM 4987  C CD   . PRO A 1 44  ? -12.604 -12.672 -3.777  1.00 0.00 ?  257 PRO A CD   3  
ATOM 4988  H HA   . PRO A 1 44  ? -13.476 -14.349 -1.207  1.00 0.00 ?  257 PRO A HA   3  
ATOM 4989  H HB2  . PRO A 1 44  ? -13.955 -15.666 -3.553  1.00 0.00 ?  257 PRO A HB2  3  
ATOM 4990  H HB3  . PRO A 1 44  ? -15.015 -14.423 -2.919  1.00 0.00 ?  257 PRO A HB3  3  
ATOM 4991  H HG2  . PRO A 1 44  ? -13.094 -14.255 -5.160  1.00 0.00 ?  257 PRO A HG2  3  
ATOM 4992  H HG3  . PRO A 1 44  ? -14.439 -13.196 -4.785  1.00 0.00 ?  257 PRO A HG3  3  
ATOM 4993  H HD2  . PRO A 1 44  ? -11.659 -12.669 -4.319  1.00 0.00 ?  257 PRO A HD2  3  
ATOM 4994  H HD3  . PRO A 1 44  ? -13.011 -11.662 -3.840  1.00 0.00 ?  257 PRO A HD3  3  
ATOM 4995  N N    . ALA A 1 45  ? -12.275 -16.497 -1.222  1.00 0.00 ?  258 ALA A N    3  
ATOM 4996  C CA   . ALA A 1 45  ? -11.354 -17.602 -1.020  1.00 0.00 ?  258 ALA A CA   3  
ATOM 4997  C C    . ALA A 1 45  ? -10.970 -18.194 -2.378  1.00 0.00 ?  258 ALA A C    3  
ATOM 4998  O O    . ALA A 1 45  ? -11.839 -18.556 -3.170  1.00 0.00 ?  258 ALA A O    3  
ATOM 4999  C CB   . ALA A 1 45  ? -11.994 -18.637 -0.093  1.00 0.00 ?  258 ALA A CB   3  
ATOM 5000  H H    . ALA A 1 45  ? -13.155 -16.589 -0.755  1.00 0.00 ?  258 ALA A H    3  
ATOM 5001  H HA   . ALA A 1 45  ? -10.460 -17.206 -0.540  1.00 0.00 ?  258 ALA A HA   3  
ATOM 5002  H HB1  . ALA A 1 45  ? -12.843 -19.100 -0.596  1.00 0.00 ?  258 ALA A HB1  3  
ATOM 5003  H HB2  . ALA A 1 45  ? -11.260 -19.402 0.159   1.00 0.00 ?  258 ALA A HB2  3  
ATOM 5004  H HB3  . ALA A 1 45  ? -12.335 -18.147 0.819   1.00 0.00 ?  258 ALA A HB3  3  
ATOM 5005  N N    . GLY A 1 46  ? -9.667  -18.274 -2.605  1.00 0.00 ?  259 GLY A N    3  
ATOM 5006  C CA   . GLY A 1 46  ? -9.157  -18.816 -3.853  1.00 0.00 ?  259 GLY A CA   3  
ATOM 5007  C C    . GLY A 1 46  ? -8.782  -17.695 -4.825  1.00 0.00 ?  259 GLY A C    3  
ATOM 5008  O O    . GLY A 1 46  ? -7.939  -17.884 -5.701  1.00 0.00 ?  259 GLY A O    3  
ATOM 5009  H H    . GLY A 1 46  ? -8.967  -17.977 -1.956  1.00 0.00 ?  259 GLY A H    3  
ATOM 5010  H HA2  . GLY A 1 46  ? -8.284  -19.437 -3.654  1.00 0.00 ?  259 GLY A HA2  3  
ATOM 5011  H HA3  . GLY A 1 46  ? -9.909  -19.460 -4.308  1.00 0.00 ?  259 GLY A HA3  3  
ATOM 5012  N N    . ALA A 1 47  ? -9.425  -16.552 -4.637  1.00 0.00 ?  260 ALA A N    3  
ATOM 5013  C CA   . ALA A 1 47  ? -9.170  -15.401 -5.486  1.00 0.00 ?  260 ALA A CA   3  
ATOM 5014  C C    . ALA A 1 47  ? -7.740  -14.910 -5.254  1.00 0.00 ?  260 ALA A C    3  
ATOM 5015  O O    . ALA A 1 47  ? -7.222  -14.997 -4.142  1.00 0.00 ?  260 ALA A O    3  
ATOM 5016  C CB   . ALA A 1 47  ? -10.212 -14.317 -5.204  1.00 0.00 ?  260 ALA A CB   3  
ATOM 5017  H H    . ALA A 1 47  ? -10.109 -16.407 -3.922  1.00 0.00 ?  260 ALA A H    3  
ATOM 5018  H HA   . ALA A 1 47  ? -9.271  -15.724 -6.522  1.00 0.00 ?  260 ALA A HA   3  
ATOM 5019  H HB1  . ALA A 1 47  ? -10.288 -13.653 -6.065  1.00 0.00 ?  260 ALA A HB1  3  
ATOM 5020  H HB2  . ALA A 1 47  ? -11.180 -14.783 -5.018  1.00 0.00 ?  260 ALA A HB2  3  
ATOM 5021  H HB3  . ALA A 1 47  ? -9.911  -13.743 -4.327  1.00 0.00 ?  260 ALA A HB3  3  
ATOM 5022  N N    . VAL A 1 48  ? -7.142  -14.403 -6.322  1.00 0.00 ?  261 VAL A N    3  
ATOM 5023  C CA   . VAL A 1 48  ? -5.782  -13.897 -6.250  1.00 0.00 ?  261 VAL A CA   3  
ATOM 5024  C C    . VAL A 1 48  ? -5.816  -12.379 -6.064  1.00 0.00 ?  261 VAL A C    3  
ATOM 5025  O O    . VAL A 1 48  ? -6.591  -11.687 -6.723  1.00 0.00 ?  261 VAL A O    3  
ATOM 5026  C CB   . VAL A 1 48  ? -4.995  -14.331 -7.488  1.00 0.00 ?  261 VAL A CB   3  
ATOM 5027  C CG1  . VAL A 1 48  ? -5.788  -14.052 -8.767  1.00 0.00 ?  261 VAL A CG1  3  
ATOM 5028  C CG2  . VAL A 1 48  ? -3.625  -13.650 -7.534  1.00 0.00 ?  261 VAL A CG2  3  
ATOM 5029  H H    . VAL A 1 48  ? -7.570  -14.336 -7.224  1.00 0.00 ?  261 VAL A H    3  
ATOM 5030  H HA   . VAL A 1 48  ? -5.310  -14.347 -5.376  1.00 0.00 ?  261 VAL A HA   3  
ATOM 5031  H HB   . VAL A 1 48  ? -4.832  -15.406 -7.423  1.00 0.00 ?  261 VAL A HB   3  
ATOM 5032  H HG11 . VAL A 1 48  ? -5.110  -14.039 -9.620  1.00 0.00 ?  261 VAL A HG11 3  
ATOM 5033  H HG12 . VAL A 1 48  ? -6.535  -14.833 -8.908  1.00 0.00 ?  261 VAL A HG12 3  
ATOM 5034  H HG13 . VAL A 1 48  ? -6.285  -13.085 -8.683  1.00 0.00 ?  261 VAL A HG13 3  
ATOM 5035  H HG21 . VAL A 1 48  ? -3.251  -13.654 -8.557  1.00 0.00 ?  261 VAL A HG21 3  
ATOM 5036  H HG22 . VAL A 1 48  ? -3.719  -12.622 -7.185  1.00 0.00 ?  261 VAL A HG22 3  
ATOM 5037  H HG23 . VAL A 1 48  ? -2.930  -14.190 -6.891  1.00 0.00 ?  261 VAL A HG23 3  
ATOM 5038  N N    . ILE A 1 49  ? -4.967  -11.905 -5.164  1.00 0.00 ?  262 ILE A N    3  
ATOM 5039  C CA   . ILE A 1 49  ? -4.890  -10.482 -4.884  1.00 0.00 ?  262 ILE A CA   3  
ATOM 5040  C C    . ILE A 1 49  ? -4.019  -9.804  -5.943  1.00 0.00 ?  262 ILE A C    3  
ATOM 5041  O O    . ILE A 1 49  ? -4.381  -8.753  -6.471  1.00 0.00 ?  262 ILE A O    3  
ATOM 5042  C CB   . ILE A 1 49  ? -4.413  -10.243 -3.450  1.00 0.00 ?  262 ILE A CB   3  
ATOM 5043  C CG1  . ILE A 1 49  ? -5.280  -11.008 -2.449  1.00 0.00 ?  262 ILE A CG1  3  
ATOM 5044  C CG2  . ILE A 1 49  ? -4.356  -8.747  -3.133  1.00 0.00 ?  262 ILE A CG2  3  
ATOM 5045  C CD1  . ILE A 1 49  ? -4.441  -11.521 -1.276  1.00 0.00 ?  262 ILE A CD1  3  
ATOM 5046  H H    . ILE A 1 49  ? -4.340  -12.475 -4.633  1.00 0.00 ?  262 ILE A H    3  
ATOM 5047  H HA   . ILE A 1 49  ? -5.900  -10.079 -4.959  1.00 0.00 ?  262 ILE A HA   3  
ATOM 5048  H HB   . ILE A 1 49  ? -3.398  -10.630 -3.359  1.00 0.00 ?  262 ILE A HB   3  
ATOM 5049  H HG12 . ILE A 1 49  ? -6.072  -10.358 -2.077  1.00 0.00 ?  262 ILE A HG12 3  
ATOM 5050  H HG13 . ILE A 1 49  ? -5.764  -11.848 -2.948  1.00 0.00 ?  262 ILE A HG13 3  
ATOM 5051  H HG21 . ILE A 1 49  ? -3.351  -8.372  -3.327  1.00 0.00 ?  262 ILE A HG21 3  
ATOM 5052  H HG22 . ILE A 1 49  ? -5.069  -8.215  -3.763  1.00 0.00 ?  262 ILE A HG22 3  
ATOM 5053  H HG23 . ILE A 1 49  ? -4.607  -8.588  -2.085  1.00 0.00 ?  262 ILE A HG23 3  
ATOM 5054  H HD11 . ILE A 1 49  ? -3.641  -10.811 -1.065  1.00 0.00 ?  262 ILE A HD11 3  
ATOM 5055  H HD12 . ILE A 1 49  ? -5.074  -11.628 -0.396  1.00 0.00 ?  262 ILE A HD12 3  
ATOM 5056  H HD13 . ILE A 1 49  ? -4.010  -12.488 -1.534  1.00 0.00 ?  262 ILE A HD13 3  
ATOM 5057  N N    . CYS A 1 50  ? -2.887  -10.433 -6.223  1.00 0.00 ?  263 CYS A N    3  
ATOM 5058  C CA   . CYS A 1 50  ? -1.961  -9.904  -7.210  1.00 0.00 ?  263 CYS A CA   3  
ATOM 5059  C C    . CYS A 1 50  ? -1.268  -11.081 -7.899  1.00 0.00 ?  263 CYS A C    3  
ATOM 5060  O O    . CYS A 1 50  ? -1.139  -12.157 -7.317  1.00 0.00 ?  263 CYS A O    3  
ATOM 5061  C CB   . CYS A 1 50  ? -0.955  -8.938  -6.581  1.00 0.00 ?  263 CYS A CB   3  
ATOM 5062  S SG   . CYS A 1 50  ? 0.315   -9.874  -5.654  1.00 0.00 ?  263 CYS A SG   3  
ATOM 5063  H H    . CYS A 1 50  ? -2.600  -11.287 -5.790  1.00 0.00 ?  263 CYS A H    3  
ATOM 5064  H HA   . CYS A 1 50  ? -2.556  -9.333  -7.924  1.00 0.00 ?  263 CYS A HA   3  
ATOM 5065  H HB2  . CYS A 1 50  ? -0.481  -8.337  -7.357  1.00 0.00 ?  263 CYS A HB2  3  
ATOM 5066  H HB3  . CYS A 1 50  ? -1.469  -8.248  -5.913  1.00 0.00 ?  263 CYS A HB3  3  
ATOM 5067  H HG   . CYS A 1 50  ? 1.200   -9.927  -6.645  1.00 0.00 ?  263 CYS A HG   3  
ATOM 5068  N N    . ARG A 1 51  ? -0.841  -10.837 -9.130  1.00 0.00 ?  264 ARG A N    3  
ATOM 5069  C CA   . ARG A 1 51  ? -0.165  -11.864 -9.904  1.00 0.00 ?  264 ARG A CA   3  
ATOM 5070  C C    . ARG A 1 51  ? 1.352   -11.719 -9.768  1.00 0.00 ?  264 ARG A C    3  
ATOM 5071  O O    . ARG A 1 51  ? 1.834   -10.822 -9.078  1.00 0.00 ?  264 ARG A O    3  
ATOM 5072  C CB   . ARG A 1 51  ? -0.548  -11.780 -11.383 1.00 0.00 ?  264 ARG A CB   3  
ATOM 5073  C CG   . ARG A 1 51  ? -1.933  -12.383 -11.626 1.00 0.00 ?  264 ARG A CG   3  
ATOM 5074  C CD   . ARG A 1 51  ? -1.824  -13.793 -12.209 1.00 0.00 ?  264 ARG A CD   3  
ATOM 5075  N NE   . ARG A 1 51  ? -2.724  -13.930 -13.375 1.00 0.00 ?  264 ARG A NE   3  
ATOM 5076  C CZ   . ARG A 1 51  ? -4.021  -14.252 -13.289 1.00 0.00 ?  264 ARG A CZ   3  
ATOM 5077  N NH1  . ARG A 1 51  ? -4.579  -14.474 -12.091 1.00 0.00 ?  264 ARG A NH1  3  
ATOM 5078  N NH2  . ARG A 1 51  ? -4.762  -14.354 -14.402 1.00 0.00 1  264 ARG A NH2  3  
ATOM 5079  H H    . ARG A 1 51  ? -0.950  -9.960  -9.596  1.00 0.00 ?  264 ARG A H    3  
ATOM 5080  H HA   . ARG A 1 51  ? -0.509  -12.807 -9.477  1.00 0.00 ?  264 ARG A HA   3  
ATOM 5081  H HB2  . ARG A 1 51  ? -0.538  -10.739 -11.706 1.00 0.00 ?  264 ARG A HB2  3  
ATOM 5082  H HB3  . ARG A 1 51  ? 0.192   -12.308 -11.984 1.00 0.00 ?  264 ARG A HB3  3  
ATOM 5083  H HG2  . ARG A 1 51  ? -2.489  -12.415 -10.688 1.00 0.00 ?  264 ARG A HG2  3  
ATOM 5084  H HG3  . ARG A 1 51  ? -2.496  -11.746 -12.308 1.00 0.00 ?  264 ARG A HG3  3  
ATOM 5085  H HD2  . ARG A 1 51  ? -0.795  -13.993 -12.507 1.00 0.00 ?  264 ARG A HD2  3  
ATOM 5086  H HD3  . ARG A 1 51  ? -2.084  -14.530 -11.449 1.00 0.00 ?  264 ARG A HD3  3  
ATOM 5087  H HE   . ARG A 1 51  ? -2.340  -13.771 -14.285 1.00 0.00 ?  264 ARG A HE   3  
ATOM 5088  H HH11 . ARG A 1 51  ? -4.026  -14.398 -11.261 1.00 0.00 ?  264 ARG A HH11 3  
ATOM 5089  H HH12 . ARG A 1 51  ? -5.547  -14.715 -12.027 1.00 0.00 ?  264 ARG A HH12 3  
ATOM 5090  H HH21 . ARG A 1 51  ? -4.346  -14.189 -15.296 1.00 0.00 ?  264 ARG A HH21 3  
ATOM 5091  H HH22 . ARG A 1 51  ? -5.730  -14.595 -14.338 1.00 0.00 ?  264 ARG A HH22 3  
ATOM 5092  N N    . ILE A 1 52  ? 2.063   -12.614 -10.438 1.00 0.00 ?  265 ILE A N    3  
ATOM 5093  C CA   . ILE A 1 52  ? 3.515   -12.597 -10.401 1.00 0.00 ?  265 ILE A CA   3  
ATOM 5094  C C    . ILE A 1 52  ? 4.031   -11.475 -11.304 1.00 0.00 ?  265 ILE A C    3  
ATOM 5095  O O    . ILE A 1 52  ? 3.544   -11.299 -12.420 1.00 0.00 ?  265 ILE A O    3  
ATOM 5096  C CB   . ILE A 1 52  ? 4.077   -13.976 -10.752 1.00 0.00 ?  265 ILE A CB   3  
ATOM 5097  C CG1  . ILE A 1 52  ? 3.735   -14.357 -12.194 1.00 0.00 ?  265 ILE A CG1  3  
ATOM 5098  C CG2  . ILE A 1 52  ? 3.600   -15.033 -9.752  1.00 0.00 ?  265 ILE A CG2  3  
ATOM 5099  C CD1  . ILE A 1 52  ? 2.629   -15.413 -12.236 1.00 0.00 ?  265 ILE A CD1  3  
ATOM 5100  H H    . ILE A 1 52  ? 1.663   -13.340 -10.997 1.00 0.00 ?  265 ILE A H    3  
ATOM 5101  H HA   . ILE A 1 52  ? 3.813   -12.379 -9.375  1.00 0.00 ?  265 ILE A HA   3  
ATOM 5102  H HB   . ILE A 1 52  ? 5.163   -13.931 -10.679 1.00 0.00 ?  265 ILE A HB   3  
ATOM 5103  H HG12 . ILE A 1 52  ? 3.417   -13.470 -12.742 1.00 0.00 ?  265 ILE A HG12 3  
ATOM 5104  H HG13 . ILE A 1 52  ? 4.626   -14.737 -12.694 1.00 0.00 ?  265 ILE A HG13 3  
ATOM 5105  H HG21 . ILE A 1 52  ? 2.538   -14.891 -9.552  1.00 0.00 ?  265 ILE A HG21 3  
ATOM 5106  H HG22 . ILE A 1 52  ? 3.762   -16.026 -10.170 1.00 0.00 ?  265 ILE A HG22 3  
ATOM 5107  H HG23 . ILE A 1 52  ? 4.161   -14.933 -8.823  1.00 0.00 ?  265 ILE A HG23 3  
ATOM 5108  H HD11 . ILE A 1 52  ? 1.885   -15.190 -11.471 1.00 0.00 ?  265 ILE A HD11 3  
ATOM 5109  H HD12 . ILE A 1 52  ? 2.156   -15.404 -13.217 1.00 0.00 ?  265 ILE A HD12 3  
ATOM 5110  H HD13 . ILE A 1 52  ? 3.059   -16.397 -12.048 1.00 0.00 ?  265 ILE A HD13 3  
ATOM 5111  N N    . GLY A 1 53  ? 5.009   -10.746 -10.788 1.00 0.00 ?  266 GLY A N    3  
ATOM 5112  C CA   . GLY A 1 53  ? 5.596   -9.646  -11.534 1.00 0.00 ?  266 GLY A CA   3  
ATOM 5113  C C    . GLY A 1 53  ? 4.516   -8.687  -12.039 1.00 0.00 ?  266 GLY A C    3  
ATOM 5114  O O    . GLY A 1 53  ? 4.452   -8.390  -13.231 1.00 0.00 ?  266 GLY A O    3  
ATOM 5115  H H    . GLY A 1 53  ? 5.399   -10.896 -9.880  1.00 0.00 ?  266 GLY A H    3  
ATOM 5116  H HA2  . GLY A 1 53  ? 6.299   -9.106  -10.900 1.00 0.00 ?  266 GLY A HA2  3  
ATOM 5117  H HA3  . GLY A 1 53  ? 6.164   -10.037 -12.379 1.00 0.00 ?  266 GLY A HA3  3  
ATOM 5118  N N    . GLU A 1 54  ? 3.693   -8.230  -11.106 1.00 0.00 ?  267 GLU A N    3  
ATOM 5119  C CA   . GLU A 1 54  ? 2.619   -7.311  -11.441 1.00 0.00 ?  267 GLU A CA   3  
ATOM 5120  C C    . GLU A 1 54  ? 3.187   -5.931  -11.780 1.00 0.00 ?  267 GLU A C    3  
ATOM 5121  O O    . GLU A 1 54  ? 4.353   -5.651  -11.505 1.00 0.00 ?  267 GLU A O    3  
ATOM 5122  C CB   . GLU A 1 54  ? 1.600   -7.220  -10.304 1.00 0.00 ?  267 GLU A CB   3  
ATOM 5123  C CG   . GLU A 1 54  ? 0.431   -8.180  -10.537 1.00 0.00 ?  267 GLU A CG   3  
ATOM 5124  C CD   . GLU A 1 54  ? -0.374  -7.773  -11.773 1.00 0.00 ?  267 GLU A CD   3  
ATOM 5125  O OE1  . GLU A 1 54  ? -1.318  -6.976  -11.663 1.00 0.00 ?  267 GLU A OE1  3  
ATOM 5126  O OE2  . GLU A 1 54  ? 0.012   -8.315  -12.878 1.00 0.00 -1 267 GLU A OE2  3  
ATOM 5127  H H    . GLU A 1 54  ? 3.752   -8.476  -10.139 1.00 0.00 ?  267 GLU A H    3  
ATOM 5128  H HA   . GLU A 1 54  ? 2.136   -7.738  -12.320 1.00 0.00 ?  267 GLU A HA   3  
ATOM 5129  H HB2  . GLU A 1 54  ? 2.085   -7.456  -9.357  1.00 0.00 ?  267 GLU A HB2  3  
ATOM 5130  H HB3  . GLU A 1 54  ? 1.227   -6.199  -10.225 1.00 0.00 ?  267 GLU A HB3  3  
ATOM 5131  H HG2  . GLU A 1 54  ? 0.809   -9.195  -10.662 1.00 0.00 ?  267 GLU A HG2  3  
ATOM 5132  H HG3  . GLU A 1 54  ? -0.218  -8.187  -9.661  1.00 0.00 ?  267 GLU A HG3  3  
ATOM 5133  H HE2  . GLU A 1 54  ? 0.476   -9.181  -12.690 1.00 0.00 ?  267 GLU A HE2  3  
ATOM 5134  N N    . PRO A 1 55  ? 2.314   -5.084  -12.388 1.00 0.00 ?  268 PRO A N    3  
ATOM 5135  C CA   . PRO A 1 55  ? 2.716   -3.740  -12.767 1.00 0.00 ?  268 PRO A CA   3  
ATOM 5136  C C    . PRO A 1 55  ? 2.803   -2.827  -11.542 1.00 0.00 ?  268 PRO A C    3  
ATOM 5137  O O    . PRO A 1 55  ? 1.867   -2.084  -11.249 1.00 0.00 ?  268 PRO A O    3  
ATOM 5138  C CB   . PRO A 1 55  ? 1.672   -3.285  -13.773 1.00 0.00 ?  268 PRO A CB   3  
ATOM 5139  C CG   . PRO A 1 55  ? 0.475   -4.200  -13.573 1.00 0.00 ?  268 PRO A CG   3  
ATOM 5140  C CD   . PRO A 1 55  ? 0.926   -5.381  -12.729 1.00 0.00 ?  268 PRO A CD   3  
ATOM 5141  H HA   . PRO A 1 55  ? 3.634   -3.751  -13.164 1.00 0.00 ?  268 PRO A HA   3  
ATOM 5142  H HB2  . PRO A 1 55  ? 1.399   -2.243  -13.609 1.00 0.00 ?  268 PRO A HB2  3  
ATOM 5143  H HB3  . PRO A 1 55  ? 2.053   -3.358  -14.792 1.00 0.00 ?  268 PRO A HB3  3  
ATOM 5144  H HG2  . PRO A 1 55  ? -0.336  -3.665  -13.078 1.00 0.00 ?  268 PRO A HG2  3  
ATOM 5145  H HG3  . PRO A 1 55  ? 0.091   -4.543  -14.534 1.00 0.00 ?  268 PRO A HG3  3  
ATOM 5146  H HD2  . PRO A 1 55  ? 0.312   -5.486  -11.835 1.00 0.00 ?  268 PRO A HD2  3  
ATOM 5147  H HD3  . PRO A 1 55  ? 0.846   -6.317  -13.282 1.00 0.00 ?  268 PRO A HD3  3  
ATOM 5148  N N    . GLY A 1 56  ? 3.935   -2.913  -10.858 1.00 0.00 ?  269 GLY A N    3  
ATOM 5149  C CA   . GLY A 1 56  ? 4.156   -2.104  -9.671  1.00 0.00 ?  269 GLY A CA   3  
ATOM 5150  C C    . GLY A 1 56  ? 3.545   -0.711  -9.836  1.00 0.00 ?  269 GLY A C    3  
ATOM 5151  O O    . GLY A 1 56  ? 4.193   0.197   -10.353 1.00 0.00 ?  269 GLY A O    3  
ATOM 5152  H H    . GLY A 1 56  ? 4.691   -3.520  -11.103 1.00 0.00 ?  269 GLY A H    3  
ATOM 5153  H HA2  . GLY A 1 56  ? 3.717   -2.598  -8.804  1.00 0.00 ?  269 GLY A HA2  3  
ATOM 5154  H HA3  . GLY A 1 56  ? 5.225   -2.017  -9.481  1.00 0.00 ?  269 GLY A HA3  3  
ATOM 5155  N N    . ASP A 1 57  ? 2.305   -0.587  -9.387  1.00 0.00 ?  270 ASP A N    3  
ATOM 5156  C CA   . ASP A 1 57  ? 1.600   0.680   -9.478  1.00 0.00 ?  270 ASP A CA   3  
ATOM 5157  C C    . ASP A 1 57  ? 0.281   0.582   -8.708  1.00 0.00 ?  270 ASP A C    3  
ATOM 5158  O O    . ASP A 1 57  ? -0.735  1.127   -9.137  1.00 0.00 ?  270 ASP A O    3  
ATOM 5159  C CB   . ASP A 1 57  ? 1.274   1.026   -10.932 1.00 0.00 ?  270 ASP A CB   3  
ATOM 5160  C CG   . ASP A 1 57  ? 2.380   1.768   -11.684 1.00 0.00 ?  270 ASP A CG   3  
ATOM 5161  O OD1  . ASP A 1 57  ? 3.291   2.346   -11.072 1.00 0.00 ?  270 ASP A OD1  3  
ATOM 5162  O OD2  . ASP A 1 57  ? 2.280   1.738   -12.970 1.00 0.00 -1 270 ASP A OD2  3  
ATOM 5163  H H    . ASP A 1 57  ? 1.785   -1.331  -8.968  1.00 0.00 ?  270 ASP A H    3  
ATOM 5164  H HA   . ASP A 1 57  ? 2.279   1.417   -9.049  1.00 0.00 ?  270 ASP A HA   3  
ATOM 5165  H HB2  . ASP A 1 57  ? 1.047   0.104   -11.467 1.00 0.00 ?  270 ASP A HB2  3  
ATOM 5166  H HB3  . ASP A 1 57  ? 0.370   1.636   -10.951 1.00 0.00 ?  270 ASP A HB3  3  
ATOM 5167  H HD2  . ASP A 1 57  ? 2.032   0.818   -13.272 1.00 0.00 ?  270 ASP A HD2  3  
ATOM 5168  N N    . ARG A 1 58  ? 0.339   -0.119  -7.585  1.00 0.00 ?  271 ARG A N    3  
ATOM 5169  C CA   . ARG A 1 58  ? -0.838  -0.296  -6.751  1.00 0.00 ?  271 ARG A CA   3  
ATOM 5170  C C    . ARG A 1 58  ? -0.452  -0.941  -5.418  1.00 0.00 ?  271 ARG A C    3  
ATOM 5171  O O    . ARG A 1 58  ? 0.491   -1.728  -5.355  1.00 0.00 ?  271 ARG A O    3  
ATOM 5172  C CB   . ARG A 1 58  ? -1.881  -1.171  -7.450  1.00 0.00 ?  271 ARG A CB   3  
ATOM 5173  C CG   . ARG A 1 58  ? -3.285  -0.586  -7.286  1.00 0.00 ?  271 ARG A CG   3  
ATOM 5174  C CD   . ARG A 1 58  ? -3.904  -0.257  -8.646  1.00 0.00 ?  271 ARG A CD   3  
ATOM 5175  N NE   . ARG A 1 58  ? -4.975  -1.228  -8.963  1.00 0.00 ?  271 ARG A NE   3  
ATOM 5176  C CZ   . ARG A 1 58  ? -5.537  -1.357  -10.172 1.00 0.00 ?  271 ARG A CZ   3  
ATOM 5177  N NH1  . ARG A 1 58  ? -5.135  -0.578  -11.186 1.00 0.00 ?  271 ARG A NH1  3  
ATOM 5178  N NH2  . ARG A 1 58  ? -6.503  -2.266  -10.368 1.00 0.00 1  271 ARG A NH2  3  
ATOM 5179  H H    . ARG A 1 58  ? 1.169   -0.559  -7.243  1.00 0.00 ?  271 ARG A H    3  
ATOM 5180  H HA   . ARG A 1 58  ? -1.228  0.711   -6.602  1.00 0.00 ?  271 ARG A HA   3  
ATOM 5181  H HB2  . ARG A 1 58  ? -1.639  -1.254  -8.510  1.00 0.00 ?  271 ARG A HB2  3  
ATOM 5182  H HB3  . ARG A 1 58  ? -1.851  -2.179  -7.036  1.00 0.00 ?  271 ARG A HB3  3  
ATOM 5183  H HG2  . ARG A 1 58  ? -3.919  -1.297  -6.756  1.00 0.00 ?  271 ARG A HG2  3  
ATOM 5184  H HG3  . ARG A 1 58  ? -3.239  0.316   -6.675  1.00 0.00 ?  271 ARG A HG3  3  
ATOM 5185  H HD2  . ARG A 1 58  ? -4.311  0.755   -8.634  1.00 0.00 ?  271 ARG A HD2  3  
ATOM 5186  H HD3  . ARG A 1 58  ? -3.137  -0.283  -9.420  1.00 0.00 ?  271 ARG A HD3  3  
ATOM 5187  H HE   . ARG A 1 58  ? -5.299  -1.825  -8.229  1.00 0.00 ?  271 ARG A HE   3  
ATOM 5188  H HH11 . ARG A 1 58  ? -4.414  0.100   -11.039 1.00 0.00 ?  271 ARG A HH11 3  
ATOM 5189  H HH12 . ARG A 1 58  ? -5.555  -0.675  -12.088 1.00 0.00 ?  271 ARG A HH12 3  
ATOM 5190  H HH21 . ARG A 1 58  ? -6.803  -2.847  -9.612  1.00 0.00 ?  271 ARG A HH21 3  
ATOM 5191  H HH22 . ARG A 1 58  ? -6.923  -2.362  -11.271 1.00 0.00 ?  271 ARG A HH22 3  
ATOM 5192  N N    . MET A 1 59  ? -1.201  -0.582  -4.386  1.00 0.00 ?  272 MET A N    3  
ATOM 5193  C CA   . MET A 1 59  ? -0.949  -1.116  -3.058  1.00 0.00 ?  272 MET A CA   3  
ATOM 5194  C C    . MET A 1 59  ? -2.196  -1.805  -2.499  1.00 0.00 ?  272 MET A C    3  
ATOM 5195  O O    . MET A 1 59  ? -3.319  -1.386  -2.777  1.00 0.00 ?  272 MET A O    3  
ATOM 5196  C CB   . MET A 1 59  ? -0.530  0.019   -2.122  1.00 0.00 ?  272 MET A CB   3  
ATOM 5197  C CG   . MET A 1 59  ? 0.639   -0.407  -1.233  1.00 0.00 ?  272 MET A CG   3  
ATOM 5198  S SD   . MET A 1 59  ? 1.007   0.878   -0.050  1.00 0.00 ?  272 MET A SD   3  
ATOM 5199  C CE   . MET A 1 59  ? 2.239   0.047   0.938   1.00 0.00 ?  272 MET A CE   3  
ATOM 5200  H H    . MET A 1 59  ? -1.966  0.059   -4.446  1.00 0.00 ?  272 MET A H    3  
ATOM 5201  H HA   . MET A 1 59  ? -0.148  -1.844  -3.182  1.00 0.00 ?  272 MET A HA   3  
ATOM 5202  H HB2  . MET A 1 59  ? -0.246  0.893   -2.709  1.00 0.00 ?  272 MET A HB2  3  
ATOM 5203  H HB3  . MET A 1 59  ? -1.376  0.315   -1.501  1.00 0.00 ?  272 MET A HB3  3  
ATOM 5204  H HG2  . MET A 1 59  ? 0.393   -1.332  -0.712  1.00 0.00 ?  272 MET A HG2  3  
ATOM 5205  H HG3  . MET A 1 59  ? 1.518   -0.611  -1.845  1.00 0.00 ?  272 MET A HG3  3  
ATOM 5206  H HE1  . MET A 1 59  ? 2.350   0.564   1.892   1.00 0.00 ?  272 MET A HE1  3  
ATOM 5207  H HE2  . MET A 1 59  ? 1.928   -0.982  1.117   1.00 0.00 ?  272 MET A HE2  3  
ATOM 5208  H HE3  . MET A 1 59  ? 3.192   0.052   0.410   1.00 0.00 ?  272 MET A HE3  3  
ATOM 5209  N N    . PHE A 1 60  ? -1.956  -2.850  -1.720  1.00 0.00 ?  273 PHE A N    3  
ATOM 5210  C CA   . PHE A 1 60  ? -3.046  -3.601  -1.119  1.00 0.00 ?  273 PHE A CA   3  
ATOM 5211  C C    . PHE A 1 60  ? -2.781  -3.858  0.365   1.00 0.00 ?  273 PHE A C    3  
ATOM 5212  O O    . PHE A 1 60  ? -1.664  -4.203  0.750   1.00 0.00 ?  273 PHE A O    3  
ATOM 5213  C CB   . PHE A 1 60  ? -3.122  -4.942  -1.852  1.00 0.00 ?  273 PHE A CB   3  
ATOM 5214  C CG   . PHE A 1 60  ? -3.587  -4.831  -3.305  1.00 0.00 ?  273 PHE A CG   3  
ATOM 5215  C CD1  . PHE A 1 60  ? -2.677  -4.641  -4.298  1.00 0.00 ?  273 PHE A CD1  3  
ATOM 5216  C CD2  . PHE A 1 60  ? -4.910  -4.924  -3.605  1.00 0.00 ?  273 PHE A CD2  3  
ATOM 5217  C CE1  . PHE A 1 60  ? -3.108  -4.538  -5.646  1.00 0.00 ?  273 PHE A CE1  3  
ATOM 5218  C CE2  . PHE A 1 60  ? -5.342  -4.822  -4.954  1.00 0.00 ?  273 PHE A CE2  3  
ATOM 5219  C CZ   . PHE A 1 60  ? -4.432  -4.631  -5.946  1.00 0.00 ?  273 PHE A CZ   3  
ATOM 5220  H H    . PHE A 1 60  ? -1.040  -3.184  -1.499  1.00 0.00 ?  273 PHE A H    3  
ATOM 5221  H HA   . PHE A 1 60  ? -3.950  -3.001  -1.226  1.00 0.00 ?  273 PHE A HA   3  
ATOM 5222  H HB2  . PHE A 1 60  ? -2.139  -5.412  -1.830  1.00 0.00 ?  273 PHE A HB2  3  
ATOM 5223  H HB3  . PHE A 1 60  ? -3.803  -5.601  -1.312  1.00 0.00 ?  273 PHE A HB3  3  
ATOM 5224  H HD1  . PHE A 1 60  ? -1.616  -4.566  -4.058  1.00 0.00 ?  273 PHE A HD1  3  
ATOM 5225  H HD2  . PHE A 1 60  ? -5.640  -5.077  -2.809  1.00 0.00 ?  273 PHE A HD2  3  
ATOM 5226  H HE1  . PHE A 1 60  ? -2.379  -4.385  -6.442  1.00 0.00 ?  273 PHE A HE1  3  
ATOM 5227  H HE2  . PHE A 1 60  ? -6.403  -4.896  -5.194  1.00 0.00 ?  273 PHE A HE2  3  
ATOM 5228  H HZ   . PHE A 1 60  ? -4.763  -4.553  -6.982  1.00 0.00 ?  273 PHE A HZ   3  
ATOM 5229  N N    . PHE A 1 61  ? -3.826  -3.680  1.160   1.00 0.00 ?  274 PHE A N    3  
ATOM 5230  C CA   . PHE A 1 61  ? -3.720  -3.889  2.594   1.00 0.00 ?  274 PHE A CA   3  
ATOM 5231  C C    . PHE A 1 61  ? -4.764  -4.896  3.080   1.00 0.00 ?  274 PHE A C    3  
ATOM 5232  O O    . PHE A 1 61  ? -5.930  -4.822  2.694   1.00 0.00 ?  274 PHE A O    3  
ATOM 5233  C CB   . PHE A 1 61  ? -3.981  -2.538  3.263   1.00 0.00 ?  274 PHE A CB   3  
ATOM 5234  C CG   . PHE A 1 61  ? -2.917  -1.480  2.964   1.00 0.00 ?  274 PHE A CG   3  
ATOM 5235  C CD1  . PHE A 1 61  ? -1.613  -1.844  2.836   1.00 0.00 ?  274 PHE A CD1  3  
ATOM 5236  C CD2  . PHE A 1 61  ? -3.276  -0.175  2.826   1.00 0.00 ?  274 PHE A CD2  3  
ATOM 5237  C CE1  . PHE A 1 61  ? -0.626  -0.861  2.559   1.00 0.00 ?  274 PHE A CE1  3  
ATOM 5238  C CE2  . PHE A 1 61  ? -2.289  0.807   2.549   1.00 0.00 ?  274 PHE A CE2  3  
ATOM 5239  C CZ   . PHE A 1 61  ? -0.985  0.443   2.421   1.00 0.00 ?  274 PHE A CZ   3  
ATOM 5240  H H    . PHE A 1 61  ? -4.731  -3.400  0.839   1.00 0.00 ?  274 PHE A H    3  
ATOM 5241  H HA   . PHE A 1 61  ? -2.722  -4.280  2.791   1.00 0.00 ?  274 PHE A HA   3  
ATOM 5242  H HB2  . PHE A 1 61  ? -4.952  -2.165  2.938   1.00 0.00 ?  274 PHE A HB2  3  
ATOM 5243  H HB3  . PHE A 1 61  ? -4.040  -2.684  4.342   1.00 0.00 ?  274 PHE A HB3  3  
ATOM 5244  H HD1  . PHE A 1 61  ? -1.326  -2.889  2.947   1.00 0.00 ?  274 PHE A HD1  3  
ATOM 5245  H HD2  . PHE A 1 61  ? -4.322  0.116   2.929   1.00 0.00 ?  274 PHE A HD2  3  
ATOM 5246  H HE1  . PHE A 1 61  ? 0.419   -1.153  2.456   1.00 0.00 ?  274 PHE A HE1  3  
ATOM 5247  H HE2  . PHE A 1 61  ? -2.577  1.853   2.438   1.00 0.00 ?  274 PHE A HE2  3  
ATOM 5248  H HZ   . PHE A 1 61  ? -0.227  1.197   2.208   1.00 0.00 ?  274 PHE A HZ   3  
ATOM 5249  N N    . VAL A 1 62  ? -4.309  -5.814  3.920   1.00 0.00 ?  275 VAL A N    3  
ATOM 5250  C CA   . VAL A 1 62  ? -5.190  -6.834  4.463   1.00 0.00 ?  275 VAL A CA   3  
ATOM 5251  C C    . VAL A 1 62  ? -5.802  -6.330  5.771   1.00 0.00 ?  275 VAL A C    3  
ATOM 5252  O O    . VAL A 1 62  ? -5.113  -5.724  6.590   1.00 0.00 ?  275 VAL A O    3  
ATOM 5253  C CB   . VAL A 1 62  ? -4.426  -8.150  4.629   1.00 0.00 ?  275 VAL A CB   3  
ATOM 5254  C CG1  . VAL A 1 62  ? -5.208  -9.130  5.506   1.00 0.00 ?  275 VAL A CG1  3  
ATOM 5255  C CG2  . VAL A 1 62  ? -4.101  -8.770  3.268   1.00 0.00 ?  275 VAL A CG2  3  
ATOM 5256  H H    . VAL A 1 62  ? -3.360  -5.867  4.229   1.00 0.00 ?  275 VAL A H    3  
ATOM 5257  H HA   . VAL A 1 62  ? -5.989  -6.997  3.741   1.00 0.00 ?  275 VAL A HA   3  
ATOM 5258  H HB   . VAL A 1 62  ? -3.484  -7.930  5.130   1.00 0.00 ?  275 VAL A HB   3  
ATOM 5259  H HG11 . VAL A 1 62  ? -4.639  -9.339  6.412   1.00 0.00 ?  275 VAL A HG11 3  
ATOM 5260  H HG12 . VAL A 1 62  ? -6.169  -8.692  5.773   1.00 0.00 ?  275 VAL A HG12 3  
ATOM 5261  H HG13 . VAL A 1 62  ? -5.371  -10.058 4.957   1.00 0.00 ?  275 VAL A HG13 3  
ATOM 5262  H HG21 . VAL A 1 62  ? -4.861  -9.510  3.015   1.00 0.00 ?  275 VAL A HG21 3  
ATOM 5263  H HG22 . VAL A 1 62  ? -4.086  -7.990  2.507   1.00 0.00 ?  275 VAL A HG22 3  
ATOM 5264  H HG23 . VAL A 1 62  ? -3.125  -9.253  3.313   1.00 0.00 ?  275 VAL A HG23 3  
ATOM 5265  N N    . VAL A 1 63  ? -7.091  -6.597  5.926   1.00 0.00 ?  276 VAL A N    3  
ATOM 5266  C CA   . VAL A 1 63  ? -7.804  -6.178  7.120   1.00 0.00 ?  276 VAL A CA   3  
ATOM 5267  C C    . VAL A 1 63  ? -8.279  -7.414  7.886   1.00 0.00 ?  276 VAL A C    3  
ATOM 5268  O O    . VAL A 1 63  ? -8.074  -7.517  9.094   1.00 0.00 ?  276 VAL A O    3  
ATOM 5269  C CB   . VAL A 1 63  ? -8.946  -5.232  6.743   1.00 0.00 ?  276 VAL A CB   3  
ATOM 5270  C CG1  . VAL A 1 63  ? -9.442  -4.457  7.965   1.00 0.00 ?  276 VAL A CG1  3  
ATOM 5271  C CG2  . VAL A 1 63  ? -8.522  -4.279  5.623   1.00 0.00 ?  276 VAL A CG2  3  
ATOM 5272  H H    . VAL A 1 63  ? -7.644  -7.090  5.254   1.00 0.00 ?  276 VAL A H    3  
ATOM 5273  H HA   . VAL A 1 63  ? -7.102  -5.626  7.746   1.00 0.00 ?  276 VAL A HA   3  
ATOM 5274  H HB   . VAL A 1 63  ? -9.773  -5.838  6.372   1.00 0.00 ?  276 VAL A HB   3  
ATOM 5275  H HG11 . VAL A 1 63  ? -10.521 -4.580  8.060   1.00 0.00 ?  276 VAL A HG11 3  
ATOM 5276  H HG12 . VAL A 1 63  ? -8.953  -4.838  8.861   1.00 0.00 ?  276 VAL A HG12 3  
ATOM 5277  H HG13 . VAL A 1 63  ? -9.206  -3.399  7.844   1.00 0.00 ?  276 VAL A HG13 3  
ATOM 5278  H HG21 . VAL A 1 63  ? -7.443  -4.344  5.481   1.00 0.00 ?  276 VAL A HG21 3  
ATOM 5279  H HG22 . VAL A 1 63  ? -9.028  -4.557  4.699   1.00 0.00 ?  276 VAL A HG22 3  
ATOM 5280  H HG23 . VAL A 1 63  ? -8.792  -3.258  5.894   1.00 0.00 ?  276 VAL A HG23 3  
ATOM 5281  N N    . GLU A 1 64  ? -8.905  -8.321  7.151   1.00 0.00 ?  277 GLU A N    3  
ATOM 5282  C CA   . GLU A 1 64  ? -9.412  -9.547  7.745   1.00 0.00 ?  277 GLU A CA   3  
ATOM 5283  C C    . GLU A 1 64  ? -9.146  -10.735 6.819   1.00 0.00 ?  277 GLU A C    3  
ATOM 5284  O O    . GLU A 1 64  ? -9.344  -10.641 5.609   1.00 0.00 ?  277 GLU A O    3  
ATOM 5285  C CB   . GLU A 1 64  ? -10.903 -9.425  8.066   1.00 0.00 ?  277 GLU A CB   3  
ATOM 5286  C CG   . GLU A 1 64  ? -11.204 -8.104  8.778   1.00 0.00 ?  277 GLU A CG   3  
ATOM 5287  C CD   . GLU A 1 64  ? -10.902 -8.207  10.274  1.00 0.00 ?  277 GLU A CD   3  
ATOM 5288  O OE1  . GLU A 1 64  ? -9.745  -8.431  10.659  1.00 0.00 ?  277 GLU A OE1  3  
ATOM 5289  O OE2  . GLU A 1 64  ? -11.921 -8.044  11.049  1.00 0.00 -1 277 GLU A OE2  3  
ATOM 5290  H H    . GLU A 1 64  ? -9.068  -8.230  6.168   1.00 0.00 ?  277 GLU A H    3  
ATOM 5291  H HA   . GLU A 1 64  ? -8.855  -9.669  8.674   1.00 0.00 ?  277 GLU A HA   3  
ATOM 5292  H HB2  . GLU A 1 64  ? -11.483 -9.487  7.145   1.00 0.00 ?  277 GLU A HB2  3  
ATOM 5293  H HB3  . GLU A 1 64  ? -11.213 -10.260 8.695   1.00 0.00 ?  277 GLU A HB3  3  
ATOM 5294  H HG2  . GLU A 1 64  ? -10.609 -7.305  8.337   1.00 0.00 ?  277 GLU A HG2  3  
ATOM 5295  H HG3  . GLU A 1 64  ? -12.252 -7.840  8.632   1.00 0.00 ?  277 GLU A HG3  3  
ATOM 5296  H HE2  . GLU A 1 64  ? -11.618 -7.950  11.997  1.00 0.00 ?  277 GLU A HE2  3  
ATOM 5297  N N    . GLY A 1 65  ? -8.700  -11.827 7.424   1.00 0.00 ?  278 GLY A N    3  
ATOM 5298  C CA   . GLY A 1 65  ? -8.405  -13.033 6.669   1.00 0.00 ?  278 GLY A CA   3  
ATOM 5299  C C    . GLY A 1 65  ? -6.900  -13.306 6.640   1.00 0.00 ?  278 GLY A C    3  
ATOM 5300  O O    . GLY A 1 65  ? -6.128  -12.622 7.309   1.00 0.00 ?  278 GLY A O    3  
ATOM 5301  H H    . GLY A 1 65  ? -8.541  -11.896 8.409   1.00 0.00 ?  278 GLY A H    3  
ATOM 5302  H HA2  . GLY A 1 65  ? -8.924  -13.881 7.114   1.00 0.00 ?  278 GLY A HA2  3  
ATOM 5303  H HA3  . GLY A 1 65  ? -8.779  -12.929 5.650   1.00 0.00 ?  278 GLY A HA3  3  
ATOM 5304  N N    . SER A 1 66  ? -6.528  -14.309 5.857   1.00 0.00 ?  279 SER A N    3  
ATOM 5305  C CA   . SER A 1 66  ? -5.129  -14.682 5.732   1.00 0.00 ?  279 SER A CA   3  
ATOM 5306  C C    . SER A 1 66  ? -4.774  -14.895 4.259   1.00 0.00 ?  279 SER A C    3  
ATOM 5307  O O    . SER A 1 66  ? -5.436  -15.661 3.562   1.00 0.00 ?  279 SER A O    3  
ATOM 5308  C CB   . SER A 1 66  ? -4.821  -15.944 6.540   1.00 0.00 ?  279 SER A CB   3  
ATOM 5309  O OG   . SER A 1 66  ? -3.426  -16.089 6.793   1.00 0.00 ?  279 SER A OG   3  
ATOM 5310  H H    . SER A 1 66  ? -7.162  -14.861 5.316   1.00 0.00 ?  279 SER A H    3  
ATOM 5311  H HA   . SER A 1 66  ? -4.569  -13.842 6.143   1.00 0.00 ?  279 SER A HA   3  
ATOM 5312  H HB2  . SER A 1 66  ? -5.359  -15.909 7.487   1.00 0.00 ?  279 SER A HB2  3  
ATOM 5313  H HB3  . SER A 1 66  ? -5.184  -16.818 6.000   1.00 0.00 ?  279 SER A HB3  3  
ATOM 5314  H HG   . SER A 1 66  ? -3.245  -16.978 7.214   1.00 0.00 ?  279 SER A HG   3  
ATOM 5315  N N    . VAL A 1 67  ? -3.729  -14.203 3.829   1.00 0.00 ?  280 VAL A N    3  
ATOM 5316  C CA   . VAL A 1 67  ? -3.278  -14.306 2.452   1.00 0.00 ?  280 VAL A CA   3  
ATOM 5317  C C    . VAL A 1 67  ? -2.015  -15.168 2.397   1.00 0.00 ?  280 VAL A C    3  
ATOM 5318  O O    . VAL A 1 67  ? -1.400  -15.441 3.427   1.00 0.00 ?  280 VAL A O    3  
ATOM 5319  C CB   . VAL A 1 67  ? -3.075  -12.910 1.862   1.00 0.00 ?  280 VAL A CB   3  
ATOM 5320  C CG1  . VAL A 1 67  ? -4.346  -12.068 1.994   1.00 0.00 ?  280 VAL A CG1  3  
ATOM 5321  C CG2  . VAL A 1 67  ? -1.882  -12.207 2.513   1.00 0.00 ?  280 VAL A CG2  3  
ATOM 5322  H H    . VAL A 1 67  ? -3.196  -13.581 4.403   1.00 0.00 ?  280 VAL A H    3  
ATOM 5323  H HA   . VAL A 1 67  ? -4.066  -14.802 1.885   1.00 0.00 ?  280 VAL A HA   3  
ATOM 5324  H HB   . VAL A 1 67  ? -2.857  -13.023 0.800   1.00 0.00 ?  280 VAL A HB   3  
ATOM 5325  H HG11 . VAL A 1 67  ? -4.576  -11.921 3.049   1.00 0.00 ?  280 VAL A HG11 3  
ATOM 5326  H HG12 . VAL A 1 67  ? -4.192  -11.100 1.517   1.00 0.00 ?  280 VAL A HG12 3  
ATOM 5327  H HG13 . VAL A 1 67  ? -5.175  -12.584 1.509   1.00 0.00 ?  280 VAL A HG13 3  
ATOM 5328  H HG21 . VAL A 1 67  ? -1.767  -11.212 2.083   1.00 0.00 ?  280 VAL A HG21 3  
ATOM 5329  H HG22 . VAL A 1 67  ? -2.053  -12.121 3.586   1.00 0.00 ?  280 VAL A HG22 3  
ATOM 5330  H HG23 . VAL A 1 67  ? -0.977  -12.787 2.335   1.00 0.00 ?  280 VAL A HG23 3  
ATOM 5331  N N    . SER A 1 68  ? -1.666  -15.573 1.185   1.00 0.00 ?  281 SER A N    3  
ATOM 5332  C CA   . SER A 1 68  ? -0.487  -16.398 0.982   1.00 0.00 ?  281 SER A CA   3  
ATOM 5333  C C    . SER A 1 68  ? 0.386   -15.801 -0.123  1.00 0.00 ?  281 SER A C    3  
ATOM 5334  O O    . SER A 1 68  ? -0.109  -15.084 -0.991  1.00 0.00 ?  281 SER A O    3  
ATOM 5335  C CB   . SER A 1 68  ? -0.875  -17.836 0.633   1.00 0.00 ?  281 SER A CB   3  
ATOM 5336  O OG   . SER A 1 68  ? 0.260   -18.627 0.290   1.00 0.00 ?  281 SER A OG   3  
ATOM 5337  H H    . SER A 1 68  ? -2.171  -15.346 0.352   1.00 0.00 ?  281 SER A H    3  
ATOM 5338  H HA   . SER A 1 68  ? 0.041   -16.386 1.936   1.00 0.00 ?  281 SER A HA   3  
ATOM 5339  H HB2  . SER A 1 68  ? -1.390  -18.289 1.480   1.00 0.00 ?  281 SER A HB2  3  
ATOM 5340  H HB3  . SER A 1 68  ? -1.578  -17.830 -0.200  1.00 0.00 ?  281 SER A HB3  3  
ATOM 5341  H HG   . SER A 1 68  ? 1.045   -18.358 0.848   1.00 0.00 ?  281 SER A HG   3  
ATOM 5342  N N    . VAL A 1 69  ? 1.671   -16.118 -0.054  1.00 0.00 ?  282 VAL A N    3  
ATOM 5343  C CA   . VAL A 1 69  ? 2.618   -15.621 -1.038  1.00 0.00 ?  282 VAL A CA   3  
ATOM 5344  C C    . VAL A 1 69  ? 3.235   -16.803 -1.788  1.00 0.00 ?  282 VAL A C    3  
ATOM 5345  O O    . VAL A 1 69  ? 3.742   -17.739 -1.170  1.00 0.00 ?  282 VAL A O    3  
ATOM 5346  C CB   . VAL A 1 69  ? 3.663   -14.734 -0.358  1.00 0.00 ?  282 VAL A CB   3  
ATOM 5347  C CG1  . VAL A 1 69  ? 4.109   -13.602 -1.286  1.00 0.00 ?  282 VAL A CG1  3  
ATOM 5348  C CG2  . VAL A 1 69  ? 3.133   -14.180 0.967   1.00 0.00 ?  282 VAL A CG2  3  
ATOM 5349  H H    . VAL A 1 69  ? 2.066   -16.701 0.656   1.00 0.00 ?  282 VAL A H    3  
ATOM 5350  H HA   . VAL A 1 69  ? 2.064   -15.007 -1.747  1.00 0.00 ?  282 VAL A HA   3  
ATOM 5351  H HB   . VAL A 1 69  ? 4.534   -15.350 -0.138  1.00 0.00 ?  282 VAL A HB   3  
ATOM 5352  H HG11 . VAL A 1 69  ? 4.926   -13.951 -1.917  1.00 0.00 ?  282 VAL A HG11 3  
ATOM 5353  H HG12 . VAL A 1 69  ? 3.272   -13.295 -1.913  1.00 0.00 ?  282 VAL A HG12 3  
ATOM 5354  H HG13 . VAL A 1 69  ? 4.446   -12.755 -0.689  1.00 0.00 ?  282 VAL A HG13 3  
ATOM 5355  H HG21 . VAL A 1 69  ? 3.927   -13.635 1.476   1.00 0.00 ?  282 VAL A HG21 3  
ATOM 5356  H HG22 . VAL A 1 69  ? 2.298   -13.508 0.771   1.00 0.00 ?  282 VAL A HG22 3  
ATOM 5357  H HG23 . VAL A 1 69  ? 2.796   -15.004 1.596   1.00 0.00 ?  282 VAL A HG23 3  
ATOM 5358  N N    . ALA A 1 70  ? 3.172   -16.724 -3.109  1.00 0.00 ?  283 ALA A N    3  
ATOM 5359  C CA   . ALA A 1 70  ? 3.718   -17.775 -3.949  1.00 0.00 ?  283 ALA A CA   3  
ATOM 5360  C C    . ALA A 1 70  ? 5.242   -17.645 -3.997  1.00 0.00 ?  283 ALA A C    3  
ATOM 5361  O O    . ALA A 1 70  ? 5.774   -16.802 -4.719  1.00 0.00 ?  283 ALA A O    3  
ATOM 5362  C CB   . ALA A 1 70  ? 3.083   -17.701 -5.339  1.00 0.00 ?  283 ALA A CB   3  
ATOM 5363  H H    . ALA A 1 70  ? 2.758   -15.959 -3.603  1.00 0.00 ?  283 ALA A H    3  
ATOM 5364  H HA   . ALA A 1 70  ? 3.458   -18.732 -3.495  1.00 0.00 ?  283 ALA A HA   3  
ATOM 5365  H HB1  . ALA A 1 70  ? 2.484   -18.594 -5.513  1.00 0.00 ?  283 ALA A HB1  3  
ATOM 5366  H HB2  . ALA A 1 70  ? 2.446   -16.818 -5.400  1.00 0.00 ?  283 ALA A HB2  3  
ATOM 5367  H HB3  . ALA A 1 70  ? 3.867   -17.636 -6.093  1.00 0.00 ?  283 ALA A HB3  3  
ATOM 5368  N N    . THR A 1 71  ? 5.901   -18.490 -3.218  1.00 0.00 ?  284 THR A N    3  
ATOM 5369  C CA   . THR A 1 71  ? 7.353   -18.479 -3.163  1.00 0.00 ?  284 THR A CA   3  
ATOM 5370  C C    . THR A 1 71  ? 7.887   -19.887 -2.889  1.00 0.00 ?  284 THR A C    3  
ATOM 5371  O O    . THR A 1 71  ? 7.141   -20.862 -2.961  1.00 0.00 ?  284 THR A O    3  
ATOM 5372  C CB   . THR A 1 71  ? 7.779   -17.453 -2.111  1.00 0.00 ?  284 THR A CB   3  
ATOM 5373  O OG1  . THR A 1 71  ? 7.902   -18.215 -0.913  1.00 0.00 ?  284 THR A OG1  3  
ATOM 5374  C CG2  . THR A 1 71  ? 6.673   -16.443 -1.797  1.00 0.00 ?  284 THR A CG2  3  
ATOM 5375  H H    . THR A 1 71  ? 5.461   -19.172 -2.634  1.00 0.00 ?  284 THR A H    3  
ATOM 5376  H HA   . THR A 1 71  ? 7.732   -18.178 -4.139  1.00 0.00 ?  284 THR A HA   3  
ATOM 5377  H HB   . THR A 1 71  ? 8.696   -16.946 -2.410  1.00 0.00 ?  284 THR A HB   3  
ATOM 5378  H HG1  . THR A 1 71  ? 8.062   -17.607 -0.136  1.00 0.00 ?  284 THR A HG1  3  
ATOM 5379  H HG21 . THR A 1 71  ? 6.441   -15.869 -2.694  1.00 0.00 ?  284 THR A HG21 3  
ATOM 5380  H HG22 . THR A 1 71  ? 5.780   -16.973 -1.464  1.00 0.00 ?  284 THR A HG22 3  
ATOM 5381  H HG23 . THR A 1 71  ? 7.010   -15.768 -1.010  1.00 0.00 ?  284 THR A HG23 3  
ATOM 5382  N N    . PRO A 1 72  ? 9.208   -19.949 -2.573  1.00 0.00 ?  285 PRO A N    3  
ATOM 5383  C CA   . PRO A 1 72  ? 9.850   -21.221 -2.288  1.00 0.00 ?  285 PRO A CA   3  
ATOM 5384  C C    . PRO A 1 72  ? 9.458   -21.735 -0.901  1.00 0.00 ?  285 PRO A C    3  
ATOM 5385  O O    . PRO A 1 72  ? 9.962   -22.763 -0.451  1.00 0.00 ?  285 PRO A O    3  
ATOM 5386  C CB   . PRO A 1 72  ? 11.339  -20.948 -2.421  1.00 0.00 ?  285 PRO A CB   3  
ATOM 5387  C CG   . PRO A 1 72  ? 11.498  -19.440 -2.317  1.00 0.00 ?  285 PRO A CG   3  
ATOM 5388  C CD   . PRO A 1 72  ? 10.122  -18.815 -2.477  1.00 0.00 ?  285 PRO A CD   3  
ATOM 5389  H HA   . PRO A 1 72  ? 9.541   -21.918 -2.935  1.00 0.00 ?  285 PRO A HA   3  
ATOM 5390  H HB2  . PRO A 1 72  ? 11.901  -21.455 -1.636  1.00 0.00 ?  285 PRO A HB2  3  
ATOM 5391  H HB3  . PRO A 1 72  ? 11.720  -21.316 -3.374  1.00 0.00 ?  285 PRO A HB3  3  
ATOM 5392  H HG2  . PRO A 1 72  ? 11.931  -19.168 -1.355  1.00 0.00 ?  285 PRO A HG2  3  
ATOM 5393  H HG3  . PRO A 1 72  ? 12.176  -19.074 -3.087  1.00 0.00 ?  285 PRO A HG3  3  
ATOM 5394  H HD2  . PRO A 1 72  ? 9.875   -18.178 -1.628  1.00 0.00 ?  285 PRO A HD2  3  
ATOM 5395  H HD3  . PRO A 1 72  ? 10.072  -18.191 -3.369  1.00 0.00 ?  285 PRO A HD3  3  
ATOM 5396  N N    . ASN A 1 73  ? 8.562   -20.997 -0.263  1.00 0.00 ?  286 ASN A N    3  
ATOM 5397  C CA   . ASN A 1 73  ? 8.097   -21.365 1.063   1.00 0.00 ?  286 ASN A CA   3  
ATOM 5398  C C    . ASN A 1 73  ? 6.663   -20.865 1.253   1.00 0.00 ?  286 ASN A C    3  
ATOM 5399  O O    . ASN A 1 73  ? 6.239   -19.920 0.590   1.00 0.00 ?  286 ASN A O    3  
ATOM 5400  C CB   . ASN A 1 73  ? 8.967   -20.728 2.149   1.00 0.00 ?  286 ASN A CB   3  
ATOM 5401  C CG   . ASN A 1 73  ? 10.453  -20.888 1.824   1.00 0.00 ?  286 ASN A CG   3  
ATOM 5402  O OD1  . ASN A 1 73  ? 11.027  -20.151 1.039   1.00 0.00 ?  286 ASN A OD1  3  
ATOM 5403  N ND2  . ASN A 1 73  ? 11.043  -21.890 2.470   1.00 0.00 ?  286 ASN A ND2  3  
ATOM 5404  H H    . ASN A 1 73  ? 8.157   -20.162 -0.636  1.00 0.00 ?  286 ASN A H    3  
ATOM 5405  H HA   . ASN A 1 73  ? 8.168   -22.452 1.100   1.00 0.00 ?  286 ASN A HA   3  
ATOM 5406  H HB2  . ASN A 1 73  ? 8.723   -19.670 2.241   1.00 0.00 ?  286 ASN A HB2  3  
ATOM 5407  H HB3  . ASN A 1 73  ? 8.750   -21.191 3.112   1.00 0.00 ?  286 ASN A HB3  3  
ATOM 5408  H HD21 . ASN A 1 73  ? 10.515  -22.457 3.102   1.00 0.00 ?  286 ASN A HD21 3  
ATOM 5409  H HD22 . ASN A 1 73  ? 12.015  -22.075 2.325   1.00 0.00 ?  286 ASN A HD22 3  
ATOM 5410  N N    . PRO A 1 74  ? 5.938   -21.539 2.185   1.00 0.00 ?  287 PRO A N    3  
ATOM 5411  C CA   . PRO A 1 74  ? 4.561   -21.173 2.471   1.00 0.00 ?  287 PRO A CA   3  
ATOM 5412  C C    . PRO A 1 74  ? 4.495   -19.888 3.299   1.00 0.00 ?  287 PRO A C    3  
ATOM 5413  O O    . PRO A 1 74  ? 4.579   -19.931 4.525   1.00 0.00 ?  287 PRO A O    3  
ATOM 5414  C CB   . PRO A 1 74  ? 3.976   -22.376 3.193   1.00 0.00 ?  287 PRO A CB   3  
ATOM 5415  C CG   . PRO A 1 74  ? 5.165   -23.179 3.696   1.00 0.00 ?  287 PRO A CG   3  
ATOM 5416  C CD   . PRO A 1 74  ? 6.408   -22.663 2.990   1.00 0.00 ?  287 PRO A CD   3  
ATOM 5417  H HA   . PRO A 1 74  ? 4.071   -20.977 1.621   1.00 0.00 ?  287 PRO A HA   3  
ATOM 5418  H HB2  . PRO A 1 74  ? 3.338   -22.063 4.020   1.00 0.00 ?  287 PRO A HB2  3  
ATOM 5419  H HB3  . PRO A 1 74  ? 3.358   -22.972 2.522   1.00 0.00 ?  287 PRO A HB3  3  
ATOM 5420  H HG2  . PRO A 1 74  ? 5.268   -23.072 4.776   1.00 0.00 ?  287 PRO A HG2  3  
ATOM 5421  H HG3  . PRO A 1 74  ? 5.022   -24.240 3.493   1.00 0.00 ?  287 PRO A HG3  3  
ATOM 5422  H HD2  . PRO A 1 74  ? 7.168   -22.348 3.704   1.00 0.00 ?  287 PRO A HD2  3  
ATOM 5423  H HD3  . PRO A 1 74  ? 6.858   -23.436 2.366   1.00 0.00 ?  287 PRO A HD3  3  
ATOM 5424  N N    . VAL A 1 75  ? 4.346   -18.776 2.595   1.00 0.00 ?  288 VAL A N    3  
ATOM 5425  C CA   . VAL A 1 75  ? 4.268   -17.481 3.249   1.00 0.00 ?  288 VAL A CA   3  
ATOM 5426  C C    . VAL A 1 75  ? 2.800   -17.071 3.387   1.00 0.00 ?  288 VAL A C    3  
ATOM 5427  O O    . VAL A 1 75  ? 2.096   -16.927 2.389   1.00 0.00 ?  288 VAL A O    3  
ATOM 5428  C CB   . VAL A 1 75  ? 5.105   -16.455 2.482   1.00 0.00 ?  288 VAL A CB   3  
ATOM 5429  C CG1  . VAL A 1 75  ? 5.521   -15.297 3.391   1.00 0.00 ?  288 VAL A CG1  3  
ATOM 5430  C CG2  . VAL A 1 75  ? 6.328   -17.115 1.841   1.00 0.00 ?  288 VAL A CG2  3  
ATOM 5431  H H    . VAL A 1 75  ? 4.278   -18.750 1.597   1.00 0.00 ?  288 VAL A H    3  
ATOM 5432  H HA   . VAL A 1 75  ? 4.697   -17.590 4.245   1.00 0.00 ?  288 VAL A HA   3  
ATOM 5433  H HB   . VAL A 1 75  ? 4.486   -16.049 1.682   1.00 0.00 ?  288 VAL A HB   3  
ATOM 5434  H HG11 . VAL A 1 75  ? 6.122   -15.680 4.216   1.00 0.00 ?  288 VAL A HG11 3  
ATOM 5435  H HG12 . VAL A 1 75  ? 6.106   -14.578 2.818   1.00 0.00 ?  288 VAL A HG12 3  
ATOM 5436  H HG13 . VAL A 1 75  ? 4.630   -14.808 3.786   1.00 0.00 ?  288 VAL A HG13 3  
ATOM 5437  H HG21 . VAL A 1 75  ? 6.008   -17.739 1.006   1.00 0.00 ?  288 VAL A HG21 3  
ATOM 5438  H HG22 . VAL A 1 75  ? 7.008   -16.344 1.478   1.00 0.00 ?  288 VAL A HG22 3  
ATOM 5439  H HG23 . VAL A 1 75  ? 6.838   -17.732 2.581   1.00 0.00 ?  288 VAL A HG23 3  
ATOM 5440  N N    . GLU A 1 76  ? 2.383   -16.896 4.632   1.00 0.00 ?  289 GLU A N    3  
ATOM 5441  C CA   . GLU A 1 76  ? 1.012   -16.506 4.914   1.00 0.00 ?  289 GLU A CA   3  
ATOM 5442  C C    . GLU A 1 76  ? 0.985   -15.230 5.758   1.00 0.00 ?  289 GLU A C    3  
ATOM 5443  O O    . GLU A 1 76  ? 1.741   -15.103 6.721   1.00 0.00 ?  289 GLU A O    3  
ATOM 5444  C CB   . GLU A 1 76  ? 0.251   -17.638 5.607   1.00 0.00 ?  289 GLU A CB   3  
ATOM 5445  C CG   . GLU A 1 76  ? -0.331  -18.615 4.584   1.00 0.00 ?  289 GLU A CG   3  
ATOM 5446  C CD   . GLU A 1 76  ? -0.696  -19.947 5.243   1.00 0.00 ?  289 GLU A CD   3  
ATOM 5447  O OE1  . GLU A 1 76  ? 0.180   -20.622 5.803   1.00 0.00 ?  289 GLU A OE1  3  
ATOM 5448  O OE2  . GLU A 1 76  ? -1.941  -20.273 5.159   1.00 0.00 -1 289 GLU A OE2  3  
ATOM 5449  H H    . GLU A 1 76  ? 2.962   -17.016 5.439   1.00 0.00 ?  289 GLU A H    3  
ATOM 5450  H HA   . GLU A 1 76  ? 0.559   -16.315 3.941   1.00 0.00 ?  289 GLU A HA   3  
ATOM 5451  H HB2  . GLU A 1 76  ? 0.920   -18.170 6.283   1.00 0.00 ?  289 GLU A HB2  3  
ATOM 5452  H HB3  . GLU A 1 76  ? -0.552  -17.222 6.216   1.00 0.00 ?  289 GLU A HB3  3  
ATOM 5453  H HG2  . GLU A 1 76  ? -1.217  -18.179 4.122   1.00 0.00 ?  289 GLU A HG2  3  
ATOM 5454  H HG3  . GLU A 1 76  ? 0.393   -18.786 3.787   1.00 0.00 ?  289 GLU A HG3  3  
ATOM 5455  H HE2  . GLU A 1 76  ? -2.312  -19.983 4.277   1.00 0.00 ?  289 GLU A HE2  3  
ATOM 5456  N N    . LEU A 1 77  ? 0.108   -14.318 5.367   1.00 0.00 ?  290 LEU A N    3  
ATOM 5457  C CA   . LEU A 1 77  ? -0.027  -13.057 6.076   1.00 0.00 ?  290 LEU A CA   3  
ATOM 5458  C C    . LEU A 1 77  ? -1.418  -12.978 6.707   1.00 0.00 ?  290 LEU A C    3  
ATOM 5459  O O    . LEU A 1 77  ? -2.399  -13.428 6.117   1.00 0.00 ?  290 LEU A O    3  
ATOM 5460  C CB   . LEU A 1 77  ? 0.294   -11.884 5.147   1.00 0.00 ?  290 LEU A CB   3  
ATOM 5461  C CG   . LEU A 1 77  ? 1.776   -11.534 4.996   1.00 0.00 ?  290 LEU A CG   3  
ATOM 5462  C CD1  . LEU A 1 77  ? 2.429   -11.312 6.362   1.00 0.00 ?  290 LEU A CD1  3  
ATOM 5463  C CD2  . LEU A 1 77  ? 2.510   -12.598 4.177   1.00 0.00 ?  290 LEU A CD2  3  
ATOM 5464  H H    . LEU A 1 77  ? -0.503  -14.430 4.583   1.00 0.00 ?  290 LEU A H    3  
ATOM 5465  H HA   . LEU A 1 77  ? 0.716   -13.049 6.873   1.00 0.00 ?  290 LEU A HA   3  
ATOM 5466  H HB2  . LEU A 1 77  ? -0.108  -12.107 4.160   1.00 0.00 ?  290 LEU A HB2  3  
ATOM 5467  H HB3  . LEU A 1 77  ? -0.231  -11.002 5.514   1.00 0.00 ?  290 LEU A HB3  3  
ATOM 5468  H HG   . LEU A 1 77  ? 1.852   -10.596 4.447   1.00 0.00 ?  290 LEU A HG   3  
ATOM 5469  H HD11 . LEU A 1 77  ? 1.667   -11.031 7.088   1.00 0.00 ?  290 LEU A HD11 3  
ATOM 5470  H HD12 . LEU A 1 77  ? 2.917   -12.232 6.685   1.00 0.00 ?  290 LEU A HD12 3  
ATOM 5471  H HD13 . LEU A 1 77  ? 3.170   -10.516 6.286   1.00 0.00 ?  290 LEU A HD13 3  
ATOM 5472  H HD21 . LEU A 1 77  ? 1.789   -13.316 3.786   1.00 0.00 ?  290 LEU A HD21 3  
ATOM 5473  H HD22 . LEU A 1 77  ? 3.034   -12.121 3.348   1.00 0.00 ?  290 LEU A HD22 3  
ATOM 5474  H HD23 . LEU A 1 77  ? 3.229   -13.115 4.812   1.00 0.00 ?  290 LEU A HD23 3  
ATOM 5475  N N    . GLY A 1 78  ? -1.460  -12.402 7.900   1.00 0.00 ?  291 GLY A N    3  
ATOM 5476  C CA   . GLY A 1 78  ? -2.714  -12.258 8.618   1.00 0.00 ?  291 GLY A CA   3  
ATOM 5477  C C    . GLY A 1 78  ? -3.300  -10.858 8.424   1.00 0.00 ?  291 GLY A C    3  
ATOM 5478  O O    . GLY A 1 78  ? -2.911  -10.140 7.504   1.00 0.00 ?  291 GLY A O    3  
ATOM 5479  H H    . GLY A 1 78  ? -0.657  -12.038 8.373   1.00 0.00 ?  291 GLY A H    3  
ATOM 5480  H HA2  . GLY A 1 78  ? -3.426  -13.005 8.268   1.00 0.00 ?  291 GLY A HA2  3  
ATOM 5481  H HA3  . GLY A 1 78  ? -2.553  -12.444 9.680   1.00 0.00 ?  291 GLY A HA3  3  
ATOM 5482  N N    . PRO A 1 79  ? -4.251  -10.502 9.329   1.00 0.00 ?  292 PRO A N    3  
ATOM 5483  C CA   . PRO A 1 79  ? -4.894  -9.201  9.266   1.00 0.00 ?  292 PRO A CA   3  
ATOM 5484  C C    . PRO A 1 79  ? -3.956  -8.101  9.767   1.00 0.00 ?  292 PRO A C    3  
ATOM 5485  O O    . PRO A 1 79  ? -3.170  -8.322  10.687  1.00 0.00 ?  292 PRO A O    3  
ATOM 5486  C CB   . PRO A 1 79  ? -6.150  -9.341  10.111  1.00 0.00 ?  292 PRO A CB   3  
ATOM 5487  C CG   . PRO A 1 79  ? -5.927  -10.562 10.989  1.00 0.00 ?  292 PRO A CG   3  
ATOM 5488  C CD   . PRO A 1 79  ? -4.737  -11.326 10.431  1.00 0.00 ?  292 PRO A CD   3  
ATOM 5489  H HA   . PRO A 1 79  ? -5.110  -8.965  8.318   1.00 0.00 ?  292 PRO A HA   3  
ATOM 5490  H HB2  . PRO A 1 79  ? -6.316  -8.450  10.716  1.00 0.00 ?  292 PRO A HB2  3  
ATOM 5491  H HB3  . PRO A 1 79  ? -7.032  -9.468  9.482   1.00 0.00 ?  292 PRO A HB3  3  
ATOM 5492  H HG2  . PRO A 1 79  ? -5.739  -10.261 12.020  1.00 0.00 ?  292 PRO A HG2  3  
ATOM 5493  H HG3  . PRO A 1 79  ? -6.816  -11.193 10.998  1.00 0.00 ?  292 PRO A HG3  3  
ATOM 5494  H HD2  . PRO A 1 79  ? -3.967  -11.468 11.190  1.00 0.00 ?  292 PRO A HD2  3  
ATOM 5495  H HD3  . PRO A 1 79  ? -5.030  -12.317 10.086  1.00 0.00 ?  292 PRO A HD3  3  
ATOM 5496  N N    . GLY A 1 80  ? -4.071  -6.939  9.141   1.00 0.00 ?  293 GLY A N    3  
ATOM 5497  C CA   . GLY A 1 80  ? -3.243  -5.804  9.512   1.00 0.00 ?  293 GLY A CA   3  
ATOM 5498  C C    . GLY A 1 80  ? -1.945  -5.784  8.703   1.00 0.00 ?  293 GLY A C    3  
ATOM 5499  O O    . GLY A 1 80  ? -1.130  -4.875  8.853   1.00 0.00 ?  293 GLY A O    3  
ATOM 5500  H H    . GLY A 1 80  ? -4.714  -6.767  8.395   1.00 0.00 ?  293 GLY A H    3  
ATOM 5501  H HA2  . GLY A 1 80  ? -3.794  -4.878  9.347   1.00 0.00 ?  293 GLY A HA2  3  
ATOM 5502  H HA3  . GLY A 1 80  ? -3.012  -5.851  10.576  1.00 0.00 ?  293 GLY A HA3  3  
ATOM 5503  N N    . ALA A 1 81  ? -1.794  -6.796  7.862   1.00 0.00 ?  294 ALA A N    3  
ATOM 5504  C CA   . ALA A 1 81  ? -0.610  -6.907  7.028   1.00 0.00 ?  294 ALA A CA   3  
ATOM 5505  C C    . ALA A 1 81  ? -0.795  -6.055  5.770   1.00 0.00 ?  294 ALA A C    3  
ATOM 5506  O O    . ALA A 1 81  ? -1.879  -6.028  5.189   1.00 0.00 ?  294 ALA A O    3  
ATOM 5507  C CB   . ALA A 1 81  ? -0.349  -8.379  6.702   1.00 0.00 ?  294 ALA A CB   3  
ATOM 5508  H H    . ALA A 1 81  ? -2.463  -7.531  7.745   1.00 0.00 ?  294 ALA A H    3  
ATOM 5509  H HA   . ALA A 1 81  ? 0.235   -6.519  7.598   1.00 0.00 ?  294 ALA A HA   3  
ATOM 5510  H HB1  . ALA A 1 81  ? 0.725   -8.552  6.638   1.00 0.00 ?  294 ALA A HB1  3  
ATOM 5511  H HB2  . ALA A 1 81  ? -0.773  -9.005  7.487   1.00 0.00 ?  294 ALA A HB2  3  
ATOM 5512  H HB3  . ALA A 1 81  ? -0.815  -8.627  5.748   1.00 0.00 ?  294 ALA A HB3  3  
ATOM 5513  N N    . PHE A 1 82  ? 0.279   -5.381  5.386   1.00 0.00 ?  295 PHE A N    3  
ATOM 5514  C CA   . PHE A 1 82  ? 0.248   -4.531  4.208   1.00 0.00 ?  295 PHE A CA   3  
ATOM 5515  C C    . PHE A 1 82  ? 1.374   -4.895  3.240   1.00 0.00 ?  295 PHE A C    3  
ATOM 5516  O O    . PHE A 1 82  ? 2.415   -5.403  3.655   1.00 0.00 ?  295 PHE A O    3  
ATOM 5517  C CB   . PHE A 1 82  ? 0.450   -3.093  4.689   1.00 0.00 ?  295 PHE A CB   3  
ATOM 5518  C CG   . PHE A 1 82  ? 1.384   -2.965  5.894   1.00 0.00 ?  295 PHE A CG   3  
ATOM 5519  C CD1  . PHE A 1 82  ? 0.903   -3.158  7.151   1.00 0.00 ?  295 PHE A CD1  3  
ATOM 5520  C CD2  . PHE A 1 82  ? 2.696   -2.658  5.707   1.00 0.00 ?  295 PHE A CD2  3  
ATOM 5521  C CE1  . PHE A 1 82  ? 1.771   -3.039  8.269   1.00 0.00 ?  295 PHE A CE1  3  
ATOM 5522  C CE2  . PHE A 1 82  ? 3.563   -2.539  6.825   1.00 0.00 ?  295 PHE A CE2  3  
ATOM 5523  C CZ   . PHE A 1 82  ? 3.082   -2.732  8.082   1.00 0.00 ?  295 PHE A CZ   3  
ATOM 5524  H H    . PHE A 1 82  ? 1.157   -5.409  5.864   1.00 0.00 ?  295 PHE A H    3  
ATOM 5525  H HA   . PHE A 1 82  ? -0.714  -4.689  3.720   1.00 0.00 ?  295 PHE A HA   3  
ATOM 5526  H HB2  . PHE A 1 82  ? 0.849   -2.498  3.867   1.00 0.00 ?  295 PHE A HB2  3  
ATOM 5527  H HB3  . PHE A 1 82  ? -0.520  -2.667  4.948   1.00 0.00 ?  295 PHE A HB3  3  
ATOM 5528  H HD1  . PHE A 1 82  ? -0.148  -3.404  7.301   1.00 0.00 ?  295 PHE A HD1  3  
ATOM 5529  H HD2  . PHE A 1 82  ? 3.081   -2.503  4.699   1.00 0.00 ?  295 PHE A HD2  3  
ATOM 5530  H HE1  . PHE A 1 82  ? 1.385   -3.194  9.277   1.00 0.00 ?  295 PHE A HE1  3  
ATOM 5531  H HE2  . PHE A 1 82  ? 4.615   -2.293  6.676   1.00 0.00 ?  295 PHE A HE2  3  
ATOM 5532  H HZ   . PHE A 1 82  ? 3.748   -2.641  8.941   1.00 0.00 ?  295 PHE A HZ   3  
ATOM 5533  N N    . PHE A 1 83  ? 1.129   -4.622  1.967   1.00 0.00 ?  296 PHE A N    3  
ATOM 5534  C CA   . PHE A 1 83  ? 2.110   -4.914  0.935   1.00 0.00 ?  296 PHE A CA   3  
ATOM 5535  C C    . PHE A 1 83  ? 1.826   -4.110  -0.335  1.00 0.00 ?  296 PHE A C    3  
ATOM 5536  O O    . PHE A 1 83  ? 0.674   -3.796  -0.631  1.00 0.00 ?  296 PHE A O    3  
ATOM 5537  C CB   . PHE A 1 83  ? 1.992   -6.406  0.617   1.00 0.00 ?  296 PHE A CB   3  
ATOM 5538  C CG   . PHE A 1 83  ? 0.603   -6.833  0.140   1.00 0.00 ?  296 PHE A CG   3  
ATOM 5539  C CD1  . PHE A 1 83  ? -0.393  -7.039  1.043   1.00 0.00 ?  296 PHE A CD1  3  
ATOM 5540  C CD2  . PHE A 1 83  ? 0.364   -7.008  -1.188  1.00 0.00 ?  296 PHE A CD2  3  
ATOM 5541  C CE1  . PHE A 1 83  ? -1.682  -7.436  0.600   1.00 0.00 ?  296 PHE A CE1  3  
ATOM 5542  C CE2  . PHE A 1 83  ? -0.925  -7.405  -1.631  1.00 0.00 ?  296 PHE A CE2  3  
ATOM 5543  C CZ   . PHE A 1 83  ? -1.921  -7.610  -0.728  1.00 0.00 ?  296 PHE A CZ   3  
ATOM 5544  H H    . PHE A 1 83  ? 0.280   -4.208  1.637   1.00 0.00 ?  296 PHE A H    3  
ATOM 5545  H HA   . PHE A 1 83  ? 3.087   -4.635  1.330   1.00 0.00 ?  296 PHE A HA   3  
ATOM 5546  H HB2  . PHE A 1 83  ? 2.724   -6.662  -0.150  1.00 0.00 ?  296 PHE A HB2  3  
ATOM 5547  H HB3  . PHE A 1 83  ? 2.251   -6.979  1.508   1.00 0.00 ?  296 PHE A HB3  3  
ATOM 5548  H HD1  . PHE A 1 83  ? -0.201  -6.899  2.107   1.00 0.00 ?  296 PHE A HD1  3  
ATOM 5549  H HD2  . PHE A 1 83  ? 1.162   -6.843  -1.911  1.00 0.00 ?  296 PHE A HD2  3  
ATOM 5550  H HE1  . PHE A 1 83  ? -2.480  -7.601  1.324   1.00 0.00 ?  296 PHE A HE1  3  
ATOM 5551  H HE2  . PHE A 1 83  ? -1.117  -7.545  -2.695  1.00 0.00 ?  296 PHE A HE2  3  
ATOM 5552  H HZ   . PHE A 1 83  ? -2.911  -7.915  -1.068  1.00 0.00 ?  296 PHE A HZ   3  
ATOM 5553  N N    . GLY A 1 84  ? 2.896   -3.799  -1.052  1.00 0.00 ?  297 GLY A N    3  
ATOM 5554  C CA   . GLY A 1 84  ? 2.777   -3.038  -2.283  1.00 0.00 ?  297 GLY A CA   3  
ATOM 5555  C C    . GLY A 1 84  ? 3.683   -1.805  -2.256  1.00 0.00 ?  297 GLY A C    3  
ATOM 5556  O O    . GLY A 1 84  ? 3.839   -1.122  -3.267  1.00 0.00 ?  297 GLY A O    3  
ATOM 5557  H H    . GLY A 1 84  ? 3.830   -4.058  -0.803  1.00 0.00 ?  297 GLY A H    3  
ATOM 5558  H HA2  . GLY A 1 84  ? 3.041   -3.669  -3.132  1.00 0.00 ?  297 GLY A HA2  3  
ATOM 5559  H HA3  . GLY A 1 84  ? 1.741   -2.729  -2.425  1.00 0.00 ?  297 GLY A HA3  3  
ATOM 5560  N N    . GLU A 1 85  ? 4.256   -1.558  -1.087  1.00 0.00 ?  298 GLU A N    3  
ATOM 5561  C CA   . GLU A 1 85  ? 5.143   -0.419  -0.914  1.00 0.00 ?  298 GLU A CA   3  
ATOM 5562  C C    . GLU A 1 85  ? 6.240   -0.434  -1.981  1.00 0.00 ?  298 GLU A C    3  
ATOM 5563  O O    . GLU A 1 85  ? 6.552   0.599   -2.570  1.00 0.00 ?  298 GLU A O    3  
ATOM 5564  C CB   . GLU A 1 85  ? 5.745   -0.402  0.492   1.00 0.00 ?  298 GLU A CB   3  
ATOM 5565  C CG   . GLU A 1 85  ? 6.633   0.828   0.693   1.00 0.00 ?  298 GLU A CG   3  
ATOM 5566  C CD   . GLU A 1 85  ? 7.475   0.695   1.963   1.00 0.00 ?  298 GLU A CD   3  
ATOM 5567  O OE1  . GLU A 1 85  ? 8.679   0.409   1.882   1.00 0.00 ?  298 GLU A OE1  3  
ATOM 5568  O OE2  . GLU A 1 85  ? 6.836   0.901   3.065   1.00 0.00 -1 298 GLU A OE2  3  
ATOM 5569  H H    . GLU A 1 85  ? 4.124   -2.118  -0.270  1.00 0.00 ?  298 GLU A H    3  
ATOM 5570  H HA   . GLU A 1 85  ? 4.512   0.461   -1.044  1.00 0.00 ?  298 GLU A HA   3  
ATOM 5571  H HB2  . GLU A 1 85  ? 4.946   -0.403  1.233   1.00 0.00 ?  298 GLU A HB2  3  
ATOM 5572  H HB3  . GLU A 1 85  ? 6.330   -1.307  0.652   1.00 0.00 ?  298 GLU A HB3  3  
ATOM 5573  H HG2  . GLU A 1 85  ? 7.287   0.953   -0.170  1.00 0.00 ?  298 GLU A HG2  3  
ATOM 5574  H HG3  . GLU A 1 85  ? 6.013   1.723   0.755   1.00 0.00 ?  298 GLU A HG3  3  
ATOM 5575  H HE2  . GLU A 1 85  ? 5.892   0.582   2.977   1.00 0.00 ?  298 GLU A HE2  3  
ATOM 5576  N N    . MET A 1 86  ? 6.796   -1.618  -2.196  1.00 0.00 ?  299 MET A N    3  
ATOM 5577  C CA   . MET A 1 86  ? 7.851   -1.781  -3.180  1.00 0.00 ?  299 MET A CA   3  
ATOM 5578  C C    . MET A 1 86  ? 7.394   -1.302  -4.560  1.00 0.00 ?  299 MET A C    3  
ATOM 5579  O O    . MET A 1 86  ? 8.176   -0.722  -5.311  1.00 0.00 ?  299 MET A O    3  
ATOM 5580  C CB   . MET A 1 86  ? 8.253   -3.255  -3.259  1.00 0.00 ?  299 MET A CB   3  
ATOM 5581  C CG   . MET A 1 86  ? 9.614   -3.488  -2.598  1.00 0.00 ?  299 MET A CG   3  
ATOM 5582  S SD   . MET A 1 86  ? 9.405   -3.741  -0.843  1.00 0.00 ?  299 MET A SD   3  
ATOM 5583  C CE   . MET A 1 86  ? 9.885   -2.132  -0.239  1.00 0.00 ?  299 MET A CE   3  
ATOM 5584  H H    . MET A 1 86  ? 6.536   -2.454  -1.712  1.00 0.00 ?  299 MET A H    3  
ATOM 5585  H HA   . MET A 1 86  ? 8.678   -1.162  -2.829  1.00 0.00 ?  299 MET A HA   3  
ATOM 5586  H HB2  . MET A 1 86  ? 7.497   -3.868  -2.769  1.00 0.00 ?  299 MET A HB2  3  
ATOM 5587  H HB3  . MET A 1 86  ? 8.293   -3.570  -4.301  1.00 0.00 ?  299 MET A HB3  3  
ATOM 5588  H HG2  . MET A 1 86  ? 10.100  -4.356  -3.043  1.00 0.00 ?  299 MET A HG2  3  
ATOM 5589  H HG3  . MET A 1 86  ? 10.265  -2.632  -2.775  1.00 0.00 ?  299 MET A HG3  3  
ATOM 5590  H HE1  . MET A 1 86  ? 10.046  -2.181  0.838   1.00 0.00 ?  299 MET A HE1  3  
ATOM 5591  H HE2  . MET A 1 86  ? 10.807  -1.820  -0.730  1.00 0.00 ?  299 MET A HE2  3  
ATOM 5592  H HE3  . MET A 1 86  ? 9.096   -1.412  -0.456  1.00 0.00 ?  299 MET A HE3  3  
ATOM 5593  N N    . ALA A 1 87  ? 6.128   -1.563  -4.851  1.00 0.00 ?  300 ALA A N    3  
ATOM 5594  C CA   . ALA A 1 87  ? 5.556   -1.167  -6.127  1.00 0.00 ?  300 ALA A CA   3  
ATOM 5595  C C    . ALA A 1 87  ? 5.507   0.361   -6.205  1.00 0.00 ?  300 ALA A C    3  
ATOM 5596  O O    . ALA A 1 87  ? 5.750   0.940   -7.263  1.00 0.00 ?  300 ALA A O    3  
ATOM 5597  C CB   . ALA A 1 87  ? 4.175   -1.804  -6.288  1.00 0.00 ?  300 ALA A CB   3  
ATOM 5598  H H    . ALA A 1 87  ? 5.498   -2.036  -4.234  1.00 0.00 ?  300 ALA A H    3  
ATOM 5599  H HA   . ALA A 1 87  ? 6.210   -1.541  -6.914  1.00 0.00 ?  300 ALA A HA   3  
ATOM 5600  H HB1  . ALA A 1 87  ? 3.523   -1.124  -6.837  1.00 0.00 ?  300 ALA A HB1  3  
ATOM 5601  H HB2  . ALA A 1 87  ? 4.269   -2.740  -6.838  1.00 0.00 ?  300 ALA A HB2  3  
ATOM 5602  H HB3  . ALA A 1 87  ? 3.749   -2.001  -5.304  1.00 0.00 ?  300 ALA A HB3  3  
ATOM 5603  N N    . LEU A 1 88  ? 5.190   0.970   -5.072  1.00 0.00 ?  301 LEU A N    3  
ATOM 5604  C CA   . LEU A 1 88  ? 5.105   2.418   -5.000  1.00 0.00 ?  301 LEU A CA   3  
ATOM 5605  C C    . LEU A 1 88  ? 6.508   2.999   -4.817  1.00 0.00 ?  301 LEU A C    3  
ATOM 5606  O O    . LEU A 1 88  ? 6.702   4.210   -4.918  1.00 0.00 ?  301 LEU A O    3  
ATOM 5607  C CB   . LEU A 1 88  ? 4.117   2.843   -3.911  1.00 0.00 ?  301 LEU A CB   3  
ATOM 5608  C CG   . LEU A 1 88  ? 2.654   2.464   -4.147  1.00 0.00 ?  301 LEU A CG   3  
ATOM 5609  C CD1  . LEU A 1 88  ? 2.208   1.367   -3.179  1.00 0.00 ?  301 LEU A CD1  3  
ATOM 5610  C CD2  . LEU A 1 88  ? 1.749   3.696   -4.074  1.00 0.00 ?  301 LEU A CD2  3  
ATOM 5611  H H    . LEU A 1 88  ? 4.993   0.491   -4.216  1.00 0.00 ?  301 LEU A H    3  
ATOM 5612  H HA   . LEU A 1 88  ? 4.706   2.770   -5.951  1.00 0.00 ?  301 LEU A HA   3  
ATOM 5613  H HB2  . LEU A 1 88  ? 4.437   2.404   -2.966  1.00 0.00 ?  301 LEU A HB2  3  
ATOM 5614  H HB3  . LEU A 1 88  ? 4.177   3.925   -3.796  1.00 0.00 ?  301 LEU A HB3  3  
ATOM 5615  H HG   . LEU A 1 88  ? 2.565   2.059   -5.155  1.00 0.00 ?  301 LEU A HG   3  
ATOM 5616  H HD11 . LEU A 1 88  ? 1.550   1.795   -2.423  1.00 0.00 ?  301 LEU A HD11 3  
ATOM 5617  H HD12 . LEU A 1 88  ? 1.674   0.592   -3.729  1.00 0.00 ?  301 LEU A HD12 3  
ATOM 5618  H HD13 . LEU A 1 88  ? 3.083   0.932   -2.695  1.00 0.00 ?  301 LEU A HD13 3  
ATOM 5619  H HD21 . LEU A 1 88  ? 2.102   4.359   -3.284  1.00 0.00 ?  301 LEU A HD21 3  
ATOM 5620  H HD22 . LEU A 1 88  ? 1.774   4.222   -5.028  1.00 0.00 ?  301 LEU A HD22 3  
ATOM 5621  H HD23 . LEU A 1 88  ? 0.728   3.384   -3.856  1.00 0.00 ?  301 LEU A HD23 3  
ATOM 5622  N N    . ILE A 1 89  ? 7.452   2.108   -4.551  1.00 0.00 ?  302 ILE A N    3  
ATOM 5623  C CA   . ILE A 1 89  ? 8.833   2.517   -4.354  1.00 0.00 ?  302 ILE A CA   3  
ATOM 5624  C C    . ILE A 1 89  ? 9.471   2.817   -5.712  1.00 0.00 ?  302 ILE A C    3  
ATOM 5625  O O    . ILE A 1 89  ? 9.977   3.915   -5.934  1.00 0.00 ?  302 ILE A O    3  
ATOM 5626  C CB   . ILE A 1 89  ? 9.590   1.468   -3.537  1.00 0.00 ?  302 ILE A CB   3  
ATOM 5627  C CG1  . ILE A 1 89  ? 9.315   1.635   -2.041  1.00 0.00 ?  302 ILE A CG1  3  
ATOM 5628  C CG2  . ILE A 1 89  ? 11.087  1.504   -3.851  1.00 0.00 ?  302 ILE A CG2  3  
ATOM 5629  C CD1  . ILE A 1 89  ? 10.114  2.804   -1.463  1.00 0.00 ?  302 ILE A CD1  3  
ATOM 5630  H H    . ILE A 1 89  ? 7.287   1.125   -4.471  1.00 0.00 ?  302 ILE A H    3  
ATOM 5631  H HA   . ILE A 1 89  ? 8.821   3.435   -3.767  1.00 0.00 ?  302 ILE A HA   3  
ATOM 5632  H HB   . ILE A 1 89  ? 9.225   0.482   -3.824  1.00 0.00 ?  302 ILE A HB   3  
ATOM 5633  H HG12 . ILE A 1 89  ? 8.250   1.802   -1.880  1.00 0.00 ?  302 ILE A HG12 3  
ATOM 5634  H HG13 . ILE A 1 89  ? 9.576   0.716   -1.515  1.00 0.00 ?  302 ILE A HG13 3  
ATOM 5635  H HG21 . ILE A 1 89  ? 11.294  0.865   -4.709  1.00 0.00 ?  302 ILE A HG21 3  
ATOM 5636  H HG22 . ILE A 1 89  ? 11.386  2.527   -4.081  1.00 0.00 ?  302 ILE A HG22 3  
ATOM 5637  H HG23 . ILE A 1 89  ? 11.649  1.147   -2.988  1.00 0.00 ?  302 ILE A HG23 3  
ATOM 5638  H HD11 . ILE A 1 89  ? 10.713  3.260   -2.251  1.00 0.00 ?  302 ILE A HD11 3  
ATOM 5639  H HD12 . ILE A 1 89  ? 9.428   3.546   -1.053  1.00 0.00 ?  302 ILE A HD12 3  
ATOM 5640  H HD13 . ILE A 1 89  ? 10.770  2.441   -0.672  1.00 0.00 ?  302 ILE A HD13 3  
ATOM 5641  N N    . SER A 1 90  ? 9.426   1.821   -6.584  1.00 0.00 ?  303 SER A N    3  
ATOM 5642  C CA   . SER A 1 90  ? 9.993   1.964   -7.914  1.00 0.00 ?  303 SER A CA   3  
ATOM 5643  C C    . SER A 1 90  ? 9.248   1.062   -8.900  1.00 0.00 ?  303 SER A C    3  
ATOM 5644  O O    . SER A 1 90  ? 9.870   0.332   -9.670  1.00 0.00 ?  303 SER A O    3  
ATOM 5645  C CB   . SER A 1 90  ? 11.486  1.632   -7.914  1.00 0.00 ?  303 SER A CB   3  
ATOM 5646  O OG   . SER A 1 90  ? 12.290  2.786   -7.682  1.00 0.00 ?  303 SER A OG   3  
ATOM 5647  H H    . SER A 1 90  ? 9.012   0.930   -6.395  1.00 0.00 ?  303 SER A H    3  
ATOM 5648  H HA   . SER A 1 90  ? 9.854   3.013   -8.175  1.00 0.00 ?  303 SER A HA   3  
ATOM 5649  H HB2  . SER A 1 90  ? 11.692  0.886   -7.146  1.00 0.00 ?  303 SER A HB2  3  
ATOM 5650  H HB3  . SER A 1 90  ? 11.759  1.188   -8.872  1.00 0.00 ?  303 SER A HB3  3  
ATOM 5651  H HG   . SER A 1 90  ? 13.219  2.511   -7.433  1.00 0.00 ?  303 SER A HG   3  
ATOM 5652  N N    . GLY A 1 91  ? 7.927   1.143   -8.845  1.00 0.00 ?  304 GLY A N    3  
ATOM 5653  C CA   . GLY A 1 91  ? 7.091   0.343   -9.724  1.00 0.00 ?  304 GLY A CA   3  
ATOM 5654  C C    . GLY A 1 91  ? 7.700   -1.043  -9.948  1.00 0.00 ?  304 GLY A C    3  
ATOM 5655  O O    . GLY A 1 91  ? 7.533   -1.633  -11.015 1.00 0.00 ?  304 GLY A O    3  
ATOM 5656  H H    . GLY A 1 91  ? 7.429   1.739   -8.216  1.00 0.00 ?  304 GLY A H    3  
ATOM 5657  H HA2  . GLY A 1 91  ? 6.096   0.241   -9.292  1.00 0.00 ?  304 GLY A HA2  3  
ATOM 5658  H HA3  . GLY A 1 91  ? 6.973   0.851   -10.681 1.00 0.00 ?  304 GLY A HA3  3  
ATOM 5659  N N    . GLU A 1 92  ? 8.393   -1.522  -8.926  1.00 0.00 ?  305 GLU A N    3  
ATOM 5660  C CA   . GLU A 1 92  ? 9.028   -2.827  -8.998  1.00 0.00 ?  305 GLU A CA   3  
ATOM 5661  C C    . GLU A 1 92  ? 7.970   -3.926  -9.109  1.00 0.00 ?  305 GLU A C    3  
ATOM 5662  O O    . GLU A 1 92  ? 6.849   -3.765  -8.629  1.00 0.00 ?  305 GLU A O    3  
ATOM 5663  C CB   . GLU A 1 92  ? 9.938   -3.062  -7.791  1.00 0.00 ?  305 GLU A CB   3  
ATOM 5664  C CG   . GLU A 1 92  ? 9.119   -3.409  -6.546  1.00 0.00 ?  305 GLU A CG   3  
ATOM 5665  C CD   . GLU A 1 92  ? 9.463   -4.810  -6.037  1.00 0.00 ?  305 GLU A CD   3  
ATOM 5666  O OE1  . GLU A 1 92  ? 10.649  -5.135  -5.870  1.00 0.00 ?  305 GLU A OE1  3  
ATOM 5667  O OE2  . GLU A 1 92  ? 8.448   -5.574  -5.811  1.00 0.00 -1 305 GLU A OE2  3  
ATOM 5668  H H    . GLU A 1 92  ? 8.524   -1.036  -8.062  1.00 0.00 ?  305 GLU A H    3  
ATOM 5669  H HA   . GLU A 1 92  ? 9.635   -2.805  -9.903  1.00 0.00 ?  305 GLU A HA   3  
ATOM 5670  H HB2  . GLU A 1 92  ? 10.636  -3.870  -8.009  1.00 0.00 ?  305 GLU A HB2  3  
ATOM 5671  H HB3  . GLU A 1 92  ? 10.534  -2.169  -7.601  1.00 0.00 ?  305 GLU A HB3  3  
ATOM 5672  H HG2  . GLU A 1 92  ? 9.311   -2.676  -5.763  1.00 0.00 ?  305 GLU A HG2  3  
ATOM 5673  H HG3  . GLU A 1 92  ? 8.055   -3.355  -6.780  1.00 0.00 ?  305 GLU A HG3  3  
ATOM 5674  H HE2  . GLU A 1 92  ? 8.759   -6.477  -5.514  1.00 0.00 ?  305 GLU A HE2  3  
ATOM 5675  N N    . PRO A 1 93  ? 8.373   -5.049  -9.762  1.00 0.00 ?  306 PRO A N    3  
ATOM 5676  C CA   . PRO A 1 93  ? 7.473   -6.175  -9.942  1.00 0.00 ?  306 PRO A CA   3  
ATOM 5677  C C    . PRO A 1 93  ? 7.301   -6.954  -8.637  1.00 0.00 ?  306 PRO A C    3  
ATOM 5678  O O    . PRO A 1 93  ? 8.284   -7.319  -7.994  1.00 0.00 ?  306 PRO A O    3  
ATOM 5679  C CB   . PRO A 1 93  ? 8.097   -7.005  -11.052 1.00 0.00 ?  306 PRO A CB   3  
ATOM 5680  C CG   . PRO A 1 93  ? 9.551   -6.568  -11.131 1.00 0.00 ?  306 PRO A CG   3  
ATOM 5681  C CD   . PRO A 1 93  ? 9.693   -5.276  -10.344 1.00 0.00 ?  306 PRO A CD   3  
ATOM 5682  H HA   . PRO A 1 93  ? 6.559   -5.852  -10.190 1.00 0.00 ?  306 PRO A HA   3  
ATOM 5683  H HB2  . PRO A 1 93  ? 8.021   -8.070  -10.833 1.00 0.00 ?  306 PRO A HB2  3  
ATOM 5684  H HB3  . PRO A 1 93  ? 7.587   -6.837  -12.000 1.00 0.00 ?  306 PRO A HB3  3  
ATOM 5685  H HG2  . PRO A 1 93  ? 10.204  -7.339  -10.720 1.00 0.00 ?  306 PRO A HG2  3  
ATOM 5686  H HG3  . PRO A 1 93  ? 9.849   -6.418  -12.168 1.00 0.00 ?  306 PRO A HG3  3  
ATOM 5687  H HD2  . PRO A 1 93  ? 10.457  -5.364  -9.571  1.00 0.00 ?  306 PRO A HD2  3  
ATOM 5688  H HD3  . PRO A 1 93  ? 9.988   -4.449  -10.990 1.00 0.00 ?  306 PRO A HD3  3  
ATOM 5689  N N    . ARG A 1 94  ? 6.045   -7.186  -8.284  1.00 0.00 ?  307 ARG A N    3  
ATOM 5690  C CA   . ARG A 1 94  ? 5.732   -7.915  -7.067  1.00 0.00 ?  307 ARG A CA   3  
ATOM 5691  C C    . ARG A 1 94  ? 6.556   -9.203  -6.993  1.00 0.00 ?  307 ARG A C    3  
ATOM 5692  O O    . ARG A 1 94  ? 6.773   -9.743  -5.909  1.00 0.00 ?  307 ARG A O    3  
ATOM 5693  C CB   . ARG A 1 94  ? 4.244   -8.266  -7.002  1.00 0.00 ?  307 ARG A CB   3  
ATOM 5694  C CG   . ARG A 1 94  ? 3.475   -7.242  -6.165  1.00 0.00 ?  307 ARG A CG   3  
ATOM 5695  C CD   . ARG A 1 94  ? 2.078   -7.002  -6.739  1.00 0.00 ?  307 ARG A CD   3  
ATOM 5696  N NE   . ARG A 1 94  ? 2.044   -5.714  -7.468  1.00 0.00 ?  307 ARG A NE   3  
ATOM 5697  C CZ   . ARG A 1 94  ? 1.815   -4.528  -6.887  1.00 0.00 ?  307 ARG A CZ   3  
ATOM 5698  N NH1  . ARG A 1 94  ? 1.598   -4.459  -5.567  1.00 0.00 ?  307 ARG A NH1  3  
ATOM 5699  N NH2  . ARG A 1 94  ? 1.803   -3.411  -7.627  1.00 0.00 1  307 ARG A NH2  3  
ATOM 5700  H H    . ARG A 1 94  ? 5.251   -6.886  -8.813  1.00 0.00 ?  307 ARG A H    3  
ATOM 5701  H HA   . ARG A 1 94  ? 5.995   -7.234  -6.258  1.00 0.00 ?  307 ARG A HA   3  
ATOM 5702  H HB2  . ARG A 1 94  ? 3.831   -8.300  -8.010  1.00 0.00 ?  307 ARG A HB2  3  
ATOM 5703  H HB3  . ARG A 1 94  ? 4.119   -9.260  -6.572  1.00 0.00 ?  307 ARG A HB3  3  
ATOM 5704  H HG2  . ARG A 1 94  ? 3.394   -7.594  -5.137  1.00 0.00 ?  307 ARG A HG2  3  
ATOM 5705  H HG3  . ARG A 1 94  ? 4.027   -6.302  -6.137  1.00 0.00 ?  307 ARG A HG3  3  
ATOM 5706  H HD2  . ARG A 1 94  ? 1.807   -7.816  -7.411  1.00 0.00 ?  307 ARG A HD2  3  
ATOM 5707  H HD3  . ARG A 1 94  ? 1.342   -6.993  -5.936  1.00 0.00 ?  307 ARG A HD3  3  
ATOM 5708  H HE   . ARG A 1 94  ? 2.202   -5.729  -8.455  1.00 0.00 ?  307 ARG A HE   3  
ATOM 5709  H HH11 . ARG A 1 94  ? 1.607   -5.293  -5.015  1.00 0.00 ?  307 ARG A HH11 3  
ATOM 5710  H HH12 . ARG A 1 94  ? 1.427   -3.574  -5.134  1.00 0.00 ?  307 ARG A HH12 3  
ATOM 5711  H HH21 . ARG A 1 94  ? 1.965   -3.462  -8.613  1.00 0.00 ?  307 ARG A HH21 3  
ATOM 5712  H HH22 . ARG A 1 94  ? 1.632   -2.526  -7.194  1.00 0.00 ?  307 ARG A HH22 3  
ATOM 5713  N N    . SER A 1 95  ? 6.992   -9.656  -8.159  1.00 0.00 ?  308 SER A N    3  
ATOM 5714  C CA   . SER A 1 95  ? 7.787   -10.870 -8.239  1.00 0.00 ?  308 SER A CA   3  
ATOM 5715  C C    . SER A 1 95  ? 7.214   -11.934 -7.302  1.00 0.00 ?  308 SER A C    3  
ATOM 5716  O O    . SER A 1 95  ? 7.914   -12.435 -6.423  1.00 0.00 ?  308 SER A O    3  
ATOM 5717  C CB   . SER A 1 95  ? 9.252   -10.592 -7.894  1.00 0.00 ?  308 SER A CB   3  
ATOM 5718  O OG   . SER A 1 95  ? 9.926   -9.904  -8.944  1.00 0.00 ?  308 SER A OG   3  
ATOM 5719  H H    . SER A 1 95  ? 6.811   -9.211  -9.035  1.00 0.00 ?  308 SER A H    3  
ATOM 5720  H HA   . SER A 1 95  ? 7.714   -11.194 -9.277  1.00 0.00 ?  308 SER A HA   3  
ATOM 5721  H HB2  . SER A 1 95  ? 9.303   -10.000 -6.981  1.00 0.00 ?  308 SER A HB2  3  
ATOM 5722  H HB3  . SER A 1 95  ? 9.761   -11.534 -7.692  1.00 0.00 ?  308 SER A HB3  3  
ATOM 5723  H HG   . SER A 1 95  ? 9.508   -9.008  -9.089  1.00 0.00 ?  308 SER A HG   3  
ATOM 5724  N N    . ALA A 1 96  ? 5.946   -12.249 -7.521  1.00 0.00 ?  309 ALA A N    3  
ATOM 5725  C CA   . ALA A 1 96  ? 5.270   -13.245 -6.707  1.00 0.00 ?  309 ALA A CA   3  
ATOM 5726  C C    . ALA A 1 96  ? 3.757   -13.099 -6.880  1.00 0.00 ?  309 ALA A C    3  
ATOM 5727  O O    . ALA A 1 96  ? 3.275   -12.045 -7.293  1.00 0.00 ?  309 ALA A O    3  
ATOM 5728  C CB   . ALA A 1 96  ? 5.707   -13.094 -5.248  1.00 0.00 ?  309 ALA A CB   3  
ATOM 5729  H H    . ALA A 1 96  ? 5.383   -11.837 -8.238  1.00 0.00 ?  309 ALA A H    3  
ATOM 5730  H HA   . ALA A 1 96  ? 5.575   -14.229 -7.065  1.00 0.00 ?  309 ALA A HA   3  
ATOM 5731  H HB1  . ALA A 1 96  ? 6.540   -13.768 -5.047  1.00 0.00 ?  309 ALA A HB1  3  
ATOM 5732  H HB2  . ALA A 1 96  ? 6.019   -12.066 -5.067  1.00 0.00 ?  309 ALA A HB2  3  
ATOM 5733  H HB3  . ALA A 1 96  ? 4.873   -13.342 -4.592  1.00 0.00 ?  309 ALA A HB3  3  
ATOM 5734  N N    . THR A 1 97  ? 3.050   -14.172 -6.557  1.00 0.00 ?  310 THR A N    3  
ATOM 5735  C CA   . THR A 1 97  ? 1.602   -14.176 -6.672  1.00 0.00 ?  310 THR A CA   3  
ATOM 5736  C C    . THR A 1 97  ? 0.957   -14.259 -5.287  1.00 0.00 ?  310 THR A C    3  
ATOM 5737  O O    . THR A 1 97  ? 1.211   -15.200 -4.536  1.00 0.00 ?  310 THR A O    3  
ATOM 5738  C CB   . THR A 1 97  ? 1.204   -15.328 -7.598  1.00 0.00 ?  310 THR A CB   3  
ATOM 5739  O OG1  . THR A 1 97  ? 0.534   -14.688 -8.680  1.00 0.00 ?  310 THR A OG1  3  
ATOM 5740  C CG2  . THR A 1 97  ? 0.136   -16.233 -6.980  1.00 0.00 ?  310 THR A CG2  3  
ATOM 5741  H H    . THR A 1 97  ? 3.450   -15.025 -6.223  1.00 0.00 ?  310 THR A H    3  
ATOM 5742  H HA   . THR A 1 97  ? 1.289   -13.230 -7.114  1.00 0.00 ?  310 THR A HA   3  
ATOM 5743  H HB   . THR A 1 97  ? 2.078   -15.906 -7.897  1.00 0.00 ?  310 THR A HB   3  
ATOM 5744  H HG1  . THR A 1 97  ? -0.402  -14.457 -8.414  1.00 0.00 ?  310 THR A HG1  3  
ATOM 5745  H HG21 . THR A 1 97  ? -0.644  -15.620 -6.531  1.00 0.00 ?  310 THR A HG21 3  
ATOM 5746  H HG22 . THR A 1 97  ? -0.299  -16.863 -7.756  1.00 0.00 ?  310 THR A HG22 3  
ATOM 5747  H HG23 . THR A 1 97  ? 0.591   -16.861 -6.214  1.00 0.00 ?  310 THR A HG23 3  
ATOM 5748  N N    . VAL A 1 98  ? 0.136   -13.263 -4.991  1.00 0.00 ?  311 VAL A N    3  
ATOM 5749  C CA   . VAL A 1 98  ? -0.547  -13.211 -3.710  1.00 0.00 ?  311 VAL A CA   3  
ATOM 5750  C C    . VAL A 1 98  ? -2.003  -13.645 -3.895  1.00 0.00 ?  311 VAL A C    3  
ATOM 5751  O O    . VAL A 1 98  ? -2.688  -13.164 -4.796  1.00 0.00 ?  311 VAL A O    3  
ATOM 5752  C CB   . VAL A 1 98  ? -0.412  -11.814 -3.101  1.00 0.00 ?  311 VAL A CB   3  
ATOM 5753  C CG1  . VAL A 1 98  ? -0.966  -11.782 -1.675  1.00 0.00 ?  311 VAL A CG1  3  
ATOM 5754  C CG2  . VAL A 1 98  ? 1.042   -11.339 -3.135  1.00 0.00 ?  311 VAL A CG2  3  
ATOM 5755  H H    . VAL A 1 98  ? -0.065  -12.502 -5.608  1.00 0.00 ?  311 VAL A H    3  
ATOM 5756  H HA   . VAL A 1 98  ? -0.052  -13.919 -3.045  1.00 0.00 ?  311 VAL A HA   3  
ATOM 5757  H HB   . VAL A 1 98  ? -1.004  -11.126 -3.705  1.00 0.00 ?  311 VAL A HB   3  
ATOM 5758  H HG11 . VAL A 1 98  ? -0.147  -11.644 -0.970  1.00 0.00 ?  311 VAL A HG11 3  
ATOM 5759  H HG12 . VAL A 1 98  ? -1.671  -10.956 -1.577  1.00 0.00 ?  311 VAL A HG12 3  
ATOM 5760  H HG13 . VAL A 1 98  ? -1.475  -12.722 -1.461  1.00 0.00 ?  311 VAL A HG13 3  
ATOM 5761  H HG21 . VAL A 1 98  ? 1.597   -11.809 -2.323  1.00 0.00 ?  311 VAL A HG21 3  
ATOM 5762  H HG22 . VAL A 1 98  ? 1.491   -11.614 -4.089  1.00 0.00 ?  311 VAL A HG22 3  
ATOM 5763  H HG23 . VAL A 1 98  ? 1.073   -10.256 -3.017  1.00 0.00 ?  311 VAL A HG23 3  
ATOM 5764  N N    . SER A 1 99  ? -2.433  -14.548 -3.026  1.00 0.00 ?  312 SER A N    3  
ATOM 5765  C CA   . SER A 1 99  ? -3.795  -15.052 -3.082  1.00 0.00 ?  312 SER A CA   3  
ATOM 5766  C C    . SER A 1 99  ? -4.369  -15.165 -1.669  1.00 0.00 ?  312 SER A C    3  
ATOM 5767  O O    . SER A 1 99  ? -3.624  -15.320 -0.703  1.00 0.00 ?  312 SER A O    3  
ATOM 5768  C CB   . SER A 1 99  ? -3.852  -16.407 -3.789  1.00 0.00 ?  312 SER A CB   3  
ATOM 5769  O OG   . SER A 1 99  ? -2.938  -17.343 -3.224  1.00 0.00 ?  312 SER A OG   3  
ATOM 5770  H H    . SER A 1 99  ? -1.869  -14.934 -2.296  1.00 0.00 ?  312 SER A H    3  
ATOM 5771  H HA   . SER A 1 99  ? -4.351  -14.316 -3.663  1.00 0.00 ?  312 SER A HA   3  
ATOM 5772  H HB2  . SER A 1 99  ? -4.864  -16.806 -3.727  1.00 0.00 ?  312 SER A HB2  3  
ATOM 5773  H HB3  . SER A 1 99  ? -3.627  -16.274 -4.848  1.00 0.00 ?  312 SER A HB3  3  
ATOM 5774  H HG   . SER A 1 99  ? -2.346  -16.885 -2.561  1.00 0.00 ?  312 SER A HG   3  
ATOM 5775  N N    . ALA A 1 100 ? -5.690  -15.084 -1.593  1.00 0.00 ?  313 ALA A N    3  
ATOM 5776  C CA   . ALA A 1 100 ? -6.373  -15.176 -0.314  1.00 0.00 ?  313 ALA A CA   3  
ATOM 5777  C C    . ALA A 1 100 ? -6.733  -16.637 -0.037  1.00 0.00 ?  313 ALA A C    3  
ATOM 5778  O O    . ALA A 1 100 ? -7.458  -17.259 -0.812  1.00 0.00 ?  313 ALA A O    3  
ATOM 5779  C CB   . ALA A 1 100 ? -7.601  -14.265 -0.324  1.00 0.00 ?  313 ALA A CB   3  
ATOM 5780  H H    . ALA A 1 100 ? -6.288  -14.958 -2.384  1.00 0.00 ?  313 ALA A H    3  
ATOM 5781  H HA   . ALA A 1 100 ? -5.684  -14.828 0.456   1.00 0.00 ?  313 ALA A HA   3  
ATOM 5782  H HB1  . ALA A 1 100 ? -8.148  -14.402 -1.257  1.00 0.00 ?  313 ALA A HB1  3  
ATOM 5783  H HB2  . ALA A 1 100 ? -8.248  -14.517 0.516   1.00 0.00 ?  313 ALA A HB2  3  
ATOM 5784  H HB3  . ALA A 1 100 ? -7.283  -13.225 -0.239  1.00 0.00 ?  313 ALA A HB3  3  
ATOM 5785  N N    . ALA A 1 101 ? -6.210  -17.143 1.071   1.00 0.00 ?  314 ALA A N    3  
ATOM 5786  C CA   . ALA A 1 101 ? -6.468  -18.519 1.459   1.00 0.00 ?  314 ALA A CA   3  
ATOM 5787  C C    . ALA A 1 101 ? -7.968  -18.705 1.697   1.00 0.00 ?  314 ALA A C    3  
ATOM 5788  O O    . ALA A 1 101 ? -8.514  -19.773 1.429   1.00 0.00 ?  314 ALA A O    3  
ATOM 5789  C CB   . ALA A 1 101 ? -5.634  -18.865 2.695   1.00 0.00 ?  314 ALA A CB   3  
ATOM 5790  H H    . ALA A 1 101 ? -5.621  -16.630 1.696   1.00 0.00 ?  314 ALA A H    3  
ATOM 5791  H HA   . ALA A 1 101 ? -6.157  -19.160 0.635   1.00 0.00 ?  314 ALA A HA   3  
ATOM 5792  H HB1  . ALA A 1 101 ? -6.001  -18.299 3.551   1.00 0.00 ?  314 ALA A HB1  3  
ATOM 5793  H HB2  . ALA A 1 101 ? -5.717  -19.932 2.901   1.00 0.00 ?  314 ALA A HB2  3  
ATOM 5794  H HB3  . ALA A 1 101 ? -4.590  -18.610 2.512   1.00 0.00 ?  314 ALA A HB3  3  
ATOM 5795  N N    . THR A 1 102 ? -8.591  -17.648 2.198   1.00 0.00 ?  315 THR A N    3  
ATOM 5796  C CA   . THR A 1 102 ? -10.016 -17.681 2.475   1.00 0.00 ?  315 THR A CA   3  
ATOM 5797  C C    . THR A 1 102 ? -10.624 -16.286 2.313   1.00 0.00 ?  315 THR A C    3  
ATOM 5798  O O    . THR A 1 102 ? -9.933  -15.346 1.924   1.00 0.00 ?  315 THR A O    3  
ATOM 5799  C CB   . THR A 1 102 ? -10.213 -18.271 3.873   1.00 0.00 ?  315 THR A CB   3  
ATOM 5800  O OG1  . THR A 1 102 ? -11.627 -18.285 4.048   1.00 0.00 ?  315 THR A OG1  3  
ATOM 5801  C CG2  . THR A 1 102 ? -9.709  -17.341 4.977   1.00 0.00 ?  315 THR A CG2  3  
ATOM 5802  H H    . THR A 1 102 ? -8.138  -16.782 2.413   1.00 0.00 ?  315 THR A H    3  
ATOM 5803  H HA   . THR A 1 102 ? -10.495 -18.326 1.737   1.00 0.00 ?  315 THR A HA   3  
ATOM 5804  H HB   . THR A 1 102 ? -9.748  -19.254 3.949   1.00 0.00 ?  315 THR A HB   3  
ATOM 5805  H HG1  . THR A 1 102 ? -12.046 -18.919 3.400   1.00 0.00 ?  315 THR A HG1  3  
ATOM 5806  H HG21 . THR A 1 102 ? -10.344 -17.444 5.857   1.00 0.00 ?  315 THR A HG21 3  
ATOM 5807  H HG22 . THR A 1 102 ? -8.683  -17.605 5.236   1.00 0.00 ?  315 THR A HG22 3  
ATOM 5808  H HG23 . THR A 1 102 ? -9.740  -16.309 4.626   1.00 0.00 ?  315 THR A HG23 3  
ATOM 5809  N N    . THR A 1 103 ? -11.909 -16.196 2.621   1.00 0.00 ?  316 THR A N    3  
ATOM 5810  C CA   . THR A 1 103 ? -12.618 -14.932 2.515   1.00 0.00 ?  316 THR A CA   3  
ATOM 5811  C C    . THR A 1 103 ? -11.836 -13.822 3.221   1.00 0.00 ?  316 THR A C    3  
ATOM 5812  O O    . THR A 1 103 ? -12.000 -13.610 4.422   1.00 0.00 ?  316 THR A O    3  
ATOM 5813  C CB   . THR A 1 103 ? -14.028 -15.132 3.073   1.00 0.00 ?  316 THR A CB   3  
ATOM 5814  O OG1  . THR A 1 103 ? -13.822 -15.845 4.290   1.00 0.00 ?  316 THR A OG1  3  
ATOM 5815  C CG2  . THR A 1 103 ? -14.866 -16.086 2.220   1.00 0.00 ?  316 THR A CG2  3  
ATOM 5816  H H    . THR A 1 103 ? -12.464 -16.966 2.937   1.00 0.00 ?  316 THR A H    3  
ATOM 5817  H HA   . THR A 1 103 ? -12.678 -14.660 1.461   1.00 0.00 ?  316 THR A HA   3  
ATOM 5818  H HB   . THR A 1 103 ? -14.535 -14.176 3.201   1.00 0.00 ?  316 THR A HB   3  
ATOM 5819  H HG1  . THR A 1 103 ? -13.447 -15.233 4.986   1.00 0.00 ?  316 THR A HG1  3  
ATOM 5820  H HG21 . THR A 1 103 ? -14.237 -16.902 1.863   1.00 0.00 ?  316 THR A HG21 3  
ATOM 5821  H HG22 . THR A 1 103 ? -15.680 -16.491 2.820   1.00 0.00 ?  316 THR A HG22 3  
ATOM 5822  H HG23 . THR A 1 103 ? -15.277 -15.545 1.367   1.00 0.00 ?  316 THR A HG23 3  
ATOM 5823  N N    . VAL A 1 104 ? -11.004 -13.143 2.446   1.00 0.00 ?  317 VAL A N    3  
ATOM 5824  C CA   . VAL A 1 104 ? -10.197 -12.060 2.982   1.00 0.00 ?  317 VAL A CA   3  
ATOM 5825  C C    . VAL A 1 104 ? -10.731 -10.725 2.460   1.00 0.00 ?  317 VAL A C    3  
ATOM 5826  O O    . VAL A 1 104 ? -11.413 -10.682 1.437   1.00 0.00 ?  317 VAL A O    3  
ATOM 5827  C CB   . VAL A 1 104 ? -8.723  -12.289 2.642   1.00 0.00 ?  317 VAL A CB   3  
ATOM 5828  C CG1  . VAL A 1 104 ? -7.896  -11.031 2.916   1.00 0.00 ?  317 VAL A CG1  3  
ATOM 5829  C CG2  . VAL A 1 104 ? -8.163  -13.490 3.406   1.00 0.00 ?  317 VAL A CG2  3  
ATOM 5830  H H    . VAL A 1 104 ? -10.877 -13.322 1.470   1.00 0.00 ?  317 VAL A H    3  
ATOM 5831  H HA   . VAL A 1 104 ? -10.300 -12.079 4.067   1.00 0.00 ?  317 VAL A HA   3  
ATOM 5832  H HB   . VAL A 1 104 ? -8.655  -12.508 1.576   1.00 0.00 ?  317 VAL A HB   3  
ATOM 5833  H HG11 . VAL A 1 104 ? -7.906  -10.815 3.984   1.00 0.00 ?  317 VAL A HG11 3  
ATOM 5834  H HG12 . VAL A 1 104 ? -6.869  -11.192 2.588   1.00 0.00 ?  317 VAL A HG12 3  
ATOM 5835  H HG13 . VAL A 1 104 ? -8.323  -10.189 2.371   1.00 0.00 ?  317 VAL A HG13 3  
ATOM 5836  H HG21 . VAL A 1 104 ? -8.966  -13.971 3.965   1.00 0.00 ?  317 VAL A HG21 3  
ATOM 5837  H HG22 . VAL A 1 104 ? -7.734  -14.202 2.700   1.00 0.00 ?  317 VAL A HG22 3  
ATOM 5838  H HG23 . VAL A 1 104 ? -7.391  -13.153 4.097   1.00 0.00 ?  317 VAL A HG23 3  
ATOM 5839  N N    . SER A 1 105 ? -10.401 -9.667  3.187   1.00 0.00 ?  318 SER A N    3  
ATOM 5840  C CA   . SER A 1 105 ? -10.839 -8.334  2.810   1.00 0.00 ?  318 SER A CA   3  
ATOM 5841  C C    . SER A 1 105 ? -9.663  -7.358  2.877   1.00 0.00 ?  318 SER A C    3  
ATOM 5842  O O    . SER A 1 105 ? -9.087  -7.147  3.943   1.00 0.00 ?  318 SER A O    3  
ATOM 5843  C CB   . SER A 1 105 ? -11.980 -7.854  3.710   1.00 0.00 ?  318 SER A CB   3  
ATOM 5844  O OG   . SER A 1 105 ? -13.140 -8.671  3.582   1.00 0.00 ?  318 SER A OG   3  
ATOM 5845  H H    . SER A 1 105 ? -9.846  -9.711  4.017   1.00 0.00 ?  318 SER A H    3  
ATOM 5846  H HA   . SER A 1 105 ? -11.201 -8.428  1.785   1.00 0.00 ?  318 SER A HA   3  
ATOM 5847  H HB2  . SER A 1 105 ? -11.647 -7.856  4.748   1.00 0.00 ?  318 SER A HB2  3  
ATOM 5848  H HB3  . SER A 1 105 ? -12.231 -6.824  3.458   1.00 0.00 ?  318 SER A HB3  3  
ATOM 5849  H HG   . SER A 1 105 ? -13.671 -8.389  2.783   1.00 0.00 ?  318 SER A HG   3  
ATOM 5850  N N    . LEU A 1 106 ? -9.341  -6.789  1.725   1.00 0.00 ?  319 LEU A N    3  
ATOM 5851  C CA   . LEU A 1 106 ? -8.244  -5.840  1.640   1.00 0.00 ?  319 LEU A CA   3  
ATOM 5852  C C    . LEU A 1 106 ? -8.709  -4.597  0.879   1.00 0.00 ?  319 LEU A C    3  
ATOM 5853  O O    . LEU A 1 106 ? -9.813  -4.572  0.338   1.00 0.00 ?  319 LEU A O    3  
ATOM 5854  C CB   . LEU A 1 106 ? -7.006  -6.505  1.034   1.00 0.00 ?  319 LEU A CB   3  
ATOM 5855  C CG   . LEU A 1 106 ? -7.272  -7.634  0.036   1.00 0.00 ?  319 LEU A CG   3  
ATOM 5856  C CD1  . LEU A 1 106 ? -7.052  -7.158  -1.401  1.00 0.00 ?  319 LEU A CD1  3  
ATOM 5857  C CD2  . LEU A 1 106 ? -6.430  -8.868  0.367   1.00 0.00 ?  319 LEU A CD2  3  
ATOM 5858  H H    . LEU A 1 106 ? -9.815  -6.966  0.862   1.00 0.00 ?  319 LEU A H    3  
ATOM 5859  H HA   . LEU A 1 106 ? -7.986  -5.546  2.657   1.00 0.00 ?  319 LEU A HA   3  
ATOM 5860  H HB2  . LEU A 1 106 ? -6.414  -5.738  0.535   1.00 0.00 ?  319 LEU A HB2  3  
ATOM 5861  H HB3  . LEU A 1 106 ? -6.397  -6.901  1.846   1.00 0.00 ?  319 LEU A HB3  3  
ATOM 5862  H HG   . LEU A 1 106 ? -8.319  -7.926  0.122   1.00 0.00 ?  319 LEU A HG   3  
ATOM 5863  H HD11 . LEU A 1 106 ? -6.482  -7.909  -1.949  1.00 0.00 ?  319 LEU A HD11 3  
ATOM 5864  H HD12 . LEU A 1 106 ? -8.017  -7.009  -1.886  1.00 0.00 ?  319 LEU A HD12 3  
ATOM 5865  H HD13 . LEU A 1 106 ? -6.500  -6.218  -1.393  1.00 0.00 ?  319 LEU A HD13 3  
ATOM 5866  H HD21 . LEU A 1 106 ? -6.854  -9.741  -0.130  1.00 0.00 ?  319 LEU A HD21 3  
ATOM 5867  H HD22 . LEU A 1 106 ? -5.408  -8.714  0.021   1.00 0.00 ?  319 LEU A HD22 3  
ATOM 5868  H HD23 . LEU A 1 106 ? -6.429  -9.028  1.445   1.00 0.00 ?  319 LEU A HD23 3  
ATOM 5869  N N    . LEU A 1 107 ? -7.842  -3.594  0.861   1.00 0.00 ?  320 LEU A N    3  
ATOM 5870  C CA   . LEU A 1 107 ? -8.149  -2.351  0.176   1.00 0.00 ?  320 LEU A CA   3  
ATOM 5871  C C    . LEU A 1 107 ? -7.041  -2.042  -0.832  1.00 0.00 ?  320 LEU A C    3  
ATOM 5872  O O    . LEU A 1 107 ? -5.859  -2.198  -0.528  1.00 0.00 ?  320 LEU A O    3  
ATOM 5873  C CB   . LEU A 1 107 ? -8.393  -1.228  1.186   1.00 0.00 ?  320 LEU A CB   3  
ATOM 5874  C CG   . LEU A 1 107 ? -8.928  -1.660  2.553   1.00 0.00 ?  320 LEU A CG   3  
ATOM 5875  C CD1  . LEU A 1 107 ? -7.796  -2.162  3.451   1.00 0.00 ?  320 LEU A CD1  3  
ATOM 5876  C CD2  . LEU A 1 107 ? -9.725  -0.532  3.210   1.00 0.00 ?  320 LEU A CD2  3  
ATOM 5877  H H    . LEU A 1 107 ? -6.946  -3.623  1.304   1.00 0.00 ?  320 LEU A H    3  
ATOM 5878  H HA   . LEU A 1 107 ? -9.081  -2.501  -0.370  1.00 0.00 ?  320 LEU A HA   3  
ATOM 5879  H HB2  . LEU A 1 107 ? -7.455  -0.693  1.338   1.00 0.00 ?  320 LEU A HB2  3  
ATOM 5880  H HB3  . LEU A 1 107 ? -9.097  -0.520  0.749   1.00 0.00 ?  320 LEU A HB3  3  
ATOM 5881  H HG   . LEU A 1 107 ? -9.614  -2.494  2.403   1.00 0.00 ?  320 LEU A HG   3  
ATOM 5882  H HD11 . LEU A 1 107 ? -6.865  -1.671  3.170   1.00 0.00 ?  320 LEU A HD11 3  
ATOM 5883  H HD12 . LEU A 1 107 ? -8.029  -1.931  4.491   1.00 0.00 ?  320 LEU A HD12 3  
ATOM 5884  H HD13 . LEU A 1 107 ? -7.689  -3.240  3.333   1.00 0.00 ?  320 LEU A HD13 3  
ATOM 5885  H HD21 . LEU A 1 107 ? -10.199 0.076   2.439   1.00 0.00 ?  320 LEU A HD21 3  
ATOM 5886  H HD22 . LEU A 1 107 ? -10.491 -0.958  3.858   1.00 0.00 ?  320 LEU A HD22 3  
ATOM 5887  H HD23 . LEU A 1 107 ? -9.054  0.091   3.802   1.00 0.00 ?  320 LEU A HD23 3  
ATOM 5888  N N    . SER A 1 108 ? -7.461  -1.609  -2.012  1.00 0.00 ?  321 SER A N    3  
ATOM 5889  C CA   . SER A 1 108 ? -6.518  -1.276  -3.066  1.00 0.00 ?  321 SER A CA   3  
ATOM 5890  C C    . SER A 1 108 ? -6.228  0.226   -3.054  1.00 0.00 ?  321 SER A C    3  
ATOM 5891  O O    . SER A 1 108 ? -7.035  1.014   -2.563  1.00 0.00 ?  321 SER A O    3  
ATOM 5892  C CB   . SER A 1 108 ? -7.051  -1.702  -4.436  1.00 0.00 ?  321 SER A CB   3  
ATOM 5893  O OG   . SER A 1 108 ? -6.414  -0.999  -5.499  1.00 0.00 ?  321 SER A OG   3  
ATOM 5894  H H    . SER A 1 108 ? -8.424  -1.485  -2.251  1.00 0.00 ?  321 SER A H    3  
ATOM 5895  H HA   . SER A 1 108 ? -5.616  -1.843  -2.836  1.00 0.00 ?  321 SER A HA   3  
ATOM 5896  H HB2  . SER A 1 108 ? -6.898  -2.773  -4.567  1.00 0.00 ?  321 SER A HB2  3  
ATOM 5897  H HB3  . SER A 1 108 ? -8.126  -1.527  -4.478  1.00 0.00 ?  321 SER A HB3  3  
ATOM 5898  H HG   . SER A 1 108 ? -7.009  -0.982  -6.303  1.00 0.00 ?  321 SER A HG   3  
ATOM 5899  N N    . LEU A 1 109 ? -5.072  0.577   -3.599  1.00 0.00 ?  322 LEU A N    3  
ATOM 5900  C CA   . LEU A 1 109 ? -4.665  1.971   -3.657  1.00 0.00 ?  322 LEU A CA   3  
ATOM 5901  C C    . LEU A 1 109 ? -3.786  2.190   -4.890  1.00 0.00 ?  322 LEU A C    3  
ATOM 5902  O O    . LEU A 1 109 ? -2.613  1.819   -4.895  1.00 0.00 ?  322 LEU A O    3  
ATOM 5903  C CB   . LEU A 1 109 ? -3.999  2.389   -2.345  1.00 0.00 ?  322 LEU A CB   3  
ATOM 5904  C CG   . LEU A 1 109 ? -3.799  3.893   -2.144  1.00 0.00 ?  322 LEU A CG   3  
ATOM 5905  C CD1  . LEU A 1 109 ? -2.335  4.284   -2.355  1.00 0.00 ?  322 LEU A CD1  3  
ATOM 5906  C CD2  . LEU A 1 109 ? -4.742  4.696   -3.041  1.00 0.00 ?  322 LEU A CD2  3  
ATOM 5907  H H    . LEU A 1 109 ? -4.422  -0.070  -3.996  1.00 0.00 ?  322 LEU A H    3  
ATOM 5908  H HA   . LEU A 1 109 ? -5.569  2.571   -3.765  1.00 0.00 ?  322 LEU A HA   3  
ATOM 5909  H HB2  . LEU A 1 109 ? -4.599  2.009   -1.518  1.00 0.00 ?  322 LEU A HB2  3  
ATOM 5910  H HB3  . LEU A 1 109 ? -3.026  1.902   -2.283  1.00 0.00 ?  322 LEU A HB3  3  
ATOM 5911  H HG   . LEU A 1 109 ? -4.051  4.136   -1.111  1.00 0.00 ?  322 LEU A HG   3  
ATOM 5912  H HD11 . LEU A 1 109 ? -1.845  3.535   -2.977  1.00 0.00 ?  322 LEU A HD11 3  
ATOM 5913  H HD12 . LEU A 1 109 ? -2.286  5.255   -2.848  1.00 0.00 ?  322 LEU A HD12 3  
ATOM 5914  H HD13 . LEU A 1 109 ? -1.831  4.341   -1.390  1.00 0.00 ?  322 LEU A HD13 3  
ATOM 5915  H HD21 . LEU A 1 109 ? -5.770  4.381   -2.862  1.00 0.00 ?  322 LEU A HD21 3  
ATOM 5916  H HD22 . LEU A 1 109 ? -4.643  5.758   -2.814  1.00 0.00 ?  322 LEU A HD22 3  
ATOM 5917  H HD23 . LEU A 1 109 ? -4.485  4.522   -4.086  1.00 0.00 ?  322 LEU A HD23 3  
ATOM 5918  N N    . HIS A 1 110 ? -4.387  2.792   -5.906  1.00 0.00 ?  323 HIS A N    3  
ATOM 5919  C CA   . HIS A 1 110 ? -3.674  3.065   -7.142  1.00 0.00 ?  323 HIS A CA   3  
ATOM 5920  C C    . HIS A 1 110 ? -2.443  3.924   -6.845  1.00 0.00 ?  323 HIS A C    3  
ATOM 5921  O O    . HIS A 1 110 ? -2.519  4.880   -6.074  1.00 0.00 ?  323 HIS A O    3  
ATOM 5922  C CB   . HIS A 1 110 ? -4.604  3.700   -8.177  1.00 0.00 ?  323 HIS A CB   3  
ATOM 5923  C CG   . HIS A 1 110 ? -5.356  4.907   -7.669  1.00 0.00 ?  323 HIS A CG   3  
ATOM 5924  N ND1  . HIS A 1 110 ? -4.999  6.204   -7.995  1.00 0.00 ?  323 HIS A ND1  3  
ATOM 5925  C CD2  . HIS A 1 110 ? -6.448  5.000   -6.857  1.00 0.00 ?  323 HIS A CD2  3  
ATOM 5926  C CE1  . HIS A 1 110 ? -5.845  7.032   -7.399  1.00 0.00 ?  323 HIS A CE1  3  
ATOM 5927  N NE2  . HIS A 1 110 ? -6.742  6.284   -6.694  1.00 0.00 ?  323 HIS A NE2  3  
ATOM 5928  H H    . HIS A 1 110 ? -5.341  3.091   -5.894  1.00 0.00 ?  323 HIS A H    3  
ATOM 5929  H HA   . HIS A 1 110 ? -3.348  2.102   -7.535  1.00 0.00 ?  323 HIS A HA   3  
ATOM 5930  H HB2  . HIS A 1 110 ? -4.017  3.991   -9.049  1.00 0.00 ?  323 HIS A HB2  3  
ATOM 5931  H HB3  . HIS A 1 110 ? -5.322  2.952   -8.512  1.00 0.00 ?  323 HIS A HB3  3  
ATOM 5932  H HD1  . HIS A 1 110 ? -4.233  6.471   -8.579  1.00 0.00 ?  323 HIS A HD1  3  
ATOM 5933  H HD2  . HIS A 1 110 ? -6.988  4.162   -6.417  1.00 0.00 ?  323 HIS A HD2  3  
ATOM 5934  H HE1  . HIS A 1 110 ? -5.827  8.120   -7.461  1.00 0.00 ?  323 HIS A HE1  3  
ATOM 5935  H HE2  . HIS A 1 110 ? -7.529  6.641   -6.192  1.00 0.00 ?  323 HIS A HE2  3  
ATOM 5936  N N    . SER A 1 111 ? -1.337  3.554   -7.473  1.00 0.00 ?  324 SER A N    3  
ATOM 5937  C CA   . SER A 1 111 ? -0.091  4.278   -7.286  1.00 0.00 ?  324 SER A CA   3  
ATOM 5938  C C    . SER A 1 111 ? -0.248  5.722   -7.767  1.00 0.00 ?  324 SER A C    3  
ATOM 5939  O O    . SER A 1 111 ? 0.509   6.601   -7.361  1.00 0.00 ?  324 SER A O    3  
ATOM 5940  C CB   . SER A 1 111 ? 1.060   3.595   -8.026  1.00 0.00 ?  324 SER A CB   3  
ATOM 5941  O OG   . SER A 1 111 ? 2.281   4.319   -7.900  1.00 0.00 ?  324 SER A OG   3  
ATOM 5942  H H    . SER A 1 111 ? -1.283  2.776   -8.099  1.00 0.00 ?  324 SER A H    3  
ATOM 5943  H HA   . SER A 1 111 ? 0.100   4.251   -6.213  1.00 0.00 ?  324 SER A HA   3  
ATOM 5944  H HB2  . SER A 1 111 ? 1.195   2.586   -7.634  1.00 0.00 ?  324 SER A HB2  3  
ATOM 5945  H HB3  . SER A 1 111 ? 0.805   3.495   -9.081  1.00 0.00 ?  324 SER A HB3  3  
ATOM 5946  H HG   . SER A 1 111 ? 3.019   3.829   -8.362  1.00 0.00 ?  324 SER A HG   3  
ATOM 5947  N N    . ALA A 1 112 ? -1.237  5.921   -8.626  1.00 0.00 ?  325 ALA A N    3  
ATOM 5948  C CA   . ALA A 1 112 ? -1.504  7.244   -9.167  1.00 0.00 ?  325 ALA A CA   3  
ATOM 5949  C C    . ALA A 1 112 ? -1.899  8.186   -8.028  1.00 0.00 ?  325 ALA A C    3  
ATOM 5950  O O    . ALA A 1 112 ? -1.640  9.386   -8.093  1.00 0.00 ?  325 ALA A O    3  
ATOM 5951  C CB   . ALA A 1 112 ? -2.585  7.146   -10.245 1.00 0.00 ?  325 ALA A CB   3  
ATOM 5952  H H    . ALA A 1 112 ? -1.849  5.201   -8.951  1.00 0.00 ?  325 ALA A H    3  
ATOM 5953  H HA   . ALA A 1 112 ? -0.583  7.606   -9.625  1.00 0.00 ?  325 ALA A HA   3  
ATOM 5954  H HB1  . ALA A 1 112 ? -2.157  7.405   -11.213 1.00 0.00 ?  325 ALA A HB1  3  
ATOM 5955  H HB2  . ALA A 1 112 ? -2.972  6.128   -10.280 1.00 0.00 ?  325 ALA A HB2  3  
ATOM 5956  H HB3  . ALA A 1 112 ? -3.396  7.835   -10.010 1.00 0.00 ?  325 ALA A HB3  3  
ATOM 5957  N N    . ASP A 1 113 ? -2.520  7.606   -7.011  1.00 0.00 ?  326 ASP A N    3  
ATOM 5958  C CA   . ASP A 1 113 ? -2.953  8.379   -5.860  1.00 0.00 ?  326 ASP A CA   3  
ATOM 5959  C C    . ASP A 1 113 ? -1.727  8.917   -5.121  1.00 0.00 ?  326 ASP A C    3  
ATOM 5960  O O    . ASP A 1 113 ? -1.668  10.099  -4.787  1.00 0.00 ?  326 ASP A O    3  
ATOM 5961  C CB   . ASP A 1 113 ? -3.751  7.512   -4.884  1.00 0.00 ?  326 ASP A CB   3  
ATOM 5962  C CG   . ASP A 1 113 ? -4.158  8.209   -3.584  1.00 0.00 ?  326 ASP A CG   3  
ATOM 5963  O OD1  . ASP A 1 113 ? -5.040  9.080   -3.575  1.00 0.00 ?  326 ASP A OD1  3  
ATOM 5964  O OD2  . ASP A 1 113 ? -3.519  7.819   -2.533  1.00 0.00 -1 326 ASP A OD2  3  
ATOM 5965  H H    . ASP A 1 113 ? -2.726  6.628   -6.967  1.00 0.00 ?  326 ASP A H    3  
ATOM 5966  H HA   . ASP A 1 113 ? -3.577  9.174   -6.268  1.00 0.00 ?  326 ASP A HA   3  
ATOM 5967  H HB2  . ASP A 1 113 ? -4.652  7.159   -5.386  1.00 0.00 ?  326 ASP A HB2  3  
ATOM 5968  H HB3  . ASP A 1 113 ? -3.159  6.631   -4.636  1.00 0.00 ?  326 ASP A HB3  3  
ATOM 5969  H HD2  . ASP A 1 113 ? -2.588  8.185   -2.544  1.00 0.00 ?  326 ASP A HD2  3  
ATOM 5970  N N    . PHE A 1 114 ? -0.777  8.023   -4.888  1.00 0.00 ?  327 PHE A N    3  
ATOM 5971  C CA   . PHE A 1 114 ? 0.445   8.393   -4.194  1.00 0.00 ?  327 PHE A CA   3  
ATOM 5972  C C    . PHE A 1 114 ? 1.260   9.395   -5.015  1.00 0.00 ?  327 PHE A C    3  
ATOM 5973  O O    . PHE A 1 114 ? 1.915   10.273  -4.457  1.00 0.00 ?  327 PHE A O    3  
ATOM 5974  C CB   . PHE A 1 114 ? 1.264   7.113   -4.016  1.00 0.00 ?  327 PHE A CB   3  
ATOM 5975  C CG   . PHE A 1 114 ? 2.723   7.356   -3.625  1.00 0.00 ?  327 PHE A CG   3  
ATOM 5976  C CD1  . PHE A 1 114 ? 3.046   8.406   -2.822  1.00 0.00 ?  327 PHE A CD1  3  
ATOM 5977  C CD2  . PHE A 1 114 ? 3.697   6.523   -4.080  1.00 0.00 ?  327 PHE A CD2  3  
ATOM 5978  C CE1  . PHE A 1 114 ? 4.400   8.632   -2.459  1.00 0.00 ?  327 PHE A CE1  3  
ATOM 5979  C CE2  . PHE A 1 114 ? 5.051   6.749   -3.716  1.00 0.00 ?  327 PHE A CE2  3  
ATOM 5980  C CZ   . PHE A 1 114 ? 5.374   7.799   -2.914  1.00 0.00 ?  327 PHE A CZ   3  
ATOM 5981  H H    . PHE A 1 114 ? -0.832  7.063   -5.163  1.00 0.00 ?  327 PHE A H    3  
ATOM 5982  H HA   . PHE A 1 114 ? 0.155   8.852   -3.249  1.00 0.00 ?  327 PHE A HA   3  
ATOM 5983  H HB2  . PHE A 1 114 ? 0.792   6.495   -3.252  1.00 0.00 ?  327 PHE A HB2  3  
ATOM 5984  H HB3  . PHE A 1 114 ? 1.238   6.544   -4.946  1.00 0.00 ?  327 PHE A HB3  3  
ATOM 5985  H HD1  . PHE A 1 114 ? 2.265   9.073   -2.458  1.00 0.00 ?  327 PHE A HD1  3  
ATOM 5986  H HD2  . PHE A 1 114 ? 3.438   5.682   -4.722  1.00 0.00 ?  327 PHE A HD2  3  
ATOM 5987  H HE1  . PHE A 1 114 ? 4.658   9.473   -1.817  1.00 0.00 ?  327 PHE A HE1  3  
ATOM 5988  H HE2  . PHE A 1 114 ? 5.832   6.081   -4.081  1.00 0.00 ?  327 PHE A HE2  3  
ATOM 5989  H HZ   . PHE A 1 114 ? 6.413   7.972   -2.635  1.00 0.00 ?  327 PHE A HZ   3  
ATOM 5990  N N    . GLN A 1 115 ? 1.192   9.229   -6.328  1.00 0.00 ?  328 GLN A N    3  
ATOM 5991  C CA   . GLN A 1 115 ? 1.915   10.107  -7.232  1.00 0.00 ?  328 GLN A CA   3  
ATOM 5992  C C    . GLN A 1 115 ? 1.282   11.500  -7.237  1.00 0.00 ?  328 GLN A C    3  
ATOM 5993  O O    . GLN A 1 115 ? 1.979   12.502  -7.389  1.00 0.00 ?  328 GLN A O    3  
ATOM 5994  C CB   . GLN A 1 115 ? 1.964   9.521   -8.644  1.00 0.00 ?  328 GLN A CB   3  
ATOM 5995  C CG   . GLN A 1 115 ? 2.835   8.264   -8.687  1.00 0.00 ?  328 GLN A CG   3  
ATOM 5996  C CD   . GLN A 1 115 ? 2.677   7.532   -10.021 1.00 0.00 ?  328 GLN A CD   3  
ATOM 5997  O OE1  . GLN A 1 115 ? 2.871   8.088   -11.090 1.00 0.00 ?  328 GLN A OE1  3  
ATOM 5998  N NE2  . GLN A 1 115 ? 2.313   6.259   -9.900  1.00 0.00 ?  328 GLN A NE2  3  
ATOM 5999  H H    . GLN A 1 115 ? 0.657   8.511   -6.774  1.00 0.00 ?  328 GLN A H    3  
ATOM 6000  H HA   . GLN A 1 115 ? 2.928   10.163  -6.833  1.00 0.00 ?  328 GLN A HA   3  
ATOM 6001  H HB2  . GLN A 1 115 ? 0.954   9.280   -8.976  1.00 0.00 ?  328 GLN A HB2  3  
ATOM 6002  H HB3  . GLN A 1 115 ? 2.358   10.265  -9.337  1.00 0.00 ?  328 GLN A HB3  3  
ATOM 6003  H HG2  . GLN A 1 115 ? 3.880   8.537   -8.539  1.00 0.00 ?  328 GLN A HG2  3  
ATOM 6004  H HG3  . GLN A 1 115 ? 2.560   7.599   -7.868  1.00 0.00 ?  328 GLN A HG3  3  
ATOM 6005  H HE21 . GLN A 1 115 ? 2.170   5.864   -8.992  1.00 0.00 ?  328 GLN A HE21 3  
ATOM 6006  H HE22 . GLN A 1 115 ? 2.184   5.696   -10.716 1.00 0.00 ?  328 GLN A HE22 3  
ATOM 6007  N N    . MET A 1 116 ? -0.032  11.518  -7.070  1.00 0.00 ?  329 MET A N    3  
ATOM 6008  C CA   . MET A 1 116 ? -0.767  12.772  -7.054  1.00 0.00 ?  329 MET A CA   3  
ATOM 6009  C C    . MET A 1 116 ? -0.438  13.584  -5.800  1.00 0.00 ?  329 MET A C    3  
ATOM 6010  O O    . MET A 1 116 ? -0.212  14.791  -5.879  1.00 0.00 ?  329 MET A O    3  
ATOM 6011  C CB   . MET A 1 116 ? -2.269  12.484  -7.096  1.00 0.00 ?  329 MET A CB   3  
ATOM 6012  C CG   . MET A 1 116 ? -3.079  13.771  -6.927  1.00 0.00 ?  329 MET A CG   3  
ATOM 6013  S SD   . MET A 1 116 ? -3.394  14.071  -5.196  1.00 0.00 ?  329 MET A SD   3  
ATOM 6014  C CE   . MET A 1 116 ? -4.723  12.912  -4.917  1.00 0.00 ?  329 MET A CE   3  
ATOM 6015  H H    . MET A 1 116 ? -0.592  10.699  -6.947  1.00 0.00 ?  329 MET A H    3  
ATOM 6016  H HA   . MET A 1 116 ? -0.442  13.313  -7.942  1.00 0.00 ?  329 MET A HA   3  
ATOM 6017  H HB2  . MET A 1 116 ? -2.526  12.010  -8.044  1.00 0.00 ?  329 MET A HB2  3  
ATOM 6018  H HB3  . MET A 1 116 ? -2.530  11.779  -6.307  1.00 0.00 ?  329 MET A HB3  3  
ATOM 6019  H HG2  . MET A 1 116 ? -2.536  14.612  -7.357  1.00 0.00 ?  329 MET A HG2  3  
ATOM 6020  H HG3  . MET A 1 116 ? -4.022  13.691  -7.468  1.00 0.00 ?  329 MET A HG3  3  
ATOM 6021  H HE1  . MET A 1 116 ? -5.214  13.143  -3.971  1.00 0.00 ?  329 MET A HE1  3  
ATOM 6022  H HE2  . MET A 1 116 ? -5.446  12.985  -5.729  1.00 0.00 ?  329 MET A HE2  3  
ATOM 6023  H HE3  . MET A 1 116 ? -4.320  11.900  -4.879  1.00 0.00 ?  329 MET A HE3  3  
ATOM 6024  N N    . LEU A 1 117 ? -0.422  12.890  -4.671  1.00 0.00 ?  330 LEU A N    3  
ATOM 6025  C CA   . LEU A 1 117 ? -0.125  13.532  -3.402  1.00 0.00 ?  330 LEU A CA   3  
ATOM 6026  C C    . LEU A 1 117 ? 1.370   13.851  -3.335  1.00 0.00 ?  330 LEU A C    3  
ATOM 6027  O O    . LEU A 1 117 ? 1.760   14.925  -2.880  1.00 0.00 ?  330 LEU A O    3  
ATOM 6028  C CB   . LEU A 1 117 ? -0.624  12.674  -2.237  1.00 0.00 ?  330 LEU A CB   3  
ATOM 6029  C CG   . LEU A 1 117 ? -2.060  12.160  -2.351  1.00 0.00 ?  330 LEU A CG   3  
ATOM 6030  C CD1  . LEU A 1 117 ? -2.102  10.632  -2.285  1.00 0.00 ?  330 LEU A CD1  3  
ATOM 6031  C CD2  . LEU A 1 117 ? -2.958  12.804  -1.293  1.00 0.00 ?  330 LEU A CD2  3  
ATOM 6032  H H    . LEU A 1 117 ? -0.608  11.909  -4.615  1.00 0.00 ?  330 LEU A H    3  
ATOM 6033  H HA   . LEU A 1 117 ? -0.679  14.470  -3.372  1.00 0.00 ?  330 LEU A HA   3  
ATOM 6034  H HB2  . LEU A 1 117 ? 0.041   11.817  -2.133  1.00 0.00 ?  330 LEU A HB2  3  
ATOM 6035  H HB3  . LEU A 1 117 ? -0.539  13.257  -1.321  1.00 0.00 ?  330 LEU A HB3  3  
ATOM 6036  H HG   . LEU A 1 117 ? -2.451  12.451  -3.326  1.00 0.00 ?  330 LEU A HG   3  
ATOM 6037  H HD11 . LEU A 1 117 ? -2.266  10.317  -1.255  1.00 0.00 ?  330 LEU A HD11 3  
ATOM 6038  H HD12 . LEU A 1 117 ? -2.914  10.263  -2.912  1.00 0.00 ?  330 LEU A HD12 3  
ATOM 6039  H HD13 . LEU A 1 117 ? -1.155  10.227  -2.643  1.00 0.00 ?  330 LEU A HD13 3  
ATOM 6040  H HD21 . LEU A 1 117 ? -2.342  13.209  -0.491  1.00 0.00 ?  330 LEU A HD21 3  
ATOM 6041  H HD22 . LEU A 1 117 ? -3.537  13.608  -1.748  1.00 0.00 ?  330 LEU A HD22 3  
ATOM 6042  H HD23 . LEU A 1 117 ? -3.637  12.053  -0.887  1.00 0.00 ?  330 LEU A HD23 3  
ATOM 6043  N N    . CYS A 1 118 ? 2.167   12.897  -3.794  1.00 0.00 ?  331 CYS A N    3  
ATOM 6044  C CA   . CYS A 1 118 ? 3.611   13.062  -3.791  1.00 0.00 ?  331 CYS A CA   3  
ATOM 6045  C C    . CYS A 1 118 ? 3.967   14.186  -4.766  1.00 0.00 ?  331 CYS A C    3  
ATOM 6046  O O    . CYS A 1 118 ? 4.864   14.984  -4.498  1.00 0.00 ?  331 CYS A O    3  
ATOM 6047  C CB   . CYS A 1 118 ? 4.330   11.757  -4.138  1.00 0.00 ?  331 CYS A CB   3  
ATOM 6048  S SG   . CYS A 1 118 ? 6.122   11.923  -3.805  1.00 0.00 ?  331 CYS A SG   3  
ATOM 6049  H H    . CYS A 1 118 ? 1.842   12.026  -4.162  1.00 0.00 ?  331 CYS A H    3  
ATOM 6050  H HA   . CYS A 1 118 ? 3.894   13.329  -2.773  1.00 0.00 ?  331 CYS A HA   3  
ATOM 6051  H HB2  . CYS A 1 118 ? 3.917   10.938  -3.550  1.00 0.00 ?  331 CYS A HB2  3  
ATOM 6052  H HB3  . CYS A 1 118 ? 4.168   11.510  -5.187  1.00 0.00 ?  331 CYS A HB3  3  
ATOM 6053  H HG   . CYS A 1 118 ? 6.216   10.857  -3.015  1.00 0.00 ?  331 CYS A HG   3  
ATOM 6054  N N    . SER A 1 119 ? 3.246   14.214  -5.877  1.00 0.00 ?  332 SER A N    3  
ATOM 6055  C CA   . SER A 1 119 ? 3.475   15.227  -6.894  1.00 0.00 ?  332 SER A CA   3  
ATOM 6056  C C    . SER A 1 119 ? 2.868   16.559  -6.450  1.00 0.00 ?  332 SER A C    3  
ATOM 6057  O O    . SER A 1 119 ? 3.312   17.622  -6.881  1.00 0.00 ?  332 SER A O    3  
ATOM 6058  C CB   . SER A 1 119 ? 2.890   14.798  -8.241  1.00 0.00 ?  332 SER A CB   3  
ATOM 6059  O OG   . SER A 1 119 ? 3.140   15.760  -9.262  1.00 0.00 ?  332 SER A OG   3  
ATOM 6060  H H    . SER A 1 119 ? 2.518   13.561  -6.088  1.00 0.00 ?  332 SER A H    3  
ATOM 6061  H HA   . SER A 1 119 ? 4.559   15.310  -6.979  1.00 0.00 ?  332 SER A HA   3  
ATOM 6062  H HB2  . SER A 1 119 ? 3.317   13.839  -8.533  1.00 0.00 ?  332 SER A HB2  3  
ATOM 6063  H HB3  . SER A 1 119 ? 1.815   14.649  -8.138  1.00 0.00 ?  332 SER A HB3  3  
ATOM 6064  H HG   . SER A 1 119 ? 2.329   15.867  -9.837  1.00 0.00 ?  332 SER A HG   3  
ATOM 6065  N N    . SER A 1 120 ? 1.860   16.458  -5.596  1.00 0.00 ?  333 SER A N    3  
ATOM 6066  C CA   . SER A 1 120 ? 1.187   17.642  -5.090  1.00 0.00 ?  333 SER A CA   3  
ATOM 6067  C C    . SER A 1 120 ? 2.097   18.383  -4.109  1.00 0.00 ?  333 SER A C    3  
ATOM 6068  O O    . SER A 1 120 ? 2.133   19.612  -4.096  1.00 0.00 ?  333 SER A O    3  
ATOM 6069  C CB   . SER A 1 120 ? -0.137  17.277  -4.414  1.00 0.00 ?  333 SER A CB   3  
ATOM 6070  O OG   . SER A 1 120 ? -0.693  18.377  -3.700  1.00 0.00 ?  333 SER A OG   3  
ATOM 6071  H H    . SER A 1 120 ? 1.504   15.590  -5.251  1.00 0.00 ?  333 SER A H    3  
ATOM 6072  H HA   . SER A 1 120 ? 0.988   18.258  -5.967  1.00 0.00 ?  333 SER A HA   3  
ATOM 6073  H HB2  . SER A 1 120 ? -0.847  16.938  -5.168  1.00 0.00 ?  333 SER A HB2  3  
ATOM 6074  H HB3  . SER A 1 120 ? 0.024   16.444  -3.730  1.00 0.00 ?  333 SER A HB3  3  
ATOM 6075  H HG   . SER A 1 120 ? -0.586  18.235  -2.716  1.00 0.00 ?  333 SER A HG   3  
ATOM 6076  N N    . SER A 1 121 ? 2.810   17.603  -3.309  1.00 0.00 ?  334 SER A N    3  
ATOM 6077  C CA   . SER A 1 121 ? 3.718   18.170  -2.326  1.00 0.00 ?  334 SER A CA   3  
ATOM 6078  C C    . SER A 1 121 ? 5.161   17.790  -2.667  1.00 0.00 ?  334 SER A C    3  
ATOM 6079  O O    . SER A 1 121 ? 5.469   16.615  -2.856  1.00 0.00 ?  334 SER A O    3  
ATOM 6080  C CB   . SER A 1 121 ? 3.365   17.700  -0.914  1.00 0.00 ?  334 SER A CB   3  
ATOM 6081  O OG   . SER A 1 121 ? 3.401   18.767  0.029   1.00 0.00 ?  334 SER A OG   3  
ATOM 6082  H H    . SER A 1 121 ? 2.776   16.604  -3.325  1.00 0.00 ?  334 SER A H    3  
ATOM 6083  H HA   . SER A 1 121 ? 3.580   19.249  -2.394  1.00 0.00 ?  334 SER A HA   3  
ATOM 6084  H HB2  . SER A 1 121 ? 2.370   17.254  -0.919  1.00 0.00 ?  334 SER A HB2  3  
ATOM 6085  H HB3  . SER A 1 121 ? 4.061   16.920  -0.606  1.00 0.00 ?  334 SER A HB3  3  
ATOM 6086  H HG   . SER A 1 121 ? 2.841   18.540  0.825   1.00 0.00 ?  334 SER A HG   3  
ATOM 6087  N N    . PRO A 1 122 ? 6.029   18.835  -2.735  1.00 0.00 ?  335 PRO A N    3  
ATOM 6088  C CA   . PRO A 1 122 ? 7.432   18.623  -3.049  1.00 0.00 ?  335 PRO A CA   3  
ATOM 6089  C C    . PRO A 1 122 ? 8.179   18.035  -1.850  1.00 0.00 ?  335 PRO A C    3  
ATOM 6090  O O    . PRO A 1 122 ? 9.162   17.316  -2.019  1.00 0.00 ?  335 PRO A O    3  
ATOM 6091  C CB   . PRO A 1 122 ? 7.954   19.989  -3.462  1.00 0.00 ?  335 PRO A CB   3  
ATOM 6092  C CG   . PRO A 1 122 ? 6.953   20.998  -2.922  1.00 0.00 ?  335 PRO A CG   3  
ATOM 6093  C CD   . PRO A 1 122 ? 5.700   20.240  -2.516  1.00 0.00 ?  335 PRO A CD   3  
ATOM 6094  H HA   . PRO A 1 122 ? 7.525   17.952  -3.785  1.00 0.00 ?  335 PRO A HA   3  
ATOM 6095  H HB2  . PRO A 1 122 ? 8.948   20.168  -3.053  1.00 0.00 ?  335 PRO A HB2  3  
ATOM 6096  H HB3  . PRO A 1 122 ? 8.037   20.064  -4.546  1.00 0.00 ?  335 PRO A HB3  3  
ATOM 6097  H HG2  . PRO A 1 122 ? 7.371   21.530  -2.067  1.00 0.00 ?  335 PRO A HG2  3  
ATOM 6098  H HG3  . PRO A 1 122 ? 6.719   21.746  -3.679  1.00 0.00 ?  335 PRO A HG3  3  
ATOM 6099  H HD2  . PRO A 1 122 ? 5.443   20.429  -1.474  1.00 0.00 ?  335 PRO A HD2  3  
ATOM 6100  H HD3  . PRO A 1 122 ? 4.842   20.544  -3.115  1.00 0.00 ?  335 PRO A HD3  3  
ATOM 6101  N N    . GLU A 1 123 ? 7.684   18.363  -0.666  1.00 0.00 ?  336 GLU A N    3  
ATOM 6102  C CA   . GLU A 1 123 ? 8.293   17.877  0.561   1.00 0.00 ?  336 GLU A CA   3  
ATOM 6103  C C    . GLU A 1 123 ? 8.113   16.362  0.678   1.00 0.00 ?  336 GLU A C    3  
ATOM 6104  O O    . GLU A 1 123 ? 8.946   15.679  1.272   1.00 0.00 ?  336 GLU A O    3  
ATOM 6105  C CB   . GLU A 1 123 ? 7.714   18.594  1.782   1.00 0.00 ?  336 GLU A CB   3  
ATOM 6106  C CG   . GLU A 1 123 ? 8.709   18.590  2.944   1.00 0.00 ?  336 GLU A CG   3  
ATOM 6107  C CD   . GLU A 1 123 ? 8.041   19.051  4.240   1.00 0.00 ?  336 GLU A CD   3  
ATOM 6108  O OE1  . GLU A 1 123 ? 7.835   18.239  5.155   1.00 0.00 ?  336 GLU A OE1  3  
ATOM 6109  O OE2  . GLU A 1 123 ? 7.732   20.303  4.279   1.00 0.00 -1 336 GLU A OE2  3  
ATOM 6110  H H    . GLU A 1 123 ? 6.884   18.949  -0.537  1.00 0.00 ?  336 GLU A H    3  
ATOM 6111  H HA   . GLU A 1 123 ? 9.352   18.118  0.474   1.00 0.00 ?  336 GLU A HA   3  
ATOM 6112  H HB2  . GLU A 1 123 ? 7.460   19.621  1.519   1.00 0.00 ?  336 GLU A HB2  3  
ATOM 6113  H HB3  . GLU A 1 123 ? 6.788   18.107  2.090   1.00 0.00 ?  336 GLU A HB3  3  
ATOM 6114  H HG2  . GLU A 1 123 ? 9.114   17.587  3.076   1.00 0.00 ?  336 GLU A HG2  3  
ATOM 6115  H HG3  . GLU A 1 123 ? 9.549   19.244  2.710   1.00 0.00 ?  336 GLU A HG3  3  
ATOM 6116  H HE2  . GLU A 1 123 ? 7.426   20.608  3.378   1.00 0.00 ?  336 GLU A HE2  3  
ATOM 6117  N N    . ILE A 1 124 ? 7.021   15.882  0.102   1.00 0.00 ?  337 ILE A N    3  
ATOM 6118  C CA   . ILE A 1 124 ? 6.721   14.460  0.135   1.00 0.00 ?  337 ILE A CA   3  
ATOM 6119  C C    . ILE A 1 124 ? 7.636   13.728  -0.850  1.00 0.00 ?  337 ILE A C    3  
ATOM 6120  O O    . ILE A 1 124 ? 8.041   12.594  -0.600  1.00 0.00 ?  337 ILE A O    3  
ATOM 6121  C CB   . ILE A 1 124 ? 5.231   14.221  -0.115  1.00 0.00 ?  337 ILE A CB   3  
ATOM 6122  C CG1  . ILE A 1 124 ? 4.390   14.727  1.058   1.00 0.00 ?  337 ILE A CG1  3  
ATOM 6123  C CG2  . ILE A 1 124 ? 4.957   12.747  -0.423  1.00 0.00 ?  337 ILE A CG2  3  
ATOM 6124  C CD1  . ILE A 1 124 ? 2.909   14.798  0.681   1.00 0.00 ?  337 ILE A CD1  3  
ATOM 6125  H H    . ILE A 1 124 ? 6.349   16.444  -0.379  1.00 0.00 ?  337 ILE A H    3  
ATOM 6126  H HA   . ILE A 1 124 ? 6.941   14.103  1.141   1.00 0.00 ?  337 ILE A HA   3  
ATOM 6127  H HB   . ILE A 1 124 ? 4.936   14.794  -0.994  1.00 0.00 ?  337 ILE A HB   3  
ATOM 6128  H HG12 . ILE A 1 124 ? 4.520   14.067  1.915   1.00 0.00 ?  337 ILE A HG12 3  
ATOM 6129  H HG13 . ILE A 1 124 ? 4.739   15.715  1.361   1.00 0.00 ?  337 ILE A HG13 3  
ATOM 6130  H HG21 . ILE A 1 124 ? 5.446   12.474  -1.358  1.00 0.00 ?  337 ILE A HG21 3  
ATOM 6131  H HG22 . ILE A 1 124 ? 5.346   12.129  0.385   1.00 0.00 ?  337 ILE A HG22 3  
ATOM 6132  H HG23 . ILE A 1 124 ? 3.882   12.590  -0.516  1.00 0.00 ?  337 ILE A HG23 3  
ATOM 6133  H HD11 . ILE A 1 124 ? 2.310   14.351  1.475   1.00 0.00 ?  337 ILE A HD11 3  
ATOM 6134  H HD12 . ILE A 1 124 ? 2.617   15.839  0.548   1.00 0.00 ?  337 ILE A HD12 3  
ATOM 6135  H HD13 . ILE A 1 124 ? 2.744   14.253  -0.249  1.00 0.00 ?  337 ILE A HD13 3  
ATOM 6136  N N    . ALA A 1 125 ? 7.933   14.406  -1.948  1.00 0.00 ?  338 ALA A N    3  
ATOM 6137  C CA   . ALA A 1 125 ? 8.792   13.834  -2.971  1.00 0.00 ?  338 ALA A CA   3  
ATOM 6138  C C    . ALA A 1 125 ? 10.235  13.812  -2.465  1.00 0.00 ?  338 ALA A C    3  
ATOM 6139  O O    . ALA A 1 125 ? 11.014  12.936  -2.838  1.00 0.00 ?  338 ALA A O    3  
ATOM 6140  C CB   . ALA A 1 125 ? 8.640   14.631  -4.269  1.00 0.00 ?  338 ALA A CB   3  
ATOM 6141  H H    . ALA A 1 125 ? 7.599   15.328  -2.144  1.00 0.00 ?  338 ALA A H    3  
ATOM 6142  H HA   . ALA A 1 125 ? 8.461   12.811  -3.147  1.00 0.00 ?  338 ALA A HA   3  
ATOM 6143  H HB1  . ALA A 1 125 ? 9.542   14.518  -4.872  1.00 0.00 ?  338 ALA A HB1  3  
ATOM 6144  H HB2  . ALA A 1 125 ? 7.781   14.258  -4.826  1.00 0.00 ?  338 ALA A HB2  3  
ATOM 6145  H HB3  . ALA A 1 125 ? 8.491   15.685  -4.033  1.00 0.00 ?  338 ALA A HB3  3  
ATOM 6146  N N    . GLU A 1 126 ? 10.549  14.787  -1.625  1.00 0.00 ?  339 GLU A N    3  
ATOM 6147  C CA   . GLU A 1 126 ? 11.886  14.890  -1.064  1.00 0.00 ?  339 GLU A CA   3  
ATOM 6148  C C    . GLU A 1 126 ? 12.091  13.829  0.018   1.00 0.00 ?  339 GLU A C    3  
ATOM 6149  O O    . GLU A 1 126 ? 13.117  13.150  0.041   1.00 0.00 ?  339 GLU A O    3  
ATOM 6150  C CB   . GLU A 1 126 ? 12.141  16.294  -0.510  1.00 0.00 ?  339 GLU A CB   3  
ATOM 6151  C CG   . GLU A 1 126 ? 12.020  17.348  -1.613  1.00 0.00 ?  339 GLU A CG   3  
ATOM 6152  C CD   . GLU A 1 126 ? 13.287  18.202  -1.696  1.00 0.00 ?  339 GLU A CD   3  
ATOM 6153  O OE1  . GLU A 1 126 ? 14.247  17.820  -2.381  1.00 0.00 ?  339 GLU A OE1  3  
ATOM 6154  O OE2  . GLU A 1 126 ? 13.251  19.299  -1.018  1.00 0.00 -1 339 GLU A OE2  3  
ATOM 6155  H H    . GLU A 1 126 ? 9.910   15.496  -1.327  1.00 0.00 ?  339 GLU A H    3  
ATOM 6156  H HA   . GLU A 1 126 ? 12.564  14.706  -1.897  1.00 0.00 ?  339 GLU A HA   3  
ATOM 6157  H HB2  . GLU A 1 126 ? 11.428  16.510  0.285   1.00 0.00 ?  339 GLU A HB2  3  
ATOM 6158  H HB3  . GLU A 1 126 ? 13.136  16.338  -0.067  1.00 0.00 ?  339 GLU A HB3  3  
ATOM 6159  H HG2  . GLU A 1 126 ? 11.843  16.859  -2.571  1.00 0.00 ?  339 GLU A HG2  3  
ATOM 6160  H HG3  . GLU A 1 126 ? 11.159  17.987  -1.417  1.00 0.00 ?  339 GLU A HG3  3  
ATOM 6161  H HE2  . GLU A 1 126 ? 13.479  19.116  -0.061  1.00 0.00 ?  339 GLU A HE2  3  
ATOM 6162  N N    . ILE A 1 127 ? 11.099  13.718  0.889   1.00 0.00 ?  340 ILE A N    3  
ATOM 6163  C CA   . ILE A 1 127 ? 11.158  12.750  1.972   1.00 0.00 ?  340 ILE A CA   3  
ATOM 6164  C C    . ILE A 1 127 ? 10.988  11.341  1.400   1.00 0.00 ?  340 ILE A C    3  
ATOM 6165  O O    . ILE A 1 127 ? 11.612  10.394  1.877   1.00 0.00 ?  340 ILE A O    3  
ATOM 6166  C CB   . ILE A 1 127 ? 10.139  13.099  3.059   1.00 0.00 ?  340 ILE A CB   3  
ATOM 6167  C CG1  . ILE A 1 127 ? 10.478  14.438  3.717   1.00 0.00 ?  340 ILE A CG1  3  
ATOM 6168  C CG2  . ILE A 1 127 ? 10.023  11.970  4.084   1.00 0.00 ?  340 ILE A CG2  3  
ATOM 6169  C CD1  . ILE A 1 127 ? 9.297   14.959  4.539   1.00 0.00 ?  340 ILE A CD1  3  
ATOM 6170  H H    . ILE A 1 127 ? 10.268  14.273  0.864   1.00 0.00 ?  340 ILE A H    3  
ATOM 6171  H HA   . ILE A 1 127 ? 12.148  12.823  2.422   1.00 0.00 ?  340 ILE A HA   3  
ATOM 6172  H HB   . ILE A 1 127 ? 9.162   13.210  2.589   1.00 0.00 ?  340 ILE A HB   3  
ATOM 6173  H HG12 . ILE A 1 127 ? 11.350  14.321  4.361   1.00 0.00 ?  340 ILE A HG12 3  
ATOM 6174  H HG13 . ILE A 1 127 ? 10.742  15.168  2.951   1.00 0.00 ?  340 ILE A HG13 3  
ATOM 6175  H HG21 . ILE A 1 127 ? 10.000  11.011  3.567   1.00 0.00 ?  340 ILE A HG21 3  
ATOM 6176  H HG22 . ILE A 1 127 ? 10.880  12.000  4.757   1.00 0.00 ?  340 ILE A HG22 3  
ATOM 6177  H HG23 . ILE A 1 127 ? 9.105   12.094  4.659   1.00 0.00 ?  340 ILE A HG23 3  
ATOM 6178  H HD11 . ILE A 1 127 ? 8.460   15.175  3.876   1.00 0.00 ?  340 ILE A HD11 3  
ATOM 6179  H HD12 . ILE A 1 127 ? 8.999   14.204  5.266   1.00 0.00 ?  340 ILE A HD12 3  
ATOM 6180  H HD13 . ILE A 1 127 ? 9.591   15.870  5.061   1.00 0.00 ?  340 ILE A HD13 3  
ATOM 6181  N N    . PHE A 1 128 ? 10.140  11.247  0.386   1.00 0.00 ?  341 PHE A N    3  
ATOM 6182  C CA   . PHE A 1 128 ? 9.880   9.969   -0.256  1.00 0.00 ?  341 PHE A CA   3  
ATOM 6183  C C    . PHE A 1 128 ? 11.119  9.467   -0.999  1.00 0.00 ?  341 PHE A C    3  
ATOM 6184  O O    . PHE A 1 128 ? 11.443  8.281   -0.942  1.00 0.00 ?  341 PHE A O    3  
ATOM 6185  C CB   . PHE A 1 128 ? 8.752   10.197  -1.264  1.00 0.00 ?  341 PHE A CB   3  
ATOM 6186  C CG   . PHE A 1 128 ? 8.510   9.014   -2.204  1.00 0.00 ?  341 PHE A CG   3  
ATOM 6187  C CD1  . PHE A 1 128 ? 8.616   7.741   -1.737  1.00 0.00 ?  341 PHE A CD1  3  
ATOM 6188  C CD2  . PHE A 1 128 ? 8.189   9.235   -3.507  1.00 0.00 ?  341 PHE A CD2  3  
ATOM 6189  C CE1  . PHE A 1 128 ? 8.391   6.643   -2.609  1.00 0.00 ?  341 PHE A CE1  3  
ATOM 6190  C CE2  . PHE A 1 128 ? 7.965   8.138   -4.380  1.00 0.00 ?  341 PHE A CE2  3  
ATOM 6191  C CZ   . PHE A 1 128 ? 8.070   6.865   -3.912  1.00 0.00 ?  341 PHE A CZ   3  
ATOM 6192  H H    . PHE A 1 128 ? 9.636   12.021  0.004   1.00 0.00 ?  341 PHE A H    3  
ATOM 6193  H HA   . PHE A 1 128 ? 9.617   9.260   0.530   1.00 0.00 ?  341 PHE A HA   3  
ATOM 6194  H HB2  . PHE A 1 128 ? 7.831   10.411  -0.722  1.00 0.00 ?  341 PHE A HB2  3  
ATOM 6195  H HB3  . PHE A 1 128 ? 8.984   11.079  -1.860  1.00 0.00 ?  341 PHE A HB3  3  
ATOM 6196  H HD1  . PHE A 1 128 ? 8.873   7.564   -0.693  1.00 0.00 ?  341 PHE A HD1  3  
ATOM 6197  H HD2  . PHE A 1 128 ? 8.104   10.255  -3.882  1.00 0.00 ?  341 PHE A HD2  3  
ATOM 6198  H HE1  . PHE A 1 128 ? 8.476   5.623   -2.235  1.00 0.00 ?  341 PHE A HE1  3  
ATOM 6199  H HE2  . PHE A 1 128 ? 7.707   8.315   -5.424  1.00 0.00 ?  341 PHE A HE2  3  
ATOM 6200  H HZ   . PHE A 1 128 ? 7.898   6.022   -4.582  1.00 0.00 ?  341 PHE A HZ   3  
ATOM 6201  N N    . ARG A 1 129 ? 11.779  10.393  -1.678  1.00 0.00 ?  342 ARG A N    3  
ATOM 6202  C CA   . ARG A 1 129 ? 12.975  10.059  -2.432  1.00 0.00 ?  342 ARG A CA   3  
ATOM 6203  C C    . ARG A 1 129 ? 14.130  9.741   -1.480  1.00 0.00 ?  342 ARG A C    3  
ATOM 6204  O O    . ARG A 1 129 ? 14.950  8.869   -1.763  1.00 0.00 ?  342 ARG A O    3  
ATOM 6205  C CB   . ARG A 1 129 ? 13.385  11.210  -3.353  1.00 0.00 ?  342 ARG A CB   3  
ATOM 6206  C CG   . ARG A 1 129 ? 14.682  10.882  -4.096  1.00 0.00 ?  342 ARG A CG   3  
ATOM 6207  C CD   . ARG A 1 129 ? 14.618  11.362  -5.548  1.00 0.00 ?  342 ARG A CD   3  
ATOM 6208  N NE   . ARG A 1 129 ? 15.434  12.586  -5.712  1.00 0.00 ?  342 ARG A NE   3  
ATOM 6209  C CZ   . ARG A 1 129 ? 15.755  13.122  -6.897  1.00 0.00 ?  342 ARG A CZ   3  
ATOM 6210  N NH1  . ARG A 1 129 ? 15.331  12.545  -8.030  1.00 0.00 ?  342 ARG A NH1  3  
ATOM 6211  N NH2  . ARG A 1 129 ? 16.499  14.235  -6.951  1.00 0.00 1  342 ARG A NH2  3  
ATOM 6212  H H    . ARG A 1 129 ? 11.508  11.355  -1.719  1.00 0.00 ?  342 ARG A H    3  
ATOM 6213  H HA   . ARG A 1 129 ? 12.699  9.184   -3.019  1.00 0.00 ?  342 ARG A HA   3  
ATOM 6214  H HB2  . ARG A 1 129 ? 12.589  11.406  -4.072  1.00 0.00 ?  342 ARG A HB2  3  
ATOM 6215  H HB3  . ARG A 1 129 ? 13.517  12.120  -2.768  1.00 0.00 ?  342 ARG A HB3  3  
ATOM 6216  H HG2  . ARG A 1 129 ? 15.524  11.353  -3.590  1.00 0.00 ?  342 ARG A HG2  3  
ATOM 6217  H HG3  . ARG A 1 129 ? 14.857  9.806   -4.073  1.00 0.00 ?  342 ARG A HG3  3  
ATOM 6218  H HD2  . ARG A 1 129 ? 14.982  10.581  -6.214  1.00 0.00 ?  342 ARG A HD2  3  
ATOM 6219  H HD3  . ARG A 1 129 ? 13.584  11.564  -5.828  1.00 0.00 ?  342 ARG A HD3  3  
ATOM 6220  H HE   . ARG A 1 129 ? 15.767  13.042  -4.886  1.00 0.00 ?  342 ARG A HE   3  
ATOM 6221  H HH11 . ARG A 1 129 ? 14.775  11.714  -7.990  1.00 0.00 ?  342 ARG A HH11 3  
ATOM 6222  H HH12 . ARG A 1 129 ? 15.570  12.944  -8.915  1.00 0.00 ?  342 ARG A HH12 3  
ATOM 6223  H HH21 . ARG A 1 129 ? 16.815  14.665  -6.105  1.00 0.00 ?  342 ARG A HH21 3  
ATOM 6224  H HH22 . ARG A 1 129 ? 16.738  14.634  -7.835  1.00 0.00 ?  342 ARG A HH22 3  
ATOM 6225  N N    . LYS A 1 130 ? 14.158  10.466  -0.371  1.00 0.00 ?  343 LYS A N    3  
ATOM 6226  C CA   . LYS A 1 130 ? 15.199  10.272  0.624   1.00 0.00 ?  343 LYS A CA   3  
ATOM 6227  C C    . LYS A 1 130 ? 15.071  8.870   1.222   1.00 0.00 ?  343 LYS A C    3  
ATOM 6228  O O    . LYS A 1 130 ? 16.048  8.124   1.279   1.00 0.00 ?  343 LYS A O    3  
ATOM 6229  C CB   . LYS A 1 130 ? 15.159  11.392  1.666   1.00 0.00 ?  343 LYS A CB   3  
ATOM 6230  C CG   . LYS A 1 130 ? 16.387  12.296  1.547   1.00 0.00 ?  343 LYS A CG   3  
ATOM 6231  C CD   . LYS A 1 130 ? 16.060  13.564  0.757   1.00 0.00 ?  343 LYS A CD   3  
ATOM 6232  C CE   . LYS A 1 130 ? 15.561  14.675  1.683   1.00 0.00 ?  343 LYS A CE   3  
ATOM 6233  N NZ   . LYS A 1 130 ? 15.975  16.001  1.173   1.00 0.00 1  343 LYS A NZ   3  
ATOM 6234  H H    . LYS A 1 130 ? 13.487  11.174  -0.149  1.00 0.00 ?  343 LYS A H    3  
ATOM 6235  H HA   . LYS A 1 130 ? 16.158  10.343  0.112   1.00 0.00 ?  343 LYS A HA   3  
ATOM 6236  H HB2  . LYS A 1 130 ? 14.253  11.984  1.536   1.00 0.00 ?  343 LYS A HB2  3  
ATOM 6237  H HB3  . LYS A 1 130 ? 15.115  10.961  2.667   1.00 0.00 ?  343 LYS A HB3  3  
ATOM 6238  H HG2  . LYS A 1 130 ? 16.743  12.565  2.542   1.00 0.00 ?  343 LYS A HG2  3  
ATOM 6239  H HG3  . LYS A 1 130 ? 17.195  11.754  1.055   1.00 0.00 ?  343 LYS A HG3  3  
ATOM 6240  H HD2  . LYS A 1 130 ? 16.948  13.903  0.222   1.00 0.00 ?  343 LYS A HD2  3  
ATOM 6241  H HD3  . LYS A 1 130 ? 15.301  13.343  0.006   1.00 0.00 ?  343 LYS A HD3  3  
ATOM 6242  H HE2  . LYS A 1 130 ? 14.475  14.631  1.761   1.00 0.00 ?  343 LYS A HE2  3  
ATOM 6243  H HE3  . LYS A 1 130 ? 15.958  14.524  2.687   1.00 0.00 ?  343 LYS A HE3  3  
ATOM 6244  H HZ1  . LYS A 1 130 ? 16.465  16.496  1.891   1.00 0.00 ?  343 LYS A HZ1  3  
ATOM 6245  H HZ2  . LYS A 1 130 ? 16.575  15.881  0.382   1.00 0.00 ?  343 LYS A HZ2  3  
ATOM 6246  H HZ3  . LYS A 1 130 ? 15.166  16.521  0.901   1.00 0.00 ?  343 LYS A HZ3  3  
ATOM 6247  N N    . THR A 1 131 ? 13.859  8.553   1.654   1.00 0.00 ?  344 THR A N    3  
ATOM 6248  C CA   . THR A 1 131 ? 13.591  7.254   2.246   1.00 0.00 ?  344 THR A CA   3  
ATOM 6249  C C    . THR A 1 131 ? 13.777  6.146   1.207   1.00 0.00 ?  344 THR A C    3  
ATOM 6250  O O    . THR A 1 131 ? 14.194  5.038   1.543   1.00 0.00 ?  344 THR A O    3  
ATOM 6251  C CB   . THR A 1 131 ? 12.187  7.290   2.851   1.00 0.00 ?  344 THR A CB   3  
ATOM 6252  O OG1  . THR A 1 131 ? 12.124  6.115   3.654   1.00 0.00 ?  344 THR A OG1  3  
ATOM 6253  C CG2  . THR A 1 131 ? 11.092  7.084   1.802   1.00 0.00 ?  344 THR A CG2  3  
ATOM 6254  H H    . THR A 1 131 ? 13.070  9.166   1.604   1.00 0.00 ?  344 THR A H    3  
ATOM 6255  H HA   . THR A 1 131 ? 14.323  7.078   3.035   1.00 0.00 ?  344 THR A HA   3  
ATOM 6256  H HB   . THR A 1 131 ? 12.025  8.214   3.405   1.00 0.00 ?  344 THR A HB   3  
ATOM 6257  H HG1  . THR A 1 131 ? 11.925  6.359   4.603   1.00 0.00 ?  344 THR A HG1  3  
ATOM 6258  H HG21 . THR A 1 131 ? 11.354  6.240   1.164   1.00 0.00 ?  344 THR A HG21 3  
ATOM 6259  H HG22 . THR A 1 131 ? 10.144  6.881   2.301   1.00 0.00 ?  344 THR A HG22 3  
ATOM 6260  H HG23 . THR A 1 131 ? 10.998  7.983   1.193   1.00 0.00 ?  344 THR A HG23 3  
ATOM 6261  N N    . ALA A 1 132 ? 13.459  6.483   -0.034  1.00 0.00 ?  345 ALA A N    3  
ATOM 6262  C CA   . ALA A 1 132 ? 13.586  5.530   -1.124  1.00 0.00 ?  345 ALA A CA   3  
ATOM 6263  C C    . ALA A 1 132 ? 15.064  5.198   -1.335  1.00 0.00 ?  345 ALA A C    3  
ATOM 6264  O O    . ALA A 1 132 ? 15.425  4.033   -1.495  1.00 0.00 ?  345 ALA A O    3  
ATOM 6265  C CB   . ALA A 1 132 ? 12.931  6.104   -2.382  1.00 0.00 ?  345 ALA A CB   3  
ATOM 6266  H H    . ALA A 1 132 ? 13.120  7.386   -0.299  1.00 0.00 ?  345 ALA A H    3  
ATOM 6267  H HA   . ALA A 1 132 ? 13.055  4.623   -0.835  1.00 0.00 ?  345 ALA A HA   3  
ATOM 6268  H HB1  . ALA A 1 132 ? 11.948  5.654   -2.518  1.00 0.00 ?  345 ALA A HB1  3  
ATOM 6269  H HB2  . ALA A 1 132 ? 12.825  7.184   -2.276  1.00 0.00 ?  345 ALA A HB2  3  
ATOM 6270  H HB3  . ALA A 1 132 ? 13.555  5.885   -3.249  1.00 0.00 ?  345 ALA A HB3  3  
ATOM 6271  N N    . LEU A 1 133 ? 15.879  6.242   -1.330  1.00 0.00 ?  346 LEU A N    3  
ATOM 6272  C CA   . LEU A 1 133 ? 17.310  6.075   -1.519  1.00 0.00 ?  346 LEU A CA   3  
ATOM 6273  C C    . LEU A 1 133 ? 17.889  5.293   -0.338  1.00 0.00 ?  346 LEU A C    3  
ATOM 6274  O O    . LEU A 1 133 ? 18.797  4.481   -0.512  1.00 0.00 ?  346 LEU A O    3  
ATOM 6275  C CB   . LEU A 1 133 ? 17.982  7.431   -1.746  1.00 0.00 ?  346 LEU A CB   3  
ATOM 6276  C CG   . LEU A 1 133 ? 18.139  7.865   -3.205  1.00 0.00 ?  346 LEU A CG   3  
ATOM 6277  C CD1  . LEU A 1 133 ? 16.976  8.760   -3.638  1.00 0.00 ?  346 LEU A CD1  3  
ATOM 6278  C CD2  . LEU A 1 133 ? 19.494  8.537   -3.435  1.00 0.00 ?  346 LEU A CD2  3  
ATOM 6279  H H    . LEU A 1 133 ? 15.578  7.186   -1.199  1.00 0.00 ?  346 LEU A H    3  
ATOM 6280  H HA   . LEU A 1 133 ? 17.453  5.488   -2.426  1.00 0.00 ?  346 LEU A HA   3  
ATOM 6281  H HB2  . LEU A 1 133 ? 17.406  8.192   -1.220  1.00 0.00 ?  346 LEU A HB2  3  
ATOM 6282  H HB3  . LEU A 1 133 ? 18.971  7.405   -1.287  1.00 0.00 ?  346 LEU A HB3  3  
ATOM 6283  H HG   . LEU A 1 133 ? 18.110  6.974   -3.832  1.00 0.00 ?  346 LEU A HG   3  
ATOM 6284  H HD11 . LEU A 1 133 ? 17.211  9.223   -4.596  1.00 0.00 ?  346 LEU A HD11 3  
ATOM 6285  H HD12 . LEU A 1 133 ? 16.072  8.159   -3.737  1.00 0.00 ?  346 LEU A HD12 3  
ATOM 6286  H HD13 . LEU A 1 133 ? 16.815  9.536   -2.889  1.00 0.00 ?  346 LEU A HD13 3  
ATOM 6287  H HD21 . LEU A 1 133 ? 19.665  9.285   -2.661  1.00 0.00 ?  346 LEU A HD21 3  
ATOM 6288  H HD22 . LEU A 1 133 ? 20.283  7.785   -3.394  1.00 0.00 ?  346 LEU A HD22 3  
ATOM 6289  H HD23 . LEU A 1 133 ? 19.500  9.017   -4.413  1.00 0.00 ?  346 LEU A HD23 3  
ATOM 6290  N N    . GLU A 1 134 ? 17.339  5.563   0.836   1.00 0.00 ?  347 GLU A N    3  
ATOM 6291  C CA   . GLU A 1 134 ? 17.789  4.894   2.045   1.00 0.00 ?  347 GLU A CA   3  
ATOM 6292  C C    . GLU A 1 134 ? 17.299  3.445   2.064   1.00 0.00 ?  347 GLU A C    3  
ATOM 6293  O O    . GLU A 1 134 ? 17.999  2.556   2.545   1.00 0.00 ?  347 GLU A O    3  
ATOM 6294  C CB   . GLU A 1 134 ? 17.323  5.647   3.294   1.00 0.00 ?  347 GLU A CB   3  
ATOM 6295  C CG   . GLU A 1 134 ? 18.334  6.723   3.694   1.00 0.00 ?  347 GLU A CG   3  
ATOM 6296  C CD   . GLU A 1 134 ? 19.155  6.279   4.907   1.00 0.00 ?  347 GLU A CD   3  
ATOM 6297  O OE1  . GLU A 1 134 ? 20.147  5.552   4.751   1.00 0.00 ?  347 GLU A OE1  3  
ATOM 6298  O OE2  . GLU A 1 134 ? 18.731  6.719   6.043   1.00 0.00 -1 347 GLU A OE2  3  
ATOM 6299  H H    . GLU A 1 134 ? 16.600  6.224   0.969   1.00 0.00 ?  347 GLU A H    3  
ATOM 6300  H HA   . GLU A 1 134 ? 18.878  4.917   2.001   1.00 0.00 ?  347 GLU A HA   3  
ATOM 6301  H HB2  . GLU A 1 134 ? 16.353  6.106   3.105   1.00 0.00 ?  347 GLU A HB2  3  
ATOM 6302  H HB3  . GLU A 1 134 ? 17.188  4.944   4.117   1.00 0.00 ?  347 GLU A HB3  3  
ATOM 6303  H HG2  . GLU A 1 134 ? 18.999  6.932   2.857   1.00 0.00 ?  347 GLU A HG2  3  
ATOM 6304  H HG3  . GLU A 1 134 ? 17.810  7.651   3.925   1.00 0.00 ?  347 GLU A HG3  3  
ATOM 6305  H HE2  . GLU A 1 134 ? 17.736  6.636   6.092   1.00 0.00 ?  347 GLU A HE2  3  
ATOM 6306  N N    . ARG A 1 135 ? 16.100  3.252   1.534   1.00 0.00 ?  348 ARG A N    3  
ATOM 6307  C CA   . ARG A 1 135 ? 15.508  1.926   1.484   1.00 0.00 ?  348 ARG A CA   3  
ATOM 6308  C C    . ARG A 1 135 ? 16.210  1.072   0.426   1.00 0.00 ?  348 ARG A C    3  
ATOM 6309  O O    . ARG A 1 135 ? 16.529  -0.091  0.673   1.00 0.00 ?  348 ARG A O    3  
ATOM 6310  C CB   . ARG A 1 135 ? 14.015  2.001   1.160   1.00 0.00 ?  348 ARG A CB   3  
ATOM 6311  C CG   . ARG A 1 135 ? 13.173  1.911   2.434   1.00 0.00 ?  348 ARG A CG   3  
ATOM 6312  C CD   . ARG A 1 135 ? 11.951  1.015   2.221   1.00 0.00 ?  348 ARG A CD   3  
ATOM 6313  N NE   . ARG A 1 135 ? 11.799  0.087   3.364   1.00 0.00 ?  348 ARG A NE   3  
ATOM 6314  C CZ   . ARG A 1 135 ? 11.479  0.472   4.607   1.00 0.00 ?  348 ARG A CZ   3  
ATOM 6315  N NH1  . ARG A 1 135 ? 11.276  1.770   4.875   1.00 0.00 ?  348 ARG A NH1  3  
ATOM 6316  N NH2  . ARG A 1 135 ? 11.362  -0.439  5.582   1.00 0.00 1  348 ARG A NH2  3  
ATOM 6317  H H    . ARG A 1 135 ? 15.537  3.981   1.145   1.00 0.00 ?  348 ARG A H    3  
ATOM 6318  H HA   . ARG A 1 135 ? 15.659  1.516   2.482   1.00 0.00 ?  348 ARG A HA   3  
ATOM 6319  H HB2  . ARG A 1 135 ? 13.798  2.935   0.641   1.00 0.00 ?  348 ARG A HB2  3  
ATOM 6320  H HB3  . ARG A 1 135 ? 13.745  1.190   0.483   1.00 0.00 ?  348 ARG A HB3  3  
ATOM 6321  H HG2  . ARG A 1 135 ? 13.780  1.517   3.249   1.00 0.00 ?  348 ARG A HG2  3  
ATOM 6322  H HG3  . ARG A 1 135 ? 12.849  2.909   2.731   1.00 0.00 ?  348 ARG A HG3  3  
ATOM 6323  H HD2  . ARG A 1 135 ? 11.055  1.626   2.116   1.00 0.00 ?  348 ARG A HD2  3  
ATOM 6324  H HD3  . ARG A 1 135 ? 12.061  0.450   1.295   1.00 0.00 ?  348 ARG A HD3  3  
ATOM 6325  H HE   . ARG A 1 135 ? 11.943  -0.888  3.198   1.00 0.00 ?  348 ARG A HE   3  
ATOM 6326  H HH11 . ARG A 1 135 ? 11.363  2.450   4.147   1.00 0.00 ?  348 ARG A HH11 3  
ATOM 6327  H HH12 . ARG A 1 135 ? 11.038  2.057   5.803   1.00 0.00 ?  348 ARG A HH12 3  
ATOM 6328  H HH21 . ARG A 1 135 ? 11.514  -1.407  5.382   1.00 0.00 ?  348 ARG A HH21 3  
ATOM 6329  H HH22 . ARG A 1 135 ? 11.124  -0.152  6.510   1.00 0.00 ?  348 ARG A HH22 3  
ATOM 6330  N N    . ARG A 1 136 ? 16.432  1.681   -0.730  1.00 0.00 ?  349 ARG A N    3  
ATOM 6331  C CA   . ARG A 1 136 ? 17.090  0.990   -1.825  1.00 0.00 ?  349 ARG A CA   3  
ATOM 6332  C C    . ARG A 1 136 ? 18.549  0.697   -1.468  1.00 0.00 ?  349 ARG A C    3  
ATOM 6333  O O    . ARG A 1 136 ? 19.092  -0.334  -1.860  1.00 0.00 ?  349 ARG A O    3  
ATOM 6334  C CB   . ARG A 1 136 ? 17.044  1.823   -3.108  1.00 0.00 ?  349 ARG A CB   3  
ATOM 6335  C CG   . ARG A 1 136 ? 16.578  0.977   -4.295  1.00 0.00 ?  349 ARG A CG   3  
ATOM 6336  C CD   . ARG A 1 136 ? 17.529  -0.197  -4.538  1.00 0.00 ?  349 ARG A CD   3  
ATOM 6337  N NE   . ARG A 1 136 ? 16.977  -1.087  -5.583  1.00 0.00 ?  349 ARG A NE   3  
ATOM 6338  C CZ   . ARG A 1 136 ? 17.461  -2.304  -5.865  1.00 0.00 ?  349 ARG A CZ   3  
ATOM 6339  N NH1  . ARG A 1 136 ? 18.509  -2.784  -5.182  1.00 0.00 ?  349 ARG A NH1  3  
ATOM 6340  N NH2  . ARG A 1 136 ? 16.897  -3.043  -6.831  1.00 0.00 1  349 ARG A NH2  3  
ATOM 6341  H H    . ARG A 1 136 ? 16.170  2.626   -0.922  1.00 0.00 ?  349 ARG A H    3  
ATOM 6342  H HA   . ARG A 1 136 ? 16.525  0.067   -1.953  1.00 0.00 ?  349 ARG A HA   3  
ATOM 6343  H HB2  . ARG A 1 136 ? 16.369  2.668   -2.973  1.00 0.00 ?  349 ARG A HB2  3  
ATOM 6344  H HB3  . ARG A 1 136 ? 18.032  2.234   -3.315  1.00 0.00 ?  349 ARG A HB3  3  
ATOM 6345  H HG2  . ARG A 1 136 ? 15.572  0.602   -4.106  1.00 0.00 ?  349 ARG A HG2  3  
ATOM 6346  H HG3  . ARG A 1 136 ? 16.524  1.597   -5.189  1.00 0.00 ?  349 ARG A HG3  3  
ATOM 6347  H HD2  . ARG A 1 136 ? 18.507  0.174   -4.843  1.00 0.00 ?  349 ARG A HD2  3  
ATOM 6348  H HD3  . ARG A 1 136 ? 17.675  -0.755  -3.613  1.00 0.00 ?  349 ARG A HD3  3  
ATOM 6349  H HE   . ARG A 1 136 ? 16.194  -0.760  -6.112  1.00 0.00 ?  349 ARG A HE   3  
ATOM 6350  H HH11 . ARG A 1 136 ? 18.931  -2.233  -4.462  1.00 0.00 ?  349 ARG A HH11 3  
ATOM 6351  H HH12 . ARG A 1 136 ? 18.871  -3.692  -5.393  1.00 0.00 ?  349 ARG A HH12 3  
ATOM 6352  H HH21 . ARG A 1 136 ? 16.114  -2.685  -7.341  1.00 0.00 ?  349 ARG A HH21 3  
ATOM 6353  H HH22 . ARG A 1 136 ? 17.258  -3.951  -7.042  1.00 0.00 ?  349 ARG A HH22 3  
ATOM 6354  N N    . GLY A 1 137 ? 19.141  1.623   -0.728  1.00 0.00 ?  350 GLY A N    3  
ATOM 6355  C CA   . GLY A 1 137 ? 20.526  1.477   -0.314  1.00 0.00 ?  350 GLY A CA   3  
ATOM 6356  C C    . GLY A 1 137 ? 20.843  0.022   0.035   1.00 0.00 ?  350 GLY A C    3  
ATOM 6357  O O    . GLY A 1 137 ? 21.863  -0.515  -0.395  1.00 0.00 ?  350 GLY A O    3  
ATOM 6358  H H    . GLY A 1 137 ? 18.691  2.459   -0.413  1.00 0.00 ?  350 GLY A H    3  
ATOM 6359  H HA2  . GLY A 1 137 ? 21.186  1.816   -1.112  1.00 0.00 ?  350 GLY A HA2  3  
ATOM 6360  H HA3  . GLY A 1 137 ? 20.719  2.113   0.550   1.00 0.00 ?  350 GLY A HA3  3  
ATOM 6361  N N    . ALA A 1 138 ? 19.951  -0.575  0.812   1.00 0.00 ?  351 ALA A N    3  
ATOM 6362  C CA   . ALA A 1 138 ? 20.123  -1.958  1.224   1.00 0.00 ?  351 ALA A CA   3  
ATOM 6363  C C    . ALA A 1 138 ? 18.754  -2.569  1.529   1.00 0.00 ?  351 ALA A C    3  
ATOM 6364  O O    . ALA A 1 138 ? 18.022  -2.067  2.381   1.00 0.00 ?  351 ALA A O    3  
ATOM 6365  C CB   . ALA A 1 138 ? 21.069  -2.019  2.425   1.00 0.00 ?  351 ALA A CB   3  
ATOM 6366  H H    . ALA A 1 138 ? 19.124  -0.131  1.158   1.00 0.00 ?  351 ALA A H    3  
ATOM 6367  H HA   . ALA A 1 138 ? 20.576  -2.498  0.393   1.00 0.00 ?  351 ALA A HA   3  
ATOM 6368  H HB1  . ALA A 1 138 ? 22.041  -2.392  2.103   1.00 0.00 ?  351 ALA A HB1  3  
ATOM 6369  H HB2  . ALA A 1 138 ? 21.185  -1.021  2.848   1.00 0.00 ?  351 ALA A HB2  3  
ATOM 6370  H HB3  . ALA A 1 138 ? 20.656  -2.688  3.180   1.00 0.00 ?  351 ALA A HB3  3  
ATOM 6371  N N    . ALA A 1 139 ? 18.449  -3.643  0.816   1.00 0.00 ?  352 ALA A N    3  
ATOM 6372  C CA   . ALA A 1 139 ? 17.181  -4.328  1.000   1.00 0.00 ?  352 ALA A CA   3  
ATOM 6373  C C    . ALA A 1 139 ? 17.118  -4.905  2.415   1.00 0.00 ?  352 ALA A C    3  
ATOM 6374  O O    . ALA A 1 139 ? 18.122  -4.928  3.125   1.00 0.00 ?  352 ALA A O    3  
ATOM 6375  C CB   . ALA A 1 139 ? 17.021  -5.404  -0.076  1.00 0.00 ?  352 ALA A CB   3  
ATOM 6376  H H    . ALA A 1 139 ? 19.050  -4.045  0.125   1.00 0.00 ?  352 ALA A H    3  
ATOM 6377  H HA   . ALA A 1 139 ? 16.386  -3.592  0.881   1.00 0.00 ?  352 ALA A HA   3  
ATOM 6378  H HB1  . ALA A 1 139 ? 18.005  -5.761  -0.382  1.00 0.00 ?  352 ALA A HB1  3  
ATOM 6379  H HB2  . ALA A 1 139 ? 16.442  -6.236  0.326   1.00 0.00 ?  352 ALA A HB2  3  
ATOM 6380  H HB3  . ALA A 1 139 ? 16.503  -4.983  -0.937  1.00 0.00 ?  352 ALA A HB3  3  
ATOM 6381  N N    . ALA A 1 140 ? 15.928  -5.356  2.784   1.00 0.00 ?  353 ALA A N    3  
ATOM 6382  C CA   . ALA A 1 140 ? 15.721  -5.931  4.102   1.00 0.00 ?  353 ALA A CA   3  
ATOM 6383  C C    . ALA A 1 140 ? 15.577  -7.449  3.975   1.00 0.00 ?  353 ALA A C    3  
ATOM 6384  O O    . ALA A 1 140 ? 14.681  -7.936  3.286   1.00 0.00 ?  353 ALA A O    3  
ATOM 6385  C CB   . ALA A 1 140 ? 14.500  -5.282  4.756   1.00 0.00 ?  353 ALA A CB   3  
ATOM 6386  H H    . ALA A 1 140 ? 15.116  -5.334  2.200   1.00 0.00 ?  353 ALA A H    3  
ATOM 6387  H HA   . ALA A 1 140 ? 16.602  -5.708  4.704   1.00 0.00 ?  353 ALA A HA   3  
ATOM 6388  H HB1  . ALA A 1 140 ? 13.843  -6.058  5.150   1.00 0.00 ?  353 ALA A HB1  3  
ATOM 6389  H HB2  . ALA A 1 140 ? 14.825  -4.634  5.570   1.00 0.00 ?  353 ALA A HB2  3  
ATOM 6390  H HB3  . ALA A 1 140 ? 13.961  -4.692  4.015   1.00 0.00 ?  353 ALA A HB3  3  
ATOM 6391  N N    . SER A 1 141 ? 16.472  -8.155  4.649   1.00 0.00 ?  354 SER A N    3  
ATOM 6392  C CA   . SER A 1 141 ? 16.455  -9.608  4.620   1.00 0.00 ?  354 SER A CA   3  
ATOM 6393  C C    . SER A 1 141 ? 15.196  -10.131 5.314   1.00 0.00 ?  354 SER A C    3  
ATOM 6394  O O    . SER A 1 141 ? 14.967  -9.848  6.490   1.00 0.00 ?  354 SER A O    3  
ATOM 6395  C CB   . SER A 1 141 ? 17.706  -10.187 5.285   1.00 0.00 ?  354 SER A CB   3  
ATOM 6396  O OG   . SER A 1 141 ? 18.577  -10.801 4.339   1.00 0.00 ?  354 SER A OG   3  
ATOM 6397  H H    . SER A 1 141 ? 17.197  -7.752  5.207   1.00 0.00 ?  354 SER A H    3  
ATOM 6398  H HA   . SER A 1 141 ? 16.449  -9.876  3.564   1.00 0.00 ?  354 SER A HA   3  
ATOM 6399  H HB2  . SER A 1 141 ? 18.240  -9.392  5.806   1.00 0.00 ?  354 SER A HB2  3  
ATOM 6400  H HB3  . SER A 1 141 ? 17.412  -10.919 6.036   1.00 0.00 ?  354 SER A HB3  3  
ATOM 6401  H HG   . SER A 1 141 ? 18.534  -10.314 3.467   1.00 0.00 ?  354 SER A HG   3  
ATOM 6402  N N    . ALA A 1 142 ? 14.412  -10.885 4.558   1.00 0.00 ?  355 ALA A N    3  
ATOM 6403  C CA   . ALA A 1 142 ? 13.181  -11.449 5.085   1.00 0.00 ?  355 ALA A CA   3  
ATOM 6404  C C    . ALA A 1 142 ? 12.605  -12.441 4.073   1.00 0.00 ?  355 ALA A C    3  
ATOM 6405  O O    . ALA A 1 142 ? 12.405  -13.612 4.389   1.00 0.00 ?  355 ALA A O    3  
ATOM 6406  C CB   . ALA A 1 142 ? 12.203  -10.321 5.419   1.00 0.00 ?  355 ALA A CB   3  
ATOM 6407  H H    . ALA A 1 142 ? 14.605  -11.110 3.603   1.00 0.00 ?  355 ALA A H    3  
ATOM 6408  H HA   . ALA A 1 142 ? 13.428  -11.983 6.003   1.00 0.00 ?  355 ALA A HA   3  
ATOM 6409  H HB1  . ALA A 1 142 ? 11.377  -10.719 6.009   1.00 0.00 ?  355 ALA A HB1  3  
ATOM 6410  H HB2  . ALA A 1 142 ? 12.720  -9.550  5.990   1.00 0.00 ?  355 ALA A HB2  3  
ATOM 6411  H HB3  . ALA A 1 142 ? 11.815  -9.892  4.495   1.00 0.00 ?  355 ALA A HB3  3  
ATOM 6412  N N    . GLY A 1 1   ? -23.657 16.695  -8.642  1.00 0.00 ?  214 GLY A N    4  
ATOM 6413  C CA   . GLY A 1 1   ? -22.381 16.317  -8.059  1.00 0.00 ?  214 GLY A CA   4  
ATOM 6414  C C    . GLY A 1 1   ? -22.178 14.802  -8.120  1.00 0.00 ?  214 GLY A C    4  
ATOM 6415  O O    . GLY A 1 1   ? -22.577 14.157  -9.089  1.00 0.00 ?  214 GLY A O    4  
ATOM 6416  H H1   . GLY A 1 1   ? -24.424 16.099  -8.403  1.00 0.00 ?  214 GLY A H1   4  
ATOM 6417  H HA2  . GLY A 1 1   ? -21.572 16.818  -8.590  1.00 0.00 ?  214 GLY A HA2  4  
ATOM 6418  H HA3  . GLY A 1 1   ? -22.337 16.652  -7.023  1.00 0.00 ?  214 GLY A HA3  4  
ATOM 6419  N N    . SER A 1 2   ? -21.556 14.277  -7.074  1.00 0.00 ?  215 SER A N    4  
ATOM 6420  C CA   . SER A 1 2   ? -21.295 12.850  -6.997  1.00 0.00 ?  215 SER A CA   4  
ATOM 6421  C C    . SER A 1 2   ? -21.775 12.303  -5.651  1.00 0.00 ?  215 SER A C    4  
ATOM 6422  O O    . SER A 1 2   ? -22.149 13.067  -4.763  1.00 0.00 ?  215 SER A O    4  
ATOM 6423  C CB   . SER A 1 2   ? -19.807 12.551  -7.192  1.00 0.00 ?  215 SER A CB   4  
ATOM 6424  O OG   . SER A 1 2   ? -19.061 12.753  -5.995  1.00 0.00 ?  215 SER A OG   4  
ATOM 6425  H H    . SER A 1 2   ? -21.235 14.809  -6.291  1.00 0.00 ?  215 SER A H    4  
ATOM 6426  H HA   . SER A 1 2   ? -21.864 12.408  -7.814  1.00 0.00 ?  215 SER A HA   4  
ATOM 6427  H HB2  . SER A 1 2   ? -19.686 11.521  -7.526  1.00 0.00 ?  215 SER A HB2  4  
ATOM 6428  H HB3  . SER A 1 2   ? -19.409 13.191  -7.980  1.00 0.00 ?  215 SER A HB3  4  
ATOM 6429  H HG   . SER A 1 2   ? -18.989 11.894  -5.488  1.00 0.00 ?  215 SER A HG   4  
ATOM 6430  N N    . GLN A 1 3   ? -21.748 10.982  -5.542  1.00 0.00 ?  216 GLN A N    4  
ATOM 6431  C CA   . GLN A 1 3   ? -22.175 10.323  -4.320  1.00 0.00 ?  216 GLN A CA   4  
ATOM 6432  C C    . GLN A 1 3   ? -20.993 9.613   -3.659  1.00 0.00 ?  216 GLN A C    4  
ATOM 6433  O O    . GLN A 1 3   ? -20.102 9.114   -4.344  1.00 0.00 ?  216 GLN A O    4  
ATOM 6434  C CB   . GLN A 1 3   ? -23.319 9.345   -4.595  1.00 0.00 ?  216 GLN A CB   4  
ATOM 6435  C CG   . GLN A 1 3   ? -24.673 10.055  -4.542  1.00 0.00 ?  216 GLN A CG   4  
ATOM 6436  C CD   . GLN A 1 3   ? -25.416 9.722   -3.247  1.00 0.00 ?  216 GLN A CD   4  
ATOM 6437  O OE1  . GLN A 1 3   ? -25.637 10.565  -2.393  1.00 0.00 ?  216 GLN A OE1  4  
ATOM 6438  N NE2  . GLN A 1 3   ? -25.790 8.449   -3.150  1.00 0.00 ?  216 GLN A NE2  4  
ATOM 6439  H H    . GLN A 1 3   ? -21.442 10.367  -6.269  1.00 0.00 ?  216 GLN A H    4  
ATOM 6440  H HA   . GLN A 1 3   ? -22.537 11.122  -3.671  1.00 0.00 ?  216 GLN A HA   4  
ATOM 6441  H HB2  . GLN A 1 3   ? -23.182 8.887   -5.575  1.00 0.00 ?  216 GLN A HB2  4  
ATOM 6442  H HB3  . GLN A 1 3   ? -23.297 8.539   -3.861  1.00 0.00 ?  216 GLN A HB3  4  
ATOM 6443  H HG2  . GLN A 1 3   ? -24.526 11.133  -4.614  1.00 0.00 ?  216 GLN A HG2  4  
ATOM 6444  H HG3  . GLN A 1 3   ? -25.277 9.758   -5.400  1.00 0.00 ?  216 GLN A HG3  4  
ATOM 6445  H HE21 . GLN A 1 3   ? -25.578 7.808   -3.888  1.00 0.00 ?  216 GLN A HE21 4  
ATOM 6446  H HE22 . GLN A 1 3   ? -26.283 8.133   -2.339  1.00 0.00 ?  216 GLN A HE22 4  
ATOM 6447  N N    . GLU A 1 4   ? -21.022 9.590   -2.334  1.00 0.00 ?  217 GLU A N    4  
ATOM 6448  C CA   . GLU A 1 4   ? -19.964 8.949   -1.573  1.00 0.00 ?  217 GLU A CA   4  
ATOM 6449  C C    . GLU A 1 4   ? -20.515 7.745   -0.807  1.00 0.00 ?  217 GLU A C    4  
ATOM 6450  O O    . GLU A 1 4   ? -21.714 7.670   -0.541  1.00 0.00 ?  217 GLU A O    4  
ATOM 6451  C CB   . GLU A 1 4   ? -19.293 9.943   -0.622  1.00 0.00 ?  217 GLU A CB   4  
ATOM 6452  C CG   . GLU A 1 4   ? -18.315 10.847  -1.375  1.00 0.00 ?  217 GLU A CG   4  
ATOM 6453  C CD   . GLU A 1 4   ? -18.472 12.306  -0.940  1.00 0.00 ?  217 GLU A CD   4  
ATOM 6454  O OE1  . GLU A 1 4   ? -19.303 13.035  -1.504  1.00 0.00 ?  217 GLU A OE1  4  
ATOM 6455  O OE2  . GLU A 1 4   ? -17.695 12.675  0.020   1.00 0.00 -1 217 GLU A OE2  4  
ATOM 6456  H H    . GLU A 1 4   ? -21.751 9.999   -1.784  1.00 0.00 ?  217 GLU A H    4  
ATOM 6457  H HA   . GLU A 1 4   ? -19.236 8.616   -2.312  1.00 0.00 ?  217 GLU A HA   4  
ATOM 6458  H HB2  . GLU A 1 4   ? -20.053 10.551  -0.131  1.00 0.00 ?  217 GLU A HB2  4  
ATOM 6459  H HB3  . GLU A 1 4   ? -18.764 9.401   0.162   1.00 0.00 ?  217 GLU A HB3  4  
ATOM 6460  H HG2  . GLU A 1 4   ? -17.293 10.517  -1.190  1.00 0.00 ?  217 GLU A HG2  4  
ATOM 6461  H HG3  . GLU A 1 4   ? -18.488 10.763  -2.447  1.00 0.00 ?  217 GLU A HG3  4  
ATOM 6462  H HE2  . GLU A 1 4   ? -17.120 13.437  -0.279  1.00 0.00 ?  217 GLU A HE2  4  
ATOM 6463  N N    . VAL A 1 5   ? -19.614 6.832   -0.475  1.00 0.00 ?  218 VAL A N    4  
ATOM 6464  C CA   . VAL A 1 5   ? -19.995 5.634   0.254   1.00 0.00 ?  218 VAL A CA   4  
ATOM 6465  C C    . VAL A 1 5   ? -19.393 5.685   1.660   1.00 0.00 ?  218 VAL A C    4  
ATOM 6466  O O    . VAL A 1 5   ? -18.585 6.562   1.961   1.00 0.00 ?  218 VAL A O    4  
ATOM 6467  C CB   . VAL A 1 5   ? -19.579 4.389   -0.530  1.00 0.00 ?  218 VAL A CB   4  
ATOM 6468  C CG1  . VAL A 1 5   ? -20.284 4.334   -1.887  1.00 0.00 ?  218 VAL A CG1  4  
ATOM 6469  C CG2  . VAL A 1 5   ? -18.059 4.330   -0.699  1.00 0.00 ?  218 VAL A CG2  4  
ATOM 6470  H H    . VAL A 1 5   ? -18.641 6.900   -0.696  1.00 0.00 ?  218 VAL A H    4  
ATOM 6471  H HA   . VAL A 1 5   ? -21.082 5.633   0.338   1.00 0.00 ?  218 VAL A HA   4  
ATOM 6472  H HB   . VAL A 1 5   ? -19.886 3.514   0.042   1.00 0.00 ?  218 VAL A HB   4  
ATOM 6473  H HG11 . VAL A 1 5   ? -19.549 4.451   -2.683  1.00 0.00 ?  218 VAL A HG11 4  
ATOM 6474  H HG12 . VAL A 1 5   ? -20.789 3.374   -1.996  1.00 0.00 ?  218 VAL A HG12 4  
ATOM 6475  H HG13 . VAL A 1 5   ? -21.017 5.139   -1.948  1.00 0.00 ?  218 VAL A HG13 4  
ATOM 6476  H HG21 . VAL A 1 5   ? -17.731 3.291   -0.676  1.00 0.00 ?  218 VAL A HG21 4  
ATOM 6477  H HG22 . VAL A 1 5   ? -17.782 4.777   -1.654  1.00 0.00 ?  218 VAL A HG22 4  
ATOM 6478  H HG23 . VAL A 1 5   ? -17.582 4.880   0.112   1.00 0.00 ?  218 VAL A HG23 4  
ATOM 6479  N N    . ARG A 1 6   ? -19.809 4.733   2.482   1.00 0.00 ?  219 ARG A N    4  
ATOM 6480  C CA   . ARG A 1 6   ? -19.320 4.658   3.848   1.00 0.00 ?  219 ARG A CA   4  
ATOM 6481  C C    . ARG A 1 6   ? -18.232 3.589   3.965   1.00 0.00 ?  219 ARG A C    4  
ATOM 6482  O O    . ARG A 1 6   ? -18.078 2.755   3.074   1.00 0.00 ?  219 ARG A O    4  
ATOM 6483  C CB   . ARG A 1 6   ? -20.454 4.330   4.822   1.00 0.00 ?  219 ARG A CB   4  
ATOM 6484  C CG   . ARG A 1 6   ? -20.195 4.952   6.195   1.00 0.00 ?  219 ARG A CG   4  
ATOM 6485  C CD   . ARG A 1 6   ? -21.482 5.529   6.788   1.00 0.00 ?  219 ARG A CD   4  
ATOM 6486  N NE   . ARG A 1 6   ? -21.281 6.950   7.148   1.00 0.00 ?  219 ARG A NE   4  
ATOM 6487  C CZ   . ARG A 1 6   ? -22.157 7.678   7.854   1.00 0.00 ?  219 ARG A CZ   4  
ATOM 6488  N NH1  . ARG A 1 6   ? -23.299 7.122   8.280   1.00 0.00 ?  219 ARG A NH1  4  
ATOM 6489  N NH2  . ARG A 1 6   ? -21.891 8.961   8.133   1.00 0.00 1  219 ARG A NH2  4  
ATOM 6490  H H    . ARG A 1 6   ? -20.466 4.024   2.229   1.00 0.00 ?  219 ARG A H    4  
ATOM 6491  H HA   . ARG A 1 6   ? -18.919 5.651   4.056   1.00 0.00 ?  219 ARG A HA   4  
ATOM 6492  H HB2  . ARG A 1 6   ? -21.399 4.701   4.423   1.00 0.00 ?  219 ARG A HB2  4  
ATOM 6493  H HB3  . ARG A 1 6   ? -20.552 3.249   4.920   1.00 0.00 ?  219 ARG A HB3  4  
ATOM 6494  H HG2  . ARG A 1 6   ? -19.786 4.198   6.868   1.00 0.00 ?  219 ARG A HG2  4  
ATOM 6495  H HG3  . ARG A 1 6   ? -19.446 5.740   6.107   1.00 0.00 ?  219 ARG A HG3  4  
ATOM 6496  H HD2  . ARG A 1 6   ? -22.295 5.439   6.069   1.00 0.00 ?  219 ARG A HD2  4  
ATOM 6497  H HD3  . ARG A 1 6   ? -21.772 4.960   7.671   1.00 0.00 ?  219 ARG A HD3  4  
ATOM 6498  H HE   . ARG A 1 6   ? -20.438 7.396   6.845   1.00 0.00 ?  219 ARG A HE   4  
ATOM 6499  H HH11 . ARG A 1 6   ? -23.498 6.165   8.072   1.00 0.00 ?  219 ARG A HH11 4  
ATOM 6500  H HH12 . ARG A 1 6   ? -23.953 7.665   8.807   1.00 0.00 ?  219 ARG A HH12 4  
ATOM 6501  H HH21 . ARG A 1 6   ? -21.038 9.376   7.815   1.00 0.00 ?  219 ARG A HH21 4  
ATOM 6502  H HH22 . ARG A 1 6   ? -22.545 9.504   8.660   1.00 0.00 ?  219 ARG A HH22 4  
ATOM 6503  N N    . ARG A 1 7   ? -17.505 3.648   5.071   1.00 0.00 ?  220 ARG A N    4  
ATOM 6504  C CA   . ARG A 1 7   ? -16.436 2.696   5.316   1.00 0.00 ?  220 ARG A CA   4  
ATOM 6505  C C    . ARG A 1 7   ? -16.409 2.295   6.792   1.00 0.00 ?  220 ARG A C    4  
ATOM 6506  O O    . ARG A 1 7   ? -16.669 3.119   7.667   1.00 0.00 ?  220 ARG A O    4  
ATOM 6507  C CB   . ARG A 1 7   ? -15.076 3.282   4.929   1.00 0.00 ?  220 ARG A CB   4  
ATOM 6508  C CG   . ARG A 1 7   ? -14.853 3.197   3.417   1.00 0.00 ?  220 ARG A CG   4  
ATOM 6509  C CD   . ARG A 1 7   ? -14.217 4.483   2.885   1.00 0.00 ?  220 ARG A CD   4  
ATOM 6510  N NE   . ARG A 1 7   ? -14.690 4.748   1.508   1.00 0.00 ?  220 ARG A NE   4  
ATOM 6511  C CZ   . ARG A 1 7   ? -14.217 4.128   0.418   1.00 0.00 ?  220 ARG A CZ   4  
ATOM 6512  N NH1  . ARG A 1 7   ? -13.255 3.203   0.538   1.00 0.00 ?  220 ARG A NH1  4  
ATOM 6513  N NH2  . ARG A 1 7   ? -14.705 4.434   -0.792  1.00 0.00 1  220 ARG A NH2  4  
ATOM 6514  H H    . ARG A 1 7   ? -17.637 4.330   5.791   1.00 0.00 ?  220 ARG A H    4  
ATOM 6515  H HA   . ARG A 1 7   ? -16.673 1.841   4.682   1.00 0.00 ?  220 ARG A HA   4  
ATOM 6516  H HB2  . ARG A 1 7   ? -15.020 4.322   5.251   1.00 0.00 ?  220 ARG A HB2  4  
ATOM 6517  H HB3  . ARG A 1 7   ? -14.283 2.744   5.448   1.00 0.00 ?  220 ARG A HB3  4  
ATOM 6518  H HG2  . ARG A 1 7   ? -14.210 2.347   3.188   1.00 0.00 ?  220 ARG A HG2  4  
ATOM 6519  H HG3  . ARG A 1 7   ? -15.804 3.023   2.915   1.00 0.00 ?  220 ARG A HG3  4  
ATOM 6520  H HD2  . ARG A 1 7   ? -14.472 5.321   3.534   1.00 0.00 ?  220 ARG A HD2  4  
ATOM 6521  H HD3  . ARG A 1 7   ? -13.131 4.392   2.893   1.00 0.00 ?  220 ARG A HD3  4  
ATOM 6522  H HE   . ARG A 1 7   ? -15.407 5.434   1.383   1.00 0.00 ?  220 ARG A HE   4  
ATOM 6523  H HH11 . ARG A 1 7   ? -12.890 2.976   1.441   1.00 0.00 ?  220 ARG A HH11 4  
ATOM 6524  H HH12 . ARG A 1 7   ? -12.902 2.741   -0.275  1.00 0.00 ?  220 ARG A HH12 4  
ATOM 6525  H HH21 . ARG A 1 7   ? -15.423 5.124   -0.882  1.00 0.00 ?  220 ARG A HH21 4  
ATOM 6526  H HH22 . ARG A 1 7   ? -14.352 3.971   -1.605  1.00 0.00 ?  220 ARG A HH22 4  
ATOM 6527  N N    . GLY A 1 8   ? -16.093 1.029   7.023   1.00 0.00 ?  221 GLY A N    4  
ATOM 6528  C CA   . GLY A 1 8   ? -16.029 0.509   8.378   1.00 0.00 ?  221 GLY A CA   4  
ATOM 6529  C C    . GLY A 1 8   ? -14.585 0.202   8.780   1.00 0.00 ?  221 GLY A C    4  
ATOM 6530  O O    . GLY A 1 8   ? -14.281 0.066   9.964   1.00 0.00 ?  221 GLY A O    4  
ATOM 6531  H H    . GLY A 1 8   ? -15.883 0.365   6.305   1.00 0.00 ?  221 GLY A H    4  
ATOM 6532  H HA2  . GLY A 1 8   ? -16.456 1.235   9.071   1.00 0.00 ?  221 GLY A HA2  4  
ATOM 6533  H HA3  . GLY A 1 8   ? -16.631 -0.396  8.454   1.00 0.00 ?  221 GLY A HA3  4  
ATOM 6534  N N    . ASP A 1 9   ? -13.732 0.100   7.771   1.00 0.00 ?  222 ASP A N    4  
ATOM 6535  C CA   . ASP A 1 9   ? -12.328 -0.189  8.004   1.00 0.00 ?  222 ASP A CA   4  
ATOM 6536  C C    . ASP A 1 9   ? -11.517 1.102   7.873   1.00 0.00 ?  222 ASP A C    4  
ATOM 6537  O O    . ASP A 1 9   ? -10.297 1.061   7.724   1.00 0.00 ?  222 ASP A O    4  
ATOM 6538  C CB   . ASP A 1 9   ? -11.793 -1.188  6.976   1.00 0.00 ?  222 ASP A CB   4  
ATOM 6539  C CG   . ASP A 1 9   ? -12.416 -1.078  5.582   1.00 0.00 ?  222 ASP A CG   4  
ATOM 6540  O OD1  . ASP A 1 9   ? -12.802 -2.087  4.974   1.00 0.00 ?  222 ASP A OD1  4  
ATOM 6541  O OD2  . ASP A 1 9   ? -12.499 0.121   5.116   1.00 0.00 -1 222 ASP A OD2  4  
ATOM 6542  H H    . ASP A 1 9   ? -13.987 0.212   6.810   1.00 0.00 ?  222 ASP A H    4  
ATOM 6543  H HA   . ASP A 1 9   ? -12.284 -0.609  9.008   1.00 0.00 ?  222 ASP A HA   4  
ATOM 6544  H HB2  . ASP A 1 9   ? -10.715 -1.054  6.887   1.00 0.00 ?  222 ASP A HB2  4  
ATOM 6545  H HB3  . ASP A 1 9   ? -11.959 -2.198  7.352   1.00 0.00 ?  222 ASP A HB3  4  
ATOM 6546  H HD2  . ASP A 1 9   ? -11.705 0.657   5.404   1.00 0.00 ?  222 ASP A HD2  4  
ATOM 6547  N N    . PHE A 1 10  ? -12.228 2.218   7.935   1.00 0.00 ?  223 PHE A N    4  
ATOM 6548  C CA   . PHE A 1 10  ? -11.590 3.519   7.826   1.00 0.00 ?  223 PHE A CA   4  
ATOM 6549  C C    . PHE A 1 10  ? -10.446 3.655   8.833   1.00 0.00 ?  223 PHE A C    4  
ATOM 6550  O O    . PHE A 1 10  ? -9.453  4.327   8.562   1.00 0.00 ?  223 PHE A O    4  
ATOM 6551  C CB   . PHE A 1 10  ? -12.658 4.569   8.140   1.00 0.00 ?  223 PHE A CB   4  
ATOM 6552  C CG   . PHE A 1 10  ? -12.281 5.988   7.710   1.00 0.00 ?  223 PHE A CG   4  
ATOM 6553  C CD1  . PHE A 1 10  ? -11.564 6.784   8.547   1.00 0.00 ?  223 PHE A CD1  4  
ATOM 6554  C CD2  . PHE A 1 10  ? -12.664 6.453   6.490   1.00 0.00 ?  223 PHE A CD2  4  
ATOM 6555  C CE1  . PHE A 1 10  ? -11.214 8.101   8.147   1.00 0.00 ?  223 PHE A CE1  4  
ATOM 6556  C CE2  . PHE A 1 10  ? -12.315 7.770   6.091   1.00 0.00 ?  223 PHE A CE2  4  
ATOM 6557  C CZ   . PHE A 1 10  ? -11.597 8.566   6.928   1.00 0.00 ?  223 PHE A CZ   4  
ATOM 6558  H H    . PHE A 1 10  ? -13.220 2.243   8.056   1.00 0.00 ?  223 PHE A H    4  
ATOM 6559  H HA   . PHE A 1 10  ? -11.193 3.601   6.814   1.00 0.00 ?  223 PHE A HA   4  
ATOM 6560  H HB2  . PHE A 1 10  ? -13.588 4.285   7.648   1.00 0.00 ?  223 PHE A HB2  4  
ATOM 6561  H HB3  . PHE A 1 10  ? -12.851 4.565   9.213   1.00 0.00 ?  223 PHE A HB3  4  
ATOM 6562  H HD1  . PHE A 1 10  ? -11.257 6.412   9.524   1.00 0.00 ?  223 PHE A HD1  4  
ATOM 6563  H HD2  . PHE A 1 10  ? -13.239 5.814   5.820   1.00 0.00 ?  223 PHE A HD2  4  
ATOM 6564  H HE1  . PHE A 1 10  ? -10.639 8.740   8.818   1.00 0.00 ?  223 PHE A HE1  4  
ATOM 6565  H HE2  . PHE A 1 10  ? -12.622 8.142   5.114   1.00 0.00 ?  223 PHE A HE2  4  
ATOM 6566  H HZ   . PHE A 1 10  ? -11.329 9.577   6.621   1.00 0.00 ?  223 PHE A HZ   4  
ATOM 6567  N N    . VAL A 1 11  ? -10.624 3.005   9.973   1.00 0.00 ?  224 VAL A N    4  
ATOM 6568  C CA   . VAL A 1 11  ? -9.620  3.044   11.022  1.00 0.00 ?  224 VAL A CA   4  
ATOM 6569  C C    . VAL A 1 11  ? -8.583  1.947   10.771  1.00 0.00 ?  224 VAL A C    4  
ATOM 6570  O O    . VAL A 1 11  ? -7.464  2.018   11.276  1.00 0.00 ?  224 VAL A O    4  
ATOM 6571  C CB   . VAL A 1 11  ? -10.289 2.932   12.393  1.00 0.00 ?  224 VAL A CB   4  
ATOM 6572  C CG1  . VAL A 1 11  ? -10.113 1.529   12.976  1.00 0.00 ?  224 VAL A CG1  4  
ATOM 6573  C CG2  . VAL A 1 11  ? -9.754  3.997   13.353  1.00 0.00 ?  224 VAL A CG2  4  
ATOM 6574  H H    . VAL A 1 11  ? -11.436 2.460   10.186  1.00 0.00 ?  224 VAL A H    4  
ATOM 6575  H HA   . VAL A 1 11  ? -9.124  4.014   10.967  1.00 0.00 ?  224 VAL A HA   4  
ATOM 6576  H HB   . VAL A 1 11  ? -11.357 3.108   12.260  1.00 0.00 ?  224 VAL A HB   4  
ATOM 6577  H HG11 . VAL A 1 11  ? -10.829 1.379   13.784  1.00 0.00 ?  224 VAL A HG11 4  
ATOM 6578  H HG12 . VAL A 1 11  ? -10.284 0.787   12.197  1.00 0.00 ?  224 VAL A HG12 4  
ATOM 6579  H HG13 . VAL A 1 11  ? -9.100  1.421   13.364  1.00 0.00 ?  224 VAL A HG13 4  
ATOM 6580  H HG21 . VAL A 1 11  ? -10.341 3.985   14.272  1.00 0.00 ?  224 VAL A HG21 4  
ATOM 6581  H HG22 . VAL A 1 11  ? -8.710  3.784   13.586  1.00 0.00 ?  224 VAL A HG22 4  
ATOM 6582  H HG23 . VAL A 1 11  ? -9.830  4.979   12.886  1.00 0.00 ?  224 VAL A HG23 4  
ATOM 6583  N N    . ARG A 1 12  ? -8.994  0.957   9.992   1.00 0.00 ?  225 ARG A N    4  
ATOM 6584  C CA   . ARG A 1 12  ? -8.115  -0.154  9.668   1.00 0.00 ?  225 ARG A CA   4  
ATOM 6585  C C    . ARG A 1 12  ? -7.104  0.264   8.598   1.00 0.00 ?  225 ARG A C    4  
ATOM 6586  O O    . ARG A 1 12  ? -5.918  -0.046  8.706   1.00 0.00 ?  225 ARG A O    4  
ATOM 6587  C CB   . ARG A 1 12  ? -8.912  -1.358  9.164   1.00 0.00 ?  225 ARG A CB   4  
ATOM 6588  C CG   . ARG A 1 12  ? -8.862  -2.510  10.169  1.00 0.00 ?  225 ARG A CG   4  
ATOM 6589  C CD   . ARG A 1 12  ? -7.469  -3.142  10.209  1.00 0.00 ?  225 ARG A CD   4  
ATOM 6590  N NE   . ARG A 1 12  ? -7.108  -3.484  11.603  1.00 0.00 ?  225 ARG A NE   4  
ATOM 6591  C CZ   . ARG A 1 12  ? -7.683  -4.467  12.309  1.00 0.00 ?  225 ARG A CZ   4  
ATOM 6592  N NH1  . ARG A 1 12  ? -8.650  -5.211  11.755  1.00 0.00 ?  225 ARG A NH1  4  
ATOM 6593  N NH2  . ARG A 1 12  ? -7.292  -4.706  13.568  1.00 0.00 1  225 ARG A NH2  4  
ATOM 6594  H H    . ARG A 1 12  ? -9.906  0.907   9.585   1.00 0.00 ?  225 ARG A H    4  
ATOM 6595  H HA   . ARG A 1 12  ? -7.616  -0.397  10.606  1.00 0.00 ?  225 ARG A HA   4  
ATOM 6596  H HB2  . ARG A 1 12  ? -9.948  -1.066  8.991   1.00 0.00 ?  225 ARG A HB2  4  
ATOM 6597  H HB3  . ARG A 1 12  ? -8.511  -1.689  8.206   1.00 0.00 ?  225 ARG A HB3  4  
ATOM 6598  H HG2  . ARG A 1 12  ? -9.127  -2.143  11.161  1.00 0.00 ?  225 ARG A HG2  4  
ATOM 6599  H HG3  . ARG A 1 12  ? -9.600  -3.265  9.900   1.00 0.00 ?  225 ARG A HG3  4  
ATOM 6600  H HD2  . ARG A 1 12  ? -7.449  -4.038  9.589   1.00 0.00 ?  225 ARG A HD2  4  
ATOM 6601  H HD3  . ARG A 1 12  ? -6.735  -2.451  9.794   1.00 0.00 ?  225 ARG A HD3  4  
ATOM 6602  H HE   . ARG A 1 12  ? -6.390  -2.947  12.046  1.00 0.00 ?  225 ARG A HE   4  
ATOM 6603  H HH11 . ARG A 1 12  ? -8.942  -5.033  10.815  1.00 0.00 ?  225 ARG A HH11 4  
ATOM 6604  H HH12 . ARG A 1 12  ? -9.080  -5.945  12.281  1.00 0.00 ?  225 ARG A HH12 4  
ATOM 6605  H HH21 . ARG A 1 12  ? -6.570  -4.151  13.981  1.00 0.00 ?  225 ARG A HH21 4  
ATOM 6606  H HH22 . ARG A 1 12  ? -7.721  -5.440  14.094  1.00 0.00 ?  225 ARG A HH22 4  
ATOM 6607  N N    . ASN A 1 13  ? -7.609  0.960   7.591   1.00 0.00 ?  226 ASN A N    4  
ATOM 6608  C CA   . ASN A 1 13  ? -6.765  1.423   6.503   1.00 0.00 ?  226 ASN A CA   4  
ATOM 6609  C C    . ASN A 1 13  ? -6.040  2.700   6.933   1.00 0.00 ?  226 ASN A C    4  
ATOM 6610  O O    . ASN A 1 13  ? -4.925  2.965   6.488   1.00 0.00 ?  226 ASN A O    4  
ATOM 6611  C CB   . ASN A 1 13  ? -7.596  1.747   5.260   1.00 0.00 ?  226 ASN A CB   4  
ATOM 6612  C CG   . ASN A 1 13  ? -8.774  2.659   5.611   1.00 0.00 ?  226 ASN A CG   4  
ATOM 6613  O OD1  . ASN A 1 13  ? -9.095  2.885   6.766   1.00 0.00 ?  226 ASN A OD1  4  
ATOM 6614  N ND2  . ASN A 1 13  ? -9.397  3.168   4.552   1.00 0.00 ?  226 ASN A ND2  4  
ATOM 6615  H H    . ASN A 1 13  ? -8.575  1.207   7.511   1.00 0.00 ?  226 ASN A H    4  
ATOM 6616  H HA   . ASN A 1 13  ? -6.078  0.600   6.303   1.00 0.00 ?  226 ASN A HA   4  
ATOM 6617  H HB2  . ASN A 1 13  ? -6.967  2.231   4.513   1.00 0.00 ?  226 ASN A HB2  4  
ATOM 6618  H HB3  . ASN A 1 13  ? -7.967  0.824   4.815   1.00 0.00 ?  226 ASN A HB3  4  
ATOM 6619  H HD21 . ASN A 1 13  ? -9.083  2.942   3.630   1.00 0.00 ?  226 ASN A HD21 4  
ATOM 6620  H HD22 . ASN A 1 13  ? -10.181 3.777   4.678   1.00 0.00 ?  226 ASN A HD22 4  
ATOM 6621  N N    . TRP A 1 14  ? -6.704  3.457   7.794   1.00 0.00 ?  227 TRP A N    4  
ATOM 6622  C CA   . TRP A 1 14  ? -6.137  4.700   8.289   1.00 0.00 ?  227 TRP A CA   4  
ATOM 6623  C C    . TRP A 1 14  ? -4.951  4.352   9.191   1.00 0.00 ?  227 TRP A C    4  
ATOM 6624  O O    . TRP A 1 14  ? -3.889  4.964   9.088   1.00 0.00 ?  227 TRP A O    4  
ATOM 6625  C CB   . TRP A 1 14  ? -7.199  5.543   8.997   1.00 0.00 ?  227 TRP A CB   4  
ATOM 6626  C CG   . TRP A 1 14  ? -6.647  6.797   9.678   1.00 0.00 ?  227 TRP A CG   4  
ATOM 6627  C CD1  . TRP A 1 14  ? -5.601  6.890   10.511  1.00 0.00 ?  227 TRP A CD1  4  
ATOM 6628  C CD2  . TRP A 1 14  ? -7.157  8.141   9.550   1.00 0.00 ?  227 TRP A CD2  4  
ATOM 6629  N NE1  . TRP A 1 14  ? -5.401  8.191   10.928  1.00 0.00 ?  227 TRP A NE1  4  
ATOM 6630  C CE2  . TRP A 1 14  ? -6.377  8.975   10.325  1.00 0.00 ?  227 TRP A CE2  4  
ATOM 6631  C CE3  . TRP A 1 14  ? -8.241  8.635   8.805   1.00 0.00 ?  227 TRP A CE3  4  
ATOM 6632  C CZ2  . TRP A 1 14  ? -6.598  10.354  10.428  1.00 0.00 ?  227 TRP A CZ2  4  
ATOM 6633  C CZ3  . TRP A 1 14  ? -8.449  10.015  8.919   1.00 0.00 ?  227 TRP A CZ3  4  
ATOM 6634  C CH2  . TRP A 1 14  ? -7.673  10.869  9.694   1.00 0.00 ?  227 TRP A CH2  4  
ATOM 6635  H H    . TRP A 1 14  ? -7.611  3.235   8.151   1.00 0.00 ?  227 TRP A H    4  
ATOM 6636  H HA   . TRP A 1 14  ? -5.795  5.276   7.430   1.00 0.00 ?  227 TRP A HA   4  
ATOM 6637  H HB2  . TRP A 1 14  ? -7.956  5.841   8.271   1.00 0.00 ?  227 TRP A HB2  4  
ATOM 6638  H HB3  . TRP A 1 14  ? -7.700  4.927   9.744   1.00 0.00 ?  227 TRP A HB3  4  
ATOM 6639  H HD1  . TRP A 1 14  ? -4.986  6.045   10.821  1.00 0.00 ?  227 TRP A HD1  4  
ATOM 6640  H HE1  . TRP A 1 14  ? -4.620  8.538   11.605  1.00 0.00 ?  227 TRP A HE1  4  
ATOM 6641  H HE3  . TRP A 1 14  ? -8.872  7.997   8.186   1.00 0.00 ?  227 TRP A HE3  4  
ATOM 6642  H HZ2  . TRP A 1 14  ? -5.967  10.992  11.047  1.00 0.00 ?  227 TRP A HZ2  4  
ATOM 6643  H HZ3  . TRP A 1 14  ? -9.278  10.450  8.361   1.00 0.00 ?  227 TRP A HZ3  4  
ATOM 6644  H HH2  . TRP A 1 14  ? -7.900  11.934  9.730   1.00 0.00 ?  227 TRP A HH2  4  
ATOM 6645  N N    . GLN A 1 15  ? -5.173  3.372   10.054  1.00 0.00 ?  228 GLN A N    4  
ATOM 6646  C CA   . GLN A 1 15  ? -4.135  2.936   10.974  1.00 0.00 ?  228 GLN A CA   4  
ATOM 6647  C C    . GLN A 1 15  ? -3.045  2.171   10.220  1.00 0.00 ?  228 GLN A C    4  
ATOM 6648  O O    . GLN A 1 15  ? -1.875  2.222   10.594  1.00 0.00 ?  228 GLN A O    4  
ATOM 6649  C CB   . GLN A 1 15  ? -4.723  2.083   12.100  1.00 0.00 ?  228 GLN A CB   4  
ATOM 6650  C CG   . GLN A 1 15  ? -4.937  0.640   11.640  1.00 0.00 ?  228 GLN A CG   4  
ATOM 6651  C CD   . GLN A 1 15  ? -5.517  -0.215  12.769  1.00 0.00 ?  228 GLN A CD   4  
ATOM 6652  O OE1  . GLN A 1 15  ? -4.909  -1.161  13.242  1.00 0.00 ?  228 GLN A OE1  4  
ATOM 6653  N NE2  . GLN A 1 15  ? -6.725  0.170   13.173  1.00 0.00 ?  228 GLN A NE2  4  
ATOM 6654  H H    . GLN A 1 15  ? -6.040  2.880   10.132  1.00 0.00 ?  228 GLN A H    4  
ATOM 6655  H HA   . GLN A 1 15  ? -3.720  3.850   11.397  1.00 0.00 ?  228 GLN A HA   4  
ATOM 6656  H HB2  . GLN A 1 15  ? -4.055  2.100   12.960  1.00 0.00 ?  228 GLN A HB2  4  
ATOM 6657  H HB3  . GLN A 1 15  ? -5.673  2.509   12.425  1.00 0.00 ?  228 GLN A HB3  4  
ATOM 6658  H HG2  . GLN A 1 15  ? -5.611  0.623   10.784  1.00 0.00 ?  228 GLN A HG2  4  
ATOM 6659  H HG3  . GLN A 1 15  ? -3.989  0.216   11.309  1.00 0.00 ?  228 GLN A HG3  4  
ATOM 6660  H HE21 . GLN A 1 15  ? -7.169  0.955   12.742  1.00 0.00 ?  228 GLN A HE21 4  
ATOM 6661  H HE22 . GLN A 1 15  ? -7.188  -0.327  13.907  1.00 0.00 ?  228 GLN A HE22 4  
ATOM 6662  N N    . LEU A 1 16  ? -3.469  1.481   9.171   1.00 0.00 ?  229 LEU A N    4  
ATOM 6663  C CA   . LEU A 1 16  ? -2.543  0.707   8.361   1.00 0.00 ?  229 LEU A CA   4  
ATOM 6664  C C    . LEU A 1 16  ? -1.535  1.651   7.704   1.00 0.00 ?  229 LEU A C    4  
ATOM 6665  O O    . LEU A 1 16  ? -0.331  1.402   7.740   1.00 0.00 ?  229 LEU A O    4  
ATOM 6666  C CB   . LEU A 1 16  ? -3.306  -0.169  7.365   1.00 0.00 ?  229 LEU A CB   4  
ATOM 6667  C CG   . LEU A 1 16  ? -3.620  -1.593  7.828   1.00 0.00 ?  229 LEU A CG   4  
ATOM 6668  C CD1  . LEU A 1 16  ? -4.949  -2.078  7.244   1.00 0.00 ?  229 LEU A CD1  4  
ATOM 6669  C CD2  . LEU A 1 16  ? -2.468  -2.544  7.497   1.00 0.00 ?  229 LEU A CD2  4  
ATOM 6670  H H    . LEU A 1 16  ? -4.423  1.444   8.873   1.00 0.00 ?  229 LEU A H    4  
ATOM 6671  H HA   . LEU A 1 16  ? -2.004  0.037   9.031   1.00 0.00 ?  229 LEU A HA   4  
ATOM 6672  H HB2  . LEU A 1 16  ? -4.245  0.328   7.120   1.00 0.00 ?  229 LEU A HB2  4  
ATOM 6673  H HB3  . LEU A 1 16  ? -2.726  -0.227  6.444   1.00 0.00 ?  229 LEU A HB3  4  
ATOM 6674  H HG   . LEU A 1 16  ? -3.729  -1.584  8.912   1.00 0.00 ?  229 LEU A HG   4  
ATOM 6675  H HD11 . LEU A 1 16  ? -5.513  -2.604  8.014   1.00 0.00 ?  229 LEU A HD11 4  
ATOM 6676  H HD12 . LEU A 1 16  ? -5.525  -1.222  6.892   1.00 0.00 ?  229 LEU A HD12 4  
ATOM 6677  H HD13 . LEU A 1 16  ? -4.755  -2.754  6.411   1.00 0.00 ?  229 LEU A HD13 4  
ATOM 6678  H HD21 . LEU A 1 16  ? -1.855  -2.111  6.707   1.00 0.00 ?  229 LEU A HD21 4  
ATOM 6679  H HD22 . LEU A 1 16  ? -1.858  -2.698  8.387   1.00 0.00 ?  229 LEU A HD22 4  
ATOM 6680  H HD23 . LEU A 1 16  ? -2.871  -3.500  7.163   1.00 0.00 ?  229 LEU A HD23 4  
ATOM 6681  N N    . VAL A 1 17  ? -2.064  2.716   7.118   1.00 0.00 ?  230 VAL A N    4  
ATOM 6682  C CA   . VAL A 1 17  ? -1.225  3.698   6.454   1.00 0.00 ?  230 VAL A CA   4  
ATOM 6683  C C    . VAL A 1 17  ? -0.368  4.419   7.496   1.00 0.00 ?  230 VAL A C    4  
ATOM 6684  O O    . VAL A 1 17  ? 0.814   4.672   7.265   1.00 0.00 ?  230 VAL A O    4  
ATOM 6685  C CB   . VAL A 1 17  ? -2.091  4.652   5.628   1.00 0.00 ?  230 VAL A CB   4  
ATOM 6686  C CG1  . VAL A 1 17  ? -2.866  3.894   4.548   1.00 0.00 ?  230 VAL A CG1  4  
ATOM 6687  C CG2  . VAL A 1 17  ? -3.039  5.449   6.527   1.00 0.00 ?  230 VAL A CG2  4  
ATOM 6688  H H    . VAL A 1 17  ? -3.045  2.911   7.093   1.00 0.00 ?  230 VAL A H    4  
ATOM 6689  H HA   . VAL A 1 17  ? -0.568  3.161   5.769   1.00 0.00 ?  230 VAL A HA   4  
ATOM 6690  H HB   . VAL A 1 17  ? -1.428  5.360   5.130   1.00 0.00 ?  230 VAL A HB   4  
ATOM 6691  H HG11 . VAL A 1 17  ? -3.933  4.086   4.665   1.00 0.00 ?  230 VAL A HG11 4  
ATOM 6692  H HG12 . VAL A 1 17  ? -2.542  4.232   3.564   1.00 0.00 ?  230 VAL A HG12 4  
ATOM 6693  H HG13 . VAL A 1 17  ? -2.676  2.826   4.647   1.00 0.00 ?  230 VAL A HG13 4  
ATOM 6694  H HG21 . VAL A 1 17  ? -3.513  6.240   5.945   1.00 0.00 ?  230 VAL A HG21 4  
ATOM 6695  H HG22 . VAL A 1 17  ? -3.805  4.784   6.926   1.00 0.00 ?  230 VAL A HG22 4  
ATOM 6696  H HG23 . VAL A 1 17  ? -2.476  5.890   7.349   1.00 0.00 ?  230 VAL A HG23 4  
ATOM 6697  N N    . ALA A 1 18  ? -0.997  4.730   8.620   1.00 0.00 ?  231 ALA A N    4  
ATOM 6698  C CA   . ALA A 1 18  ? -0.306  5.417   9.698   1.00 0.00 ?  231 ALA A CA   4  
ATOM 6699  C C    . ALA A 1 18  ? 0.584   4.420   10.444  1.00 0.00 ?  231 ALA A C    4  
ATOM 6700  O O    . ALA A 1 18  ? 1.417   4.815   11.259  1.00 0.00 ?  231 ALA A O    4  
ATOM 6701  C CB   . ALA A 1 18  ? -1.331  6.085   10.617  1.00 0.00 ?  231 ALA A CB   4  
ATOM 6702  H H    . ALA A 1 18  ? -1.958  4.521   8.799   1.00 0.00 ?  231 ALA A H    4  
ATOM 6703  H HA   . ALA A 1 18  ? 0.322   6.188   9.252   1.00 0.00 ?  231 ALA A HA   4  
ATOM 6704  H HB1  . ALA A 1 18  ? -1.945  5.321   11.093  1.00 0.00 ?  231 ALA A HB1  4  
ATOM 6705  H HB2  . ALA A 1 18  ? -0.811  6.662   11.382  1.00 0.00 ?  231 ALA A HB2  4  
ATOM 6706  H HB3  . ALA A 1 18  ? -1.966  6.749   10.030  1.00 0.00 ?  231 ALA A HB3  4  
ATOM 6707  N N    . ALA A 1 19  ? 0.377   3.147   10.140  1.00 0.00 ?  232 ALA A N    4  
ATOM 6708  C CA   . ALA A 1 19  ? 1.149   2.092   10.772  1.00 0.00 ?  232 ALA A CA   4  
ATOM 6709  C C    . ALA A 1 19  ? 2.502   1.965   10.069  1.00 0.00 ?  232 ALA A C    4  
ATOM 6710  O O    . ALA A 1 19  ? 3.479   1.518   10.670  1.00 0.00 ?  232 ALA A O    4  
ATOM 6711  C CB   . ALA A 1 19  ? 0.352   0.786   10.741  1.00 0.00 ?  232 ALA A CB   4  
ATOM 6712  H H    . ALA A 1 19  ? -0.303  2.834   9.477   1.00 0.00 ?  232 ALA A H    4  
ATOM 6713  H HA   . ALA A 1 19  ? 1.314   2.377   11.811  1.00 0.00 ?  232 ALA A HA   4  
ATOM 6714  H HB1  . ALA A 1 19  ? -0.289  0.731   11.621  1.00 0.00 ?  232 ALA A HB1  4  
ATOM 6715  H HB2  . ALA A 1 19  ? -0.263  0.758   9.841   1.00 0.00 ?  232 ALA A HB2  4  
ATOM 6716  H HB3  . ALA A 1 19  ? 1.039   -0.059  10.738  1.00 0.00 ?  232 ALA A HB3  4  
ATOM 6717  N N    . VAL A 1 20  ? 2.517   2.367   8.806   1.00 0.00 ?  233 VAL A N    4  
ATOM 6718  C CA   . VAL A 1 20  ? 3.734   2.304   8.015   1.00 0.00 ?  233 VAL A CA   4  
ATOM 6719  C C    . VAL A 1 20  ? 4.548   3.580   8.238   1.00 0.00 ?  233 VAL A C    4  
ATOM 6720  O O    . VAL A 1 20  ? 3.997   4.679   8.243   1.00 0.00 ?  233 VAL A O    4  
ATOM 6721  C CB   . VAL A 1 20  ? 3.390   2.063   6.544   1.00 0.00 ?  233 VAL A CB   4  
ATOM 6722  C CG1  . VAL A 1 20  ? 2.650   0.736   6.364   1.00 0.00 ?  233 VAL A CG1  4  
ATOM 6723  C CG2  . VAL A 1 20  ? 2.576   3.227   5.974   1.00 0.00 ?  233 VAL A CG2  4  
ATOM 6724  H H    . VAL A 1 20  ? 1.719   2.729   8.325   1.00 0.00 ?  233 VAL A H    4  
ATOM 6725  H HA   . VAL A 1 20  ? 4.314   1.451   8.370   1.00 0.00 ?  233 VAL A HA   4  
ATOM 6726  H HB   . VAL A 1 20  ? 4.325   2.004   5.987   1.00 0.00 ?  233 VAL A HB   4  
ATOM 6727  H HG11 . VAL A 1 20  ? 2.909   0.062   7.180   1.00 0.00 ?  233 VAL A HG11 4  
ATOM 6728  H HG12 . VAL A 1 20  ? 1.575   0.916   6.369   1.00 0.00 ?  233 VAL A HG12 4  
ATOM 6729  H HG13 . VAL A 1 20  ? 2.939   0.285   5.415   1.00 0.00 ?  233 VAL A HG13 4  
ATOM 6730  H HG21 . VAL A 1 20  ? 2.793   4.133   6.540   1.00 0.00 ?  233 VAL A HG21 4  
ATOM 6731  H HG22 . VAL A 1 20  ? 2.844   3.379   4.928   1.00 0.00 ?  233 VAL A HG22 4  
ATOM 6732  H HG23 . VAL A 1 20  ? 1.513   2.998   6.048   1.00 0.00 ?  233 VAL A HG23 4  
ATOM 6733  N N    . PRO A 1 21  ? 5.882   3.386   8.422   1.00 0.00 ?  234 PRO A N    4  
ATOM 6734  C CA   . PRO A 1 21  ? 6.778   4.508   8.644   1.00 0.00 ?  234 PRO A CA   4  
ATOM 6735  C C    . PRO A 1 21  ? 7.033   5.273   7.344   1.00 0.00 ?  234 PRO A C    4  
ATOM 6736  O O    . PRO A 1 21  ? 7.558   6.385   7.366   1.00 0.00 ?  234 PRO A O    4  
ATOM 6737  C CB   . PRO A 1 21  ? 8.039   3.895   9.230   1.00 0.00 ?  234 PRO A CB   4  
ATOM 6738  C CG   . PRO A 1 21  ? 7.983   2.416   8.883   1.00 0.00 ?  234 PRO A CG   4  
ATOM 6739  C CD   . PRO A 1 21  ? 6.570   2.098   8.422   1.00 0.00 ?  234 PRO A CD   4  
ATOM 6740  H HA   . PRO A 1 21  ? 6.360   5.167   9.271   1.00 0.00 ?  234 PRO A HA   4  
ATOM 6741  H HB2  . PRO A 1 21  ? 8.931   4.361   8.811   1.00 0.00 ?  234 PRO A HB2  4  
ATOM 6742  H HB3  . PRO A 1 21  ? 8.080   4.041   10.309  1.00 0.00 ?  234 PRO A HB3  4  
ATOM 6743  H HG2  . PRO A 1 21  ? 8.702   2.181   8.098   1.00 0.00 ?  234 PRO A HG2  4  
ATOM 6744  H HG3  . PRO A 1 21  ? 8.248   1.810   9.749   1.00 0.00 ?  234 PRO A HG3  4  
ATOM 6745  H HD2  . PRO A 1 21  ? 6.568   1.648   7.429   1.00 0.00 ?  234 PRO A HD2  4  
ATOM 6746  H HD3  . PRO A 1 21  ? 6.084   1.390   9.094   1.00 0.00 ?  234 PRO A HD3  4  
ATOM 6747  N N    . LEU A 1 22  ? 6.649   4.646   6.241   1.00 0.00 ?  235 LEU A N    4  
ATOM 6748  C CA   . LEU A 1 22  ? 6.829   5.253   4.934   1.00 0.00 ?  235 LEU A CA   4  
ATOM 6749  C C    . LEU A 1 22  ? 5.891   6.455   4.800   1.00 0.00 ?  235 LEU A C    4  
ATOM 6750  O O    . LEU A 1 22  ? 6.192   7.404   4.078   1.00 0.00 ?  235 LEU A O    4  
ATOM 6751  C CB   . LEU A 1 22  ? 6.652   4.209   3.829   1.00 0.00 ?  235 LEU A CB   4  
ATOM 6752  C CG   . LEU A 1 22  ? 7.588   4.340   2.626   1.00 0.00 ?  235 LEU A CG   4  
ATOM 6753  C CD1  . LEU A 1 22  ? 7.564   5.763   2.065   1.00 0.00 ?  235 LEU A CD1  4  
ATOM 6754  C CD2  . LEU A 1 22  ? 9.006   3.888   2.983   1.00 0.00 ?  235 LEU A CD2  4  
ATOM 6755  H H    . LEU A 1 22  ? 6.222   3.742   6.232   1.00 0.00 ?  235 LEU A H    4  
ATOM 6756  H HA   . LEU A 1 22  ? 7.858   5.610   4.878   1.00 0.00 ?  235 LEU A HA   4  
ATOM 6757  H HB2  . LEU A 1 22  ? 6.790   3.220   4.266   1.00 0.00 ?  235 LEU A HB2  4  
ATOM 6758  H HB3  . LEU A 1 22  ? 5.624   4.259   3.471   1.00 0.00 ?  235 LEU A HB3  4  
ATOM 6759  H HG   . LEU A 1 22  ? 7.228   3.678   1.839   1.00 0.00 ?  235 LEU A HG   4  
ATOM 6760  H HD11 . LEU A 1 22  ? 8.194   5.814   1.177   1.00 0.00 ?  235 LEU A HD11 4  
ATOM 6761  H HD12 . LEU A 1 22  ? 6.542   6.033   1.802   1.00 0.00 ?  235 LEU A HD12 4  
ATOM 6762  H HD13 . LEU A 1 22  ? 7.941   6.457   2.817   1.00 0.00 ?  235 LEU A HD13 4  
ATOM 6763  H HD21 . LEU A 1 22  ? 9.452   4.604   3.673   1.00 0.00 ?  235 LEU A HD21 4  
ATOM 6764  H HD22 . LEU A 1 22  ? 8.966   2.906   3.453   1.00 0.00 ?  235 LEU A HD22 4  
ATOM 6765  H HD23 . LEU A 1 22  ? 9.608   3.834   2.076   1.00 0.00 ?  235 LEU A HD23 4  
ATOM 6766  N N    . PHE A 1 23  ? 4.774   6.375   5.508   1.00 0.00 ?  236 PHE A N    4  
ATOM 6767  C CA   . PHE A 1 23  ? 3.791   7.444   5.478   1.00 0.00 ?  236 PHE A CA   4  
ATOM 6768  C C    . PHE A 1 23  ? 3.737   8.178   6.819   1.00 0.00 ?  236 PHE A C    4  
ATOM 6769  O O    . PHE A 1 23  ? 3.212   9.287   6.904   1.00 0.00 ?  236 PHE A O    4  
ATOM 6770  C CB   . PHE A 1 23  ? 2.432   6.794   5.211   1.00 0.00 ?  236 PHE A CB   4  
ATOM 6771  C CG   . PHE A 1 23  ? 2.239   6.325   3.768   1.00 0.00 ?  236 PHE A CG   4  
ATOM 6772  C CD1  . PHE A 1 23  ? 3.252   6.455   2.869   1.00 0.00 ?  236 PHE A CD1  4  
ATOM 6773  C CD2  . PHE A 1 23  ? 1.055   5.778   3.383   1.00 0.00 ?  236 PHE A CD2  4  
ATOM 6774  C CE1  . PHE A 1 23  ? 3.073   6.019   1.530   1.00 0.00 ?  236 PHE A CE1  4  
ATOM 6775  C CE2  . PHE A 1 23  ? 0.876   5.342   2.043   1.00 0.00 ?  236 PHE A CE2  4  
ATOM 6776  C CZ   . PHE A 1 23  ? 1.889   5.472   1.145   1.00 0.00 ?  236 PHE A CZ   4  
ATOM 6777  H H    . PHE A 1 23  ? 4.537   5.599   6.093   1.00 0.00 ?  236 PHE A H    4  
ATOM 6778  H HA   . PHE A 1 23  ? 4.095   8.140   4.697   1.00 0.00 ?  236 PHE A HA   4  
ATOM 6779  H HB2  . PHE A 1 23  ? 2.311   5.941   5.879   1.00 0.00 ?  236 PHE A HB2  4  
ATOM 6780  H HB3  . PHE A 1 23  ? 1.645   7.506   5.459   1.00 0.00 ?  236 PHE A HB3  4  
ATOM 6781  H HD1  . PHE A 1 23  ? 4.201   6.893   3.178   1.00 0.00 ?  236 PHE A HD1  4  
ATOM 6782  H HD2  . PHE A 1 23  ? 0.243   5.674   4.103   1.00 0.00 ?  236 PHE A HD2  4  
ATOM 6783  H HE1  . PHE A 1 23  ? 3.885   6.123   0.810   1.00 0.00 ?  236 PHE A HE1  4  
ATOM 6784  H HE2  . PHE A 1 23  ? -0.073  4.904   1.734   1.00 0.00 ?  236 PHE A HE2  4  
ATOM 6785  H HZ   . PHE A 1 23  ? 1.752   5.138   0.116   1.00 0.00 ?  236 PHE A HZ   4  
ATOM 6786  N N    . GLN A 1 24  ? 4.288   7.529   7.835   1.00 0.00 ?  237 GLN A N    4  
ATOM 6787  C CA   . GLN A 1 24  ? 4.310   8.106   9.168   1.00 0.00 ?  237 GLN A CA   4  
ATOM 6788  C C    . GLN A 1 24  ? 5.056   9.441   9.157   1.00 0.00 ?  237 GLN A C    4  
ATOM 6789  O O    . GLN A 1 24  ? 4.798   10.308  9.990   1.00 0.00 ?  237 GLN A O    4  
ATOM 6790  C CB   . GLN A 1 24  ? 4.934   7.137   10.175  1.00 0.00 ?  237 GLN A CB   4  
ATOM 6791  C CG   . GLN A 1 24  ? 4.383   7.379   11.582  1.00 0.00 ?  237 GLN A CG   4  
ATOM 6792  C CD   . GLN A 1 24  ? 4.916   8.691   12.161  1.00 0.00 ?  237 GLN A CD   4  
ATOM 6793  O OE1  . GLN A 1 24  ? 4.215   9.684   12.264  1.00 0.00 ?  237 GLN A OE1  4  
ATOM 6794  N NE2  . GLN A 1 24  ? 6.192   8.639   12.533  1.00 0.00 ?  237 GLN A NE2  4  
ATOM 6795  H H    . GLN A 1 24  ? 4.713   6.627   7.758   1.00 0.00 ?  237 GLN A H    4  
ATOM 6796  H HA   . GLN A 1 24  ? 3.264   8.269   9.430   1.00 0.00 ?  237 GLN A HA   4  
ATOM 6797  H HB2  . GLN A 1 24  ? 4.729   6.111   9.872   1.00 0.00 ?  237 GLN A HB2  4  
ATOM 6798  H HB3  . GLN A 1 24  ? 6.017   7.259   10.178  1.00 0.00 ?  237 GLN A HB3  4  
ATOM 6799  H HG2  . GLN A 1 24  ? 3.294   7.407   11.550  1.00 0.00 ?  237 GLN A HG2  4  
ATOM 6800  H HG3  . GLN A 1 24  ? 4.662   6.550   12.232  1.00 0.00 ?  237 GLN A HG3  4  
ATOM 6801  H HE21 . GLN A 1 24  ? 6.712   7.792   12.421  1.00 0.00 ?  237 GLN A HE21 4  
ATOM 6802  H HE22 . GLN A 1 24  ? 6.632   9.448   12.924  1.00 0.00 ?  237 GLN A HE22 4  
ATOM 6803  N N    . LYS A 1 25  ? 5.968   9.565   8.203   1.00 0.00 ?  238 LYS A N    4  
ATOM 6804  C CA   . LYS A 1 25  ? 6.754   10.780  8.072   1.00 0.00 ?  238 LYS A CA   4  
ATOM 6805  C C    . LYS A 1 25  ? 5.955   11.816  7.277   1.00 0.00 ?  238 LYS A C    4  
ATOM 6806  O O    . LYS A 1 25  ? 6.479   12.872  6.925   1.00 0.00 ?  238 LYS A O    4  
ATOM 6807  C CB   . LYS A 1 25  ? 8.126   10.468  7.471   1.00 0.00 ?  238 LYS A CB   4  
ATOM 6808  C CG   . LYS A 1 25  ? 8.759   9.253   8.152   1.00 0.00 ?  238 LYS A CG   4  
ATOM 6809  C CD   . LYS A 1 25  ? 9.189   9.588   9.582   1.00 0.00 ?  238 LYS A CD   4  
ATOM 6810  C CE   . LYS A 1 25  ? 9.543   8.318   10.358  1.00 0.00 ?  238 LYS A CE   4  
ATOM 6811  N NZ   . LYS A 1 25  ? 10.359  8.649   11.548  1.00 0.00 1  238 LYS A NZ   4  
ATOM 6812  H H    . LYS A 1 25  ? 6.172   8.855   7.529   1.00 0.00 ?  238 LYS A H    4  
ATOM 6813  H HA   . LYS A 1 25  ? 6.923   11.170  9.076   1.00 0.00 ?  238 LYS A HA   4  
ATOM 6814  H HB2  . LYS A 1 25  ? 8.025   10.279  6.402   1.00 0.00 ?  238 LYS A HB2  4  
ATOM 6815  H HB3  . LYS A 1 25  ? 8.780   11.333  7.581   1.00 0.00 ?  238 LYS A HB3  4  
ATOM 6816  H HG2  . LYS A 1 25  ? 8.048   8.428   8.165   1.00 0.00 ?  238 LYS A HG2  4  
ATOM 6817  H HG3  . LYS A 1 25  ? 9.624   8.920   7.577   1.00 0.00 ?  238 LYS A HG3  4  
ATOM 6818  H HD2  . LYS A 1 25  ? 10.049  10.257  9.560   1.00 0.00 ?  238 LYS A HD2  4  
ATOM 6819  H HD3  . LYS A 1 25  ? 8.385   10.118  10.092  1.00 0.00 ?  238 LYS A HD3  4  
ATOM 6820  H HE2  . LYS A 1 25  ? 8.631   7.807   10.667  1.00 0.00 ?  238 LYS A HE2  4  
ATOM 6821  H HE3  . LYS A 1 25  ? 10.091  7.631   9.714   1.00 0.00 ?  238 LYS A HE3  4  
ATOM 6822  H HZ1  . LYS A 1 25  ? 10.360  7.873   12.178  1.00 0.00 ?  238 LYS A HZ1  4  
ATOM 6823  H HZ2  . LYS A 1 25  ? 11.297  8.849   11.264  1.00 0.00 ?  238 LYS A HZ2  4  
ATOM 6824  H HZ3  . LYS A 1 25  ? 9.972   9.450   12.006  1.00 0.00 ?  238 LYS A HZ3  4  
ATOM 6825  N N    . LEU A 1 26  ? 4.701   11.477  7.018   1.00 0.00 ?  239 LEU A N    4  
ATOM 6826  C CA   . LEU A 1 26  ? 3.825   12.364  6.272   1.00 0.00 ?  239 LEU A CA   4  
ATOM 6827  C C    . LEU A 1 26  ? 2.890   13.086  7.244   1.00 0.00 ?  239 LEU A C    4  
ATOM 6828  O O    . LEU A 1 26  ? 2.965   12.878  8.454   1.00 0.00 ?  239 LEU A O    4  
ATOM 6829  C CB   . LEU A 1 26  ? 3.093   11.594  5.172   1.00 0.00 ?  239 LEU A CB   4  
ATOM 6830  C CG   . LEU A 1 26  ? 3.974   10.776  4.225   1.00 0.00 ?  239 LEU A CG   4  
ATOM 6831  C CD1  . LEU A 1 26  ? 3.127   9.863   3.338   1.00 0.00 ?  239 LEU A CD1  4  
ATOM 6832  C CD2  . LEU A 1 26  ? 4.887   11.688  3.402   1.00 0.00 ?  239 LEU A CD2  4  
ATOM 6833  H H    . LEU A 1 26  ? 4.283   10.616  7.308   1.00 0.00 ?  239 LEU A H    4  
ATOM 6834  H HA   . LEU A 1 26  ? 4.454   13.107  5.781   1.00 0.00 ?  239 LEU A HA   4  
ATOM 6835  H HB2  . LEU A 1 26  ? 2.377   10.919  5.642   1.00 0.00 ?  239 LEU A HB2  4  
ATOM 6836  H HB3  . LEU A 1 26  ? 2.518   12.305  4.578   1.00 0.00 ?  239 LEU A HB3  4  
ATOM 6837  H HG   . LEU A 1 26  ? 4.618   10.134  4.826   1.00 0.00 ?  239 LEU A HG   4  
ATOM 6838  H HD11 . LEU A 1 26  ? 2.724   10.438  2.504   1.00 0.00 ?  239 LEU A HD11 4  
ATOM 6839  H HD12 . LEU A 1 26  ? 3.745   9.051   2.955   1.00 0.00 ?  239 LEU A HD12 4  
ATOM 6840  H HD13 . LEU A 1 26  ? 2.305   9.448   3.923   1.00 0.00 ?  239 LEU A HD13 4  
ATOM 6841  H HD21 . LEU A 1 26  ? 5.624   12.152  4.057   1.00 0.00 ?  239 LEU A HD21 4  
ATOM 6842  H HD22 . LEU A 1 26  ? 5.398   11.099  2.640   1.00 0.00 ?  239 LEU A HD22 4  
ATOM 6843  H HD23 . LEU A 1 26  ? 4.289   12.463  2.922   1.00 0.00 ?  239 LEU A HD23 4  
ATOM 6844  N N    . GLY A 1 27  ? 2.030   13.921  6.678   1.00 0.00 ?  240 GLY A N    4  
ATOM 6845  C CA   . GLY A 1 27  ? 1.081   14.675  7.479   1.00 0.00 ?  240 GLY A CA   4  
ATOM 6846  C C    . GLY A 1 27  ? -0.243  13.921  7.614   1.00 0.00 ?  240 GLY A C    4  
ATOM 6847  O O    . GLY A 1 27  ? -0.415  12.851  7.032   1.00 0.00 ?  240 GLY A O    4  
ATOM 6848  H H    . GLY A 1 27  ? 1.976   14.084  5.692   1.00 0.00 ?  240 GLY A H    4  
ATOM 6849  H HA2  . GLY A 1 27  ? 1.501   14.860  8.467   1.00 0.00 ?  240 GLY A HA2  4  
ATOM 6850  H HA3  . GLY A 1 27  ? 0.904   15.648  7.020   1.00 0.00 ?  240 GLY A HA3  4  
ATOM 6851  N N    . PRO A 1 28  ? -1.170  14.524  8.406   1.00 0.00 ?  241 PRO A N    4  
ATOM 6852  C CA   . PRO A 1 28  ? -2.474  13.921  8.625   1.00 0.00 ?  241 PRO A CA   4  
ATOM 6853  C C    . PRO A 1 28  ? -3.368  14.086  7.395   1.00 0.00 ?  241 PRO A C    4  
ATOM 6854  O O    . PRO A 1 28  ? -4.224  13.244  7.128   1.00 0.00 ?  241 PRO A O    4  
ATOM 6855  C CB   . PRO A 1 28  ? -3.026  14.617  9.858   1.00 0.00 ?  241 PRO A CB   4  
ATOM 6856  C CG   . PRO A 1 28  ? -2.223  15.898  10.010  1.00 0.00 ?  241 PRO A CG   4  
ATOM 6857  C CD   . PRO A 1 28  ? -1.001  15.791  9.111   1.00 0.00 ?  241 PRO A CD   4  
ATOM 6858  H HA   . PRO A 1 28  ? -2.381  12.935  8.766   1.00 0.00 ?  241 PRO A HA   4  
ATOM 6859  H HB2  . PRO A 1 28  ? -4.088  14.833  9.742   1.00 0.00 ?  241 PRO A HB2  4  
ATOM 6860  H HB3  . PRO A 1 28  ? -2.925  13.986  10.741  1.00 0.00 ?  241 PRO A HB3  4  
ATOM 6861  H HG2  . PRO A 1 28  ? -2.827  16.762  9.732   1.00 0.00 ?  241 PRO A HG2  4  
ATOM 6862  H HG3  . PRO A 1 28  ? -1.922  16.040  11.048  1.00 0.00 ?  241 PRO A HG3  4  
ATOM 6863  H HD2  . PRO A 1 28  ? -0.948  16.628  8.415   1.00 0.00 ?  241 PRO A HD2  4  
ATOM 6864  H HD3  . PRO A 1 28  ? -0.080  15.801  9.693   1.00 0.00 ?  241 PRO A HD3  4  
ATOM 6865  N N    . ALA A 1 29  ? -3.138  15.176  6.678   1.00 0.00 ?  242 ALA A N    4  
ATOM 6866  C CA   . ALA A 1 29  ? -3.912  15.462  5.482   1.00 0.00 ?  242 ALA A CA   4  
ATOM 6867  C C    . ALA A 1 29  ? -3.520  14.478  4.378   1.00 0.00 ?  242 ALA A C    4  
ATOM 6868  O O    . ALA A 1 29  ? -4.345  14.120  3.539   1.00 0.00 ?  242 ALA A O    4  
ATOM 6869  C CB   . ALA A 1 29  ? -3.694  16.919  5.068   1.00 0.00 ?  242 ALA A CB   4  
ATOM 6870  H H    . ALA A 1 29  ? -2.439  15.856  6.901   1.00 0.00 ?  242 ALA A H    4  
ATOM 6871  H HA   . ALA A 1 29  ? -4.965  15.320  5.726   1.00 0.00 ?  242 ALA A HA   4  
ATOM 6872  H HB1  . ALA A 1 29  ? -3.607  17.540  5.960   1.00 0.00 ?  242 ALA A HB1  4  
ATOM 6873  H HB2  . ALA A 1 29  ? -2.780  16.997  4.480   1.00 0.00 ?  242 ALA A HB2  4  
ATOM 6874  H HB3  . ALA A 1 29  ? -4.540  17.258  4.471   1.00 0.00 ?  242 ALA A HB3  4  
ATOM 6875  N N    . VAL A 1 30  ? -2.260  14.069  4.414   1.00 0.00 ?  243 VAL A N    4  
ATOM 6876  C CA   . VAL A 1 30  ? -1.748  13.133  3.428   1.00 0.00 ?  243 VAL A CA   4  
ATOM 6877  C C    . VAL A 1 30  ? -2.236  11.723  3.767   1.00 0.00 ?  243 VAL A C    4  
ATOM 6878  O O    . VAL A 1 30  ? -2.647  10.975  2.881   1.00 0.00 ?  243 VAL A O    4  
ATOM 6879  C CB   . VAL A 1 30  ? -0.224  13.236  3.350   1.00 0.00 ?  243 VAL A CB   4  
ATOM 6880  C CG1  . VAL A 1 30  ? 0.390   11.926  2.852   1.00 0.00 ?  243 VAL A CG1  4  
ATOM 6881  C CG2  . VAL A 1 30  ? 0.203   14.412  2.469   1.00 0.00 ?  243 VAL A CG2  4  
ATOM 6882  H H    . VAL A 1 30  ? -1.595  14.365  5.100   1.00 0.00 ?  243 VAL A H    4  
ATOM 6883  H HA   . VAL A 1 30  ? -2.155  13.422  2.458   1.00 0.00 ?  243 VAL A HA   4  
ATOM 6884  H HB   . VAL A 1 30  ? 0.151   13.419  4.357   1.00 0.00 ?  243 VAL A HB   4  
ATOM 6885  H HG11 . VAL A 1 30  ? 1.469   12.043  2.756   1.00 0.00 ?  243 VAL A HG11 4  
ATOM 6886  H HG12 . VAL A 1 30  ? 0.172   11.129  3.563   1.00 0.00 ?  243 VAL A HG12 4  
ATOM 6887  H HG13 . VAL A 1 30  ? -0.036  11.672  1.881   1.00 0.00 ?  243 VAL A HG13 4  
ATOM 6888  H HG21 . VAL A 1 30  ? -0.127  15.345  2.924   1.00 0.00 ?  243 VAL A HG21 4  
ATOM 6889  H HG22 . VAL A 1 30  ? 1.288   14.418  2.372   1.00 0.00 ?  243 VAL A HG22 4  
ATOM 6890  H HG23 . VAL A 1 30  ? -0.249  14.309  1.482   1.00 0.00 ?  243 VAL A HG23 4  
ATOM 6891  N N    . LEU A 1 31  ? -2.174  11.403  5.051   1.00 0.00 ?  244 LEU A N    4  
ATOM 6892  C CA   . LEU A 1 31  ? -2.604  10.097  5.518   1.00 0.00 ?  244 LEU A CA   4  
ATOM 6893  C C    . LEU A 1 31  ? -4.118  9.967   5.335   1.00 0.00 ?  244 LEU A C    4  
ATOM 6894  O O    . LEU A 1 31  ? -4.603  8.943   4.857   1.00 0.00 ?  244 LEU A O    4  
ATOM 6895  C CB   . LEU A 1 31  ? -2.137  9.861   6.956   1.00 0.00 ?  244 LEU A CB   4  
ATOM 6896  C CG   . LEU A 1 31  ? -0.725  9.293   7.118   1.00 0.00 ?  244 LEU A CG   4  
ATOM 6897  C CD1  . LEU A 1 31  ? -0.766  7.784   7.366   1.00 0.00 ?  244 LEU A CD1  4  
ATOM 6898  C CD2  . LEU A 1 31  ? 0.151   9.653   5.917   1.00 0.00 ?  244 LEU A CD2  4  
ATOM 6899  H H    . LEU A 1 31  ? -1.838  12.018  5.765   1.00 0.00 ?  244 LEU A H    4  
ATOM 6900  H HA   . LEU A 1 31  ? -2.115  9.349   4.894   1.00 0.00 ?  244 LEU A HA   4  
ATOM 6901  H HB2  . LEU A 1 31  ? -2.191  10.807  7.494   1.00 0.00 ?  244 LEU A HB2  4  
ATOM 6902  H HB3  . LEU A 1 31  ? -2.838  9.180   7.438   1.00 0.00 ?  244 LEU A HB3  4  
ATOM 6903  H HG   . LEU A 1 31  ? -0.272  9.752   7.997   1.00 0.00 ?  244 LEU A HG   4  
ATOM 6904  H HD11 . LEU A 1 31  ? 0.248   7.412   7.507   1.00 0.00 ?  244 LEU A HD11 4  
ATOM 6905  H HD12 . LEU A 1 31  ? -1.356  7.579   8.259   1.00 0.00 ?  244 LEU A HD12 4  
ATOM 6906  H HD13 . LEU A 1 31  ? -1.220  7.287   6.509   1.00 0.00 ?  244 LEU A HD13 4  
ATOM 6907  H HD21 . LEU A 1 31  ? 0.059   10.719  5.706   1.00 0.00 ?  244 LEU A HD21 4  
ATOM 6908  H HD22 . LEU A 1 31  ? 1.191   9.416   6.142   1.00 0.00 ?  244 LEU A HD22 4  
ATOM 6909  H HD23 . LEU A 1 31  ? -0.172  9.081   5.047   1.00 0.00 ?  244 LEU A HD23 4  
ATOM 6910  N N    . VAL A 1 32  ? -4.821  11.020  5.724   1.00 0.00 ?  245 VAL A N    4  
ATOM 6911  C CA   . VAL A 1 32  ? -6.269  11.037  5.608   1.00 0.00 ?  245 VAL A CA   4  
ATOM 6912  C C    . VAL A 1 32  ? -6.659  10.980  4.130   1.00 0.00 ?  245 VAL A C    4  
ATOM 6913  O O    . VAL A 1 32  ? -7.556  10.229  3.749   1.00 0.00 ?  245 VAL A O    4  
ATOM 6914  C CB   . VAL A 1 32  ? -6.838  12.261  6.329   1.00 0.00 ?  245 VAL A CB   4  
ATOM 6915  C CG1  . VAL A 1 32  ? -6.722  13.513  5.458   1.00 0.00 ?  245 VAL A CG1  4  
ATOM 6916  C CG2  . VAL A 1 32  ? -8.287  12.022  6.756   1.00 0.00 ?  245 VAL A CG2  4  
ATOM 6917  H H    . VAL A 1 32  ? -4.418  11.849  6.112   1.00 0.00 ?  245 VAL A H    4  
ATOM 6918  H HA   . VAL A 1 32  ? -6.650  10.145  6.106   1.00 0.00 ?  245 VAL A HA   4  
ATOM 6919  H HB   . VAL A 1 32  ? -6.246  12.424  7.230   1.00 0.00 ?  245 VAL A HB   4  
ATOM 6920  H HG11 . VAL A 1 32  ? -5.699  13.610  5.095   1.00 0.00 ?  245 VAL A HG11 4  
ATOM 6921  H HG12 . VAL A 1 32  ? -7.402  13.430  4.610   1.00 0.00 ?  245 VAL A HG12 4  
ATOM 6922  H HG13 . VAL A 1 32  ? -6.983  14.392  6.048   1.00 0.00 ?  245 VAL A HG13 4  
ATOM 6923  H HG21 . VAL A 1 32  ? -8.551  10.979  6.578   1.00 0.00 ?  245 VAL A HG21 4  
ATOM 6924  H HG22 . VAL A 1 32  ? -8.396  12.248  7.816   1.00 0.00 ?  245 VAL A HG22 4  
ATOM 6925  H HG23 . VAL A 1 32  ? -8.948  12.667  6.177   1.00 0.00 ?  245 VAL A HG23 4  
ATOM 6926  N N    . GLU A 1 33  ? -5.966  11.783  3.336   1.00 0.00 ?  246 GLU A N    4  
ATOM 6927  C CA   . GLU A 1 33  ? -6.228  11.833  1.908   1.00 0.00 ?  246 GLU A CA   4  
ATOM 6928  C C    . GLU A 1 33  ? -5.863  10.498  1.254   1.00 0.00 ?  246 GLU A C    4  
ATOM 6929  O O    . GLU A 1 33  ? -6.519  10.067  0.307   1.00 0.00 ?  246 GLU A O    4  
ATOM 6930  C CB   . GLU A 1 33  ? -5.472  12.990  1.252   1.00 0.00 ?  246 GLU A CB   4  
ATOM 6931  C CG   . GLU A 1 33  ? -5.912  13.178  -0.202  1.00 0.00 ?  246 GLU A CG   4  
ATOM 6932  C CD   . GLU A 1 33  ? -7.131  14.098  -0.291  1.00 0.00 ?  246 GLU A CD   4  
ATOM 6933  O OE1  . GLU A 1 33  ? -7.423  14.835  0.662   1.00 0.00 ?  246 GLU A OE1  4  
ATOM 6934  O OE2  . GLU A 1 33  ? -7.785  14.029  -1.401  1.00 0.00 -1 246 GLU A OE2  4  
ATOM 6935  H H    . GLU A 1 33  ? -5.237  12.390  3.654   1.00 0.00 ?  246 GLU A H    4  
ATOM 6936  H HA   . GLU A 1 33  ? -7.300  12.009  1.816   1.00 0.00 ?  246 GLU A HA   4  
ATOM 6937  H HB2  . GLU A 1 33  ? -5.650  13.909  1.811   1.00 0.00 ?  246 GLU A HB2  4  
ATOM 6938  H HB3  . GLU A 1 33  ? -4.400  12.797  1.289   1.00 0.00 ?  246 GLU A HB3  4  
ATOM 6939  H HG2  . GLU A 1 33  ? -5.091  13.599  -0.782  1.00 0.00 ?  246 GLU A HG2  4  
ATOM 6940  H HG3  . GLU A 1 33  ? -6.149  12.209  -0.642  1.00 0.00 ?  246 GLU A HG3  4  
ATOM 6941  H HE2  . GLU A 1 33  ? -7.382  14.647  -2.075  1.00 0.00 ?  246 GLU A HE2  4  
ATOM 6942  N N    . ILE A 1 34  ? -4.817  9.882   1.786   1.00 0.00 ?  247 ILE A N    4  
ATOM 6943  C CA   . ILE A 1 34  ? -4.357  8.606   1.266   1.00 0.00 ?  247 ILE A CA   4  
ATOM 6944  C C    . ILE A 1 34  ? -5.393  7.526   1.586   1.00 0.00 ?  247 ILE A C    4  
ATOM 6945  O O    . ILE A 1 34  ? -5.871  6.834   0.688   1.00 0.00 ?  247 ILE A O    4  
ATOM 6946  C CB   . ILE A 1 34  ? -2.955  8.288   1.789   1.00 0.00 ?  247 ILE A CB   4  
ATOM 6947  C CG1  . ILE A 1 34  ? -1.885  9.002   0.961   1.00 0.00 ?  247 ILE A CG1  4  
ATOM 6948  C CG2  . ILE A 1 34  ? -2.721  6.777   1.847   1.00 0.00 ?  247 ILE A CG2  4  
ATOM 6949  C CD1  . ILE A 1 34  ? -0.503  8.844   1.598   1.00 0.00 ?  247 ILE A CD1  4  
ATOM 6950  H H    . ILE A 1 34  ? -4.290  10.240  2.556   1.00 0.00 ?  247 ILE A H    4  
ATOM 6951  H HA   . ILE A 1 34  ? -4.282  8.702   0.182   1.00 0.00 ?  247 ILE A HA   4  
ATOM 6952  H HB   . ILE A 1 34  ? -2.878  8.665   2.809   1.00 0.00 ?  247 ILE A HB   4  
ATOM 6953  H HG12 . ILE A 1 34  ? -1.873  8.597   -0.051  1.00 0.00 ?  247 ILE A HG12 4  
ATOM 6954  H HG13 . ILE A 1 34  ? -2.132  10.061  0.877   1.00 0.00 ?  247 ILE A HG13 4  
ATOM 6955  H HG21 . ILE A 1 34  ? -3.271  6.356   2.689   1.00 0.00 ?  247 ILE A HG21 4  
ATOM 6956  H HG22 . ILE A 1 34  ? -3.069  6.319   0.921   1.00 0.00 ?  247 ILE A HG22 4  
ATOM 6957  H HG23 . ILE A 1 34  ? -1.657  6.579   1.973   1.00 0.00 ?  247 ILE A HG23 4  
ATOM 6958  H HD11 . ILE A 1 34  ? -0.020  7.951   1.200   1.00 0.00 ?  247 ILE A HD11 4  
ATOM 6959  H HD12 . ILE A 1 34  ? 0.105   9.719   1.367   1.00 0.00 ?  247 ILE A HD12 4  
ATOM 6960  H HD13 . ILE A 1 34  ? -0.609  8.749   2.678   1.00 0.00 ?  247 ILE A HD13 4  
ATOM 6961  N N    . VAL A 1 35  ? -5.709  7.416   2.868   1.00 0.00 ?  248 VAL A N    4  
ATOM 6962  C CA   . VAL A 1 35  ? -6.679  6.432   3.317   1.00 0.00 ?  248 VAL A CA   4  
ATOM 6963  C C    . VAL A 1 35  ? -8.052  6.771   2.732   1.00 0.00 ?  248 VAL A C    4  
ATOM 6964  O O    . VAL A 1 35  ? -8.863  5.880   2.486   1.00 0.00 ?  248 VAL A O    4  
ATOM 6965  C CB   . VAL A 1 35  ? -6.682  6.361   4.846   1.00 0.00 ?  248 VAL A CB   4  
ATOM 6966  C CG1  . VAL A 1 35  ? -7.165  7.679   5.455   1.00 0.00 ?  248 VAL A CG1  4  
ATOM 6967  C CG2  . VAL A 1 35  ? -7.529  5.186   5.338   1.00 0.00 ?  248 VAL A CG2  4  
ATOM 6968  H H    . VAL A 1 35  ? -5.315  7.983   3.591   1.00 0.00 ?  248 VAL A H    4  
ATOM 6969  H HA   . VAL A 1 35  ? -6.365  5.461   2.935   1.00 0.00 ?  248 VAL A HA   4  
ATOM 6970  H HB   . VAL A 1 35  ? -5.656  6.196   5.175   1.00 0.00 ?  248 VAL A HB   4  
ATOM 6971  H HG11 . VAL A 1 35  ? -8.254  7.712   5.432   1.00 0.00 ?  248 VAL A HG11 4  
ATOM 6972  H HG12 . VAL A 1 35  ? -6.821  7.750   6.487   1.00 0.00 ?  248 VAL A HG12 4  
ATOM 6973  H HG13 . VAL A 1 35  ? -6.764  8.514   4.880   1.00 0.00 ?  248 VAL A HG13 4  
ATOM 6974  H HG21 . VAL A 1 35  ? -7.063  4.249   5.034   1.00 0.00 ?  248 VAL A HG21 4  
ATOM 6975  H HG22 . VAL A 1 35  ? -7.601  5.220   6.425   1.00 0.00 ?  248 VAL A HG22 4  
ATOM 6976  H HG23 . VAL A 1 35  ? -8.528  5.252   4.906   1.00 0.00 ?  248 VAL A HG23 4  
ATOM 6977  N N    . ARG A 1 36  ? -8.269  8.062   2.526   1.00 0.00 ?  249 ARG A N    4  
ATOM 6978  C CA   . ARG A 1 36  ? -9.529  8.530   1.974   1.00 0.00 ?  249 ARG A CA   4  
ATOM 6979  C C    . ARG A 1 36  ? -9.646  8.128   0.503   1.00 0.00 ?  249 ARG A C    4  
ATOM 6980  O O    . ARG A 1 36  ? -10.749 7.937   -0.007  1.00 0.00 ?  249 ARG A O    4  
ATOM 6981  C CB   . ARG A 1 36  ? -9.652  10.050  2.093   1.00 0.00 ?  249 ARG A CB   4  
ATOM 6982  C CG   . ARG A 1 36  ? -10.138 10.455  3.486   1.00 0.00 ?  249 ARG A CG   4  
ATOM 6983  C CD   . ARG A 1 36  ? -11.654 10.663  3.498   1.00 0.00 ?  249 ARG A CD   4  
ATOM 6984  N NE   . ARG A 1 36  ? -11.977 12.055  3.115   1.00 0.00 ?  249 ARG A NE   4  
ATOM 6985  C CZ   . ARG A 1 36  ? -13.223 12.536  3.013   1.00 0.00 ?  249 ARG A CZ   4  
ATOM 6986  N NH1  . ARG A 1 36  ? -14.271 11.740  3.265   1.00 0.00 ?  249 ARG A NH1  4  
ATOM 6987  N NH2  . ARG A 1 36  ? -13.422 13.813  2.659   1.00 0.00 1  249 ARG A NH2  4  
ATOM 6988  H H    . ARG A 1 36  ? -7.604  8.781   2.730   1.00 0.00 ?  249 ARG A H    4  
ATOM 6989  H HA   . ARG A 1 36  ? -10.296 8.041   2.576   1.00 0.00 ?  249 ARG A HA   4  
ATOM 6990  H HB2  . ARG A 1 36  ? -8.685  10.513  1.892   1.00 0.00 ?  249 ARG A HB2  4  
ATOM 6991  H HB3  . ARG A 1 36  ? -10.346 10.422  1.339   1.00 0.00 ?  249 ARG A HB3  4  
ATOM 6992  H HG2  . ARG A 1 36  ? -9.867  9.684   4.207   1.00 0.00 ?  249 ARG A HG2  4  
ATOM 6993  H HG3  . ARG A 1 36  ? -9.639  11.372  3.797   1.00 0.00 ?  249 ARG A HG3  4  
ATOM 6994  H HD2  . ARG A 1 36  ? -12.130 9.967   2.808   1.00 0.00 ?  249 ARG A HD2  4  
ATOM 6995  H HD3  . ARG A 1 36  ? -12.050 10.448  4.491   1.00 0.00 ?  249 ARG A HD3  4  
ATOM 6996  H HE   . ARG A 1 36  ? -11.217 12.676  2.921   1.00 0.00 ?  249 ARG A HE   4  
ATOM 6997  H HH11 . ARG A 1 36  ? -14.124 10.787  3.529   1.00 0.00 ?  249 ARG A HH11 4  
ATOM 6998  H HH12 . ARG A 1 36  ? -15.202 12.099  3.188   1.00 0.00 ?  249 ARG A HH12 4  
ATOM 6999  H HH21 . ARG A 1 36  ? -12.639 14.407  2.471   1.00 0.00 ?  249 ARG A HH21 4  
ATOM 7000  H HH22 . ARG A 1 36  ? -14.352 14.172  2.583   1.00 0.00 ?  249 ARG A HH22 4  
ATOM 7001  N N    . ALA A 1 37  ? -8.493  8.013   -0.139  1.00 0.00 ?  250 ALA A N    4  
ATOM 7002  C CA   . ALA A 1 37  ? -8.451  7.638   -1.542  1.00 0.00 ?  250 ALA A CA   4  
ATOM 7003  C C    . ALA A 1 37  ? -8.446  6.112   -1.658  1.00 0.00 ?  250 ALA A C    4  
ATOM 7004  O O    . ALA A 1 37  ? -8.797  5.564   -2.702  1.00 0.00 ?  250 ALA A O    4  
ATOM 7005  C CB   . ALA A 1 37  ? -7.230  8.277   -2.206  1.00 0.00 ?  250 ALA A CB   4  
ATOM 7006  H H    . ALA A 1 37  ? -7.600  8.171   0.282   1.00 0.00 ?  250 ALA A H    4  
ATOM 7007  H HA   . ALA A 1 37  ? -9.353  8.027   -2.017  1.00 0.00 ?  250 ALA A HA   4  
ATOM 7008  H HB1  . ALA A 1 37  ? -6.508  8.561   -1.441  1.00 0.00 ?  250 ALA A HB1  4  
ATOM 7009  H HB2  . ALA A 1 37  ? -6.773  7.562   -2.890  1.00 0.00 ?  250 ALA A HB2  4  
ATOM 7010  H HB3  . ALA A 1 37  ? -7.540  9.163   -2.760  1.00 0.00 ?  250 ALA A HB3  4  
ATOM 7011  N N    . LEU A 1 38  ? -8.046  5.470   -0.571  1.00 0.00 ?  251 LEU A N    4  
ATOM 7012  C CA   . LEU A 1 38  ? -7.990  4.018   -0.537  1.00 0.00 ?  251 LEU A CA   4  
ATOM 7013  C C    . LEU A 1 38  ? -9.358  3.451   -0.923  1.00 0.00 ?  251 LEU A C    4  
ATOM 7014  O O    . LEU A 1 38  ? -10.390 4.031   -0.592  1.00 0.00 ?  251 LEU A O    4  
ATOM 7015  C CB   . LEU A 1 38  ? -7.485  3.532   0.822   1.00 0.00 ?  251 LEU A CB   4  
ATOM 7016  C CG   . LEU A 1 38  ? -6.000  3.171   0.896   1.00 0.00 ?  251 LEU A CG   4  
ATOM 7017  C CD1  . LEU A 1 38  ? -5.466  3.331   2.321   1.00 0.00 ?  251 LEU A CD1  4  
ATOM 7018  C CD2  . LEU A 1 38  ? -5.750  1.765   0.345   1.00 0.00 ?  251 LEU A CD2  4  
ATOM 7019  H H    . LEU A 1 38  ? -7.762  5.923   0.274   1.00 0.00 ?  251 LEU A H    4  
ATOM 7020  H HA   . LEU A 1 38  ? -7.262  3.701   -1.284  1.00 0.00 ?  251 LEU A HA   4  
ATOM 7021  H HB2  . LEU A 1 38  ? -7.686  4.308   1.561   1.00 0.00 ?  251 LEU A HB2  4  
ATOM 7022  H HB3  . LEU A 1 38  ? -8.066  2.658   1.113   1.00 0.00 ?  251 LEU A HB3  4  
ATOM 7023  H HG   . LEU A 1 38  ? -5.447  3.866   0.265   1.00 0.00 ?  251 LEU A HG   4  
ATOM 7024  H HD11 . LEU A 1 38  ? -4.852  4.230   2.379   1.00 0.00 ?  251 LEU A HD11 4  
ATOM 7025  H HD12 . LEU A 1 38  ? -6.302  3.416   3.014   1.00 0.00 ?  251 LEU A HD12 4  
ATOM 7026  H HD13 . LEU A 1 38  ? -4.863  2.461   2.583   1.00 0.00 ?  251 LEU A HD13 4  
ATOM 7027  H HD21 . LEU A 1 38  ? -6.133  1.701   -0.674  1.00 0.00 ?  251 LEU A HD21 4  
ATOM 7028  H HD22 . LEU A 1 38  ? -4.680  1.560   0.344   1.00 0.00 ?  251 LEU A HD22 4  
ATOM 7029  H HD23 . LEU A 1 38  ? -6.260  1.033   0.972   1.00 0.00 ?  251 LEU A HD23 4  
ATOM 7030  N N    . ARG A 1 39  ? -9.321  2.323   -1.618  1.00 0.00 ?  252 ARG A N    4  
ATOM 7031  C CA   . ARG A 1 39  ? -10.544 1.671   -2.053  1.00 0.00 ?  252 ARG A CA   4  
ATOM 7032  C C    . ARG A 1 39  ? -10.673 0.294   -1.399  1.00 0.00 ?  252 ARG A C    4  
ATOM 7033  O O    . ARG A 1 39  ? -9.773  -0.536  -1.510  1.00 0.00 ?  252 ARG A O    4  
ATOM 7034  C CB   . ARG A 1 39  ? -10.573 1.511   -3.574  1.00 0.00 ?  252 ARG A CB   4  
ATOM 7035  C CG   . ARG A 1 39  ? -11.913 1.973   -4.149  1.00 0.00 ?  252 ARG A CG   4  
ATOM 7036  C CD   . ARG A 1 39  ? -12.877 0.795   -4.308  1.00 0.00 ?  252 ARG A CD   4  
ATOM 7037  N NE   . ARG A 1 39  ? -14.049 0.978   -3.424  1.00 0.00 ?  252 ARG A NE   4  
ATOM 7038  C CZ   . ARG A 1 39  ? -15.057 0.100   -3.321  1.00 0.00 ?  252 ARG A CZ   4  
ATOM 7039  N NH1  . ARG A 1 39  ? -15.041 -1.026  -4.047  1.00 0.00 ?  252 ARG A NH1  4  
ATOM 7040  N NH2  . ARG A 1 39  ? -16.080 0.348   -2.493  1.00 0.00 1  252 ARG A NH2  4  
ATOM 7041  H H    . ARG A 1 39  ? -8.477  1.858   -1.883  1.00 0.00 ?  252 ARG A H    4  
ATOM 7042  H HA   . ARG A 1 39  ? -11.345 2.336   -1.728  1.00 0.00 ?  252 ARG A HA   4  
ATOM 7043  H HB2  . ARG A 1 39  ? -9.763  2.089   -4.019  1.00 0.00 ?  252 ARG A HB2  4  
ATOM 7044  H HB3  . ARG A 1 39  ? -10.401 0.467   -3.836  1.00 0.00 ?  252 ARG A HB3  4  
ATOM 7045  H HG2  . ARG A 1 39  ? -12.355 2.723   -3.493  1.00 0.00 ?  252 ARG A HG2  4  
ATOM 7046  H HG3  . ARG A 1 39  ? -11.753 2.449   -5.116  1.00 0.00 ?  252 ARG A HG3  4  
ATOM 7047  H HD2  . ARG A 1 39  ? -13.202 0.718   -5.345  1.00 0.00 ?  252 ARG A HD2  4  
ATOM 7048  H HD3  . ARG A 1 39  ? -12.368 -0.137  -4.063  1.00 0.00 ?  252 ARG A HD3  4  
ATOM 7049  H HE   . ARG A 1 39  ? -14.093 1.808   -2.868  1.00 0.00 ?  252 ARG A HE   4  
ATOM 7050  H HH11 . ARG A 1 39  ? -14.277 -1.212  -4.665  1.00 0.00 ?  252 ARG A HH11 4  
ATOM 7051  H HH12 . ARG A 1 39  ? -15.793 -1.681  -3.971  1.00 0.00 ?  252 ARG A HH12 4  
ATOM 7052  H HH21 . ARG A 1 39  ? -16.092 1.189   -1.951  1.00 0.00 ?  252 ARG A HH21 4  
ATOM 7053  H HH22 . ARG A 1 39  ? -16.832 -0.306  -2.416  1.00 0.00 ?  252 ARG A HH22 4  
ATOM 7054  N N    . ALA A 1 40  ? -11.800 0.094   -0.731  1.00 0.00 ?  253 ALA A N    4  
ATOM 7055  C CA   . ALA A 1 40  ? -12.057 -1.168  -0.059  1.00 0.00 ?  253 ALA A CA   4  
ATOM 7056  C C    . ALA A 1 40  ? -12.581 -2.184  -1.076  1.00 0.00 ?  253 ALA A C    4  
ATOM 7057  O O    . ALA A 1 40  ? -13.574 -1.933  -1.755  1.00 0.00 ?  253 ALA A O    4  
ATOM 7058  C CB   . ALA A 1 40  ? -13.036 -0.942  1.095   1.00 0.00 ?  253 ALA A CB   4  
ATOM 7059  H H    . ALA A 1 40  ? -12.527 0.775   -0.644  1.00 0.00 ?  253 ALA A H    4  
ATOM 7060  H HA   . ALA A 1 40  ? -11.112 -1.527  0.348   1.00 0.00 ?  253 ALA A HA   4  
ATOM 7061  H HB1  . ALA A 1 40  ? -12.677 -1.462  1.983   1.00 0.00 ?  253 ALA A HB1  4  
ATOM 7062  H HB2  . ALA A 1 40  ? -13.111 0.125   1.304   1.00 0.00 ?  253 ALA A HB2  4  
ATOM 7063  H HB3  . ALA A 1 40  ? -14.018 -1.328  0.820   1.00 0.00 ?  253 ALA A HB3  4  
ATOM 7064  N N    . ARG A 1 41  ? -11.887 -3.311  -1.148  1.00 0.00 ?  254 ARG A N    4  
ATOM 7065  C CA   . ARG A 1 41  ? -12.269 -4.367  -2.071  1.00 0.00 ?  254 ARG A CA   4  
ATOM 7066  C C    . ARG A 1 41  ? -12.306 -5.715  -1.349  1.00 0.00 ?  254 ARG A C    4  
ATOM 7067  O O    . ARG A 1 41  ? -11.411 -6.029  -0.566  1.00 0.00 ?  254 ARG A O    4  
ATOM 7068  C CB   . ARG A 1 41  ? -11.293 -4.452  -3.246  1.00 0.00 ?  254 ARG A CB   4  
ATOM 7069  C CG   . ARG A 1 41  ? -10.001 -5.160  -2.835  1.00 0.00 ?  254 ARG A CG   4  
ATOM 7070  C CD   . ARG A 1 41  ? -8.959  -5.095  -3.954  1.00 0.00 ?  254 ARG A CD   4  
ATOM 7071  N NE   . ARG A 1 41  ? -8.603  -6.462  -4.394  1.00 0.00 ?  254 ARG A NE   4  
ATOM 7072  C CZ   . ARG A 1 41  ? -9.300  -7.166  -5.296  1.00 0.00 ?  254 ARG A CZ   4  
ATOM 7073  N NH1  . ARG A 1 41  ? -10.395 -6.636  -5.859  1.00 0.00 ?  254 ARG A NH1  4  
ATOM 7074  N NH2  . ARG A 1 41  ? -8.903  -8.400  -5.636  1.00 0.00 1  254 ARG A NH2  4  
ATOM 7075  H H    . ARG A 1 41  ? -11.080 -3.508  -0.592  1.00 0.00 ?  254 ARG A H    4  
ATOM 7076  H HA   . ARG A 1 41  ? -13.261 -4.083  -2.424  1.00 0.00 ?  254 ARG A HA   4  
ATOM 7077  H HB2  . ARG A 1 41  ? -11.758 -4.987  -4.073  1.00 0.00 ?  254 ARG A HB2  4  
ATOM 7078  H HB3  . ARG A 1 41  ? -11.063 -3.449  -3.605  1.00 0.00 ?  254 ARG A HB3  4  
ATOM 7079  H HG2  . ARG A 1 41  ? -9.600  -4.699  -1.932  1.00 0.00 ?  254 ARG A HG2  4  
ATOM 7080  H HG3  . ARG A 1 41  ? -10.214 -6.201  -2.592  1.00 0.00 ?  254 ARG A HG3  4  
ATOM 7081  H HD2  . ARG A 1 41  ? -9.353  -4.524  -4.795  1.00 0.00 ?  254 ARG A HD2  4  
ATOM 7082  H HD3  . ARG A 1 41  ? -8.069  -4.573  -3.603  1.00 0.00 ?  254 ARG A HD3  4  
ATOM 7083  H HE   . ARG A 1 41  ? -7.791  -6.887  -3.994  1.00 0.00 ?  254 ARG A HE   4  
ATOM 7084  H HH11 . ARG A 1 41  ? -10.692 -5.716  -5.605  1.00 0.00 ?  254 ARG A HH11 4  
ATOM 7085  H HH12 . ARG A 1 41  ? -10.916 -7.162  -6.532  1.00 0.00 ?  254 ARG A HH12 4  
ATOM 7086  H HH21 . ARG A 1 41  ? -8.086  -8.795  -5.216  1.00 0.00 ?  254 ARG A HH21 4  
ATOM 7087  H HH22 . ARG A 1 41  ? -9.423  -8.925  -6.309  1.00 0.00 ?  254 ARG A HH22 4  
ATOM 7088  N N    . THR A 1 42  ? -13.351 -6.477  -1.639  1.00 0.00 ?  255 THR A N    4  
ATOM 7089  C CA   . THR A 1 42  ? -13.516 -7.785  -1.027  1.00 0.00 ?  255 THR A CA   4  
ATOM 7090  C C    . THR A 1 42  ? -12.933 -8.873  -1.930  1.00 0.00 ?  255 THR A C    4  
ATOM 7091  O O    . THR A 1 42  ? -13.304 -8.981  -3.098  1.00 0.00 ?  255 THR A O    4  
ATOM 7092  C CB   . THR A 1 42  ? -15.002 -7.980  -0.723  1.00 0.00 ?  255 THR A CB   4  
ATOM 7093  O OG1  . THR A 1 42  ? -15.343 -6.853  0.080   1.00 0.00 ?  255 THR A OG1  4  
ATOM 7094  C CG2  . THR A 1 42  ? -15.260 -9.180  0.191   1.00 0.00 ?  255 THR A CG2  4  
ATOM 7095  H H    . THR A 1 42  ? -14.074 -6.215  -2.278  1.00 0.00 ?  255 THR A H    4  
ATOM 7096  H HA   . THR A 1 42  ? -12.948 -7.803  -0.097  1.00 0.00 ?  255 THR A HA   4  
ATOM 7097  H HB   . THR A 1 42  ? -15.581 -8.059  -1.643  1.00 0.00 ?  255 THR A HB   4  
ATOM 7098  H HG1  . THR A 1 42  ? -14.714 -6.782  0.854   1.00 0.00 ?  255 THR A HG1  4  
ATOM 7099  H HG21 . THR A 1 42  ? -15.200 -10.099 -0.391  1.00 0.00 ?  255 THR A HG21 4  
ATOM 7100  H HG22 . THR A 1 42  ? -14.511 -9.201  0.983   1.00 0.00 ?  255 THR A HG22 4  
ATOM 7101  H HG23 . THR A 1 42  ? -16.253 -9.093  0.633   1.00 0.00 ?  255 THR A HG23 4  
ATOM 7102  N N    . VAL A 1 43  ? -12.029 -9.653  -1.355  1.00 0.00 ?  256 VAL A N    4  
ATOM 7103  C CA   . VAL A 1 43  ? -11.391 -10.730 -2.094  1.00 0.00 ?  256 VAL A CA   4  
ATOM 7104  C C    . VAL A 1 43  ? -11.948 -12.072 -1.614  1.00 0.00 ?  256 VAL A C    4  
ATOM 7105  O O    . VAL A 1 43  ? -11.735 -12.463 -0.468  1.00 0.00 ?  256 VAL A O    4  
ATOM 7106  C CB   . VAL A 1 43  ? -9.870  -10.630 -1.955  1.00 0.00 ?  256 VAL A CB   4  
ATOM 7107  C CG1  . VAL A 1 43  ? -9.171  -11.688 -2.811  1.00 0.00 ?  256 VAL A CG1  4  
ATOM 7108  C CG2  . VAL A 1 43  ? -9.379  -9.225  -2.309  1.00 0.00 ?  256 VAL A CG2  4  
ATOM 7109  H H    . VAL A 1 43  ? -11.733 -9.559  -0.405  1.00 0.00 ?  256 VAL A H    4  
ATOM 7110  H HA   . VAL A 1 43  ? -11.643 -10.601 -3.146  1.00 0.00 ?  256 VAL A HA   4  
ATOM 7111  H HB   . VAL A 1 43  ? -9.616  -10.821 -0.912  1.00 0.00 ?  256 VAL A HB   4  
ATOM 7112  H HG11 . VAL A 1 43  ? -8.091  -11.592 -2.697  1.00 0.00 ?  256 VAL A HG11 4  
ATOM 7113  H HG12 . VAL A 1 43  ? -9.484  -12.681 -2.489  1.00 0.00 ?  256 VAL A HG12 4  
ATOM 7114  H HG13 . VAL A 1 43  ? -9.440  -11.544 -3.858  1.00 0.00 ?  256 VAL A HG13 4  
ATOM 7115  H HG21 . VAL A 1 43  ? -8.296  -9.179  -2.191  1.00 0.00 ?  256 VAL A HG21 4  
ATOM 7116  H HG22 . VAL A 1 43  ? -9.642  -8.997  -3.342  1.00 0.00 ?  256 VAL A HG22 4  
ATOM 7117  H HG23 . VAL A 1 43  ? -9.847  -8.498  -1.645  1.00 0.00 ?  256 VAL A HG23 4  
ATOM 7118  N N    . PRO A 1 44  ? -12.670 -12.758 -2.540  1.00 0.00 ?  257 PRO A N    4  
ATOM 7119  C CA   . PRO A 1 44  ? -13.260 -14.048 -2.223  1.00 0.00 ?  257 PRO A CA   4  
ATOM 7120  C C    . PRO A 1 44  ? -12.194 -15.145 -2.191  1.00 0.00 ?  257 PRO A C    4  
ATOM 7121  O O    . PRO A 1 44  ? -11.126 -14.996 -2.784  1.00 0.00 ?  257 PRO A O    4  
ATOM 7122  C CB   . PRO A 1 44  ? -14.312 -14.274 -3.297  1.00 0.00 ?  257 PRO A CB   4  
ATOM 7123  C CG   . PRO A 1 44  ? -13.956 -13.330 -4.434  1.00 0.00 ?  257 PRO A CG   4  
ATOM 7124  C CD   . PRO A 1 44  ? -12.944 -12.326 -3.907  1.00 0.00 ?  257 PRO A CD   4  
ATOM 7125  H HA   . PRO A 1 44  ? -13.662 -14.030 -1.308  1.00 0.00 ?  257 PRO A HA   4  
ATOM 7126  H HB2  . PRO A 1 44  ? -14.310 -15.310 -3.634  1.00 0.00 ?  257 PRO A HB2  4  
ATOM 7127  H HB3  . PRO A 1 44  ? -15.311 -14.065 -2.914  1.00 0.00 ?  257 PRO A HB3  4  
ATOM 7128  H HG2  . PRO A 1 44  ? -13.541 -13.885 -5.275  1.00 0.00 ?  257 PRO A HG2  4  
ATOM 7129  H HG3  . PRO A 1 44  ? -14.847 -12.818 -4.798  1.00 0.00 ?  257 PRO A HG3  4  
ATOM 7130  H HD2  . PRO A 1 44  ? -12.036 -12.325 -4.511  1.00 0.00 ?  257 PRO A HD2  4  
ATOM 7131  H HD3  . PRO A 1 44  ? -13.343 -11.312 -3.930  1.00 0.00 ?  257 PRO A HD3  4  
ATOM 7132  N N    . ALA A 1 45  ? -12.520 -16.222 -1.492  1.00 0.00 ?  258 ALA A N    4  
ATOM 7133  C CA   . ALA A 1 45  ? -11.604 -17.344 -1.375  1.00 0.00 ?  258 ALA A CA   4  
ATOM 7134  C C    . ALA A 1 45  ? -11.261 -17.865 -2.772  1.00 0.00 ?  258 ALA A C    4  
ATOM 7135  O O    . ALA A 1 45  ? -12.154 -18.193 -3.552  1.00 0.00 ?  258 ALA A O    4  
ATOM 7136  C CB   . ALA A 1 45  ? -12.228 -18.422 -0.487  1.00 0.00 ?  258 ALA A CB   4  
ATOM 7137  H H    . ALA A 1 45  ? -13.390 -16.335 -1.013  1.00 0.00 ?  258 ALA A H    4  
ATOM 7138  H HA   . ALA A 1 45  ? -10.694 -16.980 -0.898  1.00 0.00 ?  258 ALA A HA   4  
ATOM 7139  H HB1  . ALA A 1 45  ? -13.006 -18.945 -1.043  1.00 0.00 ?  258 ALA A HB1  4  
ATOM 7140  H HB2  . ALA A 1 45  ? -11.459 -19.133 -0.183  1.00 0.00 ?  258 ALA A HB2  4  
ATOM 7141  H HB3  . ALA A 1 45  ? -12.663 -17.957 0.398   1.00 0.00 ?  258 ALA A HB3  4  
ATOM 7142  N N    . GLY A 1 46  ? -9.966  -17.926 -3.045  1.00 0.00 ?  259 GLY A N    4  
ATOM 7143  C CA   . GLY A 1 46  ? -9.495  -18.402 -4.334  1.00 0.00 ?  259 GLY A CA   4  
ATOM 7144  C C    . GLY A 1 46  ? -9.091  -17.233 -5.236  1.00 0.00 ?  259 GLY A C    4  
ATOM 7145  O O    . GLY A 1 46  ? -8.284  -17.400 -6.149  1.00 0.00 ?  259 GLY A O    4  
ATOM 7146  H H    . GLY A 1 46  ? -9.247  -17.657 -2.405  1.00 0.00 ?  259 GLY A H    4  
ATOM 7147  H HA2  . GLY A 1 46  ? -8.643  -19.067 -4.191  1.00 0.00 ?  259 GLY A HA2  4  
ATOM 7148  H HA3  . GLY A 1 46  ? -10.277 -18.986 -4.819  1.00 0.00 ?  259 GLY A HA3  4  
ATOM 7149  N N    . ALA A 1 47  ? -9.670  -16.077 -4.947  1.00 0.00 ?  260 ALA A N    4  
ATOM 7150  C CA   . ALA A 1 47  ? -9.381  -14.882 -5.721  1.00 0.00 ?  260 ALA A CA   4  
ATOM 7151  C C    . ALA A 1 47  ? -7.892  -14.549 -5.600  1.00 0.00 ?  260 ALA A C    4  
ATOM 7152  O O    . ALA A 1 47  ? -7.278  -14.801 -4.564  1.00 0.00 ?  260 ALA A O    4  
ATOM 7153  C CB   . ALA A 1 47  ? -10.275 -13.736 -5.243  1.00 0.00 ?  260 ALA A CB   4  
ATOM 7154  H H    . ALA A 1 47  ? -10.325 -15.950 -4.203  1.00 0.00 ?  260 ALA A H    4  
ATOM 7155  H HA   . ALA A 1 47  ? -9.613  -15.097 -6.764  1.00 0.00 ?  260 ALA A HA   4  
ATOM 7156  H HB1  . ALA A 1 47  ? -11.321 -14.009 -5.381  1.00 0.00 ?  260 ALA A HB1  4  
ATOM 7157  H HB2  . ALA A 1 47  ? -10.086 -13.543 -4.187  1.00 0.00 ?  260 ALA A HB2  4  
ATOM 7158  H HB3  . ALA A 1 47  ? -10.055 -12.838 -5.821  1.00 0.00 ?  260 ALA A HB3  4  
ATOM 7159  N N    . VAL A 1 48  ? -7.355  -13.988 -6.673  1.00 0.00 ?  261 VAL A N    4  
ATOM 7160  C CA   . VAL A 1 48  ? -5.950  -13.619 -6.700  1.00 0.00 ?  261 VAL A CA   4  
ATOM 7161  C C    . VAL A 1 48  ? -5.811  -12.133 -6.364  1.00 0.00 ?  261 VAL A C    4  
ATOM 7162  O O    . VAL A 1 48  ? -6.512  -11.296 -6.932  1.00 0.00 ?  261 VAL A O    4  
ATOM 7163  C CB   . VAL A 1 48  ? -5.338  -13.985 -8.054  1.00 0.00 ?  261 VAL A CB   4  
ATOM 7164  C CG1  . VAL A 1 48  ? -4.091  -13.145 -8.338  1.00 0.00 ?  261 VAL A CG1  4  
ATOM 7165  C CG2  . VAL A 1 48  ? -5.020  -15.480 -8.125  1.00 0.00 ?  261 VAL A CG2  4  
ATOM 7166  H H    . VAL A 1 48  ? -7.861  -13.787 -7.511  1.00 0.00 ?  261 VAL A H    4  
ATOM 7167  H HA   . VAL A 1 48  ? -5.442  -14.201 -5.932  1.00 0.00 ?  261 VAL A HA   4  
ATOM 7168  H HB   . VAL A 1 48  ? -6.075  -13.763 -8.826  1.00 0.00 ?  261 VAL A HB   4  
ATOM 7169  H HG11 . VAL A 1 48  ? -3.375  -13.739 -8.905  1.00 0.00 ?  261 VAL A HG11 4  
ATOM 7170  H HG12 . VAL A 1 48  ? -4.371  -12.264 -8.915  1.00 0.00 ?  261 VAL A HG12 4  
ATOM 7171  H HG13 . VAL A 1 48  ? -3.641  -12.834 -7.396  1.00 0.00 ?  261 VAL A HG13 4  
ATOM 7172  H HG21 . VAL A 1 48  ? -5.751  -15.977 -8.762  1.00 0.00 ?  261 VAL A HG21 4  
ATOM 7173  H HG22 . VAL A 1 48  ? -4.022  -15.620 -8.540  1.00 0.00 ?  261 VAL A HG22 4  
ATOM 7174  H HG23 . VAL A 1 48  ? -5.060  -15.908 -7.124  1.00 0.00 ?  261 VAL A HG23 4  
ATOM 7175  N N    . ILE A 1 49  ? -4.903  -11.849 -5.442  1.00 0.00 ?  262 ILE A N    4  
ATOM 7176  C CA   . ILE A 1 49  ? -4.663  -10.478 -5.024  1.00 0.00 ?  262 ILE A CA   4  
ATOM 7177  C C    . ILE A 1 49  ? -3.706  -9.808  -6.011  1.00 0.00 ?  262 ILE A C    4  
ATOM 7178  O O    . ILE A 1 49  ? -3.960  -8.695  -6.470  1.00 0.00 ?  262 ILE A O    4  
ATOM 7179  C CB   . ILE A 1 49  ? -4.179  -10.438 -3.574  1.00 0.00 ?  262 ILE A CB   4  
ATOM 7180  C CG1  . ILE A 1 49  ? -5.221  -11.041 -2.630  1.00 0.00 ?  262 ILE A CG1  4  
ATOM 7181  C CG2  . ILE A 1 49  ? -3.790  -9.016  -3.165  1.00 0.00 ?  262 ILE A CG2  4  
ATOM 7182  C CD1  . ILE A 1 49  ? -4.676  -11.144 -1.204  1.00 0.00 ?  262 ILE A CD1  4  
ATOM 7183  H H    . ILE A 1 49  ? -4.337  -12.535 -4.985  1.00 0.00 ?  262 ILE A H    4  
ATOM 7184  H HA   . ILE A 1 49  ? -5.619  -9.954  -5.059  1.00 0.00 ?  262 ILE A HA   4  
ATOM 7185  H HB   . ILE A 1 49  ? -3.281  -11.051 -3.496  1.00 0.00 ?  262 ILE A HB   4  
ATOM 7186  H HG12 . ILE A 1 49  ? -6.121  -10.426 -2.635  1.00 0.00 ?  262 ILE A HG12 4  
ATOM 7187  H HG13 . ILE A 1 49  ? -5.510  -12.030 -2.985  1.00 0.00 ?  262 ILE A HG13 4  
ATOM 7188  H HG21 . ILE A 1 49  ? -4.466  -8.665  -2.385  1.00 0.00 ?  262 ILE A HG21 4  
ATOM 7189  H HG22 . ILE A 1 49  ? -2.767  -9.012  -2.788  1.00 0.00 ?  262 ILE A HG22 4  
ATOM 7190  H HG23 . ILE A 1 49  ? -3.861  -8.357  -4.030  1.00 0.00 ?  262 ILE A HG23 4  
ATOM 7191  H HD11 . ILE A 1 49  ? -5.506  -11.168 -0.498  1.00 0.00 ?  262 ILE A HD11 4  
ATOM 7192  H HD12 . ILE A 1 49  ? -4.088  -12.057 -1.105  1.00 0.00 ?  262 ILE A HD12 4  
ATOM 7193  H HD13 . ILE A 1 49  ? -4.044  -10.281 -0.994  1.00 0.00 ?  262 ILE A HD13 4  
ATOM 7194  N N    . CYS A 1 50  ? -2.625  -10.514 -6.310  1.00 0.00 ?  263 CYS A N    4  
ATOM 7195  C CA   . CYS A 1 50  ? -1.628  -10.001 -7.234  1.00 0.00 ?  263 CYS A CA   4  
ATOM 7196  C C    . CYS A 1 50  ? -0.907  -11.191 -7.872  1.00 0.00 ?  263 CYS A C    4  
ATOM 7197  O O    . CYS A 1 50  ? -0.702  -12.216 -7.224  1.00 0.00 ?  263 CYS A O    4  
ATOM 7198  C CB   . CYS A 1 50  ? -0.653  -9.047  -6.542  1.00 0.00 ?  263 CYS A CB   4  
ATOM 7199  S SG   . CYS A 1 50  ? 0.531   -9.995  -5.519  1.00 0.00 ?  263 CYS A SG   4  
ATOM 7200  H H    . CYS A 1 50  ? -2.426  -11.418 -5.933  1.00 0.00 ?  263 CYS A H    4  
ATOM 7201  H HA   . CYS A 1 50  ? -2.166  -9.426  -7.988  1.00 0.00 ?  263 CYS A HA   4  
ATOM 7202  H HB2  . CYS A 1 50  ? -0.115  -8.460  -7.287  1.00 0.00 ?  263 CYS A HB2  4  
ATOM 7203  H HB3  . CYS A 1 50  ? -1.202  -8.342  -5.918  1.00 0.00 ?  263 CYS A HB3  4  
ATOM 7204  H HG   . CYS A 1 50  ? 1.541   -9.934  -6.383  1.00 0.00 ?  263 CYS A HG   4  
ATOM 7205  N N    . ARG A 1 51  ? -0.542  -11.014 -9.133  1.00 0.00 ?  264 ARG A N    4  
ATOM 7206  C CA   . ARG A 1 51  ? 0.152   -12.060 -9.865  1.00 0.00 ?  264 ARG A CA   4  
ATOM 7207  C C    . ARG A 1 51  ? 1.665   -11.924 -9.678  1.00 0.00 ?  264 ARG A C    4  
ATOM 7208  O O    . ARG A 1 51  ? 2.131   -11.010 -9.000  1.00 0.00 ?  264 ARG A O    4  
ATOM 7209  C CB   . ARG A 1 51  ? -0.177  -11.999 -11.357 1.00 0.00 ?  264 ARG A CB   4  
ATOM 7210  C CG   . ARG A 1 51  ? -1.556  -12.601 -11.639 1.00 0.00 ?  264 ARG A CG   4  
ATOM 7211  C CD   . ARG A 1 51  ? -1.438  -14.066 -12.064 1.00 0.00 ?  264 ARG A CD   4  
ATOM 7212  N NE   . ARG A 1 51  ? -2.428  -14.367 -13.122 1.00 0.00 ?  264 ARG A NE   4  
ATOM 7213  C CZ   . ARG A 1 51  ? -2.520  -15.547 -13.752 1.00 0.00 ?  264 ARG A CZ   4  
ATOM 7214  N NH1  . ARG A 1 51  ? -1.681  -16.542 -13.434 1.00 0.00 ?  264 ARG A NH1  4  
ATOM 7215  N NH2  . ARG A 1 51  ? -3.450  -15.730 -14.699 1.00 0.00 1  264 ARG A NH2  4  
ATOM 7216  H H    . ARG A 1 51  ? -0.712  -10.176 -9.652  1.00 0.00 ?  264 ARG A H    4  
ATOM 7217  H HA   . ARG A 1 51  ? -0.214  -12.991 -9.434  1.00 0.00 ?  264 ARG A HA   4  
ATOM 7218  H HB2  . ARG A 1 51  ? -0.152  -10.964 -11.697 1.00 0.00 ?  264 ARG A HB2  4  
ATOM 7219  H HB3  . ARG A 1 51  ? 0.582   -12.539 -11.923 1.00 0.00 ?  264 ARG A HB3  4  
ATOM 7220  H HG2  . ARG A 1 51  ? -2.178  -12.526 -10.748 1.00 0.00 ?  264 ARG A HG2  4  
ATOM 7221  H HG3  . ARG A 1 51  ? -2.052  -12.030 -12.424 1.00 0.00 ?  264 ARG A HG3  4  
ATOM 7222  H HD2  . ARG A 1 51  ? -0.431  -14.267 -12.430 1.00 0.00 ?  264 ARG A HD2  4  
ATOM 7223  H HD3  . ARG A 1 51  ? -1.601  -14.717 -11.205 1.00 0.00 ?  264 ARG A HD3  4  
ATOM 7224  H HE   . ARG A 1 51  ? -3.069  -13.646 -13.383 1.00 0.00 ?  264 ARG A HE   4  
ATOM 7225  H HH11 . ARG A 1 51  ? -0.987  -16.405 -12.727 1.00 0.00 ?  264 ARG A HH11 4  
ATOM 7226  H HH12 . ARG A 1 51  ? -1.749  -17.422 -13.904 1.00 0.00 ?  264 ARG A HH12 4  
ATOM 7227  H HH21 . ARG A 1 51  ? -4.075  -14.987 -14.936 1.00 0.00 ?  264 ARG A HH21 4  
ATOM 7228  H HH22 . ARG A 1 51  ? -3.518  -16.610 -15.169 1.00 0.00 ?  264 ARG A HH22 4  
ATOM 7229  N N    . ILE A 1 52  ? 2.390   -12.848 -10.291 1.00 0.00 ?  265 ILE A N    4  
ATOM 7230  C CA   . ILE A 1 52  ? 3.840   -12.844 -10.200 1.00 0.00 ?  265 ILE A CA   4  
ATOM 7231  C C    . ILE A 1 52  ? 4.402   -11.778 -11.143 1.00 0.00 ?  265 ILE A C    4  
ATOM 7232  O O    . ILE A 1 52  ? 4.028   -11.720 -12.314 1.00 0.00 ?  265 ILE A O    4  
ATOM 7233  C CB   . ILE A 1 52  ? 4.397   -14.246 -10.455 1.00 0.00 ?  265 ILE A CB   4  
ATOM 7234  C CG1  . ILE A 1 52  ? 4.573   -14.502 -11.953 1.00 0.00 ?  265 ILE A CG1  4  
ATOM 7235  C CG2  . ILE A 1 52  ? 3.525   -15.312 -9.789  1.00 0.00 ?  265 ILE A CG2  4  
ATOM 7236  C CD1  . ILE A 1 52  ? 3.224   -14.477 -12.675 1.00 0.00 ?  265 ILE A CD1  4  
ATOM 7237  H H    . ILE A 1 52  ? 2.003   -13.589 -10.840 1.00 0.00 ?  265 ILE A H    4  
ATOM 7238  H HA   . ILE A 1 52  ? 4.103   -12.574 -9.178  1.00 0.00 ?  265 ILE A HA   4  
ATOM 7239  H HB   . ILE A 1 52  ? 5.386   -14.308 -10.000 1.00 0.00 ?  265 ILE A HB   4  
ATOM 7240  H HG12 . ILE A 1 52  ? 5.232   -13.747 -12.380 1.00 0.00 ?  265 ILE A HG12 4  
ATOM 7241  H HG13 . ILE A 1 52  ? 5.053   -15.468 -12.106 1.00 0.00 ?  265 ILE A HG13 4  
ATOM 7242  H HG21 . ILE A 1 52  ? 3.999   -16.288 -9.895  1.00 0.00 ?  265 ILE A HG21 4  
ATOM 7243  H HG22 . ILE A 1 52  ? 3.409   -15.078 -8.731  1.00 0.00 ?  265 ILE A HG22 4  
ATOM 7244  H HG23 . ILE A 1 52  ? 2.545   -15.330 -10.267 1.00 0.00 ?  265 ILE A HG23 4  
ATOM 7245  H HD11 . ILE A 1 52  ? 2.558   -15.215 -12.227 1.00 0.00 ?  265 ILE A HD11 4  
ATOM 7246  H HD12 . ILE A 1 52  ? 2.781   -13.486 -12.584 1.00 0.00 ?  265 ILE A HD12 4  
ATOM 7247  H HD13 . ILE A 1 52  ? 3.372   -14.713 -13.729 1.00 0.00 ?  265 ILE A HD13 4  
ATOM 7248  N N    . GLY A 1 53  ? 5.291   -10.961 -10.598 1.00 0.00 ?  266 GLY A N    4  
ATOM 7249  C CA   . GLY A 1 53  ? 5.908   -9.900  -11.376 1.00 0.00 ?  266 GLY A CA   4  
ATOM 7250  C C    . GLY A 1 53  ? 4.854   -8.931  -11.915 1.00 0.00 ?  266 GLY A C    4  
ATOM 7251  O O    . GLY A 1 53  ? 4.850   -8.611  -13.103 1.00 0.00 ?  266 GLY A O    4  
ATOM 7252  H H    . GLY A 1 53  ? 5.590   -11.014 -9.645  1.00 0.00 ?  266 GLY A H    4  
ATOM 7253  H HA2  . GLY A 1 53  ? 6.622   -9.358  -10.756 1.00 0.00 ?  266 GLY A HA2  4  
ATOM 7254  H HA3  . GLY A 1 53  ? 6.469   -10.332 -12.205 1.00 0.00 ?  266 GLY A HA3  4  
ATOM 7255  N N    . GLU A 1 54  ? 3.986   -8.491  -11.016 1.00 0.00 ?  267 GLU A N    4  
ATOM 7256  C CA   . GLU A 1 54  ? 2.930   -7.565  -11.386 1.00 0.00 ?  267 GLU A CA   4  
ATOM 7257  C C    . GLU A 1 54  ? 3.515   -6.182  -11.681 1.00 0.00 ?  267 GLU A C    4  
ATOM 7258  O O    . GLU A 1 54  ? 4.656   -5.898  -11.321 1.00 0.00 ?  267 GLU A O    4  
ATOM 7259  C CB   . GLU A 1 54  ? 1.861   -7.487  -10.294 1.00 0.00 ?  267 GLU A CB   4  
ATOM 7260  C CG   . GLU A 1 54  ? 2.214   -6.419  -9.257  1.00 0.00 ?  267 GLU A CG   4  
ATOM 7261  C CD   . GLU A 1 54  ? 1.405   -5.142  -9.487  1.00 0.00 ?  267 GLU A CD   4  
ATOM 7262  O OE1  . GLU A 1 54  ? 1.939   -4.033  -9.334  1.00 0.00 ?  267 GLU A OE1  4  
ATOM 7263  O OE2  . GLU A 1 54  ? 0.178   -5.329  -9.839  1.00 0.00 -1 267 GLU A OE2  4  
ATOM 7264  H H    . GLU A 1 54  ? 3.997   -8.756  -10.052 1.00 0.00 ?  267 GLU A H    4  
ATOM 7265  H HA   . GLU A 1 54  ? 2.486   -7.979  -12.292 1.00 0.00 ?  267 GLU A HA   4  
ATOM 7266  H HB2  . GLU A 1 54  ? 0.894   -7.258  -10.742 1.00 0.00 ?  267 GLU A HB2  4  
ATOM 7267  H HB3  . GLU A 1 54  ? 1.764   -8.456  -9.806  1.00 0.00 ?  267 GLU A HB3  4  
ATOM 7268  H HG2  . GLU A 1 54  ? 2.019   -6.802  -8.255  1.00 0.00 ?  267 GLU A HG2  4  
ATOM 7269  H HG3  . GLU A 1 54  ? 3.279   -6.194  -9.310  1.00 0.00 ?  267 GLU A HG3  4  
ATOM 7270  H HE2  . GLU A 1 54  ? -0.202  -6.114  -9.350  1.00 0.00 ?  267 GLU A HE2  4  
ATOM 7271  N N    . PRO A 1 55  ? 2.685   -5.337  -12.350 1.00 0.00 ?  268 PRO A N    4  
ATOM 7272  C CA   . PRO A 1 55  ? 3.108   -3.991  -12.696 1.00 0.00 ?  268 PRO A CA   4  
ATOM 7273  C C    . PRO A 1 55  ? 3.101   -3.080  -11.467 1.00 0.00 ?  268 PRO A C    4  
ATOM 7274  O O    . PRO A 1 55  ? 2.159   -2.316  -11.261 1.00 0.00 ?  268 PRO A O    4  
ATOM 7275  C CB   . PRO A 1 55  ? 2.138   -3.540  -13.776 1.00 0.00 ?  268 PRO A CB   4  
ATOM 7276  C CG   . PRO A 1 55  ? 0.933   -4.460  -13.665 1.00 0.00 ?  268 PRO A CG   4  
ATOM 7277  C CD   . PRO A 1 55  ? 1.327   -5.640  -12.792 1.00 0.00 ?  268 PRO A CD   4  
ATOM 7278  H HA   . PRO A 1 55  ? 4.052   -3.998  -13.026 1.00 0.00 ?  268 PRO A HA   4  
ATOM 7279  H HB2  . PRO A 1 55  ? 1.849   -2.499  -13.631 1.00 0.00 ?  268 PRO A HB2  4  
ATOM 7280  H HB3  . PRO A 1 55  ? 2.593   -3.609  -14.764 1.00 0.00 ?  268 PRO A HB3  4  
ATOM 7281  H HG2  . PRO A 1 55  ? 0.086   -3.929  -13.230 1.00 0.00 ?  268 PRO A HG2  4  
ATOM 7282  H HG3  . PRO A 1 55  ? 0.622   -4.802  -14.652 1.00 0.00 ?  268 PRO A HG3  4  
ATOM 7283  H HD2  . PRO A 1 55  ? 0.650   -5.749  -11.945 1.00 0.00 ?  268 PRO A HD2  4  
ATOM 7284  H HD3  . PRO A 1 55  ? 1.292   -6.575  -13.351 1.00 0.00 ?  268 PRO A HD3  4  
ATOM 7285  N N    . GLY A 1 56  ? 4.162   -3.192  -10.681 1.00 0.00 ?  269 GLY A N    4  
ATOM 7286  C CA   . GLY A 1 56  ? 4.290   -2.388  -9.478  1.00 0.00 ?  269 GLY A CA   4  
ATOM 7287  C C    . GLY A 1 56  ? 3.736   -0.979  -9.698  1.00 0.00 ?  269 GLY A C    4  
ATOM 7288  O O    . GLY A 1 56  ? 4.436   -0.105  -10.208 1.00 0.00 ?  269 GLY A O    4  
ATOM 7289  H H    . GLY A 1 56  ? 4.924   -3.816  -10.855 1.00 0.00 ?  269 GLY A H    4  
ATOM 7290  H HA2  . GLY A 1 56  ? 3.757   -2.868  -8.657  1.00 0.00 ?  269 GLY A HA2  4  
ATOM 7291  H HA3  . GLY A 1 56  ? 5.338   -2.329  -9.185  1.00 0.00 ?  269 GLY A HA3  4  
ATOM 7292  N N    . ASP A 1 57  ? 2.483   -0.802  -9.303  1.00 0.00 ?  270 ASP A N    4  
ATOM 7293  C CA   . ASP A 1 57  ? 1.827   0.486   -9.451  1.00 0.00 ?  270 ASP A CA   4  
ATOM 7294  C C    . ASP A 1 57  ? 0.495   0.465   -8.698  1.00 0.00 ?  270 ASP A C    4  
ATOM 7295  O O    . ASP A 1 57  ? -0.490  1.040   -9.156  1.00 0.00 ?  270 ASP A O    4  
ATOM 7296  C CB   . ASP A 1 57  ? 1.534   0.789   -10.921 1.00 0.00 ?  270 ASP A CB   4  
ATOM 7297  C CG   . ASP A 1 57  ? 2.405   1.883   -11.542 1.00 0.00 ?  270 ASP A CG   4  
ATOM 7298  O OD1  . ASP A 1 57  ? 3.424   2.292   -10.967 1.00 0.00 ?  270 ASP A OD1  4  
ATOM 7299  O OD2  . ASP A 1 57  ? 1.993   2.327   -12.682 1.00 0.00 -1 270 ASP A OD2  4  
ATOM 7300  H H    . ASP A 1 57  ? 1.921   -1.518  -8.889  1.00 0.00 ?  270 ASP A H    4  
ATOM 7301  H HA   . ASP A 1 57  ? 2.527   1.213   -9.039  1.00 0.00 ?  270 ASP A HA   4  
ATOM 7302  H HB2  . ASP A 1 57  ? 1.662   -0.127  -11.498 1.00 0.00 ?  270 ASP A HB2  4  
ATOM 7303  H HB3  . ASP A 1 57  ? 0.488   1.081   -11.015 1.00 0.00 ?  270 ASP A HB3  4  
ATOM 7304  H HD2  . ASP A 1 57  ? 2.710   2.873   -13.115 1.00 0.00 ?  270 ASP A HD2  4  
ATOM 7305  N N    . ARG A 1 58  ? 0.509   -0.205  -7.555  1.00 0.00 ?  271 ARG A N    4  
ATOM 7306  C CA   . ARG A 1 58  ? -0.685  -0.309  -6.734  1.00 0.00 ?  271 ARG A CA   4  
ATOM 7307  C C    . ARG A 1 58  ? -0.348  -0.948  -5.385  1.00 0.00 ?  271 ARG A C    4  
ATOM 7308  O O    . ARG A 1 58  ? 0.525   -1.810  -5.304  1.00 0.00 ?  271 ARG A O    4  
ATOM 7309  C CB   . ARG A 1 58  ? -1.762  -1.144  -7.431  1.00 0.00 ?  271 ARG A CB   4  
ATOM 7310  C CG   . ARG A 1 58  ? -3.161  -0.727  -6.973  1.00 0.00 ?  271 ARG A CG   4  
ATOM 7311  C CD   . ARG A 1 58  ? -4.129  -0.664  -8.156  1.00 0.00 ?  271 ARG A CD   4  
ATOM 7312  N NE   . ARG A 1 58  ? -5.386  0.000   -7.747  1.00 0.00 ?  271 ARG A NE   4  
ATOM 7313  C CZ   . ARG A 1 58  ? -6.490  0.051   -8.505  1.00 0.00 ?  271 ARG A CZ   4  
ATOM 7314  N NH1  . ARG A 1 58  ? -6.498  -0.521  -9.716  1.00 0.00 ?  271 ARG A NH1  4  
ATOM 7315  N NH2  . ARG A 1 58  ? -7.586  0.676   -8.052  1.00 0.00 1  271 ARG A NH2  4  
ATOM 7316  H H    . ARG A 1 58  ? 1.315   -0.670  -7.189  1.00 0.00 ?  271 ARG A H    4  
ATOM 7317  H HA   . ARG A 1 58  ? -1.026  0.718   -6.607  1.00 0.00 ?  271 ARG A HA   4  
ATOM 7318  H HB2  . ARG A 1 58  ? -1.677  -1.023  -8.511  1.00 0.00 ?  271 ARG A HB2  4  
ATOM 7319  H HB3  . ARG A 1 58  ? -1.604  -2.200  -7.215  1.00 0.00 ?  271 ARG A HB3  4  
ATOM 7320  H HG2  . ARG A 1 58  ? -3.531  -1.435  -6.232  1.00 0.00 ?  271 ARG A HG2  4  
ATOM 7321  H HG3  . ARG A 1 58  ? -3.113  0.247   -6.487  1.00 0.00 ?  271 ARG A HG3  4  
ATOM 7322  H HD2  . ARG A 1 58  ? -3.672  -0.119  -8.982  1.00 0.00 ?  271 ARG A HD2  4  
ATOM 7323  H HD3  . ARG A 1 58  ? -4.340  -1.671  -8.517  1.00 0.00 ?  271 ARG A HD3  4  
ATOM 7324  H HE   . ARG A 1 58  ? -5.414  0.438   -6.848  1.00 0.00 ?  271 ARG A HE   4  
ATOM 7325  H HH11 . ARG A 1 58  ? -5.681  -0.988  -10.055 1.00 0.00 ?  271 ARG A HH11 4  
ATOM 7326  H HH12 . ARG A 1 58  ? -7.322  -0.483  -10.282 1.00 0.00 ?  271 ARG A HH12 4  
ATOM 7327  H HH21 . ARG A 1 58  ? -7.579  1.104   -7.148  1.00 0.00 ?  271 ARG A HH21 4  
ATOM 7328  H HH22 . ARG A 1 58  ? -8.409  0.715   -8.618  1.00 0.00 ?  271 ARG A HH22 4  
ATOM 7329  N N    . MET A 1 59  ? -1.059  -0.501  -4.361  1.00 0.00 ?  272 MET A N    4  
ATOM 7330  C CA   . MET A 1 59  ? -0.847  -1.018  -3.019  1.00 0.00 ?  272 MET A CA   4  
ATOM 7331  C C    . MET A 1 59  ? -2.098  -1.729  -2.501  1.00 0.00 ?  272 MET A C    4  
ATOM 7332  O O    . MET A 1 59  ? -3.218  -1.336  -2.824  1.00 0.00 ?  272 MET A O    4  
ATOM 7333  C CB   . MET A 1 59  ? -0.487  0.134   -2.079  1.00 0.00 ?  272 MET A CB   4  
ATOM 7334  C CG   . MET A 1 59  ? 0.646   -0.266  -1.131  1.00 0.00 ?  272 MET A CG   4  
ATOM 7335  S SD   . MET A 1 59  ? 1.045   1.096   -0.048  1.00 0.00 ?  272 MET A SD   4  
ATOM 7336  C CE   . MET A 1 59  ? 2.233   0.303   1.022   1.00 0.00 ?  272 MET A CE   4  
ATOM 7337  H H    . MET A 1 59  ? -1.768  0.201   -4.435  1.00 0.00 ?  272 MET A H    4  
ATOM 7338  H HA   . MET A 1 59  ? -0.026  -1.730  -3.107  1.00 0.00 ?  272 MET A HA   4  
ATOM 7339  H HB2  . MET A 1 59  ? -0.188  1.004   -2.662  1.00 0.00 ?  272 MET A HB2  4  
ATOM 7340  H HB3  . MET A 1 59  ? -1.365  0.424   -1.501  1.00 0.00 ?  272 MET A HB3  4  
ATOM 7341  H HG2  . MET A 1 59  ? 0.349   -1.134  -0.542  1.00 0.00 ?  272 MET A HG2  4  
ATOM 7342  H HG3  . MET A 1 59  ? 1.526   -0.555  -1.705  1.00 0.00 ?  272 MET A HG3  4  
ATOM 7343  H HE1  . MET A 1 59  ? 2.464   -0.689  0.637   1.00 0.00 ?  272 MET A HE1  4  
ATOM 7344  H HE2  . MET A 1 59  ? 3.144   0.900   1.058   1.00 0.00 ?  272 MET A HE2  4  
ATOM 7345  H HE3  . MET A 1 59  ? 1.816   0.216   2.026   1.00 0.00 ?  272 MET A HE3  4  
ATOM 7346  N N    . PHE A 1 60  ? -1.866  -2.763  -1.706  1.00 0.00 ?  273 PHE A N    4  
ATOM 7347  C CA   . PHE A 1 60  ? -2.961  -3.532  -1.140  1.00 0.00 ?  273 PHE A CA   4  
ATOM 7348  C C    . PHE A 1 60  ? -2.740  -3.785  0.353   1.00 0.00 ?  273 PHE A C    4  
ATOM 7349  O O    . PHE A 1 60  ? -1.630  -4.109  0.773   1.00 0.00 ?  273 PHE A O    4  
ATOM 7350  C CB   . PHE A 1 60  ? -2.990  -4.875  -1.873  1.00 0.00 ?  273 PHE A CB   4  
ATOM 7351  C CG   . PHE A 1 60  ? -3.631  -4.811  -3.261  1.00 0.00 ?  273 PHE A CG   4  
ATOM 7352  C CD1  . PHE A 1 60  ? -2.916  -4.343  -4.319  1.00 0.00 ?  273 PHE A CD1  4  
ATOM 7353  C CD2  . PHE A 1 60  ? -4.915  -5.224  -3.437  1.00 0.00 ?  273 PHE A CD2  4  
ATOM 7354  C CE1  . PHE A 1 60  ? -3.511  -4.285  -5.607  1.00 0.00 ?  273 PHE A CE1  4  
ATOM 7355  C CE2  . PHE A 1 60  ? -5.509  -5.166  -4.725  1.00 0.00 ?  273 PHE A CE2  4  
ATOM 7356  C CZ   . PHE A 1 60  ? -4.795  -4.697  -5.783  1.00 0.00 ?  273 PHE A CZ   4  
ATOM 7357  H H    . PHE A 1 60  ? -0.952  -3.076  -1.448  1.00 0.00 ?  273 PHE A H    4  
ATOM 7358  H HA   . PHE A 1 60  ? -3.871  -2.948  -1.276  1.00 0.00 ?  273 PHE A HA   4  
ATOM 7359  H HB2  . PHE A 1 60  ? -1.970  -5.246  -1.971  1.00 0.00 ?  273 PHE A HB2  4  
ATOM 7360  H HB3  . PHE A 1 60  ? -3.535  -5.597  -1.265  1.00 0.00 ?  273 PHE A HB3  4  
ATOM 7361  H HD1  . PHE A 1 60  ? -1.887  -4.013  -4.178  1.00 0.00 ?  273 PHE A HD1  4  
ATOM 7362  H HD2  . PHE A 1 60  ? -5.488  -5.600  -2.589  1.00 0.00 ?  273 PHE A HD2  4  
ATOM 7363  H HE1  . PHE A 1 60  ? -2.938  -3.909  -6.455  1.00 0.00 ?  273 PHE A HE1  4  
ATOM 7364  H HE2  . PHE A 1 60  ? -6.538  -5.496  -4.866  1.00 0.00 ?  273 PHE A HE2  4  
ATOM 7365  H HZ   . PHE A 1 60  ? -5.251  -4.652  -6.772  1.00 0.00 ?  273 PHE A HZ   4  
ATOM 7366  N N    . PHE A 1 61  ? -3.813  -3.626  1.113   1.00 0.00 ?  274 PHE A N    4  
ATOM 7367  C CA   . PHE A 1 61  ? -3.750  -3.833  2.550   1.00 0.00 ?  274 PHE A CA   4  
ATOM 7368  C C    . PHE A 1 61  ? -4.818  -4.828  3.008   1.00 0.00 ?  274 PHE A C    4  
ATOM 7369  O O    . PHE A 1 61  ? -5.978  -4.725  2.612   1.00 0.00 ?  274 PHE A O    4  
ATOM 7370  C CB   . PHE A 1 61  ? -4.016  -2.478  3.209   1.00 0.00 ?  274 PHE A CB   4  
ATOM 7371  C CG   . PHE A 1 61  ? -2.941  -1.427  2.926   1.00 0.00 ?  274 PHE A CG   4  
ATOM 7372  C CD1  . PHE A 1 61  ? -1.639  -1.801  2.805   1.00 0.00 ?  274 PHE A CD1  4  
ATOM 7373  C CD2  . PHE A 1 61  ? -3.288  -0.118  2.795   1.00 0.00 ?  274 PHE A CD2  4  
ATOM 7374  C CE1  . PHE A 1 61  ? -0.642  -0.825  2.542   1.00 0.00 ?  274 PHE A CE1  4  
ATOM 7375  C CE2  . PHE A 1 61  ? -2.290  0.858   2.532   1.00 0.00 ?  274 PHE A CE2  4  
ATOM 7376  C CZ   . PHE A 1 61  ? -0.988  0.484   2.411   1.00 0.00 ?  274 PHE A CZ   4  
ATOM 7377  H H    . PHE A 1 61  ? -4.712  -3.362  0.763   1.00 0.00 ?  274 PHE A H    4  
ATOM 7378  H HA   . PHE A 1 61  ? -2.762  -4.234  2.776   1.00 0.00 ?  274 PHE A HA   4  
ATOM 7379  H HB2  . PHE A 1 61  ? -4.979  -2.101  2.865   1.00 0.00 ?  274 PHE A HB2  4  
ATOM 7380  H HB3  . PHE A 1 61  ? -4.096  -2.619  4.287   1.00 0.00 ?  274 PHE A HB3  4  
ATOM 7381  H HD1  . PHE A 1 61  ? -1.361  -2.849  2.910   1.00 0.00 ?  274 PHE A HD1  4  
ATOM 7382  H HD2  . PHE A 1 61  ? -4.331  0.181   2.892   1.00 0.00 ?  274 PHE A HD2  4  
ATOM 7383  H HE1  . PHE A 1 61  ? 0.402   -1.124  2.445   1.00 0.00 ?  274 PHE A HE1  4  
ATOM 7384  H HE2  . PHE A 1 61  ? -2.568  1.907   2.427   1.00 0.00 ?  274 PHE A HE2  4  
ATOM 7385  H HZ   . PHE A 1 61  ? -0.223  1.233   2.210   1.00 0.00 ?  274 PHE A HZ   4  
ATOM 7386  N N    . VAL A 1 62  ? -4.389  -5.769  3.837   1.00 0.00 ?  275 VAL A N    4  
ATOM 7387  C CA   . VAL A 1 62  ? -5.294  -6.781  4.353   1.00 0.00 ?  275 VAL A CA   4  
ATOM 7388  C C    . VAL A 1 62  ? -5.898  -6.294  5.672   1.00 0.00 ?  275 VAL A C    4  
ATOM 7389  O O    . VAL A 1 62  ? -5.181  -5.806  6.544   1.00 0.00 ?  275 VAL A O    4  
ATOM 7390  C CB   . VAL A 1 62  ? -4.561  -8.118  4.488   1.00 0.00 ?  275 VAL A CB   4  
ATOM 7391  C CG1  . VAL A 1 62  ? -5.237  -9.010  5.532   1.00 0.00 ?  275 VAL A CG1  4  
ATOM 7392  C CG2  . VAL A 1 62  ? -4.466  -8.830  3.138   1.00 0.00 ?  275 VAL A CG2  4  
ATOM 7393  H H    . VAL A 1 62  ? -3.443  -5.845  4.154   1.00 0.00 ?  275 VAL A H    4  
ATOM 7394  H HA   . VAL A 1 62  ? -6.095  -6.908  3.625   1.00 0.00 ?  275 VAL A HA   4  
ATOM 7395  H HB   . VAL A 1 62  ? -3.547  -7.911  4.830   1.00 0.00 ?  275 VAL A HB   4  
ATOM 7396  H HG11 . VAL A 1 62  ? -4.817  -8.799  6.516   1.00 0.00 ?  275 VAL A HG11 4  
ATOM 7397  H HG12 . VAL A 1 62  ? -6.308  -8.809  5.544   1.00 0.00 ?  275 VAL A HG12 4  
ATOM 7398  H HG13 . VAL A 1 62  ? -5.066  -10.056 5.281   1.00 0.00 ?  275 VAL A HG13 4  
ATOM 7399  H HG21 . VAL A 1 62  ? -3.480  -9.283  3.035   1.00 0.00 ?  275 VAL A HG21 4  
ATOM 7400  H HG22 . VAL A 1 62  ? -5.229  -9.606  3.081   1.00 0.00 ?  275 VAL A HG22 4  
ATOM 7401  H HG23 . VAL A 1 62  ? -4.620  -8.109  2.335   1.00 0.00 ?  275 VAL A HG23 4  
ATOM 7402  N N    . VAL A 1 63  ? -7.210  -6.445  5.775   1.00 0.00 ?  276 VAL A N    4  
ATOM 7403  C CA   . VAL A 1 63  ? -7.919  -6.026  6.973   1.00 0.00 ?  276 VAL A CA   4  
ATOM 7404  C C    . VAL A 1 63  ? -8.413  -7.263  7.726   1.00 0.00 ?  276 VAL A C    4  
ATOM 7405  O O    . VAL A 1 63  ? -8.438  -7.276  8.956   1.00 0.00 ?  276 VAL A O    4  
ATOM 7406  C CB   . VAL A 1 63  ? -9.047  -5.061  6.603   1.00 0.00 ?  276 VAL A CB   4  
ATOM 7407  C CG1  . VAL A 1 63  ? -9.731  -4.512  7.856   1.00 0.00 ?  276 VAL A CG1  4  
ATOM 7408  C CG2  . VAL A 1 63  ? -8.529  -3.925  5.719   1.00 0.00 ?  276 VAL A CG2  4  
ATOM 7409  H H    . VAL A 1 63  ? -7.786  -6.843  5.061   1.00 0.00 ?  276 VAL A H    4  
ATOM 7410  H HA   . VAL A 1 63  ? -7.210  -5.491  7.604   1.00 0.00 ?  276 VAL A HA   4  
ATOM 7411  H HB   . VAL A 1 63  ? -9.790  -5.618  6.032   1.00 0.00 ?  276 VAL A HB   4  
ATOM 7412  H HG11 . VAL A 1 63  ? -9.284  -4.963  8.742   1.00 0.00 ?  276 VAL A HG11 4  
ATOM 7413  H HG12 . VAL A 1 63  ? -9.604  -3.430  7.896   1.00 0.00 ?  276 VAL A HG12 4  
ATOM 7414  H HG13 . VAL A 1 63  ? -10.794 -4.752  7.825   1.00 0.00 ?  276 VAL A HG13 4  
ATOM 7415  H HG21 . VAL A 1 63  ? -7.539  -4.181  5.342   1.00 0.00 ?  276 VAL A HG21 4  
ATOM 7416  H HG22 . VAL A 1 63  ? -9.210  -3.778  4.880   1.00 0.00 ?  276 VAL A HG22 4  
ATOM 7417  H HG23 . VAL A 1 63  ? -8.469  -3.008  6.304   1.00 0.00 ?  276 VAL A HG23 4  
ATOM 7418  N N    . GLU A 1 64  ? -8.793  -8.272  6.957   1.00 0.00 ?  277 GLU A N    4  
ATOM 7419  C CA   . GLU A 1 64  ? -9.286  -9.511  7.536   1.00 0.00 ?  277 GLU A CA   4  
ATOM 7420  C C    . GLU A 1 64  ? -9.100  -10.668 6.552   1.00 0.00 ?  277 GLU A C    4  
ATOM 7421  O O    . GLU A 1 64  ? -9.347  -10.517 5.357   1.00 0.00 ?  277 GLU A O    4  
ATOM 7422  C CB   . GLU A 1 64  ? -10.751 -9.377  7.954   1.00 0.00 ?  277 GLU A CB   4  
ATOM 7423  C CG   . GLU A 1 64  ? -11.371 -8.102  7.378   1.00 0.00 ?  277 GLU A CG   4  
ATOM 7424  C CD   . GLU A 1 64  ? -12.899 -8.153  7.450   1.00 0.00 ?  277 GLU A CD   4  
ATOM 7425  O OE1  . GLU A 1 64  ? -13.540 -7.132  7.737   1.00 0.00 ?  277 GLU A OE1  4  
ATOM 7426  O OE2  . GLU A 1 64  ? -13.418 -9.306  7.196   1.00 0.00 -1 277 GLU A OE2  4  
ATOM 7427  H H    . GLU A 1 64  ? -8.770  -8.253  5.957   1.00 0.00 ?  277 GLU A H    4  
ATOM 7428  H HA   . GLU A 1 64  ? -8.675  -9.678  8.424   1.00 0.00 ?  277 GLU A HA   4  
ATOM 7429  H HB2  . GLU A 1 64  ? -11.312 -10.245 7.610   1.00 0.00 ?  277 GLU A HB2  4  
ATOM 7430  H HB3  . GLU A 1 64  ? -10.823 -9.361  9.041   1.00 0.00 ?  277 GLU A HB3  4  
ATOM 7431  H HG2  . GLU A 1 64  ? -11.006 -7.235  7.928   1.00 0.00 ?  277 GLU A HG2  4  
ATOM 7432  H HG3  . GLU A 1 64  ? -11.057 -7.976  6.341   1.00 0.00 ?  277 GLU A HG3  4  
ATOM 7433  H HE2  . GLU A 1 64  ? -14.281 -9.191  6.704   1.00 0.00 ?  277 GLU A HE2  4  
ATOM 7434  N N    . GLY A 1 65  ? -8.664  -11.797 7.091   1.00 0.00 ?  278 GLY A N    4  
ATOM 7435  C CA   . GLY A 1 65  ? -8.442  -12.979 6.276   1.00 0.00 ?  278 GLY A CA   4  
ATOM 7436  C C    . GLY A 1 65  ? -6.968  -13.388 6.294   1.00 0.00 ?  278 GLY A C    4  
ATOM 7437  O O    . GLY A 1 65  ? -6.156  -12.768 6.978   1.00 0.00 ?  278 GLY A O    4  
ATOM 7438  H H    . GLY A 1 65  ? -8.465  -11.911 8.065   1.00 0.00 ?  278 GLY A H    4  
ATOM 7439  H HA2  . GLY A 1 65  ? -9.056  -13.800 6.645   1.00 0.00 ?  278 GLY A HA2  4  
ATOM 7440  H HA3  . GLY A 1 65  ? -8.756  -12.782 5.251   1.00 0.00 ?  278 GLY A HA3  4  
ATOM 7441  N N    . SER A 1 66  ? -6.667  -14.430 5.533   1.00 0.00 ?  279 SER A N    4  
ATOM 7442  C CA   . SER A 1 66  ? -5.305  -14.930 5.453   1.00 0.00 ?  279 SER A CA   4  
ATOM 7443  C C    . SER A 1 66  ? -4.861  -15.005 3.991   1.00 0.00 ?  279 SER A C    4  
ATOM 7444  O O    . SER A 1 66  ? -5.393  -15.799 3.217   1.00 0.00 ?  279 SER A O    4  
ATOM 7445  C CB   . SER A 1 66  ? -5.182  -16.303 6.117   1.00 0.00 ?  279 SER A CB   4  
ATOM 7446  O OG   . SER A 1 66  ? -4.915  -16.199 7.513   1.00 0.00 ?  279 SER A OG   4  
ATOM 7447  H H    . SER A 1 66  ? -7.334  -14.930 4.979   1.00 0.00 ?  279 SER A H    4  
ATOM 7448  H HA   . SER A 1 66  ? -4.700  -14.207 6.000   1.00 0.00 ?  279 SER A HA   4  
ATOM 7449  H HB2  . SER A 1 66  ? -6.105  -16.863 5.964   1.00 0.00 ?  279 SER A HB2  4  
ATOM 7450  H HB3  . SER A 1 66  ? -4.383  -16.868 5.636   1.00 0.00 ?  279 SER A HB3  4  
ATOM 7451  H HG   . SER A 1 66  ? -5.708  -15.814 7.984   1.00 0.00 ?  279 SER A HG   4  
ATOM 7452  N N    . VAL A 1 67  ? -3.889  -14.168 3.657   1.00 0.00 ?  280 VAL A N    4  
ATOM 7453  C CA   . VAL A 1 67  ? -3.367  -14.130 2.302   1.00 0.00 ?  280 VAL A CA   4  
ATOM 7454  C C    . VAL A 1 67  ? -2.068  -14.936 2.237   1.00 0.00 ?  280 VAL A C    4  
ATOM 7455  O O    . VAL A 1 67  ? -1.210  -14.808 3.110   1.00 0.00 ?  280 VAL A O    4  
ATOM 7456  C CB   . VAL A 1 67  ? -3.194  -12.679 1.848   1.00 0.00 ?  280 VAL A CB   4  
ATOM 7457  C CG1  . VAL A 1 67  ? -4.529  -11.932 1.882   1.00 0.00 ?  280 VAL A CG1  4  
ATOM 7458  C CG2  . VAL A 1 67  ? -2.142  -11.962 2.696   1.00 0.00 ?  280 VAL A CG2  4  
ATOM 7459  H H    . VAL A 1 67  ? -3.461  -13.526 4.293   1.00 0.00 ?  280 VAL A H    4  
ATOM 7460  H HA   . VAL A 1 67  ? -4.104  -14.601 1.652   1.00 0.00 ?  280 VAL A HA   4  
ATOM 7461  H HB   . VAL A 1 67  ? -2.842  -12.690 0.817   1.00 0.00 ?  280 VAL A HB   4  
ATOM 7462  H HG11 . VAL A 1 67  ? -4.416  -10.966 1.389   1.00 0.00 ?  280 VAL A HG11 4  
ATOM 7463  H HG12 . VAL A 1 67  ? -5.287  -12.518 1.363   1.00 0.00 ?  280 VAL A HG12 4  
ATOM 7464  H HG13 . VAL A 1 67  ? -4.833  -11.778 2.917   1.00 0.00 ?  280 VAL A HG13 4  
ATOM 7465  H HG21 . VAL A 1 67  ? -1.887  -11.010 2.229   1.00 0.00 ?  280 VAL A HG21 4  
ATOM 7466  H HG22 . VAL A 1 67  ? -2.541  -11.782 3.694   1.00 0.00 ?  280 VAL A HG22 4  
ATOM 7467  H HG23 . VAL A 1 67  ? -1.248  -12.582 2.768   1.00 0.00 ?  280 VAL A HG23 4  
ATOM 7468  N N    . SER A 1 68  ? -1.963  -15.748 1.196   1.00 0.00 ?  281 SER A N    4  
ATOM 7469  C CA   . SER A 1 68  ? -0.783  -16.574 1.006   1.00 0.00 ?  281 SER A CA   4  
ATOM 7470  C C    . SER A 1 68  ? 0.099   -15.981 -0.094  1.00 0.00 ?  281 SER A C    4  
ATOM 7471  O O    . SER A 1 68  ? -0.403  -15.365 -1.033  1.00 0.00 ?  281 SER A O    4  
ATOM 7472  C CB   . SER A 1 68  ? -1.168  -18.014 0.660   1.00 0.00 ?  281 SER A CB   4  
ATOM 7473  O OG   . SER A 1 68  ? -0.029  -18.811 0.349   1.00 0.00 ?  281 SER A OG   4  
ATOM 7474  H H    . SER A 1 68  ? -2.666  -15.846 0.490   1.00 0.00 ?  281 SER A H    4  
ATOM 7475  H HA   . SER A 1 68  ? -0.263  -16.558 1.964   1.00 0.00 ?  281 SER A HA   4  
ATOM 7476  H HB2  . SER A 1 68  ? -1.704  -18.457 1.499   1.00 0.00 ?  281 SER A HB2  4  
ATOM 7477  H HB3  . SER A 1 68  ? -1.852  -18.012 -0.189  1.00 0.00 ?  281 SER A HB3  4  
ATOM 7478  H HG   . SER A 1 68  ? 0.534   -18.351 -0.337  1.00 0.00 ?  281 SER A HG   4  
ATOM 7479  N N    . VAL A 1 69  ? 1.399   -16.188 0.058   1.00 0.00 ?  282 VAL A N    4  
ATOM 7480  C CA   . VAL A 1 69  ? 2.356   -15.682 -0.911  1.00 0.00 ?  282 VAL A CA   4  
ATOM 7481  C C    . VAL A 1 69  ? 2.999   -16.858 -1.649  1.00 0.00 ?  282 VAL A C    4  
ATOM 7482  O O    . VAL A 1 69  ? 3.491   -17.794 -1.021  1.00 0.00 ?  282 VAL A O    4  
ATOM 7483  C CB   . VAL A 1 69  ? 3.378   -14.780 -0.215  1.00 0.00 ?  282 VAL A CB   4  
ATOM 7484  C CG1  . VAL A 1 69  ? 3.964   -13.759 -1.193  1.00 0.00 ?  282 VAL A CG1  4  
ATOM 7485  C CG2  . VAL A 1 69  ? 2.760   -14.085 0.999   1.00 0.00 ?  282 VAL A CG2  4  
ATOM 7486  H H    . VAL A 1 69  ? 1.799   -16.690 0.825   1.00 0.00 ?  282 VAL A H    4  
ATOM 7487  H HA   . VAL A 1 69  ? 1.806   -15.075 -1.631  1.00 0.00 ?  282 VAL A HA   4  
ATOM 7488  H HB   . VAL A 1 69  ? 4.194   -15.411 0.139   1.00 0.00 ?  282 VAL A HB   4  
ATOM 7489  H HG11 . VAL A 1 69  ? 3.781   -14.089 -2.216  1.00 0.00 ?  282 VAL A HG11 4  
ATOM 7490  H HG12 . VAL A 1 69  ? 3.490   -12.791 -1.033  1.00 0.00 ?  282 VAL A HG12 4  
ATOM 7491  H HG13 . VAL A 1 69  ? 5.037   -13.671 -1.026  1.00 0.00 ?  282 VAL A HG13 4  
ATOM 7492  H HG21 . VAL A 1 69  ? 3.448   -13.327 1.373   1.00 0.00 ?  282 VAL A HG21 4  
ATOM 7493  H HG22 . VAL A 1 69  ? 1.821   -13.613 0.708   1.00 0.00 ?  282 VAL A HG22 4  
ATOM 7494  H HG23 . VAL A 1 69  ? 2.570   -14.820 1.781   1.00 0.00 ?  282 VAL A HG23 4  
ATOM 7495  N N    . ALA A 1 70  ? 2.976   -16.770 -2.970  1.00 0.00 ?  283 ALA A N    4  
ATOM 7496  C CA   . ALA A 1 70  ? 3.551   -17.816 -3.800  1.00 0.00 ?  283 ALA A CA   4  
ATOM 7497  C C    . ALA A 1 70  ? 5.074   -17.676 -3.806  1.00 0.00 ?  283 ALA A C    4  
ATOM 7498  O O    . ALA A 1 70  ? 5.621   -16.834 -4.516  1.00 0.00 ?  283 ALA A O    4  
ATOM 7499  C CB   . ALA A 1 70  ? 2.952   -17.739 -5.206  1.00 0.00 ?  283 ALA A CB   4  
ATOM 7500  H H    . ALA A 1 70  ? 2.574   -16.005 -3.473  1.00 0.00 ?  283 ALA A H    4  
ATOM 7501  H HA   . ALA A 1 70  ? 3.284   -18.775 -3.357  1.00 0.00 ?  283 ALA A HA   4  
ATOM 7502  H HB1  . ALA A 1 70  ? 2.000   -18.268 -5.224  1.00 0.00 ?  283 ALA A HB1  4  
ATOM 7503  H HB2  . ALA A 1 70  ? 2.794   -16.695 -5.477  1.00 0.00 ?  283 ALA A HB2  4  
ATOM 7504  H HB3  . ALA A 1 70  ? 3.638   -18.199 -5.918  1.00 0.00 ?  283 ALA A HB3  4  
ATOM 7505  N N    . THR A 1 71  ? 5.717   -18.514 -3.006  1.00 0.00 ?  284 THR A N    4  
ATOM 7506  C CA   . THR A 1 71  ? 7.167   -18.494 -2.911  1.00 0.00 ?  284 THR A CA   4  
ATOM 7507  C C    . THR A 1 71  ? 7.700   -19.894 -2.599  1.00 0.00 ?  284 THR A C    4  
ATOM 7508  O O    . THR A 1 71  ? 6.963   -20.875 -2.682  1.00 0.00 ?  284 THR A O    4  
ATOM 7509  C CB   . THR A 1 71  ? 7.557   -17.448 -1.864  1.00 0.00 ?  284 THR A CB   4  
ATOM 7510  O OG1  . THR A 1 71  ? 7.644   -18.188 -0.649  1.00 0.00 ?  284 THR A OG1  4  
ATOM 7511  C CG2  . THR A 1 71  ? 6.441   -16.435 -1.604  1.00 0.00 ?  284 THR A CG2  4  
ATOM 7512  H H    . THR A 1 71  ? 5.265   -19.196 -2.431  1.00 0.00 ?  284 THR A H    4  
ATOM 7513  H HA   . THR A 1 71  ? 7.571   -18.207 -3.881  1.00 0.00 ?  284 THR A HA   4  
ATOM 7514  H HB   . THR A 1 71  ? 8.483   -16.945 -2.144  1.00 0.00 ?  284 THR A HB   4  
ATOM 7515  H HG1  . THR A 1 71  ? 8.145   -17.661 0.037   1.00 0.00 ?  284 THR A HG1  4  
ATOM 7516  H HG21 . THR A 1 71  ? 6.745   -15.756 -0.807  1.00 0.00 ?  284 THR A HG21 4  
ATOM 7517  H HG22 . THR A 1 71  ? 6.249   -15.864 -2.513  1.00 0.00 ?  284 THR A HG22 4  
ATOM 7518  H HG23 . THR A 1 71  ? 5.534   -16.961 -1.308  1.00 0.00 ?  284 THR A HG23 4  
ATOM 7519  N N    . PRO A 1 72  ? 9.010   -19.943 -2.238  1.00 0.00 ?  285 PRO A N    4  
ATOM 7520  C CA   . PRO A 1 72  ? 9.650   -21.206 -1.913  1.00 0.00 ?  285 PRO A CA   4  
ATOM 7521  C C    . PRO A 1 72  ? 9.216   -21.702 -0.533  1.00 0.00 ?  285 PRO A C    4  
ATOM 7522  O O    . PRO A 1 72  ? 9.707   -22.723 -0.053  1.00 0.00 ?  285 PRO A O    4  
ATOM 7523  C CB   . PRO A 1 72  ? 11.142  -20.925 -2.001  1.00 0.00 ?  285 PRO A CB   4  
ATOM 7524  C CG   . PRO A 1 72  ? 11.287  -19.415 -1.914  1.00 0.00 ?  285 PRO A CG   4  
ATOM 7525  C CD   . PRO A 1 72  ? 9.913   -18.801 -2.129  1.00 0.00 ?  285 PRO A CD   4  
ATOM 7526  H HA   . PRO A 1 72  ? 9.368   -21.915 -2.560  1.00 0.00 ?  285 PRO A HA   4  
ATOM 7527  H HB2  . PRO A 1 72  ? 11.680  -21.417 -1.191  1.00 0.00 ?  285 PRO A HB2  4  
ATOM 7528  H HB3  . PRO A 1 72  ? 11.556  -21.305 -2.935  1.00 0.00 ?  285 PRO A HB3  4  
ATOM 7529  H HG2  . PRO A 1 72  ? 11.687  -19.125 -0.942  1.00 0.00 ?  285 PRO A HG2  4  
ATOM 7530  H HG3  . PRO A 1 72  ? 11.988  -19.055 -2.667  1.00 0.00 ?  285 PRO A HG3  4  
ATOM 7531  H HD2  . PRO A 1 72  ? 9.634   -18.153 -1.298  1.00 0.00 ?  285 PRO A HD2  4  
ATOM 7532  H HD3  . PRO A 1 72  ? 9.889   -18.190 -3.032  1.00 0.00 ?  285 PRO A HD3  4  
ATOM 7533  N N    . ASN A 1 73  ? 8.298   -20.958 0.067   1.00 0.00 ?  286 ASN A N    4  
ATOM 7534  C CA   . ASN A 1 73  ? 7.792   -21.309 1.383   1.00 0.00 ?  286 ASN A CA   4  
ATOM 7535  C C    . ASN A 1 73  ? 6.365   -20.777 1.534   1.00 0.00 ?  286 ASN A C    4  
ATOM 7536  O O    . ASN A 1 73  ? 5.987   -19.810 0.875   1.00 0.00 ?  286 ASN A O    4  
ATOM 7537  C CB   . ASN A 1 73  ? 8.649   -20.687 2.487   1.00 0.00 ?  286 ASN A CB   4  
ATOM 7538  C CG   . ASN A 1 73  ? 10.124  -21.047 2.304   1.00 0.00 ?  286 ASN A CG   4  
ATOM 7539  O OD1  . ASN A 1 73  ? 10.943  -20.237 1.903   1.00 0.00 ?  286 ASN A OD1  4  
ATOM 7540  N ND2  . ASN A 1 73  ? 10.417  -22.306 2.620   1.00 0.00 ?  286 ASN A ND2  4  
ATOM 7541  H H    . ASN A 1 73  ? 7.903   -20.129 -0.331  1.00 0.00 ?  286 ASN A H    4  
ATOM 7542  H HA   . ASN A 1 73  ? 7.837   -22.397 1.426   1.00 0.00 ?  286 ASN A HA   4  
ATOM 7543  H HB2  . ASN A 1 73  ? 8.531   -19.604 2.476   1.00 0.00 ?  286 ASN A HB2  4  
ATOM 7544  H HB3  . ASN A 1 73  ? 8.303   -21.036 3.460   1.00 0.00 ?  286 ASN A HB3  4  
ATOM 7545  H HD21 . ASN A 1 73  ? 9.697   -22.920 2.944   1.00 0.00 ?  286 ASN A HD21 4  
ATOM 7546  H HD22 . ASN A 1 73  ? 11.357  -22.637 2.535   1.00 0.00 ?  286 ASN A HD22 4  
ATOM 7547  N N    . PRO A 1 74  ? 5.593   -21.448 2.430   1.00 0.00 ?  287 PRO A N    4  
ATOM 7548  C CA   . PRO A 1 74  ? 4.217   -21.053 2.677   1.00 0.00 ?  287 PRO A CA   4  
ATOM 7549  C C    . PRO A 1 74  ? 4.156   -19.781 3.525   1.00 0.00 ?  287 PRO A C    4  
ATOM 7550  O O    . PRO A 1 74  ? 4.221   -19.845 4.752   1.00 0.00 ?  287 PRO A O    4  
ATOM 7551  C CB   . PRO A 1 74  ? 3.579   -22.253 3.358   1.00 0.00 ?  287 PRO A CB   4  
ATOM 7552  C CG   . PRO A 1 74  ? 4.730   -23.093 3.885   1.00 0.00 ?  287 PRO A CG   4  
ATOM 7553  C CD   . PRO A 1 74  ? 6.008   -22.598 3.228   1.00 0.00 ?  287 PRO A CD   4  
ATOM 7554  H HA   . PRO A 1 74  ? 3.761   -20.829 1.815   1.00 0.00 ?  287 PRO A HA   4  
ATOM 7555  H HB2  . PRO A 1 74  ? 2.922   -21.938 4.169   1.00 0.00 ?  287 PRO A HB2  4  
ATOM 7556  H HB3  . PRO A 1 74  ? 2.969   -22.821 2.656   1.00 0.00 ?  287 PRO A HB3  4  
ATOM 7557  H HG2  . PRO A 1 74  ? 4.800   -23.008 4.969   1.00 0.00 ?  287 PRO A HG2  4  
ATOM 7558  H HG3  . PRO A 1 74  ? 4.569   -24.147 3.658   1.00 0.00 ?  287 PRO A HG3  4  
ATOM 7559  H HD2  . PRO A 1 74  ? 6.752   -22.314 3.974   1.00 0.00 ?  287 PRO A HD2  4  
ATOM 7560  H HD3  . PRO A 1 74  ? 6.460   -23.370 2.606   1.00 0.00 ?  287 PRO A HD3  4  
ATOM 7561  N N    . VAL A 1 75  ? 4.031   -18.655 2.838   1.00 0.00 ?  288 VAL A N    4  
ATOM 7562  C CA   . VAL A 1 75  ? 3.960   -17.370 3.513   1.00 0.00 ?  288 VAL A CA   4  
ATOM 7563  C C    . VAL A 1 75  ? 2.500   -16.922 3.595   1.00 0.00 ?  288 VAL A C    4  
ATOM 7564  O O    . VAL A 1 75  ? 1.849   -16.726 2.570   1.00 0.00 ?  288 VAL A O    4  
ATOM 7565  C CB   . VAL A 1 75  ? 4.859   -16.356 2.803   1.00 0.00 ?  288 VAL A CB   4  
ATOM 7566  C CG1  . VAL A 1 75  ? 5.383   -15.305 3.784   1.00 0.00 ?  288 VAL A CG1  4  
ATOM 7567  C CG2  . VAL A 1 75  ? 6.012   -17.055 2.081   1.00 0.00 ?  288 VAL A CG2  4  
ATOM 7568  H H    . VAL A 1 75  ? 3.979   -18.612 1.840   1.00 0.00 ?  288 VAL A H    4  
ATOM 7569  H HA   . VAL A 1 75  ? 4.342   -17.509 4.525   1.00 0.00 ?  288 VAL A HA   4  
ATOM 7570  H HB   . VAL A 1 75  ? 4.257   -15.843 2.053   1.00 0.00 ?  288 VAL A HB   4  
ATOM 7571  H HG11 . VAL A 1 75  ? 6.340   -15.633 4.190   1.00 0.00 ?  288 VAL A HG11 4  
ATOM 7572  H HG12 . VAL A 1 75  ? 5.514   -14.356 3.265   1.00 0.00 ?  288 VAL A HG12 4  
ATOM 7573  H HG13 . VAL A 1 75  ? 4.668   -15.179 4.597   1.00 0.00 ?  288 VAL A HG13 4  
ATOM 7574  H HG21 . VAL A 1 75  ? 6.892   -16.412 2.094   1.00 0.00 ?  288 VAL A HG21 4  
ATOM 7575  H HG22 . VAL A 1 75  ? 6.240   -17.994 2.586   1.00 0.00 ?  288 VAL A HG22 4  
ATOM 7576  H HG23 . VAL A 1 75  ? 5.726   -17.258 1.049   1.00 0.00 ?  288 VAL A HG23 4  
ATOM 7577  N N    . GLU A 1 76  ? 2.028   -16.772 4.824   1.00 0.00 ?  289 GLU A N    4  
ATOM 7578  C CA   . GLU A 1 76  ? 0.657   -16.350 5.052   1.00 0.00 ?  289 GLU A CA   4  
ATOM 7579  C C    . GLU A 1 76  ? 0.625   -15.109 5.947   1.00 0.00 ?  289 GLU A C    4  
ATOM 7580  O O    . GLU A 1 76  ? 1.307   -15.059 6.970   1.00 0.00 ?  289 GLU A O    4  
ATOM 7581  C CB   . GLU A 1 76  ? -0.172  -17.484 5.659   1.00 0.00 ?  289 GLU A CB   4  
ATOM 7582  C CG   . GLU A 1 76  ? -0.643  -18.458 4.577   1.00 0.00 ?  289 GLU A CG   4  
ATOM 7583  C CD   . GLU A 1 76  ? -2.120  -18.239 4.246   1.00 0.00 ?  289 GLU A CD   4  
ATOM 7584  O OE1  . GLU A 1 76  ? -2.522  -17.112 3.921   1.00 0.00 ?  289 GLU A OE1  4  
ATOM 7585  O OE2  . GLU A 1 76  ? -2.861  -19.291 4.336   1.00 0.00 -1 289 GLU A OE2  4  
ATOM 7586  H H    . GLU A 1 76  ? 2.564   -16.933 5.652   1.00 0.00 ?  289 GLU A H    4  
ATOM 7587  H HA   . GLU A 1 76  ? 0.261   -16.105 4.067   1.00 0.00 ?  289 GLU A HA   4  
ATOM 7588  H HB2  . GLU A 1 76  ? 0.423   -18.018 6.400   1.00 0.00 ?  289 GLU A HB2  4  
ATOM 7589  H HB3  . GLU A 1 76  ? -1.035  -17.070 6.181   1.00 0.00 ?  289 GLU A HB3  4  
ATOM 7590  H HG2  . GLU A 1 76  ? -0.042  -18.326 3.677   1.00 0.00 ?  289 GLU A HG2  4  
ATOM 7591  H HG3  . GLU A 1 76  ? -0.490  -19.483 4.914   1.00 0.00 ?  289 GLU A HG3  4  
ATOM 7592  H HE2  . GLU A 1 76  ? -3.803  -19.029 4.549   1.00 0.00 ?  289 GLU A HE2  4  
ATOM 7593  N N    . LEU A 1 77  ? -0.173  -14.138 5.529   1.00 0.00 ?  290 LEU A N    4  
ATOM 7594  C CA   . LEU A 1 77  ? -0.302  -12.901 6.280   1.00 0.00 ?  290 LEU A CA   4  
ATOM 7595  C C    . LEU A 1 77  ? -1.735  -12.773 6.803   1.00 0.00 ?  290 LEU A C    4  
ATOM 7596  O O    . LEU A 1 77  ? -2.688  -13.097 6.097   1.00 0.00 ?  290 LEU A O    4  
ATOM 7597  C CB   . LEU A 1 77  ? 0.151   -11.710 5.433   1.00 0.00 ?  290 LEU A CB   4  
ATOM 7598  C CG   . LEU A 1 77  ? 1.657   -11.442 5.403   1.00 0.00 ?  290 LEU A CG   4  
ATOM 7599  C CD1  . LEU A 1 77  ? 2.197   -11.193 6.813   1.00 0.00 ?  290 LEU A CD1  4  
ATOM 7600  C CD2  . LEU A 1 77  ? 2.402   -12.576 4.696   1.00 0.00 ?  290 LEU A CD2  4  
ATOM 7601  H H    . LEU A 1 77  ? -0.725  -14.186 4.697   1.00 0.00 ?  290 LEU A H    4  
ATOM 7602  H HA   . LEU A 1 77  ? 0.373   -12.964 7.134   1.00 0.00 ?  290 LEU A HA   4  
ATOM 7603  H HB2  . LEU A 1 77  ? -0.190  -11.867 4.410   1.00 0.00 ?  290 LEU A HB2  4  
ATOM 7604  H HB3  . LEU A 1 77  ? -0.350  -10.815 5.802   1.00 0.00 ?  290 LEU A HB3  4  
ATOM 7605  H HG   . LEU A 1 77  ? 1.831   -10.534 4.827   1.00 0.00 ?  290 LEU A HG   4  
ATOM 7606  H HD11 . LEU A 1 77  ? 1.487   -10.584 7.372   1.00 0.00 ?  290 LEU A HD11 4  
ATOM 7607  H HD12 . LEU A 1 77  ? 2.338   -12.147 7.322   1.00 0.00 ?  290 LEU A HD12 4  
ATOM 7608  H HD13 . LEU A 1 77  ? 3.152   -10.671 6.749   1.00 0.00 ?  290 LEU A HD13 4  
ATOM 7609  H HD21 . LEU A 1 77  ? 3.339   -12.197 4.289   1.00 0.00 ?  290 LEU A HD21 4  
ATOM 7610  H HD22 . LEU A 1 77  ? 2.611   -13.374 5.409   1.00 0.00 ?  290 LEU A HD22 4  
ATOM 7611  H HD23 . LEU A 1 77  ? 1.785   -12.966 3.886   1.00 0.00 ?  290 LEU A HD23 4  
ATOM 7612  N N    . GLY A 1 78  ? -1.841  -12.301 8.036   1.00 0.00 ?  291 GLY A N    4  
ATOM 7613  C CA   . GLY A 1 78  ? -3.141  -12.127 8.662   1.00 0.00 ?  291 GLY A CA   4  
ATOM 7614  C C    . GLY A 1 78  ? -3.637  -10.688 8.504   1.00 0.00 ?  291 GLY A C    4  
ATOM 7615  O O    . GLY A 1 78  ? -3.226  -9.984  7.584   1.00 0.00 ?  291 GLY A O    4  
ATOM 7616  H H    . GLY A 1 78  ? -1.060  -12.040 8.604   1.00 0.00 ?  291 GLY A H    4  
ATOM 7617  H HA2  . GLY A 1 78  ? -3.858  -12.815 8.214   1.00 0.00 ?  291 GLY A HA2  4  
ATOM 7618  H HA3  . GLY A 1 78  ? -3.075  -12.379 9.720   1.00 0.00 ?  291 GLY A HA3  4  
ATOM 7619  N N    . PRO A 1 79  ? -4.537  -10.285 9.440   1.00 0.00 ?  292 PRO A N    4  
ATOM 7620  C CA   . PRO A 1 79  ? -5.094  -8.943  9.413   1.00 0.00 ?  292 PRO A CA   4  
ATOM 7621  C C    . PRO A 1 79  ? -4.072  -7.916  9.904   1.00 0.00 ?  292 PRO A C    4  
ATOM 7622  O O    . PRO A 1 79  ? -3.359  -8.159  10.876  1.00 0.00 ?  292 PRO A O    4  
ATOM 7623  C CB   . PRO A 1 79  ? -6.333  -9.014  10.291  1.00 0.00 ?  292 PRO A CB   4  
ATOM 7624  C CG   . PRO A 1 79  ? -6.168  -10.260 11.145  1.00 0.00 ?  292 PRO A CG   4  
ATOM 7625  C CD   . PRO A 1 79  ? -5.047  -11.093 10.544  1.00 0.00 ?  292 PRO A CD   4  
ATOM 7626  H HA   . PRO A 1 79  ? -5.319  -8.679  8.475   1.00 0.00 ?  292 PRO A HA   4  
ATOM 7627  H HB2  . PRO A 1 79  ? -6.423  -8.123  10.913  1.00 0.00 ?  292 PRO A HB2  4  
ATOM 7628  H HB3  . PRO A 1 79  ? -7.238  -9.072  9.686   1.00 0.00 ?  292 PRO A HB3  4  
ATOM 7629  H HG2  . PRO A 1 79  ? -5.932  -9.989  12.175  1.00 0.00 ?  292 PRO A HG2  4  
ATOM 7630  H HG3  . PRO A 1 79  ? -7.096  -10.831 11.171  1.00 0.00 ?  292 PRO A HG3  4  
ATOM 7631  H HD2  . PRO A 1 79  ? -4.268  -11.297 11.278  1.00 0.00 ?  292 PRO A HD2  4  
ATOM 7632  H HD3  . PRO A 1 79  ? -5.415  -12.057 10.193  1.00 0.00 ?  292 PRO A HD3  4  
ATOM 7633  N N    . GLY A 1 80  ? -4.033  -6.789  9.208   1.00 0.00 ?  293 GLY A N    4  
ATOM 7634  C CA   . GLY A 1 80  ? -3.110  -5.723  9.561   1.00 0.00 ?  293 GLY A CA   4  
ATOM 7635  C C    . GLY A 1 80  ? -1.826  -5.815  8.735   1.00 0.00 ?  293 GLY A C    4  
ATOM 7636  O O    . GLY A 1 80  ? -0.878  -5.067  8.969   1.00 0.00 ?  293 GLY A O    4  
ATOM 7637  H H    . GLY A 1 80  ? -4.617  -6.598  8.419   1.00 0.00 ?  293 GLY A H    4  
ATOM 7638  H HA2  . GLY A 1 80  ? -3.585  -4.756  9.395   1.00 0.00 ?  293 GLY A HA2  4  
ATOM 7639  H HA3  . GLY A 1 80  ? -2.869  -5.782  10.622  1.00 0.00 ?  293 GLY A HA3  4  
ATOM 7640  N N    . ALA A 1 81  ? -1.836  -6.738  7.784   1.00 0.00 ?  294 ALA A N    4  
ATOM 7641  C CA   . ALA A 1 81  ? -0.683  -6.938  6.922   1.00 0.00 ?  294 ALA A CA   4  
ATOM 7642  C C    . ALA A 1 81  ? -0.820  -6.051  5.683   1.00 0.00 ?  294 ALA A C    4  
ATOM 7643  O O    . ALA A 1 81  ? -1.865  -6.041  5.035   1.00 0.00 ?  294 ALA A O    4  
ATOM 7644  C CB   . ALA A 1 81  ? -0.561  -8.421  6.568   1.00 0.00 ?  294 ALA A CB   4  
ATOM 7645  H H    . ALA A 1 81  ? -2.611  -7.343  7.600   1.00 0.00 ?  294 ALA A H    4  
ATOM 7646  H HA   . ALA A 1 81  ? 0.204   -6.635  7.479   1.00 0.00 ?  294 ALA A HA   4  
ATOM 7647  H HB1  . ALA A 1 81  ? -1.490  -8.764  6.113   1.00 0.00 ?  294 ALA A HB1  4  
ATOM 7648  H HB2  . ALA A 1 81  ? 0.260   -8.560  5.865   1.00 0.00 ?  294 ALA A HB2  4  
ATOM 7649  H HB3  . ALA A 1 81  ? -0.366  -8.996  7.473   1.00 0.00 ?  294 ALA A HB3  4  
ATOM 7650  N N    . PHE A 1 82  ? 0.252   -5.329  5.390   1.00 0.00 ?  295 PHE A N    4  
ATOM 7651  C CA   . PHE A 1 82  ? 0.265   -4.442  4.239   1.00 0.00 ?  295 PHE A CA   4  
ATOM 7652  C C    . PHE A 1 82  ? 1.379   -4.825  3.264   1.00 0.00 ?  295 PHE A C    4  
ATOM 7653  O O    . PHE A 1 82  ? 2.393   -5.393  3.667   1.00 0.00 ?  295 PHE A O    4  
ATOM 7654  C CB   . PHE A 1 82  ? 0.527   -3.030  4.767   1.00 0.00 ?  295 PHE A CB   4  
ATOM 7655  C CG   . PHE A 1 82  ? 1.523   -2.974  5.927   1.00 0.00 ?  295 PHE A CG   4  
ATOM 7656  C CD1  . PHE A 1 82  ? 1.110   -3.258  7.192   1.00 0.00 ?  295 PHE A CD1  4  
ATOM 7657  C CD2  . PHE A 1 82  ? 2.821   -2.641  5.694   1.00 0.00 ?  295 PHE A CD2  4  
ATOM 7658  C CE1  . PHE A 1 82  ? 2.034   -3.206  8.269   1.00 0.00 ?  295 PHE A CE1  4  
ATOM 7659  C CE2  . PHE A 1 82  ? 3.744   -2.589  6.772   1.00 0.00 ?  295 PHE A CE2  4  
ATOM 7660  C CZ   . PHE A 1 82  ? 3.331   -2.873  8.036   1.00 0.00 ?  295 PHE A CZ   4  
ATOM 7661  H H    . PHE A 1 82  ? 1.098   -5.344  5.922   1.00 0.00 ?  295 PHE A H    4  
ATOM 7662  H HA   . PHE A 1 82  ? -0.701  -4.542  3.743   1.00 0.00 ?  295 PHE A HA   4  
ATOM 7663  H HB2  . PHE A 1 82  ? 0.901   -2.412  3.950   1.00 0.00 ?  295 PHE A HB2  4  
ATOM 7664  H HB3  . PHE A 1 82  ? -0.417  -2.592  5.090   1.00 0.00 ?  295 PHE A HB3  4  
ATOM 7665  H HD1  . PHE A 1 82  ? 0.069   -3.525  7.378   1.00 0.00 ?  295 PHE A HD1  4  
ATOM 7666  H HD2  . PHE A 1 82  ? 3.152   -2.413  4.681   1.00 0.00 ?  295 PHE A HD2  4  
ATOM 7667  H HE1  . PHE A 1 82  ? 1.702   -3.433  9.282   1.00 0.00 ?  295 PHE A HE1  4  
ATOM 7668  H HE2  . PHE A 1 82  ? 4.785   -2.322  6.585   1.00 0.00 ?  295 PHE A HE2  4  
ATOM 7669  H HZ   . PHE A 1 82  ? 4.041   -2.833  8.863   1.00 0.00 ?  295 PHE A HZ   4  
ATOM 7670  N N    . PHE A 1 83  ? 1.154   -4.498  2.000   1.00 0.00 ?  296 PHE A N    4  
ATOM 7671  C CA   . PHE A 1 83  ? 2.127   -4.801  0.964   1.00 0.00 ?  296 PHE A CA   4  
ATOM 7672  C C    . PHE A 1 83  ? 1.831   -4.012  -0.313  1.00 0.00 ?  296 PHE A C    4  
ATOM 7673  O O    . PHE A 1 83  ? 0.674   -3.726  -0.617  1.00 0.00 ?  296 PHE A O    4  
ATOM 7674  C CB   . PHE A 1 83  ? 2.010   -6.296  0.664   1.00 0.00 ?  296 PHE A CB   4  
ATOM 7675  C CG   . PHE A 1 83  ? 0.628   -6.725  0.165   1.00 0.00 ?  296 PHE A CG   4  
ATOM 7676  C CD1  . PHE A 1 83  ? -0.382  -6.928  1.053   1.00 0.00 ?  296 PHE A CD1  4  
ATOM 7677  C CD2  . PHE A 1 83  ? 0.411   -6.903  -1.165  1.00 0.00 ?  296 PHE A CD2  4  
ATOM 7678  C CE1  . PHE A 1 83  ? -1.664  -7.326  0.590   1.00 0.00 ?  296 PHE A CE1  4  
ATOM 7679  C CE2  . PHE A 1 83  ? -0.871  -7.301  -1.628  1.00 0.00 ?  296 PHE A CE2  4  
ATOM 7680  C CZ   . PHE A 1 83  ? -1.882  -7.504  -0.741  1.00 0.00 ?  296 PHE A CZ   4  
ATOM 7681  H H    . PHE A 1 83  ? 0.326   -4.036  1.681   1.00 0.00 ?  296 PHE A H    4  
ATOM 7682  H HA   . PHE A 1 83  ? 3.107   -4.515  1.347   1.00 0.00 ?  296 PHE A HA   4  
ATOM 7683  H HB2  . PHE A 1 83  ? 2.755   -6.566  -0.085  1.00 0.00 ?  296 PHE A HB2  4  
ATOM 7684  H HB3  . PHE A 1 83  ? 2.249   -6.858  1.567   1.00 0.00 ?  296 PHE A HB3  4  
ATOM 7685  H HD1  . PHE A 1 83  ? -0.207  -6.785  2.119   1.00 0.00 ?  296 PHE A HD1  4  
ATOM 7686  H HD2  . PHE A 1 83  ? 1.220   -6.740  -1.877  1.00 0.00 ?  296 PHE A HD2  4  
ATOM 7687  H HE1  . PHE A 1 83  ? -2.474  -7.489  1.301   1.00 0.00 ?  296 PHE A HE1  4  
ATOM 7688  H HE2  . PHE A 1 83  ? -1.046  -7.444  -2.695  1.00 0.00 ?  296 PHE A HE2  4  
ATOM 7689  H HZ   . PHE A 1 83  ? -2.866  -7.809  -1.096  1.00 0.00 ?  296 PHE A HZ   4  
ATOM 7690  N N    . GLY A 1 84  ? 2.897   -3.682  -1.027  1.00 0.00 ?  297 GLY A N    4  
ATOM 7691  C CA   . GLY A 1 84  ? 2.767   -2.932  -2.265  1.00 0.00 ?  297 GLY A CA   4  
ATOM 7692  C C    . GLY A 1 84  ? 3.679   -1.704  -2.260  1.00 0.00 ?  297 GLY A C    4  
ATOM 7693  O O    . GLY A 1 84  ? 3.825   -1.030  -3.279  1.00 0.00 ?  297 GLY A O    4  
ATOM 7694  H H    . GLY A 1 84  ? 3.835   -3.919  -0.774  1.00 0.00 ?  297 GLY A H    4  
ATOM 7695  H HA2  . GLY A 1 84  ? 3.017   -3.572  -3.111  1.00 0.00 ?  297 GLY A HA2  4  
ATOM 7696  H HA3  . GLY A 1 84  ? 1.731   -2.620  -2.397  1.00 0.00 ?  297 GLY A HA3  4  
ATOM 7697  N N    . GLU A 1 85  ? 4.269   -1.449  -1.101  1.00 0.00 ?  298 GLU A N    4  
ATOM 7698  C CA   . GLU A 1 85  ? 5.163   -0.313  -0.951  1.00 0.00 ?  298 GLU A CA   4  
ATOM 7699  C C    . GLU A 1 85  ? 6.275   -0.370  -2.000  1.00 0.00 ?  298 GLU A C    4  
ATOM 7700  O O    . GLU A 1 85  ? 6.492   0.593   -2.733  1.00 0.00 ?  298 GLU A O    4  
ATOM 7701  C CB   . GLU A 1 85  ? 5.745   -0.258  0.463   1.00 0.00 ?  298 GLU A CB   4  
ATOM 7702  C CG   . GLU A 1 85  ? 6.988   0.633   0.510   1.00 0.00 ?  298 GLU A CG   4  
ATOM 7703  C CD   . GLU A 1 85  ? 7.483   0.809   1.947   1.00 0.00 ?  298 GLU A CD   4  
ATOM 7704  O OE1  . GLU A 1 85  ? 6.667   0.901   2.876   1.00 0.00 ?  298 GLU A OE1  4  
ATOM 7705  O OE2  . GLU A 1 85  ? 8.765   0.848   2.081   1.00 0.00 -1 298 GLU A OE2  4  
ATOM 7706  H H    . GLU A 1 85  ? 4.145   -2.002  -0.277  1.00 0.00 ?  298 GLU A H    4  
ATOM 7707  H HA   . GLU A 1 85  ? 4.543   0.568   -1.117  1.00 0.00 ?  298 GLU A HA   4  
ATOM 7708  H HB2  . GLU A 1 85  ? 4.994   0.124   1.155   1.00 0.00 ?  298 GLU A HB2  4  
ATOM 7709  H HB3  . GLU A 1 85  ? 6.001   -1.264  0.795   1.00 0.00 ?  298 GLU A HB3  4  
ATOM 7710  H HG2  . GLU A 1 85  ? 7.778   0.192   -0.099  1.00 0.00 ?  298 GLU A HG2  4  
ATOM 7711  H HG3  . GLU A 1 85  ? 6.759   1.607   0.078   1.00 0.00 ?  298 GLU A HG3  4  
ATOM 7712  H HE2  . GLU A 1 85  ? 9.142   1.604   1.546   1.00 0.00 ?  298 GLU A HE2  4  
ATOM 7713  N N    . MET A 1 86  ? 6.951   -1.509  -2.037  1.00 0.00 ?  299 MET A N    4  
ATOM 7714  C CA   . MET A 1 86  ? 8.036   -1.705  -2.984  1.00 0.00 ?  299 MET A CA   4  
ATOM 7715  C C    . MET A 1 86  ? 7.624   -1.260  -4.389  1.00 0.00 ?  299 MET A C    4  
ATOM 7716  O O    . MET A 1 86  ? 8.444   -0.739  -5.144  1.00 0.00 ?  299 MET A O    4  
ATOM 7717  C CB   . MET A 1 86  ? 8.430   -3.183  -3.012  1.00 0.00 ?  299 MET A CB   4  
ATOM 7718  C CG   . MET A 1 86  ? 9.827   -3.389  -2.424  1.00 0.00 ?  299 MET A CG   4  
ATOM 7719  S SD   . MET A 1 86  ? 9.782   -3.170  -0.653  1.00 0.00 ?  299 MET A SD   4  
ATOM 7720  C CE   . MET A 1 86  ? 10.630  -1.606  -0.512  1.00 0.00 ?  299 MET A CE   4  
ATOM 7721  H H    . MET A 1 86  ? 6.769   -2.288  -1.437  1.00 0.00 ?  299 MET A H    4  
ATOM 7722  H HA   . MET A 1 86  ? 8.855   -1.083  -2.624  1.00 0.00 ?  299 MET A HA   4  
ATOM 7723  H HB2  . MET A 1 86  ? 7.704   -3.767  -2.447  1.00 0.00 ?  299 MET A HB2  4  
ATOM 7724  H HB3  . MET A 1 86  ? 8.405   -3.550  -4.038  1.00 0.00 ?  299 MET A HB3  4  
ATOM 7725  H HG2  . MET A 1 86  ? 10.189  -4.388  -2.666  1.00 0.00 ?  299 MET A HG2  4  
ATOM 7726  H HG3  . MET A 1 86  ? 10.526  -2.681  -2.868  1.00 0.00 ?  299 MET A HG3  4  
ATOM 7727  H HE1  . MET A 1 86  ? 11.382  -1.669  0.274   1.00 0.00 ?  299 MET A HE1  4  
ATOM 7728  H HE2  . MET A 1 86  ? 11.114  -1.369  -1.460  1.00 0.00 ?  299 MET A HE2  4  
ATOM 7729  H HE3  . MET A 1 86  ? 9.912   -0.824  -0.266  1.00 0.00 ?  299 MET A HE3  4  
ATOM 7730  N N    . ALA A 1 87  ? 6.354   -1.481  -4.697  1.00 0.00 ?  300 ALA A N    4  
ATOM 7731  C CA   . ALA A 1 87  ? 5.824   -1.109  -5.997  1.00 0.00 ?  300 ALA A CA   4  
ATOM 7732  C C    . ALA A 1 87  ? 5.782   0.416   -6.109  1.00 0.00 ?  300 ALA A C    4  
ATOM 7733  O O    . ALA A 1 87  ? 6.207   0.981   -7.116  1.00 0.00 ?  300 ALA A O    4  
ATOM 7734  C CB   . ALA A 1 87  ? 4.446   -1.746  -6.188  1.00 0.00 ?  300 ALA A CB   4  
ATOM 7735  H H    . ALA A 1 87  ? 5.694   -1.905  -4.077  1.00 0.00 ?  300 ALA A H    4  
ATOM 7736  H HA   . ALA A 1 87  ? 6.501   -1.502  -6.756  1.00 0.00 ?  300 ALA A HA   4  
ATOM 7737  H HB1  . ALA A 1 87  ? 4.536   -2.618  -6.836  1.00 0.00 ?  300 ALA A HB1  4  
ATOM 7738  H HB2  . ALA A 1 87  ? 4.050   -2.052  -5.220  1.00 0.00 ?  300 ALA A HB2  4  
ATOM 7739  H HB3  . ALA A 1 87  ? 3.771   -1.022  -6.645  1.00 0.00 ?  300 ALA A HB3  4  
ATOM 7740  N N    . LEU A 1 88  ? 5.264   1.040   -5.061  1.00 0.00 ?  301 LEU A N    4  
ATOM 7741  C CA   . LEU A 1 88  ? 5.161   2.489   -5.028  1.00 0.00 ?  301 LEU A CA   4  
ATOM 7742  C C    . LEU A 1 88  ? 6.545   3.089   -4.771  1.00 0.00 ?  301 LEU A C    4  
ATOM 7743  O O    . LEU A 1 88  ? 6.704   4.309   -4.761  1.00 0.00 ?  301 LEU A O    4  
ATOM 7744  C CB   . LEU A 1 88  ? 4.102   2.928   -4.015  1.00 0.00 ?  301 LEU A CB   4  
ATOM 7745  C CG   . LEU A 1 88  ? 2.701   2.346   -4.214  1.00 0.00 ?  301 LEU A CG   4  
ATOM 7746  C CD1  . LEU A 1 88  ? 2.273   1.521   -2.998  1.00 0.00 ?  301 LEU A CD1  4  
ATOM 7747  C CD2  . LEU A 1 88  ? 1.692   3.447   -4.544  1.00 0.00 ?  301 LEU A CD2  4  
ATOM 7748  H H    . LEU A 1 88  ? 4.921   0.574   -4.246  1.00 0.00 ?  301 LEU A H    4  
ATOM 7749  H HA   . LEU A 1 88  ? 4.821   2.814   -6.011  1.00 0.00 ?  301 LEU A HA   4  
ATOM 7750  H HB2  . LEU A 1 88  ? 4.448   2.658   -3.017  1.00 0.00 ?  301 LEU A HB2  4  
ATOM 7751  H HB3  . LEU A 1 88  ? 4.029   4.015   -4.043  1.00 0.00 ?  301 LEU A HB3  4  
ATOM 7752  H HG   . LEU A 1 88  ? 2.731   1.669   -5.068  1.00 0.00 ?  301 LEU A HG   4  
ATOM 7753  H HD11 . LEU A 1 88  ? 3.156   1.216   -2.437  1.00 0.00 ?  301 LEU A HD11 4  
ATOM 7754  H HD12 . LEU A 1 88  ? 1.627   2.124   -2.360  1.00 0.00 ?  301 LEU A HD12 4  
ATOM 7755  H HD13 . LEU A 1 88  ? 1.730   0.637   -3.333  1.00 0.00 ?  301 LEU A HD13 4  
ATOM 7756  H HD21 . LEU A 1 88  ? 1.611   3.553   -5.626  1.00 0.00 ?  301 LEU A HD21 4  
ATOM 7757  H HD22 . LEU A 1 88  ? 0.718   3.183   -4.132  1.00 0.00 ?  301 LEU A HD22 4  
ATOM 7758  H HD23 . LEU A 1 88  ? 2.026   4.389   -4.111  1.00 0.00 ?  301 LEU A HD23 4  
ATOM 7759  N N    . ILE A 1 89  ? 7.510   2.205   -4.569  1.00 0.00 ?  302 ILE A N    4  
ATOM 7760  C CA   . ILE A 1 89  ? 8.875   2.632   -4.312  1.00 0.00 ?  302 ILE A CA   4  
ATOM 7761  C C    . ILE A 1 89  ? 9.601   2.832   -5.643  1.00 0.00 ?  302 ILE A C    4  
ATOM 7762  O O    . ILE A 1 89  ? 10.155  3.900   -5.898  1.00 0.00 ?  302 ILE A O    4  
ATOM 7763  C CB   . ILE A 1 89  ? 9.575   1.650   -3.370  1.00 0.00 ?  302 ILE A CB   4  
ATOM 7764  C CG1  . ILE A 1 89  ? 9.131   1.867   -1.923  1.00 0.00 ?  302 ILE A CG1  4  
ATOM 7765  C CG2  . ILE A 1 89  ? 11.095  1.735   -3.522  1.00 0.00 ?  302 ILE A CG2  4  
ATOM 7766  C CD1  . ILE A 1 89  ? 9.710   3.166   -1.360  1.00 0.00 ?  302 ILE A CD1  4  
ATOM 7767  H H    . ILE A 1 89  ? 7.372   1.214   -4.578  1.00 0.00 ?  302 ILE A H    4  
ATOM 7768  H HA   . ILE A 1 89  ? 8.825   3.592   -3.798  1.00 0.00 ?  302 ILE A HA   4  
ATOM 7769  H HB   . ILE A 1 89  ? 9.280   0.639   -3.650  1.00 0.00 ?  302 ILE A HB   4  
ATOM 7770  H HG12 . ILE A 1 89  ? 8.042   1.897   -1.873  1.00 0.00 ?  302 ILE A HG12 4  
ATOM 7771  H HG13 . ILE A 1 89  ? 9.454   1.025   -1.310  1.00 0.00 ?  302 ILE A HG13 4  
ATOM 7772  H HG21 . ILE A 1 89  ? 11.364  2.698   -3.957  1.00 0.00 ?  302 ILE A HG21 4  
ATOM 7773  H HG22 . ILE A 1 89  ? 11.565  1.635   -2.543  1.00 0.00 ?  302 ILE A HG22 4  
ATOM 7774  H HG23 . ILE A 1 89  ? 11.441  0.933   -4.174  1.00 0.00 ?  302 ILE A HG23 4  
ATOM 7775  H HD11 . ILE A 1 89  ? 10.442  3.570   -2.058  1.00 0.00 ?  302 ILE A HD11 4  
ATOM 7776  H HD12 . ILE A 1 89  ? 8.907   3.890   -1.217  1.00 0.00 ?  302 ILE A HD12 4  
ATOM 7777  H HD13 . ILE A 1 89  ? 10.192  2.965   -0.403  1.00 0.00 ?  302 ILE A HD13 4  
ATOM 7778  N N    . SER A 1 90  ? 9.575   1.787   -6.458  1.00 0.00 ?  303 SER A N    4  
ATOM 7779  C CA   . SER A 1 90  ? 10.223  1.835   -7.757  1.00 0.00 ?  303 SER A CA   4  
ATOM 7780  C C    . SER A 1 90  ? 9.478   0.938   -8.748  1.00 0.00 ?  303 SER A C    4  
ATOM 7781  O O    . SER A 1 90  ? 10.099  0.236   -9.544  1.00 0.00 ?  303 SER A O    4  
ATOM 7782  C CB   . SER A 1 90  ? 11.690  1.409   -7.656  1.00 0.00 ?  303 SER A CB   4  
ATOM 7783  O OG   . SER A 1 90  ? 12.560  2.527   -7.498  1.00 0.00 ?  303 SER A OG   4  
ATOM 7784  H H    . SER A 1 90  ? 9.121   0.922   -6.243  1.00 0.00 ?  303 SER A H    4  
ATOM 7785  H HA   . SER A 1 90  ? 10.169  2.878   -8.069  1.00 0.00 ?  303 SER A HA   4  
ATOM 7786  H HB2  . SER A 1 90  ? 11.813  0.731   -6.812  1.00 0.00 ?  303 SER A HB2  4  
ATOM 7787  H HB3  . SER A 1 90  ? 11.969  0.857   -8.553  1.00 0.00 ?  303 SER A HB3  4  
ATOM 7788  H HG   . SER A 1 90  ? 13.014  2.483   -6.608  1.00 0.00 ?  303 SER A HG   4  
ATOM 7789  N N    . GLY A 1 91  ? 8.156   0.991   -8.665  1.00 0.00 ?  304 GLY A N    4  
ATOM 7790  C CA   . GLY A 1 91  ? 7.319   0.192   -9.545  1.00 0.00 ?  304 GLY A CA   4  
ATOM 7791  C C    . GLY A 1 91  ? 7.946   -1.180  -9.801  1.00 0.00 ?  304 GLY A C    4  
ATOM 7792  O O    . GLY A 1 91  ? 7.809   -1.735  -10.890 1.00 0.00 ?  304 GLY A O    4  
ATOM 7793  H H    . GLY A 1 91  ? 7.659   1.564   -8.014  1.00 0.00 ?  304 GLY A H    4  
ATOM 7794  H HA2  . GLY A 1 91  ? 6.333   0.068   -9.099  1.00 0.00 ?  304 GLY A HA2  4  
ATOM 7795  H HA3  . GLY A 1 91  ? 7.178   0.714   -10.491 1.00 0.00 ?  304 GLY A HA3  4  
ATOM 7796  N N    . GLU A 1 92  ? 8.621   -1.687  -8.780  1.00 0.00 ?  305 GLU A N    4  
ATOM 7797  C CA   . GLU A 1 92  ? 9.270   -2.983  -8.882  1.00 0.00 ?  305 GLU A CA   4  
ATOM 7798  C C    . GLU A 1 92  ? 8.223   -4.091  -9.017  1.00 0.00 ?  305 GLU A C    4  
ATOM 7799  O O    . GLU A 1 92  ? 7.081   -3.927  -8.591  1.00 0.00 ?  305 GLU A O    4  
ATOM 7800  C CB   . GLU A 1 92  ? 10.182  -3.235  -7.680  1.00 0.00 ?  305 GLU A CB   4  
ATOM 7801  C CG   . GLU A 1 92  ? 9.363   -3.479  -6.411  1.00 0.00 ?  305 GLU A CG   4  
ATOM 7802  C CD   . GLU A 1 92  ? 9.715   -4.828  -5.781  1.00 0.00 ?  305 GLU A CD   4  
ATOM 7803  O OE1  . GLU A 1 92  ? 8.831   -5.680  -5.606  1.00 0.00 ?  305 GLU A OE1  4  
ATOM 7804  O OE2  . GLU A 1 92  ? 10.958  -4.978  -5.472  1.00 0.00 -1 305 GLU A OE2  4  
ATOM 7805  H H    . GLU A 1 92  ? 8.728   -1.228  -7.898  1.00 0.00 ?  305 GLU A H    4  
ATOM 7806  H HA   . GLU A 1 92  ? 9.876   -2.934  -9.786  1.00 0.00 ?  305 GLU A HA   4  
ATOM 7807  H HB2  . GLU A 1 92  ? 10.819  -4.097  -7.877  1.00 0.00 ?  305 GLU A HB2  4  
ATOM 7808  H HB3  . GLU A 1 92  ? 10.841  -2.379  -7.533  1.00 0.00 ?  305 GLU A HB3  4  
ATOM 7809  H HG2  . GLU A 1 92  ? 9.550   -2.679  -5.694  1.00 0.00 ?  305 GLU A HG2  4  
ATOM 7810  H HG3  . GLU A 1 92  ? 8.300   -3.451  -6.649  1.00 0.00 ?  305 GLU A HG3  4  
ATOM 7811  H HE2  . GLU A 1 92  ? 11.324  -4.123  -5.103  1.00 0.00 ?  305 GLU A HE2  4  
ATOM 7812  N N    . PRO A 1 93  ? 8.661   -5.224  -9.629  1.00 0.00 ?  306 PRO A N    4  
ATOM 7813  C CA   . PRO A 1 93  ? 7.775   -6.358  -9.826  1.00 0.00 ?  306 PRO A CA   4  
ATOM 7814  C C    . PRO A 1 93  ? 7.550   -7.113  -8.514  1.00 0.00 ?  306 PRO A C    4  
ATOM 7815  O O    . PRO A 1 93  ? 8.505   -7.458  -7.820  1.00 0.00 ?  306 PRO A O    4  
ATOM 7816  C CB   . PRO A 1 93  ? 8.453   -7.207  -10.890 1.00 0.00 ?  306 PRO A CB   4  
ATOM 7817  C CG   . PRO A 1 93  ? 9.907   -6.763  -10.913 1.00 0.00 ?  306 PRO A CG   4  
ATOM 7818  C CD   . PRO A 1 93  ? 10.007  -5.454  -10.147 1.00 0.00 ?  306 PRO A CD   4  
ATOM 7819  H HA   . PRO A 1 93  ? 6.872   -6.046  -10.121 1.00 0.00 ?  306 PRO A HA   4  
ATOM 7820  H HB2  . PRO A 1 93  ? 8.373   -8.268  -10.653 1.00 0.00 ?  306 PRO A HB2  4  
ATOM 7821  H HB3  . PRO A 1 93  ? 7.984   -7.061  -11.863 1.00 0.00 ?  306 PRO A HB3  4  
ATOM 7822  H HG2  . PRO A 1 93  ? 10.545  -7.521  -10.459 1.00 0.00 ?  306 PRO A HG2  4  
ATOM 7823  H HG3  . PRO A 1 93  ? 10.249  -6.631  -11.940 1.00 0.00 ?  306 PRO A HG3  4  
ATOM 7824  H HD2  . PRO A 1 93  ? 10.736  -5.522  -9.339  1.00 0.00 ?  306 PRO A HD2  4  
ATOM 7825  H HD3  . PRO A 1 93  ? 10.326  -4.638  -10.796 1.00 0.00 ?  306 PRO A HD3  4  
ATOM 7826  N N    . ARG A 1 94  ? 6.281   -7.347  -8.214  1.00 0.00 ?  307 ARG A N    4  
ATOM 7827  C CA   . ARG A 1 94  ? 5.918   -8.053  -6.997  1.00 0.00 ?  307 ARG A CA   4  
ATOM 7828  C C    . ARG A 1 94  ? 6.796   -9.294  -6.822  1.00 0.00 ?  307 ARG A C    4  
ATOM 7829  O O    . ARG A 1 94  ? 7.063   -9.717  -5.698  1.00 0.00 ?  307 ARG A O    4  
ATOM 7830  C CB   . ARG A 1 94  ? 4.448   -8.477  -7.024  1.00 0.00 ?  307 ARG A CB   4  
ATOM 7831  C CG   . ARG A 1 94  ? 3.719   -8.007  -5.765  1.00 0.00 ?  307 ARG A CG   4  
ATOM 7832  C CD   . ARG A 1 94  ? 3.321   -6.534  -5.879  1.00 0.00 ?  307 ARG A CD   4  
ATOM 7833  N NE   . ARG A 1 94  ? 1.847   -6.408  -5.910  1.00 0.00 ?  307 ARG A NE   4  
ATOM 7834  C CZ   . ARG A 1 94  ? 1.196   -5.260  -6.145  1.00 0.00 ?  307 ARG A CZ   4  
ATOM 7835  N NH1  . ARG A 1 94  ? 1.885   -4.133  -6.370  1.00 0.00 ?  307 ARG A NH1  4  
ATOM 7836  N NH2  . ARG A 1 94  ? -0.144  -5.240  -6.154  1.00 0.00 1  307 ARG A NH2  4  
ATOM 7837  H H    . ARG A 1 94  ? 5.510   -7.063  -8.784  1.00 0.00 ?  307 ARG A H    4  
ATOM 7838  H HA   . ARG A 1 94  ? 6.090   -7.335  -6.196  1.00 0.00 ?  307 ARG A HA   4  
ATOM 7839  H HB2  . ARG A 1 94  ? 3.962   -8.062  -7.907  1.00 0.00 ?  307 ARG A HB2  4  
ATOM 7840  H HB3  . ARG A 1 94  ? 4.380   -9.562  -7.104  1.00 0.00 ?  307 ARG A HB3  4  
ATOM 7841  H HG2  . ARG A 1 94  ? 2.828   -8.616  -5.606  1.00 0.00 ?  307 ARG A HG2  4  
ATOM 7842  H HG3  . ARG A 1 94  ? 4.360   -8.148  -4.894  1.00 0.00 ?  307 ARG A HG3  4  
ATOM 7843  H HD2  . ARG A 1 94  ? 3.725   -5.973  -5.036  1.00 0.00 ?  307 ARG A HD2  4  
ATOM 7844  H HD3  . ARG A 1 94  ? 3.751   -6.102  -6.783  1.00 0.00 ?  307 ARG A HD3  4  
ATOM 7845  H HE   . ARG A 1 94  ? 1.303   -7.230  -5.746  1.00 0.00 ?  307 ARG A HE   4  
ATOM 7846  H HH11 . ARG A 1 94  ? 2.884   -4.148  -6.364  1.00 0.00 ?  307 ARG A HH11 4  
ATOM 7847  H HH12 . ARG A 1 94  ? 1.398   -3.277  -6.545  1.00 0.00 ?  307 ARG A HH12 4  
ATOM 7848  H HH21 . ARG A 1 94  ? -0.658  -6.081  -5.986  1.00 0.00 ?  307 ARG A HH21 4  
ATOM 7849  H HH22 . ARG A 1 94  ? -0.630  -4.384  -6.329  1.00 0.00 ?  307 ARG A HH22 4  
ATOM 7850  N N    . SER A 1 95  ? 7.222   -9.843  -7.950  1.00 0.00 ?  308 SER A N    4  
ATOM 7851  C CA   . SER A 1 95  ? 8.065   -11.026 -7.936  1.00 0.00 ?  308 SER A CA   4  
ATOM 7852  C C    . SER A 1 95  ? 7.439   -12.103 -7.047  1.00 0.00 ?  308 SER A C    4  
ATOM 7853  O O    . SER A 1 95  ? 8.142   -12.780 -6.298  1.00 0.00 ?  308 SER A O    4  
ATOM 7854  C CB   . SER A 1 95  ? 9.476   -10.691 -7.450  1.00 0.00 ?  308 SER A CB   4  
ATOM 7855  O OG   . SER A 1 95  ? 10.472  -11.078 -8.394  1.00 0.00 ?  308 SER A OG   4  
ATOM 7856  H H    . SER A 1 95  ? 7.001   -9.493  -8.861  1.00 0.00 ?  308 SER A H    4  
ATOM 7857  H HA   . SER A 1 95  ? 8.108   -11.363 -8.972  1.00 0.00 ?  308 SER A HA   4  
ATOM 7858  H HB2  . SER A 1 95  ? 9.551   -9.620  -7.263  1.00 0.00 ?  308 SER A HB2  4  
ATOM 7859  H HB3  . SER A 1 95  ? 9.662   -11.194 -6.501  1.00 0.00 ?  308 SER A HB3  4  
ATOM 7860  H HG   . SER A 1 95  ? 11.242  -10.442 -8.358  1.00 0.00 ?  308 SER A HG   4  
ATOM 7861  N N    . ALA A 1 96  ? 6.125   -12.228 -7.159  1.00 0.00 ?  309 ALA A N    4  
ATOM 7862  C CA   . ALA A 1 96  ? 5.397   -13.211 -6.375  1.00 0.00 ?  309 ALA A CA   4  
ATOM 7863  C C    . ALA A 1 96  ? 3.896   -13.046 -6.624  1.00 0.00 ?  309 ALA A C    4  
ATOM 7864  O O    . ALA A 1 96  ? 3.453   -11.998 -7.091  1.00 0.00 ?  309 ALA A O    4  
ATOM 7865  C CB   . ALA A 1 96  ? 5.763   -13.058 -4.897  1.00 0.00 ?  309 ALA A CB   4  
ATOM 7866  H H    . ALA A 1 96  ? 5.561   -11.673 -7.771  1.00 0.00 ?  309 ALA A H    4  
ATOM 7867  H HA   . ALA A 1 96  ? 5.706   -14.200 -6.713  1.00 0.00 ?  309 ALA A HA   4  
ATOM 7868  H HB1  . ALA A 1 96  ? 6.139   -12.051 -4.718  1.00 0.00 ?  309 ALA A HB1  4  
ATOM 7869  H HB2  . ALA A 1 96  ? 4.878   -13.230 -4.285  1.00 0.00 ?  309 ALA A HB2  4  
ATOM 7870  H HB3  . ALA A 1 96  ? 6.532   -13.785 -4.637  1.00 0.00 ?  309 ALA A HB3  4  
ATOM 7871  N N    . THR A 1 97  ? 3.156   -14.097 -6.302  1.00 0.00 ?  310 THR A N    4  
ATOM 7872  C CA   . THR A 1 97  ? 1.715   -14.081 -6.485  1.00 0.00 ?  310 THR A CA   4  
ATOM 7873  C C    . THR A 1 97  ? 1.005   -14.237 -5.139  1.00 0.00 ?  310 THR A C    4  
ATOM 7874  O O    . THR A 1 97  ? 1.235   -15.209 -4.421  1.00 0.00 ?  310 THR A O    4  
ATOM 7875  C CB   . THR A 1 97  ? 1.355   -15.175 -7.493  1.00 0.00 ?  310 THR A CB   4  
ATOM 7876  O OG1  . THR A 1 97  ? 1.232   -14.479 -8.731  1.00 0.00 ?  310 THR A OG1  4  
ATOM 7877  C CG2  . THR A 1 97  ? -0.040  -15.756 -7.253  1.00 0.00 ?  310 THR A CG2  4  
ATOM 7878  H H    . THR A 1 97  ? 3.525   -14.945 -5.923  1.00 0.00 ?  310 THR A H    4  
ATOM 7879  H HA   . THR A 1 97  ? 1.430   -13.108 -6.886  1.00 0.00 ?  310 THR A HA   4  
ATOM 7880  H HB   . THR A 1 97  ? 2.109   -15.962 -7.499  1.00 0.00 ?  310 THR A HB   4  
ATOM 7881  H HG1  . THR A 1 97  ? 0.757   -15.052 -9.399  1.00 0.00 ?  310 THR A HG1  4  
ATOM 7882  H HG21 . THR A 1 97  ? -0.792  -14.993 -7.455  1.00 0.00 ?  310 THR A HG21 4  
ATOM 7883  H HG22 . THR A 1 97  ? -0.198  -16.607 -7.915  1.00 0.00 ?  310 THR A HG22 4  
ATOM 7884  H HG23 . THR A 1 97  ? -0.124  -16.082 -6.216  1.00 0.00 ?  310 THR A HG23 4  
ATOM 7885  N N    . VAL A 1 98  ? 0.156   -13.266 -4.838  1.00 0.00 ?  311 VAL A N    4  
ATOM 7886  C CA   . VAL A 1 98  ? -0.589  -13.283 -3.591  1.00 0.00 ?  311 VAL A CA   4  
ATOM 7887  C C    . VAL A 1 98  ? -2.035  -13.697 -3.872  1.00 0.00 ?  311 VAL A C    4  
ATOM 7888  O O    . VAL A 1 98  ? -2.674  -13.162 -4.776  1.00 0.00 ?  311 VAL A O    4  
ATOM 7889  C CB   . VAL A 1 98  ? -0.481  -11.923 -2.897  1.00 0.00 ?  311 VAL A CB   4  
ATOM 7890  C CG1  . VAL A 1 98  ? -1.340  -11.883 -1.632  1.00 0.00 ?  311 VAL A CG1  4  
ATOM 7891  C CG2  . VAL A 1 98  ? 0.977   -11.584 -2.581  1.00 0.00 ?  311 VAL A CG2  4  
ATOM 7892  H H    . VAL A 1 98  ? -0.025  -12.479 -5.428  1.00 0.00 ?  311 VAL A H    4  
ATOM 7893  H HA   . VAL A 1 98  ? -0.130  -14.030 -2.943  1.00 0.00 ?  311 VAL A HA   4  
ATOM 7894  H HB   . VAL A 1 98  ? -0.860  -11.166 -3.584  1.00 0.00 ?  311 VAL A HB   4  
ATOM 7895  H HG11 . VAL A 1 98  ? -2.217  -12.517 -1.768  1.00 0.00 ?  311 VAL A HG11 4  
ATOM 7896  H HG12 . VAL A 1 98  ? -0.758  -12.246 -0.785  1.00 0.00 ?  311 VAL A HG12 4  
ATOM 7897  H HG13 . VAL A 1 98  ? -1.659  -10.858 -1.442  1.00 0.00 ?  311 VAL A HG13 4  
ATOM 7898  H HG21 . VAL A 1 98  ? 1.610   -11.893 -3.413  1.00 0.00 ?  311 VAL A HG21 4  
ATOM 7899  H HG22 . VAL A 1 98  ? 1.075   -10.508 -2.431  1.00 0.00 ?  311 VAL A HG22 4  
ATOM 7900  H HG23 . VAL A 1 98  ? 1.284   -12.107 -1.676  1.00 0.00 ?  311 VAL A HG23 4  
ATOM 7901  N N    . SER A 1 99  ? -2.509  -14.648 -3.079  1.00 0.00 ?  312 SER A N    4  
ATOM 7902  C CA   . SER A 1 99  ? -3.868  -15.140 -3.231  1.00 0.00 ?  312 SER A CA   4  
ATOM 7903  C C    . SER A 1 99  ? -4.568  -15.172 -1.871  1.00 0.00 ?  312 SER A C    4  
ATOM 7904  O O    . SER A 1 99  ? -3.920  -15.334 -0.839  1.00 0.00 ?  312 SER A O    4  
ATOM 7905  C CB   . SER A 1 99  ? -3.881  -16.532 -3.868  1.00 0.00 ?  312 SER A CB   4  
ATOM 7906  O OG   . SER A 1 99  ? -3.111  -17.468 -3.119  1.00 0.00 ?  312 SER A OG   4  
ATOM 7907  H H    . SER A 1 99  ? -1.983  -15.078 -2.346  1.00 0.00 ?  312 SER A H    4  
ATOM 7908  H HA   . SER A 1 99  ? -4.359  -14.432 -3.898  1.00 0.00 ?  312 SER A HA   4  
ATOM 7909  H HB2  . SER A 1 99  ? -4.909  -16.886 -3.943  1.00 0.00 ?  312 SER A HB2  4  
ATOM 7910  H HB3  . SER A 1 99  ? -3.490  -16.470 -4.883  1.00 0.00 ?  312 SER A HB3  4  
ATOM 7911  H HG   . SER A 1 99  ? -2.608  -16.997 -2.395  1.00 0.00 ?  312 SER A HG   4  
ATOM 7912  N N    . ALA A 1 100 ? -5.883  -15.015 -1.915  1.00 0.00 ?  313 ALA A N    4  
ATOM 7913  C CA   . ALA A 1 100 ? -6.678  -15.023 -0.699  1.00 0.00 ?  313 ALA A CA   4  
ATOM 7914  C C    . ALA A 1 100 ? -7.064  -16.464 -0.357  1.00 0.00 ?  313 ALA A C    4  
ATOM 7915  O O    . ALA A 1 100 ? -7.878  -17.074 -1.048  1.00 0.00 ?  313 ALA A O    4  
ATOM 7916  C CB   . ALA A 1 100 ? -7.900  -14.121 -0.882  1.00 0.00 ?  313 ALA A CB   4  
ATOM 7917  H H    . ALA A 1 100 ? -6.403  -14.884 -2.759  1.00 0.00 ?  313 ALA A H    4  
ATOM 7918  H HA   . ALA A 1 100 ? -6.061  -14.620 0.104   1.00 0.00 ?  313 ALA A HA   4  
ATOM 7919  H HB1  . ALA A 1 100 ? -7.920  -13.371 -0.091  1.00 0.00 ?  313 ALA A HB1  4  
ATOM 7920  H HB2  . ALA A 1 100 ? -7.844  -13.626 -1.851  1.00 0.00 ?  313 ALA A HB2  4  
ATOM 7921  H HB3  . ALA A 1 100 ? -8.807  -14.723 -0.834  1.00 0.00 ?  313 ALA A HB3  4  
ATOM 7922  N N    . ALA A 1 101 ? -6.460  -16.966 0.711   1.00 0.00 ?  314 ALA A N    4  
ATOM 7923  C CA   . ALA A 1 101 ? -6.729  -18.323 1.153   1.00 0.00 ?  314 ALA A CA   4  
ATOM 7924  C C    . ALA A 1 101 ? -8.231  -18.487 1.398   1.00 0.00 ?  314 ALA A C    4  
ATOM 7925  O O    . ALA A 1 101 ? -8.782  -19.569 1.200   1.00 0.00 ?  314 ALA A O    4  
ATOM 7926  C CB   . ALA A 1 101 ? -5.899  -18.628 2.401   1.00 0.00 ?  314 ALA A CB   4  
ATOM 7927  H H    . ALA A 1 101 ? -5.799  -16.463 1.268   1.00 0.00 ?  314 ALA A H    4  
ATOM 7928  H HA   . ALA A 1 101 ? -6.424  -19.000 0.354   1.00 0.00 ?  314 ALA A HA   4  
ATOM 7929  H HB1  . ALA A 1 101 ? -6.097  -19.648 2.730   1.00 0.00 ?  314 ALA A HB1  4  
ATOM 7930  H HB2  . ALA A 1 101 ? -4.839  -18.522 2.167   1.00 0.00 ?  314 ALA A HB2  4  
ATOM 7931  H HB3  . ALA A 1 101 ? -6.167  -17.932 3.196   1.00 0.00 ?  314 ALA A HB3  4  
ATOM 7932  N N    . THR A 1 102 ? -8.850  -17.396 1.825   1.00 0.00 ?  315 THR A N    4  
ATOM 7933  C CA   . THR A 1 102 ? -10.277 -17.405 2.099   1.00 0.00 ?  315 THR A CA   4  
ATOM 7934  C C    . THR A 1 102 ? -10.860 -15.999 1.940   1.00 0.00 ?  315 THR A C    4  
ATOM 7935  O O    . THR A 1 102 ? -10.175 -15.089 1.476   1.00 0.00 ?  315 THR A O    4  
ATOM 7936  C CB   . THR A 1 102 ? -10.487 -17.995 3.495   1.00 0.00 ?  315 THR A CB   4  
ATOM 7937  O OG1  . THR A 1 102 ? -11.899 -17.954 3.681   1.00 0.00 ?  315 THR A OG1  4  
ATOM 7938  C CG2  . THR A 1 102 ? -9.939  -17.091 4.601   1.00 0.00 ?  315 THR A CG2  4  
ATOM 7939  H H    . THR A 1 102 ? -8.395  -16.520 1.984   1.00 0.00 ?  315 THR A H    4  
ATOM 7940  H HA   . THR A 1 102 ? -10.765 -18.039 1.359   1.00 0.00 ?  315 THR A HA   4  
ATOM 7941  H HB   . THR A 1 102 ? -10.060 -18.996 3.564   1.00 0.00 ?  315 THR A HB   4  
ATOM 7942  H HG1  . THR A 1 102 ? -12.326 -18.739 3.232   1.00 0.00 ?  315 THR A HG1  4  
ATOM 7943  H HG21 . THR A 1 102 ? -10.315 -16.077 4.461   1.00 0.00 ?  315 THR A HG21 4  
ATOM 7944  H HG22 . THR A 1 102 ? -10.263 -17.467 5.572   1.00 0.00 ?  315 THR A HG22 4  
ATOM 7945  H HG23 . THR A 1 102 ? -8.850  -17.084 4.559   1.00 0.00 ?  315 THR A HG23 4  
ATOM 7946  N N    . THR A 1 103 ? -12.118 -15.867 2.333   1.00 0.00 ?  316 THR A N    4  
ATOM 7947  C CA   . THR A 1 103 ? -12.800 -14.587 2.239   1.00 0.00 ?  316 THR A CA   4  
ATOM 7948  C C    . THR A 1 103 ? -12.001 -13.503 2.964   1.00 0.00 ?  316 THR A C    4  
ATOM 7949  O O    . THR A 1 103 ? -12.226 -13.247 4.146   1.00 0.00 ?  316 THR A O    4  
ATOM 7950  C CB   . THR A 1 103 ? -14.218 -14.766 2.787   1.00 0.00 ?  316 THR A CB   4  
ATOM 7951  O OG1  . THR A 1 103 ? -14.024 -15.012 4.177   1.00 0.00 ?  316 THR A OG1  4  
ATOM 7952  C CG2  . THR A 1 103 ? -14.887 -16.042 2.272   1.00 0.00 ?  316 THR A CG2  4  
ATOM 7953  H H    . THR A 1 103 ? -12.668 -16.613 2.709   1.00 0.00 ?  316 THR A H    4  
ATOM 7954  H HA   . THR A 1 103 ? -12.849 -14.300 1.189   1.00 0.00 ?  316 THR A HA   4  
ATOM 7955  H HB   . THR A 1 103 ? -14.831 -13.891 2.572   1.00 0.00 ?  316 THR A HB   4  
ATOM 7956  H HG1  . THR A 1 103 ? -13.365 -15.753 4.305   1.00 0.00 ?  316 THR A HG1  4  
ATOM 7957  H HG21 . THR A 1 103 ? -15.931 -15.835 2.037   1.00 0.00 ?  316 THR A HG21 4  
ATOM 7958  H HG22 . THR A 1 103 ? -14.374 -16.385 1.374   1.00 0.00 ?  316 THR A HG22 4  
ATOM 7959  H HG23 . THR A 1 103 ? -14.834 -16.815 3.039   1.00 0.00 ?  316 THR A HG23 4  
ATOM 7960  N N    . VAL A 1 104 ? -11.085 -12.894 2.226   1.00 0.00 ?  317 VAL A N    4  
ATOM 7961  C CA   . VAL A 1 104 ? -10.251 -11.843 2.784   1.00 0.00 ?  317 VAL A CA   4  
ATOM 7962  C C    . VAL A 1 104 ? -10.689 -10.493 2.211   1.00 0.00 ?  317 VAL A C    4  
ATOM 7963  O O    . VAL A 1 104 ? -11.076 -10.405 1.047   1.00 0.00 ?  317 VAL A O    4  
ATOM 7964  C CB   . VAL A 1 104 ? -8.775  -12.152 2.524   1.00 0.00 ?  317 VAL A CB   4  
ATOM 7965  C CG1  . VAL A 1 104 ? -7.872  -11.107 3.183   1.00 0.00 ?  317 VAL A CG1  4  
ATOM 7966  C CG2  . VAL A 1 104 ? -8.419  -13.562 2.999   1.00 0.00 ?  317 VAL A CG2  4  
ATOM 7967  H H    . VAL A 1 104 ? -10.909 -13.108 1.265   1.00 0.00 ?  317 VAL A H    4  
ATOM 7968  H HA   . VAL A 1 104 ? -10.410 -11.835 3.862   1.00 0.00 ?  317 VAL A HA   4  
ATOM 7969  H HB   . VAL A 1 104 ? -8.608  -12.109 1.448   1.00 0.00 ?  317 VAL A HB   4  
ATOM 7970  H HG11 . VAL A 1 104 ? -6.930  -11.046 2.638   1.00 0.00 ?  317 VAL A HG11 4  
ATOM 7971  H HG12 . VAL A 1 104 ? -8.367  -10.136 3.164   1.00 0.00 ?  317 VAL A HG12 4  
ATOM 7972  H HG13 . VAL A 1 104 ? -7.676  -11.396 4.215   1.00 0.00 ?  317 VAL A HG13 4  
ATOM 7973  H HG21 . VAL A 1 104 ? -9.232  -13.956 3.610   1.00 0.00 ?  317 VAL A HG21 4  
ATOM 7974  H HG22 . VAL A 1 104 ? -8.269  -14.209 2.135   1.00 0.00 ?  317 VAL A HG22 4  
ATOM 7975  H HG23 . VAL A 1 104 ? -7.504  -13.527 3.590   1.00 0.00 ?  317 VAL A HG23 4  
ATOM 7976  N N    . SER A 1 105 ? -10.612 -9.475  3.056   1.00 0.00 ?  318 SER A N    4  
ATOM 7977  C CA   . SER A 1 105 ? -10.996 -8.134  2.648   1.00 0.00 ?  318 SER A CA   4  
ATOM 7978  C C    . SER A 1 105 ? -9.791  -7.196  2.737   1.00 0.00 ?  318 SER A C    4  
ATOM 7979  O O    . SER A 1 105 ? -9.243  -6.984  3.819   1.00 0.00 ?  318 SER A O    4  
ATOM 7980  C CB   . SER A 1 105 ? -12.146 -7.605  3.508   1.00 0.00 ?  318 SER A CB   4  
ATOM 7981  O OG   . SER A 1 105 ? -13.321 -8.400  3.374   1.00 0.00 ?  318 SER A OG   4  
ATOM 7982  H H    . SER A 1 105 ? -10.296 -9.556  4.001   1.00 0.00 ?  318 SER A H    4  
ATOM 7983  H HA   . SER A 1 105 ? -11.330 -8.231  1.615   1.00 0.00 ?  318 SER A HA   4  
ATOM 7984  H HB2  . SER A 1 105 ? -11.838 -7.586  4.553   1.00 0.00 ?  318 SER A HB2  4  
ATOM 7985  H HB3  . SER A 1 105 ? -12.368 -6.577  3.222   1.00 0.00 ?  318 SER A HB3  4  
ATOM 7986  H HG   . SER A 1 105 ? -13.857 -8.089  2.589   1.00 0.00 ?  318 SER A HG   4  
ATOM 7987  N N    . LEU A 1 106 ? -9.413  -6.659  1.587   1.00 0.00 ?  319 LEU A N    4  
ATOM 7988  C CA   . LEU A 1 106 ? -8.283  -5.748  1.522   1.00 0.00 ?  319 LEU A CA   4  
ATOM 7989  C C    . LEU A 1 106 ? -8.704  -4.470  0.793   1.00 0.00 ?  319 LEU A C    4  
ATOM 7990  O O    . LEU A 1 106 ? -9.811  -4.390  0.262   1.00 0.00 ?  319 LEU A O    4  
ATOM 7991  C CB   . LEU A 1 106 ? -7.071  -6.441  0.896   1.00 0.00 ?  319 LEU A CB   4  
ATOM 7992  C CG   . LEU A 1 106 ? -7.365  -7.708  0.090   1.00 0.00 ?  319 LEU A CG   4  
ATOM 7993  C CD1  . LEU A 1 106 ? -6.369  -7.870  -1.060  1.00 0.00 ?  319 LEU A CD1  4  
ATOM 7994  C CD2  . LEU A 1 106 ? -7.399  -8.940  0.997   1.00 0.00 ?  319 LEU A CD2  4  
ATOM 7995  H H    . LEU A 1 106 ? -9.863  -6.836  0.712   1.00 0.00 ?  319 LEU A H    4  
ATOM 7996  H HA   . LEU A 1 106 ? -8.012  -5.488  2.545   1.00 0.00 ?  319 LEU A HA   4  
ATOM 7997  H HB2  . LEU A 1 106 ? -6.566  -5.729  0.244   1.00 0.00 ?  319 LEU A HB2  4  
ATOM 7998  H HB3  . LEU A 1 106 ? -6.372  -6.696  1.693   1.00 0.00 ?  319 LEU A HB3  4  
ATOM 7999  H HG   . LEU A 1 106 ? -8.356  -7.608  -0.354  1.00 0.00 ?  319 LEU A HG   4  
ATOM 8000  H HD11 . LEU A 1 106 ? -5.929  -8.867  -1.022  1.00 0.00 ?  319 LEU A HD11 4  
ATOM 8001  H HD12 . LEU A 1 106 ? -6.886  -7.737  -2.010  1.00 0.00 ?  319 LEU A HD12 4  
ATOM 8002  H HD13 . LEU A 1 106 ? -5.582  -7.122  -0.967  1.00 0.00 ?  319 LEU A HD13 4  
ATOM 8003  H HD21 . LEU A 1 106 ? -8.331  -8.950  1.562   1.00 0.00 ?  319 LEU A HD21 4  
ATOM 8004  H HD22 . LEU A 1 106 ? -7.333  -9.841  0.388   1.00 0.00 ?  319 LEU A HD22 4  
ATOM 8005  H HD23 . LEU A 1 106 ? -6.556  -8.905  1.688   1.00 0.00 ?  319 LEU A HD23 4  
ATOM 8006  N N    . LEU A 1 107 ? -7.799  -3.502  0.790   1.00 0.00 ?  320 LEU A N    4  
ATOM 8007  C CA   . LEU A 1 107 ? -8.063  -2.233  0.135   1.00 0.00 ?  320 LEU A CA   4  
ATOM 8008  C C    . LEU A 1 107 ? -6.959  -1.952  -0.887  1.00 0.00 ?  320 LEU A C    4  
ATOM 8009  O O    . LEU A 1 107 ? -5.780  -2.150  -0.602  1.00 0.00 ?  320 LEU A O    4  
ATOM 8010  C CB   . LEU A 1 107 ? -8.239  -1.121  1.171   1.00 0.00 ?  320 LEU A CB   4  
ATOM 8011  C CG   . LEU A 1 107 ? -8.819  -1.549  2.521   1.00 0.00 ?  320 LEU A CG   4  
ATOM 8012  C CD1  . LEU A 1 107 ? -7.704  -1.859  3.523   1.00 0.00 ?  320 LEU A CD1  4  
ATOM 8013  C CD2  . LEU A 1 107 ? -9.794  -0.499  3.057   1.00 0.00 ?  320 LEU A CD2  4  
ATOM 8014  H H    . LEU A 1 107 ? -6.901  -3.575  1.224   1.00 0.00 ?  320 LEU A H    4  
ATOM 8015  H HA   . LEU A 1 107 ? -9.010  -2.330  -0.397  1.00 0.00 ?  320 LEU A HA   4  
ATOM 8016  H HB2  . LEU A 1 107 ? -7.269  -0.657  1.345   1.00 0.00 ?  320 LEU A HB2  4  
ATOM 8017  H HB3  . LEU A 1 107 ? -8.887  -0.355  0.747   1.00 0.00 ?  320 LEU A HB3  4  
ATOM 8018  H HG   . LEU A 1 107 ? -9.384  -2.469  2.374   1.00 0.00 ?  320 LEU A HG   4  
ATOM 8019  H HD11 . LEU A 1 107 ? -6.901  -1.131  3.409   1.00 0.00 ?  320 LEU A HD11 4  
ATOM 8020  H HD12 . LEU A 1 107 ? -8.101  -1.807  4.536   1.00 0.00 ?  320 LEU A HD12 4  
ATOM 8021  H HD13 . LEU A 1 107 ? -7.316  -2.861  3.336   1.00 0.00 ?  320 LEU A HD13 4  
ATOM 8022  H HD21 . LEU A 1 107 ? -10.015 -0.709  4.103   1.00 0.00 ?  320 LEU A HD21 4  
ATOM 8023  H HD22 . LEU A 1 107 ? -9.346  0.491   2.971   1.00 0.00 ?  320 LEU A HD22 4  
ATOM 8024  H HD23 . LEU A 1 107 ? -10.717 -0.531  2.477   1.00 0.00 ?  320 LEU A HD23 4  
ATOM 8025  N N    . SER A 1 108 ? -7.382  -1.494  -2.056  1.00 0.00 ?  321 SER A N    4  
ATOM 8026  C CA   . SER A 1 108 ? -6.444  -1.183  -3.122  1.00 0.00 ?  321 SER A CA   4  
ATOM 8027  C C    . SER A 1 108 ? -6.117  0.311   -3.112  1.00 0.00 ?  321 SER A C    4  
ATOM 8028  O O    . SER A 1 108 ? -6.913  1.121   -2.640  1.00 0.00 ?  321 SER A O    4  
ATOM 8029  C CB   . SER A 1 108 ? -7.003  -1.595  -4.485  1.00 0.00 ?  321 SER A CB   4  
ATOM 8030  O OG   . SER A 1 108 ? -6.241  -1.054  -5.560  1.00 0.00 ?  321 SER A OG   4  
ATOM 8031  H H    . SER A 1 108 ? -8.344  -1.335  -2.280  1.00 0.00 ?  321 SER A H    4  
ATOM 8032  H HA   . SER A 1 108 ? -5.553  -1.772  -2.902  1.00 0.00 ?  321 SER A HA   4  
ATOM 8033  H HB2  . SER A 1 108 ? -7.014  -2.683  -4.559  1.00 0.00 ?  321 SER A HB2  4  
ATOM 8034  H HB3  . SER A 1 108 ? -8.037  -1.260  -4.569  1.00 0.00 ?  321 SER A HB3  4  
ATOM 8035  H HG   . SER A 1 108 ? -6.731  -1.177  -6.423  1.00 0.00 ?  321 SER A HG   4  
ATOM 8036  N N    . LEU A 1 109 ? -4.943  0.631   -3.638  1.00 0.00 ?  322 LEU A N    4  
ATOM 8037  C CA   . LEU A 1 109 ? -4.501  2.014   -3.695  1.00 0.00 ?  322 LEU A CA   4  
ATOM 8038  C C    . LEU A 1 109 ? -3.691  2.233   -4.975  1.00 0.00 ?  322 LEU A C    4  
ATOM 8039  O O    . LEU A 1 109 ? -2.468  2.101   -4.970  1.00 0.00 ?  322 LEU A O    4  
ATOM 8040  C CB   . LEU A 1 109 ? -3.746  2.388   -2.418  1.00 0.00 ?  322 LEU A CB   4  
ATOM 8041  C CG   . LEU A 1 109 ? -3.403  3.870   -2.251  1.00 0.00 ?  322 LEU A CG   4  
ATOM 8042  C CD1  . LEU A 1 109 ? -1.975  4.158   -2.718  1.00 0.00 ?  322 LEU A CD1  4  
ATOM 8043  C CD2  . LEU A 1 109 ? -4.429  4.753   -2.964  1.00 0.00 ?  322 LEU A CD2  4  
ATOM 8044  H H    . LEU A 1 109 ? -4.302  -0.035  -4.019  1.00 0.00 ?  322 LEU A H    4  
ATOM 8045  H HA   . LEU A 1 109 ? -5.392  2.640   -3.738  1.00 0.00 ?  322 LEU A HA   4  
ATOM 8046  H HB2  . LEU A 1 109 ? -4.343  2.075   -1.561  1.00 0.00 ?  322 LEU A HB2  4  
ATOM 8047  H HB3  . LEU A 1 109 ? -2.819  1.815   -2.387  1.00 0.00 ?  322 LEU A HB3  4  
ATOM 8048  H HG   . LEU A 1 109 ? -3.450  4.114   -1.190  1.00 0.00 ?  322 LEU A HG   4  
ATOM 8049  H HD11 . LEU A 1 109 ? -1.692  5.168   -2.419  1.00 0.00 ?  322 LEU A HD11 4  
ATOM 8050  H HD12 . LEU A 1 109 ? -1.292  3.440   -2.265  1.00 0.00 ?  322 LEU A HD12 4  
ATOM 8051  H HD13 . LEU A 1 109 ? -1.924  4.073   -3.804  1.00 0.00 ?  322 LEU A HD13 4  
ATOM 8052  H HD21 . LEU A 1 109 ? -4.228  5.800   -2.737  1.00 0.00 ?  322 LEU A HD21 4  
ATOM 8053  H HD22 . LEU A 1 109 ? -4.359  4.595   -4.040  1.00 0.00 ?  322 LEU A HD22 4  
ATOM 8054  H HD23 . LEU A 1 109 ? -5.431  4.494   -2.623  1.00 0.00 ?  322 LEU A HD23 4  
ATOM 8055  N N    . HIS A 1 110 ? -4.407  2.563   -6.040  1.00 0.00 ?  323 HIS A N    4  
ATOM 8056  C CA   . HIS A 1 110 ? -3.770  2.802   -7.324  1.00 0.00 ?  323 HIS A CA   4  
ATOM 8057  C C    . HIS A 1 110 ? -2.600  3.771   -7.144  1.00 0.00 ?  323 HIS A C    4  
ATOM 8058  O O    . HIS A 1 110 ? -2.703  4.743   -6.399  1.00 0.00 ?  323 HIS A O    4  
ATOM 8059  C CB   . HIS A 1 110 ? -4.791  3.289   -8.354  1.00 0.00 ?  323 HIS A CB   4  
ATOM 8060  C CG   . HIS A 1 110 ? -5.691  4.393   -7.852  1.00 0.00 ?  323 HIS A CG   4  
ATOM 8061  N ND1  . HIS A 1 110 ? -5.392  5.735   -8.011  1.00 0.00 ?  323 HIS A ND1  4  
ATOM 8062  C CD2  . HIS A 1 110 ? -6.884  4.340   -7.194  1.00 0.00 ?  323 HIS A CD2  4  
ATOM 8063  C CE1  . HIS A 1 110 ? -6.368  6.448   -7.469  1.00 0.00 ?  323 HIS A CE1  4  
ATOM 8064  N NE2  . HIS A 1 110 ? -7.292  5.582   -6.963  1.00 0.00 ?  323 HIS A NE2  4  
ATOM 8065  H H    . HIS A 1 110 ? -5.401  2.668   -6.035  1.00 0.00 ?  323 HIS A H    4  
ATOM 8066  H HA   . HIS A 1 110 ? -3.386  1.841   -7.666  1.00 0.00 ?  323 HIS A HA   4  
ATOM 8067  H HB2  . HIS A 1 110 ? -4.260  3.641   -9.238  1.00 0.00 ?  323 HIS A HB2  4  
ATOM 8068  H HB3  . HIS A 1 110 ? -5.407  2.446   -8.667  1.00 0.00 ?  323 HIS A HB3  4  
ATOM 8069  H HD1  . HIS A 1 110 ? -4.577  6.104   -8.460  1.00 0.00 ?  323 HIS A HD1  4  
ATOM 8070  H HD2  . HIS A 1 110 ? -7.414  3.432   -6.907  1.00 0.00 ?  323 HIS A HD2  4  
ATOM 8071  H HE1  . HIS A 1 110 ? -6.423  7.537   -7.434  1.00 0.00 ?  323 HIS A HE1  4  
ATOM 8072  H HE2  . HIS A 1 110 ? -8.163  5.840   -6.545  1.00 0.00 ?  323 HIS A HE2  4  
ATOM 8073  N N    . SER A 1 111 ? -1.513  3.472   -7.841  1.00 0.00 ?  324 SER A N    4  
ATOM 8074  C CA   . SER A 1 111 ? -0.325  4.304   -7.768  1.00 0.00 ?  324 SER A CA   4  
ATOM 8075  C C    . SER A 1 111 ? -0.655  5.728   -8.218  1.00 0.00 ?  324 SER A C    4  
ATOM 8076  O O    . SER A 1 111 ? 0.032   6.677   -7.843  1.00 0.00 ?  324 SER A O    4  
ATOM 8077  C CB   . SER A 1 111 ? 0.806   3.726   -8.622  1.00 0.00 ?  324 SER A CB   4  
ATOM 8078  O OG   . SER A 1 111 ? 1.949   4.577   -8.641  1.00 0.00 ?  324 SER A OG   4  
ATOM 8079  H H    . SER A 1 111 ? -1.437  2.679   -8.445  1.00 0.00 ?  324 SER A H    4  
ATOM 8080  H HA   . SER A 1 111 ? -0.029  4.293   -6.719  1.00 0.00 ?  324 SER A HA   4  
ATOM 8081  H HB2  . SER A 1 111 ? 1.089   2.748   -8.234  1.00 0.00 ?  324 SER A HB2  4  
ATOM 8082  H HB3  . SER A 1 111 ? 0.450   3.574   -9.640  1.00 0.00 ?  324 SER A HB3  4  
ATOM 8083  H HG   . SER A 1 111 ? 1.981   5.126   -7.806  1.00 0.00 ?  324 SER A HG   4  
ATOM 8084  N N    . ALA A 1 112 ? -1.707  5.833   -9.017  1.00 0.00 ?  325 ALA A N    4  
ATOM 8085  C CA   . ALA A 1 112 ? -2.137  7.126   -9.522  1.00 0.00 ?  325 ALA A CA   4  
ATOM 8086  C C    . ALA A 1 112 ? -2.392  8.070   -8.345  1.00 0.00 ?  325 ALA A C    4  
ATOM 8087  O O    . ALA A 1 112 ? -2.208  9.280   -8.465  1.00 0.00 ?  325 ALA A O    4  
ATOM 8088  C CB   . ALA A 1 112 ? -3.375  6.944   -10.403 1.00 0.00 ?  325 ALA A CB   4  
ATOM 8089  H H    . ALA A 1 112 ? -2.261  5.057   -9.317  1.00 0.00 ?  325 ALA A H    4  
ATOM 8090  H HA   . ALA A 1 112 ? -1.329  7.529   -10.132 1.00 0.00 ?  325 ALA A HA   4  
ATOM 8091  H HB1  . ALA A 1 112 ? -3.710  5.909   -10.349 1.00 0.00 ?  325 ALA A HB1  4  
ATOM 8092  H HB2  . ALA A 1 112 ? -4.170  7.602   -10.051 1.00 0.00 ?  325 ALA A HB2  4  
ATOM 8093  H HB3  . ALA A 1 112 ? -3.127  7.193   -11.434 1.00 0.00 ?  325 ALA A HB3  4  
ATOM 8094  N N    . ASP A 1 113 ? -2.812  7.481   -7.236  1.00 0.00 ?  326 ASP A N    4  
ATOM 8095  C CA   . ASP A 1 113 ? -3.093  8.254   -6.038  1.00 0.00 ?  326 ASP A CA   4  
ATOM 8096  C C    . ASP A 1 113 ? -1.780  8.778   -5.453  1.00 0.00 ?  326 ASP A C    4  
ATOM 8097  O O    . ASP A 1 113 ? -1.717  9.909   -4.974  1.00 0.00 ?  326 ASP A O    4  
ATOM 8098  C CB   . ASP A 1 113 ? -3.774  7.391   -4.973  1.00 0.00 ?  326 ASP A CB   4  
ATOM 8099  C CG   . ASP A 1 113 ? -4.704  8.150   -4.024  1.00 0.00 ?  326 ASP A CG   4  
ATOM 8100  O OD1  . ASP A 1 113 ? -4.412  8.300   -2.828  1.00 0.00 ?  326 ASP A OD1  4  
ATOM 8101  O OD2  . ASP A 1 113 ? -5.784  8.604   -4.566  1.00 0.00 -1 326 ASP A OD2  4  
ATOM 8102  H H    . ASP A 1 113 ? -2.959  6.495   -7.147  1.00 0.00 ?  326 ASP A H    4  
ATOM 8103  H HA   . ASP A 1 113 ? -3.754  9.057   -6.364  1.00 0.00 ?  326 ASP A HA   4  
ATOM 8104  H HB2  . ASP A 1 113 ? -4.347  6.610   -5.472  1.00 0.00 ?  326 ASP A HB2  4  
ATOM 8105  H HB3  . ASP A 1 113 ? -3.004  6.894   -4.383  1.00 0.00 ?  326 ASP A HB3  4  
ATOM 8106  H HD2  . ASP A 1 113 ? -6.248  7.873   -5.066  1.00 0.00 ?  326 ASP A HD2  4  
ATOM 8107  N N    . PHE A 1 114 ? -0.763  7.930   -5.513  1.00 0.00 ?  327 PHE A N    4  
ATOM 8108  C CA   . PHE A 1 114 ? 0.545   8.293   -4.995  1.00 0.00 ?  327 PHE A CA   4  
ATOM 8109  C C    . PHE A 1 114 ? 1.178   9.404   -5.836  1.00 0.00 ?  327 PHE A C    4  
ATOM 8110  O O    . PHE A 1 114 ? 1.856   10.281  -5.303  1.00 0.00 ?  327 PHE A O    4  
ATOM 8111  C CB   . PHE A 1 114 ? 1.422   7.043   -5.079  1.00 0.00 ?  327 PHE A CB   4  
ATOM 8112  C CG   . PHE A 1 114 ? 2.887   7.284   -4.708  1.00 0.00 ?  327 PHE A CG   4  
ATOM 8113  C CD1  . PHE A 1 114 ? 3.772   7.685   -5.660  1.00 0.00 ?  327 PHE A CD1  4  
ATOM 8114  C CD2  . PHE A 1 114 ? 3.304   7.098   -3.427  1.00 0.00 ?  327 PHE A CD2  4  
ATOM 8115  C CE1  . PHE A 1 114 ? 5.131   7.909   -5.316  1.00 0.00 ?  327 PHE A CE1  4  
ATOM 8116  C CE2  . PHE A 1 114 ? 4.663   7.322   -3.083  1.00 0.00 ?  327 PHE A CE2  4  
ATOM 8117  C CZ   . PHE A 1 114 ? 5.548   7.723   -4.035  1.00 0.00 ?  327 PHE A CZ   4  
ATOM 8118  H H    . PHE A 1 114 ? -0.823  7.012   -5.904  1.00 0.00 ?  327 PHE A H    4  
ATOM 8119  H HA   . PHE A 1 114 ? 0.402   8.650   -3.975  1.00 0.00 ?  327 PHE A HA   4  
ATOM 8120  H HB2  . PHE A 1 114 ? 1.012   6.279   -4.419  1.00 0.00 ?  327 PHE A HB2  4  
ATOM 8121  H HB3  . PHE A 1 114 ? 1.376   6.646   -6.093  1.00 0.00 ?  327 PHE A HB3  4  
ATOM 8122  H HD1  . PHE A 1 114 ? 3.438   7.835   -6.687  1.00 0.00 ?  327 PHE A HD1  4  
ATOM 8123  H HD2  . PHE A 1 114 ? 2.594   6.777   -2.665  1.00 0.00 ?  327 PHE A HD2  4  
ATOM 8124  H HE1  . PHE A 1 114 ? 5.841   8.230   -6.079  1.00 0.00 ?  327 PHE A HE1  4  
ATOM 8125  H HE2  . PHE A 1 114 ? 4.997   7.173   -2.057  1.00 0.00 ?  327 PHE A HE2  4  
ATOM 8126  H HZ   . PHE A 1 114 ? 6.592   7.895   -3.771  1.00 0.00 ?  327 PHE A HZ   4  
ATOM 8127  N N    . GLN A 1 115 ? 0.935   9.329   -7.136  1.00 0.00 ?  328 GLN A N    4  
ATOM 8128  C CA   . GLN A 1 115 ? 1.473   10.317  -8.056  1.00 0.00 ?  328 GLN A CA   4  
ATOM 8129  C C    . GLN A 1 115 ? 0.772   11.663  -7.859  1.00 0.00 ?  328 GLN A C    4  
ATOM 8130  O O    . GLN A 1 115 ? 1.401   12.715  -7.957  1.00 0.00 ?  328 GLN A O    4  
ATOM 8131  C CB   . GLN A 1 115 ? 1.350   9.841   -9.505  1.00 0.00 ?  328 GLN A CB   4  
ATOM 8132  C CG   . GLN A 1 115 ? 2.135   8.547   -9.726  1.00 0.00 ?  328 GLN A CG   4  
ATOM 8133  C CD   . GLN A 1 115 ? 1.847   7.960   -11.109 1.00 0.00 ?  328 GLN A CD   4  
ATOM 8134  O OE1  . GLN A 1 115 ? 1.899   8.638   -12.123 1.00 0.00 ?  328 GLN A OE1  4  
ATOM 8135  N NE2  . GLN A 1 115 ? 1.541   6.666   -11.095 1.00 0.00 ?  328 GLN A NE2  4  
ATOM 8136  H H    . GLN A 1 115 ? 0.383   8.612   -7.562  1.00 0.00 ?  328 GLN A H    4  
ATOM 8137  H HA   . GLN A 1 115 ? 2.528   10.408  -7.799  1.00 0.00 ?  328 GLN A HA   4  
ATOM 8138  H HB2  . GLN A 1 115 ? 0.300   9.681   -9.751  1.00 0.00 ?  328 GLN A HB2  4  
ATOM 8139  H HB3  . GLN A 1 115 ? 1.720   10.615  -10.178 1.00 0.00 ?  328 GLN A HB3  4  
ATOM 8140  H HG2  . GLN A 1 115 ? 3.203   8.744   -9.626  1.00 0.00 ?  328 GLN A HG2  4  
ATOM 8141  H HG3  . GLN A 1 115 ? 1.871   7.822   -8.957  1.00 0.00 ?  328 GLN A HG3  4  
ATOM 8142  H HE21 . GLN A 1 115 ? 1.516   6.168   -10.228 1.00 0.00 ?  328 GLN A HE21 4  
ATOM 8143  H HE22 . GLN A 1 115 ? 1.336   6.191   -11.951 1.00 0.00 ?  328 GLN A HE22 4  
ATOM 8144  N N    . MET A 1 116 ? -0.522  11.585  -7.585  1.00 0.00 ?  329 MET A N    4  
ATOM 8145  C CA   . MET A 1 116 ? -1.315  12.784  -7.374  1.00 0.00 ?  329 MET A CA   4  
ATOM 8146  C C    . MET A 1 116 ? -0.918  13.482  -6.072  1.00 0.00 ?  329 MET A C    4  
ATOM 8147  O O    . MET A 1 116 ? -0.840  14.709  -6.019  1.00 0.00 ?  329 MET A O    4  
ATOM 8148  C CB   . MET A 1 116 ? -2.799  12.413  -7.322  1.00 0.00 ?  329 MET A CB   4  
ATOM 8149  C CG   . MET A 1 116 ? -3.661  13.640  -7.018  1.00 0.00 ?  329 MET A CG   4  
ATOM 8150  S SD   . MET A 1 116 ? -5.280  13.127  -6.468  1.00 0.00 ?  329 MET A SD   4  
ATOM 8151  C CE   . MET A 1 116 ? -5.174  13.566  -4.741  1.00 0.00 ?  329 MET A CE   4  
ATOM 8152  H H    . MET A 1 116 ? -1.027  10.726  -7.507  1.00 0.00 ?  329 MET A H    4  
ATOM 8153  H HA   . MET A 1 116 ? -1.098  13.432  -8.223  1.00 0.00 ?  329 MET A HA   4  
ATOM 8154  H HB2  . MET A 1 116 ? -3.102  11.978  -8.274  1.00 0.00 ?  329 MET A HB2  4  
ATOM 8155  H HB3  . MET A 1 116 ? -2.960  11.652  -6.558  1.00 0.00 ?  329 MET A HB3  4  
ATOM 8156  H HG2  . MET A 1 116 ? -3.183  14.249  -6.251  1.00 0.00 ?  329 MET A HG2  4  
ATOM 8157  H HG3  . MET A 1 116 ? -3.750  14.261  -7.909  1.00 0.00 ?  329 MET A HG3  4  
ATOM 8158  H HE1  . MET A 1 116 ? -4.314  13.069  -4.292  1.00 0.00 ?  329 MET A HE1  4  
ATOM 8159  H HE2  . MET A 1 116 ? -5.060  14.645  -4.647  1.00 0.00 ?  329 MET A HE2  4  
ATOM 8160  H HE3  . MET A 1 116 ? -6.084  13.251  -4.230  1.00 0.00 ?  329 MET A HE3  4  
ATOM 8161  N N    . LEU A 1 117 ? -0.677  12.671  -5.053  1.00 0.00 ?  330 LEU A N    4  
ATOM 8162  C CA   . LEU A 1 117 ? -0.289  13.195  -3.754  1.00 0.00 ?  330 LEU A CA   4  
ATOM 8163  C C    . LEU A 1 117 ? 1.145   13.721  -3.829  1.00 0.00 ?  330 LEU A C    4  
ATOM 8164  O O    . LEU A 1 117 ? 1.484   14.706  -3.174  1.00 0.00 ?  330 LEU A O    4  
ATOM 8165  C CB   . LEU A 1 117 ? -0.502  12.141  -2.666  1.00 0.00 ?  330 LEU A CB   4  
ATOM 8166  C CG   . LEU A 1 117 ? -1.942  11.663  -2.466  1.00 0.00 ?  330 LEU A CG   4  
ATOM 8167  C CD1  . LEU A 1 117 ? -1.975  10.219  -1.961  1.00 0.00 ?  330 LEU A CD1  4  
ATOM 8168  C CD2  . LEU A 1 117 ? -2.711  12.611  -1.545  1.00 0.00 ?  330 LEU A CD2  4  
ATOM 8169  H H    . LEU A 1 117 ? -0.743  11.674  -5.104  1.00 0.00 ?  330 LEU A H    4  
ATOM 8170  H HA   . LEU A 1 117 ? -0.952  14.030  -3.528  1.00 0.00 ?  330 LEU A HA   4  
ATOM 8171  H HB2  . LEU A 1 117 ? 0.118   11.275  -2.900  1.00 0.00 ?  330 LEU A HB2  4  
ATOM 8172  H HB3  . LEU A 1 117 ? -0.140  12.546  -1.720  1.00 0.00 ?  330 LEU A HB3  4  
ATOM 8173  H HG   . LEU A 1 117 ? -2.443  11.677  -3.434  1.00 0.00 ?  330 LEU A HG   4  
ATOM 8174  H HD11 . LEU A 1 117 ? -2.422  9.579   -2.721  1.00 0.00 ?  330 LEU A HD11 4  
ATOM 8175  H HD12 . LEU A 1 117 ? -0.959  9.883   -1.754  1.00 0.00 ?  330 LEU A HD12 4  
ATOM 8176  H HD13 . LEU A 1 117 ? -2.569  10.168  -1.048  1.00 0.00 ?  330 LEU A HD13 4  
ATOM 8177  H HD21 . LEU A 1 117 ? -3.689  12.825  -1.978  1.00 0.00 ?  330 LEU A HD21 4  
ATOM 8178  H HD22 . LEU A 1 117 ? -2.841  12.143  -0.569  1.00 0.00 ?  330 LEU A HD22 4  
ATOM 8179  H HD23 . LEU A 1 117 ? -2.153  13.540  -1.431  1.00 0.00 ?  330 LEU A HD23 4  
ATOM 8180  N N    . CYS A 1 118 ? 1.950   13.041  -4.633  1.00 0.00 ?  331 CYS A N    4  
ATOM 8181  C CA   . CYS A 1 118 ? 3.340   13.428  -4.801  1.00 0.00 ?  331 CYS A CA   4  
ATOM 8182  C C    . CYS A 1 118 ? 3.387   14.688  -5.668  1.00 0.00 ?  331 CYS A C    4  
ATOM 8183  O O    . CYS A 1 118 ? 4.255   15.540  -5.484  1.00 0.00 ?  331 CYS A O    4  
ATOM 8184  C CB   . CYS A 1 118 ? 4.174   12.293  -5.400  1.00 0.00 ?  331 CYS A CB   4  
ATOM 8185  S SG   . CYS A 1 118 ? 4.663   11.116  -4.086  1.00 0.00 ?  331 CYS A SG   4  
ATOM 8186  H H    . CYS A 1 118 ? 1.667   12.242  -5.162  1.00 0.00 ?  331 CYS A H    4  
ATOM 8187  H HA   . CYS A 1 118 ? 3.733   13.629  -3.805  1.00 0.00 ?  331 CYS A HA   4  
ATOM 8188  H HB2  . CYS A 1 118 ? 3.601   11.776  -6.168  1.00 0.00 ?  331 CYS A HB2  4  
ATOM 8189  H HB3  . CYS A 1 118 ? 5.062   12.700  -5.884  1.00 0.00 ?  331 CYS A HB3  4  
ATOM 8190  H HG   . CYS A 1 118 ? 5.470   10.385  -4.849  1.00 0.00 ?  331 CYS A HG   4  
ATOM 8191  N N    . SER A 1 119 ? 2.442   14.767  -6.593  1.00 0.00 ?  332 SER A N    4  
ATOM 8192  C CA   . SER A 1 119 ? 2.364   15.909  -7.488  1.00 0.00 ?  332 SER A CA   4  
ATOM 8193  C C    . SER A 1 119 ? 1.783   17.115  -6.748  1.00 0.00 ?  332 SER A C    4  
ATOM 8194  O O    . SER A 1 119 ? 2.197   18.250  -6.982  1.00 0.00 ?  332 SER A O    4  
ATOM 8195  C CB   . SER A 1 119 ? 1.518   15.585  -8.721  1.00 0.00 ?  332 SER A CB   4  
ATOM 8196  O OG   . SER A 1 119 ? 1.683   16.556  -9.751  1.00 0.00 ?  332 SER A OG   4  
ATOM 8197  H H    . SER A 1 119 ? 1.740   14.070  -6.736  1.00 0.00 ?  332 SER A H    4  
ATOM 8198  H HA   . SER A 1 119 ? 3.391   16.106  -7.794  1.00 0.00 ?  332 SER A HA   4  
ATOM 8199  H HB2  . SER A 1 119 ? 1.794   14.602  -9.102  1.00 0.00 ?  332 SER A HB2  4  
ATOM 8200  H HB3  . SER A 1 119 ? 0.467   15.534  -8.437  1.00 0.00 ?  332 SER A HB3  4  
ATOM 8201  H HG   . SER A 1 119 ? 2.434   17.175  -9.521  1.00 0.00 ?  332 SER A HG   4  
ATOM 8202  N N    . SER A 1 120 ? 0.833   16.829  -5.869  1.00 0.00 ?  333 SER A N    4  
ATOM 8203  C CA   . SER A 1 120 ? 0.192   17.877  -5.093  1.00 0.00 ?  333 SER A CA   4  
ATOM 8204  C C    . SER A 1 120 ? 1.139   18.372  -3.998  1.00 0.00 ?  333 SER A C    4  
ATOM 8205  O O    . SER A 1 120 ? 1.135   19.553  -3.657  1.00 0.00 ?  333 SER A O    4  
ATOM 8206  C CB   . SER A 1 120 ? -1.119  17.383  -4.478  1.00 0.00 ?  333 SER A CB   4  
ATOM 8207  O OG   . SER A 1 120 ? -1.900  18.453  -3.954  1.00 0.00 ?  333 SER A OG   4  
ATOM 8208  H H    . SER A 1 120 ? 0.503   15.904  -5.685  1.00 0.00 ?  333 SER A H    4  
ATOM 8209  H HA   . SER A 1 120 ? -0.020  18.675  -5.805  1.00 0.00 ?  333 SER A HA   4  
ATOM 8210  H HB2  . SER A 1 120 ? -1.696  16.849  -5.234  1.00 0.00 ?  333 SER A HB2  4  
ATOM 8211  H HB3  . SER A 1 120 ? -0.900  16.670  -3.683  1.00 0.00 ?  333 SER A HB3  4  
ATOM 8212  H HG   . SER A 1 120 ? -2.819  18.430  -4.348  1.00 0.00 ?  333 SER A HG   4  
ATOM 8213  N N    . SER A 1 121 ? 1.927   17.442  -3.478  1.00 0.00 ?  334 SER A N    4  
ATOM 8214  C CA   . SER A 1 121 ? 2.878   17.769  -2.429  1.00 0.00 ?  334 SER A CA   4  
ATOM 8215  C C    . SER A 1 121 ? 4.272   17.269  -2.811  1.00 0.00 ?  334 SER A C    4  
ATOM 8216  O O    . SER A 1 121 ? 4.496   16.064  -2.917  1.00 0.00 ?  334 SER A O    4  
ATOM 8217  C CB   . SER A 1 121 ? 2.447   17.168  -1.089  1.00 0.00 ?  334 SER A CB   4  
ATOM 8218  O OG   . SER A 1 121 ? 2.160   18.173  -0.120  1.00 0.00 ?  334 SER A OG   4  
ATOM 8219  H H    . SER A 1 121 ? 1.924   16.483  -3.761  1.00 0.00 ?  334 SER A H    4  
ATOM 8220  H HA   . SER A 1 121 ? 2.867   18.857  -2.358  1.00 0.00 ?  334 SER A HA   4  
ATOM 8221  H HB2  . SER A 1 121 ? 1.564   16.546  -1.238  1.00 0.00 ?  334 SER A HB2  4  
ATOM 8222  H HB3  . SER A 1 121 ? 3.236   16.517  -0.713  1.00 0.00 ?  334 SER A HB3  4  
ATOM 8223  H HG   . SER A 1 121 ? 1.870   19.015  -0.576  1.00 0.00 ?  334 SER A HG   4  
ATOM 8224  N N    . PRO A 1 122 ? 5.197   18.245  -3.013  1.00 0.00 ?  335 PRO A N    4  
ATOM 8225  C CA   . PRO A 1 122 ? 6.564   17.916  -3.381  1.00 0.00 ?  335 PRO A CA   4  
ATOM 8226  C C    . PRO A 1 122 ? 7.342   17.380  -2.178  1.00 0.00 ?  335 PRO A C    4  
ATOM 8227  O O    . PRO A 1 122 ? 8.375   16.732  -2.341  1.00 0.00 ?  335 PRO A O    4  
ATOM 8228  C CB   . PRO A 1 122 ? 7.144   19.207  -3.935  1.00 0.00 ?  335 PRO A CB   4  
ATOM 8229  C CG   . PRO A 1 122 ? 6.240   20.321  -3.430  1.00 0.00 ?  335 PRO A CG   4  
ATOM 8230  C CD   . PRO A 1 122 ? 4.968   19.682  -2.896  1.00 0.00 ?  335 PRO A CD   4  
ATOM 8231  H HA   . PRO A 1 122 ? 6.573   17.184  -4.062  1.00 0.00 ?  335 PRO A HA   4  
ATOM 8232  H HB2  . PRO A 1 122 ? 8.169   19.353  -3.596  1.00 0.00 ?  335 PRO A HB2  4  
ATOM 8233  H HB3  . PRO A 1 122 ? 7.168   19.189  -5.025  1.00 0.00 ?  335 PRO A HB3  4  
ATOM 8234  H HG2  . PRO A 1 122 ? 6.739   20.891  -2.647  1.00 0.00 ?  335 PRO A HG2  4  
ATOM 8235  H HG3  . PRO A 1 122 ? 6.008   21.019  -4.235  1.00 0.00 ?  335 PRO A HG3  4  
ATOM 8236  H HD2  . PRO A 1 122 ? 4.784   19.971  -1.862  1.00 0.00 ?  335 PRO A HD2  4  
ATOM 8237  H HD3  . PRO A 1 122 ? 4.097   19.992  -3.473  1.00 0.00 ?  335 PRO A HD3  4  
ATOM 8238  N N    . GLU A 1 123 ? 6.816   17.669  -0.997  1.00 0.00 ?  336 GLU A N    4  
ATOM 8239  C CA   . GLU A 1 123 ? 7.448   17.223  0.233   1.00 0.00 ?  336 GLU A CA   4  
ATOM 8240  C C    . GLU A 1 123 ? 7.263   15.714  0.409   1.00 0.00 ?  336 GLU A C    4  
ATOM 8241  O O    . GLU A 1 123 ? 8.097   15.051  1.023   1.00 0.00 ?  336 GLU A O    4  
ATOM 8242  C CB   . GLU A 1 123 ? 6.899   17.987  1.440   1.00 0.00 ?  336 GLU A CB   4  
ATOM 8243  C CG   . GLU A 1 123 ? 8.034   18.476  2.342   1.00 0.00 ?  336 GLU A CG   4  
ATOM 8244  C CD   . GLU A 1 123 ? 7.528   18.751  3.760   1.00 0.00 ?  336 GLU A CD   4  
ATOM 8245  O OE1  . GLU A 1 123 ? 7.408   17.817  4.566   1.00 0.00 ?  336 GLU A OE1  4  
ATOM 8246  O OE2  . GLU A 1 123 ? 7.256   19.986  4.012   1.00 0.00 -1 336 GLU A OE2  4  
ATOM 8247  H H    . GLU A 1 123 ? 5.975   18.196  -0.873  1.00 0.00 ?  336 GLU A H    4  
ATOM 8248  H HA   . GLU A 1 123 ? 8.507   17.455  0.116   1.00 0.00 ?  336 GLU A HA   4  
ATOM 8249  H HB2  . GLU A 1 123 ? 6.308   18.837  1.099   1.00 0.00 ?  336 GLU A HB2  4  
ATOM 8250  H HB3  . GLU A 1 123 ? 6.229   17.342  2.009   1.00 0.00 ?  336 GLU A HB3  4  
ATOM 8251  H HG2  . GLU A 1 123 ? 8.826   17.729  2.373   1.00 0.00 ?  336 GLU A HG2  4  
ATOM 8252  H HG3  . GLU A 1 123 ? 8.468   19.385  1.925   1.00 0.00 ?  336 GLU A HG3  4  
ATOM 8253  H HE2  . GLU A 1 123 ? 6.469   20.045  4.626   1.00 0.00 ?  336 GLU A HE2  4  
ATOM 8254  N N    . ILE A 1 124 ? 6.166   15.217  -0.142  1.00 0.00 ?  337 ILE A N    4  
ATOM 8255  C CA   . ILE A 1 124 ? 5.861   13.799  -0.053  1.00 0.00 ?  337 ILE A CA   4  
ATOM 8256  C C    . ILE A 1 124 ? 6.806   13.021  -0.971  1.00 0.00 ?  337 ILE A C    4  
ATOM 8257  O O    . ILE A 1 124 ? 7.302   11.958  -0.600  1.00 0.00 ?  337 ILE A O    4  
ATOM 8258  C CB   . ILE A 1 124 ? 4.379   13.550  -0.344  1.00 0.00 ?  337 ILE A CB   4  
ATOM 8259  C CG1  . ILE A 1 124 ? 3.493   14.246  0.692   1.00 0.00 ?  337 ILE A CG1  4  
ATOM 8260  C CG2  . ILE A 1 124 ? 4.083   12.052  -0.438  1.00 0.00 ?  337 ILE A CG2  4  
ATOM 8261  C CD1  . ILE A 1 124 ? 2.095   14.508  0.130   1.00 0.00 ?  337 ILE A CD1  4  
ATOM 8262  H H    . ILE A 1 124 ? 5.492   15.764  -0.640  1.00 0.00 ?  337 ILE A H    4  
ATOM 8263  H HA   . ILE A 1 124 ? 6.044   13.489  0.975   1.00 0.00 ?  337 ILE A HA   4  
ATOM 8264  H HB   . ILE A 1 124 ? 4.143   13.987  -1.314  1.00 0.00 ?  337 ILE A HB   4  
ATOM 8265  H HG12 . ILE A 1 124 ? 3.419   13.627  1.587   1.00 0.00 ?  337 ILE A HG12 4  
ATOM 8266  H HG13 . ILE A 1 124 ? 3.951   15.188  0.994   1.00 0.00 ?  337 ILE A HG13 4  
ATOM 8267  H HG21 . ILE A 1 124 ? 4.748   11.596  -1.172  1.00 0.00 ?  337 ILE A HG21 4  
ATOM 8268  H HG22 . ILE A 1 124 ? 4.242   11.588  0.535   1.00 0.00 ?  337 ILE A HG22 4  
ATOM 8269  H HG23 . ILE A 1 124 ? 3.048   11.906  -0.746  1.00 0.00 ?  337 ILE A HG23 4  
ATOM 8270  H HD11 . ILE A 1 124 ? 2.141   14.540  -0.959  1.00 0.00 ?  337 ILE A HD11 4  
ATOM 8271  H HD12 . ILE A 1 124 ? 1.422   13.710  0.442   1.00 0.00 ?  337 ILE A HD12 4  
ATOM 8272  H HD13 . ILE A 1 124 ? 1.726   15.463  0.506   1.00 0.00 ?  337 ILE A HD13 4  
ATOM 8273  N N    . ALA A 1 125 ? 7.028   13.580  -2.151  1.00 0.00 ?  338 ALA A N    4  
ATOM 8274  C CA   . ALA A 1 125 ? 7.905   12.952  -3.125  1.00 0.00 ?  338 ALA A CA   4  
ATOM 8275  C C    . ALA A 1 125 ? 9.357   13.101  -2.667  1.00 0.00 ?  338 ALA A C    4  
ATOM 8276  O O    . ALA A 1 125 ? 10.186  12.230  -2.927  1.00 0.00 ?  338 ALA A O    4  
ATOM 8277  C CB   . ALA A 1 125 ? 7.662   13.568  -4.504  1.00 0.00 ?  338 ALA A CB   4  
ATOM 8278  H H    . ALA A 1 125 ? 6.621   14.445  -2.446  1.00 0.00 ?  338 ALA A H    4  
ATOM 8279  H HA   . ALA A 1 125 ? 7.652   11.893  -3.164  1.00 0.00 ?  338 ALA A HA   4  
ATOM 8280  H HB1  . ALA A 1 125 ? 8.326   13.102  -5.232  1.00 0.00 ?  338 ALA A HB1  4  
ATOM 8281  H HB2  . ALA A 1 125 ? 6.626   13.403  -4.798  1.00 0.00 ?  338 ALA A HB2  4  
ATOM 8282  H HB3  . ALA A 1 125 ? 7.862   14.639  -4.463  1.00 0.00 ?  338 ALA A HB3  4  
ATOM 8283  N N    . GLU A 1 126 ? 9.621   14.211  -1.993  1.00 0.00 ?  339 GLU A N    4  
ATOM 8284  C CA   . GLU A 1 126 ? 10.959  14.485  -1.497  1.00 0.00 ?  339 GLU A CA   4  
ATOM 8285  C C    . GLU A 1 126 ? 11.264  13.608  -0.280  1.00 0.00 ?  339 GLU A C    4  
ATOM 8286  O O    . GLU A 1 126 ? 12.377  13.107  -0.136  1.00 0.00 ?  339 GLU A O    4  
ATOM 8287  C CB   . GLU A 1 126 ? 11.125  15.968  -1.159  1.00 0.00 ?  339 GLU A CB   4  
ATOM 8288  C CG   . GLU A 1 126 ? 11.530  16.770  -2.397  1.00 0.00 ?  339 GLU A CG   4  
ATOM 8289  C CD   . GLU A 1 126 ? 12.866  17.484  -2.176  1.00 0.00 ?  339 GLU A CD   4  
ATOM 8290  O OE1  . GLU A 1 126 ? 12.888  18.610  -1.658  1.00 0.00 ?  339 GLU A OE1  4  
ATOM 8291  O OE2  . GLU A 1 126 ? 13.906  16.826  -2.561  1.00 0.00 -1 339 GLU A OE2  4  
ATOM 8292  H H    . GLU A 1 126 ? 8.941   14.914  -1.786  1.00 0.00 ?  339 GLU A H    4  
ATOM 8293  H HA   . GLU A 1 126 ? 11.630  14.228  -2.316  1.00 0.00 ?  339 GLU A HA   4  
ATOM 8294  H HB2  . GLU A 1 126 ? 10.191  16.360  -0.757  1.00 0.00 ?  339 GLU A HB2  4  
ATOM 8295  H HB3  . GLU A 1 126 ? 11.881  16.085  -0.382  1.00 0.00 ?  339 GLU A HB3  4  
ATOM 8296  H HG2  . GLU A 1 126 ? 11.608  16.104  -3.257  1.00 0.00 ?  339 GLU A HG2  4  
ATOM 8297  H HG3  . GLU A 1 126 ? 10.757  17.502  -2.630  1.00 0.00 ?  339 GLU A HG3  4  
ATOM 8298  H HE2  . GLU A 1 126 ? 13.770  15.848  -2.402  1.00 0.00 ?  339 GLU A HE2  4  
ATOM 8299  N N    . ILE A 1 127 ? 10.254  13.450  0.563   1.00 0.00 ?  340 ILE A N    4  
ATOM 8300  C CA   . ILE A 1 127 ? 10.400  12.643  1.762   1.00 0.00 ?  340 ILE A CA   4  
ATOM 8301  C C    . ILE A 1 127 ? 10.435  11.163  1.374   1.00 0.00 ?  340 ILE A C    4  
ATOM 8302  O O    . ILE A 1 127 ? 11.242  10.399  1.902   1.00 0.00 ?  340 ILE A O    4  
ATOM 8303  C CB   . ILE A 1 127 ? 9.307   12.987  2.776   1.00 0.00 ?  340 ILE A CB   4  
ATOM 8304  C CG1  . ILE A 1 127 ? 9.604   14.317  3.472   1.00 0.00 ?  340 ILE A CG1  4  
ATOM 8305  C CG2  . ILE A 1 127 ? 9.111   11.847  3.778   1.00 0.00 ?  340 ILE A CG2  4  
ATOM 8306  C CD1  . ILE A 1 127 ? 8.383   14.813  4.250   1.00 0.00 ?  340 ILE A CD1  4  
ATOM 8307  H H    . ILE A 1 127 ? 9.351   13.861  0.438   1.00 0.00 ?  340 ILE A H    4  
ATOM 8308  H HA   . ILE A 1 127 ? 11.356  12.904  2.217   1.00 0.00 ?  340 ILE A HA   4  
ATOM 8309  H HB   . ILE A 1 127 ? 8.367   13.108  2.238   1.00 0.00 ?  340 ILE A HB   4  
ATOM 8310  H HG12 . ILE A 1 127 ? 10.448  14.196  4.151   1.00 0.00 ?  340 ILE A HG12 4  
ATOM 8311  H HG13 . ILE A 1 127 ? 9.895   15.062  2.732   1.00 0.00 ?  340 ILE A HG13 4  
ATOM 8312  H HG21 . ILE A 1 127 ? 10.012  11.733  4.380   1.00 0.00 ?  340 ILE A HG21 4  
ATOM 8313  H HG22 . ILE A 1 127 ? 8.266   12.077  4.428   1.00 0.00 ?  340 ILE A HG22 4  
ATOM 8314  H HG23 . ILE A 1 127 ? 8.914   10.920  3.240   1.00 0.00 ?  340 ILE A HG23 4  
ATOM 8315  H HD11 . ILE A 1 127 ? 7.912   15.631  3.704   1.00 0.00 ?  340 ILE A HD11 4  
ATOM 8316  H HD12 . ILE A 1 127 ? 7.671   13.997  4.367   1.00 0.00 ?  340 ILE A HD12 4  
ATOM 8317  H HD13 . ILE A 1 127 ? 8.697   15.165  5.232   1.00 0.00 ?  340 ILE A HD13 4  
ATOM 8318  N N    . PHE A 1 128 ? 9.551   10.804  0.455   1.00 0.00 ?  341 PHE A N    4  
ATOM 8319  C CA   . PHE A 1 128 ? 9.471   9.430   -0.009  1.00 0.00 ?  341 PHE A CA   4  
ATOM 8320  C C    . PHE A 1 128 ? 10.706  9.056   -0.832  1.00 0.00 ?  341 PHE A C    4  
ATOM 8321  O O    . PHE A 1 128 ? 11.162  7.914   -0.789  1.00 0.00 ?  341 PHE A O    4  
ATOM 8322  C CB   . PHE A 1 128 ? 8.231   9.330   -0.899  1.00 0.00 ?  341 PHE A CB   4  
ATOM 8323  C CG   . PHE A 1 128 ? 7.878   7.901   -1.318  1.00 0.00 ?  341 PHE A CG   4  
ATOM 8324  C CD1  . PHE A 1 128 ? 8.456   7.353   -2.421  1.00 0.00 ?  341 PHE A CD1  4  
ATOM 8325  C CD2  . PHE A 1 128 ? 6.988   7.178   -0.587  1.00 0.00 ?  341 PHE A CD2  4  
ATOM 8326  C CE1  . PHE A 1 128 ? 8.129   6.027   -2.809  1.00 0.00 ?  341 PHE A CE1  4  
ATOM 8327  C CE2  . PHE A 1 128 ? 6.661   5.852   -0.975  1.00 0.00 ?  341 PHE A CE2  4  
ATOM 8328  C CZ   . PHE A 1 128 ? 7.238   5.305   -2.078  1.00 0.00 ?  341 PHE A CZ   4  
ATOM 8329  H H    . PHE A 1 128 ? 8.899   11.432  0.031   1.00 0.00 ?  341 PHE A H    4  
ATOM 8330  H HA   . PHE A 1 128 ? 9.418   8.792   0.874   1.00 0.00 ?  341 PHE A HA   4  
ATOM 8331  H HB2  . PHE A 1 128 ? 7.381   9.763   -0.371  1.00 0.00 ?  341 PHE A HB2  4  
ATOM 8332  H HB3  . PHE A 1 128 ? 8.389   9.931   -1.795  1.00 0.00 ?  341 PHE A HB3  4  
ATOM 8333  H HD1  . PHE A 1 128 ? 9.169   7.932   -3.006  1.00 0.00 ?  341 PHE A HD1  4  
ATOM 8334  H HD2  . PHE A 1 128 ? 6.525   7.617   0.297   1.00 0.00 ?  341 PHE A HD2  4  
ATOM 8335  H HE1  . PHE A 1 128 ? 8.591   5.588   -3.693  1.00 0.00 ?  341 PHE A HE1  4  
ATOM 8336  H HE2  . PHE A 1 128 ? 5.947   5.273   -0.389  1.00 0.00 ?  341 PHE A HE2  4  
ATOM 8337  H HZ   . PHE A 1 128 ? 6.987   4.287   -2.376  1.00 0.00 ?  341 PHE A HZ   4  
ATOM 8338  N N    . ARG A 1 129 ? 11.212  10.040  -1.561  1.00 0.00 ?  342 ARG A N    4  
ATOM 8339  C CA   . ARG A 1 129 ? 12.385  9.829   -2.392  1.00 0.00 ?  342 ARG A CA   4  
ATOM 8340  C C    . ARG A 1 129 ? 13.637  9.708   -1.521  1.00 0.00 ?  342 ARG A C    4  
ATOM 8341  O O    . ARG A 1 129 ? 14.513  8.890   -1.797  1.00 0.00 ?  342 ARG A O    4  
ATOM 8342  C CB   . ARG A 1 129 ? 12.570  10.978  -3.385  1.00 0.00 ?  342 ARG A CB   4  
ATOM 8343  C CG   . ARG A 1 129 ? 13.941  10.902  -4.061  1.00 0.00 ?  342 ARG A CG   4  
ATOM 8344  C CD   . ARG A 1 129 ? 13.909  11.563  -5.441  1.00 0.00 ?  342 ARG A CD   4  
ATOM 8345  N NE   . ARG A 1 129 ? 14.404  12.954  -5.347  1.00 0.00 ?  342 ARG A NE   4  
ATOM 8346  C CZ   . ARG A 1 129 ? 13.638  14.004  -5.021  1.00 0.00 ?  342 ARG A CZ   4  
ATOM 8347  N NH1  . ARG A 1 129 ? 12.337  13.827  -4.755  1.00 0.00 ?  342 ARG A NH1  4  
ATOM 8348  N NH2  . ARG A 1 129 ? 14.174  15.231  -4.960  1.00 0.00 1  342 ARG A NH2  4  
ATOM 8349  H H    . ARG A 1 129 ? 10.835  10.965  -1.590  1.00 0.00 ?  342 ARG A H    4  
ATOM 8350  H HA   . ARG A 1 129 ? 12.186  8.898   -2.924  1.00 0.00 ?  342 ARG A HA   4  
ATOM 8351  H HB2  . ARG A 1 129 ? 11.786  10.941  -4.140  1.00 0.00 ?  342 ARG A HB2  4  
ATOM 8352  H HB3  . ARG A 1 129 ? 12.469  11.931  -2.866  1.00 0.00 ?  342 ARG A HB3  4  
ATOM 8353  H HG2  . ARG A 1 129 ? 14.687  11.393  -3.436  1.00 0.00 ?  342 ARG A HG2  4  
ATOM 8354  H HG3  . ARG A 1 129 ? 14.244  9.860   -4.160  1.00 0.00 ?  342 ARG A HG3  4  
ATOM 8355  H HD2  . ARG A 1 129 ? 14.523  10.995  -6.139  1.00 0.00 ?  342 ARG A HD2  4  
ATOM 8356  H HD3  . ARG A 1 129 ? 12.892  11.556  -5.833  1.00 0.00 ?  342 ARG A HD3  4  
ATOM 8357  H HE   . ARG A 1 129 ? 15.371  13.121  -5.540  1.00 0.00 ?  342 ARG A HE   4  
ATOM 8358  H HH11 . ARG A 1 129 ? 11.937  12.912  -4.800  1.00 0.00 ?  342 ARG A HH11 4  
ATOM 8359  H HH12 . ARG A 1 129 ? 11.765  14.611  -4.511  1.00 0.00 ?  342 ARG A HH12 4  
ATOM 8360  H HH21 . ARG A 1 129 ? 15.145  15.363  -5.159  1.00 0.00 ?  342 ARG A HH21 4  
ATOM 8361  H HH22 . ARG A 1 129 ? 13.602  16.015  -4.717  1.00 0.00 ?  342 ARG A HH22 4  
ATOM 8362  N N    . LYS A 1 130 ? 13.682  10.536  -0.488  1.00 0.00 ?  343 LYS A N    4  
ATOM 8363  C CA   . LYS A 1 130 ? 14.813  10.533  0.425   1.00 0.00 ?  343 LYS A CA   4  
ATOM 8364  C C    . LYS A 1 130 ? 14.867  9.192   1.158   1.00 0.00 ?  343 LYS A C    4  
ATOM 8365  O O    . LYS A 1 130 ? 15.912  8.545   1.200   1.00 0.00 ?  343 LYS A O    4  
ATOM 8366  C CB   . LYS A 1 130 ? 14.751  11.743  1.359   1.00 0.00 ?  343 LYS A CB   4  
ATOM 8367  C CG   . LYS A 1 130 ? 15.777  12.803  0.954   1.00 0.00 ?  343 LYS A CG   4  
ATOM 8368  C CD   . LYS A 1 130 ? 15.189  13.769  -0.077  1.00 0.00 ?  343 LYS A CD   4  
ATOM 8369  C CE   . LYS A 1 130 ? 14.383  14.876  0.607   1.00 0.00 ?  343 LYS A CE   4  
ATOM 8370  N NZ   . LYS A 1 130 ? 15.286  15.826  1.294   1.00 0.00 1  343 LYS A NZ   4  
ATOM 8371  H H    . LYS A 1 130 ? 12.966  11.199  -0.271  1.00 0.00 ?  343 LYS A H    4  
ATOM 8372  H HA   . LYS A 1 130 ? 15.717  10.636  -0.175  1.00 0.00 ?  343 LYS A HA   4  
ATOM 8373  H HB2  . LYS A 1 130 ? 13.750  12.174  1.337   1.00 0.00 ?  343 LYS A HB2  4  
ATOM 8374  H HB3  . LYS A 1 130 ? 14.937  11.425  2.385   1.00 0.00 ?  343 LYS A HB3  4  
ATOM 8375  H HG2  . LYS A 1 130 ? 16.100  13.357  1.835   1.00 0.00 ?  343 LYS A HG2  4  
ATOM 8376  H HG3  . LYS A 1 130 ? 16.661  12.318  0.540   1.00 0.00 ?  343 LYS A HG3  4  
ATOM 8377  H HD2  . LYS A 1 130 ? 15.992  14.211  -0.666  1.00 0.00 ?  343 LYS A HD2  4  
ATOM 8378  H HD3  . LYS A 1 130 ? 14.549  13.223  -0.769  1.00 0.00 ?  343 LYS A HD3  4  
ATOM 8379  H HE2  . LYS A 1 130 ? 13.782  15.406  -0.132  1.00 0.00 ?  343 LYS A HE2  4  
ATOM 8380  H HE3  . LYS A 1 130 ? 13.690  14.438  1.326   1.00 0.00 ?  343 LYS A HE3  4  
ATOM 8381  H HZ1  . LYS A 1 130 ? 15.087  15.825  2.274   1.00 0.00 ?  343 LYS A HZ1  4  
ATOM 8382  H HZ2  . LYS A 1 130 ? 16.235  15.549  1.146   1.00 0.00 ?  343 LYS A HZ2  4  
ATOM 8383  H HZ3  . LYS A 1 130 ? 15.145  16.745  0.926   1.00 0.00 ?  343 LYS A HZ3  4  
ATOM 8384  N N    . THR A 1 131 ? 13.727  8.813   1.718   1.00 0.00 ?  344 THR A N    4  
ATOM 8385  C CA   . THR A 1 131 ? 13.632  7.560   2.447   1.00 0.00 ?  344 THR A CA   4  
ATOM 8386  C C    . THR A 1 131 ? 13.837  6.375   1.502   1.00 0.00 ?  344 THR A C    4  
ATOM 8387  O O    . THR A 1 131 ? 14.381  5.346   1.899   1.00 0.00 ?  344 THR A O    4  
ATOM 8388  C CB   . THR A 1 131 ? 12.283  7.535   3.169   1.00 0.00 ?  344 THR A CB   4  
ATOM 8389  O OG1  . THR A 1 131 ? 12.405  6.459   4.096   1.00 0.00 ?  344 THR A OG1  4  
ATOM 8390  C CG2  . THR A 1 131 ? 11.135  7.109   2.252   1.00 0.00 ?  344 THR A CG2  4  
ATOM 8391  H H    . THR A 1 131 ? 12.882  9.345   1.679   1.00 0.00 ?  344 THR A H    4  
ATOM 8392  H HA   . THR A 1 131 ? 14.438  7.527   3.181   1.00 0.00 ?  344 THR A HA   4  
ATOM 8393  H HB   . THR A 1 131 ? 12.073  8.498   3.635   1.00 0.00 ?  344 THR A HB   4  
ATOM 8394  H HG1  . THR A 1 131 ? 12.791  5.657   3.640   1.00 0.00 ?  344 THR A HG1  4  
ATOM 8395  H HG21 . THR A 1 131 ? 11.071  7.795   1.408   1.00 0.00 ?  344 THR A HG21 4  
ATOM 8396  H HG22 . THR A 1 131 ? 11.319  6.099   1.886   1.00 0.00 ?  344 THR A HG22 4  
ATOM 8397  H HG23 . THR A 1 131 ? 10.199  7.128   2.809   1.00 0.00 ?  344 THR A HG23 4  
ATOM 8398  N N    . ALA A 1 132 ? 13.389  6.560   0.268   1.00 0.00 ?  345 ALA A N    4  
ATOM 8399  C CA   . ALA A 1 132 ? 13.517  5.519   -0.738  1.00 0.00 ?  345 ALA A CA   4  
ATOM 8400  C C    . ALA A 1 132 ? 14.997  5.307   -1.062  1.00 0.00 ?  345 ALA A C    4  
ATOM 8401  O O    . ALA A 1 132 ? 15.461  4.172   -1.148  1.00 0.00 ?  345 ALA A O    4  
ATOM 8402  C CB   . ALA A 1 132 ? 12.698  5.899   -1.973  1.00 0.00 ?  345 ALA A CB   4  
ATOM 8403  H H    . ALA A 1 132 ? 12.948  7.400   -0.047  1.00 0.00 ?  345 ALA A H    4  
ATOM 8404  H HA   . ALA A 1 132 ? 13.110  4.599   -0.317  1.00 0.00 ?  345 ALA A HA   4  
ATOM 8405  H HB1  . ALA A 1 132 ? 13.113  5.404   -2.850  1.00 0.00 ?  345 ALA A HB1  4  
ATOM 8406  H HB2  . ALA A 1 132 ? 11.663  5.585   -1.834  1.00 0.00 ?  345 ALA A HB2  4  
ATOM 8407  H HB3  . ALA A 1 132 ? 12.734  6.979   -2.114  1.00 0.00 ?  345 ALA A HB3  4  
ATOM 8408  N N    . LEU A 1 133 ? 15.697  6.419   -1.233  1.00 0.00 ?  346 LEU A N    4  
ATOM 8409  C CA   . LEU A 1 133 ? 17.115  6.370   -1.546  1.00 0.00 ?  346 LEU A CA   4  
ATOM 8410  C C    . LEU A 1 133 ? 17.873  5.765   -0.363  1.00 0.00 ?  346 LEU A C    4  
ATOM 8411  O O    . LEU A 1 133 ? 18.835  5.022   -0.552  1.00 0.00 ?  346 LEU A O    4  
ATOM 8412  C CB   . LEU A 1 133 ? 17.621  7.754   -1.958  1.00 0.00 ?  346 LEU A CB   4  
ATOM 8413  C CG   . LEU A 1 133 ? 17.637  8.042   -3.460  1.00 0.00 ?  346 LEU A CG   4  
ATOM 8414  C CD1  . LEU A 1 133 ? 16.392  8.825   -3.881  1.00 0.00 ?  346 LEU A CD1  4  
ATOM 8415  C CD2  . LEU A 1 133 ? 18.928  8.755   -3.868  1.00 0.00 ?  346 LEU A CD2  4  
ATOM 8416  H H    . LEU A 1 133 ? 15.312  7.339   -1.161  1.00 0.00 ?  346 LEU A H    4  
ATOM 8417  H HA   . LEU A 1 133 ? 17.237  5.713   -2.407  1.00 0.00 ?  346 LEU A HA   4  
ATOM 8418  H HB2  . LEU A 1 133 ? 17.001  8.506   -1.470  1.00 0.00 ?  346 LEU A HB2  4  
ATOM 8419  H HB3  . LEU A 1 133 ? 18.634  7.878   -1.573  1.00 0.00 ?  346 LEU A HB3  4  
ATOM 8420  H HG   . LEU A 1 133 ? 17.614  7.091   -3.991  1.00 0.00 ?  346 LEU A HG   4  
ATOM 8421  H HD11 . LEU A 1 133 ? 15.501  8.239   -3.657  1.00 0.00 ?  346 LEU A HD11 4  
ATOM 8422  H HD12 . LEU A 1 133 ? 16.355  9.768   -3.336  1.00 0.00 ?  346 LEU A HD12 4  
ATOM 8423  H HD13 . LEU A 1 133 ? 16.435  9.027   -4.952  1.00 0.00 ?  346 LEU A HD13 4  
ATOM 8424  H HD21 . LEU A 1 133 ? 19.766  8.062   -3.791  1.00 0.00 ?  346 LEU A HD21 4  
ATOM 8425  H HD22 . LEU A 1 133 ? 18.840  9.107   -4.896  1.00 0.00 ?  346 LEU A HD22 4  
ATOM 8426  H HD23 . LEU A 1 133 ? 19.099  9.605   -3.206  1.00 0.00 ?  346 LEU A HD23 4  
ATOM 8427  N N    . GLU A 1 134 ? 17.411  6.105   0.832   1.00 0.00 ?  347 GLU A N    4  
ATOM 8428  C CA   . GLU A 1 134 ? 18.034  5.605   2.045   1.00 0.00 ?  347 GLU A CA   4  
ATOM 8429  C C    . GLU A 1 134 ? 17.867  4.087   2.141   1.00 0.00 ?  347 GLU A C    4  
ATOM 8430  O O    . GLU A 1 134 ? 18.784  3.383   2.560   1.00 0.00 ?  347 GLU A O    4  
ATOM 8431  C CB   . GLU A 1 134 ? 17.460  6.298   3.282   1.00 0.00 ?  347 GLU A CB   4  
ATOM 8432  C CG   . GLU A 1 134 ? 18.185  7.617   3.558   1.00 0.00 ?  347 GLU A CG   4  
ATOM 8433  C CD   . GLU A 1 134 ? 19.034  7.521   4.827   1.00 0.00 ?  347 GLU A CD   4  
ATOM 8434  O OE1  . GLU A 1 134 ? 18.546  7.828   5.925   1.00 0.00 ?  347 GLU A OE1  4  
ATOM 8435  O OE2  . GLU A 1 134 ? 20.243  7.108   4.645   1.00 0.00 -1 347 GLU A OE2  4  
ATOM 8436  H H    . GLU A 1 134 ? 16.628  6.710   0.977   1.00 0.00 ?  347 GLU A H    4  
ATOM 8437  H HA   . GLU A 1 134 ? 19.090  5.856   1.954   1.00 0.00 ?  347 GLU A HA   4  
ATOM 8438  H HB2  . GLU A 1 134 ? 16.396  6.488   3.136   1.00 0.00 ?  347 GLU A HB2  4  
ATOM 8439  H HB3  . GLU A 1 134 ? 17.550  5.641   4.147   1.00 0.00 ?  347 GLU A HB3  4  
ATOM 8440  H HG2  . GLU A 1 134 ? 18.820  7.871   2.709   1.00 0.00 ?  347 GLU A HG2  4  
ATOM 8441  H HG3  . GLU A 1 134 ? 17.457  8.421   3.663   1.00 0.00 ?  347 GLU A HG3  4  
ATOM 8442  H HE2  . GLU A 1 134 ? 20.687  7.655   3.936   1.00 0.00 ?  347 GLU A HE2  4  
ATOM 8443  N N    . ARG A 1 135 ? 16.689  3.627   1.744   1.00 0.00 ?  348 ARG A N    4  
ATOM 8444  C CA   . ARG A 1 135 ? 16.390  2.206   1.780   1.00 0.00 ?  348 ARG A CA   4  
ATOM 8445  C C    . ARG A 1 135 ? 17.151  1.475   0.671   1.00 0.00 ?  348 ARG A C    4  
ATOM 8446  O O    . ARG A 1 135 ? 17.709  0.403   0.899   1.00 0.00 ?  348 ARG A O    4  
ATOM 8447  C CB   . ARG A 1 135 ? 14.890  1.954   1.610   1.00 0.00 ?  348 ARG A CB   4  
ATOM 8448  C CG   . ARG A 1 135 ? 14.169  2.009   2.959   1.00 0.00 ?  348 ARG A CG   4  
ATOM 8449  C CD   . ARG A 1 135 ? 12.797  1.337   2.875   1.00 0.00 ?  348 ARG A CD   4  
ATOM 8450  N NE   . ARG A 1 135 ? 11.962  1.747   4.026   1.00 0.00 ?  348 ARG A NE   4  
ATOM 8451  C CZ   . ARG A 1 135 ? 12.006  1.163   5.231   1.00 0.00 ?  348 ARG A CZ   4  
ATOM 8452  N NH1  . ARG A 1 135 ? 12.844  0.140   5.451   1.00 0.00 ?  348 ARG A NH1  4  
ATOM 8453  N NH2  . ARG A 1 135 ? 11.211  1.601   6.218   1.00 0.00 1  348 ARG A NH2  4  
ATOM 8454  H H    . ARG A 1 135 ? 15.948  4.207   1.404   1.00 0.00 ?  348 ARG A H    4  
ATOM 8455  H HA   . ARG A 1 135 ? 16.720  1.876   2.765   1.00 0.00 ?  348 ARG A HA   4  
ATOM 8456  H HB2  . ARG A 1 135 ? 14.467  2.699   0.937   1.00 0.00 ?  348 ARG A HB2  4  
ATOM 8457  H HB3  . ARG A 1 135 ? 14.731  0.980   1.149   1.00 0.00 ?  348 ARG A HB3  4  
ATOM 8458  H HG2  . ARG A 1 135 ? 14.774  1.516   3.719   1.00 0.00 ?  348 ARG A HG2  4  
ATOM 8459  H HG3  . ARG A 1 135 ? 14.052  3.047   3.270   1.00 0.00 ?  348 ARG A HG3  4  
ATOM 8460  H HD2  . ARG A 1 135 ? 12.305  1.612   1.942   1.00 0.00 ?  348 ARG A HD2  4  
ATOM 8461  H HD3  . ARG A 1 135 ? 12.914  0.254   2.867   1.00 0.00 ?  348 ARG A HD3  4  
ATOM 8462  H HE   . ARG A 1 135 ? 11.325  2.507   3.897   1.00 0.00 ?  348 ARG A HE   4  
ATOM 8463  H HH11 . ARG A 1 135 ? 13.437  -0.187  4.715   1.00 0.00 ?  348 ARG A HH11 4  
ATOM 8464  H HH12 . ARG A 1 135 ? 12.877  -0.296  6.350   1.00 0.00 ?  348 ARG A HH12 4  
ATOM 8465  H HH21 . ARG A 1 135 ? 10.586  2.363   6.054   1.00 0.00 ?  348 ARG A HH21 4  
ATOM 8466  H HH22 . ARG A 1 135 ? 11.244  1.165   7.117   1.00 0.00 ?  348 ARG A HH22 4  
ATOM 8467  N N    . ARG A 1 136 ? 17.149  2.085   -0.505  1.00 0.00 ?  349 ARG A N    4  
ATOM 8468  C CA   . ARG A 1 136 ? 17.832  1.507   -1.649  1.00 0.00 ?  349 ARG A CA   4  
ATOM 8469  C C    . ARG A 1 136 ? 19.349  1.606   -1.468  1.00 0.00 ?  349 ARG A C    4  
ATOM 8470  O O    . ARG A 1 136 ? 20.087  0.719   -1.893  1.00 0.00 ?  349 ARG A O    4  
ATOM 8471  C CB   . ARG A 1 136 ? 17.433  2.215   -2.945  1.00 0.00 ?  349 ARG A CB   4  
ATOM 8472  C CG   . ARG A 1 136 ? 17.019  1.204   -4.017  1.00 0.00 ?  349 ARG A CG   4  
ATOM 8473  C CD   . ARG A 1 136 ? 18.217  0.370   -4.476  1.00 0.00 ?  349 ARG A CD   4  
ATOM 8474  N NE   . ARG A 1 136 ? 18.552  0.696   -5.881  1.00 0.00 ?  349 ARG A NE   4  
ATOM 8475  C CZ   . ARG A 1 136 ? 17.800  0.345   -6.933  1.00 0.00 ?  349 ARG A CZ   4  
ATOM 8476  N NH1  . ARG A 1 136 ? 16.667  -0.345  -6.746  1.00 0.00 ?  349 ARG A NH1  4  
ATOM 8477  N NH2  . ARG A 1 136 ? 18.182  0.684   -8.172  1.00 0.00 1  349 ARG A NH2  4  
ATOM 8478  H H    . ARG A 1 136 ? 16.693  2.958   -0.682  1.00 0.00 ?  349 ARG A H    4  
ATOM 8479  H HA   . ARG A 1 136 ? 17.507  0.467   -1.671  1.00 0.00 ?  349 ARG A HA   4  
ATOM 8480  H HB2  . ARG A 1 136 ? 16.610  2.901   -2.750  1.00 0.00 ?  349 ARG A HB2  4  
ATOM 8481  H HB3  . ARG A 1 136 ? 18.268  2.814   -3.308  1.00 0.00 ?  349 ARG A HB3  4  
ATOM 8482  H HG2  . ARG A 1 136 ? 16.244  0.548   -3.623  1.00 0.00 ?  349 ARG A HG2  4  
ATOM 8483  H HG3  . ARG A 1 136 ? 16.589  1.730   -4.870  1.00 0.00 ?  349 ARG A HG3  4  
ATOM 8484  H HD2  . ARG A 1 136 ? 19.075  0.567   -3.834  1.00 0.00 ?  349 ARG A HD2  4  
ATOM 8485  H HD3  . ARG A 1 136 ? 17.988  -0.691  -4.385  1.00 0.00 ?  349 ARG A HD3  4  
ATOM 8486  H HE   . ARG A 1 136 ? 19.391  1.210   -6.055  1.00 0.00 ?  349 ARG A HE   4  
ATOM 8487  H HH11 . ARG A 1 136 ? 16.382  -0.598  -5.822  1.00 0.00 ?  349 ARG A HH11 4  
ATOM 8488  H HH12 . ARG A 1 136 ? 16.106  -0.607  -7.532  1.00 0.00 ?  349 ARG A HH12 4  
ATOM 8489  H HH21 . ARG A 1 136 ? 19.028  1.198   -8.311  1.00 0.00 ?  349 ARG A HH21 4  
ATOM 8490  H HH22 . ARG A 1 136 ? 17.621  0.421   -8.957  1.00 0.00 ?  349 ARG A HH22 4  
ATOM 8491  N N    . GLY A 1 137 ? 19.767  2.692   -0.836  1.00 0.00 ?  350 GLY A N    4  
ATOM 8492  C CA   . GLY A 1 137 ? 21.182  2.919   -0.594  1.00 0.00 ?  350 GLY A CA   4  
ATOM 8493  C C    . GLY A 1 137 ? 21.904  1.604   -0.295  1.00 0.00 ?  350 GLY A C    4  
ATOM 8494  O O    . GLY A 1 137 ? 22.966  1.334   -0.855  1.00 0.00 ?  350 GLY A O    4  
ATOM 8495  H H    . GLY A 1 137 ? 19.160  3.409   -0.494  1.00 0.00 ?  350 GLY A H    4  
ATOM 8496  H HA2  . GLY A 1 137 ? 21.632  3.396   -1.464  1.00 0.00 ?  350 GLY A HA2  4  
ATOM 8497  H HA3  . GLY A 1 137 ? 21.306  3.604   0.244   1.00 0.00 ?  350 GLY A HA3  4  
ATOM 8498  N N    . ALA A 1 138 ? 21.300  0.820   0.586   1.00 0.00 ?  351 ALA A N    4  
ATOM 8499  C CA   . ALA A 1 138 ? 21.872  -0.460  0.966   1.00 0.00 ?  351 ALA A CA   4  
ATOM 8500  C C    . ALA A 1 138 ? 20.759  -1.385  1.460   1.00 0.00 ?  351 ALA A C    4  
ATOM 8501  O O    . ALA A 1 138 ? 20.064  -1.066  2.423   1.00 0.00 ?  351 ALA A O    4  
ATOM 8502  C CB   . ALA A 1 138 ? 22.960  -0.241  2.019   1.00 0.00 ?  351 ALA A CB   4  
ATOM 8503  H H    . ALA A 1 138 ? 20.437  1.048   1.037   1.00 0.00 ?  351 ALA A H    4  
ATOM 8504  H HA   . ALA A 1 138 ? 22.328  -0.896  0.077   1.00 0.00 ?  351 ALA A HA   4  
ATOM 8505  H HB1  . ALA A 1 138 ? 22.496  -0.106  2.997   1.00 0.00 ?  351 ALA A HB1  4  
ATOM 8506  H HB2  . ALA A 1 138 ? 23.619  -1.109  2.047   1.00 0.00 ?  351 ALA A HB2  4  
ATOM 8507  H HB3  . ALA A 1 138 ? 23.538  0.647   1.766   1.00 0.00 ?  351 ALA A HB3  4  
ATOM 8508  N N    . ALA A 1 139 ? 20.624  -2.513  0.779   1.00 0.00 ?  352 ALA A N    4  
ATOM 8509  C CA   . ALA A 1 139 ? 19.606  -3.487  1.137   1.00 0.00 ?  352 ALA A CA   4  
ATOM 8510  C C    . ALA A 1 139 ? 19.850  -3.969  2.568   1.00 0.00 ?  352 ALA A C    4  
ATOM 8511  O O    . ALA A 1 139 ? 20.888  -3.675  3.158   1.00 0.00 ?  352 ALA A O    4  
ATOM 8512  C CB   . ALA A 1 139 ? 19.619  -4.634  0.125   1.00 0.00 ?  352 ALA A CB   4  
ATOM 8513  H H    . ALA A 1 139 ? 21.193  -2.765  -0.004  1.00 0.00 ?  352 ALA A H    4  
ATOM 8514  H HA   . ALA A 1 139 ? 18.638  -2.988  1.090   1.00 0.00 ?  352 ALA A HA   4  
ATOM 8515  H HB1  . ALA A 1 139 ? 20.584  -5.138  0.159   1.00 0.00 ?  352 ALA A HB1  4  
ATOM 8516  H HB2  . ALA A 1 139 ? 18.829  -5.344  0.371   1.00 0.00 ?  352 ALA A HB2  4  
ATOM 8517  H HB3  . ALA A 1 139 ? 19.451  -4.237  -0.877  1.00 0.00 ?  352 ALA A HB3  4  
ATOM 8518  N N    . ALA A 1 140 ? 18.875  -4.702  3.085   1.00 0.00 ?  353 ALA A N    4  
ATOM 8519  C CA   . ALA A 1 140 ? 18.970  -5.228  4.436   1.00 0.00 ?  353 ALA A CA   4  
ATOM 8520  C C    . ALA A 1 140 ? 19.005  -6.757  4.383   1.00 0.00 ?  353 ALA A C    4  
ATOM 8521  O O    . ALA A 1 140 ? 18.193  -7.376  3.696   1.00 0.00 ?  353 ALA A O    4  
ATOM 8522  C CB   . ALA A 1 140 ? 17.802  -4.701  5.273   1.00 0.00 ?  353 ALA A CB   4  
ATOM 8523  H H    . ALA A 1 140 ? 18.033  -4.937  2.599   1.00 0.00 ?  353 ALA A H    4  
ATOM 8524  H HA   . ALA A 1 140 ? 19.903  -4.867  4.868   1.00 0.00 ?  353 ALA A HA   4  
ATOM 8525  H HB1  . ALA A 1 140 ? 18.155  -4.455  6.275   1.00 0.00 ?  353 ALA A HB1  4  
ATOM 8526  H HB2  . ALA A 1 140 ? 17.393  -3.807  4.803   1.00 0.00 ?  353 ALA A HB2  4  
ATOM 8527  H HB3  . ALA A 1 140 ? 17.028  -5.465  5.338   1.00 0.00 ?  353 ALA A HB3  4  
ATOM 8528  N N    . SER A 1 141 ? 19.954  -7.321  5.115   1.00 0.00 ?  354 SER A N    4  
ATOM 8529  C CA   . SER A 1 141 ? 20.105  -8.766  5.159   1.00 0.00 ?  354 SER A CA   4  
ATOM 8530  C C    . SER A 1 141 ? 19.048  -9.375  6.082   1.00 0.00 ?  354 SER A C    4  
ATOM 8531  O O    . SER A 1 141 ? 18.927  -8.979  7.240   1.00 0.00 ?  354 SER A O    4  
ATOM 8532  C CB   . SER A 1 141 ? 21.508  -9.158  5.628   1.00 0.00 ?  354 SER A CB   4  
ATOM 8533  O OG   . SER A 1 141 ? 22.523  -8.614  4.788   1.00 0.00 ?  354 SER A OG   4  
ATOM 8534  H H    . SER A 1 141 ? 20.610  -6.810  5.670   1.00 0.00 ?  354 SER A H    4  
ATOM 8535  H HA   . SER A 1 141 ? 19.958  -9.103  4.133   1.00 0.00 ?  354 SER A HA   4  
ATOM 8536  H HB2  . SER A 1 141 ? 21.659  -8.812  6.650   1.00 0.00 ?  354 SER A HB2  4  
ATOM 8537  H HB3  . SER A 1 141 ? 21.594  -10.245 5.643   1.00 0.00 ?  354 SER A HB3  4  
ATOM 8538  H HG   . SER A 1 141 ? 22.141  -7.889  4.215   1.00 0.00 ?  354 SER A HG   4  
ATOM 8539  N N    . ALA A 1 142 ? 18.308  -10.328 5.534   1.00 0.00 ?  355 ALA A N    4  
ATOM 8540  C CA   . ALA A 1 142 ? 17.265  -10.995 6.293   1.00 0.00 ?  355 ALA A CA   4  
ATOM 8541  C C    . ALA A 1 142 ? 16.686  -12.140 5.459   1.00 0.00 ?  355 ALA A C    4  
ATOM 8542  O O    . ALA A 1 142 ? 15.469  -12.270 5.336   1.00 0.00 ?  355 ALA A O    4  
ATOM 8543  C CB   . ALA A 1 142 ? 16.200  -9.976  6.703   1.00 0.00 ?  355 ALA A CB   4  
ATOM 8544  H H    . ALA A 1 142 ? 18.413  -10.644 4.591   1.00 0.00 ?  355 ALA A H    4  
ATOM 8545  H HA   . ALA A 1 142 ? 17.721  -11.408 7.193   1.00 0.00 ?  355 ALA A HA   4  
ATOM 8546  H HB1  . ALA A 1 142 ? 15.233  -10.473 6.782   1.00 0.00 ?  355 ALA A HB1  4  
ATOM 8547  H HB2  . ALA A 1 142 ? 16.465  -9.541  7.667   1.00 0.00 ?  355 ALA A HB2  4  
ATOM 8548  H HB3  . ALA A 1 142 ? 16.143  -9.188  5.952   1.00 0.00 ?  355 ALA A HB3  4  
ATOM 8549  N N    . GLY A 1 1   ? -31.769 0.153   -9.557  1.00 0.00 ?  214 GLY A N    5  
ATOM 8550  C CA   . GLY A 1 1   ? -30.514 -0.119  -10.237 1.00 0.00 ?  214 GLY A CA   5  
ATOM 8551  C C    . GLY A 1 1   ? -29.477 -0.687  -9.266  1.00 0.00 ?  214 GLY A C    5  
ATOM 8552  O O    . GLY A 1 1   ? -29.829 -1.365  -8.303  1.00 0.00 ?  214 GLY A O    5  
ATOM 8553  H H1   . GLY A 1 1   ? -32.440 -0.588  -9.597  1.00 0.00 ?  214 GLY A H1   5  
ATOM 8554  H HA2  . GLY A 1 1   ? -30.682 -0.825  -11.050 1.00 0.00 ?  214 GLY A HA2  5  
ATOM 8555  H HA3  . GLY A 1 1   ? -30.133 0.799   -10.686 1.00 0.00 ?  214 GLY A HA3  5  
ATOM 8556  N N    . SER A 1 2   ? -28.218 -0.390  -9.555  1.00 0.00 ?  215 SER A N    5  
ATOM 8557  C CA   . SER A 1 2   ? -27.127 -0.863  -8.720  1.00 0.00 ?  215 SER A CA   5  
ATOM 8558  C C    . SER A 1 2   ? -26.713 0.229   -7.731  1.00 0.00 ?  215 SER A C    5  
ATOM 8559  O O    . SER A 1 2   ? -26.838 1.417   -8.025  1.00 0.00 ?  215 SER A O    5  
ATOM 8560  C CB   . SER A 1 2   ? -25.929 -1.291  -9.569  1.00 0.00 ?  215 SER A CB   5  
ATOM 8561  O OG   . SER A 1 2   ? -26.101 -2.597  -10.114 1.00 0.00 ?  215 SER A OG   5  
ATOM 8562  H H    . SER A 1 2   ? -27.940 0.162   -10.341 1.00 0.00 ?  215 SER A H    5  
ATOM 8563  H HA   . SER A 1 2   ? -27.524 -1.728  -8.189  1.00 0.00 ?  215 SER A HA   5  
ATOM 8564  H HB2  . SER A 1 2   ? -25.785 -0.577  -10.379 1.00 0.00 ?  215 SER A HB2  5  
ATOM 8565  H HB3  . SER A 1 2   ? -25.026 -1.269  -8.960  1.00 0.00 ?  215 SER A HB3  5  
ATOM 8566  H HG   . SER A 1 2   ? -26.178 -2.544  -11.110 1.00 0.00 ?  215 SER A HG   5  
ATOM 8567  N N    . GLN A 1 3   ? -26.230 -0.212  -6.580  1.00 0.00 ?  216 GLN A N    5  
ATOM 8568  C CA   . GLN A 1 3   ? -25.797 0.714   -5.546  1.00 0.00 ?  216 GLN A CA   5  
ATOM 8569  C C    . GLN A 1 3   ? -24.758 0.050   -4.641  1.00 0.00 ?  216 GLN A C    5  
ATOM 8570  O O    . GLN A 1 3   ? -24.819 -1.155  -4.399  1.00 0.00 ?  216 GLN A O    5  
ATOM 8571  C CB   . GLN A 1 3   ? -26.988 1.223   -4.732  1.00 0.00 ?  216 GLN A CB   5  
ATOM 8572  C CG   . GLN A 1 3   ? -27.622 0.091   -3.921  1.00 0.00 ?  216 GLN A CG   5  
ATOM 8573  C CD   . GLN A 1 3   ? -28.345 0.637   -2.688  1.00 0.00 ?  216 GLN A CD   5  
ATOM 8574  O OE1  . GLN A 1 3   ? -27.791 1.373   -1.887  1.00 0.00 ?  216 GLN A OE1  5  
ATOM 8575  N NE2  . GLN A 1 3   ? -29.609 0.239   -2.581  1.00 0.00 ?  216 GLN A NE2  5  
ATOM 8576  H H    . GLN A 1 3   ? -26.132 -1.180  -6.348  1.00 0.00 ?  216 GLN A H    5  
ATOM 8577  H HA   . GLN A 1 3   ? -25.344 1.550   -6.078  1.00 0.00 ?  216 GLN A HA   5  
ATOM 8578  H HB2  . GLN A 1 3   ? -26.662 2.017   -4.061  1.00 0.00 ?  216 GLN A HB2  5  
ATOM 8579  H HB3  . GLN A 1 3   ? -27.732 1.656   -5.401  1.00 0.00 ?  216 GLN A HB3  5  
ATOM 8580  H HG2  . GLN A 1 3   ? -28.326 -0.459  -4.545  1.00 0.00 ?  216 GLN A HG2  5  
ATOM 8581  H HG3  . GLN A 1 3   ? -26.851 -0.615  -3.611  1.00 0.00 ?  216 GLN A HG3  5  
ATOM 8582  H HE21 . GLN A 1 3   ? -30.003 -0.366  -3.274  1.00 0.00 ?  216 GLN A HE21 5  
ATOM 8583  H HE22 . GLN A 1 3   ? -30.165 0.543   -1.808  1.00 0.00 ?  216 GLN A HE22 5  
ATOM 8584  N N    . GLU A 1 4   ? -23.827 0.864   -4.165  1.00 0.00 ?  217 GLU A N    5  
ATOM 8585  C CA   . GLU A 1 4   ? -22.776 0.371   -3.291  1.00 0.00 ?  217 GLU A CA   5  
ATOM 8586  C C    . GLU A 1 4   ? -22.996 0.871   -1.862  1.00 0.00 ?  217 GLU A C    5  
ATOM 8587  O O    . GLU A 1 4   ? -23.671 1.877   -1.649  1.00 0.00 ?  217 GLU A O    5  
ATOM 8588  C CB   . GLU A 1 4   ? -21.396 0.780   -3.809  1.00 0.00 ?  217 GLU A CB   5  
ATOM 8589  C CG   . GLU A 1 4   ? -20.639 -0.428  -4.366  1.00 0.00 ?  217 GLU A CG   5  
ATOM 8590  C CD   . GLU A 1 4   ? -19.605 0.006   -5.406  1.00 0.00 ?  217 GLU A CD   5  
ATOM 8591  O OE1  . GLU A 1 4   ? -18.446 0.274   -5.054  1.00 0.00 ?  217 GLU A OE1  5  
ATOM 8592  O OE2  . GLU A 1 4   ? -20.040 0.058   -6.619  1.00 0.00 -1 217 GLU A OE2  5  
ATOM 8593  H H    . GLU A 1 4   ? -23.785 1.843   -4.366  1.00 0.00 ?  217 GLU A H    5  
ATOM 8594  H HA   . GLU A 1 4   ? -22.861 -0.715  -3.320  1.00 0.00 ?  217 GLU A HA   5  
ATOM 8595  H HB2  . GLU A 1 4   ? -21.505 1.536   -4.587  1.00 0.00 ?  217 GLU A HB2  5  
ATOM 8596  H HB3  . GLU A 1 4   ? -20.821 1.234   -3.002  1.00 0.00 ?  217 GLU A HB3  5  
ATOM 8597  H HG2  . GLU A 1 4   ? -20.143 -0.957  -3.552  1.00 0.00 ?  217 GLU A HG2  5  
ATOM 8598  H HG3  . GLU A 1 4   ? -21.344 -1.126  -4.817  1.00 0.00 ?  217 GLU A HG3  5  
ATOM 8599  H HE2  . GLU A 1 4   ? -20.987 0.380   -6.629  1.00 0.00 ?  217 GLU A HE2  5  
ATOM 8600  N N    . VAL A 1 5   ? -22.413 0.145   -0.919  1.00 0.00 ?  218 VAL A N    5  
ATOM 8601  C CA   . VAL A 1 5   ? -22.536 0.502   0.484   1.00 0.00 ?  218 VAL A CA   5  
ATOM 8602  C C    . VAL A 1 5   ? -21.205 1.070   0.980   1.00 0.00 ?  218 VAL A C    5  
ATOM 8603  O O    . VAL A 1 5   ? -20.181 0.937   0.311   1.00 0.00 ?  218 VAL A O    5  
ATOM 8604  C CB   . VAL A 1 5   ? -23.009 -0.708  1.292   1.00 0.00 ?  218 VAL A CB   5  
ATOM 8605  C CG1  . VAL A 1 5   ? -24.390 -1.173  0.826   1.00 0.00 ?  218 VAL A CG1  5  
ATOM 8606  C CG2  . VAL A 1 5   ? -21.992 -1.848  1.218   1.00 0.00 ?  218 VAL A CG2  5  
ATOM 8607  H H    . VAL A 1 5   ? -21.866 -0.672  -1.101  1.00 0.00 ?  218 VAL A H    5  
ATOM 8608  H HA   . VAL A 1 5   ? -23.299 1.277   0.560   1.00 0.00 ?  218 VAL A HA   5  
ATOM 8609  H HB   . VAL A 1 5   ? -23.093 -0.402  2.335   1.00 0.00 ?  218 VAL A HB   5  
ATOM 8610  H HG11 . VAL A 1 5   ? -25.144 -0.843  1.540   1.00 0.00 ?  218 VAL A HG11 5  
ATOM 8611  H HG12 . VAL A 1 5   ? -24.605 -0.747  -0.154  1.00 0.00 ?  218 VAL A HG12 5  
ATOM 8612  H HG13 . VAL A 1 5   ? -24.403 -2.261  0.760   1.00 0.00 ?  218 VAL A HG13 5  
ATOM 8613  H HG21 . VAL A 1 5   ? -21.875 -2.297  2.204   1.00 0.00 ?  218 VAL A HG21 5  
ATOM 8614  H HG22 . VAL A 1 5   ? -22.343 -2.603  0.515   1.00 0.00 ?  218 VAL A HG22 5  
ATOM 8615  H HG23 . VAL A 1 5   ? -21.032 -1.458  0.880   1.00 0.00 ?  218 VAL A HG23 5  
ATOM 8616  N N    . ARG A 1 6   ? -21.262 1.690   2.150   1.00 0.00 ?  219 ARG A N    5  
ATOM 8617  C CA   . ARG A 1 6   ? -20.073 2.278   2.744   1.00 0.00 ?  219 ARG A CA   5  
ATOM 8618  C C    . ARG A 1 6   ? -19.552 1.393   3.877   1.00 0.00 ?  219 ARG A C    5  
ATOM 8619  O O    . ARG A 1 6   ? -20.235 0.465   4.308   1.00 0.00 ?  219 ARG A O    5  
ATOM 8620  C CB   . ARG A 1 6   ? -20.366 3.677   3.292   1.00 0.00 ?  219 ARG A CB   5  
ATOM 8621  C CG   . ARG A 1 6   ? -19.789 4.757   2.374   1.00 0.00 ?  219 ARG A CG   5  
ATOM 8622  C CD   . ARG A 1 6   ? -20.532 6.082   2.554   1.00 0.00 ?  219 ARG A CD   5  
ATOM 8623  N NE   . ARG A 1 6   ? -20.091 7.053   1.527   1.00 0.00 ?  219 ARG A NE   5  
ATOM 8624  C CZ   . ARG A 1 6   ? -20.524 7.052   0.259   1.00 0.00 ?  219 ARG A CZ   5  
ATOM 8625  N NH1  . ARG A 1 6   ? -21.411 6.133   -0.146  1.00 0.00 ?  219 ARG A NH1  5  
ATOM 8626  N NH2  . ARG A 1 6   ? -20.070 7.971   -0.605  1.00 0.00 1  219 ARG A NH2  5  
ATOM 8627  H H    . ARG A 1 6   ? -22.099 1.794   2.688   1.00 0.00 ?  219 ARG A H    5  
ATOM 8628  H HA   . ARG A 1 6   ? -19.353 2.335   1.927   1.00 0.00 ?  219 ARG A HA   5  
ATOM 8629  H HB2  . ARG A 1 6   ? -21.443 3.815   3.390   1.00 0.00 ?  219 ARG A HB2  5  
ATOM 8630  H HB3  . ARG A 1 6   ? -19.939 3.776   4.290   1.00 0.00 ?  219 ARG A HB3  5  
ATOM 8631  H HG2  . ARG A 1 6   ? -18.730 4.896   2.592   1.00 0.00 ?  219 ARG A HG2  5  
ATOM 8632  H HG3  . ARG A 1 6   ? -19.861 4.433   1.336   1.00 0.00 ?  219 ARG A HG3  5  
ATOM 8633  H HD2  . ARG A 1 6   ? -21.607 5.920   2.475   1.00 0.00 ?  219 ARG A HD2  5  
ATOM 8634  H HD3  . ARG A 1 6   ? -20.341 6.483   3.550   1.00 0.00 ?  219 ARG A HD3  5  
ATOM 8635  H HE   . ARG A 1 6   ? -19.429 7.752   1.796   1.00 0.00 ?  219 ARG A HE   5  
ATOM 8636  H HH11 . ARG A 1 6   ? -21.750 5.448   0.498   1.00 0.00 ?  219 ARG A HH11 5  
ATOM 8637  H HH12 . ARG A 1 6   ? -21.734 6.133   -1.093  1.00 0.00 ?  219 ARG A HH12 5  
ATOM 8638  H HH21 . ARG A 1 6   ? -19.407 8.657   -0.303  1.00 0.00 ?  219 ARG A HH21 5  
ATOM 8639  H HH22 . ARG A 1 6   ? -20.392 7.971   -1.551  1.00 0.00 ?  219 ARG A HH22 5  
ATOM 8640  N N    . ARG A 1 7   ? -18.348 1.710   4.327   1.00 0.00 ?  220 ARG A N    5  
ATOM 8641  C CA   . ARG A 1 7   ? -17.727 0.955   5.402   1.00 0.00 ?  220 ARG A CA   5  
ATOM 8642  C C    . ARG A 1 7   ? -17.356 1.885   6.559   1.00 0.00 ?  220 ARG A C    5  
ATOM 8643  O O    . ARG A 1 7   ? -17.142 3.079   6.356   1.00 0.00 ?  220 ARG A O    5  
ATOM 8644  C CB   . ARG A 1 7   ? -16.470 0.233   4.914   1.00 0.00 ?  220 ARG A CB   5  
ATOM 8645  C CG   . ARG A 1 7   ? -16.830 -0.929  3.986   1.00 0.00 ?  220 ARG A CG   5  
ATOM 8646  C CD   . ARG A 1 7   ? -16.048 -2.191  4.359   1.00 0.00 ?  220 ARG A CD   5  
ATOM 8647  N NE   . ARG A 1 7   ? -16.862 -3.393  4.073   1.00 0.00 ?  220 ARG A NE   5  
ATOM 8648  C CZ   . ARG A 1 7   ? -18.023 -3.677  4.678   1.00 0.00 ?  220 ARG A CZ   5  
ATOM 8649  N NH1  . ARG A 1 7   ? -18.514 -2.846  5.608   1.00 0.00 ?  220 ARG A NH1  5  
ATOM 8650  N NH2  . ARG A 1 7   ? -18.693 -4.791  4.355   1.00 0.00 1  220 ARG A NH2  5  
ATOM 8651  H H    . ARG A 1 7   ? -17.799 2.466   3.971   1.00 0.00 ?  220 ARG A H    5  
ATOM 8652  H HA   . ARG A 1 7   ? -18.483 0.232   5.707   1.00 0.00 ?  220 ARG A HA   5  
ATOM 8653  H HB2  . ARG A 1 7   ? -15.824 0.936   4.388   1.00 0.00 ?  220 ARG A HB2  5  
ATOM 8654  H HB3  . ARG A 1 7   ? -15.905 -0.140  5.768   1.00 0.00 ?  220 ARG A HB3  5  
ATOM 8655  H HG2  . ARG A 1 7   ? -17.899 -1.129  4.046   1.00 0.00 ?  220 ARG A HG2  5  
ATOM 8656  H HG3  . ARG A 1 7   ? -16.614 -0.655  2.953   1.00 0.00 ?  220 ARG A HG3  5  
ATOM 8657  H HD2  . ARG A 1 7   ? -15.115 -2.230  3.797   1.00 0.00 ?  220 ARG A HD2  5  
ATOM 8658  H HD3  . ARG A 1 7   ? -15.783 -2.165  5.416   1.00 0.00 ?  220 ARG A HD3  5  
ATOM 8659  H HE   . ARG A 1 7   ? -16.524 -4.035  3.384   1.00 0.00 ?  220 ARG A HE   5  
ATOM 8660  H HH11 . ARG A 1 7   ? -18.014 -2.014  5.850   1.00 0.00 ?  220 ARG A HH11 5  
ATOM 8661  H HH12 . ARG A 1 7   ? -19.381 -3.057  6.060   1.00 0.00 ?  220 ARG A HH12 5  
ATOM 8662  H HH21 . ARG A 1 7   ? -18.327 -5.411  3.661   1.00 0.00 ?  220 ARG A HH21 5  
ATOM 8663  H HH22 . ARG A 1 7   ? -19.560 -5.002  4.807   1.00 0.00 ?  220 ARG A HH22 5  
ATOM 8664  N N    . GLY A 1 8   ? -17.291 1.302   7.747   1.00 0.00 ?  221 GLY A N    5  
ATOM 8665  C CA   . GLY A 1 8   ? -16.950 2.063   8.937   1.00 0.00 ?  221 GLY A CA   5  
ATOM 8666  C C    . GLY A 1 8   ? -15.570 1.666   9.465   1.00 0.00 ?  221 GLY A C    5  
ATOM 8667  O O    . GLY A 1 8   ? -15.248 1.921   10.625  1.00 0.00 ?  221 GLY A O    5  
ATOM 8668  H H    . GLY A 1 8   ? -17.466 0.330   7.904   1.00 0.00 ?  221 GLY A H    5  
ATOM 8669  H HA2  . GLY A 1 8   ? -16.962 3.129   8.706   1.00 0.00 ?  221 GLY A HA2  5  
ATOM 8670  H HA3  . GLY A 1 8   ? -17.701 1.896   9.708   1.00 0.00 ?  221 GLY A HA3  5  
ATOM 8671  N N    . ASP A 1 9   ? -14.792 1.047   8.589   1.00 0.00 ?  222 ASP A N    5  
ATOM 8672  C CA   . ASP A 1 9   ? -13.454 0.611   8.953   1.00 0.00 ?  222 ASP A CA   5  
ATOM 8673  C C    . ASP A 1 9   ? -12.451 1.711   8.601   1.00 0.00 ?  222 ASP A C    5  
ATOM 8674  O O    . ASP A 1 9   ? -11.255 1.449   8.478   1.00 0.00 ?  222 ASP A O    5  
ATOM 8675  C CB   . ASP A 1 9   ? -13.059 -0.652  8.187   1.00 0.00 ?  222 ASP A CB   5  
ATOM 8676  C CG   . ASP A 1 9   ? -13.120 -1.947  9.000   1.00 0.00 ?  222 ASP A CG   5  
ATOM 8677  O OD1  . ASP A 1 9   ? -14.044 -2.156  9.801   1.00 0.00 ?  222 ASP A OD1  5  
ATOM 8678  O OD2  . ASP A 1 9   ? -12.154 -2.774  8.782   1.00 0.00 -1 222 ASP A OD2  5  
ATOM 8679  H H    . ASP A 1 9   ? -15.061 0.843   7.648   1.00 0.00 ?  222 ASP A H    5  
ATOM 8680  H HA   . ASP A 1 9   ? -13.499 0.415   10.025  1.00 0.00 ?  222 ASP A HA   5  
ATOM 8681  H HB2  . ASP A 1 9   ? -13.713 -0.754  7.321   1.00 0.00 ?  222 ASP A HB2  5  
ATOM 8682  H HB3  . ASP A 1 9   ? -12.045 -0.527  7.808   1.00 0.00 ?  222 ASP A HB3  5  
ATOM 8683  H HD2  . ASP A 1 9   ? -12.520 -3.687  8.601   1.00 0.00 ?  222 ASP A HD2  5  
ATOM 8684  N N    . PHE A 1 10  ? -12.974 2.919   8.448   1.00 0.00 ?  223 PHE A N    5  
ATOM 8685  C CA   . PHE A 1 10  ? -12.139 4.059   8.113   1.00 0.00 ?  223 PHE A CA   5  
ATOM 8686  C C    . PHE A 1 10  ? -10.971 4.191   9.092   1.00 0.00 ?  223 PHE A C    5  
ATOM 8687  O O    . PHE A 1 10  ? -9.866  4.563   8.700   1.00 0.00 ?  223 PHE A O    5  
ATOM 8688  C CB   . PHE A 1 10  ? -13.020 5.306   8.218   1.00 0.00 ?  223 PHE A CB   5  
ATOM 8689  C CG   . PHE A 1 10  ? -12.403 6.559   7.595   1.00 0.00 ?  223 PHE A CG   5  
ATOM 8690  C CD1  . PHE A 1 10  ? -12.578 6.817   6.271   1.00 0.00 ?  223 PHE A CD1  5  
ATOM 8691  C CD2  . PHE A 1 10  ? -11.679 7.415   8.365   1.00 0.00 ?  223 PHE A CD2  5  
ATOM 8692  C CE1  . PHE A 1 10  ? -12.005 7.980   5.693   1.00 0.00 ?  223 PHE A CE1  5  
ATOM 8693  C CE2  . PHE A 1 10  ? -11.106 8.579   7.786   1.00 0.00 ?  223 PHE A CE2  5  
ATOM 8694  C CZ   . PHE A 1 10  ? -11.281 8.837   6.463   1.00 0.00 ?  223 PHE A CZ   5  
ATOM 8695  H H    . PHE A 1 10  ? -13.948 3.123   8.550   1.00 0.00 ?  223 PHE A H    5  
ATOM 8696  H HA   . PHE A 1 10  ? -11.751 3.892   7.108   1.00 0.00 ?  223 PHE A HA   5  
ATOM 8697  H HB2  . PHE A 1 10  ? -13.976 5.104   7.734   1.00 0.00 ?  223 PHE A HB2  5  
ATOM 8698  H HB3  . PHE A 1 10  ? -13.231 5.501   9.269   1.00 0.00 ?  223 PHE A HB3  5  
ATOM 8699  H HD1  . PHE A 1 10  ? -13.158 6.131   5.654   1.00 0.00 ?  223 PHE A HD1  5  
ATOM 8700  H HD2  . PHE A 1 10  ? -11.539 7.208   9.426   1.00 0.00 ?  223 PHE A HD2  5  
ATOM 8701  H HE1  . PHE A 1 10  ? -12.145 8.187   4.632   1.00 0.00 ?  223 PHE A HE1  5  
ATOM 8702  H HE2  . PHE A 1 10  ? -10.526 9.265   8.403   1.00 0.00 ?  223 PHE A HE2  5  
ATOM 8703  H HZ   . PHE A 1 10  ? -10.841 9.730   6.019   1.00 0.00 ?  223 PHE A HZ   5  
ATOM 8704  N N    . VAL A 1 11  ? -11.255 3.878   10.348  1.00 0.00 ?  224 VAL A N    5  
ATOM 8705  C CA   . VAL A 1 11  ? -10.242 3.956   11.386  1.00 0.00 ?  224 VAL A CA   5  
ATOM 8706  C C    . VAL A 1 11  ? -9.197  2.863   11.157  1.00 0.00 ?  224 VAL A C    5  
ATOM 8707  O O    . VAL A 1 11  ? -8.018  3.055   11.450  1.00 0.00 ?  224 VAL A O    5  
ATOM 8708  C CB   . VAL A 1 11  ? -10.899 3.875   12.765  1.00 0.00 ?  224 VAL A CB   5  
ATOM 8709  C CG1  . VAL A 1 11  ? -10.762 2.470   13.356  1.00 0.00 ?  224 VAL A CG1  5  
ATOM 8710  C CG2  . VAL A 1 11  ? -10.319 4.927   13.713  1.00 0.00 ?  224 VAL A CG2  5  
ATOM 8711  H H    . VAL A 1 11  ? -12.157 3.576   10.659  1.00 0.00 ?  224 VAL A H    5  
ATOM 8712  H HA   . VAL A 1 11  ? -9.758  4.929   11.300  1.00 0.00 ?  224 VAL A HA   5  
ATOM 8713  H HB   . VAL A 1 11  ? -11.962 4.085   12.643  1.00 0.00 ?  224 VAL A HB   5  
ATOM 8714  H HG11 . VAL A 1 11  ? -9.719  2.283   13.611  1.00 0.00 ?  224 VAL A HG11 5  
ATOM 8715  H HG12 . VAL A 1 11  ? -11.375 2.392   14.254  1.00 0.00 ?  224 VAL A HG12 5  
ATOM 8716  H HG13 . VAL A 1 11  ? -11.095 1.734   12.624  1.00 0.00 ?  224 VAL A HG13 5  
ATOM 8717  H HG21 . VAL A 1 11  ? -10.375 5.909   13.243  1.00 0.00 ?  224 VAL A HG21 5  
ATOM 8718  H HG22 . VAL A 1 11  ? -10.890 4.934   14.641  1.00 0.00 ?  224 VAL A HG22 5  
ATOM 8719  H HG23 . VAL A 1 11  ? -9.278  4.686   13.929  1.00 0.00 ?  224 VAL A HG23 5  
ATOM 8720  N N    . ARG A 1 12  ? -9.667  1.740   10.634  1.00 0.00 ?  225 ARG A N    5  
ATOM 8721  C CA   . ARG A 1 12  ? -8.787  0.616   10.361  1.00 0.00 ?  225 ARG A CA   5  
ATOM 8722  C C    . ARG A 1 12  ? -7.820  0.962   9.228   1.00 0.00 ?  225 ARG A C    5  
ATOM 8723  O O    . ARG A 1 12  ? -6.669  0.528   9.235   1.00 0.00 ?  225 ARG A O    5  
ATOM 8724  C CB   . ARG A 1 12  ? -9.588  -0.630  9.977   1.00 0.00 ?  225 ARG A CB   5  
ATOM 8725  C CG   . ARG A 1 12  ? -9.014  -1.879  10.647  1.00 0.00 ?  225 ARG A CG   5  
ATOM 8726  C CD   . ARG A 1 12  ? -7.790  -2.396  9.887   1.00 0.00 ?  225 ARG A CD   5  
ATOM 8727  N NE   . ARG A 1 12  ? -6.849  -3.046  10.825  1.00 0.00 ?  225 ARG A NE   5  
ATOM 8728  C CZ   . ARG A 1 12  ? -7.080  -4.220  11.429  1.00 0.00 ?  225 ARG A CZ   5  
ATOM 8729  N NH1  . ARG A 1 12  ? -8.223  -4.880  11.196  1.00 0.00 ?  225 ARG A NH1  5  
ATOM 8730  N NH2  . ARG A 1 12  ? -6.168  -4.734  12.265  1.00 0.00 1  225 ARG A NH2  5  
ATOM 8731  H H    . ARG A 1 12  ? -10.627 1.592   10.398  1.00 0.00 ?  225 ARG A H    5  
ATOM 8732  H HA   . ARG A 1 12  ? -8.252  0.448   11.296  1.00 0.00 ?  225 ARG A HA   5  
ATOM 8733  H HB2  . ARG A 1 12  ? -10.630 -0.501  10.271  1.00 0.00 ?  225 ARG A HB2  5  
ATOM 8734  H HB3  . ARG A 1 12  ? -9.576  -0.755  8.895   1.00 0.00 ?  225 ARG A HB3  5  
ATOM 8735  H HG2  . ARG A 1 12  ? -8.737  -1.650  11.676  1.00 0.00 ?  225 ARG A HG2  5  
ATOM 8736  H HG3  . ARG A 1 12  ? -9.776  -2.658  10.688  1.00 0.00 ?  225 ARG A HG3  5  
ATOM 8737  H HD2  . ARG A 1 12  ? -8.101  -3.106  9.121   1.00 0.00 ?  225 ARG A HD2  5  
ATOM 8738  H HD3  . ARG A 1 12  ? -7.295  -1.571  9.375   1.00 0.00 ?  225 ARG A HD3  5  
ATOM 8739  H HE   . ARG A 1 12  ? -5.986  -2.580  11.022  1.00 0.00 ?  225 ARG A HE   5  
ATOM 8740  H HH11 . ARG A 1 12  ? -8.903  -4.496  10.572  1.00 0.00 ?  225 ARG A HH11 5  
ATOM 8741  H HH12 . ARG A 1 12  ? -8.395  -5.756  11.646  1.00 0.00 ?  225 ARG A HH12 5  
ATOM 8742  H HH21 . ARG A 1 12  ? -5.315  -4.242  12.439  1.00 0.00 ?  225 ARG A HH21 5  
ATOM 8743  H HH22 . ARG A 1 12  ? -6.340  -5.610  12.716  1.00 0.00 ?  225 ARG A HH22 5  
ATOM 8744  N N    . ASN A 1 13  ? -8.323  1.740   8.280   1.00 0.00 ?  226 ASN A N    5  
ATOM 8745  C CA   . ASN A 1 13  ? -7.517  2.148   7.142   1.00 0.00 ?  226 ASN A CA   5  
ATOM 8746  C C    . ASN A 1 13  ? -6.568  3.269   7.571   1.00 0.00 ?  226 ASN A C    5  
ATOM 8747  O O    . ASN A 1 13  ? -5.471  3.399   7.030   1.00 0.00 ?  226 ASN A O    5  
ATOM 8748  C CB   . ASN A 1 13  ? -8.396  2.681   6.009   1.00 0.00 ?  226 ASN A CB   5  
ATOM 8749  C CG   . ASN A 1 13  ? -8.723  1.576   5.002   1.00 0.00 ?  226 ASN A CG   5  
ATOM 8750  O OD1  . ASN A 1 13  ? -8.784  0.402   5.329   1.00 0.00 ?  226 ASN A OD1  5  
ATOM 8751  N ND2  . ASN A 1 13  ? -8.929  2.015   3.764   1.00 0.00 ?  226 ASN A ND2  5  
ATOM 8752  H H    . ASN A 1 13  ? -9.260  2.088   8.282   1.00 0.00 ?  226 ASN A H    5  
ATOM 8753  H HA   . ASN A 1 13  ? -6.987  1.249   6.829   1.00 0.00 ?  226 ASN A HA   5  
ATOM 8754  H HB2  . ASN A 1 13  ? -9.320  3.088   6.420   1.00 0.00 ?  226 ASN A HB2  5  
ATOM 8755  H HB3  . ASN A 1 13  ? -7.885  3.500   5.502   1.00 0.00 ?  226 ASN A HB3  5  
ATOM 8756  H HD21 . ASN A 1 13  ? -8.864  2.993   3.563   1.00 0.00 ?  226 ASN A HD21 5  
ATOM 8757  H HD22 . ASN A 1 13  ? -9.149  1.368   3.034   1.00 0.00 ?  226 ASN A HD22 5  
ATOM 8758  N N    . TRP A 1 14  ? -7.025  4.050   8.539   1.00 0.00 ?  227 TRP A N    5  
ATOM 8759  C CA   . TRP A 1 14  ? -6.229  5.155   9.046   1.00 0.00 ?  227 TRP A CA   5  
ATOM 8760  C C    . TRP A 1 14  ? -5.016  4.571   9.772   1.00 0.00 ?  227 TRP A C    5  
ATOM 8761  O O    . TRP A 1 14  ? -3.894  5.040   9.589   1.00 0.00 ?  227 TRP A O    5  
ATOM 8762  C CB   . TRP A 1 14  ? -7.072  6.074   9.934   1.00 0.00 ?  227 TRP A CB   5  
ATOM 8763  C CG   . TRP A 1 14  ? -6.639  7.541   9.899   1.00 0.00 ?  227 TRP A CG   5  
ATOM 8764  C CD1  . TRP A 1 14  ? -5.401  8.033   9.746   1.00 0.00 ?  227 TRP A CD1  5  
ATOM 8765  C CD2  . TRP A 1 14  ? -7.497  8.694   10.026  1.00 0.00 ?  227 TRP A CD2  5  
ATOM 8766  N NE1  . TRP A 1 14  ? -5.400  9.413   9.766   1.00 0.00 ?  227 TRP A NE1  5  
ATOM 8767  C CE2  . TRP A 1 14  ? -6.715  9.828   9.941   1.00 0.00 ?  227 TRP A CE2  5  
ATOM 8768  C CE3  . TRP A 1 14  ? -8.889  8.777   10.207  1.00 0.00 ?  227 TRP A CE3  5  
ATOM 8769  C CZ2  . TRP A 1 14  ? -7.233  11.125  10.027  1.00 0.00 ?  227 TRP A CZ2  5  
ATOM 8770  C CZ3  . TRP A 1 14  ? -9.392  10.081  10.291  1.00 0.00 ?  227 TRP A CZ3  5  
ATOM 8771  C CH2  . TRP A 1 14  ? -8.617  11.232  10.207  1.00 0.00 ?  227 TRP A CH2  5  
ATOM 8772  H H    . TRP A 1 14  ? -7.918  3.938   8.973   1.00 0.00 ?  227 TRP A H    5  
ATOM 8773  H HA   . TRP A 1 14  ? -5.903  5.750   8.194   1.00 0.00 ?  227 TRP A HA   5  
ATOM 8774  H HB2  . TRP A 1 14  ? -8.114  6.006   9.624   1.00 0.00 ?  227 TRP A HB2  5  
ATOM 8775  H HB3  . TRP A 1 14  ? -7.021  5.715   10.962  1.00 0.00 ?  227 TRP A HB3  5  
ATOM 8776  H HD1  . TRP A 1 14  ? -4.509  7.420   9.622   1.00 0.00 ?  227 TRP A HD1  5  
ATOM 8777  H HE1  . TRP A 1 14  ? -4.528  10.059  9.662   1.00 0.00 ?  227 TRP A HE1  5  
ATOM 8778  H HE3  . TRP A 1 14  ? -9.529  7.897   10.277  1.00 0.00 ?  227 TRP A HE3  5  
ATOM 8779  H HZ2  . TRP A 1 14  ? -6.594  12.005  9.957   1.00 0.00 ?  227 TRP A HZ2  5  
ATOM 8780  H HZ3  . TRP A 1 14  ? -10.466 10.201  10.431  1.00 0.00 ?  227 TRP A HZ3  5  
ATOM 8781  H HH2  . TRP A 1 14  ? -9.086  12.213  10.281  1.00 0.00 ?  227 TRP A HH2  5  
ATOM 8782  N N    . GLN A 1 15  ? -5.282  3.555   10.580  1.00 0.00 ?  228 GLN A N    5  
ATOM 8783  C CA   . GLN A 1 15  ? -4.226  2.901   11.334  1.00 0.00 ?  228 GLN A CA   5  
ATOM 8784  C C    . GLN A 1 15  ? -3.333  2.084   10.398  1.00 0.00 ?  228 GLN A C    5  
ATOM 8785  O O    . GLN A 1 15  ? -2.123  2.002   10.603  1.00 0.00 ?  228 GLN A O    5  
ATOM 8786  C CB   . GLN A 1 15  ? -4.807  2.022   12.443  1.00 0.00 ?  228 GLN A CB   5  
ATOM 8787  C CG   . GLN A 1 15  ? -5.657  0.893   11.858  1.00 0.00 ?  228 GLN A CG   5  
ATOM 8788  C CD   . GLN A 1 15  ? -6.229  0.006   12.967  1.00 0.00 ?  228 GLN A CD   5  
ATOM 8789  O OE1  . GLN A 1 15  ? -5.910  -1.165  13.087  1.00 0.00 ?  228 GLN A OE1  5  
ATOM 8790  N NE2  . GLN A 1 15  ? -7.088  0.629   13.768  1.00 0.00 ?  228 GLN A NE2  5  
ATOM 8791  H H    . GLN A 1 15  ? -6.198  3.179   10.723  1.00 0.00 ?  228 GLN A H    5  
ATOM 8792  H HA   . GLN A 1 15  ? -3.649  3.709   11.784  1.00 0.00 ?  228 GLN A HA   5  
ATOM 8793  H HB2  . GLN A 1 15  ? -3.998  1.601   13.040  1.00 0.00 ?  228 GLN A HB2  5  
ATOM 8794  H HB3  . GLN A 1 15  ? -5.415  2.630   13.113  1.00 0.00 ?  228 GLN A HB3  5  
ATOM 8795  H HG2  . GLN A 1 15  ? -6.472  1.314   11.268  1.00 0.00 ?  228 GLN A HG2  5  
ATOM 8796  H HG3  . GLN A 1 15  ? -5.052  0.290   11.181  1.00 0.00 ?  228 GLN A HG3  5  
ATOM 8797  H HE21 . GLN A 1 15  ? -7.307  1.592   13.615  1.00 0.00 ?  228 GLN A HE21 5  
ATOM 8798  H HE22 . GLN A 1 15  ? -7.516  0.133   14.524  1.00 0.00 ?  228 GLN A HE22 5  
ATOM 8799  N N    . LEU A 1 16  ? -3.965  1.501   9.389   1.00 0.00 ?  229 LEU A N    5  
ATOM 8800  C CA   . LEU A 1 16  ? -3.243  0.694   8.421   1.00 0.00 ?  229 LEU A CA   5  
ATOM 8801  C C    . LEU A 1 16  ? -2.210  1.566   7.705   1.00 0.00 ?  229 LEU A C    5  
ATOM 8802  O O    . LEU A 1 16  ? -1.051  1.177   7.569   1.00 0.00 ?  229 LEU A O    5  
ATOM 8803  C CB   . LEU A 1 16  ? -4.219  -0.007  7.473   1.00 0.00 ?  229 LEU A CB   5  
ATOM 8804  C CG   . LEU A 1 16  ? -4.350  -1.521  7.646   1.00 0.00 ?  229 LEU A CG   5  
ATOM 8805  C CD1  . LEU A 1 16  ? -3.113  -2.244  7.109   1.00 0.00 ?  229 LEU A CD1  5  
ATOM 8806  C CD2  . LEU A 1 16  ? -4.638  -1.884  9.104   1.00 0.00 ?  229 LEU A CD2  5  
ATOM 8807  H H    . LEU A 1 16  ? -4.949  1.573   9.229   1.00 0.00 ?  229 LEU A H    5  
ATOM 8808  H HA   . LEU A 1 16  ? -2.715  -0.084  8.973   1.00 0.00 ?  229 LEU A HA   5  
ATOM 8809  H HB2  . LEU A 1 16  ? -5.204  0.441   7.603   1.00 0.00 ?  229 LEU A HB2  5  
ATOM 8810  H HB3  . LEU A 1 16  ? -3.908  0.197   6.448   1.00 0.00 ?  229 LEU A HB3  5  
ATOM 8811  H HG   . LEU A 1 16  ? -5.202  -1.859  7.055   1.00 0.00 ?  229 LEU A HG   5  
ATOM 8812  H HD11 . LEU A 1 16  ? -3.340  -2.679  6.135   1.00 0.00 ?  229 LEU A HD11 5  
ATOM 8813  H HD12 . LEU A 1 16  ? -2.293  -1.533  7.007   1.00 0.00 ?  229 LEU A HD12 5  
ATOM 8814  H HD13 . LEU A 1 16  ? -2.825  -3.034  7.802   1.00 0.00 ?  229 LEU A HD13 5  
ATOM 8815  H HD21 . LEU A 1 16  ? -5.192  -2.823  9.142   1.00 0.00 ?  229 LEU A HD21 5  
ATOM 8816  H HD22 . LEU A 1 16  ? -3.698  -1.995  9.643   1.00 0.00 ?  229 LEU A HD22 5  
ATOM 8817  H HD23 . LEU A 1 16  ? -5.231  -1.094  9.564   1.00 0.00 ?  229 LEU A HD23 5  
ATOM 8818  N N    . VAL A 1 17  ? -2.667  2.730   7.266   1.00 0.00 ?  230 VAL A N    5  
ATOM 8819  C CA   . VAL A 1 17  ? -1.797  3.660   6.567   1.00 0.00 ?  230 VAL A CA   5  
ATOM 8820  C C    . VAL A 1 17  ? -0.813  4.277   7.563   1.00 0.00 ?  230 VAL A C    5  
ATOM 8821  O O    . VAL A 1 17  ? 0.365   4.449   7.252   1.00 0.00 ?  230 VAL A O    5  
ATOM 8822  C CB   . VAL A 1 17  ? -2.635  4.706   5.828   1.00 0.00 ?  230 VAL A CB   5  
ATOM 8823  C CG1  . VAL A 1 17  ? -1.740  5.720   5.114   1.00 0.00 ?  230 VAL A CG1  5  
ATOM 8824  C CG2  . VAL A 1 17  ? -3.602  4.040   4.847   1.00 0.00 ?  230 VAL A CG2  5  
ATOM 8825  H H    . VAL A 1 17  ? -3.611  3.038   7.380   1.00 0.00 ?  230 VAL A H    5  
ATOM 8826  H HA   . VAL A 1 17  ? -1.236  3.092   5.825   1.00 0.00 ?  230 VAL A HA   5  
ATOM 8827  H HB   . VAL A 1 17  ? -3.227  5.245   6.568   1.00 0.00 ?  230 VAL A HB   5  
ATOM 8828  H HG11 . VAL A 1 17  ? -2.241  6.688   5.083   1.00 0.00 ?  230 VAL A HG11 5  
ATOM 8829  H HG12 . VAL A 1 17  ? -0.797  5.816   5.652   1.00 0.00 ?  230 VAL A HG12 5  
ATOM 8830  H HG13 . VAL A 1 17  ? -1.545  5.380   4.097   1.00 0.00 ?  230 VAL A HG13 5  
ATOM 8831  H HG21 . VAL A 1 17  ? -3.689  2.980   5.085   1.00 0.00 ?  230 VAL A HG21 5  
ATOM 8832  H HG22 . VAL A 1 17  ? -4.582  4.512   4.926   1.00 0.00 ?  230 VAL A HG22 5  
ATOM 8833  H HG23 . VAL A 1 17  ? -3.224  4.154   3.831   1.00 0.00 ?  230 VAL A HG23 5  
ATOM 8834  N N    . ALA A 1 18  ? -1.332  4.595   8.739   1.00 0.00 ?  231 ALA A N    5  
ATOM 8835  C CA   . ALA A 1 18  ? -0.514  5.190   9.783   1.00 0.00 ?  231 ALA A CA   5  
ATOM 8836  C C    . ALA A 1 18  ? 0.456   4.138   10.325  1.00 0.00 ?  231 ALA A C    5  
ATOM 8837  O O    . ALA A 1 18  ? 1.430   4.476   10.996  1.00 0.00 ?  231 ALA A O    5  
ATOM 8838  C CB   . ALA A 1 18  ? -1.418  5.767   10.874  1.00 0.00 ?  231 ALA A CB   5  
ATOM 8839  H H    . ALA A 1 18  ? -2.292  4.452   8.984   1.00 0.00 ?  231 ALA A H    5  
ATOM 8840  H HA   . ALA A 1 18  ? 0.057   6.002   9.334   1.00 0.00 ?  231 ALA A HA   5  
ATOM 8841  H HB1  . ALA A 1 18  ? -2.155  6.431   10.422  1.00 0.00 ?  231 ALA A HB1  5  
ATOM 8842  H HB2  . ALA A 1 18  ? -1.930  4.954   11.389  1.00 0.00 ?  231 ALA A HB2  5  
ATOM 8843  H HB3  . ALA A 1 18  ? -0.814  6.327   11.588  1.00 0.00 ?  231 ALA A HB3  5  
ATOM 8844  N N    . ALA A 1 19  ? 0.156   2.886   10.014  1.00 0.00 ?  232 ALA A N    5  
ATOM 8845  C CA   . ALA A 1 19  ? 0.990   1.784   10.462  1.00 0.00 ?  232 ALA A CA   5  
ATOM 8846  C C    . ALA A 1 19  ? 2.195   1.649   9.528   1.00 0.00 ?  232 ALA A C    5  
ATOM 8847  O O    . ALA A 1 19  ? 3.138   0.917   9.827   1.00 0.00 ?  232 ALA A O    5  
ATOM 8848  C CB   . ALA A 1 19  ? 0.154   0.503   10.524  1.00 0.00 ?  232 ALA A CB   5  
ATOM 8849  H H    . ALA A 1 19  ? -0.638  2.620   9.467   1.00 0.00 ?  232 ALA A H    5  
ATOM 8850  H HA   . ALA A 1 19  ? 1.343   2.021   11.465  1.00 0.00 ?  232 ALA A HA   5  
ATOM 8851  H HB1  . ALA A 1 19  ? -0.432  0.496   11.442  1.00 0.00 ?  232 ALA A HB1  5  
ATOM 8852  H HB2  . ALA A 1 19  ? -0.516  0.465   9.665   1.00 0.00 ?  232 ALA A HB2  5  
ATOM 8853  H HB3  . ALA A 1 19  ? 0.815   -0.363  10.508  1.00 0.00 ?  232 ALA A HB3  5  
ATOM 8854  N N    . VAL A 1 20  ? 2.124   2.365   8.416   1.00 0.00 ?  233 VAL A N    5  
ATOM 8855  C CA   . VAL A 1 20  ? 3.197   2.335   7.437   1.00 0.00 ?  233 VAL A CA   5  
ATOM 8856  C C    . VAL A 1 20  ? 4.218   3.424   7.772   1.00 0.00 ?  233 VAL A C    5  
ATOM 8857  O O    . VAL A 1 20  ? 3.870   4.600   7.862   1.00 0.00 ?  233 VAL A O    5  
ATOM 8858  C CB   . VAL A 1 20  ? 2.622   2.468   6.026   1.00 0.00 ?  233 VAL A CB   5  
ATOM 8859  C CG1  . VAL A 1 20  ? 3.713   2.289   4.969   1.00 0.00 ?  233 VAL A CG1  5  
ATOM 8860  C CG2  . VAL A 1 20  ? 1.477   1.478   5.805   1.00 0.00 ?  233 VAL A CG2  5  
ATOM 8861  H H    . VAL A 1 20  ? 1.354   2.958   8.181   1.00 0.00 ?  233 VAL A H    5  
ATOM 8862  H HA   . VAL A 1 20  ? 3.684   1.363   7.513   1.00 0.00 ?  233 VAL A HA   5  
ATOM 8863  H HB   . VAL A 1 20  ? 2.218   3.476   5.922   1.00 0.00 ?  233 VAL A HB   5  
ATOM 8864  H HG11 . VAL A 1 20  ? 4.420   1.529   5.303   1.00 0.00 ?  233 VAL A HG11 5  
ATOM 8865  H HG12 . VAL A 1 20  ? 3.261   1.976   4.028   1.00 0.00 ?  233 VAL A HG12 5  
ATOM 8866  H HG13 . VAL A 1 20  ? 4.237   3.234   4.824   1.00 0.00 ?  233 VAL A HG13 5  
ATOM 8867  H HG21 . VAL A 1 20  ? 0.722   1.932   5.163   1.00 0.00 ?  233 VAL A HG21 5  
ATOM 8868  H HG22 . VAL A 1 20  ? 1.863   0.576   5.329   1.00 0.00 ?  233 VAL A HG22 5  
ATOM 8869  H HG23 . VAL A 1 20  ? 1.029   1.219   6.764   1.00 0.00 ?  233 VAL A HG23 5  
ATOM 8870  N N    . PRO A 1 21  ? 5.492   2.982   7.951   1.00 0.00 ?  234 PRO A N    5  
ATOM 8871  C CA   . PRO A 1 21  ? 6.566   3.906   8.274   1.00 0.00 ?  234 PRO A CA   5  
ATOM 8872  C C    . PRO A 1 21  ? 6.983   4.714   7.043   1.00 0.00 ?  234 PRO A C    5  
ATOM 8873  O O    . PRO A 1 21  ? 7.654   5.737   7.166   1.00 0.00 ?  234 PRO A O    5  
ATOM 8874  C CB   . PRO A 1 21  ? 7.685   3.034   8.818   1.00 0.00 ?  234 PRO A CB   5  
ATOM 8875  C CG   . PRO A 1 21  ? 7.378   1.621   8.349   1.00 0.00 ?  234 PRO A CG   5  
ATOM 8876  C CD   . PRO A 1 21  ? 5.942   1.597   7.851   1.00 0.00 ?  234 PRO A CD   5  
ATOM 8877  H HA   . PRO A 1 21  ? 6.257   4.576   8.948   1.00 0.00 ?  234 PRO A HA   5  
ATOM 8878  H HB2  . PRO A 1 21  ? 8.655   3.365   8.447   1.00 0.00 ?  234 PRO A HB2  5  
ATOM 8879  H HB3  . PRO A 1 21  ? 7.726   3.084   9.906   1.00 0.00 ?  234 PRO A HB3  5  
ATOM 8880  H HG2  . PRO A 1 21  ? 8.062   1.324   7.554   1.00 0.00 ?  234 PRO A HG2  5  
ATOM 8881  H HG3  . PRO A 1 21  ? 7.510   0.910   9.165   1.00 0.00 ?  234 PRO A HG3  5  
ATOM 8882  H HD2  . PRO A 1 21  ? 5.884   1.235   6.825   1.00 0.00 ?  234 PRO A HD2  5  
ATOM 8883  H HD3  . PRO A 1 21  ? 5.323   0.935   8.458   1.00 0.00 ?  234 PRO A HD3  5  
ATOM 8884  N N    . LEU A 1 22  ? 6.567   4.224   5.884   1.00 0.00 ?  235 LEU A N    5  
ATOM 8885  C CA   . LEU A 1 22  ? 6.889   4.888   4.632   1.00 0.00 ?  235 LEU A CA   5  
ATOM 8886  C C    . LEU A 1 22  ? 5.941   6.072   4.430   1.00 0.00 ?  235 LEU A C    5  
ATOM 8887  O O    . LEU A 1 22  ? 6.274   7.024   3.725   1.00 0.00 ?  235 LEU A O    5  
ATOM 8888  C CB   . LEU A 1 22  ? 6.877   3.885   3.476   1.00 0.00 ?  235 LEU A CB   5  
ATOM 8889  C CG   . LEU A 1 22  ? 8.048   3.978   2.496   1.00 0.00 ?  235 LEU A CG   5  
ATOM 8890  C CD1  . LEU A 1 22  ? 8.524   5.425   2.347   1.00 0.00 ?  235 LEU A CD1  5  
ATOM 8891  C CD2  . LEU A 1 22  ? 9.184   3.040   2.908   1.00 0.00 ?  235 LEU A CD2  5  
ATOM 8892  H H    . LEU A 1 22  ? 6.021   3.391   5.793   1.00 0.00 ?  235 LEU A H    5  
ATOM 8893  H HA   . LEU A 1 22  ? 7.906   5.269   4.717   1.00 0.00 ?  235 LEU A HA   5  
ATOM 8894  H HB2  . LEU A 1 22  ? 6.858   2.879   3.894   1.00 0.00 ?  235 LEU A HB2  5  
ATOM 8895  H HB3  . LEU A 1 22  ? 5.950   4.016   2.918   1.00 0.00 ?  235 LEU A HB3  5  
ATOM 8896  H HG   . LEU A 1 22  ? 7.700   3.652   1.516   1.00 0.00 ?  235 LEU A HG   5  
ATOM 8897  H HD11 . LEU A 1 22  ? 9.138   5.695   3.206   1.00 0.00 ?  235 LEU A HD11 5  
ATOM 8898  H HD12 . LEU A 1 22  ? 9.114   5.521   1.435   1.00 0.00 ?  235 LEU A HD12 5  
ATOM 8899  H HD13 . LEU A 1 22  ? 7.661   6.088   2.293   1.00 0.00 ?  235 LEU A HD13 5  
ATOM 8900  H HD21 . LEU A 1 22  ? 9.952   3.039   2.135   1.00 0.00 ?  235 LEU A HD21 5  
ATOM 8901  H HD22 . LEU A 1 22  ? 9.615   3.383   3.849   1.00 0.00 ?  235 LEU A HD22 5  
ATOM 8902  H HD23 . LEU A 1 22  ? 8.793   2.030   3.034   1.00 0.00 ?  235 LEU A HD23 5  
ATOM 8903  N N    . PHE A 1 23  ? 4.780   5.974   5.060   1.00 0.00 ?  236 PHE A N    5  
ATOM 8904  C CA   . PHE A 1 23  ? 3.782   7.025   4.958   1.00 0.00 ?  236 PHE A CA   5  
ATOM 8905  C C    . PHE A 1 23  ? 3.664   7.799   6.272   1.00 0.00 ?  236 PHE A C    5  
ATOM 8906  O O    . PHE A 1 23  ? 3.038   8.856   6.320   1.00 0.00 ?  236 PHE A O    5  
ATOM 8907  C CB   . PHE A 1 23  ? 2.445   6.345   4.659   1.00 0.00 ?  236 PHE A CB   5  
ATOM 8908  C CG   . PHE A 1 23  ? 2.188   6.106   3.169   1.00 0.00 ?  236 PHE A CG   5  
ATOM 8909  C CD1  . PHE A 1 23  ? 3.231   5.888   2.325   1.00 0.00 ?  236 PHE A CD1  5  
ATOM 8910  C CD2  . PHE A 1 23  ? 0.915   6.113   2.690   1.00 0.00 ?  236 PHE A CD2  5  
ATOM 8911  C CE1  . PHE A 1 23  ? 2.992   5.667   0.943   1.00 0.00 ?  236 PHE A CE1  5  
ATOM 8912  C CE2  . PHE A 1 23  ? 0.676   5.892   1.307   1.00 0.00 ?  236 PHE A CE2  5  
ATOM 8913  C CZ   . PHE A 1 23  ? 1.720   5.673   0.463   1.00 0.00 ?  236 PHE A CZ   5  
ATOM 8914  H H    . PHE A 1 23  ? 4.518   5.196   5.631   1.00 0.00 ?  236 PHE A H    5  
ATOM 8915  H HA   . PHE A 1 23  ? 4.106   7.702   4.167   1.00 0.00 ?  236 PHE A HA   5  
ATOM 8916  H HB2  . PHE A 1 23  ? 2.411   5.388   5.180   1.00 0.00 ?  236 PHE A HB2  5  
ATOM 8917  H HB3  . PHE A 1 23  ? 1.639   6.957   5.062   1.00 0.00 ?  236 PHE A HB3  5  
ATOM 8918  H HD1  . PHE A 1 23  ? 4.251   5.883   2.710   1.00 0.00 ?  236 PHE A HD1  5  
ATOM 8919  H HD2  . PHE A 1 23  ? 0.078   6.288   3.366   1.00 0.00 ?  236 PHE A HD2  5  
ATOM 8920  H HE1  . PHE A 1 23  ? 3.829   5.492   0.267   1.00 0.00 ?  236 PHE A HE1  5  
ATOM 8921  H HE2  . PHE A 1 23  ? -0.344  5.897   0.923   1.00 0.00 ?  236 PHE A HE2  5  
ATOM 8922  H HZ   . PHE A 1 23  ? 1.536   5.504   -0.598  1.00 0.00 ?  236 PHE A HZ   5  
ATOM 8923  N N    . GLN A 1 24  ? 4.277   7.242   7.307   1.00 0.00 ?  237 GLN A N    5  
ATOM 8924  C CA   . GLN A 1 24  ? 4.248   7.867   8.618   1.00 0.00 ?  237 GLN A CA   5  
ATOM 8925  C C    . GLN A 1 24  ? 4.915   9.243   8.566   1.00 0.00 ?  237 GLN A C    5  
ATOM 8926  O O    . GLN A 1 24  ? 4.622   10.110  9.386   1.00 0.00 ?  237 GLN A O    5  
ATOM 8927  C CB   . GLN A 1 24  ? 4.917   6.973   9.666   1.00 0.00 ?  237 GLN A CB   5  
ATOM 8928  C CG   . GLN A 1 24  ? 4.244   7.131   11.031  1.00 0.00 ?  237 GLN A CG   5  
ATOM 8929  C CD   . GLN A 1 24  ? 5.004   8.131   11.905  1.00 0.00 ?  237 GLN A CD   5  
ATOM 8930  O OE1  . GLN A 1 24  ? 4.495   9.171   12.290  1.00 0.00 ?  237 GLN A OE1  5  
ATOM 8931  N NE2  . GLN A 1 24  ? 6.247   7.760   12.195  1.00 0.00 ?  237 GLN A NE2  5  
ATOM 8932  H H    . GLN A 1 24  ? 4.784   6.381   7.259   1.00 0.00 ?  237 GLN A H    5  
ATOM 8933  H HA   . GLN A 1 24  ? 3.192   7.976   8.864   1.00 0.00 ?  237 GLN A HA   5  
ATOM 8934  H HB2  . GLN A 1 24  ? 4.863   5.932   9.348   1.00 0.00 ?  237 GLN A HB2  5  
ATOM 8935  H HB3  . GLN A 1 24  ? 5.973   7.229   9.746   1.00 0.00 ?  237 GLN A HB3  5  
ATOM 8936  H HG2  . GLN A 1 24  ? 3.216   7.468   10.896  1.00 0.00 ?  237 GLN A HG2  5  
ATOM 8937  H HG3  . GLN A 1 24  ? 4.199   6.164   11.532  1.00 0.00 ?  237 GLN A HG3  5  
ATOM 8938  H HE21 . GLN A 1 24  ? 6.605   6.893   11.846  1.00 0.00 ?  237 GLN A HE21 5  
ATOM 8939  H HE22 . GLN A 1 24  ? 6.825   8.347   12.761  1.00 0.00 ?  237 GLN A HE22 5  
ATOM 8940  N N    . LYS A 1 25  ? 5.800   9.399   7.592   1.00 0.00 ?  238 LYS A N    5  
ATOM 8941  C CA   . LYS A 1 25  ? 6.510   10.655  7.421   1.00 0.00 ?  238 LYS A CA   5  
ATOM 8942  C C    . LYS A 1 25  ? 5.563   11.694  6.819   1.00 0.00 ?  238 LYS A C    5  
ATOM 8943  O O    . LYS A 1 25  ? 5.930   12.858  6.662   1.00 0.00 ?  238 LYS A O    5  
ATOM 8944  C CB   . LYS A 1 25  ? 7.787   10.441  6.606   1.00 0.00 ?  238 LYS A CB   5  
ATOM 8945  C CG   . LYS A 1 25  ? 8.587   9.251   7.141   1.00 0.00 ?  238 LYS A CG   5  
ATOM 8946  C CD   . LYS A 1 25  ? 9.090   9.523   8.560   1.00 0.00 ?  238 LYS A CD   5  
ATOM 8947  C CE   . LYS A 1 25  ? 9.809   8.298   9.130   1.00 0.00 ?  238 LYS A CE   5  
ATOM 8948  N NZ   . LYS A 1 25  ? 10.694  8.691   10.249  1.00 0.00 1  238 LYS A NZ   5  
ATOM 8949  H H    . LYS A 1 25  ? 6.033   8.688   6.928   1.00 0.00 ?  238 LYS A H    5  
ATOM 8950  H HA   . LYS A 1 25  ? 6.813   10.996  8.411   1.00 0.00 ?  238 LYS A HA   5  
ATOM 8951  H HB2  . LYS A 1 25  ? 7.532   10.272  5.560   1.00 0.00 ?  238 LYS A HB2  5  
ATOM 8952  H HB3  . LYS A 1 25  ? 8.400   11.342  6.641   1.00 0.00 ?  238 LYS A HB3  5  
ATOM 8953  H HG2  . LYS A 1 25  ? 7.962   8.358   7.137   1.00 0.00 ?  238 LYS A HG2  5  
ATOM 8954  H HG3  . LYS A 1 25  ? 9.433   9.052   6.483   1.00 0.00 ?  238 LYS A HG3  5  
ATOM 8955  H HD2  . LYS A 1 25  ? 9.768   10.376  8.552   1.00 0.00 ?  238 LYS A HD2  5  
ATOM 8956  H HD3  . LYS A 1 25  ? 8.251   9.788   9.203   1.00 0.00 ?  238 LYS A HD3  5  
ATOM 8957  H HE2  . LYS A 1 25  ? 9.077   7.568   9.476   1.00 0.00 ?  238 LYS A HE2  5  
ATOM 8958  H HE3  . LYS A 1 25  ? 10.395  7.816   8.347   1.00 0.00 ?  238 LYS A HE3  5  
ATOM 8959  H HZ1  . LYS A 1 25  ? 10.173  8.688   11.103  1.00 0.00 ?  238 LYS A HZ1  5  
ATOM 8960  H HZ2  . LYS A 1 25  ? 11.451  8.042   10.319  1.00 0.00 ?  238 LYS A HZ2  5  
ATOM 8961  H HZ3  . LYS A 1 25  ? 11.055  9.608   10.082  1.00 0.00 ?  238 LYS A HZ3  5  
ATOM 8962  N N    . LEU A 1 26  ? 4.362   11.237  6.497   1.00 0.00 ?  239 LEU A N    5  
ATOM 8963  C CA   . LEU A 1 26  ? 3.359   12.113  5.915   1.00 0.00 ?  239 LEU A CA   5  
ATOM 8964  C C    . LEU A 1 26  ? 2.613   12.842  7.034   1.00 0.00 ?  239 LEU A C    5  
ATOM 8965  O O    . LEU A 1 26  ? 2.907   12.644  8.212   1.00 0.00 ?  239 LEU A O    5  
ATOM 8966  C CB   . LEU A 1 26  ? 2.442   11.327  4.975   1.00 0.00 ?  239 LEU A CB   5  
ATOM 8967  C CG   . LEU A 1 26  ? 3.140   10.495  3.897   1.00 0.00 ?  239 LEU A CG   5  
ATOM 8968  C CD1  . LEU A 1 26  ? 2.225   9.380   3.387   1.00 0.00 ?  239 LEU A CD1  5  
ATOM 8969  C CD2  . LEU A 1 26  ? 3.648   11.385  2.761   1.00 0.00 ?  239 LEU A CD2  5  
ATOM 8970  H H    . LEU A 1 26  ? 4.071   10.289  6.627   1.00 0.00 ?  239 LEU A H    5  
ATOM 8971  H HA   . LEU A 1 26  ? 3.883   12.853  5.310   1.00 0.00 ?  239 LEU A HA   5  
ATOM 8972  H HB2  . LEU A 1 26  ? 1.823   10.661  5.576   1.00 0.00 ?  239 LEU A HB2  5  
ATOM 8973  H HB3  . LEU A 1 26  ? 1.769   12.031  4.484   1.00 0.00 ?  239 LEU A HB3  5  
ATOM 8974  H HG   . LEU A 1 26  ? 4.011   10.017  4.346   1.00 0.00 ?  239 LEU A HG   5  
ATOM 8975  H HD11 . LEU A 1 26  ? 1.666   8.958   4.223   1.00 0.00 ?  239 LEU A HD11 5  
ATOM 8976  H HD12 . LEU A 1 26  ? 1.529   9.788   2.654   1.00 0.00 ?  239 LEU A HD12 5  
ATOM 8977  H HD13 . LEU A 1 26  ? 2.827   8.600   2.921   1.00 0.00 ?  239 LEU A HD13 5  
ATOM 8978  H HD21 . LEU A 1 26  ? 3.015   12.269  2.681   1.00 0.00 ?  239 LEU A HD21 5  
ATOM 8979  H HD22 . LEU A 1 26  ? 4.673   11.690  2.969   1.00 0.00 ?  239 LEU A HD22 5  
ATOM 8980  H HD23 . LEU A 1 26  ? 3.617   10.830  1.823   1.00 0.00 ?  239 LEU A HD23 5  
ATOM 8981  N N    . GLY A 1 27  ? 1.662   13.670  6.627   1.00 0.00 ?  240 GLY A N    5  
ATOM 8982  C CA   . GLY A 1 27  ? 0.872   14.429  7.581   1.00 0.00 ?  240 GLY A CA   5  
ATOM 8983  C C    . GLY A 1 27  ? -0.519  13.816  7.752   1.00 0.00 ?  240 GLY A C    5  
ATOM 8984  O O    . GLY A 1 27  ? -0.796  12.739  7.228   1.00 0.00 ?  240 GLY A O    5  
ATOM 8985  H H    . GLY A 1 27  ? 1.429   13.825  5.667   1.00 0.00 ?  240 GLY A H    5  
ATOM 8986  H HA2  . GLY A 1 27  ? 1.383   14.454  8.544   1.00 0.00 ?  240 GLY A HA2  5  
ATOM 8987  H HA3  . GLY A 1 27  ? 0.780   15.461  7.243   1.00 0.00 ?  240 GLY A HA3  5  
ATOM 8988  N N    . PRO A 1 28  ? -1.381  14.549  8.507   1.00 0.00 ?  241 PRO A N    5  
ATOM 8989  C CA   . PRO A 1 28  ? -2.737  14.089  8.753   1.00 0.00 ?  241 PRO A CA   5  
ATOM 8990  C C    . PRO A 1 28  ? -3.613  14.274  7.512   1.00 0.00 ?  241 PRO A C    5  
ATOM 8991  O O    . PRO A 1 28  ? -4.479  13.448  7.231   1.00 0.00 ?  241 PRO A O    5  
ATOM 8992  C CB   . PRO A 1 28  ? -3.218  14.901  9.945   1.00 0.00 ?  241 PRO A CB   5  
ATOM 8993  C CG   . PRO A 1 28  ? -2.292  16.104  10.030  1.00 0.00 ?  241 PRO A CG   5  
ATOM 8994  C CD   . PRO A 1 28  ? -1.089  15.830  9.144   1.00 0.00 ?  241 PRO A CD   5  
ATOM 8995  H HA   . PRO A 1 28  ? -2.741  13.108  8.947   1.00 0.00 ?  241 PRO A HA   5  
ATOM 8996  H HB2  . PRO A 1 28  ? -4.253  15.213  9.813   1.00 0.00 ?  241 PRO A HB2  5  
ATOM 8997  H HB3  . PRO A 1 28  ? -3.177  14.311  10.861  1.00 0.00 ?  241 PRO A HB3  5  
ATOM 8998  H HG2  . PRO A 1 28  ? -2.809  17.006  9.704   1.00 0.00 ?  241 PRO A HG2  5  
ATOM 8999  H HG3  . PRO A 1 28  ? -1.978  16.271  11.060  1.00 0.00 ?  241 PRO A HG3  5  
ATOM 9000  H HD2  . PRO A 1 28  ? -0.954  16.619  8.404   1.00 0.00 ?  241 PRO A HD2  5  
ATOM 9001  H HD3  . PRO A 1 28  ? -0.170  15.781  9.728   1.00 0.00 ?  241 PRO A HD3  5  
ATOM 9002  N N    . ALA A 1 29  ? -3.356  15.364  6.803   1.00 0.00 ?  242 ALA A N    5  
ATOM 9003  C CA   . ALA A 1 29  ? -4.110  15.668  5.599   1.00 0.00 ?  242 ALA A CA   5  
ATOM 9004  C C    . ALA A 1 29  ? -3.773  14.639  4.518   1.00 0.00 ?  242 ALA A C    5  
ATOM 9005  O O    . ALA A 1 29  ? -4.636  14.257  3.728   1.00 0.00 ?  242 ALA A O    5  
ATOM 9006  C CB   . ALA A 1 29  ? -3.807  17.100  5.155   1.00 0.00 ?  242 ALA A CB   5  
ATOM 9007  H H    . ALA A 1 29  ? -2.650  16.031  7.039   1.00 0.00 ?  242 ALA A H    5  
ATOM 9008  H HA   . ALA A 1 29  ? -5.170  15.593  5.843   1.00 0.00 ?  242 ALA A HA   5  
ATOM 9009  H HB1  . ALA A 1 29  ? -3.656  17.729  6.033   1.00 0.00 ?  242 ALA A HB1  5  
ATOM 9010  H HB2  . ALA A 1 29  ? -2.905  17.108  4.543   1.00 0.00 ?  242 ALA A HB2  5  
ATOM 9011  H HB3  . ALA A 1 29  ? -4.644  17.485  4.572   1.00 0.00 ?  242 ALA A HB3  5  
ATOM 9012  N N    . VAL A 1 30  ? -2.517  14.218  4.517   1.00 0.00 ?  243 VAL A N    5  
ATOM 9013  C CA   . VAL A 1 30  ? -2.055  13.241  3.546   1.00 0.00 ?  243 VAL A CA   5  
ATOM 9014  C C    . VAL A 1 30  ? -2.575  11.856  3.937   1.00 0.00 ?  243 VAL A C    5  
ATOM 9015  O O    . VAL A 1 30  ? -2.920  11.052  3.072   1.00 0.00 ?  243 VAL A O    5  
ATOM 9016  C CB   . VAL A 1 30  ? -0.531  13.296  3.432   1.00 0.00 ?  243 VAL A CB   5  
ATOM 9017  C CG1  . VAL A 1 30  ? 0.019   12.015  2.802   1.00 0.00 ?  243 VAL A CG1  5  
ATOM 9018  C CG2  . VAL A 1 30  ? -0.085  14.530  2.644   1.00 0.00 ?  243 VAL A CG2  5  
ATOM 9019  H H    . VAL A 1 30  ? -1.821  14.533  5.163   1.00 0.00 ?  243 VAL A H    5  
ATOM 9020  H HA   . VAL A 1 30  ? -2.477  13.514  2.579   1.00 0.00 ?  243 VAL A HA   5  
ATOM 9021  H HB   . VAL A 1 30  ? -0.122  13.377  4.439   1.00 0.00 ?  243 VAL A HB   5  
ATOM 9022  H HG11 . VAL A 1 30  ? 0.045   11.224  3.551   1.00 0.00 ?  243 VAL A HG11 5  
ATOM 9023  H HG12 . VAL A 1 30  ? -0.624  11.712  1.975   1.00 0.00 ?  243 VAL A HG12 5  
ATOM 9024  H HG13 . VAL A 1 30  ? 1.028   12.197  2.430   1.00 0.00 ?  243 VAL A HG13 5  
ATOM 9025  H HG21 . VAL A 1 30  ? 0.010   14.273  1.589   1.00 0.00 ?  243 VAL A HG21 5  
ATOM 9026  H HG22 . VAL A 1 30  ? -0.825  15.322  2.760   1.00 0.00 ?  243 VAL A HG22 5  
ATOM 9027  H HG23 . VAL A 1 30  ? 0.878   14.874  3.022   1.00 0.00 ?  243 VAL A HG23 5  
ATOM 9028  N N    . LEU A 1 31  ? -2.616  11.620  5.240   1.00 0.00 ?  244 LEU A N    5  
ATOM 9029  C CA   . LEU A 1 31  ? -3.088  10.346  5.756   1.00 0.00 ?  244 LEU A CA   5  
ATOM 9030  C C    . LEU A 1 31  ? -4.598  10.239  5.535   1.00 0.00 ?  244 LEU A C    5  
ATOM 9031  O O    . LEU A 1 31  ? -5.115  9.156   5.265   1.00 0.00 ?  244 LEU A O    5  
ATOM 9032  C CB   . LEU A 1 31  ? -2.665  10.169  7.215   1.00 0.00 ?  244 LEU A CB   5  
ATOM 9033  C CG   . LEU A 1 31  ? -1.328  9.462   7.446   1.00 0.00 ?  244 LEU A CG   5  
ATOM 9034  C CD1  . LEU A 1 31  ? -1.492  7.942   7.375   1.00 0.00 ?  244 LEU A CD1  5  
ATOM 9035  C CD2  . LEU A 1 31  ? -0.264  9.970   6.471   1.00 0.00 ?  244 LEU A CD2  5  
ATOM 9036  H H    . LEU A 1 31  ? -2.334  12.279  5.937   1.00 0.00 ?  244 LEU A H    5  
ATOM 9037  H HA   . LEU A 1 31  ? -2.598  9.559   5.181   1.00 0.00 ?  244 LEU A HA   5  
ATOM 9038  H HB2  . LEU A 1 31  ? -2.618  11.153  7.681   1.00 0.00 ?  244 LEU A HB2  5  
ATOM 9039  H HB3  . LEU A 1 31  ? -3.444  9.609   7.733   1.00 0.00 ?  244 LEU A HB3  5  
ATOM 9040  H HG   . LEU A 1 31  ? -0.984  9.701   8.452   1.00 0.00 ?  244 LEU A HG   5  
ATOM 9041  H HD11 . LEU A 1 31  ? -0.756  7.529   6.685   1.00 0.00 ?  244 LEU A HD11 5  
ATOM 9042  H HD12 . LEU A 1 31  ? -1.343  7.514   8.366   1.00 0.00 ?  244 LEU A HD12 5  
ATOM 9043  H HD13 . LEU A 1 31  ? -2.495  7.701   7.022   1.00 0.00 ?  244 LEU A HD13 5  
ATOM 9044  H HD21 . LEU A 1 31  ? 0.461   9.179   6.280   1.00 0.00 ?  244 LEU A HD21 5  
ATOM 9045  H HD22 . LEU A 1 31  ? -0.739  10.261  5.534   1.00 0.00 ?  244 LEU A HD22 5  
ATOM 9046  H HD23 . LEU A 1 31  ? 0.244   10.831  6.904   1.00 0.00 ?  244 LEU A HD23 5  
ATOM 9047  N N    . VAL A 1 32  ? -5.264  11.378  5.659   1.00 0.00 ?  245 VAL A N    5  
ATOM 9048  C CA   . VAL A 1 32  ? -6.704  11.427  5.476   1.00 0.00 ?  245 VAL A CA   5  
ATOM 9049  C C    . VAL A 1 32  ? -7.031  11.277  3.989   1.00 0.00 ?  245 VAL A C    5  
ATOM 9050  O O    . VAL A 1 32  ? -8.008  10.622  3.628   1.00 0.00 ?  245 VAL A O    5  
ATOM 9051  C CB   . VAL A 1 32  ? -7.266  12.713  6.085   1.00 0.00 ?  245 VAL A CB   5  
ATOM 9052  C CG1  . VAL A 1 32  ? -8.768  12.835  5.820   1.00 0.00 ?  245 VAL A CG1  5  
ATOM 9053  C CG2  . VAL A 1 32  ? -6.966  12.787  7.583   1.00 0.00 ?  245 VAL A CG2  5  
ATOM 9054  H H    . VAL A 1 32  ? -4.836  12.255  5.878   1.00 0.00 ?  245 VAL A H    5  
ATOM 9055  H HA   . VAL A 1 32  ? -7.133  10.583  6.017   1.00 0.00 ?  245 VAL A HA   5  
ATOM 9056  H HB   . VAL A 1 32  ? -6.771  13.556  5.603   1.00 0.00 ?  245 VAL A HB   5  
ATOM 9057  H HG11 . VAL A 1 32  ? -9.071  12.080  5.095   1.00 0.00 ?  245 VAL A HG11 5  
ATOM 9058  H HG12 . VAL A 1 32  ? -9.315  12.685  6.750   1.00 0.00 ?  245 VAL A HG12 5  
ATOM 9059  H HG13 . VAL A 1 32  ? -8.987  13.827  5.425   1.00 0.00 ?  245 VAL A HG13 5  
ATOM 9060  H HG21 . VAL A 1 32  ? -6.175  12.079  7.831   1.00 0.00 ?  245 VAL A HG21 5  
ATOM 9061  H HG22 . VAL A 1 32  ? -6.644  13.796  7.840   1.00 0.00 ?  245 VAL A HG22 5  
ATOM 9062  H HG23 . VAL A 1 32  ? -7.866  12.539  8.147   1.00 0.00 ?  245 VAL A HG23 5  
ATOM 9063  N N    . GLU A 1 33  ? -6.196  11.894  3.167   1.00 0.00 ?  246 GLU A N    5  
ATOM 9064  C CA   . GLU A 1 33  ? -6.384  11.838  1.727   1.00 0.00 ?  246 GLU A CA   5  
ATOM 9065  C C    . GLU A 1 33  ? -6.110  10.423  1.212   1.00 0.00 ?  246 GLU A C    5  
ATOM 9066  O O    . GLU A 1 33  ? -6.915  9.862   0.470   1.00 0.00 ?  246 GLU A O    5  
ATOM 9067  C CB   . GLU A 1 33  ? -5.496  12.862  1.018   1.00 0.00 ?  246 GLU A CB   5  
ATOM 9068  C CG   . GLU A 1 33  ? -6.087  13.255  -0.337  1.00 0.00 ?  246 GLU A CG   5  
ATOM 9069  C CD   . GLU A 1 33  ? -7.280  14.197  -0.162  1.00 0.00 ?  246 GLU A CD   5  
ATOM 9070  O OE1  . GLU A 1 33  ? -7.228  15.116  0.669   1.00 0.00 ?  246 GLU A OE1  5  
ATOM 9071  O OE2  . GLU A 1 33  ? -8.288  13.949  -0.929  1.00 0.00 -1 246 GLU A OE2  5  
ATOM 9072  H H    . GLU A 1 33  ? -5.404  12.425  3.469   1.00 0.00 ?  246 GLU A H    5  
ATOM 9073  H HA   . GLU A 1 33  ? -7.430  12.096  1.562   1.00 0.00 ?  246 GLU A HA   5  
ATOM 9074  H HB2  . GLU A 1 33  ? -5.387  13.748  1.642   1.00 0.00 ?  246 GLU A HB2  5  
ATOM 9075  H HB3  . GLU A 1 33  ? -4.498  12.447  0.876   1.00 0.00 ?  246 GLU A HB3  5  
ATOM 9076  H HG2  . GLU A 1 33  ? -5.323  13.739  -0.945  1.00 0.00 ?  246 GLU A HG2  5  
ATOM 9077  H HG3  . GLU A 1 33  ? -6.402  12.360  -0.874  1.00 0.00 ?  246 GLU A HG3  5  
ATOM 9078  H HE2  . GLU A 1 33  ? -8.664  13.047  -0.717  1.00 0.00 ?  246 GLU A HE2  5  
ATOM 9079  N N    . ILE A 1 34  ? -4.970  9.888   1.624   1.00 0.00 ?  247 ILE A N    5  
ATOM 9080  C CA   . ILE A 1 34  ? -4.580  8.550   1.213   1.00 0.00 ?  247 ILE A CA   5  
ATOM 9081  C C    . ILE A 1 34  ? -5.596  7.539   1.750   1.00 0.00 ?  247 ILE A C    5  
ATOM 9082  O O    . ILE A 1 34  ? -5.898  6.547   1.090   1.00 0.00 ?  247 ILE A O    5  
ATOM 9083  C CB   . ILE A 1 34  ? -3.139  8.258   1.637   1.00 0.00 ?  247 ILE A CB   5  
ATOM 9084  C CG1  . ILE A 1 34  ? -2.144  8.994   0.737   1.00 0.00 ?  247 ILE A CG1  5  
ATOM 9085  C CG2  . ILE A 1 34  ? -2.873  6.752   1.675   1.00 0.00 ?  247 ILE A CG2  5  
ATOM 9086  C CD1  . ILE A 1 34  ? -0.865  9.339   1.502   1.00 0.00 ?  247 ILE A CD1  5  
ATOM 9087  H H    . ILE A 1 34  ? -4.321  10.351  2.227   1.00 0.00 ?  247 ILE A H    5  
ATOM 9088  H HA   . ILE A 1 34  ? -4.608  8.522   0.124   1.00 0.00 ?  247 ILE A HA   5  
ATOM 9089  H HB   . ILE A 1 34  ? -2.998  8.636   2.649   1.00 0.00 ?  247 ILE A HB   5  
ATOM 9090  H HG12 . ILE A 1 34  ? -1.900  8.372   -0.125  1.00 0.00 ?  247 ILE A HG12 5  
ATOM 9091  H HG13 . ILE A 1 34  ? -2.600  9.906   0.353   1.00 0.00 ?  247 ILE A HG13 5  
ATOM 9092  H HG21 . ILE A 1 34  ? -1.874  6.569   2.070   1.00 0.00 ?  247 ILE A HG21 5  
ATOM 9093  H HG22 . ILE A 1 34  ? -3.611  6.269   2.315   1.00 0.00 ?  247 ILE A HG22 5  
ATOM 9094  H HG23 . ILE A 1 34  ? -2.945  6.345   0.666   1.00 0.00 ?  247 ILE A HG23 5  
ATOM 9095  H HD11 . ILE A 1 34  ? -0.300  8.428   1.697   1.00 0.00 ?  247 ILE A HD11 5  
ATOM 9096  H HD12 . ILE A 1 34  ? -0.258  10.021  0.906   1.00 0.00 ?  247 ILE A HD12 5  
ATOM 9097  H HD13 . ILE A 1 34  ? -1.125  9.815   2.447   1.00 0.00 ?  247 ILE A HD13 5  
ATOM 9098  N N    . VAL A 1 35  ? -6.094  7.827   2.944   1.00 0.00 ?  248 VAL A N    5  
ATOM 9099  C CA   . VAL A 1 35  ? -7.069  6.956   3.577   1.00 0.00 ?  248 VAL A CA   5  
ATOM 9100  C C    . VAL A 1 35  ? -8.377  7.000   2.784   1.00 0.00 ?  248 VAL A C    5  
ATOM 9101  O O    . VAL A 1 35  ? -9.019  5.971   2.582   1.00 0.00 ?  248 VAL A O    5  
ATOM 9102  C CB   . VAL A 1 35  ? -7.246  7.349   5.045   1.00 0.00 ?  248 VAL A CB   5  
ATOM 9103  C CG1  . VAL A 1 35  ? -8.592  6.860   5.585   1.00 0.00 ?  248 VAL A CG1  5  
ATOM 9104  C CG2  . VAL A 1 35  ? -6.090  6.822   5.897   1.00 0.00 ?  248 VAL A CG2  5  
ATOM 9105  H H    . VAL A 1 35  ? -5.843  8.636   3.474   1.00 0.00 ?  248 VAL A H    5  
ATOM 9106  H HA   . VAL A 1 35  ? -6.673  5.941   3.545   1.00 0.00 ?  248 VAL A HA   5  
ATOM 9107  H HB   . VAL A 1 35  ? -7.237  8.437   5.104   1.00 0.00 ?  248 VAL A HB   5  
ATOM 9108  H HG11 . VAL A 1 35  ? -8.480  6.568   6.629   1.00 0.00 ?  248 VAL A HG11 5  
ATOM 9109  H HG12 . VAL A 1 35  ? -9.327  7.661   5.509   1.00 0.00 ?  248 VAL A HG12 5  
ATOM 9110  H HG13 . VAL A 1 35  ? -8.927  6.002   5.002   1.00 0.00 ?  248 VAL A HG13 5  
ATOM 9111  H HG21 . VAL A 1 35  ? -6.045  7.380   6.833   1.00 0.00 ?  248 VAL A HG21 5  
ATOM 9112  H HG22 . VAL A 1 35  ? -6.248  5.766   6.112   1.00 0.00 ?  248 VAL A HG22 5  
ATOM 9113  H HG23 . VAL A 1 35  ? -5.153  6.947   5.354   1.00 0.00 ?  248 VAL A HG23 5  
ATOM 9114  N N    . ARG A 1 36  ? -8.733  8.202   2.357   1.00 0.00 ?  249 ARG A N    5  
ATOM 9115  C CA   . ARG A 1 36  ? -9.952  8.394   1.591   1.00 0.00 ?  249 ARG A CA   5  
ATOM 9116  C C    . ARG A 1 36  ? -9.746  7.943   0.144   1.00 0.00 ?  249 ARG A C    5  
ATOM 9117  O O    . ARG A 1 36  ? -10.709 7.797   -0.608  1.00 0.00 ?  249 ARG A O    5  
ATOM 9118  C CB   . ARG A 1 36  ? -10.386 9.861   1.604   1.00 0.00 ?  249 ARG A CB   5  
ATOM 9119  C CG   . ARG A 1 36  ? -10.834 10.288  3.003   1.00 0.00 ?  249 ARG A CG   5  
ATOM 9120  C CD   . ARG A 1 36  ? -12.361 10.328  3.102   1.00 0.00 ?  249 ARG A CD   5  
ATOM 9121  N NE   . ARG A 1 36  ? -12.885 11.499  2.365   1.00 0.00 ?  249 ARG A NE   5  
ATOM 9122  C CZ   . ARG A 1 36  ? -14.161 11.633  1.978   1.00 0.00 ?  249 ARG A CZ   5  
ATOM 9123  N NH1  . ARG A 1 36  ? -15.050 10.670  2.255   1.00 0.00 ?  249 ARG A NH1  5  
ATOM 9124  N NH2  . ARG A 1 36  ? -14.548 12.731  1.314   1.00 0.00 1  249 ARG A NH2  5  
ATOM 9125  H H    . ARG A 1 36  ? -8.205  9.035   2.526   1.00 0.00 ?  249 ARG A H    5  
ATOM 9126  H HA   . ARG A 1 36  ? -10.697 7.776   2.093   1.00 0.00 ?  249 ARG A HA   5  
ATOM 9127  H HB2  . ARG A 1 36  ? -9.560  10.491  1.275   1.00 0.00 ?  249 ARG A HB2  5  
ATOM 9128  H HB3  . ARG A 1 36  ? -11.201 10.009  0.896   1.00 0.00 ?  249 ARG A HB3  5  
ATOM 9129  H HG2  . ARG A 1 36  ? -10.436 9.595   3.744   1.00 0.00 ?  249 ARG A HG2  5  
ATOM 9130  H HG3  . ARG A 1 36  ? -10.426 11.272  3.235   1.00 0.00 ?  249 ARG A HG3  5  
ATOM 9131  H HD2  . ARG A 1 36  ? -12.784 9.411   2.692   1.00 0.00 ?  249 ARG A HD2  5  
ATOM 9132  H HD3  . ARG A 1 36  ? -12.665 10.379  4.147   1.00 0.00 ?  249 ARG A HD3  5  
ATOM 9133  H HE   . ARG A 1 36  ? -12.248 12.237  2.142   1.00 0.00 ?  249 ARG A HE   5  
ATOM 9134  H HH11 . ARG A 1 36  ? -14.762 9.851   2.751   1.00 0.00 ?  249 ARG A HH11 5  
ATOM 9135  H HH12 . ARG A 1 36  ? -16.002 10.770  1.966   1.00 0.00 ?  249 ARG A HH12 5  
ATOM 9136  H HH21 . ARG A 1 36  ? -13.884 13.450  1.107   1.00 0.00 ?  249 ARG A HH21 5  
ATOM 9137  H HH22 . ARG A 1 36  ? -15.500 12.831  1.025   1.00 0.00 ?  249 ARG A HH22 5  
ATOM 9138  N N    . ALA A 1 37  ? -8.485  7.735   -0.204  1.00 0.00 ?  250 ALA A N    5  
ATOM 9139  C CA   . ALA A 1 37  ? -8.140  7.303   -1.548  1.00 0.00 ?  250 ALA A CA   5  
ATOM 9140  C C    . ALA A 1 37  ? -8.153  5.775   -1.607  1.00 0.00 ?  250 ALA A C    5  
ATOM 9141  O O    . ALA A 1 37  ? -8.209  5.192   -2.689  1.00 0.00 ?  250 ALA A O    5  
ATOM 9142  C CB   . ALA A 1 37  ? -6.784  7.891   -1.941  1.00 0.00 ?  250 ALA A CB   5  
ATOM 9143  H H    . ALA A 1 37  ? -7.708  7.856   0.413   1.00 0.00 ?  250 ALA A H    5  
ATOM 9144  H HA   . ALA A 1 37  ? -8.901  7.692   -2.226  1.00 0.00 ?  250 ALA A HA   5  
ATOM 9145  H HB1  . ALA A 1 37  ? -6.927  8.883   -2.370  1.00 0.00 ?  250 ALA A HB1  5  
ATOM 9146  H HB2  . ALA A 1 37  ? -6.150  7.965   -1.057  1.00 0.00 ?  250 ALA A HB2  5  
ATOM 9147  H HB3  . ALA A 1 37  ? -6.306  7.243   -2.676  1.00 0.00 ?  250 ALA A HB3  5  
ATOM 9148  N N    . LEU A 1 38  ? -8.101  5.168   -0.430  1.00 0.00 ?  251 LEU A N    5  
ATOM 9149  C CA   . LEU A 1 38  ? -8.106  3.718   -0.335  1.00 0.00 ?  251 LEU A CA   5  
ATOM 9150  C C    . LEU A 1 38  ? -9.452  3.184   -0.827  1.00 0.00 ?  251 LEU A C    5  
ATOM 9151  O O    . LEU A 1 38  ? -10.488 3.811   -0.614  1.00 0.00 ?  251 LEU A O    5  
ATOM 9152  C CB   . LEU A 1 38  ? -7.750  3.274   1.085   1.00 0.00 ?  251 LEU A CB   5  
ATOM 9153  C CG   . LEU A 1 38  ? -6.342  2.707   1.278   1.00 0.00 ?  251 LEU A CG   5  
ATOM 9154  C CD1  . LEU A 1 38  ? -6.011  2.552   2.764   1.00 0.00 ?  251 LEU A CD1  5  
ATOM 9155  C CD2  . LEU A 1 38  ? -6.170  1.394   0.512   1.00 0.00 ?  251 LEU A CD2  5  
ATOM 9156  H H    . LEU A 1 38  ? -8.056  5.649   0.445   1.00 0.00 ?  251 LEU A H    5  
ATOM 9157  H HA   . LEU A 1 38  ? -7.323  3.345   -0.995  1.00 0.00 ?  251 LEU A HA   5  
ATOM 9158  H HB2  . LEU A 1 38  ? -7.871  4.127   1.753   1.00 0.00 ?  251 LEU A HB2  5  
ATOM 9159  H HB3  . LEU A 1 38  ? -8.470  2.519   1.399   1.00 0.00 ?  251 LEU A HB3  5  
ATOM 9160  H HG   . LEU A 1 38  ? -5.627  3.418   0.862   1.00 0.00 ?  251 LEU A HG   5  
ATOM 9161  H HD11 . LEU A 1 38  ? -6.257  3.475   3.289   1.00 0.00 ?  251 LEU A HD11 5  
ATOM 9162  H HD12 . LEU A 1 38  ? -6.593  1.730   3.181   1.00 0.00 ?  251 LEU A HD12 5  
ATOM 9163  H HD13 . LEU A 1 38  ? -4.948  2.341   2.879   1.00 0.00 ?  251 LEU A HD13 5  
ATOM 9164  H HD21 . LEU A 1 38  ? -6.587  1.500   -0.489  1.00 0.00 ?  251 LEU A HD21 5  
ATOM 9165  H HD22 . LEU A 1 38  ? -5.110  1.151   0.441   1.00 0.00 ?  251 LEU A HD22 5  
ATOM 9166  H HD23 . LEU A 1 38  ? -6.691  0.595   1.040   1.00 0.00 ?  251 LEU A HD23 5  
ATOM 9167  N N    . ARG A 1 39  ? -9.392  2.030   -1.477  1.00 0.00 ?  252 ARG A N    5  
ATOM 9168  C CA   . ARG A 1 39  ? -10.594 1.404   -2.001  1.00 0.00 ?  252 ARG A CA   5  
ATOM 9169  C C    . ARG A 1 39  ? -10.791 0.024   -1.371  1.00 0.00 ?  252 ARG A C    5  
ATOM 9170  O O    . ARG A 1 39  ? -9.853  -0.768  -1.295  1.00 0.00 ?  252 ARG A O    5  
ATOM 9171  C CB   . ARG A 1 39  ? -10.519 1.257   -3.522  1.00 0.00 ?  252 ARG A CB   5  
ATOM 9172  C CG   . ARG A 1 39  ? -11.752 1.866   -4.193  1.00 0.00 ?  252 ARG A CG   5  
ATOM 9173  C CD   . ARG A 1 39  ? -12.566 0.794   -4.921  1.00 0.00 ?  252 ARG A CD   5  
ATOM 9174  N NE   . ARG A 1 39  ? -13.577 1.432   -5.794  1.00 0.00 ?  252 ARG A NE   5  
ATOM 9175  C CZ   . ARG A 1 39  ? -14.501 0.756   -6.491  1.00 0.00 ?  252 ARG A CZ   5  
ATOM 9176  N NH1  . ARG A 1 39  ? -14.547 -0.581  -6.422  1.00 0.00 ?  252 ARG A NH1  5  
ATOM 9177  N NH2  . ARG A 1 39  ? -15.378 1.418   -7.258  1.00 0.00 1  252 ARG A NH2  5  
ATOM 9178  H H    . ARG A 1 39  ? -8.545  1.527   -1.646  1.00 0.00 ?  252 ARG A H    5  
ATOM 9179  H HA   . ARG A 1 39  ? -11.403 2.080   -1.726  1.00 0.00 ?  252 ARG A HA   5  
ATOM 9180  H HB2  . ARG A 1 39  ? -9.619  1.746   -3.895  1.00 0.00 ?  252 ARG A HB2  5  
ATOM 9181  H HB3  . ARG A 1 39  ? -10.441 0.202   -3.786  1.00 0.00 ?  252 ARG A HB3  5  
ATOM 9182  H HG2  . ARG A 1 39  ? -12.375 2.354   -3.444  1.00 0.00 ?  252 ARG A HG2  5  
ATOM 9183  H HG3  . ARG A 1 39  ? -11.443 2.635   -4.901  1.00 0.00 ?  252 ARG A HG3  5  
ATOM 9184  H HD2  . ARG A 1 39  ? -11.904 0.165   -5.516  1.00 0.00 ?  252 ARG A HD2  5  
ATOM 9185  H HD3  . ARG A 1 39  ? -13.057 0.144   -4.197  1.00 0.00 ?  252 ARG A HD3  5  
ATOM 9186  H HE   . ARG A 1 39  ? -13.570 2.429   -5.868  1.00 0.00 ?  252 ARG A HE   5  
ATOM 9187  H HH11 . ARG A 1 39  ? -13.892 -1.075  -5.850  1.00 0.00 ?  252 ARG A HH11 5  
ATOM 9188  H HH12 . ARG A 1 39  ? -15.236 -1.085  -6.943  1.00 0.00 ?  252 ARG A HH12 5  
ATOM 9189  H HH21 . ARG A 1 39  ? -15.343 2.416   -7.309  1.00 0.00 ?  252 ARG A HH21 5  
ATOM 9190  H HH22 . ARG A 1 39  ? -16.067 0.914   -7.778  1.00 0.00 ?  252 ARG A HH22 5  
ATOM 9191  N N    . ALA A 1 40  ? -12.018 -0.223  -0.936  1.00 0.00 ?  253 ALA A N    5  
ATOM 9192  C CA   . ALA A 1 40  ? -12.351 -1.494  -0.315  1.00 0.00 ?  253 ALA A CA   5  
ATOM 9193  C C    . ALA A 1 40  ? -12.590 -2.541  -1.404  1.00 0.00 ?  253 ALA A C    5  
ATOM 9194  O O    . ALA A 1 40  ? -13.334 -2.297  -2.353  1.00 0.00 ?  253 ALA A O    5  
ATOM 9195  C CB   . ALA A 1 40  ? -13.566 -1.314  0.598   1.00 0.00 ?  253 ALA A CB   5  
ATOM 9196  H H    . ALA A 1 40  ? -12.776 0.426   -1.002  1.00 0.00 ?  253 ALA A H    5  
ATOM 9197  H HA   . ALA A 1 40  ? -11.498 -1.800  0.291   1.00 0.00 ?  253 ALA A HA   5  
ATOM 9198  H HB1  . ALA A 1 40  ? -13.641 -2.165  1.274   1.00 0.00 ?  253 ALA A HB1  5  
ATOM 9199  H HB2  . ALA A 1 40  ? -13.452 -0.398  1.177   1.00 0.00 ?  253 ALA A HB2  5  
ATOM 9200  H HB3  . ALA A 1 40  ? -14.469 -1.250  -0.009  1.00 0.00 ?  253 ALA A HB3  5  
ATOM 9201  N N    . ARG A 1 41  ? -11.945 -3.686  -1.231  1.00 0.00 ?  254 ARG A N    5  
ATOM 9202  C CA   . ARG A 1 41  ? -12.078 -4.772  -2.187  1.00 0.00 ?  254 ARG A CA   5  
ATOM 9203  C C    . ARG A 1 41  ? -12.178 -6.112  -1.457  1.00 0.00 ?  254 ARG A C    5  
ATOM 9204  O O    . ARG A 1 41  ? -11.310 -6.452  -0.654  1.00 0.00 ?  254 ARG A O    5  
ATOM 9205  C CB   . ARG A 1 41  ? -10.887 -4.809  -3.147  1.00 0.00 ?  254 ARG A CB   5  
ATOM 9206  C CG   . ARG A 1 41  ? -10.672 -6.220  -3.700  1.00 0.00 ?  254 ARG A CG   5  
ATOM 9207  C CD   . ARG A 1 41  ? -9.715  -6.201  -4.893  1.00 0.00 ?  254 ARG A CD   5  
ATOM 9208  N NE   . ARG A 1 41  ? -10.224 -7.088  -5.963  1.00 0.00 ?  254 ARG A NE   5  
ATOM 9209  C CZ   . ARG A 1 41  ? -11.099 -6.705  -6.903  1.00 0.00 ?  254 ARG A CZ   5  
ATOM 9210  N NH1  . ARG A 1 41  ? -11.569 -5.450  -6.910  1.00 0.00 ?  254 ARG A NH1  5  
ATOM 9211  N NH2  . ARG A 1 41  ? -11.506 -7.578  -7.835  1.00 0.00 1  254 ARG A NH2  5  
ATOM 9212  H H    . ARG A 1 41  ? -11.341 -3.876  -0.457  1.00 0.00 ?  254 ARG A H    5  
ATOM 9213  H HA   . ARG A 1 41  ? -12.996 -4.552  -2.732  1.00 0.00 ?  254 ARG A HA   5  
ATOM 9214  H HB2  . ARG A 1 41  ? -11.056 -4.114  -3.970  1.00 0.00 ?  254 ARG A HB2  5  
ATOM 9215  H HB3  . ARG A 1 41  ? -9.987  -4.477  -2.629  1.00 0.00 ?  254 ARG A HB3  5  
ATOM 9216  H HG2  . ARG A 1 41  ? -10.271 -6.863  -2.917  1.00 0.00 ?  254 ARG A HG2  5  
ATOM 9217  H HG3  . ARG A 1 41  ? -11.629 -6.645  -4.003  1.00 0.00 ?  254 ARG A HG3  5  
ATOM 9218  H HD2  . ARG A 1 41  ? -9.611  -5.184  -5.271  1.00 0.00 ?  254 ARG A HD2  5  
ATOM 9219  H HD3  . ARG A 1 41  ? -8.723  -6.528  -4.580  1.00 0.00 ?  254 ARG A HD3  5  
ATOM 9220  H HE   . ARG A 1 41  ? -9.893  -8.031  -5.987  1.00 0.00 ?  254 ARG A HE   5  
ATOM 9221  H HH11 . ARG A 1 41  ? -11.266 -4.799  -6.214  1.00 0.00 ?  254 ARG A HH11 5  
ATOM 9222  H HH12 . ARG A 1 41  ? -12.223 -5.165  -7.611  1.00 0.00 ?  254 ARG A HH12 5  
ATOM 9223  H HH21 . ARG A 1 41  ? -11.155 -8.514  -7.830  1.00 0.00 ?  254 ARG A HH21 5  
ATOM 9224  H HH22 . ARG A 1 41  ? -12.159 -7.292  -8.536  1.00 0.00 ?  254 ARG A HH22 5  
ATOM 9225  N N    . THR A 1 42  ? -13.244 -6.838  -1.762  1.00 0.00 ?  255 THR A N    5  
ATOM 9226  C CA   . THR A 1 42  ? -13.469 -8.134  -1.145  1.00 0.00 ?  255 THR A CA   5  
ATOM 9227  C C    . THR A 1 42  ? -12.841 -9.244  -1.992  1.00 0.00 ?  255 THR A C    5  
ATOM 9228  O O    . THR A 1 42  ? -13.246 -9.463  -3.132  1.00 0.00 ?  255 THR A O    5  
ATOM 9229  C CB   . THR A 1 42  ? -14.975 -8.305  -0.939  1.00 0.00 ?  255 THR A CB   5  
ATOM 9230  O OG1  . THR A 1 42  ? -15.280 -7.424  0.139   1.00 0.00 ?  255 THR A OG1  5  
ATOM 9231  C CG2  . THR A 1 42  ? -15.339 -9.690  -0.403  1.00 0.00 ?  255 THR A CG2  5  
ATOM 9232  H H    . THR A 1 42  ? -13.945 -6.554  -2.417  1.00 0.00 ?  255 THR A H    5  
ATOM 9233  H HA   . THR A 1 42  ? -12.965 -8.146  -0.179  1.00 0.00 ?  255 THR A HA   5  
ATOM 9234  H HB   . THR A 1 42  ? -15.521 -8.087  -1.857  1.00 0.00 ?  255 THR A HB   5  
ATOM 9235  H HG1  . THR A 1 42  ? -15.180 -6.474  -0.157  1.00 0.00 ?  255 THR A HG1  5  
ATOM 9236  H HG21 . THR A 1 42  ? -16.422 -9.768  -0.303  1.00 0.00 ?  255 THR A HG21 5  
ATOM 9237  H HG22 . THR A 1 42  ? -14.982 -10.453 -1.095  1.00 0.00 ?  255 THR A HG22 5  
ATOM 9238  H HG23 . THR A 1 42  ? -14.873 -9.837  0.572   1.00 0.00 ?  255 THR A HG23 5  
ATOM 9239  N N    . VAL A 1 43  ? -11.864 -9.914  -1.401  1.00 0.00 ?  256 VAL A N    5  
ATOM 9240  C CA   . VAL A 1 43  ? -11.177 -10.995 -2.086  1.00 0.00 ?  256 VAL A CA   5  
ATOM 9241  C C    . VAL A 1 43  ? -11.613 -12.333 -1.485  1.00 0.00 ?  256 VAL A C    5  
ATOM 9242  O O    . VAL A 1 43  ? -11.290 -12.637 -0.338  1.00 0.00 ?  256 VAL A O    5  
ATOM 9243  C CB   . VAL A 1 43  ? -9.664  -10.777 -2.024  1.00 0.00 ?  256 VAL A CB   5  
ATOM 9244  C CG1  . VAL A 1 43  ? -8.909  -12.063 -2.368  1.00 0.00 ?  256 VAL A CG1  5  
ATOM 9245  C CG2  . VAL A 1 43  ? -9.237  -9.629  -2.941  1.00 0.00 ?  256 VAL A CG2  5  
ATOM 9246  H H    . VAL A 1 43  ? -11.540 -9.729  -0.473  1.00 0.00 ?  256 VAL A H    5  
ATOM 9247  H HA   . VAL A 1 43  ? -11.479 -10.966 -3.133  1.00 0.00 ?  256 VAL A HA   5  
ATOM 9248  H HB   . VAL A 1 43  ? -9.406  -10.502 -1.001  1.00 0.00 ?  256 VAL A HB   5  
ATOM 9249  H HG11 . VAL A 1 43  ? -9.350  -12.899 -1.825  1.00 0.00 ?  256 VAL A HG11 5  
ATOM 9250  H HG12 . VAL A 1 43  ? -8.979  -12.249 -3.440  1.00 0.00 ?  256 VAL A HG12 5  
ATOM 9251  H HG13 . VAL A 1 43  ? -7.862  -11.957 -2.085  1.00 0.00 ?  256 VAL A HG13 5  
ATOM 9252  H HG21 . VAL A 1 43  ? -9.701  -9.754  -3.920  1.00 0.00 ?  256 VAL A HG21 5  
ATOM 9253  H HG22 . VAL A 1 43  ? -9.554  -8.681  -2.507  1.00 0.00 ?  256 VAL A HG22 5  
ATOM 9254  H HG23 . VAL A 1 43  ? -8.153  -9.634  -3.050  1.00 0.00 ?  256 VAL A HG23 5  
ATOM 9255  N N    . PRO A 1 44  ? -12.359 -13.117 -2.308  1.00 0.00 ?  257 PRO A N    5  
ATOM 9256  C CA   . PRO A 1 44  ? -12.842 -14.415 -1.870  1.00 0.00 ?  257 PRO A CA   5  
ATOM 9257  C C    . PRO A 1 44  ? -11.711 -15.446 -1.856  1.00 0.00 ?  257 PRO A C    5  
ATOM 9258  O O    . PRO A 1 44  ? -10.586 -15.144 -2.252  1.00 0.00 ?  257 PRO A O    5  
ATOM 9259  C CB   . PRO A 1 44  ? -13.956 -14.769 -2.841  1.00 0.00 ?  257 PRO A CB   5  
ATOM 9260  C CG   . PRO A 1 44  ? -13.746 -13.882 -4.058  1.00 0.00 ?  257 PRO A CG   5  
ATOM 9261  C CD   . PRO A 1 44  ? -12.760 -12.790 -3.673  1.00 0.00 ?  257 PRO A CD   5  
ATOM 9262  H HA   . PRO A 1 44  ? -13.175 -14.362 -0.928  1.00 0.00 ?  257 PRO A HA   5  
ATOM 9263  H HB2  . PRO A 1 44  ? -13.915 -15.823 -3.115  1.00 0.00 ?  257 PRO A HB2  5  
ATOM 9264  H HB3  . PRO A 1 44  ? -14.935 -14.594 -2.394  1.00 0.00 ?  257 PRO A HB3  5  
ATOM 9265  H HG2  . PRO A 1 44  ? -13.362 -14.466 -4.894  1.00 0.00 ?  257 PRO A HG2  5  
ATOM 9266  H HG3  . PRO A 1 44  ? -14.691 -13.446 -4.380  1.00 0.00 ?  257 PRO A HG3  5  
ATOM 9267  H HD2  . PRO A 1 44  ? -11.902 -12.777 -4.346  1.00 0.00 ?  257 PRO A HD2  5  
ATOM 9268  H HD3  . PRO A 1 44  ? -13.222 -11.804 -3.725  1.00 0.00 ?  257 PRO A HD3  5  
ATOM 9269  N N    . ALA A 1 45  ? -12.049 -16.642 -1.396  1.00 0.00 ?  258 ALA A N    5  
ATOM 9270  C CA   . ALA A 1 45  ? -11.076 -17.719 -1.326  1.00 0.00 ?  258 ALA A CA   5  
ATOM 9271  C C    . ALA A 1 45  ? -10.689 -18.144 -2.744  1.00 0.00 ?  258 ALA A C    5  
ATOM 9272  O O    . ALA A 1 45  ? -11.553 -18.319 -3.601  1.00 0.00 ?  258 ALA A O    5  
ATOM 9273  C CB   . ALA A 1 45  ? -11.652 -18.875 -0.508  1.00 0.00 ?  258 ALA A CB   5  
ATOM 9274  H H    . ALA A 1 45  ? -12.966 -16.879 -1.076  1.00 0.00 ?  258 ALA A H    5  
ATOM 9275  H HA   . ALA A 1 45  ? -10.192 -17.334 -0.817  1.00 0.00 ?  258 ALA A HA   5  
ATOM 9276  H HB1  . ALA A 1 45  ? -10.843 -19.529 -0.181  1.00 0.00 ?  258 ALA A HB1  5  
ATOM 9277  H HB2  . ALA A 1 45  ? -12.173 -18.479 0.364   1.00 0.00 ?  258 ALA A HB2  5  
ATOM 9278  H HB3  . ALA A 1 45  ? -12.351 -19.442 -1.122  1.00 0.00 ?  258 ALA A HB3  5  
ATOM 9279  N N    . GLY A 1 46  ? -9.389  -18.297 -2.947  1.00 0.00 ?  259 GLY A N    5  
ATOM 9280  C CA   . GLY A 1 46  ? -8.876  -18.699 -4.246  1.00 0.00 ?  259 GLY A CA   5  
ATOM 9281  C C    . GLY A 1 46  ? -8.601  -17.479 -5.128  1.00 0.00 ?  259 GLY A C    5  
ATOM 9282  O O    . GLY A 1 46  ? -7.766  -17.535 -6.029  1.00 0.00 ?  259 GLY A O    5  
ATOM 9283  H H    . GLY A 1 46  ? -8.692  -18.153 -2.244  1.00 0.00 ?  259 GLY A H    5  
ATOM 9284  H HA2  . GLY A 1 46  ? -7.959  -19.273 -4.118  1.00 0.00 ?  259 GLY A HA2  5  
ATOM 9285  H HA3  . GLY A 1 46  ? -9.596  -19.353 -4.739  1.00 0.00 ?  259 GLY A HA3  5  
ATOM 9286  N N    . ALA A 1 47  ? -9.319  -16.404 -4.836  1.00 0.00 ?  260 ALA A N    5  
ATOM 9287  C CA   . ALA A 1 47  ? -9.163  -15.172 -5.591  1.00 0.00 ?  260 ALA A CA   5  
ATOM 9288  C C    . ALA A 1 47  ? -7.694  -14.744 -5.562  1.00 0.00 ?  260 ALA A C    5  
ATOM 9289  O O    . ALA A 1 47  ? -6.989  -14.999 -4.587  1.00 0.00 ?  260 ALA A O    5  
ATOM 9290  C CB   . ALA A 1 47  ? -10.094 -14.101 -5.019  1.00 0.00 ?  260 ALA A CB   5  
ATOM 9291  H H    . ALA A 1 47  ? -9.996  -16.366 -4.101  1.00 0.00 ?  260 ALA A H    5  
ATOM 9292  H HA   . ALA A 1 47  ? -9.453  -15.376 -6.622  1.00 0.00 ?  260 ALA A HA   5  
ATOM 9293  H HB1  . ALA A 1 47  ? -11.129 -14.424 -5.128  1.00 0.00 ?  260 ALA A HB1  5  
ATOM 9294  H HB2  . ALA A 1 47  ? -9.869  -13.950 -3.964  1.00 0.00 ?  260 ALA A HB2  5  
ATOM 9295  H HB3  . ALA A 1 47  ? -9.946  -13.166 -5.559  1.00 0.00 ?  260 ALA A HB3  5  
ATOM 9296  N N    . VAL A 1 48  ? -7.277  -14.101 -6.643  1.00 0.00 ?  261 VAL A N    5  
ATOM 9297  C CA   . VAL A 1 48  ? -5.905  -13.635 -6.753  1.00 0.00 ?  261 VAL A CA   5  
ATOM 9298  C C    . VAL A 1 48  ? -5.838  -12.160 -6.352  1.00 0.00 ?  261 VAL A C    5  
ATOM 9299  O O    . VAL A 1 48  ? -6.613  -11.343 -6.846  1.00 0.00 ?  261 VAL A O    5  
ATOM 9300  C CB   . VAL A 1 48  ? -5.376  -13.895 -8.165  1.00 0.00 ?  261 VAL A CB   5  
ATOM 9301  C CG1  . VAL A 1 48  ? -4.256  -12.915 -8.520  1.00 0.00 ?  261 VAL A CG1  5  
ATOM 9302  C CG2  . VAL A 1 48  ? -4.907  -15.344 -8.317  1.00 0.00 ?  261 VAL A CG2  5  
ATOM 9303  H H    . VAL A 1 48  ? -7.857  -13.898 -7.431  1.00 0.00 ?  261 VAL A H    5  
ATOM 9304  H HA   . VAL A 1 48  ? -5.303  -14.216 -6.055  1.00 0.00 ?  261 VAL A HA   5  
ATOM 9305  H HB   . VAL A 1 48  ? -6.196  -13.734 -8.865  1.00 0.00 ?  261 VAL A HB   5  
ATOM 9306  H HG11 . VAL A 1 48  ? -3.683  -12.678 -7.623  1.00 0.00 ?  261 VAL A HG11 5  
ATOM 9307  H HG12 . VAL A 1 48  ? -3.598  -13.369 -9.262  1.00 0.00 ?  261 VAL A HG12 5  
ATOM 9308  H HG13 . VAL A 1 48  ? -4.688  -12.002 -8.928  1.00 0.00 ?  261 VAL A HG13 5  
ATOM 9309  H HG21 . VAL A 1 48  ? -5.267  -15.932 -7.473  1.00 0.00 ?  261 VAL A HG21 5  
ATOM 9310  H HG22 . VAL A 1 48  ? -5.302  -15.758 -9.244  1.00 0.00 ?  261 VAL A HG22 5  
ATOM 9311  H HG23 . VAL A 1 48  ? -3.818  -15.372 -8.341  1.00 0.00 ?  261 VAL A HG23 5  
ATOM 9312  N N    . ILE A 1 49  ? -4.904  -11.865 -5.460  1.00 0.00 ?  262 ILE A N    5  
ATOM 9313  C CA   . ILE A 1 49  ? -4.726  -10.502 -4.987  1.00 0.00 ?  262 ILE A CA   5  
ATOM 9314  C C    . ILE A 1 49  ? -3.825  -9.742  -5.962  1.00 0.00 ?  262 ILE A C    5  
ATOM 9315  O O    . ILE A 1 49  ? -4.126  -8.609  -6.336  1.00 0.00 ?  262 ILE A O    5  
ATOM 9316  C CB   . ILE A 1 49  ? -4.212  -10.499 -3.545  1.00 0.00 ?  262 ILE A CB   5  
ATOM 9317  C CG1  . ILE A 1 49  ? -5.149  -11.286 -2.627  1.00 0.00 ?  262 ILE A CG1  5  
ATOM 9318  C CG2  . ILE A 1 49  ? -3.987  -9.070  -3.047  1.00 0.00 ?  262 ILE A CG2  5  
ATOM 9319  C CD1  . ILE A 1 49  ? -4.497  -11.539 -1.266  1.00 0.00 ?  262 ILE A CD1  5  
ATOM 9320  H H    . ILE A 1 49  ? -4.277  -12.535 -5.063  1.00 0.00 ?  262 ILE A H    5  
ATOM 9321  H HA   . ILE A 1 49  ? -5.707  -10.028 -4.980  1.00 0.00 ?  262 ILE A HA   5  
ATOM 9322  H HB   . ILE A 1 49  ? -3.245  -11.002 -3.526  1.00 0.00 ?  262 ILE A HB   5  
ATOM 9323  H HG12 . ILE A 1 49  ? -6.079  -10.735 -2.492  1.00 0.00 ?  262 ILE A HG12 5  
ATOM 9324  H HG13 . ILE A 1 49  ? -5.406  -12.237 -3.094  1.00 0.00 ?  262 ILE A HG13 5  
ATOM 9325  H HG21 . ILE A 1 49  ? -4.181  -8.368  -3.857  1.00 0.00 ?  262 ILE A HG21 5  
ATOM 9326  H HG22 . ILE A 1 49  ? -4.665  -8.864  -2.218  1.00 0.00 ?  262 ILE A HG22 5  
ATOM 9327  H HG23 . ILE A 1 49  ? -2.957  -8.960  -2.710  1.00 0.00 ?  262 ILE A HG23 5  
ATOM 9328  H HD11 . ILE A 1 49  ? -3.639  -10.878 -1.145  1.00 0.00 ?  262 ILE A HD11 5  
ATOM 9329  H HD12 . ILE A 1 49  ? -5.221  -11.343 -0.475  1.00 0.00 ?  262 ILE A HD12 5  
ATOM 9330  H HD13 . ILE A 1 49  ? -4.168  -12.577 -1.208  1.00 0.00 ?  262 ILE A HD13 5  
ATOM 9331  N N    . CYS A 1 50  ? -2.739  -10.395 -6.347  1.00 0.00 ?  263 CYS A N    5  
ATOM 9332  C CA   . CYS A 1 50  ? -1.793  -9.795  -7.272  1.00 0.00 ?  263 CYS A CA   5  
ATOM 9333  C C    . CYS A 1 50  ? -1.047  -10.919 -7.994  1.00 0.00 ?  263 CYS A C    5  
ATOM 9334  O O    . CYS A 1 50  ? -0.850  -11.997 -7.435  1.00 0.00 ?  263 CYS A O    5  
ATOM 9335  C CB   . CYS A 1 50  ? -0.834  -8.839  -6.560  1.00 0.00 ?  263 CYS A CB   5  
ATOM 9336  S SG   . CYS A 1 50  ? 0.442   -9.791  -5.656  1.00 0.00 ?  263 CYS A SG   5  
ATOM 9337  H H    . CYS A 1 50  ? -2.502  -11.316 -6.039  1.00 0.00 ?  263 CYS A H    5  
ATOM 9338  H HA   . CYS A 1 50  ? -2.377  -9.203  -7.977  1.00 0.00 ?  263 CYS A HA   5  
ATOM 9339  H HB2  . CYS A 1 50  ? -0.360  -8.178  -7.286  1.00 0.00 ?  263 CYS A HB2  5  
ATOM 9340  H HB3  . CYS A 1 50  ? -1.387  -8.206  -5.866  1.00 0.00 ?  263 CYS A HB3  5  
ATOM 9341  H HG   . CYS A 1 50  ? 1.437   -9.522  -6.496  1.00 0.00 ?  263 CYS A HG   5  
ATOM 9342  N N    . ARG A 1 51  ? -0.653  -10.629 -9.225  1.00 0.00 ?  264 ARG A N    5  
ATOM 9343  C CA   . ARG A 1 51  ? 0.067   -11.602 -10.029 1.00 0.00 ?  264 ARG A CA   5  
ATOM 9344  C C    . ARG A 1 51  ? 1.574   -11.470 -9.799  1.00 0.00 ?  264 ARG A C    5  
ATOM 9345  O O    . ARG A 1 51  ? 2.020   -10.577 -9.080  1.00 0.00 ?  264 ARG A O    5  
ATOM 9346  C CB   . ARG A 1 51  ? -0.233  -11.417 -11.518 1.00 0.00 ?  264 ARG A CB   5  
ATOM 9347  C CG   . ARG A 1 51  ? -1.608  -11.984 -11.875 1.00 0.00 ?  264 ARG A CG   5  
ATOM 9348  C CD   . ARG A 1 51  ? -1.525  -13.484 -12.163 1.00 0.00 ?  264 ARG A CD   5  
ATOM 9349  N NE   . ARG A 1 51  ? -2.477  -13.847 -13.236 1.00 0.00 ?  264 ARG A NE   5  
ATOM 9350  C CZ   . ARG A 1 51  ? -2.866  -15.102 -13.502 1.00 0.00 ?  264 ARG A CZ   5  
ATOM 9351  N NH1  . ARG A 1 51  ? -2.386  -16.120 -12.776 1.00 0.00 ?  264 ARG A NH1  5  
ATOM 9352  N NH2  . ARG A 1 51  ? -3.734  -15.337 -14.495 1.00 0.00 1  264 ARG A NH2  5  
ATOM 9353  H H    . ARG A 1 51  ? -0.817  -9.750  -9.673  1.00 0.00 ?  264 ARG A H    5  
ATOM 9354  H HA   . ARG A 1 51  ? -0.298  -12.571 -9.688  1.00 0.00 ?  264 ARG A HA   5  
ATOM 9355  H HB2  . ARG A 1 51  ? -0.196  -10.357 -11.771 1.00 0.00 ?  264 ARG A HB2  5  
ATOM 9356  H HB3  . ARG A 1 51  ? 0.534   -11.913 -12.112 1.00 0.00 ?  264 ARG A HB3  5  
ATOM 9357  H HG2  . ARG A 1 51  ? -2.303  -11.806 -11.054 1.00 0.00 ?  264 ARG A HG2  5  
ATOM 9358  H HG3  . ARG A 1 51  ? -2.005  -11.464 -12.747 1.00 0.00 ?  264 ARG A HG3  5  
ATOM 9359  H HD2  . ARG A 1 51  ? -0.510  -13.750 -12.460 1.00 0.00 ?  264 ARG A HD2  5  
ATOM 9360  H HD3  . ARG A 1 51  ? -1.750  -14.050 -11.258 1.00 0.00 ?  264 ARG A HD3  5  
ATOM 9361  H HE   . ARG A 1 51  ? -2.854  -13.110 -13.797 1.00 0.00 ?  264 ARG A HE   5  
ATOM 9362  H HH11 . ARG A 1 51  ? -1.738  -15.945 -12.035 1.00 0.00 ?  264 ARG A HH11 5  
ATOM 9363  H HH12 . ARG A 1 51  ? -2.676  -17.057 -12.975 1.00 0.00 ?  264 ARG A HH12 5  
ATOM 9364  H HH21 . ARG A 1 51  ? -4.092  -14.577 -15.038 1.00 0.00 ?  264 ARG A HH21 5  
ATOM 9365  H HH22 . ARG A 1 51  ? -4.024  -16.273 -14.695 1.00 0.00 ?  264 ARG A HH22 5  
ATOM 9366  N N    . ILE A 1 52  ? 2.317   -12.372 -10.424 1.00 0.00 ?  265 ILE A N    5  
ATOM 9367  C CA   . ILE A 1 52  ? 3.764   -12.367 -10.296 1.00 0.00 ?  265 ILE A CA   5  
ATOM 9368  C C    . ILE A 1 52  ? 4.346   -11.254 -11.171 1.00 0.00 ?  265 ILE A C    5  
ATOM 9369  O O    . ILE A 1 52  ? 3.868   -11.018 -12.280 1.00 0.00 ?  265 ILE A O    5  
ATOM 9370  C CB   . ILE A 1 52  ? 4.334   -13.753 -10.605 1.00 0.00 ?  265 ILE A CB   5  
ATOM 9371  C CG1  . ILE A 1 52  ? 4.449   -13.975 -12.115 1.00 0.00 ?  265 ILE A CG1  5  
ATOM 9372  C CG2  . ILE A 1 52  ? 3.510   -14.848 -9.926  1.00 0.00 ?  265 ILE A CG2  5  
ATOM 9373  C CD1  . ILE A 1 52  ? 3.068   -14.154 -12.749 1.00 0.00 ?  265 ILE A CD1  5  
ATOM 9374  H H    . ILE A 1 52  ? 1.947   -13.094 -11.008 1.00 0.00 ?  265 ILE A H    5  
ATOM 9375  H HA   . ILE A 1 52  ? 4.000   -12.146 -9.255  1.00 0.00 ?  265 ILE A HA   5  
ATOM 9376  H HB   . ILE A 1 52  ? 5.342   -13.807 -10.194 1.00 0.00 ?  265 ILE A HB   5  
ATOM 9377  H HG12 . ILE A 1 52  ? 4.956   -13.126 -12.573 1.00 0.00 ?  265 ILE A HG12 5  
ATOM 9378  H HG13 . ILE A 1 52  ? 5.060   -14.855 -12.311 1.00 0.00 ?  265 ILE A HG13 5  
ATOM 9379  H HG21 . ILE A 1 52  ? 3.835   -15.824 -10.286 1.00 0.00 ?  265 ILE A HG21 5  
ATOM 9380  H HG22 . ILE A 1 52  ? 3.652   -14.794 -8.847  1.00 0.00 ?  265 ILE A HG22 5  
ATOM 9381  H HG23 . ILE A 1 52  ? 2.455   -14.708 -10.161 1.00 0.00 ?  265 ILE A HG23 5  
ATOM 9382  H HD11 . ILE A 1 52  ? 2.578   -13.184 -12.833 1.00 0.00 ?  265 ILE A HD11 5  
ATOM 9383  H HD12 . ILE A 1 52  ? 3.178   -14.593 -13.741 1.00 0.00 ?  265 ILE A HD12 5  
ATOM 9384  H HD13 . ILE A 1 52  ? 2.464   -14.813 -12.125 1.00 0.00 ?  265 ILE A HD13 5  
ATOM 9385  N N    . GLY A 1 53  ? 5.368   -10.601 -10.640 1.00 0.00 ?  266 GLY A N    5  
ATOM 9386  C CA   . GLY A 1 53  ? 6.020   -9.519  -11.358 1.00 0.00 ?  266 GLY A CA   5  
ATOM 9387  C C    . GLY A 1 53  ? 4.989   -8.569  -11.971 1.00 0.00 ?  266 GLY A C    5  
ATOM 9388  O O    . GLY A 1 53  ? 5.070   -8.237  -13.153 1.00 0.00 ?  266 GLY A O    5  
ATOM 9389  H H    . GLY A 1 53  ? 5.751   -10.799 -9.738  1.00 0.00 ?  266 GLY A H    5  
ATOM 9390  H HA2  . GLY A 1 53  ? 6.670   -8.967  -10.680 1.00 0.00 ?  266 GLY A HA2  5  
ATOM 9391  H HA3  . GLY A 1 53  ? 6.653   -9.929  -12.145 1.00 0.00 ?  266 GLY A HA3  5  
ATOM 9392  N N    . GLU A 1 54  ? 4.043   -8.157  -11.139 1.00 0.00 ?  267 GLU A N    5  
ATOM 9393  C CA   . GLU A 1 54  ? 2.997   -7.252  -11.584 1.00 0.00 ?  267 GLU A CA   5  
ATOM 9394  C C    . GLU A 1 54  ? 3.561   -5.843  -11.775 1.00 0.00 ?  267 GLU A C    5  
ATOM 9395  O O    . GLU A 1 54  ? 4.718   -5.584  -11.448 1.00 0.00 ?  267 GLU A O    5  
ATOM 9396  C CB   . GLU A 1 54  ? 1.823   -7.245  -10.602 1.00 0.00 ?  267 GLU A CB   5  
ATOM 9397  C CG   . GLU A 1 54  ? 1.915   -6.052  -9.648  1.00 0.00 ?  267 GLU A CG   5  
ATOM 9398  C CD   . GLU A 1 54  ? 0.744   -6.047  -8.663  1.00 0.00 ?  267 GLU A CD   5  
ATOM 9399  O OE1  . GLU A 1 54  ? -0.422  -6.064  -9.086  1.00 0.00 ?  267 GLU A OE1  5  
ATOM 9400  O OE2  . GLU A 1 54  ? 1.078   -6.025  -7.418  1.00 0.00 -1 267 GLU A OE2  5  
ATOM 9401  H H    . GLU A 1 54  ? 3.984   -8.432  -10.180 1.00 0.00 ?  267 GLU A H    5  
ATOM 9402  H HA   . GLU A 1 54  ? 2.659   -7.648  -12.542 1.00 0.00 ?  267 GLU A HA   5  
ATOM 9403  H HB2  . GLU A 1 54  ? 0.884   -7.203  -11.153 1.00 0.00 ?  267 GLU A HB2  5  
ATOM 9404  H HB3  . GLU A 1 54  ? 1.817   -8.173  -10.031 1.00 0.00 ?  267 GLU A HB3  5  
ATOM 9405  H HG2  . GLU A 1 54  ? 2.856   -6.093  -9.099  1.00 0.00 ?  267 GLU A HG2  5  
ATOM 9406  H HG3  . GLU A 1 54  ? 1.919   -5.124  -10.219 1.00 0.00 ?  267 GLU A HG3  5  
ATOM 9407  H HE2  . GLU A 1 54  ? 0.385   -5.540  -6.886  1.00 0.00 ?  267 GLU A HE2  5  
ATOM 9408  N N    . PRO A 1 55  ? 2.695   -4.946  -12.318 1.00 0.00 ?  268 PRO A N    5  
ATOM 9409  C CA   . PRO A 1 55  ? 3.095   -3.569  -12.557 1.00 0.00 ?  268 PRO A CA   5  
ATOM 9410  C C    . PRO A 1 55  ? 3.147   -2.779  -11.248 1.00 0.00 ?  268 PRO A C    5  
ATOM 9411  O O    . PRO A 1 55  ? 2.123   -2.291  -10.772 1.00 0.00 ?  268 PRO A O    5  
ATOM 9412  C CB   . PRO A 1 55  ? 2.069   -3.026  -13.538 1.00 0.00 ?  268 PRO A CB   5  
ATOM 9413  C CG   . PRO A 1 55  ? 0.875   -3.963  -13.454 1.00 0.00 ?  268 PRO A CG   5  
ATOM 9414  C CD   . PRO A 1 55  ? 1.317   -5.217  -12.718 1.00 0.00 ?  268 PRO A CD   5  
ATOM 9415  H HA   . PRO A 1 55  ? 4.021   -3.537  -12.933 1.00 0.00 ?  268 PRO A HA   5  
ATOM 9416  H HB2  . PRO A 1 55  ? 1.784   -2.006  -13.281 1.00 0.00 ?  268 PRO A HB2  5  
ATOM 9417  H HB3  . PRO A 1 55  ? 2.473   -2.998  -14.550 1.00 0.00 ?  268 PRO A HB3  5  
ATOM 9418  H HG2  . PRO A 1 55  ? 0.049   -3.483  -12.929 1.00 0.00 ?  268 PRO A HG2  5  
ATOM 9419  H HG3  . PRO A 1 55  ? 0.515   -4.213  -14.453 1.00 0.00 ?  268 PRO A HG3  5  
ATOM 9420  H HD2  . PRO A 1 55  ? 0.684   -5.412  -11.852 1.00 0.00 ?  268 PRO A HD2  5  
ATOM 9421  H HD3  . PRO A 1 55  ? 1.257   -6.095  -13.361 1.00 0.00 ?  268 PRO A HD3  5  
ATOM 9422  N N    . GLY A 1 56  ? 4.350   -2.676  -10.703 1.00 0.00 ?  269 GLY A N    5  
ATOM 9423  C CA   . GLY A 1 56  ? 4.549   -1.954  -9.458  1.00 0.00 ?  269 GLY A CA   5  
ATOM 9424  C C    . GLY A 1 56  ? 3.921   -0.560  -9.527  1.00 0.00 ?  269 GLY A C    5  
ATOM 9425  O O    . GLY A 1 56  ? 4.578   0.403   -9.919  1.00 0.00 ?  269 GLY A O    5  
ATOM 9426  H H    . GLY A 1 56  ? 5.178   -3.076  -11.097 1.00 0.00 ?  269 GLY A H    5  
ATOM 9427  H HA2  . GLY A 1 56  ? 4.109   -2.515  -8.634  1.00 0.00 ?  269 GLY A HA2  5  
ATOM 9428  H HA3  . GLY A 1 56  ? 5.615   -1.866  -9.251  1.00 0.00 ?  269 GLY A HA3  5  
ATOM 9429  N N    . ASP A 1 57  ? 2.655   -0.497  -9.140  1.00 0.00 ?  270 ASP A N    5  
ATOM 9430  C CA   . ASP A 1 57  ? 1.931   0.762   -9.152  1.00 0.00 ?  270 ASP A CA   5  
ATOM 9431  C C    . ASP A 1 57  ? 0.590   0.581   -8.438  1.00 0.00 ?  270 ASP A C    5  
ATOM 9432  O O    . ASP A 1 57  ? -0.423  1.138   -8.861  1.00 0.00 ?  270 ASP A O    5  
ATOM 9433  C CB   . ASP A 1 57  ? 1.646   1.219   -10.585 1.00 0.00 ?  270 ASP A CB   5  
ATOM 9434  C CG   . ASP A 1 57  ? 2.803   1.946   -11.273 1.00 0.00 ?  270 ASP A CG   5  
ATOM 9435  O OD1  . ASP A 1 57  ? 3.640   2.582   -10.616 1.00 0.00 ?  270 ASP A OD1  5  
ATOM 9436  O OD2  . ASP A 1 57  ? 2.826   1.838   -12.559 1.00 0.00 -1 270 ASP A OD2  5  
ATOM 9437  H H    . ASP A 1 57  ? 2.128   -1.285  -8.822  1.00 0.00 ?  270 ASP A H    5  
ATOM 9438  H HA   . ASP A 1 57  ? 2.582   1.472   -8.643  1.00 0.00 ?  270 ASP A HA   5  
ATOM 9439  H HB2  . ASP A 1 57  ? 1.377   0.348   -11.181 1.00 0.00 ?  270 ASP A HB2  5  
ATOM 9440  H HB3  . ASP A 1 57  ? 0.778   1.879   -10.574 1.00 0.00 ?  270 ASP A HB3  5  
ATOM 9441  H HD2  . ASP A 1 57  ? 3.733   2.077   -12.906 1.00 0.00 ?  270 ASP A HD2  5  
ATOM 9442  N N    . ARG A 1 58  ? 0.626   -0.199  -7.369  1.00 0.00 ?  271 ARG A N    5  
ATOM 9443  C CA   . ARG A 1 58  ? -0.574  -0.461  -6.592  1.00 0.00 ?  271 ARG A CA   5  
ATOM 9444  C C    . ARG A 1 58  ? -0.221  -1.204  -5.302  1.00 0.00 ?  271 ARG A C    5  
ATOM 9445  O O    . ARG A 1 58  ? 0.741   -1.970  -5.267  1.00 0.00 ?  271 ARG A O    5  
ATOM 9446  C CB   . ARG A 1 58  ? -1.579  -1.292  -7.393  1.00 0.00 ?  271 ARG A CB   5  
ATOM 9447  C CG   . ARG A 1 58  ? -3.014  -0.857  -7.091  1.00 0.00 ?  271 ARG A CG   5  
ATOM 9448  C CD   . ARG A 1 58  ? -3.772  -0.534  -8.380  1.00 0.00 ?  271 ARG A CD   5  
ATOM 9449  N NE   . ARG A 1 58  ? -5.230  -0.554  -8.129  1.00 0.00 ?  271 ARG A NE   5  
ATOM 9450  C CZ   . ARG A 1 58  ? -5.972  -1.669  -8.101  1.00 0.00 ?  271 ARG A CZ   5  
ATOM 9451  N NH1  . ARG A 1 58  ? -5.397  -2.862  -8.309  1.00 0.00 ?  271 ARG A NH1  5  
ATOM 9452  N NH2  . ARG A 1 58  ? -7.289  -1.593  -7.866  1.00 0.00 1  271 ARG A NH2  5  
ATOM 9453  H H    . ARG A 1 58  ? 1.453   -0.648  -7.031  1.00 0.00 ?  271 ARG A H    5  
ATOM 9454  H HA   . ARG A 1 58  ? -0.987  0.525   -6.376  1.00 0.00 ?  271 ARG A HA   5  
ATOM 9455  H HB2  . ARG A 1 58  ? -1.378  -1.183  -8.459  1.00 0.00 ?  271 ARG A HB2  5  
ATOM 9456  H HB3  . ARG A 1 58  ? -1.456  -2.348  -7.152  1.00 0.00 ?  271 ARG A HB3  5  
ATOM 9457  H HG2  . ARG A 1 58  ? -3.532  -1.650  -6.550  1.00 0.00 ?  271 ARG A HG2  5  
ATOM 9458  H HG3  . ARG A 1 58  ? -3.004  0.018   -6.441  1.00 0.00 ?  271 ARG A HG3  5  
ATOM 9459  H HD2  . ARG A 1 58  ? -3.472  0.446   -8.752  1.00 0.00 ?  271 ARG A HD2  5  
ATOM 9460  H HD3  . ARG A 1 58  ? -3.517  -1.259  -9.153  1.00 0.00 ?  271 ARG A HD3  5  
ATOM 9461  H HE   . ARG A 1 58  ? -5.691  0.319   -7.971  1.00 0.00 ?  271 ARG A HE   5  
ATOM 9462  H HH11 . ARG A 1 58  ? -4.414  -2.920  -8.484  1.00 0.00 ?  271 ARG A HH11 5  
ATOM 9463  H HH12 . ARG A 1 58  ? -5.951  -3.695  -8.288  1.00 0.00 ?  271 ARG A HH12 5  
ATOM 9464  H HH21 . ARG A 1 58  ? -7.718  -0.703  -7.711  1.00 0.00 ?  271 ARG A HH21 5  
ATOM 9465  H HH22 . ARG A 1 58  ? -7.843  -2.425  -7.845  1.00 0.00 ?  271 ARG A HH22 5  
ATOM 9466  N N    . MET A 1 59  ? -1.017  -0.952  -4.274  1.00 0.00 ?  272 MET A N    5  
ATOM 9467  C CA   . MET A 1 59  ? -0.800  -1.588  -2.986  1.00 0.00 ?  272 MET A CA   5  
ATOM 9468  C C    . MET A 1 59  ? -2.127  -2.020  -2.358  1.00 0.00 ?  272 MET A C    5  
ATOM 9469  O O    . MET A 1 59  ? -3.149  -1.363  -2.544  1.00 0.00 ?  272 MET A O    5  
ATOM 9470  C CB   . MET A 1 59  ? -0.085  -0.612  -2.049  1.00 0.00 ?  272 MET A CB   5  
ATOM 9471  C CG   . MET A 1 59  ? -1.042  0.477   -1.558  1.00 0.00 ?  272 MET A CG   5  
ATOM 9472  S SD   . MET A 1 59  ? -0.158  1.656   -0.549  1.00 0.00 ?  272 MET A SD   5  
ATOM 9473  C CE   . MET A 1 59  ? 0.925   0.551   0.341   1.00 0.00 ?  272 MET A CE   5  
ATOM 9474  H H    . MET A 1 59  ? -1.797  -0.327  -4.311  1.00 0.00 ?  272 MET A H    5  
ATOM 9475  H HA   . MET A 1 59  ? -0.185  -2.463  -3.192  1.00 0.00 ?  272 MET A HA   5  
ATOM 9476  H HB2  . MET A 1 59  ? 0.322   -1.154  -1.196  1.00 0.00 ?  272 MET A HB2  5  
ATOM 9477  H HB3  . MET A 1 59  ? 0.757   -0.155  -2.568  1.00 0.00 ?  272 MET A HB3  5  
ATOM 9478  H HG2  . MET A 1 59  ? -1.497  0.983   -2.409  1.00 0.00 ?  272 MET A HG2  5  
ATOM 9479  H HG3  . MET A 1 59  ? -1.852  0.029   -0.983  1.00 0.00 ?  272 MET A HG3  5  
ATOM 9480  H HE1  . MET A 1 59  ? 1.309   1.055   1.228   1.00 0.00 ?  272 MET A HE1  5  
ATOM 9481  H HE2  . MET A 1 59  ? 0.371   -0.339  0.640   1.00 0.00 ?  272 MET A HE2  5  
ATOM 9482  H HE3  . MET A 1 59  ? 1.757   0.263   -0.301  1.00 0.00 ?  272 MET A HE3  5  
ATOM 9483  N N    . PHE A 1 60  ? -2.066  -3.124  -1.626  1.00 0.00 ?  273 PHE A N    5  
ATOM 9484  C CA   . PHE A 1 60  ? -3.250  -3.652  -0.970  1.00 0.00 ?  273 PHE A CA   5  
ATOM 9485  C C    . PHE A 1 60  ? -3.012  -3.825  0.532   1.00 0.00 ?  273 PHE A C    5  
ATOM 9486  O O    . PHE A 1 60  ? -1.882  -4.045  0.964   1.00 0.00 ?  273 PHE A O    5  
ATOM 9487  C CB   . PHE A 1 60  ? -3.532  -5.021  -1.591  1.00 0.00 ?  273 PHE A CB   5  
ATOM 9488  C CG   . PHE A 1 60  ? -4.072  -4.956  -3.021  1.00 0.00 ?  273 PHE A CG   5  
ATOM 9489  C CD1  . PHE A 1 60  ? -3.249  -4.597  -4.042  1.00 0.00 ?  273 PHE A CD1  5  
ATOM 9490  C CD2  . PHE A 1 60  ? -5.374  -5.259  -3.271  1.00 0.00 ?  273 PHE A CD2  5  
ATOM 9491  C CE1  . PHE A 1 60  ? -3.749  -4.537  -5.370  1.00 0.00 ?  273 PHE A CE1  5  
ATOM 9492  C CE2  . PHE A 1 60  ? -5.875  -5.199  -4.598  1.00 0.00 ?  273 PHE A CE2  5  
ATOM 9493  C CZ   . PHE A 1 60  ? -5.052  -4.839  -5.620  1.00 0.00 ?  273 PHE A CZ   5  
ATOM 9494  H H    . PHE A 1 60  ? -1.230  -3.652  -1.480  1.00 0.00 ?  273 PHE A H    5  
ATOM 9495  H HA   . PHE A 1 60  ? -4.055  -2.934  -1.128  1.00 0.00 ?  273 PHE A HA   5  
ATOM 9496  H HB2  . PHE A 1 60  ? -2.614  -5.607  -1.586  1.00 0.00 ?  273 PHE A HB2  5  
ATOM 9497  H HB3  . PHE A 1 60  ? -4.252  -5.551  -0.966  1.00 0.00 ?  273 PHE A HB3  5  
ATOM 9498  H HD1  . PHE A 1 60  ? -2.205  -4.355  -3.842  1.00 0.00 ?  273 PHE A HD1  5  
ATOM 9499  H HD2  . PHE A 1 60  ? -6.034  -5.547  -2.452  1.00 0.00 ?  273 PHE A HD2  5  
ATOM 9500  H HE1  . PHE A 1 60  ? -3.090  -4.249  -6.189  1.00 0.00 ?  273 PHE A HE1  5  
ATOM 9501  H HE2  . PHE A 1 60  ? -6.918  -5.441  -4.799  1.00 0.00 ?  273 PHE A HE2  5  
ATOM 9502  H HZ   . PHE A 1 60  ? -5.436  -4.793  -6.639  1.00 0.00 ?  273 PHE A HZ   5  
ATOM 9503  N N    . PHE A 1 61  ? -4.096  -3.719  1.286   1.00 0.00 ?  274 PHE A N    5  
ATOM 9504  C CA   . PHE A 1 61  ? -4.020  -3.861  2.730   1.00 0.00 ?  274 PHE A CA   5  
ATOM 9505  C C    . PHE A 1 61  ? -5.061  -4.861  3.238   1.00 0.00 ?  274 PHE A C    5  
ATOM 9506  O O    . PHE A 1 61  ? -6.253  -4.712  2.971   1.00 0.00 ?  274 PHE A O    5  
ATOM 9507  C CB   . PHE A 1 61  ? -4.316  -2.486  3.331   1.00 0.00 ?  274 PHE A CB   5  
ATOM 9508  C CG   . PHE A 1 61  ? -3.297  -1.409  2.952   1.00 0.00 ?  274 PHE A CG   5  
ATOM 9509  C CD1  . PHE A 1 61  ? -1.973  -1.715  2.896   1.00 0.00 ?  274 PHE A CD1  5  
ATOM 9510  C CD2  . PHE A 1 61  ? -3.716  -0.146  2.671   1.00 0.00 ?  274 PHE A CD2  5  
ATOM 9511  C CE1  . PHE A 1 61  ? -1.028  -0.715  2.543   1.00 0.00 ?  274 PHE A CE1  5  
ATOM 9512  C CE2  . PHE A 1 61  ? -2.771  0.853   2.318   1.00 0.00 ?  274 PHE A CE2  5  
ATOM 9513  C CZ   . PHE A 1 61  ? -1.447  0.548   2.262   1.00 0.00 ?  274 PHE A CZ   5  
ATOM 9514  H H    . PHE A 1 61  ? -5.012  -3.540  0.927   1.00 0.00 ?  274 PHE A H    5  
ATOM 9515  H HA   . PHE A 1 61  ? -3.021  -4.228  2.967   1.00 0.00 ?  274 PHE A HA   5  
ATOM 9516  H HB2  . PHE A 1 61  ? -5.306  -2.165  3.009   1.00 0.00 ?  274 PHE A HB2  5  
ATOM 9517  H HB3  . PHE A 1 61  ? -4.348  -2.575  4.418   1.00 0.00 ?  274 PHE A HB3  5  
ATOM 9518  H HD1  . PHE A 1 61  ? -1.638  -2.727  3.121   1.00 0.00 ?  274 PHE A HD1  5  
ATOM 9519  H HD2  . PHE A 1 61  ? -4.777  0.099   2.716   1.00 0.00 ?  274 PHE A HD2  5  
ATOM 9520  H HE1  . PHE A 1 61  ? 0.033   -0.960  2.498   1.00 0.00 ?  274 PHE A HE1  5  
ATOM 9521  H HE2  . PHE A 1 61  ? -3.107  1.866   2.093   1.00 0.00 ?  274 PHE A HE2  5  
ATOM 9522  H HZ   . PHE A 1 61  ? -0.722  1.315   1.992   1.00 0.00 ?  274 PHE A HZ   5  
ATOM 9523  N N    . VAL A 1 62  ? -4.573  -5.859  3.962   1.00 0.00 ?  275 VAL A N    5  
ATOM 9524  C CA   . VAL A 1 62  ? -5.446  -6.883  4.509   1.00 0.00 ?  275 VAL A CA   5  
ATOM 9525  C C    . VAL A 1 62  ? -6.122  -6.348  5.773   1.00 0.00 ?  275 VAL A C    5  
ATOM 9526  O O    . VAL A 1 62  ? -5.483  -5.690  6.593   1.00 0.00 ?  275 VAL A O    5  
ATOM 9527  C CB   . VAL A 1 62  ? -4.655  -8.169  4.753   1.00 0.00 ?  275 VAL A CB   5  
ATOM 9528  C CG1  . VAL A 1 62  ? -5.516  -9.217  5.462   1.00 0.00 ?  275 VAL A CG1  5  
ATOM 9529  C CG2  . VAL A 1 62  ? -4.088  -8.721  3.443   1.00 0.00 ?  275 VAL A CG2  5  
ATOM 9530  H H    . VAL A 1 62  ? -3.603  -5.973  4.174   1.00 0.00 ?  275 VAL A H    5  
ATOM 9531  H HA   . VAL A 1 62  ? -6.213  -7.094  3.764   1.00 0.00 ?  275 VAL A HA   5  
ATOM 9532  H HB   . VAL A 1 62  ? -3.816  -7.928  5.406   1.00 0.00 ?  275 VAL A HB   5  
ATOM 9533  H HG11 . VAL A 1 62  ? -6.353  -8.724  5.958   1.00 0.00 ?  275 VAL A HG11 5  
ATOM 9534  H HG12 . VAL A 1 62  ? -5.896  -9.930  4.731   1.00 0.00 ?  275 VAL A HG12 5  
ATOM 9535  H HG13 . VAL A 1 62  ? -4.913  -9.742  6.203   1.00 0.00 ?  275 VAL A HG13 5  
ATOM 9536  H HG21 . VAL A 1 62  ? -4.806  -9.410  2.999   1.00 0.00 ?  275 VAL A HG21 5  
ATOM 9537  H HG22 . VAL A 1 62  ? -3.900  -7.898  2.754   1.00 0.00 ?  275 VAL A HG22 5  
ATOM 9538  H HG23 . VAL A 1 62  ? -3.155  -9.247  3.644   1.00 0.00 ?  275 VAL A HG23 5  
ATOM 9539  N N    . VAL A 1 63  ? -7.407  -6.650  5.892   1.00 0.00 ?  276 VAL A N    5  
ATOM 9540  C CA   . VAL A 1 63  ? -8.177  -6.208  7.042   1.00 0.00 ?  276 VAL A CA   5  
ATOM 9541  C C    . VAL A 1 63  ? -8.648  -7.429  7.835   1.00 0.00 ?  276 VAL A C    5  
ATOM 9542  O O    . VAL A 1 63  ? -8.511  -7.471  9.057   1.00 0.00 ?  276 VAL A O    5  
ATOM 9543  C CB   . VAL A 1 63  ? -9.328  -5.309  6.588   1.00 0.00 ?  276 VAL A CB   5  
ATOM 9544  C CG1  . VAL A 1 63  ? -9.868  -4.477  7.753   1.00 0.00 ?  276 VAL A CG1  5  
ATOM 9545  C CG2  . VAL A 1 63  ? -8.897  -4.411  5.426   1.00 0.00 ?  276 VAL A CG2  5  
ATOM 9546  H H    . VAL A 1 63  ? -7.920  -7.185  5.221   1.00 0.00 ?  276 VAL A H    5  
ATOM 9547  H HA   . VAL A 1 63  ? -7.514  -5.614  7.673   1.00 0.00 ?  276 VAL A HA   5  
ATOM 9548  H HB   . VAL A 1 63  ? -10.134 -5.952  6.233   1.00 0.00 ?  276 VAL A HB   5  
ATOM 9549  H HG11 . VAL A 1 63  ? -10.931 -4.680  7.882   1.00 0.00 ?  276 VAL A HG11 5  
ATOM 9550  H HG12 . VAL A 1 63  ? -9.334  -4.742  8.666   1.00 0.00 ?  276 VAL A HG12 5  
ATOM 9551  H HG13 . VAL A 1 63  ? -9.722  -3.418  7.541   1.00 0.00 ?  276 VAL A HG13 5  
ATOM 9552  H HG21 . VAL A 1 63  ? -9.182  -4.876  4.482   1.00 0.00 ?  276 VAL A HG21 5  
ATOM 9553  H HG22 . VAL A 1 63  ? -9.387  -3.442  5.516   1.00 0.00 ?  276 VAL A HG22 5  
ATOM 9554  H HG23 . VAL A 1 63  ? -7.816  -4.277  5.453   1.00 0.00 ?  276 VAL A HG23 5  
ATOM 9555  N N    . GLU A 1 64  ? -9.193  -8.392  7.107   1.00 0.00 ?  277 GLU A N    5  
ATOM 9556  C CA   . GLU A 1 64  ? -9.685  -9.611  7.727   1.00 0.00 ?  277 GLU A CA   5  
ATOM 9557  C C    . GLU A 1 64  ? -9.464  -10.806 6.798   1.00 0.00 ?  277 GLU A C    5  
ATOM 9558  O O    . GLU A 1 64  ? -9.722  -10.719 5.598   1.00 0.00 ?  277 GLU A O    5  
ATOM 9559  C CB   . GLU A 1 64  ? -11.162 -9.476  8.105   1.00 0.00 ?  277 GLU A CB   5  
ATOM 9560  C CG   . GLU A 1 64  ? -11.483 -8.051  8.561   1.00 0.00 ?  277 GLU A CG   5  
ATOM 9561  C CD   . GLU A 1 64  ? -12.904 -7.962  9.122   1.00 0.00 ?  277 GLU A CD   5  
ATOM 9562  O OE1  . GLU A 1 64  ? -13.224 -8.640  10.109  1.00 0.00 ?  277 GLU A OE1  5  
ATOM 9563  O OE2  . GLU A 1 64  ? -13.688 -7.152  8.494   1.00 0.00 -1 277 GLU A OE2  5  
ATOM 9564  H H    . GLU A 1 64  ? -9.301  -8.350  6.114   1.00 0.00 ?  277 GLU A H    5  
ATOM 9565  H HA   . GLU A 1 64  ? -9.094  -9.733  8.635   1.00 0.00 ?  277 GLU A HA   5  
ATOM 9566  H HB2  . GLU A 1 64  ? -11.785 -9.737  7.250   1.00 0.00 ?  277 GLU A HB2  5  
ATOM 9567  H HB3  . GLU A 1 64  ? -11.403 -10.179 8.902   1.00 0.00 ?  277 GLU A HB3  5  
ATOM 9568  H HG2  . GLU A 1 64  ? -10.768 -7.739  9.322   1.00 0.00 ?  277 GLU A HG2  5  
ATOM 9569  H HG3  . GLU A 1 64  ? -11.376 -7.364  7.721   1.00 0.00 ?  277 GLU A HG3  5  
ATOM 9570  H HE2  . GLU A 1 64  ? -14.609 -7.538  8.444   1.00 0.00 ?  277 GLU A HE2  5  
ATOM 9571  N N    . GLY A 1 65  ? -8.990  -11.893 7.387   1.00 0.00 ?  278 GLY A N    5  
ATOM 9572  C CA   . GLY A 1 65  ? -8.732  -13.104 6.627   1.00 0.00 ?  278 GLY A CA   5  
ATOM 9573  C C    . GLY A 1 65  ? -7.240  -13.443 6.626   1.00 0.00 ?  278 GLY A C    5  
ATOM 9574  O O    . GLY A 1 65  ? -6.509  -13.048 7.534   1.00 0.00 ?  278 GLY A O    5  
ATOM 9575  H H    . GLY A 1 65  ? -8.784  -11.956 8.364   1.00 0.00 ?  278 GLY A H    5  
ATOM 9576  H HA2  . GLY A 1 65  ? -9.296  -13.934 7.054   1.00 0.00 ?  278 GLY A HA2  5  
ATOM 9577  H HA3  . GLY A 1 65  ? -9.080  -12.976 5.602   1.00 0.00 ?  278 GLY A HA3  5  
ATOM 9578  N N    . SER A 1 66  ? -6.831  -14.171 5.597   1.00 0.00 ?  279 SER A N    5  
ATOM 9579  C CA   . SER A 1 66  ? -5.439  -14.567 5.466   1.00 0.00 ?  279 SER A CA   5  
ATOM 9580  C C    . SER A 1 66  ? -5.080  -14.735 3.988   1.00 0.00 ?  279 SER A C    5  
ATOM 9581  O O    . SER A 1 66  ? -5.865  -15.278 3.212   1.00 0.00 ?  279 SER A O    5  
ATOM 9582  C CB   . SER A 1 66  ? -5.162  -15.863 6.230   1.00 0.00 ?  279 SER A CB   5  
ATOM 9583  O OG   . SER A 1 66  ? -4.843  -15.619 7.597   1.00 0.00 ?  279 SER A OG   5  
ATOM 9584  H H    . SER A 1 66  ? -7.432  -14.488 4.863   1.00 0.00 ?  279 SER A H    5  
ATOM 9585  H HA   . SER A 1 66  ? -4.865  -13.754 5.910   1.00 0.00 ?  279 SER A HA   5  
ATOM 9586  H HB2  . SER A 1 66  ? -6.035  -16.513 6.171   1.00 0.00 ?  279 SER A HB2  5  
ATOM 9587  H HB3  . SER A 1 66  ? -4.337  -16.394 5.755   1.00 0.00 ?  279 SER A HB3  5  
ATOM 9588  H HG   . SER A 1 66  ? -5.142  -14.701 7.859   1.00 0.00 ?  279 SER A HG   5  
ATOM 9589  N N    . VAL A 1 67  ? -3.893  -14.258 3.643   1.00 0.00 ?  280 VAL A N    5  
ATOM 9590  C CA   . VAL A 1 67  ? -3.420  -14.348 2.272   1.00 0.00 ?  280 VAL A CA   5  
ATOM 9591  C C    . VAL A 1 67  ? -2.156  -15.209 2.229   1.00 0.00 ?  280 VAL A C    5  
ATOM 9592  O O    . VAL A 1 67  ? -1.562  -15.498 3.266   1.00 0.00 ?  280 VAL A O    5  
ATOM 9593  C CB   . VAL A 1 67  ? -3.208  -12.946 1.698   1.00 0.00 ?  280 VAL A CB   5  
ATOM 9594  C CG1  . VAL A 1 67  ? -4.482  -12.107 1.816   1.00 0.00 ?  280 VAL A CG1  5  
ATOM 9595  C CG2  . VAL A 1 67  ? -2.027  -12.248 2.377   1.00 0.00 ?  280 VAL A CG2  5  
ATOM 9596  H H    . VAL A 1 67  ? -3.261  -13.817 4.280   1.00 0.00 ?  280 VAL A H    5  
ATOM 9597  H HA   . VAL A 1 67  ? -4.199  -14.838 1.687   1.00 0.00 ?  280 VAL A HA   5  
ATOM 9598  H HB   . VAL A 1 67  ? -2.972  -13.049 0.639   1.00 0.00 ?  280 VAL A HB   5  
ATOM 9599  H HG11 . VAL A 1 67  ? -5.312  -12.640 1.353   1.00 0.00 ?  280 VAL A HG11 5  
ATOM 9600  H HG12 . VAL A 1 67  ? -4.705  -11.931 2.869   1.00 0.00 ?  280 VAL A HG12 5  
ATOM 9601  H HG13 . VAL A 1 67  ? -4.336  -11.152 1.311   1.00 0.00 ?  280 VAL A HG13 5  
ATOM 9602  H HG21 . VAL A 1 67  ? -1.119  -12.829 2.212   1.00 0.00 ?  280 VAL A HG21 5  
ATOM 9603  H HG22 . VAL A 1 67  ? -1.903  -11.251 1.955   1.00 0.00 ?  280 VAL A HG22 5  
ATOM 9604  H HG23 . VAL A 1 67  ? -2.219  -12.169 3.447   1.00 0.00 ?  280 VAL A HG23 5  
ATOM 9605  N N    . SER A 1 68  ? -1.782  -15.595 1.018   1.00 0.00 ?  281 SER A N    5  
ATOM 9606  C CA   . SER A 1 68  ? -0.600  -16.417 0.826   1.00 0.00 ?  281 SER A CA   5  
ATOM 9607  C C    . SER A 1 68  ? 0.270   -15.830 -0.288  1.00 0.00 ?  281 SER A C    5  
ATOM 9608  O O    . SER A 1 68  ? -0.227  -15.118 -1.159  1.00 0.00 ?  281 SER A O    5  
ATOM 9609  C CB   . SER A 1 68  ? -0.981  -17.861 0.496   1.00 0.00 ?  281 SER A CB   5  
ATOM 9610  O OG   . SER A 1 68  ? 0.159   -18.654 0.175   1.00 0.00 ?  281 SER A OG   5  
ATOM 9611  H H    . SER A 1 68  ? -2.271  -15.355 0.179   1.00 0.00 ?  281 SER A H    5  
ATOM 9612  H HA   . SER A 1 68  ? -0.071  -16.389 1.778   1.00 0.00 ?  281 SER A HA   5  
ATOM 9613  H HB2  . SER A 1 68  ? -1.501  -18.302 1.347   1.00 0.00 ?  281 SER A HB2  5  
ATOM 9614  H HB3  . SER A 1 68  ? -1.677  -17.870 -0.343  1.00 0.00 ?  281 SER A HB3  5  
ATOM 9615  H HG   . SER A 1 68  ? 0.586   -18.315 -0.663  1.00 0.00 ?  281 SER A HG   5  
ATOM 9616  N N    . VAL A 1 69  ? 1.554   -16.151 -0.224  1.00 0.00 ?  282 VAL A N    5  
ATOM 9617  C CA   . VAL A 1 69  ? 2.498   -15.665 -1.216  1.00 0.00 ?  282 VAL A CA   5  
ATOM 9618  C C    . VAL A 1 69  ? 3.127   -16.856 -1.942  1.00 0.00 ?  282 VAL A C    5  
ATOM 9619  O O    . VAL A 1 69  ? 3.616   -17.788 -1.305  1.00 0.00 ?  282 VAL A O    5  
ATOM 9620  C CB   . VAL A 1 69  ? 3.533   -14.755 -0.551  1.00 0.00 ?  282 VAL A CB   5  
ATOM 9621  C CG1  . VAL A 1 69  ? 3.943   -13.617 -1.488  1.00 0.00 ?  282 VAL A CG1  5  
ATOM 9622  C CG2  . VAL A 1 69  ? 3.010   -14.210 0.779   1.00 0.00 ?  282 VAL A CG2  5  
ATOM 9623  H H    . VAL A 1 69  ? 1.950   -16.731 0.488   1.00 0.00 ?  282 VAL A H    5  
ATOM 9624  H HA   . VAL A 1 69  ? 1.938   -15.070 -1.937  1.00 0.00 ?  282 VAL A HA   5  
ATOM 9625  H HB   . VAL A 1 69  ? 4.420   -15.353 -0.342  1.00 0.00 ?  282 VAL A HB   5  
ATOM 9626  H HG11 . VAL A 1 69  ? 5.019   -13.456 -1.413  1.00 0.00 ?  282 VAL A HG11 5  
ATOM 9627  H HG12 . VAL A 1 69  ? 3.685   -13.879 -2.514  1.00 0.00 ?  282 VAL A HG12 5  
ATOM 9628  H HG13 . VAL A 1 69  ? 3.419   -12.705 -1.203  1.00 0.00 ?  282 VAL A HG13 5  
ATOM 9629  H HG21 . VAL A 1 69  ? 3.005   -15.007 1.522   1.00 0.00 ?  282 VAL A HG21 5  
ATOM 9630  H HG22 . VAL A 1 69  ? 3.656   -13.400 1.119   1.00 0.00 ?  282 VAL A HG22 5  
ATOM 9631  H HG23 . VAL A 1 69  ? 1.996   -13.833 0.644   1.00 0.00 ?  282 VAL A HG23 5  
ATOM 9632  N N    . ALA A 1 70  ? 3.093   -16.787 -3.264  1.00 0.00 ?  283 ALA A N    5  
ATOM 9633  C CA   . ALA A 1 70  ? 3.654   -17.848 -4.084  1.00 0.00 ?  283 ALA A CA   5  
ATOM 9634  C C    . ALA A 1 70  ? 5.178   -17.711 -4.114  1.00 0.00 ?  283 ALA A C    5  
ATOM 9635  O O    . ALA A 1 70  ? 5.715   -16.872 -4.835  1.00 0.00 ?  283 ALA A O    5  
ATOM 9636  C CB   . ALA A 1 70  ? 3.036   -17.794 -5.482  1.00 0.00 ?  283 ALA A CB   5  
ATOM 9637  H H    . ALA A 1 70  ? 2.693   -16.025 -3.775  1.00 0.00 ?  283 ALA A H    5  
ATOM 9638  H HA   . ALA A 1 70  ? 3.392   -18.799 -3.620  1.00 0.00 ?  283 ALA A HA   5  
ATOM 9639  H HB1  . ALA A 1 70  ? 3.720   -18.245 -6.200  1.00 0.00 ?  283 ALA A HB1  5  
ATOM 9640  H HB2  . ALA A 1 70  ? 2.094   -18.342 -5.484  1.00 0.00 ?  283 ALA A HB2  5  
ATOM 9641  H HB3  . ALA A 1 70  ? 2.853   -16.755 -5.759  1.00 0.00 ?  283 ALA A HB3  5  
ATOM 9642  N N    . THR A 1 71  ? 5.831   -18.549 -3.323  1.00 0.00 ?  284 THR A N    5  
ATOM 9643  C CA   . THR A 1 71  ? 7.282   -18.533 -3.250  1.00 0.00 ?  284 THR A CA   5  
ATOM 9644  C C    . THR A 1 71  ? 7.817   -19.938 -2.968  1.00 0.00 ?  284 THR A C    5  
ATOM 9645  O O    . THR A 1 71  ? 7.075   -20.916 -3.044  1.00 0.00 ?  284 THR A O    5  
ATOM 9646  C CB   . THR A 1 71  ? 7.691   -17.504 -2.194  1.00 0.00 ?  284 THR A CB   5  
ATOM 9647  O OG1  . THR A 1 71  ? 7.807   -18.265 -0.995  1.00 0.00 ?  284 THR A OG1  5  
ATOM 9648  C CG2  . THR A 1 71  ? 6.576   -16.500 -1.892  1.00 0.00 ?  284 THR A CG2  5  
ATOM 9649  H H    . THR A 1 71  ? 5.386   -19.229 -2.740  1.00 0.00 ?  284 THR A H    5  
ATOM 9650  H HA   . THR A 1 71  ? 7.671   -18.231 -4.222  1.00 0.00 ?  284 THR A HA   5  
ATOM 9651  H HB   . THR A 1 71  ? 8.608   -16.992 -2.485  1.00 0.00 ?  284 THR A HB   5  
ATOM 9652  H HG1  . THR A 1 71  ? 7.956   -17.655 -0.216  1.00 0.00 ?  284 THR A HG1  5  
ATOM 9653  H HG21 . THR A 1 71  ? 6.367   -15.910 -2.784  1.00 0.00 ?  284 THR A HG21 5  
ATOM 9654  H HG22 . THR A 1 71  ? 5.676   -17.037 -1.592  1.00 0.00 ?  284 THR A HG22 5  
ATOM 9655  H HG23 . THR A 1 71  ? 6.891   -15.839 -1.085  1.00 0.00 ?  284 THR A HG23 5  
ATOM 9656  N N    . PRO A 1 72  ? 9.136   -19.996 -2.641  1.00 0.00 ?  285 PRO A N    5  
ATOM 9657  C CA   . PRO A 1 72  ? 9.780   -21.265 -2.348  1.00 0.00 ?  285 PRO A CA   5  
ATOM 9658  C C    . PRO A 1 72  ? 9.378   -21.776 -0.963  1.00 0.00 ?  285 PRO A C    5  
ATOM 9659  O O    . PRO A 1 72  ? 9.892   -22.793 -0.499  1.00 0.00 ?  285 PRO A O    5  
ATOM 9660  C CB   . PRO A 1 72  ? 11.270  -20.988 -2.469  1.00 0.00 ?  285 PRO A CB   5  
ATOM 9661  C CG   . PRO A 1 72  ? 11.422  -19.479 -2.368  1.00 0.00 ?  285 PRO A CG   5  
ATOM 9662  C CD   . PRO A 1 72  ? 10.046  -18.858 -2.542  1.00 0.00 ?  285 PRO A CD   5  
ATOM 9663  H HA   . PRO A 1 72  ? 9.479   -21.965 -2.995  1.00 0.00 ?  285 PRO A HA   5  
ATOM 9664  H HB2  . PRO A 1 72  ? 11.826  -21.491 -1.679  1.00 0.00 ?  285 PRO A HB2  5  
ATOM 9665  H HB3  . PRO A 1 72  ? 11.659  -21.357 -3.418  1.00 0.00 ?  285 PRO A HB3  5  
ATOM 9666  H HG2  . PRO A 1 72  ? 11.847  -19.202 -1.403  1.00 0.00 ?  285 PRO A HG2  5  
ATOM 9667  H HG3  . PRO A 1 72  ? 12.106  -19.112 -3.134  1.00 0.00 ?  285 PRO A HG3  5  
ATOM 9668  H HD2  . PRO A 1 72  ? 9.790   -18.219 -1.696  1.00 0.00 ?  285 PRO A HD2  5  
ATOM 9669  H HD3  . PRO A 1 72  ? 10.002  -18.236 -3.436  1.00 0.00 ?  285 PRO A HD3  5  
ATOM 9670  N N    . ASN A 1 73  ? 8.463   -21.047 -0.340  1.00 0.00 ?  286 ASN A N    5  
ATOM 9671  C CA   . ASN A 1 73  ? 7.987   -21.414 0.982   1.00 0.00 ?  286 ASN A CA   5  
ATOM 9672  C C    . ASN A 1 73  ? 6.554   -20.909 1.162   1.00 0.00 ?  286 ASN A C    5  
ATOM 9673  O O    . ASN A 1 73  ? 6.132   -19.974 0.484   1.00 0.00 ?  286 ASN A O    5  
ATOM 9674  C CB   . ASN A 1 73  ? 8.851   -20.782 2.075   1.00 0.00 ?  286 ASN A CB   5  
ATOM 9675  C CG   . ASN A 1 73  ? 10.200  -21.495 2.189   1.00 0.00 ?  286 ASN A CG   5  
ATOM 9676  O OD1  . ASN A 1 73  ? 11.241  -20.973 1.824   1.00 0.00 ?  286 ASN A OD1  5  
ATOM 9677  N ND2  . ASN A 1 73  ? 10.124  -22.715 2.714   1.00 0.00 ?  286 ASN A ND2  5  
ATOM 9678  H H    . ASN A 1 73  ? 8.051   -20.221 -0.724  1.00 0.00 ?  286 ASN A H    5  
ATOM 9679  H HA   . ASN A 1 73  ? 8.054   -22.502 1.019   1.00 0.00 ?  286 ASN A HA   5  
ATOM 9680  H HB2  . ASN A 1 73  ? 9.012   -19.727 1.851   1.00 0.00 ?  286 ASN A HB2  5  
ATOM 9681  H HB3  . ASN A 1 73  ? 8.329   -20.829 3.030   1.00 0.00 ?  286 ASN A HB3  5  
ATOM 9682  H HD21 . ASN A 1 73  ? 9.238   -23.084 2.994   1.00 0.00 ?  286 ASN A HD21 5  
ATOM 9683  H HD22 . ASN A 1 73  ? 10.953  -23.262 2.830   1.00 0.00 ?  286 ASN A HD22 5  
ATOM 9684  N N    . PRO A 1 74  ? 5.826   -21.568 2.103   1.00 0.00 ?  287 PRO A N    5  
ATOM 9685  C CA   . PRO A 1 74  ? 4.449   -21.196 2.380   1.00 0.00 ?  287 PRO A CA   5  
ATOM 9686  C C    . PRO A 1 74  ? 4.384   -19.898 3.188   1.00 0.00 ?  287 PRO A C    5  
ATOM 9687  O O    . PRO A 1 74  ? 4.478   -19.921 4.415   1.00 0.00 ?  287 PRO A O    5  
ATOM 9688  C CB   . PRO A 1 74  ? 3.861   -22.386 3.120   1.00 0.00 ?  287 PRO A CB   5  
ATOM 9689  C CG   . PRO A 1 74  ? 5.047   -23.183 3.637   1.00 0.00 ?  287 PRO A CG   5  
ATOM 9690  C CD   . PRO A 1 74  ? 6.292   -22.681 2.925   1.00 0.00 ?  287 PRO A CD   5  
ATOM 9691  H HA   . PRO A 1 74  ? 3.961   -21.011 1.527   1.00 0.00 ?  287 PRO A HA   5  
ATOM 9692  H HB2  . PRO A 1 74  ? 3.222   -22.059 3.940   1.00 0.00 ?  287 PRO A HB2  5  
ATOM 9693  H HB3  . PRO A 1 74  ? 3.243   -22.992 2.456   1.00 0.00 ?  287 PRO A HB3  5  
ATOM 9694  H HG2  . PRO A 1 74  ? 5.148   -23.061 4.715   1.00 0.00 ?  287 PRO A HG2  5  
ATOM 9695  H HG3  . PRO A 1 74  ? 4.903   -24.247 3.449   1.00 0.00 ?  287 PRO A HG3  5  
ATOM 9696  H HD2  . PRO A 1 74  ? 7.052   -22.356 3.636   1.00 0.00 ?  287 PRO A HD2  5  
ATOM 9697  H HD3  . PRO A 1 74  ? 6.742   -23.463 2.314   1.00 0.00 ?  287 PRO A HD3  5  
ATOM 9698  N N    . VAL A 1 75  ? 4.224   -18.797 2.468   1.00 0.00 ?  288 VAL A N    5  
ATOM 9699  C CA   . VAL A 1 75  ? 4.145   -17.493 3.103   1.00 0.00 ?  288 VAL A CA   5  
ATOM 9700  C C    . VAL A 1 75  ? 2.678   -17.078 3.226   1.00 0.00 ?  288 VAL A C    5  
ATOM 9701  O O    . VAL A 1 75  ? 1.980   -16.949 2.221   1.00 0.00 ?  288 VAL A O    5  
ATOM 9702  C CB   . VAL A 1 75  ? 4.990   -16.481 2.326   1.00 0.00 ?  288 VAL A CB   5  
ATOM 9703  C CG1  . VAL A 1 75  ? 5.045   -15.138 3.057   1.00 0.00 ?  288 VAL A CG1  5  
ATOM 9704  C CG2  . VAL A 1 75  ? 6.397   -17.024 2.070   1.00 0.00 ?  288 VAL A CG2  5  
ATOM 9705  H H    . VAL A 1 75  ? 4.148   -18.788 1.471   1.00 0.00 ?  288 VAL A H    5  
ATOM 9706  H HA   . VAL A 1 75  ? 4.567   -17.588 4.104   1.00 0.00 ?  288 VAL A HA   5  
ATOM 9707  H HB   . VAL A 1 75  ? 4.513   -16.318 1.360   1.00 0.00 ?  288 VAL A HB   5  
ATOM 9708  H HG11 . VAL A 1 75  ? 6.006   -15.039 3.562   1.00 0.00 ?  288 VAL A HG11 5  
ATOM 9709  H HG12 . VAL A 1 75  ? 4.929   -14.328 2.337   1.00 0.00 ?  288 VAL A HG12 5  
ATOM 9710  H HG13 . VAL A 1 75  ? 4.241   -15.090 3.791   1.00 0.00 ?  288 VAL A HG13 5  
ATOM 9711  H HG21 . VAL A 1 75  ? 7.090   -16.595 2.793   1.00 0.00 ?  288 VAL A HG21 5  
ATOM 9712  H HG22 . VAL A 1 75  ? 6.392   -18.109 2.172   1.00 0.00 ?  288 VAL A HG22 5  
ATOM 9713  H HG23 . VAL A 1 75  ? 6.712   -16.755 1.061   1.00 0.00 ?  288 VAL A HG23 5  
ATOM 9714  N N    . GLU A 1 76  ? 2.253   -16.880 4.465   1.00 0.00 ?  289 GLU A N    5  
ATOM 9715  C CA   . GLU A 1 76  ? 0.881   -16.482 4.732   1.00 0.00 ?  289 GLU A CA   5  
ATOM 9716  C C    . GLU A 1 76  ? 0.853   -15.189 5.550   1.00 0.00 ?  289 GLU A C    5  
ATOM 9717  O O    . GLU A 1 76  ? 1.622   -15.033 6.497   1.00 0.00 ?  289 GLU A O    5  
ATOM 9718  C CB   . GLU A 1 76  ? 0.115   -17.599 5.444   1.00 0.00 ?  289 GLU A CB   5  
ATOM 9719  C CG   . GLU A 1 76  ? -0.451  -18.603 4.438   1.00 0.00 ?  289 GLU A CG   5  
ATOM 9720  C CD   . GLU A 1 76  ? -0.807  -19.924 5.123   1.00 0.00 ?  289 GLU A CD   5  
ATOM 9721  O OE1  . GLU A 1 76  ? -1.996  -20.228 5.303   1.00 0.00 ?  289 GLU A OE1  5  
ATOM 9722  O OE2  . GLU A 1 76  ? 0.203   -20.645 5.473   1.00 0.00 -1 289 GLU A OE2  5  
ATOM 9723  H H    . GLU A 1 76  ? 2.828   -16.987 5.277   1.00 0.00 ?  289 GLU A H    5  
ATOM 9724  H HA   . GLU A 1 76  ? 0.434   -16.310 3.753   1.00 0.00 ?  289 GLU A HA   5  
ATOM 9725  H HB2  . GLU A 1 76  ? 0.777   -18.111 6.141   1.00 0.00 ?  289 GLU A HB2  5  
ATOM 9726  H HB3  . GLU A 1 76  ? -0.696  -17.170 6.032   1.00 0.00 ?  289 GLU A HB3  5  
ATOM 9727  H HG2  . GLU A 1 76  ? -1.339  -18.185 3.963   1.00 0.00 ?  289 GLU A HG2  5  
ATOM 9728  H HG3  . GLU A 1 76  ? 0.278   -18.783 3.649   1.00 0.00 ?  289 GLU A HG3  5  
ATOM 9729  H HE2  . GLU A 1 76  ? 0.291   -20.651 6.470   1.00 0.00 ?  289 GLU A HE2  5  
ATOM 9730  N N    . LEU A 1 77  ? -0.041  -14.296 5.154   1.00 0.00 ?  290 LEU A N    5  
ATOM 9731  C CA   . LEU A 1 77  ? -0.180  -13.021 5.839   1.00 0.00 ?  290 LEU A CA   5  
ATOM 9732  C C    . LEU A 1 77  ? -1.557  -12.951 6.502   1.00 0.00 ?  290 LEU A C    5  
ATOM 9733  O O    . LEU A 1 77  ? -2.543  -13.433 5.946   1.00 0.00 ?  290 LEU A O    5  
ATOM 9734  C CB   . LEU A 1 77  ? 0.101   -11.864 4.878   1.00 0.00 ?  290 LEU A CB   5  
ATOM 9735  C CG   . LEU A 1 77  ? 1.538   -11.337 4.864   1.00 0.00 ?  290 LEU A CG   5  
ATOM 9736  C CD1  . LEU A 1 77  ? 1.911   -10.727 6.217   1.00 0.00 ?  290 LEU A CD1  5  
ATOM 9737  C CD2  . LEU A 1 77  ? 2.518   -12.431 4.438   1.00 0.00 ?  290 LEU A CD2  5  
ATOM 9738  H H    . LEU A 1 77  ? -0.662  -14.430 4.382   1.00 0.00 ?  290 LEU A H    5  
ATOM 9739  H HA   . LEU A 1 77  ? 0.581   -12.985 6.618   1.00 0.00 ?  290 LEU A HA   5  
ATOM 9740  H HB2  . LEU A 1 77  ? -0.158  -12.184 3.869   1.00 0.00 ?  290 LEU A HB2  5  
ATOM 9741  H HB3  . LEU A 1 77  ? -0.565  -11.039 5.131   1.00 0.00 ?  290 LEU A HB3  5  
ATOM 9742  H HG   . LEU A 1 77  ? 1.602   -10.540 4.123   1.00 0.00 ?  290 LEU A HG   5  
ATOM 9743  H HD11 . LEU A 1 77  ? 2.819   -10.133 6.109   1.00 0.00 ?  290 LEU A HD11 5  
ATOM 9744  H HD12 . LEU A 1 77  ? 1.099   -10.090 6.565   1.00 0.00 ?  290 LEU A HD12 5  
ATOM 9745  H HD13 . LEU A 1 77  ? 2.083   -11.525 6.940   1.00 0.00 ?  290 LEU A HD13 5  
ATOM 9746  H HD21 . LEU A 1 77  ? 2.375   -13.312 5.064   1.00 0.00 ?  290 LEU A HD21 5  
ATOM 9747  H HD22 . LEU A 1 77  ? 2.339   -12.694 3.396   1.00 0.00 ?  290 LEU A HD22 5  
ATOM 9748  H HD23 . LEU A 1 77  ? 3.540   -12.067 4.550   1.00 0.00 ?  290 LEU A HD23 5  
ATOM 9749  N N    . GLY A 1 78  ? -1.581  -12.346 7.680   1.00 0.00 ?  291 GLY A N    5  
ATOM 9750  C CA   . GLY A 1 78  ? -2.821  -12.206 8.425   1.00 0.00 ?  291 GLY A CA   5  
ATOM 9751  C C    . GLY A 1 78  ? -3.430  -10.818 8.219   1.00 0.00 ?  291 GLY A C    5  
ATOM 9752  O O    . GLY A 1 78  ? -3.041  -10.095 7.303   1.00 0.00 ?  291 GLY A O    5  
ATOM 9753  H H    . GLY A 1 78  ? -0.774  -11.957 8.125   1.00 0.00 ?  291 GLY A H    5  
ATOM 9754  H HA2  . GLY A 1 78  ? -3.529  -12.969 8.104   1.00 0.00 ?  291 GLY A HA2  5  
ATOM 9755  H HA3  . GLY A 1 78  ? -2.632  -12.371 9.485   1.00 0.00 ?  291 GLY A HA3  5  
ATOM 9756  N N    . PRO A 1 79  ? -4.401  -10.478 9.108   1.00 0.00 ?  292 PRO A N    5  
ATOM 9757  C CA   . PRO A 1 79  ? -5.068  -9.190  9.033   1.00 0.00 ?  292 PRO A CA   5  
ATOM 9758  C C    . PRO A 1 79  ? -4.158  -8.071  9.546   1.00 0.00 ?  292 PRO A C    5  
ATOM 9759  O O    . PRO A 1 79  ? -3.242  -8.320  10.328  1.00 0.00 ?  292 PRO A O    5  
ATOM 9760  C CB   . PRO A 1 79  ? -6.333  -9.353  9.860   1.00 0.00 ?  292 PRO A CB   5  
ATOM 9761  C CG   . PRO A 1 79  ? -6.099  -10.567 10.744  1.00 0.00 ?  292 PRO A CG   5  
ATOM 9762  C CD   . PRO A 1 79  ? -4.887  -11.309 10.206  1.00 0.00 ?  292 PRO A CD   5  
ATOM 9763  H HA   . PRO A 1 79  ? -5.274  -8.960  8.082   1.00 0.00 ?  292 PRO A HA   5  
ATOM 9764  H HB2  . PRO A 1 79  ? -6.524  -8.463  10.460  1.00 0.00 ?  292 PRO A HB2  5  
ATOM 9765  H HB3  . PRO A 1 79  ? -7.202  -9.498  9.219   1.00 0.00 ?  292 PRO A HB3  5  
ATOM 9766  H HG2  . PRO A 1 79  ? -5.932  -10.260 11.777  1.00 0.00 ?  292 PRO A HG2  5  
ATOM 9767  H HG3  . PRO A 1 79  ? -6.976  -11.215 10.742  1.00 0.00 ?  292 PRO A HG3  5  
ATOM 9768  H HD2  . PRO A 1 79  ? -4.125  -11.435 10.976  1.00 0.00 ?  292 PRO A HD2  5  
ATOM 9769  H HD3  . PRO A 1 79  ? -5.156  -12.307 9.858   1.00 0.00 ?  292 PRO A HD3  5  
ATOM 9770  N N    . GLY A 1 80  ? -4.443  -6.862  9.084   1.00 0.00 ?  293 GLY A N    5  
ATOM 9771  C CA   . GLY A 1 80  ? -3.663  -5.704  9.486   1.00 0.00 ?  293 GLY A CA   5  
ATOM 9772  C C    . GLY A 1 80  ? -2.327  -5.658  8.741   1.00 0.00 ?  293 GLY A C    5  
ATOM 9773  O O    . GLY A 1 80  ? -1.511  -4.768  8.977   1.00 0.00 ?  293 GLY A O    5  
ATOM 9774  H H    . GLY A 1 80  ? -5.190  -6.668  8.448   1.00 0.00 ?  293 GLY A H    5  
ATOM 9775  H HA2  . GLY A 1 80  ? -4.227  -4.794  9.286   1.00 0.00 ?  293 GLY A HA2  5  
ATOM 9776  H HA3  . GLY A 1 80  ? -3.482  -5.738  10.560  1.00 0.00 ?  293 GLY A HA3  5  
ATOM 9777  N N    . ALA A 1 81  ? -2.146  -6.627  7.856   1.00 0.00 ?  294 ALA A N    5  
ATOM 9778  C CA   . ALA A 1 81  ? -0.924  -6.708  7.075   1.00 0.00 ?  294 ALA A CA   5  
ATOM 9779  C C    . ALA A 1 81  ? -1.078  -5.868  5.805   1.00 0.00 ?  294 ALA A C    5  
ATOM 9780  O O    . ALA A 1 81  ? -2.115  -5.919  5.145   1.00 0.00 ?  294 ALA A O    5  
ATOM 9781  C CB   . ALA A 1 81  ? -0.609  -8.174  6.768   1.00 0.00 ?  294 ALA A CB   5  
ATOM 9782  H H    . ALA A 1 81  ? -2.815  -7.347  7.670   1.00 0.00 ?  294 ALA A H    5  
ATOM 9783  H HA   . ALA A 1 81  ? -0.116  -6.295  7.678   1.00 0.00 ?  294 ALA A HA   5  
ATOM 9784  H HB1  . ALA A 1 81  ? -1.386  -8.585  6.123   1.00 0.00 ?  294 ALA A HB1  5  
ATOM 9785  H HB2  . ALA A 1 81  ? 0.355   -8.241  6.265   1.00 0.00 ?  294 ALA A HB2  5  
ATOM 9786  H HB3  . ALA A 1 81  ? -0.573  -8.740  7.699   1.00 0.00 ?  294 ALA A HB3  5  
ATOM 9787  N N    . PHE A 1 82  ? -0.032  -5.114  5.502   1.00 0.00 ?  295 PHE A N    5  
ATOM 9788  C CA   . PHE A 1 82  ? -0.038  -4.263  4.324   1.00 0.00 ?  295 PHE A CA   5  
ATOM 9789  C C    . PHE A 1 82  ? 1.147   -4.583  3.411   1.00 0.00 ?  295 PHE A C    5  
ATOM 9790  O O    . PHE A 1 82  ? 2.182   -5.058  3.875   1.00 0.00 ?  295 PHE A O    5  
ATOM 9791  C CB   . PHE A 1 82  ? 0.086   -2.819  4.814   1.00 0.00 ?  295 PHE A CB   5  
ATOM 9792  C CG   . PHE A 1 82  ? 0.864   -2.671  6.123   1.00 0.00 ?  295 PHE A CG   5  
ATOM 9793  C CD1  . PHE A 1 82  ? 0.220   -2.792  7.315   1.00 0.00 ?  295 PHE A CD1  5  
ATOM 9794  C CD2  . PHE A 1 82  ? 2.200   -2.418  6.095   1.00 0.00 ?  295 PHE A CD2  5  
ATOM 9795  C CE1  . PHE A 1 82  ? 0.942   -2.654  8.530   1.00 0.00 ?  295 PHE A CE1  5  
ATOM 9796  C CE2  . PHE A 1 82  ? 2.922   -2.281  7.310   1.00 0.00 ?  295 PHE A CE2  5  
ATOM 9797  C CZ   . PHE A 1 82  ? 2.278   -2.402  8.502   1.00 0.00 ?  295 PHE A CZ   5  
ATOM 9798  H H    . PHE A 1 82  ? 0.808   -5.078  6.045   1.00 0.00 ?  295 PHE A H    5  
ATOM 9799  H HA   . PHE A 1 82  ? -0.969  -4.457  3.791   1.00 0.00 ?  295 PHE A HA   5  
ATOM 9800  H HB2  . PHE A 1 82  ? 0.577   -2.225  4.043   1.00 0.00 ?  295 PHE A HB2  5  
ATOM 9801  H HB3  . PHE A 1 82  ? -0.913  -2.405  4.948   1.00 0.00 ?  295 PHE A HB3  5  
ATOM 9802  H HD1  . PHE A 1 82  ? -0.851  -2.994  7.337   1.00 0.00 ?  295 PHE A HD1  5  
ATOM 9803  H HD2  . PHE A 1 82  ? 2.717   -2.322  5.140   1.00 0.00 ?  295 PHE A HD2  5  
ATOM 9804  H HE1  . PHE A 1 82  ? 0.425   -2.751  9.485   1.00 0.00 ?  295 PHE A HE1  5  
ATOM 9805  H HE2  . PHE A 1 82  ? 3.993   -2.079  7.288   1.00 0.00 ?  295 PHE A HE2  5  
ATOM 9806  H HZ   . PHE A 1 82  ? 2.832   -2.296  9.434   1.00 0.00 ?  295 PHE A HZ   5  
ATOM 9807  N N    . PHE A 1 83  ? 0.955   -4.310  2.128   1.00 0.00 ?  296 PHE A N    5  
ATOM 9808  C CA   . PHE A 1 83  ? 1.995   -4.563  1.146   1.00 0.00 ?  296 PHE A CA   5  
ATOM 9809  C C    . PHE A 1 83  ? 1.712   -3.812  -0.157  1.00 0.00 ?  296 PHE A C    5  
ATOM 9810  O O    . PHE A 1 83  ? 0.560   -3.685  -0.567  1.00 0.00 ?  296 PHE A O    5  
ATOM 9811  C CB   . PHE A 1 83  ? 1.989   -6.067  0.865   1.00 0.00 ?  296 PHE A CB   5  
ATOM 9812  C CG   . PHE A 1 83  ? 0.653   -6.597  0.343   1.00 0.00 ?  296 PHE A CG   5  
ATOM 9813  C CD1  . PHE A 1 83  ? 0.408   -6.625  -0.994  1.00 0.00 ?  296 PHE A CD1  5  
ATOM 9814  C CD2  . PHE A 1 83  ? -0.290  -7.042  1.216   1.00 0.00 ?  296 PHE A CD2  5  
ATOM 9815  C CE1  . PHE A 1 83  ? -0.832  -7.117  -1.479  1.00 0.00 ?  296 PHE A CE1  5  
ATOM 9816  C CE2  . PHE A 1 83  ? -1.531  -7.534  0.732   1.00 0.00 ?  296 PHE A CE2  5  
ATOM 9817  C CZ   . PHE A 1 83  ? -1.776  -7.562  -0.606  1.00 0.00 ?  296 PHE A CZ   5  
ATOM 9818  H H    . PHE A 1 83  ? 0.110   -3.924  1.759   1.00 0.00 ?  296 PHE A H    5  
ATOM 9819  H HA   . PHE A 1 83  ? 2.934   -4.209  1.571   1.00 0.00 ?  296 PHE A HA   5  
ATOM 9820  H HB2  . PHE A 1 83  ? 2.768   -6.293  0.137   1.00 0.00 ?  296 PHE A HB2  5  
ATOM 9821  H HB3  . PHE A 1 83  ? 2.246   -6.598  1.782   1.00 0.00 ?  296 PHE A HB3  5  
ATOM 9822  H HD1  . PHE A 1 83  ? 1.164   -6.269  -1.694  1.00 0.00 ?  296 PHE A HD1  5  
ATOM 9823  H HD2  . PHE A 1 83  ? -0.094  -7.020  2.288   1.00 0.00 ?  296 PHE A HD2  5  
ATOM 9824  H HE1  . PHE A 1 83  ? -1.029  -7.140  -2.551  1.00 0.00 ?  296 PHE A HE1  5  
ATOM 9825  H HE2  . PHE A 1 83  ? -2.287  -7.890  1.431   1.00 0.00 ?  296 PHE A HE2  5  
ATOM 9826  H HZ   . PHE A 1 83  ? -2.728  -7.940  -0.978  1.00 0.00 ?  296 PHE A HZ   5  
ATOM 9827  N N    . GLY A 1 84  ? 2.785   -3.334  -0.772  1.00 0.00 ?  297 GLY A N    5  
ATOM 9828  C CA   . GLY A 1 84  ? 2.666   -2.600  -2.020  1.00 0.00 ?  297 GLY A CA   5  
ATOM 9829  C C    . GLY A 1 84  ? 3.584   -1.375  -2.024  1.00 0.00 ?  297 GLY A C    5  
ATOM 9830  O O    . GLY A 1 84  ? 3.824   -0.779  -3.073  1.00 0.00 ?  297 GLY A O    5  
ATOM 9831  H H    . GLY A 1 84  ? 3.719   -3.442  -0.432  1.00 0.00 ?  297 GLY A H    5  
ATOM 9832  H HA2  . GLY A 1 84  ? 2.921   -3.252  -2.856  1.00 0.00 ?  297 GLY A HA2  5  
ATOM 9833  H HA3  . GLY A 1 84  ? 1.633   -2.285  -2.164  1.00 0.00 ?  297 GLY A HA3  5  
ATOM 9834  N N    . GLU A 1 85  ? 4.071   -1.036  -0.840  1.00 0.00 ?  298 GLU A N    5  
ATOM 9835  C CA   . GLU A 1 85  ? 4.956   0.106   -0.694  1.00 0.00 ?  298 GLU A CA   5  
ATOM 9836  C C    . GLU A 1 85  ? 6.129   -0.003  -1.670  1.00 0.00 ?  298 GLU A C    5  
ATOM 9837  O O    . GLU A 1 85  ? 6.493   0.976   -2.320  1.00 0.00 ?  298 GLU A O    5  
ATOM 9838  C CB   . GLU A 1 85  ? 5.453   0.234   0.748   1.00 0.00 ?  298 GLU A CB   5  
ATOM 9839  C CG   . GLU A 1 85  ? 6.186   -1.034  1.190   1.00 0.00 ?  298 GLU A CG   5  
ATOM 9840  C CD   . GLU A 1 85  ? 6.621   -0.935  2.653   1.00 0.00 ?  298 GLU A CD   5  
ATOM 9841  O OE1  . GLU A 1 85  ? 7.733   -0.467  2.939   1.00 0.00 ?  298 GLU A OE1  5  
ATOM 9842  O OE2  . GLU A 1 85  ? 5.756   -1.363  3.509   1.00 0.00 -1 298 GLU A OE2  5  
ATOM 9843  H H    . GLU A 1 85  ? 3.870   -1.527  0.009   1.00 0.00 ?  298 GLU A H    5  
ATOM 9844  H HA   . GLU A 1 85  ? 4.349   0.977   -0.940  1.00 0.00 ?  298 GLU A HA   5  
ATOM 9845  H HB2  . GLU A 1 85  ? 6.121   1.092   0.831   1.00 0.00 ?  298 GLU A HB2  5  
ATOM 9846  H HB3  . GLU A 1 85  ? 4.610   0.421   1.412   1.00 0.00 ?  298 GLU A HB3  5  
ATOM 9847  H HG2  . GLU A 1 85  ? 5.536   -1.899  1.058   1.00 0.00 ?  298 GLU A HG2  5  
ATOM 9848  H HG3  . GLU A 1 85  ? 7.060   -1.193  0.557   1.00 0.00 ?  298 GLU A HG3  5  
ATOM 9849  H HE2  . GLU A 1 85  ? 6.079   -2.213  3.926   1.00 0.00 ?  298 GLU A HE2  5  
ATOM 9850  N N    . MET A 1 86  ? 6.688   -1.202  -1.743  1.00 0.00 ?  299 MET A N    5  
ATOM 9851  C CA   . MET A 1 86  ? 7.812   -1.451  -2.630  1.00 0.00 ?  299 MET A CA   5  
ATOM 9852  C C    . MET A 1 86  ? 7.544   -0.887  -4.026  1.00 0.00 ?  299 MET A C    5  
ATOM 9853  O O    . MET A 1 86  ? 8.445   -0.343  -4.663  1.00 0.00 ?  299 MET A O    5  
ATOM 9854  C CB   . MET A 1 86  ? 8.061   -2.958  -2.726  1.00 0.00 ?  299 MET A CB   5  
ATOM 9855  C CG   . MET A 1 86  ? 9.428   -3.325  -2.146  1.00 0.00 ?  299 MET A CG   5  
ATOM 9856  S SD   . MET A 1 86  ? 9.378   -3.243  -0.364  1.00 0.00 ?  299 MET A SD   5  
ATOM 9857  C CE   . MET A 1 86  ? 10.375  -1.787  -0.093  1.00 0.00 ?  299 MET A CE   5  
ATOM 9858  H H    . MET A 1 86  ? 6.385   -1.993  -1.211  1.00 0.00 ?  299 MET A H    5  
ATOM 9859  H HA   . MET A 1 86  ? 8.660   -0.937  -2.179  1.00 0.00 ?  299 MET A HA   5  
ATOM 9860  H HB2  . MET A 1 86  ? 7.278   -3.495  -2.191  1.00 0.00 ?  299 MET A HB2  5  
ATOM 9861  H HB3  . MET A 1 86  ? 8.008   -3.273  -3.768  1.00 0.00 ?  299 MET A HB3  5  
ATOM 9862  H HG2  . MET A 1 86  ? 9.709   -4.329  -2.464  1.00 0.00 ?  299 MET A HG2  5  
ATOM 9863  H HG3  . MET A 1 86  ? 10.190  -2.645  -2.529  1.00 0.00 ?  299 MET A HG3  5  
ATOM 9864  H HE1  . MET A 1 86  ? 10.704  -1.389  -1.052  1.00 0.00 ?  299 MET A HE1  5  
ATOM 9865  H HE2  . MET A 1 86  ? 9.784   -1.034  0.430   1.00 0.00 ?  299 MET A HE2  5  
ATOM 9866  H HE3  . MET A 1 86  ? 11.244  -2.050  0.510   1.00 0.00 ?  299 MET A HE3  5  
ATOM 9867  N N    . ALA A 1 87  ? 6.302   -1.037  -4.462  1.00 0.00 ?  300 ALA A N    5  
ATOM 9868  C CA   . ALA A 1 87  ? 5.904   -0.549  -5.772  1.00 0.00 ?  300 ALA A CA   5  
ATOM 9869  C C    . ALA A 1 87  ? 5.824   0.978   -5.740  1.00 0.00 ?  300 ALA A C    5  
ATOM 9870  O O    . ALA A 1 87  ? 6.177   1.642   -6.713  1.00 0.00 ?  300 ALA A O    5  
ATOM 9871  C CB   . ALA A 1 87  ? 4.577   -1.194  -6.176  1.00 0.00 ?  300 ALA A CB   5  
ATOM 9872  H H    . ALA A 1 87  ? 5.575   -1.481  -3.938  1.00 0.00 ?  300 ALA A H    5  
ATOM 9873  H HA   . ALA A 1 87  ? 6.672   -0.850  -6.485  1.00 0.00 ?  300 ALA A HA   5  
ATOM 9874  H HB1  . ALA A 1 87  ? 3.906   -1.213  -5.317  1.00 0.00 ?  300 ALA A HB1  5  
ATOM 9875  H HB2  . ALA A 1 87  ? 4.121   -0.616  -6.980  1.00 0.00 ?  300 ALA A HB2  5  
ATOM 9876  H HB3  . ALA A 1 87  ? 4.757   -2.213  -6.518  1.00 0.00 ?  300 ALA A HB3  5  
ATOM 9877  N N    . LEU A 1 88  ? 5.358   1.491   -4.611  1.00 0.00 ?  301 LEU A N    5  
ATOM 9878  C CA   . LEU A 1 88  ? 5.228   2.928   -4.439  1.00 0.00 ?  301 LEU A CA   5  
ATOM 9879  C C    . LEU A 1 88  ? 6.607   3.533   -4.173  1.00 0.00 ?  301 LEU A C    5  
ATOM 9880  O O    . LEU A 1 88  ? 6.750   4.753   -4.098  1.00 0.00 ?  301 LEU A O    5  
ATOM 9881  C CB   . LEU A 1 88  ? 4.197   3.247   -3.354  1.00 0.00 ?  301 LEU A CB   5  
ATOM 9882  C CG   . LEU A 1 88  ? 2.732   3.018   -3.732  1.00 0.00 ?  301 LEU A CG   5  
ATOM 9883  C CD1  . LEU A 1 88  ? 1.940   2.463   -2.546  1.00 0.00 ?  301 LEU A CD1  5  
ATOM 9884  C CD2  . LEU A 1 88  ? 2.105   4.296   -4.293  1.00 0.00 ?  301 LEU A CD2  5  
ATOM 9885  H H    . LEU A 1 88  ? 5.073   0.944   -3.823  1.00 0.00 ?  301 LEU A H    5  
ATOM 9886  H HA   . LEU A 1 88  ? 4.846   3.336   -5.375  1.00 0.00 ?  301 LEU A HA   5  
ATOM 9887  H HB2  . LEU A 1 88  ? 4.424   2.641   -2.476  1.00 0.00 ?  301 LEU A HB2  5  
ATOM 9888  H HB3  . LEU A 1 88  ? 4.318   4.290   -3.061  1.00 0.00 ?  301 LEU A HB3  5  
ATOM 9889  H HG   . LEU A 1 88  ? 2.696   2.268   -4.522  1.00 0.00 ?  301 LEU A HG   5  
ATOM 9890  H HD11 . LEU A 1 88  ? 2.329   2.887   -1.619  1.00 0.00 ?  301 LEU A HD11 5  
ATOM 9891  H HD12 . LEU A 1 88  ? 0.889   2.730   -2.654  1.00 0.00 ?  301 LEU A HD12 5  
ATOM 9892  H HD13 . LEU A 1 88  ? 2.039   1.378   -2.519  1.00 0.00 ?  301 LEU A HD13 5  
ATOM 9893  H HD21 . LEU A 1 88  ? 1.037   4.139   -4.445  1.00 0.00 ?  301 LEU A HD21 5  
ATOM 9894  H HD22 . LEU A 1 88  ? 2.256   5.114   -3.589  1.00 0.00 ?  301 LEU A HD22 5  
ATOM 9895  H HD23 . LEU A 1 88  ? 2.575   4.544   -5.244  1.00 0.00 ?  301 LEU A HD23 5  
ATOM 9896  N N    . ILE A 1 89  ? 7.589   2.653   -4.040  1.00 0.00 ?  302 ILE A N    5  
ATOM 9897  C CA   . ILE A 1 89  ? 8.952   3.085   -3.784  1.00 0.00 ?  302 ILE A CA   5  
ATOM 9898  C C    . ILE A 1 89  ? 9.687   3.253   -5.116  1.00 0.00 ?  302 ILE A C    5  
ATOM 9899  O O    . ILE A 1 89  ? 10.289  4.296   -5.370  1.00 0.00 ?  302 ILE A O    5  
ATOM 9900  C CB   . ILE A 1 89  ? 9.646   2.125   -2.816  1.00 0.00 ?  302 ILE A CB   5  
ATOM 9901  C CG1  . ILE A 1 89  ? 9.188   2.372   -1.377  1.00 0.00 ?  302 ILE A CG1  5  
ATOM 9902  C CG2  . ILE A 1 89  ? 11.167  2.210   -2.956  1.00 0.00 ?  302 ILE A CG2  5  
ATOM 9903  C CD1  . ILE A 1 89  ? 9.872   1.403   -0.410  1.00 0.00 ?  302 ILE A CD1  5  
ATOM 9904  H H    . ILE A 1 89  ? 7.464   1.663   -4.103  1.00 0.00 ?  302 ILE A H    5  
ATOM 9905  H HA   . ILE A 1 89  ? 8.900   4.057   -3.293  1.00 0.00 ?  302 ILE A HA   5  
ATOM 9906  H HB   . ILE A 1 89  ? 9.355   1.108   -3.076  1.00 0.00 ?  302 ILE A HB   5  
ATOM 9907  H HG12 . ILE A 1 89  ? 9.416   3.399   -1.090  1.00 0.00 ?  302 ILE A HG12 5  
ATOM 9908  H HG13 . ILE A 1 89  ? 8.107   2.255   -1.310  1.00 0.00 ?  302 ILE A HG13 5  
ATOM 9909  H HG21 . ILE A 1 89  ? 11.441  3.183   -3.364  1.00 0.00 ?  302 ILE A HG21 5  
ATOM 9910  H HG22 . ILE A 1 89  ? 11.630  2.084   -1.977  1.00 0.00 ?  302 ILE A HG22 5  
ATOM 9911  H HG23 . ILE A 1 89  ? 11.515  1.423   -3.626  1.00 0.00 ?  302 ILE A HG23 5  
ATOM 9912  H HD11 . ILE A 1 89  ? 10.669  1.923   0.122   1.00 0.00 ?  302 ILE A HD11 5  
ATOM 9913  H HD12 . ILE A 1 89  ? 9.141   1.028   0.306   1.00 0.00 ?  302 ILE A HD12 5  
ATOM 9914  H HD13 . ILE A 1 89  ? 10.294  0.569   -0.970  1.00 0.00 ?  302 ILE A HD13 5  
ATOM 9915  N N    . SER A 1 90  ? 9.614   2.211   -5.931  1.00 0.00 ?  303 SER A N    5  
ATOM 9916  C CA   . SER A 1 90  ? 10.265  2.231   -7.230  1.00 0.00 ?  303 SER A CA   5  
ATOM 9917  C C    . SER A 1 90  ? 9.515   1.320   -8.204  1.00 0.00 ?  303 SER A C    5  
ATOM 9918  O O    . SER A 1 90  ? 10.134  0.598   -8.985  1.00 0.00 ?  303 SER A O    5  
ATOM 9919  C CB   . SER A 1 90  ? 11.729  1.799   -7.119  1.00 0.00 ?  303 SER A CB   5  
ATOM 9920  O OG   . SER A 1 90  ? 12.602  2.912   -6.950  1.00 0.00 ?  303 SER A OG   5  
ATOM 9921  H H    . SER A 1 90  ? 9.123   1.367   -5.717  1.00 0.00 ?  303 SER A H    5  
ATOM 9922  H HA   . SER A 1 90  ? 10.217  3.268   -7.562  1.00 0.00 ?  303 SER A HA   5  
ATOM 9923  H HB2  . SER A 1 90  ? 11.843  1.118   -6.276  1.00 0.00 ?  303 SER A HB2  5  
ATOM 9924  H HB3  . SER A 1 90  ? 12.013  1.247   -8.015  1.00 0.00 ?  303 SER A HB3  5  
ATOM 9925  H HG   . SER A 1 90  ? 12.773  3.350   -7.833  1.00 0.00 ?  303 SER A HG   5  
ATOM 9926  N N    . GLY A 1 91  ? 8.194   1.383   -8.127  1.00 0.00 ?  304 GLY A N    5  
ATOM 9927  C CA   . GLY A 1 91  ? 7.354   0.573   -8.992  1.00 0.00 ?  304 GLY A CA   5  
ATOM 9928  C C    . GLY A 1 91  ? 7.999   -0.787  -9.265  1.00 0.00 ?  304 GLY A C    5  
ATOM 9929  O O    . GLY A 1 91  ? 7.940   -1.292  -10.385 1.00 0.00 ?  304 GLY A O    5  
ATOM 9930  H H    . GLY A 1 91  ? 7.699   1.973   -7.489  1.00 0.00 ?  304 GLY A H    5  
ATOM 9931  H HA2  . GLY A 1 91  ? 6.378   0.431   -8.528  1.00 0.00 ?  304 GLY A HA2  5  
ATOM 9932  H HA3  . GLY A 1 91  ? 7.186   1.095   -9.934  1.00 0.00 ?  304 GLY A HA3  5  
ATOM 9933  N N    . GLU A 1 92  ? 8.599   -1.342  -8.222  1.00 0.00 ?  305 GLU A N    5  
ATOM 9934  C CA   . GLU A 1 92  ? 9.254   -2.634  -8.335  1.00 0.00 ?  305 GLU A CA   5  
ATOM 9935  C C    . GLU A 1 92  ? 8.217   -3.737  -8.559  1.00 0.00 ?  305 GLU A C    5  
ATOM 9936  O O    . GLU A 1 92  ? 7.076   -3.619  -8.116  1.00 0.00 ?  305 GLU A O    5  
ATOM 9937  C CB   . GLU A 1 92  ? 10.108  -2.926  -7.100  1.00 0.00 ?  305 GLU A CB   5  
ATOM 9938  C CG   . GLU A 1 92  ? 9.229   -3.190  -5.876  1.00 0.00 ?  305 GLU A CG   5  
ATOM 9939  C CD   . GLU A 1 92  ? 9.724   -4.411  -5.098  1.00 0.00 ?  305 GLU A CD   5  
ATOM 9940  O OE1  . GLU A 1 92  ? 8.941   -5.333  -4.827  1.00 0.00 ?  305 GLU A OE1  5  
ATOM 9941  O OE2  . GLU A 1 92  ? 10.973  -4.381  -4.774  1.00 0.00 -1 305 GLU A OE2  5  
ATOM 9942  H H    . GLU A 1 92  ? 8.642   -0.924  -7.315  1.00 0.00 ?  305 GLU A H    5  
ATOM 9943  H HA   . GLU A 1 92  ? 9.903   -2.554  -9.207  1.00 0.00 ?  305 GLU A HA   5  
ATOM 9944  H HB2  . GLU A 1 92  ? 10.743  -3.791  -7.289  1.00 0.00 ?  305 GLU A HB2  5  
ATOM 9945  H HB3  . GLU A 1 92  ? 10.769  -2.082  -6.902  1.00 0.00 ?  305 GLU A HB3  5  
ATOM 9946  H HG2  . GLU A 1 92  ? 9.231   -2.314  -5.226  1.00 0.00 ?  305 GLU A HG2  5  
ATOM 9947  H HG3  . GLU A 1 92  ? 8.198   -3.349  -6.192  1.00 0.00 ?  305 GLU A HG3  5  
ATOM 9948  H HE2  . GLU A 1 92  ? 11.167  -3.560  -4.237  1.00 0.00 ?  305 GLU A HE2  5  
ATOM 9949  N N    . PRO A 1 93  ? 8.663   -4.811  -9.264  1.00 0.00 ?  306 PRO A N    5  
ATOM 9950  C CA   . PRO A 1 93  ? 7.787   -5.934  -9.551  1.00 0.00 ?  306 PRO A CA   5  
ATOM 9951  C C    . PRO A 1 93  ? 7.574   -6.796  -8.306  1.00 0.00 ?  306 PRO A C    5  
ATOM 9952  O O    . PRO A 1 93  ? 8.532   -7.146  -7.617  1.00 0.00 ?  306 PRO A O    5  
ATOM 9953  C CB   . PRO A 1 93  ? 8.468   -6.684  -10.684 1.00 0.00 ?  306 PRO A CB   5  
ATOM 9954  C CG   . PRO A 1 93  ? 9.917   -6.226  -10.676 1.00 0.00 ?  306 PRO A CG   5  
ATOM 9955  C CD   . PRO A 1 93  ? 10.009  -4.984  -9.804  1.00 0.00 ?  306 PRO A CD   5  
ATOM 9956  H HA   . PRO A 1 93  ? 6.880   -5.607  -9.816  1.00 0.00 ?  306 PRO A HA   5  
ATOM 9957  H HB2  . PRO A 1 93  ? 8.399   -7.762  -10.536 1.00 0.00 ?  306 PRO A HB2  5  
ATOM 9958  H HB3  . PRO A 1 93  ? 7.994   -6.462  -11.640 1.00 0.00 ?  306 PRO A HB3  5  
ATOM 9959  H HG2  . PRO A 1 93  ? 10.564  -7.013  -10.288 1.00 0.00 ?  306 PRO A HG2  5  
ATOM 9960  H HG3  . PRO A 1 93  ? 10.254  -6.006  -11.689 1.00 0.00 ?  306 PRO A HG3  5  
ATOM 9961  H HD2  . PRO A 1 93  ? 10.742  -5.112  -9.008  1.00 0.00 ?  306 PRO A HD2  5  
ATOM 9962  H HD3  . PRO A 1 93  ? 10.317  -4.114  -10.384 1.00 0.00 ?  306 PRO A HD3  5  
ATOM 9963  N N    . ARG A 1 94  ? 6.314   -7.114  -8.053  1.00 0.00 ?  307 ARG A N    5  
ATOM 9964  C CA   . ARG A 1 94  ? 5.963   -7.929  -6.903  1.00 0.00 ?  307 ARG A CA   5  
ATOM 9965  C C    . ARG A 1 94  ? 6.922   -9.115  -6.780  1.00 0.00 ?  307 ARG A C    5  
ATOM 9966  O O    . ARG A 1 94  ? 7.401   -9.421  -5.689  1.00 0.00 ?  307 ARG A O    5  
ATOM 9967  C CB   . ARG A 1 94  ? 4.529   -8.452  -7.014  1.00 0.00 ?  307 ARG A CB   5  
ATOM 9968  C CG   . ARG A 1 94  ? 3.520   -7.303  -6.946  1.00 0.00 ?  307 ARG A CG   5  
ATOM 9969  C CD   . ARG A 1 94  ? 3.071   -7.052  -5.505  1.00 0.00 ?  307 ARG A CD   5  
ATOM 9970  N NE   . ARG A 1 94  ? 3.934   -6.027  -4.877  1.00 0.00 ?  307 ARG A NE   5  
ATOM 9971  C CZ   . ARG A 1 94  ? 3.709   -4.708  -4.952  1.00 0.00 ?  307 ARG A CZ   5  
ATOM 9972  N NH1  . ARG A 1 94  ? 2.648   -4.246  -5.627  1.00 0.00 ?  307 ARG A NH1  5  
ATOM 9973  N NH2  . ARG A 1 94  ? 4.545   -3.851  -4.351  1.00 0.00 1  307 ARG A NH2  5  
ATOM 9974  H H    . ARG A 1 94  ? 5.540   -6.826  -8.618  1.00 0.00 ?  307 ARG A H    5  
ATOM 9975  H HA   . ARG A 1 94  ? 6.056   -7.259  -6.048  1.00 0.00 ?  307 ARG A HA   5  
ATOM 9976  H HB2  . ARG A 1 94  ? 4.407   -8.993  -7.952  1.00 0.00 ?  307 ARG A HB2  5  
ATOM 9977  H HB3  . ARG A 1 94  ? 4.333   -9.161  -6.209  1.00 0.00 ?  307 ARG A HB3  5  
ATOM 9978  H HG2  . ARG A 1 94  ? 3.968   -6.397  -7.354  1.00 0.00 ?  307 ARG A HG2  5  
ATOM 9979  H HG3  . ARG A 1 94  ? 2.655   -7.538  -7.565  1.00 0.00 ?  307 ARG A HG3  5  
ATOM 9980  H HD2  . ARG A 1 94  ? 2.032   -6.723  -5.492  1.00 0.00 ?  307 ARG A HD2  5  
ATOM 9981  H HD3  . ARG A 1 94  ? 3.119   -7.979  -4.934  1.00 0.00 ?  307 ARG A HD3  5  
ATOM 9982  H HE   . ARG A 1 94  ? 4.735   -6.338  -4.366  1.00 0.00 ?  307 ARG A HE   5  
ATOM 9983  H HH11 . ARG A 1 94  ? 2.023   -4.886  -6.075  1.00 0.00 ?  307 ARG A HH11 5  
ATOM 9984  H HH12 . ARG A 1 94  ? 2.480   -3.262  -5.683  1.00 0.00 ?  307 ARG A HH12 5  
ATOM 9985  H HH21 . ARG A 1 94  ? 5.338   -4.195  -3.847  1.00 0.00 ?  307 ARG A HH21 5  
ATOM 9986  H HH22 . ARG A 1 94  ? 4.378   -2.866  -4.406  1.00 0.00 ?  307 ARG A HH22 5  
ATOM 9987  N N    . SER A 1 95  ? 7.175   -9.750  -7.915  1.00 0.00 ?  308 SER A N    5  
ATOM 9988  C CA   . SER A 1 95  ? 8.069   -10.896 -7.948  1.00 0.00 ?  308 SER A CA   5  
ATOM 9989  C C    . SER A 1 95  ? 7.455   -12.061 -7.169  1.00 0.00 ?  308 SER A C    5  
ATOM 9990  O O    . SER A 1 95  ? 8.164   -12.793 -6.479  1.00 0.00 ?  308 SER A O    5  
ATOM 9991  C CB   . SER A 1 95  ? 9.442   -10.539 -7.375  1.00 0.00 ?  308 SER A CB   5  
ATOM 9992  O OG   . SER A 1 95  ? 10.471  -10.635 -8.357  1.00 0.00 ?  308 SER A OG   5  
ATOM 9993  H H    . SER A 1 95  ? 6.782   -9.495  -8.798  1.00 0.00 ?  308 SER A H    5  
ATOM 9994  H HA   . SER A 1 95  ? 8.171   -11.152 -9.002  1.00 0.00 ?  308 SER A HA   5  
ATOM 9995  H HB2  . SER A 1 95  ? 9.416   -9.526  -6.975  1.00 0.00 ?  308 SER A HB2  5  
ATOM 9996  H HB3  . SER A 1 95  ? 9.672   -11.205 -6.543  1.00 0.00 ?  308 SER A HB3  5  
ATOM 9997  H HG   . SER A 1 95  ? 10.317  -11.435 -8.937  1.00 0.00 ?  308 SER A HG   5  
ATOM 9998  N N    . ALA A 1 96  ? 6.144   -12.197 -7.306  1.00 0.00 ?  309 ALA A N    5  
ATOM 9999  C CA   . ALA A 1 96  ? 5.428   -13.261 -6.624  1.00 0.00 ?  309 ALA A CA   5  
ATOM 10000 C C    . ALA A 1 96  ? 3.922   -13.050 -6.798  1.00 0.00 ?  309 ALA A C    5  
ATOM 10001 O O    . ALA A 1 96  ? 3.480   -11.947 -7.117  1.00 0.00 ?  309 ALA A O    5  
ATOM 10002 C CB   . ALA A 1 96  ? 5.845   -13.297 -5.152  1.00 0.00 ?  309 ALA A CB   5  
ATOM 10003 H H    . ALA A 1 96  ? 5.575   -11.598 -7.869  1.00 0.00 ?  309 ALA A H    5  
ATOM 10004 H HA   . ALA A 1 96  ? 5.710   -14.205 -7.091  1.00 0.00 ?  309 ALA A HA   5  
ATOM 10005 H HB1  . ALA A 1 96  ? 6.418   -14.204 -4.959  1.00 0.00 ?  309 ALA A HB1  5  
ATOM 10006 H HB2  . ALA A 1 96  ? 6.459   -12.425 -4.928  1.00 0.00 ?  309 ALA A HB2  5  
ATOM 10007 H HB3  . ALA A 1 96  ? 4.956   -13.287 -4.522  1.00 0.00 ?  309 ALA A HB3  5  
ATOM 10008 N N    . THR A 1 97  ? 3.177   -14.123 -6.581  1.00 0.00 ?  310 THR A N    5  
ATOM 10009 C CA   . THR A 1 97  ? 1.731   -14.069 -6.710  1.00 0.00 ?  310 THR A CA   5  
ATOM 10010 C C    . THR A 1 97  ? 1.068   -14.186 -5.336  1.00 0.00 ?  310 THR A C    5  
ATOM 10011 O O    . THR A 1 97  ? 1.328   -15.134 -4.596  1.00 0.00 ?  310 THR A O    5  
ATOM 10012 C CB   . THR A 1 97  ? 1.301   -15.164 -7.687  1.00 0.00 ?  310 THR A CB   5  
ATOM 10013 O OG1  . THR A 1 97  ? 0.685   -14.453 -8.757  1.00 0.00 ?  310 THR A OG1  5  
ATOM 10014 C CG2  . THR A 1 97  ? 0.179   -16.041 -7.128  1.00 0.00 ?  310 THR A CG2  5  
ATOM 10015 H H    . THR A 1 97  ? 3.545   -15.016 -6.322  1.00 0.00 ?  310 THR A H    5  
ATOM 10016 H HA   . THR A 1 97  ? 1.458   -13.094 -7.114  1.00 0.00 ?  310 THR A HA   5  
ATOM 10017 H HB   . THR A 1 97  ? 2.155   -15.771 -7.991  1.00 0.00 ?  310 THR A HB   5  
ATOM 10018 H HG1  . THR A 1 97  ? 1.240   -13.660 -9.005  1.00 0.00 ?  310 THR A HG1  5  
ATOM 10019 H HG21 . THR A 1 97  ? 0.509   -16.504 -6.198  1.00 0.00 ?  310 THR A HG21 5  
ATOM 10020 H HG22 . THR A 1 97  ? -0.701  -15.427 -6.935  1.00 0.00 ?  310 THR A HG22 5  
ATOM 10021 H HG23 . THR A 1 97  ? -0.070  -16.818 -7.851  1.00 0.00 ?  310 THR A HG23 5  
ATOM 10022 N N    . VAL A 1 98  ? 0.225   -13.209 -5.035  1.00 0.00 ?  311 VAL A N    5  
ATOM 10023 C CA   . VAL A 1 98  ? -0.477  -13.191 -3.763  1.00 0.00 ?  311 VAL A CA   5  
ATOM 10024 C C    . VAL A 1 98  ? -1.926  -13.635 -3.978  1.00 0.00 ?  311 VAL A C    5  
ATOM 10025 O O    . VAL A 1 98  ? -2.624  -13.095 -4.835  1.00 0.00 ?  311 VAL A O    5  
ATOM 10026 C CB   . VAL A 1 98  ? -0.365  -11.806 -3.123  1.00 0.00 ?  311 VAL A CB   5  
ATOM 10027 C CG1  . VAL A 1 98  ? -1.114  -11.756 -1.790  1.00 0.00 ?  311 VAL A CG1  5  
ATOM 10028 C CG2  . VAL A 1 98  ? 1.099   -11.401 -2.946  1.00 0.00 ?  311 VAL A CG2  5  
ATOM 10029 H H    . VAL A 1 98  ? 0.018   -12.442 -5.642  1.00 0.00 ?  311 VAL A H    5  
ATOM 10030 H HA   . VAL A 1 98  ? 0.015   -13.908 -3.106  1.00 0.00 ?  311 VAL A HA   5  
ATOM 10031 H HB   . VAL A 1 98  ? -0.832  -11.087 -3.797  1.00 0.00 ?  311 VAL A HB   5  
ATOM 10032 H HG11 . VAL A 1 98  ? -0.626  -12.418 -1.074  1.00 0.00 ?  311 VAL A HG11 5  
ATOM 10033 H HG12 . VAL A 1 98  ? -1.105  -10.736 -1.406  1.00 0.00 ?  311 VAL A HG12 5  
ATOM 10034 H HG13 . VAL A 1 98  ? -2.144  -12.079 -1.940  1.00 0.00 ?  311 VAL A HG13 5  
ATOM 10035 H HG21 . VAL A 1 98  ? 1.162   -10.324 -2.792  1.00 0.00 ?  311 VAL A HG21 5  
ATOM 10036 H HG22 . VAL A 1 98  ? 1.516   -11.916 -2.080  1.00 0.00 ?  311 VAL A HG22 5  
ATOM 10037 H HG23 . VAL A 1 98  ? 1.663   -11.674 -3.838  1.00 0.00 ?  311 VAL A HG23 5  
ATOM 10038 N N    . SER A 1 99  ? -2.334  -14.616 -3.186  1.00 0.00 ?  312 SER A N    5  
ATOM 10039 C CA   . SER A 1 99  ? -3.687  -15.139 -3.279  1.00 0.00 ?  312 SER A CA   5  
ATOM 10040 C C    . SER A 1 99  ? -4.345  -15.136 -1.898  1.00 0.00 ?  312 SER A C    5  
ATOM 10041 O O    . SER A 1 99  ? -3.657  -15.135 -0.879  1.00 0.00 ?  312 SER A O    5  
ATOM 10042 C CB   . SER A 1 99  ? -3.692  -16.551 -3.868  1.00 0.00 ?  312 SER A CB   5  
ATOM 10043 O OG   . SER A 1 99  ? -3.045  -17.488 -3.011  1.00 0.00 ?  312 SER A OG   5  
ATOM 10044 H H    . SER A 1 99  ? -1.760  -15.050 -2.492  1.00 0.00 ?  312 SER A H    5  
ATOM 10045 H HA   . SER A 1 99  ? -4.212  -14.463 -3.954  1.00 0.00 ?  312 SER A HA   5  
ATOM 10046 H HB2  . SER A 1 99  ? -4.721  -16.868 -4.040  1.00 0.00 ?  312 SER A HB2  5  
ATOM 10047 H HB3  . SER A 1 99  ? -3.194  -16.542 -4.837  1.00 0.00 ?  312 SER A HB3  5  
ATOM 10048 H HG   . SER A 1 99  ? -2.167  -17.122 -2.704  1.00 0.00 ?  312 SER A HG   5  
ATOM 10049 N N    . ALA A 1 100 ? -5.670  -15.135 -1.909  1.00 0.00 ?  313 ALA A N    5  
ATOM 10050 C CA   . ALA A 1 100 ? -6.429  -15.133 -0.670  1.00 0.00 ?  313 ALA A CA   5  
ATOM 10051 C C    . ALA A 1 100 ? -6.677  -16.576 -0.226  1.00 0.00 ?  313 ALA A C    5  
ATOM 10052 O O    . ALA A 1 100 ? -7.404  -17.316 -0.887  1.00 0.00 ?  313 ALA A O    5  
ATOM 10053 C CB   . ALA A 1 100 ? -7.729  -14.352 -0.869  1.00 0.00 ?  313 ALA A CB   5  
ATOM 10054 H H    . ALA A 1 100 ? -6.222  -15.135 -2.743  1.00 0.00 ?  313 ALA A H    5  
ATOM 10055 H HA   . ALA A 1 100 ? -5.828  -14.627 0.086   1.00 0.00 ?  313 ALA A HA   5  
ATOM 10056 H HB1  . ALA A 1 100 ? -7.572  -13.308 -0.596  1.00 0.00 ?  313 ALA A HB1  5  
ATOM 10057 H HB2  . ALA A 1 100 ? -8.033  -14.412 -1.914  1.00 0.00 ?  313 ALA A HB2  5  
ATOM 10058 H HB3  . ALA A 1 100 ? -8.509  -14.779 -0.239  1.00 0.00 ?  313 ALA A HB3  5  
ATOM 10059 N N    . ALA A 1 101 ? -6.058  -16.932 0.890   1.00 0.00 ?  314 ALA A N    5  
ATOM 10060 C CA   . ALA A 1 101 ? -6.203  -18.273 1.430   1.00 0.00 ?  314 ALA A CA   5  
ATOM 10061 C C    . ALA A 1 101 ? -7.689  -18.591 1.605   1.00 0.00 ?  314 ALA A C    5  
ATOM 10062 O O    . ALA A 1 101 ? -8.104  -19.740 1.460   1.00 0.00 ?  314 ALA A O    5  
ATOM 10063 C CB   . ALA A 1 101 ? -5.425  -18.382 2.742   1.00 0.00 ?  314 ALA A CB   5  
ATOM 10064 H H    . ALA A 1 101 ? -5.469  -16.324 1.421   1.00 0.00 ?  314 ALA A H    5  
ATOM 10065 H HA   . ALA A 1 101 ? -5.774  -18.969 0.709   1.00 0.00 ?  314 ALA A HA   5  
ATOM 10066 H HB1  . ALA A 1 101 ? -5.644  -17.517 3.368   1.00 0.00 ?  314 ALA A HB1  5  
ATOM 10067 H HB2  . ALA A 1 101 ? -5.720  -19.292 3.265   1.00 0.00 ?  314 ALA A HB2  5  
ATOM 10068 H HB3  . ALA A 1 101 ? -4.356  -18.416 2.530   1.00 0.00 ?  314 ALA A HB3  5  
ATOM 10069 N N    . THR A 1 102 ? -8.451  -17.552 1.914   1.00 0.00 ?  315 THR A N    5  
ATOM 10070 C CA   . THR A 1 102 ? -9.882  -17.705 2.111   1.00 0.00 ?  315 THR A CA   5  
ATOM 10071 C C    . THR A 1 102 ? -10.593 -16.362 1.930   1.00 0.00 ?  315 THR A C    5  
ATOM 10072 O O    . THR A 1 102 ? -10.056 -15.452 1.301   1.00 0.00 ?  315 THR A O    5  
ATOM 10073 C CB   . THR A 1 102 ? -10.106 -18.330 3.489   1.00 0.00 ?  315 THR A CB   5  
ATOM 10074 O OG1  . THR A 1 102 ? -11.516 -18.527 3.556   1.00 0.00 ?  315 THR A OG1  5  
ATOM 10075 C CG2  . THR A 1 102 ? -9.811  -17.354 4.630   1.00 0.00 ?  315 THR A CG2  5  
ATOM 10076 H H    . THR A 1 102 ? -8.106  -16.620 2.030   1.00 0.00 ?  315 THR A H    5  
ATOM 10077 H HA   . THR A 1 102 ? -10.265 -18.375 1.341   1.00 0.00 ?  315 THR A HA   5  
ATOM 10078 H HB   . THR A 1 102 ? -9.525  -19.246 3.600   1.00 0.00 ?  315 THR A HB   5  
ATOM 10079 H HG1  . THR A 1 102 ? -11.781 -19.301 2.982   1.00 0.00 ?  315 THR A HG1  5  
ATOM 10080 H HG21 . THR A 1 102 ? -9.072  -17.792 5.301   1.00 0.00 ?  315 THR A HG21 5  
ATOM 10081 H HG22 . THR A 1 102 ? -9.422  -16.422 4.219   1.00 0.00 ?  315 THR A HG22 5  
ATOM 10082 H HG23 . THR A 1 102 ? -10.729 -17.152 5.182   1.00 0.00 ?  315 THR A HG23 5  
ATOM 10083 N N    . THR A 1 103 ? -11.789 -16.281 2.494   1.00 0.00 ?  316 THR A N    5  
ATOM 10084 C CA   . THR A 1 103 ? -12.578 -15.064 2.403   1.00 0.00 ?  316 THR A CA   5  
ATOM 10085 C C    . THR A 1 103 ? -11.893 -13.927 3.163   1.00 0.00 ?  316 THR A C    5  
ATOM 10086 O O    . THR A 1 103 ? -12.251 -13.633 4.303   1.00 0.00 ?  316 THR A O    5  
ATOM 10087 C CB   . THR A 1 103 ? -13.986 -15.375 2.914   1.00 0.00 ?  316 THR A CB   5  
ATOM 10088 O OG1  . THR A 1 103 ? -14.438 -16.429 2.069   1.00 0.00 ?  316 THR A OG1  5  
ATOM 10089 C CG2  . THR A 1 103 ? -14.971 -14.235 2.647   1.00 0.00 ?  316 THR A CG2  5  
ATOM 10090 H H    . THR A 1 103 ? -12.218 -17.026 3.004   1.00 0.00 ?  316 THR A H    5  
ATOM 10091 H HA   . THR A 1 103 ? -12.629 -14.765 1.357   1.00 0.00 ?  316 THR A HA   5  
ATOM 10092 H HB   . THR A 1 103 ? -13.968 -15.633 3.973   1.00 0.00 ?  316 THR A HB   5  
ATOM 10093 H HG1  . THR A 1 103 ? -15.280 -16.824 2.435   1.00 0.00 ?  316 THR A HG1  5  
ATOM 10094 H HG21 . THR A 1 103 ? -15.130 -14.137 1.573   1.00 0.00 ?  316 THR A HG21 5  
ATOM 10095 H HG22 . THR A 1 103 ? -15.920 -14.453 3.137   1.00 0.00 ?  316 THR A HG22 5  
ATOM 10096 H HG23 . THR A 1 103 ? -14.564 -13.303 3.041   1.00 0.00 ?  316 THR A HG23 5  
ATOM 10097 N N    . VAL A 1 104 ? -10.920 -13.317 2.501   1.00 0.00 ?  317 VAL A N    5  
ATOM 10098 C CA   . VAL A 1 104 ? -10.182 -12.218 3.100   1.00 0.00 ?  317 VAL A CA   5  
ATOM 10099 C C    . VAL A 1 104 ? -10.584 -10.909 2.418   1.00 0.00 ?  317 VAL A C    5  
ATOM 10100 O O    . VAL A 1 104 ? -10.777 -10.871 1.204   1.00 0.00 ?  317 VAL A O    5  
ATOM 10101 C CB   . VAL A 1 104 ? -8.679  -12.495 3.025   1.00 0.00 ?  317 VAL A CB   5  
ATOM 10102 C CG1  . VAL A 1 104 ? -8.301  -13.106 1.674   1.00 0.00 ?  317 VAL A CG1  5  
ATOM 10103 C CG2  . VAL A 1 104 ? -7.873  -11.223 3.296   1.00 0.00 ?  317 VAL A CG2  5  
ATOM 10104 H H    . VAL A 1 104 ? -10.636 -13.562 1.574   1.00 0.00 ?  317 VAL A H    5  
ATOM 10105 H HA   . VAL A 1 104 ? -10.464 -12.167 4.152   1.00 0.00 ?  317 VAL A HA   5  
ATOM 10106 H HB   . VAL A 1 104 ? -8.433  -13.220 3.801   1.00 0.00 ?  317 VAL A HB   5  
ATOM 10107 H HG11 . VAL A 1 104 ? -9.011  -12.776 0.915   1.00 0.00 ?  317 VAL A HG11 5  
ATOM 10108 H HG12 . VAL A 1 104 ? -7.297  -12.784 1.398   1.00 0.00 ?  317 VAL A HG12 5  
ATOM 10109 H HG13 . VAL A 1 104 ? -8.327  -14.193 1.747   1.00 0.00 ?  317 VAL A HG13 5  
ATOM 10110 H HG21 . VAL A 1 104 ? -8.268  -10.407 2.691   1.00 0.00 ?  317 VAL A HG21 5  
ATOM 10111 H HG22 . VAL A 1 104 ? -7.950  -10.963 4.352   1.00 0.00 ?  317 VAL A HG22 5  
ATOM 10112 H HG23 . VAL A 1 104 ? -6.828  -11.394 3.040   1.00 0.00 ?  317 VAL A HG23 5  
ATOM 10113 N N    . SER A 1 105 ? -10.696 -9.867  3.229   1.00 0.00 ?  318 SER A N    5  
ATOM 10114 C CA   . SER A 1 105 ? -11.071 -8.559  2.719   1.00 0.00 ?  318 SER A CA   5  
ATOM 10115 C C    . SER A 1 105 ? -9.892  -7.591  2.843   1.00 0.00 ?  318 SER A C    5  
ATOM 10116 O O    . SER A 1 105 ? -9.315  -7.447  3.920   1.00 0.00 ?  318 SER A O    5  
ATOM 10117 C CB   . SER A 1 105 ? -12.291 -8.008  3.460   1.00 0.00 ?  318 SER A CB   5  
ATOM 10118 O OG   . SER A 1 105 ? -13.424 -8.862  3.333   1.00 0.00 ?  318 SER A OG   5  
ATOM 10119 H H    . SER A 1 105 ? -10.537 -9.906  4.215   1.00 0.00 ?  318 SER A H    5  
ATOM 10120 H HA   . SER A 1 105 ? -11.325 -8.719  1.671   1.00 0.00 ?  318 SER A HA   5  
ATOM 10121 H HB2  . SER A 1 105 ? -12.048 -7.882  4.515   1.00 0.00 ?  318 SER A HB2  5  
ATOM 10122 H HB3  . SER A 1 105 ? -12.536 -7.020  3.071   1.00 0.00 ?  318 SER A HB3  5  
ATOM 10123 H HG   . SER A 1 105 ? -13.156 -9.812  3.492   1.00 0.00 ?  318 SER A HG   5  
ATOM 10124 N N    . LEU A 1 106 ? -9.570  -6.954  1.727   1.00 0.00 ?  319 LEU A N    5  
ATOM 10125 C CA   . LEU A 1 106 ? -8.471  -6.005  1.698   1.00 0.00 ?  319 LEU A CA   5  
ATOM 10126 C C    . LEU A 1 106 ? -8.909  -4.747  0.945   1.00 0.00 ?  319 LEU A C    5  
ATOM 10127 O O    . LEU A 1 106 ? -10.008 -4.700  0.394   1.00 0.00 ?  319 LEU A O    5  
ATOM 10128 C CB   . LEU A 1 106 ? -7.213  -6.659  1.123   1.00 0.00 ?  319 LEU A CB   5  
ATOM 10129 C CG   . LEU A 1 106 ? -7.352  -8.123  0.702   1.00 0.00 ?  319 LEU A CG   5  
ATOM 10130 C CD1  . LEU A 1 106 ? -7.842  -8.234  -0.743  1.00 0.00 ?  319 LEU A CD1  5  
ATOM 10131 C CD2  . LEU A 1 106 ? -6.042  -8.883  0.923   1.00 0.00 ?  319 LEU A CD2  5  
ATOM 10132 H H    . LEU A 1 106 ? -10.046 -7.078  0.856   1.00 0.00 ?  319 LEU A H    5  
ATOM 10133 H HA   . LEU A 1 106 ? -8.249  -5.730  2.729   1.00 0.00 ?  319 LEU A HA   5  
ATOM 10134 H HB2  . LEU A 1 106 ? -6.891  -6.081  0.257   1.00 0.00 ?  319 LEU A HB2  5  
ATOM 10135 H HB3  . LEU A 1 106 ? -6.419  -6.589  1.866   1.00 0.00 ?  319 LEU A HB3  5  
ATOM 10136 H HG   . LEU A 1 106 ? -8.106  -8.591  1.334   1.00 0.00 ?  319 LEU A HG   5  
ATOM 10137 H HD11 . LEU A 1 106 ? -8.866  -7.868  -0.809  1.00 0.00 ?  319 LEU A HD11 5  
ATOM 10138 H HD12 . LEU A 1 106 ? -7.200  -7.637  -1.391  1.00 0.00 ?  319 LEU A HD12 5  
ATOM 10139 H HD13 . LEU A 1 106 ? -7.808  -9.277  -1.059  1.00 0.00 ?  319 LEU A HD13 5  
ATOM 10140 H HD21 . LEU A 1 106 ? -5.303  -8.214  1.363   1.00 0.00 ?  319 LEU A HD21 5  
ATOM 10141 H HD22 . LEU A 1 106 ? -6.218  -9.722  1.596   1.00 0.00 ?  319 LEU A HD22 5  
ATOM 10142 H HD23 . LEU A 1 106 ? -5.673  -9.256  -0.032  1.00 0.00 ?  319 LEU A HD23 5  
ATOM 10143 N N    . LEU A 1 107 ? -8.027  -3.759  0.945   1.00 0.00 ?  320 LEU A N    5  
ATOM 10144 C CA   . LEU A 1 107 ? -8.309  -2.504  0.268   1.00 0.00 ?  320 LEU A CA   5  
ATOM 10145 C C    . LEU A 1 107 ? -7.198  -2.214  -0.744  1.00 0.00 ?  320 LEU A C    5  
ATOM 10146 O O    . LEU A 1 107 ? -6.017  -2.367  -0.435  1.00 0.00 ?  320 LEU A O    5  
ATOM 10147 C CB   . LEU A 1 107 ? -8.521  -1.382  1.286   1.00 0.00 ?  320 LEU A CB   5  
ATOM 10148 C CG   . LEU A 1 107 ? -9.439  -1.711  2.466   1.00 0.00 ?  320 LEU A CG   5  
ATOM 10149 C CD1  . LEU A 1 107 ? -8.658  -1.722  3.781   1.00 0.00 ?  320 LEU A CD1  5  
ATOM 10150 C CD2  . LEU A 1 107 ? -10.632 -0.754  2.515   1.00 0.00 ?  320 LEU A CD2  5  
ATOM 10151 H H    . LEU A 1 107 ? -7.135  -3.805  1.395   1.00 0.00 ?  320 LEU A H    5  
ATOM 10152 H HA   . LEU A 1 107 ? -9.246  -2.628  -0.274  1.00 0.00 ?  320 LEU A HA   5  
ATOM 10153 H HB2  . LEU A 1 107 ? -7.548  -1.087  1.680   1.00 0.00 ?  320 LEU A HB2  5  
ATOM 10154 H HB3  . LEU A 1 107 ? -8.929  -0.517  0.764   1.00 0.00 ?  320 LEU A HB3  5  
ATOM 10155 H HG   . LEU A 1 107 ? -9.837  -2.715  2.319   1.00 0.00 ?  320 LEU A HG   5  
ATOM 10156 H HD11 . LEU A 1 107 ? -9.351  -1.610  4.615   1.00 0.00 ?  320 LEU A HD11 5  
ATOM 10157 H HD12 . LEU A 1 107 ? -8.123  -2.667  3.878   1.00 0.00 ?  320 LEU A HD12 5  
ATOM 10158 H HD13 . LEU A 1 107 ? -7.944  -0.899  3.788   1.00 0.00 ?  320 LEU A HD13 5  
ATOM 10159 H HD21 . LEU A 1 107 ? -10.711 -0.224  1.566   1.00 0.00 ?  320 LEU A HD21 5  
ATOM 10160 H HD22 . LEU A 1 107 ? -11.545 -1.321  2.692   1.00 0.00 ?  320 LEU A HD22 5  
ATOM 10161 H HD23 . LEU A 1 107 ? -10.488 -0.035  3.322   1.00 0.00 ?  320 LEU A HD23 5  
ATOM 10162 N N    . SER A 1 108 ? -7.616  -1.802  -1.931  1.00 0.00 ?  321 SER A N    5  
ATOM 10163 C CA   . SER A 1 108 ? -6.672  -1.490  -2.990  1.00 0.00 ?  321 SER A CA   5  
ATOM 10164 C C    . SER A 1 108 ? -6.405  0.017   -3.026  1.00 0.00 ?  321 SER A C    5  
ATOM 10165 O O    . SER A 1 108 ? -7.271  0.813   -2.666  1.00 0.00 ?  321 SER A O    5  
ATOM 10166 C CB   . SER A 1 108 ? -7.188  -1.970  -4.348  1.00 0.00 ?  321 SER A CB   5  
ATOM 10167 O OG   . SER A 1 108 ? -8.239  -1.145  -4.842  1.00 0.00 ?  321 SER A OG   5  
ATOM 10168 H H    . SER A 1 108 ? -8.579  -1.681  -2.174  1.00 0.00 ?  321 SER A H    5  
ATOM 10169 H HA   . SER A 1 108 ? -5.762  -2.033  -2.735  1.00 0.00 ?  321 SER A HA   5  
ATOM 10170 H HB2  . SER A 1 108 ? -6.367  -1.980  -5.065  1.00 0.00 ?  321 SER A HB2  5  
ATOM 10171 H HB3  . SER A 1 108 ? -7.545  -2.996  -4.258  1.00 0.00 ?  321 SER A HB3  5  
ATOM 10172 H HG   . SER A 1 108 ? -8.310  -1.238  -5.835  1.00 0.00 ?  321 SER A HG   5  
ATOM 10173 N N    . LEU A 1 109 ? -5.204  0.362   -3.465  1.00 0.00 ?  322 LEU A N    5  
ATOM 10174 C CA   . LEU A 1 109 ? -4.813  1.759   -3.553  1.00 0.00 ?  322 LEU A CA   5  
ATOM 10175 C C    . LEU A 1 109 ? -3.886  1.950   -4.755  1.00 0.00 ?  322 LEU A C    5  
ATOM 10176 O O    . LEU A 1 109 ? -2.712  1.586   -4.703  1.00 0.00 ?  322 LEU A O    5  
ATOM 10177 C CB   . LEU A 1 109 ? -4.208  2.230   -2.229  1.00 0.00 ?  322 LEU A CB   5  
ATOM 10178 C CG   . LEU A 1 109 ? -3.779  3.698   -2.173  1.00 0.00 ?  322 LEU A CG   5  
ATOM 10179 C CD1  . LEU A 1 109 ? -2.364  3.878   -2.727  1.00 0.00 ?  322 LEU A CD1  5  
ATOM 10180 C CD2  . LEU A 1 109 ? -4.793  4.593   -2.888  1.00 0.00 ?  322 LEU A CD2  5  
ATOM 10181 H H    . LEU A 1 109 ? -4.506  -0.291  -3.757  1.00 0.00 ?  322 LEU A H    5  
ATOM 10182 H HA   . LEU A 1 109 ? -5.718  2.342   -3.719  1.00 0.00 ?  322 LEU A HA   5  
ATOM 10183 H HB2  . LEU A 1 109 ? -4.935  2.054   -1.437  1.00 0.00 ?  322 LEU A HB2  5  
ATOM 10184 H HB3  . LEU A 1 109 ? -3.339  1.610   -2.009  1.00 0.00 ?  322 LEU A HB3  5  
ATOM 10185 H HG   . LEU A 1 109 ? -3.757  4.007   -1.128  1.00 0.00 ?  322 LEU A HG   5  
ATOM 10186 H HD11 . LEU A 1 109 ? -1.776  2.984   -2.518  1.00 0.00 ?  322 LEU A HD11 5  
ATOM 10187 H HD12 . LEU A 1 109 ? -2.413  4.037   -3.804  1.00 0.00 ?  322 LEU A HD12 5  
ATOM 10188 H HD13 . LEU A 1 109 ? -1.895  4.740   -2.253  1.00 0.00 ?  322 LEU A HD13 5  
ATOM 10189 H HD21 . LEU A 1 109 ? -4.590  4.588   -3.959  1.00 0.00 ?  322 LEU A HD21 5  
ATOM 10190 H HD22 . LEU A 1 109 ? -5.800  4.218   -2.708  1.00 0.00 ?  322 LEU A HD22 5  
ATOM 10191 H HD23 . LEU A 1 109 ? -4.711  5.611   -2.507  1.00 0.00 ?  322 LEU A HD23 5  
ATOM 10192 N N    . HIS A 1 110 ? -4.448  2.519   -5.811  1.00 0.00 ?  323 HIS A N    5  
ATOM 10193 C CA   . HIS A 1 110 ? -3.687  2.763   -7.025  1.00 0.00 ?  323 HIS A CA   5  
ATOM 10194 C C    . HIS A 1 110 ? -2.584  3.785   -6.742  1.00 0.00 ?  323 HIS A C    5  
ATOM 10195 O O    . HIS A 1 110 ? -2.811  4.771   -6.043  1.00 0.00 ?  323 HIS A O    5  
ATOM 10196 C CB   . HIS A 1 110 ? -4.609  3.186   -8.169  1.00 0.00 ?  323 HIS A CB   5  
ATOM 10197 C CG   . HIS A 1 110 ? -5.670  4.183   -7.767  1.00 0.00 ?  323 HIS A CG   5  
ATOM 10198 N ND1  . HIS A 1 110 ? -5.396  5.521   -7.547  1.00 0.00 ?  323 HIS A ND1  5  
ATOM 10199 C CD2  . HIS A 1 110 ? -7.006  4.022   -7.548  1.00 0.00 ?  323 HIS A CD2  5  
ATOM 10200 C CE1  . HIS A 1 110 ? -6.524  6.129   -7.211  1.00 0.00 ?  323 HIS A CE1  5  
ATOM 10201 N NE2  . HIS A 1 110 ? -7.521  5.199   -7.211  1.00 0.00 ?  323 HIS A NE2  5  
ATOM 10202 H H    . HIS A 1 110 ? -5.404  2.812   -5.846  1.00 0.00 ?  323 HIS A H    5  
ATOM 10203 H HA   . HIS A 1 110 ? -3.228  1.814   -7.301  1.00 0.00 ?  323 HIS A HA   5  
ATOM 10204 H HB2  . HIS A 1 110 ? -4.006  3.616   -8.969  1.00 0.00 ?  323 HIS A HB2  5  
ATOM 10205 H HB3  . HIS A 1 110 ? -5.095  2.300   -8.578  1.00 0.00 ?  323 HIS A HB3  5  
ATOM 10206 H HD1  . HIS A 1 110 ? -4.498  5.956   -7.628  1.00 0.00 ?  323 HIS A HD1  5  
ATOM 10207 H HD2  . HIS A 1 110 ? -7.559  3.086   -7.635  1.00 0.00 ?  323 HIS A HD2  5  
ATOM 10208 H HE1  . HIS A 1 110 ? -6.635  7.188   -6.975  1.00 0.00 ?  323 HIS A HE1  5  
ATOM 10209 H HE2  . HIS A 1 110 ? -8.490  5.385   -7.050  1.00 0.00 ?  323 HIS A HE2  5  
ATOM 10210 N N    . SER A 1 111 ? -1.414  3.516   -7.302  1.00 0.00 ?  324 SER A N    5  
ATOM 10211 C CA   . SER A 1 111 ? -0.276  4.400   -7.119  1.00 0.00 ?  324 SER A CA   5  
ATOM 10212 C C    . SER A 1 111 ? -0.607  5.796   -7.652  1.00 0.00 ?  324 SER A C    5  
ATOM 10213 O O    . SER A 1 111 ? 0.045   6.774   -7.288  1.00 0.00 ?  324 SER A O    5  
ATOM 10214 C CB   . SER A 1 111 ? 0.969   3.848   -7.816  1.00 0.00 ?  324 SER A CB   5  
ATOM 10215 O OG   . SER A 1 111 ? 0.789   3.743   -9.226  1.00 0.00 ?  324 SER A OG   5  
ATOM 10216 H H    . SER A 1 111 ? -1.237  2.712   -7.870  1.00 0.00 ?  324 SER A H    5  
ATOM 10217 H HA   . SER A 1 111 ? -0.105  4.432   -6.043  1.00 0.00 ?  324 SER A HA   5  
ATOM 10218 H HB2  . SER A 1 111 ? 1.820   4.496   -7.606  1.00 0.00 ?  324 SER A HB2  5  
ATOM 10219 H HB3  . SER A 1 111 ? 1.208   2.866   -7.407  1.00 0.00 ?  324 SER A HB3  5  
ATOM 10220 H HG   . SER A 1 111 ? -0.185  3.690   -9.444  1.00 0.00 ?  324 SER A HG   5  
ATOM 10221 N N    . ALA A 1 112 ? -1.619  5.844   -8.505  1.00 0.00 ?  325 ALA A N    5  
ATOM 10222 C CA   . ALA A 1 112 ? -2.045  7.103   -9.092  1.00 0.00 ?  325 ALA A CA   5  
ATOM 10223 C C    . ALA A 1 112 ? -2.260  8.132   -7.979  1.00 0.00 ?  325 ALA A C    5  
ATOM 10224 O O    . ALA A 1 112 ? -1.989  9.317   -8.164  1.00 0.00 ?  325 ALA A O    5  
ATOM 10225 C CB   . ALA A 1 112 ? -3.305  6.877   -9.929  1.00 0.00 ?  325 ALA A CB   5  
ATOM 10226 H H    . ALA A 1 112 ? -2.144  5.044   -8.796  1.00 0.00 ?  325 ALA A H    5  
ATOM 10227 H HA   . ALA A 1 112 ? -1.246  7.451   -9.747  1.00 0.00 ?  325 ALA A HA   5  
ATOM 10228 H HB1  . ALA A 1 112 ? -3.825  5.989   -9.569  1.00 0.00 ?  325 ALA A HB1  5  
ATOM 10229 H HB2  . ALA A 1 112 ? -3.961  7.743   -9.839  1.00 0.00 ?  325 ALA A HB2  5  
ATOM 10230 H HB3  . ALA A 1 112 ? -3.027  6.738   -10.973 1.00 0.00 ?  325 ALA A HB3  5  
ATOM 10231 N N    . ASP A 1 113 ? -2.746  7.641   -6.849  1.00 0.00 ?  326 ASP A N    5  
ATOM 10232 C CA   . ASP A 1 113 ? -3.001  8.502   -5.707  1.00 0.00 ?  326 ASP A CA   5  
ATOM 10233 C C    . ASP A 1 113 ? -1.673  9.055   -5.184  1.00 0.00 ?  326 ASP A C    5  
ATOM 10234 O O    . ASP A 1 113 ? -1.595  10.214  -4.780  1.00 0.00 ?  326 ASP A O    5  
ATOM 10235 C CB   . ASP A 1 113 ? -3.671  7.727   -4.571  1.00 0.00 ?  326 ASP A CB   5  
ATOM 10236 C CG   . ASP A 1 113 ? -2.722  6.888   -3.713  1.00 0.00 ?  326 ASP A CG   5  
ATOM 10237 O OD1  . ASP A 1 113 ? -1.885  6.135   -4.235  1.00 0.00 ?  326 ASP A OD1  5  
ATOM 10238 O OD2  . ASP A 1 113 ? -2.868  7.030   -2.439  1.00 0.00 -1 326 ASP A OD2  5  
ATOM 10239 H H    . ASP A 1 113 ? -2.963  6.675   -6.707  1.00 0.00 ?  326 ASP A H    5  
ATOM 10240 H HA   . ASP A 1 113 ? -3.660  9.285   -6.081  1.00 0.00 ?  326 ASP A HA   5  
ATOM 10241 H HB2  . ASP A 1 113 ? -4.190  8.435   -3.925  1.00 0.00 ?  326 ASP A HB2  5  
ATOM 10242 H HB3  . ASP A 1 113 ? -4.429  7.070   -4.997  1.00 0.00 ?  326 ASP A HB3  5  
ATOM 10243 H HD2  . ASP A 1 113 ? -2.378  7.844   -2.128  1.00 0.00 ?  326 ASP A HD2  5  
ATOM 10244 N N    . PHE A 1 114 ? -0.662  8.199   -5.208  1.00 0.00 ?  327 PHE A N    5  
ATOM 10245 C CA   . PHE A 1 114 ? 0.658   8.586   -4.741  1.00 0.00 ?  327 PHE A CA   5  
ATOM 10246 C C    . PHE A 1 114 ? 1.284   9.629   -5.670  1.00 0.00 ?  327 PHE A C    5  
ATOM 10247 O O    . PHE A 1 114 ? 1.959   10.549  -5.211  1.00 0.00 ?  327 PHE A O    5  
ATOM 10248 C CB   . PHE A 1 114 ? 1.524   7.325   -4.751  1.00 0.00 ?  327 PHE A CB   5  
ATOM 10249 C CG   . PHE A 1 114 ? 2.916   7.522   -4.147  1.00 0.00 ?  327 PHE A CG   5  
ATOM 10250 C CD1  . PHE A 1 114 ? 3.055   7.720   -2.809  1.00 0.00 ?  327 PHE A CD1  5  
ATOM 10251 C CD2  . PHE A 1 114 ? 4.015   7.499   -4.949  1.00 0.00 ?  327 PHE A CD2  5  
ATOM 10252 C CE1  . PHE A 1 114 ? 4.347   7.902   -2.249  1.00 0.00 ?  327 PHE A CE1  5  
ATOM 10253 C CE2  . PHE A 1 114 ? 5.307   7.681   -4.388  1.00 0.00 ?  327 PHE A CE2  5  
ATOM 10254 C CZ   . PHE A 1 114 ? 5.446   7.879   -3.050  1.00 0.00 ?  327 PHE A CZ   5  
ATOM 10255 H H    . PHE A 1 114 ? -0.734  7.257   -5.538  1.00 0.00 ?  327 PHE A H    5  
ATOM 10256 H HA   . PHE A 1 114 ? 0.536   9.016   -3.747  1.00 0.00 ?  327 PHE A HA   5  
ATOM 10257 H HB2  . PHE A 1 114 ? 1.009   6.538   -4.201  1.00 0.00 ?  327 PHE A HB2  5  
ATOM 10258 H HB3  . PHE A 1 114 ? 1.631   6.979   -5.779  1.00 0.00 ?  327 PHE A HB3  5  
ATOM 10259 H HD1  . PHE A 1 114 ? 2.175   7.739   -2.167  1.00 0.00 ?  327 PHE A HD1  5  
ATOM 10260 H HD2  . PHE A 1 114 ? 3.904   7.340   -6.021  1.00 0.00 ?  327 PHE A HD2  5  
ATOM 10261 H HE1  . PHE A 1 114 ? 4.458   8.061   -1.176  1.00 0.00 ?  327 PHE A HE1  5  
ATOM 10262 H HE2  . PHE A 1 114 ? 6.187   7.662   -5.031  1.00 0.00 ?  327 PHE A HE2  5  
ATOM 10263 H HZ   . PHE A 1 114 ? 6.437   8.019   -2.620  1.00 0.00 ?  327 PHE A HZ   5  
ATOM 10264 N N    . GLN A 1 115 ? 1.038   9.449   -6.960  1.00 0.00 ?  328 GLN A N    5  
ATOM 10265 C CA   . GLN A 1 115 ? 1.569   10.362  -7.957  1.00 0.00 ?  328 GLN A CA   5  
ATOM 10266 C C    . GLN A 1 115 ? 0.889   11.728  -7.842  1.00 0.00 ?  328 GLN A C    5  
ATOM 10267 O O    . GLN A 1 115 ? 1.509   12.758  -8.106  1.00 0.00 ?  328 GLN A O    5  
ATOM 10268 C CB   . GLN A 1 115 ? 1.409   9.788   -9.367  1.00 0.00 ?  328 GLN A CB   5  
ATOM 10269 C CG   . GLN A 1 115 ? 2.066   8.410   -9.475  1.00 0.00 ?  328 GLN A CG   5  
ATOM 10270 C CD   . GLN A 1 115 ? 1.558   7.656   -10.706 1.00 0.00 ?  328 GLN A CD   5  
ATOM 10271 O OE1  . GLN A 1 115 ? 1.351   8.219   -11.768 1.00 0.00 ?  328 GLN A OE1  5  
ATOM 10272 N NE2  . GLN A 1 115 ? 1.371   6.355   -10.504 1.00 0.00 ?  328 GLN A NE2  5  
ATOM 10273 H H    . GLN A 1 115 ? 0.488   8.697   -7.325  1.00 0.00 ?  328 GLN A H    5  
ATOM 10274 H HA   . GLN A 1 115 ? 2.630   10.456  -7.728  1.00 0.00 ?  328 GLN A HA   5  
ATOM 10275 H HB2  . GLN A 1 115 ? 0.351   9.711   -9.614  1.00 0.00 ?  328 GLN A HB2  5  
ATOM 10276 H HB3  . GLN A 1 115 ? 1.858   10.466  -10.092 1.00 0.00 ?  328 GLN A HB3  5  
ATOM 10277 H HG2  . GLN A 1 115 ? 3.148   8.523   -9.533  1.00 0.00 ?  328 GLN A HG2  5  
ATOM 10278 H HG3  . GLN A 1 115 ? 1.853   7.830   -8.576  1.00 0.00 ?  328 GLN A HG3  5  
ATOM 10279 H HE21 . GLN A 1 115 ? 1.561   5.955   -9.607  1.00 0.00 ?  328 GLN A HE21 5  
ATOM 10280 H HE22 . GLN A 1 115 ? 1.041   5.776   -11.250 1.00 0.00 ?  328 GLN A HE22 5  
ATOM 10281 N N    . MET A 1 116 ? -0.375  11.693  -7.447  1.00 0.00 ?  329 MET A N    5  
ATOM 10282 C CA   . MET A 1 116 ? -1.145  12.915  -7.293  1.00 0.00 ?  329 MET A CA   5  
ATOM 10283 C C    . MET A 1 116 ? -0.660  13.721  -6.086  1.00 0.00 ?  329 MET A C    5  
ATOM 10284 O O    . MET A 1 116 ? -0.522  14.941  -6.164  1.00 0.00 ?  329 MET A O    5  
ATOM 10285 C CB   . MET A 1 116 ? -2.624  12.568  -7.114  1.00 0.00 ?  329 MET A CB   5  
ATOM 10286 C CG   . MET A 1 116 ? -3.502  13.813  -7.261  1.00 0.00 ?  329 MET A CG   5  
ATOM 10287 S SD   . MET A 1 116 ? -3.636  14.654  -5.693  1.00 0.00 ?  329 MET A SD   5  
ATOM 10288 C CE   . MET A 1 116 ? -4.664  13.495  -4.806  1.00 0.00 ?  329 MET A CE   5  
ATOM 10289 H H    . MET A 1 116 ? -0.871  10.851  -7.234  1.00 0.00 ?  329 MET A H    5  
ATOM 10290 H HA   . MET A 1 116 ? -0.979  13.483  -8.208  1.00 0.00 ?  329 MET A HA   5  
ATOM 10291 H HB2  . MET A 1 116 ? -2.918  11.822  -7.852  1.00 0.00 ?  329 MET A HB2  5  
ATOM 10292 H HB3  . MET A 1 116 ? -2.781  12.123  -6.131  1.00 0.00 ?  329 MET A HB3  5  
ATOM 10293 H HG2  . MET A 1 116 ? -3.074  14.483  -8.007  1.00 0.00 ?  329 MET A HG2  5  
ATOM 10294 H HG3  . MET A 1 116 ? -4.492  13.530  -7.617  1.00 0.00 ?  329 MET A HG3  5  
ATOM 10295 H HE1  . MET A 1 116 ? -5.487  13.176  -5.446  1.00 0.00 ?  329 MET A HE1  5  
ATOM 10296 H HE2  . MET A 1 116 ? -4.069  12.628  -4.519  1.00 0.00 ?  329 MET A HE2  5  
ATOM 10297 H HE3  . MET A 1 116 ? -5.063  13.974  -3.912  1.00 0.00 ?  329 MET A HE3  5  
ATOM 10298 N N    . LEU A 1 117 ? -0.414  13.006  -4.998  1.00 0.00 ?  330 LEU A N    5  
ATOM 10299 C CA   . LEU A 1 117 ? 0.053   13.639  -3.776  1.00 0.00 ?  330 LEU A CA   5  
ATOM 10300 C C    . LEU A 1 117 ? 1.526   14.021  -3.936  1.00 0.00 ?  330 LEU A C    5  
ATOM 10301 O O    . LEU A 1 117 ? 1.982   15.006  -3.357  1.00 0.00 ?  330 LEU A O    5  
ATOM 10302 C CB   . LEU A 1 117 ? -0.222  12.740  -2.568  1.00 0.00 ?  330 LEU A CB   5  
ATOM 10303 C CG   . LEU A 1 117 ? -1.611  12.102  -2.510  1.00 0.00 ?  330 LEU A CG   5  
ATOM 10304 C CD1  . LEU A 1 117 ? -1.534  10.670  -1.976  1.00 0.00 ?  330 LEU A CD1  5  
ATOM 10305 C CD2  . LEU A 1 117 ? -2.578  12.966  -1.697  1.00 0.00 ?  330 LEU A CD2  5  
ATOM 10306 H H    . LEU A 1 117 ? -0.528  12.014  -4.943  1.00 0.00 ?  330 LEU A H    5  
ATOM 10307 H HA   . LEU A 1 117 ? -0.527  14.551  -3.638  1.00 0.00 ?  330 LEU A HA   5  
ATOM 10308 H HB2  . LEU A 1 117 ? 0.523   11.944  -2.556  1.00 0.00 ?  330 LEU A HB2  5  
ATOM 10309 H HB3  . LEU A 1 117 ? -0.075  13.328  -1.663  1.00 0.00 ?  330 LEU A HB3  5  
ATOM 10310 H HG   . LEU A 1 117 ? -2.004  12.046  -3.525  1.00 0.00 ?  330 LEU A HG   5  
ATOM 10311 H HD11 . LEU A 1 117 ? -1.052  10.672  -0.998  1.00 0.00 ?  330 LEU A HD11 5  
ATOM 10312 H HD12 . LEU A 1 117 ? -2.541  10.262  -1.884  1.00 0.00 ?  330 LEU A HD12 5  
ATOM 10313 H HD13 . LEU A 1 117 ? -0.955  10.056  -2.665  1.00 0.00 ?  330 LEU A HD13 5  
ATOM 10314 H HD21 . LEU A 1 117 ? -2.011  13.613  -1.028  1.00 0.00 ?  330 LEU A HD21 5  
ATOM 10315 H HD22 . LEU A 1 117 ? -3.176  13.576  -2.374  1.00 0.00 ?  330 LEU A HD22 5  
ATOM 10316 H HD23 . LEU A 1 117 ? -3.235  12.323  -1.111  1.00 0.00 ?  330 LEU A HD23 5  
ATOM 10317 N N    . CYS A 1 118 ? 2.230   13.222  -4.723  1.00 0.00 ?  331 CYS A N    5  
ATOM 10318 C CA   . CYS A 1 118 ? 3.642   13.464  -4.966  1.00 0.00 ?  331 CYS A CA   5  
ATOM 10319 C C    . CYS A 1 118 ? 3.768   14.647  -5.929  1.00 0.00 ?  331 CYS A C    5  
ATOM 10320 O O    . CYS A 1 118 ? 4.648   15.491  -5.769  1.00 0.00 ?  331 CYS A O    5  
ATOM 10321 C CB   . CYS A 1 118 ? 4.346   12.215  -5.502  1.00 0.00 ?  331 CYS A CB   5  
ATOM 10322 S SG   . CYS A 1 118 ? 4.983   11.211  -4.110  1.00 0.00 ?  331 CYS A SG   5  
ATOM 10323 H H    . CYS A 1 118 ? 1.852   12.422  -5.191  1.00 0.00 ?  331 CYS A H    5  
ATOM 10324 H HA   . CYS A 1 118 ? 4.089   13.701  -4.001  1.00 0.00 ?  331 CYS A HA   5  
ATOM 10325 H HB2  . CYS A 1 118 ? 3.653   11.625  -6.100  1.00 0.00 ?  331 CYS A HB2  5  
ATOM 10326 H HB3  . CYS A 1 118 ? 5.167   12.504  -6.158  1.00 0.00 ?  331 CYS A HB3  5  
ATOM 10327 H HG   . CYS A 1 118 ? 4.770   10.030  -4.683  1.00 0.00 ?  331 CYS A HG   5  
ATOM 10328 N N    . SER A 1 119 ? 2.874   14.670  -6.907  1.00 0.00 ?  332 SER A N    5  
ATOM 10329 C CA   . SER A 1 119 ? 2.874   15.735  -7.895  1.00 0.00 ?  332 SER A CA   5  
ATOM 10330 C C    . SER A 1 119 ? 2.408   17.044  -7.254  1.00 0.00 ?  332 SER A C    5  
ATOM 10331 O O    . SER A 1 119 ? 2.856   18.122  -7.640  1.00 0.00 ?  332 SER A O    5  
ATOM 10332 C CB   . SER A 1 119 ? 1.983   15.381  -9.087  1.00 0.00 ?  332 SER A CB   5  
ATOM 10333 O OG   . SER A 1 119 ? 2.070   16.352  -10.126 1.00 0.00 ?  332 SER A OG   5  
ATOM 10334 H H    . SER A 1 119 ? 2.162   13.980  -7.030  1.00 0.00 ?  332 SER A H    5  
ATOM 10335 H HA   . SER A 1 119 ? 3.909   15.820  -8.228  1.00 0.00 ?  332 SER A HA   5  
ATOM 10336 H HB2  . SER A 1 119 ? 2.272   14.405  -9.478  1.00 0.00 ?  332 SER A HB2  5  
ATOM 10337 H HB3  . SER A 1 119 ? 0.949   15.298  -8.754  1.00 0.00 ?  332 SER A HB3  5  
ATOM 10338 H HG   . SER A 1 119 ? 2.620   17.130  -9.822  1.00 0.00 ?  332 SER A HG   5  
ATOM 10339 N N    . SER A 1 120 ? 1.514   16.906  -6.286  1.00 0.00 ?  333 SER A N    5  
ATOM 10340 C CA   . SER A 1 120 ? 0.982   18.064  -5.588  1.00 0.00 ?  333 SER A CA   5  
ATOM 10341 C C    . SER A 1 120 ? 1.986   18.550  -4.540  1.00 0.00 ?  333 SER A C    5  
ATOM 10342 O O    . SER A 1 120 ? 2.114   19.751  -4.309  1.00 0.00 ?  333 SER A O    5  
ATOM 10343 C CB   . SER A 1 120 ? -0.359  17.740  -4.927  1.00 0.00 ?  333 SER A CB   5  
ATOM 10344 O OG   . SER A 1 120 ? -0.949  18.889  -4.324  1.00 0.00 ?  333 SER A OG   5  
ATOM 10345 H H    . SER A 1 120 ? 1.155   16.025  -5.978  1.00 0.00 ?  333 SER A H    5  
ATOM 10346 H HA   . SER A 1 120 ? 0.834   18.822  -6.357  1.00 0.00 ?  333 SER A HA   5  
ATOM 10347 H HB2  . SER A 1 120 ? -1.041  17.331  -5.673  1.00 0.00 ?  333 SER A HB2  5  
ATOM 10348 H HB3  . SER A 1 120 ? -0.214  16.968  -4.171  1.00 0.00 ?  333 SER A HB3  5  
ATOM 10349 H HG   . SER A 1 120 ? -1.587  18.610  -3.608  1.00 0.00 ?  333 SER A HG   5  
ATOM 10350 N N    . SER A 1 121 ? 2.673   17.592  -3.936  1.00 0.00 ?  334 SER A N    5  
ATOM 10351 C CA   . SER A 1 121 ? 3.661   17.907  -2.918  1.00 0.00 ?  334 SER A CA   5  
ATOM 10352 C C    . SER A 1 121 ? 4.984   17.209  -3.240  1.00 0.00 ?  334 SER A C    5  
ATOM 10353 O O    . SER A 1 121 ? 5.090   15.989  -3.126  1.00 0.00 ?  334 SER A O    5  
ATOM 10354 C CB   . SER A 1 121 ? 3.170   17.500  -1.528  1.00 0.00 ?  334 SER A CB   5  
ATOM 10355 O OG   . SER A 1 121 ? 2.483   18.563  -0.872  1.00 0.00 ?  334 SER A OG   5  
ATOM 10356 H H    . SER A 1 121 ? 2.563   16.617  -4.130  1.00 0.00 ?  334 SER A H    5  
ATOM 10357 H HA   . SER A 1 121 ? 3.781   18.990  -2.958  1.00 0.00 ?  334 SER A HA   5  
ATOM 10358 H HB2  . SER A 1 121 ? 2.507   16.639  -1.615  1.00 0.00 ?  334 SER A HB2  5  
ATOM 10359 H HB3  . SER A 1 121 ? 4.019   17.188  -0.920  1.00 0.00 ?  334 SER A HB3  5  
ATOM 10360 H HG   . SER A 1 121 ? 1.876   19.027  -1.517  1.00 0.00 ?  334 SER A HG   5  
ATOM 10361 N N    . PRO A 1 122 ? 5.986   18.035  -3.645  1.00 0.00 ?  335 PRO A N    5  
ATOM 10362 C CA   . PRO A 1 122 ? 7.298   17.509  -3.983  1.00 0.00 ?  335 PRO A CA   5  
ATOM 10363 C C    . PRO A 1 122 ? 8.077   17.125  -2.724  1.00 0.00 ?  335 PRO A C    5  
ATOM 10364 O O    . PRO A 1 122 ? 9.021   16.340  -2.788  1.00 0.00 ?  335 PRO A O    5  
ATOM 10365 C CB   . PRO A 1 122 ? 7.970   18.613  -4.784  1.00 0.00 ?  335 PRO A CB   5  
ATOM 10366 C CG   . PRO A 1 122 ? 7.198   19.884  -4.469  1.00 0.00 ?  335 PRO A CG   5  
ATOM 10367 C CD   . PRO A 1 122 ? 5.897   19.484  -3.791  1.00 0.00 ?  335 PRO A CD   5  
ATOM 10368 H HA   . PRO A 1 122 ? 7.208   16.667  -4.516  1.00 0.00 ?  335 PRO A HA   5  
ATOM 10369 H HB2  . PRO A 1 122 ? 9.018   18.714  -4.505  1.00 0.00 ?  335 PRO A HB2  5  
ATOM 10370 H HB3  . PRO A 1 122 ? 7.943   18.393  -5.851  1.00 0.00 ?  335 PRO A HB3  5  
ATOM 10371 H HG2  . PRO A 1 122 ? 7.783   20.535  -3.820  1.00 0.00 ?  335 PRO A HG2  5  
ATOM 10372 H HG3  . PRO A 1 122 ? 6.995   20.444  -5.383  1.00 0.00 ?  335 PRO A HG3  5  
ATOM 10373 H HD2  . PRO A 1 122 ? 5.789   19.974  -2.823  1.00 0.00 ?  335 PRO A HD2  5  
ATOM 10374 H HD3  . PRO A 1 122 ? 5.034   19.770  -4.391  1.00 0.00 ?  335 PRO A HD3  5  
ATOM 10375 N N    . GLU A 1 123 ? 7.651   17.697  -1.607  1.00 0.00 ?  336 GLU A N    5  
ATOM 10376 C CA   . GLU A 1 123 ? 8.297   17.424  -0.334  1.00 0.00 ?  336 GLU A CA   5  
ATOM 10377 C C    . GLU A 1 123 ? 8.086   15.963  0.067   1.00 0.00 ?  336 GLU A C    5  
ATOM 10378 O O    . GLU A 1 123 ? 8.981   15.333  0.628   1.00 0.00 ?  336 GLU A O    5  
ATOM 10379 C CB   . GLU A 1 123 ? 7.785   18.370  0.754   1.00 0.00 ?  336 GLU A CB   5  
ATOM 10380 C CG   . GLU A 1 123 ? 8.938   19.148  1.392   1.00 0.00 ?  336 GLU A CG   5  
ATOM 10381 C CD   . GLU A 1 123 ? 8.507   19.779  2.718   1.00 0.00 ?  336 GLU A CD   5  
ATOM 10382 O OE1  . GLU A 1 123 ? 7.334   20.148  2.876   1.00 0.00 ?  336 GLU A OE1  5  
ATOM 10383 O OE2  . GLU A 1 123 ? 9.440   19.880  3.602   1.00 0.00 -1 336 GLU A OE2  5  
ATOM 10384 H H    . GLU A 1 123 ? 6.882   18.334  -1.562  1.00 0.00 ?  336 GLU A H    5  
ATOM 10385 H HA   . GLU A 1 123 ? 9.357   17.613  -0.501  1.00 0.00 ?  336 GLU A HA   5  
ATOM 10386 H HB2  . GLU A 1 123 ? 7.064   19.067  0.326   1.00 0.00 ?  336 GLU A HB2  5  
ATOM 10387 H HB3  . GLU A 1 123 ? 7.259   17.799  1.520   1.00 0.00 ?  336 GLU A HB3  5  
ATOM 10388 H HG2  . GLU A 1 123 ? 9.783   18.480  1.560   1.00 0.00 ?  336 GLU A HG2  5  
ATOM 10389 H HG3  . GLU A 1 123 ? 9.278   19.926  0.709   1.00 0.00 ?  336 GLU A HG3  5  
ATOM 10390 H HE2  . GLU A 1 123 ? 10.304  20.124  3.162   1.00 0.00 ?  336 GLU A HE2  5  
ATOM 10391 N N    . ILE A 1 124 ? 6.896   15.465  -0.237  1.00 0.00 ?  337 ILE A N    5  
ATOM 10392 C CA   . ILE A 1 124 ? 6.556   14.089  0.084   1.00 0.00 ?  337 ILE A CA   5  
ATOM 10393 C C    . ILE A 1 124 ? 7.246   13.153  -0.910  1.00 0.00 ?  337 ILE A C    5  
ATOM 10394 O O    . ILE A 1 124 ? 7.785   12.118  -0.521  1.00 0.00 ?  337 ILE A O    5  
ATOM 10395 C CB   . ILE A 1 124 ? 5.037   13.913  0.142   1.00 0.00 ?  337 ILE A CB   5  
ATOM 10396 C CG1  . ILE A 1 124 ? 4.444   14.660  1.338   1.00 0.00 ?  337 ILE A CG1  5  
ATOM 10397 C CG2  . ILE A 1 124 ? 4.657   12.431  0.147   1.00 0.00 ?  337 ILE A CG2  5  
ATOM 10398 C CD1  . ILE A 1 124 ? 2.915   14.629  1.300   1.00 0.00 ?  337 ILE A CD1  5  
ATOM 10399 H H    . ILE A 1 124 ? 6.173   15.984  -0.694  1.00 0.00 ?  337 ILE A H    5  
ATOM 10400 H HA   . ILE A 1 124 ? 6.943   13.881  1.081   1.00 0.00 ?  337 ILE A HA   5  
ATOM 10401 H HB   . ILE A 1 124 ? 4.607   14.352  -0.758  1.00 0.00 ?  337 ILE A HB   5  
ATOM 10402 H HG12 . ILE A 1 124 ? 4.798   14.209  2.265   1.00 0.00 ?  337 ILE A HG12 5  
ATOM 10403 H HG13 . ILE A 1 124 ? 4.790   15.694  1.334   1.00 0.00 ?  337 ILE A HG13 5  
ATOM 10404 H HG21 . ILE A 1 124 ? 3.628   12.320  0.488   1.00 0.00 ?  337 ILE A HG21 5  
ATOM 10405 H HG22 . ILE A 1 124 ? 4.750   12.028  -0.862  1.00 0.00 ?  337 ILE A HG22 5  
ATOM 10406 H HG23 . ILE A 1 124 ? 5.323   11.887  0.817   1.00 0.00 ?  337 ILE A HG23 5  
ATOM 10407 H HD11 . ILE A 1 124 ? 2.584   14.057  0.433   1.00 0.00 ?  337 ILE A HD11 5  
ATOM 10408 H HD12 . ILE A 1 124 ? 2.538   14.161  2.210   1.00 0.00 ?  337 ILE A HD12 5  
ATOM 10409 H HD13 . ILE A 1 124 ? 2.532   15.647  1.231   1.00 0.00 ?  337 ILE A HD13 5  
ATOM 10410 N N    . ALA A 1 125 ? 7.208   13.550  -2.174  1.00 0.00 ?  338 ALA A N    5  
ATOM 10411 C CA   . ALA A 1 125 ? 7.823   12.759  -3.226  1.00 0.00 ?  338 ALA A CA   5  
ATOM 10412 C C    . ALA A 1 125 ? 9.336   12.715  -3.007  1.00 0.00 ?  338 ALA A C    5  
ATOM 10413 O O    . ALA A 1 125 ? 9.951   11.655  -3.107  1.00 0.00 ?  338 ALA A O    5  
ATOM 10414 C CB   . ALA A 1 125 ? 7.447   13.343  -4.589  1.00 0.00 ?  338 ALA A CB   5  
ATOM 10415 H H    . ALA A 1 125 ? 6.768   14.393  -2.481  1.00 0.00 ?  338 ALA A H    5  
ATOM 10416 H HA   . ALA A 1 125 ? 7.425   11.747  -3.156  1.00 0.00 ?  338 ALA A HA   5  
ATOM 10417 H HB1  . ALA A 1 125 ? 6.475   13.830  -4.521  1.00 0.00 ?  338 ALA A HB1  5  
ATOM 10418 H HB2  . ALA A 1 125 ? 8.199   14.072  -4.891  1.00 0.00 ?  338 ALA A HB2  5  
ATOM 10419 H HB3  . ALA A 1 125 ? 7.401   12.542  -5.327  1.00 0.00 ?  338 ALA A HB3  5  
ATOM 10420 N N    . GLU A 1 126 ? 9.893   13.881  -2.711  1.00 0.00 ?  339 GLU A N    5  
ATOM 10421 C CA   . GLU A 1 126 ? 11.323  13.989  -2.477  1.00 0.00 ?  339 GLU A CA   5  
ATOM 10422 C C    . GLU A 1 126 ? 11.704  13.276  -1.178  1.00 0.00 ?  339 GLU A C    5  
ATOM 10423 O O    . GLU A 1 126 ? 12.792  12.713  -1.071  1.00 0.00 ?  339 GLU A O    5  
ATOM 10424 C CB   . GLU A 1 126 ? 11.764  15.454  -2.448  1.00 0.00 ?  339 GLU A CB   5  
ATOM 10425 C CG   . GLU A 1 126 ? 11.504  16.078  -1.075  1.00 0.00 ?  339 GLU A CG   5  
ATOM 10426 C CD   . GLU A 1 126 ? 11.978  17.532  -1.035  1.00 0.00 ?  339 GLU A CD   5  
ATOM 10427 O OE1  . GLU A 1 126 ? 11.829  18.260  -2.027  1.00 0.00 ?  339 GLU A OE1  5  
ATOM 10428 O OE2  . GLU A 1 126 ? 12.518  17.898  0.078   1.00 0.00 -1 339 GLU A OE2  5  
ATOM 10429 H H    . GLU A 1 126 ? 9.386   14.739  -2.632  1.00 0.00 ?  339 GLU A H    5  
ATOM 10430 H HA   . GLU A 1 126 ? 11.794  13.491  -3.325  1.00 0.00 ?  339 GLU A HA   5  
ATOM 10431 H HB2  . GLU A 1 126 ? 12.826  15.522  -2.687  1.00 0.00 ?  339 GLU A HB2  5  
ATOM 10432 H HB3  . GLU A 1 126 ? 11.229  16.014  -3.214  1.00 0.00 ?  339 GLU A HB3  5  
ATOM 10433 H HG2  . GLU A 1 126 ? 10.439  16.032  -0.848  1.00 0.00 ?  339 GLU A HG2  5  
ATOM 10434 H HG3  . GLU A 1 126 ? 12.019  15.502  -0.306  1.00 0.00 ?  339 GLU A HG3  5  
ATOM 10435 H HE2  . GLU A 1 126 ? 12.212  18.819  0.319   1.00 0.00 ?  339 GLU A HE2  5  
ATOM 10436 N N    . ILE A 1 127 ? 10.786  13.323  -0.224  1.00 0.00 ?  340 ILE A N    5  
ATOM 10437 C CA   . ILE A 1 127 ? 11.012  12.688  1.063   1.00 0.00 ?  340 ILE A CA   5  
ATOM 10438 C C    . ILE A 1 127 ? 10.984  11.168  0.890   1.00 0.00 ?  340 ILE A C    5  
ATOM 10439 O O    . ILE A 1 127 ? 11.791  10.457  1.486   1.00 0.00 ?  340 ILE A O    5  
ATOM 10440 C CB   . ILE A 1 127 ? 10.012  13.206  2.099   1.00 0.00 ?  340 ILE A CB   5  
ATOM 10441 C CG1  . ILE A 1 127 ? 10.460  14.556  2.666   1.00 0.00 ?  340 ILE A CG1  5  
ATOM 10442 C CG2  . ILE A 1 127 ? 9.778   12.172  3.202   1.00 0.00 ?  340 ILE A CG2  5  
ATOM 10443 C CD1  . ILE A 1 127 ? 9.312   15.248  3.404   1.00 0.00 ?  340 ILE A CD1  5  
ATOM 10444 H H    . ILE A 1 127 ? 9.903   13.783  -0.319  1.00 0.00 ?  340 ILE A H    5  
ATOM 10445 H HA   . ILE A 1 127 ? 12.006  12.979  1.401   1.00 0.00 ?  340 ILE A HA   5  
ATOM 10446 H HB   . ILE A 1 127 ? 9.056   13.367  1.601   1.00 0.00 ?  340 ILE A HB   5  
ATOM 10447 H HG12 . ILE A 1 127 ? 11.299  14.409  3.345   1.00 0.00 ?  340 ILE A HG12 5  
ATOM 10448 H HG13 . ILE A 1 127 ? 10.813  15.194  1.856   1.00 0.00 ?  340 ILE A HG13 5  
ATOM 10449 H HG21 . ILE A 1 127 ? 9.109   11.394  2.834   1.00 0.00 ?  340 ILE A HG21 5  
ATOM 10450 H HG22 . ILE A 1 127 ? 10.730  11.726  3.489   1.00 0.00 ?  340 ILE A HG22 5  
ATOM 10451 H HG23 . ILE A 1 127 ? 9.329   12.658  4.067   1.00 0.00 ?  340 ILE A HG23 5  
ATOM 10452 H HD11 . ILE A 1 127 ? 8.448   14.585  3.435   1.00 0.00 ?  340 ILE A HD11 5  
ATOM 10453 H HD12 . ILE A 1 127 ? 9.625   15.484  4.421   1.00 0.00 ?  340 ILE A HD12 5  
ATOM 10454 H HD13 . ILE A 1 127 ? 9.047   16.168  2.883   1.00 0.00 ?  340 ILE A HD13 5  
ATOM 10455 N N    . PHE A 1 128 ? 10.047  10.715  0.070   1.00 0.00 ?  341 PHE A N    5  
ATOM 10456 C CA   . PHE A 1 128 ? 9.904   9.293   -0.190  1.00 0.00 ?  341 PHE A CA   5  
ATOM 10457 C C    . PHE A 1 128 ? 11.088  8.761   -1.000  1.00 0.00 ?  341 PHE A C    5  
ATOM 10458 O O    . PHE A 1 128 ? 11.521  7.627   -0.803  1.00 0.00 ?  341 PHE A O    5  
ATOM 10459 C CB   . PHE A 1 128 ? 8.622   9.114   -1.006  1.00 0.00 ?  341 PHE A CB   5  
ATOM 10460 C CG   . PHE A 1 128 ? 7.882   7.805   -0.723  1.00 0.00 ?  341 PHE A CG   5  
ATOM 10461 C CD1  . PHE A 1 128 ? 8.189   6.684   -1.428  1.00 0.00 ?  341 PHE A CD1  5  
ATOM 10462 C CD2  . PHE A 1 128 ? 6.916   7.763   0.234   1.00 0.00 ?  341 PHE A CD2  5  
ATOM 10463 C CE1  . PHE A 1 128 ? 7.502   5.469   -1.165  1.00 0.00 ?  341 PHE A CE1  5  
ATOM 10464 C CE2  . PHE A 1 128 ? 6.229   6.549   0.497   1.00 0.00 ?  341 PHE A CE2  5  
ATOM 10465 C CZ   . PHE A 1 128 ? 6.536   5.427   -0.208  1.00 0.00 ?  341 PHE A CZ   5  
ATOM 10466 H H    . PHE A 1 128 ? 9.395   11.300  -0.411  1.00 0.00 ?  341 PHE A H    5  
ATOM 10467 H HA   . PHE A 1 128 ? 9.872   8.789   0.776   1.00 0.00 ?  341 PHE A HA   5  
ATOM 10468 H HB2  . PHE A 1 128 ? 7.953   9.950   -0.800  1.00 0.00 ?  341 PHE A HB2  5  
ATOM 10469 H HB3  . PHE A 1 128 ? 8.870   9.157   -2.067  1.00 0.00 ?  341 PHE A HB3  5  
ATOM 10470 H HD1  . PHE A 1 128 ? 8.963   6.717   -2.195  1.00 0.00 ?  341 PHE A HD1  5  
ATOM 10471 H HD2  . PHE A 1 128 ? 6.670   8.662   0.799   1.00 0.00 ?  341 PHE A HD2  5  
ATOM 10472 H HE1  . PHE A 1 128 ? 7.748   4.570   -1.730  1.00 0.00 ?  341 PHE A HE1  5  
ATOM 10473 H HE2  . PHE A 1 128 ? 5.455   6.515   1.264   1.00 0.00 ?  341 PHE A HE2  5  
ATOM 10474 H HZ   . PHE A 1 128 ? 6.009   4.495   -0.006  1.00 0.00 ?  341 PHE A HZ   5  
ATOM 10475 N N    . ARG A 1 129 ? 11.579  9.607   -1.894  1.00 0.00 ?  342 ARG A N    5  
ATOM 10476 C CA   . ARG A 1 129 ? 12.705  9.237   -2.735  1.00 0.00 ?  342 ARG A CA   5  
ATOM 10477 C C    . ARG A 1 129 ? 13.986  9.155   -1.902  1.00 0.00 ?  342 ARG A C    5  
ATOM 10478 O O    . ARG A 1 129 ? 14.814  8.271   -2.115  1.00 0.00 ?  342 ARG A O    5  
ATOM 10479 C CB   . ARG A 1 129 ? 12.904  10.248  -3.866  1.00 0.00 ?  342 ARG A CB   5  
ATOM 10480 C CG   . ARG A 1 129 ? 14.153  9.916   -4.685  1.00 0.00 ?  342 ARG A CG   5  
ATOM 10481 C CD   . ARG A 1 129 ? 13.982  10.344  -6.144  1.00 0.00 ?  342 ARG A CD   5  
ATOM 10482 N NE   . ARG A 1 129 ? 15.027  9.714   -6.982  1.00 0.00 ?  342 ARG A NE   5  
ATOM 10483 C CZ   . ARG A 1 129 ? 16.261  10.210  -7.143  1.00 0.00 ?  342 ARG A CZ   5  
ATOM 10484 N NH1  . ARG A 1 129 ? 16.613  11.346  -6.525  1.00 0.00 ?  342 ARG A NH1  5  
ATOM 10485 N NH2  . ARG A 1 129 ? 17.144  9.571   -7.923  1.00 0.00 1  342 ARG A NH2  5  
ATOM 10486 H H    . ARG A 1 129 ? 11.222  10.528  -2.048  1.00 0.00 ?  342 ARG A H    5  
ATOM 10487 H HA   . ARG A 1 129 ? 12.440  8.261   -3.143  1.00 0.00 ?  342 ARG A HA   5  
ATOM 10488 H HB2  . ARG A 1 129 ? 12.028  10.248  -4.516  1.00 0.00 ?  342 ARG A HB2  5  
ATOM 10489 H HB3  . ARG A 1 129 ? 12.993  11.251  -3.450  1.00 0.00 ?  342 ARG A HB3  5  
ATOM 10490 H HG2  . ARG A 1 129 ? 15.019  10.418  -4.253  1.00 0.00 ?  342 ARG A HG2  5  
ATOM 10491 H HG3  . ARG A 1 129 ? 14.350  8.845   -4.637  1.00 0.00 ?  342 ARG A HG3  5  
ATOM 10492 H HD2  . ARG A 1 129 ? 12.994  10.057  -6.502  1.00 0.00 ?  342 ARG A HD2  5  
ATOM 10493 H HD3  . ARG A 1 129 ? 14.047  11.430  -6.223  1.00 0.00 ?  342 ARG A HD3  5  
ATOM 10494 H HE   . ARG A 1 129 ? 14.797  8.865   -7.457  1.00 0.00 ?  342 ARG A HE   5  
ATOM 10495 H HH11 . ARG A 1 129 ? 15.954  11.823  -5.943  1.00 0.00 ?  342 ARG A HH11 5  
ATOM 10496 H HH12 . ARG A 1 129 ? 17.534  11.716  -6.645  1.00 0.00 ?  342 ARG A HH12 5  
ATOM 10497 H HH21 . ARG A 1 129 ? 16.881  8.723   -8.384  1.00 0.00 ?  342 ARG A HH21 5  
ATOM 10498 H HH22 . ARG A 1 129 ? 18.065  9.941   -8.043  1.00 0.00 ?  342 ARG A HH22 5  
ATOM 10499 N N    . LYS A 1 130 ? 14.108  10.090  -0.971  1.00 0.00 ?  343 LYS A N    5  
ATOM 10500 C CA   . LYS A 1 130 ? 15.274  10.135  -0.104  1.00 0.00 ?  343 LYS A CA   5  
ATOM 10501 C C    . LYS A 1 130 ? 15.296  8.887   0.780   1.00 0.00 ?  343 LYS A C    5  
ATOM 10502 O O    . LYS A 1 130 ? 16.308  8.192   0.854   1.00 0.00 ?  343 LYS A O    5  
ATOM 10503 C CB   . LYS A 1 130 ? 15.305  11.447  0.683   1.00 0.00 ?  343 LYS A CB   5  
ATOM 10504 C CG   . LYS A 1 130 ? 16.399  12.377  0.154   1.00 0.00 ?  343 LYS A CG   5  
ATOM 10505 C CD   . LYS A 1 130 ? 15.832  13.367  -0.866  1.00 0.00 ?  343 LYS A CD   5  
ATOM 10506 C CE   . LYS A 1 130 ? 15.114  14.523  -0.167  1.00 0.00 ?  343 LYS A CE   5  
ATOM 10507 N NZ   . LYS A 1 130 ? 15.666  15.821  -0.612  1.00 0.00 1  343 LYS A NZ   5  
ATOM 10508 H H    . LYS A 1 130 ? 13.429  10.805  -0.804  1.00 0.00 ?  343 LYS A H    5  
ATOM 10509 H HA   . LYS A 1 130 ? 16.156  10.122  -0.744  1.00 0.00 ?  343 LYS A HA   5  
ATOM 10510 H HB2  . LYS A 1 130 ? 14.337  11.942  0.612   1.00 0.00 ?  343 LYS A HB2  5  
ATOM 10511 H HB3  . LYS A 1 130 ? 15.480  11.238  1.738   1.00 0.00 ?  343 LYS A HB3  5  
ATOM 10512 H HG2  . LYS A 1 130 ? 16.850  12.922  0.984   1.00 0.00 ?  343 LYS A HG2  5  
ATOM 10513 H HG3  . LYS A 1 130 ? 17.191  11.787  -0.307  1.00 0.00 ?  343 LYS A HG3  5  
ATOM 10514 H HD2  . LYS A 1 130 ? 16.639  13.757  -1.486  1.00 0.00 ?  343 LYS A HD2  5  
ATOM 10515 H HD3  . LYS A 1 130 ? 15.139  12.852  -1.531  1.00 0.00 ?  343 LYS A HD3  5  
ATOM 10516 H HE2  . LYS A 1 130 ? 14.046  14.480  -0.386  1.00 0.00 ?  343 LYS A HE2  5  
ATOM 10517 H HE3  . LYS A 1 130 ? 15.221  14.426  0.913   1.00 0.00 ?  343 LYS A HE3  5  
ATOM 10518 H HZ1  . LYS A 1 130 ? 15.423  15.976  -1.570  1.00 0.00 ?  343 LYS A HZ1  5  
ATOM 10519 H HZ2  . LYS A 1 130 ? 15.287  16.555  -0.049  1.00 0.00 ?  343 LYS A HZ2  5  
ATOM 10520 H HZ3  . LYS A 1 130 ? 16.662  15.810  -0.518  1.00 0.00 ?  343 LYS A HZ3  5  
ATOM 10521 N N    . THR A 1 131 ? 14.167  8.640   1.428   1.00 0.00 ?  344 THR A N    5  
ATOM 10522 C CA   . THR A 1 131 ? 14.044  7.487   2.304   1.00 0.00 ?  344 THR A CA   5  
ATOM 10523 C C    . THR A 1 131 ? 14.062  6.193   1.489   1.00 0.00 ?  344 THR A C    5  
ATOM 10524 O O    . THR A 1 131 ? 14.566  5.170   1.951   1.00 0.00 ?  344 THR A O    5  
ATOM 10525 C CB   . THR A 1 131 ? 12.774  7.661   3.139   1.00 0.00 ?  344 THR A CB   5  
ATOM 10526 O OG1  . THR A 1 131 ? 12.812  6.573   4.059   1.00 0.00 ?  344 THR A OG1  5  
ATOM 10527 C CG2  . THR A 1 131 ? 11.501  7.418   2.326   1.00 0.00 ?  344 THR A CG2  5  
ATOM 10528 H H    . THR A 1 131 ? 13.348  9.210   1.362   1.00 0.00 ?  344 THR A H    5  
ATOM 10529 H HA   . THR A 1 131 ? 14.912  7.462   2.963   1.00 0.00 ?  344 THR A HA   5  
ATOM 10530 H HB   . THR A 1 131 ? 12.752  8.642   3.614   1.00 0.00 ?  344 THR A HB   5  
ATOM 10531 H HG1  . THR A 1 131 ? 13.511  6.737   4.754   1.00 0.00 ?  344 THR A HG1  5  
ATOM 10532 H HG21 . THR A 1 131 ? 11.382  6.350   2.148   1.00 0.00 ?  344 THR A HG21 5  
ATOM 10533 H HG22 . THR A 1 131 ? 10.640  7.792   2.880   1.00 0.00 ?  344 THR A HG22 5  
ATOM 10534 H HG23 . THR A 1 131 ? 11.574  7.940   1.372   1.00 0.00 ?  344 THR A HG23 5  
ATOM 10535 N N    . ALA A 1 132 ? 13.507  6.279   0.289   1.00 0.00 ?  345 ALA A N    5  
ATOM 10536 C CA   . ALA A 1 132 ? 13.453  5.128   -0.596  1.00 0.00 ?  345 ALA A CA   5  
ATOM 10537 C C    . ALA A 1 132 ? 14.863  4.808   -1.096  1.00 0.00 ?  345 ALA A C    5  
ATOM 10538 O O    . ALA A 1 132 ? 15.218  3.642   -1.260  1.00 0.00 ?  345 ALA A O    5  
ATOM 10539 C CB   . ALA A 1 132 ? 12.478  5.409   -1.741  1.00 0.00 ?  345 ALA A CB   5  
ATOM 10540 H H    . ALA A 1 132 ? 13.100  7.115   -0.080  1.00 0.00 ?  345 ALA A H    5  
ATOM 10541 H HA   . ALA A 1 132 ? 13.081  4.282   -0.017  1.00 0.00 ?  345 ALA A HA   5  
ATOM 10542 H HB1  . ALA A 1 132 ? 12.743  6.351   -2.221  1.00 0.00 ?  345 ALA A HB1  5  
ATOM 10543 H HB2  . ALA A 1 132 ? 12.533  4.601   -2.471  1.00 0.00 ?  345 ALA A HB2  5  
ATOM 10544 H HB3  . ALA A 1 132 ? 11.464  5.474   -1.346  1.00 0.00 ?  345 ALA A HB3  5  
ATOM 10545 N N    . LEU A 1 133 ? 15.630  5.865   -1.324  1.00 0.00 ?  346 LEU A N    5  
ATOM 10546 C CA   . LEU A 1 133 ? 16.993  5.711   -1.802  1.00 0.00 ?  346 LEU A CA   5  
ATOM 10547 C C    . LEU A 1 133 ? 17.853  5.104   -0.692  1.00 0.00 ?  346 LEU A C    5  
ATOM 10548 O O    . LEU A 1 133 ? 18.690  4.241   -0.951  1.00 0.00 ?  346 LEU A O    5  
ATOM 10549 C CB   . LEU A 1 133 ? 17.527  7.042   -2.336  1.00 0.00 ?  346 LEU A CB   5  
ATOM 10550 C CG   . LEU A 1 133 ? 17.197  7.360   -3.796  1.00 0.00 ?  346 LEU A CG   5  
ATOM 10551 C CD1  . LEU A 1 133 ? 17.948  8.606   -4.269  1.00 0.00 ?  346 LEU A CD1  5  
ATOM 10552 C CD2  . LEU A 1 133 ? 17.467  6.152   -4.695  1.00 0.00 ?  346 LEU A CD2  5  
ATOM 10553 H H    . LEU A 1 133 ? 15.334  6.810   -1.188  1.00 0.00 ?  346 LEU A H    5  
ATOM 10554 H HA   . LEU A 1 133 ? 16.969  5.014   -2.640  1.00 0.00 ?  346 LEU A HA   5  
ATOM 10555 H HB2  . LEU A 1 133 ? 17.134  7.845   -1.712  1.00 0.00 ?  346 LEU A HB2  5  
ATOM 10556 H HB3  . LEU A 1 133 ? 18.610  7.049   -2.219  1.00 0.00 ?  346 LEU A HB3  5  
ATOM 10557 H HG   . LEU A 1 133 ? 16.132  7.581   -3.865  1.00 0.00 ?  346 LEU A HG   5  
ATOM 10558 H HD11 . LEU A 1 133 ? 17.845  8.704   -5.349  1.00 0.00 ?  346 LEU A HD11 5  
ATOM 10559 H HD12 . LEU A 1 133 ? 17.532  9.488   -3.782  1.00 0.00 ?  346 LEU A HD12 5  
ATOM 10560 H HD13 . LEU A 1 133 ? 19.003  8.514   -4.011  1.00 0.00 ?  346 LEU A HD13 5  
ATOM 10561 H HD21 . LEU A 1 133 ? 16.623  5.464   -4.642  1.00 0.00 ?  346 LEU A HD21 5  
ATOM 10562 H HD22 . LEU A 1 133 ? 17.599  6.487   -5.723  1.00 0.00 ?  346 LEU A HD22 5  
ATOM 10563 H HD23 . LEU A 1 133 ? 18.371  5.644   -4.359  1.00 0.00 ?  346 LEU A HD23 5  
ATOM 10564 N N    . GLU A 1 134 ? 17.617  5.580   0.522   1.00 0.00 ?  347 GLU A N    5  
ATOM 10565 C CA   . GLU A 1 134 ? 18.360  5.095   1.673   1.00 0.00 ?  347 GLU A CA   5  
ATOM 10566 C C    . GLU A 1 134 ? 17.985  3.643   1.974   1.00 0.00 ?  347 GLU A C    5  
ATOM 10567 O O    . GLU A 1 134 ? 18.825  2.859   2.415   1.00 0.00 ?  347 GLU A O    5  
ATOM 10568 C CB   . GLU A 1 134 ? 18.123  5.986   2.894   1.00 0.00 ?  347 GLU A CB   5  
ATOM 10569 C CG   . GLU A 1 134 ? 19.076  7.183   2.893   1.00 0.00 ?  347 GLU A CG   5  
ATOM 10570 C CD   . GLU A 1 134 ? 20.189  6.998   3.927   1.00 0.00 ?  347 GLU A CD   5  
ATOM 10571 O OE1  . GLU A 1 134 ? 20.919  5.997   3.881   1.00 0.00 ?  347 GLU A OE1  5  
ATOM 10572 O OE2  . GLU A 1 134 ? 20.281  7.942   4.802   1.00 0.00 -1 347 GLU A OE2  5  
ATOM 10573 H H    . GLU A 1 134 ? 16.934  6.282   0.725   1.00 0.00 ?  347 GLU A H    5  
ATOM 10574 H HA   . GLU A 1 134 ? 19.410  5.154   1.386   1.00 0.00 ?  347 GLU A HA   5  
ATOM 10575 H HB2  . GLU A 1 134 ? 17.091  6.339   2.896   1.00 0.00 ?  347 GLU A HB2  5  
ATOM 10576 H HB3  . GLU A 1 134 ? 18.263  5.406   3.806   1.00 0.00 ?  347 GLU A HB3  5  
ATOM 10577 H HG2  . GLU A 1 134 ? 19.513  7.303   1.901   1.00 0.00 ?  347 GLU A HG2  5  
ATOM 10578 H HG3  . GLU A 1 134 ? 18.521  8.095   3.110   1.00 0.00 ?  347 GLU A HG3  5  
ATOM 10579 H HE2  . GLU A 1 134 ? 20.894  8.658   4.469   1.00 0.00 ?  347 GLU A HE2  5  
ATOM 10580 N N    . ARG A 1 135 ? 16.723  3.327   1.723   1.00 0.00 ?  348 ARG A N    5  
ATOM 10581 C CA   . ARG A 1 135 ? 16.226  1.982   1.961   1.00 0.00 ?  348 ARG A CA   5  
ATOM 10582 C C    . ARG A 1 135 ? 16.767  1.021   0.900   1.00 0.00 ?  348 ARG A C    5  
ATOM 10583 O O    . ARG A 1 135 ? 17.174  -0.095  1.218   1.00 0.00 ?  348 ARG A O    5  
ATOM 10584 C CB   . ARG A 1 135 ? 14.697  1.948   1.938   1.00 0.00 ?  348 ARG A CB   5  
ATOM 10585 C CG   . ARG A 1 135 ? 14.122  2.205   3.333   1.00 0.00 ?  348 ARG A CG   5  
ATOM 10586 C CD   . ARG A 1 135 ? 12.597  2.087   3.328   1.00 0.00 ?  348 ARG A CD   5  
ATOM 10587 N NE   . ARG A 1 135 ? 12.027  2.841   4.467   1.00 0.00 ?  348 ARG A NE   5  
ATOM 10588 C CZ   . ARG A 1 135 ? 12.159  2.477   5.750   1.00 0.00 ?  348 ARG A CZ   5  
ATOM 10589 N NH1  . ARG A 1 135 ? 12.843  1.368   6.064   1.00 0.00 ?  348 ARG A NH1  5  
ATOM 10590 N NH2  . ARG A 1 135 ? 11.609  3.221   6.718   1.00 0.00 1  348 ARG A NH2  5  
ATOM 10591 H H    . ARG A 1 135 ? 16.046  3.970   1.364   1.00 0.00 ?  348 ARG A H    5  
ATOM 10592 H HA   . ARG A 1 135 ? 16.596  1.720   2.952   1.00 0.00 ?  348 ARG A HA   5  
ATOM 10593 H HB2  . ARG A 1 135 ? 14.323  2.699   1.243   1.00 0.00 ?  348 ARG A HB2  5  
ATOM 10594 H HB3  . ARG A 1 135 ? 14.357  0.978   1.574   1.00 0.00 ?  348 ARG A HB3  5  
ATOM 10595 H HG2  . ARG A 1 135 ? 14.543  1.491   4.041   1.00 0.00 ?  348 ARG A HG2  5  
ATOM 10596 H HG3  . ARG A 1 135 ? 14.413  3.199   3.672   1.00 0.00 ?  348 ARG A HG3  5  
ATOM 10597 H HD2  . ARG A 1 135 ? 12.197  2.473   2.390   1.00 0.00 ?  348 ARG A HD2  5  
ATOM 10598 H HD3  . ARG A 1 135 ? 12.304  1.039   3.391   1.00 0.00 ?  348 ARG A HD3  5  
ATOM 10599 H HE   . ARG A 1 135 ? 11.511  3.674   4.267   1.00 0.00 ?  348 ARG A HE   5  
ATOM 10600 H HH11 . ARG A 1 135 ? 13.254  0.812   5.342   1.00 0.00 ?  348 ARG A HH11 5  
ATOM 10601 H HH12 . ARG A 1 135 ? 12.942  1.096   7.021   1.00 0.00 ?  348 ARG A HH12 5  
ATOM 10602 H HH21 . ARG A 1 135 ? 11.098  4.049   6.483   1.00 0.00 ?  348 ARG A HH21 5  
ATOM 10603 H HH22 . ARG A 1 135 ? 11.707  2.950   7.675   1.00 0.00 ?  348 ARG A HH22 5  
ATOM 10604 N N    . ARG A 1 136 ? 16.753  1.490   -0.339  1.00 0.00 ?  349 ARG A N    5  
ATOM 10605 C CA   . ARG A 1 136 ? 17.237  0.685   -1.449  1.00 0.00 ?  349 ARG A CA   5  
ATOM 10606 C C    . ARG A 1 136 ? 18.752  0.498   -1.347  1.00 0.00 ?  349 ARG A C    5  
ATOM 10607 O O    . ARG A 1 136 ? 19.268  -0.582  -1.633  1.00 0.00 ?  349 ARG A O    5  
ATOM 10608 C CB   . ARG A 1 136 ? 16.899  1.339   -2.790  1.00 0.00 ?  349 ARG A CB   5  
ATOM 10609 C CG   . ARG A 1 136 ? 17.718  0.718   -3.924  1.00 0.00 ?  349 ARG A CG   5  
ATOM 10610 C CD   . ARG A 1 136 ? 17.509  -0.797  -3.985  1.00 0.00 ?  349 ARG A CD   5  
ATOM 10611 N NE   . ARG A 1 136 ? 17.437  -1.241  -5.395  1.00 0.00 ?  349 ARG A NE   5  
ATOM 10612 C CZ   . ARG A 1 136 ? 18.500  -1.353  -6.203  1.00 0.00 ?  349 ARG A CZ   5  
ATOM 10613 N NH1  . ARG A 1 136 ? 19.724  -1.053  -5.745  1.00 0.00 ?  349 ARG A NH1  5  
ATOM 10614 N NH2  . ARG A 1 136 ? 18.340  -1.764  -7.468  1.00 0.00 1  349 ARG A NH2  5  
ATOM 10615 H H    . ARG A 1 136 ? 16.420  2.399   -0.590  1.00 0.00 ?  349 ARG A H    5  
ATOM 10616 H HA   . ARG A 1 136 ? 16.716  -0.267  -1.350  1.00 0.00 ?  349 ARG A HA   5  
ATOM 10617 H HB2  . ARG A 1 136 ? 15.836  1.221   -2.999  1.00 0.00 ?  349 ARG A HB2  5  
ATOM 10618 H HB3  . ARG A 1 136 ? 17.098  2.409   -2.738  1.00 0.00 ?  349 ARG A HB3  5  
ATOM 10619 H HG2  . ARG A 1 136 ? 17.430  1.167   -4.874  1.00 0.00 ?  349 ARG A HG2  5  
ATOM 10620 H HG3  . ARG A 1 136 ? 18.776  0.936   -3.776  1.00 0.00 ?  349 ARG A HG3  5  
ATOM 10621 H HD2  . ARG A 1 136 ? 18.327  -1.306  -3.476  1.00 0.00 ?  349 ARG A HD2  5  
ATOM 10622 H HD3  . ARG A 1 136 ? 16.591  -1.067  -3.463  1.00 0.00 ?  349 ARG A HD3  5  
ATOM 10623 H HE   . ARG A 1 136 ? 16.538  -1.473  -5.768  1.00 0.00 ?  349 ARG A HE   5  
ATOM 10624 H HH11 . ARG A 1 136 ? 19.843  -0.746  -4.801  1.00 0.00 ?  349 ARG A HH11 5  
ATOM 10625 H HH12 . ARG A 1 136 ? 20.517  -1.136  -6.348  1.00 0.00 ?  349 ARG A HH12 5  
ATOM 10626 H HH21 . ARG A 1 136 ? 17.427  -1.988  -7.809  1.00 0.00 ?  349 ARG A HH21 5  
ATOM 10627 H HH22 . ARG A 1 136 ? 19.134  -1.847  -8.071  1.00 0.00 ?  349 ARG A HH22 5  
ATOM 10628 N N    . GLY A 1 137 ? 19.422  1.565   -0.939  1.00 0.00 ?  350 GLY A N    5  
ATOM 10629 C CA   . GLY A 1 137 ? 20.868  1.532   -0.797  1.00 0.00 ?  350 GLY A CA   5  
ATOM 10630 C C    . GLY A 1 137 ? 21.330  0.199   -0.205  1.00 0.00 ?  350 GLY A C    5  
ATOM 10631 O O    . GLY A 1 137 ? 22.272  -0.414  -0.706  1.00 0.00 ?  350 GLY A O    5  
ATOM 10632 H H    . GLY A 1 137 ? 18.995  2.440   -0.709  1.00 0.00 ?  350 GLY A H    5  
ATOM 10633 H HA2  . GLY A 1 137 ? 21.336  1.684   -1.769  1.00 0.00 ?  350 GLY A HA2  5  
ATOM 10634 H HA3  . GLY A 1 137 ? 21.193  2.350   -0.155  1.00 0.00 ?  350 GLY A HA3  5  
ATOM 10635 N N    . ALA A 1 138 ? 20.645  -0.212  0.852   1.00 0.00 ?  351 ALA A N    5  
ATOM 10636 C CA   . ALA A 1 138 ? 20.973  -1.462  1.517   1.00 0.00 ?  351 ALA A CA   5  
ATOM 10637 C C    . ALA A 1 138 ? 19.732  -1.990  2.240   1.00 0.00 ?  351 ALA A C    5  
ATOM 10638 O O    . ALA A 1 138 ? 19.184  -1.318  3.112   1.00 0.00 ?  351 ALA A O    5  
ATOM 10639 C CB   . ALA A 1 138 ? 22.151  -1.240  2.467   1.00 0.00 ?  351 ALA A CB   5  
ATOM 10640 H H    . ALA A 1 138 ? 19.879  0.292   1.253   1.00 0.00 ?  351 ALA A H    5  
ATOM 10641 H HA   . ALA A 1 138 ? 21.269  -2.178  0.751   1.00 0.00 ?  351 ALA A HA   5  
ATOM 10642 H HB1  . ALA A 1 138 ? 22.979  -0.787  1.921   1.00 0.00 ?  351 ALA A HB1  5  
ATOM 10643 H HB2  . ALA A 1 138 ? 21.846  -0.579  3.277   1.00 0.00 ?  351 ALA A HB2  5  
ATOM 10644 H HB3  . ALA A 1 138 ? 22.470  -2.197  2.880   1.00 0.00 ?  351 ALA A HB3  5  
ATOM 10645 N N    . ALA A 1 139 ? 19.326  -3.190  1.852   1.00 0.00 ?  352 ALA A N    5  
ATOM 10646 C CA   . ALA A 1 139 ? 18.161  -3.817  2.452   1.00 0.00 ?  352 ALA A CA   5  
ATOM 10647 C C    . ALA A 1 139 ? 18.396  -3.988  3.954   1.00 0.00 ?  352 ALA A C    5  
ATOM 10648 O O    . ALA A 1 139 ? 19.522  -3.845  4.430   1.00 0.00 ?  352 ALA A O    5  
ATOM 10649 C CB   . ALA A 1 139 ? 17.879  -5.147  1.751   1.00 0.00 ?  352 ALA A CB   5  
ATOM 10650 H H    . ALA A 1 139 ? 19.778  -3.731  1.142   1.00 0.00 ?  352 ALA A H    5  
ATOM 10651 H HA   . ALA A 1 139 ? 17.311  -3.152  2.299   1.00 0.00 ?  352 ALA A HA   5  
ATOM 10652 H HB1  . ALA A 1 139 ? 16.816  -5.217  1.518   1.00 0.00 ?  352 ALA A HB1  5  
ATOM 10653 H HB2  . ALA A 1 139 ? 18.458  -5.203  0.830   1.00 0.00 ?  352 ALA A HB2  5  
ATOM 10654 H HB3  . ALA A 1 139 ? 18.161  -5.971  2.408   1.00 0.00 ?  352 ALA A HB3  5  
ATOM 10655 N N    . ALA A 1 140 ? 17.316  -4.291  4.659   1.00 0.00 ?  353 ALA A N    5  
ATOM 10656 C CA   . ALA A 1 140 ? 17.391  -4.482  6.098   1.00 0.00 ?  353 ALA A CA   5  
ATOM 10657 C C    . ALA A 1 140 ? 17.360  -5.980  6.411   1.00 0.00 ?  353 ALA A C    5  
ATOM 10658 O O    . ALA A 1 140 ? 16.559  -6.720  5.842   1.00 0.00 ?  353 ALA A O    5  
ATOM 10659 C CB   . ALA A 1 140 ? 16.249  -3.722  6.774   1.00 0.00 ?  353 ALA A CB   5  
ATOM 10660 H H    . ALA A 1 140 ? 16.405  -4.405  4.265   1.00 0.00 ?  353 ALA A H    5  
ATOM 10661 H HA   . ALA A 1 140 ? 18.339  -4.068  6.439   1.00 0.00 ?  353 ALA A HA   5  
ATOM 10662 H HB1  . ALA A 1 140 ? 16.474  -2.655  6.777   1.00 0.00 ?  353 ALA A HB1  5  
ATOM 10663 H HB2  . ALA A 1 140 ? 15.322  -3.896  6.228   1.00 0.00 ?  353 ALA A HB2  5  
ATOM 10664 H HB3  . ALA A 1 140 ? 16.137  -4.072  7.800   1.00 0.00 ?  353 ALA A HB3  5  
ATOM 10665 N N    . SER A 1 141 ? 18.242  -6.381  7.314   1.00 0.00 ?  354 SER A N    5  
ATOM 10666 C CA   . SER A 1 141 ? 18.326  -7.777  7.710   1.00 0.00 ?  354 SER A CA   5  
ATOM 10667 C C    . SER A 1 141 ? 18.434  -7.883  9.232   1.00 0.00 ?  354 SER A C    5  
ATOM 10668 O O    . SER A 1 141 ? 18.656  -6.884  9.914   1.00 0.00 ?  354 SER A O    5  
ATOM 10669 C CB   . SER A 1 141 ? 19.518  -8.467  7.044   1.00 0.00 ?  354 SER A CB   5  
ATOM 10670 O OG   . SER A 1 141 ? 19.332  -8.614  5.638   1.00 0.00 ?  354 SER A OG   5  
ATOM 10671 H H    . SER A 1 141 ? 18.890  -5.772  7.773   1.00 0.00 ?  354 SER A H    5  
ATOM 10672 H HA   . SER A 1 141 ? 17.400  -8.232  7.359   1.00 0.00 ?  354 SER A HA   5  
ATOM 10673 H HB2  . SER A 1 141 ? 20.423  -7.889  7.232   1.00 0.00 ?  354 SER A HB2  5  
ATOM 10674 H HB3  . SER A 1 141 ? 19.666  -9.448  7.495   1.00 0.00 ?  354 SER A HB3  5  
ATOM 10675 H HG   . SER A 1 141 ? 20.219  -8.648  5.178   1.00 0.00 ?  354 SER A HG   5  
ATOM 10676 N N    . ALA A 1 142 ? 18.271  -9.104  9.721   1.00 0.00 ?  355 ALA A N    5  
ATOM 10677 C CA   . ALA A 1 142 ? 18.347  -9.355  11.150  1.00 0.00 ?  355 ALA A CA   5  
ATOM 10678 C C    . ALA A 1 142 ? 19.137  -10.642 11.396  1.00 0.00 ?  355 ALA A C    5  
ATOM 10679 O O    . ALA A 1 142 ? 19.917  -10.724 12.344  1.00 0.00 ?  355 ALA A O    5  
ATOM 10680 C CB   . ALA A 1 142 ? 16.934  -9.417  11.734  1.00 0.00 ?  355 ALA A CB   5  
ATOM 10681 H H    . ALA A 1 142 ? 18.091  -9.912  9.159   1.00 0.00 ?  355 ALA A H    5  
ATOM 10682 H HA   . ALA A 1 142 ? 18.879  -8.519  11.605  1.00 0.00 ?  355 ALA A HA   5  
ATOM 10683 H HB1  . ALA A 1 142 ? 16.345  -10.150 11.182  1.00 0.00 ?  355 ALA A HB1  5  
ATOM 10684 H HB2  . ALA A 1 142 ? 16.987  -9.708  12.783  1.00 0.00 ?  355 ALA A HB2  5  
ATOM 10685 H HB3  . ALA A 1 142 ? 16.464  -8.437  11.652  1.00 0.00 ?  355 ALA A HB3  5  
ATOM 10686 N N    . GLY A 1 1   ? -22.442 11.360  -9.792  1.00 0.00 ?  214 GLY A N    6  
ATOM 10687 C CA   . GLY A 1 1   ? -21.052 10.937  -9.757  1.00 0.00 ?  214 GLY A CA   6  
ATOM 10688 C C    . GLY A 1 1   ? -20.797 9.991   -8.582  1.00 0.00 ?  214 GLY A C    6  
ATOM 10689 O O    . GLY A 1 1   ? -21.509 9.003   -8.410  1.00 0.00 ?  214 GLY A O    6  
ATOM 10690 H H1   . GLY A 1 1   ? -23.099 10.636  -10.000 1.00 0.00 ?  214 GLY A H1   6  
ATOM 10691 H HA2  . GLY A 1 1   ? -20.796 10.439  -10.692 1.00 0.00 ?  214 GLY A HA2  6  
ATOM 10692 H HA3  . GLY A 1 1   ? -20.404 11.810  -9.673  1.00 0.00 ?  214 GLY A HA3  6  
ATOM 10693 N N    . SER A 1 2   ? -19.779 10.327  -7.804  1.00 0.00 ?  215 SER A N    6  
ATOM 10694 C CA   . SER A 1 2   ? -19.420 9.520   -6.650  1.00 0.00 ?  215 SER A CA   6  
ATOM 10695 C C    . SER A 1 2   ? -19.255 10.412  -5.418  1.00 0.00 ?  215 SER A C    6  
ATOM 10696 O O    . SER A 1 2   ? -19.047 11.617  -5.544  1.00 0.00 ?  215 SER A O    6  
ATOM 10697 C CB   . SER A 1 2   ? -18.137 8.729   -6.908  1.00 0.00 ?  215 SER A CB   6  
ATOM 10698 O OG   . SER A 1 2   ? -18.343 7.323   -6.793  1.00 0.00 ?  215 SER A OG   6  
ATOM 10699 H H    . SER A 1 2   ? -19.205 11.133  -7.950  1.00 0.00 ?  215 SER A H    6  
ATOM 10700 H HA   . SER A 1 2   ? -20.251 8.828   -6.513  1.00 0.00 ?  215 SER A HA   6  
ATOM 10701 H HB2  . SER A 1 2   ? -17.763 8.960   -7.906  1.00 0.00 ?  215 SER A HB2  6  
ATOM 10702 H HB3  . SER A 1 2   ? -17.369 9.041   -6.201  1.00 0.00 ?  215 SER A HB3  6  
ATOM 10703 H HG   . SER A 1 2   ? -17.801 6.840   -7.481  1.00 0.00 ?  215 SER A HG   6  
ATOM 10704 N N    . GLN A 1 3   ? -19.355 9.784   -4.255  1.00 0.00 ?  216 GLN A N    6  
ATOM 10705 C CA   . GLN A 1 3   ? -19.219 10.507  -3.002  1.00 0.00 ?  216 GLN A CA   6  
ATOM 10706 C C    . GLN A 1 3   ? -18.328 9.726   -2.033  1.00 0.00 ?  216 GLN A C    6  
ATOM 10707 O O    . GLN A 1 3   ? -17.990 8.571   -2.288  1.00 0.00 ?  216 GLN A O    6  
ATOM 10708 C CB   . GLN A 1 3   ? -20.588 10.789  -2.380  1.00 0.00 ?  216 GLN A CB   6  
ATOM 10709 C CG   . GLN A 1 3   ? -21.387 11.774  -3.236  1.00 0.00 ?  216 GLN A CG   6  
ATOM 10710 C CD   . GLN A 1 3   ? -22.889 11.508  -3.121  1.00 0.00 ?  216 GLN A CD   6  
ATOM 10711 O OE1  . GLN A 1 3   ? -23.328 10.449  -2.703  1.00 0.00 ?  216 GLN A OE1  6  
ATOM 10712 N NE2  . GLN A 1 3   ? -23.650 12.527  -3.512  1.00 0.00 ?  216 GLN A NE2  6  
ATOM 10713 H H    . GLN A 1 3   ? -19.524 8.803   -4.162  1.00 0.00 ?  216 GLN A H    6  
ATOM 10714 H HA   . GLN A 1 3   ? -18.743 11.452  -3.262  1.00 0.00 ?  216 GLN A HA   6  
ATOM 10715 H HB2  . GLN A 1 3   ? -21.144 9.857   -2.278  1.00 0.00 ?  216 GLN A HB2  6  
ATOM 10716 H HB3  . GLN A 1 3   ? -20.460 11.195  -1.377  1.00 0.00 ?  216 GLN A HB3  6  
ATOM 10717 H HG2  . GLN A 1 3   ? -21.169 12.794  -2.922  1.00 0.00 ?  216 GLN A HG2  6  
ATOM 10718 H HG3  . GLN A 1 3   ? -21.078 11.688  -4.279  1.00 0.00 ?  216 GLN A HG3  6  
ATOM 10719 H HE21 . GLN A 1 3   ? -23.226 13.369  -3.845  1.00 0.00 ?  216 GLN A HE21 6  
ATOM 10720 H HE22 . GLN A 1 3   ? -24.646 12.450  -3.474  1.00 0.00 ?  216 GLN A HE22 6  
ATOM 10721 N N    . GLU A 1 4   ? -17.972 10.388  -0.942  1.00 0.00 ?  217 GLU A N    6  
ATOM 10722 C CA   . GLU A 1 4   ? -17.127 9.770   0.066   1.00 0.00 ?  217 GLU A CA   6  
ATOM 10723 C C    . GLU A 1 4   ? -17.813 9.813   1.433   1.00 0.00 ?  217 GLU A C    6  
ATOM 10724 O O    . GLU A 1 4   ? -18.355 10.844  1.828   1.00 0.00 ?  217 GLU A O    6  
ATOM 10725 C CB   . GLU A 1 4   ? -15.755 10.446  0.120   1.00 0.00 ?  217 GLU A CB   6  
ATOM 10726 C CG   . GLU A 1 4   ? -14.883 10.011  -1.059  1.00 0.00 ?  217 GLU A CG   6  
ATOM 10727 C CD   . GLU A 1 4   ? -14.845 11.091  -2.142  1.00 0.00 ?  217 GLU A CD   6  
ATOM 10728 O OE1  . GLU A 1 4   ? -15.869 11.357  -2.789  1.00 0.00 ?  217 GLU A OE1  6  
ATOM 10729 O OE2  . GLU A 1 4   ? -13.700 11.664  -2.300  1.00 0.00 -1 217 GLU A OE2  6  
ATOM 10730 H H    . GLU A 1 4   ? -18.251 11.327  -0.742  1.00 0.00 ?  217 GLU A H    6  
ATOM 10731 H HA   . GLU A 1 4   ? -17.003 8.736   -0.254  1.00 0.00 ?  217 GLU A HA   6  
ATOM 10732 H HB2  . GLU A 1 4   ? -15.879 11.529  0.105   1.00 0.00 ?  217 GLU A HB2  6  
ATOM 10733 H HB3  . GLU A 1 4   ? -15.258 10.194  1.057   1.00 0.00 ?  217 GLU A HB3  6  
ATOM 10734 H HG2  . GLU A 1 4   ? -13.871 9.804   -0.711  1.00 0.00 ?  217 GLU A HG2  6  
ATOM 10735 H HG3  . GLU A 1 4   ? -15.271 9.083   -1.480  1.00 0.00 ?  217 GLU A HG3  6  
ATOM 10736 H HE2  . GLU A 1 4   ? -13.662 12.111  -3.194  1.00 0.00 ?  217 GLU A HE2  6  
ATOM 10737 N N    . VAL A 1 5   ? -17.768 8.679   2.117   1.00 0.00 ?  218 VAL A N    6  
ATOM 10738 C CA   . VAL A 1 5   ? -18.378 8.574   3.432   1.00 0.00 ?  218 VAL A CA   6  
ATOM 10739 C C    . VAL A 1 5   ? -17.446 7.795   4.361   1.00 0.00 ?  218 VAL A C    6  
ATOM 10740 O O    . VAL A 1 5   ? -16.599 7.031   3.900   1.00 0.00 ?  218 VAL A O    6  
ATOM 10741 C CB   . VAL A 1 5   ? -19.768 7.945   3.314   1.00 0.00 ?  218 VAL A CB   6  
ATOM 10742 C CG1  . VAL A 1 5   ? -19.679 6.418   3.301   1.00 0.00 ?  218 VAL A CG1  6  
ATOM 10743 C CG2  . VAL A 1 5   ? -20.686 8.431   4.437   1.00 0.00 ?  218 VAL A CG2  6  
ATOM 10744 H H    . VAL A 1 5   ? -17.325 7.845   1.789   1.00 0.00 ?  218 VAL A H    6  
ATOM 10745 H HA   . VAL A 1 5   ? -18.497 9.585   3.821   1.00 0.00 ?  218 VAL A HA   6  
ATOM 10746 H HB   . VAL A 1 5   ? -20.201 8.263   2.366   1.00 0.00 ?  218 VAL A HB   6  
ATOM 10747 H HG11 . VAL A 1 5   ? -18.668 6.115   3.029   1.00 0.00 ?  218 VAL A HG11 6  
ATOM 10748 H HG12 . VAL A 1 5   ? -19.919 6.031   4.292   1.00 0.00 ?  218 VAL A HG12 6  
ATOM 10749 H HG13 . VAL A 1 5   ? -20.386 6.019   2.574   1.00 0.00 ?  218 VAL A HG13 6  
ATOM 10750 H HG21 . VAL A 1 5   ? -21.718 8.168   4.202   1.00 0.00 ?  218 VAL A HG21 6  
ATOM 10751 H HG22 . VAL A 1 5   ? -20.395 7.959   5.375   1.00 0.00 ?  218 VAL A HG22 6  
ATOM 10752 H HG23 . VAL A 1 5   ? -20.601 9.514   4.533   1.00 0.00 ?  218 VAL A HG23 6  
ATOM 10753 N N    . ARG A 1 6   ? -17.633 8.014   5.654   1.00 0.00 ?  219 ARG A N    6  
ATOM 10754 C CA   . ARG A 1 6   ? -16.819 7.343   6.653   1.00 0.00 ?  219 ARG A CA   6  
ATOM 10755 C C    . ARG A 1 6   ? -17.353 5.932   6.912   1.00 0.00 ?  219 ARG A C    6  
ATOM 10756 O O    . ARG A 1 6   ? -18.561 5.707   6.880   1.00 0.00 ?  219 ARG A O    6  
ATOM 10757 C CB   . ARG A 1 6   ? -16.804 8.124   7.968   1.00 0.00 ?  219 ARG A CB   6  
ATOM 10758 C CG   . ARG A 1 6   ? -15.734 9.217   7.945   1.00 0.00 ?  219 ARG A CG   6  
ATOM 10759 C CD   . ARG A 1 6   ? -16.092 10.355  8.903   1.00 0.00 ?  219 ARG A CD   6  
ATOM 10760 N NE   . ARG A 1 6   ? -15.906 9.915   10.303  1.00 0.00 ?  219 ARG A NE   6  
ATOM 10761 C CZ   . ARG A 1 6   ? -16.492 10.498  11.358  1.00 0.00 ?  219 ARG A CZ   6  
ATOM 10762 N NH1  . ARG A 1 6   ? -17.304 11.549  11.177  1.00 0.00 ?  219 ARG A NH1  6  
ATOM 10763 N NH2  . ARG A 1 6   ? -16.266 10.031  12.593  1.00 0.00 1  219 ARG A NH2  6  
ATOM 10764 H H    . ARG A 1 6   ? -18.323 8.637   6.022   1.00 0.00 ?  219 ARG A H    6  
ATOM 10765 H HA   . ARG A 1 6   ? -15.818 7.310   6.221   1.00 0.00 ?  219 ARG A HA   6  
ATOM 10766 H HB2  . ARG A 1 6   ? -17.783 8.571   8.141   1.00 0.00 ?  219 ARG A HB2  6  
ATOM 10767 H HB3  . ARG A 1 6   ? -16.614 7.443   8.798   1.00 0.00 ?  219 ARG A HB3  6  
ATOM 10768 H HG2  . ARG A 1 6   ? -14.769 8.794   8.222   1.00 0.00 ?  219 ARG A HG2  6  
ATOM 10769 H HG3  . ARG A 1 6   ? -15.631 9.608   6.932   1.00 0.00 ?  219 ARG A HG3  6  
ATOM 10770 H HD2  . ARG A 1 6   ? -15.465 11.224  8.699   1.00 0.00 ?  219 ARG A HD2  6  
ATOM 10771 H HD3  . ARG A 1 6   ? -17.125 10.664  8.744   1.00 0.00 ?  219 ARG A HD3  6  
ATOM 10772 H HE   . ARG A 1 6   ? -15.306 9.134   10.473  1.00 0.00 ?  219 ARG A HE   6  
ATOM 10773 H HH11 . ARG A 1 6   ? -17.473 11.898  10.256  1.00 0.00 ?  219 ARG A HH11 6  
ATOM 10774 H HH12 . ARG A 1 6   ? -17.741 11.984  11.965  1.00 0.00 ?  219 ARG A HH12 6  
ATOM 10775 H HH21 . ARG A 1 6   ? -15.660 9.247   12.728  1.00 0.00 ?  219 ARG A HH21 6  
ATOM 10776 H HH22 . ARG A 1 6   ? -16.703 10.466  13.380  1.00 0.00 ?  219 ARG A HH22 6  
ATOM 10777 N N    . ARG A 1 7   ? -16.426 5.019   7.162   1.00 0.00 ?  220 ARG A N    6  
ATOM 10778 C CA   . ARG A 1 7   ? -16.788 3.637   7.426   1.00 0.00 ?  220 ARG A CA   6  
ATOM 10779 C C    . ARG A 1 7   ? -16.489 3.279   8.883   1.00 0.00 ?  220 ARG A C    6  
ATOM 10780 O O    . ARG A 1 7   ? -15.888 4.069   9.610   1.00 0.00 ?  220 ARG A O    6  
ATOM 10781 C CB   . ARG A 1 7   ? -16.024 2.682   6.506   1.00 0.00 ?  220 ARG A CB   6  
ATOM 10782 C CG   . ARG A 1 7   ? -14.535 3.031   6.470   1.00 0.00 ?  220 ARG A CG   6  
ATOM 10783 C CD   . ARG A 1 7   ? -14.185 3.807   5.198   1.00 0.00 ?  220 ARG A CD   6  
ATOM 10784 N NE   . ARG A 1 7   ? -13.490 2.920   4.239   1.00 0.00 ?  220 ARG A NE   6  
ATOM 10785 C CZ   . ARG A 1 7   ? -13.026 3.319   3.047   1.00 0.00 ?  220 ARG A CZ   6  
ATOM 10786 N NH1  . ARG A 1 7   ? -13.180 4.593   2.660   1.00 0.00 ?  220 ARG A NH1  6  
ATOM 10787 N NH2  . ARG A 1 7   ? -12.408 2.445   2.241   1.00 0.00 1  220 ARG A NH2  6  
ATOM 10788 H H    . ARG A 1 7   ? -15.444 5.211   7.186   1.00 0.00 ?  220 ARG A H    6  
ATOM 10789 H HA   . ARG A 1 7   ? -17.857 3.586   7.220   1.00 0.00 ?  220 ARG A HA   6  
ATOM 10790 H HB2  . ARG A 1 7   ? -16.153 1.657   6.853   1.00 0.00 ?  220 ARG A HB2  6  
ATOM 10791 H HB3  . ARG A 1 7   ? -16.438 2.732   5.499   1.00 0.00 ?  220 ARG A HB3  6  
ATOM 10792 H HG2  . ARG A 1 7   ? -14.275 3.625   7.346   1.00 0.00 ?  220 ARG A HG2  6  
ATOM 10793 H HG3  . ARG A 1 7   ? -13.943 2.117   6.517   1.00 0.00 ?  220 ARG A HG3  6  
ATOM 10794 H HD2  . ARG A 1 7   ? -15.092 4.207   4.745   1.00 0.00 ?  220 ARG A HD2  6  
ATOM 10795 H HD3  . ARG A 1 7   ? -13.550 4.658   5.445   1.00 0.00 ?  220 ARG A HD3  6  
ATOM 10796 H HE   . ARG A 1 7   ? -13.358 1.962   4.496   1.00 0.00 ?  220 ARG A HE   6  
ATOM 10797 H HH11 . ARG A 1 7   ? -13.641 5.245   3.261   1.00 0.00 ?  220 ARG A HH11 6  
ATOM 10798 H HH12 . ARG A 1 7   ? -12.834 4.891   1.770   1.00 0.00 ?  220 ARG A HH12 6  
ATOM 10799 H HH21 . ARG A 1 7   ? -12.293 1.494   2.530   1.00 0.00 ?  220 ARG A HH21 6  
ATOM 10800 H HH22 . ARG A 1 7   ? -12.062 2.743   1.351   1.00 0.00 ?  220 ARG A HH22 6  
ATOM 10801 N N    . GLY A 1 8   ? -16.923 2.088   9.267   1.00 0.00 ?  221 GLY A N    6  
ATOM 10802 C CA   . GLY A 1 8   ? -16.710 1.615   10.625  1.00 0.00 ?  221 GLY A CA   6  
ATOM 10803 C C    . GLY A 1 8   ? -15.260 1.173   10.830  1.00 0.00 ?  221 GLY A C    6  
ATOM 10804 O O    . GLY A 1 8   ? -14.830 0.948   11.960  1.00 0.00 ?  221 GLY A O    6  
ATOM 10805 H H    . GLY A 1 8   ? -17.412 1.451   8.670   1.00 0.00 ?  221 GLY A H    6  
ATOM 10806 H HA2  . GLY A 1 8   ? -16.956 2.408   11.332  1.00 0.00 ?  221 GLY A HA2  6  
ATOM 10807 H HA3  . GLY A 1 8   ? -17.381 0.782   10.833  1.00 0.00 ?  221 GLY A HA3  6  
ATOM 10808 N N    . ASP A 1 9   ? -14.546 1.061   9.719   1.00 0.00 ?  222 ASP A N    6  
ATOM 10809 C CA   . ASP A 1 9   ? -13.154 0.649   9.763   1.00 0.00 ?  222 ASP A CA   6  
ATOM 10810 C C    . ASP A 1 9   ? -12.262 1.842   9.413   1.00 0.00 ?  222 ASP A C    6  
ATOM 10811 O O    . ASP A 1 9   ? -11.072 1.677   9.152   1.00 0.00 ?  222 ASP A O    6  
ATOM 10812 C CB   . ASP A 1 9   ? -12.876 -0.462  8.748   1.00 0.00 ?  222 ASP A CB   6  
ATOM 10813 C CG   . ASP A 1 9   ? -13.534 -0.269  7.381   1.00 0.00 ?  222 ASP A CG   6  
ATOM 10814 O OD1  . ASP A 1 9   ? -14.758 -0.097  7.279   1.00 0.00 ?  222 ASP A OD1  6  
ATOM 10815 O OD2  . ASP A 1 9   ? -12.724 -0.300  6.377   1.00 0.00 -1 222 ASP A OD2  6  
ATOM 10816 H H    . ASP A 1 9   ? -14.904 1.246   8.804   1.00 0.00 ?  222 ASP A H    6  
ATOM 10817 H HA   . ASP A 1 9   ? -12.992 0.292   10.780  1.00 0.00 ?  222 ASP A HA   6  
ATOM 10818 H HB2  . ASP A 1 9   ? -11.798 -0.544  8.608   1.00 0.00 ?  222 ASP A HB2  6  
ATOM 10819 H HB3  . ASP A 1 9   ? -13.215 -1.409  9.167   1.00 0.00 ?  222 ASP A HB3  6  
ATOM 10820 H HD2  . ASP A 1 9   ? -12.394 0.622   6.175   1.00 0.00 ?  222 ASP A HD2  6  
ATOM 10821 N N    . PHE A 1 10  ? -12.873 3.018   9.418   1.00 0.00 ?  223 PHE A N    6  
ATOM 10822 C CA   . PHE A 1 10  ? -12.150 4.239   9.104   1.00 0.00 ?  223 PHE A CA   6  
ATOM 10823 C C    . PHE A 1 10  ? -10.895 4.370   9.970   1.00 0.00 ?  223 PHE A C    6  
ATOM 10824 O O    . PHE A 1 10  ? -9.875  4.887   9.517   1.00 0.00 ?  223 PHE A O    6  
ATOM 10825 C CB   . PHE A 1 10  ? -13.090 5.407   9.408   1.00 0.00 ?  223 PHE A CB   6  
ATOM 10826 C CG   . PHE A 1 10  ? -12.596 6.756   8.883   1.00 0.00 ?  223 PHE A CG   6  
ATOM 10827 C CD1  . PHE A 1 10  ? -12.876 7.133   7.607   1.00 0.00 ?  223 PHE A CD1  6  
ATOM 10828 C CD2  . PHE A 1 10  ? -11.878 7.579   9.693   1.00 0.00 ?  223 PHE A CD2  6  
ATOM 10829 C CE1  . PHE A 1 10  ? -12.418 8.385   7.119   1.00 0.00 ?  223 PHE A CE1  6  
ATOM 10830 C CE2  . PHE A 1 10  ? -11.419 8.832   9.206   1.00 0.00 ?  223 PHE A CE2  6  
ATOM 10831 C CZ   . PHE A 1 10  ? -11.699 9.208   7.929   1.00 0.00 ?  223 PHE A CZ   6  
ATOM 10832 H H    . PHE A 1 10  ? -13.842 3.144   9.631   1.00 0.00 ?  223 PHE A H    6  
ATOM 10833 H HA   . PHE A 1 10  ? -11.860 4.183   8.055   1.00 0.00 ?  223 PHE A HA   6  
ATOM 10834 H HB2  . PHE A 1 10  ? -14.068 5.195   8.975   1.00 0.00 ?  223 PHE A HB2  6  
ATOM 10835 H HB3  . PHE A 1 10  ? -13.229 5.477   10.487  1.00 0.00 ?  223 PHE A HB3  6  
ATOM 10836 H HD1  . PHE A 1 10  ? -13.452 6.473   6.958   1.00 0.00 ?  223 PHE A HD1  6  
ATOM 10837 H HD2  . PHE A 1 10  ? -11.654 7.277   10.716  1.00 0.00 ?  223 PHE A HD2  6  
ATOM 10838 H HE1  . PHE A 1 10  ? -12.642 8.687   6.096   1.00 0.00 ?  223 PHE A HE1  6  
ATOM 10839 H HE2  . PHE A 1 10  ? -10.843 9.491   9.855   1.00 0.00 ?  223 PHE A HE2  6  
ATOM 10840 H HZ   . PHE A 1 10  ? -11.347 10.170  7.555   1.00 0.00 ?  223 PHE A HZ   6  
ATOM 10841 N N    . VAL A 1 11  ? -11.012 3.894   11.201  1.00 0.00 ?  224 VAL A N    6  
ATOM 10842 C CA   . VAL A 1 11  ? -9.900  3.953   12.135  1.00 0.00 ?  224 VAL A CA   6  
ATOM 10843 C C    . VAL A 1 11  ? -8.873  2.881   11.765  1.00 0.00 ?  224 VAL A C    6  
ATOM 10844 O O    . VAL A 1 11  ? -7.669  3.119   11.837  1.00 0.00 ?  224 VAL A O    6  
ATOM 10845 C CB   . VAL A 1 11  ? -10.414 3.820   13.570  1.00 0.00 ?  224 VAL A CB   6  
ATOM 10846 C CG1  . VAL A 1 11  ? -10.294 2.376   14.063  1.00 0.00 ?  224 VAL A CG1  6  
ATOM 10847 C CG2  . VAL A 1 11  ? -9.681  4.782   14.506  1.00 0.00 ?  224 VAL A CG2  6  
ATOM 10848 H H    . VAL A 1 11  ? -11.845 3.476   11.562  1.00 0.00 ?  224 VAL A H    6  
ATOM 10849 H HA   . VAL A 1 11  ? -9.436  4.934   12.032  1.00 0.00 ?  224 VAL A HA   6  
ATOM 10850 H HB   . VAL A 1 11  ? -11.471 4.088   13.573  1.00 0.00 ?  224 VAL A HB   6  
ATOM 10851 H HG11 . VAL A 1 11  ? -10.887 2.252   14.969  1.00 0.00 ?  224 VAL A HG11 6  
ATOM 10852 H HG12 . VAL A 1 11  ? -10.661 1.697   13.293  1.00 0.00 ?  224 VAL A HG12 6  
ATOM 10853 H HG13 . VAL A 1 11  ? -9.250  2.152   14.279  1.00 0.00 ?  224 VAL A HG13 6  
ATOM 10854 H HG21 . VAL A 1 11  ? -9.869  5.809   14.191  1.00 0.00 ?  224 VAL A HG21 6  
ATOM 10855 H HG22 . VAL A 1 11  ? -10.042 4.643   15.525  1.00 0.00 ?  224 VAL A HG22 6  
ATOM 10856 H HG23 . VAL A 1 11  ? -8.611  4.580   14.469  1.00 0.00 ?  224 VAL A HG23 6  
ATOM 10857 N N    . ARG A 1 12  ? -9.387  1.722   11.379  1.00 0.00 ?  225 ARG A N    6  
ATOM 10858 C CA   . ARG A 1 12  ? -8.530  0.612   10.999  1.00 0.00 ?  225 ARG A CA   6  
ATOM 10859 C C    . ARG A 1 12  ? -7.800  0.929   9.693   1.00 0.00 ?  225 ARG A C    6  
ATOM 10860 O O    . ARG A 1 12  ? -6.682  0.465   9.473   1.00 0.00 ?  225 ARG A O    6  
ATOM 10861 C CB   . ARG A 1 12  ? -9.339  -0.674  10.823  1.00 0.00 ?  225 ARG A CB   6  
ATOM 10862 C CG   . ARG A 1 12  ? -8.500  -1.762  10.151  1.00 0.00 ?  225 ARG A CG   6  
ATOM 10863 C CD   . ARG A 1 12  ? -7.184  -1.981  10.900  1.00 0.00 ?  225 ARG A CD   6  
ATOM 10864 N NE   . ARG A 1 12  ? -7.427  -2.760  12.135  1.00 0.00 ?  225 ARG A NE   6  
ATOM 10865 C CZ   . ARG A 1 12  ? -7.643  -4.082  12.158  1.00 0.00 ?  225 ARG A CZ   6  
ATOM 10866 N NH1  . ARG A 1 12  ? -7.647  -4.781  11.015  1.00 0.00 ?  225 ARG A NH1  6  
ATOM 10867 N NH2  . ARG A 1 12  ? -7.854  -4.706  13.325  1.00 0.00 1  225 ARG A NH2  6  
ATOM 10868 H H    . ARG A 1 12  ? -10.369 1.536   11.324  1.00 0.00 ?  225 ARG A H    6  
ATOM 10869 H HA   . ARG A 1 12  ? -7.827  0.507   11.825  1.00 0.00 ?  225 ARG A HA   6  
ATOM 10870 H HB2  . ARG A 1 12  ? -9.686  -1.025  11.795  1.00 0.00 ?  225 ARG A HB2  6  
ATOM 10871 H HB3  . ARG A 1 12  ? -10.226 -0.471  10.223  1.00 0.00 ?  225 ARG A HB3  6  
ATOM 10872 H HG2  . ARG A 1 12  ? -9.064  -2.695  10.121  1.00 0.00 ?  225 ARG A HG2  6  
ATOM 10873 H HG3  . ARG A 1 12  ? -8.293  -1.481  9.119   1.00 0.00 ?  225 ARG A HG3  6  
ATOM 10874 H HD2  . ARG A 1 12  ? -6.475  -2.508  10.261  1.00 0.00 ?  225 ARG A HD2  6  
ATOM 10875 H HD3  . ARG A 1 12  ? -6.734  -1.020  11.150  1.00 0.00 ?  225 ARG A HD3  6  
ATOM 10876 H HE   . ARG A 1 12  ? -7.431  -2.269  13.006  1.00 0.00 ?  225 ARG A HE   6  
ATOM 10877 H HH11 . ARG A 1 12  ? -7.489  -4.315  10.144  1.00 0.00 ?  225 ARG A HH11 6  
ATOM 10878 H HH12 . ARG A 1 12  ? -7.808  -5.768  11.032  1.00 0.00 ?  225 ARG A HH12 6  
ATOM 10879 H HH21 . ARG A 1 12  ? -7.851  -4.185  14.178  1.00 0.00 ?  225 ARG A HH21 6  
ATOM 10880 H HH22 . ARG A 1 12  ? -8.016  -5.693  13.343  1.00 0.00 ?  225 ARG A HH22 6  
ATOM 10881 N N    . ASN A 1 13  ? -8.461  1.719   8.858   1.00 0.00 ?  226 ASN A N    6  
ATOM 10882 C CA   . ASN A 1 13  ? -7.889  2.103   7.580   1.00 0.00 ?  226 ASN A CA   6  
ATOM 10883 C C    . ASN A 1 13  ? -6.877  3.231   7.797   1.00 0.00 ?  226 ASN A C    6  
ATOM 10884 O O    . ASN A 1 13  ? -5.807  3.235   7.190   1.00 0.00 ?  226 ASN A O    6  
ATOM 10885 C CB   . ASN A 1 13  ? -8.969  2.615   6.624   1.00 0.00 ?  226 ASN A CB   6  
ATOM 10886 C CG   . ASN A 1 13  ? -9.274  1.581   5.538   1.00 0.00 ?  226 ASN A CG   6  
ATOM 10887 O OD1  . ASN A 1 13  ? -8.919  0.418   5.635   1.00 0.00 ?  226 ASN A OD1  6  
ATOM 10888 N ND2  . ASN A 1 13  ? -9.949  2.070   4.501   1.00 0.00 ?  226 ASN A ND2  6  
ATOM 10889 H H    . ASN A 1 13  ? -9.370  2.092   9.044   1.00 0.00 ?  226 ASN A H    6  
ATOM 10890 H HA   . ASN A 1 13  ? -7.426  1.197   7.189   1.00 0.00 ?  226 ASN A HA   6  
ATOM 10891 H HB2  . ASN A 1 13  ? -9.877  2.839   7.183   1.00 0.00 ?  226 ASN A HB2  6  
ATOM 10892 H HB3  . ASN A 1 13  ? -8.640  3.546   6.163   1.00 0.00 ?  226 ASN A HB3  6  
ATOM 10893 H HD21 . ASN A 1 13  ? -10.209 3.035   4.484   1.00 0.00 ?  226 ASN A HD21 6  
ATOM 10894 H HD22 . ASN A 1 13  ? -10.196 1.471   3.739   1.00 0.00 ?  226 ASN A HD22 6  
ATOM 10895 N N    . TRP A 1 14  ? -7.252  4.160   8.664   1.00 0.00 ?  227 TRP A N    6  
ATOM 10896 C CA   . TRP A 1 14  ? -6.391  5.290   8.969   1.00 0.00 ?  227 TRP A CA   6  
ATOM 10897 C C    . TRP A 1 14  ? -5.152  4.758   9.692   1.00 0.00 ?  227 TRP A C    6  
ATOM 10898 O O    . TRP A 1 14  ? -4.030  5.160   9.386   1.00 0.00 ?  227 TRP A O    6  
ATOM 10899 C CB   . TRP A 1 14  ? -7.144  6.351   9.774   1.00 0.00 ?  227 TRP A CB   6  
ATOM 10900 C CG   . TRP A 1 14  ? -6.470  7.725   9.776   1.00 0.00 ?  227 TRP A CG   6  
ATOM 10901 C CD1  . TRP A 1 14  ? -5.234  8.038   9.364   1.00 0.00 ?  227 TRP A CD1  6  
ATOM 10902 C CD2  . TRP A 1 14  ? -7.049  8.966   10.230  1.00 0.00 ?  227 TRP A CD2  6  
ATOM 10903 N NE1  . TRP A 1 14  ? -4.975  9.385   9.518   1.00 0.00 ?  227 TRP A NE1  6  
ATOM 10904 C CE2  . TRP A 1 14  ? -6.114  9.967   10.062  1.00 0.00 ?  227 TRP A CE2  6  
ATOM 10905 C CE3  . TRP A 1 14  ? -8.322  9.234   10.764  1.00 0.00 ?  227 TRP A CE3  6  
ATOM 10906 C CZ2  . TRP A 1 14  ? -6.352  11.303  10.404  1.00 0.00 ?  227 TRP A CZ2  6  
ATOM 10907 C CZ3  . TRP A 1 14  ? -8.544  10.575  11.101  1.00 0.00 ?  227 TRP A CZ3  6  
ATOM 10908 C CH2  . TRP A 1 14  ? -7.613  11.594  10.938  1.00 0.00 ?  227 TRP A CH2  6  
ATOM 10909 H H    . TRP A 1 14  ? -8.124  4.149   9.153   1.00 0.00 ?  227 TRP A H    6  
ATOM 10910 H HA   . TRP A 1 14  ? -6.102  5.753   8.025   1.00 0.00 ?  227 TRP A HA   6  
ATOM 10911 H HB2  . TRP A 1 14  ? -8.151  6.452   9.369   1.00 0.00 ?  227 TRP A HB2  6  
ATOM 10912 H HB3  . TRP A 1 14  ? -7.247  6.007   10.803  1.00 0.00 ?  227 TRP A HB3  6  
ATOM 10913 H HD1  . TRP A 1 14  ? -4.522  7.319   8.958   1.00 0.00 ?  227 TRP A HD1  6  
ATOM 10914 H HE1  . TRP A 1 14  ? -4.048  9.897   9.262   1.00 0.00 ?  227 TRP A HE1  6  
ATOM 10915 H HE3  . TRP A 1 14  ? -9.077  8.462   10.907  1.00 0.00 ?  227 TRP A HE3  6  
ATOM 10916 H HZ2  . TRP A 1 14  ? -5.596  12.076  10.261  1.00 0.00 ?  227 TRP A HZ2  6  
ATOM 10917 H HZ3  . TRP A 1 14  ? -9.515  10.838  11.521  1.00 0.00 ?  227 TRP A HZ3  6  
ATOM 10918 H HH2  . TRP A 1 14  ? -7.863  12.616  11.226  1.00 0.00 ?  227 TRP A HH2  6  
ATOM 10919 N N    . GLN A 1 15  ? -5.396  3.864   10.639  1.00 0.00 ?  228 GLN A N    6  
ATOM 10920 C CA   . GLN A 1 15  ? -4.314  3.273   11.408  1.00 0.00 ?  228 GLN A CA   6  
ATOM 10921 C C    . GLN A 1 15  ? -3.455  2.377   10.514  1.00 0.00 ?  228 GLN A C    6  
ATOM 10922 O O    . GLN A 1 15  ? -2.251  2.249   10.731  1.00 0.00 ?  228 GLN A O    6  
ATOM 10923 C CB   . GLN A 1 15  ? -4.856  2.494   12.608  1.00 0.00 ?  228 GLN A CB   6  
ATOM 10924 C CG   . GLN A 1 15  ? -5.208  1.058   12.214  1.00 0.00 ?  228 GLN A CG   6  
ATOM 10925 C CD   . GLN A 1 15  ? -5.727  0.271   13.420  1.00 0.00 ?  228 GLN A CD   6  
ATOM 10926 O OE1  . GLN A 1 15  ? -5.123  -0.686  13.875  1.00 0.00 ?  228 GLN A OE1  6  
ATOM 10927 N NE2  . GLN A 1 15  ? -6.877  0.726   13.908  1.00 0.00 ?  228 GLN A NE2  6  
ATOM 10928 H H    . GLN A 1 15  ? -6.312  3.543   10.882  1.00 0.00 ?  228 GLN A H    6  
ATOM 10929 H HA   . GLN A 1 15  ? -3.722  4.115   11.767  1.00 0.00 ?  228 GLN A HA   6  
ATOM 10930 H HB2  . GLN A 1 15  ? -4.114  2.485   13.405  1.00 0.00 ?  228 GLN A HB2  6  
ATOM 10931 H HB3  . GLN A 1 15  ? -5.741  2.994   13.001  1.00 0.00 ?  228 GLN A HB3  6  
ATOM 10932 H HG2  . GLN A 1 15  ? -5.964  1.067   11.429  1.00 0.00 ?  228 GLN A HG2  6  
ATOM 10933 H HG3  . GLN A 1 15  ? -4.328  0.563   11.804  1.00 0.00 ?  228 GLN A HG3  6  
ATOM 10934 H HE21 . GLN A 1 15  ? -7.321  1.517   13.487  1.00 0.00 ?  228 GLN A HE21 6  
ATOM 10935 H HE22 . GLN A 1 15  ? -7.297  0.277   14.697  1.00 0.00 ?  228 GLN A HE22 6  
ATOM 10936 N N    . LEU A 1 16  ? -4.108  1.779   9.528   1.00 0.00 ?  229 LEU A N    6  
ATOM 10937 C CA   . LEU A 1 16  ? -3.418  0.898   8.601   1.00 0.00 ?  229 LEU A CA   6  
ATOM 10938 C C    . LEU A 1 16  ? -2.379  1.702   7.817   1.00 0.00 ?  229 LEU A C    6  
ATOM 10939 O O    . LEU A 1 16  ? -1.244  1.260   7.651   1.00 0.00 ?  229 LEU A O    6  
ATOM 10940 C CB   . LEU A 1 16  ? -4.424  0.162   7.713   1.00 0.00 ?  229 LEU A CB   6  
ATOM 10941 C CG   . LEU A 1 16  ? -4.687  -1.303  8.069   1.00 0.00 ?  229 LEU A CG   6  
ATOM 10942 C CD1  . LEU A 1 16  ? -6.024  -1.775  7.495   1.00 0.00 ?  229 LEU A CD1  6  
ATOM 10943 C CD2  . LEU A 1 16  ? -3.525  -2.193  7.624   1.00 0.00 ?  229 LEU A CD2  6  
ATOM 10944 H H    . LEU A 1 16  ? -5.087  1.888   9.359   1.00 0.00 ?  229 LEU A H    6  
ATOM 10945 H HA   . LEU A 1 16  ? -2.898  0.144   9.192   1.00 0.00 ?  229 LEU A HA   6  
ATOM 10946 H HB2  . LEU A 1 16  ? -5.372  0.700   7.749   1.00 0.00 ?  229 LEU A HB2  6  
ATOM 10947 H HB3  . LEU A 1 16  ? -4.071  0.207   6.683   1.00 0.00 ?  229 LEU A HB3  6  
ATOM 10948 H HG   . LEU A 1 16  ? -4.757  -1.383  9.154   1.00 0.00 ?  229 LEU A HG   6  
ATOM 10949 H HD11 . LEU A 1 16  ? -6.613  -2.244  8.283   1.00 0.00 ?  229 LEU A HD11 6  
ATOM 10950 H HD12 . LEU A 1 16  ? -6.569  -0.921  7.093   1.00 0.00 ?  229 LEU A HD12 6  
ATOM 10951 H HD13 . LEU A 1 16  ? -5.842  -2.497  6.699   1.00 0.00 ?  229 LEU A HD13 6  
ATOM 10952 H HD21 . LEU A 1 16  ? -2.592  -1.802  8.030   1.00 0.00 ?  229 LEU A HD21 6  
ATOM 10953 H HD22 . LEU A 1 16  ? -3.683  -3.207  7.989   1.00 0.00 ?  229 LEU A HD22 6  
ATOM 10954 H HD23 . LEU A 1 16  ? -3.471  -2.202  6.535   1.00 0.00 ?  229 LEU A HD23 6  
ATOM 10955 N N    . VAL A 1 17  ? -2.806  2.869   7.355   1.00 0.00 ?  230 VAL A N    6  
ATOM 10956 C CA   . VAL A 1 17  ? -1.927  3.738   6.593   1.00 0.00 ?  230 VAL A CA   6  
ATOM 10957 C C    . VAL A 1 17  ? -0.925  4.401   7.540   1.00 0.00 ?  230 VAL A C    6  
ATOM 10958 O O    . VAL A 1 17  ? 0.245   4.564   7.197   1.00 0.00 ?  230 VAL A O    6  
ATOM 10959 C CB   . VAL A 1 17  ? -2.753  4.749   5.795   1.00 0.00 ?  230 VAL A CB   6  
ATOM 10960 C CG1  . VAL A 1 17  ? -3.662  4.040   4.788   1.00 0.00 ?  230 VAL A CG1  6  
ATOM 10961 C CG2  . VAL A 1 17  ? -3.566  5.650   6.727   1.00 0.00 ?  230 VAL A CG2  6  
ATOM 10962 H H    . VAL A 1 17  ? -3.731  3.221   7.495   1.00 0.00 ?  230 VAL A H    6  
ATOM 10963 H HA   . VAL A 1 17  ? -1.381  3.115   5.885   1.00 0.00 ?  230 VAL A HA   6  
ATOM 10964 H HB   . VAL A 1 17  ? -2.063  5.381   5.237   1.00 0.00 ?  230 VAL A HB   6  
ATOM 10965 H HG11 . VAL A 1 17  ? -4.640  4.521   4.780   1.00 0.00 ?  230 VAL A HG11 6  
ATOM 10966 H HG12 . VAL A 1 17  ? -3.219  4.102   3.793   1.00 0.00 ?  230 VAL A HG12 6  
ATOM 10967 H HG13 . VAL A 1 17  ? -3.772  2.994   5.071   1.00 0.00 ?  230 VAL A HG13 6  
ATOM 10968 H HG21 . VAL A 1 17  ? -3.966  6.491   6.161   1.00 0.00 ?  230 VAL A HG21 6  
ATOM 10969 H HG22 . VAL A 1 17  ? -4.388  5.079   7.159   1.00 0.00 ?  230 VAL A HG22 6  
ATOM 10970 H HG23 . VAL A 1 17  ? -2.923  6.022   7.525   1.00 0.00 ?  230 VAL A HG23 6  
ATOM 10971 N N    . ALA A 1 18  ? -1.420  4.765   8.714   1.00 0.00 ?  231 ALA A N    6  
ATOM 10972 C CA   . ALA A 1 18  ? -0.583  5.406   9.713   1.00 0.00 ?  231 ALA A CA   6  
ATOM 10973 C C    . ALA A 1 18  ? 0.323   4.358   10.363  1.00 0.00 ?  231 ALA A C    6  
ATOM 10974 O O    . ALA A 1 18  ? 1.262   4.702   11.079  1.00 0.00 ?  231 ALA A O    6  
ATOM 10975 C CB   . ALA A 1 18  ? -1.466  6.126   10.734  1.00 0.00 ?  231 ALA A CB   6  
ATOM 10976 H H    . ALA A 1 18  ? -2.373  4.628   8.985   1.00 0.00 ?  231 ALA A H    6  
ATOM 10977 H HA   . ALA A 1 18  ? 0.037   6.144   9.203   1.00 0.00 ?  231 ALA A HA   6  
ATOM 10978 H HB1  . ALA A 1 18  ? -0.862  6.428   11.589  1.00 0.00 ?  231 ALA A HB1  6  
ATOM 10979 H HB2  . ALA A 1 18  ? -1.909  7.009   10.273  1.00 0.00 ?  231 ALA A HB2  6  
ATOM 10980 H HB3  . ALA A 1 18  ? -2.258  5.455   11.067  1.00 0.00 ?  231 ALA A HB3  6  
ATOM 10981 N N    . ALA A 1 19  ? 0.009   3.100   10.089  1.00 0.00 ?  232 ALA A N    6  
ATOM 10982 C CA   . ALA A 1 19  ? 0.782   1.999   10.638  1.00 0.00 ?  232 ALA A CA   6  
ATOM 10983 C C    . ALA A 1 19  ? 2.039   1.793   9.790   1.00 0.00 ?  232 ALA A C    6  
ATOM 10984 O O    . ALA A 1 19  ? 3.035   1.253   10.271  1.00 0.00 ?  232 ALA A O    6  
ATOM 10985 C CB   . ALA A 1 19  ? -0.090  0.744   10.702  1.00 0.00 ?  232 ALA A CB   6  
ATOM 10986 H H    . ALA A 1 19  ? -0.757  2.829   9.506   1.00 0.00 ?  232 ALA A H    6  
ATOM 10987 H HA   . ALA A 1 19  ? 1.078   2.273   11.651  1.00 0.00 ?  232 ALA A HA   6  
ATOM 10988 H HB1  . ALA A 1 19  ? -0.643  0.734   11.642  1.00 0.00 ?  232 ALA A HB1  6  
ATOM 10989 H HB2  . ALA A 1 19  ? -0.792  0.746   9.868   1.00 0.00 ?  232 ALA A HB2  6  
ATOM 10990 H HB3  . ALA A 1 19  ? 0.542   -0.142  10.643  1.00 0.00 ?  232 ALA A HB3  6  
ATOM 10991 N N    . VAL A 1 20  ? 1.953   2.233   8.544   1.00 0.00 ?  233 VAL A N    6  
ATOM 10992 C CA   . VAL A 1 20  ? 3.071   2.103   7.625   1.00 0.00 ?  233 VAL A CA   6  
ATOM 10993 C C    . VAL A 1 20  ? 4.067   3.237   7.878   1.00 0.00 ?  233 VAL A C    6  
ATOM 10994 O O    . VAL A 1 20  ? 3.681   4.402   7.953   1.00 0.00 ?  233 VAL A O    6  
ATOM 10995 C CB   . VAL A 1 20  ? 2.562   2.066   6.183   1.00 0.00 ?  233 VAL A CB   6  
ATOM 10996 C CG1  . VAL A 1 20  ? 2.525   3.470   5.577   1.00 0.00 ?  233 VAL A CG1  6  
ATOM 10997 C CG2  . VAL A 1 20  ? 3.408   1.121   5.327   1.00 0.00 ?  233 VAL A CG2  6  
ATOM 10998 H H    . VAL A 1 20  ? 1.140   2.671   8.161   1.00 0.00 ?  233 VAL A H    6  
ATOM 10999 H HA   . VAL A 1 20  ? 3.561   1.153   7.835   1.00 0.00 ?  233 VAL A HA   6  
ATOM 11000 H HB   . VAL A 1 20  ? 1.542   1.681   6.198   1.00 0.00 ?  233 VAL A HB   6  
ATOM 11001 H HG11 . VAL A 1 20  ? 1.809   3.493   4.756   1.00 0.00 ?  233 VAL A HG11 6  
ATOM 11002 H HG12 . VAL A 1 20  ? 2.226   4.188   6.341   1.00 0.00 ?  233 VAL A HG12 6  
ATOM 11003 H HG13 . VAL A 1 20  ? 3.516   3.730   5.203   1.00 0.00 ?  233 VAL A HG13 6  
ATOM 11004 H HG21 . VAL A 1 20  ? 3.783   0.307   5.947   1.00 0.00 ?  233 VAL A HG21 6  
ATOM 11005 H HG22 . VAL A 1 20  ? 2.795   0.712   4.523   1.00 0.00 ?  233 VAL A HG22 6  
ATOM 11006 H HG23 . VAL A 1 20  ? 4.247   1.670   4.901   1.00 0.00 ?  233 VAL A HG23 6  
ATOM 11007 N N    . PRO A 1 21  ? 5.363   2.845   8.005   1.00 0.00 ?  234 PRO A N    6  
ATOM 11008 C CA   . PRO A 1 21  ? 6.418   3.815   8.248   1.00 0.00 ?  234 PRO A CA   6  
ATOM 11009 C C    . PRO A 1 21  ? 6.744   4.600   6.976   1.00 0.00 ?  234 PRO A C    6  
ATOM 11010 O O    . PRO A 1 21  ? 7.373   5.655   7.037   1.00 0.00 ?  234 PRO A O    6  
ATOM 11011 C CB   . PRO A 1 21  ? 7.593   2.998   8.759   1.00 0.00 ?  234 PRO A CB   6  
ATOM 11012 C CG   . PRO A 1 21  ? 7.314   1.562   8.346   1.00 0.00 ?  234 PRO A CG   6  
ATOM 11013 C CD   . PRO A 1 21  ? 5.857   1.474   7.921   1.00 0.00 ?  234 PRO A CD   6  
ATOM 11014 H HA   . PRO A 1 21  ? 6.118   4.493   8.918   1.00 0.00 ?  234 PRO A HA   6  
ATOM 11015 H HB2  . PRO A 1 21  ? 8.531   3.353   8.331   1.00 0.00 ?  234 PRO A HB2  6  
ATOM 11016 H HB3  . PRO A 1 21  ? 7.686   3.082   9.842   1.00 0.00 ?  234 PRO A HB3  6  
ATOM 11017 H HG2  . PRO A 1 21  ? 7.969   1.267   7.526   1.00 0.00 ?  234 PRO A HG2  6  
ATOM 11018 H HG3  . PRO A 1 21  ? 7.513   0.881   9.173   1.00 0.00 ?  234 PRO A HG3  6  
ATOM 11019 H HD2  . PRO A 1 21  ? 5.763   1.080   6.910   1.00 0.00 ?  234 PRO A HD2  6  
ATOM 11020 H HD3  . PRO A 1 21  ? 5.294   0.809   8.576   1.00 0.00 ?  234 PRO A HD3  6  
ATOM 11021 N N    . LEU A 1 22  ? 6.301   4.055   5.852   1.00 0.00 ?  235 LEU A N    6  
ATOM 11022 C CA   . LEU A 1 22  ? 6.538   4.692   4.568   1.00 0.00 ?  235 LEU A CA   6  
ATOM 11023 C C    . LEU A 1 22  ? 5.830   6.048   4.537   1.00 0.00 ?  235 LEU A C    6  
ATOM 11024 O O    . LEU A 1 22  ? 6.284   6.974   3.867   1.00 0.00 ?  235 LEU A O    6  
ATOM 11025 C CB   . LEU A 1 22  ? 6.131   3.759   3.425   1.00 0.00 ?  235 LEU A CB   6  
ATOM 11026 C CG   . LEU A 1 22  ? 7.070   3.730   2.217   1.00 0.00 ?  235 LEU A CG   6  
ATOM 11027 C CD1  . LEU A 1 22  ? 7.292   5.137   1.661   1.00 0.00 ?  235 LEU A CD1  6  
ATOM 11028 C CD2  . LEU A 1 22  ? 8.388   3.035   2.564   1.00 0.00 ?  235 LEU A CD2  6  
ATOM 11029 H H    . LEU A 1 22  ? 5.790   3.197   5.811   1.00 0.00 ?  235 LEU A H    6  
ATOM 11030 H HA   . LEU A 1 22  ? 7.611   4.860   4.479   1.00 0.00 ?  235 LEU A HA   6  
ATOM 11031 H HB2  . LEU A 1 22  ? 6.048   2.747   3.820   1.00 0.00 ?  235 LEU A HB2  6  
ATOM 11032 H HB3  . LEU A 1 22  ? 5.138   4.050   3.081   1.00 0.00 ?  235 LEU A HB3  6  
ATOM 11033 H HG   . LEU A 1 22  ? 6.595   3.144   1.430   1.00 0.00 ?  235 LEU A HG   6  
ATOM 11034 H HD11 . LEU A 1 22  ? 6.385   5.479   1.161   1.00 0.00 ?  235 LEU A HD11 6  
ATOM 11035 H HD12 . LEU A 1 22  ? 7.535   5.817   2.478   1.00 0.00 ?  235 LEU A HD12 6  
ATOM 11036 H HD13 . LEU A 1 22  ? 8.116   5.120   0.947   1.00 0.00 ?  235 LEU A HD13 6  
ATOM 11037 H HD21 . LEU A 1 22  ? 8.406   2.800   3.628   1.00 0.00 ?  235 LEU A HD21 6  
ATOM 11038 H HD22 . LEU A 1 22  ? 8.477   2.115   1.987   1.00 0.00 ?  235 LEU A HD22 6  
ATOM 11039 H HD23 . LEU A 1 22  ? 9.221   3.696   2.324   1.00 0.00 ?  235 LEU A HD23 6  
ATOM 11040 N N    . PHE A 1 23  ? 4.729   6.121   5.271   1.00 0.00 ?  236 PHE A N    6  
ATOM 11041 C CA   . PHE A 1 23  ? 3.954   7.349   5.336   1.00 0.00 ?  236 PHE A CA   6  
ATOM 11042 C C    . PHE A 1 23  ? 4.014   7.962   6.737   1.00 0.00 ?  236 PHE A C    6  
ATOM 11043 O O    . PHE A 1 23  ? 3.194   8.810   7.083   1.00 0.00 ?  236 PHE A O    6  
ATOM 11044 C CB   . PHE A 1 23  ? 2.504   6.979   5.016   1.00 0.00 ?  236 PHE A CB   6  
ATOM 11045 C CG   . PHE A 1 23  ? 2.313   6.347   3.636   1.00 0.00 ?  236 PHE A CG   6  
ATOM 11046 C CD1  . PHE A 1 23  ? 3.300   6.436   2.705   1.00 0.00 ?  236 PHE A CD1  6  
ATOM 11047 C CD2  . PHE A 1 23  ? 1.156   5.697   3.340   1.00 0.00 ?  236 PHE A CD2  6  
ATOM 11048 C CE1  . PHE A 1 23  ? 3.123   5.849   1.424   1.00 0.00 ?  236 PHE A CE1  6  
ATOM 11049 C CE2  . PHE A 1 23  ? 0.978   5.110   2.059   1.00 0.00 ?  236 PHE A CE2  6  
ATOM 11050 C CZ   . PHE A 1 23  ? 1.966   5.199   1.128   1.00 0.00 ?  236 PHE A CZ   6  
ATOM 11051 H H    . PHE A 1 23  ? 4.366   5.363   5.813   1.00 0.00 ?  236 PHE A H    6  
ATOM 11052 H HA   . PHE A 1 23  ? 4.388   8.044   4.618   1.00 0.00 ?  236 PHE A HA   6  
ATOM 11053 H HB2  . PHE A 1 23  ? 2.140   6.287   5.775   1.00 0.00 ?  236 PHE A HB2  6  
ATOM 11054 H HB3  . PHE A 1 23  ? 1.888   7.877   5.082   1.00 0.00 ?  236 PHE A HB3  6  
ATOM 11055 H HD1  . PHE A 1 23  ? 4.228   6.957   2.942   1.00 0.00 ?  236 PHE A HD1  6  
ATOM 11056 H HD2  . PHE A 1 23  ? 0.364   5.626   4.086   1.00 0.00 ?  236 PHE A HD2  6  
ATOM 11057 H HE1  . PHE A 1 23  ? 3.914   5.920   0.677   1.00 0.00 ?  236 PHE A HE1  6  
ATOM 11058 H HE2  . PHE A 1 23  ? 0.051   4.589   1.822   1.00 0.00 ?  236 PHE A HE2  6  
ATOM 11059 H HZ   . PHE A 1 23  ? 1.829   4.748   0.145   1.00 0.00 ?  236 PHE A HZ   6  
ATOM 11060 N N    . GLN A 1 24  ? 4.995   7.508   7.504   1.00 0.00 ?  237 GLN A N    6  
ATOM 11061 C CA   . GLN A 1 24  ? 5.173   8.001   8.859   1.00 0.00 ?  237 GLN A CA   6  
ATOM 11062 C C    . GLN A 1 24  ? 5.662   9.451   8.836   1.00 0.00 ?  237 GLN A C    6  
ATOM 11063 O O    . GLN A 1 24  ? 5.529   10.170  9.825   1.00 0.00 ?  237 GLN A O    6  
ATOM 11064 C CB   . GLN A 1 24  ? 6.137   7.110   9.645   1.00 0.00 ?  237 GLN A CB   6  
ATOM 11065 C CG   . GLN A 1 24  ? 5.396   6.317   10.723  1.00 0.00 ?  237 GLN A CG   6  
ATOM 11066 C CD   . GLN A 1 24  ? 6.338   5.342   11.431  1.00 0.00 ?  237 GLN A CD   6  
ATOM 11067 O OE1  . GLN A 1 24  ? 6.108   4.145   11.485  1.00 0.00 ?  237 GLN A OE1  6  
ATOM 11068 N NE2  . GLN A 1 24  ? 7.409   5.919   11.970  1.00 0.00 ?  237 GLN A NE2  6  
ATOM 11069 H H    . GLN A 1 24  ? 5.658   6.818   7.215   1.00 0.00 ?  237 GLN A H    6  
ATOM 11070 H HA   . GLN A 1 24  ? 4.186   7.951   9.318   1.00 0.00 ?  237 GLN A HA   6  
ATOM 11071 H HB2  . GLN A 1 24  ? 6.640   6.423   8.964   1.00 0.00 ?  237 GLN A HB2  6  
ATOM 11072 H HB3  . GLN A 1 24  ? 6.911   7.723   10.107  1.00 0.00 ?  237 GLN A HB3  6  
ATOM 11073 H HG2  . GLN A 1 24  ? 4.962   7.003   11.450  1.00 0.00 ?  237 GLN A HG2  6  
ATOM 11074 H HG3  . GLN A 1 24  ? 4.570   5.767   10.271  1.00 0.00 ?  237 GLN A HG3  6  
ATOM 11075 H HE21 . GLN A 1 24  ? 7.537   6.907   11.889  1.00 0.00 ?  237 GLN A HE21 6  
ATOM 11076 H HE22 . GLN A 1 24  ? 8.084   5.364   12.455  1.00 0.00 ?  237 GLN A HE22 6  
ATOM 11077 N N    . LYS A 1 25  ? 6.216   9.837   7.697   1.00 0.00 ?  238 LYS A N    6  
ATOM 11078 C CA   . LYS A 1 25  ? 6.725   11.188  7.532   1.00 0.00 ?  238 LYS A CA   6  
ATOM 11079 C C    . LYS A 1 25  ? 5.630   12.071  6.931   1.00 0.00 ?  238 LYS A C    6  
ATOM 11080 O O    . LYS A 1 25  ? 5.755   13.295  6.912   1.00 0.00 ?  238 LYS A O    6  
ATOM 11081 C CB   . LYS A 1 25  ? 8.021   11.177  6.719   1.00 0.00 ?  238 LYS A CB   6  
ATOM 11082 C CG   . LYS A 1 25  ? 8.971   10.085  7.215   1.00 0.00 ?  238 LYS A CG   6  
ATOM 11083 C CD   . LYS A 1 25  ? 9.515   10.421  8.605   1.00 0.00 ?  238 LYS A CD   6  
ATOM 11084 C CE   . LYS A 1 25  ? 10.299  9.244   9.187   1.00 0.00 ?  238 LYS A CE   6  
ATOM 11085 N NZ   . LYS A 1 25  ? 11.146  9.691   10.315  1.00 0.00 1  238 LYS A NZ   6  
ATOM 11086 H H    . LYS A 1 25  ? 6.320   9.246   6.897   1.00 0.00 ?  238 LYS A H    6  
ATOM 11087 H HA   . LYS A 1 25  ? 6.970   11.568  8.524   1.00 0.00 ?  238 LYS A HA   6  
ATOM 11088 H HB2  . LYS A 1 25  ? 7.793   11.014  5.665   1.00 0.00 ?  238 LYS A HB2  6  
ATOM 11089 H HB3  . LYS A 1 25  ? 8.509   12.149  6.792   1.00 0.00 ?  238 LYS A HB3  6  
ATOM 11090 H HG2  . LYS A 1 25  ? 8.446   9.129   7.248   1.00 0.00 ?  238 LYS A HG2  6  
ATOM 11091 H HG3  . LYS A 1 25  ? 9.798   9.970   6.515   1.00 0.00 ?  238 LYS A HG3  6  
ATOM 11092 H HD2  . LYS A 1 25  ? 10.160  11.298  8.544   1.00 0.00 ?  238 LYS A HD2  6  
ATOM 11093 H HD3  . LYS A 1 25  ? 8.691   10.678  9.270   1.00 0.00 ?  238 LYS A HD3  6  
ATOM 11094 H HE2  . LYS A 1 25  ? 9.608   8.472   9.527   1.00 0.00 ?  238 LYS A HE2  6  
ATOM 11095 H HE3  . LYS A 1 25  ? 10.921  8.795   8.413   1.00 0.00 ?  238 LYS A HE3  6  
ATOM 11096 H HZ1  . LYS A 1 25  ? 10.993  9.096   11.104  1.00 0.00 ?  238 LYS A HZ1  6  
ATOM 11097 H HZ2  . LYS A 1 25  ? 12.108  9.649   10.046  1.00 0.00 ?  238 LYS A HZ2  6  
ATOM 11098 H HZ3  . LYS A 1 25  ? 10.909  10.632  10.557  1.00 0.00 ?  238 LYS A HZ3  6  
ATOM 11099 N N    . LEU A 1 26  ? 4.581   11.417  6.454   1.00 0.00 ?  239 LEU A N    6  
ATOM 11100 C CA   . LEU A 1 26  ? 3.465   12.127  5.854   1.00 0.00 ?  239 LEU A CA   6  
ATOM 11101 C C    . LEU A 1 26  ? 2.701   12.882  6.945   1.00 0.00 ?  239 LEU A C    6  
ATOM 11102 O O    . LEU A 1 26  ? 3.059   12.813  8.119   1.00 0.00 ?  239 LEU A O    6  
ATOM 11103 C CB   . LEU A 1 26  ? 2.592   11.167  5.044   1.00 0.00 ?  239 LEU A CB   6  
ATOM 11104 C CG   . LEU A 1 26  ? 3.187   10.670  3.725   1.00 0.00 ?  239 LEU A CG   6  
ATOM 11105 C CD1  . LEU A 1 26  ? 2.208   9.749   2.994   1.00 0.00 ?  239 LEU A CD1  6  
ATOM 11106 C CD2  . LEU A 1 26  ? 3.635   11.842  2.849   1.00 0.00 ?  239 LEU A CD2  6  
ATOM 11107 H H    . LEU A 1 26  ? 4.488   10.421  6.473   1.00 0.00 ?  239 LEU A H    6  
ATOM 11108 H HA   . LEU A 1 26  ? 3.878   12.855  5.156   1.00 0.00 ?  239 LEU A HA   6  
ATOM 11109 H HB2  . LEU A 1 26  ? 2.364   10.302  5.666   1.00 0.00 ?  239 LEU A HB2  6  
ATOM 11110 H HB3  . LEU A 1 26  ? 1.645   11.663  4.828   1.00 0.00 ?  239 LEU A HB3  6  
ATOM 11111 H HG   . LEU A 1 26  ? 4.075   10.080  3.952   1.00 0.00 ?  239 LEU A HG   6  
ATOM 11112 H HD11 . LEU A 1 26  ? 1.186   10.032  3.247   1.00 0.00 ?  239 LEU A HD11 6  
ATOM 11113 H HD12 . LEU A 1 26  ? 2.356   9.843   1.918   1.00 0.00 ?  239 LEU A HD12 6  
ATOM 11114 H HD13 . LEU A 1 26  ? 2.385   8.717   3.296   1.00 0.00 ?  239 LEU A HD13 6  
ATOM 11115 H HD21 . LEU A 1 26  ? 4.719   11.945  2.906   1.00 0.00 ?  239 LEU A HD21 6  
ATOM 11116 H HD22 . LEU A 1 26  ? 3.341   11.657  1.816   1.00 0.00 ?  239 LEU A HD22 6  
ATOM 11117 H HD23 . LEU A 1 26  ? 3.164   12.760  3.202   1.00 0.00 ?  239 LEU A HD23 6  
ATOM 11118 N N    . GLY A 1 27  ? 1.663   13.585  6.517   1.00 0.00 ?  240 GLY A N    6  
ATOM 11119 C CA   . GLY A 1 27  ? 0.845   14.351  7.442   1.00 0.00 ?  240 GLY A CA   6  
ATOM 11120 C C    . GLY A 1 27  ? -0.539  13.719  7.603   1.00 0.00 ?  240 GLY A C    6  
ATOM 11121 O O    . GLY A 1 27  ? -0.802  12.645  7.065   1.00 0.00 ?  240 GLY A O    6  
ATOM 11122 H H    . GLY A 1 27  ? 1.378   13.635  5.559   1.00 0.00 ?  240 GLY A H    6  
ATOM 11123 H HA2  . GLY A 1 27  ? 1.340   14.405  8.411   1.00 0.00 ?  240 GLY A HA2  6  
ATOM 11124 H HA3  . GLY A 1 27  ? 0.742   15.374  7.080   1.00 0.00 ?  240 GLY A HA3  6  
ATOM 11125 N N    . PRO A 1 28  ? -1.410  14.431  8.368   1.00 0.00 ?  241 PRO A N    6  
ATOM 11126 C CA   . PRO A 1 28  ? -2.760  13.952  8.607   1.00 0.00 ?  241 PRO A CA   6  
ATOM 11127 C C    . PRO A 1 28  ? -3.638  14.142  7.369   1.00 0.00 ?  241 PRO A C    6  
ATOM 11128 O O    . PRO A 1 28  ? -4.534  13.341  7.109   1.00 0.00 ?  241 PRO A O    6  
ATOM 11129 C CB   . PRO A 1 28  ? -3.251  14.741  9.810   1.00 0.00 ?  241 PRO A CB   6  
ATOM 11130 C CG   . PRO A 1 28  ? -2.340  15.954  9.911   1.00 0.00 ?  241 PRO A CG   6  
ATOM 11131 C CD   . PRO A 1 28  ? -1.133  15.707  9.022   1.00 0.00 ?  241 PRO A CD   6  
ATOM 11132 H HA   . PRO A 1 28  ? -2.752  12.968  8.788   1.00 0.00 ?  241 PRO A HA   6  
ATOM 11133 H HB2  . PRO A 1 28  ? -4.290  15.043  9.682   1.00 0.00 ?  241 PRO A HB2  6  
ATOM 11134 H HB3  . PRO A 1 28  ? -3.203  14.140  10.718  1.00 0.00 ?  241 PRO A HB3  6  
ATOM 11135 H HG2  . PRO A 1 28  ? -2.868  16.855  9.597   1.00 0.00 ?  241 PRO A HG2  6  
ATOM 11136 H HG3  . PRO A 1 28  ? -2.028  16.112  10.944  1.00 0.00 ?  241 PRO A HG3  6  
ATOM 11137 H HD2  . PRO A 1 28  ? -1.008  16.507  8.292   1.00 0.00 ?  241 PRO A HD2  6  
ATOM 11138 H HD3  . PRO A 1 28  ? -0.214  15.662  9.605   1.00 0.00 ?  241 PRO A HD3  6  
ATOM 11139 N N    . ALA A 1 29  ? -3.349  15.208  6.636   1.00 0.00 ?  242 ALA A N    6  
ATOM 11140 C CA   . ALA A 1 29  ? -4.100  15.514  5.431   1.00 0.00 ?  242 ALA A CA   6  
ATOM 11141 C C    . ALA A 1 29  ? -3.711  14.527  4.329   1.00 0.00 ?  242 ALA A C    6  
ATOM 11142 O O    . ALA A 1 29  ? -4.539  14.165  3.494   1.00 0.00 ?  242 ALA A O    6  
ATOM 11143 C CB   . ALA A 1 29  ? -3.849  16.968  5.028   1.00 0.00 ?  242 ALA A CB   6  
ATOM 11144 H H    . ALA A 1 29  ? -2.618  15.855  6.854   1.00 0.00 ?  242 ALA A H    6  
ATOM 11145 H HA   . ALA A 1 29  ? -5.159  15.391  5.660   1.00 0.00 ?  242 ALA A HA   6  
ATOM 11146 H HB1  . ALA A 1 29  ? -2.931  17.030  4.443   1.00 0.00 ?  242 ALA A HB1  6  
ATOM 11147 H HB2  . ALA A 1 29  ? -4.685  17.329  4.430   1.00 0.00 ?  242 ALA A HB2  6  
ATOM 11148 H HB3  . ALA A 1 29  ? -3.751  17.582  5.923   1.00 0.00 ?  242 ALA A HB3  6  
ATOM 11149 N N    . VAL A 1 30  ? -2.451  14.121  4.360   1.00 0.00 ?  243 VAL A N    6  
ATOM 11150 C CA   . VAL A 1 30  ? -1.942  13.183  3.374   1.00 0.00 ?  243 VAL A CA   6  
ATOM 11151 C C    . VAL A 1 30  ? -2.421  11.773  3.722   1.00 0.00 ?  243 VAL A C    6  
ATOM 11152 O O    . VAL A 1 30  ? -2.724  10.979  2.833   1.00 0.00 ?  243 VAL A O    6  
ATOM 11153 C CB   . VAL A 1 30  ? -0.418  13.292  3.285   1.00 0.00 ?  243 VAL A CB   6  
ATOM 11154 C CG1  . VAL A 1 30  ? 0.162   12.174  2.418   1.00 0.00 ?  243 VAL A CG1  6  
ATOM 11155 C CG2  . VAL A 1 30  ? 0.004   14.667  2.763   1.00 0.00 ?  243 VAL A CG2  6  
ATOM 11156 H H    . VAL A 1 30  ? -1.783  14.420  5.042   1.00 0.00 ?  243 VAL A H    6  
ATOM 11157 H HA   . VAL A 1 30  ? -2.357  13.466  2.406   1.00 0.00 ?  243 VAL A HA   6  
ATOM 11158 H HB   . VAL A 1 30  ? -0.015  13.179  4.292   1.00 0.00 ?  243 VAL A HB   6  
ATOM 11159 H HG11 . VAL A 1 30  ? -0.025  12.395  1.367   1.00 0.00 ?  243 VAL A HG11 6  
ATOM 11160 H HG12 . VAL A 1 30  ? 1.237   12.102  2.588   1.00 0.00 ?  243 VAL A HG12 6  
ATOM 11161 H HG13 . VAL A 1 30  ? -0.311  11.228  2.680   1.00 0.00 ?  243 VAL A HG13 6  
ATOM 11162 H HG21 . VAL A 1 30  ? 0.388   14.567  1.747   1.00 0.00 ?  243 VAL A HG21 6  
ATOM 11163 H HG22 . VAL A 1 30  ? -0.858  15.335  2.761   1.00 0.00 ?  243 VAL A HG22 6  
ATOM 11164 H HG23 . VAL A 1 30  ? 0.781   15.078  3.406   1.00 0.00 ?  243 VAL A HG23 6  
ATOM 11165 N N    . LEU A 1 31  ? -2.474  11.504  5.019   1.00 0.00 ?  244 LEU A N    6  
ATOM 11166 C CA   . LEU A 1 31  ? -2.911  10.203  5.496   1.00 0.00 ?  244 LEU A CA   6  
ATOM 11167 C C    . LEU A 1 31  ? -4.422  10.072  5.294   1.00 0.00 ?  244 LEU A C    6  
ATOM 11168 O O    . LEU A 1 31  ? -4.907  9.025   4.867   1.00 0.00 ?  244 LEU A O    6  
ATOM 11169 C CB   . LEU A 1 31  ? -2.462  9.984   6.942   1.00 0.00 ?  244 LEU A CB   6  
ATOM 11170 C CG   . LEU A 1 31  ? -1.114  9.286   7.127   1.00 0.00 ?  244 LEU A CG   6  
ATOM 11171 C CD1  . LEU A 1 31  ? -1.206  7.806   6.749   1.00 0.00 ?  244 LEU A CD1  6  
ATOM 11172 C CD2  . LEU A 1 31  ? -0.011  10.008  6.350   1.00 0.00 ?  244 LEU A CD2  6  
ATOM 11173 H H    . LEU A 1 31  ? -2.226  12.155  5.736   1.00 0.00 ?  244 LEU A H    6  
ATOM 11174 H HA   . LEU A 1 31  ? -2.415  9.448   4.886   1.00 0.00 ?  244 LEU A HA   6  
ATOM 11175 H HB2  . LEU A 1 31  ? -2.418  10.953  7.439   1.00 0.00 ?  244 LEU A HB2  6  
ATOM 11176 H HB3  . LEU A 1 31  ? -3.226  9.398   7.454   1.00 0.00 ?  244 LEU A HB3  6  
ATOM 11177 H HG   . LEU A 1 31  ? -0.847  9.332   8.183   1.00 0.00 ?  244 LEU A HG   6  
ATOM 11178 H HD11 . LEU A 1 31  ? -0.350  7.534   6.132   1.00 0.00 ?  244 LEU A HD11 6  
ATOM 11179 H HD12 . LEU A 1 31  ? -1.208  7.199   7.655   1.00 0.00 ?  244 LEU A HD12 6  
ATOM 11180 H HD13 . LEU A 1 31  ? -2.126  7.630   6.192   1.00 0.00 ?  244 LEU A HD13 6  
ATOM 11181 H HD21 . LEU A 1 31  ? 0.544   10.658  7.027   1.00 0.00 ?  244 LEU A HD21 6  
ATOM 11182 H HD22 . LEU A 1 31  ? 0.667   9.274   5.914   1.00 0.00 ?  244 LEU A HD22 6  
ATOM 11183 H HD23 . LEU A 1 31  ? -0.458  10.606  5.556   1.00 0.00 ?  244 LEU A HD23 6  
ATOM 11184 N N    . VAL A 1 32  ? -5.125  11.149  5.612   1.00 0.00 ?  245 VAL A N    6  
ATOM 11185 C CA   . VAL A 1 32  ? -6.571  11.168  5.472   1.00 0.00 ?  245 VAL A CA   6  
ATOM 11186 C C    . VAL A 1 32  ? -6.935  11.124  3.986   1.00 0.00 ?  245 VAL A C    6  
ATOM 11187 O O    . VAL A 1 32  ? -7.889  10.452  3.597   1.00 0.00 ?  245 VAL A O    6  
ATOM 11188 C CB   . VAL A 1 32  ? -7.151  12.386  6.194   1.00 0.00 ?  245 VAL A CB   6  
ATOM 11189 C CG1  . VAL A 1 32  ? -7.026  13.645  5.333   1.00 0.00 ?  245 VAL A CG1  6  
ATOM 11190 C CG2  . VAL A 1 32  ? -8.606  12.141  6.599   1.00 0.00 ?  245 VAL A CG2  6  
ATOM 11191 H H    . VAL A 1 32  ? -4.723  11.996  5.960   1.00 0.00 ?  245 VAL A H    6  
ATOM 11192 H HA   . VAL A 1 32  ? -6.960  10.272  5.955   1.00 0.00 ?  245 VAL A HA   6  
ATOM 11193 H HB   . VAL A 1 32  ? -6.572  12.543  7.104   1.00 0.00 ?  245 VAL A HB   6  
ATOM 11194 H HG11 . VAL A 1 32  ? -7.311  14.517  5.922   1.00 0.00 ?  245 VAL A HG11 6  
ATOM 11195 H HG12 . VAL A 1 32  ? -5.995  13.754  4.998   1.00 0.00 ?  245 VAL A HG12 6  
ATOM 11196 H HG13 . VAL A 1 32  ? -7.683  13.560  4.468   1.00 0.00 ?  245 VAL A HG13 6  
ATOM 11197 H HG21 . VAL A 1 32  ? -8.988  11.267  6.071   1.00 0.00 ?  245 VAL A HG21 6  
ATOM 11198 H HG22 . VAL A 1 32  ? -8.660  11.969  7.674   1.00 0.00 ?  245 VAL A HG22 6  
ATOM 11199 H HG23 . VAL A 1 32  ? -9.207  13.013  6.340   1.00 0.00 ?  245 VAL A HG23 6  
ATOM 11200 N N    . GLU A 1 33  ? -6.156  11.849  3.197   1.00 0.00 ?  246 GLU A N    6  
ATOM 11201 C CA   . GLU A 1 33  ? -6.385  11.901  1.763   1.00 0.00 ?  246 GLU A CA   6  
ATOM 11202 C C    . GLU A 1 33  ? -6.015  10.564  1.118   1.00 0.00 ?  246 GLU A C    6  
ATOM 11203 O O    . GLU A 1 33  ? -6.721  10.082  0.233   1.00 0.00 ?  246 GLU A O    6  
ATOM 11204 C CB   . GLU A 1 33  ? -5.604  13.052  1.125   1.00 0.00 ?  246 GLU A CB   6  
ATOM 11205 C CG   . GLU A 1 33  ? -6.040  13.274  -0.325  1.00 0.00 ?  246 GLU A CG   6  
ATOM 11206 C CD   . GLU A 1 33  ? -7.278  14.170  -0.394  1.00 0.00 ?  246 GLU A CD   6  
ATOM 11207 O OE1  . GLU A 1 33  ? -8.408  13.679  -0.256  1.00 0.00 ?  246 GLU A OE1  6  
ATOM 11208 O OE2  . GLU A 1 33  ? -7.035  15.421  -0.597  1.00 0.00 -1 246 GLU A OE2  6  
ATOM 11209 H H    . GLU A 1 33  ? -5.382  12.393  3.522   1.00 0.00 ?  246 GLU A H    6  
ATOM 11210 H HA   . GLU A 1 33  ? -7.452  12.086  1.646   1.00 0.00 ?  246 GLU A HA   6  
ATOM 11211 H HB2  . GLU A 1 33  ? -5.761  13.965  1.699   1.00 0.00 ?  246 GLU A HB2  6  
ATOM 11212 H HB3  . GLU A 1 33  ? -4.536  12.835  1.158   1.00 0.00 ?  246 GLU A HB3  6  
ATOM 11213 H HG2  . GLU A 1 33  ? -5.226  13.728  -0.888  1.00 0.00 ?  246 GLU A HG2  6  
ATOM 11214 H HG3  . GLU A 1 33  ? -6.256  12.313  -0.794  1.00 0.00 ?  246 GLU A HG3  6  
ATOM 11215 H HE2  . GLU A 1 33  ? -6.403  15.525  -1.365  1.00 0.00 ?  246 GLU A HE2  6  
ATOM 11216 N N    . ILE A 1 34  ? -4.910  10.003  1.585   1.00 0.00 ?  247 ILE A N    6  
ATOM 11217 C CA   . ILE A 1 34  ? -4.438  8.731   1.065   1.00 0.00 ?  247 ILE A CA   6  
ATOM 11218 C C    . ILE A 1 34  ? -5.433  7.631   1.441   1.00 0.00 ?  247 ILE A C    6  
ATOM 11219 O O    . ILE A 1 34  ? -5.883  6.876   0.581   1.00 0.00 ?  247 ILE A O    6  
ATOM 11220 C CB   . ILE A 1 34  ? -3.009  8.456   1.536   1.00 0.00 ?  247 ILE A CB   6  
ATOM 11221 C CG1  . ILE A 1 34  ? -1.994  9.218   0.683   1.00 0.00 ?  247 ILE A CG1  6  
ATOM 11222 C CG2  . ILE A 1 34  ? -2.721  6.953   1.565   1.00 0.00 ?  247 ILE A CG2  6  
ATOM 11223 C CD1  . ILE A 1 34  ? -0.608  9.199   1.333   1.00 0.00 ?  247 ILE A CD1  6  
ATOM 11224 H H    . ILE A 1 34  ? -4.341  10.402  2.305   1.00 0.00 ?  247 ILE A H    6  
ATOM 11225 H HA   . ILE A 1 34  ? -4.409  8.813   -0.022  1.00 0.00 ?  247 ILE A HA   6  
ATOM 11226 H HB   . ILE A 1 34  ? -2.910  8.822   2.559   1.00 0.00 ?  247 ILE A HB   6  
ATOM 11227 H HG12 . ILE A 1 34  ? -1.940  8.771   -0.310  1.00 0.00 ?  247 ILE A HG12 6  
ATOM 11228 H HG13 . ILE A 1 34  ? -2.324  10.248  0.552   1.00 0.00 ?  247 ILE A HG13 6  
ATOM 11229 H HG21 . ILE A 1 34  ? -1.659  6.784   1.391   1.00 0.00 ?  247 ILE A HG21 6  
ATOM 11230 H HG22 . ILE A 1 34  ? -2.999  6.548   2.538   1.00 0.00 ?  247 ILE A HG22 6  
ATOM 11231 H HG23 . ILE A 1 34  ? -3.301  6.457   0.786   1.00 0.00 ?  247 ILE A HG23 6  
ATOM 11232 H HD11 . ILE A 1 34  ? -0.063  10.100  1.051   1.00 0.00 ?  247 ILE A HD11 6  
ATOM 11233 H HD12 . ILE A 1 34  ? -0.716  9.164   2.417   1.00 0.00 ?  247 ILE A HD12 6  
ATOM 11234 H HD13 . ILE A 1 34  ? -0.059  8.321   0.993   1.00 0.00 ?  247 ILE A HD13 6  
ATOM 11235 N N    . VAL A 1 35  ? -5.747  7.575   2.727   1.00 0.00 ?  248 VAL A N    6  
ATOM 11236 C CA   . VAL A 1 35  ? -6.680  6.580   3.227   1.00 0.00 ?  248 VAL A CA   6  
ATOM 11237 C C    . VAL A 1 35  ? -8.052  6.807   2.589   1.00 0.00 ?  248 VAL A C    6  
ATOM 11238 O O    . VAL A 1 35  ? -8.810  5.861   2.387   1.00 0.00 ?  248 VAL A O    6  
ATOM 11239 C CB   . VAL A 1 35  ? -6.718  6.621   4.756   1.00 0.00 ?  248 VAL A CB   6  
ATOM 11240 C CG1  . VAL A 1 35  ? -7.425  7.882   5.254   1.00 0.00 ?  248 VAL A CG1  6  
ATOM 11241 C CG2  . VAL A 1 35  ? -7.378  5.362   5.322   1.00 0.00 ?  248 VAL A CG2  6  
ATOM 11242 H H    . VAL A 1 35  ? -5.376  8.193   3.420   1.00 0.00 ?  248 VAL A H    6  
ATOM 11243 H HA   . VAL A 1 35  ? -6.310  5.601   2.924   1.00 0.00 ?  248 VAL A HA   6  
ATOM 11244 H HB   . VAL A 1 35  ? -5.689  6.649   5.116   1.00 0.00 ?  248 VAL A HB   6  
ATOM 11245 H HG11 . VAL A 1 35  ? -7.076  8.743   4.685   1.00 0.00 ?  248 VAL A HG11 6  
ATOM 11246 H HG12 . VAL A 1 35  ? -8.502  7.771   5.121   1.00 0.00 ?  248 VAL A HG12 6  
ATOM 11247 H HG13 . VAL A 1 35  ? -7.203  8.031   6.311   1.00 0.00 ?  248 VAL A HG13 6  
ATOM 11248 H HG21 . VAL A 1 35  ? -6.644  4.790   5.890   1.00 0.00 ?  248 VAL A HG21 6  
ATOM 11249 H HG22 . VAL A 1 35  ? -8.202  5.647   5.976   1.00 0.00 ?  248 VAL A HG22 6  
ATOM 11250 H HG23 . VAL A 1 35  ? -7.759  4.752   4.503   1.00 0.00 ?  248 VAL A HG23 6  
ATOM 11251 N N    . ARG A 1 36  ? -8.328  8.068   2.290   1.00 0.00 ?  249 ARG A N    6  
ATOM 11252 C CA   . ARG A 1 36  ? -9.596  8.431   1.679   1.00 0.00 ?  249 ARG A CA   6  
ATOM 11253 C C    . ARG A 1 36  ? -9.621  7.998   0.212   1.00 0.00 ?  249 ARG A C    6  
ATOM 11254 O O    . ARG A 1 36  ? -10.690 7.769   -0.353  1.00 0.00 ?  249 ARG A O    6  
ATOM 11255 C CB   . ARG A 1 36  ? -9.835  9.940   1.763   1.00 0.00 ?  249 ARG A CB   6  
ATOM 11256 C CG   . ARG A 1 36  ? -10.473 10.321  3.100   1.00 0.00 ?  249 ARG A CG   6  
ATOM 11257 C CD   . ARG A 1 36  ? -11.989 10.122  3.060   1.00 0.00 ?  249 ARG A CD   6  
ATOM 11258 N NE   . ARG A 1 36  ? -12.634 11.276  2.394   1.00 0.00 ?  249 ARG A NE   6  
ATOM 11259 C CZ   . ARG A 1 36  ? -12.745 12.494  2.942   1.00 0.00 ?  249 ARG A CZ   6  
ATOM 11260 N NH1  . ARG A 1 36  ? -12.255 12.725  4.168   1.00 0.00 ?  249 ARG A NH1  6  
ATOM 11261 N NH2  . ARG A 1 36  ? -13.345 13.482  2.264   1.00 0.00 1  249 ARG A NH2  6  
ATOM 11262 H H    . ARG A 1 36  ? -7.706  8.832   2.458   1.00 0.00 ?  249 ARG A H    6  
ATOM 11263 H HA   . ARG A 1 36  ? -10.348 7.897   2.259   1.00 0.00 ?  249 ARG A HA   6  
ATOM 11264 H HB2  . ARG A 1 36  ? -8.889  10.469  1.643   1.00 0.00 ?  249 ARG A HB2  6  
ATOM 11265 H HB3  . ARG A 1 36  ? -10.482 10.255  0.944   1.00 0.00 ?  249 ARG A HB3  6  
ATOM 11266 H HG2  . ARG A 1 36  ? -10.044 9.715   3.898   1.00 0.00 ?  249 ARG A HG2  6  
ATOM 11267 H HG3  . ARG A 1 36  ? -10.245 11.361  3.333   1.00 0.00 ?  249 ARG A HG3  6  
ATOM 11268 H HD2  . ARG A 1 36  ? -12.230 9.203   2.527   1.00 0.00 ?  249 ARG A HD2  6  
ATOM 11269 H HD3  . ARG A 1 36  ? -12.377 10.014  4.073   1.00 0.00 ?  249 ARG A HD3  6  
ATOM 11270 H HE   . ARG A 1 36  ? -13.011 11.138  1.478   1.00 0.00 ?  249 ARG A HE   6  
ATOM 11271 H HH11 . ARG A 1 36  ? -11.806 11.988  4.674   1.00 0.00 ?  249 ARG A HH11 6  
ATOM 11272 H HH12 . ARG A 1 36  ? -12.337 13.633  4.576   1.00 0.00 ?  249 ARG A HH12 6  
ATOM 11273 H HH21 . ARG A 1 36  ? -13.711 13.310  1.349   1.00 0.00 ?  249 ARG A HH21 6  
ATOM 11274 H HH22 . ARG A 1 36  ? -13.428 14.390  2.673   1.00 0.00 ?  249 ARG A HH22 6  
ATOM 11275 N N    . ALA A 1 37  ? -8.432  7.900   -0.364  1.00 0.00 ?  250 ALA A N    6  
ATOM 11276 C CA   . ALA A 1 37  ? -8.304  7.499   -1.754  1.00 0.00 ?  250 ALA A CA   6  
ATOM 11277 C C    . ALA A 1 37  ? -8.297  5.971   -1.841  1.00 0.00 ?  250 ALA A C    6  
ATOM 11278 O O    . ALA A 1 37  ? -8.526  5.405   -2.909  1.00 0.00 ?  250 ALA A O    6  
ATOM 11279 C CB   . ALA A 1 37  ? -7.042  8.123   -2.352  1.00 0.00 ?  250 ALA A CB   6  
ATOM 11280 H H    . ALA A 1 37  ? -7.567  8.089   0.103   1.00 0.00 ?  250 ALA A H    6  
ATOM 11281 H HA   . ALA A 1 37  ? -9.173  7.880   -2.291  1.00 0.00 ?  250 ALA A HA   6  
ATOM 11282 H HB1  . ALA A 1 37  ? -7.180  8.267   -3.424  1.00 0.00 ?  250 ALA A HB1  6  
ATOM 11283 H HB2  . ALA A 1 37  ? -6.853  9.085   -1.877  1.00 0.00 ?  250 ALA A HB2  6  
ATOM 11284 H HB3  . ALA A 1 37  ? -6.193  7.460   -2.182  1.00 0.00 ?  250 ALA A HB3  6  
ATOM 11285 N N    . LEU A 1 38  ? -8.030  5.347   -0.703  1.00 0.00 ?  251 LEU A N    6  
ATOM 11286 C CA   . LEU A 1 38  ? -7.990  3.896   -0.637  1.00 0.00 ?  251 LEU A CA   6  
ATOM 11287 C C    . LEU A 1 38  ? -9.349  3.332   -1.057  1.00 0.00 ?  251 LEU A C    6  
ATOM 11288 O O    . LEU A 1 38  ? -10.387 3.924   -0.764  1.00 0.00 ?  251 LEU A O    6  
ATOM 11289 C CB   . LEU A 1 38  ? -7.535  3.435   0.749   1.00 0.00 ?  251 LEU A CB   6  
ATOM 11290 C CG   . LEU A 1 38  ? -6.094  2.929   0.848   1.00 0.00 ?  251 LEU A CG   6  
ATOM 11291 C CD1  . LEU A 1 38  ? -5.480  3.284   2.203   1.00 0.00 ?  251 LEU A CD1  6  
ATOM 11292 C CD2  . LEU A 1 38  ? -6.019  1.428   0.560   1.00 0.00 ?  251 LEU A CD2  6  
ATOM 11293 H H    . LEU A 1 38  ? -7.845  5.814   0.161   1.00 0.00 ?  251 LEU A H    6  
ATOM 11294 H HA   . LEU A 1 38  ? -7.240  3.557   -1.352  1.00 0.00 ?  251 LEU A HA   6  
ATOM 11295 H HB2  . LEU A 1 38  ? -7.655  4.266   1.444   1.00 0.00 ?  251 LEU A HB2  6  
ATOM 11296 H HB3  . LEU A 1 38  ? -8.202  2.640   1.083   1.00 0.00 ?  251 LEU A HB3  6  
ATOM 11297 H HG   . LEU A 1 38  ? -5.502  3.433   0.084   1.00 0.00 ?  251 LEU A HG   6  
ATOM 11298 H HD11 . LEU A 1 38  ? -6.271  3.566   2.898   1.00 0.00 ?  251 LEU A HD11 6  
ATOM 11299 H HD12 . LEU A 1 38  ? -4.942  2.421   2.596   1.00 0.00 ?  251 LEU A HD12 6  
ATOM 11300 H HD13 . LEU A 1 38  ? -4.789  4.118   2.082   1.00 0.00 ?  251 LEU A HD13 6  
ATOM 11301 H HD21 . LEU A 1 38  ? -5.086  1.203   0.043   1.00 0.00 ?  251 LEU A HD21 6  
ATOM 11302 H HD22 . LEU A 1 38  ? -6.056  0.876   1.499   1.00 0.00 ?  251 LEU A HD22 6  
ATOM 11303 H HD23 . LEU A 1 38  ? -6.862  1.136   -0.067  1.00 0.00 ?  251 LEU A HD23 6  
ATOM 11304 N N    . ARG A 1 39  ? -9.298  2.196   -1.737  1.00 0.00 ?  252 ARG A N    6  
ATOM 11305 C CA   . ARG A 1 39  ? -10.512 1.546   -2.200  1.00 0.00 ?  252 ARG A CA   6  
ATOM 11306 C C    . ARG A 1 39  ? -10.650 0.162   -1.563  1.00 0.00 ?  252 ARG A C    6  
ATOM 11307 O O    . ARG A 1 39  ? -9.683  -0.596  -1.503  1.00 0.00 ?  252 ARG A O    6  
ATOM 11308 C CB   . ARG A 1 39  ? -10.513 1.402   -3.723  1.00 0.00 ?  252 ARG A CB   6  
ATOM 11309 C CG   . ARG A 1 39  ? -11.250 2.568   -4.384  1.00 0.00 ?  252 ARG A CG   6  
ATOM 11310 C CD   . ARG A 1 39  ? -12.762 2.448   -4.180  1.00 0.00 ?  252 ARG A CD   6  
ATOM 11311 N NE   . ARG A 1 39  ? -13.316 1.424   -5.093  1.00 0.00 ?  252 ARG A NE   6  
ATOM 11312 C CZ   . ARG A 1 39  ? -14.594 1.389   -5.496  1.00 0.00 ?  252 ARG A CZ   6  
ATOM 11313 N NH1  . ARG A 1 39  ? -15.457 2.320   -5.068  1.00 0.00 ?  252 ARG A NH1  6  
ATOM 11314 N NH2  . ARG A 1 39  ? -15.008 0.421   -6.326  1.00 0.00 1  252 ARG A NH2  6  
ATOM 11315 H H    . ARG A 1 39  ? -8.450  1.722   -1.971  1.00 0.00 ?  252 ARG A H    6  
ATOM 11316 H HA   . ARG A 1 39  ? -11.320 2.206   -1.882  1.00 0.00 ?  252 ARG A HA   6  
ATOM 11317 H HB2  . ARG A 1 39  ? -9.487  1.361   -4.089  1.00 0.00 ?  252 ARG A HB2  6  
ATOM 11318 H HB3  . ARG A 1 39  ? -10.989 0.462   -4.002  1.00 0.00 ?  252 ARG A HB3  6  
ATOM 11319 H HG2  . ARG A 1 39  ? -10.897 3.511   -3.965  1.00 0.00 ?  252 ARG A HG2  6  
ATOM 11320 H HG3  . ARG A 1 39  ? -11.024 2.589   -5.450  1.00 0.00 ?  252 ARG A HG3  6  
ATOM 11321 H HD2  . ARG A 1 39  ? -12.977 2.180   -3.146  1.00 0.00 ?  252 ARG A HD2  6  
ATOM 11322 H HD3  . ARG A 1 39  ? -13.240 3.410   -4.366  1.00 0.00 ?  252 ARG A HD3  6  
ATOM 11323 H HE   . ARG A 1 39  ? -12.698 0.714   -5.431  1.00 0.00 ?  252 ARG A HE   6  
ATOM 11324 H HH11 . ARG A 1 39  ? -15.148 3.042   -4.449  1.00 0.00 ?  252 ARG A HH11 6  
ATOM 11325 H HH12 . ARG A 1 39  ? -16.410 2.293   -5.369  1.00 0.00 ?  252 ARG A HH12 6  
ATOM 11326 H HH21 . ARG A 1 39  ? -14.364 -0.274  -6.645  1.00 0.00 ?  252 ARG A HH21 6  
ATOM 11327 H HH22 . ARG A 1 39  ? -15.961 0.395   -6.626  1.00 0.00 ?  252 ARG A HH22 6  
ATOM 11328 N N    . ALA A 1 40  ? -11.859 -0.125  -1.103  1.00 0.00 ?  253 ALA A N    6  
ATOM 11329 C CA   . ALA A 1 40  ? -12.135 -1.405  -0.473  1.00 0.00 ?  253 ALA A CA   6  
ATOM 11330 C C    . ALA A 1 40  ? -12.361 -2.463  -1.555  1.00 0.00 ?  253 ALA A C    6  
ATOM 11331 O O    . ALA A 1 40  ? -13.233 -2.308  -2.408  1.00 0.00 ?  253 ALA A O    6  
ATOM 11332 C CB   . ALA A 1 40  ? -13.336 -1.264  0.465   1.00 0.00 ?  253 ALA A CB   6  
ATOM 11333 H H    . ALA A 1 40  ? -12.640 0.497   -1.156  1.00 0.00 ?  253 ALA A H    6  
ATOM 11334 H HA   . ALA A 1 40  ? -11.260 -1.681  0.116   1.00 0.00 ?  253 ALA A HA   6  
ATOM 11335 H HB1  . ALA A 1 40  ? -13.575 -0.208  0.593   1.00 0.00 ?  253 ALA A HB1  6  
ATOM 11336 H HB2  . ALA A 1 40  ? -14.194 -1.782  0.035   1.00 0.00 ?  253 ALA A HB2  6  
ATOM 11337 H HB3  . ALA A 1 40  ? -13.094 -1.702  1.433   1.00 0.00 ?  253 ALA A HB3  6  
ATOM 11338 N N    . ARG A 1 41  ? -11.559 -3.516  -1.485  1.00 0.00 ?  254 ARG A N    6  
ATOM 11339 C CA   . ARG A 1 41  ? -11.661 -4.599  -2.447  1.00 0.00 ?  254 ARG A CA   6  
ATOM 11340 C C    . ARG A 1 41  ? -11.857 -5.934  -1.726  1.00 0.00 ?  254 ARG A C    6  
ATOM 11341 O O    . ARG A 1 41  ? -11.046 -6.314  -0.883  1.00 0.00 ?  254 ARG A O    6  
ATOM 11342 C CB   . ARG A 1 41  ? -10.407 -4.679  -3.321  1.00 0.00 ?  254 ARG A CB   6  
ATOM 11343 C CG   . ARG A 1 41  ? -10.251 -6.074  -3.930  1.00 0.00 ?  254 ARG A CG   6  
ATOM 11344 C CD   . ARG A 1 41  ? -9.239  -6.061  -5.078  1.00 0.00 ?  254 ARG A CD   6  
ATOM 11345 N NE   . ARG A 1 41  ? -9.948  -6.040  -6.377  1.00 0.00 ?  254 ARG A NE   6  
ATOM 11346 C CZ   . ARG A 1 41  ? -10.484 -7.122  -6.958  1.00 0.00 ?  254 ARG A CZ   6  
ATOM 11347 N NH1  . ARG A 1 41  ? -10.395 -8.317  -6.360  1.00 0.00 ?  254 ARG A NH1  6  
ATOM 11348 N NH2  . ARG A 1 41  ? -11.108 -7.008  -8.138  1.00 0.00 1  254 ARG A NH2  6  
ATOM 11349 H H    . ARG A 1 41  ? -10.852 -3.635  -0.788  1.00 0.00 ?  254 ARG A H    6  
ATOM 11350 H HA   . ARG A 1 41  ? -12.530 -4.351  -3.056  1.00 0.00 ?  254 ARG A HA   6  
ATOM 11351 H HB2  . ARG A 1 41  ? -10.464 -3.936  -4.115  1.00 0.00 ?  254 ARG A HB2  6  
ATOM 11352 H HB3  . ARG A 1 41  ? -9.527  -4.440  -2.723  1.00 0.00 ?  254 ARG A HB3  6  
ATOM 11353 H HG2  . ARG A 1 41  ? -9.927  -6.776  -3.162  1.00 0.00 ?  254 ARG A HG2  6  
ATOM 11354 H HG3  . ARG A 1 41  ? -11.216 -6.425  -4.295  1.00 0.00 ?  254 ARG A HG3  6  
ATOM 11355 H HD2  . ARG A 1 41  ? -8.592  -5.189  -4.993  1.00 0.00 ?  254 ARG A HD2  6  
ATOM 11356 H HD3  . ARG A 1 41  ? -8.598  -6.941  -5.018  1.00 0.00 ?  254 ARG A HD3  6  
ATOM 11357 H HE   . ARG A 1 41  ? -10.033 -5.163  -6.850  1.00 0.00 ?  254 ARG A HE   6  
ATOM 11358 H HH11 . ARG A 1 41  ? -9.928  -8.402  -5.479  1.00 0.00 ?  254 ARG A HH11 6  
ATOM 11359 H HH12 . ARG A 1 41  ? -10.794 -9.125  -6.794  1.00 0.00 ?  254 ARG A HH12 6  
ATOM 11360 H HH21 . ARG A 1 41  ? -11.175 -6.116  -8.585  1.00 0.00 ?  254 ARG A HH21 6  
ATOM 11361 H HH22 . ARG A 1 41  ? -11.508 -7.815  -8.572  1.00 0.00 ?  254 ARG A HH22 6  
ATOM 11362 N N    . THR A 1 42  ? -12.940 -6.609  -2.083  1.00 0.00 ?  255 THR A N    6  
ATOM 11363 C CA   . THR A 1 42  ? -13.253 -7.894  -1.480  1.00 0.00 ?  255 THR A CA   6  
ATOM 11364 C C    . THR A 1 42  ? -12.648 -9.032  -2.304  1.00 0.00 ?  255 THR A C    6  
ATOM 11365 O O    . THR A 1 42  ? -13.002 -9.217  -3.467  1.00 0.00 ?  255 THR A O    6  
ATOM 11366 C CB   . THR A 1 42  ? -14.774 -7.990  -1.335  1.00 0.00 ?  255 THR A CB   6  
ATOM 11367 O OG1  . THR A 1 42  ? -15.096 -6.981  -0.382  1.00 0.00 ?  255 THR A OG1  6  
ATOM 11368 C CG2  . THR A 1 42  ? -15.217 -9.292  -0.665  1.00 0.00 ?  255 THR A CG2  6  
ATOM 11369 H H    . THR A 1 42  ? -13.595 -6.293  -2.769  1.00 0.00 ?  255 THR A H    6  
ATOM 11370 H HA   . THR A 1 42  ? -12.791 -7.932  -0.493  1.00 0.00 ?  255 THR A HA   6  
ATOM 11371 H HB   . THR A 1 42  ? -15.265 -7.861  -2.300  1.00 0.00 ?  255 THR A HB   6  
ATOM 11372 H HG1  . THR A 1 42  ? -16.056 -6.716  -0.476  1.00 0.00 ?  255 THR A HG1  6  
ATOM 11373 H HG21 . THR A 1 42  ? -16.139 -9.643  -1.129  1.00 0.00 ?  255 THR A HG21 6  
ATOM 11374 H HG22 . THR A 1 42  ? -14.439 -10.045 -0.785  1.00 0.00 ?  255 THR A HG22 6  
ATOM 11375 H HG23 . THR A 1 42  ? -15.389 -9.113  0.397   1.00 0.00 ?  255 THR A HG23 6  
ATOM 11376 N N    . VAL A 1 43  ? -11.746 -9.765  -1.668  1.00 0.00 ?  256 VAL A N    6  
ATOM 11377 C CA   . VAL A 1 43  ? -11.088 -10.880 -2.328  1.00 0.00 ?  256 VAL A CA   6  
ATOM 11378 C C    . VAL A 1 43  ? -11.593 -12.193 -1.726  1.00 0.00 ?  256 VAL A C    6  
ATOM 11379 O O    . VAL A 1 43  ? -11.338 -12.483 -0.559  1.00 0.00 ?  256 VAL A O    6  
ATOM 11380 C CB   . VAL A 1 43  ? -9.569  -10.723 -2.231  1.00 0.00 ?  256 VAL A CB   6  
ATOM 11381 C CG1  . VAL A 1 43  ? -8.873  -12.084 -2.293  1.00 0.00 ?  256 VAL A CG1  6  
ATOM 11382 C CG2  . VAL A 1 43  ? -9.044  -9.788  -3.322  1.00 0.00 ?  256 VAL A CG2  6  
ATOM 11383 H H    . VAL A 1 43  ? -11.463 -9.607  -0.722  1.00 0.00 ?  256 VAL A H    6  
ATOM 11384 H HA   . VAL A 1 43  ? -11.364 -10.848 -3.382  1.00 0.00 ?  256 VAL A HA   6  
ATOM 11385 H HB   . VAL A 1 43  ? -9.340  -10.273 -1.265  1.00 0.00 ?  256 VAL A HB   6  
ATOM 11386 H HG11 . VAL A 1 43  ? -9.059  -12.544 -3.263  1.00 0.00 ?  256 VAL A HG11 6  
ATOM 11387 H HG12 . VAL A 1 43  ? -7.800  -11.950 -2.154  1.00 0.00 ?  256 VAL A HG12 6  
ATOM 11388 H HG13 . VAL A 1 43  ? -9.263  -12.728 -1.505  1.00 0.00 ?  256 VAL A HG13 6  
ATOM 11389 H HG21 . VAL A 1 43  ? -9.765  -8.989  -3.494  1.00 0.00 ?  256 VAL A HG21 6  
ATOM 11390 H HG22 . VAL A 1 43  ? -8.094  -9.357  -3.005  1.00 0.00 ?  256 VAL A HG22 6  
ATOM 11391 H HG23 . VAL A 1 43  ? -8.897  -10.351 -4.244  1.00 0.00 ?  256 VAL A HG23 6  
ATOM 11392 N N    . PRO A 1 44  ? -12.319 -12.971 -2.573  1.00 0.00 ?  257 PRO A N    6  
ATOM 11393 C CA   . PRO A 1 44  ? -12.862 -14.246 -2.137  1.00 0.00 ?  257 PRO A CA   6  
ATOM 11394 C C    . PRO A 1 44  ? -11.764 -15.308 -2.047  1.00 0.00 ?  257 PRO A C    6  
ATOM 11395 O O    . PRO A 1 44  ? -10.649 -15.094 -2.519  1.00 0.00 ?  257 PRO A O    6  
ATOM 11396 C CB   . PRO A 1 44  ? -13.935 -14.586 -3.158  1.00 0.00 ?  257 PRO A CB   6  
ATOM 11397 C CG   . PRO A 1 44  ? -13.637 -13.729 -4.377  1.00 0.00 ?  257 PRO A CG   6  
ATOM 11398 C CD   . PRO A 1 44  ? -12.641 -12.659 -3.962  1.00 0.00 ?  257 PRO A CD   6  
ATOM 11399 H HA   . PRO A 1 44  ? -13.241 -14.165 -1.215  1.00 0.00 ?  257 PRO A HA   6  
ATOM 11400 H HB2  . PRO A 1 44  ? -13.912 -15.646 -3.411  1.00 0.00 ?  257 PRO A HB2  6  
ATOM 11401 H HB3  . PRO A 1 44  ? -14.930 -14.375 -2.765  1.00 0.00 ?  257 PRO A HB3  6  
ATOM 11402 H HG2  . PRO A 1 44  ? -13.229 -14.339 -5.183  1.00 0.00 ?  257 PRO A HG2  6  
ATOM 11403 H HG3  . PRO A 1 44  ? -14.552 -13.273 -4.756  1.00 0.00 ?  257 PRO A HG3  6  
ATOM 11404 H HD2  . PRO A 1 44  ? -11.750 -12.683 -4.590  1.00 0.00 ?  257 PRO A HD2  6  
ATOM 11405 H HD3  . PRO A 1 44  ? -13.070 -11.661 -4.055  1.00 0.00 ?  257 PRO A HD3  6  
ATOM 11406 N N    . ALA A 1 45  ? -12.119 -16.430 -1.438  1.00 0.00 ?  258 ALA A N    6  
ATOM 11407 C CA   . ALA A 1 45  ? -11.178 -17.526 -1.280  1.00 0.00 ?  258 ALA A CA   6  
ATOM 11408 C C    . ALA A 1 45  ? -10.829 -18.095 -2.657  1.00 0.00 ?  258 ALA A C    6  
ATOM 11409 O O    . ALA A 1 45  ?