data_2KZT
# 
_entry.id   2KZT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KZT         
RCSB  RCSB101778   
WWPDB D_1000101778 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          16542 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KZT 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-06-24 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Waters, L.C.'     1  
'Strong, S.L.'     2  
'Oka, O.'          3  
'Muskett, F.W.'    4  
'Veverka, V.'      5  
'Banerjee, S.'     6  
'Schmedt, T.'      7  
'Henry, A.J.'      8  
'Klempnauer, K.H.' 9  
'Carr, M.D.'       10 
# 
_citation.id                        primary 
_citation.title                     
;Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                17270 
_citation.page_last                 17280 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21454508 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.166157 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Waters, L.C.'     1  
primary 'Strong, S.L.'     2  
primary 'Ferlemann, E.'    3  
primary 'Oka, O.'          4  
primary 'Muskett, F.W.'    5  
primary 'Veverka, V.'      6  
primary 'Banerjee, S.'     7  
primary 'Schmedt, T.'      8  
primary 'Henry, A.J.'      9  
primary 'Klempnauer, K.H.' 10 
primary 'Carr, M.D.'       11 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Programmed cell death protein 4' 17653.211 1 ? ? 'MA-3 Region, residues 157-318' ? 
2 polymer man 'Programmed cell death protein 4' 15093.329 1 ? ? 'MA-3 Region, residues 319-449' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Pdcd4, Nuclear antigen H731-like, Neoplastic transformation inhibitor protein, Protein 197/15a' 
2 'Pdcd4, Topoisomerase-inhibitor suppressed protein, Protein MA-3'                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTD
VEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVW
GSG
;
;GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTD
VEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVW
GSG
;
A ? 
2 'polypeptide(L)' no no 
;GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITI
DQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
;
;GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITI
DQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   LEU n 
1 3   PRO n 
1 4   LEU n 
1 5   ASP n 
1 6   GLU n 
1 7   ARG n 
1 8   ALA n 
1 9   PHE n 
1 10  GLU n 
1 11  LYS n 
1 12  THR n 
1 13  LEU n 
1 14  THR n 
1 15  PRO n 
1 16  ILE n 
1 17  ILE n 
1 18  GLN n 
1 19  GLU n 
1 20  TYR n 
1 21  PHE n 
1 22  GLU n 
1 23  HIS n 
1 24  GLY n 
1 25  ASP n 
1 26  THR n 
1 27  ASN n 
1 28  GLU n 
1 29  VAL n 
1 30  ALA n 
1 31  GLU n 
1 32  MET n 
1 33  LEU n 
1 34  ARG n 
1 35  ASP n 
1 36  LEU n 
1 37  ASN n 
1 38  LEU n 
1 39  GLY n 
1 40  GLU n 
1 41  MET n 
1 42  LYS n 
1 43  SER n 
1 44  GLY n 
1 45  VAL n 
1 46  PRO n 
1 47  VAL n 
1 48  LEU n 
1 49  ALA n 
1 50  VAL n 
1 51  SER n 
1 52  LEU n 
1 53  ALA n 
1 54  LEU n 
1 55  GLU n 
1 56  GLY n 
1 57  LYS n 
1 58  ALA n 
1 59  SER n 
1 60  HIS n 
1 61  ARG n 
1 62  GLU n 
1 63  MET n 
1 64  THR n 
1 65  SER n 
1 66  LYS n 
1 67  LEU n 
1 68  LEU n 
1 69  SER n 
1 70  ASP n 
1 71  LEU n 
1 72  CYS n 
1 73  GLY n 
1 74  THR n 
1 75  VAL n 
1 76  MET n 
1 77  SER n 
1 78  THR n 
1 79  THR n 
1 80  ASP n 
1 81  VAL n 
1 82  GLU n 
1 83  LYS n 
1 84  SER n 
1 85  PHE n 
1 86  ASP n 
1 87  LYS n 
1 88  LEU n 
1 89  LEU n 
1 90  LYS n 
1 91  ASP n 
1 92  LEU n 
1 93  PRO n 
1 94  GLU n 
1 95  LEU n 
1 96  ALA n 
1 97  LEU n 
1 98  ASP n 
1 99  THR n 
1 100 PRO n 
1 101 ARG n 
1 102 ALA n 
1 103 PRO n 
1 104 GLN n 
1 105 LEU n 
1 106 VAL n 
1 107 GLY n 
1 108 GLN n 
1 109 PHE n 
1 110 ILE n 
1 111 ALA n 
1 112 ARG n 
1 113 ALA n 
1 114 VAL n 
1 115 GLY n 
1 116 ASP n 
1 117 GLY n 
1 118 ILE n 
1 119 LEU n 
1 120 CYS n 
1 121 ASN n 
1 122 THR n 
1 123 TYR n 
1 124 ILE n 
1 125 ASP n 
1 126 SER n 
1 127 TYR n 
1 128 LYS n 
1 129 GLY n 
1 130 THR n 
1 131 VAL n 
1 132 ASP n 
1 133 CYS n 
1 134 VAL n 
1 135 GLN n 
1 136 ALA n 
1 137 ARG n 
1 138 ALA n 
1 139 ALA n 
1 140 LEU n 
1 141 ASP n 
1 142 LYS n 
1 143 ALA n 
1 144 THR n 
1 145 VAL n 
1 146 LEU n 
1 147 LEU n 
1 148 SER n 
1 149 MET n 
1 150 SER n 
1 151 LYS n 
1 152 GLY n 
1 153 GLY n 
1 154 LYS n 
1 155 ARG n 
1 156 LYS n 
1 157 ASP n 
1 158 SER n 
1 159 VAL n 
1 160 TRP n 
1 161 GLY n 
1 162 SER n 
1 163 GLY n 
2 1   GLY n 
2 2   GLY n 
2 3   GLN n 
2 4   GLN n 
2 5   PRO n 
2 6   VAL n 
2 7   ASN n 
2 8   HIS n 
2 9   LEU n 
2 10  VAL n 
2 11  LYS n 
2 12  GLU n 
2 13  ILE n 
2 14  ASP n 
2 15  MET n 
2 16  LEU n 
2 17  LEU n 
2 18  LYS n 
2 19  GLU n 
2 20  TYR n 
2 21  LEU n 
2 22  LEU n 
2 23  SER n 
2 24  GLY n 
2 25  ASP n 
2 26  ILE n 
2 27  SER n 
2 28  GLU n 
2 29  ALA n 
2 30  GLU n 
2 31  HIS n 
2 32  CYS n 
2 33  LEU n 
2 34  LYS n 
2 35  GLU n 
2 36  LEU n 
2 37  GLU n 
2 38  VAL n 
2 39  PRO n 
2 40  HIS n 
2 41  PHE n 
2 42  HIS n 
2 43  HIS n 
2 44  GLU n 
2 45  LEU n 
2 46  VAL n 
2 47  TYR n 
2 48  GLU n 
2 49  ALA n 
2 50  ILE n 
2 51  VAL n 
2 52  MET n 
2 53  VAL n 
2 54  LEU n 
2 55  GLU n 
2 56  SER n 
2 57  THR n 
2 58  GLY n 
2 59  GLU n 
2 60  SER n 
2 61  ALA n 
2 62  PHE n 
2 63  LYS n 
2 64  MET n 
2 65  ILE n 
2 66  LEU n 
2 67  ASP n 
2 68  LEU n 
2 69  LEU n 
2 70  LYS n 
2 71  SER n 
2 72  LEU n 
2 73  TRP n 
2 74  LYS n 
2 75  SER n 
2 76  SER n 
2 77  THR n 
2 78  ILE n 
2 79  THR n 
2 80  ILE n 
2 81  ASP n 
2 82  GLN n 
2 83  MET n 
2 84  LYS n 
2 85  ARG n 
2 86  GLY n 
2 87  TYR n 
2 88  GLU n 
2 89  ARG n 
2 90  ILE n 
2 91  TYR n 
2 92  ASN n 
2 93  GLU n 
2 94  ILE n 
2 95  PRO n 
2 96  ASP n 
2 97  ILE n 
2 98  ASN n 
2 99  LEU n 
2 100 ASP n 
2 101 VAL n 
2 102 PRO n 
2 103 HIS n 
2 104 SER n 
2 105 TYR n 
2 106 SER n 
2 107 VAL n 
2 108 LEU n 
2 109 GLU n 
2 110 ARG n 
2 111 PHE n 
2 112 VAL n 
2 113 GLU n 
2 114 GLU n 
2 115 CYS n 
2 116 PHE n 
2 117 GLN n 
2 118 ALA n 
2 119 GLY n 
2 120 ILE n 
2 121 ILE n 
2 122 SER n 
2 123 LYS n 
2 124 GLN n 
2 125 LEU n 
2 126 ARG n 
2 127 ASP n 
2 128 LEU n 
2 129 CYS n 
2 130 PRO n 
2 131 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? ? ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)' ? ? 
? ? ? ? ? vector pGex-6P-2 ? ? ? ? ? 
2 1 sample ? ? ? mouse ? ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)' ? ? 
? ? ? ? ? vector pGex-6P-2 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP PDCD4_HUMAN Q53EL6 1 
;LPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDV
EKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWG
SG
;
157 ? 
2 UNP PDCD4_MOUSE Q61823 2 
;GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITI
DQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS
;
319 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KZT A 2 ? 163 ? Q53EL6 157 ? 318 ? 157 318 
2 2 2KZT B 1 ? 131 ? Q61823 319 ? 449 ? 319 449 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2KZT 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q53EL6 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            156 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D CBCA(CO)NH'        
1 2 1 '3D HNCO'              
1 3 2 '2D 1H-15N HSQC'       
1 4 2 '3D 1H-15N NOESY-HSQC' 
1 5 1 '3D TROSY HN(CO)CA'    
1 6 1 '3D HNCA'              
1 7 1 '3D IPAP TROSY HNCO'   
1 8 3 '3D IPAP TROSY HNCO'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.15-0.5mM [U-99% 13C; U-99% 15N] Pdcd4 MA-3 M-C; 25mM sodium phosphate; 100mM sodium chloride; 2.5mM DTT; 2.5mM TCEP; 0.05mM EDTA; 0.2mM AEBSF Protease Inhibitor; 0.02% sodium azide; 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.5mM [U-99% 13C; U-99% 15N] Pdcd4 MA-3 M-C; 25mM sodium phosphate; 100mM sodium chloride; 2.5mM DTT; 2.5mM TCEP; 0.05mM EDTA; 0.2mM AEBSF Protease Inhibitor; 0.02% sodium azide; 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
;0.25mM [U-99% 13C; U-99% 15N] Pdcd4 MA-3 M-C; 25mM sodium phosphate; 100mM sodium chloride; 2.5mM DTT; 2.5mM TCEP; 0.05mM EDTA; 0.2mM AEBSF Protease Inhibitor; 0.02% sodium azide; 10mg/ml Pf1 phage; 95% H2O/5% D2O
;
3 '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker Avance 1 'Bruker Avance' 
600 Bruker DRX    2 'Bruker DRX'    
# 
_pdbx_nmr_refine.entry_id           2KZT 
_pdbx_nmr_refine.method             HADDOCK 
_pdbx_nmr_refine.details            'REFINED AS PART OF THE HADDOCK DOCKING PROTOCOL' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'acceptable RMSD to lowest HADDOCK score structure' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             73 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KZT 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KZT 
_pdbx_nmr_representative.selection_criteria   'lowest haddock score' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                            collection                  TOPSPIN    2.1   1 
'Bruker Biospin'                                            processing                  TOPSPIN    2.1   2 
Goddard                                                     'chemical shift assignment' SPARKY     3.110 3 
Goddard                                                     'data analysis'             SPARKY     3.110 4 
'Cyril Dominguez, Rolf Boelens and Alexandre M.J.J. Bonvin' docking                     HADDOCK    2.0   5 
'Cyril Dominguez, Rolf Boelens and Alexandre M.J.J. Bonvin' refinement                  HADDOCK    2.0   6 
'Schwieters, Kuszewski, Tjandra and Clore'                  refinement                  X-PLOR_NIH ?     7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    
;Structure of the tandem MA-3 region of Pdcd4, obtained by docking the structures of the individual domains (PDB 2RG8 and 2HM8) using HADDOCK
;
_exptl.entry_id                   2KZT 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KZT 
_struct.title                     'Structure of the Tandem MA-3 Region of Pdcd4' 
_struct.pdbx_descriptor           'Programmed cell death protein 4' 
_struct.pdbx_model_details        'lowest HADDOCK score, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KZT 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'Pdcd4, MA-3, eIF4A, HEAT, Apoptosis' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLY A 24  ? ASP A 160 GLY A 179 1 ? 20 
HELX_P HELX_P2  2  ASP A 25  ? ASN A 37  ? ASP A 180 ASN A 192 1 ? 13 
HELX_P HELX_P3  3  GLY A 39  ? LYS A 42  ? GLY A 194 LYS A 197 5 ? 4  
HELX_P HELX_P4  4  SER A 43  ? GLY A 56  ? SER A 198 GLY A 211 1 ? 14 
HELX_P HELX_P5  5  LYS A 57  ? CYS A 72  ? LYS A 212 CYS A 227 1 ? 16 
HELX_P HELX_P6  6  SER A 77  ? THR A 99  ? SER A 232 THR A 254 1 ? 23 
HELX_P HELX_P7  7  ARG A 101 ? GLY A 117 ? ARG A 256 GLY A 272 1 ? 17 
HELX_P HELX_P8  8  THR A 122 ? TYR A 127 ? THR A 277 TYR A 282 1 ? 6  
HELX_P HELX_P9  9  CYS A 133 ? LYS A 151 ? CYS A 288 LYS A 306 1 ? 19 
HELX_P HELX_P10 10 GLU B 12  ? LEU B 22  ? GLU B 330 LEU B 340 1 ? 11 
HELX_P HELX_P11 11 ASP B 25  ? LYS B 34  ? ASP B 343 LYS B 352 1 ? 10 
HELX_P HELX_P12 12 PRO B 39  ? PHE B 41  ? PRO B 357 PHE B 359 5 ? 3  
HELX_P HELX_P13 13 HIS B 42  ? SER B 56  ? HIS B 360 SER B 374 1 ? 15 
HELX_P HELX_P14 14 GLY B 58  ? SER B 75  ? GLY B 376 SER B 393 1 ? 18 
HELX_P HELX_P15 15 THR B 79  ? LEU B 99  ? THR B 397 LEU B 417 1 ? 21 
HELX_P HELX_P16 16 SER B 104 ? GLY B 119 ? SER B 422 GLY B 437 1 ? 16 
HELX_P HELX_P17 17 SER B 122 ? ASP B 127 ? SER B 440 ASP B 445 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2KZT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . GLY A 1 1   ? -28.924 -5.460  6.938   1.00 10.00 ? 156 GLY A N    1  
ATOM 2      C CA   . GLY A 1 1   ? -29.786 -6.272  7.826   1.00 10.00 ? 156 GLY A CA   1  
ATOM 3      C C    . GLY A 1 1   ? -29.004 -6.852  8.982   1.00 10.00 ? 156 GLY A C    1  
ATOM 4      O O    . GLY A 1 1   ? -27.776 -6.952  8.919   1.00 10.00 ? 156 GLY A O    1  
ATOM 5      H H1   . GLY A 1 1   ? -28.179 -6.061  6.523   1.00 10.00 ? 156 GLY A H1   1  
ATOM 6      H H2   . GLY A 1 1   ? -28.478 -4.696  7.479   1.00 10.00 ? 156 GLY A H2   1  
ATOM 7      H H3   . GLY A 1 1   ? -29.487 -5.045  6.169   1.00 10.00 ? 156 GLY A H3   1  
ATOM 8      N N    . LEU A 1 2   ? -29.711 -7.233  10.038  1.00 10.00 ? 157 LEU A N    1  
ATOM 9      C CA   . LEU A 1 2   ? -29.078 -7.807  11.216  1.00 10.00 ? 157 LEU A CA   1  
ATOM 10     C C    . LEU A 1 2   ? -28.880 -9.310  11.048  1.00 10.00 ? 157 LEU A C    1  
ATOM 11     O O    . LEU A 1 2   ? -29.825 -10.041 10.744  1.00 10.00 ? 157 LEU A O    1  
ATOM 12     C CB   . LEU A 1 2   ? -29.894 -7.506  12.477  1.00 10.00 ? 157 LEU A CB   1  
ATOM 13     C CG   . LEU A 1 2   ? -29.733 -6.097  13.059  1.00 10.00 ? 157 LEU A CG   1  
ATOM 14     C CD1  . LEU A 1 2   ? -30.743 -5.858  14.171  1.00 10.00 ? 157 LEU A CD1  1  
ATOM 15     C CD2  . LEU A 1 2   ? -28.317 -5.891  13.575  1.00 10.00 ? 157 LEU A CD2  1  
ATOM 16     H H    . LEU A 1 2   ? -30.687 -7.135  10.021  1.00 10.00 ? 157 LEU A H    1  
ATOM 17     N N    . PRO A 1 3   ? -27.639 -9.778  11.223  1.00 10.00 ? 158 PRO A N    1  
ATOM 18     C CA   . PRO A 1 3   ? -27.303 -11.193 11.090  1.00 10.00 ? 158 PRO A CA   1  
ATOM 19     C C    . PRO A 1 3   ? -27.724 -12.009 12.311  1.00 10.00 ? 158 PRO A C    1  
ATOM 20     O O    . PRO A 1 3   ? -27.344 -11.704 13.446  1.00 10.00 ? 158 PRO A O    1  
ATOM 21     C CB   . PRO A 1 3   ? -25.781 -11.175 10.948  1.00 10.00 ? 158 PRO A CB   1  
ATOM 22     C CG   . PRO A 1 3   ? -25.345 -9.960  11.691  1.00 10.00 ? 158 PRO A CG   1  
ATOM 23     C CD   . PRO A 1 3   ? -26.459 -8.957  11.559  1.00 10.00 ? 158 PRO A CD   1  
ATOM 24     N N    . LEU A 1 4   ? -28.522 -13.040 12.068  1.00 10.00 ? 159 LEU A N    1  
ATOM 25     C CA   . LEU A 1 4   ? -29.000 -13.913 13.136  1.00 10.00 ? 159 LEU A CA   1  
ATOM 26     C C    . LEU A 1 4   ? -27.946 -14.962 13.471  1.00 10.00 ? 159 LEU A C    1  
ATOM 27     O O    . LEU A 1 4   ? -27.360 -15.555 12.564  1.00 10.00 ? 159 LEU A O    1  
ATOM 28     C CB   . LEU A 1 4   ? -30.313 -14.595 12.729  1.00 10.00 ? 159 LEU A CB   1  
ATOM 29     C CG   . LEU A 1 4   ? -31.605 -13.888 13.156  1.00 10.00 ? 159 LEU A CG   1  
ATOM 30     C CD1  . LEU A 1 4   ? -31.703 -12.503 12.535  1.00 10.00 ? 159 LEU A CD1  1  
ATOM 31     C CD2  . LEU A 1 4   ? -32.822 -14.727 12.793  1.00 10.00 ? 159 LEU A CD2  1  
ATOM 32     H H    . LEU A 1 4   ? -28.791 -13.223 11.145  1.00 10.00 ? 159 LEU A H    1  
ATOM 33     N N    . ASP A 1 5   ? -27.707 -15.173 14.771  1.00 10.00 ? 160 ASP A N    1  
ATOM 34     C CA   . ASP A 1 5   ? -26.717 -16.151 15.241  1.00 10.00 ? 160 ASP A CA   1  
ATOM 35     C C    . ASP A 1 5   ? -25.344 -15.868 14.630  1.00 10.00 ? 160 ASP A C    1  
ATOM 36     O O    . ASP A 1 5   ? -24.839 -16.632 13.806  1.00 10.00 ? 160 ASP A O    1  
ATOM 37     C CB   . ASP A 1 5   ? -27.176 -17.576 14.920  1.00 10.00 ? 160 ASP A CB   1  
ATOM 38     C CG   . ASP A 1 5   ? -26.852 -18.569 16.017  1.00 10.00 ? 160 ASP A CG   1  
ATOM 39     O OD1  . ASP A 1 5   ? -26.339 -18.153 17.083  1.00 10.00 ? 160 ASP A OD1  1  
ATOM 40     O OD2  . ASP A 1 5   ? -27.120 -19.775 15.824  1.00 10.00 ? 160 ASP A OD2  1  
ATOM 41     H H    . ASP A 1 5   ? -28.218 -14.663 15.437  1.00 10.00 ? 160 ASP A H    1  
ATOM 42     N N    . GLU A 1 6   ? -24.737 -14.770 15.062  1.00 10.00 ? 161 GLU A N    1  
ATOM 43     C CA   . GLU A 1 6   ? -23.451 -14.332 14.527  1.00 10.00 ? 161 GLU A CA   1  
ATOM 44     C C    . GLU A 1 6   ? -22.289 -15.280 14.812  1.00 10.00 ? 161 GLU A C    1  
ATOM 45     O O    . GLU A 1 6   ? -21.630 -15.740 13.877  1.00 10.00 ? 161 GLU A O    1  
ATOM 46     C CB   . GLU A 1 6   ? -23.110 -12.932 15.030  1.00 10.00 ? 161 GLU A CB   1  
ATOM 47     C CG   . GLU A 1 6   ? -24.302 -12.001 15.129  1.00 10.00 ? 161 GLU A CG   1  
ATOM 48     C CD   . GLU A 1 6   ? -23.953 -10.698 15.811  1.00 10.00 ? 161 GLU A CD   1  
ATOM 49     O OE1  . GLU A 1 6   ? -23.944 -10.662 17.058  1.00 10.00 ? 161 GLU A OE1  1  
ATOM 50     O OE2  . GLU A 1 6   ? -23.690 -9.704  15.107  1.00 10.00 ? 161 GLU A OE2  1  
ATOM 51     H H    . GLU A 1 6   ? -25.166 -14.238 15.762  1.00 10.00 ? 161 GLU A H    1  
ATOM 52     N N    . ARG A 1 7   ? -22.042 -15.606 16.081  1.00 10.00 ? 162 ARG A N    1  
ATOM 53     C CA   . ARG A 1 7   ? -20.923 -16.472 16.442  1.00 10.00 ? 162 ARG A CA   1  
ATOM 54     C C    . ARG A 1 7   ? -21.050 -17.876 15.864  1.00 10.00 ? 162 ARG A C    1  
ATOM 55     O O    . ARG A 1 7   ? -20.066 -18.453 15.397  1.00 10.00 ? 162 ARG A O    1  
ATOM 56     C CB   . ARG A 1 7   ? -20.779 -16.535 17.966  1.00 10.00 ? 162 ARG A CB   1  
ATOM 57     C CG   . ARG A 1 7   ? -20.484 -15.193 18.619  1.00 10.00 ? 162 ARG A CG   1  
ATOM 58     C CD   . ARG A 1 7   ? -19.002 -14.859 18.558  1.00 10.00 ? 162 ARG A CD   1  
ATOM 59     N NE   . ARG A 1 7   ? -18.761 -13.416 18.572  1.00 10.00 ? 162 ARG A NE   1  
ATOM 60     C CZ   . ARG A 1 7   ? -18.479 -12.714 19.670  1.00 10.00 ? 162 ARG A CZ   1  
ATOM 61     N NH1  . ARG A 1 7   ? -18.375 -13.317 20.845  1.00 10.00 ? 162 ARG A NH1  1  
ATOM 62     N NH2  . ARG A 1 7   ? -18.285 -11.406 19.589  1.00 10.00 ? 162 ARG A NH2  1  
ATOM 63     H H    . ARG A 1 7   ? -22.603 -15.281 16.822  1.00 10.00 ? 162 ARG A H    1  
ATOM 64     H HE   . ARG A 1 7   ? -18.819 -12.944 17.710  1.00 10.00 ? 162 ARG A HE   1  
ATOM 65     H HH11 . ARG A 1 7   ? -18.503 -14.308 20.920  1.00 10.00 ? 162 ARG A HH11 1  
ATOM 66     H HH12 . ARG A 1 7   ? -18.173 -12.779 21.668  1.00 10.00 ? 162 ARG A HH12 1  
ATOM 67     H HH21 . ARG A 1 7   ? -18.349 -10.939 18.704  1.00 10.00 ? 162 ARG A HH21 1  
ATOM 68     H HH22 . ARG A 1 7   ? -18.082 -10.876 20.419  1.00 10.00 ? 162 ARG A HH22 1  
ATOM 69     N N    . ALA A 1 8   ? -22.262 -18.426 15.884  1.00 10.00 ? 163 ALA A N    1  
ATOM 70     C CA   . ALA A 1 8   ? -22.496 -19.770 15.355  1.00 10.00 ? 163 ALA A CA   1  
ATOM 71     C C    . ALA A 1 8   ? -22.107 -19.852 13.881  1.00 10.00 ? 163 ALA A C    1  
ATOM 72     O O    . ALA A 1 8   ? -21.678 -20.901 13.390  1.00 10.00 ? 163 ALA A O    1  
ATOM 73     C CB   . ALA A 1 8   ? -23.946 -20.185 15.547  1.00 10.00 ? 163 ALA A CB   1  
ATOM 74     H H    . ALA A 1 8   ? -23.015 -17.920 16.265  1.00 10.00 ? 163 ALA A H    1  
ATOM 75     N N    . PHE A 1 9   ? -22.235 -18.732 13.194  1.00 10.00 ? 164 PHE A N    1  
ATOM 76     C CA   . PHE A 1 9   ? -21.903 -18.646 11.782  1.00 10.00 ? 164 PHE A CA   1  
ATOM 77     C C    . PHE A 1 9   ? -20.389 -18.519 11.604  1.00 10.00 ? 164 PHE A C    1  
ATOM 78     O O    . PHE A 1 9   ? -19.808 -19.133 10.708  1.00 10.00 ? 164 PHE A O    1  
ATOM 79     C CB   . PHE A 1 9   ? -22.621 -17.451 11.150  1.00 10.00 ? 164 PHE A CB   1  
ATOM 80     C CG   . PHE A 1 9   ? -22.144 -17.083 9.773   1.00 10.00 ? 164 PHE A CG   1  
ATOM 81     C CD1  . PHE A 1 9   ? -22.559 -17.803 8.664   1.00 10.00 ? 164 PHE A CD1  1  
ATOM 82     C CD2  . PHE A 1 9   ? -21.283 -16.013 9.588   1.00 10.00 ? 164 PHE A CD2  1  
ATOM 83     C CE1  . PHE A 1 9   ? -22.123 -17.464 7.399   1.00 10.00 ? 164 PHE A CE1  1  
ATOM 84     C CE2  . PHE A 1 9   ? -20.844 -15.670 8.326   1.00 10.00 ? 164 PHE A CE2  1  
ATOM 85     C CZ   . PHE A 1 9   ? -21.265 -16.397 7.230   1.00 10.00 ? 164 PHE A CZ   1  
ATOM 86     H H    . PHE A 1 9   ? -22.548 -17.924 13.656  1.00 10.00 ? 164 PHE A H    1  
ATOM 87     N N    . GLU A 1 10  ? -19.760 -17.748 12.486  1.00 10.00 ? 165 GLU A N    1  
ATOM 88     C CA   . GLU A 1 10  ? -18.317 -17.528 12.426  1.00 10.00 ? 165 GLU A CA   1  
ATOM 89     C C    . GLU A 1 10  ? -17.561 -18.832 12.656  1.00 10.00 ? 165 GLU A C    1  
ATOM 90     O O    . GLU A 1 10  ? -16.652 -19.178 11.900  1.00 10.00 ? 165 GLU A O    1  
ATOM 91     C CB   . GLU A 1 10  ? -17.888 -16.509 13.485  1.00 10.00 ? 165 GLU A CB   1  
ATOM 92     C CG   . GLU A 1 10  ? -18.522 -15.133 13.360  1.00 10.00 ? 165 GLU A CG   1  
ATOM 93     C CD   . GLU A 1 10  ? -18.094 -14.214 14.489  1.00 10.00 ? 165 GLU A CD   1  
ATOM 94     O OE1  . GLU A 1 10  ? -17.941 -14.708 15.627  1.00 10.00 ? 165 GLU A OE1  1  
ATOM 95     O OE2  . GLU A 1 10  ? -17.888 -13.003 14.246  1.00 10.00 ? 165 GLU A OE2  1  
ATOM 96     H H    . GLU A 1 10  ? -20.270 -17.334 13.215  1.00 10.00 ? 165 GLU A H    1  
ATOM 97     N N    . LYS A 1 11  ? -17.955 -19.554 13.701  1.00 10.00 ? 166 LYS A N    1  
ATOM 98     C CA   . LYS A 1 11  ? -17.316 -20.818 14.053  1.00 10.00 ? 166 LYS A CA   1  
ATOM 99     C C    . LYS A 1 11  ? -17.450 -21.851 12.935  1.00 10.00 ? 166 LYS A C    1  
ATOM 100    O O    . LYS A 1 11  ? -16.535 -22.636 12.689  1.00 10.00 ? 166 LYS A O    1  
ATOM 101    C CB   . LYS A 1 11  ? -17.906 -21.367 15.353  1.00 10.00 ? 166 LYS A CB   1  
ATOM 102    C CG   . LYS A 1 11  ? -17.284 -22.677 15.810  1.00 10.00 ? 166 LYS A CG   1  
ATOM 103    C CD   . LYS A 1 11  ? -18.037 -23.279 16.985  1.00 10.00 ? 166 LYS A CD   1  
ATOM 104    C CE   . LYS A 1 11  ? -19.473 -23.625 16.619  1.00 10.00 ? 166 LYS A CE   1  
ATOM 105    N NZ   . LYS A 1 11  ? -20.187 -24.290 17.742  1.00 10.00 ? 166 LYS A NZ   1  
ATOM 106    H H    . LYS A 1 11  ? -18.694 -19.223 14.258  1.00 10.00 ? 166 LYS A H    1  
ATOM 107    H HZ1  . LYS A 1 11  ? -20.183 -23.678 18.585  1.00 10.00 ? 166 LYS A HZ1  1  
ATOM 108    H HZ2  . LYS A 1 11  ? -19.721 -25.189 17.980  1.00 10.00 ? 166 LYS A HZ2  1  
ATOM 109    H HZ3  . LYS A 1 11  ? -21.172 -24.488 17.475  1.00 10.00 ? 166 LYS A HZ3  1  
ATOM 110    N N    . THR A 1 12  ? -18.582 -21.839 12.249  1.00 10.00 ? 167 THR A N    1  
ATOM 111    C CA   . THR A 1 12  ? -18.823 -22.786 11.171  1.00 10.00 ? 167 THR A CA   1  
ATOM 112    C C    . THR A 1 12  ? -17.995 -22.446 9.927   1.00 10.00 ? 167 THR A C    1  
ATOM 113    O O    . THR A 1 12  ? -17.492 -23.337 9.242   1.00 10.00 ? 167 THR A O    1  
ATOM 114    C CB   . THR A 1 12  ? -20.321 -22.862 10.815  1.00 10.00 ? 167 THR A CB   1  
ATOM 115    O OG1  . THR A 1 12  ? -21.067 -23.159 12.006  1.00 10.00 ? 167 THR A OG1  1  
ATOM 116    C CG2  . THR A 1 12  ? -20.585 -23.946 9.778   1.00 10.00 ? 167 THR A CG2  1  
ATOM 117    H H    . THR A 1 12  ? -19.271 -21.177 12.467  1.00 10.00 ? 167 THR A H    1  
ATOM 118    H HG1  . THR A 1 12  ? -21.459 -22.344 12.352  1.00 10.00 ? 167 THR A HG1  1  
ATOM 119    N N    . LEU A 1 13  ? -17.829 -21.156 9.659   1.00 10.00 ? 168 LEU A N    1  
ATOM 120    C CA   . LEU A 1 13  ? -17.068 -20.706 8.494   1.00 10.00 ? 168 LEU A CA   1  
ATOM 121    C C    . LEU A 1 13  ? -15.556 -20.753 8.727   1.00 10.00 ? 168 LEU A C    1  
ATOM 122    O O    . LEU A 1 13  ? -14.778 -20.616 7.783   1.00 10.00 ? 168 LEU A O    1  
ATOM 123    C CB   . LEU A 1 13  ? -17.499 -19.296 8.069   1.00 10.00 ? 168 LEU A CB   1  
ATOM 124    C CG   . LEU A 1 13  ? -18.368 -19.192 6.811   1.00 10.00 ? 168 LEU A CG   1  
ATOM 125    C CD1  . LEU A 1 13  ? -17.597 -19.642 5.579   1.00 10.00 ? 168 LEU A CD1  1  
ATOM 126    C CD2  . LEU A 1 13  ? -19.647 -19.997 6.970   1.00 10.00 ? 168 LEU A CD2  1  
ATOM 127    H H    . LEU A 1 13  ? -18.236 -20.487 10.254  1.00 10.00 ? 168 LEU A H    1  
ATOM 128    N N    . THR A 1 14  ? -15.151 -20.944 9.979   1.00 10.00 ? 169 THR A N    1  
ATOM 129    C CA   . THR A 1 14  ? -13.730 -21.003 10.333  1.00 10.00 ? 169 THR A CA   1  
ATOM 130    C C    . THR A 1 14  ? -12.929 -21.994 9.467   1.00 10.00 ? 169 THR A C    1  
ATOM 131    O O    . THR A 1 14  ? -12.022 -21.580 8.742   1.00 10.00 ? 169 THR A O    1  
ATOM 132    C CB   . THR A 1 14  ? -13.515 -21.303 11.833  1.00 10.00 ? 169 THR A CB   1  
ATOM 133    O OG1  . THR A 1 14  ? -14.321 -20.417 12.624  1.00 10.00 ? 169 THR A OG1  1  
ATOM 134    C CG2  . THR A 1 14  ? -12.054 -21.128 12.212  1.00 10.00 ? 169 THR A CG2  1  
ATOM 135    H H    . THR A 1 14  ? -15.824 -21.030 10.685  1.00 10.00 ? 169 THR A H    1  
ATOM 136    H HG1  . THR A 1 14  ? -14.781 -19.796 12.047  1.00 10.00 ? 169 THR A HG1  1  
ATOM 137    N N    . PRO A 1 15  ? -13.264 -23.306 9.491   1.00 10.00 ? 170 PRO A N    1  
ATOM 138    C CA   . PRO A 1 15  ? -12.537 -24.309 8.701   1.00 10.00 ? 170 PRO A CA   1  
ATOM 139    C C    . PRO A 1 15  ? -12.755 -24.140 7.197   1.00 10.00 ? 170 PRO A C    1  
ATOM 140    O O    . PRO A 1 15  ? -11.847 -24.383 6.403   1.00 10.00 ? 170 PRO A O    1  
ATOM 141    C CB   . PRO A 1 15  ? -13.106 -25.643 9.187   1.00 10.00 ? 170 PRO A CB   1  
ATOM 142    C CG   . PRO A 1 15  ? -14.454 -25.307 9.723   1.00 10.00 ? 170 PRO A CG   1  
ATOM 143    C CD   . PRO A 1 15  ? -14.347 -23.919 10.289  1.00 10.00 ? 170 PRO A CD   1  
ATOM 144    N N    . ILE A 1 16  ? -13.956 -23.719 6.827   1.00 10.00 ? 171 ILE A N    1  
ATOM 145    C CA   . ILE A 1 16  ? -14.306 -23.507 5.416   1.00 10.00 ? 171 ILE A CA   1  
ATOM 146    C C    . ILE A 1 16  ? -13.322 -22.544 4.749   1.00 10.00 ? 171 ILE A C    1  
ATOM 147    O O    . ILE A 1 16  ? -12.770 -22.836 3.689   1.00 10.00 ? 171 ILE A O    1  
ATOM 148    C CB   . ILE A 1 16  ? -15.753 -22.990 5.246   1.00 10.00 ? 171 ILE A CB   1  
ATOM 149    C CG1  . ILE A 1 16  ? -16.741 -23.971 5.885   1.00 10.00 ? 171 ILE A CG1  1  
ATOM 150    C CG2  . ILE A 1 16  ? -16.082 -22.781 3.770   1.00 10.00 ? 171 ILE A CG2  1  
ATOM 151    C CD1  . ILE A 1 16  ? -18.188 -23.533 5.799   1.00 10.00 ? 171 ILE A CD1  1  
ATOM 152    H H    . ILE A 1 16  ? -14.633 -23.557 7.515   1.00 10.00 ? 171 ILE A H    1  
ATOM 153    N N    . ILE A 1 17  ? -13.096 -21.403 5.388   1.00 10.00 ? 172 ILE A N    1  
ATOM 154    C CA   . ILE A 1 17  ? -12.172 -20.406 4.860   1.00 10.00 ? 172 ILE A CA   1  
ATOM 155    C C    . ILE A 1 17  ? -10.728 -20.889 4.985   1.00 10.00 ? 172 ILE A C    1  
ATOM 156    O O    . ILE A 1 17  ? -9.913  -20.698 4.080   1.00 10.00 ? 172 ILE A O    1  
ATOM 157    C CB   . ILE A 1 17  ? -12.345 -19.039 5.556   1.00 10.00 ? 172 ILE A CB   1  
ATOM 158    C CG1  . ILE A 1 17  ? -13.788 -18.552 5.377   1.00 10.00 ? 172 ILE A CG1  1  
ATOM 159    C CG2  . ILE A 1 17  ? -11.371 -18.015 4.989   1.00 10.00 ? 172 ILE A CG2  1  
ATOM 160    C CD1  . ILE A 1 17  ? -14.142 -17.351 6.221   1.00 10.00 ? 172 ILE A CD1  1  
ATOM 161    H H    . ILE A 1 17  ? -13.587 -21.210 6.219   1.00 10.00 ? 172 ILE A H    1  
ATOM 162    N N    . GLN A 1 18  ? -10.416 -21.500 6.126   1.00 10.00 ? 173 GLN A N    1  
ATOM 163    C CA   . GLN A 1 18  ? -9.078  -22.038 6.368   1.00 10.00 ? 173 GLN A CA   1  
ATOM 164    C C    . GLN A 1 18  ? -8.638  -22.967 5.234   1.00 10.00 ? 173 GLN A C    1  
ATOM 165    O O    . GLN A 1 18  ? -7.567  -22.786 4.654   1.00 10.00 ? 173 GLN A O    1  
ATOM 166    C CB   . GLN A 1 18  ? -9.004  -22.770 7.714   1.00 10.00 ? 173 GLN A CB   1  
ATOM 167    C CG   . GLN A 1 18  ? -8.944  -21.844 8.917   1.00 10.00 ? 173 GLN A CG   1  
ATOM 168    C CD   . GLN A 1 18  ? -8.902  -22.592 10.234  1.00 10.00 ? 173 GLN A CD   1  
ATOM 169    O OE1  . GLN A 1 18  ? -9.439  -23.696 10.356  1.00 10.00 ? 173 GLN A OE1  1  
ATOM 170    N NE2  . GLN A 1 18  ? -8.267  -21.994 11.230  1.00 10.00 ? 173 GLN A NE2  1  
ATOM 171    H H    . GLN A 1 18  ? -11.099 -21.538 6.828   1.00 10.00 ? 173 GLN A H    1  
ATOM 172    H HE21 . GLN A 1 18  ? -7.866  -21.115 11.065  1.00 10.00 ? 173 GLN A HE21 1  
ATOM 173    H HE22 . GLN A 1 18  ? -8.225  -22.456 12.095  1.00 10.00 ? 173 GLN A HE22 1  
ATOM 174    N N    . GLU A 1 19  ? -9.479  -23.938 4.915   1.00 10.00 ? 174 GLU A N    1  
ATOM 175    C CA   . GLU A 1 19  ? -9.205  -24.901 3.838   1.00 10.00 ? 174 GLU A CA   1  
ATOM 176    C C    . GLU A 1 19  ? -9.096  -24.221 2.475   1.00 10.00 ? 174 GLU A C    1  
ATOM 177    O O    . GLU A 1 19  ? -8.499  -24.763 1.543   1.00 10.00 ? 174 GLU A O    1  
ATOM 178    C CB   . GLU A 1 19  ? -10.269 -25.994 3.806   1.00 10.00 ? 174 GLU A CB   1  
ATOM 179    C CG   . GLU A 1 19  ? -10.287 -26.868 5.050   1.00 10.00 ? 174 GLU A CG   1  
ATOM 180    C CD   . GLU A 1 19  ? -9.491  -28.142 4.881   1.00 10.00 ? 174 GLU A CD   1  
ATOM 181    O OE1  . GLU A 1 19  ? -8.243  -28.081 4.887   1.00 10.00 ? 174 GLU A OE1  1  
ATOM 182    O OE2  . GLU A 1 19  ? -10.119 -29.214 4.752   1.00 10.00 ? 174 GLU A OE2  1  
ATOM 183    H H    . GLU A 1 19  ? -10.308 -24.053 5.440   1.00 10.00 ? 174 GLU A H    1  
ATOM 184    N N    . TYR A 1 20  ? -9.672  -23.033 2.370   1.00 10.00 ? 175 TYR A N    1  
ATOM 185    C CA   . TYR A 1 20  ? -9.664  -22.289 1.114   1.00 10.00 ? 175 TYR A CA   1  
ATOM 186    C C    . TYR A 1 20  ? -8.276  -21.715 0.835   1.00 10.00 ? 175 TYR A C    1  
ATOM 187    O O    . TYR A 1 20  ? -7.744  -21.865 -0.264  1.00 10.00 ? 175 TYR A O    1  
ATOM 188    C CB   . TYR A 1 20  ? -10.715 -21.166 1.111   1.00 10.00 ? 175 TYR A CB   1  
ATOM 189    C CG   . TYR A 1 20  ? -10.467 -20.096 0.059   1.00 10.00 ? 175 TYR A CG   1  
ATOM 190    C CD1  . TYR A 1 20  ? -10.613 -20.377 -1.295  1.00 10.00 ? 175 TYR A CD1  1  
ATOM 191    C CD2  . TYR A 1 20  ? -10.070 -18.810 0.420   1.00 10.00 ? 175 TYR A CD2  1  
ATOM 192    C CE1  . TYR A 1 20  ? -10.367 -19.415 -2.256  1.00 10.00 ? 175 TYR A CE1  1  
ATOM 193    C CE2  . TYR A 1 20  ? -9.828  -17.839 -0.539  1.00 10.00 ? 175 TYR A CE2  1  
ATOM 194    C CZ   . TYR A 1 20  ? -9.976  -18.149 -1.876  1.00 10.00 ? 175 TYR A CZ   1  
ATOM 195    O OH   . TYR A 1 20  ? -9.725  -17.196 -2.841  1.00 10.00 ? 175 TYR A OH   1  
ATOM 196    H H    . TYR A 1 20  ? -10.017 -22.613 3.189   1.00 10.00 ? 175 TYR A H    1  
ATOM 197    H HH   . TYR A 1 20  ? -9.037  -16.593 -2.534  1.00 10.00 ? 175 TYR A HH   1  
ATOM 198    N N    . PHE A 1 21  ? -7.689  -21.077 1.848   1.00 10.00 ? 176 PHE A N    1  
ATOM 199    C CA   . PHE A 1 21  ? -6.372  -20.449 1.725   1.00 10.00 ? 176 PHE A CA   1  
ATOM 200    C C    . PHE A 1 21  ? -5.250  -21.444 1.426   1.00 10.00 ? 176 PHE A C    1  
ATOM 201    O O    . PHE A 1 21  ? -4.142  -21.039 1.066   1.00 10.00 ? 176 PHE A O    1  
ATOM 202    C CB   . PHE A 1 21  ? -6.033  -19.647 2.987   1.00 10.00 ? 176 PHE A CB   1  
ATOM 203    C CG   . PHE A 1 21  ? -6.843  -18.392 3.177   1.00 10.00 ? 176 PHE A CG   1  
ATOM 204    C CD1  . PHE A 1 21  ? -7.079  -17.531 2.116   1.00 10.00 ? 176 PHE A CD1  1  
ATOM 205    C CD2  . PHE A 1 21  ? -7.360  -18.066 4.422   1.00 10.00 ? 176 PHE A CD2  1  
ATOM 206    C CE1  . PHE A 1 21  ? -7.815  -16.372 2.289   1.00 10.00 ? 176 PHE A CE1  1  
ATOM 207    C CE2  . PHE A 1 21  ? -8.097  -16.910 4.603   1.00 10.00 ? 176 PHE A CE2  1  
ATOM 208    C CZ   . PHE A 1 21  ? -8.325  -16.062 3.535   1.00 10.00 ? 176 PHE A CZ   1  
ATOM 209    H H    . PHE A 1 21  ? -8.169  -21.006 2.701   1.00 10.00 ? 176 PHE A H    1  
ATOM 210    N N    . GLU A 1 22  ? -5.531  -22.733 1.563   1.00 10.00 ? 177 GLU A N    1  
ATOM 211    C CA   . GLU A 1 22  ? -4.520  -23.759 1.323   1.00 10.00 ? 177 GLU A CA   1  
ATOM 212    C C    . GLU A 1 22  ? -4.125  -23.857 -0.148  1.00 10.00 ? 177 GLU A C    1  
ATOM 213    O O    . GLU A 1 22  ? -2.957  -23.679 -0.491  1.00 10.00 ? 177 GLU A O    1  
ATOM 214    C CB   . GLU A 1 22  ? -5.020  -25.112 1.824   1.00 10.00 ? 177 GLU A CB   1  
ATOM 215    C CG   . GLU A 1 22  ? -5.183  -25.182 3.331   1.00 10.00 ? 177 GLU A CG   1  
ATOM 216    C CD   . GLU A 1 22  ? -3.871  -25.001 4.062   1.00 10.00 ? 177 GLU A CD   1  
ATOM 217    O OE1  . GLU A 1 22  ? -3.179  -26.012 4.301   1.00 10.00 ? 177 GLU A OE1  1  
ATOM 218    O OE2  . GLU A 1 22  ? -3.525  -23.850 4.400   1.00 10.00 ? 177 GLU A OE2  1  
ATOM 219    H H    . GLU A 1 22  ? -6.435  -22.996 1.839   1.00 10.00 ? 177 GLU A H    1  
ATOM 220    N N    . HIS A 1 23  ? -5.092  -24.140 -1.022  1.00 10.00 ? 178 HIS A N    1  
ATOM 221    C CA   . HIS A 1 23  ? -4.798  -24.240 -2.447  1.00 10.00 ? 178 HIS A CA   1  
ATOM 222    C C    . HIS A 1 23  ? -5.608  -23.257 -3.287  1.00 10.00 ? 178 HIS A C    1  
ATOM 223    O O    . HIS A 1 23  ? -5.460  -23.211 -4.504  1.00 10.00 ? 178 HIS A O    1  
ATOM 224    C CB   . HIS A 1 23  ? -4.888  -25.685 -2.972  1.00 10.00 ? 178 HIS A CB   1  
ATOM 225    C CG   . HIS A 1 23  ? -6.271  -26.215 -3.216  1.00 10.00 ? 178 HIS A CG   1  
ATOM 226    N ND1  . HIS A 1 23  ? -6.861  -26.221 -4.461  1.00 10.00 ? 178 HIS A ND1  1  
ATOM 227    C CD2  . HIS A 1 23  ? -7.170  -26.786 -2.373  1.00 10.00 ? 178 HIS A CD2  1  
ATOM 228    C CE1  . HIS A 1 23  ? -8.057  -26.770 -4.378  1.00 10.00 ? 178 HIS A CE1  1  
ATOM 229    N NE2  . HIS A 1 23  ? -8.268  -27.121 -3.124  1.00 10.00 ? 178 HIS A NE2  1  
ATOM 230    H H    . HIS A 1 23  ? -5.975  -24.383 -0.684  1.00 10.00 ? 178 HIS A H    1  
ATOM 231    H HD1  . HIS A 1 23  ? -6.454  -25.882 -5.292  1.00 10.00 ? 178 HIS A HD1  1  
ATOM 232    H HE2  . HIS A 1 23  ? -9.093  -27.537 -2.784  1.00 10.00 ? 178 HIS A HE2  1  
ATOM 233    N N    . GLY A 1 24  ? -6.452  -22.471 -2.630  1.00 10.00 ? 179 GLY A N    1  
ATOM 234    C CA   . GLY A 1 24  ? -7.256  -21.484 -3.332  1.00 10.00 ? 179 GLY A CA   1  
ATOM 235    C C    . GLY A 1 24  ? -8.343  -22.089 -4.195  1.00 10.00 ? 179 GLY A C    1  
ATOM 236    O O    . GLY A 1 24  ? -8.236  -22.101 -5.422  1.00 10.00 ? 179 GLY A O    1  
ATOM 237    H H    . GLY A 1 24  ? -6.532  -22.555 -1.654  1.00 10.00 ? 179 GLY A H    1  
ATOM 238    N N    . ASP A 1 25  ? -9.387  -22.601 -3.560  1.00 10.00 ? 180 ASP A N    1  
ATOM 239    C CA   . ASP A 1 25  ? -10.499 -23.193 -4.296  1.00 10.00 ? 180 ASP A CA   1  
ATOM 240    C C    . ASP A 1 25  ? -11.744 -22.318 -4.183  1.00 10.00 ? 180 ASP A C    1  
ATOM 241    O O    . ASP A 1 25  ? -12.496 -22.408 -3.211  1.00 10.00 ? 180 ASP A O    1  
ATOM 242    C CB   . ASP A 1 25  ? -10.803 -24.608 -3.816  1.00 10.00 ? 180 ASP A CB   1  
ATOM 243    C CG   . ASP A 1 25  ? -11.559 -25.415 -4.852  1.00 10.00 ? 180 ASP A CG   1  
ATOM 244    O OD1  . ASP A 1 25  ? -12.562 -24.912 -5.396  1.00 10.00 ? 180 ASP A OD1  1  
ATOM 245    O OD2  . ASP A 1 25  ? -11.145 -26.559 -5.126  1.00 10.00 ? 180 ASP A OD2  1  
ATOM 246    H H    . ASP A 1 25  ? -9.418  -22.573 -2.580  1.00 10.00 ? 180 ASP A H    1  
ATOM 247    N N    . THR A 1 26  ? -11.938 -21.469 -5.173  1.00 10.00 ? 181 THR A N    1  
ATOM 248    C CA   . THR A 1 26  ? -13.081 -20.566 -5.187  1.00 10.00 ? 181 THR A CA   1  
ATOM 249    C C    . THR A 1 26  ? -14.401 -21.305 -5.438  1.00 10.00 ? 181 THR A C    1  
ATOM 250    O O    . THR A 1 26  ? -15.464 -20.860 -4.999  1.00 10.00 ? 181 THR A O    1  
ATOM 251    C CB   . THR A 1 26  ? -12.891 -19.411 -6.187  1.00 10.00 ? 181 THR A CB   1  
ATOM 252    O OG1  . THR A 1 26  ? -12.332 -19.902 -7.412  1.00 10.00 ? 181 THR A OG1  1  
ATOM 253    C CG2  . THR A 1 26  ? -11.955 -18.364 -5.607  1.00 10.00 ? 181 THR A CG2  1  
ATOM 254    H H    . THR A 1 26  ? -11.304 -21.457 -5.921  1.00 10.00 ? 181 THR A H    1  
ATOM 255    H HG1  . THR A 1 26  ? -12.203 -19.155 -8.018  1.00 10.00 ? 181 THR A HG1  1  
ATOM 256    N N    . ASN A 1 27  ? -14.323 -22.448 -6.120  1.00 10.00 ? 182 ASN A N    1  
ATOM 257    C CA   . ASN A 1 27  ? -15.510 -23.246 -6.428  1.00 10.00 ? 182 ASN A CA   1  
ATOM 258    C C    . ASN A 1 27  ? -16.024 -23.943 -5.175  1.00 10.00 ? 182 ASN A C    1  
ATOM 259    O O    . ASN A 1 27  ? -17.228 -24.092 -4.983  1.00 10.00 ? 182 ASN A O    1  
ATOM 260    C CB   . ASN A 1 27  ? -15.187 -24.290 -7.505  1.00 10.00 ? 182 ASN A CB   1  
ATOM 261    C CG   . ASN A 1 27  ? -16.404 -25.077 -7.964  1.00 10.00 ? 182 ASN A CG   1  
ATOM 262    O OD1  . ASN A 1 27  ? -17.200 -24.594 -8.772  1.00 10.00 ? 182 ASN A OD1  1  
ATOM 263    N ND2  . ASN A 1 27  ? -16.541 -26.302 -7.480  1.00 10.00 ? 182 ASN A ND2  1  
ATOM 264    H H    . ASN A 1 27  ? -13.444 -22.765 -6.418  1.00 10.00 ? 182 ASN A H    1  
ATOM 265    H HD21 . ASN A 1 27  ? -15.855 -26.635 -6.856  1.00 10.00 ? 182 ASN A HD21 1  
ATOM 266    H HD22 . ASN A 1 27  ? -17.318 -26.828 -7.760  1.00 10.00 ? 182 ASN A HD22 1  
ATOM 267    N N    . GLU A 1 28  ? -15.090 -24.321 -4.311  1.00 10.00 ? 183 GLU A N    1  
ATOM 268    C CA   . GLU A 1 28  ? -15.413 -25.018 -3.066  1.00 10.00 ? 183 GLU A CA   1  
ATOM 269    C C    . GLU A 1 28  ? -16.330 -24.158 -2.203  1.00 10.00 ? 183 GLU A C    1  
ATOM 270    O O    . GLU A 1 28  ? -17.365 -24.616 -1.715  1.00 10.00 ? 183 GLU A O    1  
ATOM 271    C CB   . GLU A 1 28  ? -14.132 -25.341 -2.293  1.00 10.00 ? 183 GLU A CB   1  
ATOM 272    C CG   . GLU A 1 28  ? -14.315 -26.323 -1.145  1.00 10.00 ? 183 GLU A CG   1  
ATOM 273    C CD   . GLU A 1 28  ? -14.683 -27.715 -1.618  1.00 10.00 ? 183 GLU A CD   1  
ATOM 274    O OE1  . GLU A 1 28  ? -13.972 -28.258 -2.487  1.00 10.00 ? 183 GLU A OE1  1  
ATOM 275    O OE2  . GLU A 1 28  ? -15.684 -28.275 -1.126  1.00 10.00 ? 183 GLU A OE2  1  
ATOM 276    H H    . GLU A 1 28  ? -14.157 -24.082 -4.510  1.00 10.00 ? 183 GLU A H    1  
ATOM 277    N N    . VAL A 1 29  ? -15.942 -22.901 -2.043  1.00 10.00 ? 184 VAL A N    1  
ATOM 278    C CA   . VAL A 1 29  ? -16.701 -21.948 -1.240  1.00 10.00 ? 184 VAL A CA   1  
ATOM 279    C C    . VAL A 1 29  ? -18.136 -21.800 -1.743  1.00 10.00 ? 184 VAL A C    1  
ATOM 280    O O    . VAL A 1 29  ? -19.083 -21.948 -0.972  1.00 10.00 ? 184 VAL A O    1  
ATOM 281    C CB   . VAL A 1 29  ? -16.015 -20.569 -1.198  1.00 10.00 ? 184 VAL A CB   1  
ATOM 282    C CG1  . VAL A 1 29  ? -16.729 -19.651 -0.217  1.00 10.00 ? 184 VAL A CG1  1  
ATOM 283    C CG2  . VAL A 1 29  ? -14.549 -20.724 -0.818  1.00 10.00 ? 184 VAL A CG2  1  
ATOM 284    H H    . VAL A 1 29  ? -15.112 -22.610 -2.470  1.00 10.00 ? 184 VAL A H    1  
ATOM 285    N N    . ALA A 1 30  ? -18.291 -21.515 -3.034  1.00 10.00 ? 185 ALA A N    1  
ATOM 286    C CA   . ALA A 1 30  ? -19.616 -21.354 -3.639  1.00 10.00 ? 185 ALA A CA   1  
ATOM 287    C C    . ALA A 1 30  ? -20.471 -22.603 -3.426  1.00 10.00 ? 185 ALA A C    1  
ATOM 288    O O    . ALA A 1 30  ? -21.618 -22.516 -2.976  1.00 10.00 ? 185 ALA A O    1  
ATOM 289    C CB   . ALA A 1 30  ? -19.480 -21.039 -5.120  1.00 10.00 ? 185 ALA A CB   1  
ATOM 290    H H    . ALA A 1 30  ? -17.498 -21.395 -3.598  1.00 10.00 ? 185 ALA A H    1  
ATOM 291    N N    . GLU A 1 31  ? -19.914 -23.752 -3.797  1.00 10.00 ? 186 GLU A N    1  
ATOM 292    C CA   . GLU A 1 31  ? -20.593 -25.037 -3.623  1.00 10.00 ? 186 GLU A CA   1  
ATOM 293    C C    . GLU A 1 31  ? -21.132 -25.198 -2.199  1.00 10.00 ? 186 GLU A C    1  
ATOM 294    O O    . GLU A 1 31  ? -22.270 -25.631 -2.003  1.00 10.00 ? 186 GLU A O    1  
ATOM 295    C CB   . GLU A 1 31  ? -19.653 -26.196 -3.950  1.00 10.00 ? 186 GLU A CB   1  
ATOM 296    C CG   . GLU A 1 31  ? -19.228 -26.278 -5.405  1.00 10.00 ? 186 GLU A CG   1  
ATOM 297    C CD   . GLU A 1 31  ? -20.403 -26.299 -6.355  1.00 10.00 ? 186 GLU A CD   1  
ATOM 298    O OE1  . GLU A 1 31  ? -21.156 -27.294 -6.355  1.00 10.00 ? 186 GLU A OE1  1  
ATOM 299    O OE2  . GLU A 1 31  ? -20.582 -25.318 -7.103  1.00 10.00 ? 186 GLU A OE2  1  
ATOM 300    H H    . GLU A 1 31  ? -19.067 -23.705 -4.300  1.00 10.00 ? 186 GLU A H    1  
ATOM 301    N N    . MET A 1 32  ? -20.319 -24.833 -1.212  1.00 10.00 ? 187 MET A N    1  
ATOM 302    C CA   . MET A 1 32  ? -20.722 -24.937 0.187   1.00 10.00 ? 187 MET A CA   1  
ATOM 303    C C    . MET A 1 32  ? -21.720 -23.841 0.563   1.00 10.00 ? 187 MET A C    1  
ATOM 304    O O    . MET A 1 32  ? -22.613 -24.059 1.378   1.00 10.00 ? 187 MET A O    1  
ATOM 305    C CB   . MET A 1 32  ? -19.507 -24.890 1.120   1.00 10.00 ? 187 MET A CB   1  
ATOM 306    C CG   . MET A 1 32  ? -18.510 -26.019 0.904   1.00 10.00 ? 187 MET A CG   1  
ATOM 307    S SD   . MET A 1 32  ? -17.254 -26.106 2.196   1.00 10.00 ? 187 MET A SD   1  
ATOM 308    C CE   . MET A 1 32  ? -18.131 -27.027 3.458   1.00 10.00 ? 187 MET A CE   1  
ATOM 309    H H    . MET A 1 32  ? -19.424 -24.487 -1.431  1.00 10.00 ? 187 MET A H    1  
ATOM 310    N N    . LEU A 1 33  ? -21.567 -22.665 -0.037  1.00 10.00 ? 188 LEU A N    1  
ATOM 311    C CA   . LEU A 1 33  ? -22.457 -21.540 0.234   1.00 10.00 ? 188 LEU A CA   1  
ATOM 312    C C    . LEU A 1 33  ? -23.910 -21.896 -0.066  1.00 10.00 ? 188 LEU A C    1  
ATOM 313    O O    . LEU A 1 33  ? -24.792 -21.682 0.767   1.00 10.00 ? 188 LEU A O    1  
ATOM 314    C CB   . LEU A 1 33  ? -22.036 -20.301 -0.559  1.00 10.00 ? 188 LEU A CB   1  
ATOM 315    C CG   . LEU A 1 33  ? -21.213 -19.261 0.206   1.00 10.00 ? 188 LEU A CG   1  
ATOM 316    C CD1  . LEU A 1 33  ? -20.828 -18.108 -0.708  1.00 10.00 ? 188 LEU A CD1  1  
ATOM 317    C CD2  . LEU A 1 33  ? -21.986 -18.753 1.413   1.00 10.00 ? 188 LEU A CD2  1  
ATOM 318    H H    . LEU A 1 33  ? -20.826 -22.548 -0.674  1.00 10.00 ? 188 LEU A H    1  
ATOM 319    N N    . ARG A 1 34  ? -24.154 -22.420 -1.271  1.00 10.00 ? 189 ARG A N    1  
ATOM 320    C CA   . ARG A 1 34  ? -25.500 -22.836 -1.679  1.00 10.00 ? 189 ARG A CA   1  
ATOM 321    C C    . ARG A 1 34  ? -26.075 -23.876 -0.723  1.00 10.00 ? 189 ARG A C    1  
ATOM 322    O O    . ARG A 1 34  ? -27.291 -24.000 -0.576  1.00 10.00 ? 189 ARG A O    1  
ATOM 323    C CB   . ARG A 1 34  ? -25.487 -23.407 -3.100  1.00 10.00 ? 189 ARG A CB   1  
ATOM 324    C CG   . ARG A 1 34  ? -24.929 -22.470 -4.159  1.00 10.00 ? 189 ARG A CG   1  
ATOM 325    C CD   . ARG A 1 34  ? -25.220 -22.990 -5.561  1.00 10.00 ? 189 ARG A CD   1  
ATOM 326    N NE   . ARG A 1 34  ? -24.963 -24.425 -5.686  1.00 10.00 ? 189 ARG A NE   1  
ATOM 327    C CZ   . ARG A 1 34  ? -23.829 -24.948 -6.153  1.00 10.00 ? 189 ARG A CZ   1  
ATOM 328    N NH1  . ARG A 1 34  ? -22.873 -24.160 -6.633  1.00 10.00 ? 189 ARG A NH1  1  
ATOM 329    N NH2  . ARG A 1 34  ? -23.676 -26.265 -6.176  1.00 10.00 ? 189 ARG A NH2  1  
ATOM 330    H H    . ARG A 1 34  ? -23.421 -22.477 -1.923  1.00 10.00 ? 189 ARG A H    1  
ATOM 331    H HE   . ARG A 1 34  ? -25.679 -25.037 -5.392  1.00 10.00 ? 189 ARG A HE   1  
ATOM 332    H HH11 . ARG A 1 34  ? -23.002 -23.165 -6.657  1.00 10.00 ? 189 ARG A HH11 1  
ATOM 333    H HH12 . ARG A 1 34  ? -22.003 -24.561 -6.970  1.00 10.00 ? 189 ARG A HH12 1  
ATOM 334    H HH21 . ARG A 1 34  ? -24.416 -26.863 -5.850  1.00 10.00 ? 189 ARG A HH21 1  
ATOM 335    H HH22 . ARG A 1 34  ? -22.812 -26.674 -6.508  1.00 10.00 ? 189 ARG A HH22 1  
ATOM 336    N N    . ASP A 1 35  ? -25.187 -24.621 -0.078  1.00 10.00 ? 190 ASP A N    1  
ATOM 337    C CA   . ASP A 1 35  ? -25.590 -25.653 0.872   1.00 10.00 ? 190 ASP A CA   1  
ATOM 338    C C    . ASP A 1 35  ? -26.154 -25.008 2.131   1.00 10.00 ? 190 ASP A C    1  
ATOM 339    O O    . ASP A 1 35  ? -27.176 -25.440 2.670   1.00 10.00 ? 190 ASP A O    1  
ATOM 340    C CB   . ASP A 1 35  ? -24.399 -26.546 1.241   1.00 10.00 ? 190 ASP A CB   1  
ATOM 341    C CG   . ASP A 1 35  ? -24.380 -27.866 0.493   1.00 10.00 ? 190 ASP A CG   1  
ATOM 342    O OD1  . ASP A 1 35  ? -25.155 -28.022 -0.475  1.00 10.00 ? 190 ASP A OD1  1  
ATOM 343    O OD2  . ASP A 1 35  ? -23.591 -28.756 0.873   1.00 10.00 ? 190 ASP A OD2  1  
ATOM 344    H H    . ASP A 1 35  ? -24.234 -24.443 -0.236  1.00 10.00 ? 190 ASP A H    1  
ATOM 345    N N    . LEU A 1 36  ? -25.470 -23.966 2.587   1.00 10.00 ? 191 LEU A N    1  
ATOM 346    C CA   . LEU A 1 36  ? -25.878 -23.228 3.773   1.00 10.00 ? 191 LEU A CA   1  
ATOM 347    C C    . LEU A 1 36  ? -27.153 -22.432 3.505   1.00 10.00 ? 191 LEU A C    1  
ATOM 348    O O    . LEU A 1 36  ? -28.097 -22.478 4.296   1.00 10.00 ? 191 LEU A O    1  
ATOM 349    C CB   . LEU A 1 36  ? -24.756 -22.282 4.212   1.00 10.00 ? 191 LEU A CB   1  
ATOM 350    C CG   . LEU A 1 36  ? -23.372 -22.910 4.393   1.00 10.00 ? 191 LEU A CG   1  
ATOM 351    C CD1  . LEU A 1 36  ? -22.318 -21.831 4.584   1.00 10.00 ? 191 LEU A CD1  1  
ATOM 352    C CD2  . LEU A 1 36  ? -23.368 -23.871 5.571   1.00 10.00 ? 191 LEU A CD2  1  
ATOM 353    H H    . LEU A 1 36  ? -24.645 -23.708 2.122   1.00 10.00 ? 191 LEU A H    1  
ATOM 354    N N    . ASN A 1 37  ? -27.168 -21.714 2.380   1.00 10.00 ? 192 ASN A N    1  
ATOM 355    C CA   . ASN A 1 37  ? -28.316 -20.898 1.977   1.00 10.00 ? 192 ASN A CA   1  
ATOM 356    C C    . ASN A 1 37  ? -28.560 -19.741 2.950   1.00 10.00 ? 192 ASN A C    1  
ATOM 357    O O    . ASN A 1 37  ? -29.244 -19.894 3.963   1.00 10.00 ? 192 ASN A O    1  
ATOM 358    C CB   . ASN A 1 37  ? -29.578 -21.750 1.800   1.00 10.00 ? 192 ASN A CB   1  
ATOM 359    C CG   . ASN A 1 37  ? -30.691 -21.003 1.096   1.00 10.00 ? 192 ASN A CG   1  
ATOM 360    O OD1  . ASN A 1 37  ? -31.499 -20.325 1.725   1.00 10.00 ? 192 ASN A OD1  1  
ATOM 361    N ND2  . ASN A 1 37  ? -30.744 -21.127 -0.217  1.00 10.00 ? 192 ASN A ND2  1  
ATOM 362    H H    . ASN A 1 37  ? -26.377 -21.735 1.794   1.00 10.00 ? 192 ASN A H    1  
ATOM 363    H HD21 . ASN A 1 37  ? -30.073 -21.689 -0.655  1.00 10.00 ? 192 ASN A HD21 1  
ATOM 364    H HD22 . ASN A 1 37  ? -31.449 -20.647 -0.701  1.00 10.00 ? 192 ASN A HD22 1  
ATOM 365    N N    . LEU A 1 38  ? -27.994 -18.583 2.638   1.00 10.00 ? 193 LEU A N    1  
ATOM 366    C CA   . LEU A 1 38  ? -28.133 -17.413 3.495   1.00 10.00 ? 193 LEU A CA   1  
ATOM 367    C C    . LEU A 1 38  ? -28.665 -16.217 2.717   1.00 10.00 ? 193 LEU A C    1  
ATOM 368    O O    . LEU A 1 38  ? -28.543 -16.160 1.492   1.00 10.00 ? 193 LEU A O    1  
ATOM 369    C CB   . LEU A 1 38  ? -26.785 -17.057 4.121   1.00 10.00 ? 193 LEU A CB   1  
ATOM 370    C CG   . LEU A 1 38  ? -26.091 -18.173 4.903   1.00 10.00 ? 193 LEU A CG   1  
ATOM 371    C CD1  . LEU A 1 38  ? -24.614 -17.869 5.082   1.00 10.00 ? 193 LEU A CD1  1  
ATOM 372    C CD2  . LEU A 1 38  ? -26.764 -18.386 6.252   1.00 10.00 ? 193 LEU A CD2  1  
ATOM 373    H H    . LEU A 1 38  ? -27.477 -18.511 1.808   1.00 10.00 ? 193 LEU A H    1  
ATOM 374    N N    . GLY A 1 39  ? -29.258 -15.273 3.433   1.00 10.00 ? 194 GLY A N    1  
ATOM 375    C CA   . GLY A 1 39  ? -29.785 -14.077 2.809   1.00 10.00 ? 194 GLY A CA   1  
ATOM 376    C C    . GLY A 1 39  ? -28.909 -12.879 3.102   1.00 10.00 ? 194 GLY A C    1  
ATOM 377    O O    . GLY A 1 39  ? -27.916 -12.649 2.414   1.00 10.00 ? 194 GLY A O    1  
ATOM 378    H H    . GLY A 1 39  ? -29.348 -15.393 4.405   1.00 10.00 ? 194 GLY A H    1  
ATOM 379    N N    . GLU A 1 40  ? -29.260 -12.126 4.137   1.00 10.00 ? 195 GLU A N    1  
ATOM 380    C CA   . GLU A 1 40  ? -28.480 -10.953 4.526   1.00 10.00 ? 195 GLU A CA   1  
ATOM 381    C C    . GLU A 1 40  ? -27.194 -11.380 5.226   1.00 10.00 ? 195 GLU A C    1  
ATOM 382    O O    . GLU A 1 40  ? -26.227 -10.620 5.309   1.00 10.00 ? 195 GLU A O    1  
ATOM 383    C CB   . GLU A 1 40  ? -29.296 -10.028 5.430   1.00 10.00 ? 195 GLU A CB   1  
ATOM 384    C CG   . GLU A 1 40  ? -29.538 -8.646  4.838   1.00 10.00 ? 195 GLU A CG   1  
ATOM 385    C CD   . GLU A 1 40  ? -28.253 -7.902  4.534   1.00 10.00 ? 195 GLU A CD   1  
ATOM 386    O OE1  . GLU A 1 40  ? -27.642 -7.346  5.476   1.00 10.00 ? 195 GLU A OE1  1  
ATOM 387    O OE2  . GLU A 1 40  ? -27.850 -7.862  3.352   1.00 10.00 ? 195 GLU A OE2  1  
ATOM 388    H H    . GLU A 1 40  ? -30.069 -12.358 4.646   1.00 10.00 ? 195 GLU A H    1  
ATOM 389    N N    . MET A 1 41  ? -27.192 -12.611 5.723   1.00 10.00 ? 196 MET A N    1  
ATOM 390    C CA   . MET A 1 41  ? -26.031 -13.166 6.405   1.00 10.00 ? 196 MET A CA   1  
ATOM 391    C C    . MET A 1 41  ? -24.980 -13.584 5.385   1.00 10.00 ? 196 MET A C    1  
ATOM 392    O O    . MET A 1 41  ? -23.844 -13.891 5.737   1.00 10.00 ? 196 MET A O    1  
ATOM 393    C CB   . MET A 1 41  ? -26.441 -14.382 7.240   1.00 10.00 ? 196 MET A CB   1  
ATOM 394    C CG   . MET A 1 41  ? -26.182 -14.250 8.733   1.00 10.00 ? 196 MET A CG   1  
ATOM 395    S SD   . MET A 1 41  ? -24.432 -14.123 9.142   1.00 10.00 ? 196 MET A SD   1  
ATOM 396    C CE   . MET A 1 41  ? -24.475 -14.419 10.909  1.00 10.00 ? 196 MET A CE   1  
ATOM 397    H H    . MET A 1 41  ? -27.999 -13.162 5.630   1.00 10.00 ? 196 MET A H    1  
ATOM 398    N N    . LYS A 1 42  ? -25.366 -13.573 4.113   1.00 10.00 ? 197 LYS A N    1  
ATOM 399    C CA   . LYS A 1 42  ? -24.469 -13.962 3.032   1.00 10.00 ? 197 LYS A CA   1  
ATOM 400    C C    . LYS A 1 42  ? -23.256 -13.035 2.952   1.00 10.00 ? 197 LYS A C    1  
ATOM 401    O O    . LYS A 1 42  ? -22.185 -13.445 2.511   1.00 10.00 ? 197 LYS A O    1  
ATOM 402    C CB   . LYS A 1 42  ? -25.217 -13.981 1.698   1.00 10.00 ? 197 LYS A CB   1  
ATOM 403    C CG   . LYS A 1 42  ? -24.547 -14.803 0.608   1.00 10.00 ? 197 LYS A CG   1  
ATOM 404    C CD   . LYS A 1 42  ? -25.372 -14.798 -0.671  1.00 10.00 ? 197 LYS A CD   1  
ATOM 405    C CE   . LYS A 1 42  ? -25.508 -13.392 -1.230  1.00 10.00 ? 197 LYS A CE   1  
ATOM 406    N NZ   . LYS A 1 42  ? -26.321 -13.353 -2.473  1.00 10.00 ? 197 LYS A NZ   1  
ATOM 407    H H    . LYS A 1 42  ? -26.279 -13.284 3.894   1.00 10.00 ? 197 LYS A H    1  
ATOM 408    H HZ1  . LYS A 1 42  ? -25.844 -13.879 -3.236  1.00 10.00 ? 197 LYS A HZ1  1  
ATOM 409    H HZ2  . LYS A 1 42  ? -26.451 -12.362 -2.777  1.00 10.00 ? 197 LYS A HZ2  1  
ATOM 410    H HZ3  . LYS A 1 42  ? -27.255 -13.776 -2.308  1.00 10.00 ? 197 LYS A HZ3  1  
ATOM 411    N N    . SER A 1 43  ? -23.424 -11.788 3.386   1.00 10.00 ? 198 SER A N    1  
ATOM 412    C CA   . SER A 1 43  ? -22.334 -10.821 3.367   1.00 10.00 ? 198 SER A CA   1  
ATOM 413    C C    . SER A 1 43  ? -21.268 -11.175 4.411   1.00 10.00 ? 198 SER A C    1  
ATOM 414    O O    . SER A 1 43  ? -20.145 -10.682 4.357   1.00 10.00 ? 198 SER A O    1  
ATOM 415    C CB   . SER A 1 43  ? -22.871 -9.416  3.636   1.00 10.00 ? 198 SER A CB   1  
ATOM 416    O OG   . SER A 1 43  ? -24.235 -9.307  3.264   1.00 10.00 ? 198 SER A OG   1  
ATOM 417    H H    . SER A 1 43  ? -24.304 -11.510 3.722   1.00 10.00 ? 198 SER A H    1  
ATOM 418    H HG   . SER A 1 43  ? -24.303 -9.311  2.304   1.00 10.00 ? 198 SER A HG   1  
ATOM 419    N N    . GLY A 1 44  ? -21.648 -12.025 5.357   1.00 10.00 ? 199 GLY A N    1  
ATOM 420    C CA   . GLY A 1 44  ? -20.727 -12.443 6.403   1.00 10.00 ? 199 GLY A CA   1  
ATOM 421    C C    . GLY A 1 44  ? -19.515 -13.182 5.862   1.00 10.00 ? 199 GLY A C    1  
ATOM 422    O O    . GLY A 1 44  ? -18.390 -12.915 6.281   1.00 10.00 ? 199 GLY A O    1  
ATOM 423    H H    . GLY A 1 44  ? -22.570 -12.360 5.358   1.00 10.00 ? 199 GLY A H    1  
ATOM 424    N N    . VAL A 1 45  ? -19.754 -14.121 4.947   1.00 10.00 ? 200 VAL A N    1  
ATOM 425    C CA   . VAL A 1 45  ? -18.686 -14.914 4.331   1.00 10.00 ? 200 VAL A CA   1  
ATOM 426    C C    . VAL A 1 45  ? -17.518 -14.062 3.814   1.00 10.00 ? 200 VAL A C    1  
ATOM 427    O O    . VAL A 1 45  ? -16.388 -14.234 4.278   1.00 10.00 ? 200 VAL A O    1  
ATOM 428    C CB   . VAL A 1 45  ? -19.218 -15.846 3.220   1.00 10.00 ? 200 VAL A CB   1  
ATOM 429    C CG1  . VAL A 1 45  ? -18.106 -16.727 2.673   1.00 10.00 ? 200 VAL A CG1  1  
ATOM 430    C CG2  . VAL A 1 45  ? -20.363 -16.695 3.749   1.00 10.00 ? 200 VAL A CG2  1  
ATOM 431    H H    . VAL A 1 45  ? -20.679 -14.325 4.701   1.00 10.00 ? 200 VAL A H    1  
ATOM 432    N N    . PRO A 1 46  ? -17.756 -13.141 2.847   1.00 10.00 ? 201 PRO A N    1  
ATOM 433    C CA   . PRO A 1 46  ? -16.694 -12.282 2.310   1.00 10.00 ? 201 PRO A CA   1  
ATOM 434    C C    . PRO A 1 46  ? -16.005 -11.459 3.397   1.00 10.00 ? 201 PRO A C    1  
ATOM 435    O O    . PRO A 1 46  ? -14.827 -11.144 3.280   1.00 10.00 ? 201 PRO A O    1  
ATOM 436    C CB   . PRO A 1 46  ? -17.406 -11.372 1.303   1.00 10.00 ? 201 PRO A CB   1  
ATOM 437    C CG   . PRO A 1 46  ? -18.860 -11.514 1.594   1.00 10.00 ? 201 PRO A CG   1  
ATOM 438    C CD   . PRO A 1 46  ? -19.045 -12.878 2.184   1.00 10.00 ? 201 PRO A CD   1  
ATOM 439    N N    . VAL A 1 47  ? -16.742 -11.123 4.453   1.00 10.00 ? 202 VAL A N    1  
ATOM 440    C CA   . VAL A 1 47  ? -16.180 -10.352 5.554   1.00 10.00 ? 202 VAL A CA   1  
ATOM 441    C C    . VAL A 1 47  ? -15.162 -11.188 6.332   1.00 10.00 ? 202 VAL A C    1  
ATOM 442    O O    . VAL A 1 47  ? -14.005 -10.794 6.462   1.00 10.00 ? 202 VAL A O    1  
ATOM 443    C CB   . VAL A 1 47  ? -17.274 -9.835  6.517   1.00 10.00 ? 202 VAL A CB   1  
ATOM 444    C CG1  . VAL A 1 47  ? -16.663 -9.215  7.764   1.00 10.00 ? 202 VAL A CG1  1  
ATOM 445    C CG2  . VAL A 1 47  ? -18.155 -8.821  5.810   1.00 10.00 ? 202 VAL A CG2  1  
ATOM 446    H H    . VAL A 1 47  ? -17.686 -11.394 4.489   1.00 10.00 ? 202 VAL A H    1  
ATOM 447    N N    . LEU A 1 48  ? -15.590 -12.355 6.824   1.00 10.00 ? 203 LEU A N    1  
ATOM 448    C CA   . LEU A 1 48  ? -14.711 -13.230 7.589   1.00 10.00 ? 203 LEU A CA   1  
ATOM 449    C C    . LEU A 1 48  ? -13.455 -13.590 6.794   1.00 10.00 ? 203 LEU A C    1  
ATOM 450    O O    . LEU A 1 48  ? -12.344 -13.539 7.323   1.00 10.00 ? 203 LEU A O    1  
ATOM 451    C CB   . LEU A 1 48  ? -15.450 -14.486 8.046   1.00 10.00 ? 203 LEU A CB   1  
ATOM 452    C CG   . LEU A 1 48  ? -14.805 -15.271 9.190   1.00 10.00 ? 203 LEU A CG   1  
ATOM 453    C CD1  . LEU A 1 48  ? -14.622 -14.394 10.420  1.00 10.00 ? 203 LEU A CD1  1  
ATOM 454    C CD2  . LEU A 1 48  ? -15.642 -16.491 9.532   1.00 10.00 ? 203 LEU A CD2  1  
ATOM 455    H H    . LEU A 1 48  ? -16.526 -12.622 6.660   1.00 10.00 ? 203 LEU A H    1  
ATOM 456    N N    . ALA A 1 49  ? -13.643 -13.985 5.538   1.00 10.00 ? 204 ALA A N    1  
ATOM 457    C CA   . ALA A 1 49  ? -12.522 -14.309 4.647   1.00 10.00 ? 204 ALA A CA   1  
ATOM 458    C C    . ALA A 1 49  ? -11.497 -13.176 4.640   1.00 10.00 ? 204 ALA A C    1  
ATOM 459    O O    . ALA A 1 49  ? -10.294 -13.412 4.483   1.00 10.00 ? 204 ALA A O    1  
ATOM 460    C CB   . ALA A 1 49  ? -13.036 -14.530 3.233   1.00 10.00 ? 204 ALA A CB   1  
ATOM 461    H H    . ALA A 1 49  ? -14.554 -14.184 5.227   1.00 10.00 ? 204 ALA A H    1  
ATOM 462    N N    . VAL A 1 50  ? -11.991 -11.968 4.879   1.00 10.00 ? 205 VAL A N    1  
ATOM 463    C CA   . VAL A 1 50  ? -11.135 -10.801 4.868   1.00 10.00 ? 205 VAL A CA   1  
ATOM 464    C C    . VAL A 1 50  ? -10.421 -10.672 6.214   1.00 10.00 ? 205 VAL A C    1  
ATOM 465    O O    . VAL A 1 50  ? -9.212  -10.466 6.270   1.00 10.00 ? 205 VAL A O    1  
ATOM 466    C CB   . VAL A 1 50  ? -11.874 -9.487  4.502   1.00 10.00 ? 205 VAL A CB   1  
ATOM 467    C CG1  . VAL A 1 50  ? -10.988 -8.284  4.798   1.00 10.00 ? 205 VAL A CG1  1  
ATOM 468    C CG2  . VAL A 1 50  ? -12.254 -9.493  3.030   1.00 10.00 ? 205 VAL A CG2  1  
ATOM 469    H H    . VAL A 1 50  ? -12.871 -11.938 5.307   1.00 10.00 ? 205 VAL A H    1  
ATOM 470    N N    . SER A 1 51  ? -11.182 -10.858 7.295   1.00 10.00 ? 206 SER A N    1  
ATOM 471    C CA   . SER A 1 51  ? -10.658 -10.722 8.652   1.00 10.00 ? 206 SER A CA   1  
ATOM 472    C C    . SER A 1 51  ? -9.544  -11.716 8.944   1.00 10.00 ? 206 SER A C    1  
ATOM 473    O O    . SER A 1 51  ? -8.523  -11.351 9.521   1.00 10.00 ? 206 SER A O    1  
ATOM 474    C CB   . SER A 1 51  ? -11.777 -10.890 9.679   1.00 10.00 ? 206 SER A CB   1  
ATOM 475    O OG   . SER A 1 51  ? -13.044 -10.677 9.076   1.00 10.00 ? 206 SER A OG   1  
ATOM 476    H H    . SER A 1 51  ? -12.121 -11.127 7.182   1.00 10.00 ? 206 SER A H    1  
ATOM 477    H HG   . SER A 1 51  ? -13.581 -10.116 9.646   1.00 10.00 ? 206 SER A HG   1  
ATOM 478    N N    . LEU A 1 52  ? -9.747  -12.972 8.558   1.00 10.00 ? 207 LEU A N    1  
ATOM 479    C CA   . LEU A 1 52  ? -8.747  -14.010 8.785   1.00 10.00 ? 207 LEU A CA   1  
ATOM 480    C C    . LEU A 1 52  ? -7.477  -13.698 8.002   1.00 10.00 ? 207 LEU A C    1  
ATOM 481    O O    . LEU A 1 52  ? -6.366  -13.819 8.521   1.00 10.00 ? 207 LEU A O    1  
ATOM 482    C CB   . LEU A 1 52  ? -9.296  -15.390 8.411   1.00 10.00 ? 207 LEU A CB   1  
ATOM 483    C CG   . LEU A 1 52  ? -10.504 -15.879 9.218   1.00 10.00 ? 207 LEU A CG   1  
ATOM 484    C CD1  . LEU A 1 52  ? -10.999 -17.216 8.686   1.00 10.00 ? 207 LEU A CD1  1  
ATOM 485    C CD2  . LEU A 1 52  ? -10.157 -15.984 10.697  1.00 10.00 ? 207 LEU A CD2  1  
ATOM 486    H H    . LEU A 1 52  ? -10.591 -13.205 8.109   1.00 10.00 ? 207 LEU A H    1  
ATOM 487    N N    . ALA A 1 53  ? -7.660  -13.312 6.746   1.00 10.00 ? 208 ALA A N    1  
ATOM 488    C CA   . ALA A 1 53  ? -6.546  -12.934 5.874   1.00 10.00 ? 208 ALA A CA   1  
ATOM 489    C C    . ALA A 1 53  ? -5.697  -11.803 6.456   1.00 10.00 ? 208 ALA A C    1  
ATOM 490    O O    . ALA A 1 53  ? -4.538  -11.638 6.078   1.00 10.00 ? 208 ALA A O    1  
ATOM 491    C CB   . ALA A 1 53  ? -7.058  -12.563 4.493   1.00 10.00 ? 208 ALA A CB   1  
ATOM 492    H H    . ALA A 1 53  ? -8.556  -13.384 6.360   1.00 10.00 ? 208 ALA A H    1  
ATOM 493    N N    . LEU A 1 54  ? -6.263  -11.028 7.377   1.00 10.00 ? 209 LEU A N    1  
ATOM 494    C CA   . LEU A 1 54  ? -5.521  -9.942  8.004   1.00 10.00 ? 209 LEU A CA   1  
ATOM 495    C C    . LEU A 1 54  ? -4.456  -10.523 8.930   1.00 10.00 ? 209 LEU A C    1  
ATOM 496    O O    . LEU A 1 54  ? -3.336  -10.011 9.006   1.00 10.00 ? 209 LEU A O    1  
ATOM 497    C CB   . LEU A 1 54  ? -6.450  -9.009  8.789   1.00 10.00 ? 209 LEU A CB   1  
ATOM 498    C CG   . LEU A 1 54  ? -7.580  -8.335  8.003   1.00 10.00 ? 209 LEU A CG   1  
ATOM 499    C CD1  . LEU A 1 54  ? -8.309  -7.324  8.872   1.00 10.00 ? 209 LEU A CD1  1  
ATOM 500    C CD2  . LEU A 1 54  ? -7.048  -7.672  6.740   1.00 10.00 ? 209 LEU A CD2  1  
ATOM 501    H H    . LEU A 1 54  ? -7.188  -11.200 7.649   1.00 10.00 ? 209 LEU A H    1  
ATOM 502    N N    . GLU A 1 55  ? -4.815  -11.610 9.617   1.00 10.00 ? 210 GLU A N    1  
ATOM 503    C CA   . GLU A 1 55  ? -3.902  -12.281 10.530  1.00 10.00 ? 210 GLU A CA   1  
ATOM 504    C C    . GLU A 1 55  ? -2.822  -13.017 9.750   1.00 10.00 ? 210 GLU A C    1  
ATOM 505    O O    . GLU A 1 55  ? -1.647  -12.995 10.116  1.00 10.00 ? 210 GLU A O    1  
ATOM 506    C CB   . GLU A 1 55  ? -4.688  -13.297 11.366  1.00 10.00 ? 210 GLU A CB   1  
ATOM 507    C CG   . GLU A 1 55  ? -5.772  -12.693 12.240  1.00 10.00 ? 210 GLU A CG   1  
ATOM 508    C CD   . GLU A 1 55  ? -5.350  -12.600 13.687  1.00 10.00 ? 210 GLU A CD   1  
ATOM 509    O OE1  . GLU A 1 55  ? -4.249  -12.078 13.959  1.00 10.00 ? 210 GLU A OE1  1  
ATOM 510    O OE2  . GLU A 1 55  ? -6.111  -13.062 14.562  1.00 10.00 ? 210 GLU A OE2  1  
ATOM 511    H H    . GLU A 1 55  ? -5.721  -11.967 9.505   1.00 10.00 ? 210 GLU A H    1  
ATOM 512    N N    . GLY A 1 56  ? -3.238  -13.671 8.671   1.00 10.00 ? 211 GLY A N    1  
ATOM 513    C CA   . GLY A 1 56  ? -2.294  -14.394 7.837   1.00 10.00 ? 211 GLY A CA   1  
ATOM 514    C C    . GLY A 1 56  ? -1.382  -13.483 7.048   1.00 10.00 ? 211 GLY A C    1  
ATOM 515    O O    . GLY A 1 56  ? -1.514  -12.263 7.101   1.00 10.00 ? 211 GLY A O    1  
ATOM 516    H H    . GLY A 1 56  ? -4.197  -13.765 8.500   1.00 10.00 ? 211 GLY A H    1  
ATOM 517    N N    . LYS A 1 57  ? -0.461  -14.087 6.313   1.00 10.00 ? 212 LYS A N    1  
ATOM 518    C CA   . LYS A 1 57  ? 0.497   -13.344 5.503   1.00 10.00 ? 212 LYS A CA   1  
ATOM 519    C C    . LYS A 1 57  ? -0.182  -12.560 4.382   1.00 10.00 ? 212 LYS A C    1  
ATOM 520    O O    . LYS A 1 57  ? -1.330  -12.832 4.016   1.00 10.00 ? 212 LYS A O    1  
ATOM 521    C CB   . LYS A 1 57  ? 1.539   -14.292 4.917   1.00 10.00 ? 212 LYS A CB   1  
ATOM 522    C CG   . LYS A 1 57  ? 2.588   -14.759 5.909   1.00 10.00 ? 212 LYS A CG   1  
ATOM 523    C CD   . LYS A 1 57  ? 3.730   -15.455 5.190   1.00 10.00 ? 212 LYS A CD   1  
ATOM 524    C CE   . LYS A 1 57  ? 4.908   -15.688 6.116   1.00 10.00 ? 212 LYS A CE   1  
ATOM 525    N NZ   . LYS A 1 57  ? 6.069   -16.275 5.395   1.00 10.00 ? 212 LYS A NZ   1  
ATOM 526    H H    . LYS A 1 57  ? -0.419  -15.064 6.319   1.00 10.00 ? 212 LYS A H    1  
ATOM 527    H HZ1  . LYS A 1 57  ? 6.485   -15.570 4.754   1.00 10.00 ? 212 LYS A HZ1  1  
ATOM 528    H HZ2  . LYS A 1 57  ? 5.763   -17.098 4.838   1.00 10.00 ? 212 LYS A HZ2  1  
ATOM 529    H HZ3  . LYS A 1 57  ? 6.794   -16.582 6.073   1.00 10.00 ? 212 LYS A HZ3  1  
ATOM 530    N N    . ALA A 1 58  ? 0.554   -11.607 3.819   1.00 10.00 ? 213 ALA A N    1  
ATOM 531    C CA   . ALA A 1 58  ? 0.047   -10.766 2.742   1.00 10.00 ? 213 ALA A CA   1  
ATOM 532    C C    . ALA A 1 58  ? -0.310  -11.585 1.511   1.00 10.00 ? 213 ALA A C    1  
ATOM 533    O O    . ALA A 1 58  ? -1.233  -11.240 0.773   1.00 10.00 ? 213 ALA A O    1  
ATOM 534    C CB   . ALA A 1 58  ? 1.053   -9.681  2.387   1.00 10.00 ? 213 ALA A CB   1  
ATOM 535    H H    . ALA A 1 58  ? 1.476   -11.470 4.135   1.00 10.00 ? 213 ALA A H    1  
ATOM 536    N N    . SER A 1 59  ? 0.418   -12.673 1.300   1.00 10.00 ? 214 SER A N    1  
ATOM 537    C CA   . SER A 1 59  ? 0.174   -13.552 0.165   1.00 10.00 ? 214 SER A CA   1  
ATOM 538    C C    . SER A 1 59  ? -1.243  -14.097 0.227   1.00 10.00 ? 214 SER A C    1  
ATOM 539    O O    . SER A 1 59  ? -1.904  -14.288 -0.795  1.00 10.00 ? 214 SER A O    1  
ATOM 540    C CB   . SER A 1 59  ? 1.179   -14.703 0.186   1.00 10.00 ? 214 SER A CB   1  
ATOM 541    O OG   . SER A 1 59  ? 1.638   -14.929 1.510   1.00 10.00 ? 214 SER A OG   1  
ATOM 542    H H    . SER A 1 59  ? 1.138   -12.898 1.927   1.00 10.00 ? 214 SER A H    1  
ATOM 543    H HG   . SER A 1 59  ? 2.555   -14.633 1.579   1.00 10.00 ? 214 SER A HG   1  
ATOM 544    N N    . HIS A 1 60  ? -1.711  -14.346 1.439   1.00 10.00 ? 215 HIS A N    1  
ATOM 545    C CA   . HIS A 1 60  ? -3.051  -14.859 1.625   1.00 10.00 ? 215 HIS A CA   1  
ATOM 546    C C    . HIS A 1 60  ? -4.112  -13.792 1.386   1.00 10.00 ? 215 HIS A C    1  
ATOM 547    O O    . HIS A 1 60  ? -5.258  -14.118 1.079   1.00 10.00 ? 215 HIS A O    1  
ATOM 548    C CB   . HIS A 1 60  ? -3.213  -15.567 2.969   1.00 10.00 ? 215 HIS A CB   1  
ATOM 549    C CG   . HIS A 1 60  ? -2.905  -17.033 2.879   1.00 10.00 ? 215 HIS A CG   1  
ATOM 550    N ND1  . HIS A 1 60  ? -2.542  -17.807 3.957   1.00 10.00 ? 215 HIS A ND1  1  
ATOM 551    C CD2  . HIS A 1 60  ? -2.911  -17.864 1.810   1.00 10.00 ? 215 HIS A CD2  1  
ATOM 552    C CE1  . HIS A 1 60  ? -2.336  -19.049 3.553   1.00 10.00 ? 215 HIS A CE1  1  
ATOM 553    N NE2  . HIS A 1 60  ? -2.556  -19.112 2.253   1.00 10.00 ? 215 HIS A NE2  1  
ATOM 554    H H    . HIS A 1 60  ? -1.131  -14.198 2.221   1.00 10.00 ? 215 HIS A H    1  
ATOM 555    H HD1  . HIS A 1 60  ? -2.462  -17.499 4.886   1.00 10.00 ? 215 HIS A HD1  1  
ATOM 556    H HE2  . HIS A 1 60  ? -2.720  -19.948 1.758   1.00 10.00 ? 215 HIS A HE2  1  
ATOM 557    N N    . ARG A 1 61  ? -3.729  -12.513 1.497   1.00 10.00 ? 216 ARG A N    1  
ATOM 558    C CA   . ARG A 1 61  ? -4.665  -11.413 1.274   1.00 10.00 ? 216 ARG A CA   1  
ATOM 559    C C    . ARG A 1 61  ? -4.963  -11.242 -0.214  1.00 10.00 ? 216 ARG A C    1  
ATOM 560    O O    . ARG A 1 61  ? -6.123  -11.164 -0.613  1.00 10.00 ? 216 ARG A O    1  
ATOM 561    C CB   . ARG A 1 61  ? -4.121  -10.111 1.866   1.00 10.00 ? 216 ARG A CB   1  
ATOM 562    C CG   . ARG A 1 61  ? -4.062  -10.126 3.381   1.00 10.00 ? 216 ARG A CG   1  
ATOM 563    C CD   . ARG A 1 61  ? -2.982  -9.204  3.914   1.00 10.00 ? 216 ARG A CD   1  
ATOM 564    N NE   . ARG A 1 61  ? -2.506  -9.635  5.230   1.00 10.00 ? 216 ARG A NE   1  
ATOM 565    C CZ   . ARG A 1 61  ? -1.375  -9.210  5.793   1.00 10.00 ? 216 ARG A CZ   1  
ATOM 566    N NH1  . ARG A 1 61  ? -0.603  -8.330  5.168   1.00 10.00 ? 216 ARG A NH1  1  
ATOM 567    N NH2  . ARG A 1 61  ? -1.012  -9.668  6.981   1.00 10.00 ? 216 ARG A NH2  1  
ATOM 568    H H    . ARG A 1 61  ? -2.796  -12.278 1.695   1.00 10.00 ? 216 ARG A H    1  
ATOM 569    H HE   . ARG A 1 61  ? -3.061  -10.294 5.719   1.00 10.00 ? 216 ARG A HE   1  
ATOM 570    H HH11 . ARG A 1 61  ? -0.866  -7.976  4.273   1.00 10.00 ? 216 ARG A HH11 1  
ATOM 571    H HH12 . ARG A 1 61  ? 0.257   -8.025  5.591   1.00 10.00 ? 216 ARG A HH12 1  
ATOM 572    H HH21 . ARG A 1 61  ? -1.590  -10.341 7.461   1.00 10.00 ? 216 ARG A HH21 1  
ATOM 573    H HH22 . ARG A 1 61  ? -0.158  -9.359  7.403   1.00 10.00 ? 216 ARG A HH22 1  
ATOM 574    N N    . GLU A 1 62  ? -3.910  -11.118 -1.023  1.00 10.00 ? 217 GLU A N    1  
ATOM 575    C CA   . GLU A 1 62  ? -4.064  -10.984 -2.477  1.00 10.00 ? 217 GLU A CA   1  
ATOM 576    C C    . GLU A 1 62  ? -4.964  -12.089 -3.041  1.00 10.00 ? 217 GLU A C    1  
ATOM 577    O O    . GLU A 1 62  ? -5.700  -11.882 -4.007  1.00 10.00 ? 217 GLU A O    1  
ATOM 578    C CB   . GLU A 1 62  ? -2.684  -11.017 -3.155  1.00 10.00 ? 217 GLU A CB   1  
ATOM 579    C CG   . GLU A 1 62  ? -2.650  -10.431 -4.564  1.00 10.00 ? 217 GLU A CG   1  
ATOM 580    C CD   . GLU A 1 62  ? -2.088  -9.017  -4.615  1.00 10.00 ? 217 GLU A CD   1  
ATOM 581    O OE1  . GLU A 1 62  ? -2.343  -8.235  -3.676  1.00 10.00 ? 217 GLU A OE1  1  
ATOM 582    O OE2  . GLU A 1 62  ? -1.409  -8.669  -5.616  1.00 10.00 ? 217 GLU A OE2  1  
ATOM 583    H H    . GLU A 1 62  ? -3.025  -10.984 -0.631  1.00 10.00 ? 217 GLU A H    1  
ATOM 584    N N    . MET A 1 63  ? -4.918  -13.258 -2.407  1.00 10.00 ? 218 MET A N    1  
ATOM 585    C CA   . MET A 1 63  ? -5.731  -14.397 -2.827  1.00 10.00 ? 218 MET A CA   1  
ATOM 586    C C    . MET A 1 63  ? -7.202  -14.236 -2.422  1.00 10.00 ? 218 MET A C    1  
ATOM 587    O O    . MET A 1 63  ? -8.080  -14.886 -2.992  1.00 10.00 ? 218 MET A O    1  
ATOM 588    C CB   . MET A 1 63  ? -5.163  -15.706 -2.265  1.00 10.00 ? 218 MET A CB   1  
ATOM 589    C CG   . MET A 1 63  ? -3.920  -16.206 -2.986  1.00 10.00 ? 218 MET A CG   1  
ATOM 590    S SD   . MET A 1 63  ? -4.193  -16.481 -4.750  1.00 10.00 ? 218 MET A SD   1  
ATOM 591    C CE   . MET A 1 63  ? -5.398  -17.806 -4.707  1.00 10.00 ? 218 MET A CE   1  
ATOM 592    H H    . MET A 1 63  ? -4.323  -13.354 -1.636  1.00 10.00 ? 218 MET A H    1  
ATOM 593    N N    . THR A 1 64  ? -7.470  -13.371 -1.448  1.00 10.00 ? 219 THR A N    1  
ATOM 594    C CA   . THR A 1 64  ? -8.832  -13.139 -0.977  1.00 10.00 ? 219 THR A CA   1  
ATOM 595    C C    . THR A 1 64  ? -9.674  -12.449 -2.048  1.00 10.00 ? 219 THR A C    1  
ATOM 596    O O    . THR A 1 64  ? -10.837 -12.798 -2.260  1.00 10.00 ? 219 THR A O    1  
ATOM 597    C CB   . THR A 1 64  ? -8.850  -12.292 0.306   1.00 10.00 ? 219 THR A CB   1  
ATOM 598    O OG1  . THR A 1 64  ? -7.792  -12.718 1.171   1.00 10.00 ? 219 THR A OG1  1  
ATOM 599    C CG2  . THR A 1 64  ? -10.182 -12.442 1.025   1.00 10.00 ? 219 THR A CG2  1  
ATOM 600    H H    . THR A 1 64  ? -6.727  -12.879 -1.023  1.00 10.00 ? 219 THR A H    1  
ATOM 601    H HG1  . THR A 1 64  ? -8.089  -13.468 1.692   1.00 10.00 ? 219 THR A HG1  1  
ATOM 602    N N    . SER A 1 65  ? -9.094  -11.461 -2.728  1.00 10.00 ? 220 SER A N    1  
ATOM 603    C CA   . SER A 1 65  ? -9.800  -10.739 -3.781  1.00 10.00 ? 220 SER A CA   1  
ATOM 604    C C    . SER A 1 65  ? -10.252 -11.683 -4.896  1.00 10.00 ? 220 SER A C    1  
ATOM 605    O O    . SER A 1 65  ? -11.270 -11.445 -5.551  1.00 10.00 ? 220 SER A O    1  
ATOM 606    C CB   . SER A 1 65  ? -8.909  -9.631  -4.337  1.00 10.00 ? 220 SER A CB   1  
ATOM 607    O OG   . SER A 1 65  ? -8.281  -8.929  -3.281  1.00 10.00 ? 220 SER A OG   1  
ATOM 608    H H    . SER A 1 65  ? -8.179  -11.181 -2.502  1.00 10.00 ? 220 SER A H    1  
ATOM 609    H HG   . SER A 1 65  ? -8.945  -8.634  -2.655  1.00 10.00 ? 220 SER A HG   1  
ATOM 610    N N    . LYS A 1 66  ? -9.498  -12.761 -5.094  1.00 10.00 ? 221 LYS A N    1  
ATOM 611    C CA   . LYS A 1 66  ? -9.827  -13.754 -6.107  1.00 10.00 ? 221 LYS A CA   1  
ATOM 612    C C    . LYS A 1 66  ? -11.162 -14.409 -5.767  1.00 10.00 ? 221 LYS A C    1  
ATOM 613    O O    . LYS A 1 66  ? -12.010 -14.613 -6.639  1.00 10.00 ? 221 LYS A O    1  
ATOM 614    C CB   . LYS A 1 66  ? -8.726  -14.815 -6.181  1.00 10.00 ? 221 LYS A CB   1  
ATOM 615    C CG   . LYS A 1 66  ? -8.938  -15.875 -7.254  1.00 10.00 ? 221 LYS A CG   1  
ATOM 616    C CD   . LYS A 1 66  ? -8.449  -15.403 -8.616  1.00 10.00 ? 221 LYS A CD   1  
ATOM 617    C CE   . LYS A 1 66  ? -9.600  -15.213 -9.595  1.00 10.00 ? 221 LYS A CE   1  
ATOM 618    N NZ   . LYS A 1 66  ? -10.222 -16.501 -10.005 1.00 10.00 ? 221 LYS A NZ   1  
ATOM 619    H H    . LYS A 1 66  ? -8.697  -12.892 -4.540  1.00 10.00 ? 221 LYS A H    1  
ATOM 620    H HZ1  . LYS A 1 66  ? -10.943 -16.801 -9.304  1.00 10.00 ? 221 LYS A HZ1  1  
ATOM 621    H HZ2  . LYS A 1 66  ? -9.498  -17.244 -10.083 1.00 10.00 ? 221 LYS A HZ2  1  
ATOM 622    H HZ3  . LYS A 1 66  ? -10.685 -16.392 -10.929 1.00 10.00 ? 221 LYS A HZ3  1  
ATOM 623    N N    . LEU A 1 67  ? -11.346 -14.703 -4.484  1.00 10.00 ? 222 LEU A N    1  
ATOM 624    C CA   . LEU A 1 67  ? -12.567 -15.326 -4.000  1.00 10.00 ? 222 LEU A CA   1  
ATOM 625    C C    . LEU A 1 67  ? -13.757 -14.411 -4.253  1.00 10.00 ? 222 LEU A C    1  
ATOM 626    O O    . LEU A 1 67  ? -14.797 -14.851 -4.735  1.00 10.00 ? 222 LEU A O    1  
ATOM 627    C CB   . LEU A 1 67  ? -12.455 -15.621 -2.503  1.00 10.00 ? 222 LEU A CB   1  
ATOM 628    C CG   . LEU A 1 67  ? -13.642 -16.347 -1.868  1.00 10.00 ? 222 LEU A CG   1  
ATOM 629    C CD1  . LEU A 1 67  ? -13.847 -17.710 -2.509  1.00 10.00 ? 222 LEU A CD1  1  
ATOM 630    C CD2  . LEU A 1 67  ? -13.453 -16.478 -0.366  1.00 10.00 ? 222 LEU A CD2  1  
ATOM 631    H H    . LEU A 1 67  ? -10.632 -14.502 -3.841  1.00 10.00 ? 222 LEU A H    1  
ATOM 632    N N    . LEU A 1 68  ? -13.582 -13.131 -3.941  1.00 10.00 ? 223 LEU A N    1  
ATOM 633    C CA   . LEU A 1 68  ? -14.636 -12.138 -4.129  1.00 10.00 ? 223 LEU A CA   1  
ATOM 634    C C    . LEU A 1 68  ? -15.104 -12.110 -5.582  1.00 10.00 ? 223 LEU A C    1  
ATOM 635    O O    . LEU A 1 68  ? -16.291 -12.289 -5.861  1.00 10.00 ? 223 LEU A O    1  
ATOM 636    C CB   . LEU A 1 68  ? -14.146 -10.750 -3.700  1.00 10.00 ? 223 LEU A CB   1  
ATOM 637    C CG   . LEU A 1 68  ? -13.621 -10.631 -2.268  1.00 10.00 ? 223 LEU A CG   1  
ATOM 638    C CD1  . LEU A 1 68  ? -13.085 -9.233  -2.003  1.00 10.00 ? 223 LEU A CD1  1  
ATOM 639    C CD2  . LEU A 1 68  ? -14.704 -10.993 -1.263  1.00 10.00 ? 223 LEU A CD2  1  
ATOM 640    H H    . LEU A 1 68  ? -12.717 -12.846 -3.577  1.00 10.00 ? 223 LEU A H    1  
ATOM 641    N N    . SER A 1 69  ? -14.168 -11.862 -6.494  1.00 10.00 ? 224 SER A N    1  
ATOM 642    C CA   . SER A 1 69  ? -14.464 -11.825 -7.925  1.00 10.00 ? 224 SER A CA   1  
ATOM 643    C C    . SER A 1 69  ? -15.156 -13.102 -8.412  1.00 10.00 ? 224 SER A C    1  
ATOM 644    O O    . SER A 1 69  ? -16.016 -13.049 -9.290  1.00 10.00 ? 224 SER A O    1  
ATOM 645    C CB   . SER A 1 69  ? -13.180 -11.568 -8.725  1.00 10.00 ? 224 SER A CB   1  
ATOM 646    O OG   . SER A 1 69  ? -13.444 -10.827 -9.905  1.00 10.00 ? 224 SER A OG   1  
ATOM 647    H H    . SER A 1 69  ? -13.265 -11.616 -6.196  1.00 10.00 ? 224 SER A H    1  
ATOM 648    H HG   . SER A 1 69  ? -14.270 -11.131 -10.294 1.00 10.00 ? 224 SER A HG   1  
ATOM 649    N N    . ASP A 1 70  ? -14.775 -14.242 -7.846  1.00 10.00 ? 225 ASP A N    1  
ATOM 650    C CA   . ASP A 1 70  ? -15.363 -15.518 -8.229  1.00 10.00 ? 225 ASP A CA   1  
ATOM 651    C C    . ASP A 1 70  ? -16.781 -15.641 -7.677  1.00 10.00 ? 225 ASP A C    1  
ATOM 652    O O    . ASP A 1 70  ? -17.709 -16.033 -8.392  1.00 10.00 ? 225 ASP A O    1  
ATOM 653    C CB   . ASP A 1 70  ? -14.502 -16.686 -7.747  1.00 10.00 ? 225 ASP A CB   1  
ATOM 654    C CG   . ASP A 1 70  ? -13.647 -17.283 -8.850  1.00 10.00 ? 225 ASP A CG   1  
ATOM 655    O OD1  . ASP A 1 70  ? -14.210 -17.801 -9.834  1.00 10.00 ? 225 ASP A OD1  1  
ATOM 656    O OD2  . ASP A 1 70  ? -12.400 -17.259 -8.730  1.00 10.00 ? 225 ASP A OD2  1  
ATOM 657    H H    . ASP A 1 70  ? -14.097 -14.215 -7.135  1.00 10.00 ? 225 ASP A H    1  
ATOM 658    N N    . LEU A 1 71  ? -16.937 -15.300 -6.401  1.00 10.00 ? 226 LEU A N    1  
ATOM 659    C CA   . LEU A 1 71  ? -18.236 -15.363 -5.744  1.00 10.00 ? 226 LEU A CA   1  
ATOM 660    C C    . LEU A 1 71  ? -19.263 -14.469 -6.425  1.00 10.00 ? 226 LEU A C    1  
ATOM 661    O O    . LEU A 1 71  ? -20.389 -14.906 -6.698  1.00 10.00 ? 226 LEU A O    1  
ATOM 662    C CB   . LEU A 1 71  ? -18.128 -14.996 -4.263  1.00 10.00 ? 226 LEU A CB   1  
ATOM 663    C CG   . LEU A 1 71  ? -17.306 -15.928 -3.373  1.00 10.00 ? 226 LEU A CG   1  
ATOM 664    C CD1  . LEU A 1 71  ? -17.267 -15.401 -1.947  1.00 10.00 ? 226 LEU A CD1  1  
ATOM 665    C CD2  . LEU A 1 71  ? -17.861 -17.345 -3.413  1.00 10.00 ? 226 LEU A CD2  1  
ATOM 666    H H    . LEU A 1 71  ? -16.142 -15.042 -5.877  1.00 10.00 ? 226 LEU A H    1  
ATOM 667    N N    . CYS A 1 72  ? -18.896 -13.212 -6.691  1.00 10.00 ? 227 CYS A N    1  
ATOM 668    C CA   . CYS A 1 72  ? -19.799 -12.267 -7.334  1.00 10.00 ? 227 CYS A CA   1  
ATOM 669    C C    . CYS A 1 72  ? -20.211 -12.740 -8.719  1.00 10.00 ? 227 CYS A C    1  
ATOM 670    O O    . CYS A 1 72  ? -19.369 -13.053 -9.567  1.00 10.00 ? 227 CYS A O    1  
ATOM 671    C CB   . CYS A 1 72  ? -19.132 -10.891 -7.417  1.00 10.00 ? 227 CYS A CB   1  
ATOM 672    S SG   . CYS A 1 72  ? -20.265 -9.515  -7.698  1.00 10.00 ? 227 CYS A SG   1  
ATOM 673    H H    . CYS A 1 72  ? -18.001 -12.885 -6.440  1.00 10.00 ? 227 CYS A H    1  
ATOM 674    H HG   . CYS A 1 72  ? -21.325 -9.996  -8.327  1.00 10.00 ? 227 CYS A HG   1  
ATOM 675    N N    . GLY A 1 73  ? -21.515 -12.803 -8.937  1.00 10.00 ? 228 GLY A N    1  
ATOM 676    C CA   . GLY A 1 73  ? -22.046 -13.236 -10.208 1.00 10.00 ? 228 GLY A CA   1  
ATOM 677    C C    . GLY A 1 73  ? -22.474 -14.682 -10.147 1.00 10.00 ? 228 GLY A C    1  
ATOM 678    O O    . GLY A 1 73  ? -23.390 -15.100 -10.853 1.00 10.00 ? 228 GLY A O    1  
ATOM 679    H H    . GLY A 1 73  ? -22.130 -12.570 -8.198  1.00 10.00 ? 228 GLY A H    1  
ATOM 680    N N    . THR A 1 74  ? -21.815 -15.445 -9.288  1.00 10.00 ? 229 THR A N    1  
ATOM 681    C CA   . THR A 1 74  ? -22.128 -16.851 -9.130  1.00 10.00 ? 229 THR A CA   1  
ATOM 682    C C    . THR A 1 74  ? -23.090 -17.066 -7.963  1.00 10.00 ? 229 THR A C    1  
ATOM 683    O O    . THR A 1 74  ? -24.191 -17.585 -8.143  1.00 10.00 ? 229 THR A O    1  
ATOM 684    C CB   . THR A 1 74  ? -20.845 -17.681 -8.913  1.00 10.00 ? 229 THR A CB   1  
ATOM 685    O OG1  . THR A 1 74  ? -19.826 -17.215 -9.810  1.00 10.00 ? 229 THR A OG1  1  
ATOM 686    C CG2  . THR A 1 74  ? -21.110 -19.157 -9.189  1.00 10.00 ? 229 THR A CG2  1  
ATOM 687    H H    . THR A 1 74  ? -21.094 -15.052 -8.754  1.00 10.00 ? 229 THR A H    1  
ATOM 688    H HG1  . THR A 1 74  ? -19.087 -16.844 -9.300  1.00 10.00 ? 229 THR A HG1  1  
ATOM 689    N N    . VAL A 1 75  ? -22.672 -16.664 -6.768  1.00 10.00 ? 230 VAL A N    1  
ATOM 690    C CA   . VAL A 1 75  ? -23.508 -16.828 -5.579  1.00 10.00 ? 230 VAL A CA   1  
ATOM 691    C C    . VAL A 1 75  ? -23.680 -15.516 -4.816  1.00 10.00 ? 230 VAL A C    1  
ATOM 692    O O    . VAL A 1 75  ? -24.359 -15.473 -3.788  1.00 10.00 ? 230 VAL A O    1  
ATOM 693    C CB   . VAL A 1 75  ? -22.927 -17.890 -4.620  1.00 10.00 ? 230 VAL A CB   1  
ATOM 694    C CG1  . VAL A 1 75  ? -23.010 -19.276 -5.237  1.00 10.00 ? 230 VAL A CG1  1  
ATOM 695    C CG2  . VAL A 1 75  ? -21.491 -17.550 -4.253  1.00 10.00 ? 230 VAL A CG2  1  
ATOM 696    H H    . VAL A 1 75  ? -21.780 -16.268 -6.678  1.00 10.00 ? 230 VAL A H    1  
ATOM 697    N N    . MET A 1 76  ? -23.086 -14.443 -5.317  1.00 10.00 ? 231 MET A N    1  
ATOM 698    C CA   . MET A 1 76  ? -23.177 -13.154 -4.652  1.00 10.00 ? 231 MET A CA   1  
ATOM 699    C C    . MET A 1 76  ? -23.431 -12.048 -5.662  1.00 10.00 ? 231 MET A C    1  
ATOM 700    O O    . MET A 1 76  ? -22.730 -11.949 -6.661  1.00 10.00 ? 231 MET A O    1  
ATOM 701    C CB   . MET A 1 76  ? -21.893 -12.866 -3.863  1.00 10.00 ? 231 MET A CB   1  
ATOM 702    C CG   . MET A 1 76  ? -21.869 -11.507 -3.181  1.00 10.00 ? 231 MET A CG   1  
ATOM 703    S SD   . MET A 1 76  ? -20.559 -11.357 -1.949  1.00 10.00 ? 231 MET A SD   1  
ATOM 704    C CE   . MET A 1 76  ? -19.099 -11.462 -2.981  1.00 10.00 ? 231 MET A CE   1  
ATOM 705    H H    . MET A 1 76  ? -22.595 -14.513 -6.160  1.00 10.00 ? 231 MET A H    1  
ATOM 706    N N    . SER A 1 77  ? -24.445 -11.236 -5.411  1.00 10.00 ? 232 SER A N    1  
ATOM 707    C CA   . SER A 1 77  ? -24.771 -10.138 -6.302  1.00 10.00 ? 232 SER A CA   1  
ATOM 708    C C    . SER A 1 77  ? -23.785 -8.993  -6.082  1.00 10.00 ? 232 SER A C    1  
ATOM 709    O O    . SER A 1 77  ? -23.220 -8.858  -4.994  1.00 10.00 ? 232 SER A O    1  
ATOM 710    C CB   . SER A 1 77  ? -26.198 -9.663  -6.027  1.00 10.00 ? 232 SER A CB   1  
ATOM 711    O OG   . SER A 1 77  ? -26.961 -10.682 -5.390  1.00 10.00 ? 232 SER A OG   1  
ATOM 712    H H    . SER A 1 77  ? -24.990 -11.377 -4.610  1.00 10.00 ? 232 SER A H    1  
ATOM 713    H HG   . SER A 1 77  ? -26.872 -10.590 -4.425  1.00 10.00 ? 232 SER A HG   1  
ATOM 714    N N    . THR A 1 78  ? -23.579 -8.179  -7.112  1.00 10.00 ? 233 THR A N    1  
ATOM 715    C CA   . THR A 1 78  ? -22.673 -7.037  -7.024  1.00 10.00 ? 233 THR A CA   1  
ATOM 716    C C    . THR A 1 78  ? -23.101 -6.127  -5.887  1.00 10.00 ? 233 THR A C    1  
ATOM 717    O O    . THR A 1 78  ? -22.283 -5.569  -5.159  1.00 10.00 ? 233 THR A O    1  
ATOM 718    C CB   . THR A 1 78  ? -22.691 -6.241  -8.337  1.00 10.00 ? 233 THR A CB   1  
ATOM 719    O OG1  . THR A 1 78  ? -22.790 -7.159  -9.436  1.00 10.00 ? 233 THR A OG1  1  
ATOM 720    C CG2  . THR A 1 78  ? -21.423 -5.415  -8.483  1.00 10.00 ? 233 THR A CG2  1  
ATOM 721    H H    . THR A 1 78  ? -24.046 -8.350  -7.957  1.00 10.00 ? 233 THR A H    1  
ATOM 722    H HG1  . THR A 1 78  ? -22.946 -6.667  -10.249 1.00 10.00 ? 233 THR A HG1  1  
ATOM 723    N N    . THR A 1 79  ? -24.400 -6.020  -5.720  1.00 10.00 ? 234 THR A N    1  
ATOM 724    C CA   . THR A 1 79  ? -24.986 -5.208  -4.681  1.00 10.00 ? 234 THR A CA   1  
ATOM 725    C C    . THR A 1 79  ? -24.731 -5.795  -3.283  1.00 10.00 ? 234 THR A C    1  
ATOM 726    O O    . THR A 1 79  ? -24.751 -5.068  -2.277  1.00 10.00 ? 234 THR A O    1  
ATOM 727    C CB   . THR A 1 79  ? -26.475 -4.957  -4.959  1.00 10.00 ? 234 THR A CB   1  
ATOM 728    O OG1  . THR A 1 79  ? -26.653 -4.901  -6.389  1.00 10.00 ? 234 THR A OG1  1  
ATOM 729    C CG2  . THR A 1 79  ? -26.894 -3.622  -4.372  1.00 10.00 ? 234 THR A CG2  1  
ATOM 730    H H    . THR A 1 79  ? -25.002 -6.506  -6.327  1.00 10.00 ? 234 THR A H    1  
ATOM 731    H HG1  . THR A 1 79  ? -25.938 -4.370  -6.779  1.00 10.00 ? 234 THR A HG1  1  
ATOM 732    N N    . ASP A 1 80  ? -24.466 -7.113  -3.216  1.00 10.00 ? 235 ASP A N    1  
ATOM 733    C CA   . ASP A 1 80  ? -24.266 -7.768  -1.922  1.00 10.00 ? 235 ASP A CA   1  
ATOM 734    C C    . ASP A 1 80  ? -22.867 -7.434  -1.400  1.00 10.00 ? 235 ASP A C    1  
ATOM 735    O O    . ASP A 1 80  ? -22.661 -7.271  -0.196  1.00 10.00 ? 235 ASP A O    1  
ATOM 736    C CB   . ASP A 1 80  ? -24.370 -9.300  -2.052  1.00 10.00 ? 235 ASP A CB   1  
ATOM 737    C CG   . ASP A 1 80  ? -25.779 -9.863  -2.028  1.00 10.00 ? 235 ASP A CG   1  
ATOM 738    O OD1  . ASP A 1 80  ? -26.565 -9.487  -1.138  1.00 10.00 ? 235 ASP A OD1  1  
ATOM 739    O OD2  . ASP A 1 80  ? -26.086 -10.718 -2.896  1.00 10.00 ? 235 ASP A OD2  1  
ATOM 740    H H    . ASP A 1 80  ? -24.185 -7.608  -4.021  1.00 10.00 ? 235 ASP A H    1  
ATOM 741    N N    . VAL A 1 81  ? -21.903 -7.347  -2.324  1.00 10.00 ? 236 VAL A N    1  
ATOM 742    C CA   . VAL A 1 81  ? -20.512 -7.041  -1.978  1.00 10.00 ? 236 VAL A CA   1  
ATOM 743    C C    . VAL A 1 81  ? -20.414 -5.714  -1.234  1.00 10.00 ? 236 VAL A C    1  
ATOM 744    O O    . VAL A 1 81  ? -19.667 -5.586  -0.265  1.00 10.00 ? 236 VAL A O    1  
ATOM 745    C CB   . VAL A 1 81  ? -19.601 -6.971  -3.221  1.00 10.00 ? 236 VAL A CB   1  
ATOM 746    C CG1  . VAL A 1 81  ? -18.135 -7.005  -2.814  1.00 10.00 ? 236 VAL A CG1  1  
ATOM 747    C CG2  . VAL A 1 81  ? -19.915 -8.096  -4.195  1.00 10.00 ? 236 VAL A CG2  1  
ATOM 748    H H    . VAL A 1 81  ? -22.131 -7.503  -3.265  1.00 10.00 ? 236 VAL A H    1  
ATOM 749    N N    . GLU A 1 82  ? -21.176 -4.732  -1.706  1.00 10.00 ? 237 GLU A N    1  
ATOM 750    C CA   . GLU A 1 82  ? -21.205 -3.403  -1.098  1.00 10.00 ? 237 GLU A CA   1  
ATOM 751    C C    . GLU A 1 82  ? -21.520 -3.499  0.391   1.00 10.00 ? 237 GLU A C    1  
ATOM 752    O O    . GLU A 1 82  ? -20.809 -2.943  1.230   1.00 10.00 ? 237 GLU A O    1  
ATOM 753    C CB   . GLU A 1 82  ? -22.261 -2.540  -1.793  1.00 10.00 ? 237 GLU A CB   1  
ATOM 754    C CG   . GLU A 1 82  ? -22.088 -2.433  -3.302  1.00 10.00 ? 237 GLU A CG   1  
ATOM 755    C CD   . GLU A 1 82  ? -23.290 -1.817  -3.996  1.00 10.00 ? 237 GLU A CD   1  
ATOM 756    O OE1  . GLU A 1 82  ? -23.986 -0.988  -3.377  1.00 10.00 ? 237 GLU A OE1  1  
ATOM 757    O OE2  . GLU A 1 82  ? -23.539 -2.156  -5.171  1.00 10.00 ? 237 GLU A OE2  1  
ATOM 758    H H    . GLU A 1 82  ? -21.730 -4.904  -2.496  1.00 10.00 ? 237 GLU A H    1  
ATOM 759    N N    . LYS A 1 83  ? -22.594 -4.214  0.705   1.00 10.00 ? 238 LYS A N    1  
ATOM 760    C CA   . LYS A 1 83  ? -23.026 -4.406  2.085   1.00 10.00 ? 238 LYS A CA   1  
ATOM 761    C C    . LYS A 1 83  ? -21.939 -5.073  2.918   1.00 10.00 ? 238 LYS A C    1  
ATOM 762    O O    . LYS A 1 83  ? -21.765 -4.757  4.094   1.00 10.00 ? 238 LYS A O    1  
ATOM 763    C CB   . LYS A 1 83  ? -24.295 -5.258  2.127   1.00 10.00 ? 238 LYS A CB   1  
ATOM 764    C CG   . LYS A 1 83  ? -25.502 -4.615  1.466   1.00 10.00 ? 238 LYS A CG   1  
ATOM 765    C CD   . LYS A 1 83  ? -26.697 -5.556  1.460   1.00 10.00 ? 238 LYS A CD   1  
ATOM 766    C CE   . LYS A 1 83  ? -26.418 -6.800  0.632   1.00 10.00 ? 238 LYS A CE   1  
ATOM 767    N NZ   . LYS A 1 83  ? -27.568 -7.740  0.636   1.00 10.00 ? 238 LYS A NZ   1  
ATOM 768    H H    . LYS A 1 83  ? -23.131 -4.593  -0.019  1.00 10.00 ? 238 LYS A H    1  
ATOM 769    H HZ1  . LYS A 1 83  ? -27.778 -8.041  1.615   1.00 10.00 ? 238 LYS A HZ1  1  
ATOM 770    H HZ2  . LYS A 1 83  ? -27.344 -8.584  0.060   1.00 10.00 ? 238 LYS A HZ2  1  
ATOM 771    H HZ3  . LYS A 1 83  ? -28.410 -7.276  0.239   1.00 10.00 ? 238 LYS A HZ3  1  
ATOM 772    N N    . SER A 1 84  ? -21.222 -6.004  2.305   1.00 10.00 ? 239 SER A N    1  
ATOM 773    C CA   . SER A 1 84  ? -20.149 -6.716  2.983   1.00 10.00 ? 239 SER A CA   1  
ATOM 774    C C    . SER A 1 84  ? -19.058 -5.751  3.443   1.00 10.00 ? 239 SER A C    1  
ATOM 775    O O    . SER A 1 84  ? -18.542 -5.874  4.555   1.00 10.00 ? 239 SER A O    1  
ATOM 776    C CB   . SER A 1 84  ? -19.569 -7.791  2.061   1.00 10.00 ? 239 SER A CB   1  
ATOM 777    O OG   . SER A 1 84  ? -20.609 -8.552  1.468   1.00 10.00 ? 239 SER A OG   1  
ATOM 778    H H    . SER A 1 84  ? -21.418 -6.218  1.370   1.00 10.00 ? 239 SER A H    1  
ATOM 779    H HG   . SER A 1 84  ? -20.755 -8.251  0.567   1.00 10.00 ? 239 SER A HG   1  
ATOM 780    N N    . PHE A 1 85  ? -18.719 -4.786  2.595   1.00 10.00 ? 240 PHE A N    1  
ATOM 781    C CA   . PHE A 1 85  ? -17.701 -3.798  2.931   1.00 10.00 ? 240 PHE A CA   1  
ATOM 782    C C    . PHE A 1 85  ? -18.119 -2.951  4.121   1.00 10.00 ? 240 PHE A C    1  
ATOM 783    O O    . PHE A 1 85  ? -17.305 -2.662  5.000   1.00 10.00 ? 240 PHE A O    1  
ATOM 784    C CB   . PHE A 1 85  ? -17.331 -2.936  1.722   1.00 10.00 ? 240 PHE A CB   1  
ATOM 785    C CG   . PHE A 1 85  ? -16.276 -3.566  0.857   1.00 10.00 ? 240 PHE A CG   1  
ATOM 786    C CD1  . PHE A 1 85  ? -14.937 -3.481  1.206   1.00 10.00 ? 240 PHE A CD1  1  
ATOM 787    C CD2  . PHE A 1 85  ? -16.622 -4.252  -0.296  1.00 10.00 ? 240 PHE A CD2  1  
ATOM 788    C CE1  . PHE A 1 85  ? -13.964 -4.069  0.420   1.00 10.00 ? 240 PHE A CE1  1  
ATOM 789    C CE2  . PHE A 1 85  ? -15.654 -4.840  -1.087  1.00 10.00 ? 240 PHE A CE2  1  
ATOM 790    C CZ   . PHE A 1 85  ? -14.323 -4.748  -0.728  1.00 10.00 ? 240 PHE A CZ   1  
ATOM 791    H H    . PHE A 1 85  ? -19.163 -4.738  1.721   1.00 10.00 ? 240 PHE A H    1  
ATOM 792    N N    . ASP A 1 86  ? -19.398 -2.567  4.160   1.00 10.00 ? 241 ASP A N    1  
ATOM 793    C CA   . ASP A 1 86  ? -19.922 -1.771  5.273   1.00 10.00 ? 241 ASP A CA   1  
ATOM 794    C C    . ASP A 1 86  ? -19.758 -2.556  6.559   1.00 10.00 ? 241 ASP A C    1  
ATOM 795    O O    . ASP A 1 86  ? -19.226 -2.061  7.556   1.00 10.00 ? 241 ASP A O    1  
ATOM 796    C CB   . ASP A 1 86  ? -21.421 -1.491  5.090   1.00 10.00 ? 241 ASP A CB   1  
ATOM 797    C CG   . ASP A 1 86  ? -21.779 -0.696  3.850   1.00 10.00 ? 241 ASP A CG   1  
ATOM 798    O OD1  . ASP A 1 86  ? -20.979 0.157   3.421   1.00 10.00 ? 241 ASP A OD1  1  
ATOM 799    O OD2  . ASP A 1 86  ? -22.894 -0.901  3.314   1.00 10.00 ? 241 ASP A OD2  1  
ATOM 800    H H    . ASP A 1 86  ? -19.995 -2.809  3.419   1.00 10.00 ? 241 ASP A H    1  
ATOM 801    N N    . LYS A 1 87  ? -20.254 -3.792  6.525   1.00 10.00 ? 242 LYS A N    1  
ATOM 802    C CA   . LYS A 1 87  ? -20.165 -4.708  7.655   1.00 10.00 ? 242 LYS A CA   1  
ATOM 803    C C    . LYS A 1 87  ? -18.716 -4.872  8.122   1.00 10.00 ? 242 LYS A C    1  
ATOM 804    O O    . LYS A 1 87  ? -18.447 -4.907  9.324   1.00 10.00 ? 242 LYS A O    1  
ATOM 805    C CB   . LYS A 1 87  ? -20.769 -6.074  7.291   1.00 10.00 ? 242 LYS A CB   1  
ATOM 806    C CG   . LYS A 1 87  ? -22.280 -6.059  7.087   1.00 10.00 ? 242 LYS A CG   1  
ATOM 807    C CD   . LYS A 1 87  ? -22.801 -7.434  6.695   1.00 10.00 ? 242 LYS A CD   1  
ATOM 808    C CE   . LYS A 1 87  ? -24.322 -7.516  6.794   1.00 10.00 ? 242 LYS A CE   1  
ATOM 809    N NZ   . LYS A 1 87  ? -24.986 -7.460  5.460   1.00 10.00 ? 242 LYS A NZ   1  
ATOM 810    H H    . LYS A 1 87  ? -20.759 -4.053  5.723   1.00 10.00 ? 242 LYS A H    1  
ATOM 811    H HZ1  . LYS A 1 87  ? -24.717 -6.590  4.961   1.00 10.00 ? 242 LYS A HZ1  1  
ATOM 812    H HZ2  . LYS A 1 87  ? -26.029 -7.471  5.573   1.00 10.00 ? 242 LYS A HZ2  1  
ATOM 813    H HZ3  . LYS A 1 87  ? -24.709 -8.280  4.881   1.00 10.00 ? 242 LYS A HZ3  1  
ATOM 814    N N    . LEU A 1 88  ? -17.791 -4.939  7.171   1.00 10.00 ? 243 LEU A N    1  
ATOM 815    C CA   . LEU A 1 88  ? -16.376 -5.076  7.487   1.00 10.00 ? 243 LEU A CA   1  
ATOM 816    C C    . LEU A 1 88  ? -15.855 -3.810  8.165   1.00 10.00 ? 243 LEU A C    1  
ATOM 817    O O    . LEU A 1 88  ? -15.212 -3.880  9.214   1.00 10.00 ? 243 LEU A O    1  
ATOM 818    C CB   . LEU A 1 88  ? -15.570 -5.378  6.219   1.00 10.00 ? 243 LEU A CB   1  
ATOM 819    C CG   . LEU A 1 88  ? -14.052 -5.493  6.387   1.00 10.00 ? 243 LEU A CG   1  
ATOM 820    C CD1  . LEU A 1 88  ? -13.687 -6.726  7.201   1.00 10.00 ? 243 LEU A CD1  1  
ATOM 821    C CD2  . LEU A 1 88  ? -13.361 -5.515  5.034   1.00 10.00 ? 243 LEU A CD2  1  
ATOM 822    H H    . LEU A 1 88  ? -18.067 -4.897  6.229   1.00 10.00 ? 243 LEU A H    1  
ATOM 823    N N    . LEU A 1 89  ? -16.137 -2.656  7.553   1.00 10.00 ? 244 LEU A N    1  
ATOM 824    C CA   . LEU A 1 89  ? -15.710 -1.364  8.093   1.00 10.00 ? 244 LEU A CA   1  
ATOM 825    C C    . LEU A 1 89  ? -16.133 -1.182  9.551   1.00 10.00 ? 244 LEU A C    1  
ATOM 826    O O    . LEU A 1 89  ? -15.393 -0.621  10.354  1.00 10.00 ? 244 LEU A O    1  
ATOM 827    C CB   . LEU A 1 89  ? -16.223 -0.206  7.232   1.00 10.00 ? 244 LEU A CB   1  
ATOM 828    C CG   . LEU A 1 89  ? -15.578 -0.048  5.850   1.00 10.00 ? 244 LEU A CG   1  
ATOM 829    C CD1  . LEU A 1 89  ? -16.227 1.089   5.074   1.00 10.00 ? 244 LEU A CD1  1  
ATOM 830    C CD2  . LEU A 1 89  ? -14.079 0.179   5.978   1.00 10.00 ? 244 LEU A CD2  1  
ATOM 831    H H    . LEU A 1 89  ? -16.608 -2.688  6.686   1.00 10.00 ? 244 LEU A H    1  
ATOM 832    N N    . LYS A 1 90  ? -17.338 -1.636  9.877   1.00 10.00 ? 245 LYS A N    1  
ATOM 833    C CA   . LYS A 1 90  ? -17.847 -1.542  11.247  1.00 10.00 ? 245 LYS A CA   1  
ATOM 834    C C    . LYS A 1 90  ? -17.037 -2.419  12.206  1.00 10.00 ? 245 LYS A C    1  
ATOM 835    O O    . LYS A 1 90  ? -16.870 -2.080  13.377  1.00 10.00 ? 245 LYS A O    1  
ATOM 836    C CB   . LYS A 1 90  ? -19.327 -1.923  11.305  1.00 10.00 ? 245 LYS A CB   1  
ATOM 837    C CG   . LYS A 1 90  ? -20.235 -0.996  10.509  1.00 10.00 ? 245 LYS A CG   1  
ATOM 838    C CD   . LYS A 1 90  ? -20.161 0.433   11.023  1.00 10.00 ? 245 LYS A CD   1  
ATOM 839    C CE   . LYS A 1 90  ? -20.780 1.408   10.036  1.00 10.00 ? 245 LYS A CE   1  
ATOM 840    N NZ   . LYS A 1 90  ? -20.775 2.797   10.562  1.00 10.00 ? 245 LYS A NZ   1  
ATOM 841    H H    . LYS A 1 90  ? -17.923 -1.995  9.170   1.00 10.00 ? 245 LYS A H    1  
ATOM 842    H HZ1  . LYS A 1 90  ? -19.899 2.977   11.096  1.00 10.00 ? 245 LYS A HZ1  1  
ATOM 843    H HZ2  . LYS A 1 90  ? -21.586 2.942   11.195  1.00 10.00 ? 245 LYS A HZ2  1  
ATOM 844    H HZ3  . LYS A 1 90  ? -20.834 3.475   9.780   1.00 10.00 ? 245 LYS A HZ3  1  
ATOM 845    N N    . ASP A 1 91  ? -16.544 -3.538  11.697  1.00 10.00 ? 246 ASP A N    1  
ATOM 846    C CA   . ASP A 1 91  ? -15.749 -4.469  12.497  1.00 10.00 ? 246 ASP A CA   1  
ATOM 847    C C    . ASP A 1 91  ? -14.316 -3.965  12.665  1.00 10.00 ? 246 ASP A C    1  
ATOM 848    O O    . ASP A 1 91  ? -13.680 -4.222  13.686  1.00 10.00 ? 246 ASP A O    1  
ATOM 849    C CB   . ASP A 1 91  ? -15.747 -5.865  11.875  1.00 10.00 ? 246 ASP A CB   1  
ATOM 850    C CG   . ASP A 1 91  ? -15.495 -6.954  12.899  1.00 10.00 ? 246 ASP A CG   1  
ATOM 851    O OD1  . ASP A 1 91  ? -16.463 -7.368  13.580  1.00 10.00 ? 246 ASP A OD1  1  
ATOM 852    O OD2  . ASP A 1 91  ? -14.338 -7.408  13.026  1.00 10.00 ? 246 ASP A OD2  1  
ATOM 853    H H    . ASP A 1 91  ? -16.737 -3.740  10.757  1.00 10.00 ? 246 ASP A H    1  
ATOM 854    N N    . LEU A 1 92  ? -13.828 -3.257  11.645  1.00 10.00 ? 247 LEU A N    1  
ATOM 855    C CA   . LEU A 1 92  ? -12.471 -2.677  11.637  1.00 10.00 ? 247 LEU A CA   1  
ATOM 856    C C    . LEU A 1 92  ? -11.965 -2.175  13.002  1.00 10.00 ? 247 LEU A C    1  
ATOM 857    O O    . LEU A 1 92  ? -10.878 -2.577  13.426  1.00 10.00 ? 247 LEU A O    1  
ATOM 858    C CB   . LEU A 1 92  ? -12.372 -1.544  10.608  1.00 10.00 ? 247 LEU A CB   1  
ATOM 859    C CG   . LEU A 1 92  ? -11.546 -1.817  9.356   1.00 10.00 ? 247 LEU A CG   1  
ATOM 860    C CD1  . LEU A 1 92  ? -12.266 -2.792  8.441   1.00 10.00 ? 247 LEU A CD1  1  
ATOM 861    C CD2  . LEU A 1 92  ? -11.251 -0.512  8.634   1.00 10.00 ? 247 LEU A CD2  1  
ATOM 862    H H    . LEU A 1 92  ? -14.350 -3.217  10.815  1.00 10.00 ? 247 LEU A H    1  
ATOM 863    N N    . PRO A 1 93  ? -12.715 -1.288  13.700  1.00 10.00 ? 248 PRO A N    1  
ATOM 864    C CA   . PRO A 1 93  ? -12.304 -0.751  15.005  1.00 10.00 ? 248 PRO A CA   1  
ATOM 865    C C    . PRO A 1 93  ? -11.845 -1.821  15.995  1.00 10.00 ? 248 PRO A C    1  
ATOM 866    O O    . PRO A 1 93  ? -10.987 -1.559  16.837  1.00 10.00 ? 248 PRO A O    1  
ATOM 867    C CB   . PRO A 1 93  ? -13.566 -0.051  15.515  1.00 10.00 ? 248 PRO A CB   1  
ATOM 868    C CG   . PRO A 1 93  ? -14.258 0.382   14.270  1.00 10.00 ? 248 PRO A CG   1  
ATOM 869    C CD   . PRO A 1 93  ? -14.006 -0.710  13.270  1.00 10.00 ? 248 PRO A CD   1  
ATOM 870    N N    . GLU A 1 94  ? -12.414 -3.022  15.910  1.00 10.00 ? 249 GLU A N    1  
ATOM 871    C CA   . GLU A 1 94  ? -12.041 -4.094  16.826  1.00 10.00 ? 249 GLU A CA   1  
ATOM 872    C C    . GLU A 1 94  ? -10.719 -4.750  16.440  1.00 10.00 ? 249 GLU A C    1  
ATOM 873    O O    . GLU A 1 94  ? -9.781  -4.747  17.236  1.00 10.00 ? 249 GLU A O    1  
ATOM 874    C CB   . GLU A 1 94  ? -13.146 -5.164  16.842  1.00 10.00 ? 249 GLU A CB   1  
ATOM 875    C CG   . GLU A 1 94  ? -14.101 -5.074  18.020  1.00 10.00 ? 249 GLU A CG   1  
ATOM 876    C CD   . GLU A 1 94  ? -14.654 -3.686  18.205  1.00 10.00 ? 249 GLU A CD   1  
ATOM 877    O OE1  . GLU A 1 94  ? -15.542 -3.287  17.426  1.00 10.00 ? 249 GLU A OE1  1  
ATOM 878    O OE2  . GLU A 1 94  ? -14.198 -2.985  19.130  1.00 10.00 ? 249 GLU A OE2  1  
ATOM 879    H H    . GLU A 1 94  ? -13.105 -3.176  15.231  1.00 10.00 ? 249 GLU A H    1  
ATOM 880    N N    . LEU A 1 95  ? -10.634 -5.277  15.218  1.00 10.00 ? 250 LEU A N    1  
ATOM 881    C CA   . LEU A 1 95  ? -9.403  -5.897  14.732  1.00 10.00 ? 250 LEU A CA   1  
ATOM 882    C C    . LEU A 1 95  ? -8.214  -4.939  14.684  1.00 10.00 ? 250 LEU A C    1  
ATOM 883    O O    . LEU A 1 95  ? -7.064  -5.361  14.845  1.00 10.00 ? 250 LEU A O    1  
ATOM 884    C CB   . LEU A 1 95  ? -9.643  -6.514  13.354  1.00 10.00 ? 250 LEU A CB   1  
ATOM 885    C CG   . LEU A 1 95  ? -10.812 -7.502  13.260  1.00 10.00 ? 250 LEU A CG   1  
ATOM 886    C CD1  . LEU A 1 95  ? -11.186 -7.759  11.804  1.00 10.00 ? 250 LEU A CD1  1  
ATOM 887    C CD2  . LEU A 1 95  ? -10.467 -8.805  13.963  1.00 10.00 ? 250 LEU A CD2  1  
ATOM 888    H H    . LEU A 1 95  ? -11.452 -5.440  14.698  1.00 10.00 ? 250 LEU A H    1  
ATOM 889    N N    . ALA A 1 96  ? -8.484  -3.660  14.461  1.00 10.00 ? 251 ALA A N    1  
ATOM 890    C CA   . ALA A 1 96  ? -7.422  -2.659  14.389  1.00 10.00 ? 251 ALA A CA   1  
ATOM 891    C C    . ALA A 1 96  ? -6.616  -2.599  15.684  1.00 10.00 ? 251 ALA A C    1  
ATOM 892    O O    . ALA A 1 96  ? -5.447  -2.202  15.680  1.00 10.00 ? 251 ALA A O    1  
ATOM 893    C CB   . ALA A 1 96  ? -7.996  -1.291  14.055  1.00 10.00 ? 251 ALA A CB   1  
ATOM 894    H H    . ALA A 1 96  ? -9.419  -3.382  14.327  1.00 10.00 ? 251 ALA A H    1  
ATOM 895    N N    . LEU A 1 97  ? -7.246  -2.984  16.786  1.00 10.00 ? 252 LEU A N    1  
ATOM 896    C CA   . LEU A 1 97  ? -6.597  -2.968  18.087  1.00 10.00 ? 252 LEU A CA   1  
ATOM 897    C C    . LEU A 1 97  ? -5.460  -3.975  18.174  1.00 10.00 ? 252 LEU A C    1  
ATOM 898    O O    . LEU A 1 97  ? -4.366  -3.644  18.647  1.00 10.00 ? 252 LEU A O    1  
ATOM 899    C CB   . LEU A 1 97  ? -7.617  -3.224  19.202  1.00 10.00 ? 252 LEU A CB   1  
ATOM 900    C CG   . LEU A 1 97  ? -8.777  -2.234  19.300  1.00 10.00 ? 252 LEU A CG   1  
ATOM 901    C CD1  . LEU A 1 97  ? -9.751  -2.659  20.390  1.00 10.00 ? 252 LEU A CD1  1  
ATOM 902    C CD2  . LEU A 1 97  ? -8.259  -0.828  19.558  1.00 10.00 ? 252 LEU A CD2  1  
ATOM 903    H H    . LEU A 1 97  ? -8.192  -3.244  16.721  1.00 10.00 ? 252 LEU A H    1  
ATOM 904    N N    . ASP A 1 98  ? -5.696  -5.202  17.697  1.00 10.00 ? 253 ASP A N    1  
ATOM 905    C CA   . ASP A 1 98  ? -4.674  -6.239  17.773  1.00 10.00 ? 253 ASP A CA   1  
ATOM 906    C C    . ASP A 1 98  ? -3.655  -6.085  16.654  1.00 10.00 ? 253 ASP A C    1  
ATOM 907    O O    . ASP A 1 98  ? -2.452  -6.160  16.893  1.00 10.00 ? 253 ASP A O    1  
ATOM 908    C CB   . ASP A 1 98  ? -5.336  -7.615  17.664  1.00 10.00 ? 253 ASP A CB   1  
ATOM 909    C CG   . ASP A 1 98  ? -4.327  -8.735  17.490  1.00 10.00 ? 253 ASP A CG   1  
ATOM 910    O OD1  . ASP A 1 98  ? -3.826  -9.250  18.512  1.00 10.00 ? 253 ASP A OD1  1  
ATOM 911    O OD2  . ASP A 1 98  ? -4.027  -9.102  16.336  1.00 10.00 ? 253 ASP A OD2  1  
ATOM 912    H H    . ASP A 1 98  ? -6.562  -5.416  17.288  1.00 10.00 ? 253 ASP A H    1  
ATOM 913    N N    . THR A 1 99  ? -4.141  -5.873  15.438  1.00 10.00 ? 254 THR A N    1  
ATOM 914    C CA   . THR A 1 99  ? -3.246  -5.647  14.316  1.00 10.00 ? 254 THR A CA   1  
ATOM 915    C C    . THR A 1 99  ? -3.318  -4.201  13.836  1.00 10.00 ? 254 THR A C    1  
ATOM 916    O O    . THR A 1 99  ? -4.291  -3.794  13.206  1.00 10.00 ? 254 THR A O    1  
ATOM 917    C CB   . THR A 1 99  ? -3.541  -6.615  13.155  1.00 10.00 ? 254 THR A CB   1  
ATOM 918    O OG1  . THR A 1 99  ? -3.650  -7.949  13.670  1.00 10.00 ? 254 THR A OG1  1  
ATOM 919    C CG2  . THR A 1 99  ? -2.411  -6.562  12.133  1.00 10.00 ? 254 THR A CG2  1  
ATOM 920    H H    . THR A 1 99  ? -5.088  -6.047  15.271  1.00 10.00 ? 254 THR A H    1  
ATOM 921    H HG1  . THR A 1 99  ? -3.722  -7.920  14.638  1.00 10.00 ? 254 THR A HG1  1  
ATOM 922    N N    . PRO A 1 100 ? -2.270  -3.405  14.124  1.00 10.00 ? 255 PRO A N    1  
ATOM 923    C CA   . PRO A 1 100 ? -2.205  -1.985  13.732  1.00 10.00 ? 255 PRO A CA   1  
ATOM 924    C C    . PRO A 1 100 ? -2.130  -1.795  12.218  1.00 10.00 ? 255 PRO A C    1  
ATOM 925    O O    . PRO A 1 100 ? -2.409  -0.712  11.704  1.00 10.00 ? 255 PRO A O    1  
ATOM 926    C CB   . PRO A 1 100 ? -0.909  -1.490  14.377  1.00 10.00 ? 255 PRO A CB   1  
ATOM 927    C CG   . PRO A 1 100 ? -0.092  -2.719  14.581  1.00 10.00 ? 255 PRO A CG   1  
ATOM 928    C CD   . PRO A 1 100 ? -1.067  -3.822  14.867  1.00 10.00 ? 255 PRO A CD   1  
ATOM 929    N N    . ARG A 1 101 ? -1.746  -2.849  11.512  1.00 10.00 ? 256 ARG A N    1  
ATOM 930    C CA   . ARG A 1 101 ? -1.638  -2.796  10.056  1.00 10.00 ? 256 ARG A CA   1  
ATOM 931    C C    . ARG A 1 101 ? -2.959  -3.167  9.384   1.00 10.00 ? 256 ARG A C    1  
ATOM 932    O O    . ARG A 1 101 ? -3.106  -3.035  8.169   1.00 10.00 ? 256 ARG A O    1  
ATOM 933    C CB   . ARG A 1 101 ? -0.520  -3.726  9.576   1.00 10.00 ? 256 ARG A CB   1  
ATOM 934    C CG   . ARG A 1 101 ? 0.672   -3.010  8.964   1.00 10.00 ? 256 ARG A CG   1  
ATOM 935    C CD   . ARG A 1 101 ? 0.667   -3.132  7.448   1.00 10.00 ? 256 ARG A CD   1  
ATOM 936    N NE   . ARG A 1 101 ? 1.841   -2.513  6.829   1.00 10.00 ? 256 ARG A NE   1  
ATOM 937    C CZ   . ARG A 1 101 ? 3.034   -3.101  6.739   1.00 10.00 ? 256 ARG A CZ   1  
ATOM 938    N NH1  . ARG A 1 101 ? 3.247   -4.276  7.311   1.00 10.00 ? 256 ARG A NH1  1  
ATOM 939    N NH2  . ARG A 1 101 ? 4.025   -2.510  6.086   1.00 10.00 ? 256 ARG A NH2  1  
ATOM 940    H H    . ARG A 1 101 ? -1.514  -3.675  11.983  1.00 10.00 ? 256 ARG A H    1  
ATOM 941    H HE   . ARG A 1 101 ? 1.722   -1.621  6.433   1.00 10.00 ? 256 ARG A HE   1  
ATOM 942    H HH11 . ARG A 1 101 ? 2.513   -4.734  7.821   1.00 10.00 ? 256 ARG A HH11 1  
ATOM 943    H HH12 . ARG A 1 101 ? 4.155   -4.715  7.237   1.00 10.00 ? 256 ARG A HH12 1  
ATOM 944    H HH21 . ARG A 1 101 ? 3.887   -1.615  5.649   1.00 10.00 ? 256 ARG A HH21 1  
ATOM 945    H HH22 . ARG A 1 101 ? 4.928   -2.962  6.028   1.00 10.00 ? 256 ARG A HH22 1  
ATOM 946    N N    . ALA A 1 102 ? -3.911  -3.640  10.190  1.00 10.00 ? 257 ALA A N    1  
ATOM 947    C CA   . ALA A 1 102 ? -5.234  -4.046  9.700   1.00 10.00 ? 257 ALA A CA   1  
ATOM 948    C C    . ALA A 1 102 ? -5.906  -3.027  8.765   1.00 10.00 ? 257 ALA A C    1  
ATOM 949    O O    . ALA A 1 102 ? -6.240  -3.374  7.632   1.00 10.00 ? 257 ALA A O    1  
ATOM 950    C CB   . ALA A 1 102 ? -6.154  -4.461  10.840  1.00 10.00 ? 257 ALA A CB   1  
ATOM 951    H H    . ALA A 1 102 ? -3.700  -3.753  11.140  1.00 10.00 ? 257 ALA A H    1  
ATOM 952    N N    . PRO A 1 103 ? -6.116  -1.762  9.202   1.00 10.00 ? 258 PRO A N    1  
ATOM 953    C CA   . PRO A 1 103 ? -6.768  -0.739  8.364   1.00 10.00 ? 258 PRO A CA   1  
ATOM 954    C C    . PRO A 1 103 ? -6.034  -0.497  7.041   1.00 10.00 ? 258 PRO A C    1  
ATOM 955    O O    . PRO A 1 103 ? -6.663  -0.273  6.002   1.00 10.00 ? 258 PRO A O    1  
ATOM 956    C CB   . PRO A 1 103 ? -6.750  0.524   9.237   1.00 10.00 ? 258 PRO A CB   1  
ATOM 957    C CG   . PRO A 1 103 ? -5.712  0.259   10.275  1.00 10.00 ? 258 PRO A CG   1  
ATOM 958    C CD   . PRO A 1 103 ? -5.748  -1.219  10.522  1.00 10.00 ? 258 PRO A CD   1  
ATOM 959    N N    . GLN A 1 104 ? -4.703  -0.551  7.088   1.00 10.00 ? 259 GLN A N    1  
ATOM 960    C CA   . GLN A 1 104 ? -3.879  -0.345  5.898   1.00 10.00 ? 259 GLN A CA   1  
ATOM 961    C C    . GLN A 1 104 ? -4.184  -1.403  4.843   1.00 10.00 ? 259 GLN A C    1  
ATOM 962    O O    . GLN A 1 104 ? -4.205  -1.120  3.645   1.00 10.00 ? 259 GLN A O    1  
ATOM 963    C CB   . GLN A 1 104 ? -2.391  -0.368  6.257   1.00 10.00 ? 259 GLN A CB   1  
ATOM 964    C CG   . GLN A 1 104 ? -1.828  0.973   6.706   1.00 10.00 ? 259 GLN A CG   1  
ATOM 965    C CD   . GLN A 1 104 ? -1.025  0.873   7.987   1.00 10.00 ? 259 GLN A CD   1  
ATOM 966    O OE1  . GLN A 1 104 ? -0.522  -0.193  8.341   1.00 10.00 ? 259 GLN A OE1  1  
ATOM 967    N NE2  . GLN A 1 104 ? -0.876  1.989   8.682   1.00 10.00 ? 259 GLN A NE2  1  
ATOM 968    H H    . GLN A 1 104 ? -4.272  -0.725  7.951   1.00 10.00 ? 259 GLN A H    1  
ATOM 969    H HE21 . GLN A 1 104 ? -1.291  2.823   8.333   1.00 10.00 ? 259 GLN A HE21 1  
ATOM 970    H HE22 . GLN A 1 104 ? -0.348  1.956   9.506   1.00 10.00 ? 259 GLN A HE22 1  
ATOM 971    N N    . LEU A 1 105 ? -4.424  -2.626  5.303   1.00 10.00 ? 260 LEU A N    1  
ATOM 972    C CA   . LEU A 1 105 ? -4.743  -3.736  4.411   1.00 10.00 ? 260 LEU A CA   1  
ATOM 973    C C    . LEU A 1 105 ? -6.154  -3.571  3.867   1.00 10.00 ? 260 LEU A C    1  
ATOM 974    O O    . LEU A 1 105 ? -6.408  -3.792  2.686   1.00 10.00 ? 260 LEU A O    1  
ATOM 975    C CB   . LEU A 1 105 ? -4.619  -5.065  5.153   1.00 10.00 ? 260 LEU A CB   1  
ATOM 976    C CG   . LEU A 1 105 ? -3.327  -5.280  5.936   1.00 10.00 ? 260 LEU A CG   1  
ATOM 977    C CD1  . LEU A 1 105 ? -3.448  -6.500  6.833   1.00 10.00 ? 260 LEU A CD1  1  
ATOM 978    C CD2  . LEU A 1 105 ? -2.144  -5.417  4.991   1.00 10.00 ? 260 LEU A CD2  1  
ATOM 979    H H    . LEU A 1 105 ? -4.390  -2.788  6.269   1.00 10.00 ? 260 LEU A H    1  
ATOM 980    N N    . VAL A 1 106 ? -7.063  -3.206  4.764   1.00 10.00 ? 261 VAL A N    1  
ATOM 981    C CA   . VAL A 1 106 ? -8.466  -2.978  4.407   1.00 10.00 ? 261 VAL A CA   1  
ATOM 982    C C    . VAL A 1 106 ? -8.583  -2.058  3.187   1.00 10.00 ? 261 VAL A C    1  
ATOM 983    O O    . VAL A 1 106 ? -9.391  -2.306  2.288   1.00 10.00 ? 261 VAL A O    1  
ATOM 984    C CB   . VAL A 1 106 ? -9.276  -2.402  5.582   1.00 10.00 ? 261 VAL A CB   1  
ATOM 985    C CG1  . VAL A 1 106 ? -10.710 -2.121  5.153   1.00 10.00 ? 261 VAL A CG1  1  
ATOM 986    C CG2  . VAL A 1 106 ? -9.255  -3.370  6.753   1.00 10.00 ? 261 VAL A CG2  1  
ATOM 987    H H    . VAL A 1 106 ? -6.774  -3.180  5.704   1.00 10.00 ? 261 VAL A H    1  
ATOM 988    N N    . GLY A 1 107 ? -7.755  -1.015  3.154   1.00 10.00 ? 262 GLY A N    1  
ATOM 989    C CA   . GLY A 1 107 ? -7.763  -0.091  2.029   1.00 10.00 ? 262 GLY A CA   1  
ATOM 990    C C    . GLY A 1 107 ? -7.489  -0.790  0.706   1.00 10.00 ? 262 GLY A C    1  
ATOM 991    O O    . GLY A 1 107 ? -8.097  -0.473  -0.318  1.00 10.00 ? 262 GLY A O    1  
ATOM 992    H H    . GLY A 1 107 ? -7.164  -0.848  3.919   1.00 10.00 ? 262 GLY A H    1  
ATOM 993    N N    . GLN A 1 108 ? -6.584  -1.769  0.734   1.00 10.00 ? 263 GLN A N    1  
ATOM 994    C CA   . GLN A 1 108 ? -6.234  -2.535  -0.461  1.00 10.00 ? 263 GLN A CA   1  
ATOM 995    C C    . GLN A 1 108 ? -7.435  -3.327  -0.962  1.00 10.00 ? 263 GLN A C    1  
ATOM 996    O O    . GLN A 1 108 ? -7.718  -3.351  -2.160  1.00 10.00 ? 263 GLN A O    1  
ATOM 997    C CB   . GLN A 1 108 ? -5.064  -3.482  -0.170  1.00 10.00 ? 263 GLN A CB   1  
ATOM 998    C CG   . GLN A 1 108 ? -4.831  -4.549  -1.233  1.00 10.00 ? 263 GLN A CG   1  
ATOM 999    C CD   . GLN A 1 108 ? -4.380  -3.973  -2.564  1.00 10.00 ? 263 GLN A CD   1  
ATOM 1000   O OE1  . GLN A 1 108 ? -4.768  -4.457  -3.628  1.00 10.00 ? 263 GLN A OE1  1  
ATOM 1001   N NE2  . GLN A 1 108 ? -3.539  -2.950  -2.518  1.00 10.00 ? 263 GLN A NE2  1  
ATOM 1002   H H    . GLN A 1 108 ? -6.144  -1.990  1.584   1.00 10.00 ? 263 GLN A H    1  
ATOM 1003   H HE21 . GLN A 1 108 ? -3.254  -2.622  -1.636  1.00 10.00 ? 263 GLN A HE21 1  
ATOM 1004   H HE22 . GLN A 1 108 ? -3.236  -2.563  -3.362  1.00 10.00 ? 263 GLN A HE22 1  
ATOM 1005   N N    . PHE A 1 109 ? -8.140  -3.964  -0.032  1.00 10.00 ? 264 PHE A N    1  
ATOM 1006   C CA   . PHE A 1 109 ? -9.313  -4.767  -0.369  1.00 10.00 ? 264 PHE A CA   1  
ATOM 1007   C C    . PHE A 1 109 ? -10.363 -3.935  -1.094  1.00 10.00 ? 264 PHE A C    1  
ATOM 1008   O O    . PHE A 1 109 ? -10.968 -4.392  -2.065  1.00 10.00 ? 264 PHE A O    1  
ATOM 1009   C CB   . PHE A 1 109 ? -9.906  -5.420  0.883   1.00 10.00 ? 264 PHE A CB   1  
ATOM 1010   C CG   . PHE A 1 109 ? -9.066  -6.540  1.428   1.00 10.00 ? 264 PHE A CG   1  
ATOM 1011   C CD1  . PHE A 1 109 ? -9.047  -7.778  0.802   1.00 10.00 ? 264 PHE A CD1  1  
ATOM 1012   C CD2  . PHE A 1 109 ? -8.291  -6.358  2.564   1.00 10.00 ? 264 PHE A CD2  1  
ATOM 1013   C CE1  . PHE A 1 109 ? -8.276  -8.813  1.298   1.00 10.00 ? 264 PHE A CE1  1  
ATOM 1014   C CE2  . PHE A 1 109 ? -7.517  -7.389  3.065   1.00 10.00 ? 264 PHE A CE2  1  
ATOM 1015   C CZ   . PHE A 1 109 ? -7.509  -8.619  2.432   1.00 10.00 ? 264 PHE A CZ   1  
ATOM 1016   H H    . PHE A 1 109 ? -7.866  -3.885  0.909   1.00 10.00 ? 264 PHE A H    1  
ATOM 1017   N N    . ILE A 1 110 ? -10.565 -2.707  -0.627  1.00 10.00 ? 265 ILE A N    1  
ATOM 1018   C CA   . ILE A 1 110 ? -11.534 -1.810  -1.244  1.00 10.00 ? 265 ILE A CA   1  
ATOM 1019   C C    . ILE A 1 110 ? -11.067 -1.409  -2.643  1.00 10.00 ? 265 ILE A C    1  
ATOM 1020   O O    . ILE A 1 110 ? -11.825 -1.500  -3.610  1.00 10.00 ? 265 ILE A O    1  
ATOM 1021   C CB   . ILE A 1 110 ? -11.749 -0.529  -0.404  1.00 10.00 ? 265 ILE A CB   1  
ATOM 1022   C CG1  . ILE A 1 110 ? -12.096 -0.889  1.045   1.00 10.00 ? 265 ILE A CG1  1  
ATOM 1023   C CG2  . ILE A 1 110 ? -12.849 0.332   -1.014  1.00 10.00 ? 265 ILE A CG2  1  
ATOM 1024   C CD1  . ILE A 1 110 ? -12.107 0.294   1.991   1.00 10.00 ? 265 ILE A CD1  1  
ATOM 1025   H H    . ILE A 1 110 ? -10.053 -2.399  0.153   1.00 10.00 ? 265 ILE A H    1  
ATOM 1026   N N    . ALA A 1 111 ? -9.805  -1.000  -2.735  1.00 10.00 ? 266 ALA A N    1  
ATOM 1027   C CA   . ALA A 1 111 ? -9.213  -0.569  -3.998  1.00 10.00 ? 266 ALA A CA   1  
ATOM 1028   C C    . ALA A 1 111 ? -9.284  -1.660  -5.066  1.00 10.00 ? 266 ALA A C    1  
ATOM 1029   O O    . ALA A 1 111 ? -9.642  -1.392  -6.215  1.00 10.00 ? 266 ALA A O    1  
ATOM 1030   C CB   . ALA A 1 111 ? -7.768  -0.140  -3.783  1.00 10.00 ? 266 ALA A CB   1  
ATOM 1031   H H    . ALA A 1 111 ? -9.253  -0.986  -1.923  1.00 10.00 ? 266 ALA A H    1  
ATOM 1032   N N    . ARG A 1 112 ? -8.949  -2.888  -4.681  1.00 10.00 ? 267 ARG A N    1  
ATOM 1033   C CA   . ARG A 1 112 ? -8.962  -4.016  -5.607  1.00 10.00 ? 267 ARG A CA   1  
ATOM 1034   C C    . ARG A 1 112 ? -10.373 -4.305  -6.101  1.00 10.00 ? 267 ARG A C    1  
ATOM 1035   O O    . ARG A 1 112 ? -10.589 -4.535  -7.295  1.00 10.00 ? 267 ARG A O    1  
ATOM 1036   C CB   . ARG A 1 112 ? -8.368  -5.263  -4.946  1.00 10.00 ? 267 ARG A CB   1  
ATOM 1037   C CG   . ARG A 1 112 ? -7.560  -6.146  -5.885  1.00 10.00 ? 267 ARG A CG   1  
ATOM 1038   C CD   . ARG A 1 112 ? -6.277  -5.453  -6.319  1.00 10.00 ? 267 ARG A CD   1  
ATOM 1039   N NE   . ARG A 1 112 ? -5.361  -6.362  -7.007  1.00 10.00 ? 267 ARG A NE   1  
ATOM 1040   C CZ   . ARG A 1 112 ? -4.284  -6.903  -6.436  1.00 10.00 ? 267 ARG A CZ   1  
ATOM 1041   N NH1  . ARG A 1 112 ? -3.970  -6.594  -5.183  1.00 10.00 ? 267 ARG A NH1  1  
ATOM 1042   N NH2  . ARG A 1 112 ? -3.515  -7.743  -7.120  1.00 10.00 ? 267 ARG A NH2  1  
ATOM 1043   H H    . ARG A 1 112 ? -8.683  -3.038  -3.745  1.00 10.00 ? 267 ARG A H    1  
ATOM 1044   H HE   . ARG A 1 112 ? -5.571  -6.589  -7.942  1.00 10.00 ? 267 ARG A HE   1  
ATOM 1045   H HH11 . ARG A 1 112 ? -4.535  -5.946  -4.664  1.00 10.00 ? 267 ARG A HH11 1  
ATOM 1046   H HH12 . ARG A 1 112 ? -3.171  -7.028  -4.734  1.00 10.00 ? 267 ARG A HH12 1  
ATOM 1047   H HH21 . ARG A 1 112 ? -3.736  -7.973  -8.068  1.00 10.00 ? 267 ARG A HH21 1  
ATOM 1048   H HH22 . ARG A 1 112 ? -2.702  -8.157  -6.682  1.00 10.00 ? 267 ARG A HH22 1  
ATOM 1049   N N    . ALA A 1 113 ? -11.329 -4.297  -5.174  1.00 10.00 ? 268 ALA A N    1  
ATOM 1050   C CA   . ALA A 1 113 ? -12.727 -4.556  -5.499  1.00 10.00 ? 268 ALA A CA   1  
ATOM 1051   C C    . ALA A 1 113 ? -13.251 -3.589  -6.554  1.00 10.00 ? 268 ALA A C    1  
ATOM 1052   O O    . ALA A 1 113 ? -13.916 -3.999  -7.511  1.00 10.00 ? 268 ALA A O    1  
ATOM 1053   C CB   . ALA A 1 113 ? -13.585 -4.498  -4.245  1.00 10.00 ? 268 ALA A CB   1  
ATOM 1054   H H    . ALA A 1 113 ? -11.077 -4.131  -4.238  1.00 10.00 ? 268 ALA A H    1  
ATOM 1055   N N    . VAL A 1 114 ? -12.942 -2.310  -6.382  1.00 10.00 ? 269 VAL A N    1  
ATOM 1056   C CA   . VAL A 1 114 ? -13.375 -1.285  -7.324  1.00 10.00 ? 269 VAL A CA   1  
ATOM 1057   C C    . VAL A 1 114 ? -12.624 -1.428  -8.642  1.00 10.00 ? 269 VAL A C    1  
ATOM 1058   O O    . VAL A 1 114 ? -13.221 -1.380  -9.717  1.00 10.00 ? 269 VAL A O    1  
ATOM 1059   C CB   . VAL A 1 114 ? -13.161 0.139   -6.756  1.00 10.00 ? 269 VAL A CB   1  
ATOM 1060   C CG1  . VAL A 1 114 ? -13.589 1.196   -7.765  1.00 10.00 ? 269 VAL A CG1  1  
ATOM 1061   C CG2  . VAL A 1 114 ? -13.917 0.318   -5.449  1.00 10.00 ? 269 VAL A CG2  1  
ATOM 1062   H H    . VAL A 1 114 ? -12.405 -2.048  -5.600  1.00 10.00 ? 269 VAL A H    1  
ATOM 1063   N N    . GLY A 1 115 ? -11.307 -1.616  -8.541  1.00 10.00 ? 270 GLY A N    1  
ATOM 1064   C CA   . GLY A 1 115 ? -10.471 -1.763  -9.717  1.00 10.00 ? 270 GLY A CA   1  
ATOM 1065   C C    . GLY A 1 115 ? -10.934 -2.865  -10.656 1.00 10.00 ? 270 GLY A C    1  
ATOM 1066   O O    . GLY A 1 115 ? -10.950 -2.675  -11.870 1.00 10.00 ? 270 GLY A O    1  
ATOM 1067   H H    . GLY A 1 115 ? -10.907 -1.613  -7.643  1.00 10.00 ? 270 GLY A H    1  
ATOM 1068   N N    . ASP A 1 116 ? -11.270 -4.031  -10.106 1.00 10.00 ? 271 ASP A N    1  
ATOM 1069   C CA   . ASP A 1 116 ? -11.744 -5.144  -10.929 1.00 10.00 ? 271 ASP A CA   1  
ATOM 1070   C C    . ASP A 1 116 ? -13.206 -4.986  -11.345 1.00 10.00 ? 271 ASP A C    1  
ATOM 1071   O O    . ASP A 1 116 ? -13.597 -5.435  -12.426 1.00 10.00 ? 271 ASP A O    1  
ATOM 1072   C CB   . ASP A 1 116 ? -11.467 -6.503  -10.291 1.00 10.00 ? 271 ASP A CB   1  
ATOM 1073   C CG   . ASP A 1 116 ? -10.131 -7.075  -10.727 1.00 10.00 ? 271 ASP A CG   1  
ATOM 1074   O OD1  . ASP A 1 116 ? -9.626  -6.678  -11.806 1.00 10.00 ? 271 ASP A OD1  1  
ATOM 1075   O OD2  . ASP A 1 116 ? -9.574  -7.921  -10.001 1.00 10.00 ? 271 ASP A OD2  1  
ATOM 1076   H H    . ASP A 1 116 ? -11.101 -4.179  -9.147  1.00 10.00 ? 271 ASP A H    1  
ATOM 1077   N N    . GLY A 1 117 ? -14.013 -4.358  -10.498 1.00 10.00 ? 272 GLY A N    1  
ATOM 1078   C CA   . GLY A 1 117 ? -15.408 -4.140  -10.844 1.00 10.00 ? 272 GLY A CA   1  
ATOM 1079   C C    . GLY A 1 117 ? -16.410 -4.938  -10.023 1.00 10.00 ? 272 GLY A C    1  
ATOM 1080   O O    . GLY A 1 117 ? -17.494 -5.257  -10.512 1.00 10.00 ? 272 GLY A O    1  
ATOM 1081   H H    . GLY A 1 117 ? -13.657 -4.028  -9.640  1.00 10.00 ? 272 GLY A H    1  
ATOM 1082   N N    . ILE A 1 118 ? -16.067 -5.261  -8.782  1.00 10.00 ? 273 ILE A N    1  
ATOM 1083   C CA   . ILE A 1 118 ? -16.982 -6.005  -7.913  1.00 10.00 ? 273 ILE A CA   1  
ATOM 1084   C C    . ILE A 1 118 ? -17.578 -5.085  -6.851  1.00 10.00 ? 273 ILE A C    1  
ATOM 1085   O O    . ILE A 1 118 ? -18.418 -5.491  -6.050  1.00 10.00 ? 273 ILE A O    1  
ATOM 1086   C CB   . ILE A 1 118 ? -16.334 -7.243  -7.257  1.00 10.00 ? 273 ILE A CB   1  
ATOM 1087   C CG1  . ILE A 1 118 ? -14.878 -6.968  -6.875  1.00 10.00 ? 273 ILE A CG1  1  
ATOM 1088   C CG2  . ILE A 1 118 ? -16.433 -8.444  -8.187  1.00 10.00 ? 273 ILE A CG2  1  
ATOM 1089   C CD1  . ILE A 1 118 ? -14.223 -8.084  -6.093  1.00 10.00 ? 273 ILE A CD1  1  
ATOM 1090   H H    . ILE A 1 118 ? -15.186 -4.993  -8.438  1.00 10.00 ? 273 ILE A H    1  
ATOM 1091   N N    . LEU A 1 119 ? -17.130 -3.838  -6.863  1.00 10.00 ? 274 LEU A N    1  
ATOM 1092   C CA   . LEU A 1 119 ? -17.613 -2.835  -5.931  1.00 10.00 ? 274 LEU A CA   1  
ATOM 1093   C C    . LEU A 1 119 ? -17.775 -1.508  -6.660  1.00 10.00 ? 274 LEU A C    1  
ATOM 1094   O O    . LEU A 1 119 ? -17.024 -1.214  -7.591  1.00 10.00 ? 274 LEU A O    1  
ATOM 1095   C CB   . LEU A 1 119 ? -16.642 -2.683  -4.758  1.00 10.00 ? 274 LEU A CB   1  
ATOM 1096   C CG   . LEU A 1 119 ? -17.033 -1.676  -3.675  1.00 10.00 ? 274 LEU A CG   1  
ATOM 1097   C CD1  . LEU A 1 119 ? -18.294 -2.122  -2.951  1.00 10.00 ? 274 LEU A CD1  1  
ATOM 1098   C CD2  . LEU A 1 119 ? -15.890 -1.476  -2.695  1.00 10.00 ? 274 LEU A CD2  1  
ATOM 1099   H H    . LEU A 1 119 ? -16.444 -3.590  -7.517  1.00 10.00 ? 274 LEU A H    1  
ATOM 1100   N N    . CYS A 1 120 ? -18.764 -0.729  -6.252  1.00 10.00 ? 275 CYS A N    1  
ATOM 1101   C CA   . CYS A 1 120 ? -19.026 0.564   -6.867  1.00 10.00 ? 275 CYS A CA   1  
ATOM 1102   C C    . CYS A 1 120 ? -17.862 1.525   -6.643  1.00 10.00 ? 275 CYS A C    1  
ATOM 1103   O O    . CYS A 1 120 ? -17.254 1.546   -5.571  1.00 10.00 ? 275 CYS A O    1  
ATOM 1104   C CB   . CYS A 1 120 ? -20.325 1.160   -6.318  1.00 10.00 ? 275 CYS A CB   1  
ATOM 1105   S SG   . CYS A 1 120 ? -20.832 2.701   -7.114  1.00 10.00 ? 275 CYS A SG   1  
ATOM 1106   H H    . CYS A 1 120 ? -19.336 -1.032  -5.520  1.00 10.00 ? 275 CYS A H    1  
ATOM 1107   H HG   . CYS A 1 120 ? -21.734 3.282   -6.337  1.00 10.00 ? 275 CYS A HG   1  
ATOM 1108   N N    . ASN A 1 121 ? -17.557 2.318   -7.661  1.00 10.00 ? 276 ASN A N    1  
ATOM 1109   C CA   . ASN A 1 121 ? -16.468 3.286   -7.593  1.00 10.00 ? 276 ASN A CA   1  
ATOM 1110   C C    . ASN A 1 121 ? -16.803 4.441   -6.655  1.00 10.00 ? 276 ASN A C    1  
ATOM 1111   O O    . ASN A 1 121 ? -15.969 4.869   -5.857  1.00 10.00 ? 276 ASN A O    1  
ATOM 1112   C CB   . ASN A 1 121 ? -16.105 3.818   -8.987  1.00 10.00 ? 276 ASN A CB   1  
ATOM 1113   C CG   . ASN A 1 121 ? -17.267 4.483   -9.707  1.00 10.00 ? 276 ASN A CG   1  
ATOM 1114   O OD1  . ASN A 1 121 ? -18.385 3.964   -9.725  1.00 10.00 ? 276 ASN A OD1  1  
ATOM 1115   N ND2  . ASN A 1 121 ? -17.015 5.636   -10.298 1.00 10.00 ? 276 ASN A ND2  1  
ATOM 1116   H H    . ASN A 1 121 ? -18.086 2.258   -8.485  1.00 10.00 ? 276 ASN A H    1  
ATOM 1117   H HD21 . ASN A 1 121 ? -16.102 5.999   -10.241 1.00 10.00 ? 276 ASN A HD21 1  
ATOM 1118   H HD22 . ASN A 1 121 ? -17.746 6.085   -10.769 1.00 10.00 ? 276 ASN A HD22 1  
ATOM 1119   N N    . THR A 1 122 ? -18.030 4.941   -6.748  1.00 10.00 ? 277 THR A N    1  
ATOM 1120   C CA   . THR A 1 122 ? -18.486 6.046   -5.914  1.00 10.00 ? 277 THR A CA   1  
ATOM 1121   C C    . THR A 1 122 ? -18.675 5.643   -4.446  1.00 10.00 ? 277 THR A C    1  
ATOM 1122   O O    . THR A 1 122 ? -19.194 6.423   -3.645  1.00 10.00 ? 277 THR A O    1  
ATOM 1123   C CB   . THR A 1 122 ? -19.808 6.602   -6.474  1.00 10.00 ? 277 THR A CB   1  
ATOM 1124   O OG1  . THR A 1 122 ? -20.121 5.902   -7.691  1.00 10.00 ? 277 THR A OG1  1  
ATOM 1125   C CG2  . THR A 1 122 ? -19.676 8.089   -6.774  1.00 10.00 ? 277 THR A CG2  1  
ATOM 1126   H H    . THR A 1 122 ? -18.647 4.606   -7.434  1.00 10.00 ? 277 THR A H    1  
ATOM 1127   H HG1  . THR A 1 122 ? -21.039 6.069   -7.934  1.00 10.00 ? 277 THR A HG1  1  
ATOM 1128   N N    . TYR A 1 123 ? -18.255 4.434   -4.093  1.00 10.00 ? 278 TYR A N    1  
ATOM 1129   C CA   . TYR A 1 123 ? -18.371 3.959   -2.720  1.00 10.00 ? 278 TYR A CA   1  
ATOM 1130   C C    . TYR A 1 123 ? -17.567 4.857   -1.785  1.00 10.00 ? 278 TYR A C    1  
ATOM 1131   O O    . TYR A 1 123 ? -18.014 5.195   -0.688  1.00 10.00 ? 278 TYR A O    1  
ATOM 1132   C CB   . TYR A 1 123 ? -17.901 2.508   -2.601  1.00 10.00 ? 278 TYR A CB   1  
ATOM 1133   C CG   . TYR A 1 123 ? -18.052 1.930   -1.211  1.00 10.00 ? 278 TYR A CG   1  
ATOM 1134   C CD1  . TYR A 1 123 ? -19.305 1.615   -0.701  1.00 10.00 ? 278 TYR A CD1  1  
ATOM 1135   C CD2  . TYR A 1 123 ? -16.943 1.707   -0.406  1.00 10.00 ? 278 TYR A CD2  1  
ATOM 1136   C CE1  . TYR A 1 123 ? -19.446 1.095   0.573   1.00 10.00 ? 278 TYR A CE1  1  
ATOM 1137   C CE2  . TYR A 1 123 ? -17.076 1.187   0.867   1.00 10.00 ? 278 TYR A CE2  1  
ATOM 1138   C CZ   . TYR A 1 123 ? -18.330 0.883   1.351   1.00 10.00 ? 278 TYR A CZ   1  
ATOM 1139   O OH   . TYR A 1 123 ? -18.465 0.367   2.617   1.00 10.00 ? 278 TYR A OH   1  
ATOM 1140   H H    . TYR A 1 123 ? -17.865 3.843   -4.772  1.00 10.00 ? 278 TYR A H    1  
ATOM 1141   H HH   . TYR A 1 123 ? -19.404 0.208   2.805   1.00 10.00 ? 278 TYR A HH   1  
ATOM 1142   N N    . ILE A 1 124 ? -16.389 5.264   -2.244  1.00 10.00 ? 279 ILE A N    1  
ATOM 1143   C CA   . ILE A 1 124 ? -15.519 6.128   -1.457  1.00 10.00 ? 279 ILE A CA   1  
ATOM 1144   C C    . ILE A 1 124 ? -16.128 7.521   -1.340  1.00 10.00 ? 279 ILE A C    1  
ATOM 1145   O O    . ILE A 1 124 ? -16.090 8.136   -0.277  1.00 10.00 ? 279 ILE A O    1  
ATOM 1146   C CB   . ILE A 1 124 ? -14.105 6.239   -2.070  1.00 10.00 ? 279 ILE A CB   1  
ATOM 1147   C CG1  . ILE A 1 124 ? -13.525 4.848   -2.354  1.00 10.00 ? 279 ILE A CG1  1  
ATOM 1148   C CG2  . ILE A 1 124 ? -13.178 7.027   -1.152  1.00 10.00 ? 279 ILE A CG2  1  
ATOM 1149   C CD1  . ILE A 1 124 ? -13.393 3.967   -1.128  1.00 10.00 ? 279 ILE A CD1  1  
ATOM 1150   H H    . ILE A 1 124 ? -16.100 4.975   -3.136  1.00 10.00 ? 279 ILE A H    1  
ATOM 1151   N N    . ASP A 1 125 ? -16.709 7.999   -2.436  1.00 10.00 ? 280 ASP A N    1  
ATOM 1152   C CA   . ASP A 1 125 ? -17.338 9.320   -2.464  1.00 10.00 ? 280 ASP A CA   1  
ATOM 1153   C C    . ASP A 1 125 ? -18.510 9.367   -1.488  1.00 10.00 ? 280 ASP A C    1  
ATOM 1154   O O    . ASP A 1 125 ? -18.731 10.365  -0.803  1.00 10.00 ? 280 ASP A O    1  
ATOM 1155   C CB   . ASP A 1 125 ? -17.819 9.657   -3.879  1.00 10.00 ? 280 ASP A CB   1  
ATOM 1156   C CG   . ASP A 1 125 ? -17.775 11.145  -4.185  1.00 10.00 ? 280 ASP A CG   1  
ATOM 1157   O OD1  . ASP A 1 125 ? -17.657 11.953  -3.244  1.00 10.00 ? 280 ASP A OD1  1  
ATOM 1158   O OD2  . ASP A 1 125 ? -17.851 11.510  -5.377  1.00 10.00 ? 280 ASP A OD2  1  
ATOM 1159   H H    . ASP A 1 125 ? -16.716 7.450   -3.248  1.00 10.00 ? 280 ASP A H    1  
ATOM 1160   N N    . SER A 1 126 ? -19.252 8.268   -1.425  1.00 10.00 ? 281 SER A N    1  
ATOM 1161   C CA   . SER A 1 126 ? -20.389 8.150   -0.523  1.00 10.00 ? 281 SER A CA   1  
ATOM 1162   C C    . SER A 1 126 ? -19.932 8.208   0.938   1.00 10.00 ? 281 SER A C    1  
ATOM 1163   O O    . SER A 1 126 ? -20.686 8.613   1.827   1.00 10.00 ? 281 SER A O    1  
ATOM 1164   C CB   . SER A 1 126 ? -21.149 6.859   -0.815  1.00 10.00 ? 281 SER A CB   1  
ATOM 1165   O OG   . SER A 1 126 ? -21.515 6.798   -2.187  1.00 10.00 ? 281 SER A OG   1  
ATOM 1166   H H    . SER A 1 126 ? -19.044 7.522   -2.024  1.00 10.00 ? 281 SER A H    1  
ATOM 1167   H HG   . SER A 1 126 ? -20.764 6.479   -2.706  1.00 10.00 ? 281 SER A HG   1  
ATOM 1168   N N    . TYR A 1 127 ? -18.698 7.811   1.183   1.00 10.00 ? 282 TYR A N    1  
ATOM 1169   C CA   . TYR A 1 127 ? -18.151 7.845   2.523   1.00 10.00 ? 282 TYR A CA   1  
ATOM 1170   C C    . TYR A 1 127 ? -17.148 9.006   2.648   1.00 10.00 ? 282 TYR A C    1  
ATOM 1171   O O    . TYR A 1 127 ? -16.347 9.042   3.584   1.00 10.00 ? 282 TYR A O    1  
ATOM 1172   C CB   . TYR A 1 127 ? -17.493 6.491   2.859   1.00 10.00 ? 282 TYR A CB   1  
ATOM 1173   C CG   . TYR A 1 127 ? -18.473 5.408   3.292   1.00 10.00 ? 282 TYR A CG   1  
ATOM 1174   C CD1  . TYR A 1 127 ? -19.172 4.643   2.362   1.00 10.00 ? 282 TYR A CD1  1  
ATOM 1175   C CD2  . TYR A 1 127 ? -18.717 5.171   4.640   1.00 10.00 ? 282 TYR A CD2  1  
ATOM 1176   C CE1  . TYR A 1 127 ? -20.082 3.676   2.767   1.00 10.00 ? 282 TYR A CE1  1  
ATOM 1177   C CE2  . TYR A 1 127 ? -19.628 4.214   5.052   1.00 10.00 ? 282 TYR A CE2  1  
ATOM 1178   C CZ   . TYR A 1 127 ? -20.309 3.470   4.115   1.00 10.00 ? 282 TYR A CZ   1  
ATOM 1179   O OH   . TYR A 1 127 ? -21.241 2.540   4.528   1.00 10.00 ? 282 TYR A OH   1  
ATOM 1180   H H    . TYR A 1 127 ? -18.137 7.501   0.443   1.00 10.00 ? 282 TYR A H    1  
ATOM 1181   H HH   . TYR A 1 127 ? -20.993 1.660   4.198   1.00 10.00 ? 282 TYR A HH   1  
ATOM 1182   N N    . LYS A 1 128 ? -17.257 9.983   1.726   1.00 10.00 ? 283 LYS A N    1  
ATOM 1183   C CA   . LYS A 1 128 ? -16.343 11.156  1.650   1.00 10.00 ? 283 LYS A CA   1  
ATOM 1184   C C    . LYS A 1 128 ? -16.399 12.188  2.786   1.00 10.00 ? 283 LYS A C    1  
ATOM 1185   O O    . LYS A 1 128 ? -16.605 13.397  2.539   1.00 10.00 ? 283 LYS A O    1  
ATOM 1186   C CB   . LYS A 1 128 ? -16.322 11.831  0.289   1.00 10.00 ? 283 LYS A CB   1  
ATOM 1187   C CG   . LYS A 1 128 ? -15.127 12.761  0.126   1.00 10.00 ? 283 LYS A CG   1  
ATOM 1188   C CD   . LYS A 1 128 ? -15.185 13.588  -1.144  1.00 10.00 ? 283 LYS A CD   1  
ATOM 1189   C CE   . LYS A 1 128 ? -16.348 14.559  -1.122  1.00 10.00 ? 283 LYS A CE   1  
ATOM 1190   N NZ   . LYS A 1 128 ? -17.636 13.890  -1.466  1.00 10.00 ? 283 LYS A NZ   1  
ATOM 1191   H H    . LYS A 1 128 ? -17.987 9.916   1.045   1.00 10.00 ? 283 LYS A H    1  
ATOM 1192   H HZ1  . LYS A 1 128 ? -18.115 13.540  -0.609  1.00 10.00 ? 283 LYS A HZ1  1  
ATOM 1193   H HZ2  . LYS A 1 128 ? -17.469 13.082  -2.113  1.00 10.00 ? 283 LYS A HZ2  1  
ATOM 1194   H HZ3  . LYS A 1 128 ? -18.257 14.563  -1.938  1.00 10.00 ? 283 LYS A HZ3  1  
ATOM 1195   N N    . GLY A 1 129 ? -16.383 11.720  4.027   1.00 10.00 ? 284 GLY A N    1  
ATOM 1196   C CA   . GLY A 1 129 ? -16.407 12.659  5.132   1.00 10.00 ? 284 GLY A CA   1  
ATOM 1197   C C    . GLY A 1 129 ? -17.581 12.364  5.990   1.00 10.00 ? 284 GLY A C    1  
ATOM 1198   O O    . GLY A 1 129 ? -17.748 12.887  7.088   1.00 10.00 ? 284 GLY A O    1  
ATOM 1199   H H    . GLY A 1 129 ? -16.368 10.726  4.197   1.00 10.00 ? 284 GLY A H    1  
ATOM 1200   N N    . THR A 1 130 ? -18.373 11.467  5.465   1.00 10.00 ? 285 THR A N    1  
ATOM 1201   C CA   . THR A 1 130 ? -19.561 10.988  6.108   1.00 10.00 ? 285 THR A CA   1  
ATOM 1202   C C    . THR A 1 130 ? -19.208 9.814   7.013   1.00 10.00 ? 285 THR A C    1  
ATOM 1203   O O    . THR A 1 130 ? -19.970 8.858   7.135   1.00 10.00 ? 285 THR A O    1  
ATOM 1204   C CB   . THR A 1 130 ? -20.547 10.520  5.028   1.00 10.00 ? 285 THR A CB   1  
ATOM 1205   O OG1  . THR A 1 130 ? -19.842 10.396  3.781   1.00 10.00 ? 285 THR A OG1  1  
ATOM 1206   C CG2  . THR A 1 130 ? -21.647 11.545  4.863   1.00 10.00 ? 285 THR A CG2  1  
ATOM 1207   H H    . THR A 1 130 ? -18.148 11.111  4.583   1.00 10.00 ? 285 THR A H    1  
ATOM 1208   H HG1  . THR A 1 130 ? -20.349 9.829   3.178   1.00 10.00 ? 285 THR A HG1  1  
ATOM 1209   N N    . VAL A 1 131 ? -18.039 9.904   7.644   1.00 10.00 ? 286 VAL A N    1  
ATOM 1210   C CA   . VAL A 1 131 ? -17.556 8.872   8.553   1.00 10.00 ? 286 VAL A CA   1  
ATOM 1211   C C    . VAL A 1 131 ? -16.981 9.522   9.808   1.00 10.00 ? 286 VAL A C    1  
ATOM 1212   O O    . VAL A 1 131 ? -16.131 10.408  9.722   1.00 10.00 ? 286 VAL A O    1  
ATOM 1213   C CB   . VAL A 1 131 ? -16.460 7.990   7.909   1.00 10.00 ? 286 VAL A CB   1  
ATOM 1214   C CG1  . VAL A 1 131 ? -16.119 6.815   8.810   1.00 10.00 ? 286 VAL A CG1  1  
ATOM 1215   C CG2  . VAL A 1 131 ? -16.877 7.499   6.533   1.00 10.00 ? 286 VAL A CG2  1  
ATOM 1216   H H    . VAL A 1 131 ? -17.492 10.705  7.509   1.00 10.00 ? 286 VAL A H    1  
ATOM 1217   N N    . ASP A 1 132 ? -17.448 9.070   10.964  1.00 10.00 ? 287 ASP A N    1  
ATOM 1218   C CA   . ASP A 1 132 ? -17.004 9.602   12.251  1.00 10.00 ? 287 ASP A CA   1  
ATOM 1219   C C    . ASP A 1 132 ? -15.918 8.726   12.873  1.00 10.00 ? 287 ASP A C    1  
ATOM 1220   O O    . ASP A 1 132 ? -15.500 8.945   14.011  1.00 10.00 ? 287 ASP A O    1  
ATOM 1221   C CB   . ASP A 1 132 ? -18.192 9.713   13.211  1.00 10.00 ? 287 ASP A CB   1  
ATOM 1222   C CG   . ASP A 1 132 ? -18.798 8.363   13.549  1.00 10.00 ? 287 ASP A CG   1  
ATOM 1223   O OD1  . ASP A 1 132 ? -19.105 7.592   12.614  1.00 10.00 ? 287 ASP A OD1  1  
ATOM 1224   O OD2  . ASP A 1 132 ? -18.976 8.060   14.748  1.00 10.00 ? 287 ASP A OD2  1  
ATOM 1225   H H    . ASP A 1 132 ? -18.122 8.355   10.958  1.00 10.00 ? 287 ASP A H    1  
ATOM 1226   N N    . CYS A 1 133 ? -15.469 7.729   12.127  1.00 10.00 ? 288 CYS A N    1  
ATOM 1227   C CA   . CYS A 1 133 ? -14.431 6.822   12.599  1.00 10.00 ? 288 CYS A CA   1  
ATOM 1228   C C    . CYS A 1 133 ? -13.139 7.059   11.826  1.00 10.00 ? 288 CYS A C    1  
ATOM 1229   O O    . CYS A 1 133 ? -13.130 6.998   10.597  1.00 10.00 ? 288 CYS A O    1  
ATOM 1230   C CB   . CYS A 1 133 ? -14.887 5.367   12.438  1.00 10.00 ? 288 CYS A CB   1  
ATOM 1231   S SG   . CYS A 1 133 ? -13.680 4.138   12.978  1.00 10.00 ? 288 CYS A SG   1  
ATOM 1232   H H    . CYS A 1 133 ? -15.842 7.603   11.231  1.00 10.00 ? 288 CYS A H    1  
ATOM 1233   H HG   . CYS A 1 133 ? -13.405 4.373   14.256  1.00 10.00 ? 288 CYS A HG   1  
ATOM 1234   N N    . VAL A 1 134 ? -12.044 7.323   12.538  1.00 10.00 ? 289 VAL A N    1  
ATOM 1235   C CA   . VAL A 1 134 ? -10.763 7.580   11.890  1.00 10.00 ? 289 VAL A CA   1  
ATOM 1236   C C    . VAL A 1 134 ? -10.146 6.285   11.355  1.00 10.00 ? 289 VAL A C    1  
ATOM 1237   O O    . VAL A 1 134 ? -9.424  6.292   10.355  1.00 10.00 ? 289 VAL A O    1  
ATOM 1238   C CB   . VAL A 1 134 ? -9.774  8.323   12.822  1.00 10.00 ? 289 VAL A CB   1  
ATOM 1239   C CG1  . VAL A 1 134 ? -9.226  7.411   13.913  1.00 10.00 ? 289 VAL A CG1  1  
ATOM 1240   C CG2  . VAL A 1 134 ? -8.644  8.965   12.028  1.00 10.00 ? 289 VAL A CG2  1  
ATOM 1241   H H    . VAL A 1 134 ? -12.085 7.325   13.520  1.00 10.00 ? 289 VAL A H    1  
ATOM 1242   N N    . GLN A 1 135 ? -10.480 5.173   12.004  1.00 10.00 ? 290 GLN A N    1  
ATOM 1243   C CA   . GLN A 1 135 ? -9.972  3.869   11.600  1.00 10.00 ? 290 GLN A CA   1  
ATOM 1244   C C    . GLN A 1 135 ? -10.570 3.495   10.253  1.00 10.00 ? 290 GLN A C    1  
ATOM 1245   O O    . GLN A 1 135 ? -9.878  3.006   9.359   1.00 10.00 ? 290 GLN A O    1  
ATOM 1246   C CB   . GLN A 1 135 ? -10.315 2.803   12.646  1.00 10.00 ? 290 GLN A CB   1  
ATOM 1247   C CG   . GLN A 1 135 ? -9.499  2.894   13.928  1.00 10.00 ? 290 GLN A CG   1  
ATOM 1248   C CD   . GLN A 1 135 ? -8.014  2.666   13.707  1.00 10.00 ? 290 GLN A CD   1  
ATOM 1249   O OE1  . GLN A 1 135 ? -7.607  1.993   12.762  1.00 10.00 ? 290 GLN A OE1  1  
ATOM 1250   N NE2  . GLN A 1 135 ? -7.196  3.207   14.594  1.00 10.00 ? 290 GLN A NE2  1  
ATOM 1251   H H    . GLN A 1 135 ? -11.115 5.241   12.746  1.00 10.00 ? 290 GLN A H    1  
ATOM 1252   H HE21 . GLN A 1 135 ? -7.587  3.716   15.336  1.00 10.00 ? 290 GLN A HE21 1  
ATOM 1253   H HE22 . GLN A 1 135 ? -6.234  3.080   14.470  1.00 10.00 ? 290 GLN A HE22 1  
ATOM 1254   N N    . ALA A 1 136 ? -11.868 3.754   10.110  1.00 10.00 ? 291 ALA A N    1  
ATOM 1255   C CA   . ALA A 1 136 ? -12.573 3.471   8.870   1.00 10.00 ? 291 ALA A CA   1  
ATOM 1256   C C    . ALA A 1 136 ? -12.157 4.460   7.789   1.00 10.00 ? 291 ALA A C    1  
ATOM 1257   O O    . ALA A 1 136 ? -12.114 4.118   6.606   1.00 10.00 ? 291 ALA A O    1  
ATOM 1258   C CB   . ALA A 1 136 ? -14.077 3.534   9.087   1.00 10.00 ? 291 ALA A CB   1  
ATOM 1259   H H    . ALA A 1 136 ? -12.365 4.135   10.864  1.00 10.00 ? 291 ALA A H    1  
ATOM 1260   N N    . ARG A 1 137 ? -11.847 5.686   8.201   1.00 10.00 ? 292 ARG A N    1  
ATOM 1261   C CA   . ARG A 1 137 ? -11.435 6.717   7.257   1.00 10.00 ? 292 ARG A CA   1  
ATOM 1262   C C    . ARG A 1 137 ? -10.107 6.388   6.593   1.00 10.00 ? 292 ARG A C    1  
ATOM 1263   O O    . ARG A 1 137 ? -9.968  6.558   5.382   1.00 10.00 ? 292 ARG A O    1  
ATOM 1264   C CB   . ARG A 1 137 ? -11.408 8.112   7.883   1.00 10.00 ? 292 ARG A CB   1  
ATOM 1265   C CG   . ARG A 1 137 ? -12.666 8.932   7.626   1.00 10.00 ? 292 ARG A CG   1  
ATOM 1266   C CD   . ARG A 1 137 ? -13.097 8.876   6.161   1.00 10.00 ? 292 ARG A CD   1  
ATOM 1267   N NE   . ARG A 1 137 ? -12.057 9.359   5.251   1.00 10.00 ? 292 ARG A NE   1  
ATOM 1268   C CZ   . ARG A 1 137 ? -12.207 9.484   3.927   1.00 10.00 ? 292 ARG A CZ   1  
ATOM 1269   N NH1  . ARG A 1 137 ? -13.357 9.159   3.339   1.00 10.00 ? 292 ARG A NH1  1  
ATOM 1270   N NH2  . ARG A 1 137 ? -11.201 9.932   3.188   1.00 10.00 ? 292 ARG A NH2  1  
ATOM 1271   H H    . ARG A 1 137 ? -11.905 5.901   9.157   1.00 10.00 ? 292 ARG A H    1  
ATOM 1272   H HE   . ARG A 1 137 ? -11.191 9.604   5.652   1.00 10.00 ? 292 ARG A HE   1  
ATOM 1273   H HH11 . ARG A 1 137 ? -14.124 8.812   3.881   1.00 10.00 ? 292 ARG A HH11 1  
ATOM 1274   H HH12 . ARG A 1 137 ? -13.459 9.260   2.347   1.00 10.00 ? 292 ARG A HH12 1  
ATOM 1275   H HH21 . ARG A 1 137 ? -10.325 10.174  3.618   1.00 10.00 ? 292 ARG A HH21 1  
ATOM 1276   H HH22 . ARG A 1 137 ? -11.307 10.037  2.194   1.00 10.00 ? 292 ARG A HH22 1  
ATOM 1277   N N    . ALA A 1 138 ? -9.121  5.942   7.375   1.00 10.00 ? 293 ALA A N    1  
ATOM 1278   C CA   . ALA A 1 138 ? -7.818  5.580   6.827   1.00 10.00 ? 293 ALA A CA   1  
ATOM 1279   C C    . ALA A 1 138 ? -7.940  4.506   5.752   1.00 10.00 ? 293 ALA A C    1  
ATOM 1280   O O    . ALA A 1 138 ? -7.213  4.527   4.760   1.00 10.00 ? 293 ALA A O    1  
ATOM 1281   C CB   . ALA A 1 138 ? -6.889  5.119   7.939   1.00 10.00 ? 293 ALA A CB   1  
ATOM 1282   H H    . ALA A 1 138 ? -9.224  5.901   8.352   1.00 10.00 ? 293 ALA A H    1  
ATOM 1283   N N    . ALA A 1 139 ? -8.859  3.568   5.956   1.00 10.00 ? 294 ALA A N    1  
ATOM 1284   C CA   . ALA A 1 139 ? -9.085  2.503   4.988   1.00 10.00 ? 294 ALA A CA   1  
ATOM 1285   C C    . ALA A 1 139 ? -9.576  3.090   3.667   1.00 10.00 ? 294 ALA A C    1  
ATOM 1286   O O    . ALA A 1 139 ? -9.225  2.615   2.587   1.00 10.00 ? 294 ALA A O    1  
ATOM 1287   C CB   . ALA A 1 139 ? -10.098 1.508   5.530   1.00 10.00 ? 294 ALA A CB   1  
ATOM 1288   H H    . ALA A 1 139 ? -9.392  3.589   6.782   1.00 10.00 ? 294 ALA A H    1  
ATOM 1289   N N    . LEU A 1 140 ? -10.378 4.142   3.772   1.00 10.00 ? 295 LEU A N    1  
ATOM 1290   C CA   . LEU A 1 140 ? -10.923 4.818   2.605   1.00 10.00 ? 295 LEU A CA   1  
ATOM 1291   C C    . LEU A 1 140 ? -9.843  5.642   1.911   1.00 10.00 ? 295 LEU A C    1  
ATOM 1292   O O    . LEU A 1 140 ? -9.873  5.823   0.693   1.00 10.00 ? 295 LEU A O    1  
ATOM 1293   C CB   . LEU A 1 140 ? -12.099 5.709   3.009   1.00 10.00 ? 295 LEU A CB   1  
ATOM 1294   C CG   . LEU A 1 140 ? -13.278 4.994   3.675   1.00 10.00 ? 295 LEU A CG   1  
ATOM 1295   C CD1  . LEU A 1 140 ? -14.261 5.997   4.251   1.00 10.00 ? 295 LEU A CD1  1  
ATOM 1296   C CD2  . LEU A 1 140 ? -13.971 4.065   2.689   1.00 10.00 ? 295 LEU A CD2  1  
ATOM 1297   H H    . LEU A 1 140 ? -10.612 4.476   4.664   1.00 10.00 ? 295 LEU A H    1  
ATOM 1298   N N    . ASP A 1 141 ? -8.892  6.143   2.700   1.00 10.00 ? 296 ASP A N    1  
ATOM 1299   C CA   . ASP A 1 141 ? -7.794  6.945   2.163   1.00 10.00 ? 296 ASP A CA   1  
ATOM 1300   C C    . ASP A 1 141 ? -6.905  6.075   1.291   1.00 10.00 ? 296 ASP A C    1  
ATOM 1301   O O    . ASP A 1 141 ? -6.716  6.356   0.104   1.00 10.00 ? 296 ASP A O    1  
ATOM 1302   C CB   . ASP A 1 141 ? -6.971  7.556   3.305   1.00 10.00 ? 296 ASP A CB   1  
ATOM 1303   C CG   . ASP A 1 141 ? -5.942  8.569   2.824   1.00 10.00 ? 296 ASP A CG   1  
ATOM 1304   O OD1  . ASP A 1 141 ? -6.347  9.677   2.408   1.00 10.00 ? 296 ASP A OD1  1  
ATOM 1305   O OD2  . ASP A 1 141 ? -4.728  8.272   2.877   1.00 10.00 ? 296 ASP A OD2  1  
ATOM 1306   H H    . ASP A 1 141 ? -8.929  5.961   3.662   1.00 10.00 ? 296 ASP A H    1  
ATOM 1307   N N    . LYS A 1 142 ? -6.364  5.011   1.890   1.00 10.00 ? 297 LYS A N    1  
ATOM 1308   C CA   . LYS A 1 142 ? -5.511  4.058   1.177   1.00 10.00 ? 297 LYS A CA   1  
ATOM 1309   C C    . LYS A 1 142 ? -6.147  3.523   -0.104  1.00 10.00 ? 297 LYS A C    1  
ATOM 1310   O O    . LYS A 1 142 ? -5.436  3.176   -1.044  1.00 10.00 ? 297 LYS A O    1  
ATOM 1311   C CB   . LYS A 1 142 ? -5.062  2.907   2.086   1.00 10.00 ? 297 LYS A CB   1  
ATOM 1312   C CG   . LYS A 1 142 ? -3.803  3.195   2.901   1.00 10.00 ? 297 LYS A CG   1  
ATOM 1313   C CD   . LYS A 1 142 ? -4.058  4.250   3.968   1.00 10.00 ? 297 LYS A CD   1  
ATOM 1314   C CE   . LYS A 1 142 ? -2.950  4.291   5.012   1.00 10.00 ? 297 LYS A CE   1  
ATOM 1315   N NZ   . LYS A 1 142 ? -1.729  4.987   4.530   1.00 10.00 ? 297 LYS A NZ   1  
ATOM 1316   H H    . LYS A 1 142 ? -6.436  4.914   2.864   1.00 10.00 ? 297 LYS A H    1  
ATOM 1317   H HZ1  . LYS A 1 142 ? -1.984  5.857   4.012   1.00 10.00 ? 297 LYS A HZ1  1  
ATOM 1318   H HZ2  . LYS A 1 142 ? -1.184  4.362   3.889   1.00 10.00 ? 297 LYS A HZ2  1  
ATOM 1319   H HZ3  . LYS A 1 142 ? -1.119  5.248   5.340   1.00 10.00 ? 297 LYS A HZ3  1  
ATOM 1320   N N    . ALA A 1 143 ? -7.476  3.419   -0.123  1.00 10.00 ? 298 ALA A N    1  
ATOM 1321   C CA   . ALA A 1 143 ? -8.188  2.929   -1.302  1.00 10.00 ? 298 ALA A CA   1  
ATOM 1322   C C    . ALA A 1 143 ? -7.778  3.704   -2.558  1.00 10.00 ? 298 ALA A C    1  
ATOM 1323   O O    . ALA A 1 143 ? -7.455  3.107   -3.582  1.00 10.00 ? 298 ALA A O    1  
ATOM 1324   C CB   . ALA A 1 143 ? -9.694  2.990   -1.087  1.00 10.00 ? 298 ALA A CB   1  
ATOM 1325   H H    . ALA A 1 143 ? -7.988  3.676   0.672   1.00 10.00 ? 298 ALA A H    1  
ATOM 1326   N N    . THR A 1 144 ? -7.768  5.033   -2.473  1.00 10.00 ? 299 THR A N    1  
ATOM 1327   C CA   . THR A 1 144 ? -7.369  5.860   -3.605  1.00 10.00 ? 299 THR A CA   1  
ATOM 1328   C C    . THR A 1 144 ? -5.854  5.807   -3.748  1.00 10.00 ? 299 THR A C    1  
ATOM 1329   O O    . THR A 1 144 ? -5.316  5.717   -4.856  1.00 10.00 ? 299 THR A O    1  
ATOM 1330   C CB   . THR A 1 144 ? -7.811  7.324   -3.412  1.00 10.00 ? 299 THR A CB   1  
ATOM 1331   O OG1  . THR A 1 144 ? -9.179  7.361   -2.984  1.00 10.00 ? 299 THR A OG1  1  
ATOM 1332   C CG2  . THR A 1 144 ? -7.672  8.104   -4.711  1.00 10.00 ? 299 THR A CG2  1  
ATOM 1333   H H    . THR A 1 144 ? -8.028  5.463   -1.633  1.00 10.00 ? 299 THR A H    1  
ATOM 1334   H HG1  . THR A 1 144 ? -9.224  7.725   -2.096  1.00 10.00 ? 299 THR A HG1  1  
ATOM 1335   N N    . VAL A 1 145 ? -5.194  5.894   -2.599  1.00 10.00 ? 300 VAL A N    1  
ATOM 1336   C CA   . VAL A 1 145 ? -3.735  5.820   -2.528  1.00 10.00 ? 300 VAL A CA   1  
ATOM 1337   C C    . VAL A 1 145 ? -3.222  4.644   -3.368  1.00 10.00 ? 300 VAL A C    1  
ATOM 1338   O O    . VAL A 1 145 ? -2.350  4.814   -4.226  1.00 10.00 ? 300 VAL A O    1  
ATOM 1339   C CB   . VAL A 1 145 ? -3.267  5.638   -1.064  1.00 10.00 ? 300 VAL A CB   1  
ATOM 1340   C CG1  . VAL A 1 145 ? -1.771  5.369   -0.983  1.00 10.00 ? 300 VAL A CG1  1  
ATOM 1341   C CG2  . VAL A 1 145 ? -3.635  6.851   -0.226  1.00 10.00 ? 300 VAL A CG2  1  
ATOM 1342   H H    . VAL A 1 145 ? -5.722  6.169   -1.819  1.00 10.00 ? 300 VAL A H    1  
ATOM 1343   N N    . LEU A 1 146 ? -3.777  3.463   -3.135  1.00 10.00 ? 301 LEU A N    1  
ATOM 1344   C CA   . LEU A 1 146 ? -3.389  2.271   -3.867  1.00 10.00 ? 301 LEU A CA   1  
ATOM 1345   C C    . LEU A 1 146 ? -3.999  2.200   -5.275  1.00 10.00 ? 301 LEU A C    1  
ATOM 1346   O O    . LEU A 1 146 ? -3.359  1.703   -6.203  1.00 10.00 ? 301 LEU A O    1  
ATOM 1347   C CB   . LEU A 1 146 ? -3.700  1.020   -3.045  1.00 10.00 ? 301 LEU A CB   1  
ATOM 1348   C CG   . LEU A 1 146 ? -3.137  1.025   -1.617  1.00 10.00 ? 301 LEU A CG   1  
ATOM 1349   C CD1  . LEU A 1 146 ? -3.717  -0.110  -0.793  1.00 10.00 ? 301 LEU A CD1  1  
ATOM 1350   C CD2  . LEU A 1 146 ? -1.617  0.968   -1.630  1.00 10.00 ? 301 LEU A CD2  1  
ATOM 1351   H H    . LEU A 1 146 ? -4.465  3.386   -2.431  1.00 10.00 ? 301 LEU A H    1  
ATOM 1352   N N    . LEU A 1 147 ? -5.225  2.698   -5.440  1.00 10.00 ? 302 LEU A N    1  
ATOM 1353   C CA   . LEU A 1 147 ? -5.887  2.679   -6.751  1.00 10.00 ? 302 LEU A CA   1  
ATOM 1354   C C    . LEU A 1 147 ? -5.091  3.478   -7.777  1.00 10.00 ? 302 LEU A C    1  
ATOM 1355   O O    . LEU A 1 147 ? -5.031  3.120   -8.952  1.00 10.00 ? 302 LEU A O    1  
ATOM 1356   C CB   . LEU A 1 147 ? -7.314  3.229   -6.662  1.00 10.00 ? 302 LEU A CB   1  
ATOM 1357   C CG   . LEU A 1 147 ? -8.448  2.202   -6.607  1.00 10.00 ? 302 LEU A CG   1  
ATOM 1358   C CD1  . LEU A 1 147 ? -9.745  2.879   -6.201  1.00 10.00 ? 302 LEU A CD1  1  
ATOM 1359   C CD2  . LEU A 1 147 ? -8.614  1.499   -7.949  1.00 10.00 ? 302 LEU A CD2  1  
ATOM 1360   H H    . LEU A 1 147 ? -5.696  3.087   -4.667  1.00 10.00 ? 302 LEU A H    1  
ATOM 1361   N N    . SER A 1 148 ? -4.472  4.553   -7.322  1.00 10.00 ? 303 SER A N    1  
ATOM 1362   C CA   . SER A 1 148 ? -3.668  5.412   -8.174  1.00 10.00 ? 303 SER A CA   1  
ATOM 1363   C C    . SER A 1 148 ? -2.369  4.718   -8.614  1.00 10.00 ? 303 SER A C    1  
ATOM 1364   O O    . SER A 1 148 ? -1.708  5.147   -9.569  1.00 10.00 ? 303 SER A O    1  
ATOM 1365   C CB   . SER A 1 148 ? -3.353  6.713   -7.421  1.00 10.00 ? 303 SER A CB   1  
ATOM 1366   O OG   . SER A 1 148 ? -2.783  7.687   -8.274  1.00 10.00 ? 303 SER A OG   1  
ATOM 1367   H H    . SER A 1 148 ? -4.578  4.798   -6.373  1.00 10.00 ? 303 SER A H    1  
ATOM 1368   H HG   . SER A 1 148 ? -2.081  7.284   -8.796  1.00 10.00 ? 303 SER A HG   1  
ATOM 1369   N N    . MET A 1 149 ? -2.005  3.653   -7.906  1.00 10.00 ? 304 MET A N    1  
ATOM 1370   C CA   . MET A 1 149 ? -0.770  2.928   -8.177  1.00 10.00 ? 304 MET A CA   1  
ATOM 1371   C C    . MET A 1 149 ? -0.882  1.918   -9.325  1.00 10.00 ? 304 MET A C    1  
ATOM 1372   O O    . MET A 1 149 ? -0.239  2.079   -10.363 1.00 10.00 ? 304 MET A O    1  
ATOM 1373   C CB   . MET A 1 149 ? -0.334  2.217   -6.896  1.00 10.00 ? 304 MET A CB   1  
ATOM 1374   C CG   . MET A 1 149 ? 0.992   1.485   -6.971  1.00 10.00 ? 304 MET A CG   1  
ATOM 1375   S SD   . MET A 1 149 ? 1.426   0.741   -5.387  1.00 10.00 ? 304 MET A SD   1  
ATOM 1376   C CE   . MET A 1 149 ? 1.003   2.084   -4.277  1.00 10.00 ? 304 MET A CE   1  
ATOM 1377   H H    . MET A 1 149 ? -2.596  3.333   -7.183  1.00 10.00 ? 304 MET A H    1  
ATOM 1378   N N    . SER A 1 150 ? -1.714  0.900   -9.158  1.00 10.00 ? 305 SER A N    1  
ATOM 1379   C CA   . SER A 1 150 ? -1.849  -0.151  -10.171 1.00 10.00 ? 305 SER A CA   1  
ATOM 1380   C C    . SER A 1 150 ? -2.812  0.203   -11.306 1.00 10.00 ? 305 SER A C    1  
ATOM 1381   O O    . SER A 1 150 ? -3.133  -0.640  -12.145 1.00 10.00 ? 305 SER A O    1  
ATOM 1382   C CB   . SER A 1 150 ? -2.197  -1.490  -9.522  1.00 10.00 ? 305 SER A CB   1  
ATOM 1383   O OG   . SER A 1 150 ? -1.238  -1.826  -8.527  1.00 10.00 ? 305 SER A OG   1  
ATOM 1384   H H    . SER A 1 150 ? -2.252  0.846   -8.337  1.00 10.00 ? 305 SER A H    1  
ATOM 1385   H HG   . SER A 1 150 ? -0.522  -2.332  -8.926  1.00 10.00 ? 305 SER A HG   1  
ATOM 1386   N N    . LYS A 1 151 ? -3.263  1.454   -11.329 1.00 10.00 ? 306 LYS A N    1  
ATOM 1387   C CA   . LYS A 1 151 ? -4.180  1.926   -12.363 1.00 10.00 ? 306 LYS A CA   1  
ATOM 1388   C C    . LYS A 1 151 ? -3.514  1.883   -13.742 1.00 10.00 ? 306 LYS A C    1  
ATOM 1389   O O    . LYS A 1 151 ? -4.180  1.695   -14.761 1.00 10.00 ? 306 LYS A O    1  
ATOM 1390   C CB   . LYS A 1 151 ? -4.634  3.350   -12.047 1.00 10.00 ? 306 LYS A CB   1  
ATOM 1391   C CG   . LYS A 1 151 ? -5.804  3.841   -12.880 1.00 10.00 ? 306 LYS A CG   1  
ATOM 1392   C CD   . LYS A 1 151 ? -6.114  5.299   -12.585 1.00 10.00 ? 306 LYS A CD   1  
ATOM 1393   C CE   . LYS A 1 151 ? -4.914  6.178   -12.893 1.00 10.00 ? 306 LYS A CE   1  
ATOM 1394   N NZ   . LYS A 1 151 ? -5.227  7.625   -12.782 1.00 10.00 ? 306 LYS A NZ   1  
ATOM 1395   H H    . LYS A 1 151 ? -2.979  2.074   -10.626 1.00 10.00 ? 306 LYS A H    1  
ATOM 1396   H HZ1  . LYS A 1 151 ? -5.965  7.886   -13.464 1.00 10.00 ? 306 LYS A HZ1  1  
ATOM 1397   H HZ2  . LYS A 1 151 ? -4.375  8.189   -12.974 1.00 10.00 ? 306 LYS A HZ2  1  
ATOM 1398   H HZ3  . LYS A 1 151 ? -5.564  7.848   -11.822 1.00 10.00 ? 306 LYS A HZ3  1  
ATOM 1399   N N    . GLY A 1 152 ? -2.200  2.064   -13.763 1.00 10.00 ? 307 GLY A N    1  
ATOM 1400   C CA   . GLY A 1 152 ? -1.465  2.030   -15.012 1.00 10.00 ? 307 GLY A CA   1  
ATOM 1401   C C    . GLY A 1 152 ? -0.849  0.666   -15.253 1.00 10.00 ? 307 GLY A C    1  
ATOM 1402   O O    . GLY A 1 152 ? -0.790  0.187   -16.387 1.00 10.00 ? 307 GLY A O    1  
ATOM 1403   H H    . GLY A 1 152 ? -1.725  2.224   -12.922 1.00 10.00 ? 307 GLY A H    1  
ATOM 1404   N N    . GLY A 1 153 ? -0.404  0.035   -14.174 1.00 10.00 ? 308 GLY A N    1  
ATOM 1405   C CA   . GLY A 1 153 ? 0.200   -1.281  -14.272 1.00 10.00 ? 308 GLY A CA   1  
ATOM 1406   C C    . GLY A 1 153 ? -0.780  -2.370  -13.883 1.00 10.00 ? 308 GLY A C    1  
ATOM 1407   O O    . GLY A 1 153 ? -0.513  -3.168  -12.989 1.00 10.00 ? 308 GLY A O    1  
ATOM 1408   H H    . GLY A 1 153 ? -0.490  0.467   -13.299 1.00 10.00 ? 308 GLY A H    1  
ATOM 1409   N N    . LYS A 1 154 ? -1.921  -2.391  -14.559 1.00 10.00 ? 309 LYS A N    1  
ATOM 1410   C CA   . LYS A 1 154 ? -2.960  -3.374  -14.283 1.00 10.00 ? 309 LYS A CA   1  
ATOM 1411   C C    . LYS A 1 154 ? -2.738  -4.663  -15.074 1.00 10.00 ? 309 LYS A C    1  
ATOM 1412   O O    . LYS A 1 154 ? -3.101  -5.751  -14.625 1.00 10.00 ? 309 LYS A O    1  
ATOM 1413   C CB   . LYS A 1 154 ? -4.340  -2.785  -14.613 1.00 10.00 ? 309 LYS A CB   1  
ATOM 1414   C CG   . LYS A 1 154 ? -5.519  -3.698  -14.296 1.00 10.00 ? 309 LYS A CG   1  
ATOM 1415   C CD   . LYS A 1 154 ? -5.746  -3.820  -12.796 1.00 10.00 ? 309 LYS A CD   1  
ATOM 1416   C CE   . LYS A 1 154 ? -6.677  -4.977  -12.456 1.00 10.00 ? 309 LYS A CE   1  
ATOM 1417   N NZ   . LYS A 1 154 ? -8.083  -4.731  -12.889 1.00 10.00 ? 309 LYS A NZ   1  
ATOM 1418   H H    . LYS A 1 154 ? -2.072  -1.720  -15.257 1.00 10.00 ? 309 LYS A H    1  
ATOM 1419   H HZ1  . LYS A 1 154 ? -8.697  -5.517  -12.568 1.00 10.00 ? 309 LYS A HZ1  1  
ATOM 1420   H HZ2  . LYS A 1 154 ? -8.133  -4.671  -13.925 1.00 10.00 ? 309 LYS A HZ2  1  
ATOM 1421   H HZ3  . LYS A 1 154 ? -8.439  -3.842  -12.485 1.00 10.00 ? 309 LYS A HZ3  1  
ATOM 1422   N N    . ARG A 1 155 ? -2.126  -4.542  -16.248 1.00 10.00 ? 310 ARG A N    1  
ATOM 1423   C CA   . ARG A 1 155 ? -1.889  -5.704  -17.100 1.00 10.00 ? 310 ARG A CA   1  
ATOM 1424   C C    . ARG A 1 155 ? -0.443  -6.190  -17.036 1.00 10.00 ? 310 ARG A C    1  
ATOM 1425   O O    . ARG A 1 155 ? 0.013   -6.902  -17.928 1.00 10.00 ? 310 ARG A O    1  
ATOM 1426   C CB   . ARG A 1 155 ? -2.260  -5.391  -18.553 1.00 10.00 ? 310 ARG A CB   1  
ATOM 1427   C CG   . ARG A 1 155 ? -3.658  -4.831  -18.745 1.00 10.00 ? 310 ARG A CG   1  
ATOM 1428   C CD   . ARG A 1 155 ? -3.986  -4.676  -20.220 1.00 10.00 ? 310 ARG A CD   1  
ATOM 1429   N NE   . ARG A 1 155 ? -4.861  -3.532  -20.466 1.00 10.00 ? 310 ARG A NE   1  
ATOM 1430   C CZ   . ARG A 1 155 ? -4.511  -2.471  -21.196 1.00 10.00 ? 310 ARG A CZ   1  
ATOM 1431   N NH1  . ARG A 1 155 ? -3.321  -2.429  -21.787 1.00 10.00 ? 310 ARG A NH1  1  
ATOM 1432   N NH2  . ARG A 1 155 ? -5.357  -1.457  -21.349 1.00 10.00 ? 310 ARG A NH2  1  
ATOM 1433   H H    . ARG A 1 155 ? -1.827  -3.659  -16.547 1.00 10.00 ? 310 ARG A H    1  
ATOM 1434   H HE   . ARG A 1 155 ? -5.758  -3.555  -20.058 1.00 10.00 ? 310 ARG A HE   1  
ATOM 1435   H HH11 . ARG A 1 155 ? -2.678  -3.193  -21.689 1.00 10.00 ? 310 ARG A HH11 1  
ATOM 1436   H HH12 . ARG A 1 155 ? -3.057  -1.626  -22.330 1.00 10.00 ? 310 ARG A HH12 1  
ATOM 1437   H HH21 . ARG A 1 155 ? -6.261  -1.484  -20.916 1.00 10.00 ? 310 ARG A HH21 1  
ATOM 1438   H HH22 . ARG A 1 155 ? -5.090  -0.659  -21.895 1.00 10.00 ? 310 ARG A HH22 1  
ATOM 1439   N N    . LYS A 1 156 ? 0.278   -5.817  -15.986 1.00 10.00 ? 311 LYS A N    1  
ATOM 1440   C CA   . LYS A 1 156 ? 1.673   -6.229  -15.842 1.00 10.00 ? 311 LYS A CA   1  
ATOM 1441   C C    . LYS A 1 156 ? 1.922   -6.914  -14.507 1.00 10.00 ? 311 LYS A C    1  
ATOM 1442   O O    . LYS A 1 156 ? 3.065   -7.194  -14.145 1.00 10.00 ? 311 LYS A O    1  
ATOM 1443   C CB   . LYS A 1 156 ? 2.618   -5.033  -16.010 1.00 10.00 ? 311 LYS A CB   1  
ATOM 1444   C CG   . LYS A 1 156 ? 2.802   -4.578  -17.450 1.00 10.00 ? 311 LYS A CG   1  
ATOM 1445   C CD   . LYS A 1 156 ? 3.242   -5.727  -18.343 1.00 10.00 ? 311 LYS A CD   1  
ATOM 1446   C CE   . LYS A 1 156 ? 3.437   -5.265  -19.776 1.00 10.00 ? 311 LYS A CE   1  
ATOM 1447   N NZ   . LYS A 1 156 ? 3.560   -6.409  -20.716 1.00 10.00 ? 311 LYS A NZ   1  
ATOM 1448   H H    . LYS A 1 156 ? -0.135  -5.265  -15.291 1.00 10.00 ? 311 LYS A H    1  
ATOM 1449   H HZ1  . LYS A 1 156 ? 4.002   -6.096  -21.601 1.00 10.00 ? 311 LYS A HZ1  1  
ATOM 1450   H HZ2  . LYS A 1 156 ? 2.622   -6.803  -20.928 1.00 10.00 ? 311 LYS A HZ2  1  
ATOM 1451   H HZ3  . LYS A 1 156 ? 4.149   -7.156  -20.297 1.00 10.00 ? 311 LYS A HZ3  1  
ATOM 1452   N N    . ASP A 1 157 ? 0.851   -7.197  -13.786 1.00 10.00 ? 312 ASP A N    1  
ATOM 1453   C CA   . ASP A 1 157 ? 0.961   -7.840  -12.482 1.00 10.00 ? 312 ASP A CA   1  
ATOM 1454   C C    . ASP A 1 157 ? 1.168   -9.344  -12.635 1.00 10.00 ? 312 ASP A C    1  
ATOM 1455   O O    . ASP A 1 157 ? 1.914   -9.965  -11.876 1.00 10.00 ? 312 ASP A O    1  
ATOM 1456   C CB   . ASP A 1 157 ? -0.294  -7.555  -11.652 1.00 10.00 ? 312 ASP A CB   1  
ATOM 1457   C CG   . ASP A 1 157 ? -0.046  -7.569  -10.154 1.00 10.00 ? 312 ASP A CG   1  
ATOM 1458   O OD1  . ASP A 1 157 ? 1.131   -7.624  -9.727  1.00 10.00 ? 312 ASP A OD1  1  
ATOM 1459   O OD2  . ASP A 1 157 ? -1.035  -7.505  -9.390  1.00 10.00 ? 312 ASP A OD2  1  
ATOM 1460   H H    . ASP A 1 157 ? -0.036  -6.978  -14.139 1.00 10.00 ? 312 ASP A H    1  
ATOM 1461   N N    . SER A 1 158 ? 0.519   -9.923  -13.637 1.00 10.00 ? 313 SER A N    1  
ATOM 1462   C CA   . SER A 1 158 ? 0.616   -11.352 -13.889 1.00 10.00 ? 313 SER A CA   1  
ATOM 1463   C C    . SER A 1 158 ? 1.273   -11.640 -15.239 1.00 10.00 ? 313 SER A C    1  
ATOM 1464   O O    . SER A 1 158 ? 0.624   -11.602 -16.284 1.00 10.00 ? 313 SER A O    1  
ATOM 1465   C CB   . SER A 1 158 ? -0.776  -11.979 -13.826 1.00 10.00 ? 313 SER A CB   1  
ATOM 1466   O OG   . SER A 1 158 ? -1.549  -11.379 -12.796 1.00 10.00 ? 313 SER A OG   1  
ATOM 1467   H H    . SER A 1 158 ? -0.043  -9.373  -14.224 1.00 10.00 ? 313 SER A H    1  
ATOM 1468   H HG   . SER A 1 158 ? -0.966  -10.886 -12.206 1.00 10.00 ? 313 SER A HG   1  
ATOM 1469   N N    . VAL A 1 159 ? 2.572   -11.897 -15.209 1.00 10.00 ? 314 VAL A N    1  
ATOM 1470   C CA   . VAL A 1 159 ? 3.322   -12.204 -16.420 1.00 10.00 ? 314 VAL A CA   1  
ATOM 1471   C C    . VAL A 1 159 ? 4.509   -13.122 -16.099 1.00 10.00 ? 314 VAL A C    1  
ATOM 1472   O O    . VAL A 1 159 ? 5.374   -13.370 -16.936 1.00 10.00 ? 314 VAL A O    1  
ATOM 1473   C CB   . VAL A 1 159 ? 3.800   -10.909 -17.125 1.00 10.00 ? 314 VAL A CB   1  
ATOM 1474   C CG1  . VAL A 1 159 ? 4.951   -10.247 -16.377 1.00 10.00 ? 314 VAL A CG1  1  
ATOM 1475   C CG2  . VAL A 1 159 ? 4.150   -11.160 -18.585 1.00 10.00 ? 314 VAL A CG2  1  
ATOM 1476   H H    . VAL A 1 159 ? 3.045   -11.857 -14.354 1.00 10.00 ? 314 VAL A H    1  
ATOM 1477   N N    . TRP A 1 160 ? 4.527   -13.647 -14.881 1.00 10.00 ? 315 TRP A N    1  
ATOM 1478   C CA   . TRP A 1 160 ? 5.607   -14.524 -14.447 1.00 10.00 ? 315 TRP A CA   1  
ATOM 1479   C C    . TRP A 1 160 ? 5.101   -15.951 -14.288 1.00 10.00 ? 315 TRP A C    1  
ATOM 1480   O O    . TRP A 1 160 ? 4.141   -16.196 -13.556 1.00 10.00 ? 315 TRP A O    1  
ATOM 1481   C CB   . TRP A 1 160 ? 6.206   -14.038 -13.121 1.00 10.00 ? 315 TRP A CB   1  
ATOM 1482   C CG   . TRP A 1 160 ? 5.928   -12.597 -12.818 1.00 10.00 ? 315 TRP A CG   1  
ATOM 1483   C CD1  . TRP A 1 160 ? 4.804   -12.083 -12.237 1.00 10.00 ? 315 TRP A CD1  1  
ATOM 1484   C CD2  . TRP A 1 160 ? 6.791   -11.485 -13.077 1.00 10.00 ? 315 TRP A CD2  1  
ATOM 1485   N NE1  . TRP A 1 160 ? 4.907   -10.719 -12.133 1.00 10.00 ? 315 TRP A NE1  1  
ATOM 1486   C CE2  . TRP A 1 160 ? 6.121   -10.327 -12.638 1.00 10.00 ? 315 TRP A CE2  1  
ATOM 1487   C CE3  . TRP A 1 160 ? 8.065   -11.356 -13.643 1.00 10.00 ? 315 TRP A CE3  1  
ATOM 1488   C CZ2  . TRP A 1 160 ? 6.682   -9.057  -12.743 1.00 10.00 ? 315 TRP A CZ2  1  
ATOM 1489   C CZ3  . TRP A 1 160 ? 8.619   -10.095 -13.746 1.00 10.00 ? 315 TRP A CZ3  1  
ATOM 1490   C CH2  . TRP A 1 160 ? 7.929   -8.963  -13.299 1.00 10.00 ? 315 TRP A CH2  1  
ATOM 1491   H H    . TRP A 1 160 ? 3.791   -13.460 -14.263 1.00 10.00 ? 315 TRP A H    1  
ATOM 1492   H HE1  . TRP A 1 160 ? 4.222   -10.123 -11.752 1.00 10.00 ? 315 TRP A HE1  1  
ATOM 1493   N N    . GLY A 1 161 ? 5.746   -16.883 -14.971 1.00 10.00 ? 316 GLY A N    1  
ATOM 1494   C CA   . GLY A 1 161 ? 5.344   -18.273 -14.890 1.00 10.00 ? 316 GLY A CA   1  
ATOM 1495   C C    . GLY A 1 161 ? 6.494   -19.160 -14.467 1.00 10.00 ? 316 GLY A C    1  
ATOM 1496   O O    . GLY A 1 161 ? 7.465   -19.313 -15.206 1.00 10.00 ? 316 GLY A O    1  
ATOM 1497   H H    . GLY A 1 161 ? 6.509   -16.629 -15.537 1.00 10.00 ? 316 GLY A H    1  
ATOM 1498   N N    . SER A 1 162 ? 6.404   -19.716 -13.266 1.00 10.00 ? 317 SER A N    1  
ATOM 1499   C CA   . SER A 1 162 ? 7.451   -20.588 -12.741 1.00 10.00 ? 317 SER A CA   1  
ATOM 1500   C C    . SER A 1 162 ? 6.891   -21.552 -11.697 1.00 10.00 ? 317 SER A C    1  
ATOM 1501   O O    . SER A 1 162 ? 7.634   -22.104 -10.881 1.00 10.00 ? 317 SER A O    1  
ATOM 1502   C CB   . SER A 1 162 ? 8.583   -19.750 -12.131 1.00 10.00 ? 317 SER A CB   1  
ATOM 1503   O OG   . SER A 1 162 ? 9.124   -18.841 -13.080 1.00 10.00 ? 317 SER A OG   1  
ATOM 1504   H H    . SER A 1 162 ? 5.612   -19.537 -12.717 1.00 10.00 ? 317 SER A H    1  
ATOM 1505   H HG   . SER A 1 162 ? 8.707   -18.994 -13.942 1.00 10.00 ? 317 SER A HG   1  
ATOM 1506   N N    . GLY A 1 163 ? 5.581   -21.757 -11.730 1.00 10.00 ? 318 GLY A N    1  
ATOM 1507   C CA   . GLY A 1 163 ? 4.950   -22.648 -10.778 1.00 10.00 ? 318 GLY A CA   1  
ATOM 1508   C C    . GLY A 1 163 ? 4.367   -23.871 -11.450 1.00 10.00 ? 318 GLY A C    1  
ATOM 1509   O O    . GLY A 1 163 ? 5.130   -24.810 -11.738 1.00 10.00 ? 318 GLY A O    1  
ATOM 1510   O OXT  . GLY A 1 163 ? 3.142   -23.901 -11.693 1.00 10.00 ? 318 GLY A OXT  1  
ATOM 1511   H H    . GLY A 1 163 ? 5.038   -21.314 -12.419 1.00 10.00 ? 318 GLY A H    1  
ATOM 1512   N N    . GLY B 2 1   ? 2.852   -26.521 -11.296 1.00 10.00 ? 319 GLY B N    1  
ATOM 1513   C CA   . GLY B 2 1   ? 1.880   -26.654 -10.187 1.00 10.00 ? 319 GLY B CA   1  
ATOM 1514   C C    . GLY B 2 1   ? 2.255   -25.783 -9.009  1.00 10.00 ? 319 GLY B C    1  
ATOM 1515   O O    . GLY B 2 1   ? 3.116   -26.146 -8.205  1.00 10.00 ? 319 GLY B O    1  
ATOM 1516   H H1   . GLY B 2 1   ? 3.769   -26.917 -11.014 1.00 10.00 ? 319 GLY B H1   1  
ATOM 1517   H H2   . GLY B 2 1   ? 2.984   -25.515 -11.537 1.00 10.00 ? 319 GLY B H2   1  
ATOM 1518   H H3   . GLY B 2 1   ? 2.510   -27.025 -12.137 1.00 10.00 ? 319 GLY B H3   1  
ATOM 1519   N N    . GLY B 2 2   ? 1.623   -24.627 -8.912  1.00 10.00 ? 320 GLY B N    1  
ATOM 1520   C CA   . GLY B 2 2   ? 1.905   -23.720 -7.825  1.00 10.00 ? 320 GLY B CA   1  
ATOM 1521   C C    . GLY B 2 2   ? 1.407   -22.323 -8.113  1.00 10.00 ? 320 GLY B C    1  
ATOM 1522   O O    . GLY B 2 2   ? 0.613   -22.118 -9.034  1.00 10.00 ? 320 GLY B O    1  
ATOM 1523   H H    . GLY B 2 2   ? 0.957   -24.379 -9.592  1.00 10.00 ? 320 GLY B H    1  
ATOM 1524   N N    . GLN B 2 3   ? 1.877   -21.360 -7.336  1.00 10.00 ? 321 GLN B N    1  
ATOM 1525   C CA   . GLN B 2 3   ? 1.467   -19.975 -7.506  1.00 10.00 ? 321 GLN B CA   1  
ATOM 1526   C C    . GLN B 2 3   ? 2.515   -19.197 -8.290  1.00 10.00 ? 321 GLN B C    1  
ATOM 1527   O O    . GLN B 2 3   ? 3.641   -19.666 -8.465  1.00 10.00 ? 321 GLN B O    1  
ATOM 1528   C CB   . GLN B 2 3   ? 1.212   -19.323 -6.143  1.00 10.00 ? 321 GLN B CB   1  
ATOM 1529   C CG   . GLN B 2 3   ? 0.259   -20.112 -5.254  1.00 10.00 ? 321 GLN B CG   1  
ATOM 1530   C CD   . GLN B 2 3   ? -1.193  -20.000 -5.686  1.00 10.00 ? 321 GLN B CD   1  
ATOM 1531   O OE1  . GLN B 2 3   ? -1.498  -19.692 -6.837  1.00 10.00 ? 321 GLN B OE1  1  
ATOM 1532   N NE2  . GLN B 2 3   ? -2.102  -20.274 -4.765  1.00 10.00 ? 321 GLN B NE2  1  
ATOM 1533   H H    . GLN B 2 3   ? 2.523   -21.585 -6.632  1.00 10.00 ? 321 GLN B H    1  
ATOM 1534   H HE21 . GLN B 2 3   ? -1.792  -20.531 -3.871  1.00 10.00 ? 321 GLN B HE21 1  
ATOM 1535   H HE22 . GLN B 2 3   ? -3.045  -20.207 -5.015  1.00 10.00 ? 321 GLN B HE22 1  
ATOM 1536   N N    . GLN B 2 4   ? 2.137   -18.020 -8.763  1.00 10.00 ? 322 GLN B N    1  
ATOM 1537   C CA   . GLN B 2 4   ? 3.034   -17.175 -9.539  1.00 10.00 ? 322 GLN B CA   1  
ATOM 1538   C C    . GLN B 2 4   ? 4.116   -16.562 -8.655  1.00 10.00 ? 322 GLN B C    1  
ATOM 1539   O O    . GLN B 2 4   ? 3.873   -16.271 -7.481  1.00 10.00 ? 322 GLN B O    1  
ATOM 1540   C CB   . GLN B 2 4   ? 2.247   -16.061 -10.244 1.00 10.00 ? 322 GLN B CB   1  
ATOM 1541   C CG   . GLN B 2 4   ? 1.190   -16.552 -11.222 1.00 10.00 ? 322 GLN B CG   1  
ATOM 1542   C CD   . GLN B 2 4   ? -0.180  -16.723 -10.588 1.00 10.00 ? 322 GLN B CD   1  
ATOM 1543   O OE1  . GLN B 2 4   ? -0.303  -17.041 -9.404  1.00 10.00 ? 322 GLN B OE1  1  
ATOM 1544   N NE2  . GLN B 2 4   ? -1.222  -16.502 -11.368 1.00 10.00 ? 322 GLN B NE2  1  
ATOM 1545   H H    . GLN B 2 4   ? 1.223   -17.706 -8.587  1.00 10.00 ? 322 GLN B H    1  
ATOM 1546   H HE21 . GLN B 2 4   ? -1.058  -16.239 -12.301 1.00 10.00 ? 322 GLN B HE21 1  
ATOM 1547   H HE22 . GLN B 2 4   ? -2.116  -16.612 -10.985 1.00 10.00 ? 322 GLN B HE22 1  
ATOM 1548   N N    . PRO B 2 5   ? 5.328   -16.376 -9.209  1.00 10.00 ? 323 PRO B N    1  
ATOM 1549   C CA   . PRO B 2 5   ? 6.460   -15.780 -8.482  1.00 10.00 ? 323 PRO B CA   1  
ATOM 1550   C C    . PRO B 2 5   ? 6.126   -14.386 -7.944  1.00 10.00 ? 323 PRO B C    1  
ATOM 1551   O O    . PRO B 2 5   ? 5.288   -13.674 -8.506  1.00 10.00 ? 323 PRO B O    1  
ATOM 1552   C CB   . PRO B 2 5   ? 7.555   -15.682 -9.550  1.00 10.00 ? 323 PRO B CB   1  
ATOM 1553   C CG   . PRO B 2 5   ? 7.193   -16.717 -10.556 1.00 10.00 ? 323 PRO B CG   1  
ATOM 1554   C CD   . PRO B 2 5   ? 5.693   -16.746 -10.587 1.00 10.00 ? 323 PRO B CD   1  
ATOM 1555   N N    . VAL B 2 6   ? 6.784   -14.011 -6.854  1.00 10.00 ? 324 VAL B N    1  
ATOM 1556   C CA   . VAL B 2 6   ? 6.561   -12.717 -6.227  1.00 10.00 ? 324 VAL B CA   1  
ATOM 1557   C C    . VAL B 2 6   ? 7.028   -11.569 -7.116  1.00 10.00 ? 324 VAL B C    1  
ATOM 1558   O O    . VAL B 2 6   ? 8.082   -11.647 -7.752  1.00 10.00 ? 324 VAL B O    1  
ATOM 1559   C CB   . VAL B 2 6   ? 7.261   -12.622 -4.851  1.00 10.00 ? 324 VAL B CB   1  
ATOM 1560   C CG1  . VAL B 2 6   ? 6.496   -13.422 -3.808  1.00 10.00 ? 324 VAL B CG1  1  
ATOM 1561   C CG2  . VAL B 2 6   ? 8.701   -13.109 -4.943  1.00 10.00 ? 324 VAL B CG2  1  
ATOM 1562   H H    . VAL B 2 6   ? 7.440   -14.619 -6.462  1.00 10.00 ? 324 VAL B H    1  
ATOM 1563   N N    . ASN B 2 7   ? 6.229   -10.514 -7.167  1.00 10.00 ? 325 ASN B N    1  
ATOM 1564   C CA   . ASN B 2 7   ? 6.567   -9.344  -7.963  1.00 10.00 ? 325 ASN B CA   1  
ATOM 1565   C C    . ASN B 2 7   ? 7.664   -8.547  -7.257  1.00 10.00 ? 325 ASN B C    1  
ATOM 1566   O O    . ASN B 2 7   ? 7.930   -8.753  -6.069  1.00 10.00 ? 325 ASN B O    1  
ATOM 1567   C CB   . ASN B 2 7   ? 5.327   -8.476  -8.223  1.00 10.00 ? 325 ASN B CB   1  
ATOM 1568   C CG   . ASN B 2 7   ? 5.402   -7.723  -9.544  1.00 10.00 ? 325 ASN B CG   1  
ATOM 1569   O OD1  . ASN B 2 7   ? 6.480   -7.321  -9.984  1.00 10.00 ? 325 ASN B OD1  1  
ATOM 1570   N ND2  . ASN B 2 7   ? 4.258   -7.532  -10.193 1.00 10.00 ? 325 ASN B ND2  1  
ATOM 1571   H H    . ASN B 2 7   ? 5.394   -10.522 -6.661  1.00 10.00 ? 325 ASN B H    1  
ATOM 1572   H HD21 . ASN B 2 7   ? 3.427   -7.879  -9.796  1.00 10.00 ? 325 ASN B HD21 1  
ATOM 1573   H HD22 . ASN B 2 7   ? 4.288   -7.051  -11.047 1.00 10.00 ? 325 ASN B HD22 1  
ATOM 1574   N N    . HIS B 2 8   ? 8.308   -7.654  -7.989  1.00 10.00 ? 326 HIS B N    1  
ATOM 1575   C CA   . HIS B 2 8   ? 9.391   -6.846  -7.446  1.00 10.00 ? 326 HIS B CA   1  
ATOM 1576   C C    . HIS B 2 8   ? 9.438   -5.496  -8.144  1.00 10.00 ? 326 HIS B C    1  
ATOM 1577   O O    . HIS B 2 8   ? 9.114   -5.402  -9.331  1.00 10.00 ? 326 HIS B O    1  
ATOM 1578   C CB   . HIS B 2 8   ? 10.748  -7.567  -7.568  1.00 10.00 ? 326 HIS B CB   1  
ATOM 1579   C CG   . HIS B 2 8   ? 10.905  -8.442  -8.784  1.00 10.00 ? 326 HIS B CG   1  
ATOM 1580   N ND1  . HIS B 2 8   ? 11.762  -8.153  -9.821  1.00 10.00 ? 326 HIS B ND1  1  
ATOM 1581   C CD2  . HIS B 2 8   ? 10.312  -9.615  -9.116  1.00 10.00 ? 326 HIS B CD2  1  
ATOM 1582   C CE1  . HIS B 2 8   ? 11.685  -9.109  -10.734 1.00 10.00 ? 326 HIS B CE1  1  
ATOM 1583   N NE2  . HIS B 2 8   ? 10.812  -10.012 -10.330 1.00 10.00 ? 326 HIS B NE2  1  
ATOM 1584   H H    . HIS B 2 8   ? 8.028   -7.510  -8.923  1.00 10.00 ? 326 HIS B H    1  
ATOM 1585   H HD1  . HIS B 2 8   ? 12.352  -7.368  -9.876  1.00 10.00 ? 326 HIS B HD1  1  
ATOM 1586   H HE2  . HIS B 2 8   ? 10.756  -10.931 -10.681 1.00 10.00 ? 326 HIS B HE2  1  
ATOM 1587   N N    . LEU B 2 9   ? 9.841   -4.461  -7.403  1.00 10.00 ? 327 LEU B N    1  
ATOM 1588   C CA   . LEU B 2 9   ? 9.927   -3.092  -7.922  1.00 10.00 ? 327 LEU B CA   1  
ATOM 1589   C C    . LEU B 2 9   ? 8.534   -2.472  -8.045  1.00 10.00 ? 327 LEU B C    1  
ATOM 1590   O O    . LEU B 2 9   ? 8.230   -1.453  -7.409  1.00 10.00 ? 327 LEU B O    1  
ATOM 1591   C CB   . LEU B 2 9   ? 10.694  -3.001  -9.249  1.00 10.00 ? 327 LEU B CB   1  
ATOM 1592   C CG   . LEU B 2 9   ? 12.136  -3.524  -9.251  1.00 10.00 ? 327 LEU B CG   1  
ATOM 1593   C CD1  . LEU B 2 9   ? 12.721  -3.458  -10.651 1.00 10.00 ? 327 LEU B CD1  1  
ATOM 1594   C CD2  . LEU B 2 9   ? 12.999  -2.734  -8.280  1.00 10.00 ? 327 LEU B CD2  1  
ATOM 1595   H H    . LEU B 2 9   ? 10.088  -4.619  -6.458  1.00 10.00 ? 327 LEU B H    1  
ATOM 1596   N N    . VAL B 2 10  ? 7.692   -3.100  -8.855  1.00 10.00 ? 328 VAL B N    1  
ATOM 1597   C CA   . VAL B 2 10  ? 6.327   -2.638  -9.063  1.00 10.00 ? 328 VAL B CA   1  
ATOM 1598   C C    . VAL B 2 10  ? 5.497   -2.998  -7.838  1.00 10.00 ? 328 VAL B C    1  
ATOM 1599   O O    . VAL B 2 10  ? 5.671   -4.079  -7.272  1.00 10.00 ? 328 VAL B O    1  
ATOM 1600   C CB   . VAL B 2 10  ? 5.691   -3.303  -10.304 1.00 10.00 ? 328 VAL B CB   1  
ATOM 1601   C CG1  . VAL B 2 10  ? 4.562   -2.447  -10.854 1.00 10.00 ? 328 VAL B CG1  1  
ATOM 1602   C CG2  . VAL B 2 10  ? 6.735   -3.578  -11.376 1.00 10.00 ? 328 VAL B CG2  1  
ATOM 1603   H H    . VAL B 2 10  ? 7.997   -3.916  -9.315  1.00 10.00 ? 328 VAL B H    1  
ATOM 1604   N N    . LYS B 2 11  ? 4.609   -2.090  -7.425  1.00 10.00 ? 329 LYS B N    1  
ATOM 1605   C CA   . LYS B 2 11  ? 3.769   -2.303  -6.244  1.00 10.00 ? 329 LYS B CA   1  
ATOM 1606   C C    . LYS B 2 11  ? 4.648   -2.431  -4.997  1.00 10.00 ? 329 LYS B C    1  
ATOM 1607   O O    . LYS B 2 11  ? 4.254   -3.033  -4.000  1.00 10.00 ? 329 LYS B O    1  
ATOM 1608   C CB   . LYS B 2 11  ? 2.863   -3.541  -6.406  1.00 10.00 ? 329 LYS B CB   1  
ATOM 1609   C CG   . LYS B 2 11  ? 1.683   -3.354  -7.357  1.00 10.00 ? 329 LYS B CG   1  
ATOM 1610   C CD   . LYS B 2 11  ? 1.148   -4.696  -7.853  1.00 10.00 ? 329 LYS B CD   1  
ATOM 1611   C CE   . LYS B 2 11  ? 0.505   -5.505  -6.729  1.00 10.00 ? 329 LYS B CE   1  
ATOM 1612   N NZ   . LYS B 2 11  ? 0.151   -6.894  -7.147  1.00 10.00 ? 329 LYS B NZ   1  
ATOM 1613   H H    . LYS B 2 11  ? 4.514   -1.254  -7.931  1.00 10.00 ? 329 LYS B H    1  
ATOM 1614   H HZ1  . LYS B 2 11  ? 1.004   -7.414  -7.434  1.00 10.00 ? 329 LYS B HZ1  1  
ATOM 1615   H HZ2  . LYS B 2 11  ? -0.509  -6.875  -7.961  1.00 10.00 ? 329 LYS B HZ2  1  
ATOM 1616   H HZ3  . LYS B 2 11  ? -0.308  -7.408  -6.364  1.00 10.00 ? 329 LYS B HZ3  1  
ATOM 1617   N N    . GLU B 2 12  ? 5.847   -1.857  -5.076  1.00 10.00 ? 330 GLU B N    1  
ATOM 1618   C CA   . GLU B 2 12  ? 6.806   -1.904  -3.981  1.00 10.00 ? 330 GLU B CA   1  
ATOM 1619   C C    . GLU B 2 12  ? 7.331   -0.502  -3.661  1.00 10.00 ? 330 GLU B C    1  
ATOM 1620   O O    . GLU B 2 12  ? 6.997   0.076   -2.628  1.00 10.00 ? 330 GLU B O    1  
ATOM 1621   C CB   . GLU B 2 12  ? 7.961   -2.844  -4.354  1.00 10.00 ? 330 GLU B CB   1  
ATOM 1622   C CG   . GLU B 2 12  ? 8.957   -3.128  -3.240  1.00 10.00 ? 330 GLU B CG   1  
ATOM 1623   C CD   . GLU B 2 12  ? 9.910   -4.255  -3.594  1.00 10.00 ? 330 GLU B CD   1  
ATOM 1624   O OE1  . GLU B 2 12  ? 10.409  -4.282  -4.741  1.00 10.00 ? 330 GLU B OE1  1  
ATOM 1625   O OE2  . GLU B 2 12  ? 10.170  -5.116  -2.727  1.00 10.00 ? 330 GLU B OE2  1  
ATOM 1626   H H    . GLU B 2 12  ? 6.096   -1.401  -5.904  1.00 10.00 ? 330 GLU B H    1  
ATOM 1627   N N    . ILE B 2 13  ? 8.132   0.052   -4.565  1.00 10.00 ? 331 ILE B N    1  
ATOM 1628   C CA   . ILE B 2 13  ? 8.700   1.385   -4.364  1.00 10.00 ? 331 ILE B CA   1  
ATOM 1629   C C    . ILE B 2 13  ? 7.617   2.464   -4.409  1.00 10.00 ? 331 ILE B C    1  
ATOM 1630   O O    . ILE B 2 13  ? 7.657   3.432   -3.648  1.00 10.00 ? 331 ILE B O    1  
ATOM 1631   C CB   . ILE B 2 13  ? 9.792   1.712   -5.408  1.00 10.00 ? 331 ILE B CB   1  
ATOM 1632   C CG1  . ILE B 2 13  ? 10.725  0.511   -5.609  1.00 10.00 ? 331 ILE B CG1  1  
ATOM 1633   C CG2  . ILE B 2 13  ? 10.590  2.935   -4.974  1.00 10.00 ? 331 ILE B CG2  1  
ATOM 1634   C CD1  . ILE B 2 13  ? 11.714  0.684   -6.742  1.00 10.00 ? 331 ILE B CD1  1  
ATOM 1635   H H    . ILE B 2 13  ? 8.359   -0.450  -5.378  1.00 10.00 ? 331 ILE B H    1  
ATOM 1636   N N    . ASP B 2 14  ? 6.644   2.276   -5.300  1.00 10.00 ? 332 ASP B N    1  
ATOM 1637   C CA   . ASP B 2 14  ? 5.538   3.224   -5.468  1.00 10.00 ? 332 ASP B CA   1  
ATOM 1638   C C    . ASP B 2 14  ? 4.764   3.414   -4.167  1.00 10.00 ? 332 ASP B C    1  
ATOM 1639   O O    . ASP B 2 14  ? 4.407   4.538   -3.810  1.00 10.00 ? 332 ASP B O    1  
ATOM 1640   C CB   . ASP B 2 14  ? 4.588   2.744   -6.573  1.00 10.00 ? 332 ASP B CB   1  
ATOM 1641   C CG   . ASP B 2 14  ? 3.738   3.862   -7.153  1.00 10.00 ? 332 ASP B CG   1  
ATOM 1642   O OD1  . ASP B 2 14  ? 4.183   4.503   -8.128  1.00 10.00 ? 332 ASP B OD1  1  
ATOM 1643   O OD2  . ASP B 2 14  ? 2.621   4.100   -6.650  1.00 10.00 ? 332 ASP B OD2  1  
ATOM 1644   H H    . ASP B 2 14  ? 6.673   1.478   -5.865  1.00 10.00 ? 332 ASP B H    1  
ATOM 1645   N N    . MET B 2 15  ? 4.505   2.304   -3.476  1.00 10.00 ? 333 MET B N    1  
ATOM 1646   C CA   . MET B 2 15  ? 3.779   2.316   -2.200  1.00 10.00 ? 333 MET B CA   1  
ATOM 1647   C C    . MET B 2 15  ? 4.337   3.346   -1.228  1.00 10.00 ? 333 MET B C    1  
ATOM 1648   O O    . MET B 2 15  ? 3.584   4.116   -0.633  1.00 10.00 ? 333 MET B O    1  
ATOM 1649   C CB   . MET B 2 15  ? 3.833   0.932   -1.542  1.00 10.00 ? 333 MET B CB   1  
ATOM 1650   C CG   . MET B 2 15  ? 2.850   -0.083  -2.100  1.00 10.00 ? 333 MET B CG   1  
ATOM 1651   S SD   . MET B 2 15  ? 2.897   -1.652  -1.210  1.00 10.00 ? 333 MET B SD   1  
ATOM 1652   C CE   . MET B 2 15  ? 1.562   -2.532  -2.015  1.00 10.00 ? 333 MET B CE   1  
ATOM 1653   H H    . MET B 2 15  ? 4.730   1.441   -3.872  1.00 10.00 ? 333 MET B H    1  
ATOM 1654   N N    . LEU B 2 16  ? 5.655   3.365   -1.089  1.00 10.00 ? 334 LEU B N    1  
ATOM 1655   C CA   . LEU B 2 16  ? 6.327   4.285   -0.177  1.00 10.00 ? 334 LEU B CA   1  
ATOM 1656   C C    . LEU B 2 16  ? 5.949   5.743   -0.448  1.00 10.00 ? 334 LEU B C    1  
ATOM 1657   O O    . LEU B 2 16  ? 5.647   6.500   0.476   1.00 10.00 ? 334 LEU B O    1  
ATOM 1658   C CB   . LEU B 2 16  ? 7.842   4.103   -0.274  1.00 10.00 ? 334 LEU B CB   1  
ATOM 1659   C CG   . LEU B 2 16  ? 8.369   2.686   -0.025  1.00 10.00 ? 334 LEU B CG   1  
ATOM 1660   C CD1  . LEU B 2 16  ? 9.776   2.537   -0.582  1.00 10.00 ? 334 LEU B CD1  1  
ATOM 1661   C CD2  . LEU B 2 16  ? 8.345   2.361   1.461   1.00 10.00 ? 334 LEU B CD2  1  
ATOM 1662   H H    . LEU B 2 16  ? 6.197   2.741   -1.618  1.00 10.00 ? 334 LEU B H    1  
ATOM 1663   N N    . LEU B 2 17  ? 5.952   6.121   -1.721  1.00 10.00 ? 335 LEU B N    1  
ATOM 1664   C CA   . LEU B 2 17  ? 5.628   7.485   -2.122  1.00 10.00 ? 335 LEU B CA   1  
ATOM 1665   C C    . LEU B 2 17  ? 4.154   7.805   -1.897  1.00 10.00 ? 335 LEU B C    1  
ATOM 1666   O O    . LEU B 2 17  ? 3.813   8.832   -1.310  1.00 10.00 ? 335 LEU B O    1  
ATOM 1667   C CB   . LEU B 2 17  ? 5.974   7.697   -3.599  1.00 10.00 ? 335 LEU B CB   1  
ATOM 1668   C CG   . LEU B 2 17  ? 7.414   7.387   -4.011  1.00 10.00 ? 335 LEU B CG   1  
ATOM 1669   C CD1  . LEU B 2 17  ? 7.532   7.331   -5.525  1.00 10.00 ? 335 LEU B CD1  1  
ATOM 1670   C CD2  . LEU B 2 17  ? 8.370   8.420   -3.432  1.00 10.00 ? 335 LEU B CD2  1  
ATOM 1671   H H    . LEU B 2 17  ? 6.171   5.461   -2.411  1.00 10.00 ? 335 LEU B H    1  
ATOM 1672   N N    . LYS B 2 18  ? 3.286   6.915   -2.366  1.00 10.00 ? 336 LYS B N    1  
ATOM 1673   C CA   . LYS B 2 18  ? 1.842   7.103   -2.243  1.00 10.00 ? 336 LYS B CA   1  
ATOM 1674   C C    . LYS B 2 18  ? 1.392   7.275   -0.790  1.00 10.00 ? 336 LYS B C    1  
ATOM 1675   O O    . LYS B 2 18  ? 0.612   8.182   -0.484  1.00 10.00 ? 336 LYS B O    1  
ATOM 1676   C CB   . LYS B 2 18  ? 1.085   5.949   -2.902  1.00 10.00 ? 336 LYS B CB   1  
ATOM 1677   C CG   . LYS B 2 18  ? 1.233   5.873   -4.415  1.00 10.00 ? 336 LYS B CG   1  
ATOM 1678   C CD   . LYS B 2 18  ? 0.600   7.070   -5.109  1.00 10.00 ? 336 LYS B CD   1  
ATOM 1679   C CE   . LYS B 2 18  ? 0.222   6.739   -6.548  1.00 10.00 ? 336 LYS B CE   1  
ATOM 1680   N NZ   . LYS B 2 18  ? 1.402   6.367   -7.379  1.00 10.00 ? 336 LYS B NZ   1  
ATOM 1681   H H    . LYS B 2 18  ? 3.627   6.108   -2.815  1.00 10.00 ? 336 LYS B H    1  
ATOM 1682   H HZ1  . LYS B 2 18  ? 1.920   5.571   -6.938  1.00 10.00 ? 336 LYS B HZ1  1  
ATOM 1683   H HZ2  . LYS B 2 18  ? 2.049   7.176   -7.469  1.00 10.00 ? 336 LYS B HZ2  1  
ATOM 1684   H HZ3  . LYS B 2 18  ? 1.097   6.076   -8.328  1.00 10.00 ? 336 LYS B HZ3  1  
ATOM 1685   N N    . GLU B 2 19  ? 1.893   6.410   0.090   1.00 10.00 ? 337 GLU B N    1  
ATOM 1686   C CA   . GLU B 2 19  ? 1.546   6.449   1.511   1.00 10.00 ? 337 GLU B CA   1  
ATOM 1687   C C    . GLU B 2 19  ? 1.880   7.802   2.142   1.00 10.00 ? 337 GLU B C    1  
ATOM 1688   O O    . GLU B 2 19  ? 1.099   8.353   2.922   1.00 10.00 ? 337 GLU B O    1  
ATOM 1689   C CB   . GLU B 2 19  ? 2.279   5.332   2.260   1.00 10.00 ? 337 GLU B CB   1  
ATOM 1690   C CG   . GLU B 2 19  ? 1.706   3.941   2.035   1.00 10.00 ? 337 GLU B CG   1  
ATOM 1691   C CD   . GLU B 2 19  ? 0.377   3.746   2.729   1.00 10.00 ? 337 GLU B CD   1  
ATOM 1692   O OE1  . GLU B 2 19  ? -0.663  4.085   2.134   1.00 10.00 ? 337 GLU B OE1  1  
ATOM 1693   O OE2  . GLU B 2 19  ? 0.364   3.268   3.880   1.00 10.00 ? 337 GLU B OE2  1  
ATOM 1694   H H    . GLU B 2 19  ? 2.515   5.716   -0.225  1.00 10.00 ? 337 GLU B H    1  
ATOM 1695   N N    . TYR B 2 20  ? 3.036   8.341   1.793   1.00 10.00 ? 338 TYR B N    1  
ATOM 1696   C CA   . TYR B 2 20  ? 3.467   9.618   2.334   1.00 10.00 ? 338 TYR B CA   1  
ATOM 1697   C C    . TYR B 2 20  ? 2.718   10.785  1.693   1.00 10.00 ? 338 TYR B C    1  
ATOM 1698   O O    . TYR B 2 20  ? 2.491   11.811  2.333   1.00 10.00 ? 338 TYR B O    1  
ATOM 1699   C CB   . TYR B 2 20  ? 4.982   9.795   2.206   1.00 10.00 ? 338 TYR B CB   1  
ATOM 1700   C CG   . TYR B 2 20  ? 5.661   10.104  3.522   1.00 10.00 ? 338 TYR B CG   1  
ATOM 1701   C CD1  . TYR B 2 20  ? 5.916   9.101   4.448   1.00 10.00 ? 338 TYR B CD1  1  
ATOM 1702   C CD2  . TYR B 2 20  ? 6.050   11.400  3.840   1.00 10.00 ? 338 TYR B CD2  1  
ATOM 1703   C CE1  . TYR B 2 20  ? 6.539   9.377   5.651   1.00 10.00 ? 338 TYR B CE1  1  
ATOM 1704   C CE2  . TYR B 2 20  ? 6.672   11.685  5.042   1.00 10.00 ? 338 TYR B CE2  1  
ATOM 1705   C CZ   . TYR B 2 20  ? 6.914   10.670  5.945   1.00 10.00 ? 338 TYR B CZ   1  
ATOM 1706   O OH   . TYR B 2 20  ? 7.538   10.946  7.141   1.00 10.00 ? 338 TYR B OH   1  
ATOM 1707   H H    . TYR B 2 20  ? 3.603   7.879   1.141   1.00 10.00 ? 338 TYR B H    1  
ATOM 1708   H HH   . TYR B 2 20  ? 7.203   11.775  7.494   1.00 10.00 ? 338 TYR B HH   1  
ATOM 1709   N N    . LEU B 2 21  ? 2.338   10.613  0.436   1.00 10.00 ? 339 LEU B N    1  
ATOM 1710   C CA   . LEU B 2 21  ? 1.646   11.661  -0.307  1.00 10.00 ? 339 LEU B CA   1  
ATOM 1711   C C    . LEU B 2 21  ? 0.214   11.931  0.183   1.00 10.00 ? 339 LEU B C    1  
ATOM 1712   O O    . LEU B 2 21  ? -0.067  13.025  0.678   1.00 10.00 ? 339 LEU B O    1  
ATOM 1713   C CB   . LEU B 2 21  ? 1.649   11.343  -1.806  1.00 10.00 ? 339 LEU B CB   1  
ATOM 1714   C CG   . LEU B 2 21  ? 0.862   12.299  -2.704  1.00 10.00 ? 339 LEU B CG   1  
ATOM 1715   C CD1  . LEU B 2 21  ? 1.515   13.675  -2.743  1.00 10.00 ? 339 LEU B CD1  1  
ATOM 1716   C CD2  . LEU B 2 21  ? 0.714   11.725  -4.106  1.00 10.00 ? 339 LEU B CD2  1  
ATOM 1717   H H    . LEU B 2 21  ? 2.537   9.759   -0.009  1.00 10.00 ? 339 LEU B H    1  
ATOM 1718   N N    . LEU B 2 22  ? -0.680  10.958  0.045   1.00 10.00 ? 340 LEU B N    1  
ATOM 1719   C CA   . LEU B 2 22  ? -2.073  11.139  0.463   1.00 10.00 ? 340 LEU B CA   1  
ATOM 1720   C C    . LEU B 2 22  ? -2.226  11.121  1.980   1.00 10.00 ? 340 LEU B C    1  
ATOM 1721   O O    . LEU B 2 22  ? -2.722  12.083  2.577   1.00 10.00 ? 340 LEU B O    1  
ATOM 1722   C CB   . LEU B 2 22  ? -2.968  10.077  -0.180  1.00 10.00 ? 340 LEU B CB   1  
ATOM 1723   C CG   . LEU B 2 22  ? -3.867  10.529  -1.338  1.00 10.00 ? 340 LEU B CG   1  
ATOM 1724   C CD1  . LEU B 2 22  ? -4.879  11.563  -0.866  1.00 10.00 ? 340 LEU B CD1  1  
ATOM 1725   C CD2  . LEU B 2 22  ? -3.040  11.073  -2.491  1.00 10.00 ? 340 LEU B CD2  1  
ATOM 1726   H H    . LEU B 2 22  ? -0.432  10.109  -0.379  1.00 10.00 ? 340 LEU B H    1  
ATOM 1727   N N    . SER B 2 23  ? -1.813  10.027  2.594   1.00 10.00 ? 341 SER B N    1  
ATOM 1728   C CA   . SER B 2 23  ? -1.913  9.884   4.034   1.00 10.00 ? 341 SER B CA   1  
ATOM 1729   C C    . SER B 2 23  ? -0.980  10.850  4.751   1.00 10.00 ? 341 SER B C    1  
ATOM 1730   O O    . SER B 2 23  ? -1.435  11.763  5.445   1.00 10.00 ? 341 SER B O    1  
ATOM 1731   C CB   . SER B 2 23  ? -1.637  8.439   4.447   1.00 10.00 ? 341 SER B CB   1  
ATOM 1732   O OG   . SER B 2 23  ? -2.285  7.537   3.561   1.00 10.00 ? 341 SER B OG   1  
ATOM 1733   H H    . SER B 2 23  ? -1.430  9.292   2.069   1.00 10.00 ? 341 SER B H    1  
ATOM 1734   H HG   . SER B 2 23  ? -3.164  7.890   3.319   1.00 10.00 ? 341 SER B HG   1  
ATOM 1735   N N    . GLY B 2 24  ? 0.322   10.673  4.563   1.00 10.00 ? 342 GLY B N    1  
ATOM 1736   C CA   . GLY B 2 24  ? 1.277   11.549  5.204   1.00 10.00 ? 342 GLY B CA   1  
ATOM 1737   C C    . GLY B 2 24  ? 1.584   11.108  6.618   1.00 10.00 ? 342 GLY B C    1  
ATOM 1738   O O    . GLY B 2 24  ? 1.400   11.867  7.574   1.00 10.00 ? 342 GLY B O    1  
ATOM 1739   H H    . GLY B 2 24  ? 0.640   9.931   3.998   1.00 10.00 ? 342 GLY B H    1  
ATOM 1740   N N    . ASP B 2 25  ? 2.050   9.877   6.754   1.00 10.00 ? 343 ASP B N    1  
ATOM 1741   C CA   . ASP B 2 25  ? 2.375   9.330   8.061   1.00 10.00 ? 343 ASP B CA   1  
ATOM 1742   C C    . ASP B 2 25  ? 3.757   8.698   8.064   1.00 10.00 ? 343 ASP B C    1  
ATOM 1743   O O    . ASP B 2 25  ? 4.119   7.957   7.146   1.00 10.00 ? 343 ASP B O    1  
ATOM 1744   C CB   . ASP B 2 25  ? 1.328   8.317   8.510   1.00 10.00 ? 343 ASP B CB   1  
ATOM 1745   C CG   . ASP B 2 25  ? 1.450   7.979   9.981   1.00 10.00 ? 343 ASP B CG   1  
ATOM 1746   O OD1  . ASP B 2 25  ? 2.278   7.115   10.338  1.00 10.00 ? 343 ASP B OD1  1  
ATOM 1747   O OD2  . ASP B 2 25  ? 0.710   8.579   10.788  1.00 10.00 ? 343 ASP B OD2  1  
ATOM 1748   H H    . ASP B 2 25  ? 2.190   9.325   5.956   1.00 10.00 ? 343 ASP B H    1  
ATOM 1749   N N    . ILE B 2 26  ? 4.521   9.020   9.094   1.00 10.00 ? 344 ILE B N    1  
ATOM 1750   C CA   . ILE B 2 26  ? 5.877   8.505   9.242   1.00 10.00 ? 344 ILE B CA   1  
ATOM 1751   C C    . ILE B 2 26  ? 5.874   7.007   9.518   1.00 10.00 ? 344 ILE B C    1  
ATOM 1752   O O    . ILE B 2 26  ? 6.394   6.226   8.720   1.00 10.00 ? 344 ILE B O    1  
ATOM 1753   C CB   . ILE B 2 26  ? 6.645   9.233   10.365  1.00 10.00 ? 344 ILE B CB   1  
ATOM 1754   C CG1  . ILE B 2 26  ? 6.514   10.750  10.196  1.00 10.00 ? 344 ILE B CG1  1  
ATOM 1755   C CG2  . ILE B 2 26  ? 8.110   8.824   10.352  1.00 10.00 ? 344 ILE B CG2  1  
ATOM 1756   C CD1  . ILE B 2 26  ? 7.138   11.555  11.315  1.00 10.00 ? 344 ILE B CD1  1  
ATOM 1757   H H    . ILE B 2 26  ? 4.151   9.622   9.776   1.00 10.00 ? 344 ILE B H    1  
ATOM 1758   N N    . SER B 2 27  ? 5.274   6.613   10.634  1.00 10.00 ? 345 SER B N    1  
ATOM 1759   C CA   . SER B 2 27  ? 5.205   5.207   11.037  1.00 10.00 ? 345 SER B CA   1  
ATOM 1760   C C    . SER B 2 27  ? 4.669   4.270   9.962   1.00 10.00 ? 345 SER B C    1  
ATOM 1761   O O    . SER B 2 27  ? 5.096   3.115   9.867   1.00 10.00 ? 345 SER B O    1  
ATOM 1762   C CB   . SER B 2 27  ? 4.458   5.046   12.355  1.00 10.00 ? 345 SER B CB   1  
ATOM 1763   O OG   . SER B 2 27  ? 5.224   5.568   13.427  1.00 10.00 ? 345 SER B OG   1  
ATOM 1764   H H    . SER B 2 27  ? 4.885   7.293   11.229  1.00 10.00 ? 345 SER B H    1  
ATOM 1765   H HG   . SER B 2 27  ? 6.131   5.735   13.113  1.00 10.00 ? 345 SER B HG   1  
ATOM 1766   N N    . GLU B 2 28  ? 3.733   4.752   9.144   1.00 10.00 ? 346 GLU B N    1  
ATOM 1767   C CA   . GLU B 2 28  ? 3.180   3.929   8.082   1.00 10.00 ? 346 GLU B CA   1  
ATOM 1768   C C    . GLU B 2 28  ? 4.290   3.548   7.101   1.00 10.00 ? 346 GLU B C    1  
ATOM 1769   O O    . GLU B 2 28  ? 4.409   2.390   6.691   1.00 10.00 ? 346 GLU B O    1  
ATOM 1770   C CB   . GLU B 2 28  ? 2.015   4.627   7.381   1.00 10.00 ? 346 GLU B CB   1  
ATOM 1771   C CG   . GLU B 2 28  ? 0.830   4.894   8.301   1.00 10.00 ? 346 GLU B CG   1  
ATOM 1772   C CD   . GLU B 2 28  ? -0.460  5.151   7.548   1.00 10.00 ? 346 GLU B CD   1  
ATOM 1773   O OE1  . GLU B 2 28  ? -0.481  6.044   6.676   1.00 10.00 ? 346 GLU B OE1  1  
ATOM 1774   O OE2  . GLU B 2 28  ? -1.460  4.461   7.829   1.00 10.00 ? 346 GLU B OE2  1  
ATOM 1775   H H    . GLU B 2 28  ? 3.448   5.689   9.254   1.00 10.00 ? 346 GLU B H    1  
ATOM 1776   N N    . ALA B 2 29  ? 5.124   4.528   6.766   1.00 10.00 ? 347 ALA B N    1  
ATOM 1777   C CA   . ALA B 2 29  ? 6.253   4.309   5.872   1.00 10.00 ? 347 ALA B CA   1  
ATOM 1778   C C    . ALA B 2 29  ? 7.352   3.531   6.594   1.00 10.00 ? 347 ALA B C    1  
ATOM 1779   O O    . ALA B 2 29  ? 8.021   2.682   5.999   1.00 10.00 ? 347 ALA B O    1  
ATOM 1780   C CB   . ALA B 2 29  ? 6.794   5.636   5.363   1.00 10.00 ? 347 ALA B CB   1  
ATOM 1781   H H    . ALA B 2 29  ? 4.979   5.425   7.135   1.00 10.00 ? 347 ALA B H    1  
ATOM 1782   N N    . GLU B 2 30  ? 7.520   3.827   7.887   1.00 10.00 ? 348 GLU B N    1  
ATOM 1783   C CA   . GLU B 2 30  ? 8.536   3.177   8.721   1.00 10.00 ? 348 GLU B CA   1  
ATOM 1784   C C    . GLU B 2 30  ? 8.426   1.659   8.671   1.00 10.00 ? 348 GLU B C    1  
ATOM 1785   O O    . GLU B 2 30  ? 9.389   0.967   8.336   1.00 10.00 ? 348 GLU B O    1  
ATOM 1786   C CB   . GLU B 2 30  ? 8.402   3.614   10.185  1.00 10.00 ? 348 GLU B CB   1  
ATOM 1787   C CG   . GLU B 2 30  ? 8.863   5.027   10.495  1.00 10.00 ? 348 GLU B CG   1  
ATOM 1788   C CD   . GLU B 2 30  ? 8.737   5.353   11.972  1.00 10.00 ? 348 GLU B CD   1  
ATOM 1789   O OE1  . GLU B 2 30  ? 9.568   4.870   12.765  1.00 10.00 ? 348 GLU B OE1  1  
ATOM 1790   O OE2  . GLU B 2 30  ? 7.797   6.083   12.354  1.00 10.00 ? 348 GLU B OE2  1  
ATOM 1791   H H    . GLU B 2 30  ? 6.946   4.521   8.290   1.00 10.00 ? 348 GLU B H    1  
ATOM 1792   N N    . HIS B 2 31  ? 7.244   1.149   8.991   1.00 10.00 ? 349 HIS B N    1  
ATOM 1793   C CA   . HIS B 2 31  ? 7.010   -0.289  9.004   1.00 10.00 ? 349 HIS B CA   1  
ATOM 1794   C C    . HIS B 2 31  ? 7.179   -0.899  7.622   1.00 10.00 ? 349 HIS B C    1  
ATOM 1795   O O    . HIS B 2 31  ? 7.571   -2.053  7.493   1.00 10.00 ? 349 HIS B O    1  
ATOM 1796   C CB   . HIS B 2 31  ? 5.625   -0.625  9.563   1.00 10.00 ? 349 HIS B CB   1  
ATOM 1797   C CG   . HIS B 2 31  ? 5.526   -2.012  10.132  1.00 10.00 ? 349 HIS B CG   1  
ATOM 1798   N ND1  . HIS B 2 31  ? 5.771   -3.155  9.395   1.00 10.00 ? 349 HIS B ND1  1  
ATOM 1799   C CD2  . HIS B 2 31  ? 5.213   -2.436  11.379  1.00 10.00 ? 349 HIS B CD2  1  
ATOM 1800   C CE1  . HIS B 2 31  ? 5.614   -4.214  10.165  1.00 10.00 ? 349 HIS B CE1  1  
ATOM 1801   N NE2  . HIS B 2 31  ? 5.275   -3.808  11.372  1.00 10.00 ? 349 HIS B NE2  1  
ATOM 1802   H H    . HIS B 2 31  ? 6.510   1.760   9.236   1.00 10.00 ? 349 HIS B H    1  
ATOM 1803   H HD1  . HIS B 2 31  ? 6.032   -3.187  8.443   1.00 10.00 ? 349 HIS B HD1  1  
ATOM 1804   H HE2  . HIS B 2 31  ? 5.226   -4.384  12.171  1.00 10.00 ? 349 HIS B HE2  1  
ATOM 1805   N N    . CYS B 2 32  ? 6.889   -0.114  6.599   1.00 10.00 ? 350 CYS B N    1  
ATOM 1806   C CA   . CYS B 2 32  ? 6.992   -0.587  5.226   1.00 10.00 ? 350 CYS B CA   1  
ATOM 1807   C C    . CYS B 2 32  ? 8.450   -0.725  4.777   1.00 10.00 ? 350 CYS B C    1  
ATOM 1808   O O    . CYS B 2 32  ? 8.806   -1.708  4.131   1.00 10.00 ? 350 CYS B O    1  
ATOM 1809   C CB   . CYS B 2 32  ? 6.177   0.281   4.269   1.00 10.00 ? 350 CYS B CB   1  
ATOM 1810   S SG   . CYS B 2 32  ? 4.398   0.239   4.602   1.00 10.00 ? 350 CYS B SG   1  
ATOM 1811   H H    . CYS B 2 32  ? 6.643   0.822   6.766   1.00 10.00 ? 350 CYS B H    1  
ATOM 1812   H HG   . CYS B 2 32  ? 4.079   1.352   5.258   1.00 10.00 ? 350 CYS B HG   1  
ATOM 1813   N N    . LEU B 2 33  ? 9.298   0.236   5.122   1.00 10.00 ? 351 LEU B N    1  
ATOM 1814   C CA   . LEU B 2 33  ? 10.706  0.157   4.743   1.00 10.00 ? 351 LEU B CA   1  
ATOM 1815   C C    . LEU B 2 33  ? 11.388  -0.963  5.521   1.00 10.00 ? 351 LEU B C    1  
ATOM 1816   O O    . LEU B 2 33  ? 12.306  -1.628  5.026   1.00 10.00 ? 351 LEU B O    1  
ATOM 1817   C CB   . LEU B 2 33  ? 11.418  1.492   4.959   1.00 10.00 ? 351 LEU B CB   1  
ATOM 1818   C CG   . LEU B 2 33  ? 12.590  1.786   4.020   1.00 10.00 ? 351 LEU B CG   1  
ATOM 1819   C CD1  . LEU B 2 33  ? 12.162  1.650   2.561   1.00 10.00 ? 351 LEU B CD1  1  
ATOM 1820   C CD2  . LEU B 2 33  ? 13.133  3.176   4.285   1.00 10.00 ? 351 LEU B CD2  1  
ATOM 1821   H H    . LEU B 2 33  ? 8.973   1.013   5.635   1.00 10.00 ? 351 LEU B H    1  
ATOM 1822   N N    . LYS B 2 34  ? 10.905  -1.164  6.734   1.00 10.00 ? 352 LYS B N    1  
ATOM 1823   C CA   . LYS B 2 34  ? 11.398  -2.203  7.628   1.00 10.00 ? 352 LYS B CA   1  
ATOM 1824   C C    . LYS B 2 34  ? 10.989  -3.587  7.138   1.00 10.00 ? 352 LYS B C    1  
ATOM 1825   O O    . LYS B 2 34  ? 11.535  -4.603  7.572   1.00 10.00 ? 352 LYS B O    1  
ATOM 1826   C CB   . LYS B 2 34  ? 10.997  -1.937  9.075   1.00 10.00 ? 352 LYS B CB   1  
ATOM 1827   C CG   . LYS B 2 34  ? 11.692  -0.707  9.637   1.00 10.00 ? 352 LYS B CG   1  
ATOM 1828   C CD   . LYS B 2 34  ? 11.246  -0.356  11.046  1.00 10.00 ? 352 LYS B CD   1  
ATOM 1829   C CE   . LYS B 2 34  ? 11.724  1.047   11.397  1.00 10.00 ? 352 LYS B CE   1  
ATOM 1830   N NZ   . LYS B 2 34  ? 11.518  1.408   12.826  1.00 10.00 ? 352 LYS B NZ   1  
ATOM 1831   H H    . LYS B 2 34  ? 10.167  -0.584  7.049   1.00 10.00 ? 352 LYS B H    1  
ATOM 1832   H HZ1  . LYS B 2 34  ? 10.529  1.256   13.098  1.00 10.00 ? 352 LYS B HZ1  1  
ATOM 1833   H HZ2  . LYS B 2 34  ? 11.753  2.412   12.976  1.00 10.00 ? 352 LYS B HZ2  1  
ATOM 1834   H HZ3  . LYS B 2 34  ? 12.127  0.833   13.437  1.00 10.00 ? 352 LYS B HZ3  1  
ATOM 1835   N N    . GLU B 2 35  ? 10.010  -3.594  6.230   1.00 10.00 ? 353 GLU B N    1  
ATOM 1836   C CA   . GLU B 2 35  ? 9.470   -4.843  5.707   1.00 10.00 ? 353 GLU B CA   1  
ATOM 1837   C C    . GLU B 2 35  ? 10.497  -5.493  4.784   1.00 10.00 ? 353 GLU B C    1  
ATOM 1838   O O    . GLU B 2 35  ? 10.637  -6.715  4.747   1.00 10.00 ? 353 GLU B O    1  
ATOM 1839   C CB   . GLU B 2 35  ? 8.175   -4.584  4.930   1.00 10.00 ? 353 GLU B CB   1  
ATOM 1840   C CG   . GLU B 2 35  ? 7.094   -5.632  5.144   1.00 10.00 ? 353 GLU B CG   1  
ATOM 1841   C CD   . GLU B 2 35  ? 6.379   -5.470  6.472   1.00 10.00 ? 353 GLU B CD   1  
ATOM 1842   O OE1  . GLU B 2 35  ? 5.913   -4.351  6.774   1.00 10.00 ? 353 GLU B OE1  1  
ATOM 1843   O OE2  . GLU B 2 35  ? 6.266   -6.462  7.216   1.00 10.00 ? 353 GLU B OE2  1  
ATOM 1844   H H    . GLU B 2 35  ? 9.831   -2.744  5.772   1.00 10.00 ? 353 GLU B H    1  
ATOM 1845   N N    . LEU B 2 36  ? 11.224  -4.660  4.045   1.00 10.00 ? 354 LEU B N    1  
ATOM 1846   C CA   . LEU B 2 36  ? 12.235  -5.146  3.109   1.00 10.00 ? 354 LEU B CA   1  
ATOM 1847   C C    . LEU B 2 36  ? 13.451  -5.713  3.841   1.00 10.00 ? 354 LEU B C    1  
ATOM 1848   O O    . LEU B 2 36  ? 13.939  -5.124  4.811   1.00 10.00 ? 354 LEU B O    1  
ATOM 1849   C CB   . LEU B 2 36  ? 12.686  -4.037  2.147   1.00 10.00 ? 354 LEU B CB   1  
ATOM 1850   C CG   . LEU B 2 36  ? 11.647  -3.484  1.162   1.00 10.00 ? 354 LEU B CG   1  
ATOM 1851   C CD1  . LEU B 2 36  ? 10.732  -4.581  0.638   1.00 10.00 ? 354 LEU B CD1  1  
ATOM 1852   C CD2  . LEU B 2 36  ? 10.850  -2.349  1.785   1.00 10.00 ? 354 LEU B CD2  1  
ATOM 1853   H H    . LEU B 2 36  ? 11.081  -3.696  4.138   1.00 10.00 ? 354 LEU B H    1  
ATOM 1854   N N    . GLU B 2 37  ? 13.947  -6.848  3.363   1.00 10.00 ? 355 GLU B N    1  
ATOM 1855   C CA   . GLU B 2 37  ? 15.101  -7.497  3.971   1.00 10.00 ? 355 GLU B CA   1  
ATOM 1856   C C    . GLU B 2 37  ? 16.415  -6.873  3.492   1.00 10.00 ? 355 GLU B C    1  
ATOM 1857   O O    . GLU B 2 37  ? 17.431  -6.920  4.190   1.00 10.00 ? 355 GLU B O    1  
ATOM 1858   C CB   . GLU B 2 37  ? 15.081  -8.995  3.662   1.00 10.00 ? 355 GLU B CB   1  
ATOM 1859   C CG   . GLU B 2 37  ? 15.972  -9.827  4.565   1.00 10.00 ? 355 GLU B CG   1  
ATOM 1860   C CD   . GLU B 2 37  ? 15.347  -11.157 4.914   1.00 10.00 ? 355 GLU B CD   1  
ATOM 1861   O OE1  . GLU B 2 37  ? 15.534  -12.120 4.143   1.00 10.00 ? 355 GLU B OE1  1  
ATOM 1862   O OE2  . GLU B 2 37  ? 14.666  -11.239 5.962   1.00 10.00 ? 355 GLU B OE2  1  
ATOM 1863   H H    . GLU B 2 37  ? 13.512  -7.271  2.590   1.00 10.00 ? 355 GLU B H    1  
ATOM 1864   N N    . VAL B 2 38  ? 16.383  -6.287  2.304   1.00 10.00 ? 356 VAL B N    1  
ATOM 1865   C CA   . VAL B 2 38  ? 17.564  -5.657  1.720   1.00 10.00 ? 356 VAL B CA   1  
ATOM 1866   C C    . VAL B 2 38  ? 17.708  -4.195  2.152   1.00 10.00 ? 356 VAL B C    1  
ATOM 1867   O O    . VAL B 2 38  ? 16.930  -3.333  1.738   1.00 10.00 ? 356 VAL B O    1  
ATOM 1868   C CB   . VAL B 2 38  ? 17.557  -5.738  0.175   1.00 10.00 ? 356 VAL B CB   1  
ATOM 1869   C CG1  . VAL B 2 38  ? 18.169  -7.046  -0.295  1.00 10.00 ? 356 VAL B CG1  1  
ATOM 1870   C CG2  . VAL B 2 38  ? 16.143  -5.591  -0.371  1.00 10.00 ? 356 VAL B CG2  1  
ATOM 1871   H H    . VAL B 2 38  ? 15.540  -6.278  1.805   1.00 10.00 ? 356 VAL B H    1  
ATOM 1872   N N    . PRO B 2 39  ? 18.710  -3.896  2.996   1.00 10.00 ? 357 PRO B N    1  
ATOM 1873   C CA   . PRO B 2 39  ? 18.969  -2.540  3.478   1.00 10.00 ? 357 PRO B CA   1  
ATOM 1874   C C    . PRO B 2 39  ? 19.750  -1.737  2.447   1.00 10.00 ? 357 PRO B C    1  
ATOM 1875   O O    . PRO B 2 39  ? 19.641  -0.514  2.377   1.00 10.00 ? 357 PRO B O    1  
ATOM 1876   C CB   . PRO B 2 39  ? 19.833  -2.752  4.734   1.00 10.00 ? 357 PRO B CB   1  
ATOM 1877   C CG   . PRO B 2 39  ? 19.973  -4.233  4.899   1.00 10.00 ? 357 PRO B CG   1  
ATOM 1878   C CD   . PRO B 2 39  ? 19.661  -4.852  3.568   1.00 10.00 ? 357 PRO B CD   1  
ATOM 1879   N N    . HIS B 2 40  ? 20.519  -2.446  1.629   1.00 10.00 ? 358 HIS B N    1  
ATOM 1880   C CA   . HIS B 2 40  ? 21.330  -1.821  0.591   1.00 10.00 ? 358 HIS B CA   1  
ATOM 1881   C C    . HIS B 2 40  ? 20.439  -1.263  -0.513  1.00 10.00 ? 358 HIS B C    1  
ATOM 1882   O O    . HIS B 2 40  ? 20.797  -0.308  -1.203  1.00 10.00 ? 358 HIS B O    1  
ATOM 1883   C CB   . HIS B 2 40  ? 22.309  -2.846  0.015   1.00 10.00 ? 358 HIS B CB   1  
ATOM 1884   C CG   . HIS B 2 40  ? 23.673  -2.299  -0.259  1.00 10.00 ? 358 HIS B CG   1  
ATOM 1885   N ND1  . HIS B 2 40  ? 24.711  -2.375  0.645   1.00 10.00 ? 358 HIS B ND1  1  
ATOM 1886   C CD2  . HIS B 2 40  ? 24.171  -1.669  -1.346  1.00 10.00 ? 358 HIS B CD2  1  
ATOM 1887   C CE1  . HIS B 2 40  ? 25.784  -1.813  0.124   1.00 10.00 ? 358 HIS B CE1  1  
ATOM 1888   N NE2  . HIS B 2 40  ? 25.483  -1.380  -1.081  1.00 10.00 ? 358 HIS B NE2  1  
ATOM 1889   H H    . HIS B 2 40  ? 20.541  -3.423  1.727   1.00 10.00 ? 358 HIS B H    1  
ATOM 1890   H HD1  . HIS B 2 40  ? 24.667  -2.789  1.536   1.00 10.00 ? 358 HIS B HD1  1  
ATOM 1891   H HE2  . HIS B 2 40  ? 26.099  -0.910  -1.688  1.00 10.00 ? 358 HIS B HE2  1  
ATOM 1892   N N    . PHE B 2 41  ? 19.265  -1.857  -0.653  1.00 10.00 ? 359 PHE B N    1  
ATOM 1893   C CA   . PHE B 2 41  ? 18.301  -1.442  -1.659  1.00 10.00 ? 359 PHE B CA   1  
ATOM 1894   C C    . PHE B 2 41  ? 17.529  -0.204  -1.195  1.00 10.00 ? 359 PHE B C    1  
ATOM 1895   O O    . PHE B 2 41  ? 16.719  0.350   -1.935  1.00 10.00 ? 359 PHE B O    1  
ATOM 1896   C CB   . PHE B 2 41  ? 17.333  -2.600  -1.941  1.00 10.00 ? 359 PHE B CB   1  
ATOM 1897   C CG   . PHE B 2 41  ? 16.374  -2.367  -3.076  1.00 10.00 ? 359 PHE B CG   1  
ATOM 1898   C CD1  . PHE B 2 41  ? 16.808  -2.433  -4.389  1.00 10.00 ? 359 PHE B CD1  1  
ATOM 1899   C CD2  . PHE B 2 41  ? 15.040  -2.089  -2.827  1.00 10.00 ? 359 PHE B CD2  1  
ATOM 1900   C CE1  . PHE B 2 41  ? 15.930  -2.223  -5.436  1.00 10.00 ? 359 PHE B CE1  1  
ATOM 1901   C CE2  . PHE B 2 41  ? 14.157  -1.879  -3.866  1.00 10.00 ? 359 PHE B CE2  1  
ATOM 1902   C CZ   . PHE B 2 41  ? 14.601  -1.946  -5.172  1.00 10.00 ? 359 PHE B CZ   1  
ATOM 1903   H H    . PHE B 2 41  ? 19.042  -2.610  -0.065  1.00 10.00 ? 359 PHE B H    1  
ATOM 1904   N N    . HIS B 2 42  ? 17.810  0.252   0.024   1.00 10.00 ? 360 HIS B N    1  
ATOM 1905   C CA   . HIS B 2 42  ? 17.122  1.419   0.585   1.00 10.00 ? 360 HIS B CA   1  
ATOM 1906   C C    . HIS B 2 42  ? 17.494  2.715   -0.132  1.00 10.00 ? 360 HIS B C    1  
ATOM 1907   O O    . HIS B 2 42  ? 16.907  3.761   0.130   1.00 10.00 ? 360 HIS B O    1  
ATOM 1908   C CB   . HIS B 2 42  ? 17.376  1.551   2.094   1.00 10.00 ? 360 HIS B CB   1  
ATOM 1909   C CG   . HIS B 2 42  ? 16.574  0.606   2.940   1.00 10.00 ? 360 HIS B CG   1  
ATOM 1910   N ND1  . HIS B 2 42  ? 16.809  0.407   4.289   1.00 10.00 ? 360 HIS B ND1  1  
ATOM 1911   C CD2  . HIS B 2 42  ? 15.528  -0.197  2.624   1.00 10.00 ? 360 HIS B CD2  1  
ATOM 1912   C CE1  . HIS B 2 42  ? 15.947  -0.475  4.759   1.00 10.00 ? 360 HIS B CE1  1  
ATOM 1913   N NE2  . HIS B 2 42  ? 15.157  -0.856  3.771   1.00 10.00 ? 360 HIS B NE2  1  
ATOM 1914   H H    . HIS B 2 42  ? 18.502  -0.200  0.557   1.00 10.00 ? 360 HIS B H    1  
ATOM 1915   H HD1  . HIS B 2 42  ? 17.505  0.852   4.826   1.00 10.00 ? 360 HIS B HD1  1  
ATOM 1916   H HE2  . HIS B 2 42  ? 14.322  -1.363  3.887   1.00 10.00 ? 360 HIS B HE2  1  
ATOM 1917   N N    . HIS B 2 43  ? 18.443  2.632   -1.055  1.00 10.00 ? 361 HIS B N    1  
ATOM 1918   C CA   . HIS B 2 43  ? 18.892  3.810   -1.791  1.00 10.00 ? 361 HIS B CA   1  
ATOM 1919   C C    . HIS B 2 43  ? 17.882  4.240   -2.857  1.00 10.00 ? 361 HIS B C    1  
ATOM 1920   O O    . HIS B 2 43  ? 17.834  5.412   -3.239  1.00 10.00 ? 361 HIS B O    1  
ATOM 1921   C CB   . HIS B 2 43  ? 20.330  3.678   -2.327  1.00 10.00 ? 361 HIS B CB   1  
ATOM 1922   C CG   . HIS B 2 43  ? 20.485  3.106   -3.707  1.00 10.00 ? 361 HIS B CG   1  
ATOM 1923   N ND1  . HIS B 2 43  ? 20.615  3.891   -4.833  1.00 10.00 ? 361 HIS B ND1  1  
ATOM 1924   C CD2  . HIS B 2 43  ? 20.589  1.823   -4.133  1.00 10.00 ? 361 HIS B CD2  1  
ATOM 1925   C CE1  . HIS B 2 43  ? 20.793  3.118   -5.889  1.00 10.00 ? 361 HIS B CE1  1  
ATOM 1926   N NE2  . HIS B 2 43  ? 20.782  1.860   -5.491  1.00 10.00 ? 361 HIS B NE2  1  
ATOM 1927   H H    . HIS B 2 43  ? 18.828  1.754   -1.267  1.00 10.00 ? 361 HIS B H    1  
ATOM 1928   H HD1  . HIS B 2 43  ? 20.581  4.868   -4.855  1.00 10.00 ? 361 HIS B HD1  1  
ATOM 1929   H HE2  . HIS B 2 43  ? 20.776  1.078   -6.092  1.00 10.00 ? 361 HIS B HE2  1  
ATOM 1930   N N    . GLU B 2 44  ? 17.098  3.282   -3.345  1.00 10.00 ? 362 GLU B N    1  
ATOM 1931   C CA   . GLU B 2 44  ? 16.089  3.553   -4.372  1.00 10.00 ? 362 GLU B CA   1  
ATOM 1932   C C    . GLU B 2 44  ? 15.093  4.633   -3.945  1.00 10.00 ? 362 GLU B C    1  
ATOM 1933   O O    . GLU B 2 44  ? 14.892  5.615   -4.665  1.00 10.00 ? 362 GLU B O    1  
ATOM 1934   C CB   . GLU B 2 44  ? 15.354  2.279   -4.784  1.00 10.00 ? 362 GLU B CB   1  
ATOM 1935   C CG   . GLU B 2 44  ? 16.126  1.431   -5.779  1.00 10.00 ? 362 GLU B CG   1  
ATOM 1936   C CD   . GLU B 2 44  ? 16.829  2.275   -6.824  1.00 10.00 ? 362 GLU B CD   1  
ATOM 1937   O OE1  . GLU B 2 44  ? 16.147  2.997   -7.575  1.00 10.00 ? 362 GLU B OE1  1  
ATOM 1938   O OE2  . GLU B 2 44  ? 18.071  2.234   -6.888  1.00 10.00 ? 362 GLU B OE2  1  
ATOM 1939   H H    . GLU B 2 44  ? 17.195  2.366   -3.001  1.00 10.00 ? 362 GLU B H    1  
ATOM 1940   N N    . LEU B 2 45  ? 14.476  4.449   -2.776  1.00 10.00 ? 363 LEU B N    1  
ATOM 1941   C CA   . LEU B 2 45  ? 13.511  5.416   -2.257  1.00 10.00 ? 363 LEU B CA   1  
ATOM 1942   C C    . LEU B 2 45  ? 14.191  6.759   -2.058  1.00 10.00 ? 363 LEU B C    1  
ATOM 1943   O O    . LEU B 2 45  ? 13.631  7.801   -2.380  1.00 10.00 ? 363 LEU B O    1  
ATOM 1944   C CB   . LEU B 2 45  ? 12.916  4.929   -0.932  1.00 10.00 ? 363 LEU B CB   1  
ATOM 1945   C CG   . LEU B 2 45  ? 12.009  5.920   -0.194  1.00 10.00 ? 363 LEU B CG   1  
ATOM 1946   C CD1  . LEU B 2 45  ? 10.757  6.218   -1.006  1.00 10.00 ? 363 LEU B CD1  1  
ATOM 1947   C CD2  . LEU B 2 45  ? 11.647  5.396   1.188   1.00 10.00 ? 363 LEU B CD2  1  
ATOM 1948   H H    . LEU B 2 45  ? 14.674  3.645   -2.251  1.00 10.00 ? 363 LEU B H    1  
ATOM 1949   N N    . VAL B 2 46  ? 15.392  6.690   -1.494  1.00 10.00 ? 364 VAL B N    1  
ATOM 1950   C CA   . VAL B 2 46  ? 16.216  7.880   -1.269  1.00 10.00 ? 364 VAL B CA   1  
ATOM 1951   C C    . VAL B 2 46  ? 16.269  8.730   -2.539  1.00 10.00 ? 364 VAL B C    1  
ATOM 1952   O O    . VAL B 2 46  ? 15.937  9.913   -2.518  1.00 10.00 ? 364 VAL B O    1  
ATOM 1953   C CB   . VAL B 2 46  ? 17.652  7.514   -0.842  1.00 10.00 ? 364 VAL B CB   1  
ATOM 1954   C CG1  . VAL B 2 46  ? 18.541  8.750   -0.819  1.00 10.00 ? 364 VAL B CG1  1  
ATOM 1955   C CG2  . VAL B 2 46  ? 17.640  6.845   0.522   1.00 10.00 ? 364 VAL B CG2  1  
ATOM 1956   H H    . VAL B 2 46  ? 15.648  5.812   -1.147  1.00 10.00 ? 364 VAL B H    1  
ATOM 1957   N N    . TYR B 2 47  ? 16.665  8.111   -3.645  1.00 10.00 ? 365 TYR B N    1  
ATOM 1958   C CA   . TYR B 2 47  ? 16.737  8.801   -4.927  1.00 10.00 ? 365 TYR B CA   1  
ATOM 1959   C C    . TYR B 2 47  ? 15.360  9.306   -5.379  1.00 10.00 ? 365 TYR B C    1  
ATOM 1960   O O    . TYR B 2 47  ? 15.210  10.471  -5.748  1.00 10.00 ? 365 TYR B O    1  
ATOM 1961   C CB   . TYR B 2 47  ? 17.333  7.861   -5.987  1.00 10.00 ? 365 TYR B CB   1  
ATOM 1962   C CG   . TYR B 2 47  ? 17.065  8.269   -7.420  1.00 10.00 ? 365 TYR B CG   1  
ATOM 1963   C CD1  . TYR B 2 47  ? 17.887  9.180   -8.065  1.00 10.00 ? 365 TYR B CD1  1  
ATOM 1964   C CD2  . TYR B 2 47  ? 15.990  7.740   -8.127  1.00 10.00 ? 365 TYR B CD2  1  
ATOM 1965   C CE1  . TYR B 2 47  ? 17.647  9.554   -9.376  1.00 10.00 ? 365 TYR B CE1  1  
ATOM 1966   C CE2  . TYR B 2 47  ? 15.741  8.110   -9.435  1.00 10.00 ? 365 TYR B CE2  1  
ATOM 1967   C CZ   . TYR B 2 47  ? 16.571  9.017   -10.056 1.00 10.00 ? 365 TYR B CZ   1  
ATOM 1968   O OH   . TYR B 2 47  ? 16.321  9.391   -11.358 1.00 10.00 ? 365 TYR B OH   1  
ATOM 1969   H H    . TYR B 2 47  ? 16.959  7.175   -3.587  1.00 10.00 ? 365 TYR B H    1  
ATOM 1970   H HH   . TYR B 2 47  ? 16.843  8.843   -11.957 1.00 10.00 ? 365 TYR B HH   1  
ATOM 1971   N N    . GLU B 2 48  ? 14.365  8.425   -5.347  1.00 10.00 ? 366 GLU B N    1  
ATOM 1972   C CA   . GLU B 2 48  ? 13.007  8.765   -5.770  1.00 10.00 ? 366 GLU B CA   1  
ATOM 1973   C C    . GLU B 2 48  ? 12.444  9.974   -5.018  1.00 10.00 ? 366 GLU B C    1  
ATOM 1974   O O    . GLU B 2 48  ? 11.904  10.901  -5.626  1.00 10.00 ? 366 GLU B O    1  
ATOM 1975   C CB   . GLU B 2 48  ? 12.097  7.552   -5.593  1.00 10.00 ? 366 GLU B CB   1  
ATOM 1976   C CG   . GLU B 2 48  ? 10.837  7.583   -6.437  1.00 10.00 ? 366 GLU B CG   1  
ATOM 1977   C CD   . GLU B 2 48  ? 11.125  7.688   -7.919  1.00 10.00 ? 366 GLU B CD   1  
ATOM 1978   O OE1  . GLU B 2 48  ? 11.376  6.643   -8.555  1.00 10.00 ? 366 GLU B OE1  1  
ATOM 1979   O OE2  . GLU B 2 48  ? 11.092  8.815   -8.455  1.00 10.00 ? 366 GLU B OE2  1  
ATOM 1980   H H    . GLU B 2 48  ? 14.548  7.513   -5.027  1.00 10.00 ? 366 GLU B H    1  
ATOM 1981   N N    . ALA B 2 49  ? 12.547  9.944   -3.694  1.00 10.00 ? 367 ALA B N    1  
ATOM 1982   C CA   . ALA B 2 49  ? 12.067  11.038  -2.858  1.00 10.00 ? 367 ALA B CA   1  
ATOM 1983   C C    . ALA B 2 49  ? 12.700  12.371  -3.249  1.00 10.00 ? 367 ALA B C    1  
ATOM 1984   O O    . ALA B 2 49  ? 12.052  13.414  -3.173  1.00 10.00 ? 367 ALA B O    1  
ATOM 1985   C CB   . ALA B 2 49  ? 12.361  10.741  -1.393  1.00 10.00 ? 367 ALA B CB   1  
ATOM 1986   H H    . ALA B 2 49  ? 12.854  9.119   -3.258  1.00 10.00 ? 367 ALA B H    1  
ATOM 1987   N N    . ILE B 2 50  ? 13.945  12.323  -3.705  1.00 10.00 ? 368 ILE B N    1  
ATOM 1988   C CA   . ILE B 2 50  ? 14.646  13.539  -4.089  1.00 10.00 ? 368 ILE B CA   1  
ATOM 1989   C C    . ILE B 2 50  ? 14.097  14.033  -5.428  1.00 10.00 ? 368 ILE B C    1  
ATOM 1990   O O    . ILE B 2 50  ? 13.904  15.227  -5.639  1.00 10.00 ? 368 ILE B O    1  
ATOM 1991   C CB   . ILE B 2 50  ? 16.180  13.354  -4.154  1.00 10.00 ? 368 ILE B CB   1  
ATOM 1992   C CG1  . ILE B 2 50  ? 16.744  12.938  -2.787  1.00 10.00 ? 368 ILE B CG1  1  
ATOM 1993   C CG2  . ILE B 2 50  ? 16.849  14.634  -4.638  1.00 10.00 ? 368 ILE B CG2  1  
ATOM 1994   C CD1  . ILE B 2 50  ? 18.220  12.587  -2.819  1.00 10.00 ? 368 ILE B CD1  1  
ATOM 1995   H H    . ILE B 2 50  ? 14.352  11.448  -3.878  1.00 10.00 ? 368 ILE B H    1  
ATOM 1996   N N    . VAL B 2 51  ? 13.814  13.089  -6.318  1.00 10.00 ? 369 VAL B N    1  
ATOM 1997   C CA   . VAL B 2 51  ? 13.279  13.413  -7.635  1.00 10.00 ? 369 VAL B CA   1  
ATOM 1998   C C    . VAL B 2 51  ? 11.899  14.058  -7.526  1.00 10.00 ? 369 VAL B C    1  
ATOM 1999   O O    . VAL B 2 51  ? 11.596  15.008  -8.251  1.00 10.00 ? 369 VAL B O    1  
ATOM 2000   C CB   . VAL B 2 51  ? 13.182  12.165  -8.539  1.00 10.00 ? 369 VAL B CB   1  
ATOM 2001   C CG1  . VAL B 2 51  ? 12.533  12.510  -9.871  1.00 10.00 ? 369 VAL B CG1  1  
ATOM 2002   C CG2  . VAL B 2 51  ? 14.561  11.572  -8.764  1.00 10.00 ? 369 VAL B CG2  1  
ATOM 2003   H H    . VAL B 2 51  ? 13.982  12.148  -6.086  1.00 10.00 ? 369 VAL B H    1  
ATOM 2004   N N    . MET B 2 52  ? 11.068  13.530  -6.624  1.00 10.00 ? 370 MET B N    1  
ATOM 2005   C CA   . MET B 2 52  ? 9.714   14.037  -6.414  1.00 10.00 ? 370 MET B CA   1  
ATOM 2006   C C    . MET B 2 52  ? 9.686   15.546  -6.218  1.00 10.00 ? 370 MET B C    1  
ATOM 2007   O O    . MET B 2 52  ? 9.060   16.250  -6.997  1.00 10.00 ? 370 MET B O    1  
ATOM 2008   C CB   . MET B 2 52  ? 9.108   13.338  -5.198  1.00 10.00 ? 370 MET B CB   1  
ATOM 2009   C CG   . MET B 2 52  ? 7.600   13.469  -5.058  1.00 10.00 ? 370 MET B CG   1  
ATOM 2010   S SD   . MET B 2 52  ? 6.963   12.516  -3.665  1.00 10.00 ? 370 MET B SD   1  
ATOM 2011   C CE   . MET B 2 52  ? 5.206   12.843  -3.795  1.00 10.00 ? 370 MET B CE   1  
ATOM 2012   H H    . MET B 2 52  ? 11.355  12.743  -6.107  1.00 10.00 ? 370 MET B H    1  
ATOM 2013   N N    . VAL B 2 53  ? 10.366  16.036  -5.180  1.00 10.00 ? 371 VAL B N    1  
ATOM 2014   C CA   . VAL B 2 53  ? 10.437  17.483  -4.919  1.00 10.00 ? 371 VAL B CA   1  
ATOM 2015   C C    . VAL B 2 53  ? 10.815  18.315  -6.150  1.00 10.00 ? 371 VAL B C    1  
ATOM 2016   O O    . VAL B 2 53  ? 10.371  19.451  -6.288  1.00 10.00 ? 371 VAL B O    1  
ATOM 2017   C CB   . VAL B 2 53  ? 11.311  17.869  -3.703  1.00 10.00 ? 371 VAL B CB   1  
ATOM 2018   C CG1  . VAL B 2 53  ? 10.563  17.604  -2.408  1.00 10.00 ? 371 VAL B CG1  1  
ATOM 2019   C CG2  . VAL B 2 53  ? 12.643  17.143  -3.712  1.00 10.00 ? 371 VAL B CG2  1  
ATOM 2020   H H    . VAL B 2 53  ? 10.669  15.407  -4.490  1.00 10.00 ? 371 VAL B H    1  
ATOM 2021   N N    . LEU B 2 54  ? 11.600  17.746  -7.044  1.00 10.00 ? 372 LEU B N    1  
ATOM 2022   C CA   . LEU B 2 54  ? 12.039  18.473  -8.235  1.00 10.00 ? 372 LEU B CA   1  
ATOM 2023   C C    . LEU B 2 54  ? 10.953  18.463  -9.311  1.00 10.00 ? 372 LEU B C    1  
ATOM 2024   O O    . LEU B 2 54  ? 10.883  19.365  -10.150 1.00 10.00 ? 372 LEU B O    1  
ATOM 2025   C CB   . LEU B 2 54  ? 13.327  17.860  -8.790  1.00 10.00 ? 372 LEU B CB   1  
ATOM 2026   C CG   . LEU B 2 54  ? 14.507  17.766  -7.823  1.00 10.00 ? 372 LEU B CG   1  
ATOM 2027   C CD1  . LEU B 2 54  ? 15.618  16.920  -8.424  1.00 10.00 ? 372 LEU B CD1  1  
ATOM 2028   C CD2  . LEU B 2 54  ? 15.024  19.152  -7.469  1.00 10.00 ? 372 LEU B CD2  1  
ATOM 2029   H H    . LEU B 2 54  ? 11.836  16.796  -6.947  1.00 10.00 ? 372 LEU B H    1  
ATOM 2030   N N    . GLU B 2 55  ? 10.088  17.457  -9.258  1.00 10.00 ? 373 GLU B N    1  
ATOM 2031   C CA   . GLU B 2 55  ? 9.015   17.300  -10.234 1.00 10.00 ? 373 GLU B CA   1  
ATOM 2032   C C    . GLU B 2 55  ? 7.644   17.674  -9.655  1.00 10.00 ? 373 GLU B C    1  
ATOM 2033   O O    . GLU B 2 55  ? 6.625   17.592  -10.338 1.00 10.00 ? 373 GLU B O    1  
ATOM 2034   C CB   . GLU B 2 55  ? 8.984   15.846  -10.714 1.00 10.00 ? 373 GLU B CB   1  
ATOM 2035   C CG   . GLU B 2 55  ? 8.568   15.658  -12.162 1.00 10.00 ? 373 GLU B CG   1  
ATOM 2036   C CD   . GLU B 2 55  ? 9.644   16.075  -13.143 1.00 10.00 ? 373 GLU B CD   1  
ATOM 2037   O OE1  . GLU B 2 55  ? 10.541  15.257  -13.437 1.00 10.00 ? 373 GLU B OE1  1  
ATOM 2038   O OE2  . GLU B 2 55  ? 9.584   17.218  -13.640 1.00 10.00 ? 373 GLU B OE2  1  
ATOM 2039   H H    . GLU B 2 55  ? 10.170  16.794  -8.536  1.00 10.00 ? 373 GLU B H    1  
ATOM 2040   N N    . SER B 2 56  ? 7.616   18.092  -8.396  1.00 10.00 ? 374 SER B N    1  
ATOM 2041   C CA   . SER B 2 56  ? 6.360   18.451  -7.748  1.00 10.00 ? 374 SER B CA   1  
ATOM 2042   C C    . SER B 2 56  ? 6.336   19.916  -7.341  1.00 10.00 ? 374 SER B C    1  
ATOM 2043   O O    . SER B 2 56  ? 7.276   20.415  -6.724  1.00 10.00 ? 374 SER B O    1  
ATOM 2044   C CB   . SER B 2 56  ? 6.110   17.550  -6.537  1.00 10.00 ? 374 SER B CB   1  
ATOM 2045   O OG   . SER B 2 56  ? 6.374   16.192  -6.855  1.00 10.00 ? 374 SER B OG   1  
ATOM 2046   H H    . SER B 2 56  ? 8.453   18.173  -7.896  1.00 10.00 ? 374 SER B H    1  
ATOM 2047   H HG   . SER B 2 56  ? 7.213   16.139  -7.335  1.00 10.00 ? 374 SER B HG   1  
ATOM 2048   N N    . THR B 2 57  ? 5.257   20.599  -7.693  1.00 10.00 ? 375 THR B N    1  
ATOM 2049   C CA   . THR B 2 57  ? 5.100   22.002  -7.373  1.00 10.00 ? 375 THR B CA   1  
ATOM 2050   C C    . THR B 2 57  ? 4.321   22.172  -6.074  1.00 10.00 ? 375 THR B C    1  
ATOM 2051   O O    . THR B 2 57  ? 3.223   21.633  -5.923  1.00 10.00 ? 375 THR B O    1  
ATOM 2052   C CB   . THR B 2 57  ? 4.357   22.741  -8.503  1.00 10.00 ? 375 THR B CB   1  
ATOM 2053   O OG1  . THR B 2 57  ? 3.100   22.092  -8.764  1.00 10.00 ? 375 THR B OG1  1  
ATOM 2054   C CG2  . THR B 2 57  ? 5.192   22.748  -9.774  1.00 10.00 ? 375 THR B CG2  1  
ATOM 2055   H H    . THR B 2 57  ? 4.544   20.134  -8.174  1.00 10.00 ? 375 THR B H    1  
ATOM 2056   H HG1  . THR B 2 57  ? 2.567   22.097  -7.958  1.00 10.00 ? 375 THR B HG1  1  
ATOM 2057   N N    . GLY B 2 58  ? 4.895   22.912  -5.141  1.00 10.00 ? 376 GLY B N    1  
ATOM 2058   C CA   . GLY B 2 58  ? 4.244   23.136  -3.871  1.00 10.00 ? 376 GLY B CA   1  
ATOM 2059   C C    . GLY B 2 58  ? 5.182   22.904  -2.707  1.00 10.00 ? 376 GLY B C    1  
ATOM 2060   O O    . GLY B 2 58  ? 6.069   22.050  -2.774  1.00 10.00 ? 376 GLY B O    1  
ATOM 2061   H H    . GLY B 2 58  ? 5.772   23.313  -5.317  1.00 10.00 ? 376 GLY B H    1  
ATOM 2062   N N    . GLU B 2 59  ? 4.988   23.659  -1.635  1.00 10.00 ? 377 GLU B N    1  
ATOM 2063   C CA   . GLU B 2 59  ? 5.822   23.530  -0.448  1.00 10.00 ? 377 GLU B CA   1  
ATOM 2064   C C    . GLU B 2 59  ? 5.482   22.252  0.305   1.00 10.00 ? 377 GLU B C    1  
ATOM 2065   O O    . GLU B 2 59  ? 6.304   21.729  1.054   1.00 10.00 ? 377 GLU B O    1  
ATOM 2066   C CB   . GLU B 2 59  ? 5.649   24.747  0.463   1.00 10.00 ? 377 GLU B CB   1  
ATOM 2067   C CG   . GLU B 2 59  ? 4.200   25.119  0.720   1.00 10.00 ? 377 GLU B CG   1  
ATOM 2068   C CD   . GLU B 2 59  ? 4.044   26.193  1.771   1.00 10.00 ? 377 GLU B CD   1  
ATOM 2069   O OE1  . GLU B 2 59  ? 4.405   27.357  1.498   1.00 10.00 ? 377 GLU B OE1  1  
ATOM 2070   O OE2  . GLU B 2 59  ? 3.559   25.875  2.877   1.00 10.00 ? 377 GLU B OE2  1  
ATOM 2071   H H    . GLU B 2 59  ? 4.257   24.314  -1.638  1.00 10.00 ? 377 GLU B H    1  
ATOM 2072   N N    . SER B 2 60  ? 4.266   21.752  0.080   1.00 10.00 ? 378 SER B N    1  
ATOM 2073   C CA   . SER B 2 60  ? 3.779   20.534  0.711   1.00 10.00 ? 378 SER B CA   1  
ATOM 2074   C C    . SER B 2 60  ? 4.765   19.381  0.526   1.00 10.00 ? 378 SER B C    1  
ATOM 2075   O O    . SER B 2 60  ? 4.998   18.595  1.446   1.00 10.00 ? 378 SER B O    1  
ATOM 2076   C CB   . SER B 2 60  ? 2.422   20.177  0.105   1.00 10.00 ? 378 SER B CB   1  
ATOM 2077   O OG   . SER B 2 60  ? 1.851   21.311  -0.529  1.00 10.00 ? 378 SER B OG   1  
ATOM 2078   H H    . SER B 2 60  ? 3.671   22.223  -0.541  1.00 10.00 ? 378 SER B H    1  
ATOM 2079   H HG   . SER B 2 60  ? 1.015   21.530  -0.100  1.00 10.00 ? 378 SER B HG   1  
ATOM 2080   N N    . ALA B 2 61  ? 5.351   19.293  -0.660  1.00 10.00 ? 379 ALA B N    1  
ATOM 2081   C CA   . ALA B 2 61  ? 6.321   18.251  -0.947  1.00 10.00 ? 379 ALA B CA   1  
ATOM 2082   C C    . ALA B 2 61  ? 7.592   18.458  -0.133  1.00 10.00 ? 379 ALA B C    1  
ATOM 2083   O O    . ALA B 2 61  ? 7.937   17.635  0.705   1.00 10.00 ? 379 ALA B O    1  
ATOM 2084   C CB   . ALA B 2 61  ? 6.632   18.198  -2.437  1.00 10.00 ? 379 ALA B CB   1  
ATOM 2085   H H    . ALA B 2 61  ? 5.096   19.931  -1.362  1.00 10.00 ? 379 ALA B H    1  
ATOM 2086   N N    . PHE B 2 62  ? 8.280   19.573  -0.360  1.00 10.00 ? 380 PHE B N    1  
ATOM 2087   C CA   . PHE B 2 62  ? 9.516   19.906  0.359   1.00 10.00 ? 380 PHE B CA   1  
ATOM 2088   C C    . PHE B 2 62  ? 9.387   19.840  1.879   1.00 10.00 ? 380 PHE B C    1  
ATOM 2089   O O    . PHE B 2 62  ? 10.356  19.547  2.579   1.00 10.00 ? 380 PHE B O    1  
ATOM 2090   C CB   . PHE B 2 62  ? 9.974   21.312  -0.065  1.00 10.00 ? 380 PHE B CB   1  
ATOM 2091   C CG   . PHE B 2 62  ? 11.464  21.531  -0.036  1.00 10.00 ? 380 PHE B CG   1  
ATOM 2092   C CD1  . PHE B 2 62  ? 12.274  21.011  -1.035  1.00 10.00 ? 380 PHE B CD1  1  
ATOM 2093   C CD2  . PHE B 2 62  ? 12.054  22.266  0.982   1.00 10.00 ? 380 PHE B CD2  1  
ATOM 2094   C CE1  . PHE B 2 62  ? 13.641  21.217  -1.024  1.00 10.00 ? 380 PHE B CE1  1  
ATOM 2095   C CE2  . PHE B 2 62  ? 13.422  22.473  0.999   1.00 10.00 ? 380 PHE B CE2  1  
ATOM 2096   C CZ   . PHE B 2 62  ? 14.217  21.948  -0.005  1.00 10.00 ? 380 PHE B CZ   1  
ATOM 2097   H H    . PHE B 2 62  ? 8.044   20.153  -1.110  1.00 10.00 ? 380 PHE B H    1  
ATOM 2098   N N    . LYS B 2 63  ? 8.191   20.062  2.401   1.00 10.00 ? 381 LYS B N    1  
ATOM 2099   C CA   . LYS B 2 63  ? 8.026   20.039  3.845   1.00 10.00 ? 381 LYS B CA   1  
ATOM 2100   C C    . LYS B 2 63  ? 7.971   18.602  4.357   1.00 10.00 ? 381 LYS B C    1  
ATOM 2101   O O    . LYS B 2 63  ? 8.606   18.249  5.354   1.00 10.00 ? 381 LYS B O    1  
ATOM 2102   C CB   . LYS B 2 63  ? 6.843   20.893  4.342   1.00 10.00 ? 381 LYS B CB   1  
ATOM 2103   C CG   . LYS B 2 63  ? 5.498   20.547  3.735   1.00 10.00 ? 381 LYS B CG   1  
ATOM 2104   C CD   . LYS B 2 63  ? 4.366   21.349  4.366   1.00 10.00 ? 381 LYS B CD   1  
ATOM 2105   C CE   . LYS B 2 63  ? 3.847   20.673  5.628   1.00 10.00 ? 381 LYS B CE   1  
ATOM 2106   N NZ   . LYS B 2 63  ? 2.500   21.173  6.036   1.00 10.00 ? 381 LYS B NZ   1  
ATOM 2107   H H    . LYS B 2 63  ? 7.408   20.001  1.821   1.00 10.00 ? 381 LYS B H    1  
ATOM 2108   H HZ1  . LYS B 2 63  ? 1.866   21.221  5.212   1.00 10.00 ? 381 LYS B HZ1  1  
ATOM 2109   H HZ2  . LYS B 2 63  ? 2.574   22.126  6.457   1.00 10.00 ? 381 LYS B HZ2  1  
ATOM 2110   H HZ3  . LYS B 2 63  ? 2.081   20.534  6.739   1.00 10.00 ? 381 LYS B HZ3  1  
ATOM 2111   N N    . MET B 2 64  ? 7.216   17.767  3.641   1.00 10.00 ? 382 MET B N    1  
ATOM 2112   C CA   . MET B 2 64  ? 7.023   16.377  4.042   1.00 10.00 ? 382 MET B CA   1  
ATOM 2113   C C    . MET B 2 64  ? 8.100   15.417  3.522   1.00 10.00 ? 382 MET B C    1  
ATOM 2114   O O    . MET B 2 64  ? 8.369   14.394  4.151   1.00 10.00 ? 382 MET B O    1  
ATOM 2115   C CB   . MET B 2 64  ? 5.606   15.876  3.737   1.00 10.00 ? 382 MET B CB   1  
ATOM 2116   C CG   . MET B 2 64  ? 4.526   16.501  4.611   1.00 10.00 ? 382 MET B CG   1  
ATOM 2117   S SD   . MET B 2 64  ? 2.990   15.548  4.621   1.00 10.00 ? 382 MET B SD   1  
ATOM 2118   C CE   . MET B 2 64  ? 2.479   15.709  2.912   1.00 10.00 ? 382 MET B CE   1  
ATOM 2119   H H    . MET B 2 64  ? 6.905   18.049  2.752   1.00 10.00 ? 382 MET B H    1  
ATOM 2120   N N    . ILE B 2 65  ? 8.716   15.752  2.384   1.00 10.00 ? 383 ILE B N    1  
ATOM 2121   C CA   . ILE B 2 65  ? 9.733   14.882  1.768   1.00 10.00 ? 383 ILE B CA   1  
ATOM 2122   C C    . ILE B 2 65  ? 11.016  14.799  2.597   1.00 10.00 ? 383 ILE B C    1  
ATOM 2123   O O    . ILE B 2 65  ? 11.453  13.704  2.941   1.00 10.00 ? 383 ILE B O    1  
ATOM 2124   C CB   . ILE B 2 65  ? 10.060  15.304  0.313   1.00 10.00 ? 383 ILE B CB   1  
ATOM 2125   C CG1  . ILE B 2 65  ? 8.925   14.897  -0.635  1.00 10.00 ? 383 ILE B CG1  1  
ATOM 2126   C CG2  . ILE B 2 65  ? 11.385  14.719  -0.159  1.00 10.00 ? 383 ILE B CG2  1  
ATOM 2127   C CD1  . ILE B 2 65  ? 8.639   13.409  -0.653  1.00 10.00 ? 383 ILE B CD1  1  
ATOM 2128   H H    . ILE B 2 65  ? 8.508   16.610  1.950   1.00 10.00 ? 383 ILE B H    1  
ATOM 2129   N N    . LEU B 2 66  ? 11.644  15.940  2.895   1.00 10.00 ? 384 LEU B N    1  
ATOM 2130   C CA   . LEU B 2 66  ? 12.851  15.947  3.723   1.00 10.00 ? 384 LEU B CA   1  
ATOM 2131   C C    . LEU B 2 66  ? 12.590  15.303  5.080   1.00 10.00 ? 384 LEU B C    1  
ATOM 2132   O O    . LEU B 2 66  ? 13.458  14.626  5.644   1.00 10.00 ? 384 LEU B O    1  
ATOM 2133   C CB   . LEU B 2 66  ? 13.329  17.388  3.902   1.00 10.00 ? 384 LEU B CB   1  
ATOM 2134   C CG   . LEU B 2 66  ? 14.842  17.607  3.924   1.00 10.00 ? 384 LEU B CG   1  
ATOM 2135   C CD1  . LEU B 2 66  ? 15.177  19.042  3.545   1.00 10.00 ? 384 LEU B CD1  1  
ATOM 2136   C CD2  . LEU B 2 66  ? 15.412  17.273  5.292   1.00 10.00 ? 384 LEU B CD2  1  
ATOM 2137   H H    . LEU B 2 66  ? 11.412  16.784  2.454   1.00 10.00 ? 384 LEU B H    1  
ATOM 2138   N N    . ASP B 2 67  ? 11.386  15.507  5.587   1.00 10.00 ? 385 ASP B N    1  
ATOM 2139   C CA   . ASP B 2 67  ? 10.990  14.950  6.866   1.00 10.00 ? 385 ASP B CA   1  
ATOM 2140   C C    . ASP B 2 67  ? 10.994  13.428  6.803   1.00 10.00 ? 385 ASP B C    1  
ATOM 2141   O O    . ASP B 2 67  ? 11.292  12.760  7.788   1.00 10.00 ? 385 ASP B O    1  
ATOM 2142   C CB   . ASP B 2 67  ? 9.600   15.458  7.255   1.00 10.00 ? 385 ASP B CB   1  
ATOM 2143   C CG   . ASP B 2 67  ? 9.445   15.625  8.752   1.00 10.00 ? 385 ASP B CG   1  
ATOM 2144   O OD1  . ASP B 2 67  ? 9.086   14.649  9.433   1.00 10.00 ? 385 ASP B OD1  1  
ATOM 2145   O OD2  . ASP B 2 67  ? 9.679   16.746  9.254   1.00 10.00 ? 385 ASP B OD2  1  
ATOM 2146   H H    . ASP B 2 67  ? 10.743  16.047  5.085   1.00 10.00 ? 385 ASP B H    1  
ATOM 2147   N N    . LEU B 2 68  ? 10.692  12.887  5.625   1.00 10.00 ? 386 LEU B N    1  
ATOM 2148   C CA   . LEU B 2 68  ? 10.662  11.442  5.419   1.00 10.00 ? 386 LEU B CA   1  
ATOM 2149   C C    . LEU B 2 68  ? 12.031  10.815  5.630   1.00 10.00 ? 386 LEU B C    1  
ATOM 2150   O O    . LEU B 2 68  ? 12.172  9.873   6.412   1.00 10.00 ? 386 LEU B O    1  
ATOM 2151   C CB   . LEU B 2 68  ? 10.120  11.096  4.027   1.00 10.00 ? 386 LEU B CB   1  
ATOM 2152   C CG   . LEU B 2 68  ? 10.408  9.684   3.499   1.00 10.00 ? 386 LEU B CG   1  
ATOM 2153   C CD1  . LEU B 2 68  ? 9.699   8.622   4.328   1.00 10.00 ? 386 LEU B CD1  1  
ATOM 2154   C CD2  . LEU B 2 68  ? 10.014  9.573   2.035   1.00 10.00 ? 386 LEU B CD2  1  
ATOM 2155   H H    . LEU B 2 68  ? 10.486  13.478  4.869   1.00 10.00 ? 386 LEU B H    1  
ATOM 2156   N N    . LEU B 2 69  ? 13.061  11.339  4.958   1.00 10.00 ? 387 LEU B N    1  
ATOM 2157   C CA   . LEU B 2 69  ? 14.396  10.784  5.096   1.00 10.00 ? 387 LEU B CA   1  
ATOM 2158   C C    . LEU B 2 69  ? 14.932  11.009  6.501   1.00 10.00 ? 387 LEU B C    1  
ATOM 2159   O O    . LEU B 2 69  ? 15.453  10.083  7.123   1.00 10.00 ? 387 LEU B O    1  
ATOM 2160   C CB   . LEU B 2 69  ? 15.356  11.339  4.031   1.00 10.00 ? 387 LEU B CB   1  
ATOM 2161   C CG   . LEU B 2 69  ? 15.430  12.861  3.883   1.00 10.00 ? 387 LEU B CG   1  
ATOM 2162   C CD1  . LEU B 2 69  ? 16.726  13.397  4.472   1.00 10.00 ? 387 LEU B CD1  1  
ATOM 2163   C CD2  . LEU B 2 69  ? 15.296  13.263  2.421   1.00 10.00 ? 387 LEU B CD2  1  
ATOM 2164   H H    . LEU B 2 69  ? 12.938  12.130  4.389   1.00 10.00 ? 387 LEU B H    1  
ATOM 2165   N N    . LYS B 2 70  ? 14.828  12.246  6.983   1.00 10.00 ? 388 LYS B N    1  
ATOM 2166   C CA   . LYS B 2 70  ? 15.257  12.580  8.340   1.00 10.00 ? 388 LYS B CA   1  
ATOM 2167   C C    . LYS B 2 70  ? 14.611  11.667  9.379   1.00 10.00 ? 388 LYS B C    1  
ATOM 2168   O O    . LYS B 2 70  ? 15.249  11.283  10.353  1.00 10.00 ? 388 LYS B O    1  
ATOM 2169   C CB   . LYS B 2 70  ? 14.982  14.047  8.669   1.00 10.00 ? 388 LYS B CB   1  
ATOM 2170   C CG   . LYS B 2 70  ? 16.083  15.002  8.234   1.00 10.00 ? 388 LYS B CG   1  
ATOM 2171   C CD   . LYS B 2 70  ? 16.387  16.031  9.316   1.00 10.00 ? 388 LYS B CD   1  
ATOM 2172   C CE   . LYS B 2 70  ? 15.180  16.904  9.625   1.00 10.00 ? 388 LYS B CE   1  
ATOM 2173   N NZ   . LYS B 2 70  ? 15.457  17.860  10.728  1.00 10.00 ? 388 LYS B NZ   1  
ATOM 2174   H H    . LYS B 2 70  ? 14.530  12.969  6.389   1.00 10.00 ? 388 LYS B H    1  
ATOM 2175   H HZ1  . LYS B 2 70  ? 14.587  18.371  10.988  1.00 10.00 ? 388 LYS B HZ1  1  
ATOM 2176   H HZ2  . LYS B 2 70  ? 16.173  18.553  10.430  1.00 10.00 ? 388 LYS B HZ2  1  
ATOM 2177   H HZ3  . LYS B 2 70  ? 15.811  17.354  11.565  1.00 10.00 ? 388 LYS B HZ3  1  
ATOM 2178   N N    . SER B 2 71  ? 13.354  11.306  9.152   1.00 10.00 ? 389 SER B N    1  
ATOM 2179   C CA   . SER B 2 71  ? 12.642  10.431  10.072  1.00 10.00 ? 389 SER B CA   1  
ATOM 2180   C C    . SER B 2 71  ? 13.247  9.031   10.031  1.00 10.00 ? 389 SER B C    1  
ATOM 2181   O O    . SER B 2 71  ? 13.423  8.389   11.067  1.00 10.00 ? 389 SER B O    1  
ATOM 2182   C CB   . SER B 2 71  ? 11.148  10.408  9.773   1.00 10.00 ? 389 SER B CB   1  
ATOM 2183   O OG   . SER B 2 71  ? 10.559  11.654  10.123  1.00 10.00 ? 389 SER B OG   1  
ATOM 2184   H H    . SER B 2 71  ? 12.907  11.615  8.333   1.00 10.00 ? 389 SER B H    1  
ATOM 2185   H HG   . SER B 2 71  ? 10.454  12.197  9.324   1.00 10.00 ? 389 SER B HG   1  
ATOM 2186   N N    . LEU B 2 72  ? 13.575  8.576   8.834   1.00 10.00 ? 390 LEU B N    1  
ATOM 2187   C CA   . LEU B 2 72  ? 14.199  7.271   8.674   1.00 10.00 ? 390 LEU B CA   1  
ATOM 2188   C C    . LEU B 2 72  ? 15.573  7.277   9.348   1.00 10.00 ? 390 LEU B C    1  
ATOM 2189   O O    . LEU B 2 72  ? 15.943  6.324   10.040  1.00 10.00 ? 390 LEU B O    1  
ATOM 2190   C CB   . LEU B 2 72  ? 14.298  6.901   7.198   1.00 10.00 ? 390 LEU B CB   1  
ATOM 2191   C CG   . LEU B 2 72  ? 12.963  6.801   6.453   1.00 10.00 ? 390 LEU B CG   1  
ATOM 2192   C CD1  . LEU B 2 72  ? 13.188  6.747   4.952   1.00 10.00 ? 390 LEU B CD1  1  
ATOM 2193   C CD2  . LEU B 2 72  ? 12.174  5.586   6.923   1.00 10.00 ? 390 LEU B CD2  1  
ATOM 2194   H H    . LEU B 2 72  ? 13.340  9.103   8.038   1.00 10.00 ? 390 LEU B H    1  
ATOM 2195   N N    . TRP B 2 73  ? 16.339  8.347   9.144   1.00 10.00 ? 391 TRP B N    1  
ATOM 2196   C CA   . TRP B 2 73  ? 17.651  8.501   9.762   1.00 10.00 ? 391 TRP B CA   1  
ATOM 2197   C C    . TRP B 2 73  ? 17.579  8.585   11.290  1.00 10.00 ? 391 TRP B C    1  
ATOM 2198   O O    . TRP B 2 73  ? 18.589  8.425   11.973  1.00 10.00 ? 391 TRP B O    1  
ATOM 2199   C CB   . TRP B 2 73  ? 18.367  9.739   9.202   1.00 10.00 ? 391 TRP B CB   1  
ATOM 2200   C CG   . TRP B 2 73  ? 19.117  9.481   7.930   1.00 10.00 ? 391 TRP B CG   1  
ATOM 2201   C CD1  . TRP B 2 73  ? 18.659  9.642   6.653   1.00 10.00 ? 391 TRP B CD1  1  
ATOM 2202   C CD2  . TRP B 2 73  ? 20.467  9.024   7.815   1.00 10.00 ? 391 TRP B CD2  1  
ATOM 2203   N NE1  . TRP B 2 73  ? 19.643  9.308   5.753   1.00 10.00 ? 391 TRP B NE1  1  
ATOM 2204   C CE2  . TRP B 2 73  ? 20.762  8.925   6.443   1.00 10.00 ? 391 TRP B CE2  1  
ATOM 2205   C CE3  . TRP B 2 73  ? 21.458  8.688   8.743   1.00 10.00 ? 391 TRP B CE3  1  
ATOM 2206   C CZ2  . TRP B 2 73  ? 22.003  8.503   5.976   1.00 10.00 ? 391 TRP B CZ2  1  
ATOM 2207   C CZ3  . TRP B 2 73  ? 22.688  8.271   8.277   1.00 10.00 ? 391 TRP B CZ3  1  
ATOM 2208   C CH2  . TRP B 2 73  ? 22.951  8.183   6.908   1.00 10.00 ? 391 TRP B CH2  1  
ATOM 2209   H H    . TRP B 2 73  ? 16.066  9.041   8.496   1.00 10.00 ? 391 TRP B H    1  
ATOM 2210   H HE1  . TRP B 2 73  ? 19.558  9.338   4.775   1.00 10.00 ? 391 TRP B HE1  1  
ATOM 2211   N N    . LYS B 2 74  ? 16.375  8.801   11.827  1.00 10.00 ? 392 LYS B N    1  
ATOM 2212   C CA   . LYS B 2 74  ? 16.217  8.951   13.274  1.00 10.00 ? 392 LYS B CA   1  
ATOM 2213   C C    . LYS B 2 74  ? 16.499  7.634   13.988  1.00 10.00 ? 392 LYS B C    1  
ATOM 2214   O O    . LYS B 2 74  ? 17.089  7.614   15.069  1.00 10.00 ? 392 LYS B O    1  
ATOM 2215   C CB   . LYS B 2 74  ? 14.809  9.439   13.633  1.00 10.00 ? 392 LYS B CB   1  
ATOM 2216   C CG   . LYS B 2 74  ? 14.526  10.894  13.292  1.00 10.00 ? 392 LYS B CG   1  
ATOM 2217   C CD   . LYS B 2 74  ? 13.039  11.193  13.411  1.00 10.00 ? 392 LYS B CD   1  
ATOM 2218   C CE   . LYS B 2 74  ? 12.673  12.532  12.790  1.00 10.00 ? 392 LYS B CE   1  
ATOM 2219   N NZ   . LYS B 2 74  ? 11.196  12.723  12.702  1.00 10.00 ? 392 LYS B NZ   1  
ATOM 2220   H H    . LYS B 2 74  ? 15.584  8.714   11.256  1.00 10.00 ? 392 LYS B H    1  
ATOM 2221   H HZ1  . LYS B 2 74  ? 10.740  12.439  13.595  1.00 10.00 ? 392 LYS B HZ1  1  
ATOM 2222   H HZ2  . LYS B 2 74  ? 10.803  12.146  11.927  1.00 10.00 ? 392 LYS B HZ2  1  
ATOM 2223   H HZ3  . LYS B 2 74  ? 10.972  13.721  12.519  1.00 10.00 ? 392 LYS B HZ3  1  
ATOM 2224   N N    . SER B 2 75  ? 16.082  6.542   13.367  1.00 10.00 ? 393 SER B N    1  
ATOM 2225   C CA   . SER B 2 75  ? 16.268  5.214   13.933  1.00 10.00 ? 393 SER B CA   1  
ATOM 2226   C C    . SER B 2 75  ? 17.292  4.409   13.147  1.00 10.00 ? 393 SER B C    1  
ATOM 2227   O O    . SER B 2 75  ? 17.335  3.183   13.261  1.00 10.00 ? 393 SER B O    1  
ATOM 2228   C CB   . SER B 2 75  ? 14.928  4.480   13.955  1.00 10.00 ? 393 SER B CB   1  
ATOM 2229   O OG   . SER B 2 75  ? 14.012  5.084   13.053  1.00 10.00 ? 393 SER B OG   1  
ATOM 2230   H H    . SER B 2 75  ? 15.607  6.633   12.513  1.00 10.00 ? 393 SER B H    1  
ATOM 2231   H HG   . SER B 2 75  ? 13.182  5.265   13.515  1.00 10.00 ? 393 SER B HG   1  
ATOM 2232   N N    . SER B 2 76  ? 18.128  5.098   12.366  1.00 10.00 ? 394 SER B N    1  
ATOM 2233   C CA   . SER B 2 76  ? 19.144  4.446   11.544  1.00 10.00 ? 394 SER B CA   1  
ATOM 2234   C C    . SER B 2 76  ? 18.542  3.460   10.543  1.00 10.00 ? 394 SER B C    1  
ATOM 2235   O O    . SER B 2 76  ? 18.832  2.262   10.569  1.00 10.00 ? 394 SER B O    1  
ATOM 2236   C CB   . SER B 2 76  ? 20.215  3.768   12.409  1.00 10.00 ? 394 SER B CB   1  
ATOM 2237   O OG   . SER B 2 76  ? 20.769  4.669   13.355  1.00 10.00 ? 394 SER B OG   1  
ATOM 2238   H H    . SER B 2 76  ? 18.080  6.077   12.375  1.00 10.00 ? 394 SER B H    1  
ATOM 2239   H HG   . SER B 2 76  ? 20.068  5.233   13.712  1.00 10.00 ? 394 SER B HG   1  
ATOM 2240   N N    . THR B 2 77  ? 17.698  3.973   9.655   1.00 10.00 ? 395 THR B N    1  
ATOM 2241   C CA   . THR B 2 77  ? 17.069  3.142   8.645   1.00 10.00 ? 395 THR B CA   1  
ATOM 2242   C C    . THR B 2 77  ? 17.836  3.240   7.323   1.00 10.00 ? 395 THR B C    1  
ATOM 2243   O O    . THR B 2 77  ? 18.023  2.241   6.620   1.00 10.00 ? 395 THR B O    1  
ATOM 2244   C CB   . THR B 2 77  ? 15.590  3.529   8.434   1.00 10.00 ? 395 THR B CB   1  
ATOM 2245   O OG1  . THR B 2 77  ? 14.957  3.700   9.710   1.00 10.00 ? 395 THR B OG1  1  
ATOM 2246   C CG2  . THR B 2 77  ? 14.861  2.437   7.663   1.00 10.00 ? 395 THR B CG2  1  
ATOM 2247   H H    . THR B 2 77  ? 17.527  4.935   9.681   1.00 10.00 ? 395 THR B H    1  
ATOM 2248   H HG1  . THR B 2 77  ? 15.253  4.526   10.113  1.00 10.00 ? 395 THR B HG1  1  
ATOM 2249   N N    . ILE B 2 78  ? 18.268  4.451   6.989   1.00 10.00 ? 396 ILE B N    1  
ATOM 2250   C CA   . ILE B 2 78  ? 19.035  4.683   5.770   1.00 10.00 ? 396 ILE B CA   1  
ATOM 2251   C C    . ILE B 2 78  ? 20.524  4.754   6.103   1.00 10.00 ? 396 ILE B C    1  
ATOM 2252   O O    . ILE B 2 78  ? 20.916  5.355   7.105   1.00 10.00 ? 396 ILE B O    1  
ATOM 2253   C CB   . ILE B 2 78  ? 18.610  5.991   5.065   1.00 10.00 ? 396 ILE B CB   1  
ATOM 2254   C CG1  . ILE B 2 78  ? 17.106  5.993   4.780   1.00 10.00 ? 396 ILE B CG1  1  
ATOM 2255   C CG2  . ILE B 2 78  ? 19.390  6.184   3.771   1.00 10.00 ? 396 ILE B CG2  1  
ATOM 2256   C CD1  . ILE B 2 78  ? 16.605  7.294   4.191   1.00 10.00 ? 396 ILE B CD1  1  
ATOM 2257   H H    . ILE B 2 78  ? 18.038  5.212   7.557   1.00 10.00 ? 396 ILE B H    1  
ATOM 2258   N N    . THR B 2 79  ? 21.344  4.125   5.274   1.00 10.00 ? 397 THR B N    1  
ATOM 2259   C CA   . THR B 2 79  ? 22.786  4.121   5.470   1.00 10.00 ? 397 THR B CA   1  
ATOM 2260   C C    . THR B 2 79  ? 23.448  5.251   4.686   1.00 10.00 ? 397 THR B C    1  
ATOM 2261   O O    . THR B 2 79  ? 22.956  5.649   3.630   1.00 10.00 ? 397 THR B O    1  
ATOM 2262   C CB   . THR B 2 79  ? 23.378  2.774   5.024   1.00 10.00 ? 397 THR B CB   1  
ATOM 2263   O OG1  . THR B 2 79  ? 22.428  2.083   4.198   1.00 10.00 ? 397 THR B OG1  1  
ATOM 2264   C CG2  . THR B 2 79  ? 23.697  1.914   6.232   1.00 10.00 ? 397 THR B CG2  1  
ATOM 2265   H H    . THR B 2 79  ? 20.971  3.647   4.505   1.00 10.00 ? 397 THR B H    1  
ATOM 2266   H HG1  . THR B 2 79  ? 22.260  1.211   4.573   1.00 10.00 ? 397 THR B HG1  1  
ATOM 2267   N N    . ILE B 2 80  ? 24.553  5.777   5.212   1.00 10.00 ? 398 ILE B N    1  
ATOM 2268   C CA   . ILE B 2 80  ? 25.280  6.863   4.553   1.00 10.00 ? 398 ILE B CA   1  
ATOM 2269   C C    . ILE B 2 80  ? 25.681  6.482   3.128   1.00 10.00 ? 398 ILE B C    1  
ATOM 2270   O O    . ILE B 2 80  ? 25.585  7.286   2.207   1.00 10.00 ? 398 ILE B O    1  
ATOM 2271   C CB   . ILE B 2 80  ? 26.507  7.343   5.369   1.00 10.00 ? 398 ILE B CB   1  
ATOM 2272   C CG1  . ILE B 2 80  ? 27.211  8.508   4.671   1.00 10.00 ? 398 ILE B CG1  1  
ATOM 2273   C CG2  . ILE B 2 80  ? 27.482  6.205   5.633   1.00 10.00 ? 398 ILE B CG2  1  
ATOM 2274   C CD1  . ILE B 2 80  ? 26.386  9.773   4.621   1.00 10.00 ? 398 ILE B CD1  1  
ATOM 2275   H H    . ILE B 2 80  ? 24.880  5.442   6.076   1.00 10.00 ? 398 ILE B H    1  
ATOM 2276   N N    . ASP B 2 81  ? 26.121  5.236   2.957   1.00 10.00 ? 399 ASP B N    1  
ATOM 2277   C CA   . ASP B 2 81  ? 26.518  4.722   1.646   1.00 10.00 ? 399 ASP B CA   1  
ATOM 2278   C C    . ASP B 2 81  ? 25.343  4.815   0.674   1.00 10.00 ? 399 ASP B C    1  
ATOM 2279   O O    . ASP B 2 81  ? 25.482  5.260   -0.465  1.00 10.00 ? 399 ASP B O    1  
ATOM 2280   C CB   . ASP B 2 81  ? 26.940  3.256   1.793   1.00 10.00 ? 399 ASP B CB   1  
ATOM 2281   C CG   . ASP B 2 81  ? 28.315  2.973   1.223   1.00 10.00 ? 399 ASP B CG   1  
ATOM 2282   O OD1  . ASP B 2 81  ? 29.324  3.305   1.884   1.00 10.00 ? 399 ASP B OD1  1  
ATOM 2283   O OD2  . ASP B 2 81  ? 28.395  2.400   0.119   1.00 10.00 ? 399 ASP B OD2  1  
ATOM 2284   H H    . ASP B 2 81  ? 26.227  4.662   3.744   1.00 10.00 ? 399 ASP B H    1  
ATOM 2285   N N    . GLN B 2 82  ? 24.187  4.389   1.164   1.00 10.00 ? 400 GLN B N    1  
ATOM 2286   C CA   . GLN B 2 82  ? 22.950  4.410   0.390   1.00 10.00 ? 400 GLN B CA   1  
ATOM 2287   C C    . GLN B 2 82  ? 22.534  5.838   0.039   1.00 10.00 ? 400 GLN B C    1  
ATOM 2288   O O    . GLN B 2 82  ? 22.177  6.128   -1.106  1.00 10.00 ? 400 GLN B O    1  
ATOM 2289   C CB   . GLN B 2 82  ? 21.827  3.683   1.138   1.00 10.00 ? 400 GLN B CB   1  
ATOM 2290   C CG   . GLN B 2 82  ? 21.728  2.199   0.818   1.00 10.00 ? 400 GLN B CG   1  
ATOM 2291   C CD   . GLN B 2 82  ? 23.082  1.537   0.654   1.00 10.00 ? 400 GLN B CD   1  
ATOM 2292   O OE1  . GLN B 2 82  ? 23.606  1.438   -0.452  1.00 10.00 ? 400 GLN B OE1  1  
ATOM 2293   N NE2  . GLN B 2 82  ? 23.655  1.079   1.754   1.00 10.00 ? 400 GLN B NE2  1  
ATOM 2294   H H    . GLN B 2 82  ? 24.197  4.028   2.074   1.00 10.00 ? 400 GLN B H    1  
ATOM 2295   H HE21 . GLN B 2 82  ? 23.176  1.193   2.605   1.00 10.00 ? 400 GLN B HE21 1  
ATOM 2296   H HE22 . GLN B 2 82  ? 24.531  0.645   1.676   1.00 10.00 ? 400 GLN B HE22 1  
ATOM 2297   N N    . MET B 2 83  ? 22.606  6.725   1.025   1.00 10.00 ? 401 MET B N    1  
ATOM 2298   C CA   . MET B 2 83  ? 22.248  8.131   0.835   1.00 10.00 ? 401 MET B CA   1  
ATOM 2299   C C    . MET B 2 83  ? 23.232  8.811   -0.118  1.00 10.00 ? 401 MET B C    1  
ATOM 2300   O O    . MET B 2 83  ? 22.864  9.713   -0.870  1.00 10.00 ? 401 MET B O    1  
ATOM 2301   C CB   . MET B 2 83  ? 22.246  8.858   2.184   1.00 10.00 ? 401 MET B CB   1  
ATOM 2302   C CG   . MET B 2 83  ? 21.500  10.182  2.185   1.00 10.00 ? 401 MET B CG   1  
ATOM 2303   S SD   . MET B 2 83  ? 19.718  9.972   2.370   1.00 10.00 ? 401 MET B SD   1  
ATOM 2304   C CE   . MET B 2 83  ? 19.144  11.635  2.039   1.00 10.00 ? 401 MET B CE   1  
ATOM 2305   H H    . MET B 2 83  ? 22.907  6.426   1.911   1.00 10.00 ? 401 MET B H    1  
ATOM 2306   N N    . LYS B 2 84  ? 24.477  8.355   -0.071  1.00 10.00 ? 402 LYS B N    1  
ATOM 2307   C CA   . LYS B 2 84  ? 25.535  8.894   -0.925  1.00 10.00 ? 402 LYS B CA   1  
ATOM 2308   C C    . LYS B 2 84  ? 25.205  8.649   -2.392  1.00 10.00 ? 402 LYS B C    1  
ATOM 2309   O O    . LYS B 2 84  ? 25.150  9.581   -3.193  1.00 10.00 ? 402 LYS B O    1  
ATOM 2310   C CB   . LYS B 2 84  ? 26.881  8.256   -0.580  1.00 10.00 ? 402 LYS B CB   1  
ATOM 2311   C CG   . LYS B 2 84  ? 28.035  8.720   -1.452  1.00 10.00 ? 402 LYS B CG   1  
ATOM 2312   C CD   . LYS B 2 84  ? 28.741  9.921   -0.848  1.00 10.00 ? 402 LYS B CD   1  
ATOM 2313   C CE   . LYS B 2 84  ? 29.731  10.528  -1.829  1.00 10.00 ? 402 LYS B CE   1  
ATOM 2314   N NZ   . LYS B 2 84  ? 30.547  9.489   -2.515  1.00 10.00 ? 402 LYS B NZ   1  
ATOM 2315   H H    . LYS B 2 84  ? 24.684  7.626   0.558   1.00 10.00 ? 402 LYS B H    1  
ATOM 2316   H HZ1  . LYS B 2 84  ? 30.557  8.615   -1.954  1.00 10.00 ? 402 LYS B HZ1  1  
ATOM 2317   H HZ2  . LYS B 2 84  ? 31.528  9.822   -2.638  1.00 10.00 ? 402 LYS B HZ2  1  
ATOM 2318   H HZ3  . LYS B 2 84  ? 30.143  9.278   -3.460  1.00 10.00 ? 402 LYS B HZ3  1  
ATOM 2319   N N    . ARG B 2 85  ? 24.961  7.388   -2.723  1.00 10.00 ? 403 ARG B N    1  
ATOM 2320   C CA   . ARG B 2 85  ? 24.637  6.993   -4.088  1.00 10.00 ? 403 ARG B CA   1  
ATOM 2321   C C    . ARG B 2 85  ? 23.318  7.607   -4.542  1.00 10.00 ? 403 ARG B C    1  
ATOM 2322   O O    . ARG B 2 85  ? 23.110  7.850   -5.730  1.00 10.00 ? 403 ARG B O    1  
ATOM 2323   C CB   . ARG B 2 85  ? 24.591  5.470   -4.206  1.00 10.00 ? 403 ARG B CB   1  
ATOM 2324   C CG   . ARG B 2 85  ? 25.941  4.796   -4.026  1.00 10.00 ? 403 ARG B CG   1  
ATOM 2325   C CD   . ARG B 2 85  ? 25.790  3.302   -3.800  1.00 10.00 ? 403 ARG B CD   1  
ATOM 2326   N NE   . ARG B 2 85  ? 25.099  2.644   -4.907  1.00 10.00 ? 403 ARG B NE   1  
ATOM 2327   C CZ   . ARG B 2 85  ? 24.476  1.471   -4.798  1.00 10.00 ? 403 ARG B CZ   1  
ATOM 2328   N NH1  . ARG B 2 85  ? 24.468  0.831   -3.640  1.00 10.00 ? 403 ARG B NH1  1  
ATOM 2329   N NH2  . ARG B 2 85  ? 23.867  0.935   -5.846  1.00 10.00 ? 403 ARG B NH2  1  
ATOM 2330   H H    . ARG B 2 85  ? 24.995  6.699   -2.022  1.00 10.00 ? 403 ARG B H    1  
ATOM 2331   H HE   . ARG B 2 85  ? 25.105  3.101   -5.779  1.00 10.00 ? 403 ARG B HE   1  
ATOM 2332   H HH11 . ARG B 2 85  ? 24.932  1.224   -2.841  1.00 10.00 ? 403 ARG B HH11 1  
ATOM 2333   H HH12 . ARG B 2 85  ? 24.005  -0.055  -3.559  1.00 10.00 ? 403 ARG B HH12 1  
ATOM 2334   H HH21 . ARG B 2 85  ? 23.871  1.408   -6.734  1.00 10.00 ? 403 ARG B HH21 1  
ATOM 2335   H HH22 . ARG B 2 85  ? 23.394  0.051   -5.760  1.00 10.00 ? 403 ARG B HH22 1  
ATOM 2336   N N    . GLY B 2 86  ? 22.425  7.852   -3.586  1.00 10.00 ? 404 GLY B N    1  
ATOM 2337   C CA   . GLY B 2 86  ? 21.146  8.456   -3.909  1.00 10.00 ? 404 GLY B CA   1  
ATOM 2338   C C    . GLY B 2 86  ? 21.324  9.853   -4.464  1.00 10.00 ? 404 GLY B C    1  
ATOM 2339   O O    . GLY B 2 86  ? 20.705  10.217  -5.465  1.00 10.00 ? 404 GLY B O    1  
ATOM 2340   H H    . GLY B 2 86  ? 22.641  7.623   -2.656  1.00 10.00 ? 404 GLY B H    1  
ATOM 2341   N N    . TYR B 2 87  ? 22.190  10.628  -3.824  1.00 10.00 ? 405 TYR B N    1  
ATOM 2342   C CA   . TYR B 2 87  ? 22.462  11.993  -4.252  1.00 10.00 ? 405 TYR B CA   1  
ATOM 2343   C C    . TYR B 2 87  ? 23.321  12.029  -5.511  1.00 10.00 ? 405 TYR B C    1  
ATOM 2344   O O    . TYR B 2 87  ? 23.113  12.875  -6.384  1.00 10.00 ? 405 TYR B O    1  
ATOM 2345   C CB   . TYR B 2 87  ? 23.133  12.785  -3.133  1.00 10.00 ? 405 TYR B CB   1  
ATOM 2346   C CG   . TYR B 2 87  ? 22.215  13.761  -2.435  1.00 10.00 ? 405 TYR B CG   1  
ATOM 2347   C CD1  . TYR B 2 87  ? 21.669  14.836  -3.123  1.00 10.00 ? 405 TYR B CD1  1  
ATOM 2348   C CD2  . TYR B 2 87  ? 21.897  13.612  -1.092  1.00 10.00 ? 405 TYR B CD2  1  
ATOM 2349   C CE1  . TYR B 2 87  ? 20.833  15.735  -2.491  1.00 10.00 ? 405 TYR B CE1  1  
ATOM 2350   C CE2  . TYR B 2 87  ? 21.061  14.507  -0.451  1.00 10.00 ? 405 TYR B CE2  1  
ATOM 2351   C CZ   . TYR B 2 87  ? 20.533  15.567  -1.157  1.00 10.00 ? 405 TYR B CZ   1  
ATOM 2352   O OH   . TYR B 2 87  ? 19.705  16.465  -0.528  1.00 10.00 ? 405 TYR B OH   1  
ATOM 2353   H H    . TYR B 2 87  ? 22.663  10.270  -3.040  1.00 10.00 ? 405 TYR B H    1  
ATOM 2354   H HH   . TYR B 2 87  ? 19.825  16.403  0.424   1.00 10.00 ? 405 TYR B HH   1  
ATOM 2355   N N    . GLU B 2 88  ? 24.281  11.111  -5.603  1.00 10.00 ? 406 GLU B N    1  
ATOM 2356   C CA   . GLU B 2 88  ? 25.170  11.048  -6.761  1.00 10.00 ? 406 GLU B CA   1  
ATOM 2357   C C    . GLU B 2 88  ? 24.385  10.868  -8.055  1.00 10.00 ? 406 GLU B C    1  
ATOM 2358   O O    . GLU B 2 88  ? 24.719  11.461  -9.084  1.00 10.00 ? 406 GLU B O    1  
ATOM 2359   C CB   . GLU B 2 88  ? 26.204  9.930   -6.603  1.00 10.00 ? 406 GLU B CB   1  
ATOM 2360   C CG   . GLU B 2 88  ? 27.233  10.189  -5.513  1.00 10.00 ? 406 GLU B CG   1  
ATOM 2361   C CD   . GLU B 2 88  ? 28.286  9.103   -5.421  1.00 10.00 ? 406 GLU B CD   1  
ATOM 2362   O OE1  . GLU B 2 88  ? 28.006  7.958   -5.833  1.00 10.00 ? 406 GLU B OE1  1  
ATOM 2363   O OE2  . GLU B 2 88  ? 29.402  9.391   -4.930  1.00 10.00 ? 406 GLU B OE2  1  
ATOM 2364   H H    . GLU B 2 88  ? 24.397  10.463  -4.872  1.00 10.00 ? 406 GLU B H    1  
ATOM 2365   N N    . ARG B 2 89  ? 23.334  10.053  -7.998  1.00 10.00 ? 407 ARG B N    1  
ATOM 2366   C CA   . ARG B 2 89  ? 22.496  9.809   -9.166  1.00 10.00 ? 407 ARG B CA   1  
ATOM 2367   C C    . ARG B 2 89  ? 21.711  11.068  -9.529  1.00 10.00 ? 407 ARG B C    1  
ATOM 2368   O O    . ARG B 2 89  ? 21.414  11.312  -10.697 1.00 10.00 ? 407 ARG B O    1  
ATOM 2369   C CB   . ARG B 2 89  ? 21.551  8.620   -8.934  1.00 10.00 ? 407 ARG B CB   1  
ATOM 2370   C CG   . ARG B 2 89  ? 20.873  8.111   -10.202 1.00 10.00 ? 407 ARG B CG   1  
ATOM 2371   C CD   . ARG B 2 89  ? 20.498  6.638   -10.097 1.00 10.00 ? 407 ARG B CD   1  
ATOM 2372   N NE   . ARG B 2 89  ? 19.359  6.400   -9.205  1.00 10.00 ? 407 ARG B NE   1  
ATOM 2373   C CZ   . ARG B 2 89  ? 18.887  5.185   -8.913  1.00 10.00 ? 407 ARG B CZ   1  
ATOM 2374   N NH1  . ARG B 2 89  ? 19.480  4.104   -9.402  1.00 10.00 ? 407 ARG B NH1  1  
ATOM 2375   N NH2  . ARG B 2 89  ? 17.828  5.053   -8.121  1.00 10.00 ? 407 ARG B NH2  1  
ATOM 2376   H H    . ARG B 2 89  ? 23.127  9.597   -7.153  1.00 10.00 ? 407 ARG B H    1  
ATOM 2377   H HE   . ARG B 2 89  ? 18.923  7.185   -8.818  1.00 10.00 ? 407 ARG B HE   1  
ATOM 2378   H HH11 . ARG B 2 89  ? 20.289  4.195   -9.995  1.00 10.00 ? 407 ARG B HH11 1  
ATOM 2379   H HH12 . ARG B 2 89  ? 19.128  3.191   -9.182  1.00 10.00 ? 407 ARG B HH12 1  
ATOM 2380   H HH21 . ARG B 2 89  ? 17.380  5.859   -7.737  1.00 10.00 ? 407 ARG B HH21 1  
ATOM 2381   H HH22 . ARG B 2 89  ? 17.457  4.130   -7.914  1.00 10.00 ? 407 ARG B HH22 1  
ATOM 2382   N N    . ILE B 2 90  ? 21.408  11.879  -8.522  1.00 10.00 ? 408 ILE B N    1  
ATOM 2383   C CA   . ILE B 2 90  ? 20.664  13.117  -8.728  1.00 10.00 ? 408 ILE B CA   1  
ATOM 2384   C C    . ILE B 2 90  ? 21.509  14.112  -9.517  1.00 10.00 ? 408 ILE B C    1  
ATOM 2385   O O    . ILE B 2 90  ? 21.041  14.708  -10.483 1.00 10.00 ? 408 ILE B O    1  
ATOM 2386   C CB   . ILE B 2 90  ? 20.235  13.746  -7.383  1.00 10.00 ? 408 ILE B CB   1  
ATOM 2387   C CG1  . ILE B 2 90  ? 19.199  12.861  -6.686  1.00 10.00 ? 408 ILE B CG1  1  
ATOM 2388   C CG2  . ILE B 2 90  ? 19.696  15.160  -7.574  1.00 10.00 ? 408 ILE B CG2  1  
ATOM 2389   C CD1  . ILE B 2 90  ? 17.930  12.666  -7.485  1.00 10.00 ? 408 ILE B CD1  1  
ATOM 2390   H H    . ILE B 2 90  ? 21.705  11.646  -7.615  1.00 10.00 ? 408 ILE B H    1  
ATOM 2391   N N    . TYR B 2 91  ? 22.755  14.268  -9.097  1.00 10.00 ? 409 TYR B N    1  
ATOM 2392   C CA   . TYR B 2 91  ? 23.695  15.177  -9.765  1.00 10.00 ? 409 TYR B CA   1  
ATOM 2393   C C    . TYR B 2 91  ? 23.832  14.835  -11.248 1.00 10.00 ? 409 TYR B C    1  
ATOM 2394   O O    . TYR B 2 91  ? 24.136  15.696  -12.074 1.00 10.00 ? 409 TYR B O    1  
ATOM 2395   C CB   . TYR B 2 91  ? 25.066  15.154  -9.085  1.00 10.00 ? 409 TYR B CB   1  
ATOM 2396   C CG   . TYR B 2 91  ? 25.042  15.541  -7.623  1.00 10.00 ? 409 TYR B CG   1  
ATOM 2397   C CD1  . TYR B 2 91  ? 24.314  16.641  -7.180  1.00 10.00 ? 409 TYR B CD1  1  
ATOM 2398   C CD2  . TYR B 2 91  ? 25.749  14.804  -6.685  1.00 10.00 ? 409 TYR B CD2  1  
ATOM 2399   C CE1  . TYR B 2 91  ? 24.292  16.993  -5.844  1.00 10.00 ? 409 TYR B CE1  1  
ATOM 2400   C CE2  . TYR B 2 91  ? 25.734  15.150  -5.348  1.00 10.00 ? 409 TYR B CE2  1  
ATOM 2401   C CZ   . TYR B 2 91  ? 25.004  16.244  -4.933  1.00 10.00 ? 409 TYR B CZ   1  
ATOM 2402   O OH   . TYR B 2 91  ? 24.990  16.597  -3.604  1.00 10.00 ? 409 TYR B OH   1  
ATOM 2403   H H    . TYR B 2 91  ? 23.035  13.792  -8.288  1.00 10.00 ? 409 TYR B H    1  
ATOM 2404   H HH   . TYR B 2 91  ? 24.175  17.065  -3.405  1.00 10.00 ? 409 TYR B HH   1  
ATOM 2405   N N    . ASN B 2 92  ? 23.587  13.574  -11.576 1.00 10.00 ? 410 ASN B N    1  
ATOM 2406   C CA   . ASN B 2 92  ? 23.663  13.108  -12.954 1.00 10.00 ? 410 ASN B CA   1  
ATOM 2407   C C    . ASN B 2 92  ? 22.371  13.415  -13.707 1.00 10.00 ? 410 ASN B C    1  
ATOM 2408   O O    . ASN B 2 92  ? 22.400  13.802  -14.875 1.00 10.00 ? 410 ASN B O    1  
ATOM 2409   C CB   . ASN B 2 92  ? 23.952  11.604  -12.991 1.00 10.00 ? 410 ASN B CB   1  
ATOM 2410   C CG   . ASN B 2 92  ? 24.004  11.046  -14.402 1.00 10.00 ? 410 ASN B CG   1  
ATOM 2411   O OD1  . ASN B 2 92  ? 25.043  11.088  -15.057 1.00 10.00 ? 410 ASN B OD1  1  
ATOM 2412   N ND2  . ASN B 2 92  ? 22.886  10.519  -14.879 1.00 10.00 ? 410 ASN B ND2  1  
ATOM 2413   H H    . ASN B 2 92  ? 23.356  12.939  -10.868 1.00 10.00 ? 410 ASN B H    1  
ATOM 2414   H HD21 . ASN B 2 92  ? 22.085  10.518  -14.305 1.00 10.00 ? 410 ASN B HD21 1  
ATOM 2415   H HD22 . ASN B 2 92  ? 22.900  10.152  -15.788 1.00 10.00 ? 410 ASN B HD22 1  
ATOM 2416   N N    . GLU B 2 93  ? 21.244  13.262  -13.021 1.00 10.00 ? 411 GLU B N    1  
ATOM 2417   C CA   . GLU B 2 93  ? 19.937  13.504  -13.623 1.00 10.00 ? 411 GLU B CA   1  
ATOM 2418   C C    . GLU B 2 93  ? 19.644  14.993  -13.792 1.00 10.00 ? 411 GLU B C    1  
ATOM 2419   O O    . GLU B 2 93  ? 18.824  15.373  -14.624 1.00 10.00 ? 411 GLU B O    1  
ATOM 2420   C CB   . GLU B 2 93  ? 18.831  12.864  -12.784 1.00 10.00 ? 411 GLU B CB   1  
ATOM 2421   C CG   . GLU B 2 93  ? 18.953  11.359  -12.622 1.00 10.00 ? 411 GLU B CG   1  
ATOM 2422   C CD   . GLU B 2 93  ? 18.939  10.624  -13.940 1.00 10.00 ? 411 GLU B CD   1  
ATOM 2423   O OE1  . GLU B 2 93  ? 17.837  10.410  -14.495 1.00 10.00 ? 411 GLU B OE1  1  
ATOM 2424   O OE2  . GLU B 2 93  ? 20.027  10.241  -14.421 1.00 10.00 ? 411 GLU B OE2  1  
ATOM 2425   H H    . GLU B 2 93  ? 21.291  12.970  -12.085 1.00 10.00 ? 411 GLU B H    1  
ATOM 2426   N N    . ILE B 2 94  ? 20.309  15.827  -12.996 1.00 10.00 ? 412 ILE B N    1  
ATOM 2427   C CA   . ILE B 2 94  ? 20.110  17.281  -13.044 1.00 10.00 ? 412 ILE B CA   1  
ATOM 2428   C C    . ILE B 2 94  ? 20.105  17.859  -14.472 1.00 10.00 ? 412 ILE B C    1  
ATOM 2429   O O    . ILE B 2 94  ? 19.128  18.500  -14.870 1.00 10.00 ? 412 ILE B O    1  
ATOM 2430   C CB   . ILE B 2 94  ? 21.099  18.050  -12.135 1.00 10.00 ? 412 ILE B CB   1  
ATOM 2431   C CG1  . ILE B 2 94  ? 20.809  17.762  -10.658 1.00 10.00 ? 412 ILE B CG1  1  
ATOM 2432   C CG2  . ILE B 2 94  ? 21.061  19.549  -12.408 1.00 10.00 ? 412 ILE B CG2  1  
ATOM 2433   C CD1  . ILE B 2 94  ? 19.380  18.035  -10.235 1.00 10.00 ? 412 ILE B CD1  1  
ATOM 2434   H H    . ILE B 2 94  ? 20.948  15.456  -12.345 1.00 10.00 ? 412 ILE B H    1  
ATOM 2435   N N    . PRO B 2 95  ? 21.183  17.651  -15.260 1.00 10.00 ? 413 PRO B N    1  
ATOM 2436   C CA   . PRO B 2 95  ? 21.267  18.161  -16.637 1.00 10.00 ? 413 PRO B CA   1  
ATOM 2437   C C    . PRO B 2 95  ? 20.193  17.581  -17.555 1.00 10.00 ? 413 PRO B C    1  
ATOM 2438   O O    . PRO B 2 95  ? 19.786  18.217  -18.524 1.00 10.00 ? 413 PRO B O    1  
ATOM 2439   C CB   . PRO B 2 95  ? 22.655  17.716  -17.113 1.00 10.00 ? 413 PRO B CB   1  
ATOM 2440   C CG   . PRO B 2 95  ? 23.419  17.454  -15.865 1.00 10.00 ? 413 PRO B CG   1  
ATOM 2441   C CD   . PRO B 2 95  ? 22.415  16.940  -14.877 1.00 10.00 ? 413 PRO B CD   1  
ATOM 2442   N N    . ASP B 2 96  ? 19.735  16.374  -17.254 1.00 10.00 ? 414 ASP B N    1  
ATOM 2443   C CA   . ASP B 2 96  ? 18.713  15.733  -18.072 1.00 10.00 ? 414 ASP B CA   1  
ATOM 2444   C C    . ASP B 2 96  ? 17.330  16.295  -17.770 1.00 10.00 ? 414 ASP B C    1  
ATOM 2445   O O    . ASP B 2 96  ? 16.520  16.487  -18.671 1.00 10.00 ? 414 ASP B O    1  
ATOM 2446   C CB   . ASP B 2 96  ? 18.727  14.214  -17.911 1.00 10.00 ? 414 ASP B CB   1  
ATOM 2447   C CG   . ASP B 2 96  ? 17.935  13.521  -19.003 1.00 10.00 ? 414 ASP B CG   1  
ATOM 2448   O OD1  . ASP B 2 96  ? 18.132  13.858  -20.192 1.00 10.00 ? 414 ASP B OD1  1  
ATOM 2449   O OD2  . ASP B 2 96  ? 17.117  12.633  -18.682 1.00 10.00 ? 414 ASP B OD2  1  
ATOM 2450   H H    . ASP B 2 96  ? 20.080  15.911  -16.462 1.00 10.00 ? 414 ASP B H    1  
ATOM 2451   N N    . ILE B 2 97  ? 17.073  16.562  -16.496 1.00 10.00 ? 415 ILE B N    1  
ATOM 2452   C CA   . ILE B 2 97  ? 15.791  17.117  -16.073 1.00 10.00 ? 415 ILE B CA   1  
ATOM 2453   C C    . ILE B 2 97  ? 15.694  18.591  -16.457 1.00 10.00 ? 415 ILE B C    1  
ATOM 2454   O O    . ILE B 2 97  ? 14.685  19.041  -16.998 1.00 10.00 ? 415 ILE B O    1  
ATOM 2455   C CB   . ILE B 2 97  ? 15.580  16.976  -14.548 1.00 10.00 ? 415 ILE B CB   1  
ATOM 2456   C CG1  . ILE B 2 97  ? 15.658  15.505  -14.129 1.00 10.00 ? 415 ILE B CG1  1  
ATOM 2457   C CG2  . ILE B 2 97  ? 14.244  17.580  -14.132 1.00 10.00 ? 415 ILE B CG2  1  
ATOM 2458   C CD1  . ILE B 2 97  ? 15.654  15.295  -12.630 1.00 10.00 ? 415 ILE B CD1  1  
ATOM 2459   H H    . ILE B 2 97  ? 17.759  16.369  -15.821 1.00 10.00 ? 415 ILE B H    1  
ATOM 2460   N N    . ASN B 2 98  ? 16.763  19.335  -16.193 1.00 10.00 ? 416 ASN B N    1  
ATOM 2461   C CA   . ASN B 2 98  ? 16.790  20.759  -16.505 1.00 10.00 ? 416 ASN B CA   1  
ATOM 2462   C C    . ASN B 2 98  ? 16.927  20.999  -17.997 1.00 10.00 ? 416 ASN B C    1  
ATOM 2463   O O    . ASN B 2 98  ? 16.258  21.874  -18.549 1.00 10.00 ? 416 ASN B O    1  
ATOM 2464   C CB   . ASN B 2 98  ? 17.907  21.478  -15.749 1.00 10.00 ? 416 ASN B CB   1  
ATOM 2465   C CG   . ASN B 2 98  ? 17.521  21.805  -14.321 1.00 10.00 ? 416 ASN B CG   1  
ATOM 2466   O OD1  . ASN B 2 98  ? 16.878  22.823  -14.051 1.00 10.00 ? 416 ASN B OD1  1  
ATOM 2467   N ND2  . ASN B 2 98  ? 17.925  20.954  -13.389 1.00 10.00 ? 416 ASN B ND2  1  
ATOM 2468   H H    . ASN B 2 98  ? 17.552  18.915  -15.786 1.00 10.00 ? 416 ASN B H    1  
ATOM 2469   H HD21 . ASN B 2 98  ? 18.447  20.173  -13.672 1.00 10.00 ? 416 ASN B HD21 1  
ATOM 2470   H HD22 . ASN B 2 98  ? 17.684  21.139  -12.453 1.00 10.00 ? 416 ASN B HD22 1  
ATOM 2471   N N    . LEU B 2 99  ? 17.794  20.215  -18.633 1.00 10.00 ? 417 LEU B N    1  
ATOM 2472   C CA   . LEU B 2 99  ? 18.039  20.314  -20.070 1.00 10.00 ? 417 LEU B CA   1  
ATOM 2473   C C    . LEU B 2 99  ? 18.379  21.742  -20.486 1.00 10.00 ? 417 LEU B C    1  
ATOM 2474   O O    . LEU B 2 99  ? 17.610  22.385  -21.204 1.00 10.00 ? 417 LEU B O    1  
ATOM 2475   C CB   . LEU B 2 99  ? 16.845  19.786  -20.863 1.00 10.00 ? 417 LEU B CB   1  
ATOM 2476   C CG   . LEU B 2 99  ? 17.103  19.482  -22.339 1.00 10.00 ? 417 LEU B CG   1  
ATOM 2477   C CD1  . LEU B 2 99  ? 17.752  18.116  -22.501 1.00 10.00 ? 417 LEU B CD1  1  
ATOM 2478   C CD2  . LEU B 2 99  ? 15.813  19.574  -23.135 1.00 10.00 ? 417 LEU B CD2  1  
ATOM 2479   H H    . LEU B 2 99  ? 18.287  19.543  -18.120 1.00 10.00 ? 417 LEU B H    1  
ATOM 2480   N N    . ASP B 2 100 ? 19.528  22.223  -20.007 1.00 10.00 ? 418 ASP B N    1  
ATOM 2481   C CA   . ASP B 2 100 ? 20.023  23.575  -20.298 1.00 10.00 ? 418 ASP B CA   1  
ATOM 2482   C C    . ASP B 2 100 ? 19.320  24.627  -19.439 1.00 10.00 ? 418 ASP B C    1  
ATOM 2483   O O    . ASP B 2 100 ? 18.091  24.651  -19.355 1.00 10.00 ? 418 ASP B O    1  
ATOM 2484   C CB   . ASP B 2 100 ? 19.948  23.913  -21.793 1.00 10.00 ? 418 ASP B CB   1  
ATOM 2485   C CG   . ASP B 2 100 ? 20.615  25.227  -22.142 1.00 10.00 ? 418 ASP B CG   1  
ATOM 2486   O OD1  . ASP B 2 100 ? 21.756  25.461  -21.692 1.00 10.00 ? 418 ASP B OD1  1  
ATOM 2487   O OD2  . ASP B 2 100 ? 20.004  26.027  -22.880 1.00 10.00 ? 418 ASP B OD2  1  
ATOM 2488   H H    . ASP B 2 100 ? 20.061  21.649  -19.420 1.00 10.00 ? 418 ASP B H    1  
ATOM 2489   N N    . VAL B 2 101 ? 20.113  25.492  -18.805 1.00 10.00 ? 419 VAL B N    1  
ATOM 2490   C CA   . VAL B 2 101 ? 19.595  26.543  -17.917 1.00 10.00 ? 419 VAL B CA   1  
ATOM 2491   C C    . VAL B 2 101 ? 18.865  25.932  -16.715 1.00 10.00 ? 419 VAL B C    1  
ATOM 2492   O O    . VAL B 2 101 ? 17.633  25.846  -16.686 1.00 10.00 ? 419 VAL B O    1  
ATOM 2493   C CB   . VAL B 2 101 ? 18.700  27.579  -18.640 1.00 10.00 ? 419 VAL B CB   1  
ATOM 2494   C CG1  . VAL B 2 101 ? 18.330  28.713  -17.695 1.00 10.00 ? 419 VAL B CG1  1  
ATOM 2495   C CG2  . VAL B 2 101 ? 19.412  28.131  -19.866 1.00 10.00 ? 419 VAL B CG2  1  
ATOM 2496   H H    . VAL B 2 101 ? 21.081  25.426  -18.939 1.00 10.00 ? 419 VAL B H    1  
ATOM 2497   N N    . PRO B 2 102 ? 19.627  25.482  -15.708 1.00 10.00 ? 420 PRO B N    1  
ATOM 2498   C CA   . PRO B 2 102 ? 19.080  24.857  -14.507 1.00 10.00 ? 420 PRO B CA   1  
ATOM 2499   C C    . PRO B 2 102 ? 18.546  25.864  -13.491 1.00 10.00 ? 420 PRO B C    1  
ATOM 2500   O O    . PRO B 2 102 ? 19.256  26.282  -12.575 1.00 10.00 ? 420 PRO B O    1  
ATOM 2501   C CB   . PRO B 2 102 ? 20.276  24.081  -13.921 1.00 10.00 ? 420 PRO B CB   1  
ATOM 2502   C CG   . PRO B 2 102 ? 21.411  24.290  -14.876 1.00 10.00 ? 420 PRO B CG   1  
ATOM 2503   C CD   . PRO B 2 102 ? 21.089  25.531  -15.655 1.00 10.00 ? 420 PRO B CD   1  
ATOM 2504   N N    . HIS B 2 103 ? 17.284  26.254  -13.644 1.00 10.00 ? 421 HIS B N    1  
ATOM 2505   C CA   . HIS B 2 103 ? 16.663  27.201  -12.725 1.00 10.00 ? 421 HIS B CA   1  
ATOM 2506   C C    . HIS B 2 103 ? 16.341  26.544  -11.385 1.00 10.00 ? 421 HIS B C    1  
ATOM 2507   O O    . HIS B 2 103 ? 16.034  27.220  -10.405 1.00 10.00 ? 421 HIS B O    1  
ATOM 2508   C CB   . HIS B 2 103 ? 15.394  27.808  -13.329 1.00 10.00 ? 421 HIS B CB   1  
ATOM 2509   C CG   . HIS B 2 103 ? 15.649  28.928  -14.291 1.00 10.00 ? 421 HIS B CG   1  
ATOM 2510   N ND1  . HIS B 2 103 ? 15.005  29.039  -15.503 1.00 10.00 ? 421 HIS B ND1  1  
ATOM 2511   C CD2  . HIS B 2 103 ? 16.473  30.000  -14.206 1.00 10.00 ? 421 HIS B CD2  1  
ATOM 2512   C CE1  . HIS B 2 103 ? 15.419  30.130  -16.120 1.00 10.00 ? 421 HIS B CE1  1  
ATOM 2513   N NE2  . HIS B 2 103 ? 16.310  30.731  -15.355 1.00 10.00 ? 421 HIS B NE2  1  
ATOM 2514   H H    . HIS B 2 103 ? 16.766  25.913  -14.408 1.00 10.00 ? 421 HIS B H    1  
ATOM 2515   H HD1  . HIS B 2 103 ? 14.336  28.408  -15.860 1.00 10.00 ? 421 HIS B HD1  1  
ATOM 2516   H HE2  . HIS B 2 103 ? 16.850  31.513  -15.618 1.00 10.00 ? 421 HIS B HE2  1  
ATOM 2517   N N    . SER B 2 104 ? 16.438  25.220  -11.344 1.00 10.00 ? 422 SER B N    1  
ATOM 2518   C CA   . SER B 2 104 ? 16.156  24.472  -10.129 1.00 10.00 ? 422 SER B CA   1  
ATOM 2519   C C    . SER B 2 104 ? 17.364  24.471  -9.194  1.00 10.00 ? 422 SER B C    1  
ATOM 2520   O O    . SER B 2 104 ? 17.357  23.802  -8.159  1.00 10.00 ? 422 SER B O    1  
ATOM 2521   C CB   . SER B 2 104 ? 15.733  23.041  -10.467 1.00 10.00 ? 422 SER B CB   1  
ATOM 2522   O OG   . SER B 2 104 ? 16.634  22.455  -11.386 1.00 10.00 ? 422 SER B OG   1  
ATOM 2523   H H    . SER B 2 104 ? 16.711  24.736  -12.149 1.00 10.00 ? 422 SER B H    1  
ATOM 2524   H HG   . SER B 2 104 ? 16.326  22.619  -12.287 1.00 10.00 ? 422 SER B HG   1  
ATOM 2525   N N    . TYR B 2 105 ? 18.394  25.236  -9.562  1.00 10.00 ? 423 TYR B N    1  
ATOM 2526   C CA   . TYR B 2 105 ? 19.613  25.340  -8.762  1.00 10.00 ? 423 TYR B CA   1  
ATOM 2527   C C    . TYR B 2 105 ? 19.299  25.813  -7.349  1.00 10.00 ? 423 TYR B C    1  
ATOM 2528   O O    . TYR B 2 105 ? 19.953  25.409  -6.389  1.00 10.00 ? 423 TYR B O    1  
ATOM 2529   C CB   . TYR B 2 105 ? 20.617  26.290  -9.423  1.00 10.00 ? 423 TYR B CB   1  
ATOM 2530   C CG   . TYR B 2 105 ? 21.752  25.588  -10.135 1.00 10.00 ? 423 TYR B CG   1  
ATOM 2531   C CD1  . TYR B 2 105 ? 22.135  24.305  -9.771  1.00 10.00 ? 423 TYR B CD1  1  
ATOM 2532   C CD2  . TYR B 2 105 ? 22.439  26.209  -11.170 1.00 10.00 ? 423 TYR B CD2  1  
ATOM 2533   C CE1  . TYR B 2 105 ? 23.170  23.659  -10.418 1.00 10.00 ? 423 TYR B CE1  1  
ATOM 2534   C CE2  . TYR B 2 105 ? 23.476  25.569  -11.822 1.00 10.00 ? 423 TYR B CE2  1  
ATOM 2535   C CZ   . TYR B 2 105 ? 23.836  24.295  -11.442 1.00 10.00 ? 423 TYR B CZ   1  
ATOM 2536   O OH   . TYR B 2 105 ? 24.867  23.655  -12.089 1.00 10.00 ? 423 TYR B OH   1  
ATOM 2537   H H    . TYR B 2 105 ? 18.331  25.744  -10.399 1.00 10.00 ? 423 TYR B H    1  
ATOM 2538   H HH   . TYR B 2 105 ? 25.617  24.252  -12.161 1.00 10.00 ? 423 TYR B HH   1  
ATOM 2539   N N    . SER B 2 106 ? 18.288  26.669  -7.233  1.00 10.00 ? 424 SER B N    1  
ATOM 2540   C CA   . SER B 2 106 ? 17.867  27.191  -5.942  1.00 10.00 ? 424 SER B CA   1  
ATOM 2541   C C    . SER B 2 106 ? 17.382  26.048  -5.052  1.00 10.00 ? 424 SER B C    1  
ATOM 2542   O O    . SER B 2 106 ? 17.760  25.954  -3.884  1.00 10.00 ? 424 SER B O    1  
ATOM 2543   C CB   . SER B 2 106 ? 16.756  28.233  -6.128  1.00 10.00 ? 424 SER B CB   1  
ATOM 2544   O OG   . SER B 2 106 ? 16.204  28.631  -4.884  1.00 10.00 ? 424 SER B OG   1  
ATOM 2545   H H    . SER B 2 106 ? 17.817  26.961  -8.041  1.00 10.00 ? 424 SER B H    1  
ATOM 2546   H HG   . SER B 2 106 ? 16.401  29.564  -4.725  1.00 10.00 ? 424 SER B HG   1  
ATOM 2547   N N    . VAL B 2 107 ? 16.562  25.171  -5.625  1.00 10.00 ? 425 VAL B N    1  
ATOM 2548   C CA   . VAL B 2 107 ? 16.023  24.027  -4.896  1.00 10.00 ? 425 VAL B CA   1  
ATOM 2549   C C    . VAL B 2 107 ? 17.148  23.051  -4.564  1.00 10.00 ? 425 VAL B C    1  
ATOM 2550   O O    . VAL B 2 107 ? 17.279  22.600  -3.429  1.00 10.00 ? 425 VAL B O    1  
ATOM 2551   C CB   . VAL B 2 107 ? 14.943  23.289  -5.723  1.00 10.00 ? 425 VAL B CB   1  
ATOM 2552   C CG1  . VAL B 2 107 ? 14.348  22.135  -4.928  1.00 10.00 ? 425 VAL B CG1  1  
ATOM 2553   C CG2  . VAL B 2 107 ? 13.856  24.253  -6.172  1.00 10.00 ? 425 VAL B CG2  1  
ATOM 2554   H H    . VAL B 2 107 ? 16.321  25.293  -6.565  1.00 10.00 ? 425 VAL B H    1  
ATOM 2555   N N    . LEU B 2 108 ? 17.945  22.748  -5.575  1.00 10.00 ? 426 LEU B N    1  
ATOM 2556   C CA   . LEU B 2 108 ? 19.074  21.828  -5.430  1.00 10.00 ? 426 LEU B CA   1  
ATOM 2557   C C    . LEU B 2 108 ? 19.996  22.222  -4.276  1.00 10.00 ? 426 LEU B C    1  
ATOM 2558   O O    . LEU B 2 108 ? 20.264  21.411  -3.388  1.00 10.00 ? 426 LEU B O    1  
ATOM 2559   C CB   . LEU B 2 108 ? 19.869  21.735  -6.737  1.00 10.00 ? 426 LEU B CB   1  
ATOM 2560   C CG   . LEU B 2 108 ? 21.092  20.811  -6.729  1.00 10.00 ? 426 LEU B CG   1  
ATOM 2561   C CD1  . LEU B 2 108 ? 20.672  19.364  -6.515  1.00 10.00 ? 426 LEU B CD1  1  
ATOM 2562   C CD2  . LEU B 2 108 ? 21.882  20.958  -8.020  1.00 10.00 ? 426 LEU B CD2  1  
ATOM 2563   H H    . LEU B 2 108 ? 17.755  23.132  -6.460  1.00 10.00 ? 426 LEU B H    1  
ATOM 2564   N N    . GLU B 2 109 ? 20.459  23.465  -4.286  1.00 10.00 ? 427 GLU B N    1  
ATOM 2565   C CA   . GLU B 2 109 ? 21.365  23.949  -3.254  1.00 10.00 ? 427 GLU B CA   1  
ATOM 2566   C C    . GLU B 2 109 ? 20.739  23.917  -1.864  1.00 10.00 ? 427 GLU B C    1  
ATOM 2567   O O    . GLU B 2 109 ? 21.287  23.301  -0.959  1.00 10.00 ? 427 GLU B O    1  
ATOM 2568   C CB   . GLU B 2 109 ? 21.850  25.356  -3.594  1.00 10.00 ? 427 GLU B CB   1  
ATOM 2569   C CG   . GLU B 2 109 ? 22.987  25.381  -4.598  1.00 10.00 ? 427 GLU B CG   1  
ATOM 2570   C CD   . GLU B 2 109 ? 24.282  24.874  -4.003  1.00 10.00 ? 427 GLU B CD   1  
ATOM 2571   O OE1  . GLU B 2 109 ? 24.927  25.633  -3.248  1.00 10.00 ? 427 GLU B OE1  1  
ATOM 2572   O OE2  . GLU B 2 109 ? 24.661  23.718  -4.276  1.00 10.00 ? 427 GLU B OE2  1  
ATOM 2573   H H    . GLU B 2 109 ? 20.184  24.075  -5.005  1.00 10.00 ? 427 GLU B H    1  
ATOM 2574   N N    . ARG B 2 110 ? 19.598  24.581  -1.708  1.00 10.00 ? 428 ARG B N    1  
ATOM 2575   C CA   . ARG B 2 110 ? 18.908  24.625  -0.418  1.00 10.00 ? 428 ARG B CA   1  
ATOM 2576   C C    . ARG B 2 110 ? 18.656  23.231  0.157   1.00 10.00 ? 428 ARG B C    1  
ATOM 2577   O O    . ARG B 2 110 ? 18.884  22.995  1.346   1.00 10.00 ? 428 ARG B O    1  
ATOM 2578   C CB   . ARG B 2 110 ? 17.625  25.459  -0.472  1.00 10.00 ? 428 ARG B CB   1  
ATOM 2579   C CG   . ARG B 2 110 ? 16.485  24.836  -1.255  1.00 10.00 ? 428 ARG B CG   1  
ATOM 2580   C CD   . ARG B 2 110 ? 15.278  25.756  -1.286  1.00 10.00 ? 428 ARG B CD   1  
ATOM 2581   N NE   . ARG B 2 110 ? 14.710  25.956  0.047   1.00 10.00 ? 428 ARG B NE   1  
ATOM 2582   C CZ   . ARG B 2 110 ? 13.585  26.630  0.284   1.00 10.00 ? 428 ARG B CZ   1  
ATOM 2583   N NH1  . ARG B 2 110 ? 12.898  27.164  -0.721  1.00 10.00 ? 428 ARG B NH1  1  
ATOM 2584   N NH2  . ARG B 2 110 ? 13.147  26.779  1.528   1.00 10.00 ? 428 ARG B NH2  1  
ATOM 2585   H H    . ARG B 2 110 ? 19.267  25.098  -2.475  1.00 10.00 ? 428 ARG B H    1  
ATOM 2586   H HE   . ARG B 2 110 ? 15.202  25.570  0.808   1.00 10.00 ? 428 ARG B HE   1  
ATOM 2587   H HH11 . ARG B 2 110 ? 13.223  27.067  -1.667  1.00 10.00 ? 428 ARG B HH11 1  
ATOM 2588   H HH12 . ARG B 2 110 ? 12.052  27.671  -0.536  1.00 10.00 ? 428 ARG B HH12 1  
ATOM 2589   H HH21 . ARG B 2 110 ? 13.666  26.391  2.297   1.00 10.00 ? 428 ARG B HH21 1  
ATOM 2590   H HH22 . ARG B 2 110 ? 12.300  27.284  1.707   1.00 10.00 ? 428 ARG B HH22 1  
ATOM 2591   N N    . PHE B 2 111 ? 18.181  22.321  -0.688  1.00 10.00 ? 429 PHE B N    1  
ATOM 2592   C CA   . PHE B 2 111 ? 17.914  20.943  -0.285  1.00 10.00 ? 429 PHE B CA   1  
ATOM 2593   C C    . PHE B 2 111 ? 19.165  20.268  0.274   1.00 10.00 ? 429 PHE B C    1  
ATOM 2594   O O    . PHE B 2 111 ? 19.136  19.694  1.364   1.00 10.00 ? 429 PHE B O    1  
ATOM 2595   C CB   . PHE B 2 111 ? 17.348  20.144  -1.466  1.00 10.00 ? 429 PHE B CB   1  
ATOM 2596   C CG   . PHE B 2 111 ? 16.849  18.772  -1.105  1.00 10.00 ? 429 PHE B CG   1  
ATOM 2597   C CD1  . PHE B 2 111 ? 16.074  18.575  0.025   1.00 10.00 ? 429 PHE B CD1  1  
ATOM 2598   C CD2  . PHE B 2 111 ? 17.157  17.679  -1.897  1.00 10.00 ? 429 PHE B CD2  1  
ATOM 2599   C CE1  . PHE B 2 111 ? 15.616  17.315  0.359   1.00 10.00 ? 429 PHE B CE1  1  
ATOM 2600   C CE2  . PHE B 2 111 ? 16.702  16.415  -1.569  1.00 10.00 ? 429 PHE B CE2  1  
ATOM 2601   C CZ   . PHE B 2 111 ? 15.931  16.232  -0.439  1.00 10.00 ? 429 PHE B CZ   1  
ATOM 2602   H H    . PHE B 2 111 ? 17.928  22.605  -1.595  1.00 10.00 ? 429 PHE B H    1  
ATOM 2603   N N    . VAL B 2 112 ? 20.270  20.347  -0.464  1.00 10.00 ? 430 VAL B N    1  
ATOM 2604   C CA   . VAL B 2 112 ? 21.526  19.747  -0.023  1.00 10.00 ? 430 VAL B CA   1  
ATOM 2605   C C    . VAL B 2 112 ? 22.065  20.497  1.195   1.00 10.00 ? 430 VAL B C    1  
ATOM 2606   O O    . VAL B 2 112 ? 22.602  19.897  2.132   1.00 10.00 ? 430 VAL B O    1  
ATOM 2607   C CB   . VAL B 2 112 ? 22.588  19.758  -1.149  1.00 10.00 ? 430 VAL B CB   1  
ATOM 2608   C CG1  . VAL B 2 112 ? 23.885  19.113  -0.683  1.00 10.00 ? 430 VAL B CG1  1  
ATOM 2609   C CG2  . VAL B 2 112 ? 22.057  19.056  -2.389  1.00 10.00 ? 430 VAL B CG2  1  
ATOM 2610   H H    . VAL B 2 112 ? 20.247  20.819  -1.326  1.00 10.00 ? 430 VAL B H    1  
ATOM 2611   N N    . GLU B 2 113 ? 21.898  21.817  1.167   1.00 10.00 ? 431 GLU B N    1  
ATOM 2612   C CA   . GLU B 2 113 ? 22.335  22.696  2.243   1.00 10.00 ? 431 GLU B CA   1  
ATOM 2613   C C    . GLU B 2 113 ? 21.696  22.280  3.563   1.00 10.00 ? 431 GLU B C    1  
ATOM 2614   O O    . GLU B 2 113 ? 22.375  22.166  4.588   1.00 10.00 ? 431 GLU B O    1  
ATOM 2615   C CB   . GLU B 2 113 ? 21.955  24.143  1.897   1.00 10.00 ? 431 GLU B CB   1  
ATOM 2616   C CG   . GLU B 2 113 ? 22.293  25.175  2.955   1.00 10.00 ? 431 GLU B CG   1  
ATOM 2617   C CD   . GLU B 2 113 ? 21.900  26.579  2.538   1.00 10.00 ? 431 GLU B CD   1  
ATOM 2618   O OE1  . GLU B 2 113 ? 20.732  26.963  2.749   1.00 10.00 ? 431 GLU B OE1  1  
ATOM 2619   O OE2  . GLU B 2 113 ? 22.761  27.309  2.005   1.00 10.00 ? 431 GLU B OE2  1  
ATOM 2620   H H    . GLU B 2 113 ? 21.466  22.221  0.377   1.00 10.00 ? 431 GLU B H    1  
ATOM 2621   N N    . GLU B 2 114 ? 20.387  22.049  3.525   1.00 10.00 ? 432 GLU B N    1  
ATOM 2622   C CA   . GLU B 2 114 ? 19.646  21.628  4.705   1.00 10.00 ? 432 GLU B CA   1  
ATOM 2623   C C    . GLU B 2 114 ? 20.116  20.248  5.155   1.00 10.00 ? 432 GLU B C    1  
ATOM 2624   O O    . GLU B 2 114 ? 20.356  20.024  6.338   1.00 10.00 ? 432 GLU B O    1  
ATOM 2625   C CB   . GLU B 2 114 ? 18.138  21.625  4.425   1.00 10.00 ? 432 GLU B CB   1  
ATOM 2626   C CG   . GLU B 2 114 ? 17.272  21.308  5.634   1.00 10.00 ? 432 GLU B CG   1  
ATOM 2627   C CD   . GLU B 2 114 ? 17.580  22.186  6.831   1.00 10.00 ? 432 GLU B CD   1  
ATOM 2628   O OE1  . GLU B 2 114 ? 17.169  23.366  6.839   1.00 10.00 ? 432 GLU B OE1  1  
ATOM 2629   O OE2  . GLU B 2 114 ? 18.223  21.697  7.777   1.00 10.00 ? 432 GLU B OE2  1  
ATOM 2630   H H    . GLU B 2 114 ? 19.903  22.176  2.676   1.00 10.00 ? 432 GLU B H    1  
ATOM 2631   N N    . CYS B 2 115 ? 20.267  19.339  4.200   1.00 10.00 ? 433 CYS B N    1  
ATOM 2632   C CA   . CYS B 2 115 ? 20.728  17.986  4.499   1.00 10.00 ? 433 CYS B CA   1  
ATOM 2633   C C    . CYS B 2 115 ? 22.069  18.012  5.226   1.00 10.00 ? 433 CYS B C    1  
ATOM 2634   O O    . CYS B 2 115 ? 22.229  17.363  6.262   1.00 10.00 ? 433 CYS B O    1  
ATOM 2635   C CB   . CYS B 2 115 ? 20.814  17.145  3.231   1.00 10.00 ? 433 CYS B CB   1  
ATOM 2636   S SG   . CYS B 2 115 ? 19.221  16.848  2.430   1.00 10.00 ? 433 CYS B SG   1  
ATOM 2637   H H    . CYS B 2 115 ? 20.008  19.568  3.281   1.00 10.00 ? 433 CYS B H    1  
ATOM 2638   H HG   . CYS B 2 115 ? 18.759  18.016  1.997   1.00 10.00 ? 433 CYS B HG   1  
ATOM 2639   N N    . PHE B 2 116 ? 23.045  18.731  4.675   1.00 10.00 ? 434 PHE B N    1  
ATOM 2640   C CA   . PHE B 2 116 ? 24.350  18.859  5.316   1.00 10.00 ? 434 PHE B CA   1  
ATOM 2641   C C    . PHE B 2 116 ? 24.211  19.433  6.730   1.00 10.00 ? 434 PHE B C    1  
ATOM 2642   O O    . PHE B 2 116 ? 24.781  18.897  7.681   1.00 10.00 ? 434 PHE B O    1  
ATOM 2643   C CB   . PHE B 2 116 ? 25.262  19.744  4.457   1.00 10.00 ? 434 PHE B CB   1  
ATOM 2644   C CG   . PHE B 2 116 ? 26.581  20.088  5.087   1.00 10.00 ? 434 PHE B CG   1  
ATOM 2645   C CD1  . PHE B 2 116 ? 27.518  19.101  5.355   1.00 10.00 ? 434 PHE B CD1  1  
ATOM 2646   C CD2  . PHE B 2 116 ? 26.882  21.400  5.410   1.00 10.00 ? 434 PHE B CD2  1  
ATOM 2647   C CE1  . PHE B 2 116 ? 28.731  19.416  5.932   1.00 10.00 ? 434 PHE B CE1  1  
ATOM 2648   C CE2  . PHE B 2 116 ? 28.093  21.722  5.987   1.00 10.00 ? 434 PHE B CE2  1  
ATOM 2649   C CZ   . PHE B 2 116 ? 29.018  20.728  6.248   1.00 10.00 ? 434 PHE B CZ   1  
ATOM 2650   H H    . PHE B 2 116 ? 22.932  19.132  3.784   1.00 10.00 ? 434 PHE B H    1  
ATOM 2651   N N    . GLN B 2 117 ? 23.444  20.520  6.858   1.00 10.00 ? 435 GLN B N    1  
ATOM 2652   C CA   . GLN B 2 117 ? 23.220  21.153  8.156   1.00 10.00 ? 435 GLN B CA   1  
ATOM 2653   C C    . GLN B 2 117 ? 22.599  20.164  9.141   1.00 10.00 ? 435 GLN B C    1  
ATOM 2654   O O    . GLN B 2 117 ? 22.927  20.169  10.327  1.00 10.00 ? 435 GLN B O    1  
ATOM 2655   C CB   . GLN B 2 117 ? 22.328  22.386  8.017   1.00 10.00 ? 435 GLN B CB   1  
ATOM 2656   C CG   . GLN B 2 117 ? 23.027  23.595  7.420   1.00 10.00 ? 435 GLN B CG   1  
ATOM 2657   C CD   . GLN B 2 117 ? 22.136  24.818  7.383   1.00 10.00 ? 435 GLN B CD   1  
ATOM 2658   O OE1  . GLN B 2 117 ? 22.145  25.636  8.302   1.00 10.00 ? 435 GLN B OE1  1  
ATOM 2659   N NE2  . GLN B 2 117 ? 21.362  24.951  6.322   1.00 10.00 ? 435 GLN B NE2  1  
ATOM 2660   H H    . GLN B 2 117 ? 23.057  20.920  6.047   1.00 10.00 ? 435 GLN B H    1  
ATOM 2661   H HE21 . GLN B 2 117 ? 21.407  24.259  5.628   1.00 10.00 ? 435 GLN B HE21 1  
ATOM 2662   H HE22 . GLN B 2 117 ? 20.783  25.737  6.267   1.00 10.00 ? 435 GLN B HE22 1  
ATOM 2663   N N    . ALA B 2 118 ? 21.698  19.317  8.648   1.00 10.00 ? 436 ALA B N    1  
ATOM 2664   C CA   . ALA B 2 118 ? 21.050  18.308  9.483   1.00 10.00 ? 436 ALA B CA   1  
ATOM 2665   C C    . ALA B 2 118 ? 22.071  17.334  10.071  1.00 10.00 ? 436 ALA B C    1  
ATOM 2666   O O    . ALA B 2 118 ? 21.834  16.719  11.108  1.00 10.00 ? 436 ALA B O    1  
ATOM 2667   C CB   . ALA B 2 118 ? 19.994  17.556  8.684   1.00 10.00 ? 436 ALA B CB   1  
ATOM 2668   H H    . ALA B 2 118 ? 21.420  19.411  7.710   1.00 10.00 ? 436 ALA B H    1  
ATOM 2669   N N    . GLY B 2 119 ? 23.213  17.203  9.404   1.00 10.00 ? 437 GLY B N    1  
ATOM 2670   C CA   . GLY B 2 119 ? 24.263  16.324  9.887   1.00 10.00 ? 437 GLY B CA   1  
ATOM 2671   C C    . GLY B 2 119 ? 24.051  14.876  9.501   1.00 10.00 ? 437 GLY B C    1  
ATOM 2672   O O    . GLY B 2 119 ? 24.387  13.970  10.262  1.00 10.00 ? 437 GLY B O    1  
ATOM 2673   H H    . GLY B 2 119 ? 23.351  17.717  8.580   1.00 10.00 ? 437 GLY B H    1  
ATOM 2674   N N    . ILE B 2 120 ? 23.486  14.650  8.324   1.00 10.00 ? 438 ILE B N    1  
ATOM 2675   C CA   . ILE B 2 120 ? 23.238  13.288  7.861   1.00 10.00 ? 438 ILE B CA   1  
ATOM 2676   C C    . ILE B 2 120 ? 24.264  12.859  6.817   1.00 10.00 ? 438 ILE B C    1  
ATOM 2677   O O    . ILE B 2 120 ? 24.492  11.669  6.610   1.00 10.00 ? 438 ILE B O    1  
ATOM 2678   C CB   . ILE B 2 120 ? 21.810  13.112  7.299   1.00 10.00 ? 438 ILE B CB   1  
ATOM 2679   C CG1  . ILE B 2 120 ? 21.565  14.076  6.136   1.00 10.00 ? 438 ILE B CG1  1  
ATOM 2680   C CG2  . ILE B 2 120 ? 20.776  13.324  8.397   1.00 10.00 ? 438 ILE B CG2  1  
ATOM 2681   C CD1  . ILE B 2 120 ? 20.348  13.733  5.302   1.00 10.00 ? 438 ILE B CD1  1  
ATOM 2682   H H    . ILE B 2 120 ? 23.220  15.410  7.763   1.00 10.00 ? 438 ILE B H    1  
ATOM 2683   N N    . ILE B 2 121 ? 24.882  13.842  6.169   1.00 10.00 ? 439 ILE B N    1  
ATOM 2684   C CA   . ILE B 2 121 ? 25.890  13.596  5.144   1.00 10.00 ? 439 ILE B CA   1  
ATOM 2685   C C    . ILE B 2 121 ? 27.050  14.572  5.333   1.00 10.00 ? 439 ILE B C    1  
ATOM 2686   O O    . ILE B 2 121 ? 26.831  15.735  5.676   1.00 10.00 ? 439 ILE B O    1  
ATOM 2687   C CB   . ILE B 2 121 ? 25.310  13.783  3.724   1.00 10.00 ? 439 ILE B CB   1  
ATOM 2688   C CG1  . ILE B 2 121 ? 24.571  15.124  3.606   1.00 10.00 ? 439 ILE B CG1  1  
ATOM 2689   C CG2  . ILE B 2 121 ? 24.391  12.627  3.359   1.00 10.00 ? 439 ILE B CG2  1  
ATOM 2690   C CD1  . ILE B 2 121 ? 24.382  15.602  2.181   1.00 10.00 ? 439 ILE B CD1  1  
ATOM 2691   H H    . ILE B 2 121 ? 24.668  14.769  6.403   1.00 10.00 ? 439 ILE B H    1  
ATOM 2692   N N    . SER B 2 122 ? 28.281  14.116  5.143   1.00 10.00 ? 440 SER B N    1  
ATOM 2693   C CA   . SER B 2 122 ? 29.439  14.977  5.302   1.00 10.00 ? 440 SER B CA   1  
ATOM 2694   C C    . SER B 2 122 ? 29.666  15.899  4.099   1.00 10.00 ? 440 SER B C    1  
ATOM 2695   O O    . SER B 2 122 ? 28.910  15.879  3.119   1.00 10.00 ? 440 SER B O    1  
ATOM 2696   C CB   . SER B 2 122 ? 30.662  14.095  5.532   1.00 10.00 ? 440 SER B CB   1  
ATOM 2697   O OG   . SER B 2 122 ? 30.333  12.734  5.300   1.00 10.00 ? 440 SER B OG   1  
ATOM 2698   H H    . SER B 2 122 ? 28.456  13.172  4.942   1.00 10.00 ? 440 SER B H    1  
ATOM 2699   H HG   . SER B 2 122 ? 30.140  12.301  6.139   1.00 10.00 ? 440 SER B HG   1  
ATOM 2700   N N    . LYS B 2 123 ? 30.738  16.684  4.184   1.00 10.00 ? 441 LYS B N    1  
ATOM 2701   C CA   . LYS B 2 123 ? 31.106  17.640  3.142   1.00 10.00 ? 441 LYS B CA   1  
ATOM 2702   C C    . LYS B 2 123 ? 31.423  16.977  1.806   1.00 10.00 ? 441 LYS B C    1  
ATOM 2703   O O    . LYS B 2 123 ? 31.251  17.590  0.756   1.00 10.00 ? 441 LYS B O    1  
ATOM 2704   C CB   . LYS B 2 123 ? 32.304  18.484  3.593   1.00 10.00 ? 441 LYS B CB   1  
ATOM 2705   C CG   . LYS B 2 123 ? 32.019  19.418  4.758   1.00 10.00 ? 441 LYS B CG   1  
ATOM 2706   C CD   . LYS B 2 123 ? 33.259  20.205  5.164   1.00 10.00 ? 441 LYS B CD   1  
ATOM 2707   C CE   . LYS B 2 123 ? 34.292  19.324  5.848   1.00 10.00 ? 441 LYS B CE   1  
ATOM 2708   N NZ   . LYS B 2 123 ? 35.593  20.024  6.017   1.00 10.00 ? 441 LYS B NZ   1  
ATOM 2709   H H    . LYS B 2 123 ? 31.301  16.621  4.987   1.00 10.00 ? 441 LYS B H    1  
ATOM 2710   H HZ1  . LYS B 2 123 ? 35.463  20.895  6.570   1.00 10.00 ? 441 LYS B HZ1  1  
ATOM 2711   H HZ2  . LYS B 2 123 ? 35.991  20.272  5.087   1.00 10.00 ? 441 LYS B HZ2  1  
ATOM 2712   H HZ3  . LYS B 2 123 ? 36.268  19.410  6.514   1.00 10.00 ? 441 LYS B HZ3  1  
ATOM 2713   N N    . GLN B 2 124 ? 31.900  15.728  1.837   1.00 10.00 ? 442 GLN B N    1  
ATOM 2714   C CA   . GLN B 2 124 ? 32.244  15.004  0.610   1.00 10.00 ? 442 GLN B CA   1  
ATOM 2715   C C    . GLN B 2 124 ? 31.114  14.995  -0.416  1.00 10.00 ? 442 GLN B C    1  
ATOM 2716   O O    . GLN B 2 124 ? 31.350  15.164  -1.612  1.00 10.00 ? 442 GLN B O    1  
ATOM 2717   C CB   . GLN B 2 124 ? 32.716  13.577  0.906   1.00 10.00 ? 442 GLN B CB   1  
ATOM 2718   C CG   . GLN B 2 124 ? 33.274  12.856  -0.315  1.00 10.00 ? 442 GLN B CG   1  
ATOM 2719   C CD   . GLN B 2 124 ? 33.522  11.380  -0.077  1.00 10.00 ? 442 GLN B CD   1  
ATOM 2720   O OE1  . GLN B 2 124 ? 32.628  10.549  -0.262  1.00 10.00 ? 442 GLN B OE1  1  
ATOM 2721   N NE2  . GLN B 2 124 ? 34.742  11.041  0.314   1.00 10.00 ? 442 GLN B NE2  1  
ATOM 2722   H H    . GLN B 2 124 ? 32.064  15.306  2.705   1.00 10.00 ? 442 GLN B H    1  
ATOM 2723   H HE21 . GLN B 2 124 ? 35.411  11.754  0.422   1.00 10.00 ? 442 GLN B HE21 1  
ATOM 2724   H HE22 . GLN B 2 124 ? 34.928  10.094  0.492   1.00 10.00 ? 442 GLN B HE22 1  
ATOM 2725   N N    . LEU B 2 125 ? 29.886  14.822  0.055   1.00 10.00 ? 443 LEU B N    1  
ATOM 2726   C CA   . LEU B 2 125 ? 28.735  14.793  -0.832  1.00 10.00 ? 443 LEU B CA   1  
ATOM 2727   C C    . LEU B 2 125 ? 28.380  16.204  -1.278  1.00 10.00 ? 443 LEU B C    1  
ATOM 2728   O O    . LEU B 2 125 ? 27.994  16.422  -2.421  1.00 10.00 ? 443 LEU B O    1  
ATOM 2729   C CB   . LEU B 2 125 ? 27.541  14.120  -0.150  1.00 10.00 ? 443 LEU B CB   1  
ATOM 2730   C CG   . LEU B 2 125 ? 26.360  13.768  -1.059  1.00 10.00 ? 443 LEU B CG   1  
ATOM 2731   C CD1  . LEU B 2 125 ? 26.842  13.033  -2.300  1.00 10.00 ? 443 LEU B CD1  1  
ATOM 2732   C CD2  . LEU B 2 125 ? 25.335  12.931  -0.311  1.00 10.00 ? 443 LEU B CD2  1  
ATOM 2733   H H    . LEU B 2 125 ? 29.750  14.730  1.023   1.00 10.00 ? 443 LEU B H    1  
ATOM 2734   N N    . ARG B 2 126 ? 28.555  17.162  -0.373  1.00 10.00 ? 444 ARG B N    1  
ATOM 2735   C CA   . ARG B 2 126 ? 28.264  18.565  -0.666  1.00 10.00 ? 444 ARG B CA   1  
ATOM 2736   C C    . ARG B 2 126 ? 29.215  19.075  -1.747  1.00 10.00 ? 444 ARG B C    1  
ATOM 2737   O O    . ARG B 2 126 ? 28.862  19.937  -2.547  1.00 10.00 ? 444 ARG B O    1  
ATOM 2738   C CB   . ARG B 2 126 ? 28.409  19.413  0.608   1.00 10.00 ? 444 ARG B CB   1  
ATOM 2739   C CG   . ARG B 2 126 ? 27.359  20.503  0.773   1.00 10.00 ? 444 ARG B CG   1  
ATOM 2740   C CD   . ARG B 2 126 ? 27.596  21.655  -0.186  1.00 10.00 ? 444 ARG B CD   1  
ATOM 2741   N NE   . ARG B 2 126 ? 26.604  22.715  -0.029  1.00 10.00 ? 444 ARG B NE   1  
ATOM 2742   C CZ   . ARG B 2 126 ? 25.989  23.318  -1.042  1.00 10.00 ? 444 ARG B CZ   1  
ATOM 2743   N NH1  . ARG B 2 126 ? 26.277  22.985  -2.291  1.00 10.00 ? 444 ARG B NH1  1  
ATOM 2744   N NH2  . ARG B 2 126 ? 25.094  24.266  -0.804  1.00 10.00 ? 444 ARG B NH2  1  
ATOM 2745   H H    . ARG B 2 126 ? 28.886  16.922  0.519   1.00 10.00 ? 444 ARG B H    1  
ATOM 2746   H HE   . ARG B 2 126 ? 26.387  22.997  0.885   1.00 10.00 ? 444 ARG B HE   1  
ATOM 2747   H HH11 . ARG B 2 126 ? 26.970  22.286  -2.480  1.00 10.00 ? 444 ARG B HH11 1  
ATOM 2748   H HH12 . ARG B 2 126 ? 25.789  23.434  -3.064  1.00 10.00 ? 444 ARG B HH12 1  
ATOM 2749   H HH21 . ARG B 2 126 ? 24.872  24.525  0.136   1.00 10.00 ? 444 ARG B HH21 1  
ATOM 2750   H HH22 . ARG B 2 126 ? 24.656  24.748  -1.576  1.00 10.00 ? 444 ARG B HH22 1  
ATOM 2751   N N    . ASP B 2 127 ? 30.420  18.521  -1.766  1.00 10.00 ? 445 ASP B N    1  
ATOM 2752   C CA   . ASP B 2 127 ? 31.438  18.907  -2.740  1.00 10.00 ? 445 ASP B CA   1  
ATOM 2753   C C    . ASP B 2 127 ? 31.068  18.433  -4.143  1.00 10.00 ? 445 ASP B C    1  
ATOM 2754   O O    . ASP B 2 127 ? 31.527  18.993  -5.138  1.00 10.00 ? 445 ASP B O    1  
ATOM 2755   C CB   . ASP B 2 127 ? 32.810  18.353  -2.336  1.00 10.00 ? 445 ASP B CB   1  
ATOM 2756   C CG   . ASP B 2 127 ? 33.956  19.058  -3.036  1.00 10.00 ? 445 ASP B CG   1  
ATOM 2757   O OD1  . ASP B 2 127 ? 34.196  20.250  -2.742  1.00 10.00 ? 445 ASP B OD1  1  
ATOM 2758   O OD2  . ASP B 2 127 ? 34.636  18.424  -3.871  1.00 10.00 ? 445 ASP B OD2  1  
ATOM 2759   H H    . ASP B 2 127 ? 30.637  17.838  -1.099  1.00 10.00 ? 445 ASP B H    1  
ATOM 2760   N N    . LEU B 2 128 ? 30.237  17.396  -4.214  1.00 10.00 ? 446 LEU B N    1  
ATOM 2761   C CA   . LEU B 2 128 ? 29.788  16.847  -5.495  1.00 10.00 ? 446 LEU B CA   1  
ATOM 2762   C C    . LEU B 2 128 ? 28.628  17.672  -6.042  1.00 10.00 ? 446 LEU B C    1  
ATOM 2763   O O    . LEU B 2 128 ? 28.258  17.566  -7.209  1.00 10.00 ? 446 LEU B O    1  
ATOM 2764   C CB   . LEU B 2 128 ? 29.376  15.377  -5.352  1.00 10.00 ? 446 LEU B CB   1  
ATOM 2765   C CG   . LEU B 2 128 ? 30.455  14.418  -4.838  1.00 10.00 ? 446 LEU B CG   1  
ATOM 2766   C CD1  . LEU B 2 128 ? 29.884  13.027  -4.629  1.00 10.00 ? 446 LEU B CD1  1  
ATOM 2767   C CD2  . LEU B 2 128 ? 31.637  14.373  -5.792  1.00 10.00 ? 446 LEU B CD2  1  
ATOM 2768   H H    . LEU B 2 128 ? 29.914  16.988  -3.380  1.00 10.00 ? 446 LEU B H    1  
ATOM 2769   N N    . CYS B 2 129 ? 28.065  18.489  -5.171  1.00 10.00 ? 447 CYS B N    1  
ATOM 2770   C CA   . CYS B 2 129 ? 26.960  19.358  -5.539  1.00 10.00 ? 447 CYS B CA   1  
ATOM 2771   C C    . CYS B 2 129 ? 27.499  20.593  -6.247  1.00 10.00 ? 447 CYS B C    1  
ATOM 2772   O O    . CYS B 2 129 ? 28.462  21.200  -5.779  1.00 10.00 ? 447 CYS B O    1  
ATOM 2773   C CB   . CYS B 2 129 ? 26.168  19.776  -4.296  1.00 10.00 ? 447 CYS B CB   1  
ATOM 2774   S SG   . CYS B 2 129 ? 24.617  20.639  -4.649  1.00 10.00 ? 447 CYS B SG   1  
ATOM 2775   H H    . CYS B 2 129 ? 28.420  18.509  -4.259  1.00 10.00 ? 447 CYS B H    1  
ATOM 2776   H HG   . CYS B 2 129 ? 24.850  21.952  -4.608  1.00 10.00 ? 447 CYS B HG   1  
ATOM 2777   N N    . PRO B 2 130 ? 26.912  20.957  -7.398  1.00 10.00 ? 448 PRO B N    1  
ATOM 2778   C CA   . PRO B 2 130 ? 27.333  22.131  -8.167  1.00 10.00 ? 448 PRO B CA   1  
ATOM 2779   C C    . PRO B 2 130 ? 27.142  23.423  -7.373  1.00 10.00 ? 448 PRO B C    1  
ATOM 2780   O O    . PRO B 2 130 ? 26.124  24.108  -7.496  1.00 10.00 ? 448 PRO B O    1  
ATOM 2781   C CB   . PRO B 2 130 ? 26.420  22.112  -9.400  1.00 10.00 ? 448 PRO B CB   1  
ATOM 2782   C CG   . PRO B 2 130 ? 25.909  20.712  -9.474  1.00 10.00 ? 448 PRO B CG   1  
ATOM 2783   C CD   . PRO B 2 130 ? 25.806  20.242  -8.053  1.00 10.00 ? 448 PRO B CD   1  
ATOM 2784   N N    . SER B 2 131 ? 28.127  23.735  -6.548  1.00 10.00 ? 449 SER B N    1  
ATOM 2785   C CA   . SER B 2 131 ? 28.097  24.923  -5.723  1.00 10.00 ? 449 SER B CA   1  
ATOM 2786   C C    . SER B 2 131 ? 28.747  26.084  -6.466  1.00 10.00 ? 449 SER B C    1  
ATOM 2787   O O    . SER B 2 131 ? 28.246  27.221  -6.362  1.00 10.00 ? 449 SER B O    1  
ATOM 2788   C CB   . SER B 2 131 ? 28.830  24.651  -4.407  1.00 10.00 ? 449 SER B CB   1  
ATOM 2789   O OG   . SER B 2 131 ? 28.596  23.317  -3.970  1.00 10.00 ? 449 SER B OG   1  
ATOM 2790   O OXT  . SER B 2 131 ? 29.755  25.847  -7.163  1.00 10.00 ? 449 SER B OXT  1  
ATOM 2791   H H    . SER B 2 131 ? 28.909  23.144  -6.498  1.00 10.00 ? 449 SER B H    1  
ATOM 2792   H HG   . SER B 2 131 ? 28.302  22.780  -4.716  1.00 10.00 ? 449 SER B HG   1  
ATOM 2793   N N    . GLY A 1 1   ? -29.601 -6.005  7.027   1.00 10.00 ? 156 GLY A N    2  
ATOM 2794   C CA   . GLY A 1 1   ? -29.457 -5.285  8.314   1.00 10.00 ? 156 GLY A CA   2  
ATOM 2795   C C    . GLY A 1 1   ? -28.751 -6.133  9.346   1.00 10.00 ? 156 GLY A C    2  
ATOM 2796   O O    . GLY A 1 1   ? -27.548 -6.365  9.248   1.00 10.00 ? 156 GLY A O    2  
ATOM 2797   H H1   . GLY A 1 1   ? -28.656 -6.256  6.649   1.00 10.00 ? 156 GLY A H1   2  
ATOM 2798   H H2   . GLY A 1 1   ? -30.089 -5.407  6.336   1.00 10.00 ? 156 GLY A H2   2  
ATOM 2799   H H3   . GLY A 1 1   ? -30.145 -6.880  7.165   1.00 10.00 ? 156 GLY A H3   2  
ATOM 2800   N N    . LEU A 1 2   ? -29.496 -6.599  10.339  1.00 10.00 ? 157 LEU A N    2  
ATOM 2801   C CA   . LEU A 1 2   ? -28.928 -7.438  11.382  1.00 10.00 ? 157 LEU A CA   2  
ATOM 2802   C C    . LEU A 1 2   ? -28.742 -8.865  10.880  1.00 10.00 ? 157 LEU A C    2  
ATOM 2803   O O    . LEU A 1 2   ? -29.628 -9.424  10.231  1.00 10.00 ? 157 LEU A O    2  
ATOM 2804   C CB   . LEU A 1 2   ? -29.816 -7.440  12.625  1.00 10.00 ? 157 LEU A CB   2  
ATOM 2805   C CG   . LEU A 1 2   ? -29.691 -6.232  13.552  1.00 10.00 ? 157 LEU A CG   2  
ATOM 2806   C CD1  . LEU A 1 2   ? -30.642 -6.367  14.729  1.00 10.00 ? 157 LEU A CD1  2  
ATOM 2807   C CD2  . LEU A 1 2   ? -28.258 -6.079  14.038  1.00 10.00 ? 157 LEU A CD2  2  
ATOM 2808   H H    . LEU A 1 2   ? -30.450 -6.370  10.374  1.00 10.00 ? 157 LEU A H    2  
ATOM 2809   N N    . PRO A 1 3   ? -27.572 -9.458  11.144  1.00 10.00 ? 158 PRO A N    2  
ATOM 2810   C CA   . PRO A 1 3   ? -27.270 -10.826 10.739  1.00 10.00 ? 158 PRO A CA   2  
ATOM 2811   C C    . PRO A 1 3   ? -27.825 -11.833 11.745  1.00 10.00 ? 158 PRO A C    2  
ATOM 2812   O O    . PRO A 1 3   ? -27.608 -11.706 12.951  1.00 10.00 ? 158 PRO A O    2  
ATOM 2813   C CB   . PRO A 1 3   ? -25.733 -10.868 10.731  1.00 10.00 ? 158 PRO A CB   2  
ATOM 2814   C CG   . PRO A 1 3   ? -25.266 -9.515  11.184  1.00 10.00 ? 158 PRO A CG   2  
ATOM 2815   C CD   . PRO A 1 3   ? -26.440 -8.844  11.840  1.00 10.00 ? 158 PRO A CD   2  
ATOM 2816   N N    . LEU A 1 4   ? -28.549 -12.827 11.252  1.00 10.00 ? 159 LEU A N    2  
ATOM 2817   C CA   . LEU A 1 4   ? -29.132 -13.842 12.117  1.00 10.00 ? 159 LEU A CA   2  
ATOM 2818   C C    . LEU A 1 4   ? -28.121 -14.939 12.428  1.00 10.00 ? 159 LEU A C    2  
ATOM 2819   O O    . LEU A 1 4   ? -27.445 -15.439 11.527  1.00 10.00 ? 159 LEU A O    2  
ATOM 2820   C CB   . LEU A 1 4   ? -30.406 -14.427 11.503  1.00 10.00 ? 159 LEU A CB   2  
ATOM 2821   C CG   . LEU A 1 4   ? -31.646 -13.524 11.539  1.00 10.00 ? 159 LEU A CG   2  
ATOM 2822   C CD1  . LEU A 1 4   ? -31.580 -12.455 10.456  1.00 10.00 ? 159 LEU A CD1  2  
ATOM 2823   C CD2  . LEU A 1 4   ? -32.918 -14.347 11.408  1.00 10.00 ? 159 LEU A CD2  2  
ATOM 2824   H H    . LEU A 1 4   ? -28.692 -12.882 10.285  1.00 10.00 ? 159 LEU A H    2  
ATOM 2825   N N    . ASP A 1 5   ? -28.024 -15.295 13.707  1.00 10.00 ? 160 ASP A N    2  
ATOM 2826   C CA   . ASP A 1 5   ? -27.089 -16.323 14.167  1.00 10.00 ? 160 ASP A CA   2  
ATOM 2827   C C    . ASP A 1 5   ? -25.648 -15.957 13.831  1.00 10.00 ? 160 ASP A C    2  
ATOM 2828   O O    . ASP A 1 5   ? -24.945 -16.695 13.136  1.00 10.00 ? 160 ASP A O    2  
ATOM 2829   C CB   . ASP A 1 5   ? -27.454 -17.708 13.630  1.00 10.00 ? 160 ASP A CB   2  
ATOM 2830   C CG   . ASP A 1 5   ? -28.106 -18.569 14.688  1.00 10.00 ? 160 ASP A CG   2  
ATOM 2831   O OD1  . ASP A 1 5   ? -27.579 -18.620 15.819  1.00 10.00 ? 160 ASP A OD1  2  
ATOM 2832   O OD2  . ASP A 1 5   ? -29.151 -19.193 14.395  1.00 10.00 ? 160 ASP A OD2  2  
ATOM 2833   H H    . ASP A 1 5   ? -28.601 -14.852 14.366  1.00 10.00 ? 160 ASP A H    2  
ATOM 2834   N N    . GLU A 1 6   ? -25.220 -14.818 14.356  1.00 10.00 ? 161 GLU A N    2  
ATOM 2835   C CA   . GLU A 1 6   ? -23.881 -14.291 14.126  1.00 10.00 ? 161 GLU A CA   2  
ATOM 2836   C C    . GLU A 1 6   ? -22.779 -15.286 14.468  1.00 10.00 ? 161 GLU A C    2  
ATOM 2837   O O    . GLU A 1 6   ? -21.899 -15.554 13.653  1.00 10.00 ? 161 GLU A O    2  
ATOM 2838   C CB   . GLU A 1 6   ? -23.673 -12.997 14.926  1.00 10.00 ? 161 GLU A CB   2  
ATOM 2839   C CG   . GLU A 1 6   ? -24.390 -11.779 14.364  1.00 10.00 ? 161 GLU A CG   2  
ATOM 2840   C CD   . GLU A 1 6   ? -24.768 -10.775 15.439  1.00 10.00 ? 161 GLU A CD   2  
ATOM 2841   O OE1  . GLU A 1 6   ? -25.846 -10.929 16.043  1.00 10.00 ? 161 GLU A OE1  2  
ATOM 2842   O OE2  . GLU A 1 6   ? -23.991 -9.835  15.686  1.00 10.00 ? 161 GLU A OE2  2  
ATOM 2843   H H    . GLU A 1 6   ? -25.833 -14.308 14.930  1.00 10.00 ? 161 GLU A H    2  
ATOM 2844   N N    . ARG A 1 7   ? -22.845 -15.873 15.663  1.00 10.00 ? 162 ARG A N    2  
ATOM 2845   C CA   . ARG A 1 7   ? -21.814 -16.796 16.118  1.00 10.00 ? 162 ARG A CA   2  
ATOM 2846   C C    . ARG A 1 7   ? -21.877 -18.152 15.425  1.00 10.00 ? 162 ARG A C    2  
ATOM 2847   O O    . ARG A 1 7   ? -20.849 -18.787 15.183  1.00 10.00 ? 162 ARG A O    2  
ATOM 2848   C CB   . ARG A 1 7   ? -21.886 -16.959 17.640  1.00 10.00 ? 162 ARG A CB   2  
ATOM 2849   C CG   . ARG A 1 7   ? -21.902 -15.635 18.385  1.00 10.00 ? 162 ARG A CG   2  
ATOM 2850   C CD   . ARG A 1 7   ? -20.691 -14.792 18.023  1.00 10.00 ? 162 ARG A CD   2  
ATOM 2851   N NE   . ARG A 1 7   ? -20.896 -13.376 18.301  1.00 10.00 ? 162 ARG A NE   2  
ATOM 2852   C CZ   . ARG A 1 7   ? -19.921 -12.472 18.293  1.00 10.00 ? 162 ARG A CZ   2  
ATOM 2853   N NH1  . ARG A 1 7   ? -18.681 -12.825 17.973  1.00 10.00 ? 162 ARG A NH1  2  
ATOM 2854   N NH2  . ARG A 1 7   ? -20.192 -11.206 18.582  1.00 10.00 ? 162 ARG A NH2  2  
ATOM 2855   H H    . ARG A 1 7   ? -23.613 -15.702 16.244  1.00 10.00 ? 162 ARG A H    2  
ATOM 2856   H HE   . ARG A 1 7   ? -21.813 -13.083 18.511  1.00 10.00 ? 162 ARG A HE   2  
ATOM 2857   H HH11 . ARG A 1 7   ? -18.474 -13.779 17.728  1.00 10.00 ? 162 ARG A HH11 2  
ATOM 2858   H HH12 . ARG A 1 7   ? -17.944 -12.146 17.978  1.00 10.00 ? 162 ARG A HH12 2  
ATOM 2859   H HH21 . ARG A 1 7   ? -21.133 -10.932 18.800  1.00 10.00 ? 162 ARG A HH21 2  
ATOM 2860   H HH22 . ARG A 1 7   ? -19.460 -10.519 18.593  1.00 10.00 ? 162 ARG A HH22 2  
ATOM 2861   N N    . ALA A 1 8   ? -23.083 -18.589 15.096  1.00 10.00 ? 163 ALA A N    2  
ATOM 2862   C CA   . ALA A 1 8   ? -23.271 -19.868 14.421  1.00 10.00 ? 163 ALA A CA   2  
ATOM 2863   C C    . ALA A 1 8   ? -22.637 -19.829 13.037  1.00 10.00 ? 163 ALA A C    2  
ATOM 2864   O O    . ALA A 1 8   ? -22.183 -20.843 12.511  1.00 10.00 ? 163 ALA A O    2  
ATOM 2865   C CB   . ALA A 1 8   ? -24.749 -20.206 14.326  1.00 10.00 ? 163 ALA A CB   2  
ATOM 2866   H H    . ALA A 1 8   ? -23.866 -18.040 15.313  1.00 10.00 ? 163 ALA A H    2  
ATOM 2867   N N    . PHE A 1 9   ? -22.610 -18.642 12.458  1.00 10.00 ? 164 PHE A N    2  
ATOM 2868   C CA   . PHE A 1 9   ? -22.043 -18.439 11.138  1.00 10.00 ? 164 PHE A CA   2  
ATOM 2869   C C    . PHE A 1 9   ? -20.513 -18.512 11.135  1.00 10.00 ? 164 PHE A C    2  
ATOM 2870   O O    . PHE A 1 9   ? -19.927 -19.222 10.311  1.00 10.00 ? 164 PHE A O    2  
ATOM 2871   C CB   . PHE A 1 9   ? -22.508 -17.093 10.583  1.00 10.00 ? 164 PHE A CB   2  
ATOM 2872   C CG   . PHE A 1 9   ? -22.050 -16.816 9.182   1.00 10.00 ? 164 PHE A CG   2  
ATOM 2873   C CD1  . PHE A 1 9   ? -22.694 -17.400 8.106   1.00 10.00 ? 164 PHE A CD1  2  
ATOM 2874   C CD2  . PHE A 1 9   ? -20.982 -15.969 8.942   1.00 10.00 ? 164 PHE A CD2  2  
ATOM 2875   C CE1  . PHE A 1 9   ? -22.282 -17.148 6.815   1.00 10.00 ? 164 PHE A CE1  2  
ATOM 2876   C CE2  . PHE A 1 9   ? -20.563 -15.712 7.653   1.00 10.00 ? 164 PHE A CE2  2  
ATOM 2877   C CZ   . PHE A 1 9   ? -21.214 -16.302 6.588   1.00 10.00 ? 164 PHE A CZ   2  
ATOM 2878   H H    . PHE A 1 9   ? -22.988 -17.871 12.934  1.00 10.00 ? 164 PHE A H    2  
ATOM 2879   N N    . GLU A 1 10  ? -19.873 -17.794 12.063  1.00 10.00 ? 165 GLU A N    2  
ATOM 2880   C CA   . GLU A 1 10  ? -18.408 -17.753 12.128  1.00 10.00 ? 165 GLU A CA   2  
ATOM 2881   C C    . GLU A 1 10  ? -17.793 -19.138 12.247  1.00 10.00 ? 165 GLU A C    2  
ATOM 2882   O O    . GLU A 1 10  ? -17.018 -19.559 11.389  1.00 10.00 ? 165 GLU A O    2  
ATOM 2883   C CB   . GLU A 1 10  ? -17.916 -16.921 13.319  1.00 10.00 ? 165 GLU A CB   2  
ATOM 2884   C CG   . GLU A 1 10  ? -18.749 -15.704 13.669  1.00 10.00 ? 165 GLU A CG   2  
ATOM 2885   C CD   . GLU A 1 10  ? -18.532 -15.291 15.112  1.00 10.00 ? 165 GLU A CD   2  
ATOM 2886   O OE1  . GLU A 1 10  ? -18.761 -16.129 16.012  1.00 10.00 ? 165 GLU A OE1  2  
ATOM 2887   O OE2  . GLU A 1 10  ? -18.115 -14.141 15.357  1.00 10.00 ? 165 GLU A OE2  2  
ATOM 2888   H H    . GLU A 1 10  ? -20.394 -17.278 12.716  1.00 10.00 ? 165 GLU A H    2  
ATOM 2889   N N    . LYS A 1 11  ? -18.179 -19.849 13.301  1.00 10.00 ? 166 LYS A N    2  
ATOM 2890   C CA   . LYS A 1 11  ? -17.658 -21.182 13.585  1.00 10.00 ? 166 LYS A CA   2  
ATOM 2891   C C    . LYS A 1 11  ? -17.837 -22.160 12.424  1.00 10.00 ? 166 LYS A C    2  
ATOM 2892   O O    . LYS A 1 11  ? -16.969 -22.994 12.166  1.00 10.00 ? 166 LYS A O    2  
ATOM 2893   C CB   . LYS A 1 11  ? -18.312 -21.740 14.848  1.00 10.00 ? 166 LYS A CB   2  
ATOM 2894   C CG   . LYS A 1 11  ? -17.722 -23.054 15.326  1.00 10.00 ? 166 LYS A CG   2  
ATOM 2895   C CD   . LYS A 1 11  ? -18.555 -23.651 16.445  1.00 10.00 ? 166 LYS A CD   2  
ATOM 2896   C CE   . LYS A 1 11  ? -19.961 -23.985 15.972  1.00 10.00 ? 166 LYS A CE   2  
ATOM 2897   N NZ   . LYS A 1 11  ? -20.717 -24.754 16.990  1.00 10.00 ? 166 LYS A NZ   2  
ATOM 2898   H H    . LYS A 1 11  ? -18.833 -19.455 13.919  1.00 10.00 ? 166 LYS A H    2  
ATOM 2899   H HZ1  . LYS A 1 11  ? -20.863 -24.178 17.841  1.00 10.00 ? 166 LYS A HZ1  2  
ATOM 2900   H HZ2  . LYS A 1 11  ? -20.195 -25.613 17.250  1.00 10.00 ? 166 LYS A HZ2  2  
ATOM 2901   H HZ3  . LYS A 1 11  ? -21.643 -25.030 16.609  1.00 10.00 ? 166 LYS A HZ3  2  
ATOM 2902   N N    . THR A 1 12  ? -18.956 -22.056 11.727  1.00 10.00 ? 167 THR A N    2  
ATOM 2903   C CA   . THR A 1 12  ? -19.238 -22.946 10.612  1.00 10.00 ? 167 THR A CA   2  
ATOM 2904   C C    . THR A 1 12  ? -18.379 -22.626 9.385   1.00 10.00 ? 167 THR A C    2  
ATOM 2905   O O    . THR A 1 12  ? -17.872 -23.527 8.723   1.00 10.00 ? 167 THR A O    2  
ATOM 2906   C CB   . THR A 1 12  ? -20.736 -22.933 10.252  1.00 10.00 ? 167 THR A CB   2  
ATOM 2907   O OG1  . THR A 1 12  ? -21.501 -23.143 11.448  1.00 10.00 ? 167 THR A OG1  2  
ATOM 2908   C CG2  . THR A 1 12  ? -21.061 -24.038 9.259   1.00 10.00 ? 167 THR A CG2  2  
ATOM 2909   H H    . THR A 1 12  ? -19.609 -21.366 11.967  1.00 10.00 ? 167 THR A H    2  
ATOM 2910   H HG1  . THR A 1 12  ? -21.880 -22.300 11.744  1.00 10.00 ? 167 THR A HG1  2  
ATOM 2911   N N    . LEU A 1 13  ? -18.215 -21.342 9.083   1.00 10.00 ? 168 LEU A N    2  
ATOM 2912   C CA   . LEU A 1 13  ? -17.415 -20.926 7.930   1.00 10.00 ? 168 LEU A CA   2  
ATOM 2913   C C    . LEU A 1 13  ? -15.907 -20.997 8.186   1.00 10.00 ? 168 LEU A C    2  
ATOM 2914   O O    . LEU A 1 13  ? -15.124 -21.022 7.232   1.00 10.00 ? 168 LEU A O    2  
ATOM 2915   C CB   . LEU A 1 13  ? -17.814 -19.521 7.476   1.00 10.00 ? 168 LEU A CB   2  
ATOM 2916   C CG   . LEU A 1 13  ? -18.789 -19.428 6.292   1.00 10.00 ? 168 LEU A CG   2  
ATOM 2917   C CD1  . LEU A 1 13  ? -18.168 -20.007 5.030   1.00 10.00 ? 168 LEU A CD1  2  
ATOM 2918   C CD2  . LEU A 1 13  ? -20.108 -20.113 6.614   1.00 10.00 ? 168 LEU A CD2  2  
ATOM 2919   H H    . LEU A 1 13  ? -18.675 -20.657 9.620   1.00 10.00 ? 168 LEU A H    2  
ATOM 2920   N N    . THR A 1 14  ? -15.509 -21.016 9.458   1.00 10.00 ? 169 THR A N    2  
ATOM 2921   C CA   . THR A 1 14  ? -14.090 -21.071 9.823   1.00 10.00 ? 169 THR A CA   2  
ATOM 2922   C C    . THR A 1 14  ? -13.291 -22.132 9.049   1.00 10.00 ? 169 THR A C    2  
ATOM 2923   O O    . THR A 1 14  ? -12.385 -21.783 8.293   1.00 10.00 ? 169 THR A O    2  
ATOM 2924   C CB   . THR A 1 14  ? -13.868 -21.253 11.345  1.00 10.00 ? 169 THR A CB   2  
ATOM 2925   O OG1  . THR A 1 14  ? -14.639 -20.295 12.072  1.00 10.00 ? 169 THR A OG1  2  
ATOM 2926   C CG2  . THR A 1 14  ? -12.400 -21.069 11.699  1.00 10.00 ? 169 THR A CG2  2  
ATOM 2927   H H    . THR A 1 14  ? -16.189 -20.951 10.164  1.00 10.00 ? 169 THR A H    2  
ATOM 2928   H HG1  . THR A 1 14  ? -15.292 -19.891 11.484  1.00 10.00 ? 169 THR A HG1  2  
ATOM 2929   N N    . PRO A 1 15  ? -13.623 -23.436 9.187   1.00 10.00 ? 170 PRO A N    2  
ATOM 2930   C CA   . PRO A 1 15  ? -12.892 -24.507 8.493   1.00 10.00 ? 170 PRO A CA   2  
ATOM 2931   C C    . PRO A 1 15  ? -12.982 -24.404 6.970   1.00 10.00 ? 170 PRO A C    2  
ATOM 2932   O O    . PRO A 1 15  ? -12.032 -24.750 6.263   1.00 10.00 ? 170 PRO A O    2  
ATOM 2933   C CB   . PRO A 1 15  ? -13.559 -25.796 8.989   1.00 10.00 ? 170 PRO A CB   2  
ATOM 2934   C CG   . PRO A 1 15  ? -14.883 -25.372 9.520   1.00 10.00 ? 170 PRO A CG   2  
ATOM 2935   C CD   . PRO A 1 15  ? -14.706 -23.974 10.033  1.00 10.00 ? 170 PRO A CD   2  
ATOM 2936   N N    . ILE A 1 16  ? -14.114 -23.912 6.479   1.00 10.00 ? 171 ILE A N    2  
ATOM 2937   C CA   . ILE A 1 16  ? -14.331 -23.767 5.043   1.00 10.00 ? 171 ILE A CA   2  
ATOM 2938   C C    . ILE A 1 16  ? -13.293 -22.834 4.414   1.00 10.00 ? 171 ILE A C    2  
ATOM 2939   O O    . ILE A 1 16  ? -12.580 -23.221 3.490   1.00 10.00 ? 171 ILE A O    2  
ATOM 2940   C CB   . ILE A 1 16  ? -15.755 -23.249 4.734   1.00 10.00 ? 171 ILE A CB   2  
ATOM 2941   C CG1  . ILE A 1 16  ? -16.802 -24.201 5.317   1.00 10.00 ? 171 ILE A CG1  2  
ATOM 2942   C CG2  . ILE A 1 16  ? -15.957 -23.087 3.231   1.00 10.00 ? 171 ILE A CG2  2  
ATOM 2943   C CD1  . ILE A 1 16  ? -18.226 -23.698 5.212   1.00 10.00 ? 171 ILE A CD1  2  
ATOM 2944   H H    . ILE A 1 16  ? -14.822 -23.640 7.102   1.00 10.00 ? 171 ILE A H    2  
ATOM 2945   N N    . ILE A 1 17  ? -13.214 -21.610 4.923   1.00 10.00 ? 172 ILE A N    2  
ATOM 2946   C CA   . ILE A 1 17  ? -12.259 -20.630 4.414   1.00 10.00 ? 172 ILE A CA   2  
ATOM 2947   C C    . ILE A 1 17  ? -10.823 -21.030 4.777   1.00 10.00 ? 172 ILE A C    2  
ATOM 2948   O O    . ILE A 1 17  ? -9.910  -20.900 3.959   1.00 10.00 ? 172 ILE A O    2  
ATOM 2949   C CB   . ILE A 1 17  ? -12.567 -19.208 4.927   1.00 10.00 ? 172 ILE A CB   2  
ATOM 2950   C CG1  . ILE A 1 17  ? -14.035 -18.855 4.641   1.00 10.00 ? 172 ILE A CG1  2  
ATOM 2951   C CG2  . ILE A 1 17  ? -11.641 -18.188 4.279   1.00 10.00 ? 172 ILE A CG2  2  
ATOM 2952   C CD1  . ILE A 1 17  ? -14.470 -17.522 5.212   1.00 10.00 ? 172 ILE A CD1  2  
ATOM 2953   H H    . ILE A 1 17  ? -13.815 -21.356 5.659   1.00 10.00 ? 172 ILE A H    2  
ATOM 2954   N N    . GLN A 1 18  ? -10.635 -21.488 6.010   1.00 10.00 ? 173 GLN A N    2  
ATOM 2955   C CA   . GLN A 1 18  ? -9.320  -21.927 6.473   1.00 10.00 ? 173 GLN A CA   2  
ATOM 2956   C C    . GLN A 1 18  ? -8.663  -22.880 5.481   1.00 10.00 ? 173 GLN A C    2  
ATOM 2957   O O    . GLN A 1 18  ? -7.527  -22.660 5.058   1.00 10.00 ? 173 GLN A O    2  
ATOM 2958   C CB   . GLN A 1 18  ? -9.391  -22.550 7.865   1.00 10.00 ? 173 GLN A CB   2  
ATOM 2959   C CG   . GLN A 1 18  ? -9.363  -21.530 8.991   1.00 10.00 ? 173 GLN A CG   2  
ATOM 2960   C CD   . GLN A 1 18  ? -9.195  -22.165 10.354  1.00 10.00 ? 173 GLN A CD   2  
ATOM 2961   O OE1  . GLN A 1 18  ? -9.624  -23.295 10.587  1.00 10.00 ? 173 GLN A OE1  2  
ATOM 2962   N NE2  . GLN A 1 18  ? -8.564  -21.444 11.261  1.00 10.00 ? 173 GLN A NE2  2  
ATOM 2963   H H    . GLN A 1 18  ? -11.396 -21.456 6.632   1.00 10.00 ? 173 GLN A H    2  
ATOM 2964   H HE21 . GLN A 1 18  ? -8.244  -20.553 11.004  1.00 10.00 ? 173 GLN A HE21 2  
ATOM 2965   H HE22 . GLN A 1 18  ? -8.446  -21.825 12.156  1.00 10.00 ? 173 GLN A HE22 2  
ATOM 2966   N N    . GLU A 1 19  ? -9.386  -23.924 5.090   1.00 10.00 ? 174 GLU A N    2  
ATOM 2967   C CA   . GLU A 1 19  ? -8.868  -24.895 4.132   1.00 10.00 ? 174 GLU A CA   2  
ATOM 2968   C C    . GLU A 1 19  ? -8.812  -24.349 2.709   1.00 10.00 ? 174 GLU A C    2  
ATOM 2969   O O    . GLU A 1 19  ? -8.116  -24.892 1.849   1.00 10.00 ? 174 GLU A O    2  
ATOM 2970   C CB   . GLU A 1 19  ? -9.561  -26.253 4.219   1.00 10.00 ? 174 GLU A CB   2  
ATOM 2971   C CG   . GLU A 1 19  ? -8.655  -27.318 4.815   1.00 10.00 ? 174 GLU A CG   2  
ATOM 2972   C CD   . GLU A 1 19  ? -9.070  -28.730 4.469   1.00 10.00 ? 174 GLU A CD   2  
ATOM 2973   O OE1  . GLU A 1 19  ? -9.873  -29.315 5.221   1.00 10.00 ? 174 GLU A OE1  2  
ATOM 2974   O OE2  . GLU A 1 19  ? -8.576  -29.272 3.458   1.00 10.00 ? 174 GLU A OE2  2  
ATOM 2975   H H    . GLU A 1 19  ? -10.287 -24.048 5.463   1.00 10.00 ? 174 GLU A H    2  
ATOM 2976   N N    . TYR A 1 20  ? -9.570  -23.290 2.464   1.00 10.00 ? 175 TYR A N    2  
ATOM 2977   C CA   . TYR A 1 20  ? -9.609  -22.660 1.151   1.00 10.00 ? 175 TYR A CA   2  
ATOM 2978   C C    . TYR A 1 20  ? -8.221  -22.148 0.758   1.00 10.00 ? 175 TYR A C    2  
ATOM 2979   O O    . TYR A 1 20  ? -7.778  -22.359 -0.371  1.00 10.00 ? 175 TYR A O    2  
ATOM 2980   C CB   . TYR A 1 20  ? -10.650 -21.531 1.097   1.00 10.00 ? 175 TYR A CB   2  
ATOM 2981   C CG   . TYR A 1 20  ? -10.378 -20.487 0.038   1.00 10.00 ? 175 TYR A CG   2  
ATOM 2982   C CD1  . TYR A 1 20  ? -10.462 -20.801 -1.313  1.00 10.00 ? 175 TYR A CD1  2  
ATOM 2983   C CD2  . TYR A 1 20  ? -10.023 -19.190 0.390   1.00 10.00 ? 175 TYR A CD2  2  
ATOM 2984   C CE1  . TYR A 1 20  ? -10.197 -19.855 -2.284  1.00 10.00 ? 175 TYR A CE1  2  
ATOM 2985   C CE2  . TYR A 1 20  ? -9.761  -18.236 -0.577  1.00 10.00 ? 175 TYR A CE2  2  
ATOM 2986   C CZ   . TYR A 1 20  ? -9.848  -18.576 -1.911  1.00 10.00 ? 175 TYR A CZ   2  
ATOM 2987   O OH   . TYR A 1 20  ? -9.586  -17.631 -2.875  1.00 10.00 ? 175 TYR A OH   2  
ATOM 2988   H H    . TYR A 1 20  ? -10.070 -22.903 3.212   1.00 10.00 ? 175 TYR A H    2  
ATOM 2989   H HH   . TYR A 1 20  ? -8.896  -17.031 -2.557  1.00 10.00 ? 175 TYR A HH   2  
ATOM 2990   N N    . PHE A 1 21  ? -7.541  -21.491 1.699   1.00 10.00 ? 176 PHE A N    2  
ATOM 2991   C CA   . PHE A 1 21  ? -6.198  -20.968 1.453   1.00 10.00 ? 176 PHE A CA   2  
ATOM 2992   C C    . PHE A 1 21  ? -5.223  -22.105 1.172   1.00 10.00 ? 176 PHE A C    2  
ATOM 2993   O O    . PHE A 1 21  ? -4.183  -21.908 0.546   1.00 10.00 ? 176 PHE A O    2  
ATOM 2994   C CB   . PHE A 1 21  ? -5.710  -20.151 2.650   1.00 10.00 ? 176 PHE A CB   2  
ATOM 2995   C CG   . PHE A 1 21  ? -6.514  -18.914 2.923   1.00 10.00 ? 176 PHE A CG   2  
ATOM 2996   C CD1  . PHE A 1 21  ? -6.760  -17.996 1.916   1.00 10.00 ? 176 PHE A CD1  2  
ATOM 2997   C CD2  . PHE A 1 21  ? -7.020  -18.670 4.186   1.00 10.00 ? 176 PHE A CD2  2  
ATOM 2998   C CE1  . PHE A 1 21  ? -7.497  -16.854 2.164   1.00 10.00 ? 176 PHE A CE1  2  
ATOM 2999   C CE2  . PHE A 1 21  ? -7.758  -17.531 4.443   1.00 10.00 ? 176 PHE A CE2  2  
ATOM 3000   C CZ   . PHE A 1 21  ? -7.998  -16.621 3.430   1.00 10.00 ? 176 PHE A CZ   2  
ATOM 3001   H H    . PHE A 1 21  ? -7.969  -21.324 2.567   1.00 10.00 ? 176 PHE A H    2  
ATOM 3002   N N    . GLU A 1 22  ? -5.579  -23.283 1.647   1.00 10.00 ? 177 GLU A N    2  
ATOM 3003   C CA   . GLU A 1 22  ? -4.758  -24.468 1.451   1.00 10.00 ? 177 GLU A CA   2  
ATOM 3004   C C    . GLU A 1 22  ? -4.988  -25.011 0.046   1.00 10.00 ? 177 GLU A C    2  
ATOM 3005   O O    . GLU A 1 22  ? -4.046  -25.202 -0.721  1.00 10.00 ? 177 GLU A O    2  
ATOM 3006   C CB   . GLU A 1 22  ? -5.128  -25.541 2.478   1.00 10.00 ? 177 GLU A CB   2  
ATOM 3007   C CG   . GLU A 1 22  ? -5.068  -25.087 3.928   1.00 10.00 ? 177 GLU A CG   2  
ATOM 3008   C CD   . GLU A 1 22  ? -3.683  -25.224 4.528   1.00 10.00 ? 177 GLU A CD   2  
ATOM 3009   O OE1  . GLU A 1 22  ? -2.831  -24.349 4.272   1.00 10.00 ? 177 GLU A OE1  2  
ATOM 3010   O OE2  . GLU A 1 22  ? -3.442  -26.209 5.262   1.00 10.00 ? 177 GLU A OE2  2  
ATOM 3011   H H    . GLU A 1 22  ? -6.432  -23.363 2.118   1.00 10.00 ? 177 GLU A H    2  
ATOM 3012   N N    . HIS A 1 23  ? -6.259  -25.242 -0.276  1.00 10.00 ? 178 HIS A N    2  
ATOM 3013   C CA   . HIS A 1 23  ? -6.649  -25.784 -1.576  1.00 10.00 ? 178 HIS A CA   2  
ATOM 3014   C C    . HIS A 1 23  ? -6.381  -24.809 -2.718  1.00 10.00 ? 178 HIS A C    2  
ATOM 3015   O O    . HIS A 1 23  ? -5.654  -25.128 -3.658  1.00 10.00 ? 178 HIS A O    2  
ATOM 3016   C CB   . HIS A 1 23  ? -8.128  -26.195 -1.575  1.00 10.00 ? 178 HIS A CB   2  
ATOM 3017   C CG   . HIS A 1 23  ? -8.456  -27.354 -0.681  1.00 10.00 ? 178 HIS A CG   2  
ATOM 3018   N ND1  . HIS A 1 23  ? -9.551  -28.164 -0.880  1.00 10.00 ? 178 HIS A ND1  2  
ATOM 3019   C CD2  . HIS A 1 23  ? -7.841  -27.827 0.428   1.00 10.00 ? 178 HIS A CD2  2  
ATOM 3020   C CE1  . HIS A 1 23  ? -9.597  -29.080 0.068   1.00 10.00 ? 178 HIS A CE1  2  
ATOM 3021   N NE2  . HIS A 1 23  ? -8.569  -28.899 0.879   1.00 10.00 ? 178 HIS A NE2  2  
ATOM 3022   H H    . HIS A 1 23  ? -6.955  -25.059 0.394   1.00 10.00 ? 178 HIS A H    2  
ATOM 3023   H HD1  . HIS A 1 23  ? -10.198 -28.079 -1.613  1.00 10.00 ? 178 HIS A HD1  2  
ATOM 3024   H HE2  . HIS A 1 23  ? -8.514  -29.270 1.799   1.00 10.00 ? 178 HIS A HE2  2  
ATOM 3025   N N    . GLY A 1 24  ? -6.973  -23.622 -2.643  1.00 10.00 ? 179 GLY A N    2  
ATOM 3026   C CA   . GLY A 1 24  ? -6.785  -22.632 -3.687  1.00 10.00 ? 179 GLY A CA   2  
ATOM 3027   C C    . GLY A 1 24  ? -7.978  -22.554 -4.621  1.00 10.00 ? 179 GLY A C    2  
ATOM 3028   O O    . GLY A 1 24  ? -8.071  -21.652 -5.450  1.00 10.00 ? 179 GLY A O    2  
ATOM 3029   H H    . GLY A 1 24  ? -7.542  -23.402 -1.871  1.00 10.00 ? 179 GLY A H    2  
ATOM 3030   N N    . ASP A 1 25  ? -8.895  -23.503 -4.483  1.00 10.00 ? 180 ASP A N    2  
ATOM 3031   C CA   . ASP A 1 25  ? -10.092 -23.548 -5.329  1.00 10.00 ? 180 ASP A CA   2  
ATOM 3032   C C    . ASP A 1 25  ? -11.290 -22.888 -4.661  1.00 10.00 ? 180 ASP A C    2  
ATOM 3033   O O    . ASP A 1 25  ? -11.695 -23.287 -3.571  1.00 10.00 ? 180 ASP A O    2  
ATOM 3034   C CB   . ASP A 1 25  ? -10.432 -24.991 -5.706  1.00 10.00 ? 180 ASP A CB   2  
ATOM 3035   C CG   . ASP A 1 25  ? -11.847 -25.136 -6.227  1.00 10.00 ? 180 ASP A CG   2  
ATOM 3036   O OD1  . ASP A 1 25  ? -12.167 -24.536 -7.273  1.00 10.00 ? 180 ASP A OD1  2  
ATOM 3037   O OD2  . ASP A 1 25  ? -12.647 -25.855 -5.595  1.00 10.00 ? 180 ASP A OD2  2  
ATOM 3038   H H    . ASP A 1 25  ? -8.767  -24.188 -3.798  1.00 10.00 ? 180 ASP A H    2  
ATOM 3039   N N    . THR A 1 26  ? -11.840 -21.872 -5.310  1.00 10.00 ? 181 THR A N    2  
ATOM 3040   C CA   . THR A 1 26  ? -12.995 -21.157 -4.790  1.00 10.00 ? 181 THR A CA   2  
ATOM 3041   C C    . THR A 1 26  ? -14.324 -21.892 -5.061  1.00 10.00 ? 181 THR A C    2  
ATOM 3042   O O    . THR A 1 26  ? -15.328 -21.623 -4.404  1.00 10.00 ? 181 THR A O    2  
ATOM 3043   C CB   . THR A 1 26  ? -13.042 -19.710 -5.326  1.00 10.00 ? 181 THR A CB   2  
ATOM 3044   O OG1  . THR A 1 26  ? -11.700 -19.228 -5.478  1.00 10.00 ? 181 THR A OG1  2  
ATOM 3045   C CG2  . THR A 1 26  ? -13.779 -18.807 -4.347  1.00 10.00 ? 181 THR A CG2  2  
ATOM 3046   H H    . THR A 1 26  ? -11.557 -21.666 -6.220  1.00 10.00 ? 181 THR A H    2  
ATOM 3047   H HG1  . THR A 1 26  ? -11.462 -18.692 -4.712  1.00 10.00 ? 181 THR A HG1  2  
ATOM 3048   N N    . ASN A 1 27  ? -14.325 -22.822 -6.033  1.00 10.00 ? 182 ASN A N    2  
ATOM 3049   C CA   . ASN A 1 27  ? -15.540 -23.565 -6.410  1.00 10.00 ? 182 ASN A CA   2  
ATOM 3050   C C    . ASN A 1 27  ? -16.156 -24.307 -5.227  1.00 10.00 ? 182 ASN A C    2  
ATOM 3051   O O    . ASN A 1 27  ? -17.379 -24.376 -5.094  1.00 10.00 ? 182 ASN A O    2  
ATOM 3052   C CB   . ASN A 1 27  ? -15.258 -24.521 -7.579  1.00 10.00 ? 182 ASN A CB   2  
ATOM 3053   C CG   . ASN A 1 27  ? -15.794 -25.931 -7.379  1.00 10.00 ? 182 ASN A CG   2  
ATOM 3054   O OD1  . ASN A 1 27  ? -16.913 -26.250 -7.785  1.00 10.00 ? 182 ASN A OD1  2  
ATOM 3055   N ND2  . ASN A 1 27  ? -14.998 -26.787 -6.751  1.00 10.00 ? 182 ASN A ND2  2  
ATOM 3056   H H    . ASN A 1 27  ? -13.484 -23.024 -6.506  1.00 10.00 ? 182 ASN A H    2  
ATOM 3057   H HD21 . ASN A 1 27  ? -14.113 -26.463 -6.450  1.00 10.00 ? 182 ASN A HD21 2  
ATOM 3058   H HD22 . ASN A 1 27  ? -15.318 -27.702 -6.605  1.00 10.00 ? 182 ASN A HD22 2  
ATOM 3059   N N    . GLU A 1 28  ? -15.297 -24.816 -4.367  1.00 10.00 ? 183 GLU A N    2  
ATOM 3060   C CA   . GLU A 1 28  ? -15.741 -25.554 -3.190  1.00 10.00 ? 183 GLU A CA   2  
ATOM 3061   C C    . GLU A 1 28  ? -16.561 -24.639 -2.293  1.00 10.00 ? 183 GLU A C    2  
ATOM 3062   O O    . GLU A 1 28  ? -17.629 -25.009 -1.803  1.00 10.00 ? 183 GLU A O    2  
ATOM 3063   C CB   . GLU A 1 28  ? -14.549 -26.113 -2.416  1.00 10.00 ? 183 GLU A CB   2  
ATOM 3064   C CG   . GLU A 1 28  ? -14.666 -27.591 -2.089  1.00 10.00 ? 183 GLU A CG   2  
ATOM 3065   C CD   . GLU A 1 28  ? -14.177 -28.477 -3.214  1.00 10.00 ? 183 GLU A CD   2  
ATOM 3066   O OE1  . GLU A 1 28  ? -12.955 -28.495 -3.464  1.00 10.00 ? 183 GLU A OE1  2  
ATOM 3067   O OE2  . GLU A 1 28  ? -15.004 -29.174 -3.842  1.00 10.00 ? 183 GLU A OE2  2  
ATOM 3068   H H    . GLU A 1 28  ? -14.340 -24.662 -4.521  1.00 10.00 ? 183 GLU A H    2  
ATOM 3069   N N    . VAL A 1 29  ? -16.050 -23.428 -2.086  1.00 10.00 ? 184 VAL A N    2  
ATOM 3070   C CA   . VAL A 1 29  ? -16.726 -22.440 -1.264  1.00 10.00 ? 184 VAL A CA   2  
ATOM 3071   C C    . VAL A 1 29  ? -18.115 -22.123 -1.822  1.00 10.00 ? 184 VAL A C    2  
ATOM 3072   O O    . VAL A 1 29  ? -19.095 -22.123 -1.079  1.00 10.00 ? 184 VAL A O    2  
ATOM 3073   C CB   . VAL A 1 29  ? -15.906 -21.132 -1.155  1.00 10.00 ? 184 VAL A CB   2  
ATOM 3074   C CG1  . VAL A 1 29  ? -16.635 -20.096 -0.312  1.00 10.00 ? 184 VAL A CG1  2  
ATOM 3075   C CG2  . VAL A 1 29  ? -14.526 -21.413 -0.583  1.00 10.00 ? 184 VAL A CG2  2  
ATOM 3076   H H    . VAL A 1 29  ? -15.192 -23.201 -2.499  1.00 10.00 ? 184 VAL A H    2  
ATOM 3077   N N    . ALA A 1 30  ? -18.192 -21.877 -3.131  1.00 10.00 ? 185 ALA A N    2  
ATOM 3078   C CA   . ALA A 1 30  ? -19.463 -21.559 -3.781  1.00 10.00 ? 185 ALA A CA   2  
ATOM 3079   C C    . ALA A 1 30  ? -20.512 -22.650 -3.564  1.00 10.00 ? 185 ALA A C    2  
ATOM 3080   O O    . ALA A 1 30  ? -21.638 -22.365 -3.142  1.00 10.00 ? 185 ALA A O    2  
ATOM 3081   C CB   . ALA A 1 30  ? -19.245 -21.314 -5.268  1.00 10.00 ? 185 ALA A CB   2  
ATOM 3082   H H    . ALA A 1 30  ? -17.374 -21.890 -3.672  1.00 10.00 ? 185 ALA A H    2  
ATOM 3083   N N    . GLU A 1 31  ? -20.149 -23.887 -3.903  1.00 10.00 ? 186 GLU A N    2  
ATOM 3084   C CA   . GLU A 1 31  ? -21.039 -25.034 -3.726  1.00 10.00 ? 186 GLU A CA   2  
ATOM 3085   C C    . GLU A 1 31  ? -21.607 -25.087 -2.306  1.00 10.00 ? 186 GLU A C    2  
ATOM 3086   O O    . GLU A 1 31  ? -22.805 -25.301 -2.110  1.00 10.00 ? 186 GLU A O    2  
ATOM 3087   C CB   . GLU A 1 31  ? -20.321 -26.344 -4.054  1.00 10.00 ? 186 GLU A CB   2  
ATOM 3088   C CG   . GLU A 1 31  ? -19.679 -26.383 -5.433  1.00 10.00 ? 186 GLU A CG   2  
ATOM 3089   C CD   . GLU A 1 31  ? -20.676 -26.201 -6.559  1.00 10.00 ? 186 GLU A CD   2  
ATOM 3090   O OE1  . GLU A 1 31  ? -21.451 -27.143 -6.834  1.00 10.00 ? 186 GLU A OE1  2  
ATOM 3091   O OE2  . GLU A 1 31  ? -20.697 -25.119 -7.175  1.00 10.00 ? 186 GLU A OE2  2  
ATOM 3092   H H    . GLU A 1 31  ? -19.296 -23.995 -4.384  1.00 10.00 ? 186 GLU A H    2  
ATOM 3093   N N    . MET A 1 32  ? -20.740 -24.871 -1.321  1.00 10.00 ? 187 MET A N    2  
ATOM 3094   C CA   . MET A 1 32  ? -21.143 -24.892 0.078   1.00 10.00 ? 187 MET A CA   2  
ATOM 3095   C C    . MET A 1 32  ? -22.035 -23.703 0.417   1.00 10.00 ? 187 MET A C    2  
ATOM 3096   O O    . MET A 1 32  ? -22.977 -23.827 1.201   1.00 10.00 ? 187 MET A O    2  
ATOM 3097   C CB   . MET A 1 32  ? -19.917 -24.908 0.998   1.00 10.00 ? 187 MET A CB   2  
ATOM 3098   C CG   . MET A 1 32  ? -19.104 -26.192 0.928   1.00 10.00 ? 187 MET A CG   2  
ATOM 3099   S SD   . MET A 1 32  ? -17.688 -26.181 2.048   1.00 10.00 ? 187 MET A SD   2  
ATOM 3100   C CE   . MET A 1 32  ? -17.006 -27.812 1.754   1.00 10.00 ? 187 MET A CE   2  
ATOM 3101   H H    . MET A 1 32  ? -19.799 -24.695 -1.544  1.00 10.00 ? 187 MET A H    2  
ATOM 3102   N N    . LEU A 1 33  ? -21.742 -22.557 -0.189  1.00 10.00 ? 188 LEU A N    2  
ATOM 3103   C CA   . LEU A 1 33  ? -22.507 -21.336 0.055   1.00 10.00 ? 188 LEU A CA   2  
ATOM 3104   C C    . LEU A 1 33  ? -23.979 -21.494 -0.303  1.00 10.00 ? 188 LEU A C    2  
ATOM 3105   O O    . LEU A 1 33  ? -24.860 -21.154 0.491   1.00 10.00 ? 188 LEU A O    2  
ATOM 3106   C CB   . LEU A 1 33  ? -21.889 -20.138 -0.674  1.00 10.00 ? 188 LEU A CB   2  
ATOM 3107   C CG   . LEU A 1 33  ? -20.576 -19.608 -0.098  1.00 10.00 ? 188 LEU A CG   2  
ATOM 3108   C CD1  . LEU A 1 33  ? -20.115 -18.370 -0.853  1.00 10.00 ? 188 LEU A CD1  2  
ATOM 3109   C CD2  . LEU A 1 33  ? -20.716 -19.312 1.387   1.00 10.00 ? 188 LEU A CD2  2  
ATOM 3110   H H    . LEU A 1 33  ? -20.987 -22.532 -0.818  1.00 10.00 ? 188 LEU A H    2  
ATOM 3111   N N    . ARG A 1 34  ? -24.255 -21.993 -1.509  1.00 10.00 ? 189 ARG A N    2  
ATOM 3112   C CA   . ARG A 1 34  ? -25.627 -22.200 -1.949  1.00 10.00 ? 189 ARG A CA   2  
ATOM 3113   C C    . ARG A 1 34  ? -26.340 -23.197 -1.047  1.00 10.00 ? 189 ARG A C    2  
ATOM 3114   O O    . ARG A 1 34  ? -27.520 -23.037 -0.740  1.00 10.00 ? 189 ARG A O    2  
ATOM 3115   C CB   . ARG A 1 34  ? -25.668 -22.699 -3.389  1.00 10.00 ? 189 ARG A CB   2  
ATOM 3116   C CG   . ARG A 1 34  ? -25.022 -21.765 -4.397  1.00 10.00 ? 189 ARG A CG   2  
ATOM 3117   C CD   . ARG A 1 34  ? -25.146 -22.325 -5.802  1.00 10.00 ? 189 ARG A CD   2  
ATOM 3118   N NE   . ARG A 1 34  ? -24.906 -23.766 -5.831  1.00 10.00 ? 189 ARG A NE   2  
ATOM 3119   C CZ   . ARG A 1 34  ? -23.827 -24.332 -6.364  1.00 10.00 ? 189 ARG A CZ   2  
ATOM 3120   N NH1  . ARG A 1 34  ? -22.915 -23.593 -6.981  1.00 10.00 ? 189 ARG A NH1  2  
ATOM 3121   N NH2  . ARG A 1 34  ? -23.677 -25.645 -6.309  1.00 10.00 ? 189 ARG A NH2  2  
ATOM 3122   H H    . ARG A 1 34  ? -23.513 -22.208 -2.117  1.00 10.00 ? 189 ARG A H    2  
ATOM 3123   H HE   . ARG A 1 34  ? -25.584 -24.345 -5.414  1.00 10.00 ? 189 ARG A HE   2  
ATOM 3124   H HH11 . ARG A 1 34  ? -23.037 -22.602 -7.062  1.00 10.00 ? 189 ARG A HH11 2  
ATOM 3125   H HH12 . ARG A 1 34  ? -22.079 -24.029 -7.353  1.00 10.00 ? 189 ARG A HH12 2  
ATOM 3126   H HH21 . ARG A 1 34  ? -24.377 -26.215 -5.870  1.00 10.00 ? 189 ARG A HH21 2  
ATOM 3127   H HH22 . ARG A 1 34  ? -22.852 -26.081 -6.696  1.00 10.00 ? 189 ARG A HH22 2  
ATOM 3128   N N    . ASP A 1 35  ? -25.601 -24.222 -0.638  1.00 10.00 ? 190 ASP A N    2  
ATOM 3129   C CA   . ASP A 1 35  ? -26.131 -25.258 0.246   1.00 10.00 ? 190 ASP A CA   2  
ATOM 3130   C C    . ASP A 1 35  ? -26.684 -24.621 1.518   1.00 10.00 ? 190 ASP A C    2  
ATOM 3131   O O    . ASP A 1 35  ? -27.785 -24.949 1.971   1.00 10.00 ? 190 ASP A O    2  
ATOM 3132   C CB   . ASP A 1 35  ? -25.033 -26.260 0.609   1.00 10.00 ? 190 ASP A CB   2  
ATOM 3133   C CG   . ASP A 1 35  ? -25.387 -27.684 0.238   1.00 10.00 ? 190 ASP A CG   2  
ATOM 3134   O OD1  . ASP A 1 35  ? -26.318 -28.251 0.843   1.00 10.00 ? 190 ASP A OD1  2  
ATOM 3135   O OD2  . ASP A 1 35  ? -24.723 -28.255 -0.655  1.00 10.00 ? 190 ASP A OD2  2  
ATOM 3136   H H    . ASP A 1 35  ? -24.674 -24.276 -0.959  1.00 10.00 ? 190 ASP A H    2  
ATOM 3137   N N    . LEU A 1 36  ? -25.904 -23.697 2.077   1.00 10.00 ? 191 LEU A N    2  
ATOM 3138   C CA   . LEU A 1 36  ? -26.294 -22.979 3.285   1.00 10.00 ? 191 LEU A CA   2  
ATOM 3139   C C    . LEU A 1 36  ? -27.470 -22.050 2.999   1.00 10.00 ? 191 LEU A C    2  
ATOM 3140   O O    . LEU A 1 36  ? -28.364 -21.897 3.825   1.00 10.00 ? 191 LEU A O    2  
ATOM 3141   C CB   . LEU A 1 36  ? -25.110 -22.173 3.833   1.00 10.00 ? 191 LEU A CB   2  
ATOM 3142   C CG   . LEU A 1 36  ? -23.859 -22.974 4.210   1.00 10.00 ? 191 LEU A CG   2  
ATOM 3143   C CD1  . LEU A 1 36  ? -22.653 -22.053 4.323   1.00 10.00 ? 191 LEU A CD1  2  
ATOM 3144   C CD2  . LEU A 1 36  ? -24.078 -23.730 5.513   1.00 10.00 ? 191 LEU A CD2  2  
ATOM 3145   H H    . LEU A 1 36  ? -25.028 -23.510 1.676   1.00 10.00 ? 191 LEU A H    2  
ATOM 3146   N N    . ASN A 1 37  ? -27.451 -21.454 1.808   1.00 10.00 ? 192 ASN A N    2  
ATOM 3147   C CA   . ASN A 1 37  ? -28.504 -20.534 1.361   1.00 10.00 ? 192 ASN A CA   2  
ATOM 3148   C C    . ASN A 1 37  ? -28.655 -19.356 2.321   1.00 10.00 ? 192 ASN A C    2  
ATOM 3149   O O    . ASN A 1 37  ? -29.536 -19.342 3.185   1.00 10.00 ? 192 ASN A O    2  
ATOM 3150   C CB   . ASN A 1 37  ? -29.843 -21.260 1.187   1.00 10.00 ? 192 ASN A CB   2  
ATOM 3151   C CG   . ASN A 1 37  ? -30.776 -20.563 0.211   1.00 10.00 ? 192 ASN A CG   2  
ATOM 3152   O OD1  . ASN A 1 37  ? -30.647 -19.362 -0.047  1.00 10.00 ? 192 ASN A OD1  2  
ATOM 3153   N ND2  . ASN A 1 37  ? -31.727 -21.307 -0.328  1.00 10.00 ? 192 ASN A ND2  2  
ATOM 3154   H H    . ASN A 1 37  ? -26.697 -21.642 1.208   1.00 10.00 ? 192 ASN A H    2  
ATOM 3155   H HD21 . ASN A 1 37  ? -31.778 -22.253 -0.065  1.00 10.00 ? 192 ASN A HD21 2  
ATOM 3156   H HD22 . ASN A 1 37  ? -32.331 -20.890 -0.976  1.00 10.00 ? 192 ASN A HD22 2  
ATOM 3157   N N    . LEU A 1 38  ? -27.788 -18.370 2.163   1.00 10.00 ? 193 LEU A N    2  
ATOM 3158   C CA   . LEU A 1 38  ? -27.804 -17.197 3.022   1.00 10.00 ? 193 LEU A CA   2  
ATOM 3159   C C    . LEU A 1 38  ? -28.334 -15.978 2.278   1.00 10.00 ? 193 LEU A C    2  
ATOM 3160   O O    . LEU A 1 38  ? -28.087 -15.817 1.081   1.00 10.00 ? 193 LEU A O    2  
ATOM 3161   C CB   . LEU A 1 38  ? -26.392 -16.907 3.530   1.00 10.00 ? 193 LEU A CB   2  
ATOM 3162   C CG   . LEU A 1 38  ? -25.635 -18.095 4.122   1.00 10.00 ? 193 LEU A CG   2  
ATOM 3163   C CD1  . LEU A 1 38  ? -24.135 -17.861 4.038   1.00 10.00 ? 193 LEU A CD1  2  
ATOM 3164   C CD2  . LEU A 1 38  ? -26.061 -18.336 5.563   1.00 10.00 ? 193 LEU A CD2  2  
ATOM 3165   H H    . LEU A 1 38  ? -27.126 -18.428 1.444   1.00 10.00 ? 193 LEU A H    2  
ATOM 3166   N N    . GLY A 1 39  ? -29.061 -15.126 2.991   1.00 10.00 ? 194 GLY A N    2  
ATOM 3167   C CA   . GLY A 1 39  ? -29.594 -13.924 2.388   1.00 10.00 ? 194 GLY A CA   2  
ATOM 3168   C C    . GLY A 1 39  ? -28.645 -12.764 2.585   1.00 10.00 ? 194 GLY A C    2  
ATOM 3169   O O    . GLY A 1 39  ? -27.625 -12.665 1.902   1.00 10.00 ? 194 GLY A O    2  
ATOM 3170   H H    . GLY A 1 39  ? -29.232 -15.315 3.941   1.00 10.00 ? 194 GLY A H    2  
ATOM 3171   N N    . GLU A 1 40  ? -28.953 -11.902 3.540   1.00 10.00 ? 195 GLU A N    2  
ATOM 3172   C CA   . GLU A 1 40  ? -28.104 -10.755 3.832   1.00 10.00 ? 195 GLU A CA   2  
ATOM 3173   C C    . GLU A 1 40  ? -26.834 -11.221 4.542   1.00 10.00 ? 195 GLU A C    2  
ATOM 3174   O O    . GLU A 1 40  ? -25.793 -10.561 4.494   1.00 10.00 ? 195 GLU A O    2  
ATOM 3175   C CB   . GLU A 1 40  ? -28.861 -9.738  4.685   1.00 10.00 ? 195 GLU A CB   2  
ATOM 3176   C CG   . GLU A 1 40  ? -28.737 -8.302  4.199   1.00 10.00 ? 195 GLU A CG   2  
ATOM 3177   C CD   . GLU A 1 40  ? -27.510 -7.605  4.747   1.00 10.00 ? 195 GLU A CD   2  
ATOM 3178   O OE1  . GLU A 1 40  ? -27.524 -7.222  5.932   1.00 10.00 ? 195 GLU A OE1  2  
ATOM 3179   O OE2  . GLU A 1 40  ? -26.531 -7.429  3.994   1.00 10.00 ? 195 GLU A OE2  2  
ATOM 3180   H H    . GLU A 1 40  ? -29.774 -12.040 4.064   1.00 10.00 ? 195 GLU A H    2  
ATOM 3181   N N    . MET A 1 41  ? -26.929 -12.383 5.177   1.00 10.00 ? 196 MET A N    2  
ATOM 3182   C CA   . MET A 1 41  ? -25.806 -12.978 5.892   1.00 10.00 ? 196 MET A CA   2  
ATOM 3183   C C    . MET A 1 41  ? -24.726 -13.429 4.912   1.00 10.00 ? 196 MET A C    2  
ATOM 3184   O O    . MET A 1 41  ? -23.606 -13.742 5.310   1.00 10.00 ? 196 MET A O    2  
ATOM 3185   C CB   . MET A 1 41  ? -26.279 -14.178 6.718   1.00 10.00 ? 196 MET A CB   2  
ATOM 3186   C CG   . MET A 1 41  ? -26.132 -14.012 8.220   1.00 10.00 ? 196 MET A CG   2  
ATOM 3187   S SD   . MET A 1 41  ? -24.430 -13.693 8.727   1.00 10.00 ? 196 MET A SD   2  
ATOM 3188   C CE   . MET A 1 41  ? -24.511 -14.114 10.465  1.00 10.00 ? 196 MET A CE   2  
ATOM 3189   H H    . MET A 1 41  ? -27.790 -12.857 5.170   1.00 10.00 ? 196 MET A H    2  
ATOM 3190   N N    . LYS A 1 42  ? -25.072 -13.453 3.627   1.00 10.00 ? 197 LYS A N    2  
ATOM 3191   C CA   . LYS A 1 42  ? -24.136 -13.857 2.583   1.00 10.00 ? 197 LYS A CA   2  
ATOM 3192   C C    . LYS A 1 42  ? -22.955 -12.896 2.508   1.00 10.00 ? 197 LYS A C    2  
ATOM 3193   O O    . LYS A 1 42  ? -21.864 -13.272 2.086   1.00 10.00 ? 197 LYS A O    2  
ATOM 3194   C CB   . LYS A 1 42  ? -24.836 -13.965 1.228   1.00 10.00 ? 197 LYS A CB   2  
ATOM 3195   C CG   . LYS A 1 42  ? -24.049 -14.748 0.188   1.00 10.00 ? 197 LYS A CG   2  
ATOM 3196   C CD   . LYS A 1 42  ? -24.920 -15.136 -0.996  1.00 10.00 ? 197 LYS A CD   2  
ATOM 3197   C CE   . LYS A 1 42  ? -25.594 -13.924 -1.617  1.00 10.00 ? 197 LYS A CE   2  
ATOM 3198   N NZ   . LYS A 1 42  ? -26.467 -14.297 -2.760  1.00 10.00 ? 197 LYS A NZ   2  
ATOM 3199   H H    . LYS A 1 42  ? -25.984 -13.189 3.377   1.00 10.00 ? 197 LYS A H    2  
ATOM 3200   H HZ1  . LYS A 1 42  ? -25.892 -14.690 -3.536  1.00 10.00 ? 197 LYS A HZ1  2  
ATOM 3201   H HZ2  . LYS A 1 42  ? -26.975 -13.460 -3.112  1.00 10.00 ? 197 LYS A HZ2  2  
ATOM 3202   H HZ3  . LYS A 1 42  ? -27.160 -15.013 -2.464  1.00 10.00 ? 197 LYS A HZ3  2  
ATOM 3203   N N    . SER A 1 43  ? -23.180 -11.652 2.917   1.00 10.00 ? 198 SER A N    2  
ATOM 3204   C CA   . SER A 1 43  ? -22.129 -10.649 2.918   1.00 10.00 ? 198 SER A CA   2  
ATOM 3205   C C    . SER A 1 43  ? -21.106 -10.969 4.003   1.00 10.00 ? 198 SER A C    2  
ATOM 3206   O O    . SER A 1 43  ? -19.965 -10.512 3.954   1.00 10.00 ? 198 SER A O    2  
ATOM 3207   C CB   . SER A 1 43  ? -22.730 -9.260  3.139   1.00 10.00 ? 198 SER A CB   2  
ATOM 3208   O OG   . SER A 1 43  ? -23.512 -8.871  2.023   1.00 10.00 ? 198 SER A OG   2  
ATOM 3209   H H    . SER A 1 43  ? -24.078 -11.405 3.230   1.00 10.00 ? 198 SER A H    2  
ATOM 3210   H HG   . SER A 1 43  ? -22.922 -8.700  1.272   1.00 10.00 ? 198 SER A HG   2  
ATOM 3211   N N    . GLY A 1 44  ? -21.543 -11.747 4.982   1.00 10.00 ? 199 GLY A N    2  
ATOM 3212   C CA   . GLY A 1 44  ? -20.682 -12.155 6.076   1.00 10.00 ? 199 GLY A CA   2  
ATOM 3213   C C    . GLY A 1 44  ? -19.481 -12.974 5.616   1.00 10.00 ? 199 GLY A C    2  
ATOM 3214   O O    . GLY A 1 44  ? -18.374 -12.775 6.115   1.00 10.00 ? 199 GLY A O    2  
ATOM 3215   H H    . GLY A 1 44  ? -22.488 -12.017 4.978   1.00 10.00 ? 199 GLY A H    2  
ATOM 3216   N N    . VAL A 1 45  ? -19.707 -13.910 4.692   1.00 10.00 ? 200 VAL A N    2  
ATOM 3217   C CA   . VAL A 1 45  ? -18.637 -14.763 4.160   1.00 10.00 ? 200 VAL A CA   2  
ATOM 3218   C C    . VAL A 1 45  ? -17.369 -13.985 3.770   1.00 10.00 ? 200 VAL A C    2  
ATOM 3219   O O    . VAL A 1 45  ? -16.298 -14.238 4.331   1.00 10.00 ? 200 VAL A O    2  
ATOM 3220   C CB   . VAL A 1 45  ? -19.105 -15.645 2.985   1.00 10.00 ? 200 VAL A CB   2  
ATOM 3221   C CG1  . VAL A 1 45  ? -18.174 -16.833 2.799   1.00 10.00 ? 200 VAL A CG1  2  
ATOM 3222   C CG2  . VAL A 1 45  ? -20.541 -16.107 3.188   1.00 10.00 ? 200 VAL A CG2  2  
ATOM 3223   H H    . VAL A 1 45  ? -20.624 -14.076 4.394   1.00 10.00 ? 200 VAL A H    2  
ATOM 3224   N N    . PRO A 1 46  ? -17.456 -13.044 2.803   1.00 10.00 ? 201 PRO A N    2  
ATOM 3225   C CA   . PRO A 1 46  ? -16.302 -12.244 2.381   1.00 10.00 ? 201 PRO A CA   2  
ATOM 3226   C C    . PRO A 1 46  ? -15.681 -11.464 3.542   1.00 10.00 ? 201 PRO A C    2  
ATOM 3227   O O    . PRO A 1 46  ? -14.489 -11.168 3.528   1.00 10.00 ? 201 PRO A O    2  
ATOM 3228   C CB   . PRO A 1 46  ? -16.856 -11.292 1.312   1.00 10.00 ? 201 PRO A CB   2  
ATOM 3229   C CG   . PRO A 1 46  ? -18.337 -11.368 1.440   1.00 10.00 ? 201 PRO A CG   2  
ATOM 3230   C CD   . PRO A 1 46  ? -18.656 -12.716 2.018   1.00 10.00 ? 201 PRO A CD   2  
ATOM 3231   N N    . VAL A 1 47  ? -16.496 -11.129 4.543   1.00 10.00 ? 202 VAL A N    2  
ATOM 3232   C CA   . VAL A 1 47  ? -16.010 -10.411 5.719   1.00 10.00 ? 202 VAL A CA   2  
ATOM 3233   C C    . VAL A 1 47  ? -15.040 -11.296 6.495   1.00 10.00 ? 202 VAL A C    2  
ATOM 3234   O O    . VAL A 1 47  ? -13.903 -10.904 6.767   1.00 10.00 ? 202 VAL A O    2  
ATOM 3235   C CB   . VAL A 1 47  ? -17.173 -9.978  6.642   1.00 10.00 ? 202 VAL A CB   2  
ATOM 3236   C CG1  . VAL A 1 47  ? -16.660 -9.412  7.957   1.00 10.00 ? 202 VAL A CG1  2  
ATOM 3237   C CG2  . VAL A 1 47  ? -18.065 -8.961  5.942   1.00 10.00 ? 202 VAL A CG2  2  
ATOM 3238   H H    . VAL A 1 47  ? -17.446 -11.372 4.491   1.00 10.00 ? 202 VAL A H    2  
ATOM 3239   N N    . LEU A 1 48  ? -15.492 -12.508 6.828   1.00 10.00 ? 203 LEU A N    2  
ATOM 3240   C CA   . LEU A 1 48  ? -14.672 -13.463 7.562   1.00 10.00 ? 203 LEU A CA   2  
ATOM 3241   C C    . LEU A 1 48  ? -13.349 -13.720 6.840   1.00 10.00 ? 203 LEU A C    2  
ATOM 3242   O O    . LEU A 1 48  ? -12.276 -13.672 7.450   1.00 10.00 ? 203 LEU A O    2  
ATOM 3243   C CB   . LEU A 1 48  ? -15.424 -14.785 7.769   1.00 10.00 ? 203 LEU A CB   2  
ATOM 3244   C CG   . LEU A 1 48  ? -16.099 -14.974 9.131   1.00 10.00 ? 203 LEU A CG   2  
ATOM 3245   C CD1  . LEU A 1 48  ? -17.333 -14.094 9.253   1.00 10.00 ? 203 LEU A CD1  2  
ATOM 3246   C CD2  . LEU A 1 48  ? -16.449 -16.437 9.355   1.00 10.00 ? 203 LEU A CD2  2  
ATOM 3247   H H    . LEU A 1 48  ? -16.411 -12.743 6.558   1.00 10.00 ? 203 LEU A H    2  
ATOM 3248   N N    . ALA A 1 49  ? -13.447 -14.021 5.543   1.00 10.00 ? 204 ALA A N    2  
ATOM 3249   C CA   . ALA A 1 49  ? -12.275 -14.253 4.689   1.00 10.00 ? 204 ALA A CA   2  
ATOM 3250   C C    . ALA A 1 49  ? -11.242 -13.132 4.822   1.00 10.00 ? 204 ALA A C    2  
ATOM 3251   O O    . ALA A 1 49  ? -10.043 -13.353 4.666   1.00 10.00 ? 204 ALA A O    2  
ATOM 3252   C CB   . ALA A 1 49  ? -12.714 -14.410 3.240   1.00 10.00 ? 204 ALA A CB   2  
ATOM 3253   H H    . ALA A 1 49  ? -14.339 -14.199 5.176   1.00 10.00 ? 204 ALA A H    2  
ATOM 3254   N N    . VAL A 1 50  ? -11.729 -11.937 5.128   1.00 10.00 ? 205 VAL A N    2  
ATOM 3255   C CA   . VAL A 1 50  ? -10.858 -10.775 5.282   1.00 10.00 ? 205 VAL A CA   2  
ATOM 3256   C C    . VAL A 1 50  ? -10.170 -10.793 6.660   1.00 10.00 ? 205 VAL A C    2  
ATOM 3257   O O    . VAL A 1 50  ? -8.963  -10.589 6.760   1.00 10.00 ? 205 VAL A O    2  
ATOM 3258   C CB   . VAL A 1 50  ? -11.583 -9.428  5.054   1.00 10.00 ? 205 VAL A CB   2  
ATOM 3259   C CG1  . VAL A 1 50  ? -10.729 -8.262  5.530   1.00 10.00 ? 205 VAL A CG1  2  
ATOM 3260   C CG2  . VAL A 1 50  ? -11.930 -9.252  3.581   1.00 10.00 ? 205 VAL A CG2  2  
ATOM 3261   H H    . VAL A 1 50  ? -12.663 -11.895 5.412   1.00 10.00 ? 205 VAL A H    2  
ATOM 3262   N N    . SER A 1 51  ? -10.961 -11.069 7.693   1.00 10.00 ? 206 SER A N    2  
ATOM 3263   C CA   . SER A 1 51  ? -10.474 -11.090 9.078   1.00 10.00 ? 206 SER A CA   2  
ATOM 3264   C C    . SER A 1 51  ? -9.371  -12.127 9.297   1.00 10.00 ? 206 SER A C    2  
ATOM 3265   O O    . SER A 1 51  ? -8.331  -11.823 9.888   1.00 10.00 ? 206 SER A O    2  
ATOM 3266   C CB   . SER A 1 51  ? -11.645 -11.347 10.023  1.00 10.00 ? 206 SER A CB   2  
ATOM 3267   O OG   . SER A 1 51  ? -12.830 -10.739 9.533   1.00 10.00 ? 206 SER A OG   2  
ATOM 3268   H H    . SER A 1 51  ? -11.904 -11.293 7.538   1.00 10.00 ? 206 SER A H    2  
ATOM 3269   H HG   . SER A 1 51  ? -13.003 -9.933  10.025  1.00 10.00 ? 206 SER A HG   2  
ATOM 3270   N N    . LEU A 1 52  ? -9.605  -13.354 8.843   1.00 10.00 ? 207 LEU A N    2  
ATOM 3271   C CA   . LEU A 1 52  ? -8.622  -14.424 8.986   1.00 10.00 ? 207 LEU A CA   2  
ATOM 3272   C C    . LEU A 1 52  ? -7.340  -14.076 8.241   1.00 10.00 ? 207 LEU A C    2  
ATOM 3273   O O    . LEU A 1 52  ? -6.234  -14.261 8.758   1.00 10.00 ? 207 LEU A O    2  
ATOM 3274   C CB   . LEU A 1 52  ? -9.196  -15.742 8.445   1.00 10.00 ? 207 LEU A CB   2  
ATOM 3275   C CG   . LEU A 1 52  ? -10.381 -16.330 9.208   1.00 10.00 ? 207 LEU A CG   2  
ATOM 3276   C CD1  . LEU A 1 52  ? -10.959 -17.521 8.459   1.00 10.00 ? 207 LEU A CD1  2  
ATOM 3277   C CD2  . LEU A 1 52  ? -9.961  -16.733 10.616  1.00 10.00 ? 207 LEU A CD2  2  
ATOM 3278   H H    . LEU A 1 52  ? -10.468 -13.547 8.419   1.00 10.00 ? 207 LEU A H    2  
ATOM 3279   N N    . ALA A 1 53  ? -7.503  -13.587 7.014   1.00 10.00 ? 208 ALA A N    2  
ATOM 3280   C CA   . ALA A 1 53  ? -6.373  -13.181 6.172   1.00 10.00 ? 208 ALA A CA   2  
ATOM 3281   C C    . ALA A 1 53  ? -5.473  -12.159 6.861   1.00 10.00 ? 208 ALA A C    2  
ATOM 3282   O O    . ALA A 1 53  ? -4.296  -12.027 6.524   1.00 10.00 ? 208 ALA A O    2  
ATOM 3283   C CB   . ALA A 1 53  ? -6.865  -12.641 4.842   1.00 10.00 ? 208 ALA A CB   2  
ATOM 3284   H H    . ALA A 1 53  ? -8.406  -13.637 6.628   1.00 10.00 ? 208 ALA A H    2  
ATOM 3285   N N    . LEU A 1 54  ? -6.022  -11.431 7.823   1.00 10.00 ? 209 LEU A N    2  
ATOM 3286   C CA   . LEU A 1 54  ? -5.239  -10.452 8.554   1.00 10.00 ? 209 LEU A CA   2  
ATOM 3287   C C    . LEU A 1 54  ? -4.301  -11.157 9.534   1.00 10.00 ? 209 LEU A C    2  
ATOM 3288   O O    . LEU A 1 54  ? -3.168  -10.720 9.738   1.00 10.00 ? 209 LEU A O    2  
ATOM 3289   C CB   . LEU A 1 54  ? -6.140  -9.480  9.316   1.00 10.00 ? 209 LEU A CB   2  
ATOM 3290   C CG   . LEU A 1 54  ? -7.102  -8.638  8.480   1.00 10.00 ? 209 LEU A CG   2  
ATOM 3291   C CD1  . LEU A 1 54  ? -7.865  -7.670  9.373   1.00 10.00 ? 209 LEU A CD1  2  
ATOM 3292   C CD2  . LEU A 1 54  ? -6.362  -7.890  7.379   1.00 10.00 ? 209 LEU A CD2  2  
ATOM 3293   H H    . LEU A 1 54  ? -6.970  -11.555 8.038   1.00 10.00 ? 209 LEU A H    2  
ATOM 3294   N N    . GLU A 1 55  ? -4.770  -12.263 10.123  1.00 10.00 ? 210 GLU A N    2  
ATOM 3295   C CA   . GLU A 1 55  ? -3.966  -13.008 11.081  1.00 10.00 ? 210 GLU A CA   2  
ATOM 3296   C C    . GLU A 1 55  ? -2.830  -13.717 10.365  1.00 10.00 ? 210 GLU A C    2  
ATOM 3297   O O    . GLU A 1 55  ? -1.699  -13.758 10.855  1.00 10.00 ? 210 GLU A O    2  
ATOM 3298   C CB   . GLU A 1 55  ? -4.823  -14.043 11.810  1.00 10.00 ? 210 GLU A CB   2  
ATOM 3299   C CG   . GLU A 1 55  ? -6.065  -13.489 12.478  1.00 10.00 ? 210 GLU A CG   2  
ATOM 3300   C CD   . GLU A 1 55  ? -6.936  -14.583 13.062  1.00 10.00 ? 210 GLU A CD   2  
ATOM 3301   O OE1  . GLU A 1 55  ? -6.786  -15.754 12.654  1.00 10.00 ? 210 GLU A OE1  2  
ATOM 3302   O OE2  . GLU A 1 55  ? -7.781  -14.274 13.930  1.00 10.00 ? 210 GLU A OE2  2  
ATOM 3303   H H    . GLU A 1 55  ? -5.668  -12.582 9.891   1.00 10.00 ? 210 GLU A H    2  
ATOM 3304   N N    . GLY A 1 56  ? -3.144  -14.294 9.213   1.00 10.00 ? 211 GLY A N    2  
ATOM 3305   C CA   . GLY A 1 56  ? -2.134  -14.961 8.427   1.00 10.00 ? 211 GLY A CA   2  
ATOM 3306   C C    . GLY A 1 56  ? -1.221  -13.979 7.730   1.00 10.00 ? 211 GLY A C    2  
ATOM 3307   O O    . GLY A 1 56  ? -1.390  -12.769 7.861   1.00 10.00 ? 211 GLY A O    2  
ATOM 3308   H H    . GLY A 1 56  ? -4.087  -14.355 8.944   1.00 10.00 ? 211 GLY A H    2  
ATOM 3309   N N    . LYS A 1 57  ? -0.251  -14.498 6.995   1.00 10.00 ? 212 LYS A N    2  
ATOM 3310   C CA   . LYS A 1 57  ? 0.691   -13.660 6.269   1.00 10.00 ? 212 LYS A CA   2  
ATOM 3311   C C    . LYS A 1 57  ? 0.015   -12.937 5.107   1.00 10.00 ? 212 LYS A C    2  
ATOM 3312   O O    . LYS A 1 57  ? -1.173  -13.135 4.840   1.00 10.00 ? 212 LYS A O    2  
ATOM 3313   C CB   . LYS A 1 57  ? 1.861   -14.494 5.752   1.00 10.00 ? 212 LYS A CB   2  
ATOM 3314   C CG   . LYS A 1 57  ? 2.693   -15.139 6.843   1.00 10.00 ? 212 LYS A CG   2  
ATOM 3315   C CD   . LYS A 1 57  ? 3.979   -15.714 6.280   1.00 10.00 ? 212 LYS A CD   2  
ATOM 3316   C CE   . LYS A 1 57  ? 3.706   -16.850 5.308   1.00 10.00 ? 212 LYS A CE   2  
ATOM 3317   N NZ   . LYS A 1 57  ? 4.930   -17.642 5.045   1.00 10.00 ? 212 LYS A NZ   2  
ATOM 3318   H H    . LYS A 1 57  ? -0.162  -15.476 6.943   1.00 10.00 ? 212 LYS A H    2  
ATOM 3319   H HZ1  . LYS A 1 57  ? 5.463   -17.774 5.928   1.00 10.00 ? 212 LYS A HZ1  2  
ATOM 3320   H HZ2  . LYS A 1 57  ? 5.540   -17.150 4.361   1.00 10.00 ? 212 LYS A HZ2  2  
ATOM 3321   H HZ3  . LYS A 1 57  ? 4.683   -18.578 4.662   1.00 10.00 ? 212 LYS A HZ3  2  
ATOM 3322   N N    . ALA A 1 58  ? 0.789   -12.120 4.405   1.00 10.00 ? 213 ALA A N    2  
ATOM 3323   C CA   . ALA A 1 58  ? 0.280   -11.353 3.273   1.00 10.00 ? 213 ALA A CA   2  
ATOM 3324   C C    . ALA A 1 58  ? -0.236  -12.264 2.165   1.00 10.00 ? 213 ALA A C    2  
ATOM 3325   O O    . ALA A 1 58  ? -1.167  -11.904 1.442   1.00 10.00 ? 213 ALA A O    2  
ATOM 3326   C CB   . ALA A 1 58  ? 1.346   -10.407 2.744   1.00 10.00 ? 213 ALA A CB   2  
ATOM 3327   H H    . ALA A 1 58  ? 1.735   -12.028 4.653   1.00 10.00 ? 213 ALA A H    2  
ATOM 3328   N N    . SER A 1 59  ? 0.363   -13.443 2.045   1.00 10.00 ? 214 SER A N    2  
ATOM 3329   C CA   . SER A 1 59  ? -0.036  -14.414 1.036   1.00 10.00 ? 214 SER A CA   2  
ATOM 3330   C C    . SER A 1 59  ? -1.488  -14.838 1.239   1.00 10.00 ? 214 SER A C    2  
ATOM 3331   O O    . SER A 1 59  ? -2.211  -15.114 0.283   1.00 10.00 ? 214 SER A O    2  
ATOM 3332   C CB   . SER A 1 59  ? 0.884   -15.629 1.113   1.00 10.00 ? 214 SER A CB   2  
ATOM 3333   O OG   . SER A 1 59  ? 2.011   -15.344 1.932   1.00 10.00 ? 214 SER A OG   2  
ATOM 3334   H H    . SER A 1 59  ? 1.103   -13.670 2.653   1.00 10.00 ? 214 SER A H    2  
ATOM 3335   H HG   . SER A 1 59  ? 2.655   -14.832 1.425   1.00 10.00 ? 214 SER A HG   2  
ATOM 3336   N N    . HIS A 1 60  ? -1.912  -14.883 2.496   1.00 10.00 ? 215 HIS A N    2  
ATOM 3337   C CA   . HIS A 1 60  ? -3.277  -15.258 2.816   1.00 10.00 ? 215 HIS A CA   2  
ATOM 3338   C C    . HIS A 1 60  ? -4.259  -14.148 2.457   1.00 10.00 ? 215 HIS A C    2  
ATOM 3339   O O    . HIS A 1 60  ? -5.441  -14.412 2.273   1.00 10.00 ? 215 HIS A O    2  
ATOM 3340   C CB   . HIS A 1 60  ? -3.417  -15.686 4.282   1.00 10.00 ? 215 HIS A CB   2  
ATOM 3341   C CG   . HIS A 1 60  ? -3.215  -17.160 4.492   1.00 10.00 ? 215 HIS A CG   2  
ATOM 3342   N ND1  . HIS A 1 60  ? -3.735  -17.855 5.562   1.00 10.00 ? 215 HIS A ND1  2  
ATOM 3343   C CD2  . HIS A 1 60  ? -2.547  -18.073 3.749   1.00 10.00 ? 215 HIS A CD2  2  
ATOM 3344   C CE1  . HIS A 1 60  ? -3.396  -19.126 5.468   1.00 10.00 ? 215 HIS A CE1  2  
ATOM 3345   N NE2  . HIS A 1 60  ? -2.677  -19.285 4.376   1.00 10.00 ? 215 HIS A NE2  2  
ATOM 3346   H H    . HIS A 1 60  ? -1.293  -14.657 3.221   1.00 10.00 ? 215 HIS A H    2  
ATOM 3347   H HD1  . HIS A 1 60  ? -4.280  -17.472 6.289   1.00 10.00 ? 215 HIS A HD1  2  
ATOM 3348   H HE2  . HIS A 1 60  ? -2.174  -20.102 4.147   1.00 10.00 ? 215 HIS A HE2  2  
ATOM 3349   N N    . ARG A 1 61  ? -3.771  -12.916 2.364   1.00 10.00 ? 216 ARG A N    2  
ATOM 3350   C CA   . ARG A 1 61  ? -4.611  -11.779 2.002   1.00 10.00 ? 216 ARG A CA   2  
ATOM 3351   C C    . ARG A 1 61  ? -4.919  -11.789 0.510   1.00 10.00 ? 216 ARG A C    2  
ATOM 3352   O O    . ARG A 1 61  ? -6.077  -11.804 0.111   1.00 10.00 ? 216 ARG A O    2  
ATOM 3353   C CB   . ARG A 1 61  ? -3.948  -10.462 2.407   1.00 10.00 ? 216 ARG A CB   2  
ATOM 3354   C CG   . ARG A 1 61  ? -4.009  -10.194 3.900   1.00 10.00 ? 216 ARG A CG   2  
ATOM 3355   C CD   . ARG A 1 61  ? -2.778  -9.450  4.381   1.00 10.00 ? 216 ARG A CD   2  
ATOM 3356   N NE   . ARG A 1 61  ? -2.269  -10.004 5.635   1.00 10.00 ? 216 ARG A NE   2  
ATOM 3357   C CZ   . ARG A 1 61  ? -1.169  -9.572  6.247   1.00 10.00 ? 216 ARG A CZ   2  
ATOM 3358   N NH1  . ARG A 1 61  ? -0.456  -8.584  5.717   1.00 10.00 ? 216 ARG A NH1  2  
ATOM 3359   N NH2  . ARG A 1 61  ? -0.778  -10.133 7.382   1.00 10.00 ? 216 ARG A NH2  2  
ATOM 3360   H H    . ARG A 1 61  ? -2.813  -12.755 2.502   1.00 10.00 ? 216 ARG A H    2  
ATOM 3361   H HE   . ARG A 1 61  ? -2.781  -10.747 6.041   1.00 10.00 ? 216 ARG A HE   2  
ATOM 3362   H HH11 . ARG A 1 61  ? -0.744  -8.159  4.859   1.00 10.00 ? 216 ARG A HH11 2  
ATOM 3363   H HH12 . ARG A 1 61  ? 0.379   -8.263  6.171   1.00 10.00 ? 216 ARG A HH12 2  
ATOM 3364   H HH21 . ARG A 1 61  ? -1.308  -10.889 7.784   1.00 10.00 ? 216 ARG A HH21 2  
ATOM 3365   H HH22 . ARG A 1 61  ? 0.055   -9.814  7.843   1.00 10.00 ? 216 ARG A HH22 2  
ATOM 3366   N N    . GLU A 1 62  ? -3.861  -11.772 -0.301  1.00 10.00 ? 217 GLU A N    2  
ATOM 3367   C CA   . GLU A 1 62  ? -3.990  -11.794 -1.766  1.00 10.00 ? 217 GLU A CA   2  
ATOM 3368   C C    . GLU A 1 62  ? -4.863  -12.961 -2.237  1.00 10.00 ? 217 GLU A C    2  
ATOM 3369   O O    . GLU A 1 62  ? -5.528  -12.879 -3.273  1.00 10.00 ? 217 GLU A O    2  
ATOM 3370   C CB   . GLU A 1 62  ? -2.604  -11.843 -2.423  1.00 10.00 ? 217 GLU A CB   2  
ATOM 3371   C CG   . GLU A 1 62  ? -2.611  -11.847 -3.948  1.00 10.00 ? 217 GLU A CG   2  
ATOM 3372   C CD   . GLU A 1 62  ? -3.264  -10.621 -4.565  1.00 10.00 ? 217 GLU A CD   2  
ATOM 3373   O OE1  . GLU A 1 62  ? -3.970  -9.883  -3.853  1.00 10.00 ? 217 GLU A OE1  2  
ATOM 3374   O OE2  . GLU A 1 62  ? -3.070  -10.393 -5.777  1.00 10.00 ? 217 GLU A OE2  2  
ATOM 3375   H H    . GLU A 1 62  ? -2.967  -11.657 0.085   1.00 10.00 ? 217 GLU A H    2  
ATOM 3376   N N    . MET A 1 63  ? -4.855  -14.039 -1.469  1.00 10.00 ? 218 MET A N    2  
ATOM 3377   C CA   . MET A 1 63  ? -5.651  -15.212 -1.791  1.00 10.00 ? 218 MET A CA   2  
ATOM 3378   C C    . MET A 1 63  ? -7.144  -14.905 -1.675  1.00 10.00 ? 218 MET A C    2  
ATOM 3379   O O    . MET A 1 63  ? -7.969  -15.543 -2.332  1.00 10.00 ? 218 MET A O    2  
ATOM 3380   C CB   . MET A 1 63  ? -5.274  -16.382 -0.880  1.00 10.00 ? 218 MET A CB   2  
ATOM 3381   C CG   . MET A 1 63  ? -4.182  -17.278 -1.442  1.00 10.00 ? 218 MET A CG   2  
ATOM 3382   S SD   . MET A 1 63  ? -4.745  -18.269 -2.841  1.00 10.00 ? 218 MET A SD   2  
ATOM 3383   C CE   . MET A 1 63  ? -6.009  -19.267 -2.057  1.00 10.00 ? 218 MET A CE   2  
ATOM 3384   H H    . MET A 1 63  ? -4.308  -14.038 -0.656  1.00 10.00 ? 218 MET A H    2  
ATOM 3385   N N    . THR A 1 64  ? -7.481  -13.922 -0.846  1.00 10.00 ? 219 THR A N    2  
ATOM 3386   C CA   . THR A 1 64  ? -8.863  -13.520 -0.654  1.00 10.00 ? 219 THR A CA   2  
ATOM 3387   C C    . THR A 1 64  ? -9.382  -12.784 -1.886  1.00 10.00 ? 219 THR A C    2  
ATOM 3388   O O    . THR A 1 64  ? -10.504 -13.027 -2.327  1.00 10.00 ? 219 THR A O    2  
ATOM 3389   C CB   . THR A 1 64  ? -9.030  -12.632 0.596   1.00 10.00 ? 219 THR A CB   2  
ATOM 3390   O OG1  . THR A 1 64  ? -8.390  -13.264 1.712   1.00 10.00 ? 219 THR A OG1  2  
ATOM 3391   C CG2  . THR A 1 64  ? -10.504 -12.425 0.917   1.00 10.00 ? 219 THR A CG2  2  
ATOM 3392   H H    . THR A 1 64  ? -6.775  -13.442 -0.357  1.00 10.00 ? 219 THR A H    2  
ATOM 3393   H HG1  . THR A 1 64  ? -8.987  -13.263 2.469   1.00 10.00 ? 219 THR A HG1  2  
ATOM 3394   N N    . SER A 1 65  ? -8.573  -11.874 -2.435  1.00 10.00 ? 220 SER A N    2  
ATOM 3395   C CA   . SER A 1 65  ? -8.948  -11.118 -3.626  1.00 10.00 ? 220 SER A CA   2  
ATOM 3396   C C    . SER A 1 65  ? -9.452  -12.013 -4.761  1.00 10.00 ? 220 SER A C    2  
ATOM 3397   O O    . SER A 1 65  ? -10.335 -11.617 -5.528  1.00 10.00 ? 220 SER A O    2  
ATOM 3398   C CB   . SER A 1 65  ? -7.744  -10.295 -4.088  1.00 10.00 ? 220 SER A CB   2  
ATOM 3399   O OG   . SER A 1 65  ? -6.885  -10.011 -2.990  1.00 10.00 ? 220 SER A OG   2  
ATOM 3400   H H    . SER A 1 65  ? -7.745  -11.598 -1.983  1.00 10.00 ? 220 SER A H    2  
ATOM 3401   H HG   . SER A 1 65  ? -5.961  -10.036 -3.288  1.00 10.00 ? 220 SER A HG   2  
ATOM 3402   N N    . LYS A 1 66  ? -8.908  -13.220 -4.859  1.00 10.00 ? 221 LYS A N    2  
ATOM 3403   C CA   . LYS A 1 66  ? -9.337  -14.156 -5.888  1.00 10.00 ? 221 LYS A CA   2  
ATOM 3404   C C    . LYS A 1 66  ? -10.737 -14.668 -5.570  1.00 10.00 ? 221 LYS A C    2  
ATOM 3405   O O    . LYS A 1 66  ? -11.578 -14.798 -6.457  1.00 10.00 ? 221 LYS A O    2  
ATOM 3406   C CB   . LYS A 1 66  ? -8.368  -15.336 -5.996  1.00 10.00 ? 221 LYS A CB   2  
ATOM 3407   C CG   . LYS A 1 66  ? -8.880  -16.457 -6.890  1.00 10.00 ? 221 LYS A CG   2  
ATOM 3408   C CD   . LYS A 1 66  ? -8.100  -17.745 -6.687  1.00 10.00 ? 221 LYS A CD   2  
ATOM 3409   C CE   . LYS A 1 66  ? -8.942  -18.961 -7.048  1.00 10.00 ? 221 LYS A CE   2  
ATOM 3410   N NZ   . LYS A 1 66  ? -9.727  -18.758 -8.297  1.00 10.00 ? 221 LYS A NZ   2  
ATOM 3411   H H    . LYS A 1 66  ? -8.209  -13.485 -4.223  1.00 10.00 ? 221 LYS A H    2  
ATOM 3412   H HZ1  . LYS A 1 66  ? -10.060 -19.673 -8.660  1.00 10.00 ? 221 LYS A HZ1  2  
ATOM 3413   H HZ2  . LYS A 1 66  ? -9.136  -18.306 -9.024  1.00 10.00 ? 221 LYS A HZ2  2  
ATOM 3414   H HZ3  . LYS A 1 66  ? -10.559 -18.154 -8.109  1.00 10.00 ? 221 LYS A HZ3  2  
ATOM 3415   N N    . LEU A 1 67  ? -10.977 -14.917 -4.293  1.00 10.00 ? 222 LEU A N    2  
ATOM 3416   C CA   . LEU A 1 67  ? -12.262 -15.424 -3.828  1.00 10.00 ? 222 LEU A CA   2  
ATOM 3417   C C    . LEU A 1 67  ? -13.345 -14.372 -4.000  1.00 10.00 ? 222 LEU A C    2  
ATOM 3418   O O    . LEU A 1 67  ? -14.481 -14.693 -4.346  1.00 10.00 ? 222 LEU A O    2  
ATOM 3419   C CB   . LEU A 1 67  ? -12.151 -15.856 -2.358  1.00 10.00 ? 222 LEU A CB   2  
ATOM 3420   C CG   . LEU A 1 67  ? -13.458 -16.027 -1.575  1.00 10.00 ? 222 LEU A CG   2  
ATOM 3421   C CD1  . LEU A 1 67  ? -13.458 -17.342 -0.811  1.00 10.00 ? 222 LEU A CD1  2  
ATOM 3422   C CD2  . LEU A 1 67  ? -13.663 -14.860 -0.621  1.00 10.00 ? 222 LEU A CD2  2  
ATOM 3423   H H    . LEU A 1 67  ? -10.278 -14.725 -3.629  1.00 10.00 ? 222 LEU A H    2  
ATOM 3424   N N    . LEU A 1 68  ? -12.970 -13.120 -3.767  1.00 10.00 ? 223 LEU A N    2  
ATOM 3425   C CA   . LEU A 1 68  ? -13.896 -12.000 -3.872  1.00 10.00 ? 223 LEU A CA   2  
ATOM 3426   C C    . LEU A 1 68  ? -14.596 -11.953 -5.233  1.00 10.00 ? 223 LEU A C    2  
ATOM 3427   O O    . LEU A 1 68  ? -15.817 -12.103 -5.318  1.00 10.00 ? 223 LEU A O    2  
ATOM 3428   C CB   . LEU A 1 68  ? -13.155 -10.677 -3.640  1.00 10.00 ? 223 LEU A CB   2  
ATOM 3429   C CG   . LEU A 1 68  ? -12.502 -10.480 -2.272  1.00 10.00 ? 223 LEU A CG   2  
ATOM 3430   C CD1  . LEU A 1 68  ? -11.749 -9.161  -2.229  1.00 10.00 ? 223 LEU A CD1  2  
ATOM 3431   C CD2  . LEU A 1 68  ? -13.541 -10.537 -1.164  1.00 10.00 ? 223 LEU A CD2  2  
ATOM 3432   H H    . LEU A 1 68  ? -12.039 -12.946 -3.504  1.00 10.00 ? 223 LEU A H    2  
ATOM 3433   N N    . SER A 1 69  ? -13.820 -11.752 -6.287  1.00 10.00 ? 224 SER A N    2  
ATOM 3434   C CA   . SER A 1 69  ? -14.368 -11.669 -7.641  1.00 10.00 ? 224 SER A CA   2  
ATOM 3435   C C    . SER A 1 69  ? -14.958 -12.998 -8.101  1.00 10.00 ? 224 SER A C    2  
ATOM 3436   O O    . SER A 1 69  ? -15.847 -13.025 -8.952  1.00 10.00 ? 224 SER A O    2  
ATOM 3437   C CB   . SER A 1 69  ? -13.310 -11.183 -8.629  1.00 10.00 ? 224 SER A CB   2  
ATOM 3438   O OG   . SER A 1 69  ? -13.912 -10.651 -9.798  1.00 10.00 ? 224 SER A OG   2  
ATOM 3439   H H    . SER A 1 69  ? -12.857 -11.601 -6.165  1.00 10.00 ? 224 SER A H    2  
ATOM 3440   H HG   . SER A 1 69  ? -14.743 -11.114 -9.968  1.00 10.00 ? 224 SER A HG   2  
ATOM 3441   N N    . ASP A 1 70  ? -14.462 -14.084 -7.536  1.00 10.00 ? 225 ASP A N    2  
ATOM 3442   C CA   . ASP A 1 70  ? -14.955 -15.409 -7.900  1.00 10.00 ? 225 ASP A CA   2  
ATOM 3443   C C    . ASP A 1 70  ? -16.383 -15.574 -7.398  1.00 10.00 ? 225 ASP A C    2  
ATOM 3444   O O    . ASP A 1 70  ? -17.275 -15.995 -8.134  1.00 10.00 ? 225 ASP A O    2  
ATOM 3445   C CB   . ASP A 1 70  ? -14.056 -16.513 -7.329  1.00 10.00 ? 225 ASP A CB   2  
ATOM 3446   C CG   . ASP A 1 70  ? -13.426 -17.370 -8.410  1.00 10.00 ? 225 ASP A CG   2  
ATOM 3447   O OD1  . ASP A 1 70  ? -13.980 -17.433 -9.524  1.00 10.00 ? 225 ASP A OD1  2  
ATOM 3448   O OD2  . ASP A 1 70  ? -12.365 -17.984 -8.156  1.00 10.00 ? 225 ASP A OD2  2  
ATOM 3449   H H    . ASP A 1 70  ? -13.767 -13.996 -6.851  1.00 10.00 ? 225 ASP A H    2  
ATOM 3450   N N    . LEU A 1 71  ? -16.580 -15.230 -6.130  1.00 10.00 ? 226 LEU A N    2  
ATOM 3451   C CA   . LEU A 1 71  ? -17.891 -15.312 -5.504  1.00 10.00 ? 226 LEU A CA   2  
ATOM 3452   C C    . LEU A 1 71  ? -18.903 -14.360 -6.141  1.00 10.00 ? 226 LEU A C    2  
ATOM 3453   O O    . LEU A 1 71  ? -20.062 -14.741 -6.343  1.00 10.00 ? 226 LEU A O    2  
ATOM 3454   C CB   . LEU A 1 71  ? -17.798 -15.045 -4.001  1.00 10.00 ? 226 LEU A CB   2  
ATOM 3455   C CG   . LEU A 1 71  ? -17.019 -16.070 -3.174  1.00 10.00 ? 226 LEU A CG   2  
ATOM 3456   C CD1  . LEU A 1 71  ? -17.149 -15.763 -1.688  1.00 10.00 ? 226 LEU A CD1  2  
ATOM 3457   C CD2  . LEU A 1 71  ? -17.491 -17.483 -3.480  1.00 10.00 ? 226 LEU A CD2  2  
ATOM 3458   H H    . LEU A 1 71  ? -15.807 -14.965 -5.584  1.00 10.00 ? 226 LEU A H    2  
ATOM 3459   N N    . CYS A 1 72  ? -18.484 -13.137 -6.454  1.00 10.00 ? 227 CYS A N    2  
ATOM 3460   C CA   . CYS A 1 72  ? -19.385 -12.164 -7.056  1.00 10.00 ? 227 CYS A CA   2  
ATOM 3461   C C    . CYS A 1 72  ? -19.731 -12.560 -8.485  1.00 10.00 ? 227 CYS A C    2  
ATOM 3462   O O    . CYS A 1 72  ? -18.857 -12.915 -9.275  1.00 10.00 ? 227 CYS A O    2  
ATOM 3463   C CB   . CYS A 1 72  ? -18.779 -10.761 -7.017  1.00 10.00 ? 227 CYS A CB   2  
ATOM 3464   S SG   . CYS A 1 72  ? -19.974 -9.425  -7.270  1.00 10.00 ? 227 CYS A SG   2  
ATOM 3465   H H    . CYS A 1 72  ? -17.552 -12.874 -6.288  1.00 10.00 ? 227 CYS A H    2  
ATOM 3466   H HG   . CYS A 1 72  ? -20.579 -9.634  -8.432  1.00 10.00 ? 227 CYS A HG   2  
ATOM 3467   N N    . GLY A 1 73  ? -21.011 -12.499 -8.803  1.00 10.00 ? 228 GLY A N    2  
ATOM 3468   C CA   . GLY A 1 73  ? -21.471 -12.869 -10.123 1.00 10.00 ? 228 GLY A CA   2  
ATOM 3469   C C    . GLY A 1 73  ? -21.887 -14.321 -10.156 1.00 10.00 ? 228 GLY A C    2  
ATOM 3470   O O    . GLY A 1 73  ? -22.818 -14.696 -10.864 1.00 10.00 ? 228 GLY A O    2  
ATOM 3471   H H    . GLY A 1 73  ? -21.661 -12.196 -8.127  1.00 10.00 ? 228 GLY A H    2  
ATOM 3472   N N    . THR A 1 74  ? -21.191 -15.136 -9.373  1.00 10.00 ? 229 THR A N    2  
ATOM 3473   C CA   . THR A 1 74  ? -21.484 -16.555 -9.293  1.00 10.00 ? 229 THR A CA   2  
ATOM 3474   C C    . THR A 1 74  ? -22.557 -16.826 -8.236  1.00 10.00 ? 229 THR A C    2  
ATOM 3475   O O    . THR A 1 74  ? -23.646 -17.311 -8.553  1.00 10.00 ? 229 THR A O    2  
ATOM 3476   C CB   . THR A 1 74  ? -20.215 -17.364 -8.953  1.00 10.00 ? 229 THR A CB   2  
ATOM 3477   O OG1  . THR A 1 74  ? -19.138 -16.954 -9.808  1.00 10.00 ? 229 THR A OG1  2  
ATOM 3478   C CG2  . THR A 1 74  ? -20.467 -18.854 -9.138  1.00 10.00 ? 229 THR A CG2  2  
ATOM 3479   H H    . THR A 1 74  ? -20.455 -14.770 -8.842  1.00 10.00 ? 229 THR A H    2  
ATOM 3480   H HG1  . THR A 1 74  ? -18.442 -16.537 -9.274  1.00 10.00 ? 229 THR A HG1  2  
ATOM 3481   N N    . VAL A 1 75  ? -22.253 -16.501 -6.982  1.00 10.00 ? 230 VAL A N    2  
ATOM 3482   C CA   . VAL A 1 75  ? -23.192 -16.733 -5.882  1.00 10.00 ? 230 VAL A CA   2  
ATOM 3483   C C    . VAL A 1 75  ? -23.518 -15.449 -5.108  1.00 10.00 ? 230 VAL A C    2  
ATOM 3484   O O    . VAL A 1 75  ? -24.438 -15.430 -4.296  1.00 10.00 ? 230 VAL A O    2  
ATOM 3485   C CB   . VAL A 1 75  ? -22.691 -17.806 -4.894  1.00 10.00 ? 230 VAL A CB   2  
ATOM 3486   C CG1  . VAL A 1 75  ? -22.682 -19.182 -5.545  1.00 10.00 ? 230 VAL A CG1  2  
ATOM 3487   C CG2  . VAL A 1 75  ? -21.307 -17.456 -4.366  1.00 10.00 ? 230 VAL A CG2  2  
ATOM 3488   H H    . VAL A 1 75  ? -21.364 -16.134 -6.779  1.00 10.00 ? 230 VAL A H    2  
ATOM 3489   N N    . MET A 1 76  ? -22.769 -14.388 -5.360  1.00 10.00 ? 231 MET A N    2  
ATOM 3490   C CA   . MET A 1 76  ? -22.993 -13.125 -4.661  1.00 10.00 ? 231 MET A CA   2  
ATOM 3491   C C    . MET A 1 76  ? -23.278 -12.011 -5.650  1.00 10.00 ? 231 MET A C    2  
ATOM 3492   O O    . MET A 1 76  ? -22.673 -11.956 -6.720  1.00 10.00 ? 231 MET A O    2  
ATOM 3493   C CB   . MET A 1 76  ? -21.790 -12.761 -3.787  1.00 10.00 ? 231 MET A CB   2  
ATOM 3494   C CG   . MET A 1 76  ? -21.628 -13.636 -2.555  1.00 10.00 ? 231 MET A CG   2  
ATOM 3495   S SD   . MET A 1 76  ? -20.279 -13.101 -1.488  1.00 10.00 ? 231 MET A SD   2  
ATOM 3496   C CE   . MET A 1 76  ? -20.869 -11.485 -0.986  1.00 10.00 ? 231 MET A CE   2  
ATOM 3497   H H    . MET A 1 76  ? -22.060 -14.441 -6.034  1.00 10.00 ? 231 MET A H    2  
ATOM 3498   N N    . SER A 1 77  ? -24.200 -11.128 -5.299  1.00 10.00 ? 232 SER A N    2  
ATOM 3499   C CA   . SER A 1 77  ? -24.557 -10.024 -6.168  1.00 10.00 ? 232 SER A CA   2  
ATOM 3500   C C    . SER A 1 77  ? -23.685 -8.806  -5.881  1.00 10.00 ? 232 SER A C    2  
ATOM 3501   O O    . SER A 1 77  ? -23.048 -8.727  -4.832  1.00 10.00 ? 232 SER A O    2  
ATOM 3502   C CB   . SER A 1 77  ? -26.037 -9.673  -5.997  1.00 10.00 ? 232 SER A CB   2  
ATOM 3503   O OG   . SER A 1 77  ? -26.330 -9.321  -4.653  1.00 10.00 ? 232 SER A OG   2  
ATOM 3504   H H    . SER A 1 77  ? -24.645 -11.215 -4.425  1.00 10.00 ? 232 SER A H    2  
ATOM 3505   H HG   . SER A 1 77  ? -26.190 -10.092 -4.076  1.00 10.00 ? 232 SER A HG   2  
ATOM 3506   N N    . THR A 1 78  ? -23.613 -7.895  -6.842  1.00 10.00 ? 233 THR A N    2  
ATOM 3507   C CA   . THR A 1 78  ? -22.839 -6.664  -6.701  1.00 10.00 ? 233 THR A CA   2  
ATOM 3508   C C    . THR A 1 78  ? -23.099 -5.957  -5.359  1.00 10.00 ? 233 THR A C    2  
ATOM 3509   O O    . THR A 1 78  ? -22.164 -5.501  -4.696  1.00 10.00 ? 233 THR A O    2  
ATOM 3510   C CB   . THR A 1 78  ? -23.123 -5.701  -7.866  1.00 10.00 ? 233 THR A CB   2  
ATOM 3511   O OG1  . THR A 1 78  ? -23.345 -6.472  -9.059  1.00 10.00 ? 233 THR A OG1  2  
ATOM 3512   C CG2  . THR A 1 78  ? -21.939 -4.770  -8.085  1.00 10.00 ? 233 THR A CG2  2  
ATOM 3513   H H    . THR A 1 78  ? -24.023 -8.110  -7.707  1.00 10.00 ? 233 THR A H    2  
ATOM 3514   H HG1  . THR A 1 78  ? -23.773 -5.916  -9.722  1.00 10.00 ? 233 THR A HG1  2  
ATOM 3515   N N    . THR A 1 79  ? -24.363 -5.884  -4.954  1.00 10.00 ? 234 THR A N    2  
ATOM 3516   C CA   . THR A 1 79  ? -24.726 -5.244  -3.693  1.00 10.00 ? 234 THR A CA   2  
ATOM 3517   C C    . THR A 1 79  ? -24.221 -6.072  -2.506  1.00 10.00 ? 234 THR A C    2  
ATOM 3518   O O    . THR A 1 79  ? -23.870 -5.533  -1.455  1.00 10.00 ? 234 THR A O    2  
ATOM 3519   C CB   . THR A 1 79  ? -26.254 -5.069  -3.583  1.00 10.00 ? 234 THR A CB   2  
ATOM 3520   O OG1  . THR A 1 79  ? -26.770 -4.583  -4.832  1.00 10.00 ? 234 THR A OG1  2  
ATOM 3521   C CG2  . THR A 1 79  ? -26.602 -4.080  -2.484  1.00 10.00 ? 234 THR A CG2  2  
ATOM 3522   H H    . THR A 1 79  ? -25.070 -6.261  -5.520  1.00 10.00 ? 234 THR A H    2  
ATOM 3523   H HG1  . THR A 1 79  ? -26.859 -3.620  -4.789  1.00 10.00 ? 234 THR A HG1  2  
ATOM 3524   N N    . ASP A 1 80  ? -24.200 -7.388  -2.693  1.00 10.00 ? 235 ASP A N    2  
ATOM 3525   C CA   . ASP A 1 80  ? -23.731 -8.315  -1.659  1.00 10.00 ? 235 ASP A CA   2  
ATOM 3526   C C    . ASP A 1 80  ? -22.319 -7.963  -1.215  1.00 10.00 ? 235 ASP A C    2  
ATOM 3527   O O    . ASP A 1 80  ? -22.054 -7.837  -0.020  1.00 10.00 ? 235 ASP A O    2  
ATOM 3528   C CB   . ASP A 1 80  ? -23.762 -9.768  -2.144  1.00 10.00 ? 235 ASP A CB   2  
ATOM 3529   C CG   . ASP A 1 80  ? -25.068 -10.476 -1.856  1.00 10.00 ? 235 ASP A CG   2  
ATOM 3530   O OD1  . ASP A 1 80  ? -25.500 -10.484 -0.687  1.00 10.00 ? 235 ASP A OD1  2  
ATOM 3531   O OD2  . ASP A 1 80  ? -25.660 -11.043 -2.806  1.00 10.00 ? 235 ASP A OD2  2  
ATOM 3532   H H    . ASP A 1 80  ? -24.526 -7.732  -3.551  1.00 10.00 ? 235 ASP A H    2  
ATOM 3533   N N    . VAL A 1 81  ? -21.426 -7.797  -2.186  1.00 10.00 ? 236 VAL A N    2  
ATOM 3534   C CA   . VAL A 1 81  ? -20.031 -7.459  -1.904  1.00 10.00 ? 236 VAL A CA   2  
ATOM 3535   C C    . VAL A 1 81  ? -19.933 -6.073  -1.278  1.00 10.00 ? 236 VAL A C    2  
ATOM 3536   O O    . VAL A 1 81  ? -19.160 -5.854  -0.346  1.00 10.00 ? 236 VAL A O    2  
ATOM 3537   C CB   . VAL A 1 81  ? -19.169 -7.504  -3.184  1.00 10.00 ? 236 VAL A CB   2  
ATOM 3538   C CG1  . VAL A 1 81  ? -17.704 -7.255  -2.860  1.00 10.00 ? 236 VAL A CG1  2  
ATOM 3539   C CG2  . VAL A 1 81  ? -19.336 -8.840  -3.888  1.00 10.00 ? 236 VAL A CG2  2  
ATOM 3540   H H    . VAL A 1 81  ? -21.712 -7.901  -3.120  1.00 10.00 ? 236 VAL A H    2  
ATOM 3541   N N    . GLU A 1 82  ? -20.728 -5.143  -1.793  1.00 10.00 ? 237 GLU A N    2  
ATOM 3542   C CA   . GLU A 1 82  ? -20.747 -3.778  -1.283  1.00 10.00 ? 237 GLU A CA   2  
ATOM 3543   C C    . GLU A 1 82  ? -21.133 -3.766  0.199   1.00 10.00 ? 237 GLU A C    2  
ATOM 3544   O O    . GLU A 1 82  ? -20.477 -3.121  1.018   1.00 10.00 ? 237 GLU A O    2  
ATOM 3545   C CB   . GLU A 1 82  ? -21.732 -2.941  -2.095  1.00 10.00 ? 237 GLU A CB   2  
ATOM 3546   C CG   . GLU A 1 82  ? -21.327 -1.486  -2.252  1.00 10.00 ? 237 GLU A CG   2  
ATOM 3547   C CD   . GLU A 1 82  ? -22.070 -0.803  -3.378  1.00 10.00 ? 237 GLU A CD   2  
ATOM 3548   O OE1  . GLU A 1 82  ? -23.260 -0.481  -3.189  1.00 10.00 ? 237 GLU A OE1  2  
ATOM 3549   O OE2  . GLU A 1 82  ? -21.472 -0.592  -4.453  1.00 10.00 ? 237 GLU A OE2  2  
ATOM 3550   H H    . GLU A 1 82  ? -21.310 -5.378  -2.548  1.00 10.00 ? 237 GLU A H    2  
ATOM 3551   N N    . LYS A 1 83  ? -22.208 -4.484  0.522   1.00 10.00 ? 238 LYS A N    2  
ATOM 3552   C CA   . LYS A 1 83  ? -22.688 -4.584  1.901   1.00 10.00 ? 238 LYS A CA   2  
ATOM 3553   C C    . LYS A 1 83  ? -21.628 -5.179  2.826   1.00 10.00 ? 238 LYS A C    2  
ATOM 3554   O O    . LYS A 1 83  ? -21.612 -4.887  4.024   1.00 10.00 ? 238 LYS A O    2  
ATOM 3555   C CB   . LYS A 1 83  ? -23.970 -5.414  1.974   1.00 10.00 ? 238 LYS A CB   2  
ATOM 3556   C CG   . LYS A 1 83  ? -25.177 -4.746  1.331   1.00 10.00 ? 238 LYS A CG   2  
ATOM 3557   C CD   . LYS A 1 83  ? -26.425 -5.612  1.437   1.00 10.00 ? 238 LYS A CD   2  
ATOM 3558   C CE   . LYS A 1 83  ? -26.299 -6.890  0.619   1.00 10.00 ? 238 LYS A CE   2  
ATOM 3559   N NZ   . LYS A 1 83  ? -26.048 -8.083  1.472   1.00 10.00 ? 238 LYS A NZ   2  
ATOM 3560   H H    . LYS A 1 83  ? -22.726 -4.908  -0.196  1.00 10.00 ? 238 LYS A H    2  
ATOM 3561   H HZ1  . LYS A 1 83  ? -25.026 -8.273  1.535   1.00 10.00 ? 238 LYS A HZ1  2  
ATOM 3562   H HZ2  . LYS A 1 83  ? -26.517 -8.917  1.068   1.00 10.00 ? 238 LYS A HZ2  2  
ATOM 3563   H HZ3  . LYS A 1 83  ? -26.414 -7.922  2.438   1.00 10.00 ? 238 LYS A HZ3  2  
ATOM 3564   N N    . SER A 1 84  ? -20.752 -6.013  2.272   1.00 10.00 ? 239 SER A N    2  
ATOM 3565   C CA   . SER A 1 84  ? -19.694 -6.632  3.051   1.00 10.00 ? 239 SER A CA   2  
ATOM 3566   C C    . SER A 1 84  ? -18.714 -5.578  3.539   1.00 10.00 ? 239 SER A C    2  
ATOM 3567   O O    . SER A 1 84  ? -18.311 -5.584  4.700   1.00 10.00 ? 239 SER A O    2  
ATOM 3568   C CB   . SER A 1 84  ? -18.959 -7.677  2.217   1.00 10.00 ? 239 SER A CB   2  
ATOM 3569   O OG   . SER A 1 84  ? -19.860 -8.640  1.706   1.00 10.00 ? 239 SER A OG   2  
ATOM 3570   H H    . SER A 1 84  ? -20.816 -6.210  1.312   1.00 10.00 ? 239 SER A H    2  
ATOM 3571   H HG   . SER A 1 84  ? -19.832 -9.425  2.263   1.00 10.00 ? 239 SER A HG   2  
ATOM 3572   N N    . PHE A 1 85  ? -18.340 -4.671  2.644   1.00 10.00 ? 240 PHE A N    2  
ATOM 3573   C CA   . PHE A 1 85  ? -17.409 -3.608  2.994   1.00 10.00 ? 240 PHE A CA   2  
ATOM 3574   C C    . PHE A 1 85  ? -17.964 -2.732  4.108   1.00 10.00 ? 240 PHE A C    2  
ATOM 3575   O O    . PHE A 1 85  ? -17.227 -2.352  5.021   1.00 10.00 ? 240 PHE A O    2  
ATOM 3576   C CB   . PHE A 1 85  ? -17.043 -2.767  1.775   1.00 10.00 ? 240 PHE A CB   2  
ATOM 3577   C CG   . PHE A 1 85  ? -16.079 -3.458  0.860   1.00 10.00 ? 240 PHE A CG   2  
ATOM 3578   C CD1  . PHE A 1 85  ? -14.727 -3.485  1.152   1.00 10.00 ? 240 PHE A CD1  2  
ATOM 3579   C CD2  . PHE A 1 85  ? -16.524 -4.091  -0.285  1.00 10.00 ? 240 PHE A CD2  2  
ATOM 3580   C CE1  . PHE A 1 85  ? -13.834 -4.129  0.317   1.00 10.00 ? 240 PHE A CE1  2  
ATOM 3581   C CE2  . PHE A 1 85  ? -15.639 -4.735  -1.125  1.00 10.00 ? 240 PHE A CE2  2  
ATOM 3582   C CZ   . PHE A 1 85  ? -14.290 -4.755  -0.824  1.00 10.00 ? 240 PHE A CZ   2  
ATOM 3583   H H    . PHE A 1 85  ? -18.696 -4.718  1.728   1.00 10.00 ? 240 PHE A H    2  
ATOM 3584   N N    . ASP A 1 86  ? -19.257 -2.430  4.032   1.00 10.00 ? 241 ASP A N    2  
ATOM 3585   C CA   . ASP A 1 86  ? -19.927 -1.602  5.033   1.00 10.00 ? 241 ASP A CA   2  
ATOM 3586   C C    . ASP A 1 86  ? -19.815 -2.237  6.416   1.00 10.00 ? 241 ASP A C    2  
ATOM 3587   O O    . ASP A 1 86  ? -19.335 -1.623  7.373   1.00 10.00 ? 241 ASP A O    2  
ATOM 3588   C CB   . ASP A 1 86  ? -21.415 -1.543  4.660   1.00 10.00 ? 241 ASP A CB   2  
ATOM 3589   C CG   . ASP A 1 86  ? -21.945 -0.152  4.409   1.00 10.00 ? 241 ASP A CG   2  
ATOM 3590   O OD1  . ASP A 1 86  ? -21.505 0.493   3.435   1.00 10.00 ? 241 ASP A OD1  2  
ATOM 3591   O OD2  . ASP A 1 86  ? -22.831 0.289   5.175   1.00 10.00 ? 241 ASP A OD2  2  
ATOM 3592   H H    . ASP A 1 86  ? -19.773 -2.711  3.248   1.00 10.00 ? 241 ASP A H    2  
ATOM 3593   N N    . LYS A 1 87  ? -20.278 -3.478  6.503   1.00 10.00 ? 242 LYS A N    2  
ATOM 3594   C CA   . LYS A 1 87  ? -20.233 -4.236  7.746   1.00 10.00 ? 242 LYS A CA   2  
ATOM 3595   C C    . LYS A 1 87  ? -18.809 -4.435  8.247   1.00 10.00 ? 242 LYS A C    2  
ATOM 3596   O O    . LYS A 1 87  ? -18.563 -4.420  9.449   1.00 10.00 ? 242 LYS A O    2  
ATOM 3597   C CB   . LYS A 1 87  ? -20.957 -5.578  7.608   1.00 10.00 ? 242 LYS A CB   2  
ATOM 3598   C CG   . LYS A 1 87  ? -22.472 -5.451  7.576   1.00 10.00 ? 242 LYS A CG   2  
ATOM 3599   C CD   . LYS A 1 87  ? -23.139 -6.800  7.360   1.00 10.00 ? 242 LYS A CD   2  
ATOM 3600   C CE   . LYS A 1 87  ? -24.654 -6.672  7.292   1.00 10.00 ? 242 LYS A CE   2  
ATOM 3601   N NZ   . LYS A 1 87  ? -25.107 -5.977  6.057   1.00 10.00 ? 242 LYS A NZ   2  
ATOM 3602   H H    . LYS A 1 87  ? -20.760 -3.820  5.719   1.00 10.00 ? 242 LYS A H    2  
ATOM 3603   H HZ1  . LYS A 1 87  ? -24.719 -6.448  5.220   1.00 10.00 ? 242 LYS A HZ1  2  
ATOM 3604   H HZ2  . LYS A 1 87  ? -24.795 -4.983  6.063   1.00 10.00 ? 242 LYS A HZ2  2  
ATOM 3605   H HZ3  . LYS A 1 87  ? -26.149 -6.006  5.996   1.00 10.00 ? 242 LYS A HZ3  2  
ATOM 3606   N N    . LEU A 1 88  ? -17.879 -4.597  7.319   1.00 10.00 ? 243 LEU A N    2  
ATOM 3607   C CA   . LEU A 1 88  ? -16.482 -4.790  7.661   1.00 10.00 ? 243 LEU A CA   2  
ATOM 3608   C C    . LEU A 1 88  ? -15.922 -3.548  8.354   1.00 10.00 ? 243 LEU A C    2  
ATOM 3609   O O    . LEU A 1 88  ? -15.398 -3.635  9.460   1.00 10.00 ? 243 LEU A O    2  
ATOM 3610   C CB   . LEU A 1 88  ? -15.675 -5.095  6.393   1.00 10.00 ? 243 LEU A CB   2  
ATOM 3611   C CG   . LEU A 1 88  ? -14.186 -5.377  6.584   1.00 10.00 ? 243 LEU A CG   2  
ATOM 3612   C CD1  . LEU A 1 88  ? -13.973 -6.728  7.249   1.00 10.00 ? 243 LEU A CD1  2  
ATOM 3613   C CD2  . LEU A 1 88  ? -13.460 -5.307  5.251   1.00 10.00 ? 243 LEU A CD2  2  
ATOM 3614   H H    . LEU A 1 88  ? -18.144 -4.580  6.371   1.00 10.00 ? 243 LEU A H    2  
ATOM 3615   N N    . LEU A 1 89  ? -16.023 -2.411  7.672   1.00 10.00 ? 244 LEU A N    2  
ATOM 3616   C CA   . LEU A 1 89  ? -15.548 -1.126  8.199   1.00 10.00 ? 244 LEU A CA   2  
ATOM 3617   C C    . LEU A 1 89  ? -15.977 -0.875  9.644   1.00 10.00 ? 244 LEU A C    2  
ATOM 3618   O O    . LEU A 1 89  ? -15.204 -0.339  10.441  1.00 10.00 ? 244 LEU A O    2  
ATOM 3619   C CB   . LEU A 1 89  ? -15.999 0.028   7.305   1.00 10.00 ? 244 LEU A CB   2  
ATOM 3620   C CG   . LEU A 1 89  ? -15.301 0.142   5.948   1.00 10.00 ? 244 LEU A CG   2  
ATOM 3621   C CD1  . LEU A 1 89  ? -15.969 1.209   5.096   1.00 10.00 ? 244 LEU A CD1  2  
ATOM 3622   C CD2  . LEU A 1 89  ? -13.821 0.449   6.128   1.00 10.00 ? 244 LEU A CD2  2  
ATOM 3623   H H    . LEU A 1 89  ? -16.351 -2.461  6.746   1.00 10.00 ? 244 LEU A H    2  
ATOM 3624   N N    . LYS A 1 90  ? -17.204 -1.256  9.977   1.00 10.00 ? 245 LYS A N    2  
ATOM 3625   C CA   . LYS A 1 90  ? -17.726 -1.064  11.328  1.00 10.00 ? 245 LYS A CA   2  
ATOM 3626   C C    . LYS A 1 90  ? -17.063 -1.993  12.342  1.00 10.00 ? 245 LYS A C    2  
ATOM 3627   O O    . LYS A 1 90  ? -17.002 -1.684  13.532  1.00 10.00 ? 245 LYS A O    2  
ATOM 3628   C CB   . LYS A 1 90  ? -19.247 -1.237  11.355  1.00 10.00 ? 245 LYS A CB   2  
ATOM 3629   C CG   . LYS A 1 90  ? -20.004 -0.244  10.486  1.00 10.00 ? 245 LYS A CG   2  
ATOM 3630   C CD   . LYS A 1 90  ? -19.568 1.188   10.763  1.00 10.00 ? 245 LYS A CD   2  
ATOM 3631   C CE   . LYS A 1 90  ? -20.443 2.194   10.029  1.00 10.00 ? 245 LYS A CE   2  
ATOM 3632   N NZ   . LYS A 1 90  ? -21.592 2.644   10.861  1.00 10.00 ? 245 LYS A NZ   2  
ATOM 3633   H H    . LYS A 1 90  ? -17.785 -1.648  9.289   1.00 10.00 ? 245 LYS A H    2  
ATOM 3634   H HZ1  . LYS A 1 90  ? -21.257 3.214   11.664  1.00 10.00 ? 245 LYS A HZ1  2  
ATOM 3635   H HZ2  . LYS A 1 90  ? -22.110 1.823   11.231  1.00 10.00 ? 245 LYS A HZ2  2  
ATOM 3636   H HZ3  . LYS A 1 90  ? -22.246 3.218   10.292  1.00 10.00 ? 245 LYS A HZ3  2  
ATOM 3637   N N    . ASP A 1 91  ? -16.573 -3.127  11.865  1.00 10.00 ? 246 ASP A N    2  
ATOM 3638   C CA   . ASP A 1 91  ? -15.910 -4.113  12.721  1.00 10.00 ? 246 ASP A CA   2  
ATOM 3639   C C    . ASP A 1 91  ? -14.452 -3.735  12.966  1.00 10.00 ? 246 ASP A C    2  
ATOM 3640   O O    . ASP A 1 91  ? -13.928 -3.942  14.060  1.00 10.00 ? 246 ASP A O    2  
ATOM 3641   C CB   . ASP A 1 91  ? -15.986 -5.497  12.076  1.00 10.00 ? 246 ASP A CB   2  
ATOM 3642   C CG   . ASP A 1 91  ? -15.390 -6.590  12.942  1.00 10.00 ? 246 ASP A CG   2  
ATOM 3643   O OD1  . ASP A 1 91  ? -16.032 -6.976  13.945  1.00 10.00 ? 246 ASP A OD1  2  
ATOM 3644   O OD2  . ASP A 1 91  ? -14.292 -7.084  12.615  1.00 10.00 ? 246 ASP A OD2  2  
ATOM 3645   H H    . ASP A 1 91  ? -16.651 -3.314  10.905  1.00 10.00 ? 246 ASP A H    2  
ATOM 3646   N N    . LEU A 1 92  ? -13.811 -3.192  11.926  1.00 10.00 ? 247 LEU A N    2  
ATOM 3647   C CA   . LEU A 1 92  ? -12.403 -2.760  11.971  1.00 10.00 ? 247 LEU A CA   2  
ATOM 3648   C C    . LEU A 1 92  ? -11.906 -2.227  13.318  1.00 10.00 ? 247 LEU A C    2  
ATOM 3649   O O    . LEU A 1 92  ? -10.884 -2.704  13.811  1.00 10.00 ? 247 LEU A O    2  
ATOM 3650   C CB   . LEU A 1 92  ? -12.126 -1.715  10.889  1.00 10.00 ? 247 LEU A CB   2  
ATOM 3651   C CG   . LEU A 1 92  ? -11.468 -2.206  9.602   1.00 10.00 ? 247 LEU A CG   2  
ATOM 3652   C CD1  . LEU A 1 92  ? -12.348 -3.228  8.906   1.00 10.00 ? 247 LEU A CD1  2  
ATOM 3653   C CD2  . LEU A 1 92  ? -11.177 -1.033  8.684   1.00 10.00 ? 247 LEU A CD2  2  
ATOM 3654   H H    . LEU A 1 92  ? -14.251 -3.216  11.050  1.00 10.00 ? 247 LEU A H    2  
ATOM 3655   N N    . PRO A 1 93  ? -12.580 -1.231  13.936  1.00 10.00 ? 248 PRO A N    2  
ATOM 3656   C CA   . PRO A 1 93  ? -12.146 -0.673  15.223  1.00 10.00 ? 248 PRO A CA   2  
ATOM 3657   C C    . PRO A 1 93  ? -11.894 -1.721  16.309  1.00 10.00 ? 248 PRO A C    2  
ATOM 3658   O O    . PRO A 1 93  ? -11.152 -1.458  17.260  1.00 10.00 ? 248 PRO A O    2  
ATOM 3659   C CB   . PRO A 1 93  ? -13.275 0.286   15.624  1.00 10.00 ? 248 PRO A CB   2  
ATOM 3660   C CG   . PRO A 1 93  ? -14.403 0.000   14.690  1.00 10.00 ? 248 PRO A CG   2  
ATOM 3661   C CD   . PRO A 1 93  ? -13.788 -0.548  13.435  1.00 10.00 ? 248 PRO A CD   2  
ATOM 3662   N N    . GLU A 1 94  ? -12.503 -2.908  16.195  1.00 10.00 ? 249 GLU A N    2  
ATOM 3663   C CA   . GLU A 1 94  ? -12.293 -3.951  17.193  1.00 10.00 ? 249 GLU A CA   2  
ATOM 3664   C C    . GLU A 1 94  ? -10.989 -4.705  16.943  1.00 10.00 ? 249 GLU A C    2  
ATOM 3665   O O    . GLU A 1 94  ? -10.113 -4.753  17.814  1.00 10.00 ? 249 GLU A O    2  
ATOM 3666   C CB   . GLU A 1 94  ? -13.441 -4.960  17.111  1.00 10.00 ? 249 GLU A CB   2  
ATOM 3667   C CG   . GLU A 1 94  ? -14.063 -5.304  18.446  1.00 10.00 ? 249 GLU A CG   2  
ATOM 3668   C CD   . GLU A 1 94  ? -14.644 -4.091  19.131  1.00 10.00 ? 249 GLU A CD   2  
ATOM 3669   O OE1  . GLU A 1 94  ? -15.806 -3.734  18.837  1.00 10.00 ? 249 GLU A OE1  2  
ATOM 3670   O OE2  . GLU A 1 94  ? -13.949 -3.493  19.978  1.00 10.00 ? 249 GLU A OE2  2  
ATOM 3671   H H    . GLU A 1 94  ? -13.094 -3.074  15.423  1.00 10.00 ? 249 GLU A H    2  
ATOM 3672   N N    . LEU A 1 95  ? -10.846 -5.289  15.750  1.00 10.00 ? 250 LEU A N    2  
ATOM 3673   C CA   . LEU A 1 95  ? -9.624  -6.009  15.385  1.00 10.00 ? 250 LEU A CA   2  
ATOM 3674   C C    . LEU A 1 95  ? -8.381  -5.142  15.386  1.00 10.00 ? 250 LEU A C    2  
ATOM 3675   O O    . LEU A 1 95  ? -7.272  -5.642  15.562  1.00 10.00 ? 250 LEU A O    2  
ATOM 3676   C CB   . LEU A 1 95  ? -9.790  -6.713  14.034  1.00 10.00 ? 250 LEU A CB   2  
ATOM 3677   C CG   . LEU A 1 95  ? -10.708 -7.940  14.015  1.00 10.00 ? 250 LEU A CG   2  
ATOM 3678   C CD1  . LEU A 1 95  ? -10.941 -8.410  12.586  1.00 10.00 ? 250 LEU A CD1  2  
ATOM 3679   C CD2  . LEU A 1 95  ? -10.122 -9.061  14.859  1.00 10.00 ? 250 LEU A CD2  2  
ATOM 3680   H H    . LEU A 1 95  ? -11.630 -5.450  15.193  1.00 10.00 ? 250 LEU A H    2  
ATOM 3681   N N    . ALA A 1 96  ? -8.570  -3.844  15.197  1.00 10.00 ? 251 ALA A N    2  
ATOM 3682   C CA   . ALA A 1 96  ? -7.457  -2.904  15.181  1.00 10.00 ? 251 ALA A CA   2  
ATOM 3683   C C    . ALA A 1 96  ? -6.676  -2.956  16.492  1.00 10.00 ? 251 ALA A C    2  
ATOM 3684   O O    . ALA A 1 96  ? -5.489  -2.638  16.540  1.00 10.00 ? 251 ALA A O    2  
ATOM 3685   C CB   . ALA A 1 96  ? -7.962  -1.496  14.914  1.00 10.00 ? 251 ALA A CB   2  
ATOM 3686   H H    . ALA A 1 96  ? -9.485  -3.509  15.057  1.00 10.00 ? 251 ALA A H    2  
ATOM 3687   N N    . LEU A 1 97  ? -7.356  -3.360  17.566  1.00 10.00 ? 252 LEU A N    2  
ATOM 3688   C CA   . LEU A 1 97  ? -6.732  -3.460  18.877  1.00 10.00 ? 252 LEU A CA   2  
ATOM 3689   C C    . LEU A 1 97  ? -5.652  -4.548  18.911  1.00 10.00 ? 252 LEU A C    2  
ATOM 3690   O O    . LEU A 1 97  ? -4.523  -4.294  19.340  1.00 10.00 ? 252 LEU A O    2  
ATOM 3691   C CB   . LEU A 1 97  ? -7.784  -3.712  19.958  1.00 10.00 ? 252 LEU A CB   2  
ATOM 3692   C CG   . LEU A 1 97  ? -8.805  -2.590  20.170  1.00 10.00 ? 252 LEU A CG   2  
ATOM 3693   C CD1  . LEU A 1 97  ? -9.882  -3.012  21.154  1.00 10.00 ? 252 LEU A CD1  2  
ATOM 3694   C CD2  . LEU A 1 97  ? -8.117  -1.317  20.638  1.00 10.00 ? 252 LEU A CD2  2  
ATOM 3695   H H    . LEU A 1 97  ? -8.312  -3.563  17.464  1.00 10.00 ? 252 LEU A H    2  
ATOM 3696   N N    . ASP A 1 98  ? -5.993  -5.744  18.456  1.00 10.00 ? 253 ASP A N    2  
ATOM 3697   C CA   . ASP A 1 98  ? -5.051  -6.862  18.450  1.00 10.00 ? 253 ASP A CA   2  
ATOM 3698   C C    . ASP A 1 98  ? -4.216  -6.900  17.173  1.00 10.00 ? 253 ASP A C    2  
ATOM 3699   O O    . ASP A 1 98  ? -3.495  -7.869  16.930  1.00 10.00 ? 253 ASP A O    2  
ATOM 3700   C CB   . ASP A 1 98  ? -5.804  -8.181  18.597  1.00 10.00 ? 253 ASP A CB   2  
ATOM 3701   C CG   . ASP A 1 98  ? -5.582  -8.826  19.945  1.00 10.00 ? 253 ASP A CG   2  
ATOM 3702   O OD1  . ASP A 1 98  ? -4.414  -8.952  20.362  1.00 10.00 ? 253 ASP A OD1  2  
ATOM 3703   O OD2  . ASP A 1 98  ? -6.575  -9.214  20.596  1.00 10.00 ? 253 ASP A OD2  2  
ATOM 3704   H H    . ASP A 1 98  ? -6.911  -5.913  18.149  1.00 10.00 ? 253 ASP A H    2  
ATOM 3705   N N    . THR A 1 99  ? -4.308  -5.837  16.386  1.00 10.00 ? 254 THR A N    2  
ATOM 3706   C CA   . THR A 1 99  ? -3.576  -5.728  15.122  1.00 10.00 ? 254 THR A CA   2  
ATOM 3707   C C    . THR A 1 99  ? -3.611  -4.280  14.639  1.00 10.00 ? 254 THR A C    2  
ATOM 3708   O O    . THR A 1 99  ? -4.575  -3.857  14.003  1.00 10.00 ? 254 THR A O    2  
ATOM 3709   C CB   . THR A 1 99  ? -4.170  -6.640  14.015  1.00 10.00 ? 254 THR A CB   2  
ATOM 3710   O OG1  . THR A 1 99  ? -4.363  -7.971  14.508  1.00 10.00 ? 254 THR A OG1  2  
ATOM 3711   C CG2  . THR A 1 99  ? -3.237  -6.694  12.812  1.00 10.00 ? 254 THR A CG2  2  
ATOM 3712   H H    . THR A 1 99  ? -4.823  -5.067  16.703  1.00 10.00 ? 254 THR A H    2  
ATOM 3713   H HG1  . THR A 1 99  ? -3.843  -8.090  15.316  1.00 10.00 ? 254 THR A HG1  2  
ATOM 3714   N N    . PRO A 1 100 ? -2.564  -3.499  14.934  1.00 10.00 ? 255 PRO A N    2  
ATOM 3715   C CA   . PRO A 1 100 ? -2.491  -2.087  14.533  1.00 10.00 ? 255 PRO A CA   2  
ATOM 3716   C C    . PRO A 1 100 ? -2.448  -1.921  13.017  1.00 10.00 ? 255 PRO A C    2  
ATOM 3717   O O    . PRO A 1 100 ? -2.700  -0.838  12.488  1.00 10.00 ? 255 PRO A O    2  
ATOM 3718   C CB   . PRO A 1 100 ? -1.184  -1.591  15.167  1.00 10.00 ? 255 PRO A CB   2  
ATOM 3719   C CG   . PRO A 1 100 ? -0.386  -2.820  15.430  1.00 10.00 ? 255 PRO A CG   2  
ATOM 3720   C CD   . PRO A 1 100 ? -1.371  -3.925  15.685  1.00 10.00 ? 255 PRO A CD   2  
ATOM 3721   N N    . ARG A 1 101 ? -2.148  -3.007  12.319  1.00 10.00 ? 256 ARG A N    2  
ATOM 3722   C CA   . ARG A 1 101 ? -2.073  -2.984  10.867  1.00 10.00 ? 256 ARG A CA   2  
ATOM 3723   C C    . ARG A 1 101 ? -3.377  -3.466  10.246  1.00 10.00 ? 256 ARG A C    2  
ATOM 3724   O O    . ARG A 1 101 ? -3.513  -3.494  9.024   1.00 10.00 ? 256 ARG A O    2  
ATOM 3725   C CB   . ARG A 1 101 ? -0.908  -3.855  10.376  1.00 10.00 ? 256 ARG A CB   2  
ATOM 3726   C CG   . ARG A 1 101 ? 0.089   -3.131  9.483   1.00 10.00 ? 256 ARG A CG   2  
ATOM 3727   C CD   . ARG A 1 101 ? -0.422  -2.982  8.060   1.00 10.00 ? 256 ARG A CD   2  
ATOM 3728   N NE   . ARG A 1 101 ? 0.337   -1.994  7.292   1.00 10.00 ? 256 ARG A NE   2  
ATOM 3729   C CZ   . ARG A 1 101 ? 1.280   -2.295  6.401   1.00 10.00 ? 256 ARG A CZ   2  
ATOM 3730   N NH1  . ARG A 1 101 ? 1.680   -3.553  6.241   1.00 10.00 ? 256 ARG A NH1  2  
ATOM 3731   N NH2  . ARG A 1 101 ? 1.838   -1.325  5.686   1.00 10.00 ? 256 ARG A NH2  2  
ATOM 3732   H H    . ARG A 1 101 ? -1.973  -3.843  12.796  1.00 10.00 ? 256 ARG A H    2  
ATOM 3733   H HE   . ARG A 1 101 ? 0.109   -1.037  7.429   1.00 10.00 ? 256 ARG A HE   2  
ATOM 3734   H HH11 . ARG A 1 101 ? 1.272   -4.287  6.790   1.00 10.00 ? 256 ARG A HH11 2  
ATOM 3735   H HH12 . ARG A 1 101 ? 2.406   -3.779  5.568   1.00 10.00 ? 256 ARG A HH12 2  
ATOM 3736   H HH21 . ARG A 1 101 ? 1.541   -0.365  5.820   1.00 10.00 ? 256 ARG A HH21 2  
ATOM 3737   H HH22 . ARG A 1 101 ? 2.546   -1.536  5.008   1.00 10.00 ? 256 ARG A HH22 2  
ATOM 3738   N N    . ALA A 1 102 ? -4.343  -3.829  11.088  1.00 10.00 ? 257 ALA A N    2  
ATOM 3739   C CA   . ALA A 1 102 ? -5.634  -4.322  10.603  1.00 10.00 ? 257 ALA A CA   2  
ATOM 3740   C C    . ALA A 1 102 ? -6.336  -3.341  9.655   1.00 10.00 ? 257 ALA A C    2  
ATOM 3741   O O    . ALA A 1 102 ? -6.609  -3.697  8.512   1.00 10.00 ? 257 ALA A O    2  
ATOM 3742   C CB   . ALA A 1 102 ? -6.547  -4.760  11.743  1.00 10.00 ? 257 ALA A CB   2  
ATOM 3743   H H    . ALA A 1 102 ? -4.192  -3.762  12.054  1.00 10.00 ? 257 ALA A H    2  
ATOM 3744   N N    . PRO A 1 103 ? -6.612  -2.087  10.083  1.00 10.00 ? 258 PRO A N    2  
ATOM 3745   C CA   . PRO A 1 103 ? -7.283  -1.103  9.219   1.00 10.00 ? 258 PRO A CA   2  
ATOM 3746   C C    . PRO A 1 103 ? -6.427  -0.747  8.009   1.00 10.00 ? 258 PRO A C    2  
ATOM 3747   O O    . PRO A 1 103 ? -6.928  -0.583  6.896   1.00 10.00 ? 258 PRO A O    2  
ATOM 3748   C CB   . PRO A 1 103 ? -7.461  0.119   10.126  1.00 10.00 ? 258 PRO A CB   2  
ATOM 3749   C CG   . PRO A 1 103 ? -6.450  -0.051  11.207  1.00 10.00 ? 258 PRO A CG   2  
ATOM 3750   C CD   . PRO A 1 103 ? -6.305  -1.526  11.416  1.00 10.00 ? 258 PRO A CD   2  
ATOM 3751   N N    . GLN A 1 104 ? -5.129  -0.626  8.253   1.00 10.00 ? 259 GLN A N    2  
ATOM 3752   C CA   . GLN A 1 104 ? -4.165  -0.305  7.209   1.00 10.00 ? 259 GLN A CA   2  
ATOM 3753   C C    . GLN A 1 104 ? -4.206  -1.335  6.080   1.00 10.00 ? 259 GLN A C    2  
ATOM 3754   O O    . GLN A 1 104 ? -4.161  -0.978  4.903   1.00 10.00 ? 259 GLN A O    2  
ATOM 3755   C CB   . GLN A 1 104 ? -2.757  -0.189  7.807   1.00 10.00 ? 259 GLN A CB   2  
ATOM 3756   C CG   . GLN A 1 104 ? -2.618  0.930   8.832   1.00 10.00 ? 259 GLN A CG   2  
ATOM 3757   C CD   . GLN A 1 104 ? -1.356  0.820   9.668   1.00 10.00 ? 259 GLN A CD   2  
ATOM 3758   O OE1  . GLN A 1 104 ? -0.873  -0.276  9.943   1.00 10.00 ? 259 GLN A OE1  2  
ATOM 3759   N NE2  . GLN A 1 104 ? -0.809  1.953   10.074  1.00 10.00 ? 259 GLN A NE2  2  
ATOM 3760   H H    . GLN A 1 104 ? -4.810  -0.743  9.172   1.00 10.00 ? 259 GLN A H    2  
ATOM 3761   H HE21 . GLN A 1 104 ? -1.240  2.795   9.816   1.00 10.00 ? 259 GLN A HE21 2  
ATOM 3762   H HE22 . GLN A 1 104 ? 0.006   1.903   10.609  1.00 10.00 ? 259 GLN A HE22 2  
ATOM 3763   N N    . LEU A 1 105 ? -4.305  -2.610  6.440   1.00 10.00 ? 260 LEU A N    2  
ATOM 3764   C CA   . LEU A 1 105 ? -4.377  -3.679  5.452   1.00 10.00 ? 260 LEU A CA   2  
ATOM 3765   C C    . LEU A 1 105 ? -5.746  -3.703  4.778   1.00 10.00 ? 260 LEU A C    2  
ATOM 3766   O O    . LEU A 1 105 ? -5.844  -3.881  3.565   1.00 10.00 ? 260 LEU A O    2  
ATOM 3767   C CB   . LEU A 1 105 ? -4.092  -5.035  6.101   1.00 10.00 ? 260 LEU A CB   2  
ATOM 3768   C CG   . LEU A 1 105 ? -2.665  -5.259  6.604   1.00 10.00 ? 260 LEU A CG   2  
ATOM 3769   C CD1  . LEU A 1 105 ? -2.594  -6.510  7.463   1.00 10.00 ? 260 LEU A CD1  2  
ATOM 3770   C CD2  . LEU A 1 105 ? -1.692  -5.345  5.439   1.00 10.00 ? 260 LEU A CD2  2  
ATOM 3771   H H    . LEU A 1 105 ? -4.324  -2.838  7.396   1.00 10.00 ? 260 LEU A H    2  
ATOM 3772   N N    . VAL A 1 106 ? -6.794  -3.545  5.588   1.00 10.00 ? 261 VAL A N    2  
ATOM 3773   C CA   . VAL A 1 106 ? -8.172  -3.539  5.099   1.00 10.00 ? 261 VAL A CA   2  
ATOM 3774   C C    . VAL A 1 106 ? -8.363  -2.596  3.908   1.00 10.00 ? 261 VAL A C    2  
ATOM 3775   O O    . VAL A 1 106 ? -9.047  -2.943  2.942   1.00 10.00 ? 261 VAL A O    2  
ATOM 3776   C CB   . VAL A 1 106 ? -9.179  -3.203  6.218   1.00 10.00 ? 261 VAL A CB   2  
ATOM 3777   C CG1  . VAL A 1 106 ? -10.546 -2.858  5.643   1.00 10.00 ? 261 VAL A CG1  2  
ATOM 3778   C CG2  . VAL A 1 106 ? -9.300  -4.373  7.185   1.00 10.00 ? 261 VAL A CG2  2  
ATOM 3779   H H    . VAL A 1 106 ? -6.615  -3.493  6.554   1.00 10.00 ? 261 VAL A H    2  
ATOM 3780   N N    . GLY A 1 107 ? -7.748  -1.417  3.975   1.00 10.00 ? 262 GLY A N    2  
ATOM 3781   C CA   . GLY A 1 107 ? -7.861  -0.449  2.896   1.00 10.00 ? 262 GLY A CA   2  
ATOM 3782   C C    . GLY A 1 107 ? -7.466  -1.018  1.542   1.00 10.00 ? 262 GLY A C    2  
ATOM 3783   O O    . GLY A 1 107 ? -8.025  -0.636  0.512   1.00 10.00 ? 262 GLY A O    2  
ATOM 3784   H H    . GLY A 1 107 ? -7.215  -1.201  4.770   1.00 10.00 ? 262 GLY A H    2  
ATOM 3785   N N    . GLN A 1 108 ? -6.522  -1.956  1.550   1.00 10.00 ? 263 GLN A N    2  
ATOM 3786   C CA   . GLN A 1 108 ? -6.046  -2.586  0.326   1.00 10.00 ? 263 GLN A CA   2  
ATOM 3787   C C    . GLN A 1 108 ? -7.150  -3.403  -0.332  1.00 10.00 ? 263 GLN A C    2  
ATOM 3788   O O    . GLN A 1 108 ? -7.267  -3.445  -1.557  1.00 10.00 ? 263 GLN A O    2  
ATOM 3789   C CB   . GLN A 1 108 ? -4.841  -3.482  0.631   1.00 10.00 ? 263 GLN A CB   2  
ATOM 3790   C CG   . GLN A 1 108 ? -4.169  -4.083  -0.593  1.00 10.00 ? 263 GLN A CG   2  
ATOM 3791   C CD   . GLN A 1 108 ? -3.449  -3.048  -1.433  1.00 10.00 ? 263 GLN A CD   2  
ATOM 3792   O OE1  . GLN A 1 108 ? -4.013  -2.481  -2.366  1.00 10.00 ? 263 GLN A OE1  2  
ATOM 3793   N NE2  . GLN A 1 108 ? -2.193  -2.794  -1.102  1.00 10.00 ? 263 GLN A NE2  2  
ATOM 3794   H H    . GLN A 1 108 ? -6.144  -2.244  2.411   1.00 10.00 ? 263 GLN A H    2  
ATOM 3795   H HE21 . GLN A 1 108 ? -1.809  -3.279  -0.345  1.00 10.00 ? 263 GLN A HE21 2  
ATOM 3796   H HE22 . GLN A 1 108 ? -1.699  -2.133  -1.631  1.00 10.00 ? 263 GLN A HE22 2  
ATOM 3797   N N    . PHE A 1 109 ? -7.970  -4.031  0.494   1.00 10.00 ? 264 PHE A N    2  
ATOM 3798   C CA   . PHE A 1 109 ? -9.064  -4.855  0.004   1.00 10.00 ? 264 PHE A CA   2  
ATOM 3799   C C    . PHE A 1 109 ? -10.134 -4.024  -0.694  1.00 10.00 ? 264 PHE A C    2  
ATOM 3800   O O    . PHE A 1 109 ? -10.824 -4.517  -1.589  1.00 10.00 ? 264 PHE A O    2  
ATOM 3801   C CB   . PHE A 1 109 ? -9.675  -5.697  1.129   1.00 10.00 ? 264 PHE A CB   2  
ATOM 3802   C CG   . PHE A 1 109 ? -8.878  -6.924  1.460   1.00 10.00 ? 264 PHE A CG   2  
ATOM 3803   C CD1  . PHE A 1 109 ? -8.625  -7.881  0.490   1.00 10.00 ? 264 PHE A CD1  2  
ATOM 3804   C CD2  . PHE A 1 109 ? -8.378  -7.121  2.735   1.00 10.00 ? 264 PHE A CD2  2  
ATOM 3805   C CE1  . PHE A 1 109 ? -7.890  -9.012  0.786   1.00 10.00 ? 264 PHE A CE1  2  
ATOM 3806   C CE2  . PHE A 1 109 ? -7.643  -8.251  3.039   1.00 10.00 ? 264 PHE A CE2  2  
ATOM 3807   C CZ   . PHE A 1 109 ? -7.397  -9.197  2.063   1.00 10.00 ? 264 PHE A CZ   2  
ATOM 3808   H H    . PHE A 1 109 ? -7.843  -3.928  1.464   1.00 10.00 ? 264 PHE A H    2  
ATOM 3809   N N    . ILE A 1 110 ? -10.263 -2.764  -0.299  1.00 10.00 ? 265 ILE A N    2  
ATOM 3810   C CA   . ILE A 1 110 ? -11.255 -1.877  -0.894  1.00 10.00 ? 265 ILE A CA   2  
ATOM 3811   C C    . ILE A 1 110 ? -10.829 -1.475  -2.304  1.00 10.00 ? 265 ILE A C    2  
ATOM 3812   O O    . ILE A 1 110 ? -11.592 -1.626  -3.261  1.00 10.00 ? 265 ILE A O    2  
ATOM 3813   C CB   . ILE A 1 110 ? -11.438 -0.600  -0.044  1.00 10.00 ? 265 ILE A CB   2  
ATOM 3814   C CG1  . ILE A 1 110 ? -11.662 -0.968  1.426   1.00 10.00 ? 265 ILE A CG1  2  
ATOM 3815   C CG2  . ILE A 1 110 ? -12.595 0.237   -0.570  1.00 10.00 ? 265 ILE A CG2  2  
ATOM 3816   C CD1  . ILE A 1 110 ? -11.628 0.216   2.372   1.00 10.00 ? 265 ILE A CD1  2  
ATOM 3817   H H    . ILE A 1 110 ? -9.667  -2.396  0.392   1.00 10.00 ? 265 ILE A H    2  
ATOM 3818   N N    . ALA A 1 111 ? -9.604  -0.970  -2.420  1.00 10.00 ? 266 ALA A N    2  
ATOM 3819   C CA   . ALA A 1 111 ? -9.069  -0.539  -3.706  1.00 10.00 ? 266 ALA A CA   2  
ATOM 3820   C C    . ALA A 1 111 ? -9.049  -1.695  -4.698  1.00 10.00 ? 266 ALA A C    2  
ATOM 3821   O O    . ALA A 1 111 ? -9.422  -1.537  -5.864  1.00 10.00 ? 266 ALA A O    2  
ATOM 3822   C CB   . ALA A 1 111 ? -7.674  0.043   -3.533  1.00 10.00 ? 266 ALA A CB   2  
ATOM 3823   H H    . ALA A 1 111 ? -9.056  -0.864  -1.613  1.00 10.00 ? 266 ALA A H    2  
ATOM 3824   N N    . ARG A 1 112 ? -8.623  -2.859  -4.219  1.00 10.00 ? 267 ARG A N    2  
ATOM 3825   C CA   . ARG A 1 112 ? -8.558  -4.061  -5.043  1.00 10.00 ? 267 ARG A CA   2  
ATOM 3826   C C    . ARG A 1 112 ? -9.930  -4.395  -5.634  1.00 10.00 ? 267 ARG A C    2  
ATOM 3827   O O    . ARG A 1 112 ? -10.044 -4.730  -6.812  1.00 10.00 ? 267 ARG A O    2  
ATOM 3828   C CB   . ARG A 1 112 ? -8.045  -5.237  -4.207  1.00 10.00 ? 267 ARG A CB   2  
ATOM 3829   C CG   . ARG A 1 112 ? -7.949  -6.549  -4.965  1.00 10.00 ? 267 ARG A CG   2  
ATOM 3830   C CD   . ARG A 1 112 ? -6.956  -6.453  -6.110  1.00 10.00 ? 267 ARG A CD   2  
ATOM 3831   N NE   . ARG A 1 112 ? -6.977  -7.654  -6.937  1.00 10.00 ? 267 ARG A NE   2  
ATOM 3832   C CZ   . ARG A 1 112 ? -6.065  -8.620  -6.867  1.00 10.00 ? 267 ARG A CZ   2  
ATOM 3833   N NH1  . ARG A 1 112 ? -5.045  -8.514  -6.029  1.00 10.00 ? 267 ARG A NH1  2  
ATOM 3834   N NH2  . ARG A 1 112 ? -6.178  -9.697  -7.624  1.00 10.00 ? 267 ARG A NH2  2  
ATOM 3835   H H    . ARG A 1 112 ? -8.333  -2.909  -3.281  1.00 10.00 ? 267 ARG A H    2  
ATOM 3836   H HE   . ARG A 1 112 ? -7.734  -7.750  -7.577  1.00 10.00 ? 267 ARG A HE   2  
ATOM 3837   H HH11 . ARG A 1 112 ? -4.954  -7.709  -5.448  1.00 10.00 ? 267 ARG A HH11 2  
ATOM 3838   H HH12 . ARG A 1 112 ? -4.359  -9.260  -5.959  1.00 10.00 ? 267 ARG A HH12 2  
ATOM 3839   H HH21 . ARG A 1 112 ? -6.951  -9.792  -8.258  1.00 10.00 ? 267 ARG A HH21 2  
ATOM 3840   H HH22 . ARG A 1 112 ? -5.493  -10.436 -7.556  1.00 10.00 ? 267 ARG A HH22 2  
ATOM 3841   N N    . ALA A 1 113 ? -10.959 -4.293  -4.804  1.00 10.00 ? 268 ALA A N    2  
ATOM 3842   C CA   . ALA A 1 113 ? -12.326 -4.580  -5.227  1.00 10.00 ? 268 ALA A CA   2  
ATOM 3843   C C    . ALA A 1 113 ? -12.778 -3.667  -6.367  1.00 10.00 ? 268 ALA A C    2  
ATOM 3844   O O    . ALA A 1 113 ? -13.542 -4.086  -7.239  1.00 10.00 ? 268 ALA A O    2  
ATOM 3845   C CB   . ALA A 1 113 ? -13.277 -4.484  -4.049  1.00 10.00 ? 268 ALA A CB   2  
ATOM 3846   H H    . ALA A 1 113 ? -10.791 -4.044  -3.870  1.00 10.00 ? 268 ALA A H    2  
ATOM 3847   N N    . VAL A 1 114 ? -12.315 -2.423  -6.359  1.00 10.00 ? 269 VAL A N    2  
ATOM 3848   C CA   . VAL A 1 114 ? -12.678 -1.481  -7.410  1.00 10.00 ? 269 VAL A CA   2  
ATOM 3849   C C    . VAL A 1 114 ? -11.939 -1.842  -8.694  1.00 10.00 ? 269 VAL A C    2  
ATOM 3850   O O    . VAL A 1 114 ? -12.536 -1.901  -9.769  1.00 10.00 ? 269 VAL A O    2  
ATOM 3851   C CB   . VAL A 1 114 ? -12.367 -0.022  -7.014  1.00 10.00 ? 269 VAL A CB   2  
ATOM 3852   C CG1  . VAL A 1 114 ? -12.711 0.930   -8.151  1.00 10.00 ? 269 VAL A CG1  2  
ATOM 3853   C CG2  . VAL A 1 114 ? -13.131 0.360   -5.755  1.00 10.00 ? 269 VAL A CG2  2  
ATOM 3854   H H    . VAL A 1 114 ? -11.718 -2.136  -5.637  1.00 10.00 ? 269 VAL A H    2  
ATOM 3855   N N    . GLY A 1 115 ? -10.631 -2.066  -8.558  1.00 10.00 ? 270 GLY A N    2  
ATOM 3856   C CA   . GLY A 1 115 ? -9.812  -2.453  -9.691  1.00 10.00 ? 270 GLY A CA   2  
ATOM 3857   C C    . GLY A 1 115 ? -10.340 -3.697  -10.383 1.00 10.00 ? 270 GLY A C    2  
ATOM 3858   O O    . GLY A 1 115 ? -10.396 -3.753  -11.611 1.00 10.00 ? 270 GLY A O    2  
ATOM 3859   H H    . GLY A 1 115 ? -10.218 -1.912  -7.679  1.00 10.00 ? 270 GLY A H    2  
ATOM 3860   N N    . ASP A 1 116 ? -10.718 -4.698  -9.594  1.00 10.00 ? 271 ASP A N    2  
ATOM 3861   C CA   . ASP A 1 116 ? -11.264 -5.937  -10.134 1.00 10.00 ? 271 ASP A CA   2  
ATOM 3862   C C    . ASP A 1 116 ? -12.609 -5.676  -10.796 1.00 10.00 ? 271 ASP A C    2  
ATOM 3863   O O    . ASP A 1 116 ? -12.919 -6.244  -11.842 1.00 10.00 ? 271 ASP A O    2  
ATOM 3864   C CB   . ASP A 1 116 ? -11.406 -7.002  -9.043  1.00 10.00 ? 271 ASP A CB   2  
ATOM 3865   C CG   . ASP A 1 116 ? -10.255 -7.994  -9.045  1.00 10.00 ? 271 ASP A CG   2  
ATOM 3866   O OD1  . ASP A 1 116 ? -9.157  -7.654  -8.550  1.00 10.00 ? 271 ASP A OD1  2  
ATOM 3867   O OD2  . ASP A 1 116 ? -10.442 -9.119  -9.543  1.00 10.00 ? 271 ASP A OD2  2  
ATOM 3868   H H    . ASP A 1 116 ? -10.586 -4.619  -8.622  1.00 10.00 ? 271 ASP A H    2  
ATOM 3869   N N    . GLY A 1 117 ? -13.397 -4.807  -10.182 1.00 10.00 ? 272 GLY A N    2  
ATOM 3870   C CA   . GLY A 1 117 ? -14.690 -4.459  -10.732 1.00 10.00 ? 272 GLY A CA   2  
ATOM 3871   C C    . GLY A 1 117 ? -15.846 -5.063  -9.967  1.00 10.00 ? 272 GLY A C    2  
ATOM 3872   O O    . GLY A 1 117 ? -16.885 -5.368  -10.547 1.00 10.00 ? 272 GLY A O    2  
ATOM 3873   H H    . GLY A 1 117 ? -13.096 -4.398  -9.340  1.00 10.00 ? 272 GLY A H    2  
ATOM 3874   N N    . ILE A 1 118 ? -15.675 -5.239  -8.664  1.00 10.00 ? 273 ILE A N    2  
ATOM 3875   C CA   . ILE A 1 118 ? -16.729 -5.813  -7.839  1.00 10.00 ? 273 ILE A CA   2  
ATOM 3876   C C    . ILE A 1 118 ? -17.302 -4.799  -6.854  1.00 10.00 ? 273 ILE A C    2  
ATOM 3877   O O    . ILE A 1 118 ? -18.305 -5.061  -6.195  1.00 10.00 ? 273 ILE A O    2  
ATOM 3878   C CB   . ILE A 1 118 ? -16.267 -7.078  -7.085  1.00 10.00 ? 273 ILE A CB   2  
ATOM 3879   C CG1  . ILE A 1 118 ? -14.968 -6.814  -6.324  1.00 10.00 ? 273 ILE A CG1  2  
ATOM 3880   C CG2  . ILE A 1 118 ? -16.102 -8.241  -8.052  1.00 10.00 ? 273 ILE A CG2  2  
ATOM 3881   C CD1  . ILE A 1 118 ? -14.587 -7.914  -5.361  1.00 10.00 ? 273 ILE A CD1  2  
ATOM 3882   H H    . ILE A 1 118 ? -14.822 -4.981  -8.250  1.00 10.00 ? 273 ILE A H    2  
ATOM 3883   N N    . LEU A 1 119 ? -16.672 -3.637  -6.764  1.00 10.00 ? 274 LEU A N    2  
ATOM 3884   C CA   . LEU A 1 119 ? -17.134 -2.595  -5.858  1.00 10.00 ? 274 LEU A CA   2  
ATOM 3885   C C    . LEU A 1 119 ? -17.246 -1.263  -6.585  1.00 10.00 ? 274 LEU A C    2  
ATOM 3886   O O    . LEU A 1 119 ? -16.518 -1.015  -7.548  1.00 10.00 ? 274 LEU A O    2  
ATOM 3887   C CB   . LEU A 1 119 ? -16.189 -2.461  -4.661  1.00 10.00 ? 274 LEU A CB   2  
ATOM 3888   C CG   . LEU A 1 119 ? -16.605 -1.452  -3.586  1.00 10.00 ? 274 LEU A CG   2  
ATOM 3889   C CD1  . LEU A 1 119 ? -17.791 -1.971  -2.791  1.00 10.00 ? 274 LEU A CD1  2  
ATOM 3890   C CD2  . LEU A 1 119 ? -15.436 -1.122  -2.670  1.00 10.00 ? 274 LEU A CD2  2  
ATOM 3891   H H    . LEU A 1 119 ? -15.882 -3.473  -7.320  1.00 10.00 ? 274 LEU A H    2  
ATOM 3892   N N    . CYS A 1 120 ? -18.166 -0.420  -6.130  1.00 10.00 ? 275 CYS A N    2  
ATOM 3893   C CA   . CYS A 1 120 ? -18.368 0.887   -6.731  1.00 10.00 ? 275 CYS A CA   2  
ATOM 3894   C C    . CYS A 1 120 ? -17.191 1.806   -6.416  1.00 10.00 ? 275 CYS A C    2  
ATOM 3895   O O    . CYS A 1 120 ? -16.731 1.871   -5.277  1.00 10.00 ? 275 CYS A O    2  
ATOM 3896   C CB   . CYS A 1 120 ? -19.669 1.509   -6.224  1.00 10.00 ? 275 CYS A CB   2  
ATOM 3897   S SG   . CYS A 1 120 ? -20.376 2.745   -7.333  1.00 10.00 ? 275 CYS A SG   2  
ATOM 3898   H H    . CYS A 1 120 ? -18.724 -0.686  -5.368  1.00 10.00 ? 275 CYS A H    2  
ATOM 3899   H HG   . CYS A 1 120 ? -20.979 2.100   -8.326  1.00 10.00 ? 275 CYS A HG   2  
ATOM 3900   N N    . ASN A 1 121 ? -16.713 2.522   -7.422  1.00 10.00 ? 276 ASN A N    2  
ATOM 3901   C CA   . ASN A 1 121 ? -15.582 3.426   -7.246  1.00 10.00 ? 276 ASN A CA   2  
ATOM 3902   C C    . ASN A 1 121 ? -15.923 4.618   -6.355  1.00 10.00 ? 276 ASN A C    2  
ATOM 3903   O O    . ASN A 1 121 ? -15.093 5.075   -5.570  1.00 10.00 ? 276 ASN A O    2  
ATOM 3904   C CB   . ASN A 1 121 ? -15.030 3.900   -8.596  1.00 10.00 ? 276 ASN A CB   2  
ATOM 3905   C CG   . ASN A 1 121 ? -15.972 4.821   -9.351  1.00 10.00 ? 276 ASN A CG   2  
ATOM 3906   O OD1  . ASN A 1 121 ? -17.192 4.657   -9.313  1.00 10.00 ? 276 ASN A OD1  2  
ATOM 3907   N ND2  . ASN A 1 121 ? -15.413 5.799   -10.042 1.00 10.00 ? 276 ASN A ND2  2  
ATOM 3908   H H    . ASN A 1 121 ? -17.132 2.446   -8.307  1.00 10.00 ? 276 ASN A H    2  
ATOM 3909   H HD21 . ASN A 1 121 ? -14.435 5.875   -10.031 1.00 10.00 ? 276 ASN A HD21 2  
ATOM 3910   H HD22 . ASN A 1 121 ? -15.998 6.406   -10.542 1.00 10.00 ? 276 ASN A HD22 2  
ATOM 3911   N N    . THR A 1 122 ? -17.149 5.118   -6.470  1.00 10.00 ? 277 THR A N    2  
ATOM 3912   C CA   . THR A 1 122 ? -17.589 6.256   -5.680  1.00 10.00 ? 277 THR A CA   2  
ATOM 3913   C C    . THR A 1 122 ? -17.921 5.890   -4.234  1.00 10.00 ? 277 THR A C    2  
ATOM 3914   O O    . THR A 1 122 ? -18.467 6.709   -3.490  1.00 10.00 ? 277 THR A O    2  
ATOM 3915   C CB   . THR A 1 122 ? -18.804 6.937   -6.339  1.00 10.00 ? 277 THR A CB   2  
ATOM 3916   O OG1  . THR A 1 122 ? -19.718 5.933   -6.803  1.00 10.00 ? 277 THR A OG1  2  
ATOM 3917   C CG2  . THR A 1 122 ? -18.362 7.783   -7.520  1.00 10.00 ? 277 THR A CG2  2  
ATOM 3918   H H    . THR A 1 122 ? -17.767 4.750   -7.138  1.00 10.00 ? 277 THR A H    2  
ATOM 3919   H HG1  . THR A 1 122 ? -20.607 6.306   -6.833  1.00 10.00 ? 277 THR A HG1  2  
ATOM 3920   N N    . TYR A 1 123 ? -17.573 4.671   -3.826  1.00 10.00 ? 278 TYR A N    2  
ATOM 3921   C CA   . TYR A 1 123 ? -17.835 4.220   -2.464  1.00 10.00 ? 278 TYR A CA   2  
ATOM 3922   C C    . TYR A 1 123 ? -17.092 5.104   -1.465  1.00 10.00 ? 278 TYR A C    2  
ATOM 3923   O O    . TYR A 1 123 ? -17.568 5.352   -0.356  1.00 10.00 ? 278 TYR A O    2  
ATOM 3924   C CB   . TYR A 1 123 ? -17.427 2.754   -2.290  1.00 10.00 ? 278 TYR A CB   2  
ATOM 3925   C CG   . TYR A 1 123 ? -17.817 2.163   -0.954  1.00 10.00 ? 278 TYR A CG   2  
ATOM 3926   C CD1  . TYR A 1 123 ? -19.135 2.188   -0.521  1.00 10.00 ? 278 TYR A CD1  2  
ATOM 3927   C CD2  . TYR A 1 123 ? -16.864 1.585   -0.124  1.00 10.00 ? 278 TYR A CD2  2  
ATOM 3928   C CE1  . TYR A 1 123 ? -19.496 1.655   0.701   1.00 10.00 ? 278 TYR A CE1  2  
ATOM 3929   C CE2  . TYR A 1 123 ? -17.216 1.047   1.097   1.00 10.00 ? 278 TYR A CE2  2  
ATOM 3930   C CZ   . TYR A 1 123 ? -18.531 1.085   1.506   1.00 10.00 ? 278 TYR A CZ   2  
ATOM 3931   O OH   . TYR A 1 123 ? -18.882 0.554   2.726   1.00 10.00 ? 278 TYR A OH   2  
ATOM 3932   H H    . TYR A 1 123 ? -17.132 4.061   -4.458  1.00 10.00 ? 278 TYR A H    2  
ATOM 3933   H HH   . TYR A 1 123 ? -19.829 0.344   2.731   1.00 10.00 ? 278 TYR A HH   2  
ATOM 3934   N N    . ILE A 1 124 ? -15.930 5.594   -1.882  1.00 10.00 ? 279 ILE A N    2  
ATOM 3935   C CA   . ILE A 1 124 ? -15.116 6.461   -1.040  1.00 10.00 ? 279 ILE A CA   2  
ATOM 3936   C C    . ILE A 1 124 ? -15.794 7.818   -0.853  1.00 10.00 ? 279 ILE A C    2  
ATOM 3937   O O    . ILE A 1 124 ? -15.764 8.390   0.238   1.00 10.00 ? 279 ILE A O    2  
ATOM 3938   C CB   . ILE A 1 124 ? -13.705 6.673   -1.637  1.00 10.00 ? 279 ILE A CB   2  
ATOM 3939   C CG1  . ILE A 1 124 ? -13.066 5.334   -2.033  1.00 10.00 ? 279 ILE A CG1  2  
ATOM 3940   C CG2  . ILE A 1 124 ? -12.810 7.431   -0.664  1.00 10.00 ? 279 ILE A CG2  2  
ATOM 3941   C CD1  . ILE A 1 124 ? -12.919 4.349   -0.891  1.00 10.00 ? 279 ILE A CD1  2  
ATOM 3942   H H    . ILE A 1 124 ? -15.611 5.364   -2.778  1.00 10.00 ? 279 ILE A H    2  
ATOM 3943   N N    . ASP A 1 125 ? -16.434 8.310   -1.913  1.00 10.00 ? 280 ASP A N    2  
ATOM 3944   C CA   . ASP A 1 125 ? -17.117 9.603   -1.865  1.00 10.00 ? 280 ASP A CA   2  
ATOM 3945   C C    . ASP A 1 125 ? -18.319 9.539   -0.931  1.00 10.00 ? 280 ASP A C    2  
ATOM 3946   O O    . ASP A 1 125 ? -18.690 10.529  -0.297  1.00 10.00 ? 280 ASP A O    2  
ATOM 3947   C CB   . ASP A 1 125 ? -17.522 10.076  -3.266  1.00 10.00 ? 280 ASP A CB   2  
ATOM 3948   C CG   . ASP A 1 125 ? -16.375 10.720  -4.029  1.00 10.00 ? 280 ASP A CG   2  
ATOM 3949   O OD1  . ASP A 1 125 ? -15.742 11.657  -3.492  1.00 10.00 ? 280 ASP A OD1  2  
ATOM 3950   O OD2  . ASP A 1 125 ? -16.096 10.296  -5.171  1.00 10.00 ? 280 ASP A OD2  2  
ATOM 3951   H H    . ASP A 1 125 ? -16.465 7.784   -2.739  1.00 10.00 ? 280 ASP A H    2  
ATOM 3952   N N    . SER A 1 126 ? -18.920 8.363   -0.846  1.00 10.00 ? 281 SER A N    2  
ATOM 3953   C CA   . SER A 1 126 ? -20.053 8.135   0.034   1.00 10.00 ? 281 SER A CA   2  
ATOM 3954   C C    . SER A 1 126 ? -19.622 8.171   1.519   1.00 10.00 ? 281 SER A C    2  
ATOM 3955   O O    . SER A 1 126 ? -20.443 8.409   2.407   1.00 10.00 ? 281 SER A O    2  
ATOM 3956   C CB   . SER A 1 126 ? -20.746 6.818   -0.321  1.00 10.00 ? 281 SER A CB   2  
ATOM 3957   O OG   . SER A 1 126 ? -21.048 6.756   -1.711  1.00 10.00 ? 281 SER A OG   2  
ATOM 3958   H H    . SER A 1 126 ? -18.612 7.632   -1.422  1.00 10.00 ? 281 SER A H    2  
ATOM 3959   H HG   . SER A 1 126 ? -20.784 7.579   -2.140  1.00 10.00 ? 281 SER A HG   2  
ATOM 3960   N N    . TYR A 1 127 ? -18.330 7.924   1.776   1.00 10.00 ? 282 TYR A N    2  
ATOM 3961   C CA   . TYR A 1 127 ? -17.783 7.906   3.145   1.00 10.00 ? 282 TYR A CA   2  
ATOM 3962   C C    . TYR A 1 127 ? -16.887 9.137   3.407   1.00 10.00 ? 282 TYR A C    2  
ATOM 3963   O O    . TYR A 1 127 ? -16.114 9.204   4.374   1.00 10.00 ? 282 TYR A O    2  
ATOM 3964   C CB   . TYR A 1 127 ? -17.036 6.581   3.354   1.00 10.00 ? 282 TYR A CB   2  
ATOM 3965   C CG   . TYR A 1 127 ? -17.947 5.444   3.791   1.00 10.00 ? 282 TYR A CG   2  
ATOM 3966   C CD1  . TYR A 1 127 ? -18.896 4.888   2.934   1.00 10.00 ? 282 TYR A CD1  2  
ATOM 3967   C CD2  . TYR A 1 127 ? -17.865 4.946   5.080   1.00 10.00 ? 282 TYR A CD2  2  
ATOM 3968   C CE1  . TYR A 1 127 ? -19.729 3.867   3.360   1.00 10.00 ? 282 TYR A CE1  2  
ATOM 3969   C CE2  . TYR A 1 127 ? -18.689 3.933   5.512   1.00 10.00 ? 282 TYR A CE2  2  
ATOM 3970   C CZ   . TYR A 1 127 ? -19.619 3.396   4.654   1.00 10.00 ? 282 TYR A CZ   2  
ATOM 3971   O OH   . TYR A 1 127 ? -20.440 2.385   5.098   1.00 10.00 ? 282 TYR A OH   2  
ATOM 3972   H H    . TYR A 1 127 ? -17.724 7.764   1.020   1.00 10.00 ? 282 TYR A H    2  
ATOM 3973   H HH   . TYR A 1 127 ? -20.575 1.740   4.385   1.00 10.00 ? 282 TYR A HH   2  
ATOM 3974   N N    . LYS A 1 128 ? -17.031 10.096  2.506   1.00 10.00 ? 283 LYS A N    2  
ATOM 3975   C CA   . LYS A 1 128 ? -16.306 11.392  2.478   1.00 10.00 ? 283 LYS A CA   2  
ATOM 3976   C C    . LYS A 1 128 ? -16.692 12.490  3.485   1.00 10.00 ? 283 LYS A C    2  
ATOM 3977   O O    . LYS A 1 128 ? -17.048 13.604  3.104   1.00 10.00 ? 283 LYS A O    2  
ATOM 3978   C CB   . LYS A 1 128 ? -15.940 11.871  1.082   1.00 10.00 ? 283 LYS A CB   2  
ATOM 3979   C CG   . LYS A 1 128 ? -14.533 11.443  0.708   1.00 10.00 ? 283 LYS A CG   2  
ATOM 3980   C CD   . LYS A 1 128 ? -14.139 11.951  -0.659  1.00 10.00 ? 283 LYS A CD   2  
ATOM 3981   C CE   . LYS A 1 128 ? -14.374 13.443  -0.795  1.00 10.00 ? 283 LYS A CE   2  
ATOM 3982   N NZ   . LYS A 1 128 ? -14.789 13.788  -2.184  1.00 10.00 ? 283 LYS A NZ   2  
ATOM 3983   H H    . LYS A 1 128 ? -17.646 9.909   1.784   1.00 10.00 ? 283 LYS A H    2  
ATOM 3984   H HZ1  . LYS A 1 128 ? -15.488 14.557  -2.172  1.00 10.00 ? 283 LYS A HZ1  2  
ATOM 3985   H HZ2  . LYS A 1 128 ? -15.221 12.952  -2.644  1.00 10.00 ? 283 LYS A HZ2  2  
ATOM 3986   H HZ3  . LYS A 1 128 ? -13.969 14.094  -2.747  1.00 10.00 ? 283 LYS A HZ3  2  
ATOM 3987   N N    . GLY A 1 129 ? -16.715 12.138  4.759   1.00 10.00 ? 284 GLY A N    2  
ATOM 3988   C CA   . GLY A 1 129 ? -17.092 13.084  5.803   1.00 10.00 ? 284 GLY A CA   2  
ATOM 3989   C C    . GLY A 1 129 ? -18.289 12.554  6.525   1.00 10.00 ? 284 GLY A C    2  
ATOM 3990   O O    . GLY A 1 129 ? -18.886 13.210  7.376   1.00 10.00 ? 284 GLY A O    2  
ATOM 3991   H H    . GLY A 1 129 ? -16.408 11.257  5.011   1.00 10.00 ? 284 GLY A H    2  
ATOM 3992   N N    . THR A 1 130 ? -18.646 11.346  6.130   1.00 10.00 ? 285 THR A N    2  
ATOM 3993   C CA   . THR A 1 130 ? -19.768 10.637  6.690   1.00 10.00 ? 285 THR A CA   2  
ATOM 3994   C C    . THR A 1 130 ? -19.307 9.697   7.807   1.00 10.00 ? 285 THR A C    2  
ATOM 3995   O O    . THR A 1 130 ? -20.119 9.198   8.580   1.00 10.00 ? 285 THR A O    2  
ATOM 3996   C CB   . THR A 1 130 ? -20.453 9.812   5.575   1.00 10.00 ? 285 THR A CB   2  
ATOM 3997   O OG1  . THR A 1 130 ? -19.936 10.222  4.292   1.00 10.00 ? 285 THR A OG1  2  
ATOM 3998   C CG2  . THR A 1 130 ? -21.957 10.033  5.599   1.00 10.00 ? 285 THR A CG2  2  
ATOM 3999   H H    . THR A 1 130 ? -18.141 10.920  5.402   1.00 10.00 ? 285 THR A H    2  
ATOM 4000   H HG1  . THR A 1 130 ? -20.334 9.671   3.596   1.00 10.00 ? 285 THR A HG1  2  
ATOM 4001   N N    . VAL A 1 131 ? -17.996 9.480   7.909   1.00 10.00 ? 286 VAL A N    2  
ATOM 4002   C CA   . VAL A 1 131 ? -17.459 8.586   8.932   1.00 10.00 ? 286 VAL A CA   2  
ATOM 4003   C C    . VAL A 1 131 ? -17.032 9.349   10.179  1.00 10.00 ? 286 VAL A C    2  
ATOM 4004   O O    . VAL A 1 131 ? -16.248 10.294  10.101  1.00 10.00 ? 286 VAL A O    2  
ATOM 4005   C CB   . VAL A 1 131 ? -16.262 7.755   8.422   1.00 10.00 ? 286 VAL A CB   2  
ATOM 4006   C CG1  . VAL A 1 131 ? -16.016 6.560   9.332   1.00 10.00 ? 286 VAL A CG1  2  
ATOM 4007   C CG2  . VAL A 1 131 ? -16.482 7.300   6.993   1.00 10.00 ? 286 VAL A CG2  2  
ATOM 4008   H H    . VAL A 1 131 ? -17.380 9.939   7.296   1.00 10.00 ? 286 VAL A H    2  
ATOM 4009   N N    . ASP A 1 132 ? -17.557 8.934   11.326  1.00 10.00 ? 287 ASP A N    2  
ATOM 4010   C CA   . ASP A 1 132 ? -17.220 9.563   12.598  1.00 10.00 ? 287 ASP A CA   2  
ATOM 4011   C C    . ASP A 1 132 ? -16.124 8.776   13.318  1.00 10.00 ? 287 ASP A C    2  
ATOM 4012   O O    . ASP A 1 132 ? -15.672 9.158   14.401  1.00 10.00 ? 287 ASP A O    2  
ATOM 4013   C CB   . ASP A 1 132 ? -18.461 9.698   13.493  1.00 10.00 ? 287 ASP A CB   2  
ATOM 4014   C CG   . ASP A 1 132 ? -18.869 8.398   14.165  1.00 10.00 ? 287 ASP A CG   2  
ATOM 4015   O OD1  . ASP A 1 132 ? -19.648 7.626   13.560  1.00 10.00 ? 287 ASP A OD1  2  
ATOM 4016   O OD2  . ASP A 1 132 ? -18.427 8.150   15.308  1.00 10.00 ? 287 ASP A OD2  2  
ATOM 4017   H H    . ASP A 1 132 ? -18.204 8.198   11.316  1.00 10.00 ? 287 ASP A H    2  
ATOM 4018   N N    . CYS A 1 133 ? -15.696 7.681   12.702  1.00 10.00 ? 288 CYS A N    2  
ATOM 4019   C CA   . CYS A 1 133 ? -14.658 6.828   13.265  1.00 10.00 ? 288 CYS A CA   2  
ATOM 4020   C C    . CYS A 1 133 ? -13.314 7.113   12.606  1.00 10.00 ? 288 CYS A C    2  
ATOM 4021   O O    . CYS A 1 133 ? -13.242 7.337   11.397  1.00 10.00 ? 288 CYS A O    2  
ATOM 4022   C CB   . CYS A 1 133 ? -15.027 5.354   13.074  1.00 10.00 ? 288 CYS A CB   2  
ATOM 4023   S SG   . CYS A 1 133 ? -13.826 4.184   13.749  1.00 10.00 ? 288 CYS A SG   2  
ATOM 4024   H H    . CYS A 1 133 ? -16.091 7.443   11.839  1.00 10.00 ? 288 CYS A H    2  
ATOM 4025   H HG   . CYS A 1 133 ? -14.306 3.740   14.905  1.00 10.00 ? 288 CYS A HG   2  
ATOM 4026   N N    . VAL A 1 134 ? -12.247 7.098   13.400  1.00 10.00 ? 289 VAL A N    2  
ATOM 4027   C CA   . VAL A 1 134 ? -10.908 7.360   12.885  1.00 10.00 ? 289 VAL A CA   2  
ATOM 4028   C C    . VAL A 1 134 ? -10.367 6.184   12.065  1.00 10.00 ? 289 VAL A C    2  
ATOM 4029   O O    . VAL A 1 134 ? -9.992  6.360   10.906  1.00 10.00 ? 289 VAL A O    2  
ATOM 4030   C CB   . VAL A 1 134 ? -9.906  7.787   13.989  1.00 10.00 ? 289 VAL A CB   2  
ATOM 4031   C CG1  . VAL A 1 134 ? -9.880  6.794   15.144  1.00 10.00 ? 289 VAL A CG1  2  
ATOM 4032   C CG2  . VAL A 1 134 ? -8.512  7.993   13.412  1.00 10.00 ? 289 VAL A CG2  2  
ATOM 4033   H H    . VAL A 1 134 ? -12.365 6.906   14.357  1.00 10.00 ? 289 VAL A H    2  
ATOM 4034   N N    . GLN A 1 135 ? -10.321 4.998   12.672  1.00 10.00 ? 290 GLN A N    2  
ATOM 4035   C CA   . GLN A 1 135 ? -9.833  3.789   11.997  1.00 10.00 ? 290 GLN A CA   2  
ATOM 4036   C C    . GLN A 1 135 ? -10.470 3.576   10.629  1.00 10.00 ? 290 GLN A C    2  
ATOM 4037   O O    . GLN A 1 135 ? -9.772  3.341   9.643   1.00 10.00 ? 290 GLN A O    2  
ATOM 4038   C CB   . GLN A 1 135 ? -10.076 2.556   12.870  1.00 10.00 ? 290 GLN A CB   2  
ATOM 4039   C CG   . GLN A 1 135 ? -9.414  2.619   14.234  1.00 10.00 ? 290 GLN A CG   2  
ATOM 4040   C CD   . GLN A 1 135 ? -7.908  2.766   14.146  1.00 10.00 ? 290 GLN A CD   2  
ATOM 4041   O OE1  . GLN A 1 135 ? -7.280  2.307   13.193  1.00 10.00 ? 290 GLN A OE1  2  
ATOM 4042   N NE2  . GLN A 1 135 ? -7.322  3.406   15.137  1.00 10.00 ? 290 GLN A NE2  2  
ATOM 4043   H H    . GLN A 1 135 ? -10.508 4.948   13.631  1.00 10.00 ? 290 GLN A H    2  
ATOM 4044   H HE21 . GLN A 1 135 ? -7.885  3.747   15.866  1.00 10.00 ? 290 GLN A HE21 2  
ATOM 4045   H HE22 . GLN A 1 135 ? -6.351  3.515   15.107  1.00 10.00 ? 290 GLN A HE22 2  
ATOM 4046   N N    . ALA A 1 136 ? -11.792 3.662   10.573  1.00 10.00 ? 291 ALA A N    2  
ATOM 4047   C CA   . ALA A 1 136 ? -12.509 3.474   9.320   1.00 10.00 ? 291 ALA A CA   2  
ATOM 4048   C C    . ALA A 1 136 ? -12.091 4.518   8.289   1.00 10.00 ? 291 ALA A C    2  
ATOM 4049   O O    . ALA A 1 136 ? -11.954 4.214   7.105   1.00 10.00 ? 291 ALA A O    2  
ATOM 4050   C CB   . ALA A 1 136 ? -14.012 3.509   9.552   1.00 10.00 ? 291 ALA A CB   2  
ATOM 4051   H H    . ALA A 1 136 ? -12.294 3.852   11.392  1.00 10.00 ? 291 ALA A H    2  
ATOM 4052   N N    . ARG A 1 137 ? -11.868 5.742   8.754   1.00 10.00 ? 292 ARG A N    2  
ATOM 4053   C CA   . ARG A 1 137 ? -11.465 6.836   7.881   1.00 10.00 ? 292 ARG A CA   2  
ATOM 4054   C C    . ARG A 1 137 ? -10.113 6.572   7.234   1.00 10.00 ? 292 ARG A C    2  
ATOM 4055   O O    . ARG A 1 137 ? -9.985  6.644   6.011   1.00 10.00 ? 292 ARG A O    2  
ATOM 4056   C CB   . ARG A 1 137 ? -11.422 8.154   8.655   1.00 10.00 ? 292 ARG A CB   2  
ATOM 4057   C CG   . ARG A 1 137 ? -12.450 9.172   8.201   1.00 10.00 ? 292 ARG A CG   2  
ATOM 4058   C CD   . ARG A 1 137 ? -11.811 10.312  7.423   1.00 10.00 ? 292 ARG A CD   2  
ATOM 4059   N NE   . ARG A 1 137 ? -11.228 9.876   6.149   1.00 10.00 ? 292 ARG A NE   2  
ATOM 4060   C CZ   . ARG A 1 137 ? -11.930 9.658   5.033   1.00 10.00 ? 292 ARG A CZ   2  
ATOM 4061   N NH1  . ARG A 1 137 ? -13.257 9.765   5.039   1.00 10.00 ? 292 ARG A NH1  2  
ATOM 4062   N NH2  . ARG A 1 137 ? -11.299 9.326   3.915   1.00 10.00 ? 292 ARG A NH2  2  
ATOM 4063   H H    . ARG A 1 137 ? -11.974 5.916   9.713   1.00 10.00 ? 292 ARG A H    2  
ATOM 4064   H HE   . ARG A 1 137 ? -10.247 9.757   6.121   1.00 10.00 ? 292 ARG A HE   2  
ATOM 4065   H HH11 . ARG A 1 137 ? -13.739 10.015  5.884   1.00 10.00 ? 292 ARG A HH11 2  
ATOM 4066   H HH12 . ARG A 1 137 ? -13.783 9.596   4.203   1.00 10.00 ? 292 ARG A HH12 2  
ATOM 4067   H HH21 . ARG A 1 137 ? -10.288 9.239   3.910   1.00 10.00 ? 292 ARG A HH21 2  
ATOM 4068   H HH22 . ARG A 1 137 ? -11.811 9.171   3.071   1.00 10.00 ? 292 ARG A HH22 2  
ATOM 4069   N N    . ALA A 1 138 ? -9.111  6.246   8.048   1.00 10.00 ? 293 ALA A N    2  
ATOM 4070   C CA   . ALA A 1 138 ? -7.766  5.990   7.545   1.00 10.00 ? 293 ALA A CA   2  
ATOM 4071   C C    . ALA A 1 138 ? -7.734  4.796   6.599   1.00 10.00 ? 293 ALA A C    2  
ATOM 4072   O O    . ALA A 1 138 ? -6.925  4.756   5.668   1.00 10.00 ? 293 ALA A O    2  
ATOM 4073   C CB   . ALA A 1 138 ? -6.795  5.785   8.700   1.00 10.00 ? 293 ALA A CB   2  
ATOM 4074   H H    . ALA A 1 138 ? -9.261  6.173   9.019   1.00 10.00 ? 293 ALA A H    2  
ATOM 4075   N N    . ALA A 1 139 ? -8.609  3.826   6.844   1.00 10.00 ? 294 ALA A N    2  
ATOM 4076   C CA   . ALA A 1 139 ? -8.690  2.641   5.998   1.00 10.00 ? 294 ALA A CA   2  
ATOM 4077   C C    . ALA A 1 139 ? -9.114  3.036   4.590   1.00 10.00 ? 294 ALA A C    2  
ATOM 4078   O O    . ALA A 1 139 ? -8.561  2.555   3.600   1.00 10.00 ? 294 ALA A O    2  
ATOM 4079   C CB   . ALA A 1 139 ? -9.665  1.634   6.586   1.00 10.00 ? 294 ALA A CB   2  
ATOM 4080   H H    . ALA A 1 139 ? -9.210  3.907   7.617   1.00 10.00 ? 294 ALA A H    2  
ATOM 4081   N N    . LEU A 1 140 ? -10.089 3.934   4.508   1.00 10.00 ? 295 LEU A N    2  
ATOM 4082   C CA   . LEU A 1 140 ? -10.579 4.415   3.226   1.00 10.00 ? 295 LEU A CA   2  
ATOM 4083   C C    . LEU A 1 140 ? -9.555  5.357   2.607   1.00 10.00 ? 295 LEU A C    2  
ATOM 4084   O O    . LEU A 1 140 ? -9.403  5.414   1.387   1.00 10.00 ? 295 LEU A O    2  
ATOM 4085   C CB   . LEU A 1 140 ? -11.909 5.148   3.403   1.00 10.00 ? 295 LEU A CB   2  
ATOM 4086   C CG   . LEU A 1 140 ? -13.031 4.357   4.074   1.00 10.00 ? 295 LEU A CG   2  
ATOM 4087   C CD1  . LEU A 1 140 ? -14.052 5.303   4.682   1.00 10.00 ? 295 LEU A CD1  2  
ATOM 4088   C CD2  . LEU A 1 140 ? -13.697 3.418   3.079   1.00 10.00 ? 295 LEU A CD2  2  
ATOM 4089   H H    . LEU A 1 140 ? -10.489 4.280   5.336   1.00 10.00 ? 295 LEU A H    2  
ATOM 4090   N N    . ASP A 1 141 ? -8.858  6.097   3.467   1.00 10.00 ? 296 ASP A N    2  
ATOM 4091   C CA   . ASP A 1 141 ? -7.833  7.036   3.025   1.00 10.00 ? 296 ASP A CA   2  
ATOM 4092   C C    . ASP A 1 141 ? -6.765  6.305   2.224   1.00 10.00 ? 296 ASP A C    2  
ATOM 4093   O O    . ASP A 1 141 ? -6.504  6.645   1.069   1.00 10.00 ? 296 ASP A O    2  
ATOM 4094   C CB   . ASP A 1 141 ? -7.197  7.767   4.213   1.00 10.00 ? 296 ASP A CB   2  
ATOM 4095   C CG   . ASP A 1 141 ? -8.029  8.935   4.707   1.00 10.00 ? 296 ASP A CG   2  
ATOM 4096   O OD1  . ASP A 1 141 ? -8.674  9.607   3.875   1.00 10.00 ? 296 ASP A OD1  2  
ATOM 4097   O OD2  . ASP A 1 141 ? -8.043  9.192   5.930   1.00 10.00 ? 296 ASP A OD2  2  
ATOM 4098   H H    . ASP A 1 141 ? -9.044  6.008   4.427   1.00 10.00 ? 296 ASP A H    2  
ATOM 4099   N N    . LYS A 1 142 ? -6.151  5.297   2.841   1.00 10.00 ? 297 LYS A N    2  
ATOM 4100   C CA   . LYS A 1 142 ? -5.137  4.495   2.171   1.00 10.00 ? 297 LYS A CA   2  
ATOM 4101   C C    . LYS A 1 142 ? -5.687  3.887   0.883   1.00 10.00 ? 297 LYS A C    2  
ATOM 4102   O O    . LYS A 1 142 ? -4.992  3.833   -0.131  1.00 10.00 ? 297 LYS A O    2  
ATOM 4103   C CB   . LYS A 1 142 ? -4.628  3.392   3.109   1.00 10.00 ? 297 LYS A CB   2  
ATOM 4104   C CG   . LYS A 1 142 ? -3.509  2.536   2.533   1.00 10.00 ? 297 LYS A CG   2  
ATOM 4105   C CD   . LYS A 1 142 ? -2.145  2.955   3.060   1.00 10.00 ? 297 LYS A CD   2  
ATOM 4106   C CE   . LYS A 1 142 ? -1.027  2.236   2.319   1.00 10.00 ? 297 LYS A CE   2  
ATOM 4107   N NZ   . LYS A 1 142 ? 0.299   2.441   2.960   1.00 10.00 ? 297 LYS A NZ   2  
ATOM 4108   H H    . LYS A 1 142 ? -6.320  5.131   3.796   1.00 10.00 ? 297 LYS A H    2  
ATOM 4109   H HZ1  . LYS A 1 142 ? 1.054   2.064   2.358   1.00 10.00 ? 297 LYS A HZ1  2  
ATOM 4110   H HZ2  . LYS A 1 142 ? 0.332   1.952   3.887   1.00 10.00 ? 297 LYS A HZ2  2  
ATOM 4111   H HZ3  . LYS A 1 142 ? 0.474   3.459   3.119   1.00 10.00 ? 297 LYS A HZ3  2  
ATOM 4112   N N    . ALA A 1 143 ? -6.944  3.458   0.922   1.00 10.00 ? 298 ALA A N    2  
ATOM 4113   C CA   . ALA A 1 143 ? -7.592  2.865   -0.243  1.00 10.00 ? 298 ALA A CA   2  
ATOM 4114   C C    . ALA A 1 143 ? -7.649  3.859   -1.401  1.00 10.00 ? 298 ALA A C    2  
ATOM 4115   O O    . ALA A 1 143 ? -7.525  3.477   -2.566  1.00 10.00 ? 298 ALA A O    2  
ATOM 4116   C CB   . ALA A 1 143 ? -8.993  2.386   0.111   1.00 10.00 ? 298 ALA A CB   2  
ATOM 4117   H H    . ALA A 1 143 ? -7.453  3.547   1.759   1.00 10.00 ? 298 ALA A H    2  
ATOM 4118   N N    . THR A 1 144 ? -7.810  5.132   -1.065  1.00 10.00 ? 299 THR A N    2  
ATOM 4119   C CA   . THR A 1 144 ? -7.883  6.188   -2.059  1.00 10.00 ? 299 THR A CA   2  
ATOM 4120   C C    . THR A 1 144 ? -6.553  6.348   -2.794  1.00 10.00 ? 299 THR A C    2  
ATOM 4121   O O    . THR A 1 144 ? -6.524  6.448   -4.022  1.00 10.00 ? 299 THR A O    2  
ATOM 4122   C CB   . THR A 1 144 ? -8.297  7.533   -1.421  1.00 10.00 ? 299 THR A CB   2  
ATOM 4123   O OG1  . THR A 1 144 ? -9.442  7.336   -0.577  1.00 10.00 ? 299 THR A OG1  2  
ATOM 4124   C CG2  . THR A 1 144 ? -8.644  8.557   -2.492  1.00 10.00 ? 299 THR A CG2  2  
ATOM 4125   H H    . THR A 1 144 ? -7.870  5.370   -0.115  1.00 10.00 ? 299 THR A H    2  
ATOM 4126   H HG1  . THR A 1 144 ? -9.226  6.703   0.119   1.00 10.00 ? 299 THR A HG1  2  
ATOM 4127   N N    . VAL A 1 145 ? -5.443  6.347   -2.053  1.00 10.00 ? 300 VAL A N    2  
ATOM 4128   C CA   . VAL A 1 145 ? -4.128  6.504   -2.664  1.00 10.00 ? 300 VAL A CA   2  
ATOM 4129   C C    . VAL A 1 145 ? -3.685  5.221   -3.367  1.00 10.00 ? 300 VAL A C    2  
ATOM 4130   O O    . VAL A 1 145 ? -2.975  5.270   -4.371  1.00 10.00 ? 300 VAL A O    2  
ATOM 4131   C CB   . VAL A 1 145 ? -3.051  6.993   -1.659  1.00 10.00 ? 300 VAL A CB   2  
ATOM 4132   C CG1  . VAL A 1 145 ? -2.651  5.904   -0.679  1.00 10.00 ? 300 VAL A CG1  2  
ATOM 4133   C CG2  . VAL A 1 145 ? -1.835  7.547   -2.388  1.00 10.00 ? 300 VAL A CG2  2  
ATOM 4134   H H    . VAL A 1 145 ? -5.479  6.184   -1.084  1.00 10.00 ? 300 VAL A H    2  
ATOM 4135   N N    . LEU A 1 146 ? -4.124  4.074   -2.841  1.00 10.00 ? 301 LEU A N    2  
ATOM 4136   C CA   . LEU A 1 146 ? -3.765  2.773   -3.405  1.00 10.00 ? 301 LEU A CA   2  
ATOM 4137   C C    . LEU A 1 146 ? -4.088  2.702   -4.889  1.00 10.00 ? 301 LEU A C    2  
ATOM 4138   O O    . LEU A 1 146 ? -3.311  2.159   -5.675  1.00 10.00 ? 301 LEU A O    2  
ATOM 4139   C CB   . LEU A 1 146 ? -4.468  1.641   -2.659  1.00 10.00 ? 301 LEU A CB   2  
ATOM 4140   C CG   . LEU A 1 146 ? -3.909  1.292   -1.280  1.00 10.00 ? 301 LEU A CG   2  
ATOM 4141   C CD1  . LEU A 1 146 ? -4.861  0.374   -0.538  1.00 10.00 ? 301 LEU A CD1  2  
ATOM 4142   C CD2  . LEU A 1 146 ? -2.537  0.651   -1.403  1.00 10.00 ? 301 LEU A CD2  2  
ATOM 4143   H H    . LEU A 1 146 ? -4.702  4.105   -2.045  1.00 10.00 ? 301 LEU A H    2  
ATOM 4144   N N    . LEU A 1 147 ? -5.222  3.271   -5.274  1.00 10.00 ? 302 LEU A N    2  
ATOM 4145   C CA   . LEU A 1 147 ? -5.632  3.279   -6.669  1.00 10.00 ? 302 LEU A CA   2  
ATOM 4146   C C    . LEU A 1 147 ? -4.641  4.076   -7.513  1.00 10.00 ? 302 LEU A C    2  
ATOM 4147   O O    . LEU A 1 147 ? -4.201  3.618   -8.566  1.00 10.00 ? 302 LEU A O    2  
ATOM 4148   C CB   . LEU A 1 147 ? -7.040  3.859   -6.815  1.00 10.00 ? 302 LEU A CB   2  
ATOM 4149   C CG   . LEU A 1 147 ? -8.182  2.991   -6.280  1.00 10.00 ? 302 LEU A CG   2  
ATOM 4150   C CD1  . LEU A 1 147 ? -9.510  3.725   -6.394  1.00 10.00 ? 302 LEU A CD1  2  
ATOM 4151   C CD2  . LEU A 1 147 ? -8.239  1.662   -7.019  1.00 10.00 ? 302 LEU A CD2  2  
ATOM 4152   H H    . LEU A 1 147 ? -5.799  3.692   -4.601  1.00 10.00 ? 302 LEU A H    2  
ATOM 4153   N N    . SER A 1 148 ? -4.259  5.248   -7.018  1.00 10.00 ? 303 SER A N    2  
ATOM 4154   C CA   . SER A 1 148 ? -3.325  6.112   -7.728  1.00 10.00 ? 303 SER A CA   2  
ATOM 4155   C C    . SER A 1 148 ? -1.934  5.483   -7.806  1.00 10.00 ? 303 SER A C    2  
ATOM 4156   O O    . SER A 1 148 ? -1.207  5.683   -8.778  1.00 10.00 ? 303 SER A O    2  
ATOM 4157   C CB   . SER A 1 148 ? -3.256  7.494   -7.069  1.00 10.00 ? 303 SER A CB   2  
ATOM 4158   O OG   . SER A 1 148 ? -2.637  8.443   -7.924  1.00 10.00 ? 303 SER A OG   2  
ATOM 4159   H H    . SER A 1 148 ? -4.608  5.533   -6.147  1.00 10.00 ? 303 SER A H    2  
ATOM 4160   H HG   . SER A 1 148 ? -2.124  7.983   -8.598  1.00 10.00 ? 303 SER A HG   2  
ATOM 4161   N N    . MET A 1 149 ? -1.569  4.727   -6.781  1.00 10.00 ? 304 MET A N    2  
ATOM 4162   C CA   . MET A 1 149 ? -0.270  4.072   -6.746  1.00 10.00 ? 304 MET A CA   2  
ATOM 4163   C C    . MET A 1 149 ? -0.233  2.888   -7.701  1.00 10.00 ? 304 MET A C    2  
ATOM 4164   O O    . MET A 1 149 ? 0.712   2.724   -8.473  1.00 10.00 ? 304 MET A O    2  
ATOM 4165   C CB   . MET A 1 149 ? 0.069   3.634   -5.321  1.00 10.00 ? 304 MET A CB   2  
ATOM 4166   C CG   . MET A 1 149 ? 0.223   4.805   -4.367  1.00 10.00 ? 304 MET A CG   2  
ATOM 4167   S SD   . MET A 1 149 ? 0.881   4.342   -2.757  1.00 10.00 ? 304 MET A SD   2  
ATOM 4168   C CE   . MET A 1 149 ? -0.435  3.314   -2.121  1.00 10.00 ? 304 MET A CE   2  
ATOM 4169   H H    . MET A 1 149 ? -2.182  4.613   -6.024  1.00 10.00 ? 304 MET A H    2  
ATOM 4170   N N    . SER A 1 150 ? -1.290  2.093   -7.676  1.00 10.00 ? 305 SER A N    2  
ATOM 4171   C CA   . SER A 1 150 ? -1.390  0.920   -8.526  1.00 10.00 ? 305 SER A CA   2  
ATOM 4172   C C    . SER A 1 150 ? -1.460  1.285   -10.008 1.00 10.00 ? 305 SER A C    2  
ATOM 4173   O O    . SER A 1 150 ? -1.059  0.495   -10.863 1.00 10.00 ? 305 SER A O    2  
ATOM 4174   C CB   . SER A 1 150 ? -2.595  0.074   -8.120  1.00 10.00 ? 305 SER A CB   2  
ATOM 4175   O OG   . SER A 1 150 ? -2.565  -0.196  -6.729  1.00 10.00 ? 305 SER A OG   2  
ATOM 4176   H H    . SER A 1 150 ? -2.025  2.296   -7.056  1.00 10.00 ? 305 SER A H    2  
ATOM 4177   H HG   . SER A 1 150 ? -2.955  0.549   -6.249  1.00 10.00 ? 305 SER A HG   2  
ATOM 4178   N N    . LYS A 1 151 ? -1.953  2.483   -10.306 1.00 10.00 ? 306 LYS A N    2  
ATOM 4179   C CA   . LYS A 1 151 ? -2.072  2.936   -11.688 1.00 10.00 ? 306 LYS A CA   2  
ATOM 4180   C C    . LYS A 1 151 ? -0.703  3.212   -12.297 1.00 10.00 ? 306 LYS A C    2  
ATOM 4181   O O    . LYS A 1 151 ? -0.486  2.981   -13.487 1.00 10.00 ? 306 LYS A O    2  
ATOM 4182   C CB   . LYS A 1 151 ? -2.974  4.168   -11.785 1.00 10.00 ? 306 LYS A CB   2  
ATOM 4183   C CG   . LYS A 1 151 ? -4.458  3.843   -11.769 1.00 10.00 ? 306 LYS A CG   2  
ATOM 4184   C CD   . LYS A 1 151 ? -5.305  5.083   -11.524 1.00 10.00 ? 306 LYS A CD   2  
ATOM 4185   C CE   . LYS A 1 151 ? -5.174  6.093   -12.653 1.00 10.00 ? 306 LYS A CE   2  
ATOM 4186   N NZ   . LYS A 1 151 ? -6.239  7.129   -12.589 1.00 10.00 ? 306 LYS A NZ   2  
ATOM 4187   H H    . LYS A 1 151 ? -2.247  3.076   -9.581  1.00 10.00 ? 306 LYS A H    2  
ATOM 4188   H HZ1  . LYS A 1 151 ? -6.165  7.668   -11.705 1.00 10.00 ? 306 LYS A HZ1  2  
ATOM 4189   H HZ2  . LYS A 1 151 ? -7.180  6.681   -12.629 1.00 10.00 ? 306 LYS A HZ2  2  
ATOM 4190   H HZ3  . LYS A 1 151 ? -6.148  7.785   -13.387 1.00 10.00 ? 306 LYS A HZ3  2  
ATOM 4191   N N    . GLY A 1 152 ? 0.223   3.688   -11.472 1.00 10.00 ? 307 GLY A N    2  
ATOM 4192   C CA   . GLY A 1 152 ? 1.563   3.983   -11.947 1.00 10.00 ? 307 GLY A CA   2  
ATOM 4193   C C    . GLY A 1 152 ? 2.346   2.720   -12.244 1.00 10.00 ? 307 GLY A C    2  
ATOM 4194   O O    . GLY A 1 152 ? 3.365   2.750   -12.935 1.00 10.00 ? 307 GLY A O    2  
ATOM 4195   H H    . GLY A 1 152 ? -0.004  3.837   -10.530 1.00 10.00 ? 307 GLY A H    2  
ATOM 4196   N N    . GLY A 1 153 ? 1.855   1.605   -11.728 1.00 10.00 ? 308 GLY A N    2  
ATOM 4197   C CA   . GLY A 1 153 ? 2.506   0.335   -11.944 1.00 10.00 ? 308 GLY A CA   2  
ATOM 4198   C C    . GLY A 1 153 ? 1.552   -0.684  -12.520 1.00 10.00 ? 308 GLY A C    2  
ATOM 4199   O O    . GLY A 1 153 ? 1.424   -1.790  -11.994 1.00 10.00 ? 308 GLY A O    2  
ATOM 4200   H H    . GLY A 1 153 ? 1.029   1.647   -11.201 1.00 10.00 ? 308 GLY A H    2  
ATOM 4201   N N    . LYS A 1 154 ? 0.857   -0.295  -13.581 1.00 10.00 ? 309 LYS A N    2  
ATOM 4202   C CA   . LYS A 1 154 ? -0.095  -1.179  -14.242 1.00 10.00 ? 309 LYS A CA   2  
ATOM 4203   C C    . LYS A 1 154 ? 0.651   -2.212  -15.078 1.00 10.00 ? 309 LYS A C    2  
ATOM 4204   O O    . LYS A 1 154 ? 0.586   -3.411  -14.815 1.00 10.00 ? 309 LYS A O    2  
ATOM 4205   C CB   . LYS A 1 154 ? -1.040  -0.363  -15.130 1.00 10.00 ? 309 LYS A CB   2  
ATOM 4206   C CG   . LYS A 1 154 ? -2.202  -1.154  -15.707 1.00 10.00 ? 309 LYS A CG   2  
ATOM 4207   C CD   . LYS A 1 154 ? -3.148  -1.617  -14.615 1.00 10.00 ? 309 LYS A CD   2  
ATOM 4208   C CE   . LYS A 1 154 ? -4.363  -2.307  -15.205 1.00 10.00 ? 309 LYS A CE   2  
ATOM 4209   N NZ   . LYS A 1 154 ? -5.232  -2.904  -14.155 1.00 10.00 ? 309 LYS A NZ   2  
ATOM 4210   H H    . LYS A 1 154 ? 0.985   0.614   -13.927 1.00 10.00 ? 309 LYS A H    2  
ATOM 4211   H HZ1  . LYS A 1 154 ? -6.104  -3.278  -14.584 1.00 10.00 ? 309 LYS A HZ1  2  
ATOM 4212   H HZ2  . LYS A 1 154 ? -5.489  -2.185  -13.450 1.00 10.00 ? 309 LYS A HZ2  2  
ATOM 4213   H HZ3  . LYS A 1 154 ? -4.736  -3.680  -13.678 1.00 10.00 ? 309 LYS A HZ3  2  
ATOM 4214   N N    . ARG A 1 155 ? 1.363   -1.729  -16.082 1.00 10.00 ? 310 ARG A N    2  
ATOM 4215   C CA   . ARG A 1 155 ? 2.143   -2.589  -16.958 1.00 10.00 ? 310 ARG A CA   2  
ATOM 4216   C C    . ARG A 1 155 ? 3.579   -2.089  -17.004 1.00 10.00 ? 310 ARG A C    2  
ATOM 4217   O O    . ARG A 1 155 ? 4.013   -1.485  -17.981 1.00 10.00 ? 310 ARG A O    2  
ATOM 4218   C CB   . ARG A 1 155 ? 1.534   -2.644  -18.364 1.00 10.00 ? 310 ARG A CB   2  
ATOM 4219   C CG   . ARG A 1 155 ? 0.152   -3.281  -18.422 1.00 10.00 ? 310 ARG A CG   2  
ATOM 4220   C CD   . ARG A 1 155 ? 0.182   -4.715  -17.919 1.00 10.00 ? 310 ARG A CD   2  
ATOM 4221   N NE   . ARG A 1 155 ? -1.136  -5.179  -17.489 1.00 10.00 ? 310 ARG A NE   2  
ATOM 4222   C CZ   . ARG A 1 155 ? -1.354  -5.887  -16.378 1.00 10.00 ? 310 ARG A CZ   2  
ATOM 4223   N NH1  . ARG A 1 155 ? -0.344  -6.189  -15.572 1.00 10.00 ? 310 ARG A NH1  2  
ATOM 4224   N NH2  . ARG A 1 155 ? -2.583  -6.282  -16.072 1.00 10.00 ? 310 ARG A NH2  2  
ATOM 4225   H H    . ARG A 1 155 ? 1.368   -0.763  -16.240 1.00 10.00 ? 310 ARG A H    2  
ATOM 4226   H HE   . ARG A 1 155 ? -1.903  -4.955  -18.064 1.00 10.00 ? 310 ARG A HE   2  
ATOM 4227   H HH11 . ARG A 1 155 ? 0.590   -5.889  -15.797 1.00 10.00 ? 310 ARG A HH11 2  
ATOM 4228   H HH12 . ARG A 1 155 ? -0.507  -6.705  -14.726 1.00 10.00 ? 310 ARG A HH12 2  
ATOM 4229   H HH21 . ARG A 1 155 ? -3.351  -6.044  -16.672 1.00 10.00 ? 310 ARG A HH21 2  
ATOM 4230   H HH22 . ARG A 1 155 ? -2.749  -6.833  -15.249 1.00 10.00 ? 310 ARG A HH22 2  
ATOM 4231   N N    . LYS A 1 156 ? 4.302   -2.322  -15.917 1.00 10.00 ? 311 LYS A N    2  
ATOM 4232   C CA   . LYS A 1 156 ? 5.688   -1.885  -15.809 1.00 10.00 ? 311 LYS A CA   2  
ATOM 4233   C C    . LYS A 1 156 ? 6.629   -3.082  -15.716 1.00 10.00 ? 311 LYS A C    2  
ATOM 4234   O O    . LYS A 1 156 ? 7.848   -2.930  -15.755 1.00 10.00 ? 311 LYS A O    2  
ATOM 4235   C CB   . LYS A 1 156 ? 5.861   -0.990  -14.574 1.00 10.00 ? 311 LYS A CB   2  
ATOM 4236   C CG   . LYS A 1 156 ? 6.841   0.163   -14.756 1.00 10.00 ? 311 LYS A CG   2  
ATOM 4237   C CD   . LYS A 1 156 ? 6.199   1.320   -15.506 1.00 10.00 ? 311 LYS A CD   2  
ATOM 4238   C CE   . LYS A 1 156 ? 7.137   2.514   -15.617 1.00 10.00 ? 311 LYS A CE   2  
ATOM 4239   N NZ   . LYS A 1 156 ? 8.282   2.253   -16.528 1.00 10.00 ? 311 LYS A NZ   2  
ATOM 4240   H H    . LYS A 1 156 ? 3.892   -2.802  -15.168 1.00 10.00 ? 311 LYS A H    2  
ATOM 4241   H HZ1  . LYS A 1 156 ? 8.552   3.131   -17.018 1.00 10.00 ? 311 LYS A HZ1  2  
ATOM 4242   H HZ2  . LYS A 1 156 ? 8.020   1.542   -17.240 1.00 10.00 ? 311 LYS A HZ2  2  
ATOM 4243   H HZ3  . LYS A 1 156 ? 9.101   1.907   -15.990 1.00 10.00 ? 311 LYS A HZ3  2  
ATOM 4244   N N    . ASP A 1 157 ? 6.055   -4.272  -15.594 1.00 10.00 ? 312 ASP A N    2  
ATOM 4245   C CA   . ASP A 1 157 ? 6.849   -5.492  -15.489 1.00 10.00 ? 312 ASP A CA   2  
ATOM 4246   C C    . ASP A 1 157 ? 6.338   -6.551  -16.457 1.00 10.00 ? 312 ASP A C    2  
ATOM 4247   O O    . ASP A 1 157 ? 5.131   -6.755  -16.596 1.00 10.00 ? 312 ASP A O    2  
ATOM 4248   C CB   . ASP A 1 157 ? 6.831   -6.032  -14.057 1.00 10.00 ? 312 ASP A CB   2  
ATOM 4249   C CG   . ASP A 1 157 ? 7.838   -7.145  -13.839 1.00 10.00 ? 312 ASP A CG   2  
ATOM 4250   O OD1  . ASP A 1 157 ? 7.613   -8.262  -14.352 1.00 10.00 ? 312 ASP A OD1  2  
ATOM 4251   O OD2  . ASP A 1 157 ? 8.858   -6.903  -13.158 1.00 10.00 ? 312 ASP A OD2  2  
ATOM 4252   H H    . ASP A 1 157 ? 5.077   -4.336  -15.586 1.00 10.00 ? 312 ASP A H    2  
ATOM 4253   N N    . SER A 1 158 ? 7.260   -7.204  -17.143 1.00 10.00 ? 313 SER A N    2  
ATOM 4254   C CA   . SER A 1 158 ? 6.915   -8.233  -18.105 1.00 10.00 ? 313 SER A CA   2  
ATOM 4255   C C    . SER A 1 158 ? 7.873   -9.412  -17.988 1.00 10.00 ? 313 SER A C    2  
ATOM 4256   O O    . SER A 1 158 ? 8.272   -10.006 -18.990 1.00 10.00 ? 313 SER A O    2  
ATOM 4257   C CB   . SER A 1 158 ? 6.952   -7.648  -19.516 1.00 10.00 ? 313 SER A CB   2  
ATOM 4258   O OG   . SER A 1 158 ? 6.206   -6.443  -19.576 1.00 10.00 ? 313 SER A OG   2  
ATOM 4259   H H    . SER A 1 158 ? 8.206   -6.994  -16.990 1.00 10.00 ? 313 SER A H    2  
ATOM 4260   H HG   . SER A 1 158 ? 6.334   -5.950  -18.754 1.00 10.00 ? 313 SER A HG   2  
ATOM 4261   N N    . VAL A 1 159 ? 8.236   -9.749  -16.755 1.00 10.00 ? 314 VAL A N    2  
ATOM 4262   C CA   . VAL A 1 159 ? 9.148   -10.858 -16.503 1.00 10.00 ? 314 VAL A CA   2  
ATOM 4263   C C    . VAL A 1 159 ? 8.496   -12.192 -16.871 1.00 10.00 ? 314 VAL A C    2  
ATOM 4264   O O    . VAL A 1 159 ? 9.158   -13.107 -17.369 1.00 10.00 ? 314 VAL A O    2  
ATOM 4265   C CB   . VAL A 1 159 ? 9.615   -10.885 -15.028 1.00 10.00 ? 314 VAL A CB   2  
ATOM 4266   C CG1  . VAL A 1 159 ? 10.413  -12.143 -14.726 1.00 10.00 ? 314 VAL A CG1  2  
ATOM 4267   C CG2  . VAL A 1 159 ? 10.446  -9.651  -14.714 1.00 10.00 ? 314 VAL A CG2  2  
ATOM 4268   H H    . VAL A 1 159 ? 7.886   -9.229  -15.988 1.00 10.00 ? 314 VAL A H    2  
ATOM 4269   N N    . TRP A 1 160 ? 7.191   -12.281 -16.660 1.00 10.00 ? 315 TRP A N    2  
ATOM 4270   C CA   . TRP A 1 160 ? 6.443   -13.497 -16.952 1.00 10.00 ? 315 TRP A CA   2  
ATOM 4271   C C    . TRP A 1 160 ? 5.121   -13.171 -17.635 1.00 10.00 ? 315 TRP A C    2  
ATOM 4272   O O    . TRP A 1 160 ? 4.734   -12.005 -17.733 1.00 10.00 ? 315 TRP A O    2  
ATOM 4273   C CB   . TRP A 1 160 ? 6.179   -14.280 -15.659 1.00 10.00 ? 315 TRP A CB   2  
ATOM 4274   C CG   . TRP A 1 160 ? 6.007   -13.406 -14.449 1.00 10.00 ? 315 TRP A CG   2  
ATOM 4275   C CD1  . TRP A 1 160 ? 5.149   -12.354 -14.304 1.00 10.00 ? 315 TRP A CD1  2  
ATOM 4276   C CD2  . TRP A 1 160 ? 6.715   -13.516 -13.211 1.00 10.00 ? 315 TRP A CD2  2  
ATOM 4277   N NE1  . TRP A 1 160 ? 5.293   -11.791 -13.060 1.00 10.00 ? 315 TRP A NE1  2  
ATOM 4278   C CE2  . TRP A 1 160 ? 6.245   -12.491 -12.368 1.00 10.00 ? 315 TRP A CE2  2  
ATOM 4279   C CE3  . TRP A 1 160 ? 7.706   -14.379 -12.737 1.00 10.00 ? 315 TRP A CE3  2  
ATOM 4280   C CZ2  . TRP A 1 160 ? 6.730   -12.308 -11.077 1.00 10.00 ? 315 TRP A CZ2  2  
ATOM 4281   C CZ3  . TRP A 1 160 ? 8.184   -14.197 -11.455 1.00 10.00 ? 315 TRP A CZ3  2  
ATOM 4282   C CH2  . TRP A 1 160 ? 7.698   -13.171 -10.641 1.00 10.00 ? 315 TRP A CH2  2  
ATOM 4283   H H    . TRP A 1 160 ? 6.711   -11.502 -16.308 1.00 10.00 ? 315 TRP A H    2  
ATOM 4284   H HE1  . TRP A 1 160 ? 4.793   -11.017 -12.721 1.00 10.00 ? 315 TRP A HE1  2  
ATOM 4285   N N    . GLY A 1 161 ? 4.435   -14.205 -18.099 1.00 10.00 ? 316 GLY A N    2  
ATOM 4286   C CA   . GLY A 1 161 ? 3.154   -14.018 -18.751 1.00 10.00 ? 316 GLY A CA   2  
ATOM 4287   C C    . GLY A 1 161 ? 2.055   -14.742 -18.004 1.00 10.00 ? 316 GLY A C    2  
ATOM 4288   O O    . GLY A 1 161 ? 0.907   -14.791 -18.449 1.00 10.00 ? 316 GLY A O    2  
ATOM 4289   H H    . GLY A 1 161 ? 4.803   -15.111 -18.005 1.00 10.00 ? 316 GLY A H    2  
ATOM 4290   N N    . SER A 1 162 ? 2.421   -15.319 -16.871 1.00 10.00 ? 317 SER A N    2  
ATOM 4291   C CA   . SER A 1 162 ? 1.491   -16.053 -16.034 1.00 10.00 ? 317 SER A CA   2  
ATOM 4292   C C    . SER A 1 162 ? 0.892   -15.145 -14.960 1.00 10.00 ? 317 SER A C    2  
ATOM 4293   O O    . SER A 1 162 ? 1.293   -13.985 -14.819 1.00 10.00 ? 317 SER A O    2  
ATOM 4294   C CB   . SER A 1 162 ? 2.230   -17.222 -15.384 1.00 10.00 ? 317 SER A CB   2  
ATOM 4295   O OG   . SER A 1 162 ? 3.633   -17.093 -15.571 1.00 10.00 ? 317 SER A OG   2  
ATOM 4296   H H    . SER A 1 162 ? 3.355   -15.256 -16.584 1.00 10.00 ? 317 SER A H    2  
ATOM 4297   H HG   . SER A 1 162 ? 4.071   -17.882 -15.230 1.00 10.00 ? 317 SER A HG   2  
ATOM 4298   N N    . GLY A 1 163 ? -0.067  -15.670 -14.211 1.00 10.00 ? 318 GLY A N    2  
ATOM 4299   C CA   . GLY A 1 163 ? -0.692  -14.892 -13.164 1.00 10.00 ? 318 GLY A CA   2  
ATOM 4300   C C    . GLY A 1 163 ? -2.014  -14.315 -13.609 1.00 10.00 ? 318 GLY A C    2  
ATOM 4301   O O    . GLY A 1 163 ? -2.390  -13.234 -13.127 1.00 10.00 ? 318 GLY A O    2  
ATOM 4302   O OXT  . GLY A 1 163 ? -2.690  -14.948 -14.449 1.00 10.00 ? 318 GLY A OXT  2  
ATOM 4303   H H    . GLY A 1 163 ? -0.359  -16.588 -14.376 1.00 10.00 ? 318 GLY A H    2  
ATOM 4304   N N    . GLY B 2 1   ? -4.585  -15.488 -12.578 1.00 10.00 ? 319 GLY B N    2  
ATOM 4305   C CA   . GLY B 2 1   ? -5.151  -14.247 -12.002 1.00 10.00 ? 319 GLY B CA   2  
ATOM 4306   C C    . GLY B 2 1   ? -5.424  -14.403 -10.525 1.00 10.00 ? 319 GLY B C    2  
ATOM 4307   O O    . GLY B 2 1   ? -4.982  -15.380 -9.913  1.00 10.00 ? 319 GLY B O    2  
ATOM 4308   H H1   . GLY B 2 1   ? -3.896  -15.258 -13.325 1.00 10.00 ? 319 GLY B H1   2  
ATOM 4309   H H2   . GLY B 2 1   ? -5.343  -16.070 -12.985 1.00 10.00 ? 319 GLY B H2   2  
ATOM 4310   H H3   . GLY B 2 1   ? -4.109  -16.037 -11.836 1.00 10.00 ? 319 GLY B H3   2  
ATOM 4311   N N    . GLY B 2 2   ? -6.151  -13.452 -9.950  1.00 10.00 ? 320 GLY B N    2  
ATOM 4312   C CA   . GLY B 2 2   ? -6.465  -13.507 -8.534  1.00 10.00 ? 320 GLY B CA   2  
ATOM 4313   C C    . GLY B 2 2   ? -5.255  -13.229 -7.668  1.00 10.00 ? 320 GLY B C    2  
ATOM 4314   O O    . GLY B 2 2   ? -5.056  -12.108 -7.208  1.00 10.00 ? 320 GLY B O    2  
ATOM 4315   H H    . GLY B 2 2   ? -6.488  -12.708 -10.496 1.00 10.00 ? 320 GLY B H    2  
ATOM 4316   N N    . GLN B 2 3   ? -4.437  -14.249 -7.472  1.00 10.00 ? 321 GLN B N    2  
ATOM 4317   C CA   . GLN B 2 3   ? -3.239  -14.127 -6.661  1.00 10.00 ? 321 GLN B CA   2  
ATOM 4318   C C    . GLN B 2 3   ? -2.046  -13.797 -7.550  1.00 10.00 ? 321 GLN B C    2  
ATOM 4319   O O    . GLN B 2 3   ? -1.702  -14.567 -8.454  1.00 10.00 ? 321 GLN B O    2  
ATOM 4320   C CB   . GLN B 2 3   ? -2.984  -15.432 -5.905  1.00 10.00 ? 321 GLN B CB   2  
ATOM 4321   C CG   . GLN B 2 3   ? -1.725  -15.429 -5.051  1.00 10.00 ? 321 GLN B CG   2  
ATOM 4322   C CD   . GLN B 2 3   ? -1.209  -16.826 -4.753  1.00 10.00 ? 321 GLN B CD   2  
ATOM 4323   O OE1  . GLN B 2 3   ? -0.005  -17.037 -4.604  1.00 10.00 ? 321 GLN B OE1  2  
ATOM 4324   N NE2  . GLN B 2 3   ? -2.112  -17.791 -4.668  1.00 10.00 ? 321 GLN B NE2  2  
ATOM 4325   H H    . GLN B 2 3   ? -4.630  -15.106 -7.912  1.00 10.00 ? 321 GLN B H    2  
ATOM 4326   H HE21 . GLN B 2 3   ? -3.056  -17.558 -4.800  1.00 10.00 ? 321 GLN B HE21 2  
ATOM 4327   H HE22 . GLN B 2 3   ? -1.801  -18.700 -4.472  1.00 10.00 ? 321 GLN B HE22 2  
ATOM 4328   N N    . GLN B 2 4   ? -1.438  -12.643 -7.316  1.00 10.00 ? 322 GLN B N    2  
ATOM 4329   C CA   . GLN B 2 4   ? -0.284  -12.223 -8.098  1.00 10.00 ? 322 GLN B CA   2  
ATOM 4330   C C    . GLN B 2 4   ? 0.990   -12.926 -7.623  1.00 10.00 ? 322 GLN B C    2  
ATOM 4331   O O    . GLN B 2 4   ? 1.115   -13.273 -6.448  1.00 10.00 ? 322 GLN B O    2  
ATOM 4332   C CB   . GLN B 2 4   ? -0.129  -10.695 -8.079  1.00 10.00 ? 322 GLN B CB   2  
ATOM 4333   C CG   . GLN B 2 4   ? 0.222   -10.096 -6.725  1.00 10.00 ? 322 GLN B CG   2  
ATOM 4334   C CD   . GLN B 2 4   ? -0.163  -8.632  -6.622  1.00 10.00 ? 322 GLN B CD   2  
ATOM 4335   O OE1  . GLN B 2 4   ? 0.611   -7.740  -6.975  1.00 10.00 ? 322 GLN B OE1  2  
ATOM 4336   N NE2  . GLN B 2 4   ? -1.369  -8.376  -6.143  1.00 10.00 ? 322 GLN B NE2  2  
ATOM 4337   H H    . GLN B 2 4   ? -1.780  -12.054 -6.608  1.00 10.00 ? 322 GLN B H    2  
ATOM 4338   H HE21 . GLN B 2 4   ? -1.942  -9.145  -5.887  1.00 10.00 ? 322 GLN B HE21 2  
ATOM 4339   H HE22 . GLN B 2 4   ? -1.645  -7.445  -6.055  1.00 10.00 ? 322 GLN B HE22 2  
ATOM 4340   N N    . PRO B 2 5   ? 1.937   -13.177 -8.543  1.00 10.00 ? 323 PRO B N    2  
ATOM 4341   C CA   . PRO B 2 5   ? 3.206   -13.842 -8.223  1.00 10.00 ? 323 PRO B CA   2  
ATOM 4342   C C    . PRO B 2 5   ? 4.132   -12.954 -7.391  1.00 10.00 ? 323 PRO B C    2  
ATOM 4343   O O    . PRO B 2 5   ? 3.792   -11.815 -7.067  1.00 10.00 ? 323 PRO B O    2  
ATOM 4344   C CB   . PRO B 2 5   ? 3.832   -14.126 -9.599  1.00 10.00 ? 323 PRO B CB   2  
ATOM 4345   C CG   . PRO B 2 5   ? 2.748   -13.870 -10.594 1.00 10.00 ? 323 PRO B CG   2  
ATOM 4346   C CD   . PRO B 2 5   ? 1.846   -12.848 -9.970  1.00 10.00 ? 323 PRO B CD   2  
ATOM 4347   N N    . VAL B 2 6   ? 5.305   -13.489 -7.049  1.00 10.00 ? 324 VAL B N    2  
ATOM 4348   C CA   . VAL B 2 6   ? 6.287   -12.763 -6.248  1.00 10.00 ? 324 VAL B CA   2  
ATOM 4349   C C    . VAL B 2 6   ? 6.637   -11.410 -6.860  1.00 10.00 ? 324 VAL B C    2  
ATOM 4350   O O    . VAL B 2 6   ? 7.139   -11.321 -7.984  1.00 10.00 ? 324 VAL B O    2  
ATOM 4351   C CB   . VAL B 2 6   ? 7.570   -13.583 -5.991  1.00 10.00 ? 324 VAL B CB   2  
ATOM 4352   C CG1  . VAL B 2 6   ? 7.315   -14.645 -4.933  1.00 10.00 ? 324 VAL B CG1  2  
ATOM 4353   C CG2  . VAL B 2 6   ? 8.077   -14.224 -7.273  1.00 10.00 ? 324 VAL B CG2  2  
ATOM 4354   H H    . VAL B 2 6   ? 5.514   -14.397 -7.345  1.00 10.00 ? 324 VAL B H    2  
ATOM 4355   N N    . ASN B 2 7   ? 6.359   -10.361 -6.110  1.00 10.00 ? 325 ASN B N    2  
ATOM 4356   C CA   . ASN B 2 7   ? 6.615   -9.002  -6.553  1.00 10.00 ? 325 ASN B CA   2  
ATOM 4357   C C    . ASN B 2 7   ? 8.085   -8.643  -6.370  1.00 10.00 ? 325 ASN B C    2  
ATOM 4358   O O    . ASN B 2 7   ? 8.783   -9.254  -5.560  1.00 10.00 ? 325 ASN B O    2  
ATOM 4359   C CB   . ASN B 2 7   ? 5.728   -8.038  -5.763  1.00 10.00 ? 325 ASN B CB   2  
ATOM 4360   C CG   . ASN B 2 7   ? 5.637   -6.664  -6.388  1.00 10.00 ? 325 ASN B CG   2  
ATOM 4361   O OD1  . ASN B 2 7   ? 5.740   -6.509  -7.606  1.00 10.00 ? 325 ASN B OD1  2  
ATOM 4362   N ND2  . ASN B 2 7   ? 5.441   -5.656  -5.558  1.00 10.00 ? 325 ASN B ND2  2  
ATOM 4363   H H    . ASN B 2 7   ? 5.971   -10.503 -5.222  1.00 10.00 ? 325 ASN B H    2  
ATOM 4364   H HD21 . ASN B 2 7   ? 5.365   -5.853  -4.597  1.00 10.00 ? 325 ASN B HD21 2  
ATOM 4365   H HD22 . ASN B 2 7   ? 5.387   -4.752  -5.935  1.00 10.00 ? 325 ASN B HD22 2  
ATOM 4366   N N    . HIS B 2 8   ? 8.553   -7.660  -7.132  1.00 10.00 ? 326 HIS B N    2  
ATOM 4367   C CA   . HIS B 2 8   ? 9.949   -7.225  -7.052  1.00 10.00 ? 326 HIS B CA   2  
ATOM 4368   C C    . HIS B 2 8   ? 10.142  -5.800  -7.562  1.00 10.00 ? 326 HIS B C    2  
ATOM 4369   O O    . HIS B 2 8   ? 10.030  -5.546  -8.764  1.00 10.00 ? 326 HIS B O    2  
ATOM 4370   C CB   . HIS B 2 8   ? 10.907  -8.191  -7.771  1.00 10.00 ? 326 HIS B CB   2  
ATOM 4371   C CG   . HIS B 2 8   ? 10.377  -8.822  -9.030  1.00 10.00 ? 326 HIS B CG   2  
ATOM 4372   N ND1  . HIS B 2 8   ? 9.950   -8.101  -10.127 1.00 10.00 ? 326 HIS B ND1  2  
ATOM 4373   C CD2  . HIS B 2 8   ? 10.230  -10.126 -9.362  1.00 10.00 ? 326 HIS B CD2  2  
ATOM 4374   C CE1  . HIS B 2 8   ? 9.565   -8.938  -11.075 1.00 10.00 ? 326 HIS B CE1  2  
ATOM 4375   N NE2  . HIS B 2 8   ? 9.727   -10.172 -10.637 1.00 10.00 ? 326 HIS B NE2  2  
ATOM 4376   H H    . HIS B 2 8   ? 7.942   -7.204  -7.754  1.00 10.00 ? 326 HIS B H    2  
ATOM 4377   H HD1  . HIS B 2 8   ? 9.925   -7.119  -10.200 1.00 10.00 ? 326 HIS B HD1  2  
ATOM 4378   H HE2  . HIS B 2 8   ? 9.707   -10.976 -11.202 1.00 10.00 ? 326 HIS B HE2  2  
ATOM 4379   N N    . LEU B 2 9   ? 10.420  -4.888  -6.627  1.00 10.00 ? 327 LEU B N    2  
ATOM 4380   C CA   . LEU B 2 9   ? 10.658  -3.467  -6.910  1.00 10.00 ? 327 LEU B CA   2  
ATOM 4381   C C    . LEU B 2 9   ? 9.408   -2.715  -7.360  1.00 10.00 ? 327 LEU B C    2  
ATOM 4382   O O    . LEU B 2 9   ? 9.039   -1.696  -6.767  1.00 10.00 ? 327 LEU B O    2  
ATOM 4383   C CB   . LEU B 2 9   ? 11.813  -3.258  -7.894  1.00 10.00 ? 327 LEU B CB   2  
ATOM 4384   C CG   . LEU B 2 9   ? 13.172  -3.829  -7.481  1.00 10.00 ? 327 LEU B CG   2  
ATOM 4385   C CD1  . LEU B 2 9   ? 14.249  -3.407  -8.470  1.00 10.00 ? 327 LEU B CD1  2  
ATOM 4386   C CD2  . LEU B 2 9   ? 13.534  -3.395  -6.067  1.00 10.00 ? 327 LEU B CD2  2  
ATOM 4387   H H    . LEU B 2 9   ? 10.456  -5.183  -5.686  1.00 10.00 ? 327 LEU B H    2  
ATOM 4388   N N    . VAL B 2 10  ? 8.774   -3.209  -8.415  1.00 10.00 ? 328 VAL B N    2  
ATOM 4389   C CA   . VAL B 2 10  ? 7.574   -2.596  -8.962  1.00 10.00 ? 328 VAL B CA   2  
ATOM 4390   C C    . VAL B 2 10  ? 6.470   -2.538  -7.909  1.00 10.00 ? 328 VAL B C    2  
ATOM 4391   O O    . VAL B 2 10  ? 6.235   -3.509  -7.193  1.00 10.00 ? 328 VAL B O    2  
ATOM 4392   C CB   . VAL B 2 10  ? 7.064   -3.368  -10.202 1.00 10.00 ? 328 VAL B CB   2  
ATOM 4393   C CG1  . VAL B 2 10  ? 5.969   -2.589  -10.916 1.00 10.00 ? 328 VAL B CG1  2  
ATOM 4394   C CG2  . VAL B 2 10  ? 8.212   -3.673  -11.154 1.00 10.00 ? 328 VAL B CG2  2  
ATOM 4395   H H    . VAL B 2 10  ? 9.129   -4.022  -8.838  1.00 10.00 ? 328 VAL B H    2  
ATOM 4396   N N    . LYS B 2 11  ? 5.833   -1.371  -7.795  1.00 10.00 ? 329 LYS B N    2  
ATOM 4397   C CA   . LYS B 2 11  ? 4.741   -1.143  -6.840  1.00 10.00 ? 329 LYS B CA   2  
ATOM 4398   C C    . LYS B 2 11  ? 5.239   -0.944  -5.405  1.00 10.00 ? 329 LYS B C    2  
ATOM 4399   O O    . LYS B 2 11  ? 4.695   -0.125  -4.672  1.00 10.00 ? 329 LYS B O    2  
ATOM 4400   C CB   . LYS B 2 11  ? 3.669   -2.242  -6.903  1.00 10.00 ? 329 LYS B CB   2  
ATOM 4401   C CG   . LYS B 2 11  ? 2.952   -2.353  -8.241  1.00 10.00 ? 329 LYS B CG   2  
ATOM 4402   C CD   . LYS B 2 11  ? 1.907   -1.261  -8.411  1.00 10.00 ? 329 LYS B CD   2  
ATOM 4403   C CE   . LYS B 2 11  ? 0.498   -1.838  -8.432  1.00 10.00 ? 329 LYS B CE   2  
ATOM 4404   N NZ   . LYS B 2 11  ? 0.213   -2.588  -9.686  1.00 10.00 ? 329 LYS B NZ   2  
ATOM 4405   H H    . LYS B 2 11  ? 6.113   -0.631  -8.369  1.00 10.00 ? 329 LYS B H    2  
ATOM 4406   H HZ1  . LYS B 2 11  ? 0.345   -3.608  -9.530  1.00 10.00 ? 329 LYS B HZ1  2  
ATOM 4407   H HZ2  . LYS B 2 11  ? 0.852   -2.279  -10.449 1.00 10.00 ? 329 LYS B HZ2  2  
ATOM 4408   H HZ3  . LYS B 2 11  ? -0.769  -2.421  -9.985  1.00 10.00 ? 329 LYS B HZ3  2  
ATOM 4409   N N    . GLU B 2 12  ? 6.275   -1.684  -5.018  1.00 10.00 ? 330 GLU B N    2  
ATOM 4410   C CA   . GLU B 2 12  ? 6.833   -1.594  -3.668  1.00 10.00 ? 330 GLU B CA   2  
ATOM 4411   C C    . GLU B 2 12  ? 7.334   -0.188  -3.355  1.00 10.00 ? 330 GLU B C    2  
ATOM 4412   O O    . GLU B 2 12  ? 6.907   0.434   -2.384  1.00 10.00 ? 330 GLU B O    2  
ATOM 4413   C CB   . GLU B 2 12  ? 7.959   -2.617  -3.478  1.00 10.00 ? 330 GLU B CB   2  
ATOM 4414   C CG   . GLU B 2 12  ? 7.532   -4.050  -3.747  1.00 10.00 ? 330 GLU B CG   2  
ATOM 4415   C CD   . GLU B 2 12  ? 8.630   -5.064  -3.505  1.00 10.00 ? 330 GLU B CD   2  
ATOM 4416   O OE1  . GLU B 2 12  ? 9.759   -4.856  -3.990  1.00 10.00 ? 330 GLU B OE1  2  
ATOM 4417   O OE2  . GLU B 2 12  ? 8.357   -6.091  -2.841  1.00 10.00 ? 330 GLU B OE2  2  
ATOM 4418   H H    . GLU B 2 12  ? 6.674   -2.315  -5.657  1.00 10.00 ? 330 GLU B H    2  
ATOM 4419   N N    . ILE B 2 13  ? 8.232   0.315   -4.189  1.00 10.00 ? 331 ILE B N    2  
ATOM 4420   C CA   . ILE B 2 13  ? 8.793   1.648   -3.991  1.00 10.00 ? 331 ILE B CA   2  
ATOM 4421   C C    . ILE B 2 13  ? 7.735   2.734   -4.196  1.00 10.00 ? 331 ILE B C    2  
ATOM 4422   O O    . ILE B 2 13  ? 7.724   3.748   -3.491  1.00 10.00 ? 331 ILE B O    2  
ATOM 4423   C CB   . ILE B 2 13  ? 10.006  1.896   -4.913  1.00 10.00 ? 331 ILE B CB   2  
ATOM 4424   C CG1  . ILE B 2 13  ? 11.031  0.769   -4.728  1.00 10.00 ? 331 ILE B CG1  2  
ATOM 4425   C CG2  . ILE B 2 13  ? 10.643  3.248   -4.615  1.00 10.00 ? 331 ILE B CG2  2  
ATOM 4426   C CD1  . ILE B 2 13  ? 12.275  0.911   -5.577  1.00 10.00 ? 331 ILE B CD1  2  
ATOM 4427   H H    . ILE B 2 13  ? 8.534   -0.226  -4.951  1.00 10.00 ? 331 ILE B H    2  
ATOM 4428   N N    . ASP B 2 14  ? 6.840   2.506   -5.147  1.00 10.00 ? 332 ASP B N    2  
ATOM 4429   C CA   . ASP B 2 14  ? 5.772   3.460   -5.441  1.00 10.00 ? 332 ASP B CA   2  
ATOM 4430   C C    . ASP B 2 14  ? 4.858   3.640   -4.236  1.00 10.00 ? 332 ASP B C    2  
ATOM 4431   O O    . ASP B 2 14  ? 4.621   4.764   -3.789  1.00 10.00 ? 332 ASP B O    2  
ATOM 4432   C CB   . ASP B 2 14  ? 4.952   3.008   -6.651  1.00 10.00 ? 332 ASP B CB   2  
ATOM 4433   C CG   . ASP B 2 14  ? 3.953   4.056   -7.100  1.00 10.00 ? 332 ASP B CG   2  
ATOM 4434   O OD1  . ASP B 2 14  ? 4.318   4.909   -7.935  1.00 10.00 ? 332 ASP B OD1  2  
ATOM 4435   O OD2  . ASP B 2 14  ? 2.796   4.038   -6.627  1.00 10.00 ? 332 ASP B OD2  2  
ATOM 4436   H H    . ASP B 2 14  ? 6.899   1.680   -5.666  1.00 10.00 ? 332 ASP B H    2  
ATOM 4437   N N    . MET B 2 15  ? 4.370   2.525   -3.703  1.00 10.00 ? 333 MET B N    2  
ATOM 4438   C CA   . MET B 2 15  ? 3.472   2.544   -2.552  1.00 10.00 ? 333 MET B CA   2  
ATOM 4439   C C    . MET B 2 15  ? 4.118   3.152   -1.317  1.00 10.00 ? 333 MET B C    2  
ATOM 4440   O O    . MET B 2 15  ? 3.426   3.634   -0.419  1.00 10.00 ? 333 MET B O    2  
ATOM 4441   C CB   . MET B 2 15  ? 2.943   1.141   -2.240  1.00 10.00 ? 333 MET B CB   2  
ATOM 4442   C CG   . MET B 2 15  ? 1.912   0.638   -3.235  1.00 10.00 ? 333 MET B CG   2  
ATOM 4443   S SD   . MET B 2 15  ? 0.971   -0.765  -2.605  1.00 10.00 ? 333 MET B SD   2  
ATOM 4444   C CE   . MET B 2 15  ? -0.180  -1.029  -3.953  1.00 10.00 ? 333 MET B CE   2  
ATOM 4445   H H    . MET B 2 15  ? 4.617   1.659   -4.099  1.00 10.00 ? 333 MET B H    2  
ATOM 4446   N N    . LEU B 2 16  ? 5.438   3.121   -1.272  1.00 10.00 ? 334 LEU B N    2  
ATOM 4447   C CA   . LEU B 2 16  ? 6.166   3.679   -0.151  1.00 10.00 ? 334 LEU B CA   2  
ATOM 4448   C C    . LEU B 2 16  ? 6.175   5.205   -0.203  1.00 10.00 ? 334 LEU B C    2  
ATOM 4449   O O    . LEU B 2 16  ? 5.951   5.865   0.803   1.00 10.00 ? 334 LEU B O    2  
ATOM 4450   C CB   . LEU B 2 16  ? 7.592   3.111   -0.117  1.00 10.00 ? 334 LEU B CB   2  
ATOM 4451   C CG   . LEU B 2 16  ? 7.901   2.134   1.022   1.00 10.00 ? 334 LEU B CG   2  
ATOM 4452   C CD1  . LEU B 2 16  ? 8.846   1.033   0.557   1.00 10.00 ? 334 LEU B CD1  2  
ATOM 4453   C CD2  . LEU B 2 16  ? 8.496   2.883   2.203   1.00 10.00 ? 334 LEU B CD2  2  
ATOM 4454   H H    . LEU B 2 16  ? 5.936   2.725   -2.020  1.00 10.00 ? 334 LEU B H    2  
ATOM 4455   N N    . LEU B 2 17  ? 6.496   5.757   -1.364  1.00 10.00 ? 335 LEU B N    2  
ATOM 4456   C CA   . LEU B 2 17  ? 6.540   7.205   -1.545  1.00 10.00 ? 335 LEU B CA   2  
ATOM 4457   C C    . LEU B 2 17  ? 5.199   7.905   -1.847  1.00 10.00 ? 335 LEU B C    2  
ATOM 4458   O O    . LEU B 2 17  ? 4.863   8.913   -1.222  1.00 10.00 ? 335 LEU B O    2  
ATOM 4459   C CB   . LEU B 2 17  ? 7.668   7.600   -2.487  1.00 10.00 ? 335 LEU B CB   2  
ATOM 4460   C CG   . LEU B 2 17  ? 9.051   7.149   -2.012  1.00 10.00 ? 335 LEU B CG   2  
ATOM 4461   C CD1  . LEU B 2 17  ? 10.118  7.414   -3.059  1.00 10.00 ? 335 LEU B CD1  2  
ATOM 4462   C CD2  . LEU B 2 17  ? 9.409   7.813   -0.689  1.00 10.00 ? 335 LEU B CD2  2  
ATOM 4463   H H    . LEU B 2 17  ? 6.699   5.174   -2.130  1.00 10.00 ? 335 LEU B H    2  
ATOM 4464   N N    . LYS B 2 18  ? 4.431   7.353   -2.788  1.00 10.00 ? 336 LYS B N    2  
ATOM 4465   C CA   . LYS B 2 18  ? 3.166   7.950   -3.229  1.00 10.00 ? 336 LYS B CA   2  
ATOM 4466   C C    . LYS B 2 18  ? 2.112   8.058   -2.134  1.00 10.00 ? 336 LYS B C    2  
ATOM 4467   O O    . LYS B 2 18  ? 1.348   9.028   -2.096  1.00 10.00 ? 336 LYS B O    2  
ATOM 4468   C CB   . LYS B 2 18  ? 2.611   7.201   -4.439  1.00 10.00 ? 336 LYS B CB   2  
ATOM 4469   C CG   . LYS B 2 18  ? 3.428   7.358   -5.711  1.00 10.00 ? 336 LYS B CG   2  
ATOM 4470   C CD   . LYS B 2 18  ? 2.656   8.134   -6.765  1.00 10.00 ? 336 LYS B CD   2  
ATOM 4471   C CE   . LYS B 2 18  ? 1.452   7.351   -7.267  1.00 10.00 ? 336 LYS B CE   2  
ATOM 4472   N NZ   . LYS B 2 18  ? 1.849   6.151   -8.052  1.00 10.00 ? 336 LYS B NZ   2  
ATOM 4473   H H    . LYS B 2 18  ? 4.713   6.504   -3.192  1.00 10.00 ? 336 LYS B H    2  
ATOM 4474   H HZ1  . LYS B 2 18  ? 2.236   5.408   -7.419  1.00 10.00 ? 336 LYS B HZ1  2  
ATOM 4475   H HZ2  . LYS B 2 18  ? 2.575   6.404   -8.751  1.00 10.00 ? 336 LYS B HZ2  2  
ATOM 4476   H HZ3  . LYS B 2 18  ? 1.026   5.767   -8.556  1.00 10.00 ? 336 LYS B HZ3  2  
ATOM 4477   N N    . GLU B 2 19  ? 2.054   7.065   -1.265  1.00 10.00 ? 337 GLU B N    2  
ATOM 4478   C CA   . GLU B 2 19  ? 1.088   7.078   -0.182  1.00 10.00 ? 337 GLU B CA   2  
ATOM 4479   C C    . GLU B 2 19  ? 1.383   8.228   0.770   1.00 10.00 ? 337 GLU B C    2  
ATOM 4480   O O    . GLU B 2 19  ? 0.473   8.858   1.302   1.00 10.00 ? 337 GLU B O    2  
ATOM 4481   C CB   . GLU B 2 19  ? 1.113   5.754   0.576   1.00 10.00 ? 337 GLU B CB   2  
ATOM 4482   C CG   . GLU B 2 19  ? 0.040   5.634   1.639   1.00 10.00 ? 337 GLU B CG   2  
ATOM 4483   C CD   . GLU B 2 19  ? 0.579   5.839   3.039   1.00 10.00 ? 337 GLU B CD   2  
ATOM 4484   O OE1  . GLU B 2 19  ? 1.034   4.846   3.638   1.00 10.00 ? 337 GLU B OE1  2  
ATOM 4485   O OE2  . GLU B 2 19  ? 0.533   6.982   3.539   1.00 10.00 ? 337 GLU B OE2  2  
ATOM 4486   H H    . GLU B 2 19  ? 2.668   6.307   -1.357  1.00 10.00 ? 337 GLU B H    2  
ATOM 4487   N N    . TYR B 2 20  ? 2.660   8.527   0.931   1.00 10.00 ? 338 TYR B N    2  
ATOM 4488   C CA   . TYR B 2 20  ? 3.083   9.599   1.818   1.00 10.00 ? 338 TYR B CA   2  
ATOM 4489   C C    . TYR B 2 20  ? 2.688   10.958  1.243   1.00 10.00 ? 338 TYR B C    2  
ATOM 4490   O O    . TYR B 2 20  ? 2.466   11.913  1.983   1.00 10.00 ? 338 TYR B O    2  
ATOM 4491   C CB   . TYR B 2 20  ? 4.579   9.531   2.147   1.00 10.00 ? 338 TYR B CB   2  
ATOM 4492   C CG   . TYR B 2 20  ? 4.939   10.313  3.394   1.00 10.00 ? 338 TYR B CG   2  
ATOM 4493   C CD1  . TYR B 2 20  ? 4.558   9.861   4.653   1.00 10.00 ? 338 TYR B CD1  2  
ATOM 4494   C CD2  . TYR B 2 20  ? 5.632   11.515  3.312   1.00 10.00 ? 338 TYR B CD2  2  
ATOM 4495   C CE1  . TYR B 2 20  ? 4.854   10.587  5.792   1.00 10.00 ? 338 TYR B CE1  2  
ATOM 4496   C CE2  . TYR B 2 20  ? 5.936   12.243  4.448   1.00 10.00 ? 338 TYR B CE2  2  
ATOM 4497   C CZ   . TYR B 2 20  ? 5.542   11.777  5.684   1.00 10.00 ? 338 TYR B CZ   2  
ATOM 4498   O OH   . TYR B 2 20  ? 5.824   12.510  6.814   1.00 10.00 ? 338 TYR B OH   2  
ATOM 4499   H H    . TYR B 2 20  ? 3.330   8.046   0.399   1.00 10.00 ? 338 TYR B H    2  
ATOM 4500   H HH   . TYR B 2 20  ? 5.677   13.445  6.633   1.00 10.00 ? 338 TYR B HH   2  
ATOM 4501   N N    . LEU B 2 21  ? 2.622   11.035  -0.079  1.00 10.00 ? 339 LEU B N    2  
ATOM 4502   C CA   . LEU B 2 21  ? 2.259   12.269  -0.759  1.00 10.00 ? 339 LEU B CA   2  
ATOM 4503   C C    . LEU B 2 21  ? 0.800   12.655  -0.508  1.00 10.00 ? 339 LEU B C    2  
ATOM 4504   O O    . LEU B 2 21  ? 0.509   13.778  -0.097  1.00 10.00 ? 339 LEU B O    2  
ATOM 4505   C CB   . LEU B 2 21  ? 2.520   12.141  -2.263  1.00 10.00 ? 339 LEU B CB   2  
ATOM 4506   C CG   . LEU B 2 21  ? 2.426   13.432  -3.077  1.00 10.00 ? 339 LEU B CG   2  
ATOM 4507   C CD1  . LEU B 2 21  ? 3.577   14.366  -2.733  1.00 10.00 ? 339 LEU B CD1  2  
ATOM 4508   C CD2  . LEU B 2 21  ? 2.403   13.127  -4.566  1.00 10.00 ? 339 LEU B CD2  2  
ATOM 4509   H H    . LEU B 2 21  ? 2.817   10.236  -0.611  1.00 10.00 ? 339 LEU B H    2  
ATOM 4510   N N    . LEU B 2 22  ? -0.116  11.727  -0.759  1.00 10.00 ? 340 LEU B N    2  
ATOM 4511   C CA   . LEU B 2 22  ? -1.543  11.997  -0.571  1.00 10.00 ? 340 LEU B CA   2  
ATOM 4512   C C    . LEU B 2 22  ? -2.011  11.765  0.864   1.00 10.00 ? 340 LEU B C    2  
ATOM 4513   O O    . LEU B 2 22  ? -2.637  12.641  1.461   1.00 10.00 ? 340 LEU B O    2  
ATOM 4514   C CB   . LEU B 2 22  ? -2.391  11.194  -1.557  1.00 10.00 ? 340 LEU B CB   2  
ATOM 4515   C CG   . LEU B 2 22  ? -2.409  11.713  -2.997  1.00 10.00 ? 340 LEU B CG   2  
ATOM 4516   C CD1  . LEU B 2 22  ? -3.043  10.693  -3.928  1.00 10.00 ? 340 LEU B CD1  2  
ATOM 4517   C CD2  . LEU B 2 22  ? -3.144  13.040  -3.079  1.00 10.00 ? 340 LEU B CD2  2  
ATOM 4518   H H    . LEU B 2 22  ? 0.153   10.850  -1.107  1.00 10.00 ? 340 LEU B H    2  
ATOM 4519   N N    . SER B 2 23  ? -1.731  10.589  1.414   1.00 10.00 ? 341 SER B N    2  
ATOM 4520   C CA   . SER B 2 23  ? -2.147  10.277  2.774   1.00 10.00 ? 341 SER B CA   2  
ATOM 4521   C C    . SER B 2 23  ? -1.325  11.061  3.790   1.00 10.00 ? 341 SER B C    2  
ATOM 4522   O O    . SER B 2 23  ? -1.841  11.969  4.448   1.00 10.00 ? 341 SER B O    2  
ATOM 4523   C CB   . SER B 2 23  ? -2.071  8.776   3.043   1.00 10.00 ? 341 SER B CB   2  
ATOM 4524   O OG   . SER B 2 23  ? -2.160  8.048   1.830   1.00 10.00 ? 341 SER B OG   2  
ATOM 4525   H H    . SER B 2 23  ? -1.225  9.921   0.902   1.00 10.00 ? 341 SER B H    2  
ATOM 4526   H HG   . SER B 2 23  ? -1.283  7.718   1.603   1.00 10.00 ? 341 SER B HG   2  
ATOM 4527   N N    . GLY B 2 24  ? -0.048  10.717  3.930   1.00 10.00 ? 342 GLY B N    2  
ATOM 4528   C CA   . GLY B 2 24  ? 0.798   11.433  4.860   1.00 10.00 ? 342 GLY B CA   2  
ATOM 4529   C C    . GLY B 2 24  ? 1.002   10.688  6.165   1.00 10.00 ? 342 GLY B C    2  
ATOM 4530   O O    . GLY B 2 24  ? 1.116   11.305  7.223   1.00 10.00 ? 342 GLY B O    2  
ATOM 4531   H H    . GLY B 2 24  ? 0.331   9.959   3.432   1.00 10.00 ? 342 GLY B H    2  
ATOM 4532   N N    . ASP B 2 25  ? 1.049   9.366   6.101   1.00 10.00 ? 343 ASP B N    2  
ATOM 4533   C CA   . ASP B 2 25  ? 1.240   8.570   7.306   1.00 10.00 ? 343 ASP B CA   2  
ATOM 4534   C C    . ASP B 2 25  ? 2.656   8.017   7.410   1.00 10.00 ? 343 ASP B C    2  
ATOM 4535   O O    . ASP B 2 25  ? 3.084   7.202   6.592   1.00 10.00 ? 343 ASP B O    2  
ATOM 4536   C CB   . ASP B 2 25  ? 0.219   7.442   7.421   1.00 10.00 ? 343 ASP B CB   2  
ATOM 4537   C CG   . ASP B 2 25  ? 0.099   6.944   8.846   1.00 10.00 ? 343 ASP B CG   2  
ATOM 4538   O OD1  . ASP B 2 25  ? 0.974   6.172   9.292   1.00 10.00 ? 343 ASP B OD1  2  
ATOM 4539   O OD2  . ASP B 2 25  ? -0.864  7.344   9.535   1.00 10.00 ? 343 ASP B OD2  2  
ATOM 4540   H H    . ASP B 2 25  ? 0.958   8.913   5.233   1.00 10.00 ? 343 ASP B H    2  
ATOM 4541   N N    . ILE B 2 26  ? 3.378   8.485   8.417   1.00 10.00 ? 344 ILE B N    2  
ATOM 4542   C CA   . ILE B 2 26  ? 4.746   8.042   8.649   1.00 10.00 ? 344 ILE B CA   2  
ATOM 4543   C C    . ILE B 2 26  ? 4.767   6.558   9.010   1.00 10.00 ? 344 ILE B C    2  
ATOM 4544   O O    . ILE B 2 26  ? 5.450   5.763   8.366   1.00 10.00 ? 344 ILE B O    2  
ATOM 4545   C CB   . ILE B 2 26  ? 5.451   8.855   9.753   1.00 10.00 ? 344 ILE B CB   2  
ATOM 4546   C CG1  . ILE B 2 26  ? 5.317   10.356  9.479   1.00 10.00 ? 344 ILE B CG1  2  
ATOM 4547   C CG2  . ILE B 2 26  ? 6.920   8.464   9.837   1.00 10.00 ? 344 ILE B CG2  2  
ATOM 4548   C CD1  . ILE B 2 26  ? 5.780   11.234  10.621  1.00 10.00 ? 344 ILE B CD1  2  
ATOM 4549   H H    . ILE B 2 26  ? 2.964   9.155   9.003   1.00 10.00 ? 344 ILE B H    2  
ATOM 4550   N N    . SER B 2 27  ? 4.014   6.198   10.045  1.00 10.00 ? 345 SER B N    2  
ATOM 4551   C CA   . SER B 2 27  ? 3.924   4.816   10.512  1.00 10.00 ? 345 SER B CA   2  
ATOM 4552   C C    . SER B 2 27  ? 3.545   3.826   9.404   1.00 10.00 ? 345 SER B C    2  
ATOM 4553   O O    . SER B 2 27  ? 4.003   2.681   9.415   1.00 10.00 ? 345 SER B O    2  
ATOM 4554   C CB   . SER B 2 27  ? 2.953   4.722   11.683  1.00 10.00 ? 345 SER B CB   2  
ATOM 4555   O OG   . SER B 2 27  ? 2.040   5.806   11.668  1.00 10.00 ? 345 SER B OG   2  
ATOM 4556   H H    . SER B 2 27  ? 3.556   6.896   10.563  1.00 10.00 ? 345 SER B H    2  
ATOM 4557   H HG   . SER B 2 27  ? 1.671   5.904   10.767  1.00 10.00 ? 345 SER B HG   2  
ATOM 4558   N N    . GLU B 2 28  ? 2.727   4.265   8.455   1.00 10.00 ? 346 GLU B N    2  
ATOM 4559   C CA   . GLU B 2 28  ? 2.303   3.399   7.360   1.00 10.00 ? 346 GLU B CA   2  
ATOM 4560   C C    . GLU B 2 28  ? 3.437   3.212   6.361   1.00 10.00 ? 346 GLU B C    2  
ATOM 4561   O O    . GLU B 2 28  ? 3.742   2.089   5.953   1.00 10.00 ? 346 GLU B O    2  
ATOM 4562   C CB   . GLU B 2 28  ? 1.043   3.914   6.673   1.00 10.00 ? 346 GLU B CB   2  
ATOM 4563   C CG   . GLU B 2 28  ? -0.097  2.902   6.658   1.00 10.00 ? 346 GLU B CG   2  
ATOM 4564   C CD   . GLU B 2 28  ? 0.377   1.493   6.345   1.00 10.00 ? 346 GLU B CD   2  
ATOM 4565   O OE1  . GLU B 2 28  ? 0.440   1.134   5.154   1.00 10.00 ? 346 GLU B OE1  2  
ATOM 4566   O OE2  . GLU B 2 28  ? 0.694   0.737   7.282   1.00 10.00 ? 346 GLU B OE2  2  
ATOM 4567   H H    . GLU B 2 28  ? 2.458   5.211   8.478   1.00 10.00 ? 346 GLU B H    2  
ATOM 4568   N N    . ALA B 2 29  ? 4.067   4.317   5.979   1.00 10.00 ? 347 ALA B N    2  
ATOM 4569   C CA   . ALA B 2 29  ? 5.187   4.269   5.053   1.00 10.00 ? 347 ALA B CA   2  
ATOM 4570   C C    . ALA B 2 29  ? 6.325   3.468   5.679   1.00 10.00 ? 347 ALA B C    2  
ATOM 4571   O O    . ALA B 2 29  ? 6.964   2.644   5.022   1.00 10.00 ? 347 ALA B O    2  
ATOM 4572   C CB   . ALA B 2 29  ? 5.649   5.677   4.706   1.00 10.00 ? 347 ALA B CB   2  
ATOM 4573   H H    . ALA B 2 29  ? 3.757   5.188   6.316   1.00 10.00 ? 347 ALA B H    2  
ATOM 4574   N N    . GLU B 2 30  ? 6.542   3.696   6.973   1.00 10.00 ? 348 GLU B N    2  
ATOM 4575   C CA   . GLU B 2 30  ? 7.579   2.997   7.716   1.00 10.00 ? 348 GLU B CA   2  
ATOM 4576   C C    . GLU B 2 30  ? 7.252   1.514   7.779   1.00 10.00 ? 348 GLU B C    2  
ATOM 4577   O O    . GLU B 2 30  ? 8.137   0.663   7.683   1.00 10.00 ? 348 GLU B O    2  
ATOM 4578   C CB   . GLU B 2 30  ? 7.683   3.558   9.138   1.00 10.00 ? 348 GLU B CB   2  
ATOM 4579   C CG   . GLU B 2 30  ? 8.890   3.058   9.922   1.00 10.00 ? 348 GLU B CG   2  
ATOM 4580   C CD   . GLU B 2 30  ? 8.721   3.203   11.421  1.00 10.00 ? 348 GLU B CD   2  
ATOM 4581   O OE1  . GLU B 2 30  ? 8.781   4.341   11.927  1.00 10.00 ? 348 GLU B OE1  2  
ATOM 4582   O OE2  . GLU B 2 30  ? 8.524   2.178   12.105  1.00 10.00 ? 348 GLU B OE2  2  
ATOM 4583   H H    . GLU B 2 30  ? 5.986   4.363   7.438   1.00 10.00 ? 348 GLU B H    2  
ATOM 4584   N N    . HIS B 2 31  ? 5.969   1.206   7.919   1.00 10.00 ? 349 HIS B N    2  
ATOM 4585   C CA   . HIS B 2 31  ? 5.522   -0.177  7.997   1.00 10.00 ? 349 HIS B CA   2  
ATOM 4586   C C    . HIS B 2 31  ? 5.777   -0.911  6.689   1.00 10.00 ? 349 HIS B C    2  
ATOM 4587   O O    . HIS B 2 31  ? 6.091   -2.099  6.692   1.00 10.00 ? 349 HIS B O    2  
ATOM 4588   C CB   . HIS B 2 31  ? 4.042   -0.277  8.385   1.00 10.00 ? 349 HIS B CB   2  
ATOM 4589   C CG   . HIS B 2 31  ? 3.714   -1.537  9.126   1.00 10.00 ? 349 HIS B CG   2  
ATOM 4590   N ND1  . HIS B 2 31  ? 3.797   -2.794  8.559   1.00 10.00 ? 349 HIS B ND1  2  
ATOM 4591   C CD2  . HIS B 2 31  ? 3.334   -1.731  10.411  1.00 10.00 ? 349 HIS B CD2  2  
ATOM 4592   C CE1  . HIS B 2 31  ? 3.485   -3.705  9.465   1.00 10.00 ? 349 HIS B CE1  2  
ATOM 4593   N NE2  . HIS B 2 31  ? 3.200   -3.086  10.596  1.00 10.00 ? 349 HIS B NE2  2  
ATOM 4594   H H    . HIS B 2 31  ? 5.304   1.930   7.967   1.00 10.00 ? 349 HIS B H    2  
ATOM 4595   H HD1  . HIS B 2 31  ? 4.041   -2.988  7.623   1.00 10.00 ? 349 HIS B HD1  2  
ATOM 4596   H HE2  . HIS B 2 31  ? 2.987   -3.529  11.450  1.00 10.00 ? 349 HIS B HE2  2  
ATOM 4597   N N    . CYS B 2 32  ? 5.659   -0.196  5.577   1.00 10.00 ? 350 CYS B N    2  
ATOM 4598   C CA   . CYS B 2 32  ? 5.876   -0.789  4.264   1.00 10.00 ? 350 CYS B CA   2  
ATOM 4599   C C    . CYS B 2 32  ? 7.365   -1.006  4.003   1.00 10.00 ? 350 CYS B C    2  
ATOM 4600   O O    . CYS B 2 32  ? 7.769   -2.005  3.409   1.00 10.00 ? 350 CYS B O    2  
ATOM 4601   C CB   . CYS B 2 32  ? 5.271   0.090   3.161   1.00 10.00 ? 350 CYS B CB   2  
ATOM 4602   S SG   . CYS B 2 32  ? 3.520   0.486   3.391   1.00 10.00 ? 350 CYS B SG   2  
ATOM 4603   H H    . CYS B 2 32  ? 5.431   0.758   5.642   1.00 10.00 ? 350 CYS B H    2  
ATOM 4604   H HG   . CYS B 2 32  ? 3.435   1.477   4.274   1.00 10.00 ? 350 CYS B HG   2  
ATOM 4605   N N    . LEU B 2 33  ? 8.182   -0.060  4.471   1.00 10.00 ? 351 LEU B N    2  
ATOM 4606   C CA   . LEU B 2 33  ? 9.629   -0.129  4.286   1.00 10.00 ? 351 LEU B CA   2  
ATOM 4607   C C    . LEU B 2 33  ? 10.252  -1.345  4.965   1.00 10.00 ? 351 LEU B C    2  
ATOM 4608   O O    . LEU B 2 33  ? 11.154  -1.969  4.412   1.00 10.00 ? 351 LEU B O    2  
ATOM 4609   C CB   . LEU B 2 33  ? 10.303  1.152   4.773   1.00 10.00 ? 351 LEU B CB   2  
ATOM 4610   C CG   . LEU B 2 33  ? 11.819  1.229   4.569   1.00 10.00 ? 351 LEU B CG   2  
ATOM 4611   C CD1  . LEU B 2 33  ? 12.176  1.031   3.103   1.00 10.00 ? 351 LEU B CD1  2  
ATOM 4612   C CD2  . LEU B 2 33  ? 12.360  2.556   5.076   1.00 10.00 ? 351 LEU B CD2  2  
ATOM 4613   H H    . LEU B 2 33  ? 7.798   0.711   4.939   1.00 10.00 ? 351 LEU B H    2  
ATOM 4614   N N    . LYS B 2 34  ? 9.783   -1.668  6.167   1.00 10.00 ? 352 LYS B N    2  
ATOM 4615   C CA   . LYS B 2 34  ? 10.314  -2.815  6.907   1.00 10.00 ? 352 LYS B CA   2  
ATOM 4616   C C    . LYS B 2 34  ? 10.126  -4.099  6.111   1.00 10.00 ? 352 LYS B C    2  
ATOM 4617   O O    . LYS B 2 34  ? 11.071  -4.854  5.901   1.00 10.00 ? 352 LYS B O    2  
ATOM 4618   C CB   . LYS B 2 34  ? 9.590   -2.978  8.241   1.00 10.00 ? 352 LYS B CB   2  
ATOM 4619   C CG   . LYS B 2 34  ? 9.654   -1.773  9.153   1.00 10.00 ? 352 LYS B CG   2  
ATOM 4620   C CD   . LYS B 2 34  ? 8.999   -2.081  10.486  1.00 10.00 ? 352 LYS B CD   2  
ATOM 4621   C CE   . LYS B 2 34  ? 8.744   -0.819  11.283  1.00 10.00 ? 352 LYS B CE   2  
ATOM 4622   N NZ   . LYS B 2 34  ? 9.995   -0.060  11.526  1.00 10.00 ? 352 LYS B NZ   2  
ATOM 4623   H H    . LYS B 2 34  ? 9.069   -1.125  6.563   1.00 10.00 ? 352 LYS B H    2  
ATOM 4624   H HZ1  . LYS B 2 34  ? 9.774   0.865   11.956  1.00 10.00 ? 352 LYS B HZ1  2  
ATOM 4625   H HZ2  . LYS B 2 34  ? 10.501  0.098   10.633  1.00 10.00 ? 352 LYS B HZ2  2  
ATOM 4626   H HZ3  . LYS B 2 34  ? 10.616  -0.587  12.171  1.00 10.00 ? 352 LYS B HZ3  2  
ATOM 4627   N N    . GLU B 2 35  ? 8.867   -4.341  5.728   1.00 10.00 ? 353 GLU B N    2  
ATOM 4628   C CA   . GLU B 2 35  ? 8.511   -5.536  4.942   1.00 10.00 ? 353 GLU B CA   2  
ATOM 4629   C C    . GLU B 2 35  ? 9.460   -5.779  3.759   1.00 10.00 ? 353 GLU B C    2  
ATOM 4630   O O    . GLU B 2 35  ? 9.599   -6.912  3.298   1.00 10.00 ? 353 GLU B O    2  
ATOM 4631   C CB   . GLU B 2 35  ? 7.054   -5.474  4.477   1.00 10.00 ? 353 GLU B CB   2  
ATOM 4632   C CG   . GLU B 2 35  ? 6.079   -5.058  5.573   1.00 10.00 ? 353 GLU B CG   2  
ATOM 4633   C CD   . GLU B 2 35  ? 4.623   -5.223  5.181   1.00 10.00 ? 353 GLU B CD   2  
ATOM 4634   O OE1  . GLU B 2 35  ? 4.165   -6.381  5.077   1.00 10.00 ? 353 GLU B OE1  2  
ATOM 4635   O OE2  . GLU B 2 35  ? 3.924   -4.201  5.008   1.00 10.00 ? 353 GLU B OE2  2  
ATOM 4636   H H    . GLU B 2 35  ? 8.177   -3.857  6.217   1.00 10.00 ? 353 GLU B H    2  
ATOM 4637   N N    . LEU B 2 36  ? 10.111  -4.728  3.270   1.00 10.00 ? 354 LEU B N    2  
ATOM 4638   C CA   . LEU B 2 36  ? 11.094  -4.886  2.207   1.00 10.00 ? 354 LEU B CA   2  
ATOM 4639   C C    . LEU B 2 36  ? 12.427  -5.377  2.791   1.00 10.00 ? 354 LEU B C    2  
ATOM 4640   O O    . LEU B 2 36  ? 13.095  -4.674  3.550   1.00 10.00 ? 354 LEU B O    2  
ATOM 4641   C CB   . LEU B 2 36  ? 11.264  -3.598  1.405   1.00 10.00 ? 354 LEU B CB   2  
ATOM 4642   C CG   . LEU B 2 36  ? 10.586  -3.591  0.033   1.00 10.00 ? 354 LEU B CG   2  
ATOM 4643   C CD1  . LEU B 2 36  ? 9.073   -3.603  0.171   1.00 10.00 ? 354 LEU B CD1  2  
ATOM 4644   C CD2  . LEU B 2 36  ? 11.053  -2.402  -0.793  1.00 10.00 ? 354 LEU B CD2  2  
ATOM 4645   H H    . LEU B 2 36  ? 9.903   -3.833  3.614   1.00 10.00 ? 354 LEU B H    2  
ATOM 4646   N N    . GLU B 2 37  ? 12.789  -6.589  2.424   1.00 10.00 ? 355 GLU B N    2  
ATOM 4647   C CA   . GLU B 2 37  ? 13.998  -7.265  2.901   1.00 10.00 ? 355 GLU B CA   2  
ATOM 4648   C C    . GLU B 2 37  ? 15.307  -6.823  2.227   1.00 10.00 ? 355 GLU B C    2  
ATOM 4649   O O    . GLU B 2 37  ? 16.296  -7.557  2.218   1.00 10.00 ? 355 GLU B O    2  
ATOM 4650   C CB   . GLU B 2 37  ? 13.794  -8.781  2.914   1.00 10.00 ? 355 GLU B CB   2  
ATOM 4651   C CG   . GLU B 2 37  ? 12.881  -9.195  4.061   1.00 10.00 ? 355 GLU B CG   2  
ATOM 4652   C CD   . GLU B 2 37  ? 12.287  -10.572 3.922   1.00 10.00 ? 355 GLU B CD   2  
ATOM 4653   O OE1  . GLU B 2 37  ? 13.002  -11.558 4.193   1.00 10.00 ? 355 GLU B OE1  2  
ATOM 4654   O OE2  . GLU B 2 37  ? 11.091  -10.672 3.578   1.00 10.00 ? 355 GLU B OE2  2  
ATOM 4655   H H    . GLU B 2 37  ? 12.207  -7.071  1.812   1.00 10.00 ? 355 GLU B H    2  
ATOM 4656   N N    . VAL B 2 38  ? 15.297  -5.642  1.625   1.00 10.00 ? 356 VAL B N    2  
ATOM 4657   C CA   . VAL B 2 38  ? 16.462  -5.133  0.898   1.00 10.00 ? 356 VAL B CA   2  
ATOM 4658   C C    . VAL B 2 38  ? 17.036  -3.815  1.449   1.00 10.00 ? 356 VAL B C    2  
ATOM 4659   O O    . VAL B 2 38  ? 16.574  -2.727  1.093   1.00 10.00 ? 356 VAL B O    2  
ATOM 4660   C CB   . VAL B 2 38  ? 16.122  -4.953  -0.591  1.00 10.00 ? 356 VAL B CB   2  
ATOM 4661   C CG1  . VAL B 2 38  ? 16.314  -6.266  -1.331  1.00 10.00 ? 356 VAL B CG1  2  
ATOM 4662   C CG2  . VAL B 2 38  ? 14.682  -4.465  -0.750  1.00 10.00 ? 356 VAL B CG2  2  
ATOM 4663   H H    . VAL B 2 38  ? 14.503  -5.081  1.700   1.00 10.00 ? 356 VAL B H    2  
ATOM 4664   N N    . PRO B 2 39  ? 18.068  -3.887  2.313   1.00 10.00 ? 357 PRO B N    2  
ATOM 4665   C CA   . PRO B 2 39  ? 18.713  -2.695  2.879   1.00 10.00 ? 357 PRO B CA   2  
ATOM 4666   C C    . PRO B 2 39  ? 19.646  -2.015  1.873   1.00 10.00 ? 357 PRO B C    2  
ATOM 4667   O O    . PRO B 2 39  ? 19.739  -0.782  1.822   1.00 10.00 ? 357 PRO B O    2  
ATOM 4668   C CB   . PRO B 2 39  ? 19.537  -3.242  4.055   1.00 10.00 ? 357 PRO B CB   2  
ATOM 4669   C CG   . PRO B 2 39  ? 19.139  -4.676  4.200   1.00 10.00 ? 357 PRO B CG   2  
ATOM 4670   C CD   . PRO B 2 39  ? 18.654  -5.119  2.850   1.00 10.00 ? 357 PRO B CD   2  
ATOM 4671   N N    . HIS B 2 40  ? 20.310  -2.821  1.050   1.00 10.00 ? 358 HIS B N    2  
ATOM 4672   C CA   . HIS B 2 40  ? 21.256  -2.306  0.063   1.00 10.00 ? 358 HIS B CA   2  
ATOM 4673   C C    . HIS B 2 40  ? 20.561  -1.636  -1.121  1.00 10.00 ? 358 HIS B C    2  
ATOM 4674   O O    . HIS B 2 40  ? 21.204  -0.955  -1.923  1.00 10.00 ? 358 HIS B O    2  
ATOM 4675   C CB   . HIS B 2 40  ? 22.190  -3.419  -0.421  1.00 10.00 ? 358 HIS B CB   2  
ATOM 4676   C CG   . HIS B 2 40  ? 23.468  -2.918  -1.018  1.00 10.00 ? 358 HIS B CG   2  
ATOM 4677   N ND1  . HIS B 2 40  ? 24.492  -2.383  -0.267  1.00 10.00 ? 358 HIS B ND1  2  
ATOM 4678   C CD2  . HIS B 2 40  ? 23.885  -2.869  -2.304  1.00 10.00 ? 358 HIS B CD2  2  
ATOM 4679   C CE1  . HIS B 2 40  ? 25.479  -2.024  -1.066  1.00 10.00 ? 358 HIS B CE1  2  
ATOM 4680   N NE2  . HIS B 2 40  ? 25.134  -2.309  -2.305  1.00 10.00 ? 358 HIS B NE2  2  
ATOM 4681   H H    . HIS B 2 40  ? 20.166  -3.789  1.111   1.00 10.00 ? 358 HIS B H    2  
ATOM 4682   H HD1  . HIS B 2 40  ? 24.500  -2.282  0.713   1.00 10.00 ? 358 HIS B HD1  2  
ATOM 4683   H HE2  . HIS B 2 40  ? 25.669  -2.099  -3.104  1.00 10.00 ? 358 HIS B HE2  2  
ATOM 4684   N N    . PHE B 2 41  ? 19.252  -1.814  -1.227  1.00 10.00 ? 359 PHE B N    2  
ATOM 4685   C CA   . PHE B 2 41  ? 18.500  -1.219  -2.321  1.00 10.00 ? 359 PHE B CA   2  
ATOM 4686   C C    . PHE B 2 41  ? 17.754  0.030   -1.858  1.00 10.00 ? 359 PHE B C    2  
ATOM 4687   O O    . PHE B 2 41  ? 16.908  0.567   -2.573  1.00 10.00 ? 359 PHE B O    2  
ATOM 4688   C CB   . PHE B 2 41  ? 17.530  -2.233  -2.938  1.00 10.00 ? 359 PHE B CB   2  
ATOM 4689   C CG   . PHE B 2 41  ? 17.516  -2.212  -4.440  1.00 10.00 ? 359 PHE B CG   2  
ATOM 4690   C CD1  . PHE B 2 41  ? 16.666  -1.361  -5.129  1.00 10.00 ? 359 PHE B CD1  2  
ATOM 4691   C CD2  . PHE B 2 41  ? 18.356  -3.041  -5.164  1.00 10.00 ? 359 PHE B CD2  2  
ATOM 4692   C CE1  . PHE B 2 41  ? 16.655  -1.337  -6.509  1.00 10.00 ? 359 PHE B CE1  2  
ATOM 4693   C CE2  . PHE B 2 41  ? 18.350  -3.024  -6.545  1.00 10.00 ? 359 PHE B CE2  2  
ATOM 4694   C CZ   . PHE B 2 41  ? 17.498  -2.170  -7.219  1.00 10.00 ? 359 PHE B CZ   2  
ATOM 4695   H H    . PHE B 2 41  ? 18.783  -2.355  -0.556  1.00 10.00 ? 359 PHE B H    2  
ATOM 4696   N N    . HIS B 2 42  ? 18.104  0.513   -0.670  1.00 10.00 ? 360 HIS B N    2  
ATOM 4697   C CA   . HIS B 2 42  ? 17.459  1.696   -0.105  1.00 10.00 ? 360 HIS B CA   2  
ATOM 4698   C C    . HIS B 2 42  ? 17.864  2.980   -0.831  1.00 10.00 ? 360 HIS B C    2  
ATOM 4699   O O    . HIS B 2 42  ? 17.329  4.047   -0.551  1.00 10.00 ? 360 HIS B O    2  
ATOM 4700   C CB   . HIS B 2 42  ? 17.754  1.824   1.399   1.00 10.00 ? 360 HIS B CB   2  
ATOM 4701   C CG   . HIS B 2 42  ? 16.872  0.991   2.286   1.00 10.00 ? 360 HIS B CG   2  
ATOM 4702   N ND1  . HIS B 2 42  ? 17.057  0.888   3.653   1.00 10.00 ? 360 HIS B ND1  2  
ATOM 4703   C CD2  . HIS B 2 42  ? 15.796  0.220   1.999   1.00 10.00 ? 360 HIS B CD2  2  
ATOM 4704   C CE1  . HIS B 2 42  ? 16.134  0.091   4.161   1.00 10.00 ? 360 HIS B CE1  2  
ATOM 4705   N NE2  . HIS B 2 42  ? 15.358  -0.325  3.180   1.00 10.00 ? 360 HIS B NE2  2  
ATOM 4706   H H    . HIS B 2 42  ? 18.816  0.063   -0.162  1.00 10.00 ? 360 HIS B H    2  
ATOM 4707   H HD1  . HIS B 2 42  ? 17.761  1.331   4.174   1.00 10.00 ? 360 HIS B HD1  2  
ATOM 4708   H HE2  . HIS B 2 42  ? 14.659  -1.015  3.267   1.00 10.00 ? 360 HIS B HE2  2  
ATOM 4709   N N    . HIS B 2 43  ? 18.804  2.871   -1.766  1.00 10.00 ? 361 HIS B N    2  
ATOM 4710   C CA   . HIS B 2 43  ? 19.272  4.034   -2.515  1.00 10.00 ? 361 HIS B CA   2  
ATOM 4711   C C    . HIS B 2 43  ? 18.187  4.601   -3.439  1.00 10.00 ? 361 HIS B C    2  
ATOM 4712   O O    . HIS B 2 43  ? 18.164  5.797   -3.708  1.00 10.00 ? 361 HIS B O    2  
ATOM 4713   C CB   . HIS B 2 43  ? 20.594  3.754   -3.257  1.00 10.00 ? 361 HIS B CB   2  
ATOM 4714   C CG   . HIS B 2 43  ? 20.470  3.265   -4.676  1.00 10.00 ? 361 HIS B CG   2  
ATOM 4715   N ND1  . HIS B 2 43  ? 20.718  4.065   -5.771  1.00 10.00 ? 361 HIS B ND1  2  
ATOM 4716   C CD2  . HIS B 2 43  ? 20.155  2.042   -5.173  1.00 10.00 ? 361 HIS B CD2  2  
ATOM 4717   C CE1  . HIS B 2 43  ? 20.563  3.360   -6.875  1.00 10.00 ? 361 HIS B CE1  2  
ATOM 4718   N NE2  . HIS B 2 43  ? 20.223  2.130   -6.542  1.00 10.00 ? 361 HIS B NE2  2  
ATOM 4719   H H    . HIS B 2 43  ? 19.188  1.989   -1.956  1.00 10.00 ? 361 HIS B H    2  
ATOM 4720   H HD1  . HIS B 2 43  ? 20.966  5.013   -5.747  1.00 10.00 ? 361 HIS B HD1  2  
ATOM 4721   H HE2  . HIS B 2 43  ? 20.147  1.377   -7.169  1.00 10.00 ? 361 HIS B HE2  2  
ATOM 4722   N N    . GLU B 2 44  ? 17.295  3.733   -3.900  1.00 10.00 ? 362 GLU B N    2  
ATOM 4723   C CA   . GLU B 2 44  ? 16.222  4.147   -4.790  1.00 10.00 ? 362 GLU B CA   2  
ATOM 4724   C C    . GLU B 2 44  ? 15.144  4.916   -4.043  1.00 10.00 ? 362 GLU B C    2  
ATOM 4725   O O    . GLU B 2 44  ? 14.530  5.830   -4.591  1.00 10.00 ? 362 GLU B O    2  
ATOM 4726   C CB   . GLU B 2 44  ? 15.647  2.942   -5.519  1.00 10.00 ? 362 GLU B CB   2  
ATOM 4727   C CG   . GLU B 2 44  ? 16.577  2.397   -6.584  1.00 10.00 ? 362 GLU B CG   2  
ATOM 4728   C CD   . GLU B 2 44  ? 16.878  3.426   -7.656  1.00 10.00 ? 362 GLU B CD   2  
ATOM 4729   O OE1  . GLU B 2 44  ? 17.744  4.302   -7.431  1.00 10.00 ? 362 GLU B OE1  2  
ATOM 4730   O OE2  . GLU B 2 44  ? 16.260  3.354   -8.735  1.00 10.00 ? 362 GLU B OE2  2  
ATOM 4731   H H    . GLU B 2 44  ? 17.346  2.798   -3.623  1.00 10.00 ? 362 GLU B H    2  
ATOM 4732   N N    . LEU B 2 45  ? 14.932  4.543   -2.782  1.00 10.00 ? 363 LEU B N    2  
ATOM 4733   C CA   . LEU B 2 45  ? 13.948  5.215   -1.933  1.00 10.00 ? 363 LEU B CA   2  
ATOM 4734   C C    . LEU B 2 45  ? 14.354  6.675   -1.744  1.00 10.00 ? 363 LEU B C    2  
ATOM 4735   O O    . LEU B 2 45  ? 13.522  7.558   -1.557  1.00 10.00 ? 363 LEU B O    2  
ATOM 4736   C CB   . LEU B 2 45  ? 13.830  4.512   -0.577  1.00 10.00 ? 363 LEU B CB   2  
ATOM 4737   C CG   . LEU B 2 45  ? 12.539  4.790   0.198   1.00 10.00 ? 363 LEU B CG   2  
ATOM 4738   C CD1  . LEU B 2 45  ? 11.337  4.238   -0.554  1.00 10.00 ? 363 LEU B CD1  2  
ATOM 4739   C CD2  . LEU B 2 45  ? 12.606  4.215   1.603   1.00 10.00 ? 363 LEU B CD2  2  
ATOM 4740   H H    . LEU B 2 45  ? 15.453  3.800   -2.413  1.00 10.00 ? 363 LEU B H    2  
ATOM 4741   N N    . VAL B 2 46  ? 15.657  6.897   -1.834  1.00 10.00 ? 364 VAL B N    2  
ATOM 4742   C CA   . VAL B 2 46  ? 16.222  8.231   -1.687  1.00 10.00 ? 364 VAL B CA   2  
ATOM 4743   C C    . VAL B 2 46  ? 16.189  8.965   -3.030  1.00 10.00 ? 364 VAL B C    2  
ATOM 4744   O O    . VAL B 2 46  ? 15.753  10.106  -3.112  1.00 10.00 ? 364 VAL B O    2  
ATOM 4745   C CB   . VAL B 2 46  ? 17.659  8.226   -1.109  1.00 10.00 ? 364 VAL B CB   2  
ATOM 4746   C CG1  . VAL B 2 46  ? 18.075  9.642   -0.726  1.00 10.00 ? 364 VAL B CG1  2  
ATOM 4747   C CG2  . VAL B 2 46  ? 17.769  7.295   0.086   1.00 10.00 ? 364 VAL B CG2  2  
ATOM 4748   H H    . VAL B 2 46  ? 16.197  6.175   -2.192  1.00 10.00 ? 364 VAL B H    2  
ATOM 4749   N N    . TYR B 2 47  ? 16.633  8.263   -4.084  1.00 10.00 ? 365 TYR B N    2  
ATOM 4750   C CA   . TYR B 2 47  ? 16.702  8.819   -5.445  1.00 10.00 ? 365 TYR B CA   2  
ATOM 4751   C C    . TYR B 2 47  ? 15.341  9.308   -5.930  1.00 10.00 ? 365 TYR B C    2  
ATOM 4752   O O    . TYR B 2 47  ? 15.191  10.470  -6.306  1.00 10.00 ? 365 TYR B O    2  
ATOM 4753   C CB   . TYR B 2 47  ? 17.282  7.774   -6.417  1.00 10.00 ? 365 TYR B CB   2  
ATOM 4754   C CG   . TYR B 2 47  ? 17.109  8.102   -7.889  1.00 10.00 ? 365 TYR B CG   2  
ATOM 4755   C CD1  . TYR B 2 47  ? 17.896  9.066   -8.507  1.00 10.00 ? 365 TYR B CD1  2  
ATOM 4756   C CD2  . TYR B 2 47  ? 16.151  7.449   -8.662  1.00 10.00 ? 365 TYR B CD2  2  
ATOM 4757   C CE1  . TYR B 2 47  ? 17.736  9.369   -9.848  1.00 10.00 ? 365 TYR B CE1  2  
ATOM 4758   C CE2  . TYR B 2 47  ? 15.982  7.746   -10.002 1.00 10.00 ? 365 TYR B CE2  2  
ATOM 4759   C CZ   . TYR B 2 47  ? 16.777  8.707   -10.590 1.00 10.00 ? 365 TYR B CZ   2  
ATOM 4760   O OH   . TYR B 2 47  ? 16.603  9.017   -11.922 1.00 10.00 ? 365 TYR B OH   2  
ATOM 4761   H H    . TYR B 2 47  ? 16.912  7.332   -3.946  1.00 10.00 ? 365 TYR B H    2  
ATOM 4762   H HH   . TYR B 2 47  ? 17.469  9.179   -12.341 1.00 10.00 ? 365 TYR B HH   2  
ATOM 4763   N N    . GLU B 2 48  ? 14.361  8.416   -5.914  1.00 10.00 ? 366 GLU B N    2  
ATOM 4764   C CA   . GLU B 2 48  ? 13.016  8.742   -6.364  1.00 10.00 ? 366 GLU B CA   2  
ATOM 4765   C C    . GLU B 2 48  ? 12.459  9.952   -5.611  1.00 10.00 ? 366 GLU B C    2  
ATOM 4766   O O    . GLU B 2 48  ? 11.948  10.889  -6.222  1.00 10.00 ? 366 GLU B O    2  
ATOM 4767   C CB   . GLU B 2 48  ? 12.097  7.533   -6.174  1.00 10.00 ? 366 GLU B CB   2  
ATOM 4768   C CG   . GLU B 2 48  ? 11.141  7.277   -7.328  1.00 10.00 ? 366 GLU B CG   2  
ATOM 4769   C CD   . GLU B 2 48  ? 11.855  7.064   -8.646  1.00 10.00 ? 366 GLU B CD   2  
ATOM 4770   O OE1  . GLU B 2 48  ? 12.379  5.953   -8.872  1.00 10.00 ? 366 GLU B OE1  2  
ATOM 4771   O OE2  . GLU B 2 48  ? 11.883  8.005   -9.466  1.00 10.00 ? 366 GLU B OE2  2  
ATOM 4772   H H    . GLU B 2 48  ? 14.549  7.507   -5.590  1.00 10.00 ? 366 GLU B H    2  
ATOM 4773   N N    . ALA B 2 49  ? 12.561  9.913   -4.282  1.00 10.00 ? 367 ALA B N    2  
ATOM 4774   C CA   . ALA B 2 49  ? 12.069  11.006  -3.436  1.00 10.00 ? 367 ALA B CA   2  
ATOM 4775   C C    . ALA B 2 49  ? 12.610  12.390  -3.821  1.00 10.00 ? 367 ALA B C    2  
ATOM 4776   O O    . ALA B 2 49  ? 11.898  13.390  -3.705  1.00 10.00 ? 367 ALA B O    2  
ATOM 4777   C CB   . ALA B 2 49  ? 12.348  10.714  -1.963  1.00 10.00 ? 367 ALA B CB   2  
ATOM 4778   H H    . ALA B 2 49  ? 12.798  9.061   -3.861  1.00 10.00 ? 367 ALA B H    2  
ATOM 4779   N N    . ILE B 2 50  ? 13.840  12.460  -4.297  1.00 10.00 ? 368 ILE B N    2  
ATOM 4780   C CA   . ILE B 2 50  ? 14.411  13.746  -4.686  1.00 10.00 ? 368 ILE B CA   2  
ATOM 4781   C C    . ILE B 2 50  ? 13.873  14.172  -6.049  1.00 10.00 ? 368 ILE B C    2  
ATOM 4782   O O    . ILE B 2 50  ? 13.579  15.346  -6.286  1.00 10.00 ? 368 ILE B O    2  
ATOM 4783   C CB   . ILE B 2 50  ? 15.950  13.746  -4.686  1.00 10.00 ? 368 ILE B CB   2  
ATOM 4784   C CG1  . ILE B 2 50  ? 16.455  13.159  -3.366  1.00 10.00 ? 368 ILE B CG1  2  
ATOM 4785   C CG2  . ILE B 2 50  ? 16.474  15.164  -4.866  1.00 10.00 ? 368 ILE B CG2  2  
ATOM 4786   C CD1  . ILE B 2 50  ? 17.926  12.812  -3.368  1.00 10.00 ? 368 ILE B CD1  2  
ATOM 4787   H H    . ILE B 2 50  ? 14.316  11.628  -4.515  1.00 10.00 ? 368 ILE B H    2  
ATOM 4788   N N    . VAL B 2 51  ? 13.686  13.184  -6.905  1.00 10.00 ? 369 VAL B N    2  
ATOM 4789   C CA   . VAL B 2 51  ? 13.190  13.399  -8.256  1.00 10.00 ? 369 VAL B CA   2  
ATOM 4790   C C    . VAL B 2 51  ? 11.731  13.869  -8.233  1.00 10.00 ? 369 VAL B C    2  
ATOM 4791   O O    . VAL B 2 51  ? 11.201  14.321  -9.242  1.00 10.00 ? 369 VAL B O    2  
ATOM 4792   C CB   . VAL B 2 51  ? 13.426  12.188  -9.205  1.00 10.00 ? 369 VAL B CB   2  
ATOM 4793   C CG1  . VAL B 2 51  ? 13.226  12.585  -10.658 1.00 10.00 ? 369 VAL B CG1  2  
ATOM 4794   C CG2  . VAL B 2 51  ? 14.827  11.640  -9.019  1.00 10.00 ? 369 VAL B CG2  2  
ATOM 4795   H H    . VAL B 2 51  ? 13.807  12.259  -6.609  1.00 10.00 ? 369 VAL B H    2  
ATOM 4796   N N    . MET B 2 52  ? 11.058  13.753  -7.076  1.00 10.00 ? 370 MET B N    2  
ATOM 4797   C CA   . MET B 2 52  ? 9.662   14.150  -7.008  1.00 10.00 ? 370 MET B CA   2  
ATOM 4798   C C    . MET B 2 52  ? 9.582   15.639  -6.673  1.00 10.00 ? 370 MET B C    2  
ATOM 4799   O O    . MET B 2 52  ? 9.040   16.421  -7.444  1.00 10.00 ? 370 MET B O    2  
ATOM 4800   C CB   . MET B 2 52  ? 8.958   13.340  -5.916  1.00 10.00 ? 370 MET B CB   2  
ATOM 4801   C CG   . MET B 2 52  ? 8.862   11.868  -6.236  1.00 10.00 ? 370 MET B CG   2  
ATOM 4802   S SD   . MET B 2 52  ? 8.353   10.862  -4.836  1.00 10.00 ? 370 MET B SD   2  
ATOM 4803   C CE   . MET B 2 52  ? 8.055   9.325   -5.693  1.00 10.00 ? 370 MET B CE   2  
ATOM 4804   H H    . MET B 2 52  ? 11.510  13.736  -6.222  1.00 10.00 ? 370 MET B H    2  
ATOM 4805   N N    . VAL B 2 53  ? 10.138  16.009  -5.497  1.00 10.00 ? 371 VAL B N    2  
ATOM 4806   C CA   . VAL B 2 53  ? 10.177  17.425  -5.032  1.00 10.00 ? 371 VAL B CA   2  
ATOM 4807   C C    . VAL B 2 53  ? 10.692  18.400  -6.092  1.00 10.00 ? 371 VAL B C    2  
ATOM 4808   O O    . VAL B 2 53  ? 10.250  19.549  -6.170  1.00 10.00 ? 371 VAL B O    2  
ATOM 4809   C CB   . VAL B 2 53  ? 11.038  17.587  -3.752  1.00 10.00 ? 371 VAL B CB   2  
ATOM 4810   C CG1  . VAL B 2 53  ? 10.815  18.946  -3.109  1.00 10.00 ? 371 VAL B CG1  2  
ATOM 4811   C CG2  . VAL B 2 53  ? 10.734  16.474  -2.763  1.00 10.00 ? 371 VAL B CG2  2  
ATOM 4812   H H    . VAL B 2 53  ? 10.337  15.296  -4.858  1.00 10.00 ? 371 VAL B H    2  
ATOM 4813   N N    . LEU B 2 54  ? 11.600  17.926  -6.918  1.00 10.00 ? 372 LEU B N    2  
ATOM 4814   C CA   . LEU B 2 54  ? 12.192  18.743  -7.964  1.00 10.00 ? 372 LEU B CA   2  
ATOM 4815   C C    . LEU B 2 54  ? 11.168  19.072  -9.050  1.00 10.00 ? 372 LEU B C    2  
ATOM 4816   O O    . LEU B 2 54  ? 11.134  20.191  -9.561  1.00 10.00 ? 372 LEU B O    2  
ATOM 4817   C CB   . LEU B 2 54  ? 13.384  18.010  -8.590  1.00 10.00 ? 372 LEU B CB   2  
ATOM 4818   C CG   . LEU B 2 54  ? 14.670  17.980  -7.762  1.00 10.00 ? 372 LEU B CG   2  
ATOM 4819   C CD1  . LEU B 2 54  ? 15.778  17.263  -8.521  1.00 10.00 ? 372 LEU B CD1  2  
ATOM 4820   C CD2  . LEU B 2 54  ? 15.101  19.392  -7.387  1.00 10.00 ? 372 LEU B CD2  2  
ATOM 4821   H H    . LEU B 2 54  ? 11.830  16.981  -6.865  1.00 10.00 ? 372 LEU B H    2  
ATOM 4822   N N    . GLU B 2 55  ? 10.313  18.105  -9.361  1.00 10.00 ? 373 GLU B N    2  
ATOM 4823   C CA   . GLU B 2 55  ? 9.300   18.262  -10.407 1.00 10.00 ? 373 GLU B CA   2  
ATOM 4824   C C    . GLU B 2 55  ? 7.884   18.419  -9.840  1.00 10.00 ? 373 GLU B C    2  
ATOM 4825   O O    . GLU B 2 55  ? 6.898   18.329  -10.570 1.00 10.00 ? 373 GLU B O    2  
ATOM 4826   C CB   . GLU B 2 55  ? 9.385   17.095  -11.394 1.00 10.00 ? 373 GLU B CB   2  
ATOM 4827   C CG   . GLU B 2 55  ? 10.725  17.031  -12.118 1.00 10.00 ? 373 GLU B CG   2  
ATOM 4828   C CD   . GLU B 2 55  ? 10.842  15.859  -13.067 1.00 10.00 ? 373 GLU B CD   2  
ATOM 4829   O OE1  . GLU B 2 55  ? 9.917   15.655  -13.881 1.00 10.00 ? 373 GLU B OE1  2  
ATOM 4830   O OE2  . GLU B 2 55  ? 11.863  15.146  -13.017 1.00 10.00 ? 373 GLU B OE2  2  
ATOM 4831   H H    . GLU B 2 55  ? 10.360  17.255  -8.872  1.00 10.00 ? 373 GLU B H    2  
ATOM 4832   N N    . SER B 2 56  ? 7.798   18.643  -8.537  1.00 10.00 ? 374 SER B N    2  
ATOM 4833   C CA   . SER B 2 56  ? 6.519   18.788  -7.856  1.00 10.00 ? 374 SER B CA   2  
ATOM 4834   C C    . SER B 2 56  ? 5.859   20.149  -8.135  1.00 10.00 ? 374 SER B C    2  
ATOM 4835   O O    . SER B 2 56  ? 6.227   20.853  -9.075  1.00 10.00 ? 374 SER B O    2  
ATOM 4836   C CB   . SER B 2 56  ? 6.707   18.579  -6.349  1.00 10.00 ? 374 SER B CB   2  
ATOM 4837   O OG   . SER B 2 56  ? 5.478   18.277  -5.707  1.00 10.00 ? 374 SER B OG   2  
ATOM 4838   H H    . SER B 2 56  ? 8.624   18.719  -8.020  1.00 10.00 ? 374 SER B H    2  
ATOM 4839   H HG   . SER B 2 56  ? 5.345   17.322  -5.706  1.00 10.00 ? 374 SER B HG   2  
ATOM 4840   N N    . THR B 2 57  ? 4.881   20.506  -7.303  1.00 10.00 ? 375 THR B N    2  
ATOM 4841   C CA   . THR B 2 57  ? 4.145   21.759  -7.457  1.00 10.00 ? 375 THR B CA   2  
ATOM 4842   C C    . THR B 2 57  ? 3.698   22.296  -6.100  1.00 10.00 ? 375 THR B C    2  
ATOM 4843   O O    . THR B 2 57  ? 2.633   21.931  -5.602  1.00 10.00 ? 375 THR B O    2  
ATOM 4844   C CB   . THR B 2 57  ? 2.885   21.555  -8.325  1.00 10.00 ? 375 THR B CB   2  
ATOM 4845   O OG1  . THR B 2 57  ? 3.175   20.671  -9.411  1.00 10.00 ? 375 THR B OG1  2  
ATOM 4846   C CG2  . THR B 2 57  ? 2.386   22.881  -8.877  1.00 10.00 ? 375 THR B CG2  2  
ATOM 4847   H H    . THR B 2 57  ? 4.669   19.918  -6.543  1.00 10.00 ? 375 THR B H    2  
ATOM 4848   H HG1  . THR B 2 57  ? 4.127   20.561  -9.483  1.00 10.00 ? 375 THR B HG1  2  
ATOM 4849   N N    . GLY B 2 58  ? 4.525   23.139  -5.495  1.00 10.00 ? 376 GLY B N    2  
ATOM 4850   C CA   . GLY B 2 58  ? 4.175   23.718  -4.213  1.00 10.00 ? 376 GLY B CA   2  
ATOM 4851   C C    . GLY B 2 58  ? 5.116   23.305  -3.105  1.00 10.00 ? 376 GLY B C    2  
ATOM 4852   O O    . GLY B 2 58  ? 5.976   22.451  -3.305  1.00 10.00 ? 376 GLY B O    2  
ATOM 4853   H H    . GLY B 2 58  ? 5.401   23.325  -5.892  1.00 10.00 ? 376 GLY B H    2  
ATOM 4854   N N    . GLU B 2 59  ? 4.949   23.909  -1.934  1.00 10.00 ? 377 GLU B N    2  
ATOM 4855   C CA   . GLU B 2 59  ? 5.794   23.605  -0.787  1.00 10.00 ? 377 GLU B CA   2  
ATOM 4856   C C    . GLU B 2 59  ? 5.243   22.442  0.045   1.00 10.00 ? 377 GLU B C    2  
ATOM 4857   O O    . GLU B 2 59  ? 5.852   22.030  1.036   1.00 10.00 ? 377 GLU B O    2  
ATOM 4858   C CB   . GLU B 2 59  ? 5.991   24.850  0.086   1.00 10.00 ? 377 GLU B CB   2  
ATOM 4859   C CG   . GLU B 2 59  ? 4.720   25.346  0.752   1.00 10.00 ? 377 GLU B CG   2  
ATOM 4860   C CD   . GLU B 2 59  ? 4.779   26.812  1.112   1.00 10.00 ? 377 GLU B CD   2  
ATOM 4861   O OE1  . GLU B 2 59  ? 4.648   27.654  0.201   1.00 10.00 ? 377 GLU B OE1  2  
ATOM 4862   O OE2  . GLU B 2 59  ? 4.947   27.134  2.304   1.00 10.00 ? 377 GLU B OE2  2  
ATOM 4863   H H    . GLU B 2 59  ? 4.247   24.593  -1.844  1.00 10.00 ? 377 GLU B H    2  
ATOM 4864   N N    . SER B 2 60  ? 4.097   21.913  -0.369  1.00 10.00 ? 378 SER B N    2  
ATOM 4865   C CA   . SER B 2 60  ? 3.465   20.791  0.314   1.00 10.00 ? 378 SER B CA   2  
ATOM 4866   C C    . SER B 2 60  ? 4.402   19.593  0.329   1.00 10.00 ? 378 SER B C    2  
ATOM 4867   O O    . SER B 2 60  ? 4.696   19.016  1.389   1.00 10.00 ? 378 SER B O    2  
ATOM 4868   C CB   . SER B 2 60  ? 2.191   20.444  -0.461  1.00 10.00 ? 378 SER B CB   2  
ATOM 4869   O OG   . SER B 2 60  ? 2.252   21.029  -1.762  1.00 10.00 ? 378 SER B OG   2  
ATOM 4870   H H    . SER B 2 60  ? 3.661   22.272  -1.175  1.00 10.00 ? 378 SER B H    2  
ATOM 4871   H HG   . SER B 2 60  ? 1.355   21.193  -2.081  1.00 10.00 ? 378 SER B HG   2  
ATOM 4872   N N    . ALA B 2 61  ? 4.914   19.270  -0.849  1.00 10.00 ? 379 ALA B N    2  
ATOM 4873   C CA   . ALA B 2 61  ? 5.828   18.164  -1.067  1.00 10.00 ? 379 ALA B CA   2  
ATOM 4874   C C    . ALA B 2 61  ? 7.248   18.530  -0.627  1.00 10.00 ? 379 ALA B C    2  
ATOM 4875   O O    . ALA B 2 61  ? 8.093   17.657  -0.421  1.00 10.00 ? 379 ALA B O    2  
ATOM 4876   C CB   . ALA B 2 61  ? 5.791   17.750  -2.536  1.00 10.00 ? 379 ALA B CB   2  
ATOM 4877   H H    . ALA B 2 61  ? 4.729   19.855  -1.612  1.00 10.00 ? 379 ALA B H    2  
ATOM 4878   N N    . PHE B 2 62  ? 7.474   19.827  -0.380  1.00 10.00 ? 380 PHE B N    2  
ATOM 4879   C CA   . PHE B 2 62  ? 8.814   20.306  -0.059  1.00 10.00 ? 380 PHE B CA   2  
ATOM 4880   C C    . PHE B 2 62  ? 9.137   19.989  1.400   1.00 10.00 ? 380 PHE B C    2  
ATOM 4881   O O    . PHE B 2 62  ? 10.266  19.648  1.716   1.00 10.00 ? 380 PHE B O    2  
ATOM 4882   C CB   . PHE B 2 62  ? 8.855   21.847  -0.262  1.00 10.00 ? 380 PHE B CB   2  
ATOM 4883   C CG   . PHE B 2 62  ? 10.229  22.445  -0.450  1.00 10.00 ? 380 PHE B CG   2  
ATOM 4884   C CD1  . PHE B 2 62  ? 10.949  22.183  -1.602  1.00 10.00 ? 380 PHE B CD1  2  
ATOM 4885   C CD2  . PHE B 2 62  ? 10.813  23.242  0.530   1.00 10.00 ? 380 PHE B CD2  2  
ATOM 4886   C CE1  . PHE B 2 62  ? 12.215  22.693  -1.773  1.00 10.00 ? 380 PHE B CE1  2  
ATOM 4887   C CE2  . PHE B 2 62  ? 12.086  23.762  0.357   1.00 10.00 ? 380 PHE B CE2  2  
ATOM 4888   C CZ   . PHE B 2 62  ? 12.786  23.481  -0.797  1.00 10.00 ? 380 PHE B CZ   2  
ATOM 4889   H H    . PHE B 2 62  ? 6.762   20.355  -0.020  1.00 10.00 ? 380 PHE B H    2  
ATOM 4890   N N    . LYS B 2 63  ? 8.116   20.094  2.285   1.00 10.00 ? 381 LYS B N    2  
ATOM 4891   C CA   . LYS B 2 63  ? 8.282   19.842  3.732   1.00 10.00 ? 381 LYS B CA   2  
ATOM 4892   C C    . LYS B 2 63  ? 8.109   18.355  4.099   1.00 10.00 ? 381 LYS B C    2  
ATOM 4893   O O    . LYS B 2 63  ? 8.740   17.828  5.024   1.00 10.00 ? 381 LYS B O    2  
ATOM 4894   C CB   . LYS B 2 63  ? 7.333   20.720  4.560   1.00 10.00 ? 381 LYS B CB   2  
ATOM 4895   C CG   . LYS B 2 63  ? 5.878   20.635  4.145   1.00 10.00 ? 381 LYS B CG   2  
ATOM 4896   C CD   . LYS B 2 63  ? 4.951   20.670  5.347   1.00 10.00 ? 381 LYS B CD   2  
ATOM 4897   C CE   . LYS B 2 63  ? 3.496   20.554  4.927   1.00 10.00 ? 381 LYS B CE   2  
ATOM 4898   N NZ   . LYS B 2 63  ? 2.610   20.593  6.108   1.00 10.00 ? 381 LYS B NZ   2  
ATOM 4899   H H    . LYS B 2 63  ? 7.207   20.063  1.957   1.00 10.00 ? 381 LYS B H    2  
ATOM 4900   H HZ1  . LYS B 2 63  ? 2.786   21.460  6.647   1.00 10.00 ? 381 LYS B HZ1  2  
ATOM 4901   H HZ2  . LYS B 2 63  ? 2.802   19.777  6.723   1.00 10.00 ? 381 LYS B HZ2  2  
ATOM 4902   H HZ3  . LYS B 2 63  ? 1.613   20.570  5.819   1.00 10.00 ? 381 LYS B HZ3  2  
ATOM 4903   N N    . MET B 2 64  ? 7.268   17.681  3.309   1.00 10.00 ? 382 MET B N    2  
ATOM 4904   C CA   . MET B 2 64  ? 6.866   16.287  3.566   1.00 10.00 ? 382 MET B CA   2  
ATOM 4905   C C    . MET B 2 64  ? 7.867   15.268  3.057   1.00 10.00 ? 382 MET B C    2  
ATOM 4906   O O    . MET B 2 64  ? 8.177   14.292  3.740   1.00 10.00 ? 382 MET B O    2  
ATOM 4907   C CB   . MET B 2 64  ? 5.496   16.014  2.922   1.00 10.00 ? 382 MET B CB   2  
ATOM 4908   C CG   . MET B 2 64  ? 4.316   16.511  3.730   1.00 10.00 ? 382 MET B CG   2  
ATOM 4909   S SD   . MET B 2 64  ? 3.867   15.385  5.066   1.00 10.00 ? 382 MET B SD   2  
ATOM 4910   C CE   . MET B 2 64  ? 2.826   14.236  4.175   1.00 10.00 ? 382 MET B CE   2  
ATOM 4911   H H    . MET B 2 64  ? 7.104   18.056  2.428   1.00 10.00 ? 382 MET B H    2  
ATOM 4912   N N    . ILE B 2 65  ? 8.407   15.517  1.881   1.00 10.00 ? 383 ILE B N    2  
ATOM 4913   C CA   . ILE B 2 65  ? 9.356   14.595  1.269   1.00 10.00 ? 383 ILE B CA   2  
ATOM 4914   C C    . ILE B 2 65  ? 10.771  14.872  1.796   1.00 10.00 ? 383 ILE B C    2  
ATOM 4915   O O    . ILE B 2 65  ? 11.663  14.035  1.708   1.00 10.00 ? 383 ILE B O    2  
ATOM 4916   C CB   . ILE B 2 65  ? 9.246   14.529  -0.288  1.00 10.00 ? 383 ILE B CB   2  
ATOM 4917   C CG1  . ILE B 2 65  ? 7.766   14.545  -0.702  1.00 10.00 ? 383 ILE B CG1  2  
ATOM 4918   C CG2  . ILE B 2 65  ? 9.896   13.262  -0.824  1.00 10.00 ? 383 ILE B CG2  2  
ATOM 4919   C CD1  . ILE B 2 65  ? 6.960   13.353  -0.222  1.00 10.00 ? 383 ILE B CD1  2  
ATOM 4920   H H    . ILE B 2 65  ? 8.275   16.387  1.458   1.00 10.00 ? 383 ILE B H    2  
ATOM 4921   N N    . LEU B 2 66  ? 10.935  16.065  2.414   1.00 10.00 ? 384 LEU B N    2  
ATOM 4922   C CA   . LEU B 2 66  ? 12.222  16.497  2.944   1.00 10.00 ? 384 LEU B CA   2  
ATOM 4923   C C    . LEU B 2 66  ? 12.467  15.826  4.300   1.00 10.00 ? 384 LEU B C    2  
ATOM 4924   O O    . LEU B 2 66  ? 13.470  15.136  4.495   1.00 10.00 ? 384 LEU B O    2  
ATOM 4925   C CB   . LEU B 2 66  ? 12.225  18.021  3.132   1.00 10.00 ? 384 LEU B CB   2  
ATOM 4926   C CG   . LEU B 2 66  ? 13.469  18.635  3.788   1.00 10.00 ? 384 LEU B CG   2  
ATOM 4927   C CD1  . LEU B 2 66  ? 14.700  18.348  2.951   1.00 10.00 ? 384 LEU B CD1  2  
ATOM 4928   C CD2  . LEU B 2 66  ? 13.299  20.138  4.002   1.00 10.00 ? 384 LEU B CD2  2  
ATOM 4929   H H    . LEU B 2 66  ? 10.170  16.481  2.807   1.00 10.00 ? 384 LEU B H    2  
ATOM 4930   N N    . ASP B 2 67  ? 11.507  16.027  5.236   1.00 10.00 ? 385 ASP B N    2  
ATOM 4931   C CA   . ASP B 2 67  ? 11.574  15.470  6.614   1.00 10.00 ? 385 ASP B CA   2  
ATOM 4932   C C    . ASP B 2 67  ? 11.413  13.960  6.630   1.00 10.00 ? 385 ASP B C    2  
ATOM 4933   O O    . ASP B 2 67  ? 11.730  13.292  7.611   1.00 10.00 ? 385 ASP B O    2  
ATOM 4934   C CB   . ASP B 2 67  ? 10.549  16.125  7.554   1.00 10.00 ? 385 ASP B CB   2  
ATOM 4935   C CG   . ASP B 2 67  ? 11.002  16.128  9.018   1.00 10.00 ? 385 ASP B CG   2  
ATOM 4936   O OD1  . ASP B 2 67  ? 12.024  16.779  9.330   1.00 10.00 ? 385 ASP B OD1  2  
ATOM 4937   O OD2  . ASP B 2 67  ? 10.344  15.486  9.863   1.00 10.00 ? 385 ASP B OD2  2  
ATOM 4938   H H    . ASP B 2 67  ? 10.725  16.572  4.993   1.00 10.00 ? 385 ASP B H    2  
ATOM 4939   N N    . LEU B 2 68  ? 10.900  13.440  5.528   1.00 10.00 ? 386 LEU B N    2  
ATOM 4940   C CA   . LEU B 2 68  ? 10.671  12.017  5.385   1.00 10.00 ? 386 LEU B CA   2  
ATOM 4941   C C    . LEU B 2 68  ? 11.992  11.265  5.503   1.00 10.00 ? 386 LEU B C    2  
ATOM 4942   O O    . LEU B 2 68  ? 12.054  10.194  6.113   1.00 10.00 ? 386 LEU B O    2  
ATOM 4943   C CB   . LEU B 2 68  ? 10.021  11.719  4.035   1.00 10.00 ? 386 LEU B CB   2  
ATOM 4944   C CG   . LEU B 2 68  ? 9.762   10.246  3.711   1.00 10.00 ? 386 LEU B CG   2  
ATOM 4945   C CD1  . LEU B 2 68  ? 8.736   9.653   4.664   1.00 10.00 ? 386 LEU B CD1  2  
ATOM 4946   C CD2  . LEU B 2 68  ? 9.311   10.086  2.267   1.00 10.00 ? 386 LEU B CD2  2  
ATOM 4947   H H    . LEU B 2 68  ? 10.805  14.021  4.757   1.00 10.00 ? 386 LEU B H    2  
ATOM 4948   N N    . LEU B 2 69  ? 13.061  11.840  4.956   1.00 10.00 ? 387 LEU B N    2  
ATOM 4949   C CA   . LEU B 2 69  ? 14.373  11.207  5.019   1.00 10.00 ? 387 LEU B CA   2  
ATOM 4950   C C    . LEU B 2 69  ? 14.863  11.234  6.461   1.00 10.00 ? 387 LEU B C    2  
ATOM 4951   O O    . LEU B 2 69  ? 15.247  10.208  7.020   1.00 10.00 ? 387 LEU B O    2  
ATOM 4952   C CB   . LEU B 2 69  ? 15.358  11.933  4.101   1.00 10.00 ? 387 LEU B CB   2  
ATOM 4953   C CG   . LEU B 2 69  ? 14.893  12.140  2.655   1.00 10.00 ? 387 LEU B CG   2  
ATOM 4954   C CD1  . LEU B 2 69  ? 15.755  13.174  1.953   1.00 10.00 ? 387 LEU B CD1  2  
ATOM 4955   C CD2  . LEU B 2 69  ? 14.904  10.822  1.893   1.00 10.00 ? 387 LEU B CD2  2  
ATOM 4956   H H    . LEU B 2 69  ? 13.002  12.733  4.546   1.00 10.00 ? 387 LEU B H    2  
ATOM 4957   N N    . LYS B 2 70  ? 14.847  12.431  7.043   1.00 10.00 ? 388 LYS B N    2  
ATOM 4958   C CA   . LYS B 2 70  ? 15.242  12.632  8.437   1.00 10.00 ? 388 LYS B CA   2  
ATOM 4959   C C    . LYS B 2 70  ? 14.434  11.754  9.397   1.00 10.00 ? 388 LYS B C    2  
ATOM 4960   O O    . LYS B 2 70  ? 14.922  11.349  10.446  1.00 10.00 ? 388 LYS B O    2  
ATOM 4961   C CB   . LYS B 2 70  ? 15.130  14.111  8.820   1.00 10.00 ? 388 LYS B CB   2  
ATOM 4962   C CG   . LYS B 2 70  ? 16.221  14.976  8.213   1.00 10.00 ? 388 LYS B CG   2  
ATOM 4963   C CD   . LYS B 2 70  ? 16.250  16.363  8.834   1.00 10.00 ? 388 LYS B CD   2  
ATOM 4964   C CE   . LYS B 2 70  ? 15.056  17.196  8.394   1.00 10.00 ? 388 LYS B CE   2  
ATOM 4965   N NZ   . LYS B 2 70  ? 15.192  18.620  8.793   1.00 10.00 ? 388 LYS B NZ   2  
ATOM 4966   H H    . LYS B 2 70  ? 14.640  13.215  6.495   1.00 10.00 ? 388 LYS B H    2  
ATOM 4967   H HZ1  . LYS B 2 70  ? 16.141  18.967  8.555   1.00 10.00 ? 388 LYS B HZ1  2  
ATOM 4968   H HZ2  . LYS B 2 70  ? 15.045  18.724  9.817   1.00 10.00 ? 388 LYS B HZ2  2  
ATOM 4969   H HZ3  . LYS B 2 70  ? 14.490  19.202  8.292   1.00 10.00 ? 388 LYS B HZ3  2  
ATOM 4970   N N    . SER B 2 71  ? 13.194  11.453  9.014   1.00 10.00 ? 389 SER B N    2  
ATOM 4971   C CA   . SER B 2 71  ? 12.329  10.614  9.831   1.00 10.00 ? 389 SER B CA   2  
ATOM 4972   C C    . SER B 2 71  ? 12.862  9.186   9.830   1.00 10.00 ? 389 SER B C    2  
ATOM 4973   O O    . SER B 2 71  ? 12.893  8.518   10.862  1.00 10.00 ? 389 SER B O    2  
ATOM 4974   C CB   . SER B 2 71  ? 10.879  10.657  9.345   1.00 10.00 ? 389 SER B CB   2  
ATOM 4975   O OG   . SER B 2 71  ? 10.299  11.932  9.575   1.00 10.00 ? 389 SER B OG   2  
ATOM 4976   H H    . SER B 2 71  ? 12.889  11.761  8.138   1.00 10.00 ? 389 SER B H    2  
ATOM 4977   H HG   . SER B 2 71  ? 10.725  12.583  9.003   1.00 10.00 ? 389 SER B HG   2  
ATOM 4978   N N    . LEU B 2 72  ? 13.287  8.734   8.660   1.00 10.00 ? 390 LEU B N    2  
ATOM 4979   C CA   . LEU B 2 72  ? 13.850  7.402   8.524   1.00 10.00 ? 390 LEU B CA   2  
ATOM 4980   C C    . LEU B 2 72  ? 15.199  7.339   9.233   1.00 10.00 ? 390 LEU B C    2  
ATOM 4981   O O    . LEU B 2 72  ? 15.480  6.382   9.958   1.00 10.00 ? 390 LEU B O    2  
ATOM 4982   C CB   . LEU B 2 72  ? 13.953  6.999   7.055   1.00 10.00 ? 390 LEU B CB   2  
ATOM 4983   C CG   . LEU B 2 72  ? 12.619  6.951   6.300   1.00 10.00 ? 390 LEU B CG   2  
ATOM 4984   C CD1  . LEU B 2 72  ? 12.840  6.700   4.816   1.00 10.00 ? 390 LEU B CD1  2  
ATOM 4985   C CD2  . LEU B 2 72  ? 11.698  5.897   6.895   1.00 10.00 ? 390 LEU B CD2  2  
ATOM 4986   H H    . LEU B 2 72  ? 13.207  9.302   7.865   1.00 10.00 ? 390 LEU B H    2  
ATOM 4987   N N    . TRP B 2 73  ? 16.046  8.342   9.004   1.00 10.00 ? 391 TRP B N    2  
ATOM 4988   C CA   . TRP B 2 73  ? 17.346  8.456   9.671   1.00 10.00 ? 391 TRP B CA   2  
ATOM 4989   C C    . TRP B 2 73  ? 17.204  8.572   11.190  1.00 10.00 ? 391 TRP B C    2  
ATOM 4990   O O    . TRP B 2 73  ? 18.173  8.387   11.929  1.00 10.00 ? 391 TRP B O    2  
ATOM 4991   C CB   . TRP B 2 73  ? 18.089  9.694   9.152   1.00 10.00 ? 391 TRP B CB   2  
ATOM 4992   C CG   . TRP B 2 73  ? 18.840  9.496   7.867   1.00 10.00 ? 391 TRP B CG   2  
ATOM 4993   C CD1  . TRP B 2 73  ? 18.418  9.815   6.608   1.00 10.00 ? 391 TRP B CD1  2  
ATOM 4994   C CD2  . TRP B 2 73  ? 20.163  8.962   7.721   1.00 10.00 ? 391 TRP B CD2  2  
ATOM 4995   N NE1  . TRP B 2 73  ? 19.393  9.507   5.688   1.00 10.00 ? 391 TRP B NE1  2  
ATOM 4996   C CE2  . TRP B 2 73  ? 20.472  8.987   6.347   1.00 10.00 ? 391 TRP B CE2  2  
ATOM 4997   C CE3  . TRP B 2 73  ? 21.117  8.474   8.619   1.00 10.00 ? 391 TRP B CE3  2  
ATOM 4998   C CZ2  . TRP B 2 73  ? 21.690  8.530   5.851   1.00 10.00 ? 391 TRP B CZ2  2  
ATOM 4999   C CZ3  . TRP B 2 73  ? 22.324  8.023   8.123   1.00 10.00 ? 391 TRP B CZ3  2  
ATOM 5000   C CH2  . TRP B 2 73  ? 22.601  8.061   6.756   1.00 10.00 ? 391 TRP B CH2  2  
ATOM 5001   H H    . TRP B 2 73  ? 15.874  9.000   8.292   1.00 10.00 ? 391 TRP B H    2  
ATOM 5002   H HE1  . TRP B 2 73  ? 19.327  9.640   4.718   1.00 10.00 ? 391 TRP B HE1  2  
ATOM 5003   N N    . LYS B 2 74  ? 15.988  8.849   11.651  1.00 10.00 ? 392 LYS B N    2  
ATOM 5004   C CA   . LYS B 2 74  ? 15.750  9.036   13.076  1.00 10.00 ? 392 LYS B CA   2  
ATOM 5005   C C    . LYS B 2 74  ? 15.793  7.695   13.792  1.00 10.00 ? 392 LYS B C    2  
ATOM 5006   O O    . LYS B 2 74  ? 16.224  7.609   14.937  1.00 10.00 ? 392 LYS B O    2  
ATOM 5007   C CB   . LYS B 2 74  ? 14.401  9.712   13.330  1.00 10.00 ? 392 LYS B CB   2  
ATOM 5008   C CG   . LYS B 2 74  ? 14.499  11.171  13.743  1.00 10.00 ? 392 LYS B CG   2  
ATOM 5009   C CD   . LYS B 2 74  ? 13.141  11.725  14.144  1.00 10.00 ? 392 LYS B CD   2  
ATOM 5010   C CE   . LYS B 2 74  ? 12.162  11.699  12.982  1.00 10.00 ? 392 LYS B CE   2  
ATOM 5011   N NZ   . LYS B 2 74  ? 10.900  12.420  13.292  1.00 10.00 ? 392 LYS B NZ   2  
ATOM 5012   H H    . LYS B 2 74  ? 15.231  8.743   11.046  1.00 10.00 ? 392 LYS B H    2  
ATOM 5013   H HZ1  . LYS B 2 74  ? 11.074  13.143  14.019  1.00 10.00 ? 392 LYS B HZ1  2  
ATOM 5014   H HZ2  . LYS B 2 74  ? 10.179  11.756  13.646  1.00 10.00 ? 392 LYS B HZ2  2  
ATOM 5015   H HZ3  . LYS B 2 74  ? 10.538  12.888  12.436  1.00 10.00 ? 392 LYS B HZ3  2  
ATOM 5016   N N    . SER B 2 75  ? 15.357  6.652   13.100  1.00 10.00 ? 393 SER B N    2  
ATOM 5017   C CA   . SER B 2 75  ? 15.338  5.311   13.660  1.00 10.00 ? 393 SER B CA   2  
ATOM 5018   C C    . SER B 2 75  ? 16.434  4.450   13.030  1.00 10.00 ? 393 SER B C    2  
ATOM 5019   O O    . SER B 2 75  ? 16.403  3.222   13.122  1.00 10.00 ? 393 SER B O    2  
ATOM 5020   C CB   . SER B 2 75  ? 13.966  4.685   13.406  1.00 10.00 ? 393 SER B CB   2  
ATOM 5021   O OG   . SER B 2 75  ? 13.350  5.288   12.277  1.00 10.00 ? 393 SER B OG   2  
ATOM 5022   H H    . SER B 2 75  ? 15.025  6.788   12.188  1.00 10.00 ? 393 SER B H    2  
ATOM 5023   H HG   . SER B 2 75  ? 12.732  4.665   11.881  1.00 10.00 ? 393 SER B HG   2  
ATOM 5024   N N    . SER B 2 76  ? 17.416  5.118   12.422  1.00 10.00 ? 394 SER B N    2  
ATOM 5025   C CA   . SER B 2 76  ? 18.527  4.445   11.755  1.00 10.00 ? 394 SER B CA   2  
ATOM 5026   C C    . SER B 2 76  ? 18.034  3.446   10.710  1.00 10.00 ? 394 SER B C    2  
ATOM 5027   O O    . SER B 2 76  ? 18.276  2.238   10.807  1.00 10.00 ? 394 SER B O    2  
ATOM 5028   C CB   . SER B 2 76  ? 19.441  3.772   12.783  1.00 10.00 ? 394 SER B CB   2  
ATOM 5029   O OG   . SER B 2 76  ? 19.710  4.650   13.868  1.00 10.00 ? 394 SER B OG   2  
ATOM 5030   H H    . SER B 2 76  ? 17.399  6.095   12.437  1.00 10.00 ? 394 SER B H    2  
ATOM 5031   H HG   . SER B 2 76  ? 19.197  4.377   14.635  1.00 10.00 ? 394 SER B HG   2  
ATOM 5032   N N    . THR B 2 77  ? 17.347  3.952   9.691   1.00 10.00 ? 395 THR B N    2  
ATOM 5033   C CA   . THR B 2 77  ? 16.809  3.106   8.641   1.00 10.00 ? 395 THR B CA   2  
ATOM 5034   C C    . THR B 2 77  ? 17.605  3.231   7.338   1.00 10.00 ? 395 THR B C    2  
ATOM 5035   O O    . THR B 2 77  ? 17.904  2.233   6.677   1.00 10.00 ? 395 THR B O    2  
ATOM 5036   C CB   . THR B 2 77  ? 15.317  3.397   8.380   1.00 10.00 ? 395 THR B CB   2  
ATOM 5037   O OG1  . THR B 2 77  ? 14.679  3.762   9.610   1.00 10.00 ? 395 THR B OG1  2  
ATOM 5038   C CG2  . THR B 2 77  ? 14.635  2.157   7.820   1.00 10.00 ? 395 THR B CG2  2  
ATOM 5039   H H    . THR B 2 77  ? 17.211  4.922   9.654   1.00 10.00 ? 395 THR B H    2  
ATOM 5040   H HG1  . THR B 2 77  ? 14.825  4.699   9.781   1.00 10.00 ? 395 THR B HG1  2  
ATOM 5041   N N    . ILE B 2 78  ? 17.939  4.461   6.962   1.00 10.00 ? 396 ILE B N    2  
ATOM 5042   C CA   . ILE B 2 78  ? 18.711  4.702   5.746   1.00 10.00 ? 396 ILE B CA   2  
ATOM 5043   C C    . ILE B 2 78  ? 20.202  4.737   6.072   1.00 10.00 ? 396 ILE B C    2  
ATOM 5044   O O    . ILE B 2 78  ? 20.596  5.231   7.128   1.00 10.00 ? 396 ILE B O    2  
ATOM 5045   C CB   . ILE B 2 78  ? 18.316  6.040   5.069   1.00 10.00 ? 396 ILE B CB   2  
ATOM 5046   C CG1  . ILE B 2 78  ? 16.795  6.158   4.929   1.00 10.00 ? 396 ILE B CG1  2  
ATOM 5047   C CG2  . ILE B 2 78  ? 18.986  6.169   3.706   1.00 10.00 ? 396 ILE B CG2  2  
ATOM 5048   C CD1  . ILE B 2 78  ? 16.334  7.505   4.410   1.00 10.00 ? 396 ILE B CD1  2  
ATOM 5049   H H    . ILE B 2 78  ? 17.636  5.224   7.492   1.00 10.00 ? 396 ILE B H    2  
ATOM 5050   N N    . THR B 2 79  ? 21.016  4.200   5.175   1.00 10.00 ? 397 THR B N    2  
ATOM 5051   C CA   . THR B 2 79  ? 22.453  4.180   5.361   1.00 10.00 ? 397 THR B CA   2  
ATOM 5052   C C    . THR B 2 79  ? 23.107  5.284   4.530   1.00 10.00 ? 397 THR B C    2  
ATOM 5053   O O    . THR B 2 79  ? 22.651  5.586   3.420   1.00 10.00 ? 397 THR B O    2  
ATOM 5054   C CB   . THR B 2 79  ? 23.042  2.811   4.960   1.00 10.00 ? 397 THR B CB   2  
ATOM 5055   O OG1  . THR B 2 79  ? 22.152  2.157   4.038   1.00 10.00 ? 397 THR B OG1  2  
ATOM 5056   C CG2  . THR B 2 79  ? 23.223  1.929   6.188   1.00 10.00 ? 397 THR B CG2  2  
ATOM 5057   H H    . THR B 2 79  ? 20.641  3.810   4.360   1.00 10.00 ? 397 THR B H    2  
ATOM 5058   H HG1  . THR B 2 79  ? 21.973  1.266   4.356   1.00 10.00 ? 397 THR B HG1  2  
ATOM 5059   N N    . ILE B 2 80  ? 24.144  5.903   5.090   1.00 10.00 ? 398 ILE B N    2  
ATOM 5060   C CA   . ILE B 2 80  ? 24.872  6.978   4.412   1.00 10.00 ? 398 ILE B CA   2  
ATOM 5061   C C    . ILE B 2 80  ? 25.292  6.596   2.991   1.00 10.00 ? 398 ILE B C    2  
ATOM 5062   O O    . ILE B 2 80  ? 25.219  7.414   2.077   1.00 10.00 ? 398 ILE B O    2  
ATOM 5063   C CB   . ILE B 2 80  ? 26.102  7.458   5.233   1.00 10.00 ? 398 ILE B CB   2  
ATOM 5064   C CG1  . ILE B 2 80  ? 26.898  8.534   4.481   1.00 10.00 ? 398 ILE B CG1  2  
ATOM 5065   C CG2  . ILE B 2 80  ? 27.005  6.296   5.620   1.00 10.00 ? 398 ILE B CG2  2  
ATOM 5066   C CD1  . ILE B 2 80  ? 26.115  9.797   4.202   1.00 10.00 ? 398 ILE B CD1  2  
ATOM 5067   H H    . ILE B 2 80  ? 24.369  5.689   6.020   1.00 10.00 ? 398 ILE B H    2  
ATOM 5068   N N    . ASP B 2 81  ? 25.686  5.346   2.808   1.00 10.00 ? 399 ASP B N    2  
ATOM 5069   C CA   . ASP B 2 81  ? 26.110  4.862   1.500   1.00 10.00 ? 399 ASP B CA   2  
ATOM 5070   C C    . ASP B 2 81  ? 24.968  4.949   0.497   1.00 10.00 ? 399 ASP B C    2  
ATOM 5071   O O    . ASP B 2 81  ? 25.152  5.388   -0.638  1.00 10.00 ? 399 ASP B O    2  
ATOM 5072   C CB   . ASP B 2 81  ? 26.591  3.409   1.592   1.00 10.00 ? 399 ASP B CB   2  
ATOM 5073   C CG   . ASP B 2 81  ? 28.010  3.290   2.099   1.00 10.00 ? 399 ASP B CG   2  
ATOM 5074   O OD1  . ASP B 2 81  ? 28.940  3.657   1.360   1.00 10.00 ? 399 ASP B OD1  2  
ATOM 5075   O OD2  . ASP B 2 81  ? 28.208  2.809   3.237   1.00 10.00 ? 399 ASP B OD2  2  
ATOM 5076   H H    . ASP B 2 81  ? 25.690  4.734   3.572   1.00 10.00 ? 399 ASP B H    2  
ATOM 5077   N N    . GLN B 2 82  ? 23.781  4.555   0.940   1.00 10.00 ? 400 GLN B N    2  
ATOM 5078   C CA   . GLN B 2 82  ? 22.598  4.562   0.091   1.00 10.00 ? 400 GLN B CA   2  
ATOM 5079   C C    . GLN B 2 82  ? 22.211  5.975   -0.328  1.00 10.00 ? 400 GLN B C    2  
ATOM 5080   O O    . GLN B 2 82  ? 21.995  6.237   -1.513  1.00 10.00 ? 400 GLN B O    2  
ATOM 5081   C CB   . GLN B 2 82  ? 21.438  3.859   0.791   1.00 10.00 ? 400 GLN B CB   2  
ATOM 5082   C CG   . GLN B 2 82  ? 21.304  2.375   0.461   1.00 10.00 ? 400 GLN B CG   2  
ATOM 5083   C CD   . GLN B 2 82  ? 22.640  1.682   0.243   1.00 10.00 ? 400 GLN B CD   2  
ATOM 5084   O OE1  . GLN B 2 82  ? 23.132  1.592   -0.887  1.00 10.00 ? 400 GLN B OE1  2  
ATOM 5085   N NE2  . GLN B 2 82  ? 23.236  1.193   1.318   1.00 10.00 ? 400 GLN B NE2  2  
ATOM 5086   H H    . GLN B 2 82  ? 23.702  4.256   1.870   1.00 10.00 ? 400 GLN B H    2  
ATOM 5087   H HE21 . GLN B 2 82  ? 22.791  1.305   2.189   1.00 10.00 ? 400 GLN B HE21 2  
ATOM 5088   H HE22 . GLN B 2 82  ? 24.096  0.735   1.205   1.00 10.00 ? 400 GLN B HE22 2  
ATOM 5089   N N    . MET B 2 83  ? 22.122  6.883   0.636   1.00 10.00 ? 401 MET B N    2  
ATOM 5090   C CA   . MET B 2 83  ? 21.759  8.271   0.346   1.00 10.00 ? 401 MET B CA   2  
ATOM 5091   C C    . MET B 2 83  ? 22.851  8.960   -0.468  1.00 10.00 ? 401 MET B C    2  
ATOM 5092   O O    . MET B 2 83  ? 22.592  9.889   -1.234  1.00 10.00 ? 401 MET B O    2  
ATOM 5093   C CB   . MET B 2 83  ? 21.477  9.046   1.638   1.00 10.00 ? 401 MET B CB   2  
ATOM 5094   C CG   . MET B 2 83  ? 20.910  10.438  1.413   1.00 10.00 ? 401 MET B CG   2  
ATOM 5095   S SD   . MET B 2 83  ? 20.414  11.245  2.943   1.00 10.00 ? 401 MET B SD   2  
ATOM 5096   C CE   . MET B 2 83  ? 19.713  12.766  2.307   1.00 10.00 ? 401 MET B CE   2  
ATOM 5097   H H    . MET B 2 83  ? 22.296  6.617   1.568   1.00 10.00 ? 401 MET B H    2  
ATOM 5098   N N    . LYS B 2 84  ? 24.074  8.465   -0.313  1.00 10.00 ? 402 LYS B N    2  
ATOM 5099   C CA   . LYS B 2 84  ? 25.218  9.014   -1.030  1.00 10.00 ? 402 LYS B CA   2  
ATOM 5100   C C    . LYS B 2 84  ? 25.110  8.664   -2.511  1.00 10.00 ? 402 LYS B C    2  
ATOM 5101   O O    . LYS B 2 84  ? 25.168  9.542   -3.370  1.00 10.00 ? 402 LYS B O    2  
ATOM 5102   C CB   . LYS B 2 84  ? 26.534  8.486   -0.444  1.00 10.00 ? 402 LYS B CB   2  
ATOM 5103   C CG   . LYS B 2 84  ? 27.781  9.111   -1.051  1.00 10.00 ? 402 LYS B CG   2  
ATOM 5104   C CD   . LYS B 2 84  ? 29.040  8.619   -0.358  1.00 10.00 ? 402 LYS B CD   2  
ATOM 5105   C CE   . LYS B 2 84  ? 30.288  8.996   -1.141  1.00 10.00 ? 402 LYS B CE   2  
ATOM 5106   N NZ   . LYS B 2 84  ? 30.367  8.280   -2.438  1.00 10.00 ? 402 LYS B NZ   2  
ATOM 5107   H H    . LYS B 2 84  ? 24.183  7.695   0.281   1.00 10.00 ? 402 LYS B H    2  
ATOM 5108   H HZ1  . LYS B 2 84  ? 30.199  7.264   -2.300  1.00 10.00 ? 402 LYS B HZ1  2  
ATOM 5109   H HZ2  . LYS B 2 84  ? 31.303  8.408   -2.870  1.00 10.00 ? 402 LYS B HZ2  2  
ATOM 5110   H HZ3  . LYS B 2 84  ? 29.644  8.649   -3.096  1.00 10.00 ? 402 LYS B HZ3  2  
ATOM 5111   N N    . ARG B 2 85  ? 24.913  7.375   -2.790  1.00 10.00 ? 403 ARG B N    2  
ATOM 5112   C CA   . ARG B 2 85  ? 24.778  6.887   -4.162  1.00 10.00 ? 403 ARG B CA   2  
ATOM 5113   C C    . ARG B 2 85  ? 23.567  7.539   -4.824  1.00 10.00 ? 403 ARG B C    2  
ATOM 5114   O O    . ARG B 2 85  ? 23.595  7.880   -6.008  1.00 10.00 ? 403 ARG B O    2  
ATOM 5115   C CB   . ARG B 2 85  ? 24.580  5.367   -4.174  1.00 10.00 ? 403 ARG B CB   2  
ATOM 5116   C CG   . ARG B 2 85  ? 25.741  4.556   -3.617  1.00 10.00 ? 403 ARG B CG   2  
ATOM 5117   C CD   . ARG B 2 85  ? 25.337  3.102   -3.419  1.00 10.00 ? 403 ARG B CD   2  
ATOM 5118   N NE   . ARG B 2 85  ? 24.899  2.482   -4.670  1.00 10.00 ? 403 ARG B NE   2  
ATOM 5119   C CZ   . ARG B 2 85  ? 24.054  1.451   -4.746  1.00 10.00 ? 403 ARG B CZ   2  
ATOM 5120   N NH1  . ARG B 2 85  ? 23.493  0.950   -3.642  1.00 10.00 ? 403 ARG B NH1  2  
ATOM 5121   N NH2  . ARG B 2 85  ? 23.751  0.937   -5.933  1.00 10.00 ? 403 ARG B NH2  2  
ATOM 5122   H H    . ARG B 2 85  ? 24.859  6.732   -2.050  1.00 10.00 ? 403 ARG B H    2  
ATOM 5123   H HE   . ARG B 2 85  ? 25.272  2.851   -5.508  1.00 10.00 ? 403 ARG B HE   2  
ATOM 5124   H HH11 . ARG B 2 85  ? 23.703  1.349   -2.740  1.00 10.00 ? 403 ARG B HH11 2  
ATOM 5125   H HH12 . ARG B 2 85  ? 22.863  0.172   -3.704  1.00 10.00 ? 403 ARG B HH12 2  
ATOM 5126   H HH21 . ARG B 2 85  ? 24.153  1.326   -6.770  1.00 10.00 ? 403 ARG B HH21 2  
ATOM 5127   H HH22 . ARG B 2 85  ? 23.137  0.149   -6.002  1.00 10.00 ? 403 ARG B HH22 2  
ATOM 5128   N N    . GLY B 2 86  ? 22.512  7.698   -4.034  1.00 10.00 ? 404 GLY B N    2  
ATOM 5129   C CA   . GLY B 2 86  ? 21.295  8.304   -4.529  1.00 10.00 ? 404 GLY B CA   2  
ATOM 5130   C C    . GLY B 2 86  ? 21.512  9.732   -4.972  1.00 10.00 ? 404 GLY B C    2  
ATOM 5131   O O    . GLY B 2 86  ? 21.122  10.109  -6.077  1.00 10.00 ? 404 GLY B O    2  
ATOM 5132   H H    . GLY B 2 86  ? 22.567  7.405   -3.098  1.00 10.00 ? 404 GLY B H    2  
ATOM 5133   N N    . TYR B 2 87  ? 22.155  10.520  -4.122  1.00 10.00 ? 405 TYR B N    2  
ATOM 5134   C CA   . TYR B 2 87  ? 22.428  11.914  -4.436  1.00 10.00 ? 405 TYR B CA   2  
ATOM 5135   C C    . TYR B 2 87  ? 23.401  12.046  -5.600  1.00 10.00 ? 405 TYR B C    2  
ATOM 5136   O O    . TYR B 2 87  ? 23.293  12.967  -6.407  1.00 10.00 ? 405 TYR B O    2  
ATOM 5137   C CB   . TYR B 2 87  ? 22.954  12.655  -3.209  1.00 10.00 ? 405 TYR B CB   2  
ATOM 5138   C CG   . TYR B 2 87  ? 22.004  13.705  -2.691  1.00 10.00 ? 405 TYR B CG   2  
ATOM 5139   C CD1  . TYR B 2 87  ? 21.912  14.943  -3.308  1.00 10.00 ? 405 TYR B CD1  2  
ATOM 5140   C CD2  . TYR B 2 87  ? 21.194  13.458  -1.591  1.00 10.00 ? 405 TYR B CD2  2  
ATOM 5141   C CE1  . TYR B 2 87  ? 21.043  15.910  -2.847  1.00 10.00 ? 405 TYR B CE1  2  
ATOM 5142   C CE2  . TYR B 2 87  ? 20.319  14.418  -1.122  1.00 10.00 ? 405 TYR B CE2  2  
ATOM 5143   C CZ   . TYR B 2 87  ? 20.248  15.643  -1.754  1.00 10.00 ? 405 TYR B CZ   2  
ATOM 5144   O OH   . TYR B 2 87  ? 19.381  16.601  -1.291  1.00 10.00 ? 405 TYR B OH   2  
ATOM 5145   H H    . TYR B 2 87  ? 22.458  10.156  -3.259  1.00 10.00 ? 405 TYR B H    2  
ATOM 5146   H HH   . TYR B 2 87  ? 19.255  16.489  -0.342  1.00 10.00 ? 405 TYR B HH   2  
ATOM 5147   N N    . GLU B 2 88  ? 24.329  11.101  -5.691  1.00 10.00 ? 406 GLU B N    2  
ATOM 5148   C CA   . GLU B 2 88  ? 25.323  11.102  -6.764  1.00 10.00 ? 406 GLU B CA   2  
ATOM 5149   C C    . GLU B 2 88  ? 24.644  10.917  -8.115  1.00 10.00 ? 406 GLU B C    2  
ATOM 5150   O O    . GLU B 2 88  ? 25.091  11.457  -9.127  1.00 10.00 ? 406 GLU B O    2  
ATOM 5151   C CB   . GLU B 2 88  ? 26.380  10.025  -6.540  1.00 10.00 ? 406 GLU B CB   2  
ATOM 5152   C CG   . GLU B 2 88  ? 27.455  10.438  -5.547  1.00 10.00 ? 406 GLU B CG   2  
ATOM 5153   C CD   . GLU B 2 88  ? 28.487  9.355   -5.319  1.00 10.00 ? 406 GLU B CD   2  
ATOM 5154   O OE1  . GLU B 2 88  ? 29.260  9.057   -6.256  1.00 10.00 ? 406 GLU B OE1  2  
ATOM 5155   O OE2  . GLU B 2 88  ? 28.536  8.797   -4.205  1.00 10.00 ? 406 GLU B OE2  2  
ATOM 5156   H H    . GLU B 2 88  ? 24.352  10.379  -5.025  1.00 10.00 ? 406 GLU B H    2  
ATOM 5157   N N    . ARG B 2 89  ? 23.555  10.157  -8.123  1.00 10.00 ? 407 ARG B N    2  
ATOM 5158   C CA   . ARG B 2 89  ? 22.813  9.933   -9.345  1.00 10.00 ? 407 ARG B CA   2  
ATOM 5159   C C    . ARG B 2 89  ? 22.081  11.212  -9.732  1.00 10.00 ? 407 ARG B C    2  
ATOM 5160   O O    . ARG B 2 89  ? 22.114  11.623  -10.885 1.00 10.00 ? 407 ARG B O    2  
ATOM 5161   C CB   . ARG B 2 89  ? 21.827  8.775   -9.189  1.00 10.00 ? 407 ARG B CB   2  
ATOM 5162   C CG   . ARG B 2 89  ? 21.275  8.265   -10.511 1.00 10.00 ? 407 ARG B CG   2  
ATOM 5163   C CD   . ARG B 2 89  ? 21.363  6.751   -10.608 1.00 10.00 ? 407 ARG B CD   2  
ATOM 5164   N NE   . ARG B 2 89  ? 20.216  6.091   -9.990  1.00 10.00 ? 407 ARG B NE   2  
ATOM 5165   C CZ   . ARG B 2 89  ? 19.238  5.505   -10.679 1.00 10.00 ? 407 ARG B CZ   2  
ATOM 5166   N NH1  . ARG B 2 89  ? 19.298  5.446   -12.008 1.00 10.00 ? 407 ARG B NH1  2  
ATOM 5167   N NH2  . ARG B 2 89  ? 18.212  4.958   -10.040 1.00 10.00 ? 407 ARG B NH2  2  
ATOM 5168   H H    . ARG B 2 89  ? 23.252  9.740   -7.286  1.00 10.00 ? 407 ARG B H    2  
ATOM 5169   H HE   . ARG B 2 89  ? 20.167  6.097   -9.009  1.00 10.00 ? 407 ARG B HE   2  
ATOM 5170   H HH11 . ARG B 2 89  ? 20.082  5.840   -12.496 1.00 10.00 ? 407 ARG B HH11 2  
ATOM 5171   H HH12 . ARG B 2 89  ? 18.562  5.009   -12.528 1.00 10.00 ? 407 ARG B HH12 2  
ATOM 5172   H HH21 . ARG B 2 89  ? 18.163  4.977   -9.030  1.00 10.00 ? 407 ARG B HH21 2  
ATOM 5173   H HH22 . ARG B 2 89  ? 17.467  4.525   -10.554 1.00 10.00 ? 407 ARG B HH22 2  
ATOM 5174   N N    . ILE B 2 90  ? 21.455  11.850  -8.740  1.00 10.00 ? 408 ILE B N    2  
ATOM 5175   C CA   . ILE B 2 90  ? 20.712  13.098  -8.946  1.00 10.00 ? 408 ILE B CA   2  
ATOM 5176   C C    . ILE B 2 90  ? 21.598  14.128  -9.645  1.00 10.00 ? 408 ILE B C    2  
ATOM 5177   O O    . ILE B 2 90  ? 21.195  14.761  -10.619 1.00 10.00 ? 408 ILE B O    2  
ATOM 5178   C CB   . ILE B 2 90  ? 20.264  13.699  -7.593  1.00 10.00 ? 408 ILE B CB   2  
ATOM 5179   C CG1  . ILE B 2 90  ? 19.468  12.684  -6.767  1.00 10.00 ? 408 ILE B CG1  2  
ATOM 5180   C CG2  . ILE B 2 90  ? 19.470  14.984  -7.792  1.00 10.00 ? 408 ILE B CG2  2  
ATOM 5181   C CD1  . ILE B 2 90  ? 18.133  12.298  -7.369  1.00 10.00 ? 408 ILE B CD1  2  
ATOM 5182   H H    . ILE B 2 90  ? 21.498  11.470  -7.836  1.00 10.00 ? 408 ILE B H    2  
ATOM 5183   N N    . TYR B 2 91  ? 22.801  14.277  -9.112  1.00 10.00 ? 409 TYR B N    2  
ATOM 5184   C CA   . TYR B 2 91  ? 23.782  15.221  -9.660  1.00 10.00 ? 409 TYR B CA   2  
ATOM 5185   C C    . TYR B 2 91  ? 24.017  15.002  -11.154 1.00 10.00 ? 409 TYR B C    2  
ATOM 5186   O O    . TYR B 2 91  ? 24.261  15.955  -11.896 1.00 10.00 ? 409 TYR B O    2  
ATOM 5187   C CB   . TYR B 2 91  ? 25.105  15.154  -8.894  1.00 10.00 ? 409 TYR B CB   2  
ATOM 5188   C CG   . TYR B 2 91  ? 24.989  15.564  -7.447  1.00 10.00 ? 409 TYR B CG   2  
ATOM 5189   C CD1  . TYR B 2 91  ? 24.084  16.540  -7.053  1.00 10.00 ? 409 TYR B CD1  2  
ATOM 5190   C CD2  . TYR B 2 91  ? 25.780  14.969  -6.473  1.00 10.00 ? 409 TYR B CD2  2  
ATOM 5191   C CE1  . TYR B 2 91  ? 23.970  16.912  -5.730  1.00 10.00 ? 409 TYR B CE1  2  
ATOM 5192   C CE2  . TYR B 2 91  ? 25.671  15.334  -5.146  1.00 10.00 ? 409 TYR B CE2  2  
ATOM 5193   C CZ   . TYR B 2 91  ? 24.765  16.305  -4.781  1.00 10.00 ? 409 TYR B CZ   2  
ATOM 5194   O OH   . TYR B 2 91  ? 24.651  16.673  -3.461  1.00 10.00 ? 409 TYR B OH   2  
ATOM 5195   H H    . TYR B 2 91  ? 22.963  13.807  -8.265  1.00 10.00 ? 409 TYR B H    2  
ATOM 5196   H HH   . TYR B 2 91  ? 23.741  16.558  -3.175  1.00 10.00 ? 409 TYR B HH   2  
ATOM 5197   N N    . ASN B 2 92  ? 23.917  13.756  -11.596 1.00 10.00 ? 410 ASN B N    2  
ATOM 5198   C CA   . ASN B 2 92  ? 24.111  13.432  -13.005 1.00 10.00 ? 410 ASN B CA   2  
ATOM 5199   C C    . ASN B 2 92  ? 22.796  13.531  -13.786 1.00 10.00 ? 410 ASN B C    2  
ATOM 5200   O O    . ASN B 2 92  ? 22.796  13.693  -15.008 1.00 10.00 ? 410 ASN B O    2  
ATOM 5201   C CB   . ASN B 2 92  ? 24.712  12.033  -13.163 1.00 10.00 ? 410 ASN B CB   2  
ATOM 5202   C CG   . ASN B 2 92  ? 25.212  11.777  -14.572 1.00 10.00 ? 410 ASN B CG   2  
ATOM 5203   O OD1  . ASN B 2 92  ? 25.726  12.675  -15.236 1.00 10.00 ? 410 ASN B OD1  2  
ATOM 5204   N ND2  . ASN B 2 92  ? 25.053  10.555  -15.044 1.00 10.00 ? 410 ASN B ND2  2  
ATOM 5205   H H    . ASN B 2 92  ? 23.712  13.037  -10.961 1.00 10.00 ? 410 ASN B H    2  
ATOM 5206   H HD21 . ASN B 2 92  ? 24.626  9.884   -14.467 1.00 10.00 ? 410 ASN B HD21 2  
ATOM 5207   H HD22 . ASN B 2 92  ? 25.367  10.365  -15.952 1.00 10.00 ? 410 ASN B HD22 2  
ATOM 5208   N N    . GLU B 2 93  ? 21.675  13.435  -13.078 1.00 10.00 ? 411 GLU B N    2  
ATOM 5209   C CA   . GLU B 2 93  ? 20.353  13.512  -13.704 1.00 10.00 ? 411 GLU B CA   2  
ATOM 5210   C C    . GLU B 2 93  ? 19.956  14.964  -13.976 1.00 10.00 ? 411 GLU B C    2  
ATOM 5211   O O    . GLU B 2 93  ? 19.151  15.240  -14.868 1.00 10.00 ? 411 GLU B O    2  
ATOM 5212   C CB   . GLU B 2 93  ? 19.292  12.851  -12.819 1.00 10.00 ? 411 GLU B CB   2  
ATOM 5213   C CG   . GLU B 2 93  ? 19.583  11.406  -12.444 1.00 10.00 ? 411 GLU B CG   2  
ATOM 5214   C CD   . GLU B 2 93  ? 19.455  10.447  -13.608 1.00 10.00 ? 411 GLU B CD   2  
ATOM 5215   O OE1  . GLU B 2 93  ? 20.334  10.452  -14.495 1.00 10.00 ? 411 GLU B OE1  2  
ATOM 5216   O OE2  . GLU B 2 93  ? 18.486  9.665   -13.625 1.00 10.00 ? 411 GLU B OE2  2  
ATOM 5217   H H    . GLU B 2 93  ? 21.735  13.306  -12.107 1.00 10.00 ? 411 GLU B H    2  
ATOM 5218   N N    . ILE B 2 94  ? 20.531  15.882  -13.198 1.00 10.00 ? 412 ILE B N    2  
ATOM 5219   C CA   . ILE B 2 94  ? 20.254  17.317  -13.323 1.00 10.00 ? 412 ILE B CA   2  
ATOM 5220   C C    . ILE B 2 94  ? 20.266  17.823  -14.777 1.00 10.00 ? 412 ILE B C    2  
ATOM 5221   O O    . ILE B 2 94  ? 19.292  18.435  -15.218 1.00 10.00 ? 412 ILE B O    2  
ATOM 5222   C CB   . ILE B 2 94  ? 21.182  18.179  -12.426 1.00 10.00 ? 412 ILE B CB   2  
ATOM 5223   C CG1  . ILE B 2 94  ? 20.891  17.923  -10.940 1.00 10.00 ? 412 ILE B CG1  2  
ATOM 5224   C CG2  . ILE B 2 94  ? 21.064  19.665  -12.749 1.00 10.00 ? 412 ILE B CG2  2  
ATOM 5225   C CD1  . ILE B 2 94  ? 19.463  18.218  -10.525 1.00 10.00 ? 412 ILE B CD1  2  
ATOM 5226   H H    . ILE B 2 94  ? 21.161  15.581  -12.506 1.00 10.00 ? 412 ILE B H    2  
ATOM 5227   N N    . PRO B 2 95  ? 21.354  17.578  -15.549 1.00 10.00 ? 413 PRO B N    2  
ATOM 5228   C CA   . PRO B 2 95  ? 21.448  18.024  -16.950 1.00 10.00 ? 413 PRO B CA   2  
ATOM 5229   C C    . PRO B 2 95  ? 20.285  17.539  -17.820 1.00 10.00 ? 413 PRO B C    2  
ATOM 5230   O O    . PRO B 2 95  ? 19.846  18.245  -18.724 1.00 10.00 ? 413 PRO B O    2  
ATOM 5231   C CB   . PRO B 2 95  ? 22.762  17.408  -17.439 1.00 10.00 ? 413 PRO B CB   2  
ATOM 5232   C CG   . PRO B 2 95  ? 23.568  17.213  -16.204 1.00 10.00 ? 413 PRO B CG   2  
ATOM 5233   C CD   . PRO B 2 95  ? 22.585  16.883  -15.120 1.00 10.00 ? 413 PRO B CD   2  
ATOM 5234   N N    . ASP B 2 96  ? 19.775  16.345  -17.531 1.00 10.00 ? 414 ASP B N    2  
ATOM 5235   C CA   . ASP B 2 96  ? 18.674  15.771  -18.306 1.00 10.00 ? 414 ASP B CA   2  
ATOM 5236   C C    . ASP B 2 96  ? 17.352  16.451  -17.981 1.00 10.00 ? 414 ASP B C    2  
ATOM 5237   O O    . ASP B 2 96  ? 16.573  16.778  -18.876 1.00 10.00 ? 414 ASP B O    2  
ATOM 5238   C CB   . ASP B 2 96  ? 18.556  14.266  -18.046 1.00 10.00 ? 414 ASP B CB   2  
ATOM 5239   C CG   . ASP B 2 96  ? 17.934  13.515  -19.207 1.00 10.00 ? 414 ASP B CG   2  
ATOM 5240   O OD1  . ASP B 2 96  ? 18.675  13.148  -20.146 1.00 10.00 ? 414 ASP B OD1  2  
ATOM 5241   O OD2  . ASP B 2 96  ? 16.716  13.258  -19.177 1.00 10.00 ? 414 ASP B OD2  2  
ATOM 5242   H H    . ASP B 2 96  ? 20.141  15.842  -16.774 1.00 10.00 ? 414 ASP B H    2  
ATOM 5243   N N    . ILE B 2 97  ? 17.113  16.665  -16.693 1.00 10.00 ? 415 ILE B N    2  
ATOM 5244   C CA   . ILE B 2 97  ? 15.885  17.302  -16.231 1.00 10.00 ? 415 ILE B CA   2  
ATOM 5245   C C    . ILE B 2 97  ? 15.870  18.791  -16.578 1.00 10.00 ? 415 ILE B C    2  
ATOM 5246   O O    . ILE B 2 97  ? 14.812  19.376  -16.820 1.00 10.00 ? 415 ILE B O    2  
ATOM 5247   C CB   . ILE B 2 97  ? 15.730  17.148  -14.699 1.00 10.00 ? 415 ILE B CB   2  
ATOM 5248   C CG1  . ILE B 2 97  ? 15.884  15.681  -14.284 1.00 10.00 ? 415 ILE B CG1  2  
ATOM 5249   C CG2  . ILE B 2 97  ? 14.388  17.699  -14.231 1.00 10.00 ? 415 ILE B CG2  2  
ATOM 5250   C CD1  . ILE B 2 97  ? 15.948  15.468  -12.786 1.00 10.00 ? 415 ILE B CD1  2  
ATOM 5251   H H    . ILE B 2 97  ? 17.780  16.377  -16.032 1.00 10.00 ? 415 ILE B H    2  
ATOM 5252   N N    . ASN B 2 98  ? 17.049  19.396  -16.607 1.00 10.00 ? 416 ASN B N    2  
ATOM 5253   C CA   . ASN B 2 98  ? 17.174  20.823  -16.893 1.00 10.00 ? 416 ASN B CA   2  
ATOM 5254   C C    . ASN B 2 98  ? 17.262  21.140  -18.379 1.00 10.00 ? 416 ASN B C    2  
ATOM 5255   O O    . ASN B 2 98  ? 16.554  22.022  -18.866 1.00 10.00 ? 416 ASN B O    2  
ATOM 5256   C CB   . ASN B 2 98  ? 18.366  21.428  -16.148 1.00 10.00 ? 416 ASN B CB   2  
ATOM 5257   C CG   . ASN B 2 98  ? 17.980  21.970  -14.787 1.00 10.00 ? 416 ASN B CG   2  
ATOM 5258   O OD1  . ASN B 2 98  ? 17.536  23.111  -14.668 1.00 10.00 ? 416 ASN B OD1  2  
ATOM 5259   N ND2  . ASN B 2 98  ? 18.146  21.159  -13.752 1.00 10.00 ? 416 ASN B ND2  2  
ATOM 5260   H H    . ASN B 2 98  ? 17.860  18.871  -16.429 1.00 10.00 ? 416 ASN B H    2  
ATOM 5261   H HD21 . ASN B 2 98  ? 18.508  20.262  -13.921 1.00 10.00 ? 416 ASN B HD21 2  
ATOM 5262   H HD22 . ASN B 2 98  ? 17.888  21.485  -12.862 1.00 10.00 ? 416 ASN B HD22 2  
ATOM 5263   N N    . LEU B 2 99  ? 18.136  20.431  -19.088 1.00 10.00 ? 417 LEU B N    2  
ATOM 5264   C CA   . LEU B 2 99  ? 18.338  20.647  -20.519 1.00 10.00 ? 417 LEU B CA   2  
ATOM 5265   C C    . LEU B 2 99  ? 18.780  22.083  -20.802 1.00 10.00 ? 417 LEU B C    2  
ATOM 5266   O O    . LEU B 2 99  ? 18.049  22.870  -21.414 1.00 10.00 ? 417 LEU B O    2  
ATOM 5267   C CB   . LEU B 2 99  ? 17.096  20.276  -21.335 1.00 10.00 ? 417 LEU B CB   2  
ATOM 5268   C CG   . LEU B 2 99  ? 17.289  20.198  -22.851 1.00 10.00 ? 417 LEU B CG   2  
ATOM 5269   C CD1  . LEU B 2 99  ? 18.159  19.006  -23.223 1.00 10.00 ? 417 LEU B CD1  2  
ATOM 5270   C CD2  . LEU B 2 99  ? 15.947  20.134  -23.561 1.00 10.00 ? 417 LEU B CD2  2  
ATOM 5271   H H    . LEU B 2 99  ? 18.662  19.734  -18.638 1.00 10.00 ? 417 LEU B H    2  
ATOM 5272   N N    . ASP B 2 100 ? 19.981  22.406  -20.322 1.00 10.00 ? 418 ASP B N    2  
ATOM 5273   C CA   . ASP B 2 100 ? 20.586  23.730  -20.485 1.00 10.00 ? 418 ASP B CA   2  
ATOM 5274   C C    . ASP B 2 100 ? 19.880  24.780  -19.628 1.00 10.00 ? 418 ASP B C    2  
ATOM 5275   O O    . ASP B 2 100 ? 18.671  24.717  -19.425 1.00 10.00 ? 418 ASP B O    2  
ATOM 5276   C CB   . ASP B 2 100 ? 20.657  24.153  -21.958 1.00 10.00 ? 418 ASP B CB   2  
ATOM 5277   C CG   . ASP B 2 100 ? 21.651  25.271  -22.219 1.00 10.00 ? 418 ASP B CG   2  
ATOM 5278   O OD1  . ASP B 2 100 ? 22.404  25.648  -21.294 1.00 10.00 ? 418 ASP B OD1  2  
ATOM 5279   O OD2  . ASP B 2 100 ? 21.682  25.779  -23.360 1.00 10.00 ? 418 ASP B OD2  2  
ATOM 5280   H H    . ASP B 2 100 ? 20.482  21.726  -19.825 1.00 10.00 ? 418 ASP B H    2  
ATOM 5281   N N    . VAL B 2 101 ? 20.643  25.751  -19.131 1.00 10.00 ? 419 VAL B N    2  
ATOM 5282   C CA   . VAL B 2 101 ? 20.099  26.805  -18.272 1.00 10.00 ? 419 VAL B CA   2  
ATOM 5283   C C    . VAL B 2 101 ? 19.440  26.191  -17.024 1.00 10.00 ? 419 VAL B C    2  
ATOM 5284   O O    . VAL B 2 101 ? 18.215  26.064  -16.943 1.00 10.00 ? 419 VAL B O    2  
ATOM 5285   C CB   . VAL B 2 101 ? 19.102  27.720  -19.027 1.00 10.00 ? 419 VAL B CB   2  
ATOM 5286   C CG1  . VAL B 2 101 ? 18.693  28.908  -18.170 1.00 10.00 ? 419 VAL B CG1  2  
ATOM 5287   C CG2  . VAL B 2 101 ? 19.706  28.205  -20.337 1.00 10.00 ? 419 VAL B CG2  2  
ATOM 5288   H H    . VAL B 2 101 ? 21.596  25.770  -19.363 1.00 10.00 ? 419 VAL B H    2  
ATOM 5289   N N    . PRO B 2 102 ? 20.262  25.789  -16.037 1.00 10.00 ? 420 PRO B N    2  
ATOM 5290   C CA   . PRO B 2 102 ? 19.786  25.163  -14.802 1.00 10.00 ? 420 PRO B CA   2  
ATOM 5291   C C    . PRO B 2 102 ? 19.205  26.171  -13.815 1.00 10.00 ? 420 PRO B C    2  
ATOM 5292   O O    . PRO B 2 102 ? 19.913  26.694  -12.956 1.00 10.00 ? 420 PRO B O    2  
ATOM 5293   C CB   . PRO B 2 102 ? 21.049  24.513  -14.206 1.00 10.00 ? 420 PRO B CB   2  
ATOM 5294   C CG   . PRO B 2 102 ? 22.149  24.754  -15.195 1.00 10.00 ? 420 PRO B CG   2  
ATOM 5295   C CD   . PRO B 2 102 ? 21.721  25.918  -16.038 1.00 10.00 ? 420 PRO B CD   2  
ATOM 5296   N N    . HIS B 2 103 ? 17.915  26.449  -13.935 1.00 10.00 ? 421 HIS B N    2  
ATOM 5297   C CA   . HIS B 2 103 ? 17.256  27.397  -13.041 1.00 10.00 ? 421 HIS B CA   2  
ATOM 5298   C C    . HIS B 2 103 ? 16.861  26.766  -11.707 1.00 10.00 ? 421 HIS B C    2  
ATOM 5299   O O    . HIS B 2 103 ? 16.589  27.469  -10.735 1.00 10.00 ? 421 HIS B O    2  
ATOM 5300   C CB   . HIS B 2 103 ? 16.046  28.048  -13.716 1.00 10.00 ? 421 HIS B CB   2  
ATOM 5301   C CG   . HIS B 2 103 ? 16.355  29.374  -14.335 1.00 10.00 ? 421 HIS B CG   2  
ATOM 5302   N ND1  . HIS B 2 103 ? 15.520  30.467  -14.243 1.00 10.00 ? 421 HIS B ND1  2  
ATOM 5303   C CD2  . HIS B 2 103 ? 17.428  29.785  -15.052 1.00 10.00 ? 421 HIS B CD2  2  
ATOM 5304   C CE1  . HIS B 2 103 ? 16.066  31.489  -14.876 1.00 10.00 ? 421 HIS B CE1  2  
ATOM 5305   N NE2  . HIS B 2 103 ? 17.223  31.101  -15.375 1.00 10.00 ? 421 HIS B NE2  2  
ATOM 5306   H H    . HIS B 2 103 ? 17.397  26.050  -14.672 1.00 10.00 ? 421 HIS B H    2  
ATOM 5307   H HD1  . HIS B 2 103 ? 14.655  30.492  -13.775 1.00 10.00 ? 421 HIS B HD1  2  
ATOM 5308   H HE2  . HIS B 2 103 ? 17.793  31.638  -15.965 1.00 10.00 ? 421 HIS B HE2  2  
ATOM 5309   N N    . SER B 2 104 ? 16.848  25.439  -11.652 1.00 10.00 ? 422 SER B N    2  
ATOM 5310   C CA   . SER B 2 104 ? 16.486  24.730  -10.427 1.00 10.00 ? 422 SER B CA   2  
ATOM 5311   C C    . SER B 2 104 ? 17.668  24.648  -9.462  1.00 10.00 ? 422 SER B C    2  
ATOM 5312   O O    . SER B 2 104 ? 17.568  24.047  -8.395  1.00 10.00 ? 422 SER B O    2  
ATOM 5313   C CB   . SER B 2 104 ? 15.960  23.328  -10.749 1.00 10.00 ? 422 SER B CB   2  
ATOM 5314   O OG   . SER B 2 104 ? 16.389  22.912  -12.034 1.00 10.00 ? 422 SER B OG   2  
ATOM 5315   H H    . SER B 2 104 ? 17.076  24.919  -12.452 1.00 10.00 ? 422 SER B H    2  
ATOM 5316   H HG   . SER B 2 104 ? 15.633  22.912  -12.636 1.00 10.00 ? 422 SER B HG   2  
ATOM 5317   N N    . TYR B 2 105 ? 18.779  25.276  -9.841  1.00 10.00 ? 423 TYR B N    2  
ATOM 5318   C CA   . TYR B 2 105 ? 19.988  25.283  -9.022  1.00 10.00 ? 423 TYR B CA   2  
ATOM 5319   C C    . TYR B 2 105 ? 19.734  25.892  -7.651  1.00 10.00 ? 423 TYR B C    2  
ATOM 5320   O O    . TYR B 2 105 ? 20.222  25.388  -6.643  1.00 10.00 ? 423 TYR B O    2  
ATOM 5321   C CB   . TYR B 2 105 ? 21.103  26.057  -9.722  1.00 10.00 ? 423 TYR B CB   2  
ATOM 5322   C CG   . TYR B 2 105 ? 22.164  25.188  -10.357 1.00 10.00 ? 423 TYR B CG   2  
ATOM 5323   C CD1  . TYR B 2 105 ? 22.025  23.807  -10.416 1.00 10.00 ? 423 TYR B CD1  2  
ATOM 5324   C CD2  . TYR B 2 105 ? 23.305  25.755  -10.902 1.00 10.00 ? 423 TYR B CD2  2  
ATOM 5325   C CE1  . TYR B 2 105 ? 22.996  23.016  -11.001 1.00 10.00 ? 423 TYR B CE1  2  
ATOM 5326   C CE2  . TYR B 2 105 ? 24.280  24.974  -11.487 1.00 10.00 ? 423 TYR B CE2  2  
ATOM 5327   C CZ   . TYR B 2 105 ? 24.120  23.605  -11.536 1.00 10.00 ? 423 TYR B CZ   2  
ATOM 5328   O OH   . TYR B 2 105 ? 25.088  22.825  -12.127 1.00 10.00 ? 423 TYR B OH   2  
ATOM 5329   H H    . TYR B 2 105 ? 18.785  25.747  -10.701 1.00 10.00 ? 423 TYR B H    2  
ATOM 5330   H HH   . TYR B 2 105 ? 25.939  23.001  -11.711 1.00 10.00 ? 423 TYR B HH   2  
ATOM 5331   N N    . SER B 2 106 ? 18.965  26.970  -7.625  1.00 10.00 ? 424 SER B N    2  
ATOM 5332   C CA   . SER B 2 106 ? 18.635  27.654  -6.387  1.00 10.00 ? 424 SER B CA   2  
ATOM 5333   C C    . SER B 2 106 ? 17.932  26.704  -5.419  1.00 10.00 ? 424 SER B C    2  
ATOM 5334   O O    . SER B 2 106 ? 18.167  26.737  -4.209  1.00 10.00 ? 424 SER B O    2  
ATOM 5335   C CB   . SER B 2 106 ? 17.741  28.844  -6.710  1.00 10.00 ? 424 SER B CB   2  
ATOM 5336   O OG   . SER B 2 106 ? 17.614  28.984  -8.119  1.00 10.00 ? 424 SER B OG   2  
ATOM 5337   H H    . SER B 2 106 ? 18.611  27.326  -8.470  1.00 10.00 ? 424 SER B H    2  
ATOM 5338   H HG   . SER B 2 106 ? 16.677  28.963  -8.356  1.00 10.00 ? 424 SER B HG   2  
ATOM 5339   N N    . VAL B 2 107 ? 17.086  25.845  -5.971  1.00 10.00 ? 425 VAL B N    2  
ATOM 5340   C CA   . VAL B 2 107 ? 16.353  24.873  -5.178  1.00 10.00 ? 425 VAL B CA   2  
ATOM 5341   C C    . VAL B 2 107 ? 17.281  23.730  -4.793  1.00 10.00 ? 425 VAL B C    2  
ATOM 5342   O O    . VAL B 2 107 ? 17.263  23.257  -3.658  1.00 10.00 ? 425 VAL B O    2  
ATOM 5343   C CB   . VAL B 2 107 ? 15.149  24.307  -5.953  1.00 10.00 ? 425 VAL B CB   2  
ATOM 5344   C CG1  . VAL B 2 107 ? 14.261  23.471  -5.044  1.00 10.00 ? 425 VAL B CG1  2  
ATOM 5345   C CG2  . VAL B 2 107 ? 14.354  25.430  -6.599  1.00 10.00 ? 425 VAL B CG2  2  
ATOM 5346   H H    . VAL B 2 107 ? 16.959  25.856  -6.942  1.00 10.00 ? 425 VAL B H    2  
ATOM 5347   N N    . LEU B 2 108 ? 18.089  23.303  -5.756  1.00 10.00 ? 426 LEU B N    2  
ATOM 5348   C CA   . LEU B 2 108 ? 19.044  22.222  -5.540  1.00 10.00 ? 426 LEU B CA   2  
ATOM 5349   C C    . LEU B 2 108 ? 19.997  22.541  -4.389  1.00 10.00 ? 426 LEU B C    2  
ATOM 5350   O O    . LEU B 2 108 ? 20.142  21.739  -3.469  1.00 10.00 ? 426 LEU B O    2  
ATOM 5351   C CB   . LEU B 2 108 ? 19.837  21.938  -6.822  1.00 10.00 ? 426 LEU B CB   2  
ATOM 5352   C CG   . LEU B 2 108 ? 20.725  20.692  -6.808  1.00 10.00 ? 426 LEU B CG   2  
ATOM 5353   C CD1  . LEU B 2 108 ? 19.890  19.439  -6.607  1.00 10.00 ? 426 LEU B CD1  2  
ATOM 5354   C CD2  . LEU B 2 108 ? 21.546  20.595  -8.086  1.00 10.00 ? 426 LEU B CD2  2  
ATOM 5355   H H    . LEU B 2 108 ? 18.042  23.723  -6.645  1.00 10.00 ? 426 LEU B H    2  
ATOM 5356   N N    . GLU B 2 109 ? 20.638  23.712  -4.436  1.00 10.00 ? 427 GLU B N    2  
ATOM 5357   C CA   . GLU B 2 109 ? 21.559  24.123  -3.381  1.00 10.00 ? 427 GLU B CA   2  
ATOM 5358   C C    . GLU B 2 109 ? 20.861  24.129  -2.032  1.00 10.00 ? 427 GLU B C    2  
ATOM 5359   O O    . GLU B 2 109 ? 21.325  23.504  -1.081  1.00 10.00 ? 427 GLU B O    2  
ATOM 5360   C CB   . GLU B 2 109 ? 22.119  25.518  -3.673  1.00 10.00 ? 427 GLU B CB   2  
ATOM 5361   C CG   . GLU B 2 109 ? 23.156  25.556  -4.779  1.00 10.00 ? 427 GLU B CG   2  
ATOM 5362   C CD   . GLU B 2 109 ? 23.627  26.961  -5.080  1.00 10.00 ? 427 GLU B CD   2  
ATOM 5363   O OE1  . GLU B 2 109 ? 24.172  27.618  -4.169  1.00 10.00 ? 427 GLU B OE1  2  
ATOM 5364   O OE2  . GLU B 2 109 ? 23.459  27.418  -6.229  1.00 10.00 ? 427 GLU B OE2  2  
ATOM 5365   H H    . GLU B 2 109 ? 20.489  24.308  -5.207  1.00 10.00 ? 427 GLU B H    2  
ATOM 5366   N N    . ARG B 2 110 ? 19.743  24.853  -1.968  1.00 10.00 ? 428 ARG B N    2  
ATOM 5367   C CA   . ARG B 2 110 ? 18.941  24.936  -0.756  1.00 10.00 ? 428 ARG B CA   2  
ATOM 5368   C C    . ARG B 2 110 ? 18.621  23.540  -0.222  1.00 10.00 ? 428 ARG B C    2  
ATOM 5369   O O    . ARG B 2 110 ? 18.764  23.274  0.967   1.00 10.00 ? 428 ARG B O    2  
ATOM 5370   C CB   . ARG B 2 110 ? 17.636  25.701  -1.013  1.00 10.00 ? 428 ARG B CB   2  
ATOM 5371   C CG   . ARG B 2 110 ? 16.717  25.769  0.199   1.00 10.00 ? 428 ARG B CG   2  
ATOM 5372   C CD   . ARG B 2 110 ? 15.286  26.113  -0.188  1.00 10.00 ? 428 ARG B CD   2  
ATOM 5373   N NE   . ARG B 2 110 ? 15.108  27.537  -0.463  1.00 10.00 ? 428 ARG B NE   2  
ATOM 5374   C CZ   . ARG B 2 110 ? 14.393  28.018  -1.479  1.00 10.00 ? 428 ARG B CZ   2  
ATOM 5375   N NH1  . ARG B 2 110 ? 13.761  27.188  -2.302  1.00 10.00 ? 428 ARG B NH1  2  
ATOM 5376   N NH2  . ARG B 2 110 ? 14.294  29.328  -1.662  1.00 10.00 ? 428 ARG B NH2  2  
ATOM 5377   H H    . ARG B 2 110 ? 19.543  25.414  -2.749  1.00 10.00 ? 428 ARG B H    2  
ATOM 5378   H HE   . ARG B 2 110 ? 15.548  28.173  0.149   1.00 10.00 ? 428 ARG B HE   2  
ATOM 5379   H HH11 . ARG B 2 110 ? 13.816  26.203  -2.161  1.00 10.00 ? 428 ARG B HH11 2  
ATOM 5380   H HH12 . ARG B 2 110 ? 13.226  27.549  -3.074  1.00 10.00 ? 428 ARG B HH12 2  
ATOM 5381   H HH21 . ARG B 2 110 ? 14.757  29.963  -1.030  1.00 10.00 ? 428 ARG B HH21 2  
ATOM 5382   H HH22 . ARG B 2 110 ? 13.764  29.692  -2.434  1.00 10.00 ? 428 ARG B HH22 2  
ATOM 5383   N N    . PHE B 2 111 ? 18.207  22.652  -1.114  1.00 10.00 ? 429 PHE B N    2  
ATOM 5384   C CA   . PHE B 2 111 ? 17.874  21.287  -0.743  1.00 10.00 ? 429 PHE B CA   2  
ATOM 5385   C C    . PHE B 2 111 ? 19.080  20.540  -0.170  1.00 10.00 ? 429 PHE B C    2  
ATOM 5386   O O    . PHE B 2 111 ? 18.958  19.847  0.842   1.00 10.00 ? 429 PHE B O    2  
ATOM 5387   C CB   . PHE B 2 111 ? 17.306  20.531  -1.948  1.00 10.00 ? 429 PHE B CB   2  
ATOM 5388   C CG   . PHE B 2 111 ? 16.291  19.480  -1.592  1.00 10.00 ? 429 PHE B CG   2  
ATOM 5389   C CD1  . PHE B 2 111 ? 14.983  19.831  -1.301  1.00 10.00 ? 429 PHE B CD1  2  
ATOM 5390   C CD2  . PHE B 2 111 ? 16.644  18.141  -1.553  1.00 10.00 ? 429 PHE B CD2  2  
ATOM 5391   C CE1  . PHE B 2 111 ? 14.047  18.866  -0.978  1.00 10.00 ? 429 PHE B CE1  2  
ATOM 5392   C CE2  . PHE B 2 111 ? 15.714  17.169  -1.230  1.00 10.00 ? 429 PHE B CE2  2  
ATOM 5393   C CZ   . PHE B 2 111 ? 14.413  17.532  -0.942  1.00 10.00 ? 429 PHE B CZ   2  
ATOM 5394   H H    . PHE B 2 111 ? 18.102  22.929  -2.051  1.00 10.00 ? 429 PHE B H    2  
ATOM 5395   N N    . VAL B 2 112 ? 20.251  20.708  -0.788  1.00 10.00 ? 430 VAL B N    2  
ATOM 5396   C CA   . VAL B 2 112 ? 21.460  20.024  -0.343  1.00 10.00 ? 430 VAL B CA   2  
ATOM 5397   C C    . VAL B 2 112 ? 21.988  20.615  0.962   1.00 10.00 ? 430 VAL B C    2  
ATOM 5398   O O    . VAL B 2 112 ? 22.350  19.878  1.882   1.00 10.00 ? 430 VAL B O    2  
ATOM 5399   C CB   . VAL B 2 112 ? 22.565  20.068  -1.424  1.00 10.00 ? 430 VAL B CB   2  
ATOM 5400   C CG1  . VAL B 2 112 ? 23.851  19.417  -0.929  1.00 10.00 ? 430 VAL B CG1  2  
ATOM 5401   C CG2  . VAL B 2 112 ? 22.088  19.392  -2.699  1.00 10.00 ? 430 VAL B CG2  2  
ATOM 5402   H H    . VAL B 2 112 ? 20.334  21.337  -1.541  1.00 10.00 ? 430 VAL B H    2  
ATOM 5403   N N    . GLU B 2 113 ? 22.027  21.944  1.047   1.00 10.00 ? 431 GLU B N    2  
ATOM 5404   C CA   . GLU B 2 113 ? 22.515  22.606  2.250   1.00 10.00 ? 431 GLU B CA   2  
ATOM 5405   C C    . GLU B 2 113 ? 21.624  22.281  3.443   1.00 10.00 ? 431 GLU B C    2  
ATOM 5406   O O    . GLU B 2 113 ? 22.101  22.177  4.570   1.00 10.00 ? 431 GLU B O    2  
ATOM 5407   C CB   . GLU B 2 113 ? 22.685  24.117  2.060   1.00 10.00 ? 431 GLU B CB   2  
ATOM 5408   C CG   . GLU B 2 113 ? 21.397  24.888  1.849   1.00 10.00 ? 431 GLU B CG   2  
ATOM 5409   C CD   . GLU B 2 113 ? 21.622  26.383  1.853   1.00 10.00 ? 431 GLU B CD   2  
ATOM 5410   O OE1  . GLU B 2 113 ? 22.202  26.906  0.879   1.00 10.00 ? 431 GLU B OE1  2  
ATOM 5411   O OE2  . GLU B 2 113 ? 21.226  27.043  2.832   1.00 10.00 ? 431 GLU B OE2  2  
ATOM 5412   H H    . GLU B 2 113 ? 21.715  22.490  0.286   1.00 10.00 ? 431 GLU B H    2  
ATOM 5413   N N    . GLU B 2 114 ? 20.339  22.105  3.178   1.00 10.00 ? 432 GLU B N    2  
ATOM 5414   C CA   . GLU B 2 114 ? 19.383  21.749  4.221   1.00 10.00 ? 432 GLU B CA   2  
ATOM 5415   C C    . GLU B 2 114 ? 19.702  20.345  4.728   1.00 10.00 ? 432 GLU B C    2  
ATOM 5416   O O    . GLU B 2 114 ? 19.708  20.089  5.933   1.00 10.00 ? 432 GLU B O    2  
ATOM 5417   C CB   . GLU B 2 114 ? 17.955  21.795  3.677   1.00 10.00 ? 432 GLU B CB   2  
ATOM 5418   C CG   . GLU B 2 114 ? 16.893  21.386  4.684   1.00 10.00 ? 432 GLU B CG   2  
ATOM 5419   C CD   . GLU B 2 114 ? 16.840  22.310  5.885   1.00 10.00 ? 432 GLU B CD   2  
ATOM 5420   O OE1  . GLU B 2 114 ? 16.363  23.449  5.737   1.00 10.00 ? 432 GLU B OE1  2  
ATOM 5421   O OE2  . GLU B 2 114 ? 17.257  21.897  6.983   1.00 10.00 ? 432 GLU B OE2  2  
ATOM 5422   H H    . GLU B 2 114 ? 20.014  22.231  2.258   1.00 10.00 ? 432 GLU B H    2  
ATOM 5423   N N    . CYS B 2 115 ? 19.938  19.439  3.789   1.00 10.00 ? 433 CYS B N    2  
ATOM 5424   C CA   . CYS B 2 115 ? 20.283  18.065  4.125   1.00 10.00 ? 433 CYS B CA   2  
ATOM 5425   C C    . CYS B 2 115 ? 21.537  18.012  5.003   1.00 10.00 ? 433 CYS B C    2  
ATOM 5426   O O    . CYS B 2 115 ? 21.511  17.404  6.077   1.00 10.00 ? 433 CYS B O    2  
ATOM 5427   C CB   . CYS B 2 115 ? 20.476  17.225  2.860   1.00 10.00 ? 433 CYS B CB   2  
ATOM 5428   S SG   . CYS B 2 115 ? 18.986  17.047  1.851   1.00 10.00 ? 433 CYS B SG   2  
ATOM 5429   H H    . CYS B 2 115 ? 19.846  19.689  2.847   1.00 10.00 ? 433 CYS B H    2  
ATOM 5430   H HG   . CYS B 2 115 ? 18.648  18.253  1.410   1.00 10.00 ? 433 CYS B HG   2  
ATOM 5431   N N    . PHE B 2 116 ? 22.626  18.643  4.552   1.00 10.00 ? 434 PHE B N    2  
ATOM 5432   C CA   . PHE B 2 116 ? 23.871  18.681  5.317   1.00 10.00 ? 434 PHE B CA   2  
ATOM 5433   C C    . PHE B 2 116 ? 23.669  19.322  6.684   1.00 10.00 ? 434 PHE B C    2  
ATOM 5434   O O    . PHE B 2 116 ? 24.267  18.904  7.672   1.00 10.00 ? 434 PHE B O    2  
ATOM 5435   C CB   . PHE B 2 116 ? 24.933  19.466  4.538   1.00 10.00 ? 434 PHE B CB   2  
ATOM 5436   C CG   . PHE B 2 116 ? 26.156  19.819  5.345   1.00 10.00 ? 434 PHE B CG   2  
ATOM 5437   C CD1  . PHE B 2 116 ? 27.029  18.832  5.767   1.00 10.00 ? 434 PHE B CD1  2  
ATOM 5438   C CD2  . PHE B 2 116 ? 26.429  21.137  5.682   1.00 10.00 ? 434 PHE B CD2  2  
ATOM 5439   C CE1  . PHE B 2 116 ? 28.152  19.146  6.507   1.00 10.00 ? 434 PHE B CE1  2  
ATOM 5440   C CE2  . PHE B 2 116 ? 27.551  21.459  6.421   1.00 10.00 ? 434 PHE B CE2  2  
ATOM 5441   C CZ   . PHE B 2 116 ? 28.414  20.463  6.834   1.00 10.00 ? 434 PHE B CZ   2  
ATOM 5442   H H    . PHE B 2 116 ? 22.640  19.059  3.664   1.00 10.00 ? 434 PHE B H    2  
ATOM 5443   N N    . GLN B 2 117 ? 22.836  20.357  6.707   1.00 10.00 ? 435 GLN B N    2  
ATOM 5444   C CA   . GLN B 2 117 ? 22.545  21.074  7.948   1.00 10.00 ? 435 GLN B CA   2  
ATOM 5445   C C    . GLN B 2 117 ? 22.218  20.147  9.114   1.00 10.00 ? 435 GLN B C    2  
ATOM 5446   O O    . GLN B 2 117 ? 22.505  20.499  10.266  1.00 10.00 ? 435 GLN B O    2  
ATOM 5447   C CB   . GLN B 2 117 ? 21.411  22.083  7.763   1.00 10.00 ? 435 GLN B CB   2  
ATOM 5448   C CG   . GLN B 2 117 ? 21.863  23.490  7.406   1.00 10.00 ? 435 GLN B CG   2  
ATOM 5449   C CD   . GLN B 2 117 ? 20.697  24.451  7.250   1.00 10.00 ? 435 GLN B CD   2  
ATOM 5450   O OE1  . GLN B 2 117 ? 20.294  25.120  8.203   1.00 10.00 ? 435 GLN B OE1  2  
ATOM 5451   N NE2  . GLN B 2 117 ? 20.152  24.528  6.047   1.00 10.00 ? 435 GLN B NE2  2  
ATOM 5452   H H    . GLN B 2 117 ? 22.561  20.732  5.835   1.00 10.00 ? 435 GLN B H    2  
ATOM 5453   H HE21 . GLN B 2 117 ? 20.526  23.971  5.333   1.00 10.00 ? 435 GLN B HE21 2  
ATOM 5454   H HE22 . GLN B 2 117 ? 19.394  25.141  5.918   1.00 10.00 ? 435 GLN B HE22 2  
ATOM 5455   N N    . ALA B 2 118 ? 21.620  18.972  8.881   1.00 10.00 ? 436 ALA B N    2  
ATOM 5456   C CA   . ALA B 2 118 ? 21.348  18.128  10.049  1.00 10.00 ? 436 ALA B CA   2  
ATOM 5457   C C    . ALA B 2 118 ? 22.565  17.312  10.470  1.00 10.00 ? 436 ALA B C    2  
ATOM 5458   O O    . ALA B 2 118 ? 22.964  17.404  11.629  1.00 10.00 ? 436 ALA B O    2  
ATOM 5459   C CB   . ALA B 2 118 ? 20.148  17.238  9.828   1.00 10.00 ? 436 ALA B CB   2  
ATOM 5460   H H    . ALA B 2 118 ? 21.267  18.764  7.982   1.00 10.00 ? 436 ALA B H    2  
ATOM 5461   N N    . GLY B 2 119 ? 23.227  16.565  9.570   1.00 10.00 ? 437 GLY B N    2  
ATOM 5462   C CA   . GLY B 2 119 ? 24.433  15.888  10.006  1.00 10.00 ? 437 GLY B CA   2  
ATOM 5463   C C    . GLY B 2 119 ? 24.583  14.525  9.313   1.00 10.00 ? 437 GLY B C    2  
ATOM 5464   O O    . GLY B 2 119 ? 25.700  14.030  9.158   1.00 10.00 ? 437 GLY B O    2  
ATOM 5465   H H    . GLY B 2 119 ? 22.811  16.183  8.793   1.00 10.00 ? 437 GLY B H    2  
ATOM 5466   N N    . ILE B 2 120 ? 23.446  13.889  8.962   1.00 10.00 ? 438 ILE B N    2  
ATOM 5467   C CA   . ILE B 2 120 ? 23.422  12.586  8.256   1.00 10.00 ? 438 ILE B CA   2  
ATOM 5468   C C    . ILE B 2 120 ? 24.421  12.471  7.092   1.00 10.00 ? 438 ILE B C    2  
ATOM 5469   O O    . ILE B 2 120 ? 24.821  11.367  6.719   1.00 10.00 ? 438 ILE B O    2  
ATOM 5470   C CB   . ILE B 2 120 ? 22.008  12.294  7.706   1.00 10.00 ? 438 ILE B CB   2  
ATOM 5471   C CG1  . ILE B 2 120 ? 21.552  13.440  6.792   1.00 10.00 ? 438 ILE B CG1  2  
ATOM 5472   C CG2  . ILE B 2 120 ? 21.026  12.092  8.851   1.00 10.00 ? 438 ILE B CG2  2  
ATOM 5473   C CD1  . ILE B 2 120 ? 20.152  13.281  6.236   1.00 10.00 ? 438 ILE B CD1  2  
ATOM 5474   H H    . ILE B 2 120 ? 22.589  14.241  9.303   1.00 10.00 ? 438 ILE B H    2  
ATOM 5475   N N    . ILE B 2 121 ? 24.823  13.605  6.521   1.00 10.00 ? 439 ILE B N    2  
ATOM 5476   C CA   . ILE B 2 121 ? 25.759  13.613  5.401   1.00 10.00 ? 439 ILE B CA   2  
ATOM 5477   C C    . ILE B 2 121 ? 26.842  14.663  5.630   1.00 10.00 ? 439 ILE B C    2  
ATOM 5478   O O    . ILE B 2 121 ? 26.545  15.795  6.022   1.00 10.00 ? 439 ILE B O    2  
ATOM 5479   C CB   . ILE B 2 121 ? 25.058  13.884  4.047   1.00 10.00 ? 439 ILE B CB   2  
ATOM 5480   C CG1  . ILE B 2 121 ? 24.261  15.193  4.079   1.00 10.00 ? 439 ILE B CG1  2  
ATOM 5481   C CG2  . ILE B 2 121 ? 24.157  12.717  3.659   1.00 10.00 ? 439 ILE B CG2  2  
ATOM 5482   C CD1  . ILE B 2 121 ? 23.729  15.624  2.730   1.00 10.00 ? 439 ILE B CD1  2  
ATOM 5483   H H    . ILE B 2 121 ? 24.522  14.458  6.892   1.00 10.00 ? 439 ILE B H    2  
ATOM 5484   N N    . SER B 2 122 ? 28.099  14.289  5.429   1.00 10.00 ? 440 SER B N    2  
ATOM 5485   C CA   . SER B 2 122 ? 29.210  15.204  5.608   1.00 10.00 ? 440 SER B CA   2  
ATOM 5486   C C    . SER B 2 122 ? 29.440  16.061  4.365   1.00 10.00 ? 440 SER B C    2  
ATOM 5487   O O    . SER B 2 122 ? 28.670  16.007  3.402   1.00 10.00 ? 440 SER B O    2  
ATOM 5488   C CB   . SER B 2 122 ? 30.462  14.398  5.940   1.00 10.00 ? 440 SER B CB   2  
ATOM 5489   O OG   . SER B 2 122 ? 30.407  13.128  5.309   1.00 10.00 ? 440 SER B OG   2  
ATOM 5490   H H    . SER B 2 122 ? 28.309  13.361  5.194   1.00 10.00 ? 440 SER B H    2  
ATOM 5491   H HG   . SER B 2 122 ? 31.048  12.537  5.723   1.00 10.00 ? 440 SER B HG   2  
ATOM 5492   N N    . LYS B 2 123 ? 30.522  16.834  4.387   1.00 10.00 ? 441 LYS B N    2  
ATOM 5493   C CA   . LYS B 2 123 ? 30.865  17.724  3.287   1.00 10.00 ? 441 LYS B CA   2  
ATOM 5494   C C    . LYS B 2 123 ? 31.283  16.962  2.035   1.00 10.00 ? 441 LYS B C    2  
ATOM 5495   O O    . LYS B 2 123 ? 31.190  17.491  0.931   1.00 10.00 ? 441 LYS B O    2  
ATOM 5496   C CB   . LYS B 2 123 ? 31.968  18.694  3.713   1.00 10.00 ? 441 LYS B CB   2  
ATOM 5497   C CG   . LYS B 2 123 ? 31.567  19.608  4.860   1.00 10.00 ? 441 LYS B CG   2  
ATOM 5498   C CD   . LYS B 2 123 ? 32.756  20.381  5.409   1.00 10.00 ? 441 LYS B CD   2  
ATOM 5499   C CE   . LYS B 2 123 ? 33.825  19.446  5.953   1.00 10.00 ? 441 LYS B CE   2  
ATOM 5500   N NZ   . LYS B 2 123 ? 34.860  20.171  6.735   1.00 10.00 ? 441 LYS B NZ   2  
ATOM 5501   H H    . LYS B 2 123 ? 31.118  16.791  5.163   1.00 10.00 ? 441 LYS B H    2  
ATOM 5502   H HZ1  . LYS B 2 123 ? 34.501  20.400  7.685   1.00 10.00 ? 441 LYS B HZ1  2  
ATOM 5503   H HZ2  . LYS B 2 123 ? 35.125  21.054  6.251   1.00 10.00 ? 441 LYS B HZ2  2  
ATOM 5504   H HZ3  . LYS B 2 123 ? 35.709  19.579  6.833   1.00 10.00 ? 441 LYS B HZ3  2  
ATOM 5505   N N    . GLN B 2 124 ? 31.733  15.721  2.213   1.00 10.00 ? 442 GLN B N    2  
ATOM 5506   C CA   . GLN B 2 124 ? 32.175  14.890  1.090   1.00 10.00 ? 442 GLN B CA   2  
ATOM 5507   C C    . GLN B 2 124 ? 31.100  14.782  0.007   1.00 10.00 ? 442 GLN B C    2  
ATOM 5508   O O    . GLN B 2 124 ? 31.392  14.916  -1.181  1.00 10.00 ? 442 GLN B O    2  
ATOM 5509   C CB   . GLN B 2 124 ? 32.587  13.495  1.565   1.00 10.00 ? 442 GLN B CB   2  
ATOM 5510   C CG   . GLN B 2 124 ? 33.441  12.732  0.561   1.00 10.00 ? 442 GLN B CG   2  
ATOM 5511   C CD   . GLN B 2 124 ? 33.379  11.230  0.757   1.00 10.00 ? 442 GLN B CD   2  
ATOM 5512   O OE1  . GLN B 2 124 ? 32.549  10.548  0.160   1.00 10.00 ? 442 GLN B OE1  2  
ATOM 5513   N NE2  . GLN B 2 124 ? 34.259  10.701  1.589   1.00 10.00 ? 442 GLN B NE2  2  
ATOM 5514   H H    . GLN B 2 124 ? 31.780  15.359  3.124   1.00 10.00 ? 442 GLN B H    2  
ATOM 5515   H HE21 . GLN B 2 124 ? 34.898  11.302  2.031   1.00 10.00 ? 442 GLN B HE21 2  
ATOM 5516   H HE22 . GLN B 2 124 ? 34.232  9.731   1.741   1.00 10.00 ? 442 GLN B HE22 2  
ATOM 5517   N N    . LEU B 2 125 ? 29.858  14.546  0.421   1.00 10.00 ? 443 LEU B N    2  
ATOM 5518   C CA   . LEU B 2 125 ? 28.750  14.429  -0.523  1.00 10.00 ? 443 LEU B CA   2  
ATOM 5519   C C    . LEU B 2 125 ? 28.450  15.780  -1.174  1.00 10.00 ? 443 LEU B C    2  
ATOM 5520   O O    . LEU B 2 125 ? 28.181  15.853  -2.371  1.00 10.00 ? 443 LEU B O    2  
ATOM 5521   C CB   . LEU B 2 125 ? 27.498  13.885  0.176   1.00 10.00 ? 443 LEU B CB   2  
ATOM 5522   C CG   . LEU B 2 125 ? 26.275  13.654  -0.716  1.00 10.00 ? 443 LEU B CG   2  
ATOM 5523   C CD1  . LEU B 2 125 ? 26.589  12.660  -1.824  1.00 10.00 ? 443 LEU B CD1  2  
ATOM 5524   C CD2  . LEU B 2 125 ? 25.092  13.176  0.111   1.00 10.00 ? 443 LEU B CD2  2  
ATOM 5525   H H    . LEU B 2 125 ? 29.684  14.447  1.379   1.00 10.00 ? 443 LEU B H    2  
ATOM 5526   N N    . ARG B 2 126 ? 28.519  16.844  -0.377  1.00 10.00 ? 444 ARG B N    2  
ATOM 5527   C CA   . ARG B 2 126 ? 28.273  18.202  -0.869  1.00 10.00 ? 444 ARG B CA   2  
ATOM 5528   C C    . ARG B 2 126 ? 29.349  18.621  -1.872  1.00 10.00 ? 444 ARG B C    2  
ATOM 5529   O O    . ARG B 2 126 ? 29.119  19.463  -2.743  1.00 10.00 ? 444 ARG B O    2  
ATOM 5530   C CB   . ARG B 2 126 ? 28.183  19.216  0.278   1.00 10.00 ? 444 ARG B CB   2  
ATOM 5531   C CG   . ARG B 2 126 ? 27.525  20.525  -0.137  1.00 10.00 ? 444 ARG B CG   2  
ATOM 5532   C CD   . ARG B 2 126 ? 27.657  21.605  0.924   1.00 10.00 ? 444 ARG B CD   2  
ATOM 5533   N NE   . ARG B 2 126 ? 27.068  22.863  0.465   1.00 10.00 ? 444 ARG B NE   2  
ATOM 5534   C CZ   . ARG B 2 126 ? 27.152  24.021  1.128   1.00 10.00 ? 444 ARG B CZ   2  
ATOM 5535   N NH1  . ARG B 2 126 ? 27.806  24.080  2.285   1.00 10.00 ? 444 ARG B NH1  2  
ATOM 5536   N NH2  . ARG B 2 126 ? 26.571  25.114  0.635   1.00 10.00 ? 444 ARG B NH2  2  
ATOM 5537   H H    . ARG B 2 126 ? 28.732  16.712  0.569   1.00 10.00 ? 444 ARG B H    2  
ATOM 5538   H HE   . ARG B 2 126 ? 26.585  22.846  -0.386  1.00 10.00 ? 444 ARG B HE   2  
ATOM 5539   H HH11 . ARG B 2 126 ? 28.243  23.260  2.668   1.00 10.00 ? 444 ARG B HH11 2  
ATOM 5540   H HH12 . ARG B 2 126 ? 27.853  24.949  2.791   1.00 10.00 ? 444 ARG B HH12 2  
ATOM 5541   H HH21 . ARG B 2 126 ? 26.055  25.076  -0.228  1.00 10.00 ? 444 ARG B HH21 2  
ATOM 5542   H HH22 . ARG B 2 126 ? 26.661  25.993  1.118   1.00 10.00 ? 444 ARG B HH22 2  
ATOM 5543   N N    . ASP B 2 127 ? 30.531  18.030  -1.730  1.00 10.00 ? 445 ASP B N    2  
ATOM 5544   C CA   . ASP B 2 127 ? 31.662  18.316  -2.610  1.00 10.00 ? 445 ASP B CA   2  
ATOM 5545   C C    . ASP B 2 127 ? 31.378  17.883  -4.048  1.00 10.00 ? 445 ASP B C    2  
ATOM 5546   O O    . ASP B 2 127 ? 31.937  18.432  -5.003  1.00 10.00 ? 445 ASP B O    2  
ATOM 5547   C CB   . ASP B 2 127 ? 32.913  17.608  -2.090  1.00 10.00 ? 445 ASP B CB   2  
ATOM 5548   C CG   . ASP B 2 127 ? 34.180  18.081  -2.765  1.00 10.00 ? 445 ASP B CG   2  
ATOM 5549   O OD1  . ASP B 2 127 ? 34.662  19.183  -2.419  1.00 10.00 ? 445 ASP B OD1  2  
ATOM 5550   O OD2  . ASP B 2 127 ? 34.708  17.346  -3.626  1.00 10.00 ? 445 ASP B OD2  2  
ATOM 5551   H H    . ASP B 2 127 ? 30.637  17.377  -1.002  1.00 10.00 ? 445 ASP B H    2  
ATOM 5552   N N    . LEU B 2 128 ? 30.493  16.907  -4.199  1.00 10.00 ? 446 LEU B N    2  
ATOM 5553   C CA   . LEU B 2 128 ? 30.118  16.402  -5.515  1.00 10.00 ? 446 LEU B CA   2  
ATOM 5554   C C    . LEU B 2 128 ? 28.914  17.171  -6.053  1.00 10.00 ? 446 LEU B C    2  
ATOM 5555   O O    . LEU B 2 128 ? 28.376  16.853  -7.115  1.00 10.00 ? 446 LEU B O    2  
ATOM 5556   C CB   . LEU B 2 128 ? 29.785  14.909  -5.427  1.00 10.00 ? 446 LEU B CB   2  
ATOM 5557   C CG   . LEU B 2 128 ? 30.888  14.007  -4.865  1.00 10.00 ? 446 LEU B CG   2  
ATOM 5558   C CD1  . LEU B 2 128 ? 30.307  12.675  -4.409  1.00 10.00 ? 446 LEU B CD1  2  
ATOM 5559   C CD2  . LEU B 2 128 ? 31.979  13.787  -5.902  1.00 10.00 ? 446 LEU B CD2  2  
ATOM 5560   H H    . LEU B 2 128 ? 30.077  16.512  -3.402  1.00 10.00 ? 446 LEU B H    2  
ATOM 5561   N N    . CYS B 2 129 ? 28.507  18.187  -5.308  1.00 10.00 ? 447 CYS B N    2  
ATOM 5562   C CA   . CYS B 2 129 ? 27.372  19.013  -5.678  1.00 10.00 ? 447 CYS B CA   2  
ATOM 5563   C C    . CYS B 2 129 ? 27.849  20.331  -6.271  1.00 10.00 ? 447 CYS B C    2  
ATOM 5564   O O    . CYS B 2 129 ? 28.751  20.973  -5.726  1.00 10.00 ? 447 CYS B O    2  
ATOM 5565   C CB   . CYS B 2 129 ? 26.503  19.291  -4.448  1.00 10.00 ? 447 CYS B CB   2  
ATOM 5566   S SG   . CYS B 2 129 ? 24.932  20.114  -4.798  1.00 10.00 ? 447 CYS B SG   2  
ATOM 5567   H H    . CYS B 2 129 ? 28.998  18.398  -4.482  1.00 10.00 ? 447 CYS B H    2  
ATOM 5568   H HG   . CYS B 2 129 ? 23.958  19.305  -4.403  1.00 10.00 ? 447 CYS B HG   2  
ATOM 5569   N N    . PRO B 2 130 ? 27.266  20.745  -7.404  1.00 10.00 ? 448 PRO B N    2  
ATOM 5570   C CA   . PRO B 2 130 ? 27.626  22.002  -8.063  1.00 10.00 ? 448 PRO B CA   2  
ATOM 5571   C C    . PRO B 2 130 ? 27.210  23.220  -7.231  1.00 10.00 ? 448 PRO B C    2  
ATOM 5572   O O    . PRO B 2 130 ? 26.088  23.719  -7.359  1.00 10.00 ? 448 PRO B O    2  
ATOM 5573   C CB   . PRO B 2 130 ? 26.837  21.972  -9.380  1.00 10.00 ? 448 PRO B CB   2  
ATOM 5574   C CG   . PRO B 2 130 ? 26.369  20.563  -9.532  1.00 10.00 ? 448 PRO B CG   2  
ATOM 5575   C CD   . PRO B 2 130 ? 26.226  20.018  -8.142  1.00 10.00 ? 448 PRO B CD   2  
ATOM 5576   N N    . SER B 2 131 ? 28.107  23.675  -6.368  1.00 10.00 ? 449 SER B N    2  
ATOM 5577   C CA   . SER B 2 131 ? 27.838  24.828  -5.523  1.00 10.00 ? 449 SER B CA   2  
ATOM 5578   C C    . SER B 2 131 ? 28.542  26.064  -6.077  1.00 10.00 ? 449 SER B C    2  
ATOM 5579   O O    . SER B 2 131 ? 28.299  27.175  -5.564  1.00 10.00 ? 449 SER B O    2  
ATOM 5580   C CB   . SER B 2 131 ? 28.298  24.548  -4.091  1.00 10.00 ? 449 SER B CB   2  
ATOM 5581   O OG   . SER B 2 131 ? 27.862  23.266  -3.664  1.00 10.00 ? 449 SER B OG   2  
ATOM 5582   O OXT  . SER B 2 131 ? 29.344  25.917  -7.030  1.00 10.00 ? 449 SER B OXT  2  
ATOM 5583   H H    . SER B 2 131 ? 28.974  23.227  -6.298  1.00 10.00 ? 449 SER B H    2  
ATOM 5584   H HG   . SER B 2 131 ? 27.686  22.718  -4.436  1.00 10.00 ? 449 SER B HG   2  
ATOM 5585   N N    . GLY A 1 1   ? -30.206 -6.533  6.511   1.00 10.00 ? 156 GLY A N    3  
ATOM 5586   C CA   . GLY A 1 1   ? -30.450 -5.990  7.867   1.00 10.00 ? 156 GLY A CA   3  
ATOM 5587   C C    . GLY A 1 1   ? -29.544 -6.622  8.897   1.00 10.00 ? 156 GLY A C    3  
ATOM 5588   O O    . GLY A 1 1   ? -28.337 -6.726  8.685   1.00 10.00 ? 156 GLY A O    3  
ATOM 5589   H H1   . GLY A 1 1   ? -29.181 -6.690  6.366   1.00 10.00 ? 156 GLY A H1   3  
ATOM 5590   H H2   . GLY A 1 1   ? -30.545 -5.863  5.794   1.00 10.00 ? 156 GLY A H2   3  
ATOM 5591   H H3   . GLY A 1 1   ? -30.704 -7.436  6.390   1.00 10.00 ? 156 GLY A H3   3  
ATOM 5592   N N    . LEU A 1 2   ? -30.114 -7.040  10.015  1.00 10.00 ? 157 LEU A N    3  
ATOM 5593   C CA   . LEU A 1 2   ? -29.338 -7.673  11.069  1.00 10.00 ? 157 LEU A CA   3  
ATOM 5594   C C    . LEU A 1 2   ? -29.350 -9.187  10.894  1.00 10.00 ? 157 LEU A C    3  
ATOM 5595   O O    . LEU A 1 2   ? -30.416 -9.799  10.803  1.00 10.00 ? 157 LEU A O    3  
ATOM 5596   C CB   . LEU A 1 2   ? -29.880 -7.279  12.443  1.00 10.00 ? 157 LEU A CB   3  
ATOM 5597   C CG   . LEU A 1 2   ? -29.896 -5.780  12.752  1.00 10.00 ? 157 LEU A CG   3  
ATOM 5598   C CD1  . LEU A 1 2   ? -30.454 -5.528  14.139  1.00 10.00 ? 157 LEU A CD1  3  
ATOM 5599   C CD2  . LEU A 1 2   ? -28.503 -5.187  12.622  1.00 10.00 ? 157 LEU A CD2  3  
ATOM 5600   H H    . LEU A 1 2   ? -31.083 -6.927  10.134  1.00 10.00 ? 157 LEU A H    3  
ATOM 5601   N N    . PRO A 1 3   ? -28.160 -9.801  10.836  1.00 10.00 ? 158 PRO A N    3  
ATOM 5602   C CA   . PRO A 1 3   ? -28.011 -11.247 10.651  1.00 10.00 ? 158 PRO A CA   3  
ATOM 5603   C C    . PRO A 1 3   ? -28.410 -12.044 11.888  1.00 10.00 ? 158 PRO A C    3  
ATOM 5604   O O    . PRO A 1 3   ? -28.320 -11.559 13.017  1.00 10.00 ? 158 PRO A O    3  
ATOM 5605   C CB   . PRO A 1 3   ? -26.510 -11.428 10.382  1.00 10.00 ? 158 PRO A CB   3  
ATOM 5606   C CG   . PRO A 1 3   ? -25.962 -10.056 10.180  1.00 10.00 ? 158 PRO A CG   3  
ATOM 5607   C CD   . PRO A 1 3   ? -26.858 -9.135  10.949  1.00 10.00 ? 158 PRO A CD   3  
ATOM 5608   N N    . LEU A 1 4   ? -28.854 -13.272 11.665  1.00 10.00 ? 159 LEU A N    3  
ATOM 5609   C CA   . LEU A 1 4   ? -29.257 -14.153 12.750  1.00 10.00 ? 159 LEU A CA   3  
ATOM 5610   C C    . LEU A 1 4   ? -28.205 -15.239 12.944  1.00 10.00 ? 159 LEU A C    3  
ATOM 5611   O O    . LEU A 1 4   ? -27.661 -15.752 11.964  1.00 10.00 ? 159 LEU A O    3  
ATOM 5612   C CB   . LEU A 1 4   ? -30.623 -14.776 12.454  1.00 10.00 ? 159 LEU A CB   3  
ATOM 5613   C CG   . LEU A 1 4   ? -31.763 -13.789 12.176  1.00 10.00 ? 159 LEU A CG   3  
ATOM 5614   C CD1  . LEU A 1 4   ? -32.968 -14.514 11.606  1.00 10.00 ? 159 LEU A CD1  3  
ATOM 5615   C CD2  . LEU A 1 4   ? -32.144 -13.033 13.442  1.00 10.00 ? 159 LEU A CD2  3  
ATOM 5616   H H    . LEU A 1 4   ? -28.904 -13.599 10.740  1.00 10.00 ? 159 LEU A H    3  
ATOM 5617   N N    . ASP A 1 5   ? -27.920 -15.573 14.202  1.00 10.00 ? 160 ASP A N    3  
ATOM 5618   C CA   . ASP A 1 5   ? -26.909 -16.582 14.537  1.00 10.00 ? 160 ASP A CA   3  
ATOM 5619   C C    . ASP A 1 5   ? -25.549 -16.169 13.992  1.00 10.00 ? 160 ASP A C    3  
ATOM 5620   O O    . ASP A 1 5   ? -24.930 -16.890 13.206  1.00 10.00 ? 160 ASP A O    3  
ATOM 5621   C CB   . ASP A 1 5   ? -27.299 -17.979 14.042  1.00 10.00 ? 160 ASP A CB   3  
ATOM 5622   C CG   . ASP A 1 5   ? -28.151 -18.737 15.038  1.00 10.00 ? 160 ASP A CG   3  
ATOM 5623   O OD1  . ASP A 1 5   ? -27.587 -19.396 15.937  1.00 10.00 ? 160 ASP A OD1  3  
ATOM 5624   O OD2  . ASP A 1 5   ? -29.391 -18.685 14.929  1.00 10.00 ? 160 ASP A OD2  3  
ATOM 5625   H H    . ASP A 1 5   ? -28.398 -15.126 14.930  1.00 10.00 ? 160 ASP A H    3  
ATOM 5626   N N    . GLU A 1 6   ? -25.098 -15.001 14.430  1.00 10.00 ? 161 GLU A N    3  
ATOM 5627   C CA   . GLU A 1 6   ? -23.834 -14.428 13.985  1.00 10.00 ? 161 GLU A CA   3  
ATOM 5628   C C    . GLU A 1 6   ? -22.619 -15.290 14.325  1.00 10.00 ? 161 GLU A C    3  
ATOM 5629   O O    . GLU A 1 6   ? -21.779 -15.549 13.461  1.00 10.00 ? 161 GLU A O    3  
ATOM 5630   C CB   . GLU A 1 6   ? -23.657 -13.004 14.525  1.00 10.00 ? 161 GLU A CB   3  
ATOM 5631   C CG   . GLU A 1 6   ? -24.688 -12.006 14.016  1.00 10.00 ? 161 GLU A CG   3  
ATOM 5632   C CD   . GLU A 1 6   ? -24.290 -10.562 14.270  1.00 10.00 ? 161 GLU A CD   3  
ATOM 5633   O OE1  . GLU A 1 6   ? -23.359 -10.073 13.601  1.00 10.00 ? 161 GLU A OE1  3  
ATOM 5634   O OE2  . GLU A 1 6   ? -24.910 -9.909  15.137  1.00 10.00 ? 161 GLU A OE2  3  
ATOM 5635   H H    . GLU A 1 6   ? -25.636 -14.505 15.083  1.00 10.00 ? 161 GLU A H    3  
ATOM 5636   N N    . ARG A 1 7   ? -22.534 -15.780 15.559  1.00 10.00 ? 162 ARG A N    3  
ATOM 5637   C CA   . ARG A 1 7   ? -21.389 -16.579 15.982  1.00 10.00 ? 162 ARG A CA   3  
ATOM 5638   C C    . ARG A 1 7   ? -21.439 -17.976 15.387  1.00 10.00 ? 162 ARG A C    3  
ATOM 5639   O O    . ARG A 1 7   ? -20.414 -18.529 14.993  1.00 10.00 ? 162 ARG A O    3  
ATOM 5640   C CB   . ARG A 1 7   ? -21.349 -16.670 17.505  1.00 10.00 ? 162 ARG A CB   3  
ATOM 5641   C CG   . ARG A 1 7   ? -21.369 -15.325 18.201  1.00 10.00 ? 162 ARG A CG   3  
ATOM 5642   C CD   . ARG A 1 7   ? -20.018 -14.637 18.116  1.00 10.00 ? 162 ARG A CD   3  
ATOM 5643   N NE   . ARG A 1 7   ? -20.115 -13.210 18.418  1.00 10.00 ? 162 ARG A NE   3  
ATOM 5644   C CZ   . ARG A 1 7   ? -20.391 -12.714 19.625  1.00 10.00 ? 162 ARG A CZ   3  
ATOM 5645   N NH1  . ARG A 1 7   ? -20.579 -13.529 20.660  1.00 10.00 ? 162 ARG A NH1  3  
ATOM 5646   N NH2  . ARG A 1 7   ? -20.469 -11.403 19.801  1.00 10.00 ? 162 ARG A NH2  3  
ATOM 5647   H H    . ARG A 1 7   ? -23.259 -15.650 16.204  1.00 10.00 ? 162 ARG A H    3  
ATOM 5648   H HE   . ARG A 1 7   ? -19.967 -12.582 17.670  1.00 10.00 ? 162 ARG A HE   3  
ATOM 5649   H HH11 . ARG A 1 7   ? -20.508 -14.522 20.541  1.00 10.00 ? 162 ARG A HH11 3  
ATOM 5650   H HH12 . ARG A 1 7   ? -20.795 -13.152 21.567  1.00 10.00 ? 162 ARG A HH12 3  
ATOM 5651   H HH21 . ARG A 1 7   ? -20.317 -10.780 19.027  1.00 10.00 ? 162 ARG A HH21 3  
ATOM 5652   H HH22 . ARG A 1 7   ? -20.679 -11.027 20.706  1.00 10.00 ? 162 ARG A HH22 3  
ATOM 5653   N N    . ALA A 1 8   ? -22.639 -18.545 15.330  1.00 10.00 ? 163 ALA A N    3  
ATOM 5654   C CA   . ALA A 1 8   ? -22.825 -19.878 14.770  1.00 10.00 ? 163 ALA A CA   3  
ATOM 5655   C C    . ALA A 1 8   ? -22.403 -19.881 13.309  1.00 10.00 ? 163 ALA A C    3  
ATOM 5656   O O    . ALA A 1 8   ? -21.897 -20.880 12.792  1.00 10.00 ? 163 ALA A O    3  
ATOM 5657   C CB   . ALA A 1 8   ? -24.273 -20.316 14.906  1.00 10.00 ? 163 ALA A CB   3  
ATOM 5658   H H    . ALA A 1 8   ? -23.416 -18.056 15.675  1.00 10.00 ? 163 ALA A H    3  
ATOM 5659   N N    . PHE A 1 9   ? -22.600 -18.740 12.664  1.00 10.00 ? 164 PHE A N    3  
ATOM 5660   C CA   . PHE A 1 9   ? -22.229 -18.570 11.272  1.00 10.00 ? 164 PHE A CA   3  
ATOM 5661   C C    . PHE A 1 9   ? -20.710 -18.525 11.152  1.00 10.00 ? 164 PHE A C    3  
ATOM 5662   O O    . PHE A 1 9   ? -20.120 -19.223 10.325  1.00 10.00 ? 164 PHE A O    3  
ATOM 5663   C CB   . PHE A 1 9   ? -22.844 -17.281 10.727  1.00 10.00 ? 164 PHE A CB   3  
ATOM 5664   C CG   . PHE A 1 9   ? -22.465 -16.972 9.312   1.00 10.00 ? 164 PHE A CG   3  
ATOM 5665   C CD1  . PHE A 1 9   ? -23.041 -17.664 8.263   1.00 10.00 ? 164 PHE A CD1  3  
ATOM 5666   C CD2  . PHE A 1 9   ? -21.533 -15.986 9.033   1.00 10.00 ? 164 PHE A CD2  3  
ATOM 5667   C CE1  . PHE A 1 9   ? -22.693 -17.383 6.958   1.00 10.00 ? 164 PHE A CE1  3  
ATOM 5668   C CE2  . PHE A 1 9   ? -21.180 -15.700 7.732   1.00 10.00 ? 164 PHE A CE2  3  
ATOM 5669   C CZ   . PHE A 1 9   ? -21.762 -16.399 6.693   1.00 10.00 ? 164 PHE A CZ   3  
ATOM 5670   H H    . PHE A 1 9   ? -23.012 -17.989 13.139  1.00 10.00 ? 164 PHE A H    3  
ATOM 5671   N N    . GLU A 1 10  ? -20.081 -17.717 12.011  1.00 10.00 ? 165 GLU A N    3  
ATOM 5672   C CA   . GLU A 1 10  ? -18.628 -17.580 12.022  1.00 10.00 ? 165 GLU A CA   3  
ATOM 5673   C C    . GLU A 1 10  ? -17.975 -18.931 12.280  1.00 10.00 ? 165 GLU A C    3  
ATOM 5674   O O    . GLU A 1 10  ? -17.109 -19.368 11.527  1.00 10.00 ? 165 GLU A O    3  
ATOM 5675   C CB   . GLU A 1 10  ? -18.186 -16.618 13.134  1.00 10.00 ? 165 GLU A CB   3  
ATOM 5676   C CG   . GLU A 1 10  ? -18.592 -15.166 12.953  1.00 10.00 ? 165 GLU A CG   3  
ATOM 5677   C CD   . GLU A 1 10  ? -18.053 -14.290 14.068  1.00 10.00 ? 165 GLU A CD   3  
ATOM 5678   O OE1  . GLU A 1 10  ? -18.671 -14.248 15.155  1.00 10.00 ? 165 GLU A OE1  3  
ATOM 5679   O OE2  . GLU A 1 10  ? -16.999 -13.651 13.875  1.00 10.00 ? 165 GLU A OE2  3  
ATOM 5680   H H    . GLU A 1 10  ? -20.606 -17.208 12.665  1.00 10.00 ? 165 GLU A H    3  
ATOM 5681   N N    . LYS A 1 11  ? -18.415 -19.588 13.348  1.00 10.00 ? 166 LYS A N    3  
ATOM 5682   C CA   . LYS A 1 11  ? -17.884 -20.885 13.755  1.00 10.00 ? 166 LYS A CA   3  
ATOM 5683   C C    . LYS A 1 11  ? -17.937 -21.918 12.631  1.00 10.00 ? 166 LYS A C    3  
ATOM 5684   O O    . LYS A 1 11  ? -16.999 -22.691 12.446  1.00 10.00 ? 166 LYS A O    3  
ATOM 5685   C CB   . LYS A 1 11  ? -18.643 -21.392 14.985  1.00 10.00 ? 166 LYS A CB   3  
ATOM 5686   C CG   . LYS A 1 11  ? -18.228 -22.773 15.465  1.00 10.00 ? 166 LYS A CG   3  
ATOM 5687   C CD   . LYS A 1 11  ? -18.764 -23.055 16.859  1.00 10.00 ? 166 LYS A CD   3  
ATOM 5688   C CE   . LYS A 1 11  ? -20.285 -23.002 16.902  1.00 10.00 ? 166 LYS A CE   3  
ATOM 5689   N NZ   . LYS A 1 11  ? -20.807 -23.137 18.286  1.00 10.00 ? 166 LYS A NZ   3  
ATOM 5690   H H    . LYS A 1 11  ? -19.130 -19.180 13.890  1.00 10.00 ? 166 LYS A H    3  
ATOM 5691   H HZ1  . LYS A 1 11  ? -20.355 -22.437 18.909  1.00 10.00 ? 166 LYS A HZ1  3  
ATOM 5692   H HZ2  . LYS A 1 11  ? -20.603 -24.088 18.655  1.00 10.00 ? 166 LYS A HZ2  3  
ATOM 5693   H HZ3  . LYS A 1 11  ? -21.834 -22.984 18.302  1.00 10.00 ? 166 LYS A HZ3  3  
ATOM 5694   N N    . THR A 1 12  ? -19.029 -21.924 11.883  1.00 10.00 ? 167 THR A N    3  
ATOM 5695   C CA   . THR A 1 12  ? -19.194 -22.872 10.792  1.00 10.00 ? 167 THR A CA   3  
ATOM 5696   C C    . THR A 1 12  ? -18.303 -22.531 9.596   1.00 10.00 ? 167 THR A C    3  
ATOM 5697   O O    . THR A 1 12  ? -17.687 -23.411 9.000   1.00 10.00 ? 167 THR A O    3  
ATOM 5698   C CB   . THR A 1 12  ? -20.663 -22.940 10.329  1.00 10.00 ? 167 THR A CB   3  
ATOM 5699   O OG1  . THR A 1 12  ? -21.512 -23.178 11.464  1.00 10.00 ? 167 THR A OG1  3  
ATOM 5700   C CG2  . THR A 1 12  ? -20.851 -24.058 9.316   1.00 10.00 ? 167 THR A CG2  3  
ATOM 5701   H H    . THR A 1 12  ? -19.742 -21.278 12.072  1.00 10.00 ? 167 THR A H    3  
ATOM 5702   H HG1  . THR A 1 12  ? -21.726 -22.335 11.891  1.00 10.00 ? 167 THR A HG1  3  
ATOM 5703   N N    . LEU A 1 13  ? -18.230 -21.251 9.265   1.00 10.00 ? 168 LEU A N    3  
ATOM 5704   C CA   . LEU A 1 13  ? -17.437 -20.799 8.126   1.00 10.00 ? 168 LEU A CA   3  
ATOM 5705   C C    . LEU A 1 13  ? -15.935 -20.778 8.405   1.00 10.00 ? 168 LEU A C    3  
ATOM 5706   O O    . LEU A 1 13  ? -15.134 -20.816 7.472   1.00 10.00 ? 168 LEU A O    3  
ATOM 5707   C CB   . LEU A 1 13  ? -17.910 -19.420 7.653   1.00 10.00 ? 168 LEU A CB   3  
ATOM 5708   C CG   . LEU A 1 13  ? -18.947 -19.401 6.521   1.00 10.00 ? 168 LEU A CG   3  
ATOM 5709   C CD1  . LEU A 1 13  ? -18.380 -20.028 5.258   1.00 10.00 ? 168 LEU A CD1  3  
ATOM 5710   C CD2  . LEU A 1 13  ? -20.231 -20.103 6.937   1.00 10.00 ? 168 LEU A CD2  3  
ATOM 5711   H H    . LEU A 1 13  ? -18.726 -20.588 9.795   1.00 10.00 ? 168 LEU A H    3  
ATOM 5712   N N    . THR A 1 14  ? -15.560 -20.720 9.679   1.00 10.00 ? 169 THR A N    3  
ATOM 5713   C CA   . THR A 1 14  ? -14.148 -20.678 10.070  1.00 10.00 ? 169 THR A CA   3  
ATOM 5714   C C    . THR A 1 14  ? -13.289 -21.772 9.411   1.00 10.00 ? 169 THR A C    3  
ATOM 5715   O O    . THR A 1 14  ? -12.366 -21.452 8.661   1.00 10.00 ? 169 THR A O    3  
ATOM 5716   C CB   . THR A 1 14  ? -13.954 -20.667 11.603  1.00 10.00 ? 169 THR A CB   3  
ATOM 5717   O OG1  . THR A 1 14  ? -14.583 -19.503 12.155  1.00 10.00 ? 169 THR A OG1  3  
ATOM 5718   C CG2  . THR A 1 14  ? -12.477 -20.645 11.962  1.00 10.00 ? 169 THR A CG2  3  
ATOM 5719   H H    . THR A 1 14  ? -16.249 -20.699 10.379  1.00 10.00 ? 169 THR A H    3  
ATOM 5720   H HG1  . THR A 1 14  ? -15.509 -19.474 11.873  1.00 10.00 ? 169 THR A HG1  3  
ATOM 5721   N N    . PRO A 1 15  ? -13.583 -23.071 9.650   1.00 10.00 ? 170 PRO A N    3  
ATOM 5722   C CA   . PRO A 1 15  ? -12.801 -24.170 9.066   1.00 10.00 ? 170 PRO A CA   3  
ATOM 5723   C C    . PRO A 1 15  ? -12.775 -24.099 7.540   1.00 10.00 ? 170 PRO A C    3  
ATOM 5724   O O    . PRO A 1 15  ? -11.725 -24.257 6.918   1.00 10.00 ? 170 PRO A O    3  
ATOM 5725   C CB   . PRO A 1 15  ? -13.532 -25.438 9.535   1.00 10.00 ? 170 PRO A CB   3  
ATOM 5726   C CG   . PRO A 1 15  ? -14.876 -24.974 9.986   1.00 10.00 ? 170 PRO A CG   3  
ATOM 5727   C CD   . PRO A 1 15  ? -14.677 -23.579 10.496  1.00 10.00 ? 170 PRO A CD   3  
ATOM 5728   N N    . ILE A 1 16  ? -13.946 -23.854 6.968   1.00 10.00 ? 171 ILE A N    3  
ATOM 5729   C CA   . ILE A 1 16  ? -14.119 -23.748 5.519   1.00 10.00 ? 171 ILE A CA   3  
ATOM 5730   C C    . ILE A 1 16  ? -13.126 -22.772 4.883   1.00 10.00 ? 171 ILE A C    3  
ATOM 5731   O O    . ILE A 1 16  ? -12.397 -23.131 3.955   1.00 10.00 ? 171 ILE A O    3  
ATOM 5732   C CB   . ILE A 1 16  ? -15.560 -23.318 5.165   1.00 10.00 ? 171 ILE A CB   3  
ATOM 5733   C CG1  . ILE A 1 16  ? -16.563 -24.359 5.677   1.00 10.00 ? 171 ILE A CG1  3  
ATOM 5734   C CG2  . ILE A 1 16  ? -15.717 -23.108 3.665   1.00 10.00 ? 171 ILE A CG2  3  
ATOM 5735   C CD1  . ILE A 1 16  ? -18.012 -23.940 5.543   1.00 10.00 ? 171 ILE A CD1  3  
ATOM 5736   H H    . ILE A 1 16  ? -14.731 -23.775 7.547   1.00 10.00 ? 171 ILE A H    3  
ATOM 5737   N N    . ILE A 1 17  ? -13.091 -21.546 5.389   1.00 10.00 ? 172 ILE A N    3  
ATOM 5738   C CA   . ILE A 1 17  ? -12.194 -20.527 4.856   1.00 10.00 ? 172 ILE A CA   3  
ATOM 5739   C C    . ILE A 1 17  ? -10.728 -20.834 5.189   1.00 10.00 ? 172 ILE A C    3  
ATOM 5740   O O    . ILE A 1 17  ? -9.836  -20.589 4.380   1.00 10.00 ? 172 ILE A O    3  
ATOM 5741   C CB   . ILE A 1 17  ? -12.579 -19.116 5.343   1.00 10.00 ? 172 ILE A CB   3  
ATOM 5742   C CG1  . ILE A 1 17  ? -14.052 -18.836 5.015   1.00 10.00 ? 172 ILE A CG1  3  
ATOM 5743   C CG2  . ILE A 1 17  ? -11.689 -18.066 4.693   1.00 10.00 ? 172 ILE A CG2  3  
ATOM 5744   C CD1  . ILE A 1 17  ? -14.592 -17.563 5.631   1.00 10.00 ? 172 ILE A CD1  3  
ATOM 5745   H H    . ILE A 1 17  ? -13.685 -21.322 6.142   1.00 10.00 ? 172 ILE A H    3  
ATOM 5746   N N    . GLN A 1 18  ? -10.497 -21.354 6.387   1.00 10.00 ? 173 GLN A N    3  
ATOM 5747   C CA   . GLN A 1 18  ? -9.143  -21.715 6.822   1.00 10.00 ? 173 GLN A CA   3  
ATOM 5748   C C    . GLN A 1 18  ? -8.435  -22.619 5.803   1.00 10.00 ? 173 GLN A C    3  
ATOM 5749   O O    . GLN A 1 18  ? -7.333  -22.308 5.351   1.00 10.00 ? 173 GLN A O    3  
ATOM 5750   C CB   . GLN A 1 18  ? -9.154  -22.357 8.207   1.00 10.00 ? 173 GLN A CB   3  
ATOM 5751   C CG   . GLN A 1 18  ? -9.320  -21.354 9.339   1.00 10.00 ? 173 GLN A CG   3  
ATOM 5752   C CD   . GLN A 1 18  ? -9.379  -22.014 10.702  1.00 10.00 ? 173 GLN A CD   3  
ATOM 5753   O OE1  . GLN A 1 18  ? -9.799  -23.164 10.833  1.00 10.00 ? 173 GLN A OE1  3  
ATOM 5754   N NE2  . GLN A 1 18  ? -8.964  -21.288 11.728  1.00 10.00 ? 173 GLN A NE2  3  
ATOM 5755   H H    . GLN A 1 18  ? -11.255 -21.428 7.009   1.00 10.00 ? 173 GLN A H    3  
ATOM 5756   H HE21 . GLN A 1 18  ? -8.647  -20.372 11.555  1.00 10.00 ? 173 GLN A HE21 3  
ATOM 5757   H HE22 . GLN A 1 18  ? -8.993  -21.688 12.621  1.00 10.00 ? 173 GLN A HE22 3  
ATOM 5758   N N    . GLU A 1 19  ? -9.083  -23.720 5.439   1.00 10.00 ? 174 GLU A N    3  
ATOM 5759   C CA   . GLU A 1 19  ? -8.524  -24.664 4.465   1.00 10.00 ? 174 GLU A CA   3  
ATOM 5760   C C    . GLU A 1 19  ? -8.535  -24.097 3.044   1.00 10.00 ? 174 GLU A C    3  
ATOM 5761   O O    . GLU A 1 19  ? -7.822  -24.579 2.160   1.00 10.00 ? 174 GLU A O    3  
ATOM 5762   C CB   . GLU A 1 19  ? -9.172  -26.051 4.534   1.00 10.00 ? 174 GLU A CB   3  
ATOM 5763   C CG   . GLU A 1 19  ? -10.685 -26.064 4.639   1.00 10.00 ? 174 GLU A CG   3  
ATOM 5764   C CD   . GLU A 1 19  ? -11.263 -27.420 4.300   1.00 10.00 ? 174 GLU A CD   3  
ATOM 5765   O OE1  . GLU A 1 19  ? -10.923 -28.407 4.988   1.00 10.00 ? 174 GLU A OE1  3  
ATOM 5766   O OE2  . GLU A 1 19  ? -12.056 -27.505 3.343   1.00 10.00 ? 174 GLU A OE2  3  
ATOM 5767   H H    . GLU A 1 19  ? -9.964  -23.906 5.834   1.00 10.00 ? 174 GLU A H    3  
ATOM 5768   N N    . TYR A 1 20  ? -9.359  -23.075 2.840   1.00 10.00 ? 175 TYR A N    3  
ATOM 5769   C CA   . TYR A 1 20  ? -9.478  -22.436 1.535   1.00 10.00 ? 175 TYR A CA   3  
ATOM 5770   C C    . TYR A 1 20  ? -8.122  -21.879 1.111   1.00 10.00 ? 175 TYR A C    3  
ATOM 5771   O O    . TYR A 1 20  ? -7.679  -22.095 -0.017  1.00 10.00 ? 175 TYR A O    3  
ATOM 5772   C CB   . TYR A 1 20  ? -10.546 -21.330 1.545   1.00 10.00 ? 175 TYR A CB   3  
ATOM 5773   C CG   . TYR A 1 20  ? -10.344 -20.251 0.500   1.00 10.00 ? 175 TYR A CG   3  
ATOM 5774   C CD1  . TYR A 1 20  ? -10.586 -20.503 -0.845  1.00 10.00 ? 175 TYR A CD1  3  
ATOM 5775   C CD2  . TYR A 1 20  ? -9.907  -18.981 0.860   1.00 10.00 ? 175 TYR A CD2  3  
ATOM 5776   C CE1  . TYR A 1 20  ? -10.399 -19.521 -1.801  1.00 10.00 ? 175 TYR A CE1  3  
ATOM 5777   C CE2  . TYR A 1 20  ? -9.718  -17.994 -0.089  1.00 10.00 ? 175 TYR A CE2  3  
ATOM 5778   C CZ   . TYR A 1 20  ? -9.964  -18.269 -1.417  1.00 10.00 ? 175 TYR A CZ   3  
ATOM 5779   O OH   . TYR A 1 20  ? -9.779  -17.288 -2.366  1.00 10.00 ? 175 TYR A OH   3  
ATOM 5780   H H    . TYR A 1 20  ? -9.825  -22.710 3.620   1.00 10.00 ? 175 TYR A H    3  
ATOM 5781   H HH   . TYR A 1 20  ? -8.971  -16.802 -2.177  1.00 10.00 ? 175 TYR A HH   3  
ATOM 5782   N N    . PHE A 1 21  ? -7.467  -21.187 2.036   1.00 10.00 ? 176 PHE A N    3  
ATOM 5783   C CA   . PHE A 1 21  ? -6.158  -20.598 1.784   1.00 10.00 ? 176 PHE A CA   3  
ATOM 5784   C C    . PHE A 1 21  ? -5.099  -21.656 1.463   1.00 10.00 ? 176 PHE A C    3  
ATOM 5785   O O    . PHE A 1 21  ? -4.053  -21.339 0.903   1.00 10.00 ? 176 PHE A O    3  
ATOM 5786   C CB   . PHE A 1 21  ? -5.702  -19.786 3.004   1.00 10.00 ? 176 PHE A CB   3  
ATOM 5787   C CG   . PHE A 1 21  ? -6.534  -18.572 3.299   1.00 10.00 ? 176 PHE A CG   3  
ATOM 5788   C CD1  . PHE A 1 21  ? -6.604  -17.525 2.395   1.00 10.00 ? 176 PHE A CD1  3  
ATOM 5789   C CD2  . PHE A 1 21  ? -7.240  -18.473 4.487   1.00 10.00 ? 176 PHE A CD2  3  
ATOM 5790   C CE1  . PHE A 1 21  ? -7.361  -16.404 2.670   1.00 10.00 ? 176 PHE A CE1  3  
ATOM 5791   C CE2  . PHE A 1 21  ? -8.002  -17.357 4.769   1.00 10.00 ? 176 PHE A CE2  3  
ATOM 5792   C CZ   . PHE A 1 21  ? -8.063  -16.319 3.857   1.00 10.00 ? 176 PHE A CZ   3  
ATOM 5793   H H    . PHE A 1 21  ? -7.895  -21.035 2.908   1.00 10.00 ? 176 PHE A H    3  
ATOM 5794   N N    . GLU A 1 22  ? -5.370  -22.906 1.806   1.00 10.00 ? 177 GLU A N    3  
ATOM 5795   C CA   . GLU A 1 22  ? -4.405  -23.975 1.565   1.00 10.00 ? 177 GLU A CA   3  
ATOM 5796   C C    . GLU A 1 22  ? -4.434  -24.484 0.128   1.00 10.00 ? 177 GLU A C    3  
ATOM 5797   O O    . GLU A 1 22  ? -3.434  -24.393 -0.582  1.00 10.00 ? 177 GLU A O    3  
ATOM 5798   C CB   . GLU A 1 22  ? -4.625  -25.133 2.537   1.00 10.00 ? 177 GLU A CB   3  
ATOM 5799   C CG   . GLU A 1 22  ? -4.483  -24.741 3.999   1.00 10.00 ? 177 GLU A CG   3  
ATOM 5800   C CD   . GLU A 1 22  ? -3.181  -24.018 4.282   1.00 10.00 ? 177 GLU A CD   3  
ATOM 5801   O OE1  . GLU A 1 22  ? -2.112  -24.550 3.916   1.00 10.00 ? 177 GLU A OE1  3  
ATOM 5802   O OE2  . GLU A 1 22  ? -3.221  -22.912 4.855   1.00 10.00 ? 177 GLU A OE2  3  
ATOM 5803   H H    . GLU A 1 22  ? -6.228  -23.120 2.234   1.00 10.00 ? 177 GLU A H    3  
ATOM 5804   N N    . HIS A 1 23  ? -5.582  -24.979 -0.317  1.00 10.00 ? 178 HIS A N    3  
ATOM 5805   C CA   . HIS A 1 23  ? -5.695  -25.502 -1.682  1.00 10.00 ? 178 HIS A CA   3  
ATOM 5806   C C    . HIS A 1 23  ? -6.025  -24.420 -2.699  1.00 10.00 ? 178 HIS A C    3  
ATOM 5807   O O    . HIS A 1 23  ? -5.744  -24.568 -3.888  1.00 10.00 ? 178 HIS A O    3  
ATOM 5808   C CB   . HIS A 1 23  ? -6.664  -26.689 -1.796  1.00 10.00 ? 178 HIS A CB   3  
ATOM 5809   C CG   . HIS A 1 23  ? -8.100  -26.401 -1.466  1.00 10.00 ? 178 HIS A CG   3  
ATOM 5810   N ND1  . HIS A 1 23  ? -9.146  -27.151 -1.953  1.00 10.00 ? 178 HIS A ND1  3  
ATOM 5811   C CD2  . HIS A 1 23  ? -8.658  -25.468 -0.662  1.00 10.00 ? 178 HIS A CD2  3  
ATOM 5812   C CE1  . HIS A 1 23  ? -10.280 -26.691 -1.459  1.00 10.00 ? 178 HIS A CE1  3  
ATOM 5813   N NE2  . HIS A 1 23  ? -10.013 -25.667 -0.669  1.00 10.00 ? 178 HIS A NE2  3  
ATOM 5814   H H    . HIS A 1 23  ? -6.358  -25.009 0.283   1.00 10.00 ? 178 HIS A H    3  
ATOM 5815   H HD1  . HIS A 1 23  ? -9.072  -27.914 -2.575  1.00 10.00 ? 178 HIS A HD1  3  
ATOM 5816   H HE2  . HIS A 1 23  ? -10.631 -25.319 0.014   1.00 10.00 ? 178 HIS A HE2  3  
ATOM 5817   N N    . GLY A 1 24  ? -6.597  -23.323 -2.221  1.00 10.00 ? 179 GLY A N    3  
ATOM 5818   C CA   . GLY A 1 24  ? -6.964  -22.225 -3.097  1.00 10.00 ? 179 GLY A CA   3  
ATOM 5819   C C    . GLY A 1 24  ? -8.010  -22.614 -4.129  1.00 10.00 ? 179 GLY A C    3  
ATOM 5820   O O    . GLY A 1 24  ? -7.740  -22.596 -5.329  1.00 10.00 ? 179 GLY A O    3  
ATOM 5821   H H    . GLY A 1 24  ? -6.737  -23.241 -1.251  1.00 10.00 ? 179 GLY A H    3  
ATOM 5822   N N    . ASP A 1 25  ? -9.204  -22.971 -3.666  1.00 10.00 ? 180 ASP A N    3  
ATOM 5823   C CA   . ASP A 1 25  ? -10.285 -23.351 -4.573  1.00 10.00 ? 180 ASP A CA   3  
ATOM 5824   C C    . ASP A 1 25  ? -11.475 -22.411 -4.419  1.00 10.00 ? 180 ASP A C    3  
ATOM 5825   O O    . ASP A 1 25  ? -12.151 -22.402 -3.390  1.00 10.00 ? 180 ASP A O    3  
ATOM 5826   C CB   . ASP A 1 25  ? -10.713 -24.808 -4.384  1.00 10.00 ? 180 ASP A CB   3  
ATOM 5827   C CG   . ASP A 1 25  ? -11.446 -25.359 -5.596  1.00 10.00 ? 180 ASP A CG   3  
ATOM 5828   O OD1  . ASP A 1 25  ? -12.538 -24.851 -5.922  1.00 10.00 ? 180 ASP A OD1  3  
ATOM 5829   O OD2  . ASP A 1 25  ? -10.930 -26.306 -6.227  1.00 10.00 ? 180 ASP A OD2  3  
ATOM 5830   H H    . ASP A 1 25  ? -9.366  -22.972 -2.702  1.00 10.00 ? 180 ASP A H    3  
ATOM 5831   N N    . THR A 1 26  ? -11.684 -21.603 -5.439  1.00 10.00 ? 181 THR A N    3  
ATOM 5832   C CA   . THR A 1 26  ? -12.760 -20.629 -5.461  1.00 10.00 ? 181 THR A CA   3  
ATOM 5833   C C    . THR A 1 26  ? -14.145 -21.264 -5.646  1.00 10.00 ? 181 THR A C    3  
ATOM 5834   O O    . THR A 1 26  ? -15.130 -20.805 -5.064  1.00 10.00 ? 181 THR A O    3  
ATOM 5835   C CB   . THR A 1 26  ? -12.503 -19.577 -6.548  1.00 10.00 ? 181 THR A CB   3  
ATOM 5836   O OG1  . THR A 1 26  ? -11.665 -20.151 -7.563  1.00 10.00 ? 181 THR A OG1  3  
ATOM 5837   C CG2  . THR A 1 26  ? -11.798 -18.373 -5.949  1.00 10.00 ? 181 THR A CG2  3  
ATOM 5838   H H    . THR A 1 26  ? -11.086 -21.675 -6.210  1.00 10.00 ? 181 THR A H    3  
ATOM 5839   H HG1  . THR A 1 26  ? -11.414 -19.465 -8.195  1.00 10.00 ? 181 THR A HG1  3  
ATOM 5840   N N    . ASN A 1 27  ? -14.216 -22.326 -6.446  1.00 10.00 ? 182 ASN A N    3  
ATOM 5841   C CA   . ASN A 1 27  ? -15.484 -23.003 -6.709  1.00 10.00 ? 182 ASN A CA   3  
ATOM 5842   C C    . ASN A 1 27  ? -15.936 -23.778 -5.481  1.00 10.00 ? 182 ASN A C    3  
ATOM 5843   O O    . ASN A 1 27  ? -17.133 -23.918 -5.224  1.00 10.00 ? 182 ASN A O    3  
ATOM 5844   C CB   . ASN A 1 27  ? -15.357 -23.945 -7.908  1.00 10.00 ? 182 ASN A CB   3  
ATOM 5845   C CG   . ASN A 1 27  ? -16.647 -24.685 -8.211  1.00 10.00 ? 182 ASN A CG   3  
ATOM 5846   O OD1  . ASN A 1 27  ? -17.689 -24.070 -8.442  1.00 10.00 ? 182 ASN A OD1  3  
ATOM 5847   N ND2  . ASN A 1 27  ? -16.581 -26.007 -8.220  1.00 10.00 ? 182 ASN A ND2  3  
ATOM 5848   H H    . ASN A 1 27  ? -13.397 -22.673 -6.858  1.00 10.00 ? 182 ASN A H    3  
ATOM 5849   H HD21 . ASN A 1 27  ? -15.713 -26.430 -8.035  1.00 10.00 ? 182 ASN A HD21 3  
ATOM 5850   H HD22 . ASN A 1 27  ? -17.402 -26.510 -8.411  1.00 10.00 ? 182 ASN A HD22 3  
ATOM 5851   N N    . GLU A 1 28  ? -14.957 -24.256 -4.723  1.00 10.00 ? 183 GLU A N    3  
ATOM 5852   C CA   . GLU A 1 28  ? -15.207 -25.019 -3.511  1.00 10.00 ? 183 GLU A CA   3  
ATOM 5853   C C    . GLU A 1 28  ? -16.141 -24.235 -2.595  1.00 10.00 ? 183 GLU A C    3  
ATOM 5854   O O    . GLU A 1 28  ? -17.178 -24.742 -2.163  1.00 10.00 ? 183 GLU A O    3  
ATOM 5855   C CB   . GLU A 1 28  ? -13.884 -25.287 -2.792  1.00 10.00 ? 183 GLU A CB   3  
ATOM 5856   C CG   . GLU A 1 28  ? -13.784 -26.654 -2.138  1.00 10.00 ? 183 GLU A CG   3  
ATOM 5857   C CD   . GLU A 1 28  ? -13.546 -27.765 -3.138  1.00 10.00 ? 183 GLU A CD   3  
ATOM 5858   O OE1  . GLU A 1 28  ? -12.372 -28.044 -3.454  1.00 10.00 ? 183 GLU A OE1  3  
ATOM 5859   O OE2  . GLU A 1 28  ? -14.535 -28.371 -3.603  1.00 10.00 ? 183 GLU A OE2  3  
ATOM 5860   H H    . GLU A 1 28  ? -14.033 -24.057 -4.997  1.00 10.00 ? 183 GLU A H    3  
ATOM 5861   N N    . VAL A 1 29  ? -15.769 -22.985 -2.340  1.00 10.00 ? 184 VAL A N    3  
ATOM 5862   C CA   . VAL A 1 29  ? -16.547 -22.093 -1.484  1.00 10.00 ? 184 VAL A CA   3  
ATOM 5863   C C    . VAL A 1 29  ? -17.964 -21.880 -2.027  1.00 10.00 ? 184 VAL A C    3  
ATOM 5864   O O    . VAL A 1 29  ? -18.935 -22.012 -1.282  1.00 10.00 ? 184 VAL A O    3  
ATOM 5865   C CB   . VAL A 1 29  ? -15.848 -20.727 -1.305  1.00 10.00 ? 184 VAL A CB   3  
ATOM 5866   C CG1  . VAL A 1 29  ? -16.581 -19.870 -0.281  1.00 10.00 ? 184 VAL A CG1  3  
ATOM 5867   C CG2  . VAL A 1 29  ? -14.395 -20.920 -0.899  1.00 10.00 ? 184 VAL A CG2  3  
ATOM 5868   H H    . VAL A 1 29  ? -14.939 -22.649 -2.740  1.00 10.00 ? 184 VAL A H    3  
ATOM 5869   N N    . ALA A 1 30  ? -18.081 -21.559 -3.314  1.00 10.00 ? 185 ALA A N    3  
ATOM 5870   C CA   . ALA A 1 30  ? -19.387 -21.336 -3.933  1.00 10.00 ? 185 ALA A CA   3  
ATOM 5871   C C    . ALA A 1 30  ? -20.306 -22.540 -3.741  1.00 10.00 ? 185 ALA A C    3  
ATOM 5872   O O    . ALA A 1 30  ? -21.448 -22.401 -3.296  1.00 10.00 ? 185 ALA A O    3  
ATOM 5873   C CB   . ALA A 1 30  ? -19.223 -21.019 -5.414  1.00 10.00 ? 185 ALA A CB   3  
ATOM 5874   H H    . ALA A 1 30  ? -17.270 -21.455 -3.861  1.00 10.00 ? 185 ALA A H    3  
ATOM 5875   N N    . GLU A 1 31  ? -19.807 -23.711 -4.127  1.00 10.00 ? 186 GLU A N    3  
ATOM 5876   C CA   . GLU A 1 31  ? -20.549 -24.962 -3.972  1.00 10.00 ? 186 GLU A CA   3  
ATOM 5877   C C    . GLU A 1 31  ? -21.054 -25.145 -2.540  1.00 10.00 ? 186 GLU A C    3  
ATOM 5878   O O    . GLU A 1 31  ? -22.152 -25.655 -2.318  1.00 10.00 ? 186 GLU A O    3  
ATOM 5879   C CB   . GLU A 1 31  ? -19.684 -26.152 -4.381  1.00 10.00 ? 186 GLU A CB   3  
ATOM 5880   C CG   . GLU A 1 31  ? -19.211 -26.095 -5.823  1.00 10.00 ? 186 GLU A CG   3  
ATOM 5881   C CD   . GLU A 1 31  ? -20.174 -26.753 -6.785  1.00 10.00 ? 186 GLU A CD   3  
ATOM 5882   O OE1  . GLU A 1 31  ? -21.138 -26.092 -7.220  1.00 10.00 ? 186 GLU A OE1  3  
ATOM 5883   O OE2  . GLU A 1 31  ? -19.962 -27.938 -7.114  1.00 10.00 ? 186 GLU A OE2  3  
ATOM 5884   H H    . GLU A 1 31  ? -18.959 -23.700 -4.625  1.00 10.00 ? 186 GLU A H    3  
ATOM 5885   N N    . MET A 1 32  ? -20.254 -24.720 -1.574  1.00 10.00 ? 187 MET A N    3  
ATOM 5886   C CA   . MET A 1 32  ? -20.627 -24.830 -0.169  1.00 10.00 ? 187 MET A CA   3  
ATOM 5887   C C    . MET A 1 32  ? -21.673 -23.781 0.203   1.00 10.00 ? 187 MET A C    3  
ATOM 5888   O O    . MET A 1 32  ? -22.604 -24.059 0.961   1.00 10.00 ? 187 MET A O    3  
ATOM 5889   C CB   . MET A 1 32  ? -19.396 -24.682 0.730   1.00 10.00 ? 187 MET A CB   3  
ATOM 5890   C CG   . MET A 1 32  ? -18.364 -25.784 0.559   1.00 10.00 ? 187 MET A CG   3  
ATOM 5891   S SD   . MET A 1 32  ? -16.772 -25.360 1.291   1.00 10.00 ? 187 MET A SD   3  
ATOM 5892   C CE   . MET A 1 32  ? -15.762 -26.717 0.709   1.00 10.00 ? 187 MET A CE   3  
ATOM 5893   H H    . MET A 1 32  ? -19.387 -24.320 -1.808  1.00 10.00 ? 187 MET A H    3  
ATOM 5894   N N    . LEU A 1 33  ? -21.524 -22.578 -0.346  1.00 10.00 ? 188 LEU A N    3  
ATOM 5895   C CA   . LEU A 1 33  ? -22.446 -21.478 -0.069  1.00 10.00 ? 188 LEU A CA   3  
ATOM 5896   C C    . LEU A 1 33  ? -23.888 -21.826 -0.433  1.00 10.00 ? 188 LEU A C    3  
ATOM 5897   O O    . LEU A 1 33  ? -24.804 -21.594 0.354   1.00 10.00 ? 188 LEU A O    3  
ATOM 5898   C CB   . LEU A 1 33  ? -22.009 -20.200 -0.789  1.00 10.00 ? 188 LEU A CB   3  
ATOM 5899   C CG   . LEU A 1 33  ? -20.699 -19.570 -0.308  1.00 10.00 ? 188 LEU A CG   3  
ATOM 5900   C CD1  . LEU A 1 33  ? -20.445 -18.248 -1.017  1.00 10.00 ? 188 LEU A CD1  3  
ATOM 5901   C CD2  . LEU A 1 33  ? -20.710 -19.381 1.199   1.00 10.00 ? 188 LEU A CD2  3  
ATOM 5902   H H    . LEU A 1 33  ? -20.760 -22.422 -0.947  1.00 10.00 ? 188 LEU A H    3  
ATOM 5903   N N    . ARG A 1 34  ? -24.083 -22.359 -1.638  1.00 10.00 ? 189 ARG A N    3  
ATOM 5904   C CA   . ARG A 1 34  ? -25.416 -22.760 -2.112  1.00 10.00 ? 189 ARG A CA   3  
ATOM 5905   C C    . ARG A 1 34  ? -26.081 -23.795 -1.207  1.00 10.00 ? 189 ARG A C    3  
ATOM 5906   O O    . ARG A 1 34  ? -27.301 -23.960 -1.220  1.00 10.00 ? 189 ARG A O    3  
ATOM 5907   C CB   . ARG A 1 34  ? -25.363 -23.242 -3.561  1.00 10.00 ? 189 ARG A CB   3  
ATOM 5908   C CG   . ARG A 1 34  ? -24.814 -22.205 -4.529  1.00 10.00 ? 189 ARG A CG   3  
ATOM 5909   C CD   . ARG A 1 34  ? -25.155 -22.544 -5.972  1.00 10.00 ? 189 ARG A CD   3  
ATOM 5910   N NE   . ARG A 1 34  ? -24.995 -23.969 -6.256  1.00 10.00 ? 189 ARG A NE   3  
ATOM 5911   C CZ   . ARG A 1 34  ? -23.839 -24.543 -6.597  1.00 10.00 ? 189 ARG A CZ   3  
ATOM 5912   N NH1  . ARG A 1 34  ? -22.722 -23.828 -6.663  1.00 10.00 ? 189 ARG A NH1  3  
ATOM 5913   N NH2  . ARG A 1 34  ? -23.793 -25.838 -6.863  1.00 10.00 ? 189 ARG A NH2  3  
ATOM 5914   H H    . ARG A 1 34  ? -23.322 -22.434 -2.253  1.00 10.00 ? 189 ARG A H    3  
ATOM 5915   H HE   . ARG A 1 34  ? -25.803 -24.531 -6.197  1.00 10.00 ? 189 ARG A HE   3  
ATOM 5916   H HH11 . ARG A 1 34  ? -22.734 -22.853 -6.456  1.00 10.00 ? 189 ARG A HH11 3  
ATOM 5917   H HH12 . ARG A 1 34  ? -21.856 -24.276 -6.924  1.00 10.00 ? 189 ARG A HH12 3  
ATOM 5918   H HH21 . ARG A 1 34  ? -24.623 -26.401 -6.810  1.00 10.00 ? 189 ARG A HH21 3  
ATOM 5919   H HH22 . ARG A 1 34  ? -22.913 -26.266 -7.120  1.00 10.00 ? 189 ARG A HH22 3  
ATOM 5920   N N    . ASP A 1 35  ? -25.268 -24.493 -0.426  1.00 10.00 ? 190 ASP A N    3  
ATOM 5921   C CA   . ASP A 1 35  ? -25.789 -25.503 0.489   1.00 10.00 ? 190 ASP A CA   3  
ATOM 5922   C C    . ASP A 1 35  ? -26.347 -24.814 1.726   1.00 10.00 ? 190 ASP A C    3  
ATOM 5923   O O    . ASP A 1 35  ? -27.346 -25.247 2.304   1.00 10.00 ? 190 ASP A O    3  
ATOM 5924   C CB   . ASP A 1 35  ? -24.753 -26.563 0.855   1.00 10.00 ? 190 ASP A CB   3  
ATOM 5925   C CG   . ASP A 1 35  ? -25.222 -27.959 0.492   1.00 10.00 ? 190 ASP A CG   3  
ATOM 5926   O OD1  . ASP A 1 35  ? -26.448 -28.213 0.530   1.00 10.00 ? 190 ASP A OD1  3  
ATOM 5927   O OD2  . ASP A 1 35  ? -24.367 -28.808 0.151   1.00 10.00 ? 190 ASP A OD2  3  
ATOM 5928   H H    . ASP A 1 35  ? -24.321 -24.245 -0.431  1.00 10.00 ? 190 ASP A H    3  
ATOM 5929   N N    . LEU A 1 36  ? -25.690 -23.734 2.126   1.00 10.00 ? 191 LEU A N    3  
ATOM 5930   C CA   . LEU A 1 36  ? -26.133 -22.940 3.258   1.00 10.00 ? 191 LEU A CA   3  
ATOM 5931   C C    . LEU A 1 36  ? -27.380 -22.153 2.859   1.00 10.00 ? 191 LEU A C    3  
ATOM 5932   O O    . LEU A 1 36  ? -28.399 -22.197 3.545   1.00 10.00 ? 191 LEU A O    3  
ATOM 5933   C CB   . LEU A 1 36  ? -25.036 -21.964 3.690   1.00 10.00 ? 191 LEU A CB   3  
ATOM 5934   C CG   . LEU A 1 36  ? -23.744 -22.589 4.221   1.00 10.00 ? 191 LEU A CG   3  
ATOM 5935   C CD1  . LEU A 1 36  ? -22.594 -21.601 4.101   1.00 10.00 ? 191 LEU A CD1  3  
ATOM 5936   C CD2  . LEU A 1 36  ? -23.922 -23.027 5.669   1.00 10.00 ? 191 LEU A CD2  3  
ATOM 5937   H H    . LEU A 1 36  ? -24.865 -23.480 1.658   1.00 10.00 ? 191 LEU A H    3  
ATOM 5938   N N    . ASN A 1 37  ? -27.273 -21.455 1.722   1.00 10.00 ? 192 ASN A N    3  
ATOM 5939   C CA   . ASN A 1 37  ? -28.371 -20.640 1.183   1.00 10.00 ? 192 ASN A CA   3  
ATOM 5940   C C    . ASN A 1 37  ? -28.792 -19.543 2.151   1.00 10.00 ? 192 ASN A C    3  
ATOM 5941   O O    . ASN A 1 37  ? -29.656 -19.748 3.004   1.00 10.00 ? 192 ASN A O    3  
ATOM 5942   C CB   . ASN A 1 37  ? -29.576 -21.484 0.746   1.00 10.00 ? 192 ASN A CB   3  
ATOM 5943   C CG   . ASN A 1 37  ? -30.535 -20.720 -0.158  1.00 10.00 ? 192 ASN A CG   3  
ATOM 5944   O OD1  . ASN A 1 37  ? -30.560 -19.489 -0.168  1.00 10.00 ? 192 ASN A OD1  3  
ATOM 5945   N ND2  . ASN A 1 37  ? -31.346 -21.448 -0.908  1.00 10.00 ? 192 ASN A ND2  3  
ATOM 5946   H H    . ASN A 1 37  ? -26.429 -21.465 1.223   1.00 10.00 ? 192 ASN A H    3  
ATOM 5947   H HD21 . ASN A 1 37  ? -31.290 -22.426 -0.840  1.00 10.00 ? 192 ASN A HD21 3  
ATOM 5948   H HD22 . ASN A 1 37  ? -31.969 -20.980 -1.503  1.00 10.00 ? 192 ASN A HD22 3  
ATOM 5949   N N    . LEU A 1 38  ? -28.167 -18.386 2.015   1.00 10.00 ? 193 LEU A N    3  
ATOM 5950   C CA   . LEU A 1 38  ? -28.467 -17.244 2.862   1.00 10.00 ? 193 LEU A CA   3  
ATOM 5951   C C    . LEU A 1 38  ? -28.513 -15.978 2.019   1.00 10.00 ? 193 LEU A C    3  
ATOM 5952   O O    . LEU A 1 38  ? -27.927 -15.926 0.937   1.00 10.00 ? 193 LEU A O    3  
ATOM 5953   C CB   . LEU A 1 38  ? -27.414 -17.098 3.966   1.00 10.00 ? 193 LEU A CB   3  
ATOM 5954   C CG   . LEU A 1 38  ? -27.454 -18.139 5.086   1.00 10.00 ? 193 LEU A CG   3  
ATOM 5955   C CD1  . LEU A 1 38  ? -26.239 -18.002 5.987   1.00 10.00 ? 193 LEU A CD1  3  
ATOM 5956   C CD2  . LEU A 1 38  ? -28.736 -18.013 5.894   1.00 10.00 ? 193 LEU A CD2  3  
ATOM 5957   H H    . LEU A 1 38  ? -27.494 -18.289 1.311   1.00 10.00 ? 193 LEU A H    3  
ATOM 5958   N N    . GLY A 1 39  ? -29.205 -14.964 2.517   1.00 10.00 ? 194 GLY A N    3  
ATOM 5959   C CA   . GLY A 1 39  ? -29.309 -13.712 1.793   1.00 10.00 ? 194 GLY A CA   3  
ATOM 5960   C C    . GLY A 1 39  ? -28.329 -12.677 2.307   1.00 10.00 ? 194 GLY A C    3  
ATOM 5961   O O    . GLY A 1 39  ? -27.181 -12.624 1.865   1.00 10.00 ? 194 GLY A O    3  
ATOM 5962   H H    . GLY A 1 39  ? -29.654 -15.066 3.381   1.00 10.00 ? 194 GLY A H    3  
ATOM 5963   N N    . GLU A 1 40  ? -28.774 -11.868 3.260   1.00 10.00 ? 195 GLU A N    3  
ATOM 5964   C CA   . GLU A 1 40  ? -27.930 -10.833 3.843   1.00 10.00 ? 195 GLU A CA   3  
ATOM 5965   C C    . GLU A 1 40  ? -26.827 -11.455 4.694   1.00 10.00 ? 195 GLU A C    3  
ATOM 5966   O O    . GLU A 1 40  ? -25.781 -10.849 4.923   1.00 10.00 ? 195 GLU A O    3  
ATOM 5967   C CB   . GLU A 1 40  ? -28.773 -9.870  4.678   1.00 10.00 ? 195 GLU A CB   3  
ATOM 5968   C CG   . GLU A 1 40  ? -28.737 -8.436  4.184   1.00 10.00 ? 195 GLU A CG   3  
ATOM 5969   C CD   . GLU A 1 40  ? -27.520 -7.686  4.674   1.00 10.00 ? 195 GLU A CD   3  
ATOM 5970   O OE1  . GLU A 1 40  ? -26.462 -7.758  4.015   1.00 10.00 ? 195 GLU A OE1  3  
ATOM 5971   O OE2  . GLU A 1 40  ? -27.617 -7.018  5.727   1.00 10.00 ? 195 GLU A OE2  3  
ATOM 5972   H H    . GLU A 1 40  ? -29.697 -11.966 3.578   1.00 10.00 ? 195 GLU A H    3  
ATOM 5973   N N    . MET A 1 41  ? -27.066 -12.679 5.146   1.00 10.00 ? 196 MET A N    3  
ATOM 5974   C CA   . MET A 1 41  ? -26.096 -13.396 5.959   1.00 10.00 ? 196 MET A CA   3  
ATOM 5975   C C    . MET A 1 41  ? -24.977 -13.945 5.076   1.00 10.00 ? 196 MET A C    3  
ATOM 5976   O O    . MET A 1 41  ? -23.887 -14.255 5.546   1.00 10.00 ? 196 MET A O    3  
ATOM 5977   C CB   . MET A 1 41  ? -26.776 -14.538 6.715   1.00 10.00 ? 196 MET A CB   3  
ATOM 5978   C CG   . MET A 1 41  ? -26.562 -14.508 8.221   1.00 10.00 ? 196 MET A CG   3  
ATOM 5979   S SD   . MET A 1 41  ? -24.834 -14.283 8.676   1.00 10.00 ? 196 MET A SD   3  
ATOM 5980   C CE   . MET A 1 41  ? -24.912 -14.550 10.443  1.00 10.00 ? 196 MET A CE   3  
ATOM 5981   H H    . MET A 1 41  ? -27.920 -13.109 4.929   1.00 10.00 ? 196 MET A H    3  
ATOM 5982   N N    . LYS A 1 42  ? -25.260 -14.034 3.780   1.00 10.00 ? 197 LYS A N    3  
ATOM 5983   C CA   . LYS A 1 42  ? -24.301 -14.543 2.809   1.00 10.00 ? 197 LYS A CA   3  
ATOM 5984   C C    . LYS A 1 42  ? -23.141 -13.566 2.633   1.00 10.00 ? 197 LYS A C    3  
ATOM 5985   O O    . LYS A 1 42  ? -22.026 -13.964 2.301   1.00 10.00 ? 197 LYS A O    3  
ATOM 5986   C CB   . LYS A 1 42  ? -24.993 -14.789 1.471   1.00 10.00 ? 197 LYS A CB   3  
ATOM 5987   C CG   . LYS A 1 42  ? -24.118 -15.413 0.398   1.00 10.00 ? 197 LYS A CG   3  
ATOM 5988   C CD   . LYS A 1 42  ? -24.793 -15.336 -0.962  1.00 10.00 ? 197 LYS A CD   3  
ATOM 5989   C CE   . LYS A 1 42  ? -25.133 -13.897 -1.319  1.00 10.00 ? 197 LYS A CE   3  
ATOM 5990   N NZ   . LYS A 1 42  ? -25.859 -13.795 -2.610  1.00 10.00 ? 197 LYS A NZ   3  
ATOM 5991   H H    . LYS A 1 42  ? -26.140 -13.736 3.465   1.00 10.00 ? 197 LYS A H    3  
ATOM 5992   H HZ1  . LYS A 1 42  ? -25.346 -14.316 -3.352  1.00 10.00 ? 197 LYS A HZ1  3  
ATOM 5993   H HZ2  . LYS A 1 42  ? -25.943 -12.795 -2.894  1.00 10.00 ? 197 LYS A HZ2  3  
ATOM 5994   H HZ3  . LYS A 1 42  ? -26.813 -14.197 -2.517  1.00 10.00 ? 197 LYS A HZ3  3  
ATOM 5995   N N    . SER A 1 43  ? -23.415 -12.284 2.867   1.00 10.00 ? 198 SER A N    3  
ATOM 5996   C CA   . SER A 1 43  ? -22.390 -11.254 2.752   1.00 10.00 ? 198 SER A CA   3  
ATOM 5997   C C    . SER A 1 43  ? -21.378 -11.408 3.886   1.00 10.00 ? 198 SER A C    3  
ATOM 5998   O O    . SER A 1 43  ? -20.302 -10.815 3.869   1.00 10.00 ? 198 SER A O    3  
ATOM 5999   C CB   . SER A 1 43  ? -23.036 -9.867  2.796   1.00 10.00 ? 198 SER A CB   3  
ATOM 6000   O OG   . SER A 1 43  ? -24.207 -9.826  1.989   1.00 10.00 ? 198 SER A OG   3  
ATOM 6001   H H    . SER A 1 43  ? -24.326 -12.026 3.126   1.00 10.00 ? 198 SER A H    3  
ATOM 6002   H HG   . SER A 1 43  ? -24.203 -10.573 1.384   1.00 10.00 ? 198 SER A HG   3  
ATOM 6003   N N    . GLY A 1 44  ? -21.752 -12.197 4.890   1.00 10.00 ? 199 GLY A N    3  
ATOM 6004   C CA   . GLY A 1 44  ? -20.890 -12.453 6.019   1.00 10.00 ? 199 GLY A CA   3  
ATOM 6005   C C    . GLY A 1 44  ? -19.629 -13.219 5.659   1.00 10.00 ? 199 GLY A C    3  
ATOM 6006   O O    . GLY A 1 44  ? -18.544 -12.894 6.144   1.00 10.00 ? 199 GLY A O    3  
ATOM 6007   H H    . GLY A 1 44  ? -22.662 -12.566 4.861   1.00 10.00 ? 199 GLY A H    3  
ATOM 6008   N N    . VAL A 1 45  ? -19.772 -14.249 4.818   1.00 10.00 ? 200 VAL A N    3  
ATOM 6009   C CA   . VAL A 1 45  ? -18.634 -15.076 4.388   1.00 10.00 ? 200 VAL A CA   3  
ATOM 6010   C C    . VAL A 1 45  ? -17.398 -14.261 3.974   1.00 10.00 ? 200 VAL A C    3  
ATOM 6011   O O    . VAL A 1 45  ? -16.324 -14.441 4.556   1.00 10.00 ? 200 VAL A O    3  
ATOM 6012   C CB   . VAL A 1 45  ? -19.014 -16.084 3.274   1.00 10.00 ? 200 VAL A CB   3  
ATOM 6013   C CG1  . VAL A 1 45  ? -17.838 -16.991 2.944   1.00 10.00 ? 200 VAL A CG1  3  
ATOM 6014   C CG2  . VAL A 1 45  ? -20.223 -16.906 3.690   1.00 10.00 ? 200 VAL A CG2  3  
ATOM 6015   H H    . VAL A 1 45  ? -20.671 -14.500 4.518   1.00 10.00 ? 200 VAL A H    3  
ATOM 6016   N N    . PRO A 1 46  ? -17.513 -13.359 2.970   1.00 10.00 ? 201 PRO A N    3  
ATOM 6017   C CA   . PRO A 1 46  ? -16.382 -12.533 2.526   1.00 10.00 ? 201 PRO A CA   3  
ATOM 6018   C C    . PRO A 1 46  ? -15.798 -11.672 3.649   1.00 10.00 ? 201 PRO A C    3  
ATOM 6019   O O    . PRO A 1 46  ? -14.609 -11.361 3.639   1.00 10.00 ? 201 PRO A O    3  
ATOM 6020   C CB   . PRO A 1 46  ? -16.960 -11.655 1.408   1.00 10.00 ? 201 PRO A CB   3  
ATOM 6021   C CG   . PRO A 1 46  ? -18.439 -11.752 1.552   1.00 10.00 ? 201 PRO A CG   3  
ATOM 6022   C CD   . PRO A 1 46  ? -18.725 -13.090 2.175   1.00 10.00 ? 201 PRO A CD   3  
ATOM 6023   N N    . VAL A 1 47  ? -16.628 -11.311 4.625   1.00 10.00 ? 202 VAL A N    3  
ATOM 6024   C CA   . VAL A 1 47  ? -16.169 -10.498 5.749   1.00 10.00 ? 202 VAL A CA   3  
ATOM 6025   C C    . VAL A 1 47  ? -15.232 -11.312 6.638   1.00 10.00 ? 202 VAL A C    3  
ATOM 6026   O O    . VAL A 1 47  ? -14.148 -10.851 7.004   1.00 10.00 ? 202 VAL A O    3  
ATOM 6027   C CB   . VAL A 1 47  ? -17.346 -9.947  6.588   1.00 10.00 ? 202 VAL A CB   3  
ATOM 6028   C CG1  . VAL A 1 47  ? -16.837 -9.077  7.728   1.00 10.00 ? 202 VAL A CG1  3  
ATOM 6029   C CG2  . VAL A 1 47  ? -18.311 -9.165  5.715   1.00 10.00 ? 202 VAL A CG2  3  
ATOM 6030   H H    . VAL A 1 47  ? -17.553 -11.630 4.606   1.00 10.00 ? 202 VAL A H    3  
ATOM 6031   N N    . LEU A 1 48  ? -15.645 -12.537 6.963   1.00 10.00 ? 203 LEU A N    3  
ATOM 6032   C CA   . LEU A 1 48  ? -14.830 -13.421 7.793   1.00 10.00 ? 203 LEU A CA   3  
ATOM 6033   C C    . LEU A 1 48  ? -13.521 -13.740 7.062   1.00 10.00 ? 203 LEU A C    3  
ATOM 6034   O O    . LEU A 1 48  ? -12.434 -13.622 7.639   1.00 10.00 ? 203 LEU A O    3  
ATOM 6035   C CB   . LEU A 1 48  ? -15.592 -14.706 8.121   1.00 10.00 ? 203 LEU A CB   3  
ATOM 6036   C CG   . LEU A 1 48  ? -14.924 -15.651 9.125   1.00 10.00 ? 203 LEU A CG   3  
ATOM 6037   C CD1  . LEU A 1 48  ? -14.653 -14.934 10.440  1.00 10.00 ? 203 LEU A CD1  3  
ATOM 6038   C CD2  . LEU A 1 48  ? -15.792 -16.879 9.353   1.00 10.00 ? 203 LEU A CD2  3  
ATOM 6039   H H    . LEU A 1 48  ? -16.517 -12.852 6.636   1.00 10.00 ? 203 LEU A H    3  
ATOM 6040   N N    . ALA A 1 49  ? -13.649 -14.158 5.802   1.00 10.00 ? 204 ALA A N    3  
ATOM 6041   C CA   . ALA A 1 49  ? -12.500 -14.460 4.928   1.00 10.00 ? 204 ALA A CA   3  
ATOM 6042   C C    . ALA A 1 49  ? -11.478 -13.304 4.930   1.00 10.00 ? 204 ALA A C    3  
ATOM 6043   O O    . ALA A 1 49  ? -10.283 -13.516 4.713   1.00 10.00 ? 204 ALA A O    3  
ATOM 6044   C CB   . ALA A 1 49  ? -12.982 -14.732 3.506   1.00 10.00 ? 204 ALA A CB   3  
ATOM 6045   H H    . ALA A 1 49  ? -14.547 -14.397 5.476   1.00 10.00 ? 204 ALA A H    3  
ATOM 6046   N N    . VAL A 1 50  ? -11.976 -12.113 5.193   1.00 10.00 ? 205 VAL A N    3  
ATOM 6047   C CA   . VAL A 1 50  ? -11.118 -10.931 5.238   1.00 10.00 ? 205 VAL A CA   3  
ATOM 6048   C C    . VAL A 1 50  ? -10.413 -10.818 6.596   1.00 10.00 ? 205 VAL A C    3  
ATOM 6049   O O    . VAL A 1 50  ? -9.224  -10.519 6.672   1.00 10.00 ? 205 VAL A O    3  
ATOM 6050   C CB   . VAL A 1 50  ? -11.846 -9.611  4.871   1.00 10.00 ? 205 VAL A CB   3  
ATOM 6051   C CG1  . VAL A 1 50  ? -11.037 -8.403  5.319   1.00 10.00 ? 205 VAL A CG1  3  
ATOM 6052   C CG2  . VAL A 1 50  ? -12.068 -9.548  3.364   1.00 10.00 ? 205 VAL A CG2  3  
ATOM 6053   H H    . VAL A 1 50  ? -12.875 -12.096 5.562   1.00 10.00 ? 205 VAL A H    3  
ATOM 6054   N N    . SER A 1 51  ? -11.167 -11.115 7.657   1.00 10.00 ? 206 SER A N    3  
ATOM 6055   C CA   . SER A 1 51  ? -10.668 -11.020 9.032   1.00 10.00 ? 206 SER A CA   3  
ATOM 6056   C C    . SER A 1 51  ? -9.487  -11.965 9.265   1.00 10.00 ? 206 SER A C    3  
ATOM 6057   O O    . SER A 1 51  ? -8.442  -11.548 9.769   1.00 10.00 ? 206 SER A O    3  
ATOM 6058   C CB   . SER A 1 51  ? -11.798 -11.344 10.015  1.00 10.00 ? 206 SER A CB   3  
ATOM 6059   O OG   . SER A 1 51  ? -13.025 -10.737 9.627   1.00 10.00 ? 206 SER A OG   3  
ATOM 6060   H H    . SER A 1 51  ? -12.077 -11.439 7.512   1.00 10.00 ? 206 SER A H    3  
ATOM 6061   H HG   . SER A 1 51  ? -13.055 -10.643 8.669   1.00 10.00 ? 206 SER A HG   3  
ATOM 6062   N N    . LEU A 1 52  ? -9.669  -13.218 8.890   1.00 10.00 ? 207 LEU A N    3  
ATOM 6063   C CA   . LEU A 1 52  ? -8.629  -14.236 9.055   1.00 10.00 ? 207 LEU A CA   3  
ATOM 6064   C C    . LEU A 1 52  ? -7.345  -13.821 8.336   1.00 10.00 ? 207 LEU A C    3  
ATOM 6065   O O    . LEU A 1 52  ? -6.259  -13.851 8.916   1.00 10.00 ? 207 LEU A O    3  
ATOM 6066   C CB   . LEU A 1 52  ? -9.118  -15.586 8.513   1.00 10.00 ? 207 LEU A CB   3  
ATOM 6067   C CG   . LEU A 1 52  ? -10.480 -16.073 9.019   1.00 10.00 ? 207 LEU A CG   3  
ATOM 6068   C CD1  . LEU A 1 52  ? -10.851 -17.400 8.375   1.00 10.00 ? 207 LEU A CD1  3  
ATOM 6069   C CD2  . LEU A 1 52  ? -10.481 -16.198 10.534  1.00 10.00 ? 207 LEU A CD2  3  
ATOM 6070   H H    . LEU A 1 52  ? -10.529 -13.494 8.510   1.00 10.00 ? 207 LEU A H    3  
ATOM 6071   N N    . ALA A 1 53  ? -7.490  -13.439 7.070   1.00 10.00 ? 208 ALA A N    3  
ATOM 6072   C CA   . ALA A 1 53  ? -6.357  -13.005 6.253   1.00 10.00 ? 208 ALA A CA   3  
ATOM 6073   C C    . ALA A 1 53  ? -5.580  -11.838 6.865   1.00 10.00 ? 208 ALA A C    3  
ATOM 6074   O O    . ALA A 1 53  ? -4.406  -11.644 6.558   1.00 10.00 ? 208 ALA A O    3  
ATOM 6075   C CB   . ALA A 1 53  ? -6.822  -12.655 4.849   1.00 10.00 ? 208 ALA A CB   3  
ATOM 6076   H H    . ALA A 1 53  ? -8.361  -13.576 6.646   1.00 10.00 ? 208 ALA A H    3  
ATOM 6077   N N    . LEU A 1 54  ? -6.217  -11.070 7.739   1.00 10.00 ? 209 LEU A N    3  
ATOM 6078   C CA   . LEU A 1 54  ? -5.542  -9.947  8.377   1.00 10.00 ? 209 LEU A CA   3  
ATOM 6079   C C    . LEU A 1 54  ? -4.569  -10.451 9.433   1.00 10.00 ? 209 LEU A C    3  
ATOM 6080   O O    . LEU A 1 54  ? -3.550  -9.819  9.711   1.00 10.00 ? 209 LEU A O    3  
ATOM 6081   C CB   . LEU A 1 54  ? -6.550  -8.981  9.008   1.00 10.00 ? 209 LEU A CB   3  
ATOM 6082   C CG   . LEU A 1 54  ? -7.483  -8.247  8.046   1.00 10.00 ? 209 LEU A CG   3  
ATOM 6083   C CD1  . LEU A 1 54  ? -8.543  -7.484  8.819   1.00 10.00 ? 209 LEU A CD1  3  
ATOM 6084   C CD2  . LEU A 1 54  ? -6.699  -7.311  7.142   1.00 10.00 ? 209 LEU A CD2  3  
ATOM 6085   H H    . LEU A 1 54  ? -7.149  -11.269 7.968   1.00 10.00 ? 209 LEU A H    3  
ATOM 6086   N N    . GLU A 1 55  ? -4.899  -11.600 10.021  1.00 10.00 ? 210 GLU A N    3  
ATOM 6087   C CA   . GLU A 1 55  ? -4.055  -12.206 11.050  1.00 10.00 ? 210 GLU A CA   3  
ATOM 6088   C C    . GLU A 1 55  ? -2.825  -12.859 10.427  1.00 10.00 ? 210 GLU A C    3  
ATOM 6089   O O    . GLU A 1 55  ? -1.717  -12.737 10.951  1.00 10.00 ? 210 GLU A O    3  
ATOM 6090   C CB   . GLU A 1 55  ? -4.843  -13.267 11.826  1.00 10.00 ? 210 GLU A CB   3  
ATOM 6091   C CG   . GLU A 1 55  ? -6.278  -12.887 12.147  1.00 10.00 ? 210 GLU A CG   3  
ATOM 6092   C CD   . GLU A 1 55  ? -7.024  -13.986 12.883  1.00 10.00 ? 210 GLU A CD   3  
ATOM 6093   O OE1  . GLU A 1 55  ? -6.986  -14.005 14.130  1.00 10.00 ? 210 GLU A OE1  3  
ATOM 6094   O OE2  . GLU A 1 55  ? -7.659  -14.834 12.220  1.00 10.00 ? 210 GLU A OE2  3  
ATOM 6095   H H    . GLU A 1 55  ? -5.743  -12.035 9.767   1.00 10.00 ? 210 GLU A H    3  
ATOM 6096   N N    . GLY A 1 56  ? -3.025  -13.557 9.316   1.00 10.00 ? 211 GLY A N    3  
ATOM 6097   C CA   . GLY A 1 56  ? -1.917  -14.217 8.645   1.00 10.00 ? 211 GLY A CA   3  
ATOM 6098   C C    . GLY A 1 56  ? -1.033  -13.285 7.836   1.00 10.00 ? 211 GLY A C    3  
ATOM 6099   O O    . GLY A 1 56  ? -1.174  -12.061 7.889   1.00 10.00 ? 211 GLY A O    3  
ATOM 6100   H H    . GLY A 1 56  ? -3.937  -13.709 8.994   1.00 10.00 ? 211 GLY A H    3  
ATOM 6101   N N    . LYS A 1 57  ? -0.112  -13.881 7.081   1.00 10.00 ? 212 LYS A N    3  
ATOM 6102   C CA   . LYS A 1 57  ? 0.815   -13.125 6.247   1.00 10.00 ? 212 LYS A CA   3  
ATOM 6103   C C    . LYS A 1 57  ? 0.089   -12.363 5.143   1.00 10.00 ? 212 LYS A C    3  
ATOM 6104   O O    . LYS A 1 57  ? -1.089  -12.604 4.871   1.00 10.00 ? 212 LYS A O    3  
ATOM 6105   C CB   . LYS A 1 57  ? 1.846   -14.060 5.615   1.00 10.00 ? 212 LYS A CB   3  
ATOM 6106   C CG   . LYS A 1 57  ? 2.963   -14.507 6.540   1.00 10.00 ? 212 LYS A CG   3  
ATOM 6107   C CD   . LYS A 1 57  ? 3.991   -15.314 5.769   1.00 10.00 ? 212 LYS A CD   3  
ATOM 6108   C CE   . LYS A 1 57  ? 5.102   -15.820 6.671   1.00 10.00 ? 212 LYS A CE   3  
ATOM 6109   N NZ   . LYS A 1 57  ? 5.978   -16.786 5.962   1.00 10.00 ? 212 LYS A NZ   3  
ATOM 6110   H H    . LYS A 1 57  ? -0.059  -14.857 7.083   1.00 10.00 ? 212 LYS A H    3  
ATOM 6111   H HZ1  . LYS A 1 57  ? 6.397   -16.337 5.121   1.00 10.00 ? 212 LYS A HZ1  3  
ATOM 6112   H HZ2  . LYS A 1 57  ? 5.428   -17.616 5.662   1.00 10.00 ? 212 LYS A HZ2  3  
ATOM 6113   H HZ3  . LYS A 1 57  ? 6.743   -17.103 6.589   1.00 10.00 ? 212 LYS A HZ3  3  
ATOM 6114   N N    . ALA A 1 58  ? 0.816   -11.465 4.489   1.00 10.00 ? 213 ALA A N    3  
ATOM 6115   C CA   . ALA A 1 58  ? 0.259   -10.655 3.412   1.00 10.00 ? 213 ALA A CA   3  
ATOM 6116   C C    . ALA A 1 58  ? -0.086  -11.497 2.188   1.00 10.00 ? 213 ALA A C    3  
ATOM 6117   O O    . ALA A 1 58  ? -0.977  -11.140 1.412   1.00 10.00 ? 213 ALA A O    3  
ATOM 6118   C CB   . ALA A 1 58  ? 1.220   -9.536  3.040   1.00 10.00 ? 213 ALA A CB   3  
ATOM 6119   H H    . ALA A 1 58  ? 1.761   -11.345 4.736   1.00 10.00 ? 213 ALA A H    3  
ATOM 6120   N N    . SER A 1 59  ? 0.607   -12.621 2.037   1.00 10.00 ? 214 SER A N    3  
ATOM 6121   C CA   . SER A 1 59  ? 0.404   -13.527 0.913   1.00 10.00 ? 214 SER A CA   3  
ATOM 6122   C C    . SER A 1 59  ? -1.037  -14.037 0.883   1.00 10.00 ? 214 SER A C    3  
ATOM 6123   O O    . SER A 1 59  ? -1.666  -14.117 -0.174  1.00 10.00 ? 214 SER A O    3  
ATOM 6124   C CB   . SER A 1 59  ? 1.382   -14.697 1.061   1.00 10.00 ? 214 SER A CB   3  
ATOM 6125   O OG   . SER A 1 59  ? 2.260   -14.472 2.159   1.00 10.00 ? 214 SER A OG   3  
ATOM 6126   H H    . SER A 1 59  ? 1.284   -12.851 2.706   1.00 10.00 ? 214 SER A H    3  
ATOM 6127   H HG   . SER A 1 59  ? 3.168   -14.394 1.835   1.00 10.00 ? 214 SER A HG   3  
ATOM 6128   N N    . HIS A 1 60  ? -1.550  -14.361 2.058   1.00 10.00 ? 215 HIS A N    3  
ATOM 6129   C CA   . HIS A 1 60  ? -2.902  -14.851 2.202   1.00 10.00 ? 215 HIS A CA   3  
ATOM 6130   C C    . HIS A 1 60  ? -3.952  -13.744 2.079   1.00 10.00 ? 215 HIS A C    3  
ATOM 6131   O O    . HIS A 1 60  ? -5.130  -14.034 1.987   1.00 10.00 ? 215 HIS A O    3  
ATOM 6132   C CB   . HIS A 1 60  ? -3.090  -15.774 3.424   1.00 10.00 ? 215 HIS A CB   3  
ATOM 6133   C CG   . HIS A 1 60  ? -2.670  -17.194 3.141   1.00 10.00 ? 215 HIS A CG   3  
ATOM 6134   N ND1  . HIS A 1 60  ? -2.791  -18.234 4.048   1.00 10.00 ? 215 HIS A ND1  3  
ATOM 6135   C CD2  . HIS A 1 60  ? -2.120  -17.739 2.033   1.00 10.00 ? 215 HIS A CD2  3  
ATOM 6136   C CE1  . HIS A 1 60  ? -2.328  -19.347 3.497   1.00 10.00 ? 215 HIS A CE1  3  
ATOM 6137   N NE2  . HIS A 1 60  ? -1.918  -19.070 2.277   1.00 10.00 ? 215 HIS A NE2  3  
ATOM 6138   H H    . HIS A 1 60  ? -1.012  -14.213 2.864   1.00 10.00 ? 215 HIS A H    3  
ATOM 6139   H HD1  . HIS A 1 60  ? -3.167  -18.174 4.956   1.00 10.00 ? 215 HIS A HD1  3  
ATOM 6140   H HE2  . HIS A 1 60  ? -1.642  -19.733 1.606   1.00 10.00 ? 215 HIS A HE2  3  
ATOM 6141   N N    . ARG A 1 61  ? -3.522  -12.478 2.128   1.00 10.00 ? 216 ARG A N    3  
ATOM 6142   C CA   . ARG A 1 61  ? -4.458  -11.340 2.034   1.00 10.00 ? 216 ARG A CA   3  
ATOM 6143   C C    . ARG A 1 61  ? -4.942  -11.067 0.604   1.00 10.00 ? 216 ARG A C    3  
ATOM 6144   O O    . ARG A 1 61  ? -6.131  -11.198 0.313   1.00 10.00 ? 216 ARG A O    3  
ATOM 6145   C CB   . ARG A 1 61  ? -3.801  -10.097 2.638   1.00 10.00 ? 216 ARG A CB   3  
ATOM 6146   C CG   . ARG A 1 61  ? -3.407  -10.323 4.084   1.00 10.00 ? 216 ARG A CG   3  
ATOM 6147   C CD   . ARG A 1 61  ? -2.614  -9.182  4.673   1.00 10.00 ? 216 ARG A CD   3  
ATOM 6148   N NE   . ARG A 1 61  ? -1.886  -9.630  5.857   1.00 10.00 ? 216 ARG A NE   3  
ATOM 6149   C CZ   . ARG A 1 61  ? -0.806  -9.029  6.343   1.00 10.00 ? 216 ARG A CZ   3  
ATOM 6150   N NH1  . ARG A 1 61  ? -0.355  -7.925  5.767   1.00 10.00 ? 216 ARG A NH1  3  
ATOM 6151   N NH2  . ARG A 1 61  ? -0.183  -9.529  7.403   1.00 10.00 ? 216 ARG A NH2  3  
ATOM 6152   H H    . ARG A 1 61  ? -2.570  -12.258 2.144   1.00 10.00 ? 216 ARG A H    3  
ATOM 6153   H HE   . ARG A 1 61  ? -2.216  -10.451 6.302   1.00 10.00 ? 216 ARG A HE   3  
ATOM 6154   H HH11 . ARG A 1 61  ? -0.823  -7.551  4.969   1.00 10.00 ? 216 ARG A HH11 3  
ATOM 6155   H HH12 . ARG A 1 61  ? 0.465   -7.468  6.123   1.00 10.00 ? 216 ARG A HH12 3  
ATOM 6156   H HH21 . ARG A 1 61  ? -0.519  -10.381 7.836   1.00 10.00 ? 216 ARG A HH21 3  
ATOM 6157   H HH22 . ARG A 1 61  ? 0.621   -9.063  7.784   1.00 10.00 ? 216 ARG A HH22 3  
ATOM 6158   N N    . GLU A 1 62  ? -4.014  -10.688 -0.288  1.00 10.00 ? 217 GLU A N    3  
ATOM 6159   C CA   . GLU A 1 62  ? -4.331  -10.432 -1.693  1.00 10.00 ? 217 GLU A CA   3  
ATOM 6160   C C    . GLU A 1 62  ? -4.887  -11.671 -2.385  1.00 10.00 ? 217 GLU A C    3  
ATOM 6161   O O    . GLU A 1 62  ? -5.514  -11.597 -3.448  1.00 10.00 ? 217 GLU A O    3  
ATOM 6162   C CB   . GLU A 1 62  ? -3.166  -9.762  -2.447  1.00 10.00 ? 217 GLU A CB   3  
ATOM 6163   C CG   . GLU A 1 62  ? -3.098  -8.253  -2.188  1.00 10.00 ? 217 GLU A CG   3  
ATOM 6164   C CD   . GLU A 1 62  ? -2.068  -7.505  -3.016  1.00 10.00 ? 217 GLU A CD   3  
ATOM 6165   O OE1  . GLU A 1 62  ? -2.354  -7.173  -4.189  1.00 10.00 ? 217 GLU A OE1  3  
ATOM 6166   O OE2  . GLU A 1 62  ? -0.971  -7.221  -2.498  1.00 10.00 ? 217 GLU A OE2  3  
ATOM 6167   H H    . GLU A 1 62  ? -3.104  -10.519 0.029   1.00 10.00 ? 217 GLU A H    3  
ATOM 6168   N N    . MET A 1 63  ? -4.591  -12.812 -1.789  1.00 10.00 ? 218 MET A N    3  
ATOM 6169   C CA   . MET A 1 63  ? -5.051  -14.102 -2.278  1.00 10.00 ? 218 MET A CA   3  
ATOM 6170   C C    . MET A 1 63  ? -6.567  -14.230 -2.113  1.00 10.00 ? 218 MET A C    3  
ATOM 6171   O O    . MET A 1 63  ? -7.238  -14.880 -2.918  1.00 10.00 ? 218 MET A O    3  
ATOM 6172   C CB   . MET A 1 63  ? -4.367  -15.219 -1.479  1.00 10.00 ? 218 MET A CB   3  
ATOM 6173   C CG   . MET A 1 63  ? -4.700  -16.616 -1.961  1.00 10.00 ? 218 MET A CG   3  
ATOM 6174   S SD   . MET A 1 63  ? -4.534  -17.865 -0.672  1.00 10.00 ? 218 MET A SD   3  
ATOM 6175   C CE   . MET A 1 63  ? -4.774  -19.357 -1.629  1.00 10.00 ? 218 MET A CE   3  
ATOM 6176   H H    . MET A 1 63  ? -4.061  -12.783 -0.969  1.00 10.00 ? 218 MET A H    3  
ATOM 6177   N N    . THR A 1 64  ? -7.102  -13.599 -1.071  1.00 10.00 ? 219 THR A N    3  
ATOM 6178   C CA   . THR A 1 64  ? -8.529  -13.650 -0.795  1.00 10.00 ? 219 THR A CA   3  
ATOM 6179   C C    . THR A 1 64  ? -9.328  -12.834 -1.807  1.00 10.00 ? 219 THR A C    3  
ATOM 6180   O O    . THR A 1 64  ? -10.450 -13.208 -2.155  1.00 10.00 ? 219 THR A O    3  
ATOM 6181   C CB   . THR A 1 64  ? -8.837  -13.159 0.625   1.00 10.00 ? 219 THR A CB   3  
ATOM 6182   O OG1  . THR A 1 64  ? -7.765  -13.558 1.480   1.00 10.00 ? 219 THR A OG1  3  
ATOM 6183   C CG2  . THR A 1 64  ? -10.133 -13.776 1.130   1.00 10.00 ? 219 THR A CG2  3  
ATOM 6184   H H    . THR A 1 64  ? -6.519  -13.091 -0.461  1.00 10.00 ? 219 THR A H    3  
ATOM 6185   H HG1  . THR A 1 64  ? -7.951  -13.289 2.380   1.00 10.00 ? 219 THR A HG1  3  
ATOM 6186   N N    . SER A 1 65  ? -8.775  -11.711 -2.258  1.00 10.00 ? 220 SER A N    3  
ATOM 6187   C CA   . SER A 1 65  ? -9.438  -10.869 -3.249  1.00 10.00 ? 220 SER A CA   3  
ATOM 6188   C C    . SER A 1 65  ? -9.842  -11.655 -4.501  1.00 10.00 ? 220 SER A C    3  
ATOM 6189   O O    . SER A 1 65  ? -10.790 -11.283 -5.194  1.00 10.00 ? 220 SER A O    3  
ATOM 6190   C CB   . SER A 1 65  ? -8.533  -9.695  -3.607  1.00 10.00 ? 220 SER A CB   3  
ATOM 6191   O OG   . SER A 1 65  ? -7.935  -9.154  -2.437  1.00 10.00 ? 220 SER A OG   3  
ATOM 6192   H H    . SER A 1 65  ? -7.937  -11.370 -1.873  1.00 10.00 ? 220 SER A H    3  
ATOM 6193   H HG   . SER A 1 65  ? -8.036  -8.198  -2.435  1.00 10.00 ? 220 SER A HG   3  
ATOM 6194   N N    . LYS A 1 66  ? -9.127  -12.743 -4.783  1.00 10.00 ? 221 LYS A N    3  
ATOM 6195   C CA   . LYS A 1 66  ? -9.441  -13.575 -5.936  1.00 10.00 ? 221 LYS A CA   3  
ATOM 6196   C C    . LYS A 1 66  ? -10.797 -14.250 -5.733  1.00 10.00 ? 221 LYS A C    3  
ATOM 6197   O O    . LYS A 1 66  ? -11.537 -14.484 -6.690  1.00 10.00 ? 221 LYS A O    3  
ATOM 6198   C CB   . LYS A 1 66  ? -8.354  -14.630 -6.163  1.00 10.00 ? 221 LYS A CB   3  
ATOM 6199   C CG   . LYS A 1 66  ? -8.579  -15.518 -7.384  1.00 10.00 ? 221 LYS A CG   3  
ATOM 6200   C CD   . LYS A 1 66  ? -8.286  -14.774 -8.680  1.00 10.00 ? 221 LYS A CD   3  
ATOM 6201   C CE   . LYS A 1 66  ? -9.550  -14.203 -9.310  1.00 10.00 ? 221 LYS A CE   3  
ATOM 6202   N NZ   . LYS A 1 66  ? -10.270 -15.213 -10.130 1.00 10.00 ? 221 LYS A NZ   3  
ATOM 6203   H H    . LYS A 1 66  ? -8.380  -12.993 -4.198  1.00 10.00 ? 221 LYS A H    3  
ATOM 6204   H HZ1  . LYS A 1 66  ? -10.830 -14.743 -10.866 1.00 10.00 ? 221 LYS A HZ1  3  
ATOM 6205   H HZ2  . LYS A 1 66  ? -10.914 -15.781 -9.530  1.00 10.00 ? 221 LYS A HZ2  3  
ATOM 6206   H HZ3  . LYS A 1 66  ? -9.591  -15.852 -10.589 1.00 10.00 ? 221 LYS A HZ3  3  
ATOM 6207   N N    . LEU A 1 67  ? -11.115 -14.546 -4.475  1.00 10.00 ? 222 LEU A N    3  
ATOM 6208   C CA   . LEU A 1 67  ? -12.380 -15.178 -4.131  1.00 10.00 ? 222 LEU A CA   3  
ATOM 6209   C C    . LEU A 1 67  ? -13.524 -14.213 -4.391  1.00 10.00 ? 222 LEU A C    3  
ATOM 6210   O O    . LEU A 1 67  ? -14.556 -14.596 -4.934  1.00 10.00 ? 222 LEU A O    3  
ATOM 6211   C CB   . LEU A 1 67  ? -12.392 -15.611 -2.660  1.00 10.00 ? 222 LEU A CB   3  
ATOM 6212   C CG   . LEU A 1 67  ? -13.598 -16.437 -2.198  1.00 10.00 ? 222 LEU A CG   3  
ATOM 6213   C CD1  . LEU A 1 67  ? -13.645 -17.775 -2.920  1.00 10.00 ? 222 LEU A CD1  3  
ATOM 6214   C CD2  . LEU A 1 67  ? -13.569 -16.639 -0.690  1.00 10.00 ? 222 LEU A CD2  3  
ATOM 6215   H H    . LEU A 1 67  ? -10.485 -14.321 -3.757  1.00 10.00 ? 222 LEU A H    3  
ATOM 6216   N N    . LEU A 1 68  ? -13.323 -12.953 -4.011  1.00 10.00 ? 223 LEU A N    3  
ATOM 6217   C CA   . LEU A 1 68  ? -14.334 -11.916 -4.198  1.00 10.00 ? 223 LEU A CA   3  
ATOM 6218   C C    . LEU A 1 68  ? -14.814 -11.878 -5.649  1.00 10.00 ? 223 LEU A C    3  
ATOM 6219   O O    . LEU A 1 68  ? -15.993 -12.108 -5.927  1.00 10.00 ? 223 LEU A O    3  
ATOM 6220   C CB   . LEU A 1 68  ? -13.764 -10.548 -3.811  1.00 10.00 ? 223 LEU A CB   3  
ATOM 6221   C CG   . LEU A 1 68  ? -13.165 -10.423 -2.409  1.00 10.00 ? 223 LEU A CG   3  
ATOM 6222   C CD1  . LEU A 1 68  ? -12.490 -9.071  -2.242  1.00 10.00 ? 223 LEU A CD1  3  
ATOM 6223   C CD2  . LEU A 1 68  ? -14.236 -10.625 -1.347  1.00 10.00 ? 223 LEU A CD2  3  
ATOM 6224   H H    . LEU A 1 68  ? -12.470 -12.717 -3.586  1.00 10.00 ? 223 LEU A H    3  
ATOM 6225   N N    . SER A 1 69  ? -13.891 -11.570 -6.561  1.00 10.00 ? 224 SER A N    3  
ATOM 6226   C CA   . SER A 1 69  ? -14.185 -11.510 -7.993  1.00 10.00 ? 224 SER A CA   3  
ATOM 6227   C C    . SER A 1 69  ? -14.834 -12.801 -8.523  1.00 10.00 ? 224 SER A C    3  
ATOM 6228   O O    . SER A 1 69  ? -15.663 -12.754 -9.436  1.00 10.00 ? 224 SER A O    3  
ATOM 6229   C CB   . SER A 1 69  ? -12.898 -11.195 -8.767  1.00 10.00 ? 224 SER A CB   3  
ATOM 6230   O OG   . SER A 1 69  ? -13.120 -11.188 -10.165 1.00 10.00 ? 224 SER A OG   3  
ATOM 6231   H H    . SER A 1 69  ? -13.003 -11.286 -6.256  1.00 10.00 ? 224 SER A H    3  
ATOM 6232   H HG   . SER A 1 69  ? -12.771 -10.372 -10.540 1.00 10.00 ? 224 SER A HG   3  
ATOM 6233   N N    . ASP A 1 70  ? -14.451 -13.934 -7.956  1.00 10.00 ? 225 ASP A N    3  
ATOM 6234   C CA   . ASP A 1 70  ? -15.000 -15.219 -8.384  1.00 10.00 ? 225 ASP A CA   3  
ATOM 6235   C C    . ASP A 1 70  ? -16.409 -15.441 -7.855  1.00 10.00 ? 225 ASP A C    3  
ATOM 6236   O O    . ASP A 1 70  ? -17.305 -15.870 -8.592  1.00 10.00 ? 225 ASP A O    3  
ATOM 6237   C CB   . ASP A 1 70  ? -14.079 -16.388 -8.056  1.00 10.00 ? 225 ASP A CB   3  
ATOM 6238   C CG   . ASP A 1 70  ? -13.259 -16.800 -9.258  1.00 10.00 ? 225 ASP A CG   3  
ATOM 6239   O OD1  . ASP A 1 70  ? -13.847 -17.016 -10.340 1.00 10.00 ? 225 ASP A OD1  3  
ATOM 6240   O OD2  . ASP A 1 70  ? -12.023 -16.900 -9.136  1.00 10.00 ? 225 ASP A OD2  3  
ATOM 6241   H H    . ASP A 1 70  ? -13.858 -13.881 -7.179  1.00 10.00 ? 225 ASP A H    3  
ATOM 6242   N N    . LEU A 1 71  ? -16.595 -15.160 -6.572  1.00 10.00 ? 226 LEU A N    3  
ATOM 6243   C CA   . LEU A 1 71  ? -17.883 -15.313 -5.926  1.00 10.00 ? 226 LEU A CA   3  
ATOM 6244   C C    . LEU A 1 71  ? -18.935 -14.419 -6.568  1.00 10.00 ? 226 LEU A C    3  
ATOM 6245   O O    . LEU A 1 71  ? -20.057 -14.868 -6.824  1.00 10.00 ? 226 LEU A O    3  
ATOM 6246   C CB   . LEU A 1 71  ? -17.794 -15.020 -4.425  1.00 10.00 ? 226 LEU A CB   3  
ATOM 6247   C CG   . LEU A 1 71  ? -17.028 -16.041 -3.579  1.00 10.00 ? 226 LEU A CG   3  
ATOM 6248   C CD1  . LEU A 1 71  ? -17.170 -15.721 -2.099  1.00 10.00 ? 226 LEU A CD1  3  
ATOM 6249   C CD2  . LEU A 1 71  ? -17.506 -17.457 -3.874  1.00 10.00 ? 226 LEU A CD2  3  
ATOM 6250   H H    . LEU A 1 71  ? -15.823 -14.863 -6.036  1.00 10.00 ? 226 LEU A H    3  
ATOM 6251   N N    . CYS A 1 72  ? -18.584 -13.165 -6.837  1.00 10.00 ? 227 CYS A N    3  
ATOM 6252   C CA   . CYS A 1 72  ? -19.518 -12.230 -7.451  1.00 10.00 ? 227 CYS A CA   3  
ATOM 6253   C C    . CYS A 1 72  ? -19.904 -12.688 -8.850  1.00 10.00 ? 227 CYS A C    3  
ATOM 6254   O O    . CYS A 1 72  ? -19.070 -13.159 -9.624  1.00 10.00 ? 227 CYS A O    3  
ATOM 6255   C CB   . CYS A 1 72  ? -18.905 -10.832 -7.496  1.00 10.00 ? 227 CYS A CB   3  
ATOM 6256   S SG   . CYS A 1 72  ? -20.105 -9.481  -7.432  1.00 10.00 ? 227 CYS A SG   3  
ATOM 6257   H H    . CYS A 1 72  ? -17.691 -12.807 -6.631  1.00 10.00 ? 227 CYS A H    3  
ATOM 6258   H HG   . CYS A 1 72  ? -20.809 -9.516  -8.555  1.00 10.00 ? 227 CYS A HG   3  
ATOM 6259   N N    . GLY A 1 73  ? -21.188 -12.583 -9.143  1.00 10.00 ? 228 GLY A N    3  
ATOM 6260   C CA   . GLY A 1 73  ? -21.707 -12.989 -10.431 1.00 10.00 ? 228 GLY A CA   3  
ATOM 6261   C C    . GLY A 1 73  ? -22.147 -14.433 -10.378 1.00 10.00 ? 228 GLY A C    3  
ATOM 6262   O O    . GLY A 1 73  ? -23.203 -14.796 -10.890 1.00 10.00 ? 228 GLY A O    3  
ATOM 6263   H H    . GLY A 1 73  ? -21.800 -12.256 -8.442  1.00 10.00 ? 228 GLY A H    3  
ATOM 6264   N N    . THR A 1 74  ? -21.335 -15.245 -9.724  1.00 10.00 ? 229 THR A N    3  
ATOM 6265   C CA   . THR A 1 74  ? -21.606 -16.658 -9.574  1.00 10.00 ? 229 THR A CA   3  
ATOM 6266   C C    . THR A 1 74  ? -22.658 -16.912 -8.492  1.00 10.00 ? 229 THR A C    3  
ATOM 6267   O O    . THR A 1 74  ? -23.737 -17.438 -8.775  1.00 10.00 ? 229 THR A O    3  
ATOM 6268   C CB   . THR A 1 74  ? -20.312 -17.416 -9.218  1.00 10.00 ? 229 THR A CB   3  
ATOM 6269   O OG1  . THR A 1 74  ? -19.258 -16.995 -10.097 1.00 10.00 ? 229 THR A OG1  3  
ATOM 6270   C CG2  . THR A 1 74  ? -20.509 -18.917 -9.347  1.00 10.00 ? 229 THR A CG2  3  
ATOM 6271   H H    . THR A 1 74  ? -20.509 -14.878 -9.342  1.00 10.00 ? 229 THR A H    3  
ATOM 6272   H HG1  . THR A 1 74  ? -18.627 -16.447 -9.605  1.00 10.00 ? 229 THR A HG1  3  
ATOM 6273   N N    . VAL A 1 75  ? -22.349 -16.528 -7.254  1.00 10.00 ? 230 VAL A N    3  
ATOM 6274   C CA   . VAL A 1 75  ? -23.271 -16.742 -6.137  1.00 10.00 ? 230 VAL A CA   3  
ATOM 6275   C C    . VAL A 1 75  ? -23.399 -15.501 -5.255  1.00 10.00 ? 230 VAL A C    3  
ATOM 6276   O O    . VAL A 1 75  ? -24.074 -15.526 -4.224  1.00 10.00 ? 230 VAL A O    3  
ATOM 6277   C CB   . VAL A 1 75  ? -22.839 -17.937 -5.256  1.00 10.00 ? 230 VAL A CB   3  
ATOM 6278   C CG1  . VAL A 1 75  ? -23.108 -19.256 -5.961  1.00 10.00 ? 230 VAL A CG1  3  
ATOM 6279   C CG2  . VAL A 1 75  ? -21.370 -17.822 -4.872  1.00 10.00 ? 230 VAL A CG2  3  
ATOM 6280   H H    . VAL A 1 75  ? -21.485 -16.087 -7.088  1.00 10.00 ? 230 VAL A H    3  
ATOM 6281   N N    . MET A 1 76  ? -22.759 -14.419 -5.661  1.00 10.00 ? 231 MET A N    3  
ATOM 6282   C CA   . MET A 1 76  ? -22.799 -13.184 -4.891  1.00 10.00 ? 231 MET A CA   3  
ATOM 6283   C C    . MET A 1 76  ? -23.040 -11.998 -5.813  1.00 10.00 ? 231 MET A C    3  
ATOM 6284   O O    . MET A 1 76  ? -22.541 -11.972 -6.934  1.00 10.00 ? 231 MET A O    3  
ATOM 6285   C CB   . MET A 1 76  ? -21.487 -13.012 -4.121  1.00 10.00 ? 231 MET A CB   3  
ATOM 6286   C CG   . MET A 1 76  ? -21.498 -11.893 -3.094  1.00 10.00 ? 231 MET A CG   3  
ATOM 6287   S SD   . MET A 1 76  ? -20.086 -11.964 -1.976  1.00 10.00 ? 231 MET A SD   3  
ATOM 6288   C CE   . MET A 1 76  ? -18.726 -11.758 -3.123  1.00 10.00 ? 231 MET A CE   3  
ATOM 6289   H H    . MET A 1 76  ? -22.252 -14.441 -6.500  1.00 10.00 ? 231 MET A H    3  
ATOM 6290   N N    . SER A 1 77  ? -23.820 -11.030 -5.356  1.00 10.00 ? 232 SER A N    3  
ATOM 6291   C CA   . SER A 1 77  ? -24.110 -9.851  -6.157  1.00 10.00 ? 232 SER A CA   3  
ATOM 6292   C C    . SER A 1 77  ? -23.251 -8.669  -5.713  1.00 10.00 ? 232 SER A C    3  
ATOM 6293   O O    . SER A 1 77  ? -22.739 -8.659  -4.590  1.00 10.00 ? 232 SER A O    3  
ATOM 6294   C CB   . SER A 1 77  ? -25.597 -9.497  -6.060  1.00 10.00 ? 232 SER A CB   3  
ATOM 6295   O OG   . SER A 1 77  ? -25.968 -9.199  -4.724  1.00 10.00 ? 232 SER A OG   3  
ATOM 6296   H H    . SER A 1 77  ? -24.213 -11.108 -4.457  1.00 10.00 ? 232 SER A H    3  
ATOM 6297   H HG   . SER A 1 77  ? -25.880 -9.997  -4.179  1.00 10.00 ? 232 SER A HG   3  
ATOM 6298   N N    . THR A 1 78  ? -23.059 -7.707  -6.607  1.00 10.00 ? 233 THR A N    3  
ATOM 6299   C CA   . THR A 1 78  ? -22.281 -6.505  -6.309  1.00 10.00 ? 233 THR A CA   3  
ATOM 6300   C C    . THR A 1 78  ? -22.695 -5.866  -4.985  1.00 10.00 ? 233 THR A C    3  
ATOM 6301   O O    . THR A 1 78  ? -21.845 -5.476  -4.180  1.00 10.00 ? 233 THR A O    3  
ATOM 6302   C CB   . THR A 1 78  ? -22.396 -5.475  -7.442  1.00 10.00 ? 233 THR A CB   3  
ATOM 6303   O OG1  . THR A 1 78  ? -23.715 -5.539  -8.006  1.00 10.00 ? 233 THR A OG1  3  
ATOM 6304   C CG2  . THR A 1 78  ? -21.376 -5.772  -8.526  1.00 10.00 ? 233 THR A CG2  3  
ATOM 6305   H H    . THR A 1 78  ? -23.399 -7.836  -7.519  1.00 10.00 ? 233 THR A H    3  
ATOM 6306   H HG1  . THR A 1 78  ? -24.140 -4.675  -7.922  1.00 10.00 ? 233 THR A HG1  3  
ATOM 6307   N N    . THR A 1 79  ? -24.006 -5.772  -4.762  1.00 10.00 ? 234 THR A N    3  
ATOM 6308   C CA   . THR A 1 79  ? -24.541 -5.203  -3.532  1.00 10.00 ? 234 THR A CA   3  
ATOM 6309   C C    . THR A 1 79  ? -23.998 -5.965  -2.325  1.00 10.00 ? 234 THR A C    3  
ATOM 6310   O O    . THR A 1 79  ? -23.566 -5.364  -1.341  1.00 10.00 ? 234 THR A O    3  
ATOM 6311   C CB   . THR A 1 79  ? -26.077 -5.285  -3.526  1.00 10.00 ? 234 THR A CB   3  
ATOM 6312   O OG1  . THR A 1 79  ? -26.564 -5.064  -4.857  1.00 10.00 ? 234 THR A OG1  3  
ATOM 6313   C CG2  . THR A 1 79  ? -26.668 -4.242  -2.588  1.00 10.00 ? 234 THR A CG2  3  
ATOM 6314   H H    . THR A 1 79  ? -24.629 -6.083  -5.452  1.00 10.00 ? 234 THR A H    3  
ATOM 6315   H HG1  . THR A 1 79  ? -26.418 -4.141  -5.104  1.00 10.00 ? 234 THR A HG1  3  
ATOM 6316   N N    . ASP A 1 80  ? -24.043 -7.294  -2.413  1.00 10.00 ? 235 ASP A N    3  
ATOM 6317   C CA   . ASP A 1 80  ? -23.534 -8.159  -1.352  1.00 10.00 ? 235 ASP A CA   3  
ATOM 6318   C C    . ASP A 1 80  ? -22.101 -7.782  -0.990  1.00 10.00 ? 235 ASP A C    3  
ATOM 6319   O O    . ASP A 1 80  ? -21.768 -7.644  0.185   1.00 10.00 ? 235 ASP A O    3  
ATOM 6320   C CB   . ASP A 1 80  ? -23.602 -9.639  -1.744  1.00 10.00 ? 235 ASP A CB   3  
ATOM 6321   C CG   . ASP A 1 80  ? -25.014 -10.181 -1.826  1.00 10.00 ? 235 ASP A CG   3  
ATOM 6322   O OD1  . ASP A 1 80  ? -25.847 -9.837  -0.960  1.00 10.00 ? 235 ASP A OD1  3  
ATOM 6323   O OD2  . ASP A 1 80  ? -25.299 -10.961 -2.766  1.00 10.00 ? 235 ASP A OD2  3  
ATOM 6324   H H    . ASP A 1 80  ? -24.469 -7.679  -3.208  1.00 10.00 ? 235 ASP A H    3  
ATOM 6325   N N    . VAL A 1 81  ? -21.269 -7.585  -2.011  1.00 10.00 ? 236 VAL A N    3  
ATOM 6326   C CA   . VAL A 1 81  ? -19.874 -7.205  -1.806  1.00 10.00 ? 236 VAL A CA   3  
ATOM 6327   C C    . VAL A 1 81  ? -19.789 -5.863  -1.082  1.00 10.00 ? 236 VAL A C    3  
ATOM 6328   O O    . VAL A 1 81  ? -19.036 -5.709  -0.118  1.00 10.00 ? 236 VAL A O    3  
ATOM 6329   C CB   . VAL A 1 81  ? -19.110 -7.106  -3.144  1.00 10.00 ? 236 VAL A CB   3  
ATOM 6330   C CG1  . VAL A 1 81  ? -17.632 -6.831  -2.908  1.00 10.00 ? 236 VAL A CG1  3  
ATOM 6331   C CG2  . VAL A 1 81  ? -19.294 -8.374  -3.962  1.00 10.00 ? 236 VAL A CG2  3  
ATOM 6332   H H    . VAL A 1 81  ? -21.606 -7.695  -2.928  1.00 10.00 ? 236 VAL A H    3  
ATOM 6333   N N    . GLU A 1 82  ? -20.582 -4.904  -1.542  1.00 10.00 ? 237 GLU A N    3  
ATOM 6334   C CA   . GLU A 1 82  ? -20.615 -3.575  -0.947  1.00 10.00 ? 237 GLU A CA   3  
ATOM 6335   C C    . GLU A 1 82  ? -21.026 -3.662  0.520   1.00 10.00 ? 237 GLU A C    3  
ATOM 6336   O O    . GLU A 1 82  ? -20.385 -3.073  1.393   1.00 10.00 ? 237 GLU A O    3  
ATOM 6337   C CB   . GLU A 1 82  ? -21.585 -2.685  -1.718  1.00 10.00 ? 237 GLU A CB   3  
ATOM 6338   C CG   . GLU A 1 82  ? -21.174 -1.227  -1.785  1.00 10.00 ? 237 GLU A CG   3  
ATOM 6339   C CD   . GLU A 1 82  ? -21.728 -0.540  -3.012  1.00 10.00 ? 237 GLU A CD   3  
ATOM 6340   O OE1  . GLU A 1 82  ? -22.862 -0.012  -2.945  1.00 10.00 ? 237 GLU A OE1  3  
ATOM 6341   O OE2  . GLU A 1 82  ? -21.044 -0.538  -4.057  1.00 10.00 ? 237 GLU A OE2  3  
ATOM 6342   H H    . GLU A 1 82  ? -21.163 -5.098  -2.311  1.00 10.00 ? 237 GLU A H    3  
ATOM 6343   N N    . LYS A 1 83  ? -22.090 -4.416  0.780   1.00 10.00 ? 238 LYS A N    3  
ATOM 6344   C CA   . LYS A 1 83  ? -22.591 -4.611  2.138   1.00 10.00 ? 238 LYS A CA   3  
ATOM 6345   C C    . LYS A 1 83  ? -21.530 -5.273  3.011   1.00 10.00 ? 238 LYS A C    3  
ATOM 6346   O O    . LYS A 1 83  ? -21.458 -5.026  4.216   1.00 10.00 ? 238 LYS A O    3  
ATOM 6347   C CB   . LYS A 1 83  ? -23.861 -5.470  2.130   1.00 10.00 ? 238 LYS A CB   3  
ATOM 6348   C CG   . LYS A 1 83  ? -25.061 -4.829  1.447   1.00 10.00 ? 238 LYS A CG   3  
ATOM 6349   C CD   . LYS A 1 83  ? -26.264 -5.763  1.452   1.00 10.00 ? 238 LYS A CD   3  
ATOM 6350   C CE   . LYS A 1 83  ? -26.013 -6.991  0.592   1.00 10.00 ? 238 LYS A CE   3  
ATOM 6351   N NZ   . LYS A 1 83  ? -26.718 -8.199  1.098   1.00 10.00 ? 238 LYS A NZ   3  
ATOM 6352   H H    . LYS A 1 83  ? -22.562 -4.846  0.031   1.00 10.00 ? 238 LYS A H    3  
ATOM 6353   H HZ1  . LYS A 1 83  ? -26.490 -8.355  2.104   1.00 10.00 ? 238 LYS A HZ1  3  
ATOM 6354   H HZ2  . LYS A 1 83  ? -26.424 -9.037  0.550   1.00 10.00 ? 238 LYS A HZ2  3  
ATOM 6355   H HZ3  . LYS A 1 83  ? -27.746 -8.080  1.000   1.00 10.00 ? 238 LYS A HZ3  3  
ATOM 6356   N N    . SER A 1 84  ? -20.712 -6.123  2.393   1.00 10.00 ? 239 SER A N    3  
ATOM 6357   C CA   . SER A 1 84  ? -19.647 -6.819  3.095   1.00 10.00 ? 239 SER A CA   3  
ATOM 6358   C C    . SER A 1 84  ? -18.603 -5.826  3.589   1.00 10.00 ? 239 SER A C    3  
ATOM 6359   O O    . SER A 1 84  ? -18.191 -5.872  4.747   1.00 10.00 ? 239 SER A O    3  
ATOM 6360   C CB   . SER A 1 84  ? -18.993 -7.862  2.184   1.00 10.00 ? 239 SER A CB   3  
ATOM 6361   O OG   . SER A 1 84  ? -19.947 -8.787  1.695   1.00 10.00 ? 239 SER A OG   3  
ATOM 6362   H H    . SER A 1 84  ? -20.834 -6.284  1.433   1.00 10.00 ? 239 SER A H    3  
ATOM 6363   H HG   . SER A 1 84  ? -20.546 -8.339  1.083   1.00 10.00 ? 239 SER A HG   3  
ATOM 6364   N N    . PHE A 1 85  ? -18.195 -4.914  2.711   1.00 10.00 ? 240 PHE A N    3  
ATOM 6365   C CA   . PHE A 1 85  ? -17.204 -3.906  3.071   1.00 10.00 ? 240 PHE A CA   3  
ATOM 6366   C C    . PHE A 1 85  ? -17.742 -2.964  4.134   1.00 10.00 ? 240 PHE A C    3  
ATOM 6367   O O    . PHE A 1 85  ? -17.014 -2.565  5.044   1.00 10.00 ? 240 PHE A O    3  
ATOM 6368   C CB   . PHE A 1 85  ? -16.692 -3.148  1.848   1.00 10.00 ? 240 PHE A CB   3  
ATOM 6369   C CG   . PHE A 1 85  ? -15.684 -3.934  1.067   1.00 10.00 ? 240 PHE A CG   3  
ATOM 6370   C CD1  . PHE A 1 85  ? -14.393 -4.093  1.542   1.00 10.00 ? 240 PHE A CD1  3  
ATOM 6371   C CD2  . PHE A 1 85  ? -16.032 -4.537  -0.129  1.00 10.00 ? 240 PHE A CD2  3  
ATOM 6372   C CE1  . PHE A 1 85  ? -13.464 -4.832  0.836   1.00 10.00 ? 240 PHE A CE1  3  
ATOM 6373   C CE2  . PHE A 1 85  ? -15.108 -5.276  -0.842  1.00 10.00 ? 240 PHE A CE2  3  
ATOM 6374   C CZ   . PHE A 1 85  ? -13.824 -5.428  -0.357  1.00 10.00 ? 240 PHE A CZ   3  
ATOM 6375   H H    . PHE A 1 85  ? -18.564 -4.926  1.798   1.00 10.00 ? 240 PHE A H    3  
ATOM 6376   N N    . ASP A 1 86  ? -19.020 -2.611  4.022   1.00 10.00 ? 241 ASP A N    3  
ATOM 6377   C CA   . ASP A 1 86  ? -19.668 -1.742  5.004   1.00 10.00 ? 241 ASP A CA   3  
ATOM 6378   C C    . ASP A 1 86  ? -19.592 -2.406  6.378   1.00 10.00 ? 241 ASP A C    3  
ATOM 6379   O O    . ASP A 1 86  ? -19.137 -1.809  7.354   1.00 10.00 ? 241 ASP A O    3  
ATOM 6380   C CB   . ASP A 1 86  ? -21.139 -1.550  4.611   1.00 10.00 ? 241 ASP A CB   3  
ATOM 6381   C CG   . ASP A 1 86  ? -21.735 -0.256  5.116   1.00 10.00 ? 241 ASP A CG   3  
ATOM 6382   O OD1  . ASP A 1 86  ? -21.337 0.817   4.617   1.00 10.00 ? 241 ASP A OD1  3  
ATOM 6383   O OD2  . ASP A 1 86  ? -22.629 -0.305  5.985   1.00 10.00 ? 241 ASP A OD2  3  
ATOM 6384   H H    . ASP A 1 86  ? -19.537 -2.901  3.239   1.00 10.00 ? 241 ASP A H    3  
ATOM 6385   N N    . LYS A 1 87  ? -20.054 -3.655  6.425   1.00 10.00 ? 242 LYS A N    3  
ATOM 6386   C CA   . LYS A 1 87  ? -20.010 -4.460  7.650   1.00 10.00 ? 242 LYS A CA   3  
ATOM 6387   C C    . LYS A 1 87  ? -18.587 -4.536  8.199   1.00 10.00 ? 242 LYS A C    3  
ATOM 6388   O O    . LYS A 1 87  ? -18.365 -4.376  9.399   1.00 10.00 ? 242 LYS A O    3  
ATOM 6389   C CB   . LYS A 1 87  ? -20.530 -5.880  7.387   1.00 10.00 ? 242 LYS A CB   3  
ATOM 6390   C CG   . LYS A 1 87  ? -22.041 -6.002  7.250   1.00 10.00 ? 242 LYS A CG   3  
ATOM 6391   C CD   . LYS A 1 87  ? -22.426 -7.410  6.813   1.00 10.00 ? 242 LYS A CD   3  
ATOM 6392   C CE   . LYS A 1 87  ? -23.934 -7.612  6.808   1.00 10.00 ? 242 LYS A CE   3  
ATOM 6393   N NZ   . LYS A 1 87  ? -24.604 -6.749  5.802   1.00 10.00 ? 242 LYS A NZ   3  
ATOM 6394   H H    . LYS A 1 87  ? -20.523 -3.998  5.634   1.00 10.00 ? 242 LYS A H    3  
ATOM 6395   H HZ1  . LYS A 1 87  ? -24.827 -5.823  6.219   1.00 10.00 ? 242 LYS A HZ1  3  
ATOM 6396   H HZ2  . LYS A 1 87  ? -25.494 -7.193  5.477   1.00 10.00 ? 242 LYS A HZ2  3  
ATOM 6397   H HZ3  . LYS A 1 87  ? -23.985 -6.606  4.982   1.00 10.00 ? 242 LYS A HZ3  3  
ATOM 6398   N N    . LEU A 1 88  ? -17.631 -4.766  7.303   1.00 10.00 ? 243 LEU A N    3  
ATOM 6399   C CA   . LEU A 1 88  ? -16.225 -4.871  7.675   1.00 10.00 ? 243 LEU A CA   3  
ATOM 6400   C C    . LEU A 1 88  ? -15.725 -3.588  8.338   1.00 10.00 ? 243 LEU A C    3  
ATOM 6401   O O    . LEU A 1 88  ? -15.135 -3.637  9.416   1.00 10.00 ? 243 LEU A O    3  
ATOM 6402   C CB   . LEU A 1 88  ? -15.369 -5.205  6.449   1.00 10.00 ? 243 LEU A CB   3  
ATOM 6403   C CG   . LEU A 1 88  ? -13.852 -5.230  6.662   1.00 10.00 ? 243 LEU A CG   3  
ATOM 6404   C CD1  . LEU A 1 88  ? -13.443 -6.405  7.540   1.00 10.00 ? 243 LEU A CD1  3  
ATOM 6405   C CD2  . LEU A 1 88  ? -13.124 -5.267  5.327   1.00 10.00 ? 243 LEU A CD2  3  
ATOM 6406   H H    . LEU A 1 88  ? -17.883 -4.873  6.360   1.00 10.00 ? 243 LEU A H    3  
ATOM 6407   N N    . LEU A 1 89  ? -15.938 -2.460  7.662   1.00 10.00 ? 244 LEU A N    3  
ATOM 6408   C CA   . LEU A 1 89  ? -15.526 -1.152  8.182   1.00 10.00 ? 244 LEU A CA   3  
ATOM 6409   C C    . LEU A 1 89  ? -15.995 -0.941  9.621   1.00 10.00 ? 244 LEU A C    3  
ATOM 6410   O O    . LEU A 1 89  ? -15.286 -0.337  10.428  1.00 10.00 ? 244 LEU A O    3  
ATOM 6411   C CB   . LEU A 1 89  ? -16.039 -0.022  7.284   1.00 10.00 ? 244 LEU A CB   3  
ATOM 6412   C CG   . LEU A 1 89  ? -15.285 0.189   5.967   1.00 10.00 ? 244 LEU A CG   3  
ATOM 6413   C CD1  . LEU A 1 89  ? -15.957 1.269   5.135   1.00 10.00 ? 244 LEU A CD1  3  
ATOM 6414   C CD2  . LEU A 1 89  ? -13.832 0.551   6.237   1.00 10.00 ? 244 LEU A CD2  3  
ATOM 6415   H H    . LEU A 1 89  ? -16.318 -2.521  6.758   1.00 10.00 ? 244 LEU A H    3  
ATOM 6416   N N    . LYS A 1 90  ? -17.186 -1.432  9.931   1.00 10.00 ? 245 LYS A N    3  
ATOM 6417   C CA   . LYS A 1 90  ? -17.744 -1.304  11.272  1.00 10.00 ? 245 LYS A CA   3  
ATOM 6418   C C    . LYS A 1 90  ? -17.006 -2.178  12.280  1.00 10.00 ? 245 LYS A C    3  
ATOM 6419   O O    . LYS A 1 90  ? -16.768 -1.762  13.410  1.00 10.00 ? 245 LYS A O    3  
ATOM 6420   C CB   . LYS A 1 90  ? -19.234 -1.652  11.273  1.00 10.00 ? 245 LYS A CB   3  
ATOM 6421   C CG   . LYS A 1 90  ? -20.100 -0.661  10.520  1.00 10.00 ? 245 LYS A CG   3  
ATOM 6422   C CD   . LYS A 1 90  ? -20.093 0.694   11.202  1.00 10.00 ? 245 LYS A CD   3  
ATOM 6423   C CE   . LYS A 1 90  ? -20.896 1.710   10.413  1.00 10.00 ? 245 LYS A CE   3  
ATOM 6424   N NZ   . LYS A 1 90  ? -21.127 2.946   11.198  1.00 10.00 ? 245 LYS A NZ   3  
ATOM 6425   H H    . LYS A 1 90  ? -17.732 -1.840  9.224   1.00 10.00 ? 245 LYS A H    3  
ATOM 6426   H HZ1  . LYS A 1 90  ? -20.221 3.394   11.440  1.00 10.00 ? 245 LYS A HZ1  3  
ATOM 6427   H HZ2  . LYS A 1 90  ? -21.631 2.721   12.078  1.00 10.00 ? 245 LYS A HZ2  3  
ATOM 6428   H HZ3  . LYS A 1 90  ? -21.697 3.618   10.648  1.00 10.00 ? 245 LYS A HZ3  3  
ATOM 6429   N N    . ASP A 1 91  ? -16.653 -3.390  11.872  1.00 10.00 ? 246 ASP A N    3  
ATOM 6430   C CA   . ASP A 1 91  ? -15.947 -4.315  12.757  1.00 10.00 ? 246 ASP A CA   3  
ATOM 6431   C C    . ASP A 1 91  ? -14.488 -3.919  12.928  1.00 10.00 ? 246 ASP A C    3  
ATOM 6432   O O    . ASP A 1 91  ? -13.914 -4.091  14.002  1.00 10.00 ? 246 ASP A O    3  
ATOM 6433   C CB   . ASP A 1 91  ? -16.032 -5.747  12.225  1.00 10.00 ? 246 ASP A CB   3  
ATOM 6434   C CG   . ASP A 1 91  ? -16.985 -6.617  13.022  1.00 10.00 ? 246 ASP A CG   3  
ATOM 6435   O OD1  . ASP A 1 91  ? -16.551 -7.218  14.027  1.00 10.00 ? 246 ASP A OD1  3  
ATOM 6436   O OD2  . ASP A 1 91  ? -18.176 -6.706  12.646  1.00 10.00 ? 246 ASP A OD2  3  
ATOM 6437   H H    . ASP A 1 91  ? -16.873 -3.673  10.957  1.00 10.00 ? 246 ASP A H    3  
ATOM 6438   N N    . LEU A 1 92  ? -13.904 -3.393  11.846  1.00 10.00 ? 247 LEU A N    3  
ATOM 6439   C CA   . LEU A 1 92  ? -12.501 -2.954  11.803  1.00 10.00 ? 247 LEU A CA   3  
ATOM 6440   C C    . LEU A 1 92  ? -11.960 -2.337  13.100  1.00 10.00 ? 247 LEU A C    3  
ATOM 6441   O O    . LEU A 1 92  ? -10.895 -2.758  13.553  1.00 10.00 ? 247 LEU A O    3  
ATOM 6442   C CB   . LEU A 1 92  ? -12.265 -2.012  10.615  1.00 10.00 ? 247 LEU A CB   3  
ATOM 6443   C CG   . LEU A 1 92  ? -10.838 -1.498  10.419  1.00 10.00 ? 247 LEU A CG   3  
ATOM 6444   C CD1  . LEU A 1 92  ? -9.869  -2.656  10.229  1.00 10.00 ? 247 LEU A CD1  3  
ATOM 6445   C CD2  . LEU A 1 92  ? -10.782 -0.550  9.233   1.00 10.00 ? 247 LEU A CD2  3  
ATOM 6446   H H    . LEU A 1 92  ? -14.389 -3.427  10.991  1.00 10.00 ? 247 LEU A H    3  
ATOM 6447   N N    . PRO A 1 93  ? -12.640 -1.343  13.703  1.00 10.00 ? 248 PRO A N    3  
ATOM 6448   C CA   . PRO A 1 93  ? -12.182 -0.734  14.955  1.00 10.00 ? 248 PRO A CA   3  
ATOM 6449   C C    . PRO A 1 93  ? -11.752 -1.745  16.020  1.00 10.00 ? 248 PRO A C    3  
ATOM 6450   O O    . PRO A 1 93  ? -10.903 -1.437  16.856  1.00 10.00 ? 248 PRO A O    3  
ATOM 6451   C CB   . PRO A 1 93  ? -13.405 0.051   15.438  1.00 10.00 ? 248 PRO A CB   3  
ATOM 6452   C CG   . PRO A 1 93  ? -14.120 0.418   14.186  1.00 10.00 ? 248 PRO A CG   3  
ATOM 6453   C CD   . PRO A 1 93  ? -13.874 -0.699  13.209  1.00 10.00 ? 248 PRO A CD   3  
ATOM 6454   N N    . GLU A 1 94  ? -12.318 -2.961  15.994  1.00 10.00 ? 249 GLU A N    3  
ATOM 6455   C CA   . GLU A 1 94  ? -11.964 -3.969  16.987  1.00 10.00 ? 249 GLU A CA   3  
ATOM 6456   C C    . GLU A 1 94  ? -10.648 -4.659  16.645  1.00 10.00 ? 249 GLU A C    3  
ATOM 6457   O O    . GLU A 1 94  ? -9.710  -4.629  17.438  1.00 10.00 ? 249 GLU A O    3  
ATOM 6458   C CB   . GLU A 1 94  ? -13.057 -5.039  17.041  1.00 10.00 ? 249 GLU A CB   3  
ATOM 6459   C CG   . GLU A 1 94  ? -14.182 -4.780  18.035  1.00 10.00 ? 249 GLU A CG   3  
ATOM 6460   C CD   . GLU A 1 94  ? -15.036 -3.580  17.684  1.00 10.00 ? 249 GLU A CD   3  
ATOM 6461   O OE1  . GLU A 1 94  ? -14.630 -2.451  18.009  1.00 10.00 ? 249 GLU A OE1  3  
ATOM 6462   O OE2  . GLU A 1 94  ? -16.121 -3.765  17.094  1.00 10.00 ? 249 GLU A OE2  3  
ATOM 6463   H H    . GLU A 1 94  ? -12.980 -3.175  15.293  1.00 10.00 ? 249 GLU A H    3  
ATOM 6464   N N    . LEU A 1 95  ? -10.564 -5.276  15.457  1.00 10.00 ? 250 LEU A N    3  
ATOM 6465   C CA   . LEU A 1 95  ? -9.328  -5.939  15.044  1.00 10.00 ? 250 LEU A CA   3  
ATOM 6466   C C    . LEU A 1 95  ? -8.143  -5.001  14.963  1.00 10.00 ? 250 LEU A C    3  
ATOM 6467   O O    . LEU A 1 95  ? -6.998  -5.424  15.128  1.00 10.00 ? 250 LEU A O    3  
ATOM 6468   C CB   . LEU A 1 95  ? -9.510  -6.699  13.725  1.00 10.00 ? 250 LEU A CB   3  
ATOM 6469   C CG   . LEU A 1 95  ? -10.382 -7.962  13.774  1.00 10.00 ? 250 LEU A CG   3  
ATOM 6470   C CD1  . LEU A 1 95  ? -10.383 -8.658  12.422  1.00 10.00 ? 250 LEU A CD1  3  
ATOM 6471   C CD2  . LEU A 1 95  ? -9.914  -8.916  14.866  1.00 10.00 ? 250 LEU A CD2  3  
ATOM 6472   H H    . LEU A 1 95  ? -11.372 -5.486  14.956  1.00 10.00 ? 250 LEU A H    3  
ATOM 6473   N N    . ALA A 1 96  ? -8.426  -3.733  14.715  1.00 10.00 ? 251 ALA A N    3  
ATOM 6474   C CA   . ALA A 1 96  ? -7.390  -2.721  14.626  1.00 10.00 ? 251 ALA A CA   3  
ATOM 6475   C C    . ALA A 1 96  ? -6.648  -2.603  15.949  1.00 10.00 ? 251 ALA A C    3  
ATOM 6476   O O    . ALA A 1 96  ? -5.479  -2.226  15.986  1.00 10.00 ? 251 ALA A O    3  
ATOM 6477   C CB   . ALA A 1 96  ? -8.000  -1.383  14.242  1.00 10.00 ? 251 ALA A CB   3  
ATOM 6478   H H    . ALA A 1 96  ? -9.364  -3.470  14.587  1.00 10.00 ? 251 ALA A H    3  
ATOM 6479   N N    . LEU A 1 97  ? -7.337  -2.939  17.031  1.00 10.00 ? 252 LEU A N    3  
ATOM 6480   C CA   . LEU A 1 97  ? -6.752  -2.872  18.355  1.00 10.00 ? 252 LEU A CA   3  
ATOM 6481   C C    . LEU A 1 97  ? -5.641  -3.900  18.544  1.00 10.00 ? 252 LEU A C    3  
ATOM 6482   O O    . LEU A 1 97  ? -4.576  -3.571  19.055  1.00 10.00 ? 252 LEU A O    3  
ATOM 6483   C CB   . LEU A 1 97  ? -7.816  -3.019  19.443  1.00 10.00 ? 252 LEU A CB   3  
ATOM 6484   C CG   . LEU A 1 97  ? -8.889  -1.928  19.481  1.00 10.00 ? 252 LEU A CG   3  
ATOM 6485   C CD1  . LEU A 1 97  ? -9.957  -2.266  20.506  1.00 10.00 ? 252 LEU A CD1  3  
ATOM 6486   C CD2  . LEU A 1 97  ? -8.272  -0.569  19.774  1.00 10.00 ? 252 LEU A CD2  3  
ATOM 6487   H H    . LEU A 1 97  ? -8.270  -3.234  16.934  1.00 10.00 ? 252 LEU A H    3  
ATOM 6488   N N    . ASP A 1 98  ? -5.875  -5.148  18.139  1.00 10.00 ? 253 ASP A N    3  
ATOM 6489   C CA   . ASP A 1 98  ? -4.853  -6.179  18.314  1.00 10.00 ? 253 ASP A CA   3  
ATOM 6490   C C    . ASP A 1 98  ? -3.755  -6.015  17.269  1.00 10.00 ? 253 ASP A C    3  
ATOM 6491   O O    . ASP A 1 98  ? -2.573  -5.972  17.594  1.00 10.00 ? 253 ASP A O    3  
ATOM 6492   C CB   . ASP A 1 98  ? -5.534  -7.542  18.129  1.00 10.00 ? 253 ASP A CB   3  
ATOM 6493   C CG   . ASP A 1 98  ? -4.697  -8.732  18.556  1.00 10.00 ? 253 ASP A CG   3  
ATOM 6494   O OD1  . ASP A 1 98  ? -3.576  -8.902  18.035  1.00 10.00 ? 253 ASP A OD1  3  
ATOM 6495   O OD2  . ASP A 1 98  ? -5.169  -9.514  19.412  1.00 10.00 ? 253 ASP A OD2  3  
ATOM 6496   H H    . ASP A 1 98  ? -6.732  -5.397  17.733  1.00 10.00 ? 253 ASP A H    3  
ATOM 6497   N N    . THR A 1 99  ? -4.159  -5.876  16.020  1.00 10.00 ? 254 THR A N    3  
ATOM 6498   C CA   . THR A 1 99  ? -3.193  -5.659  14.952  1.00 10.00 ? 254 THR A CA   3  
ATOM 6499   C C    . THR A 1 99  ? -3.311  -4.248  14.404  1.00 10.00 ? 254 THR A C    3  
ATOM 6500   O O    . THR A 1 99  ? -4.253  -3.934  13.683  1.00 10.00 ? 254 THR A O    3  
ATOM 6501   C CB   . THR A 1 99  ? -3.337  -6.686  13.811  1.00 10.00 ? 254 THR A CB   3  
ATOM 6502   O OG1  . THR A 1 99  ? -4.711  -7.058  13.669  1.00 10.00 ? 254 THR A OG1  3  
ATOM 6503   C CG2  . THR A 1 99  ? -2.494  -7.923  14.082  1.00 10.00 ? 254 THR A CG2  3  
ATOM 6504   H H    . THR A 1 99  ? -5.087  -6.097  15.801  1.00 10.00 ? 254 THR A H    3  
ATOM 6505   H HG1  . THR A 1 99  ? -5.253  -6.264  13.630  1.00 10.00 ? 254 THR A HG1  3  
ATOM 6506   N N    . PRO A 1 100 ? -2.335  -3.386  14.724  1.00 10.00 ? 255 PRO A N    3  
ATOM 6507   C CA   . PRO A 1 100 ? -2.337  -1.986  14.282  1.00 10.00 ? 255 PRO A CA   3  
ATOM 6508   C C    . PRO A 1 100 ? -2.254  -1.855  12.764  1.00 10.00 ? 255 PRO A C    3  
ATOM 6509   O O    . PRO A 1 100 ? -2.548  -0.801  12.206  1.00 10.00 ? 255 PRO A O    3  
ATOM 6510   C CB   . PRO A 1 100 ? -1.081  -1.397  14.940  1.00 10.00 ? 255 PRO A CB   3  
ATOM 6511   C CG   . PRO A 1 100 ? -0.211  -2.573  15.221  1.00 10.00 ? 255 PRO A CG   3  
ATOM 6512   C CD   . PRO A 1 100 ? -1.145  -3.707  15.530  1.00 10.00 ? 255 PRO A CD   3  
ATOM 6513   N N    . ARG A 1 101 ? -1.854  -2.932  12.104  1.00 10.00 ? 256 ARG A N    3  
ATOM 6514   C CA   . ARG A 1 101 ? -1.739  -2.939  10.655  1.00 10.00 ? 256 ARG A CA   3  
ATOM 6515   C C    . ARG A 1 101 ? -3.044  -3.364  9.991   1.00 10.00 ? 256 ARG A C    3  
ATOM 6516   O O    . ARG A 1 101 ? -3.210  -3.193  8.785   1.00 10.00 ? 256 ARG A O    3  
ATOM 6517   C CB   . ARG A 1 101 ? -0.599  -3.856  10.217  1.00 10.00 ? 256 ARG A CB   3  
ATOM 6518   C CG   . ARG A 1 101 ? 0.440   -3.185  9.330   1.00 10.00 ? 256 ARG A CG   3  
ATOM 6519   C CD   . ARG A 1 101 ? -0.083  -2.965  7.918   1.00 10.00 ? 256 ARG A CD   3  
ATOM 6520   N NE   . ARG A 1 101 ? 0.819   -2.139  7.120   1.00 10.00 ? 256 ARG A NE   3  
ATOM 6521   C CZ   . ARG A 1 101 ? 1.788   -2.617  6.341   1.00 10.00 ? 256 ARG A CZ   3  
ATOM 6522   N NH1  . ARG A 1 101 ? 2.018   -3.926  6.267   1.00 10.00 ? 256 ARG A NH1  3  
ATOM 6523   N NH2  . ARG A 1 101 ? 2.532   -1.781  5.636   1.00 10.00 ? 256 ARG A NH2  3  
ATOM 6524   H H    . ARG A 1 101 ? -1.620  -3.741  12.607  1.00 10.00 ? 256 ARG A H    3  
ATOM 6525   H HE   . ARG A 1 101 ? 0.690   -1.155  7.161   1.00 10.00 ? 256 ARG A HE   3  
ATOM 6526   H HH11 . ARG A 1 101 ? 1.455   -4.565  6.789   1.00 10.00 ? 256 ARG A HH11 3  
ATOM 6527   H HH12 . ARG A 1 101 ? 2.773   -4.274  5.693   1.00 10.00 ? 256 ARG A HH12 3  
ATOM 6528   H HH21 . ARG A 1 101 ? 2.352   -0.786  5.688   1.00 10.00 ? 256 ARG A HH21 3  
ATOM 6529   H HH22 . ARG A 1 101 ? 3.272   -2.124  5.052   1.00 10.00 ? 256 ARG A HH22 3  
ATOM 6530   N N    . ALA A 1 102 ? -3.969  -3.895  10.784  1.00 10.00 ? 257 ALA A N    3  
ATOM 6531   C CA   . ALA A 1 102 ? -5.257  -4.358  10.273  1.00 10.00 ? 257 ALA A CA   3  
ATOM 6532   C C    . ALA A 1 102 ? -6.012  -3.289  9.470   1.00 10.00 ? 257 ALA A C    3  
ATOM 6533   O O    . ALA A 1 102 ? -6.439  -3.562  8.349   1.00 10.00 ? 257 ALA A O    3  
ATOM 6534   C CB   . ALA A 1 102 ? -6.121  -4.956  11.373  1.00 10.00 ? 257 ALA A CB   3  
ATOM 6535   H H    . ALA A 1 102 ? -3.785  -3.965  11.748  1.00 10.00 ? 257 ALA A H    3  
ATOM 6536   N N    . PRO A 1 103 ? -6.195  -2.060  10.013  1.00 10.00 ? 258 PRO A N    3  
ATOM 6537   C CA   . PRO A 1 103 ? -6.905  -0.989  9.295   1.00 10.00 ? 258 PRO A CA   3  
ATOM 6538   C C    . PRO A 1 103 ? -6.207  -0.645  7.985   1.00 10.00 ? 258 PRO A C    3  
ATOM 6539   O O    . PRO A 1 103 ? -6.841  -0.540  6.932   1.00 10.00 ? 258 PRO A O    3  
ATOM 6540   C CB   . PRO A 1 103 ? -6.840  0.207   10.258  1.00 10.00 ? 258 PRO A CB   3  
ATOM 6541   C CG   . PRO A 1 103 ? -5.750  -0.122  11.219  1.00 10.00 ? 258 PRO A CG   3  
ATOM 6542   C CD   . PRO A 1 103 ? -5.756  -1.616  11.348  1.00 10.00 ? 258 PRO A CD   3  
ATOM 6543   N N    . GLN A 1 104 ? -4.892  -0.472  8.064   1.00 10.00 ? 259 GLN A N    3  
ATOM 6544   C CA   . GLN A 1 104 ? -4.072  -0.155  6.905   1.00 10.00 ? 259 GLN A CA   3  
ATOM 6545   C C    . GLN A 1 104 ? -4.223  -1.207  5.799   1.00 10.00 ? 259 GLN A C    3  
ATOM 6546   O O    . GLN A 1 104 ? -4.182  -0.889  4.613   1.00 10.00 ? 259 GLN A O    3  
ATOM 6547   C CB   . GLN A 1 104 ? -2.604  -0.006  7.322   1.00 10.00 ? 259 GLN A CB   3  
ATOM 6548   C CG   . GLN A 1 104 ? -2.366  1.100   8.343   1.00 10.00 ? 259 GLN A CG   3  
ATOM 6549   C CD   . GLN A 1 104 ? -1.064  0.938   9.104   1.00 10.00 ? 259 GLN A CD   3  
ATOM 6550   O OE1  . GLN A 1 104 ? -0.600  -0.177  9.327   1.00 10.00 ? 259 GLN A OE1  3  
ATOM 6551   N NE2  . GLN A 1 104 ? -0.470  2.050   9.509   1.00 10.00 ? 259 GLN A NE2  3  
ATOM 6552   H H    . GLN A 1 104 ? -4.473  -0.524  8.950   1.00 10.00 ? 259 GLN A H    3  
ATOM 6553   H HE21 . GLN A 1 104 ? -0.897  2.909   9.301   1.00 10.00 ? 259 GLN A HE21 3  
ATOM 6554   H HE22 . GLN A 1 104 ? 0.379   1.970   9.994   1.00 10.00 ? 259 GLN A HE22 3  
ATOM 6555   N N    . LEU A 1 105 ? -4.405  -2.461  6.199   1.00 10.00 ? 260 LEU A N    3  
ATOM 6556   C CA   . LEU A 1 105 ? -4.569  -3.559  5.248   1.00 10.00 ? 260 LEU A CA   3  
ATOM 6557   C C    . LEU A 1 105 ? -5.949  -3.533  4.599   1.00 10.00 ? 260 LEU A C    3  
ATOM 6558   O O    . LEU A 1 105 ? -6.072  -3.686  3.384   1.00 10.00 ? 260 LEU A O    3  
ATOM 6559   C CB   . LEU A 1 105 ? -4.334  -4.899  5.941   1.00 10.00 ? 260 LEU A CB   3  
ATOM 6560   C CG   . LEU A 1 105 ? -2.932  -5.112  6.509   1.00 10.00 ? 260 LEU A CG   3  
ATOM 6561   C CD1  . LEU A 1 105 ? -2.873  -6.374  7.355   1.00 10.00 ? 260 LEU A CD1  3  
ATOM 6562   C CD2  . LEU A 1 105 ? -1.900  -5.150  5.392   1.00 10.00 ? 260 LEU A CD2  3  
ATOM 6563   H H    . LEU A 1 105 ? -4.433  -2.655  7.159   1.00 10.00 ? 260 LEU A H    3  
ATOM 6564   N N    . VAL A 1 106 ? -6.970  -3.358  5.430   1.00 10.00 ? 261 VAL A N    3  
ATOM 6565   C CA   . VAL A 1 106 ? -8.358  -3.302  4.964   1.00 10.00 ? 261 VAL A CA   3  
ATOM 6566   C C    . VAL A 1 106 ? -8.508  -2.354  3.773   1.00 10.00 ? 261 VAL A C    3  
ATOM 6567   O O    . VAL A 1 106 ? -9.210  -2.667  2.808   1.00 10.00 ? 261 VAL A O    3  
ATOM 6568   C CB   . VAL A 1 106 ? -9.331  -2.908  6.095   1.00 10.00 ? 261 VAL A CB   3  
ATOM 6569   C CG1  . VAL A 1 106 ? -10.700 -2.536  5.542   1.00 10.00 ? 261 VAL A CG1  3  
ATOM 6570   C CG2  . VAL A 1 106 ? -9.459  -4.052  7.087   1.00 10.00 ? 261 VAL A CG2  3  
ATOM 6571   H H    . VAL A 1 106 ? -6.770  -3.337  6.390   1.00 10.00 ? 261 VAL A H    3  
ATOM 6572   N N    . GLY A 1 107 ? -7.826  -1.214  3.840   1.00 10.00 ? 262 GLY A N    3  
ATOM 6573   C CA   . GLY A 1 107 ? -7.873  -0.249  2.752   1.00 10.00 ? 262 GLY A CA   3  
ATOM 6574   C C    . GLY A 1 107 ? -7.516  -0.860  1.403   1.00 10.00 ? 262 GLY A C    3  
ATOM 6575   O O    . GLY A 1 107 ? -8.150  -0.557  0.392   1.00 10.00 ? 262 GLY A O    3  
ATOM 6576   H H    . GLY A 1 107 ? -7.313  -1.004  4.651   1.00 10.00 ? 262 GLY A H    3  
ATOM 6577   N N    . GLN A 1 108 ? -6.514  -1.735  1.391   1.00 10.00 ? 263 GLN A N    3  
ATOM 6578   C CA   . GLN A 1 108 ? -6.078  -2.391  0.159   1.00 10.00 ? 263 GLN A CA   3  
ATOM 6579   C C    . GLN A 1 108 ? -7.199  -3.241  -0.426  1.00 10.00 ? 263 GLN A C    3  
ATOM 6580   O O    . GLN A 1 108 ? -7.420  -3.255  -1.640  1.00 10.00 ? 263 GLN A O    3  
ATOM 6581   C CB   . GLN A 1 108 ? -4.841  -3.263  0.422   1.00 10.00 ? 263 GLN A CB   3  
ATOM 6582   C CG   . GLN A 1 108 ? -4.329  -4.024  -0.795  1.00 10.00 ? 263 GLN A CG   3  
ATOM 6583   C CD   . GLN A 1 108 ? -3.582  -3.140  -1.774  1.00 10.00 ? 263 GLN A CD   3  
ATOM 6584   O OE1  . GLN A 1 108 ? -4.170  -2.561  -2.685  1.00 10.00 ? 263 GLN A OE1  3  
ATOM 6585   N NE2  . GLN A 1 108 ? -2.275  -3.033  -1.593  1.00 10.00 ? 263 GLN A NE2  3  
ATOM 6586   H H    . GLN A 1 108 ? -6.062  -1.954  2.235   1.00 10.00 ? 263 GLN A H    3  
ATOM 6587   H HE21 . GLN A 1 108 ? -1.869  -3.524  -0.849  1.00 10.00 ? 263 GLN A HE21 3  
ATOM 6588   H HE22 . GLN A 1 108 ? -1.767  -2.466  -2.210  1.00 10.00 ? 263 GLN A HE22 3  
ATOM 6589   N N    . PHE A 1 109 ? -7.918  -3.932  0.448   1.00 10.00 ? 264 PHE A N    3  
ATOM 6590   C CA   . PHE A 1 109 ? -9.013  -4.791  0.029   1.00 10.00 ? 264 PHE A CA   3  
ATOM 6591   C C    . PHE A 1 109 ? -10.128 -4.003  -0.650  1.00 10.00 ? 264 PHE A C    3  
ATOM 6592   O O    . PHE A 1 109 ? -10.785 -4.511  -1.559  1.00 10.00 ? 264 PHE A O    3  
ATOM 6593   C CB   . PHE A 1 109 ? -9.566  -5.588  1.211   1.00 10.00 ? 264 PHE A CB   3  
ATOM 6594   C CG   . PHE A 1 109 ? -8.710  -6.757  1.600   1.00 10.00 ? 264 PHE A CG   3  
ATOM 6595   C CD1  . PHE A 1 109 ? -7.614  -6.587  2.429   1.00 10.00 ? 264 PHE A CD1  3  
ATOM 6596   C CD2  . PHE A 1 109 ? -9.002  -8.027  1.132   1.00 10.00 ? 264 PHE A CD2  3  
ATOM 6597   C CE1  . PHE A 1 109 ? -6.826  -7.662  2.788   1.00 10.00 ? 264 PHE A CE1  3  
ATOM 6598   C CE2  . PHE A 1 109 ? -8.219  -9.106  1.487   1.00 10.00 ? 264 PHE A CE2  3  
ATOM 6599   C CZ   . PHE A 1 109 ? -7.129  -8.922  2.315   1.00 10.00 ? 264 PHE A CZ   3  
ATOM 6600   H H    . PHE A 1 109 ? -7.705  -3.859  1.404   1.00 10.00 ? 264 PHE A H    3  
ATOM 6601   N N    . ILE A 1 110 ? -10.326 -2.762  -0.228  1.00 10.00 ? 265 ILE A N    3  
ATOM 6602   C CA   . ILE A 1 110 ? -11.371 -1.923  -0.808  1.00 10.00 ? 265 ILE A CA   3  
ATOM 6603   C C    . ILE A 1 110 ? -10.951 -1.457  -2.197  1.00 10.00 ? 265 ILE A C    3  
ATOM 6604   O O    . ILE A 1 110 ? -11.719 -1.558  -3.156  1.00 10.00 ? 265 ILE A O    3  
ATOM 6605   C CB   . ILE A 1 110 ? -11.680 -0.703  0.088   1.00 10.00 ? 265 ILE A CB   3  
ATOM 6606   C CG1  . ILE A 1 110 ? -11.865 -1.144  1.545   1.00 10.00 ? 265 ILE A CG1  3  
ATOM 6607   C CG2  . ILE A 1 110 ? -12.928 0.021   -0.407  1.00 10.00 ? 265 ILE A CG2  3  
ATOM 6608   C CD1  . ILE A 1 110 ? -12.105 -0.007  2.516   1.00 10.00 ? 265 ILE A CD1  3  
ATOM 6609   H H    . ILE A 1 110 ? -9.759  -2.366  0.467   1.00 10.00 ? 265 ILE A H    3  
ATOM 6610   N N    . ALA A 1 111 ? -9.722  -0.954  -2.303  1.00 10.00 ? 266 ALA A N    3  
ATOM 6611   C CA   . ALA A 1 111 ? -9.186  -0.495  -3.582  1.00 10.00 ? 266 ALA A CA   3  
ATOM 6612   C C    . ALA A 1 111 ? -9.218  -1.620  -4.613  1.00 10.00 ? 266 ALA A C    3  
ATOM 6613   O O    . ALA A 1 111 ? -9.557  -1.408  -5.779  1.00 10.00 ? 266 ALA A O    3  
ATOM 6614   C CB   . ALA A 1 111 ? -7.764  0.015   -3.408  1.00 10.00 ? 266 ALA A CB   3  
ATOM 6615   H H    . ALA A 1 111 ? -9.170  -0.870  -1.493  1.00 10.00 ? 266 ALA A H    3  
ATOM 6616   N N    . ARG A 1 112 ? -8.873  -2.820  -4.166  1.00 10.00 ? 267 ARG A N    3  
ATOM 6617   C CA   . ARG A 1 112 ? -8.862  -3.994  -5.024  1.00 10.00 ? 267 ARG A CA   3  
ATOM 6618   C C    . ARG A 1 112 ? -10.251 -4.269  -5.599  1.00 10.00 ? 267 ARG A C    3  
ATOM 6619   O O    . ARG A 1 112 ? -10.392 -4.580  -6.780  1.00 10.00 ? 267 ARG A O    3  
ATOM 6620   C CB   . ARG A 1 112 ? -8.369  -5.206  -4.233  1.00 10.00 ? 267 ARG A CB   3  
ATOM 6621   C CG   . ARG A 1 112 ? -8.320  -6.492  -5.035  1.00 10.00 ? 267 ARG A CG   3  
ATOM 6622   C CD   . ARG A 1 112 ? -7.272  -6.422  -6.133  1.00 10.00 ? 267 ARG A CD   3  
ATOM 6623   N NE   . ARG A 1 112 ? -7.509  -7.429  -7.161  1.00 10.00 ? 267 ARG A NE   3  
ATOM 6624   C CZ   . ARG A 1 112 ? -6.549  -8.119  -7.771  1.00 10.00 ? 267 ARG A CZ   3  
ATOM 6625   N NH1  . ARG A 1 112 ? -5.272  -7.919  -7.450  1.00 10.00 ? 267 ARG A NH1  3  
ATOM 6626   N NH2  . ARG A 1 112 ? -6.873  -9.021  -8.693  1.00 10.00 ? 267 ARG A NH2  3  
ATOM 6627   H H    . ARG A 1 112 ? -8.609  -2.921  -3.224  1.00 10.00 ? 267 ARG A H    3  
ATOM 6628   H HE   . ARG A 1 112 ? -8.458  -7.602  -7.418  1.00 10.00 ? 267 ARG A HE   3  
ATOM 6629   H HH11 . ARG A 1 112 ? -5.029  -7.244  -6.750  1.00 10.00 ? 267 ARG A HH11 3  
ATOM 6630   H HH12 . ARG A 1 112 ? -4.547  -8.439  -7.904  1.00 10.00 ? 267 ARG A HH12 3  
ATOM 6631   H HH21 . ARG A 1 112 ? -7.839  -9.177  -8.928  1.00 10.00 ? 267 ARG A HH21 3  
ATOM 6632   H HH22 . ARG A 1 112 ? -6.158  -9.533  -9.175  1.00 10.00 ? 267 ARG A HH22 3  
ATOM 6633   N N    . ALA A 1 113 ? -11.268 -4.150  -4.747  1.00 10.00 ? 268 ALA A N    3  
ATOM 6634   C CA   . ALA A 1 113 ? -12.649 -4.384  -5.154  1.00 10.00 ? 268 ALA A CA   3  
ATOM 6635   C C    . ALA A 1 113 ? -13.060 -3.479  -6.314  1.00 10.00 ? 268 ALA A C    3  
ATOM 6636   O O    . ALA A 1 113 ? -13.720 -3.923  -7.262  1.00 10.00 ? 268 ALA A O    3  
ATOM 6637   C CB   . ALA A 1 113 ? -13.588 -4.207  -3.971  1.00 10.00 ? 268 ALA A CB   3  
ATOM 6638   H H    . ALA A 1 113 ? -11.071 -3.924  -3.815  1.00 10.00 ? 268 ALA A H    3  
ATOM 6639   N N    . VAL A 1 114 ? -12.673 -2.212  -6.241  1.00 10.00 ? 269 VAL A N    3  
ATOM 6640   C CA   . VAL A 1 114 ? -12.991 -1.266  -7.302  1.00 10.00 ? 269 VAL A CA   3  
ATOM 6641   C C    . VAL A 1 114 ? -12.222 -1.640  -8.568  1.00 10.00 ? 269 VAL A C    3  
ATOM 6642   O O    . VAL A 1 114 ? -12.781 -1.647  -9.666  1.00 10.00 ? 269 VAL A O    3  
ATOM 6643   C CB   . VAL A 1 114 ? -12.651 0.190   -6.911  1.00 10.00 ? 269 VAL A CB   3  
ATOM 6644   C CG1  . VAL A 1 114 ? -13.146 1.158   -7.975  1.00 10.00 ? 269 VAL A CG1  3  
ATOM 6645   C CG2  . VAL A 1 114 ? -13.246 0.536   -5.553  1.00 10.00 ? 269 VAL A CG2  3  
ATOM 6646   H H    . VAL A 1 114 ? -12.160 -1.908  -5.459  1.00 10.00 ? 269 VAL A H    3  
ATOM 6647   N N    . GLY A 1 115 ? -10.939 -1.946  -8.390  1.00 10.00 ? 270 GLY A N    3  
ATOM 6648   C CA   . GLY A 1 115 ? -10.097 -2.335  -9.508  1.00 10.00 ? 270 GLY A CA   3  
ATOM 6649   C C    . GLY A 1 115 ? -10.635 -3.549  -10.250 1.00 10.00 ? 270 GLY A C    3  
ATOM 6650   O O    . GLY A 1 115 ? -10.682 -3.555  -11.479 1.00 10.00 ? 270 GLY A O    3  
ATOM 6651   H H    . GLY A 1 115 ? -10.564 -1.846  -7.486  1.00 10.00 ? 270 GLY A H    3  
ATOM 6652   N N    . ASP A 1 116 ? -11.027 -4.582  -9.504  1.00 10.00 ? 271 ASP A N    3  
ATOM 6653   C CA   . ASP A 1 116 ? -11.583 -5.792  -10.115 1.00 10.00 ? 271 ASP A CA   3  
ATOM 6654   C C    . ASP A 1 116 ? -12.911 -5.503  -10.805 1.00 10.00 ? 271 ASP A C    3  
ATOM 6655   O O    . ASP A 1 116 ? -13.255 -6.134  -11.805 1.00 10.00 ? 271 ASP A O    3  
ATOM 6656   C CB   . ASP A 1 116 ? -11.754 -6.920  -9.089  1.00 10.00 ? 271 ASP A CB   3  
ATOM 6657   C CG   . ASP A 1 116 ? -10.576 -7.878  -9.050  1.00 10.00 ? 271 ASP A CG   3  
ATOM 6658   O OD1  . ASP A 1 116 ? -10.284 -8.523  -10.082 1.00 10.00 ? 271 ASP A OD1  3  
ATOM 6659   O OD2  . ASP A 1 116 ? -9.939  -7.994  -7.985  1.00 10.00 ? 271 ASP A OD2  3  
ATOM 6660   H H    . ASP A 1 116 ? -10.873 -4.559  -8.532  1.00 10.00 ? 271 ASP A H    3  
ATOM 6661   N N    . GLY A 1 117 ? -13.653 -4.556  -10.251 1.00 10.00 ? 272 GLY A N    3  
ATOM 6662   C CA   . GLY A 1 117 ? -14.929 -4.177  -10.829 1.00 10.00 ? 272 GLY A CA   3  
ATOM 6663   C C    . GLY A 1 117 ? -16.099 -4.818  -10.116 1.00 10.00 ? 272 GLY A C    3  
ATOM 6664   O O    . GLY A 1 117 ? -17.091 -5.193  -10.742 1.00 10.00 ? 272 GLY A O    3  
ATOM 6665   H H    . GLY A 1 117 ? -13.336 -4.126  -9.431  1.00 10.00 ? 272 GLY A H    3  
ATOM 6666   N N    . ILE A 1 118 ? -15.983 -4.958  -8.805  1.00 10.00 ? 273 ILE A N    3  
ATOM 6667   C CA   . ILE A 1 118 ? -17.045 -5.555  -8.004  1.00 10.00 ? 273 ILE A CA   3  
ATOM 6668   C C    . ILE A 1 118 ? -17.571 -4.573  -6.964  1.00 10.00 ? 273 ILE A C    3  
ATOM 6669   O O    . ILE A 1 118 ? -18.538 -4.855  -6.258  1.00 10.00 ? 273 ILE A O    3  
ATOM 6670   C CB   . ILE A 1 118 ? -16.580 -6.847  -7.302  1.00 10.00 ? 273 ILE A CB   3  
ATOM 6671   C CG1  . ILE A 1 118 ? -15.251 -6.618  -6.581  1.00 10.00 ? 273 ILE A CG1  3  
ATOM 6672   C CG2  . ILE A 1 118 ? -16.464 -7.987  -8.302  1.00 10.00 ? 273 ILE A CG2  3  
ATOM 6673   C CD1  . ILE A 1 118 ? -14.796 -7.787  -5.739  1.00 10.00 ? 273 ILE A CD1  3  
ATOM 6674   H H    . ILE A 1 118 ? -15.158 -4.661  -8.363  1.00 10.00 ? 273 ILE A H    3  
ATOM 6675   N N    . LEU A 1 119 ? -16.940 -3.410  -6.887  1.00 10.00 ? 274 LEU A N    3  
ATOM 6676   C CA   . LEU A 1 119 ? -17.337 -2.387  -5.932  1.00 10.00 ? 274 LEU A CA   3  
ATOM 6677   C C    . LEU A 1 119 ? -17.500 -1.045  -6.629  1.00 10.00 ? 274 LEU A C    3  
ATOM 6678   O O    . LEU A 1 119 ? -16.821 -0.766  -7.623  1.00 10.00 ? 274 LEU A O    3  
ATOM 6679   C CB   . LEU A 1 119 ? -16.289 -2.268  -4.822  1.00 10.00 ? 274 LEU A CB   3  
ATOM 6680   C CG   . LEU A 1 119 ? -16.622 -1.319  -3.667  1.00 10.00 ? 274 LEU A CG   3  
ATOM 6681   C CD1  . LEU A 1 119 ? -17.694 -1.917  -2.774  1.00 10.00 ? 274 LEU A CD1  3  
ATOM 6682   C CD2  . LEU A 1 119 ? -15.374 -0.994  -2.864  1.00 10.00 ? 274 LEU A CD2  3  
ATOM 6683   H H    . LEU A 1 119 ? -16.197 -3.229  -7.496  1.00 10.00 ? 274 LEU A H    3  
ATOM 6684   N N    . CYS A 1 120 ? -18.413 -0.230  -6.121  1.00 10.00 ? 275 CYS A N    3  
ATOM 6685   C CA   . CYS A 1 120 ? -18.654 1.087   -6.678  1.00 10.00 ? 275 CYS A CA   3  
ATOM 6686   C C    . CYS A 1 120 ? -17.507 2.018   -6.303  1.00 10.00 ? 275 CYS A C    3  
ATOM 6687   O O    . CYS A 1 120 ? -17.090 2.070   -5.145  1.00 10.00 ? 275 CYS A O    3  
ATOM 6688   C CB   . CYS A 1 120 ? -19.979 1.644   -6.148  1.00 10.00 ? 275 CYS A CB   3  
ATOM 6689   S SG   . CYS A 1 120 ? -20.500 3.202   -6.900  1.00 10.00 ? 275 CYS A SG   3  
ATOM 6690   H H    . CYS A 1 120 ? -18.944 -0.524  -5.347  1.00 10.00 ? 275 CYS A H    3  
ATOM 6691   H HG   . CYS A 1 120 ? -21.705 3.013   -7.425  1.00 10.00 ? 275 CYS A HG   3  
ATOM 6692   N N    . ASN A 1 121 ? -16.988 2.748   -7.279  1.00 10.00 ? 276 ASN A N    3  
ATOM 6693   C CA   . ASN A 1 121 ? -15.890 3.671   -7.029  1.00 10.00 ? 276 ASN A CA   3  
ATOM 6694   C C    . ASN A 1 121 ? -16.346 4.834   -6.149  1.00 10.00 ? 276 ASN A C    3  
ATOM 6695   O O    . ASN A 1 121 ? -15.593 5.311   -5.300  1.00 10.00 ? 276 ASN A O    3  
ATOM 6696   C CB   . ASN A 1 121 ? -15.253 4.181   -8.330  1.00 10.00 ? 276 ASN A CB   3  
ATOM 6697   C CG   . ASN A 1 121 ? -16.241 4.826   -9.284  1.00 10.00 ? 276 ASN A CG   3  
ATOM 6698   O OD1  . ASN A 1 121 ? -17.308 4.278   -9.560  1.00 10.00 ? 276 ASN A OD1  3  
ATOM 6699   N ND2  . ASN A 1 121 ? -15.893 5.995   -9.794  1.00 10.00 ? 276 ASN A ND2  3  
ATOM 6700   H H    . ASN A 1 121 ? -17.352 2.668   -8.186  1.00 10.00 ? 276 ASN A H    3  
ATOM 6701   H HD21 . ASN A 1 121 ? -15.029 6.379   -9.531  1.00 10.00 ? 276 ASN A HD21 3  
ATOM 6702   H HD22 . ASN A 1 121 ? -16.518 6.438   -10.411 1.00 10.00 ? 276 ASN A HD22 3  
ATOM 6703   N N    . THR A 1 122 ? -17.580 5.269   -6.348  1.00 10.00 ? 277 THR A N    3  
ATOM 6704   C CA   . THR A 1 122 ? -18.156 6.368   -5.581  1.00 10.00 ? 277 THR A CA   3  
ATOM 6705   C C    . THR A 1 122 ? -18.419 5.984   -4.120  1.00 10.00 ? 277 THR A C    3  
ATOM 6706   O O    . THR A 1 122 ? -18.794 6.834   -3.312  1.00 10.00 ? 277 THR A O    3  
ATOM 6707   C CB   . THR A 1 122 ? -19.480 6.814   -6.221  1.00 10.00 ? 277 THR A CB   3  
ATOM 6708   O OG1  . THR A 1 122 ? -19.496 6.405   -7.599  1.00 10.00 ? 277 THR A OG1  3  
ATOM 6709   C CG2  . THR A 1 122 ? -19.637 8.325   -6.143  1.00 10.00 ? 277 THR A CG2  3  
ATOM 6710   H H    . THR A 1 122 ? -18.126 4.883   -7.068  1.00 10.00 ? 277 THR A H    3  
ATOM 6711   H HG1  . THR A 1 122 ? -20.330 5.951   -7.786  1.00 10.00 ? 277 THR A HG1  3  
ATOM 6712   N N    . TYR A 1 123 ? -18.185 4.718   -3.771  1.00 10.00 ? 278 TYR A N    3  
ATOM 6713   C CA   . TYR A 1 123 ? -18.422 4.249   -2.410  1.00 10.00 ? 278 TYR A CA   3  
ATOM 6714   C C    . TYR A 1 123 ? -17.555 5.022   -1.423  1.00 10.00 ? 278 TYR A C    3  
ATOM 6715   O O    . TYR A 1 123 ? -17.992 5.363   -0.321  1.00 10.00 ? 278 TYR A O    3  
ATOM 6716   C CB   . TYR A 1 123 ? -18.145 2.744   -2.297  1.00 10.00 ? 278 TYR A CB   3  
ATOM 6717   C CG   . TYR A 1 123 ? -18.275 2.202   -0.892  1.00 10.00 ? 278 TYR A CG   3  
ATOM 6718   C CD1  . TYR A 1 123 ? -19.523 2.010   -0.315  1.00 10.00 ? 278 TYR A CD1  3  
ATOM 6719   C CD2  . TYR A 1 123 ? -17.149 1.893   -0.138  1.00 10.00 ? 278 TYR A CD2  3  
ATOM 6720   C CE1  . TYR A 1 123 ? -19.647 1.527   0.973   1.00 10.00 ? 278 TYR A CE1  3  
ATOM 6721   C CE2  . TYR A 1 123 ? -17.264 1.407   1.151   1.00 10.00 ? 278 TYR A CE2  3  
ATOM 6722   C CZ   . TYR A 1 123 ? -18.516 1.229   1.701   1.00 10.00 ? 278 TYR A CZ   3  
ATOM 6723   O OH   . TYR A 1 123 ? -18.635 0.755   2.987   1.00 10.00 ? 278 TYR A OH   3  
ATOM 6724   H H    . TYR A 1 123 ? -17.805 4.099   -4.428  1.00 10.00 ? 278 TYR A H    3  
ATOM 6725   H HH   . TYR A 1 123 ? -19.524 0.413   3.125   1.00 10.00 ? 278 TYR A HH   3  
ATOM 6726   N N    . ILE A 1 124 ? -16.329 5.318   -1.838  1.00 10.00 ? 279 ILE A N    3  
ATOM 6727   C CA   . ILE A 1 124 ? -15.392 6.051   -0.998  1.00 10.00 ? 279 ILE A CA   3  
ATOM 6728   C C    . ILE A 1 124 ? -15.856 7.495   -0.821  1.00 10.00 ? 279 ILE A C    3  
ATOM 6729   O O    . ILE A 1 124 ? -15.732 8.070   0.260   1.00 10.00 ? 279 ILE A O    3  
ATOM 6730   C CB   . ILE A 1 124 ? -13.963 6.032   -1.583  1.00 10.00 ? 279 ILE A CB   3  
ATOM 6731   C CG1  . ILE A 1 124 ? -13.588 4.622   -2.055  1.00 10.00 ? 279 ILE A CG1  3  
ATOM 6732   C CG2  . ILE A 1 124 ? -12.956 6.534   -0.557  1.00 10.00 ? 279 ILE A CG2  3  
ATOM 6733   C CD1  . ILE A 1 124 ? -13.566 3.584   -0.952  1.00 10.00 ? 279 ILE A CD1  3  
ATOM 6734   H H    . ILE A 1 124 ? -16.048 5.035   -2.734  1.00 10.00 ? 279 ILE A H    3  
ATOM 6735   N N    . ASP A 1 125 ? -16.433 8.061   -1.877  1.00 10.00 ? 280 ASP A N    3  
ATOM 6736   C CA   . ASP A 1 125 ? -16.920 9.438   -1.847  1.00 10.00 ? 280 ASP A CA   3  
ATOM 6737   C C    . ASP A 1 125 ? -18.102 9.579   -0.896  1.00 10.00 ? 280 ASP A C    3  
ATOM 6738   O O    . ASP A 1 125 ? -18.285 10.614  -0.258  1.00 10.00 ? 280 ASP A O    3  
ATOM 6739   C CB   . ASP A 1 125 ? -17.307 9.904   -3.248  1.00 10.00 ? 280 ASP A CB   3  
ATOM 6740   C CG   . ASP A 1 125 ? -16.303 10.875  -3.832  1.00 10.00 ? 280 ASP A CG   3  
ATOM 6741   O OD1  . ASP A 1 125 ? -16.373 12.077  -3.502  1.00 10.00 ? 280 ASP A OD1  3  
ATOM 6742   O OD2  . ASP A 1 125 ? -15.451 10.445  -4.633  1.00 10.00 ? 280 ASP A OD2  3  
ATOM 6743   H H    . ASP A 1 125 ? -16.541 7.533   -2.696  1.00 10.00 ? 280 ASP A H    3  
ATOM 6744   N N    . SER A 1 126 ? -18.888 8.523   -0.802  1.00 10.00 ? 281 SER A N    3  
ATOM 6745   C CA   . SER A 1 126 ? -20.045 8.493   0.077   1.00 10.00 ? 281 SER A CA   3  
ATOM 6746   C C    . SER A 1 126 ? -19.629 8.523   1.558   1.00 10.00 ? 281 SER A C    3  
ATOM 6747   O O    . SER A 1 126 ? -20.406 8.924   2.424   1.00 10.00 ? 281 SER A O    3  
ATOM 6748   C CB   . SER A 1 126 ? -20.929 7.284   -0.246  1.00 10.00 ? 281 SER A CB   3  
ATOM 6749   O OG   . SER A 1 126 ? -21.323 7.308   -1.612  1.00 10.00 ? 281 SER A OG   3  
ATOM 6750   H H    . SER A 1 126 ? -18.696 7.733   -1.358  1.00 10.00 ? 281 SER A H    3  
ATOM 6751   H HG   . SER A 1 126 ? -21.456 8.222   -1.891  1.00 10.00 ? 281 SER A HG   3  
ATOM 6752   N N    . TYR A 1 127 ? -18.398 8.080   1.844   1.00 10.00 ? 282 TYR A N    3  
ATOM 6753   C CA   . TYR A 1 127 ? -17.869 8.052   3.213   1.00 10.00 ? 282 TYR A CA   3  
ATOM 6754   C C    . TYR A 1 127 ? -16.728 9.071   3.395   1.00 10.00 ? 282 TYR A C    3  
ATOM 6755   O O    . TYR A 1 127 ? -16.073 9.129   4.437   1.00 10.00 ? 282 TYR A O    3  
ATOM 6756   C CB   . TYR A 1 127 ? -17.419 6.636   3.570   1.00 10.00 ? 282 TYR A CB   3  
ATOM 6757   C CG   . TYR A 1 127 ? -18.556 5.745   4.013   1.00 10.00 ? 282 TYR A CG   3  
ATOM 6758   C CD1  . TYR A 1 127 ? -19.159 5.934   5.248   1.00 10.00 ? 282 TYR A CD1  3  
ATOM 6759   C CD2  . TYR A 1 127 ? -19.021 4.712   3.207   1.00 10.00 ? 282 TYR A CD2  3  
ATOM 6760   C CE1  . TYR A 1 127 ? -20.194 5.128   5.671   1.00 10.00 ? 282 TYR A CE1  3  
ATOM 6761   C CE2  . TYR A 1 127 ? -20.060 3.900   3.622   1.00 10.00 ? 282 TYR A CE2  3  
ATOM 6762   C CZ   . TYR A 1 127 ? -20.640 4.110   4.855   1.00 10.00 ? 282 TYR A CZ   3  
ATOM 6763   O OH   . TYR A 1 127 ? -21.670 3.302   5.278   1.00 10.00 ? 282 TYR A OH   3  
ATOM 6764   H H    . TYR A 1 127 ? -17.829 7.763   1.110   1.00 10.00 ? 282 TYR A H    3  
ATOM 6765   H HH   . TYR A 1 127 ? -21.418 2.365   5.154   1.00 10.00 ? 282 TYR A HH   3  
ATOM 6766   N N    . LYS A 1 128 ? -16.526 9.857   2.346   1.00 10.00 ? 283 LYS A N    3  
ATOM 6767   C CA   . LYS A 1 128 ? -15.494 10.914  2.257   1.00 10.00 ? 283 LYS A CA   3  
ATOM 6768   C C    . LYS A 1 128 ? -15.637 12.084  3.241   1.00 10.00 ? 283 LYS A C    3  
ATOM 6769   O O    . LYS A 1 128 ? -15.690 13.242  2.827   1.00 10.00 ? 283 LYS A O    3  
ATOM 6770   C CB   . LYS A 1 128 ? -15.228 11.378  0.829   1.00 10.00 ? 283 LYS A CB   3  
ATOM 6771   C CG   . LYS A 1 128 ? -13.810 11.892  0.644   1.00 10.00 ? 283 LYS A CG   3  
ATOM 6772   C CD   . LYS A 1 128 ? -13.528 12.300  -0.791  1.00 10.00 ? 283 LYS A CD   3  
ATOM 6773   C CE   . LYS A 1 128 ? -14.172 13.628  -1.145  1.00 10.00 ? 283 LYS A CE   3  
ATOM 6774   N NZ   . LYS A 1 128 ? -15.623 13.481  -1.424  1.00 10.00 ? 283 LYS A NZ   3  
ATOM 6775   H H    . LYS A 1 128 ? -17.086 9.699   1.561   1.00 10.00 ? 283 LYS A H    3  
ATOM 6776   H HZ1  . LYS A 1 128 ? -16.103 13.058  -0.606  1.00 10.00 ? 283 LYS A HZ1  3  
ATOM 6777   H HZ2  . LYS A 1 128 ? -15.771 12.867  -2.257  1.00 10.00 ? 283 LYS A HZ2  3  
ATOM 6778   H HZ3  . LYS A 1 128 ? -16.049 14.409  -1.615  1.00 10.00 ? 283 LYS A HZ3  3  
ATOM 6779   N N    . GLY A 1 129 ? -15.788 11.778  4.510   1.00 10.00 ? 284 GLY A N    3  
ATOM 6780   C CA   . GLY A 1 129 ? -15.952 12.805  5.510   1.00 10.00 ? 284 GLY A CA   3  
ATOM 6781   C C    . GLY A 1 129 ? -17.161 12.507  6.350   1.00 10.00 ? 284 GLY A C    3  
ATOM 6782   O O    . GLY A 1 129 ? -17.481 13.220  7.296   1.00 10.00 ? 284 GLY A O    3  
ATOM 6783   H H    . GLY A 1 129 ? -15.728 10.836  4.779   1.00 10.00 ? 284 GLY A H    3  
ATOM 6784   N N    . THR A 1 130 ? -17.831 11.435  5.981   1.00 10.00 ? 285 THR A N    3  
ATOM 6785   C CA   . THR A 1 130 ? -19.017 10.984  6.675   1.00 10.00 ? 285 THR A CA   3  
ATOM 6786   C C    . THR A 1 130 ? -18.688 9.779   7.549   1.00 10.00 ? 285 THR A C    3  
ATOM 6787   O O    . THR A 1 130 ? -19.493 8.864   7.689   1.00 10.00 ? 285 THR A O    3  
ATOM 6788   C CB   . THR A 1 130 ? -20.111 10.603  5.664   1.00 10.00 ? 285 THR A CB   3  
ATOM 6789   O OG1  . THR A 1 130 ? -19.532 10.494  4.353   1.00 10.00 ? 285 THR A OG1  3  
ATOM 6790   C CG2  . THR A 1 130 ? -21.204 11.659  5.639   1.00 10.00 ? 285 THR A CG2  3  
ATOM 6791   H H    . THR A 1 130 ? -17.522 10.930  5.198   1.00 10.00 ? 285 THR A H    3  
ATOM 6792   H HG1  . THR A 1 130 ? -20.012 9.820   3.845   1.00 10.00 ? 285 THR A HG1  3  
ATOM 6793   N N    . VAL A 1 131 ? -17.488 9.779   8.119   1.00 10.00 ? 286 VAL A N    3  
ATOM 6794   C CA   . VAL A 1 131 ? -17.050 8.690   8.981   1.00 10.00 ? 286 VAL A CA   3  
ATOM 6795   C C    . VAL A 1 131 ? -16.610 9.235   10.332  1.00 10.00 ? 286 VAL A C    3  
ATOM 6796   O O    . VAL A 1 131 ? -15.717 10.081  10.408  1.00 10.00 ? 286 VAL A O    3  
ATOM 6797   C CB   . VAL A 1 131 ? -15.889 7.882   8.354   1.00 10.00 ? 286 VAL A CB   3  
ATOM 6798   C CG1  . VAL A 1 131 ? -15.430 6.780   9.297   1.00 10.00 ? 286 VAL A CG1  3  
ATOM 6799   C CG2  . VAL A 1 131 ? -16.308 7.286   7.023   1.00 10.00 ? 286 VAL A CG2  3  
ATOM 6800   H H    . VAL A 1 131 ? -16.886 10.536  7.965   1.00 10.00 ? 286 VAL A H    3  
ATOM 6801   N N    . ASP A 1 132 ? -17.246 8.756   11.390  1.00 10.00 ? 287 ASP A N    3  
ATOM 6802   C CA   . ASP A 1 132 ? -16.919 9.190   12.746  1.00 10.00 ? 287 ASP A CA   3  
ATOM 6803   C C    . ASP A 1 132 ? -15.779 8.365   13.331  1.00 10.00 ? 287 ASP A C    3  
ATOM 6804   O O    . ASP A 1 132 ? -15.156 8.757   14.318  1.00 10.00 ? 287 ASP A O    3  
ATOM 6805   C CB   . ASP A 1 132 ? -18.153 9.118   13.656  1.00 10.00 ? 287 ASP A CB   3  
ATOM 6806   C CG   . ASP A 1 132 ? -18.498 7.708   14.105  1.00 10.00 ? 287 ASP A CG   3  
ATOM 6807   O OD1  . ASP A 1 132 ? -18.481 6.786   13.264  1.00 10.00 ? 287 ASP A OD1  3  
ATOM 6808   O OD2  . ASP A 1 132 ? -18.805 7.514   15.304  1.00 10.00 ? 287 ASP A OD2  3  
ATOM 6809   H H    . ASP A 1 132 ? -17.963 8.101   11.263  1.00 10.00 ? 287 ASP A H    3  
ATOM 6810   N N    . CYS A 1 133 ? -15.500 7.221   12.718  1.00 10.00 ? 288 CYS A N    3  
ATOM 6811   C CA   . CYS A 1 133 ? -14.446 6.340   13.187  1.00 10.00 ? 288 CYS A CA   3  
ATOM 6812   C C    . CYS A 1 133 ? -13.098 6.685   12.567  1.00 10.00 ? 288 CYS A C    3  
ATOM 6813   O O    . CYS A 1 133 ? -13.007 6.973   11.373  1.00 10.00 ? 288 CYS A O    3  
ATOM 6814   C CB   . CYS A 1 133 ? -14.799 4.890   12.861  1.00 10.00 ? 288 CYS A CB   3  
ATOM 6815   S SG   . CYS A 1 133 ? -13.555 3.697   13.392  1.00 10.00 ? 288 CYS A SG   3  
ATOM 6816   H H    . CYS A 1 133 ? -16.025 6.959   11.933  1.00 10.00 ? 288 CYS A H    3  
ATOM 6817   H HG   . CYS A 1 133 ? -13.812 3.392   14.660  1.00 10.00 ? 288 CYS A HG   3  
ATOM 6818   N N    . VAL A 1 134 ? -12.051 6.683   13.387  1.00 10.00 ? 289 VAL A N    3  
ATOM 6819   C CA   . VAL A 1 134 ? -10.703 6.981   12.922  1.00 10.00 ? 289 VAL A CA   3  
ATOM 6820   C C    . VAL A 1 134 ? -10.057 5.776   12.215  1.00 10.00 ? 289 VAL A C    3  
ATOM 6821   O O    . VAL A 1 134 ? -9.175  5.935   11.369  1.00 10.00 ? 289 VAL A O    3  
ATOM 6822   C CB   . VAL A 1 134 ? -9.803  7.489   14.077  1.00 10.00 ? 289 VAL A CB   3  
ATOM 6823   C CG1  . VAL A 1 134 ? -9.535  6.393   15.100  1.00 10.00 ? 289 VAL A CG1  3  
ATOM 6824   C CG2  . VAL A 1 134 ? -8.507  8.085   13.548  1.00 10.00 ? 289 VAL A CG2  3  
ATOM 6825   H H    . VAL A 1 134 ? -12.175 6.461   14.338  1.00 10.00 ? 289 VAL A H    3  
ATOM 6826   N N    . GLN A 1 135 ? -10.538 4.578   12.537  1.00 10.00 ? 290 GLN A N    3  
ATOM 6827   C CA   . GLN A 1 135 ? -9.991  3.350   11.955  1.00 10.00 ? 290 GLN A CA   3  
ATOM 6828   C C    . GLN A 1 135 ? -10.395 3.245   10.494  1.00 10.00 ? 290 GLN A C    3  
ATOM 6829   O O    . GLN A 1 135 ? -9.588  2.896   9.629   1.00 10.00 ? 290 GLN A O    3  
ATOM 6830   C CB   . GLN A 1 135 ? -10.468 2.111   12.719  1.00 10.00 ? 290 GLN A CB   3  
ATOM 6831   C CG   . GLN A 1 135 ? -10.216 2.156   14.217  1.00 10.00 ? 290 GLN A CG   3  
ATOM 6832   C CD   . GLN A 1 135 ? -8.764  2.416   14.569  1.00 10.00 ? 290 GLN A CD   3  
ATOM 6833   O OE1  . GLN A 1 135 ? -7.855  2.042   13.832  1.00 10.00 ? 290 GLN A OE1  3  
ATOM 6834   N NE2  . GLN A 1 135 ? -8.543  3.058   15.706  1.00 10.00 ? 290 GLN A NE2  3  
ATOM 6835   H H    . GLN A 1 135 ? -11.313 4.528   13.135  1.00 10.00 ? 290 GLN A H    3  
ATOM 6836   H HE21 . GLN A 1 135 ? -9.320  3.321   16.247  1.00 10.00 ? 290 GLN A HE21 3  
ATOM 6837   H HE22 . GLN A 1 135 ? -7.614  3.244   15.960  1.00 10.00 ? 290 GLN A HE22 3  
ATOM 6838   N N    . ALA A 1 136 ? -11.653 3.561   10.228  1.00 10.00 ? 291 ALA A N    3  
ATOM 6839   C CA   . ALA A 1 136 ? -12.182 3.523   8.878   1.00 10.00 ? 291 ALA A CA   3  
ATOM 6840   C C    . ALA A 1 136 ? -11.609 4.669   8.054   1.00 10.00 ? 291 ALA A C    3  
ATOM 6841   O O    . ALA A 1 136 ? -11.491 4.569   6.834   1.00 10.00 ? 291 ALA A O    3  
ATOM 6842   C CB   . ALA A 1 136 ? -13.703 3.581   8.902   1.00 10.00 ? 291 ALA A CB   3  
ATOM 6843   H H    . ALA A 1 136 ? -12.244 3.821   10.967  1.00 10.00 ? 291 ALA A H    3  
ATOM 6844   N N    . ARG A 1 137 ? -11.241 5.752   8.737   1.00 10.00 ? 292 ARG A N    3  
ATOM 6845   C CA   . ARG A 1 137 ? -10.682 6.921   8.072   1.00 10.00 ? 292 ARG A CA   3  
ATOM 6846   C C    . ARG A 1 137 ? -9.399  6.572   7.331   1.00 10.00 ? 292 ARG A C    3  
ATOM 6847   O O    . ARG A 1 137 ? -9.302  6.792   6.124   1.00 10.00 ? 292 ARG A O    3  
ATOM 6848   C CB   . ARG A 1 137 ? -10.412 8.034   9.085   1.00 10.00 ? 292 ARG A CB   3  
ATOM 6849   C CG   . ARG A 1 137 ? -11.239 9.293   8.870   1.00 10.00 ? 292 ARG A CG   3  
ATOM 6850   C CD   . ARG A 1 137 ? -10.371 10.460  8.421   1.00 10.00 ? 292 ARG A CD   3  
ATOM 6851   N NE   . ARG A 1 137 ? -10.023 10.384  7.004   1.00 10.00 ? 292 ARG A NE   3  
ATOM 6852   C CZ   . ARG A 1 137 ? -10.700 11.003  6.037   1.00 10.00 ? 292 ARG A CZ   3  
ATOM 6853   N NH1  . ARG A 1 137 ? -11.730 11.790  6.333   1.00 10.00 ? 292 ARG A NH1  3  
ATOM 6854   N NH2  . ARG A 1 137 ? -10.338 10.855  4.773   1.00 10.00 ? 292 ARG A NH2  3  
ATOM 6855   H H    . ARG A 1 137 ? -11.346 5.760   9.710   1.00 10.00 ? 292 ARG A H    3  
ATOM 6856   H HE   . ARG A 1 137 ? -9.233  9.833   6.755   1.00 10.00 ? 292 ARG A HE   3  
ATOM 6857   H HH11 . ARG A 1 137 ? -12.004 11.927  7.289   1.00 10.00 ? 292 ARG A HH11 3  
ATOM 6858   H HH12 . ARG A 1 137 ? -12.233 12.257  5.600   1.00 10.00 ? 292 ARG A HH12 3  
ATOM 6859   H HH21 . ARG A 1 137 ? -9.543  10.272  4.534   1.00 10.00 ? 292 ARG A HH21 3  
ATOM 6860   H HH22 . ARG A 1 137 ? -10.844 11.321  4.046   1.00 10.00 ? 292 ARG A HH22 3  
ATOM 6861   N N    . ALA A 1 138 ? -8.423  5.993   8.035   1.00 10.00 ? 293 ALA A N    3  
ATOM 6862   C CA   . ALA A 1 138 ? -7.154  5.618   7.418   1.00 10.00 ? 293 ALA A CA   3  
ATOM 6863   C C    . ALA A 1 138 ? -7.336  4.575   6.322   1.00 10.00 ? 293 ALA A C    3  
ATOM 6864   O O    . ALA A 1 138 ? -6.587  4.554   5.346   1.00 10.00 ? 293 ALA A O    3  
ATOM 6865   C CB   . ALA A 1 138 ? -6.175  5.119   8.468   1.00 10.00 ? 293 ALA A CB   3  
ATOM 6866   H H    . ALA A 1 138 ? -8.515  5.859   9.003   1.00 10.00 ? 293 ALA A H    3  
ATOM 6867   N N    . ALA A 1 139 ? -8.323  3.706   6.488   1.00 10.00 ? 294 ALA A N    3  
ATOM 6868   C CA   . ALA A 1 139 ? -8.598  2.674   5.497   1.00 10.00 ? 294 ALA A CA   3  
ATOM 6869   C C    . ALA A 1 139 ? -9.033  3.309   4.179   1.00 10.00 ? 294 ALA A C    3  
ATOM 6870   O O    . ALA A 1 139 ? -8.612  2.885   3.099   1.00 10.00 ? 294 ALA A O    3  
ATOM 6871   C CB   . ALA A 1 139 ? -9.649  1.703   6.012   1.00 10.00 ? 294 ALA A CB   3  
ATOM 6872   H H    . ALA A 1 139 ? -8.876  3.756   7.297   1.00 10.00 ? 294 ALA A H    3  
ATOM 6873   N N    . LEU A 1 140 ? -9.853  4.350   4.273   1.00 10.00 ? 295 LEU A N    3  
ATOM 6874   C CA   . LEU A 1 140 ? -10.331 5.060   3.095   1.00 10.00 ? 295 LEU A CA   3  
ATOM 6875   C C    . LEU A 1 140 ? -9.217  5.936   2.526   1.00 10.00 ? 295 LEU A C    3  
ATOM 6876   O O    . LEU A 1 140 ? -9.119  6.125   1.314   1.00 10.00 ? 295 LEU A O    3  
ATOM 6877   C CB   . LEU A 1 140 ? -11.557 5.909   3.447   1.00 10.00 ? 295 LEU A CB   3  
ATOM 6878   C CG   . LEU A 1 140 ? -12.797 5.136   3.902   1.00 10.00 ? 295 LEU A CG   3  
ATOM 6879   C CD1  . LEU A 1 140 ? -13.939 6.085   4.216   1.00 10.00 ? 295 LEU A CD1  3  
ATOM 6880   C CD2  . LEU A 1 140 ? -13.215 4.120   2.847   1.00 10.00 ? 295 LEU A CD2  3  
ATOM 6881   H H    . LEU A 1 140 ? -10.144 4.650   5.163   1.00 10.00 ? 295 LEU A H    3  
ATOM 6882   N N    . ASP A 1 141 ? -8.361  6.427   3.421   1.00 10.00 ? 296 ASP A N    3  
ATOM 6883   C CA   . ASP A 1 141 ? -7.227  7.281   3.056   1.00 10.00 ? 296 ASP A CA   3  
ATOM 6884   C C    . ASP A 1 141 ? -6.160  6.456   2.325   1.00 10.00 ? 296 ASP A C    3  
ATOM 6885   O O    . ASP A 1 141 ? -5.278  6.988   1.654   1.00 10.00 ? 296 ASP A O    3  
ATOM 6886   C CB   . ASP A 1 141 ? -6.669  7.970   4.304   1.00 10.00 ? 296 ASP A CB   3  
ATOM 6887   C CG   . ASP A 1 141 ? -7.560  9.126   4.727   1.00 10.00 ? 296 ASP A CG   3  
ATOM 6888   O OD1  . ASP A 1 141 ? -8.148  9.776   3.840   1.00 10.00 ? 296 ASP A OD1  3  
ATOM 6889   O OD2  . ASP A 1 141 ? -7.702  9.380   5.945   1.00 10.00 ? 296 ASP A OD2  3  
ATOM 6890   H H    . ASP A 1 141 ? -8.492  6.199   4.370   1.00 10.00 ? 296 ASP A H    3  
ATOM 6891   N N    . LYS A 1 142 ? -6.271  5.158   2.525   1.00 10.00 ? 297 LYS A N    3  
ATOM 6892   C CA   . LYS A 1 142 ? -5.377  4.195   1.882   1.00 10.00 ? 297 LYS A CA   3  
ATOM 6893   C C    . LYS A 1 142 ? -5.850  3.783   0.482   1.00 10.00 ? 297 LYS A C    3  
ATOM 6894   O O    . LYS A 1 142 ? -5.149  3.974   -0.518  1.00 10.00 ? 297 LYS A O    3  
ATOM 6895   C CB   . LYS A 1 142 ? -5.092  2.961   2.732   1.00 10.00 ? 297 LYS A CB   3  
ATOM 6896   C CG   . LYS A 1 142 ? -3.717  2.385   2.457   1.00 10.00 ? 297 LYS A CG   3  
ATOM 6897   C CD   . LYS A 1 142 ? -3.064  1.895   3.728   1.00 10.00 ? 297 LYS A CD   3  
ATOM 6898   C CE   . LYS A 1 142 ? -1.940  0.929   3.420   1.00 10.00 ? 297 LYS A CE   3  
ATOM 6899   N NZ   . LYS A 1 142 ? -0.696  1.626   3.009   1.00 10.00 ? 297 LYS A NZ   3  
ATOM 6900   H H    . LYS A 1 142 ? -7.095  4.904   2.973   1.00 10.00 ? 297 LYS A H    3  
ATOM 6901   H HZ1  . LYS A 1 142 ? -0.444  1.377   2.031   1.00 10.00 ? 297 LYS A HZ1  3  
ATOM 6902   H HZ2  . LYS A 1 142 ? 0.091   1.358   3.642   1.00 10.00 ? 297 LYS A HZ2  3  
ATOM 6903   H HZ3  . LYS A 1 142 ? -0.824  2.665   3.055   1.00 10.00 ? 297 LYS A HZ3  3  
ATOM 6904   N N    . ALA A 1 143 ? -7.080  3.253   0.444   1.00 10.00 ? 298 ALA A N    3  
ATOM 6905   C CA   . ALA A 1 143 ? -7.718  2.740   -0.775  1.00 10.00 ? 298 ALA A CA   3  
ATOM 6906   C C    . ALA A 1 143 ? -7.770  3.766   -1.886  1.00 10.00 ? 298 ALA A C    3  
ATOM 6907   O O    . ALA A 1 143 ? -7.626  3.438   -3.069  1.00 10.00 ? 298 ALA A O    3  
ATOM 6908   C CB   . ALA A 1 143 ? -9.132  2.282   -0.447  1.00 10.00 ? 298 ALA A CB   3  
ATOM 6909   H H    . ALA A 1 143 ? -7.583  3.206   1.283   1.00 10.00 ? 298 ALA A H    3  
ATOM 6910   N N    . THR A 1 144 ? -7.991  5.001   -1.502  1.00 10.00 ? 299 THR A N    3  
ATOM 6911   C CA   . THR A 1 144 ? -8.071  6.077   -2.457  1.00 10.00 ? 299 THR A CA   3  
ATOM 6912   C C    . THR A 1 144 ? -6.730  6.292   -3.154  1.00 10.00 ? 299 THR A C    3  
ATOM 6913   O O    . THR A 1 144 ? -6.687  6.480   -4.370  1.00 10.00 ? 299 THR A O    3  
ATOM 6914   C CB   . THR A 1 144 ? -8.549  7.381   -1.790  1.00 10.00 ? 299 THR A CB   3  
ATOM 6915   O OG1  . THR A 1 144 ? -9.725  7.103   -1.016  1.00 10.00 ? 299 THR A OG1  3  
ATOM 6916   C CG2  . THR A 1 144 ? -8.885  8.425   -2.843  1.00 10.00 ? 299 THR A CG2  3  
ATOM 6917   H H    . THR A 1 144 ? -8.111  5.196   -0.551  1.00 10.00 ? 299 THR A H    3  
ATOM 6918   H HG1  . THR A 1 144 ? -9.474  6.893   -0.106  1.00 10.00 ? 299 THR A HG1  3  
ATOM 6919   N N    . VAL A 1 145 ? -5.626  6.246   -2.408  1.00 10.00 ? 300 VAL A N    3  
ATOM 6920   C CA   . VAL A 1 145 ? -4.307  6.455   -2.990  1.00 10.00 ? 300 VAL A CA   3  
ATOM 6921   C C    . VAL A 1 145 ? -3.785  5.210   -3.717  1.00 10.00 ? 300 VAL A C    3  
ATOM 6922   O O    . VAL A 1 145 ? -3.070  5.324   -4.710  1.00 10.00 ? 300 VAL A O    3  
ATOM 6923   C CB   . VAL A 1 145 ? -3.293  6.921   -1.927  1.00 10.00 ? 300 VAL A CB   3  
ATOM 6924   C CG1  . VAL A 1 145 ? -1.950  7.252   -2.558  1.00 10.00 ? 300 VAL A CG1  3  
ATOM 6925   C CG2  . VAL A 1 145 ? -3.846  8.135   -1.194  1.00 10.00 ? 300 VAL A CG2  3  
ATOM 6926   H H    . VAL A 1 145 ? -5.642  6.009   -1.456  1.00 10.00 ? 300 VAL A H    3  
ATOM 6927   N N    . LEU A 1 146 ? -4.138  4.024   -3.221  1.00 10.00 ? 301 LEU A N    3  
ATOM 6928   C CA   . LEU A 1 146 ? -3.695  2.769   -3.836  1.00 10.00 ? 301 LEU A CA   3  
ATOM 6929   C C    . LEU A 1 146 ? -4.047  2.737   -5.315  1.00 10.00 ? 301 LEU A C    3  
ATOM 6930   O O    . LEU A 1 146 ? -3.223  2.363   -6.156  1.00 10.00 ? 301 LEU A O    3  
ATOM 6931   C CB   . LEU A 1 146 ? -4.312  1.567   -3.116  1.00 10.00 ? 301 LEU A CB   3  
ATOM 6932   C CG   . LEU A 1 146 ? -3.654  1.166   -1.797  1.00 10.00 ? 301 LEU A CG   3  
ATOM 6933   C CD1  . LEU A 1 146 ? -4.617  0.358   -0.948  1.00 10.00 ? 301 LEU A CD1  3  
ATOM 6934   C CD2  . LEU A 1 146 ? -2.380  0.377   -2.056  1.00 10.00 ? 301 LEU A CD2  3  
ATOM 6935   H H    . LEU A 1 146 ? -4.697  3.989   -2.413  1.00 10.00 ? 301 LEU A H    3  
ATOM 6936   N N    . LEU A 1 147 ? -5.265  3.160   -5.625  1.00 10.00 ? 302 LEU A N    3  
ATOM 6937   C CA   . LEU A 1 147 ? -5.731  3.215   -7.005  1.00 10.00 ? 302 LEU A CA   3  
ATOM 6938   C C    . LEU A 1 147 ? -4.960  4.277   -7.783  1.00 10.00 ? 302 LEU A C    3  
ATOM 6939   O O    . LEU A 1 147 ? -4.814  4.194   -9.001  1.00 10.00 ? 302 LEU A O    3  
ATOM 6940   C CB   . LEU A 1 147 ? -7.231  3.515   -7.048  1.00 10.00 ? 302 LEU A CB   3  
ATOM 6941   C CG   . LEU A 1 147 ? -8.162  2.339   -6.748  1.00 10.00 ? 302 LEU A CG   3  
ATOM 6942   C CD1  . LEU A 1 147 ? -9.612  2.797   -6.724  1.00 10.00 ? 302 LEU A CD1  3  
ATOM 6943   C CD2  . LEU A 1 147 ? -7.967  1.229   -7.771  1.00 10.00 ? 302 LEU A CD2  3  
ATOM 6944   H H    . LEU A 1 147 ? -5.873  3.432   -4.904  1.00 10.00 ? 302 LEU A H    3  
ATOM 6945   N N    . SER A 1 148 ? -4.459  5.273   -7.068  1.00 10.00 ? 303 SER A N    3  
ATOM 6946   C CA   . SER A 1 148 ? -3.692  6.352   -7.669  1.00 10.00 ? 303 SER A CA   3  
ATOM 6947   C C    . SER A 1 148 ? -2.266  5.886   -7.988  1.00 10.00 ? 303 SER A C    3  
ATOM 6948   O O    . SER A 1 148 ? -1.643  6.347   -8.946  1.00 10.00 ? 303 SER A O    3  
ATOM 6949   C CB   . SER A 1 148 ? -3.682  7.564   -6.722  1.00 10.00 ? 303 SER A CB   3  
ATOM 6950   O OG   . SER A 1 148 ? -2.890  8.628   -7.215  1.00 10.00 ? 303 SER A OG   3  
ATOM 6951   H H    . SER A 1 148 ? -4.606  5.279   -6.096  1.00 10.00 ? 303 SER A H    3  
ATOM 6952   H HG   . SER A 1 148 ? -2.705  9.247   -6.497  1.00 10.00 ? 303 SER A HG   3  
ATOM 6953   N N    . MET A 1 149 ? -1.769  4.940   -7.198  1.00 10.00 ? 304 MET A N    3  
ATOM 6954   C CA   . MET A 1 149 ? -0.419  4.412   -7.378  1.00 10.00 ? 304 MET A CA   3  
ATOM 6955   C C    . MET A 1 149 ? -0.395  3.269   -8.385  1.00 10.00 ? 304 MET A C    3  
ATOM 6956   O O    . MET A 1 149 ? 0.568   3.103   -9.135  1.00 10.00 ? 304 MET A O    3  
ATOM 6957   C CB   . MET A 1 149 ? 0.128   3.935   -6.037  1.00 10.00 ? 304 MET A CB   3  
ATOM 6958   C CG   . MET A 1 149 ? 0.035   4.975   -4.939  1.00 10.00 ? 304 MET A CG   3  
ATOM 6959   S SD   . MET A 1 149 ? 0.806   4.442   -3.407  1.00 10.00 ? 304 MET A SD   3  
ATOM 6960   C CE   . MET A 1 149 ? -0.451  3.362   -2.736  1.00 10.00 ? 304 MET A CE   3  
ATOM 6961   H H    . MET A 1 149 ? -2.323  4.593   -6.465  1.00 10.00 ? 304 MET A H    3  
ATOM 6962   N N    . SER A 1 150 ? -1.470  2.496   -8.406  1.00 10.00 ? 305 SER A N    3  
ATOM 6963   C CA   . SER A 1 150 ? -1.596  1.354   -9.306  1.00 10.00 ? 305 SER A CA   3  
ATOM 6964   C C    . SER A 1 150 ? -1.803  1.765   -10.771 1.00 10.00 ? 305 SER A C    3  
ATOM 6965   O O    . SER A 1 150 ? -2.167  0.943   -11.610 1.00 10.00 ? 305 SER A O    3  
ATOM 6966   C CB   . SER A 1 150 ? -2.690  0.397   -8.827  1.00 10.00 ? 305 SER A CB   3  
ATOM 6967   O OG   . SER A 1 150 ? -2.334  -0.184  -7.579  1.00 10.00 ? 305 SER A OG   3  
ATOM 6968   H H    . SER A 1 150 ? -2.208  2.698   -7.788  1.00 10.00 ? 305 SER A H    3  
ATOM 6969   H HG   . SER A 1 150 ? -2.131  0.511   -6.942  1.00 10.00 ? 305 SER A HG   3  
ATOM 6970   N N    . LYS A 1 151 ? -1.606  3.043   -11.069 1.00 10.00 ? 306 LYS A N    3  
ATOM 6971   C CA   . LYS A 1 151 ? -1.766  3.544   -12.426 1.00 10.00 ? 306 LYS A CA   3  
ATOM 6972   C C    . LYS A 1 151 ? -0.477  3.358   -13.226 1.00 10.00 ? 306 LYS A C    3  
ATOM 6973   O O    . LYS A 1 151 ? -0.511  3.100   -14.430 1.00 10.00 ? 306 LYS A O    3  
ATOM 6974   C CB   . LYS A 1 151 ? -2.164  5.022   -12.414 1.00 10.00 ? 306 LYS A CB   3  
ATOM 6975   C CG   . LYS A 1 151 ? -3.435  5.318   -11.636 1.00 10.00 ? 306 LYS A CG   3  
ATOM 6976   C CD   . LYS A 1 151 ? -3.939  6.723   -11.921 1.00 10.00 ? 306 LYS A CD   3  
ATOM 6977   C CE   . LYS A 1 151 ? -4.783  7.262   -10.774 1.00 10.00 ? 306 LYS A CE   3  
ATOM 6978   N NZ   . LYS A 1 151 ? -6.047  6.499   -10.582 1.00 10.00 ? 306 LYS A NZ   3  
ATOM 6979   H H    . LYS A 1 151 ? -1.334  3.660   -10.357 1.00 10.00 ? 306 LYS A H    3  
ATOM 6980   H HZ1  . LYS A 1 151 ? -6.600  6.918   -9.806  1.00 10.00 ? 306 LYS A HZ1  3  
ATOM 6981   H HZ2  . LYS A 1 151 ? -5.839  5.504   -10.348 1.00 10.00 ? 306 LYS A HZ2  3  
ATOM 6982   H HZ3  . LYS A 1 151 ? -6.618  6.524   -11.450 1.00 10.00 ? 306 LYS A HZ3  3  
ATOM 6983   N N    . GLY A 1 152 ? 0.656   3.491   -12.546 1.00 10.00 ? 307 GLY A N    3  
ATOM 6984   C CA   . GLY A 1 152 ? 1.940   3.343   -13.204 1.00 10.00 ? 307 GLY A CA   3  
ATOM 6985   C C    . GLY A 1 152 ? 2.559   1.983   -12.965 1.00 10.00 ? 307 GLY A C    3  
ATOM 6986   O O    . GLY A 1 152 ? 3.138   1.386   -13.876 1.00 10.00 ? 307 GLY A O    3  
ATOM 6987   H H    . GLY A 1 152 ? 0.620   3.686   -11.588 1.00 10.00 ? 307 GLY A H    3  
ATOM 6988   N N    . GLY A 1 153 ? 2.427   1.487   -11.740 1.00 10.00 ? 308 GLY A N    3  
ATOM 6989   C CA   . GLY A 1 153 ? 2.983   0.192   -11.396 1.00 10.00 ? 308 GLY A CA   3  
ATOM 6990   C C    . GLY A 1 153 ? 2.106   -0.954  -11.856 1.00 10.00 ? 308 GLY A C    3  
ATOM 6991   O O    . GLY A 1 153 ? 1.561   -1.691  -11.039 1.00 10.00 ? 308 GLY A O    3  
ATOM 6992   H H    . GLY A 1 153 ? 1.944   2.004   -11.063 1.00 10.00 ? 308 GLY A H    3  
ATOM 6993   N N    . LYS A 1 154 ? 1.961   -1.093  -13.167 1.00 10.00 ? 309 LYS A N    3  
ATOM 6994   C CA   . LYS A 1 154 ? 1.151   -2.157  -13.743 1.00 10.00 ? 309 LYS A CA   3  
ATOM 6995   C C    . LYS A 1 154 ? 1.995   -3.083  -14.611 1.00 10.00 ? 309 LYS A C    3  
ATOM 6996   O O    . LYS A 1 154 ? 2.189   -4.254  -14.288 1.00 10.00 ? 309 LYS A O    3  
ATOM 6997   C CB   . LYS A 1 154 ? -0.002  -1.572  -14.569 1.00 10.00 ? 309 LYS A CB   3  
ATOM 6998   C CG   . LYS A 1 154 ? -1.197  -1.110  -13.751 1.00 10.00 ? 309 LYS A CG   3  
ATOM 6999   C CD   . LYS A 1 154 ? -2.121  -2.270  -13.410 1.00 10.00 ? 309 LYS A CD   3  
ATOM 7000   C CE   . LYS A 1 154 ? -3.379  -1.790  -12.703 1.00 10.00 ? 309 LYS A CE   3  
ATOM 7001   N NZ   . LYS A 1 154 ? -4.103  -0.758  -13.492 1.00 10.00 ? 309 LYS A NZ   3  
ATOM 7002   H H    . LYS A 1 154 ? 2.413   -0.456  -13.765 1.00 10.00 ? 309 LYS A H    3  
ATOM 7003   H HZ1  . LYS A 1 154 ? -3.674  0.176   -13.345 1.00 10.00 ? 309 LYS A HZ1  3  
ATOM 7004   H HZ2  . LYS A 1 154 ? -5.101  -0.716  -13.199 1.00 10.00 ? 309 LYS A HZ2  3  
ATOM 7005   H HZ3  . LYS A 1 154 ? -4.066  -0.986  -14.504 1.00 10.00 ? 309 LYS A HZ3  3  
ATOM 7006   N N    . ARG A 1 155 ? 2.525   -2.542  -15.700 1.00 10.00 ? 310 ARG A N    3  
ATOM 7007   C CA   . ARG A 1 155 ? 3.331   -3.325  -16.629 1.00 10.00 ? 310 ARG A CA   3  
ATOM 7008   C C    . ARG A 1 155 ? 4.810   -3.275  -16.255 1.00 10.00 ? 310 ARG A C    3  
ATOM 7009   O O    . ARG A 1 155 ? 5.647   -2.819  -17.032 1.00 10.00 ? 310 ARG A O    3  
ATOM 7010   C CB   . ARG A 1 155 ? 3.116   -2.845  -18.070 1.00 10.00 ? 310 ARG A CB   3  
ATOM 7011   C CG   . ARG A 1 155 ? 1.668   -2.508  -18.398 1.00 10.00 ? 310 ARG A CG   3  
ATOM 7012   C CD   . ARG A 1 155 ? 1.441   -2.392  -19.896 1.00 10.00 ? 310 ARG A CD   3  
ATOM 7013   N NE   . ARG A 1 155 ? 1.275   -3.702  -20.529 1.00 10.00 ? 310 ARG A NE   3  
ATOM 7014   C CZ   . ARG A 1 155 ? 1.667   -3.986  -21.770 1.00 10.00 ? 310 ARG A CZ   3  
ATOM 7015   N NH1  . ARG A 1 155 ? 2.282   -3.064  -22.504 1.00 10.00 ? 310 ARG A NH1  3  
ATOM 7016   N NH2  . ARG A 1 155 ? 1.448   -5.195  -22.273 1.00 10.00 ? 310 ARG A NH2  3  
ATOM 7017   H H    . ARG A 1 155 ? 2.385   -1.586  -15.879 1.00 10.00 ? 310 ARG A H    3  
ATOM 7018   H HE   . ARG A 1 155 ? 0.832   -4.406  -20.001 1.00 10.00 ? 310 ARG A HE   3  
ATOM 7019   H HH11 . ARG A 1 155 ? 2.455   -2.148  -22.128 1.00 10.00 ? 310 ARG A HH11 3  
ATOM 7020   H HH12 . ARG A 1 155 ? 2.579   -3.278  -23.439 1.00 10.00 ? 310 ARG A HH12 3  
ATOM 7021   H HH21 . ARG A 1 155 ? 0.989   -5.897  -21.716 1.00 10.00 ? 310 ARG A HH21 3  
ATOM 7022   H HH22 . ARG A 1 155 ? 1.728   -5.411  -23.215 1.00 10.00 ? 310 ARG A HH22 3  
ATOM 7023   N N    . LYS A 1 156 ? 5.118   -3.747  -15.056 1.00 10.00 ? 311 LYS A N    3  
ATOM 7024   C CA   . LYS A 1 156 ? 6.494   -3.763  -14.574 1.00 10.00 ? 311 LYS A CA   3  
ATOM 7025   C C    . LYS A 1 156 ? 7.044   -5.185  -14.498 1.00 10.00 ? 311 LYS A C    3  
ATOM 7026   O O    . LYS A 1 156 ? 8.171   -5.447  -14.925 1.00 10.00 ? 311 LYS A O    3  
ATOM 7027   C CB   . LYS A 1 156 ? 6.610   -3.068  -13.215 1.00 10.00 ? 311 LYS A CB   3  
ATOM 7028   C CG   . LYS A 1 156 ? 6.400   -1.562  -13.261 1.00 10.00 ? 311 LYS A CG   3  
ATOM 7029   C CD   . LYS A 1 156 ? 7.404   -0.887  -14.181 1.00 10.00 ? 311 LYS A CD   3  
ATOM 7030   C CE   . LYS A 1 156 ? 7.280   0.624   -14.109 1.00 10.00 ? 311 LYS A CE   3  
ATOM 7031   N NZ   . LYS A 1 156 ? 8.040   1.297   -15.192 1.00 10.00 ? 311 LYS A NZ   3  
ATOM 7032   H H    . LYS A 1 156 ? 4.403   -4.093  -14.483 1.00 10.00 ? 311 LYS A H    3  
ATOM 7033   H HZ1  . LYS A 1 156 ? 8.316   2.253   -14.893 1.00 10.00 ? 311 LYS A HZ1  3  
ATOM 7034   H HZ2  . LYS A 1 156 ? 7.452   1.370   -16.048 1.00 10.00 ? 311 LYS A HZ2  3  
ATOM 7035   H HZ3  . LYS A 1 156 ? 8.897   0.756   -15.421 1.00 10.00 ? 311 LYS A HZ3  3  
ATOM 7036   N N    . ASP A 1 157 ? 6.247   -6.108  -13.966 1.00 10.00 ? 312 ASP A N    3  
ATOM 7037   C CA   . ASP A 1 157 ? 6.673   -7.500  -13.841 1.00 10.00 ? 312 ASP A CA   3  
ATOM 7038   C C    . ASP A 1 157 ? 6.470   -8.250  -15.151 1.00 10.00 ? 312 ASP A C    3  
ATOM 7039   O O    . ASP A 1 157 ? 5.467   -8.932  -15.348 1.00 10.00 ? 312 ASP A O    3  
ATOM 7040   C CB   . ASP A 1 157 ? 5.943   -8.212  -12.698 1.00 10.00 ? 312 ASP A CB   3  
ATOM 7041   C CG   . ASP A 1 157 ? 6.454   -9.624  -12.463 1.00 10.00 ? 312 ASP A CG   3  
ATOM 7042   O OD1  . ASP A 1 157 ? 7.632   -9.898  -12.775 1.00 10.00 ? 312 ASP A OD1  3  
ATOM 7043   O OD2  . ASP A 1 157 ? 5.686   -10.460 -11.945 1.00 10.00 ? 312 ASP A OD2  3  
ATOM 7044   H H    . ASP A 1 157 ? 5.356   -5.852  -13.654 1.00 10.00 ? 312 ASP A H    3  
ATOM 7045   N N    . SER A 1 158 ? 7.407   -8.078  -16.062 1.00 10.00 ? 313 SER A N    3  
ATOM 7046   C CA   . SER A 1 158 ? 7.348   -8.739  -17.352 1.00 10.00 ? 313 SER A CA   3  
ATOM 7047   C C    . SER A 1 158 ? 8.670   -9.421  -17.663 1.00 10.00 ? 313 SER A C    3  
ATOM 7048   O O    . SER A 1 158 ? 8.702   -10.501 -18.251 1.00 10.00 ? 313 SER A O    3  
ATOM 7049   C CB   . SER A 1 158 ? 7.006   -7.728  -18.445 1.00 10.00 ? 313 SER A CB   3  
ATOM 7050   O OG   . SER A 1 158 ? 5.874   -6.963  -18.071 1.00 10.00 ? 313 SER A OG   3  
ATOM 7051   H H    . SER A 1 158 ? 8.153   -7.475  -15.865 1.00 10.00 ? 313 SER A H    3  
ATOM 7052   H HG   . SER A 1 158 ? 5.513   -7.316  -17.250 1.00 10.00 ? 313 SER A HG   3  
ATOM 7053   N N    . VAL A 1 159 ? 9.759   -8.799  -17.226 1.00 10.00 ? 314 VAL A N    3  
ATOM 7054   C CA   . VAL A 1 159 ? 11.092  -9.332  -17.465 1.00 10.00 ? 314 VAL A CA   3  
ATOM 7055   C C    . VAL A 1 159 ? 11.343  -10.620 -16.682 1.00 10.00 ? 314 VAL A C    3  
ATOM 7056   O O    . VAL A 1 159 ? 12.300  -11.342 -16.957 1.00 10.00 ? 314 VAL A O    3  
ATOM 7057   C CB   . VAL A 1 159 ? 12.196  -8.293  -17.169 1.00 10.00 ? 314 VAL A CB   3  
ATOM 7058   C CG1  . VAL A 1 159 ? 12.058  -7.096  -18.095 1.00 10.00 ? 314 VAL A CG1  3  
ATOM 7059   C CG2  . VAL A 1 159 ? 12.159  -7.848  -15.716 1.00 10.00 ? 314 VAL A CG2  3  
ATOM 7060   H H    . VAL A 1 159 ? 9.665   -7.959  -16.735 1.00 10.00 ? 314 VAL A H    3  
ATOM 7061   N N    . TRP A 1 160 ? 10.486  -10.905 -15.707 1.00 10.00 ? 315 TRP A N    3  
ATOM 7062   C CA   . TRP A 1 160 ? 10.618  -12.120 -14.915 1.00 10.00 ? 315 TRP A CA   3  
ATOM 7063   C C    . TRP A 1 160 ? 9.771   -13.244 -15.505 1.00 10.00 ? 315 TRP A C    3  
ATOM 7064   O O    . TRP A 1 160 ? 10.139  -14.417 -15.428 1.00 10.00 ? 315 TRP A O    3  
ATOM 7065   C CB   . TRP A 1 160 ? 10.232  -11.870 -13.457 1.00 10.00 ? 315 TRP A CB   3  
ATOM 7066   C CG   . TRP A 1 160 ? 11.278  -11.135 -12.675 1.00 10.00 ? 315 TRP A CG   3  
ATOM 7067   C CD1  . TRP A 1 160 ? 12.373  -11.675 -12.066 1.00 10.00 ? 315 TRP A CD1  3  
ATOM 7068   C CD2  . TRP A 1 160 ? 11.328  -9.727  -12.413 1.00 10.00 ? 315 TRP A CD2  3  
ATOM 7069   N NE1  . TRP A 1 160 ? 13.100  -10.693 -11.441 1.00 10.00 ? 315 TRP A NE1  3  
ATOM 7070   C CE2  . TRP A 1 160 ? 12.479  -9.488  -11.639 1.00 10.00 ? 315 TRP A CE2  3  
ATOM 7071   C CE3  . TRP A 1 160 ? 10.510  -8.646  -12.757 1.00 10.00 ? 315 TRP A CE3  3  
ATOM 7072   C CZ2  . TRP A 1 160 ? 12.833  -8.215  -11.202 1.00 10.00 ? 315 TRP A CZ2  3  
ATOM 7073   C CZ3  . TRP A 1 160 ? 10.863  -7.381  -12.323 1.00 10.00 ? 315 TRP A CZ3  3  
ATOM 7074   C CH2  . TRP A 1 160 ? 12.013  -7.178  -11.555 1.00 10.00 ? 315 TRP A CH2  3  
ATOM 7075   H H    . TRP A 1 160 ? 9.754   -10.285 -15.513 1.00 10.00 ? 315 TRP A H    3  
ATOM 7076   H HE1  . TRP A 1 160 ? 13.932  -10.832 -10.934 1.00 10.00 ? 315 TRP A HE1  3  
ATOM 7077   N N    . GLY A 1 161 ? 8.642   -12.878 -16.102 1.00 10.00 ? 316 GLY A N    3  
ATOM 7078   C CA   . GLY A 1 161 ? 7.766   -13.862 -16.710 1.00 10.00 ? 316 GLY A CA   3  
ATOM 7079   C C    . GLY A 1 161 ? 6.888   -14.576 -15.700 1.00 10.00 ? 316 GLY A C    3  
ATOM 7080   O O    . GLY A 1 161 ? 7.161   -15.716 -15.320 1.00 10.00 ? 316 GLY A O    3  
ATOM 7081   H H    . GLY A 1 161 ? 8.400   -11.930 -16.126 1.00 10.00 ? 316 GLY A H    3  
ATOM 7082   N N    . SER A 1 162 ? 5.824   -13.920 -15.277 1.00 10.00 ? 317 SER A N    3  
ATOM 7083   C CA   . SER A 1 162 ? 4.908   -14.500 -14.310 1.00 10.00 ? 317 SER A CA   3  
ATOM 7084   C C    . SER A 1 162 ? 3.670   -15.054 -15.010 1.00 10.00 ? 317 SER A C    3  
ATOM 7085   O O    . SER A 1 162 ? 3.084   -14.394 -15.871 1.00 10.00 ? 317 SER A O    3  
ATOM 7086   C CB   . SER A 1 162 ? 4.526   -13.463 -13.254 1.00 10.00 ? 317 SER A CB   3  
ATOM 7087   O OG   . SER A 1 162 ? 5.684   -12.995 -12.582 1.00 10.00 ? 317 SER A OG   3  
ATOM 7088   H H    . SER A 1 162 ? 5.640   -13.024 -15.631 1.00 10.00 ? 317 SER A H    3  
ATOM 7089   H HG   . SER A 1 162 ? 5.631   -12.029 -12.475 1.00 10.00 ? 317 SER A HG   3  
ATOM 7090   N N    . GLY A 1 163 ? 3.289   -16.270 -14.653 1.00 10.00 ? 318 GLY A N    3  
ATOM 7091   C CA   . GLY A 1 163 ? 2.136   -16.891 -15.260 1.00 10.00 ? 318 GLY A CA   3  
ATOM 7092   C C    . GLY A 1 163 ? 2.411   -18.338 -15.599 1.00 10.00 ? 318 GLY A C    3  
ATOM 7093   O O    . GLY A 1 163 ? 1.926   -18.813 -16.645 1.00 10.00 ? 318 GLY A O    3  
ATOM 7094   O OXT  . GLY A 1 163 ? 3.118   -19.010 -14.815 1.00 10.00 ? 318 GLY A OXT  3  
ATOM 7095   H H    . GLY A 1 163 ? 3.801   -16.759 -13.974 1.00 10.00 ? 318 GLY A H    3  
ATOM 7096   N N    . GLY B 2 1   ? 1.257   -20.990 -15.065 1.00 10.00 ? 319 GLY B N    3  
ATOM 7097   C CA   . GLY B 2 1   ? 1.592   -22.327 -14.527 1.00 10.00 ? 319 GLY B CA   3  
ATOM 7098   C C    . GLY B 2 1   ? 1.894   -22.270 -13.047 1.00 10.00 ? 319 GLY B C    3  
ATOM 7099   O O    . GLY B 2 1   ? 2.164   -21.193 -12.509 1.00 10.00 ? 319 GLY B O    3  
ATOM 7100   H H1   . GLY B 2 1   ? 0.458   -20.583 -14.539 1.00 10.00 ? 319 GLY B H1   3  
ATOM 7101   H H2   . GLY B 2 1   ? 0.996   -21.059 -16.067 1.00 10.00 ? 319 GLY B H2   3  
ATOM 7102   H H3   . GLY B 2 1   ? 2.077   -20.350 -14.975 1.00 10.00 ? 319 GLY B H3   3  
ATOM 7103   N N    . GLY B 2 2   ? 1.840   -23.419 -12.384 1.00 10.00 ? 320 GLY B N    3  
ATOM 7104   C CA   . GLY B 2 2   ? 2.118   -23.473 -10.963 1.00 10.00 ? 320 GLY B CA   3  
ATOM 7105   C C    . GLY B 2 2   ? 0.965   -22.949 -10.134 1.00 10.00 ? 320 GLY B C    3  
ATOM 7106   O O    . GLY B 2 2   ? -0.199  -23.167 -10.472 1.00 10.00 ? 320 GLY B O    3  
ATOM 7107   H H    . GLY B 2 2   ? 1.600   -24.242 -12.864 1.00 10.00 ? 320 GLY B H    3  
ATOM 7108   N N    . GLN B 2 3   ? 1.281   -22.270 -9.044  1.00 10.00 ? 321 GLN B N    3  
ATOM 7109   C CA   . GLN B 2 3   ? 0.259   -21.705 -8.174  1.00 10.00 ? 321 GLN B CA   3  
ATOM 7110   C C    . GLN B 2 3   ? 0.196   -20.192 -8.341  1.00 10.00 ? 321 GLN B C    3  
ATOM 7111   O O    . GLN B 2 3   ? -0.780  -19.654 -8.865  1.00 10.00 ? 321 GLN B O    3  
ATOM 7112   C CB   . GLN B 2 3   ? 0.525   -22.066 -6.708  1.00 10.00 ? 321 GLN B CB   3  
ATOM 7113   C CG   . GLN B 2 3   ? 0.312   -23.536 -6.376  1.00 10.00 ? 321 GLN B CG   3  
ATOM 7114   C CD   . GLN B 2 3   ? -1.127  -23.975 -6.564  1.00 10.00 ? 321 GLN B CD   3  
ATOM 7115   O OE1  . GLN B 2 3   ? -1.943  -23.890 -5.647  1.00 10.00 ? 321 GLN B OE1  3  
ATOM 7116   N NE2  . GLN B 2 3   ? -1.445  -24.458 -7.753  1.00 10.00 ? 321 GLN B NE2  3  
ATOM 7117   H H    . GLN B 2 3   ? 2.228   -22.148 -8.814  1.00 10.00 ? 321 GLN B H    3  
ATOM 7118   H HE21 . GLN B 2 3   ? -0.741  -24.509 -8.435  1.00 10.00 ? 321 GLN B HE21 3  
ATOM 7119   H HE22 . GLN B 2 3   ? -2.370  -24.735 -7.908  1.00 10.00 ? 321 GLN B HE22 3  
ATOM 7120   N N    . GLN B 2 4   ? 1.250   -19.512 -7.911  1.00 10.00 ? 322 GLN B N    3  
ATOM 7121   C CA   . GLN B 2 4   ? 1.325   -18.064 -8.010  1.00 10.00 ? 322 GLN B CA   3  
ATOM 7122   C C    . GLN B 2 4   ? 2.750   -17.591 -7.739  1.00 10.00 ? 322 GLN B C    3  
ATOM 7123   O O    . GLN B 2 4   ? 3.346   -17.964 -6.729  1.00 10.00 ? 322 GLN B O    3  
ATOM 7124   C CB   . GLN B 2 4   ? 0.363   -17.412 -7.009  1.00 10.00 ? 322 GLN B CB   3  
ATOM 7125   C CG   . GLN B 2 4   ? 0.084   -15.940 -7.277  1.00 10.00 ? 322 GLN B CG   3  
ATOM 7126   C CD   . GLN B 2 4   ? -0.687  -15.276 -6.152  1.00 10.00 ? 322 GLN B CD   3  
ATOM 7127   O OE1  . GLN B 2 4   ? -0.101  -14.715 -5.227  1.00 10.00 ? 322 GLN B OE1  3  
ATOM 7128   N NE2  . GLN B 2 4   ? -2.010  -15.338 -6.220  1.00 10.00 ? 322 GLN B NE2  3  
ATOM 7129   H H    . GLN B 2 4   ? 2.006   -20.001 -7.515  1.00 10.00 ? 322 GLN B H    3  
ATOM 7130   H HE21 . GLN B 2 4   ? -2.412  -15.804 -6.982  1.00 10.00 ? 322 GLN B HE21 3  
ATOM 7131   H HE22 . GLN B 2 4   ? -2.529  -14.917 -5.506  1.00 10.00 ? 322 GLN B HE22 3  
ATOM 7132   N N    . PRO B 2 5   ? 3.328   -16.799 -8.656  1.00 10.00 ? 323 PRO B N    3  
ATOM 7133   C CA   . PRO B 2 5   ? 4.682   -16.260 -8.501  1.00 10.00 ? 323 PRO B CA   3  
ATOM 7134   C C    . PRO B 2 5   ? 4.716   -15.171 -7.428  1.00 10.00 ? 323 PRO B C    3  
ATOM 7135   O O    . PRO B 2 5   ? 3.669   -14.680 -6.999  1.00 10.00 ? 323 PRO B O    3  
ATOM 7136   C CB   . PRO B 2 5   ? 4.995   -15.660 -9.881  1.00 10.00 ? 323 PRO B CB   3  
ATOM 7137   C CG   . PRO B 2 5   ? 3.926   -16.169 -10.788 1.00 10.00 ? 323 PRO B CG   3  
ATOM 7138   C CD   . PRO B 2 5   ? 2.723   -16.382 -9.924  1.00 10.00 ? 323 PRO B CD   3  
ATOM 7139   N N    . VAL B 2 6   ? 5.908   -14.786 -7.000  1.00 10.00 ? 324 VAL B N    3  
ATOM 7140   C CA   . VAL B 2 6   ? 6.042   -13.766 -5.969  1.00 10.00 ? 324 VAL B CA   3  
ATOM 7141   C C    . VAL B 2 6   ? 6.217   -12.367 -6.553  1.00 10.00 ? 324 VAL B C    3  
ATOM 7142   O O    . VAL B 2 6   ? 6.783   -12.196 -7.635  1.00 10.00 ? 324 VAL B O    3  
ATOM 7143   C CB   . VAL B 2 6   ? 7.183   -14.075 -4.977  1.00 10.00 ? 324 VAL B CB   3  
ATOM 7144   C CG1  . VAL B 2 6   ? 6.704   -15.057 -3.919  1.00 10.00 ? 324 VAL B CG1  3  
ATOM 7145   C CG2  . VAL B 2 6   ? 8.401   -14.626 -5.705  1.00 10.00 ? 324 VAL B CG2  3  
ATOM 7146   H H    . VAL B 2 6   ? 6.714   -15.184 -7.393  1.00 10.00 ? 324 VAL B H    3  
ATOM 7147   N N    . ASN B 2 7   ? 5.708   -11.377 -5.830  1.00 10.00 ? 325 ASN B N    3  
ATOM 7148   C CA   . ASN B 2 7   ? 5.798   -9.982  -6.248  1.00 10.00 ? 325 ASN B CA   3  
ATOM 7149   C C    . ASN B 2 7   ? 7.207   -9.444  -6.014  1.00 10.00 ? 325 ASN B C    3  
ATOM 7150   O O    . ASN B 2 7   ? 7.897   -9.873  -5.088  1.00 10.00 ? 325 ASN B O    3  
ATOM 7151   C CB   . ASN B 2 7   ? 4.779   -9.134  -5.476  1.00 10.00 ? 325 ASN B CB   3  
ATOM 7152   C CG   . ASN B 2 7   ? 4.773   -7.675  -5.900  1.00 10.00 ? 325 ASN B CG   3  
ATOM 7153   O OD1  . ASN B 2 7   ? 4.094   -7.299  -6.853  1.00 10.00 ? 325 ASN B OD1  3  
ATOM 7154   N ND2  . ASN B 2 7   ? 5.526   -6.841  -5.196  1.00 10.00 ? 325 ASN B ND2  3  
ATOM 7155   H H    . ASN B 2 7   ? 5.249   -11.593 -4.992  1.00 10.00 ? 325 ASN B H    3  
ATOM 7156   H HD21 . ASN B 2 7   ? 6.050   -7.201  -4.442  1.00 10.00 ? 325 ASN B HD21 3  
ATOM 7157   H HD22 . ASN B 2 7   ? 5.531   -5.888  -5.455  1.00 10.00 ? 325 ASN B HD22 3  
ATOM 7158   N N    . HIS B 2 8   ? 7.627   -8.513  -6.859  1.00 10.00 ? 326 HIS B N    3  
ATOM 7159   C CA   . HIS B 2 8   ? 8.954   -7.916  -6.754  1.00 10.00 ? 326 HIS B CA   3  
ATOM 7160   C C    . HIS B 2 8   ? 8.990   -6.547  -7.424  1.00 10.00 ? 326 HIS B C    3  
ATOM 7161   O O    . HIS B 2 8   ? 8.644   -6.424  -8.601  1.00 10.00 ? 326 HIS B O    3  
ATOM 7162   C CB   . HIS B 2 8   ? 10.026  -8.837  -7.367  1.00 10.00 ? 326 HIS B CB   3  
ATOM 7163   C CG   . HIS B 2 8   ? 9.558   -9.652  -8.540  1.00 10.00 ? 326 HIS B CG   3  
ATOM 7164   N ND1  . HIS B 2 8   ? 9.676   -11.023 -8.599  1.00 10.00 ? 326 HIS B ND1  3  
ATOM 7165   C CD2  . HIS B 2 8   ? 8.948   -9.283  -9.690  1.00 10.00 ? 326 HIS B CD2  3  
ATOM 7166   C CE1  . HIS B 2 8   ? 9.160   -11.458 -9.733  1.00 10.00 ? 326 HIS B CE1  3  
ATOM 7167   N NE2  . HIS B 2 8   ? 8.713   -10.423 -10.409 1.00 10.00 ? 326 HIS B NE2  3  
ATOM 7168   H H    . HIS B 2 8   ? 7.026   -8.208  -7.570  1.00 10.00 ? 326 HIS B H    3  
ATOM 7169   H HD1  . HIS B 2 8   ? 10.083  -11.597 -7.911  1.00 10.00 ? 326 HIS B HD1  3  
ATOM 7170   H HE2  . HIS B 2 8   ? 8.328   -10.457 -11.324 1.00 10.00 ? 326 HIS B HE2  3  
ATOM 7171   N N    . LEU B 2 9   ? 9.370   -5.524  -6.657  1.00 10.00 ? 327 LEU B N    3  
ATOM 7172   C CA   . LEU B 2 9   ? 9.482   -4.142  -7.146  1.00 10.00 ? 327 LEU B CA   3  
ATOM 7173   C C    . LEU B 2 9   ? 8.125   -3.463  -7.353  1.00 10.00 ? 327 LEU B C    3  
ATOM 7174   O O    . LEU B 2 9   ? 7.927   -2.309  -6.955  1.00 10.00 ? 327 LEU B O    3  
ATOM 7175   C CB   . LEU B 2 9   ? 10.339  -4.062  -8.415  1.00 10.00 ? 327 LEU B CB   3  
ATOM 7176   C CG   . LEU B 2 9   ? 10.636  -2.660  -8.949  1.00 10.00 ? 327 LEU B CG   3  
ATOM 7177   C CD1  . LEU B 2 9   ? 11.597  -1.927  -8.026  1.00 10.00 ? 327 LEU B CD1  3  
ATOM 7178   C CD2  . LEU B 2 9   ? 11.195  -2.733  -10.361 1.00 10.00 ? 327 LEU B CD2  3  
ATOM 7179   H H    . LEU B 2 9   ? 9.573   -5.697  -5.706  1.00 10.00 ? 327 LEU B H    3  
ATOM 7180   N N    . VAL B 2 10  ? 7.200   -4.173  -7.978  1.00 10.00 ? 328 VAL B N    3  
ATOM 7181   C CA   . VAL B 2 10  ? 5.870   -3.646  -8.251  1.00 10.00 ? 328 VAL B CA   3  
ATOM 7182   C C    . VAL B 2 10  ? 5.099   -3.434  -6.952  1.00 10.00 ? 328 VAL B C    3  
ATOM 7183   O O    . VAL B 2 10  ? 5.096   -4.300  -6.080  1.00 10.00 ? 328 VAL B O    3  
ATOM 7184   C CB   . VAL B 2 10  ? 5.064   -4.596  -9.165  1.00 10.00 ? 328 VAL B CB   3  
ATOM 7185   C CG1  . VAL B 2 10  ? 3.825   -3.905  -9.714  1.00 10.00 ? 328 VAL B CG1  3  
ATOM 7186   C CG2  . VAL B 2 10  ? 5.930   -5.124  -10.298 1.00 10.00 ? 328 VAL B CG2  3  
ATOM 7187   H H    . VAL B 2 10  ? 7.421   -5.087  -8.260  1.00 10.00 ? 328 VAL B H    3  
ATOM 7188   N N    . LYS B 2 11  ? 4.465   -2.268  -6.831  1.00 10.00 ? 329 LYS B N    3  
ATOM 7189   C CA   . LYS B 2 11  ? 3.675   -1.923  -5.647  1.00 10.00 ? 329 LYS B CA   3  
ATOM 7190   C C    . LYS B 2 11  ? 4.545   -1.810  -4.396  1.00 10.00 ? 329 LYS B C    3  
ATOM 7191   O O    . LYS B 2 11  ? 4.040   -1.856  -3.277  1.00 10.00 ? 329 LYS B O    3  
ATOM 7192   C CB   . LYS B 2 11  ? 2.541   -2.935  -5.417  1.00 10.00 ? 329 LYS B CB   3  
ATOM 7193   C CG   . LYS B 2 11  ? 1.609   -3.136  -6.603  1.00 10.00 ? 329 LYS B CG   3  
ATOM 7194   C CD   . LYS B 2 11  ? 0.965   -4.516  -6.570  1.00 10.00 ? 329 LYS B CD   3  
ATOM 7195   C CE   . LYS B 2 11  ? -0.048  -4.641  -5.440  1.00 10.00 ? 329 LYS B CE   3  
ATOM 7196   N NZ   . LYS B 2 11  ? 0.118   -5.914  -4.685  1.00 10.00 ? 329 LYS B NZ   3  
ATOM 7197   H H    . LYS B 2 11  ? 4.531   -1.619  -7.559  1.00 10.00 ? 329 LYS B H    3  
ATOM 7198   H HZ1  . LYS B 2 11  ? -0.787  -6.197  -4.237  1.00 10.00 ? 329 LYS B HZ1  3  
ATOM 7199   H HZ2  . LYS B 2 11  ? 0.835   -5.799  -3.942  1.00 10.00 ? 329 LYS B HZ2  3  
ATOM 7200   H HZ3  . LYS B 2 11  ? 0.420   -6.671  -5.325  1.00 10.00 ? 329 LYS B HZ3  3  
ATOM 7201   N N    . GLU B 2 12  ? 5.850   -1.644  -4.587  1.00 10.00 ? 330 GLU B N    3  
ATOM 7202   C CA   . GLU B 2 12  ? 6.769   -1.530  -3.465  1.00 10.00 ? 330 GLU B CA   3  
ATOM 7203   C C    . GLU B 2 12  ? 7.346   -0.121  -3.351  1.00 10.00 ? 330 GLU B C    3  
ATOM 7204   O O    . GLU B 2 12  ? 6.731   0.763   -2.757  1.00 10.00 ? 330 GLU B O    3  
ATOM 7205   C CB   . GLU B 2 12  ? 7.890   -2.569  -3.565  1.00 10.00 ? 330 GLU B CB   3  
ATOM 7206   C CG   . GLU B 2 12  ? 7.431   -4.004  -3.341  1.00 10.00 ? 330 GLU B CG   3  
ATOM 7207   C CD   . GLU B 2 12  ? 8.499   -5.025  -3.695  1.00 10.00 ? 330 GLU B CD   3  
ATOM 7208   O OE1  . GLU B 2 12  ? 9.659   -4.625  -3.920  1.00 10.00 ? 330 GLU B OE1  3  
ATOM 7209   O OE2  . GLU B 2 12  ? 8.181   -6.233  -3.765  1.00 10.00 ? 330 GLU B OE2  3  
ATOM 7210   H H    . GLU B 2 12  ? 6.201   -1.605  -5.502  1.00 10.00 ? 330 GLU B H    3  
ATOM 7211   N N    . ILE B 2 13  ? 8.519   0.083   -3.948  1.00 10.00 ? 331 ILE B N    3  
ATOM 7212   C CA   . ILE B 2 13  ? 9.206   1.375   -3.908  1.00 10.00 ? 331 ILE B CA   3  
ATOM 7213   C C    . ILE B 2 13  ? 8.317   2.526   -4.382  1.00 10.00 ? 331 ILE B C    3  
ATOM 7214   O O    . ILE B 2 13  ? 8.199   3.546   -3.703  1.00 10.00 ? 331 ILE B O    3  
ATOM 7215   C CB   . ILE B 2 13  ? 10.503  1.354   -4.746  1.00 10.00 ? 331 ILE B CB   3  
ATOM 7216   C CG1  . ILE B 2 13  ? 11.441  0.246   -4.257  1.00 10.00 ? 331 ILE B CG1  3  
ATOM 7217   C CG2  . ILE B 2 13  ? 11.200  2.710   -4.701  1.00 10.00 ? 331 ILE B CG2  3  
ATOM 7218   C CD1  . ILE B 2 13  ? 12.746  0.162   -5.018  1.00 10.00 ? 331 ILE B CD1  3  
ATOM 7219   H H    . ILE B 2 13  ? 8.945   -0.666  -4.418  1.00 10.00 ? 331 ILE B H    3  
ATOM 7220   N N    . ASP B 2 14  ? 7.694   2.350   -5.542  1.00 10.00 ? 332 ASP B N    3  
ATOM 7221   C CA   . ASP B 2 14  ? 6.830   3.382   -6.113  1.00 10.00 ? 332 ASP B CA   3  
ATOM 7222   C C    . ASP B 2 14  ? 5.683   3.739   -5.174  1.00 10.00 ? 332 ASP B C    3  
ATOM 7223   O O    . ASP B 2 14  ? 5.471   4.909   -4.853  1.00 10.00 ? 332 ASP B O    3  
ATOM 7224   C CB   . ASP B 2 14  ? 6.286   2.938   -7.473  1.00 10.00 ? 332 ASP B CB   3  
ATOM 7225   C CG   . ASP B 2 14  ? 5.657   4.079   -8.249  1.00 10.00 ? 332 ASP B CG   3  
ATOM 7226   O OD1  . ASP B 2 14  ? 4.445   4.329   -8.077  1.00 10.00 ? 332 ASP B OD1  3  
ATOM 7227   O OD2  . ASP B 2 14  ? 6.371   4.735   -9.034  1.00 10.00 ? 332 ASP B OD2  3  
ATOM 7228   H H    . ASP B 2 14  ? 7.817   1.509   -6.025  1.00 10.00 ? 332 ASP B H    3  
ATOM 7229   N N    . MET B 2 15  ? 4.970   2.721   -4.708  1.00 10.00 ? 333 MET B N    3  
ATOM 7230   C CA   . MET B 2 15  ? 3.833   2.919   -3.816  1.00 10.00 ? 333 MET B CA   3  
ATOM 7231   C C    . MET B 2 15  ? 4.232   3.555   -2.490  1.00 10.00 ? 333 MET B C    3  
ATOM 7232   O O    . MET B 2 15  ? 3.537   4.438   -1.989  1.00 10.00 ? 333 MET B O    3  
ATOM 7233   C CB   . MET B 2 15  ? 3.097   1.604   -3.567  1.00 10.00 ? 333 MET B CB   3  
ATOM 7234   C CG   . MET B 2 15  ? 2.085   1.255   -4.642  1.00 10.00 ? 333 MET B CG   3  
ATOM 7235   S SD   . MET B 2 15  ? 0.978   -0.078  -4.147  1.00 10.00 ? 333 MET B SD   3  
ATOM 7236   C CE   . MET B 2 15  ? -0.303  0.072   -5.387  1.00 10.00 ? 333 MET B CE   3  
ATOM 7237   H H    . MET B 2 15  ? 5.217   1.812   -4.969  1.00 10.00 ? 333 MET B H    3  
ATOM 7238   N N    . LEU B 2 16  ? 5.362   3.123   -1.941  1.00 10.00 ? 334 LEU B N    3  
ATOM 7239   C CA   . LEU B 2 16  ? 5.843   3.642   -0.663  1.00 10.00 ? 334 LEU B CA   3  
ATOM 7240   C C    . LEU B 2 16  ? 5.928   5.171   -0.685  1.00 10.00 ? 334 LEU B C    3  
ATOM 7241   O O    . LEU B 2 16  ? 5.543   5.837   0.275   1.00 10.00 ? 334 LEU B O    3  
ATOM 7242   C CB   . LEU B 2 16  ? 7.206   3.026   -0.324  1.00 10.00 ? 334 LEU B CB   3  
ATOM 7243   C CG   . LEU B 2 16  ? 7.519   2.827   1.162   1.00 10.00 ? 334 LEU B CG   3  
ATOM 7244   C CD1  . LEU B 2 16  ? 8.456   1.646   1.352   1.00 10.00 ? 334 LEU B CD1  3  
ATOM 7245   C CD2  . LEU B 2 16  ? 8.130   4.087   1.758   1.00 10.00 ? 334 LEU B CD2  3  
ATOM 7246   H H    . LEU B 2 16  ? 5.887   2.432   -2.405  1.00 10.00 ? 334 LEU B H    3  
ATOM 7247   N N    . LEU B 2 17  ? 6.452   5.717   -1.772  1.00 10.00 ? 335 LEU B N    3  
ATOM 7248   C CA   . LEU B 2 17  ? 6.572   7.162   -1.922  1.00 10.00 ? 335 LEU B CA   3  
ATOM 7249   C C    . LEU B 2 17  ? 5.253   7.835   -2.315  1.00 10.00 ? 335 LEU B C    3  
ATOM 7250   O O    . LEU B 2 17  ? 4.903   8.893   -1.790  1.00 10.00 ? 335 LEU B O    3  
ATOM 7251   C CB   . LEU B 2 17  ? 7.686   7.522   -2.898  1.00 10.00 ? 335 LEU B CB   3  
ATOM 7252   C CG   . LEU B 2 17  ? 9.100   7.439   -2.331  1.00 10.00 ? 335 LEU B CG   3  
ATOM 7253   C CD1  . LEU B 2 17  ? 10.132  7.620   -3.429  1.00 10.00 ? 335 LEU B CD1  3  
ATOM 7254   C CD2  . LEU B 2 17  ? 9.294   8.463   -1.225  1.00 10.00 ? 335 LEU B CD2  3  
ATOM 7255   H H    . LEU B 2 17  ? 6.762   5.132   -2.497  1.00 10.00 ? 335 LEU B H    3  
ATOM 7256   N N    . LYS B 2 18  ? 4.523   7.206   -3.232  1.00 10.00 ? 336 LYS B N    3  
ATOM 7257   C CA   . LYS B 2 18  ? 3.264   7.756   -3.729  1.00 10.00 ? 336 LYS B CA   3  
ATOM 7258   C C    . LYS B 2 18  ? 2.202   7.902   -2.639  1.00 10.00 ? 336 LYS B C    3  
ATOM 7259   O O    . LYS B 2 18  ? 1.522   8.930   -2.560  1.00 10.00 ? 336 LYS B O    3  
ATOM 7260   C CB   . LYS B 2 18  ? 2.721   6.916   -4.890  1.00 10.00 ? 336 LYS B CB   3  
ATOM 7261   C CG   . LYS B 2 18  ? 3.513   7.022   -6.185  1.00 10.00 ? 336 LYS B CG   3  
ATOM 7262   C CD   . LYS B 2 18  ? 2.762   7.831   -7.230  1.00 10.00 ? 336 LYS B CD   3  
ATOM 7263   C CE   . LYS B 2 18  ? 2.823   7.172   -8.602  1.00 10.00 ? 336 LYS B CE   3  
ATOM 7264   N NZ   . LYS B 2 18  ? 4.213   6.819   -9.002  1.00 10.00 ? 336 LYS B NZ   3  
ATOM 7265   H H    . LYS B 2 18  ? 4.835   6.342   -3.576  1.00 10.00 ? 336 LYS B H    3  
ATOM 7266   H HZ1  . LYS B 2 18  ? 4.514   5.939   -8.518  1.00 10.00 ? 336 LYS B HZ1  3  
ATOM 7267   H HZ2  . LYS B 2 18  ? 4.867   7.584   -8.748  1.00 10.00 ? 336 LYS B HZ2  3  
ATOM 7268   H HZ3  . LYS B 2 18  ? 4.260   6.664   -10.029 1.00 10.00 ? 336 LYS B HZ3  3  
ATOM 7269   N N    . GLU B 2 19  ? 2.065   6.886   -1.798  1.00 10.00 ? 337 GLU B N    3  
ATOM 7270   C CA   . GLU B 2 19  ? 1.075   6.920   -0.726  1.00 10.00 ? 337 GLU B CA   3  
ATOM 7271   C C    . GLU B 2 19  ? 1.484   7.900   0.362   1.00 10.00 ? 337 GLU B C    3  
ATOM 7272   O O    . GLU B 2 19  ? 0.641   8.544   0.987   1.00 10.00 ? 337 GLU B O    3  
ATOM 7273   C CB   . GLU B 2 19  ? 0.856   5.533   -0.131  1.00 10.00 ? 337 GLU B CB   3  
ATOM 7274   C CG   . GLU B 2 19  ? -0.531  5.347   0.458   1.00 10.00 ? 337 GLU B CG   3  
ATOM 7275   C CD   . GLU B 2 19  ? -0.649  4.091   1.287   1.00 10.00 ? 337 GLU B CD   3  
ATOM 7276   O OE1  . GLU B 2 19  ? -0.896  3.010   0.709   1.00 10.00 ? 337 GLU B OE1  3  
ATOM 7277   O OE2  . GLU B 2 19  ? -0.501  4.175   2.524   1.00 10.00 ? 337 GLU B OE2  3  
ATOM 7278   H H    . GLU B 2 19  ? 2.637   6.093   -1.899  1.00 10.00 ? 337 GLU B H    3  
ATOM 7279   N N    . TYR B 2 20  ? 2.780   8.037   0.564   1.00 10.00 ? 338 TYR B N    3  
ATOM 7280   C CA   . TYR B 2 20  ? 3.282   8.953   1.566   1.00 10.00 ? 338 TYR B CA   3  
ATOM 7281   C C    . TYR B 2 20  ? 3.012   10.385  1.120   1.00 10.00 ? 338 TYR B C    3  
ATOM 7282   O O    . TYR B 2 20  ? 2.781   11.276  1.940   1.00 10.00 ? 338 TYR B O    3  
ATOM 7283   C CB   . TYR B 2 20  ? 4.771   8.731   1.824   1.00 10.00 ? 338 TYR B CB   3  
ATOM 7284   C CG   . TYR B 2 20  ? 5.346   9.697   2.830   1.00 10.00 ? 338 TYR B CG   3  
ATOM 7285   C CD1  . TYR B 2 20  ? 5.142   9.517   4.193   1.00 10.00 ? 338 TYR B CD1  3  
ATOM 7286   C CD2  . TYR B 2 20  ? 6.076   10.800  2.414   1.00 10.00 ? 338 TYR B CD2  3  
ATOM 7287   C CE1  . TYR B 2 20  ? 5.650   10.412  5.112   1.00 10.00 ? 338 TYR B CE1  3  
ATOM 7288   C CE2  . TYR B 2 20  ? 6.589   11.695  3.324   1.00 10.00 ? 338 TYR B CE2  3  
ATOM 7289   C CZ   . TYR B 2 20  ? 6.372   11.500  4.671   1.00 10.00 ? 338 TYR B CZ   3  
ATOM 7290   O OH   . TYR B 2 20  ? 6.884   12.395  5.577   1.00 10.00 ? 338 TYR B OH   3  
ATOM 7291   H H    . TYR B 2 20  ? 3.400   7.548   -0.019  1.00 10.00 ? 338 TYR B H    3  
ATOM 7292   H HH   . TYR B 2 20  ? 7.164   13.197  5.109   1.00 10.00 ? 338 TYR B HH   3  
ATOM 7293   N N    . LEU B 2 21  ? 3.033   10.585  -0.189  1.00 10.00 ? 339 LEU B N    3  
ATOM 7294   C CA   . LEU B 2 21  ? 2.796   11.891  -0.773  1.00 10.00 ? 339 LEU B CA   3  
ATOM 7295   C C    . LEU B 2 21  ? 1.325   12.289  -0.677  1.00 10.00 ? 339 LEU B C    3  
ATOM 7296   O O    . LEU B 2 21  ? 1.006   13.406  -0.268  1.00 10.00 ? 339 LEU B O    3  
ATOM 7297   C CB   . LEU B 2 21  ? 3.251   11.903  -2.237  1.00 10.00 ? 339 LEU B CB   3  
ATOM 7298   C CG   . LEU B 2 21  ? 3.062   13.218  -2.998  1.00 10.00 ? 339 LEU B CG   3  
ATOM 7299   C CD1  . LEU B 2 21  ? 3.998   14.290  -2.462  1.00 10.00 ? 339 LEU B CD1  3  
ATOM 7300   C CD2  . LEU B 2 21  ? 3.277   13.007  -4.488  1.00 10.00 ? 339 LEU B CD2  3  
ATOM 7301   H H    . LEU B 2 21  ? 3.217   9.824   -0.783  1.00 10.00 ? 339 LEU B H    3  
ATOM 7302   N N    . LEU B 2 22  ? 0.425   11.382  -1.047  1.00 10.00 ? 340 LEU B N    3  
ATOM 7303   C CA   . LEU B 2 22  ? -1.002  11.677  -1.014  1.00 10.00 ? 340 LEU B CA   3  
ATOM 7304   C C    . LEU B 2 22  ? -1.631  11.485  0.372   1.00 10.00 ? 340 LEU B C    3  
ATOM 7305   O O    . LEU B 2 22  ? -2.193  12.428  0.929   1.00 10.00 ? 340 LEU B O    3  
ATOM 7306   C CB   . LEU B 2 22  ? -1.755  10.890  -2.091  1.00 10.00 ? 340 LEU B CB   3  
ATOM 7307   C CG   . LEU B 2 22  ? -1.339  11.165  -3.544  1.00 10.00 ? 340 LEU B CG   3  
ATOM 7308   C CD1  . LEU B 2 22  ? -2.127  10.299  -4.520  1.00 10.00 ? 340 LEU B CD1  3  
ATOM 7309   C CD2  . LEU B 2 22  ? -1.502  12.639  -3.884  1.00 10.00 ? 340 LEU B CD2  3  
ATOM 7310   H H    . LEU B 2 22  ? 0.725   10.499  -1.359  1.00 10.00 ? 340 LEU B H    3  
ATOM 7311   N N    . SER B 2 23  ? -1.548  10.274  0.922   1.00 10.00 ? 341 SER B N    3  
ATOM 7312   C CA   . SER B 2 23  ? -2.121  9.992   2.240   1.00 10.00 ? 341 SER B CA   3  
ATOM 7313   C C    . SER B 2 23  ? -1.452  10.833  3.322   1.00 10.00 ? 341 SER B C    3  
ATOM 7314   O O    . SER B 2 23  ? -2.117  11.575  4.051   1.00 10.00 ? 341 SER B O    3  
ATOM 7315   C CB   . SER B 2 23  ? -2.005  8.504   2.578   1.00 10.00 ? 341 SER B CB   3  
ATOM 7316   O OG   . SER B 2 23  ? -2.533  7.709   1.534   1.00 10.00 ? 341 SER B OG   3  
ATOM 7317   H H    . SER B 2 23  ? -1.094  9.553   0.436   1.00 10.00 ? 341 SER B H    3  
ATOM 7318   H HG   . SER B 2 23  ? -3.414  7.395   1.778   1.00 10.00 ? 341 SER B HG   3  
ATOM 7319   N N    . GLY B 2 24  ? -0.132  10.714  3.419   1.00 10.00 ? 342 GLY B N    3  
ATOM 7320   C CA   . GLY B 2 24  ? 0.612   11.476  4.400   1.00 10.00 ? 342 GLY B CA   3  
ATOM 7321   C C    . GLY B 2 24  ? 0.788   10.752  5.722   1.00 10.00 ? 342 GLY B C    3  
ATOM 7322   O O    . GLY B 2 24  ? 0.556   11.332  6.783   1.00 10.00 ? 342 GLY B O    3  
ATOM 7323   H H    . GLY B 2 24  ? 0.338   10.103  2.812   1.00 10.00 ? 342 GLY B H    3  
ATOM 7324   N N    . ASP B 2 25  ? 1.205   9.492   5.666   1.00 10.00 ? 343 ASP B N    3  
ATOM 7325   C CA   . ASP B 2 25  ? 1.421   8.710   6.881   1.00 10.00 ? 343 ASP B CA   3  
ATOM 7326   C C    . ASP B 2 25  ? 2.857   8.207   6.968   1.00 10.00 ? 343 ASP B C    3  
ATOM 7327   O O    . ASP B 2 25  ? 3.344   7.512   6.078   1.00 10.00 ? 343 ASP B O    3  
ATOM 7328   C CB   . ASP B 2 25  ? 0.440   7.542   6.993   1.00 10.00 ? 343 ASP B CB   3  
ATOM 7329   C CG   . ASP B 2 25  ? 0.445   6.915   8.377   1.00 10.00 ? 343 ASP B CG   3  
ATOM 7330   O OD1  . ASP B 2 25  ? 1.508   6.427   8.813   1.00 10.00 ? 343 ASP B OD1  3  
ATOM 7331   O OD2  . ASP B 2 25  ? -0.612  6.918   9.040   1.00 10.00 ? 343 ASP B OD2  3  
ATOM 7332   H H    . ASP B 2 25  ? 1.372   9.079   4.794   1.00 10.00 ? 343 ASP B H    3  
ATOM 7333   N N    . ILE B 2 26  ? 3.529   8.606   8.036   1.00 10.00 ? 344 ILE B N    3  
ATOM 7334   C CA   . ILE B 2 26  ? 4.913   8.203   8.278   1.00 10.00 ? 344 ILE B CA   3  
ATOM 7335   C C    . ILE B 2 26  ? 5.011   6.719   8.650   1.00 10.00 ? 344 ILE B C    3  
ATOM 7336   O O    . ILE B 2 26  ? 5.661   5.938   7.953   1.00 10.00 ? 344 ILE B O    3  
ATOM 7337   C CB   . ILE B 2 26  ? 5.583   9.056   9.382   1.00 10.00 ? 344 ILE B CB   3  
ATOM 7338   C CG1  . ILE B 2 26  ? 5.278   10.543  9.181   1.00 10.00 ? 344 ILE B CG1  3  
ATOM 7339   C CG2  . ILE B 2 26  ? 7.089   8.827   9.391   1.00 10.00 ? 344 ILE B CG2  3  
ATOM 7340   C CD1  . ILE B 2 26  ? 4.228   11.087  10.125  1.00 10.00 ? 344 ILE B CD1  3  
ATOM 7341   H H    . ILE B 2 26  ? 3.072   9.181   8.679   1.00 10.00 ? 344 ILE B H    3  
ATOM 7342   N N    . SER B 2 27  ? 4.365   6.356   9.754   1.00 10.00 ? 345 SER B N    3  
ATOM 7343   C CA   . SER B 2 27  ? 4.352   4.984   10.272  1.00 10.00 ? 345 SER B CA   3  
ATOM 7344   C C    . SER B 2 27  ? 4.028   3.909   9.230   1.00 10.00 ? 345 SER B C    3  
ATOM 7345   O O    . SER B 2 27  ? 4.535   2.789   9.312   1.00 10.00 ? 345 SER B O    3  
ATOM 7346   C CB   . SER B 2 27  ? 3.411   4.887   11.467  1.00 10.00 ? 345 SER B CB   3  
ATOM 7347   O OG   . SER B 2 27  ? 3.659   5.949   12.374  1.00 10.00 ? 345 SER B OG   3  
ATOM 7348   H H    . SER B 2 27  ? 3.911   7.048   10.279  1.00 10.00 ? 345 SER B H    3  
ATOM 7349   H HG   . SER B 2 27  ? 4.606   6.136   12.394  1.00 10.00 ? 345 SER B HG   3  
ATOM 7350   N N    . GLU B 2 28  ? 3.196   4.241   8.245   1.00 10.00 ? 346 GLU B N    3  
ATOM 7351   C CA   . GLU B 2 28  ? 2.840   3.269   7.221   1.00 10.00 ? 346 GLU B CA   3  
ATOM 7352   C C    . GLU B 2 28  ? 4.038   3.016   6.315   1.00 10.00 ? 346 GLU B C    3  
ATOM 7353   O O    . GLU B 2 28  ? 4.334   1.876   5.948   1.00 10.00 ? 346 GLU B O    3  
ATOM 7354   C CB   . GLU B 2 28  ? 1.626   3.707   6.406   1.00 10.00 ? 346 GLU B CB   3  
ATOM 7355   C CG   . GLU B 2 28  ? 0.538   2.645   6.310   1.00 10.00 ? 346 GLU B CG   3  
ATOM 7356   C CD   . GLU B 2 28  ? 1.073   1.258   5.985   1.00 10.00 ? 346 GLU B CD   3  
ATOM 7357   O OE1  . GLU B 2 28  ? 1.531   0.554   6.907   1.00 10.00 ? 346 GLU B OE1  3  
ATOM 7358   O OE2  . GLU B 2 28  ? 1.021   0.857   4.806   1.00 10.00 ? 346 GLU B OE2  3  
ATOM 7359   H H    . GLU B 2 28  ? 2.890   5.175   8.188   1.00 10.00 ? 346 GLU B H    3  
ATOM 7360   N N    . ALA B 2 29  ? 4.746   4.090   5.985   1.00 10.00 ? 347 ALA B N    3  
ATOM 7361   C CA   . ALA B 2 29  ? 5.931   3.992   5.149   1.00 10.00 ? 347 ALA B CA   3  
ATOM 7362   C C    . ALA B 2 29  ? 7.003   3.194   5.880   1.00 10.00 ? 347 ALA B C    3  
ATOM 7363   O O    . ALA B 2 29  ? 7.680   2.349   5.290   1.00 10.00 ? 347 ALA B O    3  
ATOM 7364   C CB   . ALA B 2 29  ? 6.448   5.382   4.801   1.00 10.00 ? 347 ALA B CB   3  
ATOM 7365   H H    . ALA B 2 29  ? 4.466   4.970   6.318   1.00 10.00 ? 347 ALA B H    3  
ATOM 7366   N N    . GLU B 2 30  ? 7.127   3.459   7.178   1.00 10.00 ? 348 GLU B N    3  
ATOM 7367   C CA   . GLU B 2 30  ? 8.094   2.770   8.022   1.00 10.00 ? 348 GLU B CA   3  
ATOM 7368   C C    . GLU B 2 30  ? 7.839   1.267   8.026   1.00 10.00 ? 348 GLU B C    3  
ATOM 7369   O O    . GLU B 2 30  ? 8.773   0.469   7.973   1.00 10.00 ? 348 GLU B O    3  
ATOM 7370   C CB   . GLU B 2 30  ? 8.026   3.300   9.455   1.00 10.00 ? 348 GLU B CB   3  
ATOM 7371   C CG   . GLU B 2 30  ? 8.289   4.790   9.599   1.00 10.00 ? 348 GLU B CG   3  
ATOM 7372   C CD   . GLU B 2 30  ? 8.231   5.245   11.046  1.00 10.00 ? 348 GLU B CD   3  
ATOM 7373   O OE1  . GLU B 2 30  ? 7.116   5.355   11.601  1.00 10.00 ? 348 GLU B OE1  3  
ATOM 7374   O OE2  . GLU B 2 30  ? 9.302   5.477   11.643  1.00 10.00 ? 348 GLU B OE2  3  
ATOM 7375   H H    . GLU B 2 30  ? 6.554   4.153   7.578   1.00 10.00 ? 348 GLU B H    3  
ATOM 7376   N N    . HIS B 2 31  ? 6.568   0.884   8.069   1.00 10.00 ? 349 HIS B N    3  
ATOM 7377   C CA   . HIS B 2 31  ? 6.197   -0.524  8.089   1.00 10.00 ? 349 HIS B CA   3  
ATOM 7378   C C    . HIS B 2 31  ? 6.527   -1.209  6.770   1.00 10.00 ? 349 HIS B C    3  
ATOM 7379   O O    . HIS B 2 31  ? 7.021   -2.332  6.760   1.00 10.00 ? 349 HIS B O    3  
ATOM 7380   C CB   . HIS B 2 31  ? 4.712   -0.704  8.407   1.00 10.00 ? 349 HIS B CB   3  
ATOM 7381   C CG   . HIS B 2 31  ? 4.375   -2.059  8.955   1.00 10.00 ? 349 HIS B CG   3  
ATOM 7382   N ND1  . HIS B 2 31  ? 4.445   -3.222  8.211   1.00 10.00 ? 349 HIS B ND1  3  
ATOM 7383   C CD2  . HIS B 2 31  ? 3.979   -2.435  10.193  1.00 10.00 ? 349 HIS B CD2  3  
ATOM 7384   C CE1  . HIS B 2 31  ? 4.109   -4.248  8.971   1.00 10.00 ? 349 HIS B CE1  3  
ATOM 7385   N NE2  . HIS B 2 31  ? 3.822   -3.799  10.178  1.00 10.00 ? 349 HIS B NE2  3  
ATOM 7386   H H    . HIS B 2 31  ? 5.863   1.569   8.089   1.00 10.00 ? 349 HIS B H    3  
ATOM 7387   H HD1  . HIS B 2 31  ? 4.698   -3.286  7.250   1.00 10.00 ? 349 HIS B HD1  3  
ATOM 7388   H HE2  . HIS B 2 31  ? 3.678   -4.363  10.970  1.00 10.00 ? 349 HIS B HE2  3  
ATOM 7389   N N    . CYS B 2 32  ? 6.287   -0.512  5.667   1.00 10.00 ? 350 CYS B N    3  
ATOM 7390   C CA   . CYS B 2 32  ? 6.539   -1.072  4.346   1.00 10.00 ? 350 CYS B CA   3  
ATOM 7391   C C    . CYS B 2 32  ? 8.038   -1.229  4.096   1.00 10.00 ? 350 CYS B C    3  
ATOM 7392   O O    . CYS B 2 32  ? 8.485   -2.222  3.511   1.00 10.00 ? 350 CYS B O    3  
ATOM 7393   C CB   . CYS B 2 32  ? 5.901   -0.195  3.266   1.00 10.00 ? 350 CYS B CB   3  
ATOM 7394   S SG   . CYS B 2 32  ? 4.125   0.085   3.480   1.00 10.00 ? 350 CYS B SG   3  
ATOM 7395   H H    . CYS B 2 32  ? 5.998   0.423   5.749   1.00 10.00 ? 350 CYS B H    3  
ATOM 7396   H HG   . CYS B 2 32  ? 3.958   0.932   4.490   1.00 10.00 ? 350 CYS B HG   3  
ATOM 7397   N N    . LEU B 2 33  ? 8.812   -0.257  4.568   1.00 10.00 ? 351 LEU B N    3  
ATOM 7398   C CA   . LEU B 2 33  ? 10.263  -0.281  4.402   1.00 10.00 ? 351 LEU B CA   3  
ATOM 7399   C C    . LEU B 2 33  ? 10.873  -1.395  5.259   1.00 10.00 ? 351 LEU B C    3  
ATOM 7400   O O    . LEU B 2 33  ? 11.913  -1.963  4.913   1.00 10.00 ? 351 LEU B O    3  
ATOM 7401   C CB   . LEU B 2 33  ? 10.867  1.075   4.782   1.00 10.00 ? 351 LEU B CB   3  
ATOM 7402   C CG   . LEU B 2 33  ? 12.221  1.399   4.147   1.00 10.00 ? 351 LEU B CG   3  
ATOM 7403   C CD1  . LEU B 2 33  ? 12.099  1.458   2.633   1.00 10.00 ? 351 LEU B CD1  3  
ATOM 7404   C CD2  . LEU B 2 33  ? 12.774  2.709   4.694   1.00 10.00 ? 351 LEU B CD2  3  
ATOM 7405   H H    . LEU B 2 33  ? 8.395   0.500   5.033   1.00 10.00 ? 351 LEU B H    3  
ATOM 7406   N N    . LYS B 2 34  ? 10.222  -1.656  6.385   1.00 10.00 ? 352 LYS B N    3  
ATOM 7407   C CA   . LYS B 2 34  ? 10.620  -2.698  7.336   1.00 10.00 ? 352 LYS B CA   3  
ATOM 7408   C C    . LYS B 2 34  ? 10.303  -4.127  6.845   1.00 10.00 ? 352 LYS B C    3  
ATOM 7409   O O    . LYS B 2 34  ? 10.864  -5.109  7.321   1.00 10.00 ? 352 LYS B O    3  
ATOM 7410   C CB   . LYS B 2 34  ? 10.180  -2.380  8.771   1.00 10.00 ? 352 LYS B CB   3  
ATOM 7411   C CG   . LYS B 2 34  ? 11.118  -1.353  9.403   1.00 10.00 ? 352 LYS B CG   3  
ATOM 7412   C CD   . LYS B 2 34  ? 10.656  -0.865  10.762  1.00 10.00 ? 352 LYS B CD   3  
ATOM 7413   C CE   . LYS B 2 34  ? 11.765  -0.076  11.446  1.00 10.00 ? 352 LYS B CE   3  
ATOM 7414   N NZ   . LYS B 2 34  ? 12.824  -0.964  11.993  1.00 10.00 ? 352 LYS B NZ   3  
ATOM 7415   H H    . LYS B 2 34  ? 9.429   -1.109  6.596   1.00 10.00 ? 352 LYS B H    3  
ATOM 7416   H HZ1  . LYS B 2 34  ? 13.691  -0.420  12.183  1.00 10.00 ? 352 LYS B HZ1  3  
ATOM 7417   H HZ2  . LYS B 2 34  ? 13.045  -1.721  11.315  1.00 10.00 ? 352 LYS B HZ2  3  
ATOM 7418   H HZ3  . LYS B 2 34  ? 12.502  -1.397  12.878  1.00 10.00 ? 352 LYS B HZ3  3  
ATOM 7419   N N    . GLU B 2 35  ? 9.397   -4.194  5.880   1.00 10.00 ? 353 GLU B N    3  
ATOM 7420   C CA   . GLU B 2 35  ? 8.970   -5.470  5.298   1.00 10.00 ? 353 GLU B CA   3  
ATOM 7421   C C    . GLU B 2 35  ? 9.950   -6.017  4.244   1.00 10.00 ? 353 GLU B C    3  
ATOM 7422   O O    . GLU B 2 35  ? 10.122  -7.234  4.109   1.00 10.00 ? 353 GLU B O    3  
ATOM 7423   C CB   . GLU B 2 35  ? 7.523   -5.428  4.818   1.00 10.00 ? 353 GLU B CB   3  
ATOM 7424   C CG   . GLU B 2 35  ? 6.568   -5.351  6.001   1.00 10.00 ? 353 GLU B CG   3  
ATOM 7425   C CD   . GLU B 2 35  ? 5.137   -5.084  5.625   1.00 10.00 ? 353 GLU B CD   3  
ATOM 7426   O OE1  . GLU B 2 35  ? 4.395   -6.056  5.394   1.00 10.00 ? 353 GLU B OE1  3  
ATOM 7427   O OE2  . GLU B 2 35  ? 4.731   -3.905  5.614   1.00 10.00 ? 353 GLU B OE2  3  
ATOM 7428   H H    . GLU B 2 35  ? 9.183   -3.341  5.462   1.00 10.00 ? 353 GLU B H    3  
ATOM 7429   N N    . LEU B 2 36  ? 10.575  -5.110  3.486   1.00 10.00 ? 354 LEU B N    3  
ATOM 7430   C CA   . LEU B 2 36  ? 11.555  -5.487  2.467   1.00 10.00 ? 354 LEU B CA   3  
ATOM 7431   C C    . LEU B 2 36  ? 12.893  -5.872  3.106   1.00 10.00 ? 354 LEU B C    3  
ATOM 7432   O O    . LEU B 2 36  ? 13.402  -5.178  3.980   1.00 10.00 ? 354 LEU B O    3  
ATOM 7433   C CB   . LEU B 2 36  ? 11.753  -4.369  1.434   1.00 10.00 ? 354 LEU B CB   3  
ATOM 7434   C CG   . LEU B 2 36  ? 10.862  -4.395  0.181   1.00 10.00 ? 354 LEU B CG   3  
ATOM 7435   C CD1  . LEU B 2 36  ? 11.000  -5.710  -0.575  1.00 10.00 ? 354 LEU B CD1  3  
ATOM 7436   C CD2  . LEU B 2 36  ? 9.406   -4.105  0.524   1.00 10.00 ? 354 LEU B CD2  3  
ATOM 7437   H H    . LEU B 2 36  ? 10.375  -4.162  3.626   1.00 10.00 ? 354 LEU B H    3  
ATOM 7438   N N    . GLU B 2 37  ? 13.452  -6.970  2.630   1.00 10.00 ? 355 GLU B N    3  
ATOM 7439   C CA   . GLU B 2 37  ? 14.707  -7.523  3.146   1.00 10.00 ? 355 GLU B CA   3  
ATOM 7440   C C    . GLU B 2 37  ? 15.956  -7.036  2.412   1.00 10.00 ? 355 GLU B C    3  
ATOM 7441   O O    . GLU B 2 37  ? 16.994  -7.694  2.441   1.00 10.00 ? 355 GLU B O    3  
ATOM 7442   C CB   . GLU B 2 37  ? 14.626  -9.043  3.189   1.00 10.00 ? 355 GLU B CB   3  
ATOM 7443   C CG   . GLU B 2 37  ? 13.544  -9.538  4.138   1.00 10.00 ? 355 GLU B CG   3  
ATOM 7444   C CD   . GLU B 2 37  ? 13.123  -10.955 3.853   1.00 10.00 ? 355 GLU B CD   3  
ATOM 7445   O OE1  . GLU B 2 37  ? 12.321  -11.166 2.926   1.00 10.00 ? 355 GLU B OE1  3  
ATOM 7446   O OE2  . GLU B 2 37  ? 13.599  -11.865 4.552   1.00 10.00 ? 355 GLU B OE2  3  
ATOM 7447   H H    . GLU B 2 37  ? 12.997  -7.448  1.901   1.00 10.00 ? 355 GLU B H    3  
ATOM 7448   N N    . VAL B 2 38  ? 15.847  -5.928  1.705   1.00 10.00 ? 356 VAL B N    3  
ATOM 7449   C CA   . VAL B 2 38  ? 16.972  -5.406  0.938   1.00 10.00 ? 356 VAL B CA   3  
ATOM 7450   C C    . VAL B 2 38  ? 17.454  -4.018  1.401   1.00 10.00 ? 356 VAL B C    3  
ATOM 7451   O O    . VAL B 2 38  ? 17.018  -2.994  0.874   1.00 10.00 ? 356 VAL B O    3  
ATOM 7452   C CB   . VAL B 2 38  ? 16.638  -5.372  -0.563  1.00 10.00 ? 356 VAL B CB   3  
ATOM 7453   C CG1  . VAL B 2 38  ? 16.805  -6.760  -1.162  1.00 10.00 ? 356 VAL B CG1  3  
ATOM 7454   C CG2  . VAL B 2 38  ? 15.210  -4.879  -0.775  1.00 10.00 ? 356 VAL B CG2  3  
ATOM 7455   H H    . VAL B 2 38  ? 15.005  -5.433  1.729   1.00 10.00 ? 356 VAL B H    3  
ATOM 7456   N N    . PRO B 2 39  ? 18.365  -3.967  2.392   1.00 10.00 ? 357 PRO B N    3  
ATOM 7457   C CA   . PRO B 2 39  ? 18.914  -2.703  2.909   1.00 10.00 ? 357 PRO B CA   3  
ATOM 7458   C C    . PRO B 2 39  ? 19.712  -1.929  1.854   1.00 10.00 ? 357 PRO B C    3  
ATOM 7459   O O    . PRO B 2 39  ? 19.561  -0.713  1.721   1.00 10.00 ? 357 PRO B O    3  
ATOM 7460   C CB   . PRO B 2 39  ? 19.838  -3.139  4.053   1.00 10.00 ? 357 PRO B CB   3  
ATOM 7461   C CG   . PRO B 2 39  ? 19.380  -4.512  4.403   1.00 10.00 ? 357 PRO B CG   3  
ATOM 7462   C CD   . PRO B 2 39  ? 18.908  -5.127  3.116   1.00 10.00 ? 357 PRO B CD   3  
ATOM 7463   N N    . HIS B 2 40  ? 20.539  -2.635  1.088   1.00 10.00 ? 358 HIS B N    3  
ATOM 7464   C CA   . HIS B 2 40  ? 21.364  -2.002  0.057   1.00 10.00 ? 358 HIS B CA   3  
ATOM 7465   C C    . HIS B 2 40  ? 20.531  -1.471  -1.114  1.00 10.00 ? 358 HIS B C    3  
ATOM 7466   O O    . HIS B 2 40  ? 21.004  -0.642  -1.896  1.00 10.00 ? 358 HIS B O    3  
ATOM 7467   C CB   . HIS B 2 40  ? 22.445  -2.967  -0.445  1.00 10.00 ? 358 HIS B CB   3  
ATOM 7468   C CG   . HIS B 2 40  ? 23.572  -2.298  -1.174  1.00 10.00 ? 358 HIS B CG   3  
ATOM 7469   N ND1  . HIS B 2 40  ? 24.437  -1.414  -0.569  1.00 10.00 ? 358 HIS B ND1  3  
ATOM 7470   C CD2  . HIS B 2 40  ? 23.972  -2.384  -2.465  1.00 10.00 ? 358 HIS B CD2  3  
ATOM 7471   C CE1  . HIS B 2 40  ? 25.317  -0.985  -1.451  1.00 10.00 ? 358 HIS B CE1  3  
ATOM 7472   N NE2  . HIS B 2 40  ? 25.059  -1.556  -2.610  1.00 10.00 ? 358 HIS B NE2  3  
ATOM 7473   H H    . HIS B 2 40  ? 20.607  -3.608  1.226   1.00 10.00 ? 358 HIS B H    3  
ATOM 7474   H HD1  . HIS B 2 40  ? 24.413  -1.145  0.376   1.00 10.00 ? 358 HIS B HD1  3  
ATOM 7475   H HE2  . HIS B 2 40  ? 25.640  -1.514  -3.400  1.00 10.00 ? 358 HIS B HE2  3  
ATOM 7476   N N    . PHE B 2 41  ? 19.297  -1.940  -1.226  1.00 10.00 ? 359 PHE B N    3  
ATOM 7477   C CA   . PHE B 2 41  ? 18.412  -1.508  -2.306  1.00 10.00 ? 359 PHE B CA   3  
ATOM 7478   C C    . PHE B 2 41  ? 17.464  -0.406  -1.838  1.00 10.00 ? 359 PHE B C    3  
ATOM 7479   O O    . PHE B 2 41  ? 16.712  0.160   -2.631  1.00 10.00 ? 359 PHE B O    3  
ATOM 7480   C CB   . PHE B 2 41  ? 17.614  -2.697  -2.852  1.00 10.00 ? 359 PHE B CB   3  
ATOM 7481   C CG   . PHE B 2 41  ? 17.366  -2.635  -4.334  1.00 10.00 ? 359 PHE B CG   3  
ATOM 7482   C CD1  . PHE B 2 41  ? 18.326  -3.082  -5.224  1.00 10.00 ? 359 PHE B CD1  3  
ATOM 7483   C CD2  . PHE B 2 41  ? 16.178  -2.125  -4.838  1.00 10.00 ? 359 PHE B CD2  3  
ATOM 7484   C CE1  . PHE B 2 41  ? 18.109  -3.029  -6.586  1.00 10.00 ? 359 PHE B CE1  3  
ATOM 7485   C CE2  . PHE B 2 41  ? 15.954  -2.069  -6.200  1.00 10.00 ? 359 PHE B CE2  3  
ATOM 7486   C CZ   . PHE B 2 41  ? 16.923  -2.519  -7.076  1.00 10.00 ? 359 PHE B CZ   3  
ATOM 7487   H H    . PHE B 2 41  ? 18.971  -2.592  -0.569  1.00 10.00 ? 359 PHE B H    3  
ATOM 7488   N N    . HIS B 2 42  ? 17.533  -0.075  -0.551  1.00 10.00 ? 360 HIS B N    3  
ATOM 7489   C CA   . HIS B 2 42  ? 16.666  0.950   0.039   1.00 10.00 ? 360 HIS B CA   3  
ATOM 7490   C C    . HIS B 2 42  ? 16.975  2.353   -0.489  1.00 10.00 ? 360 HIS B C    3  
ATOM 7491   O O    . HIS B 2 42  ? 16.257  3.309   -0.192  1.00 10.00 ? 360 HIS B O    3  
ATOM 7492   C CB   . HIS B 2 42  ? 16.782  0.938   1.568   1.00 10.00 ? 360 HIS B CB   3  
ATOM 7493   C CG   . HIS B 2 42  ? 15.928  -0.090  2.249   1.00 10.00 ? 360 HIS B CG   3  
ATOM 7494   N ND1  . HIS B 2 42  ? 16.234  -0.622  3.484   1.00 10.00 ? 360 HIS B ND1  3  
ATOM 7495   C CD2  . HIS B 2 42  ? 14.758  -0.662  1.880   1.00 10.00 ? 360 HIS B CD2  3  
ATOM 7496   C CE1  . HIS B 2 42  ? 15.291  -1.472  3.842   1.00 10.00 ? 360 HIS B CE1  3  
ATOM 7497   N NE2  . HIS B 2 42  ? 14.380  -1.517  2.890   1.00 10.00 ? 360 HIS B NE2  3  
ATOM 7498   H H    . HIS B 2 42  ? 18.190  -0.530  0.019   1.00 10.00 ? 360 HIS B H    3  
ATOM 7499   H HD1  . HIS B 2 42  ? 17.027  -0.407  4.023   1.00 10.00 ? 360 HIS B HD1  3  
ATOM 7500   H HE2  . HIS B 2 42  ? 13.474  -1.874  3.014   1.00 10.00 ? 360 HIS B HE2  3  
ATOM 7501   N N    . HIS B 2 43  ? 18.032  2.465   -1.278  1.00 10.00 ? 361 HIS B N    3  
ATOM 7502   C CA   . HIS B 2 43  ? 18.437  3.751   -1.834  1.00 10.00 ? 361 HIS B CA   3  
ATOM 7503   C C    . HIS B 2 43  ? 17.572  4.216   -3.009  1.00 10.00 ? 361 HIS B C    3  
ATOM 7504   O O    . HIS B 2 43  ? 17.459  5.414   -3.256  1.00 10.00 ? 361 HIS B O    3  
ATOM 7505   C CB   . HIS B 2 43  ? 19.939  3.807   -2.149  1.00 10.00 ? 361 HIS B CB   3  
ATOM 7506   C CG   . HIS B 2 43  ? 20.312  3.595   -3.581  1.00 10.00 ? 361 HIS B CG   3  
ATOM 7507   N ND1  . HIS B 2 43  ? 20.675  4.623   -4.424  1.00 10.00 ? 361 HIS B ND1  3  
ATOM 7508   C CD2  . HIS B 2 43  ? 20.404  2.461   -4.311  1.00 10.00 ? 361 HIS B CD2  3  
ATOM 7509   C CE1  . HIS B 2 43  ? 20.976  4.124   -5.607  1.00 10.00 ? 361 HIS B CE1  3  
ATOM 7510   N NE2  . HIS B 2 43  ? 20.820  2.813   -5.568  1.00 10.00 ? 361 HIS B NE2  3  
ATOM 7511   H H    . HIS B 2 43  ? 18.509  1.651   -1.538  1.00 10.00 ? 361 HIS B H    3  
ATOM 7512   H HD1  . HIS B 2 43  ? 20.693  5.579   -4.194  1.00 10.00 ? 361 HIS B HD1  3  
ATOM 7513   H HE2  . HIS B 2 43  ? 20.738  2.238   -6.365  1.00 10.00 ? 361 HIS B HE2  3  
ATOM 7514   N N    . GLU B 2 44  ? 16.979  3.265   -3.745  1.00 10.00 ? 362 GLU B N    3  
ATOM 7515   C CA   . GLU B 2 44  ? 16.135  3.604   -4.898  1.00 10.00 ? 362 GLU B CA   3  
ATOM 7516   C C    . GLU B 2 44  ? 14.983  4.517   -4.489  1.00 10.00 ? 362 GLU B C    3  
ATOM 7517   O O    . GLU B 2 44  ? 14.588  5.413   -5.239  1.00 10.00 ? 362 GLU B O    3  
ATOM 7518   C CB   . GLU B 2 44  ? 15.605  2.345   -5.587  1.00 10.00 ? 362 GLU B CB   3  
ATOM 7519   C CG   . GLU B 2 44  ? 16.613  1.666   -6.500  1.00 10.00 ? 362 GLU B CG   3  
ATOM 7520   C CD   . GLU B 2 44  ? 17.358  2.649   -7.383  1.00 10.00 ? 362 GLU B CD   3  
ATOM 7521   O OE1  . GLU B 2 44  ? 16.750  3.217   -8.311  1.00 10.00 ? 362 GLU B OE1  3  
ATOM 7522   O OE2  . GLU B 2 44  ? 18.564  2.859   -7.148  1.00 10.00 ? 362 GLU B OE2  3  
ATOM 7523   H H    . GLU B 2 44  ? 17.103  2.323   -3.506  1.00 10.00 ? 362 GLU B H    3  
ATOM 7524   N N    . LEU B 2 45  ? 14.455  4.280   -3.295  1.00 10.00 ? 363 LEU B N    3  
ATOM 7525   C CA   . LEU B 2 45  ? 13.367  5.084   -2.759  1.00 10.00 ? 363 LEU B CA   3  
ATOM 7526   C C    . LEU B 2 45  ? 13.883  6.497   -2.524  1.00 10.00 ? 363 LEU B C    3  
ATOM 7527   O O    . LEU B 2 45  ? 13.332  7.470   -3.036  1.00 10.00 ? 363 LEU B O    3  
ATOM 7528   C CB   . LEU B 2 45  ? 12.915  4.488   -1.422  1.00 10.00 ? 363 LEU B CB   3  
ATOM 7529   C CG   . LEU B 2 45  ? 11.699  5.136   -0.764  1.00 10.00 ? 363 LEU B CG   3  
ATOM 7530   C CD1  . LEU B 2 45  ? 10.421  4.469   -1.241  1.00 10.00 ? 363 LEU B CD1  3  
ATOM 7531   C CD2  . LEU B 2 45  ? 11.812  5.075   0.751   1.00 10.00 ? 363 LEU B CD2  3  
ATOM 7532   H H    . LEU B 2 45  ? 14.812  3.542   -2.759  1.00 10.00 ? 363 LEU B H    3  
ATOM 7533   N N    . VAL B 2 46  ? 14.950  6.564   -1.734  1.00 10.00 ? 364 VAL B N    3  
ATOM 7534   C CA   . VAL B 2 46  ? 15.610  7.826   -1.412  1.00 10.00 ? 364 VAL B CA   3  
ATOM 7535   C C    . VAL B 2 46  ? 15.826  8.664   -2.675  1.00 10.00 ? 364 VAL B C    3  
ATOM 7536   O O    . VAL B 2 46  ? 15.473  9.841   -2.708  1.00 10.00 ? 364 VAL B O    3  
ATOM 7537   C CB   . VAL B 2 46  ? 16.972  7.580   -0.725  1.00 10.00 ? 364 VAL B CB   3  
ATOM 7538   C CG1  . VAL B 2 46  ? 17.674  8.896   -0.421  1.00 10.00 ? 364 VAL B CG1  3  
ATOM 7539   C CG2  . VAL B 2 46  ? 16.795  6.762   0.547   1.00 10.00 ? 364 VAL B CG2  3  
ATOM 7540   H H    . VAL B 2 46  ? 15.196  5.736   -1.273  1.00 10.00 ? 364 VAL B H    3  
ATOM 7541   N N    . TYR B 2 47  ? 16.406  8.053   -3.707  1.00 10.00 ? 365 TYR B N    3  
ATOM 7542   C CA   . TYR B 2 47  ? 16.639  8.737   -4.974  1.00 10.00 ? 365 TYR B CA   3  
ATOM 7543   C C    . TYR B 2 47  ? 15.356  9.341   -5.548  1.00 10.00 ? 365 TYR B C    3  
ATOM 7544   O O    . TYR B 2 47  ? 15.288  10.545  -5.807  1.00 10.00 ? 365 TYR B O    3  
ATOM 7545   C CB   . TYR B 2 47  ? 17.280  7.784   -5.998  1.00 10.00 ? 365 TYR B CB   3  
ATOM 7546   C CG   . TYR B 2 47  ? 17.106  8.229   -7.435  1.00 10.00 ? 365 TYR B CG   3  
ATOM 7547   C CD1  . TYR B 2 47  ? 17.885  9.247   -7.967  1.00 10.00 ? 365 TYR B CD1  3  
ATOM 7548   C CD2  . TYR B 2 47  ? 16.131  7.658   -8.247  1.00 10.00 ? 365 TYR B CD2  3  
ATOM 7549   C CE1  . TYR B 2 47  ? 17.709  9.673   -9.270  1.00 10.00 ? 365 TYR B CE1  3  
ATOM 7550   C CE2  . TYR B 2 47  ? 15.943  8.085   -9.547  1.00 10.00 ? 365 TYR B CE2  3  
ATOM 7551   C CZ   . TYR B 2 47  ? 16.731  9.096   -10.052 1.00 10.00 ? 365 TYR B CZ   3  
ATOM 7552   O OH   . TYR B 2 47  ? 16.535  9.536   -11.343 1.00 10.00 ? 365 TYR B OH   3  
ATOM 7553   H H    . TYR B 2 47  ? 16.717  7.129   -3.598  1.00 10.00 ? 365 TYR B H    3  
ATOM 7554   H HH   . TYR B 2 47  ? 17.364  9.486   -11.832 1.00 10.00 ? 365 TYR B HH   3  
ATOM 7555   N N    . GLU B 2 48  ? 14.346  8.497   -5.735  1.00 10.00 ? 366 GLU B N    3  
ATOM 7556   C CA   . GLU B 2 48  ? 13.068  8.927   -6.294  1.00 10.00 ? 366 GLU B CA   3  
ATOM 7557   C C    . GLU B 2 48  ? 12.441  10.046  -5.468  1.00 10.00 ? 366 GLU B C    3  
ATOM 7558   O O    . GLU B 2 48  ? 11.906  11.008  -6.020  1.00 10.00 ? 366 GLU B O    3  
ATOM 7559   C CB   . GLU B 2 48  ? 12.110  7.740   -6.396  1.00 10.00 ? 366 GLU B CB   3  
ATOM 7560   C CG   . GLU B 2 48  ? 10.856  8.013   -7.211  1.00 10.00 ? 366 GLU B CG   3  
ATOM 7561   C CD   . GLU B 2 48  ? 11.135  8.114   -8.697  1.00 10.00 ? 366 GLU B CD   3  
ATOM 7562   O OE1  . GLU B 2 48  ? 11.234  7.062   -9.360  1.00 10.00 ? 366 GLU B OE1  3  
ATOM 7563   O OE2  . GLU B 2 48  ? 11.241  9.245   -9.209  1.00 10.00 ? 366 GLU B OE2  3  
ATOM 7564   H H    . GLU B 2 48  ? 14.463  7.556   -5.484  1.00 10.00 ? 366 GLU B H    3  
ATOM 7565   N N    . ALA B 2 49  ? 12.507  9.905   -4.147  1.00 10.00 ? 367 ALA B N    3  
ATOM 7566   C CA   . ALA B 2 49  ? 11.956  10.909  -3.235  1.00 10.00 ? 367 ALA B CA   3  
ATOM 7567   C C    . ALA B 2 49  ? 12.542  12.286  -3.511  1.00 10.00 ? 367 ALA B C    3  
ATOM 7568   O O    . ALA B 2 49  ? 11.872  13.305  -3.355  1.00 10.00 ? 367 ALA B O    3  
ATOM 7569   C CB   . ALA B 2 49  ? 12.216  10.508  -1.790  1.00 10.00 ? 367 ALA B CB   3  
ATOM 7570   H H    . ALA B 2 49  ? 12.844  9.058   -3.778  1.00 10.00 ? 367 ALA B H    3  
ATOM 7571   N N    . ILE B 2 50  ? 13.793  12.307  -3.940  1.00 10.00 ? 368 ILE B N    3  
ATOM 7572   C CA   . ILE B 2 50  ? 14.468  13.555  -4.258  1.00 10.00 ? 368 ILE B CA   3  
ATOM 7573   C C    . ILE B 2 50  ? 13.931  14.104  -5.579  1.00 10.00 ? 368 ILE B C    3  
ATOM 7574   O O    . ILE B 2 50  ? 13.649  15.296  -5.703  1.00 10.00 ? 368 ILE B O    3  
ATOM 7575   C CB   . ILE B 2 50  ? 16.000  13.370  -4.346  1.00 10.00 ? 368 ILE B CB   3  
ATOM 7576   C CG1  . ILE B 2 50  ? 16.546  12.856  -3.008  1.00 10.00 ? 368 ILE B CG1  3  
ATOM 7577   C CG2  . ILE B 2 50  ? 16.675  14.680  -4.728  1.00 10.00 ? 368 ILE B CG2  3  
ATOM 7578   C CD1  . ILE B 2 50  ? 17.962  12.325  -3.080  1.00 10.00 ? 368 ILE B CD1  3  
ATOM 7579   H H    . ILE B 2 50  ? 14.262  11.456  -4.076  1.00 10.00 ? 368 ILE B H    3  
ATOM 7580   N N    . VAL B 2 51  ? 13.764  13.211  -6.552  1.00 10.00 ? 369 VAL B N    3  
ATOM 7581   C CA   . VAL B 2 51  ? 13.264  13.578  -7.872  1.00 10.00 ? 369 VAL B CA   3  
ATOM 7582   C C    . VAL B 2 51  ? 11.856  14.157  -7.792  1.00 10.00 ? 369 VAL B C    3  
ATOM 7583   O O    . VAL B 2 51  ? 11.570  15.191  -8.391  1.00 10.00 ? 369 VAL B O    3  
ATOM 7584   C CB   . VAL B 2 51  ? 13.249  12.369  -8.833  1.00 10.00 ? 369 VAL B CB   3  
ATOM 7585   C CG1  . VAL B 2 51  ? 12.847  12.790  -10.238 1.00 10.00 ? 369 VAL B CG1  3  
ATOM 7586   C CG2  . VAL B 2 51  ? 14.602  11.679  -8.852  1.00 10.00 ? 369 VAL B CG2  3  
ATOM 7587   H H    . VAL B 2 51  ? 13.986  12.269  -6.376  1.00 10.00 ? 369 VAL B H    3  
ATOM 7588   N N    . MET B 2 52  ? 10.986  13.482  -7.044  1.00 10.00 ? 370 MET B N    3  
ATOM 7589   C CA   . MET B 2 52  ? 9.601   13.923  -6.885  1.00 10.00 ? 370 MET B CA   3  
ATOM 7590   C C    . MET B 2 52  ? 9.538   15.388  -6.465  1.00 10.00 ? 370 MET B C    3  
ATOM 7591   O O    . MET B 2 52  ? 8.901   16.197  -7.125  1.00 10.00 ? 370 MET B O    3  
ATOM 7592   C CB   . MET B 2 52  ? 8.872   13.049  -5.861  1.00 10.00 ? 370 MET B CB   3  
ATOM 7593   C CG   . MET B 2 52  ? 8.579   11.643  -6.349  1.00 10.00 ? 370 MET B CG   3  
ATOM 7594   S SD   . MET B 2 52  ? 7.686   10.650  -5.139  1.00 10.00 ? 370 MET B SD   3  
ATOM 7595   C CE   . MET B 2 52  ? 7.338   9.184   -6.108  1.00 10.00 ? 370 MET B CE   3  
ATOM 7596   H H    . MET B 2 52  ? 11.281  12.656  -6.594  1.00 10.00 ? 370 MET B H    3  
ATOM 7597   N N    . VAL B 2 53  ? 10.183  15.706  -5.346  1.00 10.00 ? 371 VAL B N    3  
ATOM 7598   C CA   . VAL B 2 53  ? 10.235  17.084  -4.835  1.00 10.00 ? 371 VAL B CA   3  
ATOM 7599   C C    . VAL B 2 53  ? 10.631  18.101  -5.910  1.00 10.00 ? 371 VAL B C    3  
ATOM 7600   O O    . VAL B 2 53  ? 10.115  19.215  -5.935  1.00 10.00 ? 371 VAL B O    3  
ATOM 7601   C CB   . VAL B 2 53  ? 11.225  17.211  -3.660  1.00 10.00 ? 371 VAL B CB   3  
ATOM 7602   C CG1  . VAL B 2 53  ? 11.255  18.632  -3.125  1.00 10.00 ? 371 VAL B CG1  3  
ATOM 7603   C CG2  . VAL B 2 53  ? 10.861  16.245  -2.556  1.00 10.00 ? 371 VAL B CG2  3  
ATOM 7604   H H    . VAL B 2 53  ? 10.480  14.967  -4.777  1.00 10.00 ? 371 VAL B H    3  
ATOM 7605   N N    . LEU B 2 54  ? 11.515  17.705  -6.815  1.00 10.00 ? 372 LEU B N    3  
ATOM 7606   C CA   . LEU B 2 54  ? 11.971  18.604  -7.866  1.00 10.00 ? 372 LEU B CA   3  
ATOM 7607   C C    . LEU B 2 54  ? 10.957  18.703  -9.001  1.00 10.00 ? 372 LEU B C    3  
ATOM 7608   O O    . LEU B 2 54  ? 10.930  19.681  -9.750  1.00 10.00 ? 372 LEU B O    3  
ATOM 7609   C CB   . LEU B 2 54  ? 13.337  18.151  -8.395  1.00 10.00 ? 372 LEU B CB   3  
ATOM 7610   C CG   . LEU B 2 54  ? 14.469  18.081  -7.366  1.00 10.00 ? 372 LEU B CG   3  
ATOM 7611   C CD1  . LEU B 2 54  ? 15.755  17.594  -8.015  1.00 10.00 ? 372 LEU B CD1  3  
ATOM 7612   C CD2  . LEU B 2 54  ? 14.682  19.434  -6.704  1.00 10.00 ? 372 LEU B CD2  3  
ATOM 7613   H H    . LEU B 2 54  ? 11.806  16.768  -6.812  1.00 10.00 ? 372 LEU B H    3  
ATOM 7614   N N    . GLU B 2 55  ? 10.127  17.685  -9.116  1.00 10.00 ? 373 GLU B N    3  
ATOM 7615   C CA   . GLU B 2 55  ? 9.094   17.625  -10.151 1.00 10.00 ? 373 GLU B CA   3  
ATOM 7616   C C    . GLU B 2 55  ? 7.714   17.981  -9.595  1.00 10.00 ? 373 GLU B C    3  
ATOM 7617   O O    . GLU B 2 55  ? 6.699   17.806  -10.273 1.00 10.00 ? 373 GLU B O    3  
ATOM 7618   C CB   . GLU B 2 55  ? 9.063   16.232  -10.784 1.00 10.00 ? 373 GLU B CB   3  
ATOM 7619   C CG   . GLU B 2 55  ? 8.677   16.225  -12.253 1.00 10.00 ? 373 GLU B CG   3  
ATOM 7620   C CD   . GLU B 2 55  ? 9.719   16.888  -13.130 1.00 10.00 ? 373 GLU B CD   3  
ATOM 7621   O OE1  . GLU B 2 55  ? 10.666  16.197  -13.557 1.00 10.00 ? 373 GLU B OE1  3  
ATOM 7622   O OE2  . GLU B 2 55  ? 9.588   18.101  -13.398 1.00 10.00 ? 373 GLU B OE2  3  
ATOM 7623   H H    . GLU B 2 55  ? 10.205  16.930  -8.489  1.00 10.00 ? 373 GLU B H    3  
ATOM 7624   N N    . SER B 2 56  ? 7.676   18.476  -8.363  1.00 10.00 ? 374 SER B N    3  
ATOM 7625   C CA   . SER B 2 56  ? 6.416   18.838  -7.728  1.00 10.00 ? 374 SER B CA   3  
ATOM 7626   C C    . SER B 2 56  ? 6.352   20.329  -7.412  1.00 10.00 ? 374 SER B C    3  
ATOM 7627   O O    . SER B 2 56  ? 7.334   20.927  -6.978  1.00 10.00 ? 374 SER B O    3  
ATOM 7628   C CB   . SER B 2 56  ? 6.203   18.034  -6.447  1.00 10.00 ? 374 SER B CB   3  
ATOM 7629   O OG   . SER B 2 56  ? 6.327   16.645  -6.695  1.00 10.00 ? 374 SER B OG   3  
ATOM 7630   H H    . SER B 2 56  ? 8.516   18.609  -7.875  1.00 10.00 ? 374 SER B H    3  
ATOM 7631   H HG   . SER B 2 56  ? 7.249   16.449  -6.908  1.00 10.00 ? 374 SER B HG   3  
ATOM 7632   N N    . THR B 2 57  ? 5.184   20.920  -7.634  1.00 10.00 ? 375 THR B N    3  
ATOM 7633   C CA   . THR B 2 57  ? 4.973   22.331  -7.359  1.00 10.00 ? 375 THR B CA   3  
ATOM 7634   C C    . THR B 2 57  ? 4.245   22.504  -6.028  1.00 10.00 ? 375 THR B C    3  
ATOM 7635   O O    . THR B 2 57  ? 3.093   22.089  -5.886  1.00 10.00 ? 375 THR B O    3  
ATOM 7636   C CB   . THR B 2 57  ? 4.155   22.998  -8.478  1.00 10.00 ? 375 THR B CB   3  
ATOM 7637   O OG1  . THR B 2 57  ? 3.261   22.037  -9.057  1.00 10.00 ? 375 THR B OG1  3  
ATOM 7638   C CG2  . THR B 2 57  ? 5.075   23.542  -9.560  1.00 10.00 ? 375 THR B CG2  3  
ATOM 7639   H H    . THR B 2 57  ? 4.442   20.387  -8.001  1.00 10.00 ? 375 THR B H    3  
ATOM 7640   H HG1  . THR B 2 57  ? 2.578   21.803  -8.410  1.00 10.00 ? 375 THR B HG1  3  
ATOM 7641   N N    . GLY B 2 58  ? 4.911   23.119  -5.060  1.00 10.00 ? 376 GLY B N    3  
ATOM 7642   C CA   . GLY B 2 58  ? 4.292   23.320  -3.765  1.00 10.00 ? 376 GLY B CA   3  
ATOM 7643   C C    . GLY B 2 58  ? 5.242   23.099  -2.606  1.00 10.00 ? 376 GLY B C    3  
ATOM 7644   O O    . GLY B 2 58  ? 5.985   22.118  -2.573  1.00 10.00 ? 376 GLY B O    3  
ATOM 7645   H H    . GLY B 2 58  ? 5.802   23.482  -5.238  1.00 10.00 ? 376 GLY B H    3  
ATOM 7646   N N    . GLU B 2 59  ? 5.203   24.019  -1.647  1.00 10.00 ? 377 GLU B N    3  
ATOM 7647   C CA   . GLU B 2 59  ? 6.044   23.946  -0.457  1.00 10.00 ? 377 GLU B CA   3  
ATOM 7648   C C    . GLU B 2 59  ? 5.678   22.720  0.373   1.00 10.00 ? 377 GLU B C    3  
ATOM 7649   O O    . GLU B 2 59  ? 6.500   22.199  1.132   1.00 10.00 ? 377 GLU B O    3  
ATOM 7650   C CB   . GLU B 2 59  ? 5.884   25.214  0.391   1.00 10.00 ? 377 GLU B CB   3  
ATOM 7651   C CG   . GLU B 2 59  ? 4.436   25.650  0.579   1.00 10.00 ? 377 GLU B CG   3  
ATOM 7652   C CD   . GLU B 2 59  ? 4.193   26.381  1.884   1.00 10.00 ? 377 GLU B CD   3  
ATOM 7653   O OE1  . GLU B 2 59  ? 4.608   27.554  2.002   1.00 10.00 ? 377 GLU B OE1  3  
ATOM 7654   O OE2  . GLU B 2 59  ? 3.568   25.793  2.793   1.00 10.00 ? 377 GLU B OE2  3  
ATOM 7655   H H    . GLU B 2 59  ? 4.593   24.780  -1.747  1.00 10.00 ? 377 GLU B H    3  
ATOM 7656   N N    . SER B 2 60  ? 4.437   22.264  0.217   1.00 10.00 ? 378 SER B N    3  
ATOM 7657   C CA   . SER B 2 60  ? 3.947   21.100  0.930   1.00 10.00 ? 378 SER B CA   3  
ATOM 7658   C C    . SER B 2 60  ? 4.747   19.857  0.543   1.00 10.00 ? 378 SER B C    3  
ATOM 7659   O O    . SER B 2 60  ? 5.005   18.994  1.380   1.00 10.00 ? 378 SER B O    3  
ATOM 7660   C CB   . SER B 2 60  ? 2.466   20.896  0.615   1.00 10.00 ? 378 SER B CB   3  
ATOM 7661   O OG   . SER B 2 60  ? 2.139   21.461  -0.646  1.00 10.00 ? 378 SER B OG   3  
ATOM 7662   H H    . SER B 2 60  ? 3.835   22.725  -0.405  1.00 10.00 ? 378 SER B H    3  
ATOM 7663   H HG   . SER B 2 60  ? 1.290   21.107  -0.939  1.00 10.00 ? 378 SER B HG   3  
ATOM 7664   N N    . ALA B 2 61  ? 5.155   19.800  -0.721  1.00 10.00 ? 379 ALA B N    3  
ATOM 7665   C CA   . ALA B 2 61  ? 5.933   18.677  -1.228  1.00 10.00 ? 379 ALA B CA   3  
ATOM 7666   C C    . ALA B 2 61  ? 7.246   18.556  -0.468  1.00 10.00 ? 379 ALA B C    3  
ATOM 7667   O O    . ALA B 2 61  ? 7.550   17.511  0.108   1.00 10.00 ? 379 ALA B O    3  
ATOM 7668   C CB   . ALA B 2 61  ? 6.192   18.838  -2.717  1.00 10.00 ? 379 ALA B CB   3  
ATOM 7669   H H    . ALA B 2 61  ? 4.888   20.516  -1.336  1.00 10.00 ? 379 ALA B H    3  
ATOM 7670   N N    . PHE B 2 62  ? 8.033   19.636  -0.464  1.00 10.00 ? 380 PHE B N    3  
ATOM 7671   C CA   . PHE B 2 62  ? 9.324   19.673  0.216   1.00 10.00 ? 380 PHE B CA   3  
ATOM 7672   C C    . PHE B 2 62  ? 9.220   19.222  1.671   1.00 10.00 ? 380 PHE B C    3  
ATOM 7673   O O    . PHE B 2 62  ? 9.802   18.207  2.052   1.00 10.00 ? 380 PHE B O    3  
ATOM 7674   C CB   . PHE B 2 62  ? 9.834   21.120  0.171   1.00 10.00 ? 380 PHE B CB   3  
ATOM 7675   C CG   . PHE B 2 62  ? 11.305  21.303  0.407   1.00 10.00 ? 380 PHE B CG   3  
ATOM 7676   C CD1  . PHE B 2 62  ? 11.847  21.169  1.675   1.00 10.00 ? 380 PHE B CD1  3  
ATOM 7677   C CD2  . PHE B 2 62  ? 12.144  21.636  -0.641  1.00 10.00 ? 380 PHE B CD2  3  
ATOM 7678   C CE1  . PHE B 2 62  ? 13.199  21.357  1.890   1.00 10.00 ? 380 PHE B CE1  3  
ATOM 7679   C CE2  . PHE B 2 62  ? 13.496  21.828  -0.434  1.00 10.00 ? 380 PHE B CE2  3  
ATOM 7680   C CZ   . PHE B 2 62  ? 14.025  21.690  0.834   1.00 10.00 ? 380 PHE B CZ   3  
ATOM 7681   H H    . PHE B 2 62  ? 7.785   20.431  -0.979  1.00 10.00 ? 380 PHE B H    3  
ATOM 7682   N N    . LYS B 2 63  ? 8.483   19.990  2.467   1.00 10.00 ? 381 LYS B N    3  
ATOM 7683   C CA   . LYS B 2 63  ? 8.298   19.688  3.888   1.00 10.00 ? 381 LYS B CA   3  
ATOM 7684   C C    . LYS B 2 63  ? 7.837   18.254  4.153   1.00 10.00 ? 381 LYS B C    3  
ATOM 7685   O O    . LYS B 2 63  ? 8.195   17.662  5.169   1.00 10.00 ? 381 LYS B O    3  
ATOM 7686   C CB   . LYS B 2 63  ? 7.379   20.704  4.571   1.00 10.00 ? 381 LYS B CB   3  
ATOM 7687   C CG   . LYS B 2 63  ? 5.922   20.618  4.157   1.00 10.00 ? 381 LYS B CG   3  
ATOM 7688   C CD   . LYS B 2 63  ? 5.016   21.201  5.224   1.00 10.00 ? 381 LYS B CD   3  
ATOM 7689   C CE   . LYS B 2 63  ? 3.573   20.793  4.996   1.00 10.00 ? 381 LYS B CE   3  
ATOM 7690   N NZ   . LYS B 2 63  ? 2.722   21.101  6.173   1.00 10.00 ? 381 LYS B NZ   3  
ATOM 7691   H H    . LYS B 2 63  ? 8.094   20.815  2.105   1.00 10.00 ? 381 LYS B H    3  
ATOM 7692   H HZ1  . LYS B 2 63  ? 2.443   22.105  6.163   1.00 10.00 ? 381 LYS B HZ1  3  
ATOM 7693   H HZ2  . LYS B 2 63  ? 3.243   20.905  7.053   1.00 10.00 ? 381 LYS B HZ2  3  
ATOM 7694   H HZ3  . LYS B 2 63  ? 1.863   20.517  6.154   1.00 10.00 ? 381 LYS B HZ3  3  
ATOM 7695   N N    . MET B 2 64  ? 7.058   17.692  3.239   1.00 10.00 ? 382 MET B N    3  
ATOM 7696   C CA   . MET B 2 64  ? 6.548   16.338  3.412   1.00 10.00 ? 382 MET B CA   3  
ATOM 7697   C C    . MET B 2 64  ? 7.608   15.280  3.123   1.00 10.00 ? 382 MET B C    3  
ATOM 7698   O O    . MET B 2 64  ? 7.818   14.372  3.925   1.00 10.00 ? 382 MET B O    3  
ATOM 7699   C CB   . MET B 2 64  ? 5.303   16.084  2.552   1.00 10.00 ? 382 MET B CB   3  
ATOM 7700   C CG   . MET B 2 64  ? 4.001   16.605  3.147   1.00 10.00 ? 382 MET B CG   3  
ATOM 7701   S SD   . MET B 2 64  ? 3.593   15.850  4.736   1.00 10.00 ? 382 MET B SD   3  
ATOM 7702   C CE   . MET B 2 64  ? 3.502   14.117  4.282   1.00 10.00 ? 382 MET B CE   3  
ATOM 7703   H H    . MET B 2 64  ? 6.843   18.187  2.419   1.00 10.00 ? 382 MET B H    3  
ATOM 7704   N N    . ILE B 2 65  ? 8.301   15.412  1.995   1.00 10.00 ? 383 ILE B N    3  
ATOM 7705   C CA   . ILE B 2 65  ? 9.306   14.428  1.604   1.00 10.00 ? 383 ILE B CA   3  
ATOM 7706   C C    . ILE B 2 65  ? 10.560  14.471  2.468   1.00 10.00 ? 383 ILE B C    3  
ATOM 7707   O O    . ILE B 2 65  ? 10.958  13.447  3.017   1.00 10.00 ? 383 ILE B O    3  
ATOM 7708   C CB   . ILE B 2 65  ? 9.690   14.551  0.121   1.00 10.00 ? 383 ILE B CB   3  
ATOM 7709   C CG1  . ILE B 2 65  ? 8.466   14.332  -0.774  1.00 10.00 ? 383 ILE B CG1  3  
ATOM 7710   C CG2  . ILE B 2 65  ? 10.805  13.575  -0.235  1.00 10.00 ? 383 ILE B CG2  3  
ATOM 7711   C CD1  . ILE B 2 65  ? 7.867   12.946  -0.681  1.00 10.00 ? 383 ILE B CD1  3  
ATOM 7712   H H    . ILE B 2 65  ? 8.132   16.189  1.416   1.00 10.00 ? 383 ILE B H    3  
ATOM 7713   N N    . LEU B 2 66  ? 11.209  15.633  2.582   1.00 10.00 ? 384 LEU B N    3  
ATOM 7714   C CA   . LEU B 2 66  ? 12.410  15.753  3.404   1.00 10.00 ? 384 LEU B CA   3  
ATOM 7715   C C    . LEU B 2 66  ? 12.197  15.249  4.822   1.00 10.00 ? 384 LEU B C    3  
ATOM 7716   O O    . LEU B 2 66  ? 13.071  14.590  5.394   1.00 10.00 ? 384 LEU B O    3  
ATOM 7717   C CB   . LEU B 2 66  ? 12.884  17.210  3.416   1.00 10.00 ? 384 LEU B CB   3  
ATOM 7718   C CG   . LEU B 2 66  ? 14.055  17.545  4.341   1.00 10.00 ? 384 LEU B CG   3  
ATOM 7719   C CD1  . LEU B 2 66  ? 15.348  16.936  3.824   1.00 10.00 ? 384 LEU B CD1  3  
ATOM 7720   C CD2  . LEU B 2 66  ? 14.193  19.048  4.499   1.00 10.00 ? 384 LEU B CD2  3  
ATOM 7721   H H    . LEU B 2 66  ? 10.979  16.411  2.033   1.00 10.00 ? 384 LEU B H    3  
ATOM 7722   N N    . ASP B 2 67  ? 11.029  15.544  5.377   1.00 10.00 ? 385 ASP B N    3  
ATOM 7723   C CA   . ASP B 2 67  ? 10.697  15.111  6.729   1.00 10.00 ? 385 ASP B CA   3  
ATOM 7724   C C    . ASP B 2 67  ? 10.690  13.591  6.824   1.00 10.00 ? 385 ASP B C    3  
ATOM 7725   O O    . ASP B 2 67  ? 11.017  13.025  7.864   1.00 10.00 ? 385 ASP B O    3  
ATOM 7726   C CB   . ASP B 2 67  ? 9.339   15.663  7.158   1.00 10.00 ? 385 ASP B CB   3  
ATOM 7727   C CG   . ASP B 2 67  ? 8.970   15.257  8.569   1.00 10.00 ? 385 ASP B CG   3  
ATOM 7728   O OD1  . ASP B 2 67  ? 9.647   15.708  9.514   1.00 10.00 ? 385 ASP B OD1  3  
ATOM 7729   O OD2  . ASP B 2 67  ? 8.001   14.493  8.741   1.00 10.00 ? 385 ASP B OD2  3  
ATOM 7730   H H    . ASP B 2 67  ? 10.375  16.070  4.866   1.00 10.00 ? 385 ASP B H    3  
ATOM 7731   N N    . LEU B 2 68  ? 10.362  12.935  5.714   1.00 10.00 ? 386 LEU B N    3  
ATOM 7732   C CA   . LEU B 2 68  ? 10.301  11.480  5.664   1.00 10.00 ? 386 LEU B CA   3  
ATOM 7733   C C    . LEU B 2 68  ? 11.683  10.870  5.823   1.00 10.00 ? 386 LEU B C    3  
ATOM 7734   O O    . LEU B 2 68  ? 11.848  9.864   6.513   1.00 10.00 ? 386 LEU B O    3  
ATOM 7735   C CB   . LEU B 2 68  ? 9.690   11.008  4.339   1.00 10.00 ? 386 LEU B CB   3  
ATOM 7736   C CG   . LEU B 2 68  ? 9.860   9.522   3.997   1.00 10.00 ? 386 LEU B CG   3  
ATOM 7737   C CD1  . LEU B 2 68  ? 8.896   8.655   4.798   1.00 10.00 ? 386 LEU B CD1  3  
ATOM 7738   C CD2  . LEU B 2 68  ? 9.692   9.292   2.504   1.00 10.00 ? 386 LEU B CD2  3  
ATOM 7739   H H    . LEU B 2 68  ? 10.177  13.449  4.897   1.00 10.00 ? 386 LEU B H    3  
ATOM 7740   N N    . LEU B 2 69  ? 12.685  11.498  5.215   1.00 10.00 ? 387 LEU B N    3  
ATOM 7741   C CA   . LEU B 2 69  ? 14.044  10.986  5.276   1.00 10.00 ? 387 LEU B CA   3  
ATOM 7742   C C    . LEU B 2 69  ? 14.595  11.138  6.680   1.00 10.00 ? 387 LEU B C    3  
ATOM 7743   O O    . LEU B 2 69  ? 15.065  10.173  7.278   1.00 10.00 ? 387 LEU B O    3  
ATOM 7744   C CB   . LEU B 2 69  ? 14.939  11.713  4.266   1.00 10.00 ? 387 LEU B CB   3  
ATOM 7745   C CG   . LEU B 2 69  ? 14.438  11.740  2.818   1.00 10.00 ? 387 LEU B CG   3  
ATOM 7746   C CD1  . LEU B 2 69  ? 15.401  12.513  1.930   1.00 10.00 ? 387 LEU B CD1  3  
ATOM 7747   C CD2  . LEU B 2 69  ? 14.229  10.328  2.288   1.00 10.00 ? 387 LEU B CD2  3  
ATOM 7748   H H    . LEU B 2 69  ? 12.538  12.357  4.764   1.00 10.00 ? 387 LEU B H    3  
ATOM 7749   N N    . LYS B 2 70  ? 14.542  12.366  7.202   1.00 10.00 ? 388 LYS B N    3  
ATOM 7750   C CA   . LYS B 2 70  ? 15.005  12.634  8.558   1.00 10.00 ? 388 LYS B CA   3  
ATOM 7751   C C    . LYS B 2 70  ? 14.292  11.766  9.584   1.00 10.00 ? 388 LYS B C    3  
ATOM 7752   O O    . LYS B 2 70  ? 14.873  11.389  10.599  1.00 10.00 ? 388 LYS B O    3  
ATOM 7753   C CB   . LYS B 2 70  ? 14.874  14.119  8.904   1.00 10.00 ? 388 LYS B CB   3  
ATOM 7754   C CG   . LYS B 2 70  ? 15.872  15.005  8.179   1.00 10.00 ? 388 LYS B CG   3  
ATOM 7755   C CD   . LYS B 2 70  ? 16.375  16.128  9.073   1.00 10.00 ? 388 LYS B CD   3  
ATOM 7756   C CE   . LYS B 2 70  ? 15.231  16.988  9.577   1.00 10.00 ? 388 LYS B CE   3  
ATOM 7757   N NZ   . LYS B 2 70  ? 15.706  18.163  10.351  1.00 10.00 ? 388 LYS B NZ   3  
ATOM 7758   H H    . LYS B 2 70  ? 14.242  13.110  6.640   1.00 10.00 ? 388 LYS B H    3  
ATOM 7759   H HZ1  . LYS B 2 70  ? 16.347  17.858  11.112  1.00 10.00 ? 388 LYS B HZ1  3  
ATOM 7760   H HZ2  . LYS B 2 70  ? 14.898  18.662  10.775  1.00 10.00 ? 388 LYS B HZ2  3  
ATOM 7761   H HZ3  . LYS B 2 70  ? 16.215  18.821  9.730   1.00 10.00 ? 388 LYS B HZ3  3  
ATOM 7762   N N    . SER B 2 71  ? 13.031  11.425  9.306   1.00 10.00 ? 389 SER B N    3  
ATOM 7763   C CA   . SER B 2 71  ? 12.266  10.574  10.203  1.00 10.00 ? 389 SER B CA   3  
ATOM 7764   C C    . SER B 2 71  ? 12.858  9.165   10.174  1.00 10.00 ? 389 SER B C    3  
ATOM 7765   O O    . SER B 2 71  ? 13.042  8.527   11.213  1.00 10.00 ? 389 SER B O    3  
ATOM 7766   C CB   . SER B 2 71  ? 10.790  10.545  9.813   1.00 10.00 ? 389 SER B CB   3  
ATOM 7767   O OG   . SER B 2 71  ? 10.178  11.805  10.039  1.00 10.00 ? 389 SER B OG   3  
ATOM 7768   H H    . SER B 2 71  ? 12.651  11.717  8.448   1.00 10.00 ? 389 SER B H    3  
ATOM 7769   H HG   . SER B 2 71  ? 10.359  12.389  9.285   1.00 10.00 ? 389 SER B HG   3  
ATOM 7770   N N    . LEU B 2 72  ? 13.177  8.705   8.973   1.00 10.00 ? 390 LEU B N    3  
ATOM 7771   C CA   . LEU B 2 72  ? 13.767  7.390   8.788   1.00 10.00 ? 390 LEU B CA   3  
ATOM 7772   C C    . LEU B 2 72  ? 15.178  7.330   9.372   1.00 10.00 ? 390 LEU B C    3  
ATOM 7773   O O    . LEU B 2 72  ? 15.545  6.350   10.020  1.00 10.00 ? 390 LEU B O    3  
ATOM 7774   C CB   . LEU B 2 72  ? 13.756  6.993   7.315   1.00 10.00 ? 390 LEU B CB   3  
ATOM 7775   C CG   . LEU B 2 72  ? 12.375  6.669   6.743   1.00 10.00 ? 390 LEU B CG   3  
ATOM 7776   C CD1  . LEU B 2 72  ? 12.426  6.570   5.229   1.00 10.00 ? 390 LEU B CD1  3  
ATOM 7777   C CD2  . LEU B 2 72  ? 11.826  5.389   7.355   1.00 10.00 ? 390 LEU B CD2  3  
ATOM 7778   H H    . LEU B 2 72  ? 12.987  9.257   8.185   1.00 10.00 ? 390 LEU B H    3  
ATOM 7779   N N    . TRP B 2 73  ? 15.996  8.366   9.130   1.00 10.00 ? 391 TRP B N    3  
ATOM 7780   C CA   . TRP B 2 73  ? 17.346  8.419   9.687   1.00 10.00 ? 391 TRP B CA   3  
ATOM 7781   C C    . TRP B 2 73  ? 17.285  8.353   11.203  1.00 10.00 ? 391 TRP B C    3  
ATOM 7782   O O    . TRP B 2 73  ? 18.014  7.588   11.829  1.00 10.00 ? 391 TRP B O    3  
ATOM 7783   C CB   . TRP B 2 73  ? 18.034  9.720   9.265   1.00 10.00 ? 391 TRP B CB   3  
ATOM 7784   C CG   . TRP B 2 73  ? 18.811  9.614   7.993   1.00 10.00 ? 391 TRP B CG   3  
ATOM 7785   C CD1  . TRP B 2 73  ? 18.380  9.936   6.739   1.00 10.00 ? 391 TRP B CD1  3  
ATOM 7786   C CD2  . TRP B 2 73  ? 20.160  9.161   7.852   1.00 10.00 ? 391 TRP B CD2  3  
ATOM 7787   N NE1  . TRP B 2 73  ? 19.380  9.711   5.825   1.00 10.00 ? 391 TRP B NE1  3  
ATOM 7788   C CE2  . TRP B 2 73  ? 20.484  9.235   6.483   1.00 10.00 ? 391 TRP B CE2  3  
ATOM 7789   C CE3  . TRP B 2 73  ? 21.127  8.701   8.752   1.00 10.00 ? 391 TRP B CE3  3  
ATOM 7790   C CZ2  . TRP B 2 73  ? 21.734  8.864   5.992   1.00 10.00 ? 391 TRP B CZ2  3  
ATOM 7791   C CZ3  . TRP B 2 73  ? 22.366  8.335   8.263   1.00 10.00 ? 391 TRP B CZ3  3  
ATOM 7792   C CH2  . TRP B 2 73  ? 22.659  8.418   6.898   1.00 10.00 ? 391 TRP B CH2  3  
ATOM 7793   H H    . TRP B 2 73  ? 15.729  9.096   8.526   1.00 10.00 ? 391 TRP B H    3  
ATOM 7794   H HE1  . TRP B 2 73  ? 19.315  9.865   4.856   1.00 10.00 ? 391 TRP B HE1  3  
ATOM 7795   N N    . LYS B 2 74  ? 16.431  9.201   11.777  1.00 10.00 ? 392 LYS B N    3  
ATOM 7796   C CA   . LYS B 2 74  ? 16.207  9.227   13.227  1.00 10.00 ? 392 LYS B CA   3  
ATOM 7797   C C    . LYS B 2 74  ? 15.926  7.822   13.755  1.00 10.00 ? 392 LYS B C    3  
ATOM 7798   O O    . LYS B 2 74  ? 16.376  7.454   14.838  1.00 10.00 ? 392 LYS B O    3  
ATOM 7799   C CB   . LYS B 2 74  ? 14.973  10.076  13.533  1.00 10.00 ? 392 LYS B CB   3  
ATOM 7800   C CG   . LYS B 2 74  ? 15.240  11.505  13.968  1.00 10.00 ? 392 LYS B CG   3  
ATOM 7801   C CD   . LYS B 2 74  ? 13.930  12.222  14.275  1.00 10.00 ? 392 LYS B CD   3  
ATOM 7802   C CE   . LYS B 2 74  ? 13.125  12.474  13.007  1.00 10.00 ? 392 LYS B CE   3  
ATOM 7803   N NZ   . LYS B 2 74  ? 11.705  12.824  13.285  1.00 10.00 ? 392 LYS B NZ   3  
ATOM 7804   H H    . LYS B 2 74  ? 16.082  9.936   11.228  1.00 10.00 ? 392 LYS B H    3  
ATOM 7805   H HZ1  . LYS B 2 74  ? 11.187  11.989  13.630  1.00 10.00 ? 392 LYS B HZ1  3  
ATOM 7806   H HZ2  . LYS B 2 74  ? 11.244  13.161  12.413  1.00 10.00 ? 392 LYS B HZ2  3  
ATOM 7807   H HZ3  . LYS B 2 74  ? 11.646  13.574  14.001  1.00 10.00 ? 392 LYS B HZ3  3  
ATOM 7808   N N    . SER B 2 75  ? 15.200  7.039   12.974  1.00 10.00 ? 393 SER B N    3  
ATOM 7809   C CA   . SER B 2 75  ? 14.848  5.681   13.362  1.00 10.00 ? 393 SER B CA   3  
ATOM 7810   C C    . SER B 2 75  ? 15.962  4.686   13.037  1.00 10.00 ? 393 SER B C    3  
ATOM 7811   O O    . SER B 2 75  ? 15.842  3.497   13.313  1.00 10.00 ? 393 SER B O    3  
ATOM 7812   C CB   . SER B 2 75  ? 13.548  5.271   12.672  1.00 10.00 ? 393 SER B CB   3  
ATOM 7813   O OG   . SER B 2 75  ? 12.571  6.294   12.800  1.00 10.00 ? 393 SER B OG   3  
ATOM 7814   H H    . SER B 2 75  ? 14.899  7.380   12.103  1.00 10.00 ? 393 SER B H    3  
ATOM 7815   H HG   . SER B 2 75  ? 12.711  6.960   12.111  1.00 10.00 ? 393 SER B HG   3  
ATOM 7816   N N    . SER B 2 76  ? 17.033  5.191   12.428  1.00 10.00 ? 394 SER B N    3  
ATOM 7817   C CA   . SER B 2 76  ? 18.187  4.374   12.060  1.00 10.00 ? 394 SER B CA   3  
ATOM 7818   C C    . SER B 2 76  ? 17.804  3.328   11.017  1.00 10.00 ? 394 SER B C    3  
ATOM 7819   O O    . SER B 2 76  ? 18.059  2.132   11.178  1.00 10.00 ? 394 SER B O    3  
ATOM 7820   C CB   . SER B 2 76  ? 18.829  3.729   13.298  1.00 10.00 ? 394 SER B CB   3  
ATOM 7821   O OG   . SER B 2 76  ? 18.968  4.684   14.342  1.00 10.00 ? 394 SER B OG   3  
ATOM 7822   H H    . SER B 2 76  ? 17.039  6.147   12.201  1.00 10.00 ? 394 SER B H    3  
ATOM 7823   H HG   . SER B 2 76  ? 18.530  5.503   14.081  1.00 10.00 ? 394 SER B HG   3  
ATOM 7824   N N    . THR B 2 77  ? 17.163  3.791   9.950   1.00 10.00 ? 395 THR B N    3  
ATOM 7825   C CA   . THR B 2 77  ? 16.734  2.919   8.869   1.00 10.00 ? 395 THR B CA   3  
ATOM 7826   C C    . THR B 2 77  ? 17.522  3.188   7.584   1.00 10.00 ? 395 THR B C    3  
ATOM 7827   O O    . THR B 2 77  ? 17.894  2.257   6.875   1.00 10.00 ? 395 THR B O    3  
ATOM 7828   C CB   . THR B 2 77  ? 15.221  3.054   8.621   1.00 10.00 ? 395 THR B CB   3  
ATOM 7829   O OG1  . THR B 2 77  ? 14.549  3.111   9.886   1.00 10.00 ? 395 THR B OG1  3  
ATOM 7830   C CG2  . THR B 2 77  ? 14.698  1.855   7.842   1.00 10.00 ? 395 THR B CG2  3  
ATOM 7831   H H    . THR B 2 77  ? 16.959  4.750   9.897   1.00 10.00 ? 395 THR B H    3  
ATOM 7832   H HG1  . THR B 2 77  ? 15.005  2.543   10.516  1.00 10.00 ? 395 THR B HG1  3  
ATOM 7833   N N    . ILE B 2 78  ? 17.772  4.458   7.278   1.00 10.00 ? 396 ILE B N    3  
ATOM 7834   C CA   . ILE B 2 78  ? 18.543  4.807   6.087   1.00 10.00 ? 396 ILE B CA   3  
ATOM 7835   C C    . ILE B 2 78  ? 20.027  4.866   6.424   1.00 10.00 ? 396 ILE B C    3  
ATOM 7836   O O    . ILE B 2 78  ? 20.417  5.424   7.448   1.00 10.00 ? 396 ILE B O    3  
ATOM 7837   C CB   . ILE B 2 78  ? 18.108  6.153   5.465   1.00 10.00 ? 396 ILE B CB   3  
ATOM 7838   C CG1  . ILE B 2 78  ? 16.615  6.128   5.126   1.00 10.00 ? 396 ILE B CG1  3  
ATOM 7839   C CG2  . ILE B 2 78  ? 18.928  6.458   4.216   1.00 10.00 ? 396 ILE B CG2  3  
ATOM 7840   C CD1  . ILE B 2 78  ? 16.101  7.417   4.518   1.00 10.00 ? 396 ILE B CD1  3  
ATOM 7841   H H    . ILE B 2 78  ? 17.435  5.172   7.855   1.00 10.00 ? 396 ILE B H    3  
ATOM 7842   N N    . THR B 2 79  ? 20.844  4.262   5.579   1.00 10.00 ? 397 THR B N    3  
ATOM 7843   C CA   . THR B 2 79  ? 22.276  4.254   5.781   1.00 10.00 ? 397 THR B CA   3  
ATOM 7844   C C    . THR B 2 79  ? 22.965  5.231   4.827   1.00 10.00 ? 397 THR B C    3  
ATOM 7845   O O    . THR B 2 79  ? 22.447  5.519   3.744   1.00 10.00 ? 397 THR B O    3  
ATOM 7846   C CB   . THR B 2 79  ? 22.827  2.835   5.587   1.00 10.00 ? 397 THR B CB   3  
ATOM 7847   O OG1  . THR B 2 79  ? 21.845  2.045   4.894   1.00 10.00 ? 397 THR B OG1  3  
ATOM 7848   C CG2  . THR B 2 79  ? 23.108  2.198   6.940   1.00 10.00 ? 397 THR B CG2  3  
ATOM 7849   H H    . THR B 2 79  ? 20.472  3.797   4.802   1.00 10.00 ? 397 THR B H    3  
ATOM 7850   H HG1  . THR B 2 79  ? 21.439  1.431   5.516   1.00 10.00 ? 397 THR B HG1  3  
ATOM 7851   N N    . ILE B 2 80  ? 24.119  5.747   5.249   1.00 10.00 ? 398 ILE B N    3  
ATOM 7852   C CA   . ILE B 2 80  ? 24.892  6.706   4.449   1.00 10.00 ? 398 ILE B CA   3  
ATOM 7853   C C    . ILE B 2 80  ? 25.104  6.236   3.008   1.00 10.00 ? 398 ILE B C    3  
ATOM 7854   O O    . ILE B 2 80  ? 24.964  7.023   2.075   1.00 10.00 ? 398 ILE B O    3  
ATOM 7855   C CB   . ILE B 2 80  ? 26.253  7.049   5.108   1.00 10.00 ? 398 ILE B CB   3  
ATOM 7856   C CG1  . ILE B 2 80  ? 27.102  7.960   4.208   1.00 10.00 ? 398 ILE B CG1  3  
ATOM 7857   C CG2  . ILE B 2 80  ? 27.023  5.790   5.481   1.00 10.00 ? 398 ILE B CG2  3  
ATOM 7858   C CD1  . ILE B 2 80  ? 26.708  9.423   4.253   1.00 10.00 ? 398 ILE B CD1  3  
ATOM 7859   H H    . ILE B 2 80  ? 24.421  5.527   6.159   1.00 10.00 ? 398 ILE B H    3  
ATOM 7860   N N    . ASP B 2 81  ? 25.405  4.957   2.827   1.00 10.00 ? 399 ASP B N    3  
ATOM 7861   C CA   . ASP B 2 81  ? 25.637  4.397   1.493   1.00 10.00 ? 399 ASP B CA   3  
ATOM 7862   C C    . ASP B 2 81  ? 24.406  4.532   0.604   1.00 10.00 ? 399 ASP B C    3  
ATOM 7863   O O    . ASP B 2 81  ? 24.511  4.673   -0.616  1.00 10.00 ? 399 ASP B O    3  
ATOM 7864   C CB   . ASP B 2 81  ? 26.041  2.926   1.592   1.00 10.00 ? 399 ASP B CB   3  
ATOM 7865   C CG   . ASP B 2 81  ? 27.453  2.744   2.102   1.00 10.00 ? 399 ASP B CG   3  
ATOM 7866   O OD1  . ASP B 2 81  ? 28.406  2.959   1.327   1.00 10.00 ? 399 ASP B OD1  3  
ATOM 7867   O OD2  . ASP B 2 81  ? 27.618  2.379   3.287   1.00 10.00 ? 399 ASP B OD2  3  
ATOM 7868   H H    . ASP B 2 81  ? 25.479  4.370   3.611   1.00 10.00 ? 399 ASP B H    3  
ATOM 7869   N N    . GLN B 2 82  ? 23.242  4.488   1.225   1.00 10.00 ? 400 GLN B N    3  
ATOM 7870   C CA   . GLN B 2 82  ? 21.978  4.602   0.511   1.00 10.00 ? 400 GLN B CA   3  
ATOM 7871   C C    . GLN B 2 82  ? 21.737  6.050   0.102   1.00 10.00 ? 400 GLN B C    3  
ATOM 7872   O O    . GLN B 2 82  ? 21.454  6.343   -1.062  1.00 10.00 ? 400 GLN B O    3  
ATOM 7873   C CB   . GLN B 2 82  ? 20.827  4.098   1.387   1.00 10.00 ? 400 GLN B CB   3  
ATOM 7874   C CG   . GLN B 2 82  ? 20.564  2.597   1.305   1.00 10.00 ? 400 GLN B CG   3  
ATOM 7875   C CD   . GLN B 2 82  ? 21.822  1.769   1.111   1.00 10.00 ? 400 GLN B CD   3  
ATOM 7876   O OE1  . GLN B 2 82  ? 22.195  1.435   -0.017  1.00 10.00 ? 400 GLN B OE1  3  
ATOM 7877   N NE2  . GLN B 2 82  ? 22.490  1.439   2.204   1.00 10.00 ? 400 GLN B NE2  3  
ATOM 7878   H H    . GLN B 2 82  ? 23.224  4.386   2.201   1.00 10.00 ? 400 GLN B H    3  
ATOM 7879   H HE21 . GLN B 2 82  ? 22.139  1.744   3.076   1.00 10.00 ? 400 GLN B HE21 3  
ATOM 7880   H HE22 . GLN B 2 82  ? 23.305  0.902   2.107   1.00 10.00 ? 400 GLN B HE22 3  
ATOM 7881   N N    . MET B 2 83  ? 21.862  6.947   1.070   1.00 10.00 ? 401 MET B N    3  
ATOM 7882   C CA   . MET B 2 83  ? 21.670  8.371   0.838   1.00 10.00 ? 401 MET B CA   3  
ATOM 7883   C C    . MET B 2 83  ? 22.684  8.886   -0.172  1.00 10.00 ? 401 MET B C    3  
ATOM 7884   O O    . MET B 2 83  ? 22.356  9.662   -1.075  1.00 10.00 ? 401 MET B O    3  
ATOM 7885   C CB   . MET B 2 83  ? 21.837  9.121   2.160   1.00 10.00 ? 401 MET B CB   3  
ATOM 7886   C CG   . MET B 2 83  ? 21.173  10.485  2.193   1.00 10.00 ? 401 MET B CG   3  
ATOM 7887   S SD   . MET B 2 83  ? 19.441  10.398  2.678   1.00 10.00 ? 401 MET B SD   3  
ATOM 7888   C CE   . MET B 2 83  ? 18.965  12.114  2.491   1.00 10.00 ? 401 MET B CE   3  
ATOM 7889   H H    . MET B 2 83  ? 22.091  6.641   1.973   1.00 10.00 ? 401 MET B H    3  
ATOM 7890   N N    . LYS B 2 84  ? 23.922  8.423   -0.028  1.00 10.00 ? 402 LYS B N    3  
ATOM 7891   C CA   . LYS B 2 84  ? 25.016  8.813   -0.899  1.00 10.00 ? 402 LYS B CA   3  
ATOM 7892   C C    . LYS B 2 84  ? 24.718  8.457   -2.352  1.00 10.00 ? 402 LYS B C    3  
ATOM 7893   O O    . LYS B 2 84  ? 24.665  9.333   -3.215  1.00 10.00 ? 402 LYS B O    3  
ATOM 7894   C CB   . LYS B 2 84  ? 26.305  8.118   -0.455  1.00 10.00 ? 402 LYS B CB   3  
ATOM 7895   C CG   . LYS B 2 84  ? 27.588  8.740   -0.977  1.00 10.00 ? 402 LYS B CG   3  
ATOM 7896   C CD   . LYS B 2 84  ? 28.789  7.895   -0.584  1.00 10.00 ? 402 LYS B CD   3  
ATOM 7897   C CE   . LYS B 2 84  ? 30.062  8.718   -0.536  1.00 10.00 ? 402 LYS B CE   3  
ATOM 7898   N NZ   . LYS B 2 84  ? 30.645  8.943   -1.885  1.00 10.00 ? 402 LYS B NZ   3  
ATOM 7899   H H    . LYS B 2 84  ? 24.090  7.784   0.705   1.00 10.00 ? 402 LYS B H    3  
ATOM 7900   H HZ1  . LYS B 2 84  ? 31.096  8.074   -2.231  1.00 10.00 ? 402 LYS B HZ1  3  
ATOM 7901   H HZ2  . LYS B 2 84  ? 31.360  9.698   -1.843  1.00 10.00 ? 402 LYS B HZ2  3  
ATOM 7902   H HZ3  . LYS B 2 84  ? 29.898  9.221   -2.563  1.00 10.00 ? 402 LYS B HZ3  3  
ATOM 7903   N N    . ARG B 2 85  ? 24.482  7.171   -2.608  1.00 10.00 ? 403 ARG B N    3  
ATOM 7904   C CA   . ARG B 2 85  ? 24.200  6.695   -3.960  1.00 10.00 ? 403 ARG B CA   3  
ATOM 7905   C C    . ARG B 2 85  ? 22.930  7.330   -4.530  1.00 10.00 ? 403 ARG B C    3  
ATOM 7906   O O    . ARG B 2 85  ? 22.725  7.345   -5.745  1.00 10.00 ? 403 ARG B O    3  
ATOM 7907   C CB   . ARG B 2 85  ? 24.116  5.169   -3.995  1.00 10.00 ? 403 ARG B CB   3  
ATOM 7908   C CG   . ARG B 2 85  ? 25.267  4.505   -4.738  1.00 10.00 ? 403 ARG B CG   3  
ATOM 7909   C CD   . ARG B 2 85  ? 25.625  3.153   -4.132  1.00 10.00 ? 403 ARG B CD   3  
ATOM 7910   N NE   . ARG B 2 85  ? 24.571  2.152   -4.320  1.00 10.00 ? 403 ARG B NE   3  
ATOM 7911   C CZ   . ARG B 2 85  ? 23.809  1.672   -3.330  1.00 10.00 ? 403 ARG B CZ   3  
ATOM 7912   N NH1  . ARG B 2 85  ? 23.991  2.083   -2.079  1.00 10.00 ? 403 ARG B NH1  3  
ATOM 7913   N NH2  . ARG B 2 85  ? 22.879  0.763   -3.587  1.00 10.00 ? 403 ARG B NH2  3  
ATOM 7914   H H    . ARG B 2 85  ? 24.506  6.526   -1.868  1.00 10.00 ? 403 ARG B H    3  
ATOM 7915   H HE   . ARG B 2 85  ? 24.430  1.821   -5.238  1.00 10.00 ? 403 ARG B HE   3  
ATOM 7916   H HH11 . ARG B 2 85  ? 24.708  2.759   -1.868  1.00 10.00 ? 403 ARG B HH11 3  
ATOM 7917   H HH12 . ARG B 2 85  ? 23.416  1.724   -1.337  1.00 10.00 ? 403 ARG B HH12 3  
ATOM 7918   H HH21 . ARG B 2 85  ? 22.742  0.429   -4.529  1.00 10.00 ? 403 ARG B HH21 3  
ATOM 7919   H HH22 . ARG B 2 85  ? 22.301  0.406   -2.846  1.00 10.00 ? 403 ARG B HH22 3  
ATOM 7920   N N    . GLY B 2 86  ? 22.078  7.829   -3.652  1.00 10.00 ? 404 GLY B N    3  
ATOM 7921   C CA   . GLY B 2 86  ? 20.853  8.476   -4.086  1.00 10.00 ? 404 GLY B CA   3  
ATOM 7922   C C    . GLY B 2 86  ? 21.117  9.880   -4.597  1.00 10.00 ? 404 GLY B C    3  
ATOM 7923   O O    . GLY B 2 86  ? 20.620  10.270  -5.656  1.00 10.00 ? 404 GLY B O    3  
ATOM 7924   H H    . GLY B 2 86  ? 22.280  7.768   -2.693  1.00 10.00 ? 404 GLY B H    3  
ATOM 7925   N N    . TYR B 2 87  ? 21.924  10.628  -3.854  1.00 10.00 ? 405 TYR B N    3  
ATOM 7926   C CA   . TYR B 2 87  ? 22.255  11.995  -4.221  1.00 10.00 ? 405 TYR B CA   3  
ATOM 7927   C C    . TYR B 2 87  ? 23.231  12.054  -5.386  1.00 10.00 ? 405 TYR B C    3  
ATOM 7928   O O    . TYR B 2 87  ? 23.077  12.870  -6.299  1.00 10.00 ? 405 TYR B O    3  
ATOM 7929   C CB   . TYR B 2 87  ? 22.823  12.749  -3.020  1.00 10.00 ? 405 TYR B CB   3  
ATOM 7930   C CG   . TYR B 2 87  ? 21.875  13.772  -2.446  1.00 10.00 ? 405 TYR B CG   3  
ATOM 7931   C CD1  . TYR B 2 87  ? 21.436  14.839  -3.216  1.00 10.00 ? 405 TYR B CD1  3  
ATOM 7932   C CD2  . TYR B 2 87  ? 21.417  13.671  -1.139  1.00 10.00 ? 405 TYR B CD2  3  
ATOM 7933   C CE1  . TYR B 2 87  ? 20.564  15.777  -2.703  1.00 10.00 ? 405 TYR B CE1  3  
ATOM 7934   C CE2  . TYR B 2 87  ? 20.544  14.604  -0.616  1.00 10.00 ? 405 TYR B CE2  3  
ATOM 7935   C CZ   . TYR B 2 87  ? 20.123  15.657  -1.402  1.00 10.00 ? 405 TYR B CZ   3  
ATOM 7936   O OH   . TYR B 2 87  ? 19.257  16.590  -0.887  1.00 10.00 ? 405 TYR B OH   3  
ATOM 7937   H H    . TYR B 2 87  ? 22.308  10.249  -3.035  1.00 10.00 ? 405 TYR B H    3  
ATOM 7938   H HH   . TYR B 2 87  ? 18.606  16.827  -1.555  1.00 10.00 ? 405 TYR B HH   3  
ATOM 7939   N N    . GLU B 2 88  ? 24.234  11.173  -5.359  1.00 10.00 ? 406 GLU B N    3  
ATOM 7940   C CA   . GLU B 2 88  ? 25.240  11.119  -6.412  1.00 10.00 ? 406 GLU B CA   3  
ATOM 7941   C C    . GLU B 2 88  ? 24.609  10.935  -7.792  1.00 10.00 ? 406 GLU B C    3  
ATOM 7942   O O    . GLU B 2 88  ? 25.129  11.429  -8.791  1.00 10.00 ? 406 GLU B O    3  
ATOM 7943   C CB   . GLU B 2 88  ? 26.273  10.017  -6.123  1.00 10.00 ? 406 GLU B CB   3  
ATOM 7944   C CG   . GLU B 2 88  ? 27.131  10.295  -4.896  1.00 10.00 ? 406 GLU B CG   3  
ATOM 7945   C CD   . GLU B 2 88  ? 28.084  9.160   -4.566  1.00 10.00 ? 406 GLU B CD   3  
ATOM 7946   O OE1  . GLU B 2 88  ? 27.760  7.992   -4.869  1.00 10.00 ? 406 GLU B OE1  3  
ATOM 7947   O OE2  . GLU B 2 88  ? 29.162  9.427   -3.996  1.00 10.00 ? 406 GLU B OE2  3  
ATOM 7948   H H    . GLU B 2 88  ? 24.301  10.556  -4.597  1.00 10.00 ? 406 GLU B H    3  
ATOM 7949   N N    . ARG B 2 89  ? 23.480  10.233  -7.840  1.00 10.00 ? 407 ARG B N    3  
ATOM 7950   C CA   . ARG B 2 89  ? 22.780  10.014  -9.102  1.00 10.00 ? 407 ARG B CA   3  
ATOM 7951   C C    . ARG B 2 89  ? 22.053  11.283  -9.535  1.00 10.00 ? 407 ARG B C    3  
ATOM 7952   O O    . ARG B 2 89  ? 22.092  11.652  -10.703 1.00 10.00 ? 407 ARG B O    3  
ATOM 7953   C CB   . ARG B 2 89  ? 21.815  8.834   -9.007  1.00 10.00 ? 407 ARG B CB   3  
ATOM 7954   C CG   . ARG B 2 89  ? 21.733  8.014   -10.287 1.00 10.00 ? 407 ARG B CG   3  
ATOM 7955   C CD   . ARG B 2 89  ? 21.308  6.581   -10.007 1.00 10.00 ? 407 ARG B CD   3  
ATOM 7956   N NE   . ARG B 2 89  ? 19.861  6.397   -10.124 1.00 10.00 ? 407 ARG B NE   3  
ATOM 7957   C CZ   . ARG B 2 89  ? 19.177  5.457   -9.475  1.00 10.00 ? 407 ARG B CZ   3  
ATOM 7958   N NH1  . ARG B 2 89  ? 19.803  4.619   -8.662  1.00 10.00 ? 407 ARG B NH1  3  
ATOM 7959   N NH2  . ARG B 2 89  ? 17.870  5.337   -9.675  1.00 10.00 ? 407 ARG B NH2  3  
ATOM 7960   H H    . ARG B 2 89  ? 23.114  9.855   -7.015  1.00 10.00 ? 407 ARG B H    3  
ATOM 7961   H HE   . ARG B 2 89  ? 19.382  7.000   -10.730 1.00 10.00 ? 407 ARG B HE   3  
ATOM 7962   H HH11 . ARG B 2 89  ? 20.796  4.693   -8.527  1.00 10.00 ? 407 ARG B HH11 3  
ATOM 7963   H HH12 . ARG B 2 89  ? 19.276  3.897   -8.165  1.00 10.00 ? 407 ARG B HH12 3  
ATOM 7964   H HH21 . ARG B 2 89  ? 17.399  5.953   -10.308 1.00 10.00 ? 407 ARG B HH21 3  
ATOM 7965   H HH22 . ARG B 2 89  ? 17.339  4.630   -9.171  1.00 10.00 ? 407 ARG B HH22 3  
ATOM 7966   N N    . ILE B 2 90  ? 21.426  11.962  -8.578  1.00 10.00 ? 408 ILE B N    3  
ATOM 7967   C CA   . ILE B 2 90  ? 20.703  13.204  -8.853  1.00 10.00 ? 408 ILE B CA   3  
ATOM 7968   C C    . ILE B 2 90  ? 21.620  14.207  -9.550  1.00 10.00 ? 408 ILE B C    3  
ATOM 7969   O O    . ILE B 2 90  ? 21.212  14.892  -10.482 1.00 10.00 ? 408 ILE B O    3  
ATOM 7970   C CB   . ILE B 2 90  ? 20.121  13.814  -7.552  1.00 10.00 ? 408 ILE B CB   3  
ATOM 7971   C CG1  . ILE B 2 90  ? 18.864  13.048  -7.125  1.00 10.00 ? 408 ILE B CG1  3  
ATOM 7972   C CG2  . ILE B 2 90  ? 19.826  15.302  -7.694  1.00 10.00 ? 408 ILE B CG2  3  
ATOM 7973   C CD1  . ILE B 2 90  ? 17.728  13.129  -8.122  1.00 10.00 ? 408 ILE B CD1  3  
ATOM 7974   H H    . ILE B 2 90  ? 21.453  11.621  -7.658  1.00 10.00 ? 408 ILE B H    3  
ATOM 7975   N N    . TYR B 2 91  ? 22.866  14.258  -9.099  1.00 10.00 ? 409 TYR B N    3  
ATOM 7976   C CA   . TYR B 2 91  ? 23.861  15.156  -9.681  1.00 10.00 ? 409 TYR B CA   3  
ATOM 7977   C C    . TYR B 2 91  ? 24.020  14.903  -11.188 1.00 10.00 ? 409 TYR B C    3  
ATOM 7978   O O    . TYR B 2 91  ? 24.396  15.801  -11.941 1.00 10.00 ? 409 TYR B O    3  
ATOM 7979   C CB   . TYR B 2 91  ? 25.212  15.022  -8.970  1.00 10.00 ? 409 TYR B CB   3  
ATOM 7980   C CG   . TYR B 2 91  ? 25.158  15.190  -7.465  1.00 10.00 ? 409 TYR B CG   3  
ATOM 7981   C CD1  . TYR B 2 91  ? 24.310  16.119  -6.869  1.00 10.00 ? 409 TYR B CD1  3  
ATOM 7982   C CD2  . TYR B 2 91  ? 25.956  14.414  -6.637  1.00 10.00 ? 409 TYR B CD2  3  
ATOM 7983   C CE1  . TYR B 2 91  ? 24.266  16.272  -5.495  1.00 10.00 ? 409 TYR B CE1  3  
ATOM 7984   C CE2  . TYR B 2 91  ? 25.920  14.560  -5.263  1.00 10.00 ? 409 TYR B CE2  3  
ATOM 7985   C CZ   . TYR B 2 91  ? 25.071  15.485  -4.697  1.00 10.00 ? 409 TYR B CZ   3  
ATOM 7986   O OH   . TYR B 2 91  ? 25.033  15.631  -3.330  1.00 10.00 ? 409 TYR B OH   3  
ATOM 7987   H H    . TYR B 2 91  ? 23.102  13.698  -8.327  1.00 10.00 ? 409 TYR B H    3  
ATOM 7988   H HH   . TYR B 2 91  ? 25.921  15.816  -3.004  1.00 10.00 ? 409 TYR B HH   3  
ATOM 7989   N N    . ASN B 2 92  ? 23.728  13.680  -11.618 1.00 10.00 ? 410 ASN B N    3  
ATOM 7990   C CA   . ASN B 2 92  ? 23.825  13.309  -13.029 1.00 10.00 ? 410 ASN B CA   3  
ATOM 7991   C C    . ASN B 2 92  ? 22.489  13.516  -13.746 1.00 10.00 ? 410 ASN B C    3  
ATOM 7992   O O    . ASN B 2 92  ? 22.450  13.873  -14.925 1.00 10.00 ? 410 ASN B O    3  
ATOM 7993   C CB   . ASN B 2 92  ? 24.279  11.852  -13.177 1.00 10.00 ? 410 ASN B CB   3  
ATOM 7994   C CG   . ASN B 2 92  ? 24.416  11.423  -14.626 1.00 10.00 ? 410 ASN B CG   3  
ATOM 7995   O OD1  . ASN B 2 92  ? 25.432  11.688  -15.272 1.00 10.00 ? 410 ASN B OD1  3  
ATOM 7996   N ND2  . ASN B 2 92  ? 23.403  10.743  -15.145 1.00 10.00 ? 410 ASN B ND2  3  
ATOM 7997   H H    . ASN B 2 92  ? 23.432  13.004  -10.969 1.00 10.00 ? 410 ASN B H    3  
ATOM 7998   H HD21 . ASN B 2 92  ? 22.627  10.552  -14.570 1.00 10.00 ? 410 ASN B HD21 3  
ATOM 7999   H HD22 . ASN B 2 92  ? 23.464  10.461  -16.080 1.00 10.00 ? 410 ASN B HD22 3  
ATOM 8000   N N    . GLU B 2 93  ? 21.398  13.290  -13.021 1.00 10.00 ? 411 GLU B N    3  
ATOM 8001   C CA   . GLU B 2 93  ? 20.054  13.434  -13.573 1.00 10.00 ? 411 GLU B CA   3  
ATOM 8002   C C    . GLU B 2 93  ? 19.684  14.907  -13.749 1.00 10.00 ? 411 GLU B C    3  
ATOM 8003   O O    . GLU B 2 93  ? 18.876  15.252  -14.616 1.00 10.00 ? 411 GLU B O    3  
ATOM 8004   C CB   . GLU B 2 93  ? 19.027  12.747  -12.667 1.00 10.00 ? 411 GLU B CB   3  
ATOM 8005   C CG   . GLU B 2 93  ? 19.437  11.359  -12.191 1.00 10.00 ? 411 GLU B CG   3  
ATOM 8006   C CD   . GLU B 2 93  ? 19.483  10.328  -13.299 1.00 10.00 ? 411 GLU B CD   3  
ATOM 8007   O OE1  . GLU B 2 93  ? 18.444  9.679   -13.550 1.00 10.00 ? 411 GLU B OE1  3  
ATOM 8008   O OE2  . GLU B 2 93  ? 20.557  10.150  -13.913 1.00 10.00 ? 411 GLU B OE2  3  
ATOM 8009   H H    . GLU B 2 93  ? 21.501  13.010  -12.087 1.00 10.00 ? 411 GLU B H    3  
ATOM 8010   N N    . ILE B 2 94  ? 20.277  15.763  -12.916 1.00 10.00 ? 412 ILE B N    3  
ATOM 8011   C CA   . ILE B 2 94  ? 20.029  17.205  -12.962 1.00 10.00 ? 412 ILE B CA   3  
ATOM 8012   C C    . ILE B 2 94  ? 20.071  17.763  -14.391 1.00 10.00 ? 412 ILE B C    3  
ATOM 8013   O O    . ILE B 2 94  ? 19.091  18.360  -14.841 1.00 10.00 ? 412 ILE B O    3  
ATOM 8014   C CB   . ILE B 2 94  ? 20.965  18.004  -12.014 1.00 10.00 ? 412 ILE B CB   3  
ATOM 8015   C CG1  . ILE B 2 94  ? 20.504  17.871  -10.559 1.00 10.00 ? 412 ILE B CG1  3  
ATOM 8016   C CG2  . ILE B 2 94  ? 21.055  19.473  -12.413 1.00 10.00 ? 412 ILE B CG2  3  
ATOM 8017   C CD1  . ILE B 2 94  ? 19.092  18.361  -10.308 1.00 10.00 ? 412 ILE B CD1  3  
ATOM 8018   H H    . ILE B 2 94  ? 20.899  15.410  -12.241 1.00 10.00 ? 412 ILE B H    3  
ATOM 8019   N N    . PRO B 2 95  ? 21.185  17.576  -15.134 1.00 10.00 ? 413 PRO B N    3  
ATOM 8020   C CA   . PRO B 2 95  ? 21.299  18.067  -16.515 1.00 10.00 ? 413 PRO B CA   3  
ATOM 8021   C C    . PRO B 2 95  ? 20.204  17.514  -17.428 1.00 10.00 ? 413 PRO B C    3  
ATOM 8022   O O    . PRO B 2 95  ? 19.654  18.236  -18.255 1.00 10.00 ? 413 PRO B O    3  
ATOM 8023   C CB   . PRO B 2 95  ? 22.666  17.555  -16.974 1.00 10.00 ? 413 PRO B CB   3  
ATOM 8024   C CG   . PRO B 2 95  ? 23.432  17.343  -15.716 1.00 10.00 ? 413 PRO B CG   3  
ATOM 8025   C CD   . PRO B 2 95  ? 22.426  16.911  -14.692 1.00 10.00 ? 413 PRO B CD   3  
ATOM 8026   N N    . ASP B 2 96  ? 19.879  16.237  -17.257 1.00 10.00 ? 414 ASP B N    3  
ATOM 8027   C CA   . ASP B 2 96  ? 18.863  15.583  -18.081 1.00 10.00 ? 414 ASP B CA   3  
ATOM 8028   C C    . ASP B 2 96  ? 17.466  16.142  -17.821 1.00 10.00 ? 414 ASP B C    3  
ATOM 8029   O O    . ASP B 2 96  ? 16.633  16.201  -18.726 1.00 10.00 ? 414 ASP B O    3  
ATOM 8030   C CB   . ASP B 2 96  ? 18.868  14.071  -17.854 1.00 10.00 ? 414 ASP B CB   3  
ATOM 8031   C CG   . ASP B 2 96  ? 18.139  13.326  -18.949 1.00 10.00 ? 414 ASP B CG   3  
ATOM 8032   O OD1  . ASP B 2 96  ? 18.512  13.496  -20.132 1.00 10.00 ? 414 ASP B OD1  3  
ATOM 8033   O OD2  . ASP B 2 96  ? 17.196  12.561  -18.640 1.00 10.00 ? 414 ASP B OD2  3  
ATOM 8034   H H    . ASP B 2 96  ? 20.335  15.717  -16.561 1.00 10.00 ? 414 ASP B H    3  
ATOM 8035   N N    . ILE B 2 97  ? 17.216  16.542  -16.585 1.00 10.00 ? 415 ILE B N    3  
ATOM 8036   C CA   . ILE B 2 97  ? 15.919  17.088  -16.205 1.00 10.00 ? 415 ILE B CA   3  
ATOM 8037   C C    . ILE B 2 97  ? 15.822  18.579  -16.538 1.00 10.00 ? 415 ILE B C    3  
ATOM 8038   O O    . ILE B 2 97  ? 14.754  19.079  -16.886 1.00 10.00 ? 415 ILE B O    3  
ATOM 8039   C CB   . ILE B 2 97  ? 15.638  16.868  -14.700 1.00 10.00 ? 415 ILE B CB   3  
ATOM 8040   C CG1  . ILE B 2 97  ? 15.659  15.371  -14.370 1.00 10.00 ? 415 ILE B CG1  3  
ATOM 8041   C CG2  . ILE B 2 97  ? 14.306  17.486  -14.293 1.00 10.00 ? 415 ILE B CG2  3  
ATOM 8042   C CD1  . ILE B 2 97  ? 15.462  15.059  -12.901 1.00 10.00 ? 415 ILE B CD1  3  
ATOM 8043   H H    . ILE B 2 97  ? 17.922  16.460  -15.905 1.00 10.00 ? 415 ILE B H    3  
ATOM 8044   N N    . ASN B 2 98  ? 16.941  19.284  -16.442 1.00 10.00 ? 416 ASN B N    3  
ATOM 8045   C CA   . ASN B 2 98  ? 16.956  20.717  -16.720 1.00 10.00 ? 416 ASN B CA   3  
ATOM 8046   C C    . ASN B 2 98  ? 17.011  21.008  -18.212 1.00 10.00 ? 416 ASN B C    3  
ATOM 8047   O O    . ASN B 2 98  ? 16.301  21.891  -18.699 1.00 10.00 ? 416 ASN B O    3  
ATOM 8048   C CB   . ASN B 2 98  ? 18.117  21.409  -15.997 1.00 10.00 ? 416 ASN B CB   3  
ATOM 8049   C CG   . ASN B 2 98  ? 17.844  21.656  -14.524 1.00 10.00 ? 416 ASN B CG   3  
ATOM 8050   O OD1  . ASN B 2 98  ? 17.403  22.737  -14.127 1.00 10.00 ? 416 ASN B OD1  3  
ATOM 8051   N ND2  . ASN B 2 98  ? 18.107  20.655  -13.698 1.00 10.00 ? 416 ASN B ND2  3  
ATOM 8052   H H    . ASN B 2 98  ? 17.774  18.834  -16.181 1.00 10.00 ? 416 ASN B H    3  
ATOM 8053   H HD21 . ASN B 2 98  ? 18.460  19.820  -14.083 1.00 10.00 ? 416 ASN B HD21 3  
ATOM 8054   H HD22 . ASN B 2 98  ? 17.940  20.786  -12.744 1.00 10.00 ? 416 ASN B HD22 3  
ATOM 8055   N N    . LEU B 2 99  ? 17.840  20.249  -18.931 1.00 10.00 ? 417 LEU B N    3  
ATOM 8056   C CA   . LEU B 2 99  ? 18.015  20.424  -20.372 1.00 10.00 ? 417 LEU B CA   3  
ATOM 8057   C C    . LEU B 2 99  ? 18.481  21.846  -20.672 1.00 10.00 ? 417 LEU B C    3  
ATOM 8058   O O    . LEU B 2 99  ? 17.832  22.586  -21.418 1.00 10.00 ? 417 LEU B O    3  
ATOM 8059   C CB   . LEU B 2 99  ? 16.729  20.083  -21.135 1.00 10.00 ? 417 LEU B CB   3  
ATOM 8060   C CG   . LEU B 2 99  ? 16.898  19.704  -22.606 1.00 10.00 ? 417 LEU B CG   3  
ATOM 8061   C CD1  . LEU B 2 99  ? 17.795  18.485  -22.741 1.00 10.00 ? 417 LEU B CD1  3  
ATOM 8062   C CD2  . LEU B 2 99  ? 15.545  19.444  -23.247 1.00 10.00 ? 417 LEU B CD2  3  
ATOM 8063   H H    . LEU B 2 99  ? 18.351  19.545  -18.477 1.00 10.00 ? 417 LEU B H    3  
ATOM 8064   N N    . ASP B 2 100 ? 19.609  22.205  -20.061 1.00 10.00 ? 418 ASP B N    3  
ATOM 8065   C CA   . ASP B 2 100 ? 20.210  23.538  -20.187 1.00 10.00 ? 418 ASP B CA   3  
ATOM 8066   C C    . ASP B 2 100 ? 19.427  24.558  -19.366 1.00 10.00 ? 418 ASP B C    3  
ATOM 8067   O O    . ASP B 2 100 ? 18.319  24.270  -18.908 1.00 10.00 ? 418 ASP B O    3  
ATOM 8068   C CB   . ASP B 2 100 ? 20.361  23.994  -21.645 1.00 10.00 ? 418 ASP B CB   3  
ATOM 8069   C CG   . ASP B 2 100 ? 21.596  24.847  -21.871 1.00 10.00 ? 418 ASP B CG   3  
ATOM 8070   O OD1  . ASP B 2 100 ? 21.665  25.970  -21.328 1.00 10.00 ? 418 ASP B OD1  3  
ATOM 8071   O OD2  . ASP B 2 100 ? 22.509  24.395  -22.591 1.00 10.00 ? 418 ASP B OD2  3  
ATOM 8072   H H    . ASP B 2 100 ? 20.059  21.544  -19.495 1.00 10.00 ? 418 ASP B H    3  
ATOM 8073   N N    . VAL B 2 101 ? 20.004  25.744  -19.188 1.00 10.00 ? 419 VAL B N    3  
ATOM 8074   C CA   . VAL B 2 101 ? 19.382  26.814  -18.404 1.00 10.00 ? 419 VAL B CA   3  
ATOM 8075   C C    . VAL B 2 101 ? 18.925  26.277  -17.043 1.00 10.00 ? 419 VAL B C    3  
ATOM 8076   O O    . VAL B 2 101 ? 17.729  26.148  -16.777 1.00 10.00 ? 419 VAL B O    3  
ATOM 8077   C CB   . VAL B 2 101 ? 18.198  27.466  -19.154 1.00 10.00 ? 419 VAL B CB   3  
ATOM 8078   C CG1  . VAL B 2 101 ? 17.782  28.766  -18.482 1.00 10.00 ? 419 VAL B CG1  3  
ATOM 8079   C CG2  . VAL B 2 101 ? 18.564  27.718  -20.608 1.00 10.00 ? 419 VAL B CG2  3  
ATOM 8080   H H    . VAL B 2 101 ? 20.875  25.910  -19.609 1.00 10.00 ? 419 VAL B H    3  
ATOM 8081   N N    . PRO B 2 102 ? 19.885  25.945  -16.166 1.00 10.00 ? 420 PRO B N    3  
ATOM 8082   C CA   . PRO B 2 102 ? 19.592  25.381  -14.851 1.00 10.00 ? 420 PRO B CA   3  
ATOM 8083   C C    . PRO B 2 102 ? 19.154  26.414  -13.815 1.00 10.00 ? 420 PRO B C    3  
ATOM 8084   O O    . PRO B 2 102 ? 19.964  26.916  -13.034 1.00 10.00 ? 420 PRO B O    3  
ATOM 8085   C CB   . PRO B 2 102 ? 20.920  24.744  -14.449 1.00 10.00 ? 420 PRO B CB   3  
ATOM 8086   C CG   . PRO B 2 102 ? 21.954  25.584  -15.115 1.00 10.00 ? 420 PRO B CG   3  
ATOM 8087   C CD   . PRO B 2 102 ? 21.336  26.095  -16.389 1.00 10.00 ? 420 PRO B CD   3  
ATOM 8088   N N    . HIS B 2 103 ? 17.869  26.725  -13.806 1.00 10.00 ? 421 HIS B N    3  
ATOM 8089   C CA   . HIS B 2 103 ? 17.328  27.675  -12.845 1.00 10.00 ? 421 HIS B CA   3  
ATOM 8090   C C    . HIS B 2 103 ? 16.891  26.941  -11.593 1.00 10.00 ? 421 HIS B C    3  
ATOM 8091   O O    . HIS B 2 103 ? 16.734  27.535  -10.530 1.00 10.00 ? 421 HIS B O    3  
ATOM 8092   C CB   . HIS B 2 103 ? 16.163  28.460  -13.439 1.00 10.00 ? 421 HIS B CB   3  
ATOM 8093   C CG   . HIS B 2 103 ? 16.596  29.681  -14.181 1.00 10.00 ? 421 HIS B CG   3  
ATOM 8094   N ND1  . HIS B 2 103 ? 16.013  30.915  -14.005 1.00 10.00 ? 421 HIS B ND1  3  
ATOM 8095   C CD2  . HIS B 2 103 ? 17.560  29.853  -15.112 1.00 10.00 ? 421 HIS B CD2  3  
ATOM 8096   C CE1  . HIS B 2 103 ? 16.596  31.791  -14.796 1.00 10.00 ? 421 HIS B CE1  3  
ATOM 8097   N NE2  . HIS B 2 103 ? 17.537  31.173  -15.477 1.00 10.00 ? 421 HIS B NE2  3  
ATOM 8098   H H    . HIS B 2 103 ? 17.269  26.306  -14.463 1.00 10.00 ? 421 HIS B H    3  
ATOM 8099   H HD1  . HIS B 2 103 ? 15.276  31.121  -13.388 1.00 10.00 ? 421 HIS B HD1  3  
ATOM 8100   H HE2  . HIS B 2 103 ? 18.122  31.593  -16.141 1.00 10.00 ? 421 HIS B HE2  3  
ATOM 8101   N N    . SER B 2 104 ? 16.727  25.631  -11.733 1.00 10.00 ? 422 SER B N    3  
ATOM 8102   C CA   . SER B 2 104 ? 16.327  24.771  -10.628 1.00 10.00 ? 422 SER B CA   3  
ATOM 8103   C C    . SER B 2 104 ? 17.471  24.604  -9.626  1.00 10.00 ? 422 SER B C    3  
ATOM 8104   O O    . SER B 2 104 ? 17.344  23.892  -8.627  1.00 10.00 ? 422 SER B O    3  
ATOM 8105   C CB   . SER B 2 104 ? 15.902  23.408  -11.177 1.00 10.00 ? 422 SER B CB   3  
ATOM 8106   O OG   . SER B 2 104 ? 15.242  23.556  -12.425 1.00 10.00 ? 422 SER B OG   3  
ATOM 8107   H H    . SER B 2 104 ? 16.866  25.228  -12.617 1.00 10.00 ? 422 SER B H    3  
ATOM 8108   H HG   . SER B 2 104 ? 15.844  23.308  -13.142 1.00 10.00 ? 422 SER B HG   3  
ATOM 8109   N N    . TYR B 2 105 ? 18.590  25.271  -9.904  1.00 10.00 ? 423 TYR B N    3  
ATOM 8110   C CA   . TYR B 2 105 ? 19.763  25.218  -9.043  1.00 10.00 ? 423 TYR B CA   3  
ATOM 8111   C C    . TYR B 2 105 ? 19.462  25.795  -7.667  1.00 10.00 ? 423 TYR B C    3  
ATOM 8112   O O    . TYR B 2 105 ? 20.019  25.347  -6.667  1.00 10.00 ? 423 TYR B O    3  
ATOM 8113   C CB   . TYR B 2 105 ? 20.945  25.946  -9.685  1.00 10.00 ? 423 TYR B CB   3  
ATOM 8114   C CG   . TYR B 2 105 ? 21.856  25.048  -10.493 1.00 10.00 ? 423 TYR B CG   3  
ATOM 8115   C CD1  . TYR B 2 105 ? 21.505  23.733  -10.771 1.00 10.00 ? 423 TYR B CD1  3  
ATOM 8116   C CD2  . TYR B 2 105 ? 23.072  25.515  -10.976 1.00 10.00 ? 423 TYR B CD2  3  
ATOM 8117   C CE1  . TYR B 2 105 ? 22.335  22.911  -11.508 1.00 10.00 ? 423 TYR B CE1  3  
ATOM 8118   C CE2  . TYR B 2 105 ? 23.910  24.698  -11.716 1.00 10.00 ? 423 TYR B CE2  3  
ATOM 8119   C CZ   . TYR B 2 105 ? 23.536  23.396  -11.976 1.00 10.00 ? 423 TYR B CZ   3  
ATOM 8120   O OH   . TYR B 2 105 ? 24.362  22.579  -12.711 1.00 10.00 ? 423 TYR B OH   3  
ATOM 8121   H H    . TYR B 2 105 ? 18.624  25.818  -10.717 1.00 10.00 ? 423 TYR B H    3  
ATOM 8122   H HH   . TYR B 2 105 ? 25.281  22.852  -12.580 1.00 10.00 ? 423 TYR B HH   3  
ATOM 8123   N N    . SER B 2 106 ? 18.572  26.781  -7.624  1.00 10.00 ? 424 SER B N    3  
ATOM 8124   C CA   . SER B 2 106 ? 18.183  27.410  -6.369  1.00 10.00 ? 424 SER B CA   3  
ATOM 8125   C C    . SER B 2 106 ? 17.583  26.372  -5.429  1.00 10.00 ? 424 SER B C    3  
ATOM 8126   O O    . SER B 2 106 ? 17.840  26.380  -4.224  1.00 10.00 ? 424 SER B O    3  
ATOM 8127   C CB   . SER B 2 106 ? 17.161  28.512  -6.648  1.00 10.00 ? 424 SER B CB   3  
ATOM 8128   O OG   . SER B 2 106 ? 16.386  28.192  -7.795  1.00 10.00 ? 424 SER B OG   3  
ATOM 8129   H H    . SER B 2 106 ? 18.160  27.093  -8.458  1.00 10.00 ? 424 SER B H    3  
ATOM 8130   H HG   . SER B 2 106 ? 16.660  28.751  -8.533  1.00 10.00 ? 424 SER B HG   3  
ATOM 8131   N N    . VAL B 2 107 ? 16.795  25.467  -5.996  1.00 10.00 ? 425 VAL B N    3  
ATOM 8132   C CA   . VAL B 2 107 ? 16.165  24.411  -5.227  1.00 10.00 ? 425 VAL B CA   3  
ATOM 8133   C C    . VAL B 2 107 ? 17.183  23.321  -4.910  1.00 10.00 ? 425 VAL B C    3  
ATOM 8134   O O    . VAL B 2 107 ? 17.267  22.850  -3.778  1.00 10.00 ? 425 VAL B O    3  
ATOM 8135   C CB   . VAL B 2 107 ? 14.969  23.790  -5.984  1.00 10.00 ? 425 VAL B CB   3  
ATOM 8136   C CG1  . VAL B 2 107 ? 14.220  22.804  -5.099  1.00 10.00 ? 425 VAL B CG1  3  
ATOM 8137   C CG2  . VAL B 2 107 ? 14.032  24.878  -6.488  1.00 10.00 ? 425 VAL B CG2  3  
ATOM 8138   H H    . VAL B 2 107 ? 16.639  25.514  -6.963  1.00 10.00 ? 425 VAL B H    3  
ATOM 8139   N N    . LEU B 2 108 ? 17.955  22.939  -5.924  1.00 10.00 ? 426 LEU B N    3  
ATOM 8140   C CA   . LEU B 2 108 ? 18.985  21.911  -5.772  1.00 10.00 ? 426 LEU B CA   3  
ATOM 8141   C C    . LEU B 2 108 ? 19.936  22.233  -4.624  1.00 10.00 ? 426 LEU B C    3  
ATOM 8142   O O    . LEU B 2 108 ? 20.099  21.431  -3.706  1.00 10.00 ? 426 LEU B O    3  
ATOM 8143   C CB   . LEU B 2 108 ? 19.775  21.746  -7.078  1.00 10.00 ? 426 LEU B CB   3  
ATOM 8144   C CG   . LEU B 2 108 ? 20.989  20.814  -7.022  1.00 10.00 ? 426 LEU B CG   3  
ATOM 8145   C CD1  . LEU B 2 108 ? 20.561  19.377  -6.773  1.00 10.00 ? 426 LEU B CD1  3  
ATOM 8146   C CD2  . LEU B 2 108 ? 21.809  20.922  -8.296  1.00 10.00 ? 426 LEU B CD2  3  
ATOM 8147   H H    . LEU B 2 108 ? 17.821  23.345  -6.806  1.00 10.00 ? 426 LEU B H    3  
ATOM 8148   N N    . GLU B 2 109 ? 20.526  23.421  -4.658  1.00 10.00 ? 427 GLU B N    3  
ATOM 8149   C CA   . GLU B 2 109 ? 21.465  23.839  -3.626  1.00 10.00 ? 427 GLU B CA   3  
ATOM 8150   C C    . GLU B 2 109 ? 20.775  23.907  -2.272  1.00 10.00 ? 427 GLU B C    3  
ATOM 8151   O O    . GLU B 2 109 ? 21.280  23.381  -1.280  1.00 10.00 ? 427 GLU B O    3  
ATOM 8152   C CB   . GLU B 2 109 ? 22.086  25.191  -3.978  1.00 10.00 ? 427 GLU B CB   3  
ATOM 8153   C CG   . GLU B 2 109 ? 23.221  25.109  -4.986  1.00 10.00 ? 427 GLU B CG   3  
ATOM 8154   C CD   . GLU B 2 109 ? 24.487  24.553  -4.376  1.00 10.00 ? 427 GLU B CD   3  
ATOM 8155   O OE1  . GLU B 2 109 ? 25.295  25.350  -3.852  1.00 10.00 ? 427 GLU B OE1  3  
ATOM 8156   O OE2  . GLU B 2 109 ? 24.679  23.319  -4.408  1.00 10.00 ? 427 GLU B OE2  3  
ATOM 8157   H H    . GLU B 2 109 ? 20.325  24.038  -5.399  1.00 10.00 ? 427 GLU B H    3  
ATOM 8158   N N    . ARG B 2 110 ? 19.627  24.567  -2.252  1.00 10.00 ? 428 ARG B N    3  
ATOM 8159   C CA   . ARG B 2 110 ? 18.829  24.713  -1.038  1.00 10.00 ? 428 ARG B CA   3  
ATOM 8160   C C    . ARG B 2 110 ? 18.568  23.358  -0.383  1.00 10.00 ? 428 ARG B C    3  
ATOM 8161   O O    . ARG B 2 110 ? 18.770  23.186  0.817   1.00 10.00 ? 428 ARG B O    3  
ATOM 8162   C CB   . ARG B 2 110 ? 17.497  25.389  -1.371  1.00 10.00 ? 428 ARG B CB   3  
ATOM 8163   C CG   . ARG B 2 110 ? 16.623  25.684  -0.166  1.00 10.00 ? 428 ARG B CG   3  
ATOM 8164   C CD   . ARG B 2 110 ? 15.198  25.973  -0.590  1.00 10.00 ? 428 ARG B CD   3  
ATOM 8165   N NE   . ARG B 2 110 ? 14.413  26.569  0.489   1.00 10.00 ? 428 ARG B NE   3  
ATOM 8166   C CZ   . ARG B 2 110 ? 13.492  27.513  0.301   1.00 10.00 ? 428 ARG B CZ   3  
ATOM 8167   N NH1  . ARG B 2 110 ? 13.259  27.979  -0.924  1.00 10.00 ? 428 ARG B NH1  3  
ATOM 8168   N NH2  . ARG B 2 110 ? 12.803  27.988  1.330   1.00 10.00 ? 428 ARG B NH2  3  
ATOM 8169   H H    . ARG B 2 110 ? 19.327  25.000  -3.081  1.00 10.00 ? 428 ARG B H    3  
ATOM 8170   H HE   . ARG B 2 110 ? 14.574  26.240  1.404   1.00 10.00 ? 428 ARG B HE   3  
ATOM 8171   H HH11 . ARG B 2 110 ? 13.764  27.621  -1.708  1.00 10.00 ? 428 ARG B HH11 3  
ATOM 8172   H HH12 . ARG B 2 110 ? 12.578  28.707  -1.066  1.00 10.00 ? 428 ARG B HH12 3  
ATOM 8173   H HH21 . ARG B 2 110 ? 12.970  27.633  2.258   1.00 10.00 ? 428 ARG B HH21 3  
ATOM 8174   H HH22 . ARG B 2 110 ? 12.108  28.695  1.191   1.00 10.00 ? 428 ARG B HH22 3  
ATOM 8175   N N    . PHE B 2 111 ? 18.096  22.409  -1.182  1.00 10.00 ? 429 PHE B N    3  
ATOM 8176   C CA   . PHE B 2 111 ? 17.808  21.070  -0.696  1.00 10.00 ? 429 PHE B CA   3  
ATOM 8177   C C    . PHE B 2 111 ? 19.059  20.372  -0.165  1.00 10.00 ? 429 PHE B C    3  
ATOM 8178   O O    . PHE B 2 111 ? 19.031  19.783  0.914   1.00 10.00 ? 429 PHE B O    3  
ATOM 8179   C CB   . PHE B 2 111 ? 17.153  20.234  -1.797  1.00 10.00 ? 429 PHE B CB   3  
ATOM 8180   C CG   . PHE B 2 111 ? 16.583  18.924  -1.331  1.00 10.00 ? 429 PHE B CG   3  
ATOM 8181   C CD1  . PHE B 2 111 ? 16.055  18.791  -0.057  1.00 10.00 ? 429 PHE B CD1  3  
ATOM 8182   C CD2  . PHE B 2 111 ? 16.567  17.825  -2.175  1.00 10.00 ? 429 PHE B CD2  3  
ATOM 8183   C CE1  . PHE B 2 111 ? 15.527  17.590  0.368   1.00 10.00 ? 429 PHE B CE1  3  
ATOM 8184   C CE2  . PHE B 2 111 ? 16.038  16.620  -1.754  1.00 10.00 ? 429 PHE B CE2  3  
ATOM 8185   C CZ   . PHE B 2 111 ? 15.518  16.503  -0.480  1.00 10.00 ? 429 PHE B CZ   3  
ATOM 8186   H H    . PHE B 2 111 ? 17.885  22.635  -2.117  1.00 10.00 ? 429 PHE B H    3  
ATOM 8187   N N    . VAL B 2 112 ? 20.161  20.475  -0.897  1.00 10.00 ? 430 VAL B N    3  
ATOM 8188   C CA   . VAL B 2 112 ? 21.400  19.826  -0.492  1.00 10.00 ? 430 VAL B CA   3  
ATOM 8189   C C    . VAL B 2 112 ? 21.978  20.462  0.771   1.00 10.00 ? 430 VAL B C    3  
ATOM 8190   O O    . VAL B 2 112 ? 22.432  19.757  1.679   1.00 10.00 ? 430 VAL B O    3  
ATOM 8191   C CB   . VAL B 2 112 ? 22.454  19.852  -1.620  1.00 10.00 ? 430 VAL B CB   3  
ATOM 8192   C CG1  . VAL B 2 112 ? 23.763  19.232  -1.158  1.00 10.00 ? 430 VAL B CG1  3  
ATOM 8193   C CG2  . VAL B 2 112 ? 21.932  19.119  -2.846  1.00 10.00 ? 430 VAL B CG2  3  
ATOM 8194   H H    . VAL B 2 112 ? 20.164  21.022  -1.718  1.00 10.00 ? 430 VAL B H    3  
ATOM 8195   N N    . GLU B 2 113 ? 21.964  21.791  0.837   1.00 10.00 ? 431 GLU B N    3  
ATOM 8196   C CA   . GLU B 2 113 ? 22.490  22.484  2.003   1.00 10.00 ? 431 GLU B CA   3  
ATOM 8197   C C    . GLU B 2 113 ? 21.659  22.180  3.243   1.00 10.00 ? 431 GLU B C    3  
ATOM 8198   O O    . GLU B 2 113 ? 22.186  22.127  4.354   1.00 10.00 ? 431 GLU B O    3  
ATOM 8199   C CB   . GLU B 2 113 ? 22.637  23.993  1.771   1.00 10.00 ? 431 GLU B CB   3  
ATOM 8200   C CG   . GLU B 2 113 ? 21.345  24.790  1.824   1.00 10.00 ? 431 GLU B CG   3  
ATOM 8201   C CD   . GLU B 2 113 ? 21.589  26.268  2.045   1.00 10.00 ? 431 GLU B CD   3  
ATOM 8202   O OE1  . GLU B 2 113 ? 22.316  26.883  1.234   1.00 10.00 ? 431 GLU B OE1  3  
ATOM 8203   O OE2  . GLU B 2 113 ? 21.060  26.823  3.027   1.00 10.00 ? 431 GLU B OE2  3  
ATOM 8204   H H    . GLU B 2 113 ? 21.596  22.312  0.084   1.00 10.00 ? 431 GLU B H    3  
ATOM 8205   N N    . GLU B 2 114 ? 20.358  21.972  3.046   1.00 10.00 ? 432 GLU B N    3  
ATOM 8206   C CA   . GLU B 2 114 ? 19.460  21.641  4.144   1.00 10.00 ? 432 GLU B CA   3  
ATOM 8207   C C    . GLU B 2 114 ? 19.853  20.289  4.727   1.00 10.00 ? 432 GLU B C    3  
ATOM 8208   O O    . GLU B 2 114 ? 19.961  20.131  5.944   1.00 10.00 ? 432 GLU B O    3  
ATOM 8209   C CB   . GLU B 2 114 ? 18.015  21.588  3.648   1.00 10.00 ? 432 GLU B CB   3  
ATOM 8210   C CG   . GLU B 2 114 ? 16.987  21.397  4.751   1.00 10.00 ? 432 GLU B CG   3  
ATOM 8211   C CD   . GLU B 2 114 ? 16.954  22.558  5.720   1.00 10.00 ? 432 GLU B CD   3  
ATOM 8212   O OE1  . GLU B 2 114 ? 16.639  23.684  5.287   1.00 10.00 ? 432 GLU B OE1  3  
ATOM 8213   O OE2  . GLU B 2 114 ? 17.231  22.347  6.923   1.00 10.00 ? 432 GLU B OE2  3  
ATOM 8214   H H    . GLU B 2 114 ? 19.996  22.054  2.137   1.00 10.00 ? 432 GLU B H    3  
ATOM 8215   N N    . CYS B 2 115 ? 20.054  19.316  3.840   1.00 10.00 ? 433 CYS B N    3  
ATOM 8216   C CA   . CYS B 2 115 ? 20.457  17.977  4.252   1.00 10.00 ? 433 CYS B CA   3  
ATOM 8217   C C    . CYS B 2 115 ? 21.744  18.009  5.078   1.00 10.00 ? 433 CYS B C    3  
ATOM 8218   O O    . CYS B 2 115 ? 21.808  17.397  6.150   1.00 10.00 ? 433 CYS B O    3  
ATOM 8219   C CB   . CYS B 2 115 ? 20.614  17.054  3.039   1.00 10.00 ? 433 CYS B CB   3  
ATOM 8220   S SG   . CYS B 2 115 ? 19.065  16.696  2.180   1.00 10.00 ? 433 CYS B SG   3  
ATOM 8221   H H    . CYS B 2 115 ? 19.856  19.495  2.895   1.00 10.00 ? 433 CYS B H    3  
ATOM 8222   H HG   . CYS B 2 115 ? 19.282  16.818  0.874   1.00 10.00 ? 433 CYS B HG   3  
ATOM 8223   N N    . PHE B 2 116 ? 22.771  18.715  4.596   1.00 10.00 ? 434 PHE B N    3  
ATOM 8224   C CA   . PHE B 2 116 ? 24.026  18.830  5.326   1.00 10.00 ? 434 PHE B CA   3  
ATOM 8225   C C    . PHE B 2 116 ? 23.809  19.500  6.679   1.00 10.00 ? 434 PHE B C    3  
ATOM 8226   O O    . PHE B 2 116 ? 24.371  19.074  7.689   1.00 10.00 ? 434 PHE B O    3  
ATOM 8227   C CB   . PHE B 2 116 ? 25.056  19.605  4.500   1.00 10.00 ? 434 PHE B CB   3  
ATOM 8228   C CG   . PHE B 2 116 ? 26.313  19.950  5.250   1.00 10.00 ? 434 PHE B CG   3  
ATOM 8229   C CD1  . PHE B 2 116 ? 27.210  18.962  5.630   1.00 10.00 ? 434 PHE B CD1  3  
ATOM 8230   C CD2  . PHE B 2 116 ? 26.598  21.265  5.575   1.00 10.00 ? 434 PHE B CD2  3  
ATOM 8231   C CE1  . PHE B 2 116 ? 28.363  19.281  6.322   1.00 10.00 ? 434 PHE B CE1  3  
ATOM 8232   C CE2  . PHE B 2 116 ? 27.747  21.592  6.267   1.00 10.00 ? 434 PHE B CE2  3  
ATOM 8233   C CZ   . PHE B 2 116 ? 28.632  20.599  6.640   1.00 10.00 ? 434 PHE B CZ   3  
ATOM 8234   H H    . PHE B 2 116 ? 22.707  19.139  3.712   1.00 10.00 ? 434 PHE B H    3  
ATOM 8235   N N    . GLN B 2 117 ? 23.002  20.565  6.692   1.00 10.00 ? 435 GLN B N    3  
ATOM 8236   C CA   . GLN B 2 117 ? 22.689  21.275  7.926   1.00 10.00 ? 435 GLN B CA   3  
ATOM 8237   C C    . GLN B 2 117 ? 22.120  20.320  8.969   1.00 10.00 ? 435 GLN B C    3  
ATOM 8238   O O    . GLN B 2 117 ? 22.404  20.443  10.162  1.00 10.00 ? 435 GLN B O    3  
ATOM 8239   C CB   . GLN B 2 117 ? 21.692  22.404  7.661   1.00 10.00 ? 435 GLN B CB   3  
ATOM 8240   C CG   . GLN B 2 117 ? 22.328  23.717  7.240   1.00 10.00 ? 435 GLN B CG   3  
ATOM 8241   C CD   . GLN B 2 117 ? 21.304  24.721  6.750   1.00 10.00 ? 435 GLN B CD   3  
ATOM 8242   O OE1  . GLN B 2 117 ? 20.713  25.463  7.538   1.00 10.00 ? 435 GLN B OE1  3  
ATOM 8243   N NE2  . GLN B 2 117 ? 21.086  24.750  5.446   1.00 10.00 ? 435 GLN B NE2  3  
ATOM 8244   H H    . GLN B 2 117 ? 22.663  20.900  5.831   1.00 10.00 ? 435 GLN B H    3  
ATOM 8245   H HE21 . GLN B 2 117 ? 21.591  24.128  4.881   1.00 10.00 ? 435 GLN B HE21 3  
ATOM 8246   H HE22 . GLN B 2 117 ? 20.438  25.399  5.094   1.00 10.00 ? 435 GLN B HE22 3  
ATOM 8247   N N    . ALA B 2 118 ? 21.297  19.377  8.509   1.00 10.00 ? 436 ALA B N    3  
ATOM 8248   C CA   . ALA B 2 118 ? 20.689  18.374  9.380   1.00 10.00 ? 436 ALA B CA   3  
ATOM 8249   C C    . ALA B 2 118 ? 21.742  17.443  9.987   1.00 10.00 ? 436 ALA B C    3  
ATOM 8250   O O    . ALA B 2 118 ? 21.510  16.829  11.029  1.00 10.00 ? 436 ALA B O    3  
ATOM 8251   C CB   . ALA B 2 118 ? 19.651  17.573  8.613   1.00 10.00 ? 436 ALA B CB   3  
ATOM 8252   H H    . ALA B 2 118 ? 21.065  19.380  7.553   1.00 10.00 ? 436 ALA B H    3  
ATOM 8253   N N    . GLY B 2 119 ? 22.892  17.343  9.326   1.00 10.00 ? 437 GLY B N    3  
ATOM 8254   C CA   . GLY B 2 119 ? 23.966  16.504  9.819   1.00 10.00 ? 437 GLY B CA   3  
ATOM 8255   C C    . GLY B 2 119 ? 23.763  15.033  9.524   1.00 10.00 ? 437 GLY B C    3  
ATOM 8256   O O    . GLY B 2 119 ? 24.142  14.176  10.324  1.00 10.00 ? 437 GLY B O    3  
ATOM 8257   H H    . GLY B 2 119 ? 23.012  17.855  8.498   1.00 10.00 ? 437 GLY B H    3  
ATOM 8258   N N    . ILE B 2 120 ? 23.169  14.732  8.383   1.00 10.00 ? 438 ILE B N    3  
ATOM 8259   C CA   . ILE B 2 120 ? 22.932  13.343  8.000   1.00 10.00 ? 438 ILE B CA   3  
ATOM 8260   C C    . ILE B 2 120 ? 24.000  12.854  7.020   1.00 10.00 ? 438 ILE B C    3  
ATOM 8261   O O    . ILE B 2 120 ? 24.232  11.654  6.881   1.00 10.00 ? 438 ILE B O    3  
ATOM 8262   C CB   . ILE B 2 120 ? 21.526  13.130  7.402   1.00 10.00 ? 438 ILE B CB   3  
ATOM 8263   C CG1  . ILE B 2 120 ? 21.275  14.069  6.214   1.00 10.00 ? 438 ILE B CG1  3  
ATOM 8264   C CG2  . ILE B 2 120 ? 20.458  13.310  8.475   1.00 10.00 ? 438 ILE B CG2  3  
ATOM 8265   C CD1  . ILE B 2 120 ? 19.931  13.869  5.547   1.00 10.00 ? 438 ILE B CD1  3  
ATOM 8266   H H    . ILE B 2 120 ? 22.889  15.452  7.781   1.00 10.00 ? 438 ILE B H    3  
ATOM 8267   N N    . ILE B 2 121 ? 24.648  13.800  6.351   1.00 10.00 ? 439 ILE B N    3  
ATOM 8268   C CA   . ILE B 2 121 ? 25.688  13.491  5.376   1.00 10.00 ? 439 ILE B CA   3  
ATOM 8269   C C    . ILE B 2 121 ? 26.814  14.509  5.507   1.00 10.00 ? 439 ILE B C    3  
ATOM 8270   O O    . ILE B 2 121 ? 26.553  15.700  5.682   1.00 10.00 ? 439 ILE B O    3  
ATOM 8271   C CB   . ILE B 2 121 ? 25.137  13.563  3.936   1.00 10.00 ? 439 ILE B CB   3  
ATOM 8272   C CG1  . ILE B 2 121 ? 24.279  14.824  3.753   1.00 10.00 ? 439 ILE B CG1  3  
ATOM 8273   C CG2  . ILE B 2 121 ? 24.331  12.312  3.606   1.00 10.00 ? 439 ILE B CG2  3  
ATOM 8274   C CD1  . ILE B 2 121 ? 24.260  15.362  2.338   1.00 10.00 ? 439 ILE B CD1  3  
ATOM 8275   H H    . ILE B 2 121 ? 24.428  14.736  6.521   1.00 10.00 ? 439 ILE B H    3  
ATOM 8276   N N    . SER B 2 122 ? 28.060  14.053  5.463   1.00 10.00 ? 440 SER B N    3  
ATOM 8277   C CA   . SER B 2 122 ? 29.203  14.943  5.562   1.00 10.00 ? 440 SER B CA   3  
ATOM 8278   C C    . SER B 2 122 ? 29.401  15.779  4.299   1.00 10.00 ? 440 SER B C    3  
ATOM 8279   O O    . SER B 2 122 ? 28.605  15.724  3.358   1.00 10.00 ? 440 SER B O    3  
ATOM 8280   C CB   . SER B 2 122 ? 30.441  14.096  5.826   1.00 10.00 ? 440 SER B CB   3  
ATOM 8281   O OG   . SER B 2 122 ? 30.072  12.743  6.033   1.00 10.00 ? 440 SER B OG   3  
ATOM 8282   H H    . SER B 2 122 ? 28.258  13.092  5.433   1.00 10.00 ? 440 SER B H    3  
ATOM 8283   H HG   . SER B 2 122 ? 30.559  12.396  6.790   1.00 10.00 ? 440 SER B HG   3  
ATOM 8284   N N    . LYS B 2 123 ? 30.502  16.522  4.271   1.00 10.00 ? 441 LYS B N    3  
ATOM 8285   C CA   . LYS B 2 123 ? 30.823  17.403  3.156   1.00 10.00 ? 441 LYS B CA   3  
ATOM 8286   C C    . LYS B 2 123 ? 31.179  16.664  1.871   1.00 10.00 ? 441 LYS B C    3  
ATOM 8287   O O    . LYS B 2 123 ? 31.059  17.232  0.794   1.00 10.00 ? 441 LYS B O    3  
ATOM 8288   C CB   . LYS B 2 123 ? 31.928  18.385  3.534   1.00 10.00 ? 441 LYS B CB   3  
ATOM 8289   C CG   . LYS B 2 123 ? 31.470  19.513  4.442   1.00 10.00 ? 441 LYS B CG   3  
ATOM 8290   C CD   . LYS B 2 123 ? 32.644  20.331  4.947   1.00 10.00 ? 441 LYS B CD   3  
ATOM 8291   C CE   . LYS B 2 123 ? 33.500  19.527  5.912   1.00 10.00 ? 441 LYS B CE   3  
ATOM 8292   N NZ   . LYS B 2 123 ? 34.657  20.312  6.406   1.00 10.00 ? 441 LYS B NZ   3  
ATOM 8293   H H    . LYS B 2 123 ? 31.131  16.461  5.021   1.00 10.00 ? 441 LYS B H    3  
ATOM 8294   H HZ1  . LYS B 2 123 ? 34.327  21.165  6.900   1.00 10.00 ? 441 LYS B HZ1  3  
ATOM 8295   H HZ2  . LYS B 2 123 ? 35.258  20.601  5.607   1.00 10.00 ? 441 LYS B HZ2  3  
ATOM 8296   H HZ3  . LYS B 2 123 ? 35.223  19.741  7.062   1.00 10.00 ? 441 LYS B HZ3  3  
ATOM 8297   N N    . GLN B 2 124 ? 31.627  15.413  1.977   1.00 10.00 ? 442 GLN B N    3  
ATOM 8298   C CA   . GLN B 2 124 ? 31.990  14.634  0.789   1.00 10.00 ? 442 GLN B CA   3  
ATOM 8299   C C    . GLN B 2 124 ? 30.867  14.609  -0.249  1.00 10.00 ? 442 GLN B C    3  
ATOM 8300   O O    . GLN B 2 124 ? 31.116  14.667  -1.452  1.00 10.00 ? 442 GLN B O    3  
ATOM 8301   C CB   . GLN B 2 124 ? 32.397  13.207  1.154   1.00 10.00 ? 442 GLN B CB   3  
ATOM 8302   C CG   . GLN B 2 124 ? 33.302  12.568  0.115   1.00 10.00 ? 442 GLN B CG   3  
ATOM 8303   C CD   . GLN B 2 124 ? 33.396  11.067  0.256   1.00 10.00 ? 442 GLN B CD   3  
ATOM 8304   O OE1  . GLN B 2 124 ? 32.659  10.323  -0.394  1.00 10.00 ? 442 GLN B OE1  3  
ATOM 8305   N NE2  . GLN B 2 124 ? 34.295  10.612  1.112   1.00 10.00 ? 442 GLN B NE2  3  
ATOM 8306   H H    . GLN B 2 124 ? 31.750  15.023  2.868   1.00 10.00 ? 442 GLN B H    3  
ATOM 8307   H HE21 . GLN B 2 124 ? 34.840  11.264  1.599   1.00 10.00 ? 442 GLN B HE21 3  
ATOM 8308   H HE22 . GLN B 2 124 ? 34.378  9.642   1.225   1.00 10.00 ? 442 GLN B HE22 3  
ATOM 8309   N N    . LEU B 2 125 ? 29.627  14.529  0.219   1.00 10.00 ? 443 LEU B N    3  
ATOM 8310   C CA   . LEU B 2 125 ? 28.480  14.510  -0.675  1.00 10.00 ? 443 LEU B CA   3  
ATOM 8311   C C    . LEU B 2 125 ? 28.201  15.917  -1.197  1.00 10.00 ? 443 LEU B C    3  
ATOM 8312   O O    . LEU B 2 125 ? 27.860  16.112  -2.365  1.00 10.00 ? 443 LEU B O    3  
ATOM 8313   C CB   . LEU B 2 125 ? 27.253  13.940  0.043   1.00 10.00 ? 443 LEU B CB   3  
ATOM 8314   C CG   . LEU B 2 125 ? 26.163  13.346  -0.855  1.00 10.00 ? 443 LEU B CG   3  
ATOM 8315   C CD1  . LEU B 2 125 ? 26.766  12.359  -1.839  1.00 10.00 ? 443 LEU B CD1  3  
ATOM 8316   C CD2  . LEU B 2 125 ? 25.092  12.661  -0.021  1.00 10.00 ? 443 LEU B CD2  3  
ATOM 8317   H H    . LEU B 2 125 ? 29.480  14.488  1.186   1.00 10.00 ? 443 LEU B H    3  
ATOM 8318   N N    . ARG B 2 126 ? 28.350  16.898  -0.308  1.00 10.00 ? 444 ARG B N    3  
ATOM 8319   C CA   . ARG B 2 126 ? 28.150  18.300  -0.648  1.00 10.00 ? 444 ARG B CA   3  
ATOM 8320   C C    . ARG B 2 126 ? 29.184  18.747  -1.686  1.00 10.00 ? 444 ARG B C    3  
ATOM 8321   O O    . ARG B 2 126 ? 28.884  19.528  -2.581  1.00 10.00 ? 444 ARG B O    3  
ATOM 8322   C CB   . ARG B 2 126 ? 28.284  19.150  0.625   1.00 10.00 ? 444 ARG B CB   3  
ATOM 8323   C CG   . ARG B 2 126 ? 28.368  20.648  0.386   1.00 10.00 ? 444 ARG B CG   3  
ATOM 8324   C CD   . ARG B 2 126 ? 27.016  21.237  0.018   1.00 10.00 ? 444 ARG B CD   3  
ATOM 8325   N NE   . ARG B 2 126 ? 27.123  22.647  -0.349  1.00 10.00 ? 444 ARG B NE   3  
ATOM 8326   C CZ   . ARG B 2 126 ? 26.536  23.178  -1.418  1.00 10.00 ? 444 ARG B CZ   3  
ATOM 8327   N NH1  . ARG B 2 126 ? 25.799  22.422  -2.222  1.00 10.00 ? 444 ARG B NH1  3  
ATOM 8328   N NH2  . ARG B 2 126 ? 26.695  24.467  -1.703  1.00 10.00 ? 444 ARG B NH2  3  
ATOM 8329   H H    . ARG B 2 126 ? 28.589  16.663  0.616   1.00 10.00 ? 444 ARG B H    3  
ATOM 8330   H HE   . ARG B 2 126 ? 27.673  23.221  0.236   1.00 10.00 ? 444 ARG B HE   3  
ATOM 8331   H HH11 . ARG B 2 126 ? 25.670  21.453  -2.021  1.00 10.00 ? 444 ARG B HH11 3  
ATOM 8332   H HH12 . ARG B 2 126 ? 25.384  22.820  -3.062  1.00 10.00 ? 444 ARG B HH12 3  
ATOM 8333   H HH21 . ARG B 2 126 ? 27.264  25.044  -1.123  1.00 10.00 ? 444 ARG B HH21 3  
ATOM 8334   H HH22 . ARG B 2 126 ? 26.217  24.875  -2.493  1.00 10.00 ? 444 ARG B HH22 3  
ATOM 8335   N N    . ASP B 2 127 ? 30.395  18.223  -1.549  1.00 10.00 ? 445 ASP B N    3  
ATOM 8336   C CA   . ASP B 2 127 ? 31.502  18.530  -2.454  1.00 10.00 ? 445 ASP B CA   3  
ATOM 8337   C C    . ASP B 2 127 ? 31.200  18.042  -3.866  1.00 10.00 ? 445 ASP B C    3  
ATOM 8338   O O    . ASP B 2 127 ? 31.737  18.561  -4.847  1.00 10.00 ? 445 ASP B O    3  
ATOM 8339   C CB   . ASP B 2 127 ? 32.786  17.878  -1.924  1.00 10.00 ? 445 ASP B CB   3  
ATOM 8340   C CG   . ASP B 2 127 ? 34.038  18.291  -2.679  1.00 10.00 ? 445 ASP B CG   3  
ATOM 8341   O OD1  . ASP B 2 127 ? 34.325  19.503  -2.754  1.00 10.00 ? 445 ASP B OD1  3  
ATOM 8342   O OD2  . ASP B 2 127 ? 34.753  17.395  -3.180  1.00 10.00 ? 445 ASP B OD2  3  
ATOM 8343   H H    . ASP B 2 127 ? 30.560  17.616  -0.795  1.00 10.00 ? 445 ASP B H    3  
ATOM 8344   N N    . LEU B 2 128 ? 30.331  17.039  -3.962  1.00 10.00 ? 446 LEU B N    3  
ATOM 8345   C CA   . LEU B 2 128 ? 29.935  16.478  -5.248  1.00 10.00 ? 446 LEU B CA   3  
ATOM 8346   C C    . LEU B 2 128 ? 28.837  17.317  -5.897  1.00 10.00 ? 446 LEU B C    3  
ATOM 8347   O O    . LEU B 2 128 ? 28.506  17.138  -7.068  1.00 10.00 ? 446 LEU B O    3  
ATOM 8348   C CB   . LEU B 2 128 ? 29.479  15.025  -5.084  1.00 10.00 ? 446 LEU B CB   3  
ATOM 8349   C CG   . LEU B 2 128 ? 30.575  14.016  -4.733  1.00 10.00 ? 446 LEU B CG   3  
ATOM 8350   C CD1  . LEU B 2 128 ? 29.973  12.683  -4.322  1.00 10.00 ? 446 LEU B CD1  3  
ATOM 8351   C CD2  . LEU B 2 128 ? 31.531  13.834  -5.904  1.00 10.00 ? 446 LEU B CD2  3  
ATOM 8352   H H    . LEU B 2 128 ? 29.949  16.662  -3.140  1.00 10.00 ? 446 LEU B H    3  
ATOM 8353   N N    . CYS B 2 129 ? 28.285  18.242  -5.125  1.00 10.00 ? 447 CYS B N    3  
ATOM 8354   C CA   . CYS B 2 129 ? 27.237  19.122  -5.614  1.00 10.00 ? 447 CYS B CA   3  
ATOM 8355   C C    . CYS B 2 129 ? 27.873  20.371  -6.220  1.00 10.00 ? 447 CYS B C    3  
ATOM 8356   O O    . CYS B 2 129 ? 28.853  20.894  -5.677  1.00 10.00 ? 447 CYS B O    3  
ATOM 8357   C CB   . CYS B 2 129 ? 26.276  19.503  -4.477  1.00 10.00 ? 447 CYS B CB   3  
ATOM 8358   S SG   . CYS B 2 129 ? 24.707  20.223  -5.017  1.00 10.00 ? 447 CYS B SG   3  
ATOM 8359   H H    . CYS B 2 129 ? 28.606  18.348  -4.208  1.00 10.00 ? 447 CYS B H    3  
ATOM 8360   H HG   . CYS B 2 129 ? 24.838  21.548  -5.023  1.00 10.00 ? 447 CYS B HG   3  
ATOM 8361   N N    . PRO B 2 130 ? 27.348  20.842  -7.364  1.00 10.00 ? 448 PRO B N    3  
ATOM 8362   C CA   . PRO B 2 130 ? 27.868  22.027  -8.057  1.00 10.00 ? 448 PRO B CA   3  
ATOM 8363   C C    . PRO B 2 130 ? 27.690  23.315  -7.249  1.00 10.00 ? 448 PRO B C    3  
ATOM 8364   O O    . PRO B 2 130 ? 26.762  24.093  -7.491  1.00 10.00 ? 448 PRO B O    3  
ATOM 8365   C CB   . PRO B 2 130 ? 27.039  22.084  -9.347  1.00 10.00 ? 448 PRO B CB   3  
ATOM 8366   C CG   . PRO B 2 130 ? 25.795  21.327  -9.030  1.00 10.00 ? 448 PRO B CG   3  
ATOM 8367   C CD   . PRO B 2 130 ? 26.208  20.243  -8.080  1.00 10.00 ? 448 PRO B CD   3  
ATOM 8368   N N    . SER B 2 131 ? 28.582  23.529  -6.295  1.00 10.00 ? 449 SER B N    3  
ATOM 8369   C CA   . SER B 2 131 ? 28.536  24.716  -5.462  1.00 10.00 ? 449 SER B CA   3  
ATOM 8370   C C    . SER B 2 131 ? 29.036  25.920  -6.249  1.00 10.00 ? 449 SER B C    3  
ATOM 8371   O O    . SER B 2 131 ? 28.294  26.916  -6.354  1.00 10.00 ? 449 SER B O    3  
ATOM 8372   C CB   . SER B 2 131 ? 29.382  24.523  -4.202  1.00 10.00 ? 449 SER B CB   3  
ATOM 8373   O OG   . SER B 2 131 ? 29.200  23.227  -3.648  1.00 10.00 ? 449 SER B OG   3  
ATOM 8374   O OXT  . SER B 2 131 ? 30.166  25.857  -6.778  1.00 10.00 ? 449 SER B OXT  3  
ATOM 8375   H H    . SER B 2 131 ? 29.297  22.874  -6.154  1.00 10.00 ? 449 SER B H    3  
ATOM 8376   H HG   . SER B 2 131 ? 28.731  22.671  -4.279  1.00 10.00 ? 449 SER B HG   3  
ATOM 8377   N N    . GLY A 1 1   ? -30.607 -6.012  6.861   1.00 10.00 ? 156 GLY A N    4  
ATOM 8378   C CA   . GLY A 1 1   ? -30.605 -5.212  8.107   1.00 10.00 ? 156 GLY A CA   4  
ATOM 8379   C C    . GLY A 1 1   ? -29.761 -5.853  9.190   1.00 10.00 ? 156 GLY A C    4  
ATOM 8380   O O    . GLY A 1 1   ? -28.627 -5.439  9.430   1.00 10.00 ? 156 GLY A O    4  
ATOM 8381   H H1   . GLY A 1 1   ? -29.627 -6.233  6.580   1.00 10.00 ? 156 GLY A H1   4  
ATOM 8382   H H2   . GLY A 1 1   ? -31.065 -5.486  6.093   1.00 10.00 ? 156 GLY A H2   4  
ATOM 8383   H H3   . GLY A 1 1   ? -31.118 -6.904  7.010   1.00 10.00 ? 156 GLY A H3   4  
ATOM 8384   N N    . LEU A 1 2   ? -30.312 -6.864  9.846   1.00 10.00 ? 157 LEU A N    4  
ATOM 8385   C CA   . LEU A 1 2   ? -29.607 -7.566  10.907  1.00 10.00 ? 157 LEU A CA   4  
ATOM 8386   C C    . LEU A 1 2   ? -29.513 -9.052  10.598  1.00 10.00 ? 157 LEU A C    4  
ATOM 8387   O O    . LEU A 1 2   ? -30.525 -9.697  10.313  1.00 10.00 ? 157 LEU A O    4  
ATOM 8388   C CB   . LEU A 1 2   ? -30.321 -7.369  12.246  1.00 10.00 ? 157 LEU A CB   4  
ATOM 8389   C CG   . LEU A 1 2   ? -29.904 -6.145  13.062  1.00 10.00 ? 157 LEU A CG   4  
ATOM 8390   C CD1  . LEU A 1 2   ? -30.828 -5.963  14.254  1.00 10.00 ? 157 LEU A CD1  4  
ATOM 8391   C CD2  . LEU A 1 2   ? -28.459 -6.277  13.520  1.00 10.00 ? 157 LEU A CD2  4  
ATOM 8392   H H    . LEU A 1 2   ? -31.220 -7.153  9.606   1.00 10.00 ? 157 LEU A H    4  
ATOM 8393   N N    . PRO A 1 3   ? -28.298 -9.610  10.622  1.00 10.00 ? 158 PRO A N    4  
ATOM 8394   C CA   . PRO A 1 3   ? -28.084 -11.034 10.362  1.00 10.00 ? 158 PRO A CA   4  
ATOM 8395   C C    . PRO A 1 3   ? -28.657 -11.886 11.494  1.00 10.00 ? 158 PRO A C    4  
ATOM 8396   O O    . PRO A 1 3   ? -28.806 -11.410 12.620  1.00 10.00 ? 158 PRO A O    4  
ATOM 8397   C CB   . PRO A 1 3   ? -26.559 -11.165 10.315  1.00 10.00 ? 158 PRO A CB   4  
ATOM 8398   C CG   . PRO A 1 3   ? -26.050 -10.007 11.103  1.00 10.00 ? 158 PRO A CG   4  
ATOM 8399   C CD   . PRO A 1 3   ? -27.038 -8.897  10.897  1.00 10.00 ? 158 PRO A CD   4  
ATOM 8400   N N    . LEU A 1 4   ? -28.986 -13.134 11.191  1.00 10.00 ? 159 LEU A N    4  
ATOM 8401   C CA   . LEU A 1 4   ? -29.550 -14.035 12.189  1.00 10.00 ? 159 LEU A CA   4  
ATOM 8402   C C    . LEU A 1 4   ? -28.584 -15.166 12.492  1.00 10.00 ? 159 LEU A C    4  
ATOM 8403   O O    . LEU A 1 4   ? -27.865 -15.619 11.599  1.00 10.00 ? 159 LEU A O    4  
ATOM 8404   C CB   . LEU A 1 4   ? -30.888 -14.605 11.712  1.00 10.00 ? 159 LEU A CB   4  
ATOM 8405   C CG   . LEU A 1 4   ? -32.031 -13.604 11.532  1.00 10.00 ? 159 LEU A CG   4  
ATOM 8406   C CD1  . LEU A 1 4   ? -32.038 -13.034 10.121  1.00 10.00 ? 159 LEU A CD1  4  
ATOM 8407   C CD2  . LEU A 1 4   ? -33.365 -14.258 11.853  1.00 10.00 ? 159 LEU A CD2  4  
ATOM 8408   H H    . LEU A 1 4   ? -28.838 -13.462 10.282  1.00 10.00 ? 159 LEU A H    4  
ATOM 8409   N N    . ASP A 1 5   ? -28.572 -15.610 13.751  1.00 10.00 ? 160 ASP A N    4  
ATOM 8410   C CA   . ASP A 1 5   ? -27.692 -16.690 14.191  1.00 10.00 ? 160 ASP A CA   4  
ATOM 8411   C C    . ASP A 1 5   ? -26.246 -16.350 13.859  1.00 10.00 ? 160 ASP A C    4  
ATOM 8412   O O    . ASP A 1 5   ? -25.503 -17.189 13.348  1.00 10.00 ? 160 ASP A O    4  
ATOM 8413   C CB   . ASP A 1 5   ? -28.084 -18.031 13.543  1.00 10.00 ? 160 ASP A CB   4  
ATOM 8414   C CG   . ASP A 1 5   ? -29.419 -18.571 14.020  1.00 10.00 ? 160 ASP A CG   4  
ATOM 8415   O OD1  . ASP A 1 5   ? -29.726 -18.439 15.224  1.00 10.00 ? 160 ASP A OD1  4  
ATOM 8416   O OD2  . ASP A 1 5   ? -30.163 -19.145 13.198  1.00 10.00 ? 160 ASP A OD2  4  
ATOM 8417   H H    . ASP A 1 5   ? -29.168 -15.192 14.407  1.00 10.00 ? 160 ASP A H    4  
ATOM 8418   N N    . GLU A 1 6   ? -25.848 -15.119 14.174  1.00 10.00 ? 161 GLU A N    4  
ATOM 8419   C CA   . GLU A 1 6   ? -24.503 -14.636 13.877  1.00 10.00 ? 161 GLU A CA   4  
ATOM 8420   C C    . GLU A 1 6   ? -23.420 -15.535 14.462  1.00 10.00 ? 161 GLU A C    4  
ATOM 8421   O O    . GLU A 1 6   ? -22.554 -16.018 13.733  1.00 10.00 ? 161 GLU A O    4  
ATOM 8422   C CB   . GLU A 1 6   ? -24.330 -13.202 14.390  1.00 10.00 ? 161 GLU A CB   4  
ATOM 8423   C CG   . GLU A 1 6   ? -25.472 -12.260 14.029  1.00 10.00 ? 161 GLU A CG   4  
ATOM 8424   C CD   . GLU A 1 6   ? -26.483 -12.099 15.148  1.00 10.00 ? 161 GLU A CD   4  
ATOM 8425   O OE1  . GLU A 1 6   ? -27.159 -13.093 15.488  1.00 10.00 ? 161 GLU A OE1  4  
ATOM 8426   O OE2  . GLU A 1 6   ? -26.601 -10.982 15.693  1.00 10.00 ? 161 GLU A OE2  4  
ATOM 8427   H H    . GLU A 1 6   ? -26.469 -14.503 14.637  1.00 10.00 ? 161 GLU A H    4  
ATOM 8428   N N    . ARG A 1 7   ? -23.474 -15.762 15.770  1.00 10.00 ? 162 ARG A N    4  
ATOM 8429   C CA   . ARG A 1 7   ? -22.495 -16.612 16.441  1.00 10.00 ? 162 ARG A CA   4  
ATOM 8430   C C    . ARG A 1 7   ? -22.464 -18.018 15.848  1.00 10.00 ? 162 ARG A C    4  
ATOM 8431   O O    . ARG A 1 7   ? -21.407 -18.646 15.768  1.00 10.00 ? 162 ARG A O    4  
ATOM 8432   C CB   . ARG A 1 7   ? -22.765 -16.673 17.945  1.00 10.00 ? 162 ARG A CB   4  
ATOM 8433   C CG   . ARG A 1 7   ? -22.966 -15.316 18.607  1.00 10.00 ? 162 ARG A CG   4  
ATOM 8434   C CD   . ARG A 1 7   ? -21.827 -14.355 18.303  1.00 10.00 ? 162 ARG A CD   4  
ATOM 8435   N NE   . ARG A 1 7   ? -22.044 -13.047 18.916  1.00 10.00 ? 162 ARG A NE   4  
ATOM 8436   C CZ   . ARG A 1 7   ? -21.072 -12.280 19.411  1.00 10.00 ? 162 ARG A CZ   4  
ATOM 8437   N NH1  . ARG A 1 7   ? -19.803 -12.664 19.317  1.00 10.00 ? 162 ARG A NH1  4  
ATOM 8438   N NH2  . ARG A 1 7   ? -21.368 -11.120 19.984  1.00 10.00 ? 162 ARG A NH2  4  
ATOM 8439   H H    . ARG A 1 7   ? -24.126 -15.271 16.315  1.00 10.00 ? 162 ARG A H    4  
ATOM 8440   H HE   . ARG A 1 7   ? -22.974 -12.724 18.965  1.00 10.00 ? 162 ARG A HE   4  
ATOM 8441   H HH11 . ARG A 1 7   ? -19.570 -13.532 18.868  1.00 10.00 ? 162 ARG A HH11 4  
ATOM 8442   H HH12 . ARG A 1 7   ? -19.072 -12.084 19.686  1.00 10.00 ? 162 ARG A HH12 4  
ATOM 8443   H HH21 . ARG A 1 7   ? -22.322 -10.815 20.045  1.00 10.00 ? 162 ARG A HH21 4  
ATOM 8444   H HH22 . ARG A 1 7   ? -20.637 -10.543 20.363  1.00 10.00 ? 162 ARG A HH22 4  
ATOM 8445   N N    . ALA A 1 8   ? -23.624 -18.503 15.427  1.00 10.00 ? 163 ALA A N    4  
ATOM 8446   C CA   . ALA A 1 8   ? -23.715 -19.827 14.837  1.00 10.00 ? 163 ALA A CA   4  
ATOM 8447   C C    . ALA A 1 8   ? -23.001 -19.844 13.495  1.00 10.00 ? 163 ALA A C    4  
ATOM 8448   O O    . ALA A 1 8   ? -22.221 -20.750 13.206  1.00 10.00 ? 163 ALA A O    4  
ATOM 8449   C CB   . ALA A 1 8   ? -25.170 -20.243 14.677  1.00 10.00 ? 163 ALA A CB   4  
ATOM 8450   H H    . ALA A 1 8   ? -24.432 -17.953 15.504  1.00 10.00 ? 163 ALA A H    4  
ATOM 8451   N N    . PHE A 1 9   ? -23.255 -18.820 12.691  1.00 10.00 ? 164 PHE A N    4  
ATOM 8452   C CA   . PHE A 1 9   ? -22.639 -18.699 11.378  1.00 10.00 ? 164 PHE A CA   4  
ATOM 8453   C C    . PHE A 1 9   ? -21.124 -18.585 11.488  1.00 10.00 ? 164 PHE A C    4  
ATOM 8454   O O    . PHE A 1 9   ? -20.396 -19.269 10.767  1.00 10.00 ? 164 PHE A O    4  
ATOM 8455   C CB   . PHE A 1 9   ? -23.207 -17.493 10.622  1.00 10.00 ? 164 PHE A CB   4  
ATOM 8456   C CG   . PHE A 1 9   ? -22.755 -17.402 9.190   1.00 10.00 ? 164 PHE A CG   4  
ATOM 8457   C CD1  . PHE A 1 9   ? -23.458 -18.044 8.184   1.00 10.00 ? 164 PHE A CD1  4  
ATOM 8458   C CD2  . PHE A 1 9   ? -21.625 -16.675 8.852   1.00 10.00 ? 164 PHE A CD2  4  
ATOM 8459   C CE1  . PHE A 1 9   ? -23.041 -17.964 6.869   1.00 10.00 ? 164 PHE A CE1  4  
ATOM 8460   C CE2  . PHE A 1 9   ? -21.203 -16.591 7.540   1.00 10.00 ? 164 PHE A CE2  4  
ATOM 8461   C CZ   . PHE A 1 9   ? -21.912 -17.236 6.546   1.00 10.00 ? 164 PHE A CZ   4  
ATOM 8462   H H    . PHE A 1 9   ? -23.883 -18.124 12.989  1.00 10.00 ? 164 PHE A H    4  
ATOM 8463   N N    . GLU A 1 10  ? -20.658 -17.719 12.387  1.00 10.00 ? 165 GLU A N    4  
ATOM 8464   C CA   . GLU A 1 10  ? -19.226 -17.517 12.595  1.00 10.00 ? 165 GLU A CA   4  
ATOM 8465   C C    . GLU A 1 10  ? -18.535 -18.829 12.961  1.00 10.00 ? 165 GLU A C    4  
ATOM 8466   O O    . GLU A 1 10  ? -17.428 -19.107 12.503  1.00 10.00 ? 165 GLU A O    4  
ATOM 8467   C CB   . GLU A 1 10  ? -18.978 -16.466 13.683  1.00 10.00 ? 165 GLU A CB   4  
ATOM 8468   C CG   . GLU A 1 10  ? -19.539 -15.088 13.365  1.00 10.00 ? 165 GLU A CG   4  
ATOM 8469   C CD   . GLU A 1 10  ? -19.264 -14.076 14.461  1.00 10.00 ? 165 GLU A CD   4  
ATOM 8470   O OE1  . GLU A 1 10  ? -18.149 -13.524 14.497  1.00 10.00 ? 165 GLU A OE1  4  
ATOM 8471   O OE2  . GLU A 1 10  ? -20.162 -13.834 15.297  1.00 10.00 ? 165 GLU A OE2  4  
ATOM 8472   H H    . GLU A 1 10  ? -21.290 -17.181 12.918  1.00 10.00 ? 165 GLU A H    4  
ATOM 8473   N N    . LYS A 1 11  ? -19.205 -19.632 13.779  1.00 10.00 ? 166 LYS A N    4  
ATOM 8474   C CA   . LYS A 1 11  ? -18.666 -20.918 14.204  1.00 10.00 ? 166 LYS A CA   4  
ATOM 8475   C C    . LYS A 1 11  ? -18.781 -21.975 13.096  1.00 10.00 ? 166 LYS A C    4  
ATOM 8476   O O    . LYS A 1 11  ? -17.988 -22.915 13.029  1.00 10.00 ? 166 LYS A O    4  
ATOM 8477   C CB   . LYS A 1 11  ? -19.375 -21.391 15.474  1.00 10.00 ? 166 LYS A CB   4  
ATOM 8478   C CG   . LYS A 1 11  ? -18.613 -22.438 16.270  1.00 10.00 ? 166 LYS A CG   4  
ATOM 8479   C CD   . LYS A 1 11  ? -19.547 -23.219 17.181  1.00 10.00 ? 166 LYS A CD   4  
ATOM 8480   C CE   . LYS A 1 11  ? -20.640 -23.914 16.382  1.00 10.00 ? 166 LYS A CE   4  
ATOM 8481   N NZ   . LYS A 1 11  ? -21.649 -24.563 17.260  1.00 10.00 ? 166 LYS A NZ   4  
ATOM 8482   H H    . LYS A 1 11  ? -20.080 -19.345 14.119  1.00 10.00 ? 166 LYS A H    4  
ATOM 8483   H HZ1  . LYS A 1 11  ? -22.003 -23.884 17.963  1.00 10.00 ? 166 LYS A HZ1  4  
ATOM 8484   H HZ2  . LYS A 1 11  ? -21.226 -25.370 17.758  1.00 10.00 ? 166 LYS A HZ2  4  
ATOM 8485   H HZ3  . LYS A 1 11  ? -22.452 -24.904 16.693  1.00 10.00 ? 166 LYS A HZ3  4  
ATOM 8486   N N    . THR A 1 12  ? -19.800 -21.839 12.257  1.00 10.00 ? 167 THR A N    4  
ATOM 8487   C CA   . THR A 1 12  ? -20.026 -22.774 11.157  1.00 10.00 ? 167 THR A CA   4  
ATOM 8488   C C    . THR A 1 12  ? -19.058 -22.572 9.980   1.00 10.00 ? 167 THR A C    4  
ATOM 8489   O O    . THR A 1 12  ? -18.322 -23.481 9.611   1.00 10.00 ? 167 THR A O    4  
ATOM 8490   C CB   . THR A 1 12  ? -21.476 -22.682 10.635  1.00 10.00 ? 167 THR A CB   4  
ATOM 8491   O OG1  . THR A 1 12  ? -22.389 -22.905 11.717  1.00 10.00 ? 167 THR A OG1  4  
ATOM 8492   C CG2  . THR A 1 12  ? -21.721 -23.720 9.546   1.00 10.00 ? 167 THR A CG2  4  
ATOM 8493   H H    . THR A 1 12  ? -20.429 -21.097 12.386  1.00 10.00 ? 167 THR A H    4  
ATOM 8494   H HG1  . THR A 1 12  ? -22.362 -22.147 12.319  1.00 10.00 ? 167 THR A HG1  4  
ATOM 8495   N N    . LEU A 1 13  ? -19.051 -21.378 9.411   1.00 10.00 ? 168 LEU A N    4  
ATOM 8496   C CA   . LEU A 1 13  ? -18.216 -21.077 8.238   1.00 10.00 ? 168 LEU A CA   4  
ATOM 8497   C C    . LEU A 1 13  ? -16.716 -20.976 8.527   1.00 10.00 ? 168 LEU A C    4  
ATOM 8498   O O    . LEU A 1 13  ? -15.952 -20.499 7.688   1.00 10.00 ? 168 LEU A O    4  
ATOM 8499   C CB   . LEU A 1 13  ? -18.722 -19.831 7.508   1.00 10.00 ? 168 LEU A CB   4  
ATOM 8500   C CG   . LEU A 1 13  ? -19.715 -20.060 6.366   1.00 10.00 ? 168 LEU A CG   4  
ATOM 8501   C CD1  . LEU A 1 13  ? -19.032 -20.721 5.181   1.00 10.00 ? 168 LEU A CD1  4  
ATOM 8502   C CD2  . LEU A 1 13  ? -20.902 -20.888 6.830   1.00 10.00 ? 168 LEU A CD2  4  
ATOM 8503   H H    . LEU A 1 13  ? -19.637 -20.671 9.778   1.00 10.00 ? 168 LEU A H    4  
ATOM 8504   N N    . THR A 1 14  ? -16.295 -21.446 9.694   1.00 10.00 ? 169 THR A N    4  
ATOM 8505   C CA   . THR A 1 14  ? -14.889 -21.354 10.073  1.00 10.00 ? 169 THR A CA   4  
ATOM 8506   C C    . THR A 1 14  ? -14.021 -22.457 9.422   1.00 10.00 ? 169 THR A C    4  
ATOM 8507   O O    . THR A 1 14  ? -13.138 -22.158 8.620   1.00 10.00 ? 169 THR A O    4  
ATOM 8508   C CB   . THR A 1 14  ? -14.696 -21.314 11.600  1.00 10.00 ? 169 THR A CB   4  
ATOM 8509   O OG1  . THR A 1 14  ? -15.982 -21.317 12.234  1.00 10.00 ? 169 THR A OG1  4  
ATOM 8510   C CG2  . THR A 1 14  ? -13.934 -20.060 12.011  1.00 10.00 ? 169 THR A CG2  4  
ATOM 8511   H H    . THR A 1 14  ? -16.868 -22.062 10.189  1.00 10.00 ? 169 THR A H    4  
ATOM 8512   H HG1  . THR A 1 14  ? -16.366 -20.428 12.204  1.00 10.00 ? 169 THR A HG1  4  
ATOM 8513   N N    . PRO A 1 15  ? -14.302 -23.757 9.718   1.00 10.00 ? 170 PRO A N    4  
ATOM 8514   C CA   . PRO A 1 15  ? -13.510 -24.892 9.199   1.00 10.00 ? 170 PRO A CA   4  
ATOM 8515   C C    . PRO A 1 15  ? -13.632 -25.120 7.696   1.00 10.00 ? 170 PRO A C    4  
ATOM 8516   O O    . PRO A 1 15  ? -12.792 -25.794 7.095   1.00 10.00 ? 170 PRO A O    4  
ATOM 8517   C CB   . PRO A 1 15  ? -14.059 -26.099 9.963   1.00 10.00 ? 170 PRO A CB   4  
ATOM 8518   C CG   . PRO A 1 15  ? -15.447 -25.710 10.325  1.00 10.00 ? 170 PRO A CG   4  
ATOM 8519   C CD   . PRO A 1 15  ? -15.403 -24.231 10.588  1.00 10.00 ? 170 PRO A CD   4  
ATOM 8520   N N    . ILE A 1 16  ? -14.672 -24.571 7.093   1.00 10.00 ? 171 ILE A N    4  
ATOM 8521   C CA   . ILE A 1 16  ? -14.897 -24.729 5.664   1.00 10.00 ? 171 ILE A CA   4  
ATOM 8522   C C    . ILE A 1 16  ? -13.926 -23.847 4.879   1.00 10.00 ? 171 ILE A C    4  
ATOM 8523   O O    . ILE A 1 16  ? -13.233 -24.302 3.976   1.00 10.00 ? 171 ILE A O    4  
ATOM 8524   C CB   . ILE A 1 16  ? -16.342 -24.321 5.305   1.00 10.00 ? 171 ILE A CB   4  
ATOM 8525   C CG1  . ILE A 1 16  ? -17.330 -24.932 6.302   1.00 10.00 ? 171 ILE A CG1  4  
ATOM 8526   C CG2  . ILE A 1 16  ? -16.680 -24.744 3.883   1.00 10.00 ? 171 ILE A CG2  4  
ATOM 8527   C CD1  . ILE A 1 16  ? -18.736 -24.384 6.189   1.00 10.00 ? 171 ILE A CD1  4  
ATOM 8528   H H    . ILE A 1 16  ? -15.306 -24.047 7.622   1.00 10.00 ? 171 ILE A H    4  
ATOM 8529   N N    . ILE A 1 17  ? -13.857 -22.598 5.276   1.00 10.00 ? 172 ILE A N    4  
ATOM 8530   C CA   . ILE A 1 17  ? -12.998 -21.616 4.624   1.00 10.00 ? 172 ILE A CA   4  
ATOM 8531   C C    . ILE A 1 17  ? -11.559 -21.670 5.142   1.00 10.00 ? 172 ILE A C    4  
ATOM 8532   O O    . ILE A 1 17  ? -10.649 -21.104 4.539   1.00 10.00 ? 172 ILE A O    4  
ATOM 8533   C CB   . ILE A 1 17  ? -13.577 -20.182 4.672   1.00 10.00 ? 172 ILE A CB   4  
ATOM 8534   C CG1  . ILE A 1 17  ? -15.109 -20.241 4.635   1.00 10.00 ? 172 ILE A CG1  4  
ATOM 8535   C CG2  . ILE A 1 17  ? -13.078 -19.386 3.471   1.00 10.00 ? 172 ILE A CG2  4  
ATOM 8536   C CD1  . ILE A 1 17  ? -15.774 -18.885 4.697   1.00 10.00 ? 172 ILE A CD1  4  
ATOM 8537   H H    . ILE A 1 17  ? -14.383 -22.309 6.054   1.00 10.00 ? 172 ILE A H    4  
ATOM 8538   N N    . GLN A 1 18  ? -11.367 -22.368 6.261   1.00 10.00 ? 173 GLN A N    4  
ATOM 8539   C CA   . GLN A 1 18  ? -10.061 -22.443 6.917   1.00 10.00 ? 173 GLN A CA   4  
ATOM 8540   C C    . GLN A 1 18  ? -8.967  -22.895 5.952   1.00 10.00 ? 173 GLN A C    4  
ATOM 8541   O O    . GLN A 1 18  ? -7.982  -22.188 5.744   1.00 10.00 ? 173 GLN A O    4  
ATOM 8542   C CB   . GLN A 1 18  ? -10.151 -23.402 8.104   1.00 10.00 ? 173 GLN A CB   4  
ATOM 8543   C CG   . GLN A 1 18  ? -9.271  -23.028 9.284   1.00 10.00 ? 173 GLN A CG   4  
ATOM 8544   C CD   . GLN A 1 18  ? -9.526  -23.897 10.500  1.00 10.00 ? 173 GLN A CD   4  
ATOM 8545   O OE1  . GLN A 1 18  ? -10.631 -24.398 10.705  1.00 10.00 ? 173 GLN A OE1  4  
ATOM 8546   N NE2  . GLN A 1 18  ? -8.505  -24.082 11.319  1.00 10.00 ? 173 GLN A NE2  4  
ATOM 8547   H H    . GLN A 1 18  ? -12.071 -22.976 6.557   1.00 10.00 ? 173 GLN A H    4  
ATOM 8548   H HE21 . GLN A 1 18  ? -7.649  -23.652 11.100  1.00 10.00 ? 173 GLN A HE21 4  
ATOM 8549   H HE22 . GLN A 1 18  ? -8.643  -24.638 12.114  1.00 10.00 ? 173 GLN A HE22 4  
ATOM 8550   N N    . GLU A 1 19  ? -9.148  -24.057 5.339   1.00 10.00 ? 174 GLU A N    4  
ATOM 8551   C CA   . GLU A 1 19  ? -8.185  -24.597 4.381   1.00 10.00 ? 174 GLU A CA   4  
ATOM 8552   C C    . GLU A 1 19  ? -8.248  -23.896 3.029   1.00 10.00 ? 174 GLU A C    4  
ATOM 8553   O O    . GLU A 1 19  ? -7.330  -24.024 2.214   1.00 10.00 ? 174 GLU A O    4  
ATOM 8554   C CB   . GLU A 1 19  ? -8.335  -26.111 4.208   1.00 10.00 ? 174 GLU A CB   4  
ATOM 8555   C CG   . GLU A 1 19  ? -9.749  -26.578 3.906   1.00 10.00 ? 174 GLU A CG   4  
ATOM 8556   C CD   . GLU A 1 19  ? -9.777  -27.978 3.329   1.00 10.00 ? 174 GLU A CD   4  
ATOM 8557   O OE1  . GLU A 1 19  ? -9.624  -28.115 2.095   1.00 10.00 ? 174 GLU A OE1  4  
ATOM 8558   O OE2  . GLU A 1 19  ? -9.928  -28.945 4.104   1.00 10.00 ? 174 GLU A OE2  4  
ATOM 8559   H H    . GLU A 1 19  ? -9.935  -24.610 5.532   1.00 10.00 ? 174 GLU A H    4  
ATOM 8560   N N    . TYR A 1 20  ? -9.340  -23.164 2.793   1.00 10.00 ? 175 TYR A N    4  
ATOM 8561   C CA   . TYR A 1 20  ? -9.555  -22.496 1.511   1.00 10.00 ? 175 TYR A CA   4  
ATOM 8562   C C    . TYR A 1 20  ? -8.337  -21.682 1.103   1.00 10.00 ? 175 TYR A C    4  
ATOM 8563   O O    . TYR A 1 20  ? -7.958  -21.661 -0.070  1.00 10.00 ? 175 TYR A O    4  
ATOM 8564   C CB   . TYR A 1 20  ? -10.786 -21.585 1.551   1.00 10.00 ? 175 TYR A CB   4  
ATOM 8565   C CG   . TYR A 1 20  ? -10.847 -20.607 0.398   1.00 10.00 ? 175 TYR A CG   4  
ATOM 8566   C CD1  . TYR A 1 20  ? -11.033 -21.056 -0.902  1.00 10.00 ? 175 TYR A CD1  4  
ATOM 8567   C CD2  . TYR A 1 20  ? -10.695 -19.239 0.603   1.00 10.00 ? 175 TYR A CD2  4  
ATOM 8568   C CE1  . TYR A 1 20  ? -11.068 -20.175 -1.964  1.00 10.00 ? 175 TYR A CE1  4  
ATOM 8569   C CE2  . TYR A 1 20  ? -10.733 -18.351 -0.455  1.00 10.00 ? 175 TYR A CE2  4  
ATOM 8570   C CZ   . TYR A 1 20  ? -10.918 -18.825 -1.736  1.00 10.00 ? 175 TYR A CZ   4  
ATOM 8571   O OH   . TYR A 1 20  ? -10.950 -17.948 -2.793  1.00 10.00 ? 175 TYR A OH   4  
ATOM 8572   H H    . TYR A 1 20  ? -9.922  -22.942 3.547   1.00 10.00 ? 175 TYR A H    4  
ATOM 8573   H HH   . TYR A 1 20  ? -10.279 -17.273 -2.669  1.00 10.00 ? 175 TYR A HH   4  
ATOM 8574   N N    . PHE A 1 21  ? -7.710  -21.036 2.073   1.00 10.00 ? 176 PHE A N    4  
ATOM 8575   C CA   . PHE A 1 21  ? -6.551  -20.213 1.804   1.00 10.00 ? 176 PHE A CA   4  
ATOM 8576   C C    . PHE A 1 21  ? -5.300  -21.006 1.404   1.00 10.00 ? 176 PHE A C    4  
ATOM 8577   O O    . PHE A 1 21  ? -4.260  -20.393 1.164   1.00 10.00 ? 176 PHE A O    4  
ATOM 8578   C CB   . PHE A 1 21  ? -6.232  -19.311 3.005   1.00 10.00 ? 176 PHE A CB   4  
ATOM 8579   C CG   . PHE A 1 21  ? -7.428  -18.671 3.658   1.00 10.00 ? 176 PHE A CG   4  
ATOM 8580   C CD1  . PHE A 1 21  ? -8.266  -17.828 2.947   1.00 10.00 ? 176 PHE A CD1  4  
ATOM 8581   C CD2  . PHE A 1 21  ? -7.708  -18.912 4.994   1.00 10.00 ? 176 PHE A CD2  4  
ATOM 8582   C CE1  . PHE A 1 21  ? -9.361  -17.242 3.551   1.00 10.00 ? 176 PHE A CE1  4  
ATOM 8583   C CE2  . PHE A 1 21  ? -8.801  -18.330 5.606   1.00 10.00 ? 176 PHE A CE2  4  
ATOM 8584   C CZ   . PHE A 1 21  ? -9.629  -17.492 4.883   1.00 10.00 ? 176 PHE A CZ   4  
ATOM 8585   H H    . PHE A 1 21  ? -8.039  -21.082 2.998   1.00 10.00 ? 176 PHE A H    4  
ATOM 8586   N N    . GLU A 1 22  ? -5.350  -22.346 1.346   1.00 10.00 ? 177 GLU A N    4  
ATOM 8587   C CA   . GLU A 1 22  ? -4.142  -23.080 0.979   1.00 10.00 ? 177 GLU A CA   4  
ATOM 8588   C C    . GLU A 1 22  ? -4.162  -23.631 -0.446  1.00 10.00 ? 177 GLU A C    4  
ATOM 8589   O O    . GLU A 1 22  ? -3.453  -23.128 -1.316  1.00 10.00 ? 177 GLU A O    4  
ATOM 8590   C CB   . GLU A 1 22  ? -3.949  -24.240 1.952   1.00 10.00 ? 177 GLU A CB   4  
ATOM 8591   C CG   . GLU A 1 22  ? -3.247  -23.834 3.222   1.00 10.00 ? 177 GLU A CG   4  
ATOM 8592   C CD   . GLU A 1 22  ? -1.962  -23.114 2.911   1.00 10.00 ? 177 GLU A CD   4  
ATOM 8593   O OE1  . GLU A 1 22  ? -1.099  -23.709 2.231   1.00 10.00 ? 177 GLU A OE1  4  
ATOM 8594   O OE2  . GLU A 1 22  ? -1.816  -21.946 3.321   1.00 10.00 ? 177 GLU A OE2  4  
ATOM 8595   H H    . GLU A 1 22  ? -6.182  -22.851 1.446   1.00 10.00 ? 177 GLU A H    4  
ATOM 8596   N N    . HIS A 1 23  ? -4.987  -24.662 -0.687  1.00 10.00 ? 178 HIS A N    4  
ATOM 8597   C CA   . HIS A 1 23  ? -5.098  -25.234 -2.031  1.00 10.00 ? 178 HIS A CA   4  
ATOM 8598   C C    . HIS A 1 23  ? -5.768  -24.291 -3.011  1.00 10.00 ? 178 HIS A C    4  
ATOM 8599   O O    . HIS A 1 23  ? -5.498  -24.338 -4.210  1.00 10.00 ? 178 HIS A O    4  
ATOM 8600   C CB   . HIS A 1 23  ? -5.803  -26.603 -2.011  1.00 10.00 ? 178 HIS A CB   4  
ATOM 8601   C CG   . HIS A 1 23  ? -7.148  -26.630 -1.337  1.00 10.00 ? 178 HIS A CG   4  
ATOM 8602   N ND1  . HIS A 1 23  ? -8.325  -26.846 -2.014  1.00 10.00 ? 178 HIS A ND1  4  
ATOM 8603   C CD2  . HIS A 1 23  ? -7.493  -26.495 -0.032  1.00 10.00 ? 178 HIS A CD2  4  
ATOM 8604   C CE1  . HIS A 1 23  ? -9.331  -26.841 -1.160  1.00 10.00 ? 178 HIS A CE1  4  
ATOM 8605   N NE2  . HIS A 1 23  ? -8.856  -26.633 0.055   1.00 10.00 ? 178 HIS A NE2  4  
ATOM 8606   H H    . HIS A 1 23  ? -5.321  -25.199 0.061   1.00 10.00 ? 178 HIS A H    4  
ATOM 8607   H HD1  . HIS A 1 23  ? -8.408  -27.026 -2.979  1.00 10.00 ? 178 HIS A HD1  4  
ATOM 8608   H HE2  . HIS A 1 23  ? -9.333  -26.891 0.882   1.00 10.00 ? 178 HIS A HE2  4  
ATOM 8609   N N    . GLY A 1 24  ? -6.643  -23.445 -2.494  1.00 10.00 ? 179 GLY A N    4  
ATOM 8610   C CA   . GLY A 1 24  ? -7.345  -22.495 -3.330  1.00 10.00 ? 179 GLY A CA   4  
ATOM 8611   C C    . GLY A 1 24  ? -8.397  -23.167 -4.183  1.00 10.00 ? 179 GLY A C    4  
ATOM 8612   O O    . GLY A 1 24  ? -8.076  -23.839 -5.163  1.00 10.00 ? 179 GLY A O    4  
ATOM 8613   H H    . GLY A 1 24  ? -6.821  -23.473 -1.536  1.00 10.00 ? 179 GLY A H    4  
ATOM 8614   N N    . ASP A 1 25  ? -9.656  -23.009 -3.807  1.00 10.00 ? 180 ASP A N    4  
ATOM 8615   C CA   . ASP A 1 25  ? -10.741 -23.610 -4.567  1.00 10.00 ? 180 ASP A CA   4  
ATOM 8616   C C    . ASP A 1 25  ? -12.059 -22.892 -4.328  1.00 10.00 ? 180 ASP A C    4  
ATOM 8617   O O    . ASP A 1 25  ? -12.649 -23.004 -3.255  1.00 10.00 ? 180 ASP A O    4  
ATOM 8618   C CB   . ASP A 1 25  ? -10.888 -25.089 -4.231  1.00 10.00 ? 180 ASP A CB   4  
ATOM 8619   C CG   . ASP A 1 25  ? -11.610 -25.847 -5.325  1.00 10.00 ? 180 ASP A CG   4  
ATOM 8620   O OD1  . ASP A 1 25  ? -12.677 -25.390 -5.771  1.00 10.00 ? 180 ASP A OD1  4  
ATOM 8621   O OD2  . ASP A 1 25  ? -11.096 -26.896 -5.758  1.00 10.00 ? 180 ASP A OD2  4  
ATOM 8622   H H    . ASP A 1 25  ? -9.867  -22.478 -3.010  1.00 10.00 ? 180 ASP A H    4  
ATOM 8623   N N    . THR A 1 26  ? -12.512 -22.152 -5.331  1.00 10.00 ? 181 THR A N    4  
ATOM 8624   C CA   . THR A 1 26  ? -13.760 -21.417 -5.227  1.00 10.00 ? 181 THR A CA   4  
ATOM 8625   C C    . THR A 1 26  ? -14.958 -22.341 -5.465  1.00 10.00 ? 181 THR A C    4  
ATOM 8626   O O    . THR A 1 26  ? -16.060 -22.093 -4.981  1.00 10.00 ? 181 THR A O    4  
ATOM 8627   C CB   . THR A 1 26  ? -13.792 -20.201 -6.157  1.00 10.00 ? 181 THR A CB   4  
ATOM 8628   O OG1  . THR A 1 26  ? -13.133 -20.531 -7.384  1.00 10.00 ? 181 THR A OG1  4  
ATOM 8629   C CG2  . THR A 1 26  ? -13.064 -19.037 -5.502  1.00 10.00 ? 181 THR A CG2  4  
ATOM 8630   H H    . THR A 1 26  ? -12.095 -22.236 -6.213  1.00 10.00 ? 181 THR A H    4  
ATOM 8631   H HG1  . THR A 1 26  ? -13.416 -19.905 -8.071  1.00 10.00 ? 181 THR A HG1  4  
ATOM 8632   N N    . ASN A 1 27  ? -14.718 -23.419 -6.209  1.00 10.00 ? 182 ASN A N    4  
ATOM 8633   C CA   . ASN A 1 27  ? -15.760 -24.394 -6.537  1.00 10.00 ? 182 ASN A CA   4  
ATOM 8634   C C    . ASN A 1 27  ? -16.218 -25.108 -5.280  1.00 10.00 ? 182 ASN A C    4  
ATOM 8635   O O    . ASN A 1 27  ? -17.363 -25.537 -5.170  1.00 10.00 ? 182 ASN A O    4  
ATOM 8636   C CB   . ASN A 1 27  ? -15.277 -25.401 -7.586  1.00 10.00 ? 182 ASN A CB   4  
ATOM 8637   C CG   . ASN A 1 27  ? -16.338 -25.741 -8.619  1.00 10.00 ? 182 ASN A CG   4  
ATOM 8638   O OD1  . ASN A 1 27  ? -16.536 -25.005 -9.585  1.00 10.00 ? 182 ASN A OD1  4  
ATOM 8639   N ND2  . ASN A 1 27  ? -16.998 -26.872 -8.445  1.00 10.00 ? 182 ASN A ND2  4  
ATOM 8640   H H    . ASN A 1 27  ? -13.807 -23.573 -6.535  1.00 10.00 ? 182 ASN A H    4  
ATOM 8641   H HD21 . ASN A 1 27  ? -16.769 -27.429 -7.670  1.00 10.00 ? 182 ASN A HD21 4  
ATOM 8642   H HD22 . ASN A 1 27  ? -17.689 -27.113 -9.096  1.00 10.00 ? 182 ASN A HD22 4  
ATOM 8643   N N    . GLU A 1 28  ? -15.315 -25.217 -4.322  1.00 10.00 ? 183 GLU A N    4  
ATOM 8644   C CA   . GLU A 1 28  ? -15.629 -25.867 -3.068  1.00 10.00 ? 183 GLU A CA   4  
ATOM 8645   C C    . GLU A 1 28  ? -16.516 -24.925 -2.263  1.00 10.00 ? 183 GLU A C    4  
ATOM 8646   O O    . GLU A 1 28  ? -17.352 -25.346 -1.466  1.00 10.00 ? 183 GLU A O    4  
ATOM 8647   C CB   . GLU A 1 28  ? -14.341 -26.171 -2.299  1.00 10.00 ? 183 GLU A CB   4  
ATOM 8648   C CG   . GLU A 1 28  ? -14.475 -27.302 -1.292  1.00 10.00 ? 183 GLU A CG   4  
ATOM 8649   C CD   . GLU A 1 28  ? -15.011 -28.569 -1.925  1.00 10.00 ? 183 GLU A CD   4  
ATOM 8650   O OE1  . GLU A 1 28  ? -16.242 -28.691 -2.065  1.00 10.00 ? 183 GLU A OE1  4  
ATOM 8651   O OE2  . GLU A 1 28  ? -14.200 -29.447 -2.288  1.00 10.00 ? 183 GLU A OE2  4  
ATOM 8652   H H    . GLU A 1 28  ? -14.493 -24.687 -4.373  1.00 10.00 ? 183 GLU A H    4  
ATOM 8653   N N    . VAL A 1 29  ? -16.333 -23.630 -2.534  1.00 10.00 ? 184 VAL A N    4  
ATOM 8654   C CA   . VAL A 1 29  ? -17.041 -22.581 -1.816  1.00 10.00 ? 184 VAL A CA   4  
ATOM 8655   C C    . VAL A 1 29  ? -18.429 -22.307 -2.411  1.00 10.00 ? 184 VAL A C    4  
ATOM 8656   O O    . VAL A 1 29  ? -19.344 -21.919 -1.686  1.00 10.00 ? 184 VAL A O    4  
ATOM 8657   C CB   . VAL A 1 29  ? -16.245 -21.251 -1.725  1.00 10.00 ? 184 VAL A CB   4  
ATOM 8658   C CG1  . VAL A 1 29  ? -16.867 -20.321 -0.686  1.00 10.00 ? 184 VAL A CG1  4  
ATOM 8659   C CG2  . VAL A 1 29  ? -14.777 -21.497 -1.398  1.00 10.00 ? 184 VAL A CG2  4  
ATOM 8660   H H    . VAL A 1 29  ? -15.896 -23.405 -3.376  1.00 10.00 ? 184 VAL A H    4  
ATOM 8661   N N    . ALA A 1 30  ? -18.601 -22.543 -3.727  1.00 10.00 ? 185 ALA A N    4  
ATOM 8662   C CA   . ALA A 1 30  ? -19.859 -22.211 -4.407  1.00 10.00 ? 185 ALA A CA   4  
ATOM 8663   C C    . ALA A 1 30  ? -21.082 -22.995 -3.924  1.00 10.00 ? 185 ALA A C    4  
ATOM 8664   O O    . ALA A 1 30  ? -22.069 -22.381 -3.509  1.00 10.00 ? 185 ALA A O    4  
ATOM 8665   C CB   . ALA A 1 30  ? -19.707 -22.333 -5.916  1.00 10.00 ? 185 ALA A CB   4  
ATOM 8666   H H    . ALA A 1 30  ? -17.901 -23.006 -4.233  1.00 10.00 ? 185 ALA A H    4  
ATOM 8667   N N    . GLU A 1 31  ? -21.059 -24.331 -4.002  1.00 10.00 ? 186 GLU A N    4  
ATOM 8668   C CA   . GLU A 1 31  ? -22.187 -25.133 -3.529  1.00 10.00 ? 186 GLU A CA   4  
ATOM 8669   C C    . GLU A 1 31  ? -22.456 -24.930 -2.050  1.00 10.00 ? 186 GLU A C    4  
ATOM 8670   O O    . GLU A 1 31  ? -23.610 -24.866 -1.626  1.00 10.00 ? 186 GLU A O    4  
ATOM 8671   C CB   . GLU A 1 31  ? -21.917 -26.615 -3.806  1.00 10.00 ? 186 GLU A CB   4  
ATOM 8672   C CG   . GLU A 1 31  ? -20.939 -26.880 -4.946  1.00 10.00 ? 186 GLU A CG   4  
ATOM 8673   C CD   . GLU A 1 31  ? -21.551 -26.662 -6.311  1.00 10.00 ? 186 GLU A CD   4  
ATOM 8674   O OE1  . GLU A 1 31  ? -22.238 -27.578 -6.811  1.00 10.00 ? 186 GLU A OE1  4  
ATOM 8675   O OE2  . GLU A 1 31  ? -21.365 -25.569 -6.884  1.00 10.00 ? 186 GLU A OE2  4  
ATOM 8676   H H    . GLU A 1 31  ? -20.405 -24.815 -4.546  1.00 10.00 ? 186 GLU A H    4  
ATOM 8677   N N    . MET A 1 32  ? -21.383 -24.827 -1.279  1.00 10.00 ? 187 MET A N    4  
ATOM 8678   C CA   . MET A 1 32  ? -21.489 -24.630 0.161   1.00 10.00 ? 187 MET A CA   4  
ATOM 8679   C C    . MET A 1 32  ? -22.335 -23.405 0.472   1.00 10.00 ? 187 MET A C    4  
ATOM 8680   O O    . MET A 1 32  ? -23.149 -23.419 1.391   1.00 10.00 ? 187 MET A O    4  
ATOM 8681   C CB   . MET A 1 32  ? -20.103 -24.487 0.789   1.00 10.00 ? 187 MET A CB   4  
ATOM 8682   C CG   . MET A 1 32  ? -19.272 -25.758 0.753   1.00 10.00 ? 187 MET A CG   4  
ATOM 8683   S SD   . MET A 1 32  ? -19.702 -26.927 2.054   1.00 10.00 ? 187 MET A SD   4  
ATOM 8684   C CE   . MET A 1 32  ? -18.606 -28.283 1.639   1.00 10.00 ? 187 MET A CE   4  
ATOM 8685   H H    . MET A 1 32  ? -20.497 -24.886 -1.692  1.00 10.00 ? 187 MET A H    4  
ATOM 8686   N N    . LEU A 1 33  ? -22.146 -22.351 -0.313  1.00 10.00 ? 188 LEU A N    4  
ATOM 8687   C CA   . LEU A 1 33  ? -22.887 -21.121 -0.123  1.00 10.00 ? 188 LEU A CA   4  
ATOM 8688   C C    . LEU A 1 33  ? -24.353 -21.235 -0.544  1.00 10.00 ? 188 LEU A C    4  
ATOM 8689   O O    . LEU A 1 33  ? -25.207 -20.534 0.004   1.00 10.00 ? 188 LEU A O    4  
ATOM 8690   C CB   . LEU A 1 33  ? -22.198 -19.939 -0.804  1.00 10.00 ? 188 LEU A CB   4  
ATOM 8691   C CG   . LEU A 1 33  ? -21.506 -18.946 0.134   1.00 10.00 ? 188 LEU A CG   4  
ATOM 8692   C CD1  . LEU A 1 33  ? -20.997 -17.743 -0.643  1.00 10.00 ? 188 LEU A CD1  4  
ATOM 8693   C CD2  . LEU A 1 33  ? -22.454 -18.506 1.240   1.00 10.00 ? 188 LEU A CD2  4  
ATOM 8694   H H    . LEU A 1 33  ? -21.483 -22.401 -1.036  1.00 10.00 ? 188 LEU A H    4  
ATOM 8695   N N    . ARG A 1 34  ? -24.660 -22.112 -1.503  1.00 10.00 ? 189 ARG A N    4  
ATOM 8696   C CA   . ARG A 1 34  ? -26.043 -22.259 -1.963  1.00 10.00 ? 189 ARG A CA   4  
ATOM 8697   C C    . ARG A 1 34  ? -26.893 -22.916 -0.886  1.00 10.00 ? 189 ARG A C    4  
ATOM 8698   O O    . ARG A 1 34  ? -27.878 -22.339 -0.424  1.00 10.00 ? 189 ARG A O    4  
ATOM 8699   C CB   . ARG A 1 34  ? -26.111 -23.108 -3.235  1.00 10.00 ? 189 ARG A CB   4  
ATOM 8700   C CG   . ARG A 1 34  ? -25.541 -22.445 -4.476  1.00 10.00 ? 189 ARG A CG   4  
ATOM 8701   C CD   . ARG A 1 34  ? -26.089 -23.084 -5.744  1.00 10.00 ? 189 ARG A CD   4  
ATOM 8702   N NE   . ARG A 1 34  ? -25.874 -24.531 -5.775  1.00 10.00 ? 189 ARG A NE   4  
ATOM 8703   C CZ   . ARG A 1 34  ? -24.787 -25.116 -6.279  1.00 10.00 ? 189 ARG A CZ   4  
ATOM 8704   N NH1  . ARG A 1 34  ? -23.824 -24.383 -6.830  1.00 10.00 ? 189 ARG A NH1  4  
ATOM 8705   N NH2  . ARG A 1 34  ? -24.672 -26.438 -6.245  1.00 10.00 ? 189 ARG A NH2  4  
ATOM 8706   H H    . ARG A 1 34  ? -23.979 -22.711 -1.879  1.00 10.00 ? 189 ARG A H    4  
ATOM 8707   H HE   . ARG A 1 34  ? -26.580 -25.101 -5.383  1.00 10.00 ? 189 ARG A HE   4  
ATOM 8708   H HH11 . ARG A 1 34  ? -23.909 -23.388 -6.878  1.00 10.00 ? 189 ARG A HH11 4  
ATOM 8709   H HH12 . ARG A 1 34  ? -22.989 -24.829 -7.183  1.00 10.00 ? 189 ARG A HH12 4  
ATOM 8710   H HH21 . ARG A 1 34  ? -25.402 -27.004 -5.843  1.00 10.00 ? 189 ARG A HH21 4  
ATOM 8711   H HH22 . ARG A 1 34  ? -23.846 -26.886 -6.620  1.00 10.00 ? 189 ARG A HH22 4  
ATOM 8712   N N    . ASP A 1 35  ? -26.537 -24.147 -0.525  1.00 10.00 ? 190 ASP A N    4  
ATOM 8713   C CA   . ASP A 1 35  ? -27.224 -24.889 0.534   1.00 10.00 ? 190 ASP A CA   4  
ATOM 8714   C C    . ASP A 1 35  ? -27.227 -24.231 1.915   1.00 10.00 ? 190 ASP A C    4  
ATOM 8715   O O    . ASP A 1 35  ? -27.517 -24.888 2.915   1.00 10.00 ? 190 ASP A O    4  
ATOM 8716   C CB   . ASP A 1 35  ? -26.760 -26.342 0.578   1.00 10.00 ? 190 ASP A CB   4  
ATOM 8717   C CG   . ASP A 1 35  ? -27.075 -27.063 -0.719  1.00 10.00 ? 190 ASP A CG   4  
ATOM 8718   O OD1  . ASP A 1 35  ? -28.252 -27.411 -0.942  1.00 10.00 ? 190 ASP A OD1  4  
ATOM 8719   O OD2  . ASP A 1 35  ? -26.148 -27.278 -1.530  1.00 10.00 ? 190 ASP A OD2  4  
ATOM 8720   H H    . ASP A 1 35  ? -25.948 -24.670 -1.106  1.00 10.00 ? 190 ASP A H    4  
ATOM 8721   N N    . LEU A 1 36  ? -26.897 -22.949 1.976   1.00 10.00 ? 191 LEU A N    4  
ATOM 8722   C CA   . LEU A 1 36  ? -26.892 -22.217 3.231   1.00 10.00 ? 191 LEU A CA   4  
ATOM 8723   C C    . LEU A 1 36  ? -28.157 -21.365 3.339   1.00 10.00 ? 191 LEU A C    4  
ATOM 8724   O O    . LEU A 1 36  ? -28.595 -21.031 4.439   1.00 10.00 ? 191 LEU A O    4  
ATOM 8725   C CB   . LEU A 1 36  ? -25.642 -21.343 3.345   1.00 10.00 ? 191 LEU A CB   4  
ATOM 8726   C CG   . LEU A 1 36  ? -24.378 -22.045 3.845   1.00 10.00 ? 191 LEU A CG   4  
ATOM 8727   C CD1  . LEU A 1 36  ? -23.179 -21.114 3.760   1.00 10.00 ? 191 LEU A CD1  4  
ATOM 8728   C CD2  . LEU A 1 36  ? -24.571 -22.539 5.267   1.00 10.00 ? 191 LEU A CD2  4  
ATOM 8729   H H    . LEU A 1 36  ? -26.719 -22.461 1.144   1.00 10.00 ? 191 LEU A H    4  
ATOM 8730   N N    . ASN A 1 37  ? -28.734 -21.031 2.180   1.00 10.00 ? 192 ASN A N    4  
ATOM 8731   C CA   . ASN A 1 37  ? -29.963 -20.233 2.100   1.00 10.00 ? 192 ASN A CA   4  
ATOM 8732   C C    . ASN A 1 37  ? -29.852 -18.936 2.902   1.00 10.00 ? 192 ASN A C    4  
ATOM 8733   O O    . ASN A 1 37  ? -30.560 -18.736 3.892   1.00 10.00 ? 192 ASN A O    4  
ATOM 8734   C CB   . ASN A 1 37  ? -31.189 -21.049 2.540   1.00 10.00 ? 192 ASN A CB   4  
ATOM 8735   C CG   . ASN A 1 37  ? -32.503 -20.469 2.040   1.00 10.00 ? 192 ASN A CG   4  
ATOM 8736   O OD1  . ASN A 1 37  ? -33.104 -19.607 2.683   1.00 10.00 ? 192 ASN A OD1  4  
ATOM 8737   N ND2  . ASN A 1 37  ? -32.963 -20.944 0.893   1.00 10.00 ? 192 ASN A ND2  4  
ATOM 8738   H H    . ASN A 1 37  ? -28.314 -21.328 1.345   1.00 10.00 ? 192 ASN A H    4  
ATOM 8739   H HD21 . ASN A 1 37  ? -32.437 -21.637 0.432   1.00 10.00 ? 192 ASN A HD21 4  
ATOM 8740   H HD22 . ASN A 1 37  ? -33.807 -20.587 0.550   1.00 10.00 ? 192 ASN A HD22 4  
ATOM 8741   N N    . LEU A 1 38  ? -28.950 -18.065 2.477   1.00 10.00 ? 193 LEU A N    4  
ATOM 8742   C CA   . LEU A 1 38  ? -28.742 -16.805 3.162   1.00 10.00 ? 193 LEU A CA   4  
ATOM 8743   C C    . LEU A 1 38  ? -29.204 -15.636 2.308   1.00 10.00 ? 193 LEU A C    4  
ATOM 8744   O O    . LEU A 1 38  ? -28.696 -15.427 1.207   1.00 10.00 ? 193 LEU A O    4  
ATOM 8745   C CB   . LEU A 1 38  ? -27.257 -16.641 3.492   1.00 10.00 ? 193 LEU A CB   4  
ATOM 8746   C CG   . LEU A 1 38  ? -26.584 -17.806 4.220   1.00 10.00 ? 193 LEU A CG   4  
ATOM 8747   C CD1  . LEU A 1 38  ? -25.071 -17.687 4.120   1.00 10.00 ? 193 LEU A CD1  4  
ATOM 8748   C CD2  . LEU A 1 38  ? -27.018 -17.850 5.676   1.00 10.00 ? 193 LEU A CD2  4  
ATOM 8749   H H    . LEU A 1 38  ? -28.416 -18.273 1.684   1.00 10.00 ? 193 LEU A H    4  
ATOM 8750   N N    . GLY A 1 39  ? -30.171 -14.884 2.817   1.00 10.00 ? 194 GLY A N    4  
ATOM 8751   C CA   . GLY A 1 39  ? -30.666 -13.730 2.095   1.00 10.00 ? 194 GLY A CA   4  
ATOM 8752   C C    . GLY A 1 39  ? -29.707 -12.566 2.231   1.00 10.00 ? 194 GLY A C    4  
ATOM 8753   O O    . GLY A 1 39  ? -28.831 -12.372 1.392   1.00 10.00 ? 194 GLY A O    4  
ATOM 8754   H H    . GLY A 1 39  ? -30.550 -15.114 3.694   1.00 10.00 ? 194 GLY A H    4  
ATOM 8755   N N    . GLU A 1 40  ? -29.855 -11.809 3.306   1.00 10.00 ? 195 GLU A N    4  
ATOM 8756   C CA   . GLU A 1 40  ? -28.979 -10.679 3.569   1.00 10.00 ? 195 GLU A CA   4  
ATOM 8757   C C    . GLU A 1 40  ? -27.689 -11.199 4.190   1.00 10.00 ? 195 GLU A C    4  
ATOM 8758   O O    . GLU A 1 40  ? -26.631 -10.581 4.085   1.00 10.00 ? 195 GLU A O    4  
ATOM 8759   C CB   . GLU A 1 40  ? -29.670 -9.690  4.512   1.00 10.00 ? 195 GLU A CB   4  
ATOM 8760   C CG   . GLU A 1 40  ? -29.185 -8.256  4.386   1.00 10.00 ? 195 GLU A CG   4  
ATOM 8761   C CD   . GLU A 1 40  ? -28.186 -7.876  5.457   1.00 10.00 ? 195 GLU A CD   4  
ATOM 8762   O OE1  . GLU A 1 40  ? -28.587 -7.787  6.638   1.00 10.00 ? 195 GLU A OE1  4  
ATOM 8763   O OE2  . GLU A 1 40  ? -27.006 -7.655  5.123   1.00 10.00 ? 195 GLU A OE2  4  
ATOM 8764   H H    . GLU A 1 40  ? -30.576 -12.011 3.939   1.00 10.00 ? 195 GLU A H    4  
ATOM 8765   N N    . MET A 1 41  ? -27.793 -12.375 4.805   1.00 10.00 ? 196 MET A N    4  
ATOM 8766   C CA   . MET A 1 41  ? -26.657 -13.026 5.446   1.00 10.00 ? 196 MET A CA   4  
ATOM 8767   C C    . MET A 1 41  ? -25.703 -13.613 4.403   1.00 10.00 ? 196 MET A C    4  
ATOM 8768   O O    . MET A 1 41  ? -24.684 -14.206 4.748   1.00 10.00 ? 196 MET A O    4  
ATOM 8769   C CB   . MET A 1 41  ? -27.147 -14.136 6.381   1.00 10.00 ? 196 MET A CB   4  
ATOM 8770   C CG   . MET A 1 41  ? -26.671 -14.012 7.822   1.00 10.00 ? 196 MET A CG   4  
ATOM 8771   S SD   . MET A 1 41  ? -24.874 -13.946 7.971   1.00 10.00 ? 196 MET A SD   4  
ATOM 8772   C CE   . MET A 1 41  ? -24.671 -14.182 9.735   1.00 10.00 ? 196 MET A CE   4  
ATOM 8773   H H    . MET A 1 41  ? -28.671 -12.817 4.833   1.00 10.00 ? 196 MET A H    4  
ATOM 8774   N N    . LYS A 1 42  ? -26.043 -13.450 3.124   1.00 10.00 ? 197 LYS A N    4  
ATOM 8775   C CA   . LYS A 1 42  ? -25.208 -13.955 2.036   1.00 10.00 ? 197 LYS A CA   4  
ATOM 8776   C C    . LYS A 1 42  ? -23.840 -13.288 2.074   1.00 10.00 ? 197 LYS A C    4  
ATOM 8777   O O    . LYS A 1 42  ? -22.831 -13.878 1.687   1.00 10.00 ? 197 LYS A O    4  
ATOM 8778   C CB   . LYS A 1 42  ? -25.872 -13.681 0.685   1.00 10.00 ? 197 LYS A CB   4  
ATOM 8779   C CG   . LYS A 1 42  ? -25.097 -14.220 -0.507  1.00 10.00 ? 197 LYS A CG   4  
ATOM 8780   C CD   . LYS A 1 42  ? -25.500 -15.650 -0.830  1.00 10.00 ? 197 LYS A CD   4  
ATOM 8781   C CE   . LYS A 1 42  ? -26.838 -15.690 -1.549  1.00 10.00 ? 197 LYS A CE   4  
ATOM 8782   N NZ   . LYS A 1 42  ? -26.850 -14.789 -2.731  1.00 10.00 ? 197 LYS A NZ   4  
ATOM 8783   H H    . LYS A 1 42  ? -26.875 -12.978 2.906   1.00 10.00 ? 197 LYS A H    4  
ATOM 8784   H HZ1  . LYS A 1 42  ? -26.038 -14.997 -3.351  1.00 10.00 ? 197 LYS A HZ1  4  
ATOM 8785   H HZ2  . LYS A 1 42  ? -26.794 -13.796 -2.429  1.00 10.00 ? 197 LYS A HZ2  4  
ATOM 8786   H HZ3  . LYS A 1 42  ? -27.726 -14.921 -3.273  1.00 10.00 ? 197 LYS A HZ3  4  
ATOM 8787   N N    . SER A 1 43  ? -23.820 -12.057 2.566   1.00 10.00 ? 198 SER A N    4  
ATOM 8788   C CA   . SER A 1 43  ? -22.591 -11.290 2.676   1.00 10.00 ? 198 SER A CA   4  
ATOM 8789   C C    . SER A 1 43  ? -21.762 -11.767 3.871   1.00 10.00 ? 198 SER A C    4  
ATOM 8790   O O    . SER A 1 43  ? -20.696 -11.228 4.152   1.00 10.00 ? 198 SER A O    4  
ATOM 8791   C CB   . SER A 1 43  ? -22.932 -9.807  2.831   1.00 10.00 ? 198 SER A CB   4  
ATOM 8792   O OG   . SER A 1 43  ? -24.201 -9.515  2.257   1.00 10.00 ? 198 SER A OG   4  
ATOM 8793   H H    . SER A 1 43  ? -24.660 -11.651 2.867   1.00 10.00 ? 198 SER A H    4  
ATOM 8794   H HG   . SER A 1 43  ? -24.312 -10.025 1.440   1.00 10.00 ? 198 SER A HG   4  
ATOM 8795   N N    . GLY A 1 44  ? -22.261 -12.787 4.563   1.00 10.00 ? 199 GLY A N    4  
ATOM 8796   C CA   . GLY A 1 44  ? -21.574 -13.325 5.718   1.00 10.00 ? 199 GLY A CA   4  
ATOM 8797   C C    . GLY A 1 44  ? -20.172 -13.804 5.402   1.00 10.00 ? 199 GLY A C    4  
ATOM 8798   O O    . GLY A 1 44  ? -19.213 -13.372 6.041   1.00 10.00 ? 199 GLY A O    4  
ATOM 8799   H H    . GLY A 1 44  ? -23.114 -13.183 4.284   1.00 10.00 ? 199 GLY A H    4  
ATOM 8800   N N    . VAL A 1 45  ? -20.039 -14.707 4.429   1.00 10.00 ? 200 VAL A N    4  
ATOM 8801   C CA   . VAL A 1 45  ? -18.734 -15.244 4.034   1.00 10.00 ? 200 VAL A CA   4  
ATOM 8802   C C    . VAL A 1 45  ? -17.694 -14.172 3.681   1.00 10.00 ? 200 VAL A C    4  
ATOM 8803   O O    . VAL A 1 45  ? -16.618 -14.153 4.279   1.00 10.00 ? 200 VAL A O    4  
ATOM 8804   C CB   . VAL A 1 45  ? -18.871 -16.264 2.879   1.00 10.00 ? 200 VAL A CB   4  
ATOM 8805   C CG1  . VAL A 1 45  ? -17.511 -16.740 2.395   1.00 10.00 ? 200 VAL A CG1  4  
ATOM 8806   C CG2  . VAL A 1 45  ? -19.718 -17.443 3.322   1.00 10.00 ? 200 VAL A CG2  4  
ATOM 8807   H H    . VAL A 1 45  ? -20.820 -15.082 3.974   1.00 10.00 ? 200 VAL A H    4  
ATOM 8808   N N    . PRO A 1 46  ? -17.978 -13.270 2.712   1.00 10.00 ? 201 PRO A N    4  
ATOM 8809   C CA   . PRO A 1 46  ? -17.032 -12.216 2.324   1.00 10.00 ? 201 PRO A CA   4  
ATOM 8810   C C    . PRO A 1 46  ? -16.675 -11.294 3.491   1.00 10.00 ? 201 PRO A C    4  
ATOM 8811   O O    . PRO A 1 46  ? -15.728 -10.522 3.410   1.00 10.00 ? 201 PRO A O    4  
ATOM 8812   C CB   . PRO A 1 46  ? -17.747 -11.446 1.210   1.00 10.00 ? 201 PRO A CB   4  
ATOM 8813   C CG   . PRO A 1 46  ? -19.183 -11.822 1.338   1.00 10.00 ? 201 PRO A CG   4  
ATOM 8814   C CD   . PRO A 1 46  ? -19.210 -13.211 1.905   1.00 10.00 ? 201 PRO A CD   4  
ATOM 8815   N N    . VAL A 1 47  ? -17.467 -11.342 4.555   1.00 10.00 ? 202 VAL A N    4  
ATOM 8816   C CA   . VAL A 1 47  ? -17.188 -10.551 5.746   1.00 10.00 ? 202 VAL A CA   4  
ATOM 8817   C C    . VAL A 1 47  ? -16.303 -11.344 6.719   1.00 10.00 ? 202 VAL A C    4  
ATOM 8818   O O    . VAL A 1 47  ? -15.353 -10.801 7.298   1.00 10.00 ? 202 VAL A O    4  
ATOM 8819   C CB   . VAL A 1 47  ? -18.485 -10.059 6.435   1.00 10.00 ? 202 VAL A CB   4  
ATOM 8820   C CG1  . VAL A 1 47  ? -18.197 -9.461  7.804   1.00 10.00 ? 202 VAL A CG1  4  
ATOM 8821   C CG2  . VAL A 1 47  ? -19.169 -9.022  5.558   1.00 10.00 ? 202 VAL A CG2  4  
ATOM 8822   H H    . VAL A 1 47  ? -18.264 -11.916 4.534   1.00 10.00 ? 202 VAL A H    4  
ATOM 8823   N N    . LEU A 1 48  ? -16.614 -12.635 6.881   1.00 10.00 ? 203 LEU A N    4  
ATOM 8824   C CA   . LEU A 1 48  ? -15.861 -13.516 7.770   1.00 10.00 ? 203 LEU A CA   4  
ATOM 8825   C C    . LEU A 1 48  ? -14.500 -13.855 7.181   1.00 10.00 ? 203 LEU A C    4  
ATOM 8826   O O    . LEU A 1 48  ? -13.472 -13.417 7.685   1.00 10.00 ? 203 LEU A O    4  
ATOM 8827   C CB   . LEU A 1 48  ? -16.672 -14.804 7.956   1.00 10.00 ? 203 LEU A CB   4  
ATOM 8828   C CG   . LEU A 1 48  ? -16.289 -15.695 9.128   1.00 10.00 ? 203 LEU A CG   4  
ATOM 8829   C CD1  . LEU A 1 48  ? -16.460 -14.945 10.438  1.00 10.00 ? 203 LEU A CD1  4  
ATOM 8830   C CD2  . LEU A 1 48  ? -17.149 -16.949 9.118   1.00 10.00 ? 203 LEU A CD2  4  
ATOM 8831   H H    . LEU A 1 48  ? -17.385 -13.001 6.396   1.00 10.00 ? 203 LEU A H    4  
ATOM 8832   N N    . ALA A 1 49  ? -14.482 -14.589 6.094   1.00 10.00 ? 204 ALA A N    4  
ATOM 8833   C CA   . ALA A 1 49  ? -13.246 -14.926 5.425   1.00 10.00 ? 204 ALA A CA   4  
ATOM 8834   C C    . ALA A 1 49  ? -12.353 -13.731 5.106   1.00 10.00 ? 204 ALA A C    4  
ATOM 8835   O O    . ALA A 1 49  ? -11.114 -13.911 5.065   1.00 10.00 ? 204 ALA A O    4  
ATOM 8836   C CB   . ALA A 1 49  ? -13.547 -15.719 4.164   1.00 10.00 ? 204 ALA A CB   4  
ATOM 8837   H H    . ALA A 1 49  ? -15.292 -15.046 5.738   1.00 10.00 ? 204 ALA A H    4  
ATOM 8838   N N    . VAL A 1 50  ? -12.923 -12.481 4.991   1.00 10.00 ? 205 VAL A N    4  
ATOM 8839   C CA   . VAL A 1 50  ? -12.044 -11.399 4.524   1.00 10.00 ? 205 VAL A CA   4  
ATOM 8840   C C    . VAL A 1 50  ? -11.229 -10.971 5.764   1.00 10.00 ? 205 VAL A C    4  
ATOM 8841   O O    . VAL A 1 50  ? -10.089 -10.542 5.652   1.00 10.00 ? 205 VAL A O    4  
ATOM 8842   C CB   . VAL A 1 50  ? -12.910 -10.168 4.026   1.00 10.00 ? 205 VAL A CB   4  
ATOM 8843   C CG1  . VAL A 1 50  ? -13.427 -9.323  5.179   1.00 10.00 ? 205 VAL A CG1  4  
ATOM 8844   C CG2  . VAL A 1 50  ? -12.289 -9.276  2.941   1.00 10.00 ? 205 VAL A CG2  4  
ATOM 8845   H H    . VAL A 1 50  ? -13.523 -12.114 5.644   1.00 10.00 ? 205 VAL A H    4  
ATOM 8846   N N    . SER A 1 51  ? -11.858 -11.151 6.963   1.00 10.00 ? 206 SER A N    4  
ATOM 8847   C CA   . SER A 1 51  ? -11.279 -10.706 8.256   1.00 10.00 ? 206 SER A CA   4  
ATOM 8848   C C    . SER A 1 51  ? -10.178 -11.622 8.815   1.00 10.00 ? 206 SER A C    4  
ATOM 8849   O O    . SER A 1 51  ? -9.307  -11.174 9.572   1.00 10.00 ? 206 SER A O    4  
ATOM 8850   C CB   . SER A 1 51  ? -12.357 -10.425 9.318   1.00 10.00 ? 206 SER A CB   4  
ATOM 8851   O OG   . SER A 1 51  ? -13.379 -9.596  8.802   1.00 10.00 ? 206 SER A OG   4  
ATOM 8852   H H    . SER A 1 51  ? -12.651 -11.746 6.972   1.00 10.00 ? 206 SER A H    4  
ATOM 8853   H HG   . SER A 1 51  ? -14.059 -10.148 8.407   1.00 10.00 ? 206 SER A HG   4  
ATOM 8854   N N    . LEU A 1 52  ? -10.263 -12.908 8.473   1.00 10.00 ? 207 LEU A N    4  
ATOM 8855   C CA   . LEU A 1 52  ? -9.304  -13.923 8.945   1.00 10.00 ? 207 LEU A CA   4  
ATOM 8856   C C    . LEU A 1 52  ? -7.928  -13.725 8.296   1.00 10.00 ? 207 LEU A C    4  
ATOM 8857   O O    . LEU A 1 52  ? -6.923  -13.616 8.989   1.00 10.00 ? 207 LEU A O    4  
ATOM 8858   C CB   . LEU A 1 52  ? -9.827  -15.318 8.593   1.00 10.00 ? 207 LEU A CB   4  
ATOM 8859   C CG   . LEU A 1 52  ? -11.175 -15.729 9.189   1.00 10.00 ? 207 LEU A CG   4  
ATOM 8860   C CD1  . LEU A 1 52  ? -11.812 -16.816 8.337   1.00 10.00 ? 207 LEU A CD1  4  
ATOM 8861   C CD2  . LEU A 1 52  ? -11.004 -16.210 10.621  1.00 10.00 ? 207 LEU A CD2  4  
ATOM 8862   H H    . LEU A 1 52  ? -10.982 -13.188 7.868   1.00 10.00 ? 207 LEU A H    4  
ATOM 8863   N N    . ALA A 1 53  ? -7.910  -13.748 6.955   1.00 10.00 ? 208 ALA A N    4  
ATOM 8864   C CA   . ALA A 1 53  ? -6.698  -13.509 6.098   1.00 10.00 ? 208 ALA A CA   4  
ATOM 8865   C C    . ALA A 1 53  ? -5.834  -12.275 6.464   1.00 10.00 ? 208 ALA A C    4  
ATOM 8866   O O    . ALA A 1 53  ? -4.778  -12.018 5.848   1.00 10.00 ? 208 ALA A O    4  
ATOM 8867   C CB   . ALA A 1 53  ? -7.132  -13.463 4.643   1.00 10.00 ? 208 ALA A CB   4  
ATOM 8868   H H    . ALA A 1 53  ? -8.638  -14.214 6.494   1.00 10.00 ? 208 ALA A H    4  
ATOM 8869   N N    . LEU A 1 54  ? -6.310  -11.597 7.502   1.00 10.00 ? 209 LEU A N    4  
ATOM 8870   C CA   . LEU A 1 54  ? -5.679  -10.384 8.010   1.00 10.00 ? 209 LEU A CA   4  
ATOM 8871   C C    . LEU A 1 54  ? -4.572  -10.666 9.040   1.00 10.00 ? 209 LEU A C    4  
ATOM 8872   O O    . LEU A 1 54  ? -3.480  -10.129 8.920   1.00 10.00 ? 209 LEU A O    4  
ATOM 8873   C CB   . LEU A 1 54  ? -6.686  -9.392  8.609   1.00 10.00 ? 209 LEU A CB   4  
ATOM 8874   C CG   . LEU A 1 54  ? -6.234  -7.931  8.531   1.00 10.00 ? 209 LEU A CG   4  
ATOM 8875   C CD1  . LEU A 1 54  ? -6.307  -7.449  7.090   1.00 10.00 ? 209 LEU A CD1  4  
ATOM 8876   C CD2  . LEU A 1 54  ? -7.041  -7.016  9.447   1.00 10.00 ? 209 LEU A CD2  4  
ATOM 8877   H H    . LEU A 1 54  ? -6.928  -12.168 8.000   1.00 10.00 ? 209 LEU A H    4  
ATOM 8878   N N    . GLU A 1 55  ? -4.848  -11.590 9.975   1.00 10.00 ? 210 GLU A N    4  
ATOM 8879   C CA   . GLU A 1 55  ? -3.962  -11.897 11.135  1.00 10.00 ? 210 GLU A CA   4  
ATOM 8880   C C    . GLU A 1 55  ? -2.484  -12.285 10.866  1.00 10.00 ? 210 GLU A C    4  
ATOM 8881   O O    . GLU A 1 55  ? -1.595  -11.868 11.622  1.00 10.00 ? 210 GLU A O    4  
ATOM 8882   C CB   . GLU A 1 55  ? -4.632  -13.010 11.948  1.00 10.00 ? 210 GLU A CB   4  
ATOM 8883   C CG   . GLU A 1 55  ? -3.892  -13.487 13.187  1.00 10.00 ? 210 GLU A CG   4  
ATOM 8884   C CD   . GLU A 1 55  ? -4.515  -14.757 13.727  1.00 10.00 ? 210 GLU A CD   4  
ATOM 8885   O OE1  . GLU A 1 55  ? -4.266  -15.837 13.150  1.00 10.00 ? 210 GLU A OE1  4  
ATOM 8886   O OE2  . GLU A 1 55  ? -5.280  -14.681 14.714  1.00 10.00 ? 210 GLU A OE2  4  
ATOM 8887   H H    . GLU A 1 55  ? -5.692  -12.093 9.889   1.00 10.00 ? 210 GLU A H    4  
ATOM 8888   N N    . GLY A 1 56  ? -2.185  -13.093 9.866   1.00 10.00 ? 211 GLY A N    4  
ATOM 8889   C CA   . GLY A 1 56  ? -0.800  -13.447 9.637   1.00 10.00 ? 211 GLY A CA   4  
ATOM 8890   C C    . GLY A 1 56  ? -0.251  -12.827 8.384   1.00 10.00 ? 211 GLY A C    4  
ATOM 8891   O O    . GLY A 1 56  ? -0.290  -11.609 8.213   1.00 10.00 ? 211 GLY A O    4  
ATOM 8892   H H    . GLY A 1 56  ? -2.873  -13.496 9.305   1.00 10.00 ? 211 GLY A H    4  
ATOM 8893   N N    . LYS A 1 57  ? 0.248   -13.672 7.501   1.00 10.00 ? 212 LYS A N    4  
ATOM 8894   C CA   . LYS A 1 57  ? 0.826   -13.227 6.250   1.00 10.00 ? 212 LYS A CA   4  
ATOM 8895   C C    . LYS A 1 57  ? -0.191  -12.597 5.306   1.00 10.00 ? 212 LYS A C    4  
ATOM 8896   O O    . LYS A 1 57  ? -1.341  -13.036 5.202   1.00 10.00 ? 212 LYS A O    4  
ATOM 8897   C CB   . LYS A 1 57  ? 1.568   -14.366 5.560   1.00 10.00 ? 212 LYS A CB   4  
ATOM 8898   C CG   . LYS A 1 57  ? 2.961   -14.591 6.109   1.00 10.00 ? 212 LYS A CG   4  
ATOM 8899   C CD   . LYS A 1 57  ? 3.684   -15.691 5.356   1.00 10.00 ? 212 LYS A CD   4  
ATOM 8900   C CE   . LYS A 1 57  ? 5.156   -15.722 5.725   1.00 10.00 ? 212 LYS A CE   4  
ATOM 8901   N NZ   . LYS A 1 57  ? 5.882   -14.529 5.213   1.00 10.00 ? 212 LYS A NZ   4  
ATOM 8902   H H    . LYS A 1 57  ? 0.230   -14.633 7.703   1.00 10.00 ? 212 LYS A H    4  
ATOM 8903   H HZ1  . LYS A 1 57  ? 5.369   -13.658 5.461   1.00 10.00 ? 212 LYS A HZ1  4  
ATOM 8904   H HZ2  . LYS A 1 57  ? 5.974   -14.581 4.178   1.00 10.00 ? 212 LYS A HZ2  4  
ATOM 8905   H HZ3  . LYS A 1 57  ? 6.833   -14.482 5.628   1.00 10.00 ? 212 LYS A HZ3  4  
ATOM 8906   N N    . ALA A 1 58  ? 0.268   -11.567 4.612   1.00 10.00 ? 213 ALA A N    4  
ATOM 8907   C CA   . ALA A 1 58  ? -0.542  -10.828 3.656   1.00 10.00 ? 213 ALA A CA   4  
ATOM 8908   C C    . ALA A 1 58  ? -0.852  -11.658 2.414   1.00 10.00 ? 213 ALA A C    4  
ATOM 8909   O O    . ALA A 1 58  ? -1.841  -11.405 1.727   1.00 10.00 ? 213 ALA A O    4  
ATOM 8910   C CB   . ALA A 1 58  ? 0.177   -9.547  3.259   1.00 10.00 ? 213 ALA A CB   4  
ATOM 8911   H H    . ALA A 1 58  ? 1.195   -11.282 4.757   1.00 10.00 ? 213 ALA A H    4  
ATOM 8912   N N    . SER A 1 59  ? 0.003   -12.637 2.121   1.00 10.00 ? 214 SER A N    4  
ATOM 8913   C CA   . SER A 1 59  ? -0.177  -13.492 0.953   1.00 10.00 ? 214 SER A CA   4  
ATOM 8914   C C    . SER A 1 59  ? -1.506  -14.245 1.008   1.00 10.00 ? 214 SER A C    4  
ATOM 8915   O O    . SER A 1 59  ? -2.146  -14.473 -0.021  1.00 10.00 ? 214 SER A O    4  
ATOM 8916   C CB   . SER A 1 59  ? 0.998   -14.462 0.814   1.00 10.00 ? 214 SER A CB   4  
ATOM 8917   O OG   . SER A 1 59  ? 1.761   -14.507 2.011   1.00 10.00 ? 214 SER A OG   4  
ATOM 8918   H H    . SER A 1 59  ? 0.775   -12.793 2.706   1.00 10.00 ? 214 SER A H    4  
ATOM 8919   H HG   . SER A 1 59  ? 2.699   -14.590 1.789   1.00 10.00 ? 214 SER A HG   4  
ATOM 8920   N N    . HIS A 1 60  ? -1.924  -14.617 2.212   1.00 10.00 ? 215 HIS A N    4  
ATOM 8921   C CA   . HIS A 1 60  ? -3.182  -15.321 2.384   1.00 10.00 ? 215 HIS A CA   4  
ATOM 8922   C C    . HIS A 1 60  ? -4.348  -14.424 1.977   1.00 10.00 ? 215 HIS A C    4  
ATOM 8923   O O    . HIS A 1 60  ? -5.320  -14.887 1.383   1.00 10.00 ? 215 HIS A O    4  
ATOM 8924   C CB   . HIS A 1 60  ? -3.345  -15.852 3.814   1.00 10.00 ? 215 HIS A CB   4  
ATOM 8925   C CG   . HIS A 1 60  ? -2.852  -17.262 4.001   1.00 10.00 ? 215 HIS A CG   4  
ATOM 8926   N ND1  . HIS A 1 60  ? -2.493  -17.785 5.229   1.00 10.00 ? 215 HIS A ND1  4  
ATOM 8927   C CD2  . HIS A 1 60  ? -2.673  -18.267 3.106   1.00 10.00 ? 215 HIS A CD2  4  
ATOM 8928   C CE1  . HIS A 1 60  ? -2.115  -19.042 5.076   1.00 10.00 ? 215 HIS A CE1  4  
ATOM 8929   N NE2  . HIS A 1 60  ? -2.216  -19.360 3.801   1.00 10.00 ? 215 HIS A NE2  4  
ATOM 8930   H H    . HIS A 1 60  ? -1.377  -14.403 2.999   1.00 10.00 ? 215 HIS A H    4  
ATOM 8931   H HD1  . HIS A 1 60  ? -2.509  -17.307 6.089   1.00 10.00 ? 215 HIS A HD1  4  
ATOM 8932   H HE2  . HIS A 1 60  ? -2.161  -20.285 3.445   1.00 10.00 ? 215 HIS A HE2  4  
ATOM 8933   N N    . ARG A 1 61  ? -4.226  -13.135 2.290   1.00 10.00 ? 216 ARG A N    4  
ATOM 8934   C CA   . ARG A 1 61  ? -5.243  -12.145 1.937   1.00 10.00 ? 216 ARG A CA   4  
ATOM 8935   C C    . ARG A 1 61  ? -5.312  -12.005 0.425   1.00 10.00 ? 216 ARG A C    4  
ATOM 8936   O O    . ARG A 1 61  ? -6.382  -12.114 -0.169  1.00 10.00 ? 216 ARG A O    4  
ATOM 8937   C CB   . ARG A 1 61  ? -4.869  -10.801 2.556   1.00 10.00 ? 216 ARG A CB   4  
ATOM 8938   C CG   . ARG A 1 61  ? -5.802  -9.657  2.199   1.00 10.00 ? 216 ARG A CG   4  
ATOM 8939   C CD   . ARG A 1 61  ? -5.279  -8.347  2.756   1.00 10.00 ? 216 ARG A CD   4  
ATOM 8940   N NE   . ARG A 1 61  ? -4.842  -8.498  4.142   1.00 10.00 ? 216 ARG A NE   4  
ATOM 8941   C CZ   . ARG A 1 61  ? -3.585  -8.324  4.549   1.00 10.00 ? 216 ARG A CZ   4  
ATOM 8942   N NH1  . ARG A 1 61  ? -2.645  -7.968  3.683   1.00 10.00 ? 216 ARG A NH1  4  
ATOM 8943   N NH2  . ARG A 1 61  ? -3.267  -8.522  5.819   1.00 10.00 ? 216 ARG A NH2  4  
ATOM 8944   H H    . ARG A 1 61  ? -3.439  -12.832 2.786   1.00 10.00 ? 216 ARG A H    4  
ATOM 8945   H HE   . ARG A 1 61  ? -5.522  -8.763  4.800   1.00 10.00 ? 216 ARG A HE   4  
ATOM 8946   H HH11 . ARG A 1 61  ? -2.871  -7.829  2.713   1.00 10.00 ? 216 ARG A HH11 4  
ATOM 8947   H HH12 . ARG A 1 61  ? -1.702  -7.837  3.990   1.00 10.00 ? 216 ARG A HH12 4  
ATOM 8948   H HH21 . ARG A 1 61  ? -3.967  -8.802  6.480   1.00 10.00 ? 216 ARG A HH21 4  
ATOM 8949   H HH22 . ARG A 1 61  ? -2.316  -8.400  6.126   1.00 10.00 ? 216 ARG A HH22 4  
ATOM 8950   N N    . GLU A 1 62  ? -4.161  -11.694 -0.164  1.00 10.00 ? 217 GLU A N    4  
ATOM 8951   C CA   . GLU A 1 62  ? -4.043  -11.567 -1.615  1.00 10.00 ? 217 GLU A CA   4  
ATOM 8952   C C    . GLU A 1 62  ? -4.727  -12.739 -2.328  1.00 10.00 ? 217 GLU A C    4  
ATOM 8953   O O    . GLU A 1 62  ? -5.396  -12.541 -3.344  1.00 10.00 ? 217 GLU A O    4  
ATOM 8954   C CB   . GLU A 1 62  ? -2.559  -11.507 -2.002  1.00 10.00 ? 217 GLU A CB   4  
ATOM 8955   C CG   . GLU A 1 62  ? -2.255  -10.670 -3.237  1.00 10.00 ? 217 GLU A CG   4  
ATOM 8956   C CD   . GLU A 1 62  ? -1.756  -9.272  -2.905  1.00 10.00 ? 217 GLU A CD   4  
ATOM 8957   O OE1  . GLU A 1 62  ? -1.890  -8.841  -1.742  1.00 10.00 ? 217 GLU A OE1  4  
ATOM 8958   O OE2  . GLU A 1 62  ? -1.235  -8.591  -3.821  1.00 10.00 ? 217 GLU A OE2  4  
ATOM 8959   H H    . GLU A 1 62  ? -3.457  -11.327 0.404   1.00 10.00 ? 217 GLU A H    4  
ATOM 8960   N N    . MET A 1 63  ? -4.578  -13.944 -1.782  1.00 10.00 ? 218 MET A N    4  
ATOM 8961   C CA   . MET A 1 63  ? -5.212  -15.135 -2.346  1.00 10.00 ? 218 MET A CA   4  
ATOM 8962   C C    . MET A 1 63  ? -6.734  -15.049 -2.184  1.00 10.00 ? 218 MET A C    4  
ATOM 8963   O O    . MET A 1 63  ? -7.495  -15.306 -3.119  1.00 10.00 ? 218 MET A O    4  
ATOM 8964   C CB   . MET A 1 63  ? -4.707  -16.377 -1.604  1.00 10.00 ? 218 MET A CB   4  
ATOM 8965   C CG   . MET A 1 63  ? -3.469  -17.021 -2.201  1.00 10.00 ? 218 MET A CG   4  
ATOM 8966   S SD   . MET A 1 63  ? -3.868  -18.114 -3.575  1.00 10.00 ? 218 MET A SD   4  
ATOM 8967   C CE   . MET A 1 63  ? -4.691  -19.452 -2.713  1.00 10.00 ? 218 MET A CE   4  
ATOM 8968   H H    . MET A 1 63  ? -4.015  -14.037 -0.982  1.00 10.00 ? 218 MET A H    4  
ATOM 8969   N N    . THR A 1 64  ? -7.139  -14.707 -0.968  1.00 10.00 ? 219 THR A N    4  
ATOM 8970   C CA   . THR A 1 64  ? -8.556  -14.566 -0.619  1.00 10.00 ? 219 THR A CA   4  
ATOM 8971   C C    . THR A 1 64  ? -9.331  -13.654 -1.577  1.00 10.00 ? 219 THR A C    4  
ATOM 8972   O O    . THR A 1 64  ? -10.489 -13.931 -1.877  1.00 10.00 ? 219 THR A O    4  
ATOM 8973   C CB   . THR A 1 64  ? -8.727  -14.047 0.818   1.00 10.00 ? 219 THR A CB   4  
ATOM 8974   O OG1  . THR A 1 64  ? -7.975  -14.867 1.716   1.00 10.00 ? 219 THR A OG1  4  
ATOM 8975   C CG2  . THR A 1 64  ? -10.190 -14.061 1.234   1.00 10.00 ? 219 THR A CG2  4  
ATOM 8976   H H    . THR A 1 64  ? -6.455  -14.728 -0.268  1.00 10.00 ? 219 THR A H    4  
ATOM 8977   H HG1  . THR A 1 64  ? -7.035  -14.688 1.603   1.00 10.00 ? 219 THR A HG1  4  
ATOM 8978   N N    . SER A 1 65  ? -8.721  -12.566 -2.035  1.00 10.00 ? 220 SER A N    4  
ATOM 8979   C CA   . SER A 1 65  ? -9.378  -11.665 -2.978  1.00 10.00 ? 220 SER A CA   4  
ATOM 8980   C C    . SER A 1 65  ? -10.043 -12.380 -4.168  1.00 10.00 ? 220 SER A C    4  
ATOM 8981   O O    . SER A 1 65  ? -11.087 -11.933 -4.648  1.00 10.00 ? 220 SER A O    4  
ATOM 8982   C CB   . SER A 1 65  ? -8.357  -10.649 -3.474  1.00 10.00 ? 220 SER A CB   4  
ATOM 8983   O OG   . SER A 1 65  ? -7.281  -10.538 -2.552  1.00 10.00 ? 220 SER A OG   4  
ATOM 8984   H H    . SER A 1 65  ? -7.898  -12.254 -1.604  1.00 10.00 ? 220 SER A H    4  
ATOM 8985   H HG   . SER A 1 65  ? -6.568  -11.138 -2.814  1.00 10.00 ? 220 SER A HG   4  
ATOM 8986   N N    . LYS A 1 66  ? -9.479  -13.500 -4.623  1.00 10.00 ? 221 LYS A N    4  
ATOM 8987   C CA   . LYS A 1 66  ? -10.067 -14.232 -5.746  1.00 10.00 ? 221 LYS A CA   4  
ATOM 8988   C C    . LYS A 1 66  ? -11.476 -14.733 -5.412  1.00 10.00 ? 221 LYS A C    4  
ATOM 8989   O O    . LYS A 1 66  ? -12.301 -14.930 -6.303  1.00 10.00 ? 221 LYS A O    4  
ATOM 8990   C CB   . LYS A 1 66  ? -9.170  -15.385 -6.210  1.00 10.00 ? 221 LYS A CB   4  
ATOM 8991   C CG   . LYS A 1 66  ? -9.541  -15.945 -7.580  1.00 10.00 ? 221 LYS A CG   4  
ATOM 8992   C CD   . LYS A 1 66  ? -9.189  -14.971 -8.696  1.00 10.00 ? 221 LYS A CD   4  
ATOM 8993   C CE   . LYS A 1 66  ? -10.281 -14.906 -9.758  1.00 10.00 ? 221 LYS A CE   4  
ATOM 8994   N NZ   . LYS A 1 66  ? -10.684 -16.253 -10.252 1.00 10.00 ? 221 LYS A NZ   4  
ATOM 8995   H H    . LYS A 1 66  ? -8.661  -13.845 -4.193  1.00 10.00 ? 221 LYS A H    4  
ATOM 8996   H HZ1  . LYS A 1 66  ? -9.892  -16.922 -10.167 1.00 10.00 ? 221 LYS A HZ1  4  
ATOM 8997   H HZ2  . LYS A 1 66  ? -10.971 -16.198 -11.249 1.00 10.00 ? 221 LYS A HZ2  4  
ATOM 8998   H HZ3  . LYS A 1 66  ? -11.495 -16.613 -9.698  1.00 10.00 ? 221 LYS A HZ3  4  
ATOM 8999   N N    . LEU A 1 67  ? -11.748 -14.914 -4.119  1.00 10.00 ? 222 LEU A N    4  
ATOM 9000   C CA   . LEU A 1 67  ? -13.040 -15.401 -3.657  1.00 10.00 ? 222 LEU A CA   4  
ATOM 9001   C C    . LEU A 1 67  ? -14.167 -14.459 -4.077  1.00 10.00 ? 222 LEU A C    4  
ATOM 9002   O O    . LEU A 1 67  ? -15.236 -14.909 -4.480  1.00 10.00 ? 222 LEU A O    4  
ATOM 9003   C CB   . LEU A 1 67  ? -13.026 -15.553 -2.130  1.00 10.00 ? 222 LEU A CB   4  
ATOM 9004   C CG   . LEU A 1 67  ? -14.266 -16.170 -1.479  1.00 10.00 ? 222 LEU A CG   4  
ATOM 9005   C CD1  . LEU A 1 67  ? -14.506 -17.576 -2.004  1.00 10.00 ? 222 LEU A CD1  4  
ATOM 9006   C CD2  . LEU A 1 67  ? -14.119 -16.181 0.035   1.00 10.00 ? 222 LEU A CD2  4  
ATOM 9007   H H    . LEU A 1 67  ? -11.076 -14.654 -3.450  1.00 10.00 ? 222 LEU A H    4  
ATOM 9008   N N    . LEU A 1 68  ? -13.916 -13.155 -4.013  1.00 10.00 ? 223 LEU A N    4  
ATOM 9009   C CA   . LEU A 1 68  ? -14.930 -12.167 -4.380  1.00 10.00 ? 223 LEU A CA   4  
ATOM 9010   C C    . LEU A 1 68  ? -15.251 -12.237 -5.870  1.00 10.00 ? 223 LEU A C    4  
ATOM 9011   O O    . LEU A 1 68  ? -16.393 -12.501 -6.250  1.00 10.00 ? 223 LEU A O    4  
ATOM 9012   C CB   . LEU A 1 68  ? -14.481 -10.754 -3.997  1.00 10.00 ? 223 LEU A CB   4  
ATOM 9013   C CG   . LEU A 1 68  ? -14.327 -10.468 -2.503  1.00 10.00 ? 223 LEU A CG   4  
ATOM 9014   C CD1  . LEU A 1 68  ? -13.811 -9.055  -2.287  1.00 10.00 ? 223 LEU A CD1  4  
ATOM 9015   C CD2  . LEU A 1 68  ? -15.648 -10.672 -1.777  1.00 10.00 ? 223 LEU A CD2  4  
ATOM 9016   H H    . LEU A 1 68  ? -13.026 -12.852 -3.730  1.00 10.00 ? 223 LEU A H    4  
ATOM 9017   N N    . SER A 1 69  ? -14.242 -11.954 -6.697  1.00 10.00 ? 224 SER A N    4  
ATOM 9018   C CA   . SER A 1 69  ? -14.375 -12.022 -8.152  1.00 10.00 ? 224 SER A CA   4  
ATOM 9019   C C    . SER A 1 69  ? -15.020 -13.349 -8.594  1.00 10.00 ? 224 SER A C    4  
ATOM 9020   O O    . SER A 1 69  ? -15.651 -13.438 -9.648  1.00 10.00 ? 224 SER A O    4  
ATOM 9021   C CB   . SER A 1 69  ? -12.994 -11.826 -8.793  1.00 10.00 ? 224 SER A CB   4  
ATOM 9022   O OG   . SER A 1 69  ? -12.246 -10.848 -8.074  1.00 10.00 ? 224 SER A OG   4  
ATOM 9023   H H    . SER A 1 69  ? -13.433 -11.564 -6.309  1.00 10.00 ? 224 SER A H    4  
ATOM 9024   H HG   . SER A 1 69  ? -11.803 -10.246 -8.701  1.00 10.00 ? 224 SER A HG   4  
ATOM 9025   N N    . ASP A 1 70  ? -14.824 -14.372 -7.780  1.00 10.00 ? 225 ASP A N    4  
ATOM 9026   C CA   . ASP A 1 70  ? -15.407 -15.679 -8.048  1.00 10.00 ? 225 ASP A CA   4  
ATOM 9027   C C    . ASP A 1 70  ? -16.876 -15.783 -7.617  1.00 10.00 ? 225 ASP A C    4  
ATOM 9028   O O    . ASP A 1 70  ? -17.742 -16.170 -8.405  1.00 10.00 ? 225 ASP A O    4  
ATOM 9029   C CB   . ASP A 1 70  ? -14.558 -16.846 -7.569  1.00 10.00 ? 225 ASP A CB   4  
ATOM 9030   C CG   . ASP A 1 70  ? -13.886 -17.552 -8.732  1.00 10.00 ? 225 ASP A CG   4  
ATOM 9031   O OD1  . ASP A 1 70  ? -13.051 -16.922 -9.409  1.00 10.00 ? 225 ASP A OD1  4  
ATOM 9032   O OD2  . ASP A 1 70  ? -14.191 -18.739 -8.982  1.00 10.00 ? 225 ASP A OD2  4  
ATOM 9033   H H    . ASP A 1 70  ? -14.372 -14.178 -6.937  1.00 10.00 ? 225 ASP A H    4  
ATOM 9034   N N    . LEU A 1 71  ? -17.146 -15.435 -6.353  1.00 10.00 ? 226 LEU A N    4  
ATOM 9035   C CA   . LEU A 1 71  ? -18.496 -15.511 -5.783  1.00 10.00 ? 226 LEU A CA   4  
ATOM 9036   C C    . LEU A 1 71  ? -19.506 -14.620 -6.488  1.00 10.00 ? 226 LEU A C    4  
ATOM 9037   O O    . LEU A 1 71  ? -20.601 -15.077 -6.839  1.00 10.00 ? 226 LEU A O    4  
ATOM 9038   C CB   . LEU A 1 71  ? -18.487 -15.188 -4.287  1.00 10.00 ? 226 LEU A CB   4  
ATOM 9039   C CG   . LEU A 1 71  ? -17.728 -16.159 -3.379  1.00 10.00 ? 226 LEU A CG   4  
ATOM 9040   C CD1  . LEU A 1 71  ? -17.889 -15.760 -1.922  1.00 10.00 ? 226 LEU A CD1  4  
ATOM 9041   C CD2  . LEU A 1 71  ? -18.189 -17.594 -3.601  1.00 10.00 ? 226 LEU A CD2  4  
ATOM 9042   H H    . LEU A 1 71  ? -16.408 -15.123 -5.778  1.00 10.00 ? 226 LEU A H    4  
ATOM 9043   N N    . CYS A 1 72  ? -19.166 -13.352 -6.653  1.00 10.00 ? 227 CYS A N    4  
ATOM 9044   C CA   . CYS A 1 72  ? -20.055 -12.402 -7.312  1.00 10.00 ? 227 CYS A CA   4  
ATOM 9045   C C    . CYS A 1 72  ? -20.460 -12.901 -8.689  1.00 10.00 ? 227 CYS A C    4  
ATOM 9046   O O    . CYS A 1 72  ? -19.639 -13.440 -9.430  1.00 10.00 ? 227 CYS A O    4  
ATOM 9047   C CB   . CYS A 1 72  ? -19.404 -11.016 -7.404  1.00 10.00 ? 227 CYS A CB   4  
ATOM 9048   S SG   . CYS A 1 72  ? -20.576 -9.652  -7.627  1.00 10.00 ? 227 CYS A SG   4  
ATOM 9049   H H    . CYS A 1 72  ? -18.313 -13.027 -6.293  1.00 10.00 ? 227 CYS A H    4  
ATOM 9050   H HG   . CYS A 1 72  ? -21.012 -9.285  -6.427  1.00 10.00 ? 227 CYS A HG   4  
ATOM 9051   N N    . GLY A 1 73  ? -21.733 -12.745 -9.012  1.00 10.00 ? 228 GLY A N    4  
ATOM 9052   C CA   . GLY A 1 73  ? -22.241 -13.193 -10.295 1.00 10.00 ? 228 GLY A CA   4  
ATOM 9053   C C    . GLY A 1 73  ? -22.656 -14.650 -10.270 1.00 10.00 ? 228 GLY A C    4  
ATOM 9054   O O    . GLY A 1 73  ? -23.617 -15.045 -10.927 1.00 10.00 ? 228 GLY A O    4  
ATOM 9055   H H    . GLY A 1 73  ? -22.339 -12.298 -8.374  1.00 10.00 ? 228 GLY A H    4  
ATOM 9056   N N    . THR A 1 74  ? -21.934 -15.449 -9.499  1.00 10.00 ? 229 THR A N    4  
ATOM 9057   C CA   . THR A 1 74  ? -22.227 -16.867 -9.384  1.00 10.00 ? 229 THR A CA   4  
ATOM 9058   C C    . THR A 1 74  ? -23.256 -17.123 -8.279  1.00 10.00 ? 229 THR A C    4  
ATOM 9059   O O    . THR A 1 74  ? -24.315 -17.700 -8.523  1.00 10.00 ? 229 THR A O    4  
ATOM 9060   C CB   . THR A 1 74  ? -20.943 -17.663 -9.088  1.00 10.00 ? 229 THR A CB   4  
ATOM 9061   O OG1  . THR A 1 74  ? -19.843 -17.059 -9.789  1.00 10.00 ? 229 THR A OG1  4  
ATOM 9062   C CG2  . THR A 1 74  ? -21.093 -19.106 -9.542  1.00 10.00 ? 229 THR A CG2  4  
ATOM 9063   H H    . THR A 1 74  ? -21.174 -15.079 -9.006  1.00 10.00 ? 229 THR A H    4  
ATOM 9064   H HG1  . THR A 1 74  ? -19.120 -16.879 -9.167  1.00 10.00 ? 229 THR A HG1  4  
ATOM 9065   N N    . VAL A 1 75  ? -22.943 -16.684 -7.062  1.00 10.00 ? 230 VAL A N    4  
ATOM 9066   C CA   . VAL A 1 75  ? -23.842 -16.876 -5.930  1.00 10.00 ? 230 VAL A CA   4  
ATOM 9067   C C    . VAL A 1 75  ? -23.943 -15.616 -5.076  1.00 10.00 ? 230 VAL A C    4  
ATOM 9068   O O    . VAL A 1 75  ? -24.564 -15.623 -4.015  1.00 10.00 ? 230 VAL A O    4  
ATOM 9069   C CB   . VAL A 1 75  ? -23.422 -18.065 -5.035  1.00 10.00 ? 230 VAL A CB   4  
ATOM 9070   C CG1  . VAL A 1 75  ? -23.843 -19.387 -5.658  1.00 10.00 ? 230 VAL A CG1  4  
ATOM 9071   C CG2  . VAL A 1 75  ? -21.922 -18.045 -4.771  1.00 10.00 ? 230 VAL A CG2  4  
ATOM 9072   H H    . VAL A 1 75  ? -22.081 -16.228 -6.927  1.00 10.00 ? 230 VAL A H    4  
ATOM 9073   N N    . MET A 1 76  ? -23.335 -14.537 -5.543  1.00 10.00 ? 231 MET A N    4  
ATOM 9074   C CA   . MET A 1 76  ? -23.361 -13.274 -4.816  1.00 10.00 ? 231 MET A CA   4  
ATOM 9075   C C    . MET A 1 76  ? -23.782 -12.142 -5.736  1.00 10.00 ? 231 MET A C    4  
ATOM 9076   O O    . MET A 1 76  ? -23.370 -12.091 -6.894  1.00 10.00 ? 231 MET A O    4  
ATOM 9077   C CB   . MET A 1 76  ? -21.993 -12.965 -4.206  1.00 10.00 ? 231 MET A CB   4  
ATOM 9078   C CG   . MET A 1 76  ? -21.742 -13.616 -2.856  1.00 10.00 ? 231 MET A CG   4  
ATOM 9079   S SD   . MET A 1 76  ? -20.253 -12.993 -2.051  1.00 10.00 ? 231 MET A SD   4  
ATOM 9080   C CE   . MET A 1 76  ? -20.658 -11.255 -1.887  1.00 10.00 ? 231 MET A CE   4  
ATOM 9081   H H    . MET A 1 76  ? -22.868 -14.581 -6.405  1.00 10.00 ? 231 MET A H    4  
ATOM 9082   N N    . SER A 1 77  ? -24.598 -11.237 -5.218  1.00 10.00 ? 232 SER A N    4  
ATOM 9083   C CA   . SER A 1 77  ? -25.069 -10.106 -6.000  1.00 10.00 ? 232 SER A CA   4  
ATOM 9084   C C    . SER A 1 77  ? -24.037 -8.980  -5.992  1.00 10.00 ? 232 SER A C    4  
ATOM 9085   O O    . SER A 1 77  ? -23.128 -8.963  -5.155  1.00 10.00 ? 232 SER A O    4  
ATOM 9086   C CB   . SER A 1 77  ? -26.406 -9.604  -5.446  1.00 10.00 ? 232 SER A CB   4  
ATOM 9087   O OG   . SER A 1 77  ? -26.268 -9.148  -4.110  1.00 10.00 ? 232 SER A OG   4  
ATOM 9088   H H    . SER A 1 77  ? -24.893 -11.329 -4.285  1.00 10.00 ? 232 SER A H    4  
ATOM 9089   H HG   . SER A 1 77  ? -26.280 -9.911  -3.506  1.00 10.00 ? 232 SER A HG   4  
ATOM 9090   N N    . THR A 1 78  ? -24.159 -8.060  -6.940  1.00 10.00 ? 233 THR A N    4  
ATOM 9091   C CA   . THR A 1 78  ? -23.254 -6.923  -7.012  1.00 10.00 ? 233 THR A CA   4  
ATOM 9092   C C    . THR A 1 78  ? -23.381 -6.061  -5.749  1.00 10.00 ? 233 THR A C    4  
ATOM 9093   O O    . THR A 1 78  ? -22.413 -5.448  -5.299  1.00 10.00 ? 233 THR A O    4  
ATOM 9094   C CB   . THR A 1 78  ? -23.514 -6.077  -8.272  1.00 10.00 ? 233 THR A CB   4  
ATOM 9095   O OG1  . THR A 1 78  ? -23.744 -6.957  -9.386  1.00 10.00 ? 233 THR A OG1  4  
ATOM 9096   C CG2  . THR A 1 78  ? -22.307 -5.204  -8.577  1.00 10.00 ? 233 THR A CG2  4  
ATOM 9097   H H    . THR A 1 78  ? -24.848 -8.170  -7.633  1.00 10.00 ? 233 THR A H    4  
ATOM 9098   H HG1  . THR A 1 78  ? -24.267 -6.495  -10.054 1.00 10.00 ? 233 THR A HG1  4  
ATOM 9099   N N    . THR A 1 79  ? -24.582 -6.037  -5.172  1.00 10.00 ? 234 THR A N    4  
ATOM 9100   C CA   . THR A 1 79  ? -24.837 -5.284  -3.952  1.00 10.00 ? 234 THR A CA   4  
ATOM 9101   C C    . THR A 1 79  ? -24.175 -5.975  -2.758  1.00 10.00 ? 234 THR A C    4  
ATOM 9102   O O    . THR A 1 79  ? -23.528 -5.323  -1.939  1.00 10.00 ? 234 THR A O    4  
ATOM 9103   C CB   . THR A 1 79  ? -26.354 -5.173  -3.691  1.00 10.00 ? 234 THR A CB   4  
ATOM 9104   O OG1  . THR A 1 79  ? -27.013 -4.704  -4.878  1.00 10.00 ? 234 THR A OG1  4  
ATOM 9105   C CG2  . THR A 1 79  ? -26.633 -4.211  -2.545  1.00 10.00 ? 234 THR A CG2  4  
ATOM 9106   H H    . THR A 1 79  ? -25.317 -6.534  -5.581  1.00 10.00 ? 234 THR A H    4  
ATOM 9107   H HG1  . THR A 1 79  ? -26.672 -3.828  -5.105  1.00 10.00 ? 234 THR A HG1  4  
ATOM 9108   N N    . ASP A 1 80  ? -24.429 -7.286  -2.643  1.00 10.00 ? 235 ASP A N    4  
ATOM 9109   C CA   . ASP A 1 80  ? -23.833 -8.100  -1.567  1.00 10.00 ? 235 ASP A CA   4  
ATOM 9110   C C    . ASP A 1 80  ? -22.370 -7.764  -1.301  1.00 10.00 ? 235 ASP A C    4  
ATOM 9111   O O    . ASP A 1 80  ? -21.965 -7.680  -0.142  1.00 10.00 ? 235 ASP A O    4  
ATOM 9112   C CB   . ASP A 1 80  ? -23.930 -9.595  -1.892  1.00 10.00 ? 235 ASP A CB   4  
ATOM 9113   C CG   . ASP A 1 80  ? -25.189 -10.251 -1.370  1.00 10.00 ? 235 ASP A CG   4  
ATOM 9114   O OD1  . ASP A 1 80  ? -25.499 -10.094 -0.167  1.00 10.00 ? 235 ASP A OD1  4  
ATOM 9115   O OD2  . ASP A 1 80  ? -25.872 -10.930 -2.166  1.00 10.00 ? 235 ASP A OD2  4  
ATOM 9116   H H    . ASP A 1 80  ? -25.232 -7.605  -3.101  1.00 10.00 ? 235 ASP A H    4  
ATOM 9117   N N    . VAL A 1 81  ? -21.586 -7.546  -2.349  1.00 10.00 ? 236 VAL A N    4  
ATOM 9118   C CA   . VAL A 1 81  ? -20.179 -7.202  -2.165  1.00 10.00 ? 236 VAL A CA   4  
ATOM 9119   C C    . VAL A 1 81  ? -20.038 -5.888  -1.387  1.00 10.00 ? 236 VAL A C    4  
ATOM 9120   O O    . VAL A 1 81  ? -19.273 -5.811  -0.422  1.00 10.00 ? 236 VAL A O    4  
ATOM 9121   C CB   . VAL A 1 81  ? -19.404 -7.122  -3.496  1.00 10.00 ? 236 VAL A CB   4  
ATOM 9122   C CG1  . VAL A 1 81  ? -17.907 -7.023  -3.235  1.00 10.00 ? 236 VAL A CG1  4  
ATOM 9123   C CG2  . VAL A 1 81  ? -19.708 -8.331  -4.363  1.00 10.00 ? 236 VAL A CG2  4  
ATOM 9124   H H    . VAL A 1 81  ? -21.955 -7.618  -3.254  1.00 10.00 ? 236 VAL A H    4  
ATOM 9125   N N    . GLU A 1 82  ? -20.802 -4.868  -1.787  1.00 10.00 ? 237 GLU A N    4  
ATOM 9126   C CA   . GLU A 1 82  ? -20.764 -3.570  -1.108  1.00 10.00 ? 237 GLU A CA   4  
ATOM 9127   C C    . GLU A 1 82  ? -21.173 -3.744  0.354   1.00 10.00 ? 237 GLU A C    4  
ATOM 9128   O O    . GLU A 1 82  ? -20.459 -3.323  1.264   1.00 10.00 ? 237 GLU A O    4  
ATOM 9129   C CB   . GLU A 1 82  ? -21.718 -2.578  -1.785  1.00 10.00 ? 237 GLU A CB   4  
ATOM 9130   C CG   . GLU A 1 82  ? -21.473 -2.357  -3.270  1.00 10.00 ? 237 GLU A CG   4  
ATOM 9131   C CD   . GLU A 1 82  ? -22.417 -1.329  -3.852  1.00 10.00 ? 237 GLU A CD   4  
ATOM 9132   O OE1  . GLU A 1 82  ? -22.711 -0.328  -3.161  1.00 10.00 ? 237 GLU A OE1  4  
ATOM 9133   O OE2  . GLU A 1 82  ? -22.870 -1.509  -5.004  1.00 10.00 ? 237 GLU A OE2  4  
ATOM 9134   H H    . GLU A 1 82  ? -21.411 -4.995  -2.546  1.00 10.00 ? 237 GLU A H    4  
ATOM 9135   N N    . LYS A 1 83  ? -22.358 -4.330  0.561   1.00 10.00 ? 238 LYS A N    4  
ATOM 9136   C CA   . LYS A 1 83  ? -22.863 -4.629  1.908   1.00 10.00 ? 238 LYS A CA   4  
ATOM 9137   C C    . LYS A 1 83  ? -21.843 -5.354  2.783   1.00 10.00 ? 238 LYS A C    4  
ATOM 9138   O O    . LYS A 1 83  ? -21.909 -5.276  4.013   1.00 10.00 ? 238 LYS A O    4  
ATOM 9139   C CB   . LYS A 1 83  ? -24.112 -5.511  1.820   1.00 10.00 ? 238 LYS A CB   4  
ATOM 9140   C CG   . LYS A 1 83  ? -25.323 -4.880  1.153   1.00 10.00 ? 238 LYS A CG   4  
ATOM 9141   C CD   . LYS A 1 83  ? -26.549 -5.772  1.313   1.00 10.00 ? 238 LYS A CD   4  
ATOM 9142   C CE   . LYS A 1 83  ? -26.363 -7.105  0.602   1.00 10.00 ? 238 LYS A CE   4  
ATOM 9143   N NZ   . LYS A 1 83  ? -27.168 -8.196  1.215   1.00 10.00 ? 238 LYS A NZ   4  
ATOM 9144   H H    . LYS A 1 83  ? -22.995 -4.363  -0.183  1.00 10.00 ? 238 LYS A H    4  
ATOM 9145   H HZ1  . LYS A 1 83  ? -26.955 -8.272  2.230   1.00 10.00 ? 238 LYS A HZ1  4  
ATOM 9146   H HZ2  . LYS A 1 83  ? -26.941 -9.105  0.755   1.00 10.00 ? 238 LYS A HZ2  4  
ATOM 9147   H HZ3  . LYS A 1 83  ? -28.184 -8.004  1.098   1.00 10.00 ? 238 LYS A HZ3  4  
ATOM 9148   N N    . SER A 1 84  ? -20.907 -6.051  2.160   1.00 10.00 ? 239 SER A N    4  
ATOM 9149   C CA   . SER A 1 84  ? -19.898 -6.778  2.906   1.00 10.00 ? 239 SER A CA   4  
ATOM 9150   C C    . SER A 1 84  ? -18.835 -5.806  3.399   1.00 10.00 ? 239 SER A C    4  
ATOM 9151   O O    . SER A 1 84  ? -18.435 -5.840  4.563   1.00 10.00 ? 239 SER A O    4  
ATOM 9152   C CB   . SER A 1 84  ? -19.268 -7.862  2.034   1.00 10.00 ? 239 SER A CB   4  
ATOM 9153   O OG   . SER A 1 84  ? -20.260 -8.739  1.532   1.00 10.00 ? 239 SER A OG   4  
ATOM 9154   H H    . SER A 1 84  ? -20.854 -6.017  1.181   1.00 10.00 ? 239 SER A H    4  
ATOM 9155   H HG   . SER A 1 84  ? -20.911 -8.234  1.024   1.00 10.00 ? 239 SER A HG   4  
ATOM 9156   N N    . PHE A 1 85  ? -18.400 -4.937  2.494   1.00 10.00 ? 240 PHE A N    4  
ATOM 9157   C CA   . PHE A 1 85  ? -17.390 -3.934  2.807   1.00 10.00 ? 240 PHE A CA   4  
ATOM 9158   C C    . PHE A 1 85  ? -17.776 -3.086  4.012   1.00 10.00 ? 240 PHE A C    4  
ATOM 9159   O O    . PHE A 1 85  ? -16.957 -2.889  4.902   1.00 10.00 ? 240 PHE A O    4  
ATOM 9160   C CB   . PHE A 1 85  ? -17.059 -3.065  1.594   1.00 10.00 ? 240 PHE A CB   4  
ATOM 9161   C CG   . PHE A 1 85  ? -16.059 -3.703  0.674   1.00 10.00 ? 240 PHE A CG   4  
ATOM 9162   C CD1  . PHE A 1 85  ? -14.701 -3.584  0.919   1.00 10.00 ? 240 PHE A CD1  4  
ATOM 9163   C CD2  . PHE A 1 85  ? -16.473 -4.438  -0.423  1.00 10.00 ? 240 PHE A CD2  4  
ATOM 9164   C CE1  . PHE A 1 85  ? -13.774 -4.185  0.087   1.00 10.00 ? 240 PHE A CE1  4  
ATOM 9165   C CE2  . PHE A 1 85  ? -15.554 -5.039  -1.261  1.00 10.00 ? 240 PHE A CE2  4  
ATOM 9166   C CZ   . PHE A 1 85  ? -14.202 -4.915  -1.004  1.00 10.00 ? 240 PHE A CZ   4  
ATOM 9167   H H    . PHE A 1 85  ? -18.733 -5.021  1.576   1.00 10.00 ? 240 PHE A H    4  
ATOM 9168   N N    . ASP A 1 86  ? -19.015 -2.590  4.044   1.00 10.00 ? 241 ASP A N    4  
ATOM 9169   C CA   . ASP A 1 86  ? -19.479 -1.778  5.174   1.00 10.00 ? 241 ASP A CA   4  
ATOM 9170   C C    . ASP A 1 86  ? -19.351 -2.561  6.476   1.00 10.00 ? 241 ASP A C    4  
ATOM 9171   O O    . ASP A 1 86  ? -18.787 -2.068  7.455   1.00 10.00 ? 241 ASP A O    4  
ATOM 9172   C CB   . ASP A 1 86  ? -20.937 -1.359  4.969   1.00 10.00 ? 241 ASP A CB   4  
ATOM 9173   C CG   . ASP A 1 86  ? -21.091 -0.080  4.163   1.00 10.00 ? 241 ASP A CG   4  
ATOM 9174   O OD1  . ASP A 1 86  ? -20.818 1.011   4.708   1.00 10.00 ? 241 ASP A OD1  4  
ATOM 9175   O OD2  . ASP A 1 86  ? -21.517 -0.159  2.990   1.00 10.00 ? 241 ASP A OD2  4  
ATOM 9176   H H    . ASP A 1 86  ? -19.619 -2.740  3.284   1.00 10.00 ? 241 ASP A H    4  
ATOM 9177   N N    . LYS A 1 87  ? -19.939 -3.757  6.486   1.00 10.00 ? 242 LYS A N    4  
ATOM 9178   C CA   . LYS A 1 87  ? -19.839 -4.649  7.646   1.00 10.00 ? 242 LYS A CA   4  
ATOM 9179   C C    . LYS A 1 87  ? -18.381 -4.839  8.065   1.00 10.00 ? 242 LYS A C    4  
ATOM 9180   O O    . LYS A 1 87  ? -18.071 -4.861  9.254   1.00 10.00 ? 242 LYS A O    4  
ATOM 9181   C CB   . LYS A 1 87  ? -20.451 -6.017  7.328   1.00 10.00 ? 242 LYS A CB   4  
ATOM 9182   C CG   . LYS A 1 87  ? -21.966 -6.036  7.194   1.00 10.00 ? 242 LYS A CG   4  
ATOM 9183   C CD   . LYS A 1 87  ? -22.453 -7.434  6.837   1.00 10.00 ? 242 LYS A CD   4  
ATOM 9184   C CE   . LYS A 1 87  ? -23.970 -7.533  6.871   1.00 10.00 ? 242 LYS A CE   4  
ATOM 9185   N NZ   . LYS A 1 87  ? -24.599 -6.901  5.683   1.00 10.00 ? 242 LYS A NZ   4  
ATOM 9186   H H    . LYS A 1 87  ? -20.609 -3.932  5.796   1.00 10.00 ? 242 LYS A H    4  
ATOM 9187   H HZ1  . LYS A 1 87  ? -24.091 -7.176  4.821   1.00 10.00 ? 242 LYS A HZ1  4  
ATOM 9188   H HZ2  . LYS A 1 87  ? -24.576 -5.865  5.771   1.00 10.00 ? 242 LYS A HZ2  4  
ATOM 9189   H HZ3  . LYS A 1 87  ? -25.598 -7.210  5.595   1.00 10.00 ? 242 LYS A HZ3  4  
ATOM 9190   N N    . LEU A 1 88  ? -17.494 -4.974  7.088   1.00 10.00 ? 243 LEU A N    4  
ATOM 9191   C CA   . LEU A 1 88  ? -16.072 -5.132  7.364   1.00 10.00 ? 243 LEU A CA   4  
ATOM 9192   C C    . LEU A 1 88  ? -15.500 -3.845  7.954   1.00 10.00 ? 243 LEU A C    4  
ATOM 9193   O O    . LEU A 1 88  ? -14.761 -3.875  8.937   1.00 10.00 ? 243 LEU A O    4  
ATOM 9194   C CB   . LEU A 1 88  ? -15.326 -5.515  6.080   1.00 10.00 ? 243 LEU A CB   4  
ATOM 9195   C CG   . LEU A 1 88  ? -13.797 -5.447  6.128   1.00 10.00 ? 243 LEU A CG   4  
ATOM 9196   C CD1  . LEU A 1 88  ? -13.242 -6.420  7.157   1.00 10.00 ? 243 LEU A CD1  4  
ATOM 9197   C CD2  . LEU A 1 88  ? -13.208 -5.722  4.752   1.00 10.00 ? 243 LEU A CD2  4  
ATOM 9198   H H    . LEU A 1 88  ? -17.804 -4.973  6.155   1.00 10.00 ? 243 LEU A H    4  
ATOM 9199   N N    . LEU A 1 89  ? -15.845 -2.717  7.333   1.00 10.00 ? 244 LEU A N    4  
ATOM 9200   C CA   . LEU A 1 89  ? -15.390 -1.406  7.791   1.00 10.00 ? 244 LEU A CA   4  
ATOM 9201   C C    . LEU A 1 89  ? -15.709 -1.193  9.265   1.00 10.00 ? 244 LEU A C    4  
ATOM 9202   O O    . LEU A 1 89  ? -14.822 -0.884  10.058  1.00 10.00 ? 244 LEU A O    4  
ATOM 9203   C CB   . LEU A 1 89  ? -16.033 -0.278  6.972   1.00 10.00 ? 244 LEU A CB   4  
ATOM 9204   C CG   . LEU A 1 89  ? -15.708 -0.236  5.479   1.00 10.00 ? 244 LEU A CG   4  
ATOM 9205   C CD1  . LEU A 1 89  ? -16.562 0.813   4.777   1.00 10.00 ? 244 LEU A CD1  4  
ATOM 9206   C CD2  . LEU A 1 89  ? -14.229 0.037   5.256   1.00 10.00 ? 244 LEU A CD2  4  
ATOM 9207   H H    . LEU A 1 89  ? -16.383 -2.798  6.510   1.00 10.00 ? 244 LEU A H    4  
ATOM 9208   N N    . LYS A 1 90  ? -16.980 -1.344  9.627   1.00 10.00 ? 245 LYS A N    4  
ATOM 9209   C CA   . LYS A 1 90  ? -17.416 -1.179  11.016  1.00 10.00 ? 245 LYS A CA   4  
ATOM 9210   C C    . LYS A 1 90  ? -16.877 -2.265  11.952  1.00 10.00 ? 245 LYS A C    4  
ATOM 9211   O O    . LYS A 1 90  ? -16.984 -2.147  13.174  1.00 10.00 ? 245 LYS A O    4  
ATOM 9212   C CB   . LYS A 1 90  ? -18.946 -1.146  11.089  1.00 10.00 ? 245 LYS A CB   4  
ATOM 9213   C CG   . LYS A 1 90  ? -19.616 -0.273  10.039  1.00 10.00 ? 245 LYS A CG   4  
ATOM 9214   C CD   . LYS A 1 90  ? -19.491 1.208   10.365  1.00 10.00 ? 245 LYS A CD   4  
ATOM 9215   C CE   . LYS A 1 90  ? -20.154 2.062   9.294   1.00 10.00 ? 245 LYS A CE   4  
ATOM 9216   N NZ   . LYS A 1 90  ? -20.398 3.455   9.751   1.00 10.00 ? 245 LYS A NZ   4  
ATOM 9217   H H    . LYS A 1 90  ? -17.674 -1.445  8.937   1.00 10.00 ? 245 LYS A H    4  
ATOM 9218   H HZ1  . LYS A 1 90  ? -21.047 3.455   10.563  1.00 10.00 ? 245 LYS A HZ1  4  
ATOM 9219   H HZ2  . LYS A 1 90  ? -20.826 4.011   8.984   1.00 10.00 ? 245 LYS A HZ2  4  
ATOM 9220   H HZ3  . LYS A 1 90  ? -19.506 3.908   10.034  1.00 10.00 ? 245 LYS A HZ3  4  
ATOM 9221   N N    . ASP A 1 91  ? -16.284 -3.315  11.396  1.00 10.00 ? 246 ASP A N    4  
ATOM 9222   C CA   . ASP A 1 91  ? -15.751 -4.401  12.213  1.00 10.00 ? 246 ASP A CA   4  
ATOM 9223   C C    . ASP A 1 91  ? -14.266 -4.206  12.459  1.00 10.00 ? 246 ASP A C    4  
ATOM 9224   O O    . ASP A 1 91  ? -13.791 -4.357  13.580  1.00 10.00 ? 246 ASP A O    4  
ATOM 9225   C CB   . ASP A 1 91  ? -15.982 -5.760  11.553  1.00 10.00 ? 246 ASP A CB   4  
ATOM 9226   C CG   . ASP A 1 91  ? -16.009 -6.883  12.568  1.00 10.00 ? 246 ASP A CG   4  
ATOM 9227   O OD1  . ASP A 1 91  ? -14.932 -7.289  13.049  1.00 10.00 ? 246 ASP A OD1  4  
ATOM 9228   O OD2  . ASP A 1 91  ? -17.122 -7.345  12.908  1.00 10.00 ? 246 ASP A OD2  4  
ATOM 9229   H H    . ASP A 1 91  ? -16.176 -3.343  10.420  1.00 10.00 ? 246 ASP A H    4  
ATOM 9230   N N    . LEU A 1 92  ? -13.554 -3.892  11.379  1.00 10.00 ? 247 LEU A N    4  
ATOM 9231   C CA   . LEU A 1 92  ? -12.108 -3.642  11.404  1.00 10.00 ? 247 LEU A CA   4  
ATOM 9232   C C    . LEU A 1 92  ? -11.556 -3.050  12.715  1.00 10.00 ? 247 LEU A C    4  
ATOM 9233   O O    . LEU A 1 92  ? -10.605 -3.613  13.268  1.00 10.00 ? 247 LEU A O    4  
ATOM 9234   C CB   . LEU A 1 92  ? -11.703 -2.788  10.192  1.00 10.00 ? 247 LEU A CB   4  
ATOM 9235   C CG   . LEU A 1 92  ? -10.302 -2.174  10.212  1.00 10.00 ? 247 LEU A CG   4  
ATOM 9236   C CD1  . LEU A 1 92  ? -9.236  -3.259  10.225  1.00 10.00 ? 247 LEU A CD1  4  
ATOM 9237   C CD2  . LEU A 1 92  ? -10.117 -1.241  9.024   1.00 10.00 ? 247 LEU A CD2  4  
ATOM 9238   H H    . LEU A 1 92  ? -13.982 -4.017  10.503  1.00 10.00 ? 247 LEU A H    4  
ATOM 9239   N N    . PRO A 1 93  ? -12.107 -1.932  13.246  1.00 10.00 ? 248 PRO A N    4  
ATOM 9240   C CA   . PRO A 1 93  ? -11.627 -1.341  14.504  1.00 10.00 ? 248 PRO A CA   4  
ATOM 9241   C C    . PRO A 1 93  ? -11.552 -2.329  15.684  1.00 10.00 ? 248 PRO A C    4  
ATOM 9242   O O    . PRO A 1 93  ? -10.876 -2.048  16.680  1.00 10.00 ? 248 PRO A O    4  
ATOM 9243   C CB   . PRO A 1 93  ? -12.638 -0.222  14.806  1.00 10.00 ? 248 PRO A CB   4  
ATOM 9244   C CG   . PRO A 1 93  ? -13.770 -0.431  13.858  1.00 10.00 ? 248 PRO A CG   4  
ATOM 9245   C CD   . PRO A 1 93  ? -13.195 -1.128  12.663  1.00 10.00 ? 248 PRO A CD   4  
ATOM 9246   N N    . GLU A 1 94  ? -12.226 -3.482  15.577  1.00 10.00 ? 249 GLU A N    4  
ATOM 9247   C CA   . GLU A 1 94  ? -12.220 -4.462  16.659  1.00 10.00 ? 249 GLU A CA   4  
ATOM 9248   C C    . GLU A 1 94  ? -10.917 -5.248  16.701  1.00 10.00 ? 249 GLU A C    4  
ATOM 9249   O O    . GLU A 1 94  ? -10.221 -5.232  17.713  1.00 10.00 ? 249 GLU A O    4  
ATOM 9250   C CB   . GLU A 1 94  ? -13.371 -5.456  16.466  1.00 10.00 ? 249 GLU A CB   4  
ATOM 9251   C CG   . GLU A 1 94  ? -14.349 -5.510  17.619  1.00 10.00 ? 249 GLU A CG   4  
ATOM 9252   C CD   . GLU A 1 94  ? -15.056 -4.194  17.814  1.00 10.00 ? 249 GLU A CD   4  
ATOM 9253   O OE1  . GLU A 1 94  ? -16.022 -3.920  17.074  1.00 10.00 ? 249 GLU A OE1  4  
ATOM 9254   O OE2  . GLU A 1 94  ? -14.639 -3.422  18.702  1.00 10.00 ? 249 GLU A OE2  4  
ATOM 9255   H H    . GLU A 1 94  ? -12.733 -3.672  14.755  1.00 10.00 ? 249 GLU A H    4  
ATOM 9256   N N    . LEU A 1 95  ? -10.549 -5.908  15.605  1.00 10.00 ? 250 LEU A N    4  
ATOM 9257   C CA   . LEU A 1 95  ? -9.301  -6.653  15.564  1.00 10.00 ? 250 LEU A CA   4  
ATOM 9258   C C    . LEU A 1 95  ? -8.113  -5.728  15.368  1.00 10.00 ? 250 LEU A C    4  
ATOM 9259   O O    . LEU A 1 95  ? -6.957  -6.130  15.536  1.00 10.00 ? 250 LEU A O    4  
ATOM 9260   C CB   . LEU A 1 95  ? -9.350  -7.773  14.513  1.00 10.00 ? 250 LEU A CB   4  
ATOM 9261   C CG   . LEU A 1 95  ? -9.461  -7.366  13.038  1.00 10.00 ? 250 LEU A CG   4  
ATOM 9262   C CD1  . LEU A 1 95  ? -8.917  -8.479  12.156  1.00 10.00 ? 250 LEU A CD1  4  
ATOM 9263   C CD2  . LEU A 1 95  ? -10.903 -7.055  12.657  1.00 10.00 ? 250 LEU A CD2  4  
ATOM 9264   H H    . LEU A 1 95  ? -11.161 -6.061  14.855  1.00 10.00 ? 250 LEU A H    4  
ATOM 9265   N N    . ALA A 1 96  ? -8.403  -4.486  14.985  1.00 10.00 ? 251 ALA A N    4  
ATOM 9266   C CA   . ALA A 1 96  ? -7.366  -3.480  14.796  1.00 10.00 ? 251 ALA A CA   4  
ATOM 9267   C C    . ALA A 1 96  ? -6.683  -3.185  16.125  1.00 10.00 ? 251 ALA A C    4  
ATOM 9268   O O    . ALA A 1 96  ? -5.666  -2.499  16.187  1.00 10.00 ? 251 ALA A O    4  
ATOM 9269   C CB   . ALA A 1 96  ? -7.960  -2.206  14.221  1.00 10.00 ? 251 ALA A CB   4  
ATOM 9270   H H    . ALA A 1 96  ? -9.342  -4.246  14.816  1.00 10.00 ? 251 ALA A H    4  
ATOM 9271   N N    . LEU A 1 97  ? -7.246  -3.732  17.198  1.00 10.00 ? 252 LEU A N    4  
ATOM 9272   C CA   . LEU A 1 97  ? -6.704  -3.540  18.526  1.00 10.00 ? 252 LEU A CA   4  
ATOM 9273   C C    . LEU A 1 97  ? -5.524  -4.470  18.762  1.00 10.00 ? 252 LEU A C    4  
ATOM 9274   O O    . LEU A 1 97  ? -4.602  -4.141  19.503  1.00 10.00 ? 252 LEU A O    4  
ATOM 9275   C CB   . LEU A 1 97  ? -7.782  -3.771  19.594  1.00 10.00 ? 252 LEU A CB   4  
ATOM 9276   C CG   . LEU A 1 97  ? -8.926  -2.760  19.621  1.00 10.00 ? 252 LEU A CG   4  
ATOM 9277   C CD1  . LEU A 1 97  ? -10.008 -3.201  20.590  1.00 10.00 ? 252 LEU A CD1  4  
ATOM 9278   C CD2  . LEU A 1 97  ? -8.413  -1.377  19.986  1.00 10.00 ? 252 LEU A CD2  4  
ATOM 9279   H H    . LEU A 1 97  ? -8.041  -4.296  17.086  1.00 10.00 ? 252 LEU A H    4  
ATOM 9280   N N    . ASP A 1 98  ? -5.531  -5.644  18.124  1.00 10.00 ? 253 ASP A N    4  
ATOM 9281   C CA   . ASP A 1 98  ? -4.448  -6.606  18.284  1.00 10.00 ? 253 ASP A CA   4  
ATOM 9282   C C    . ASP A 1 98  ? -3.600  -6.634  17.018  1.00 10.00 ? 253 ASP A C    4  
ATOM 9283   O O    . ASP A 1 98  ? -2.786  -7.536  16.817  1.00 10.00 ? 253 ASP A O    4  
ATOM 9284   C CB   . ASP A 1 98  ? -5.017  -8.006  18.542  1.00 10.00 ? 253 ASP A CB   4  
ATOM 9285   C CG   . ASP A 1 98  ? -6.274  -7.994  19.387  1.00 10.00 ? 253 ASP A CG   4  
ATOM 9286   O OD1  . ASP A 1 98  ? -6.163  -7.880  20.627  1.00 10.00 ? 253 ASP A OD1  4  
ATOM 9287   O OD2  . ASP A 1 98  ? -7.382  -8.096  18.813  1.00 10.00 ? 253 ASP A OD2  4  
ATOM 9288   H H    . ASP A 1 98  ? -6.239  -5.890  17.493  1.00 10.00 ? 253 ASP A H    4  
ATOM 9289   N N    . THR A 1 99  ? -3.770  -5.610  16.186  1.00 10.00 ? 254 THR A N    4  
ATOM 9290   C CA   . THR A 1 99  ? -3.056  -5.507  14.922  1.00 10.00 ? 254 THR A CA   4  
ATOM 9291   C C    . THR A 1 99  ? -2.998  -4.033  14.526  1.00 10.00 ? 254 THR A C    4  
ATOM 9292   O O    . THR A 1 99  ? -3.873  -3.543  13.815  1.00 10.00 ? 254 THR A O    4  
ATOM 9293   C CB   . THR A 1 99  ? -3.735  -6.314  13.791  1.00 10.00 ? 254 THR A CB   4  
ATOM 9294   O OG1  . THR A 1 99  ? -4.567  -7.348  14.340  1.00 10.00 ? 254 THR A OG1  4  
ATOM 9295   C CG2  . THR A 1 99  ? -2.689  -6.943  12.883  1.00 10.00 ? 254 THR A CG2  4  
ATOM 9296   H H    . THR A 1 99  ? -4.311  -4.848  16.476  1.00 10.00 ? 254 THR A H    4  
ATOM 9297   H HG1  . THR A 1 99  ? -5.409  -6.968  14.614  1.00 10.00 ? 254 THR A HG1  4  
ATOM 9298   N N    . PRO A 1 100 ? -1.971  -3.308  15.005  1.00 10.00 ? 255 PRO A N    4  
ATOM 9299   C CA   . PRO A 1 100 ? -1.797  -1.868  14.742  1.00 10.00 ? 255 PRO A CA   4  
ATOM 9300   C C    . PRO A 1 100 ? -1.778  -1.481  13.260  1.00 10.00 ? 255 PRO A C    4  
ATOM 9301   O O    . PRO A 1 100 ? -1.900  -0.303  12.925  1.00 10.00 ? 255 PRO A O    4  
ATOM 9302   C CB   . PRO A 1 100 ? -0.453  -1.526  15.400  1.00 10.00 ? 255 PRO A CB   4  
ATOM 9303   C CG   . PRO A 1 100 ? 0.214   -2.837  15.642  1.00 10.00 ? 255 PRO A CG   4  
ATOM 9304   C CD   . PRO A 1 100 ? -0.889  -3.833  15.854  1.00 10.00 ? 255 PRO A CD   4  
ATOM 9305   N N    . ARG A 1 101 ? -1.613  -2.454  12.378  1.00 10.00 ? 256 ARG A N    4  
ATOM 9306   C CA   . ARG A 1 101 ? -1.583  -2.174  10.948  1.00 10.00 ? 256 ARG A CA   4  
ATOM 9307   C C    . ARG A 1 101 ? -2.738  -2.843  10.216  1.00 10.00 ? 256 ARG A C    4  
ATOM 9308   O O    . ARG A 1 101 ? -2.788  -2.836  8.986   1.00 10.00 ? 256 ARG A O    4  
ATOM 9309   C CB   . ARG A 1 101 ? -0.244  -2.578  10.337  1.00 10.00 ? 256 ARG A CB   4  
ATOM 9310   C CG   . ARG A 1 101 ? 0.925   -1.741  10.828  1.00 10.00 ? 256 ARG A CG   4  
ATOM 9311   C CD   . ARG A 1 101 ? 2.217   -2.148  10.148  1.00 10.00 ? 256 ARG A CD   4  
ATOM 9312   N NE   . ARG A 1 101 ? 2.243   -1.742  8.748   1.00 10.00 ? 256 ARG A NE   4  
ATOM 9313   C CZ   . ARG A 1 101 ? 2.568   -2.546  7.744   1.00 10.00 ? 256 ARG A CZ   4  
ATOM 9314   N NH1  . ARG A 1 101 ? 2.882   -3.814  7.984   1.00 10.00 ? 256 ARG A NH1  4  
ATOM 9315   N NH2  . ARG A 1 101 ? 2.567   -2.083  6.499   1.00 10.00 ? 256 ARG A NH2  4  
ATOM 9316   H H    . ARG A 1 101 ? -1.499  -3.378  12.693  1.00 10.00 ? 256 ARG A H    4  
ATOM 9317   H HE   . ARG A 1 101 ? 2.007   -0.794  8.546   1.00 10.00 ? 256 ARG A HE   4  
ATOM 9318   H HH11 . ARG A 1 101 ? 2.870   -4.170  8.924   1.00 10.00 ? 256 ARG A HH11 4  
ATOM 9319   H HH12 . ARG A 1 101 ? 3.146   -4.417  7.233   1.00 10.00 ? 256 ARG A HH12 4  
ATOM 9320   H HH21 . ARG A 1 101 ? 2.315   -1.120  6.317   1.00 10.00 ? 256 ARG A HH21 4  
ATOM 9321   H HH22 . ARG A 1 101 ? 2.828   -2.678  5.736   1.00 10.00 ? 256 ARG A HH22 4  
ATOM 9322   N N    . ALA A 1 102 ? -3.674  -3.405  10.978  1.00 10.00 ? 257 ALA A N    4  
ATOM 9323   C CA   . ALA A 1 102 ? -4.840  -4.073  10.403  1.00 10.00 ? 257 ALA A CA   4  
ATOM 9324   C C    . ALA A 1 102 ? -5.641  -3.146  9.484   1.00 10.00 ? 257 ALA A C    4  
ATOM 9325   O O    . ALA A 1 102 ? -5.938  -3.523  8.348   1.00 10.00 ? 257 ALA A O    4  
ATOM 9326   C CB   . ALA A 1 102 ? -5.723  -4.678  11.486  1.00 10.00 ? 257 ALA A CB   4  
ATOM 9327   H H    . ALA A 1 102 ? -3.584  -3.361  11.954  1.00 10.00 ? 257 ALA A H    4  
ATOM 9328   N N    . PRO A 1 103 ? -6.017  -1.927  9.953   1.00 10.00 ? 258 PRO A N    4  
ATOM 9329   C CA   . PRO A 1 103 ? -6.771  -0.970  9.137   1.00 10.00 ? 258 PRO A CA   4  
ATOM 9330   C C    . PRO A 1 103 ? -6.102  -0.715  7.790   1.00 10.00 ? 258 PRO A C    4  
ATOM 9331   O O    . PRO A 1 103 ? -6.736  -0.838  6.741   1.00 10.00 ? 258 PRO A O    4  
ATOM 9332   C CB   . PRO A 1 103 ? -6.795  0.316   9.979   1.00 10.00 ? 258 PRO A CB   4  
ATOM 9333   C CG   . PRO A 1 103 ? -5.826  0.088   11.091  1.00 10.00 ? 258 PRO A CG   4  
ATOM 9334   C CD   . PRO A 1 103 ? -5.775  -1.393  11.306  1.00 10.00 ? 258 PRO A CD   4  
ATOM 9335   N N    . GLN A 1 104 ? -4.825  -0.346  7.833   1.00 10.00 ? 259 GLN A N    4  
ATOM 9336   C CA   . GLN A 1 104 ? -4.053  -0.093  6.624   1.00 10.00 ? 259 GLN A CA   4  
ATOM 9337   C C    . GLN A 1 104 ? -4.088  -1.280  5.672   1.00 10.00 ? 259 GLN A C    4  
ATOM 9338   O O    . GLN A 1 104 ? -4.223  -1.112  4.462   1.00 10.00 ? 259 GLN A O    4  
ATOM 9339   C CB   . GLN A 1 104 ? -2.603  0.259   6.968   1.00 10.00 ? 259 GLN A CB   4  
ATOM 9340   C CG   . GLN A 1 104 ? -2.402  1.688   7.444   1.00 10.00 ? 259 GLN A CG   4  
ATOM 9341   C CD   . GLN A 1 104 ? -2.526  1.839   8.948   1.00 10.00 ? 259 GLN A CD   4  
ATOM 9342   O OE1  . GLN A 1 104 ? -3.295  1.133   9.596   1.00 10.00 ? 259 GLN A OE1  4  
ATOM 9343   N NE2  . GLN A 1 104 ? -1.758  2.757   9.514   1.00 10.00 ? 259 GLN A NE2  4  
ATOM 9344   H H    . GLN A 1 104 ? -4.407  -0.184  8.708   1.00 10.00 ? 259 GLN A H    4  
ATOM 9345   H HE21 . GLN A 1 104 ? -1.161  3.280   8.942   1.00 10.00 ? 259 GLN A HE21 4  
ATOM 9346   H HE22 . GLN A 1 104 ? -1.814  2.873   10.487  1.00 10.00 ? 259 GLN A HE22 4  
ATOM 9347   N N    . LEU A 1 105 ? -3.979  -2.484  6.223   1.00 10.00 ? 260 LEU A N    4  
ATOM 9348   C CA   . LEU A 1 105 ? -4.000  -3.695  5.414   1.00 10.00 ? 260 LEU A CA   4  
ATOM 9349   C C    . LEU A 1 105 ? -5.324  -3.827  4.669   1.00 10.00 ? 260 LEU A C    4  
ATOM 9350   O O    . LEU A 1 105 ? -5.342  -4.129  3.474   1.00 10.00 ? 260 LEU A O    4  
ATOM 9351   C CB   . LEU A 1 105 ? -3.709  -4.932  6.265   1.00 10.00 ? 260 LEU A CB   4  
ATOM 9352   C CG   . LEU A 1 105 ? -2.304  -5.001  6.875   1.00 10.00 ? 260 LEU A CG   4  
ATOM 9353   C CD1  . LEU A 1 105 ? -2.203  -6.147  7.868   1.00 10.00 ? 260 LEU A CD1  4  
ATOM 9354   C CD2  . LEU A 1 105 ? -1.245  -5.132  5.789   1.00 10.00 ? 260 LEU A CD2  4  
ATOM 9355   H H    . LEU A 1 105 ? -3.885  -2.558  7.199   1.00 10.00 ? 260 LEU A H    4  
ATOM 9356   N N    . VAL A 1 106 ? -6.428  -3.618  5.383   1.00 10.00 ? 261 VAL A N    4  
ATOM 9357   C CA   . VAL A 1 106 ? -7.762  -3.668  4.782   1.00 10.00 ? 261 VAL A CA   4  
ATOM 9358   C C    . VAL A 1 106 ? -7.879  -2.707  3.593   1.00 10.00 ? 261 VAL A C    4  
ATOM 9359   O O    . VAL A 1 106 ? -8.614  -2.973  2.638   1.00 10.00 ? 261 VAL A O    4  
ATOM 9360   C CB   . VAL A 1 106 ? -8.861  -3.366  5.828   1.00 10.00 ? 261 VAL A CB   4  
ATOM 9361   C CG1  . VAL A 1 106 ? -10.237 -3.272  5.182   1.00 10.00 ? 261 VAL A CG1  4  
ATOM 9362   C CG2  . VAL A 1 106 ? -8.860  -4.431  6.914   1.00 10.00 ? 261 VAL A CG2  4  
ATOM 9363   H H    . VAL A 1 106 ? -6.354  -3.498  6.357   1.00 10.00 ? 261 VAL A H    4  
ATOM 9364   N N    . GLY A 1 107 ? -7.130  -1.605  3.644   1.00 10.00 ? 262 GLY A N    4  
ATOM 9365   C CA   . GLY A 1 107 ? -7.152  -0.637  2.561   1.00 10.00 ? 262 GLY A CA   4  
ATOM 9366   C C    . GLY A 1 107 ? -6.692  -1.236  1.243   1.00 10.00 ? 262 GLY A C    4  
ATOM 9367   O O    . GLY A 1 107 ? -7.154  -0.839  0.173   1.00 10.00 ? 262 GLY A O    4  
ATOM 9368   H H    . GLY A 1 107 ? -6.552  -1.455  4.426   1.00 10.00 ? 262 GLY A H    4  
ATOM 9369   N N    . GLN A 1 108 ? -5.787  -2.207  1.328   1.00 10.00 ? 263 GLN A N    4  
ATOM 9370   C CA   . GLN A 1 108 ? -5.260  -2.884  0.149   1.00 10.00 ? 263 GLN A CA   4  
ATOM 9371   C C    . GLN A 1 108 ? -6.357  -3.716  -0.521  1.00 10.00 ? 263 GLN A C    4  
ATOM 9372   O O    . GLN A 1 108 ? -6.410  -3.830  -1.748  1.00 10.00 ? 263 GLN A O    4  
ATOM 9373   C CB   . GLN A 1 108 ? -4.069  -3.774  0.547   1.00 10.00 ? 263 GLN A CB   4  
ATOM 9374   C CG   . GLN A 1 108 ? -3.570  -4.720  -0.540  1.00 10.00 ? 263 GLN A CG   4  
ATOM 9375   C CD   . GLN A 1 108 ? -2.213  -4.330  -1.103  1.00 10.00 ? 263 GLN A CD   4  
ATOM 9376   O OE1  . GLN A 1 108 ? -1.909  -4.606  -2.265  1.00 10.00 ? 263 GLN A OE1  4  
ATOM 9377   N NE2  . GLN A 1 108 ? -1.381  -3.701  -0.285  1.00 10.00 ? 263 GLN A NE2  4  
ATOM 9378   H H    . GLN A 1 108 ? -5.469  -2.480  2.217   1.00 10.00 ? 263 GLN A H    4  
ATOM 9379   H HE21 . GLN A 1 108 ? -1.676  -3.522  0.630   1.00 10.00 ? 263 GLN A HE21 4  
ATOM 9380   H HE22 . GLN A 1 108 ? -0.502  -3.442  -0.629  1.00 10.00 ? 263 GLN A HE22 4  
ATOM 9381   N N    . PHE A 1 109 ? -7.246  -4.268  0.300   1.00 10.00 ? 264 PHE A N    4  
ATOM 9382   C CA   . PHE A 1 109 ? -8.347  -5.094  -0.184  1.00 10.00 ? 264 PHE A CA   4  
ATOM 9383   C C    . PHE A 1 109 ? -9.395  -4.241  -0.897  1.00 10.00 ? 264 PHE A C    4  
ATOM 9384   O O    . PHE A 1 109 ? -9.782  -4.539  -2.028  1.00 10.00 ? 264 PHE A O    4  
ATOM 9385   C CB   . PHE A 1 109 ? -8.992  -5.837  0.987   1.00 10.00 ? 264 PHE A CB   4  
ATOM 9386   C CG   . PHE A 1 109 ? -9.360  -7.257  0.677   1.00 10.00 ? 264 PHE A CG   4  
ATOM 9387   C CD1  . PHE A 1 109 ? -10.230 -7.558  -0.360  1.00 10.00 ? 264 PHE A CD1  4  
ATOM 9388   C CD2  . PHE A 1 109 ? -8.833  -8.290  1.425   1.00 10.00 ? 264 PHE A CD2  4  
ATOM 9389   C CE1  . PHE A 1 109 ? -10.564 -8.867  -0.641  1.00 10.00 ? 264 PHE A CE1  4  
ATOM 9390   C CE2  . PHE A 1 109 ? -9.162  -9.600  1.150   1.00 10.00 ? 264 PHE A CE2  4  
ATOM 9391   C CZ   . PHE A 1 109 ? -10.027 -9.889  0.116   1.00 10.00 ? 264 PHE A CZ   4  
ATOM 9392   H H    . PHE A 1 109 ? -7.168  -4.101  1.264   1.00 10.00 ? 264 PHE A H    4  
ATOM 9393   N N    . ILE A 1 110 ? -9.872  -3.217  -0.192  1.00 10.00 ? 265 ILE A N    4  
ATOM 9394   C CA   . ILE A 1 110 ? -10.865 -2.298  -0.757  1.00 10.00 ? 265 ILE A CA   4  
ATOM 9395   C C    . ILE A 1 110 ? -10.438 -1.811  -2.143  1.00 10.00 ? 265 ILE A C    4  
ATOM 9396   O O    . ILE A 1 110 ? -11.196 -1.944  -3.106  1.00 10.00 ? 265 ILE A O    4  
ATOM 9397   C CB   . ILE A 1 110 ? -11.086 -1.071  0.153   1.00 10.00 ? 265 ILE A CB   4  
ATOM 9398   C CG1  . ILE A 1 110 ? -11.514 -1.513  1.556   1.00 10.00 ? 265 ILE A CG1  4  
ATOM 9399   C CG2  . ILE A 1 110 ? -12.119 -0.132  -0.460  1.00 10.00 ? 265 ILE A CG2  4  
ATOM 9400   C CD1  . ILE A 1 110 ? -11.475 -0.404  2.586   1.00 10.00 ? 265 ILE A CD1  4  
ATOM 9401   H H    . ILE A 1 110 ? -9.696  -3.231  0.771   1.00 10.00 ? 265 ILE A H    4  
ATOM 9402   N N    . ALA A 1 111 ? -9.233  -1.258  -2.244  1.00 10.00 ? 266 ALA A N    4  
ATOM 9403   C CA   . ALA A 1 111 ? -8.714  -0.786  -3.526  1.00 10.00 ? 266 ALA A CA   4  
ATOM 9404   C C    . ALA A 1 111 ? -8.690  -1.893  -4.590  1.00 10.00 ? 266 ALA A C    4  
ATOM 9405   O O    . ALA A 1 111 ? -8.909  -1.628  -5.774  1.00 10.00 ? 266 ALA A O    4  
ATOM 9406   C CB   . ALA A 1 111 ? -7.329  -0.194  -3.349  1.00 10.00 ? 266 ALA A CB   4  
ATOM 9407   H H    . ALA A 1 111 ? -8.723  -1.067  -1.426  1.00 10.00 ? 266 ALA A H    4  
ATOM 9408   N N    . ARG A 1 112 ? -8.436  -3.125  -4.165  1.00 10.00 ? 267 ARG A N    4  
ATOM 9409   C CA   . ARG A 1 112 ? -8.375  -4.259  -5.084  1.00 10.00 ? 267 ARG A CA   4  
ATOM 9410   C C    . ARG A 1 112 ? -9.723  -4.490  -5.764  1.00 10.00 ? 267 ARG A C    4  
ATOM 9411   O O    . ARG A 1 112 ? -9.803  -4.570  -6.990  1.00 10.00 ? 267 ARG A O    4  
ATOM 9412   C CB   . ARG A 1 112 ? -7.942  -5.523  -4.339  1.00 10.00 ? 267 ARG A CB   4  
ATOM 9413   C CG   . ARG A 1 112 ? -7.199  -6.536  -5.193  1.00 10.00 ? 267 ARG A CG   4  
ATOM 9414   C CD   . ARG A 1 112 ? -5.779  -6.070  -5.478  1.00 10.00 ? 267 ARG A CD   4  
ATOM 9415   N NE   . ARG A 1 112 ? -4.933  -7.156  -5.974  1.00 10.00 ? 267 ARG A NE   4  
ATOM 9416   C CZ   . ARG A 1 112 ? -3.783  -7.528  -5.403  1.00 10.00 ? 267 ARG A CZ   4  
ATOM 9417   N NH1  . ARG A 1 112 ? -3.325  -6.892  -4.327  1.00 10.00 ? 267 ARG A NH1  4  
ATOM 9418   N NH2  . ARG A 1 112 ? -3.083  -8.537  -5.906  1.00 10.00 ? 267 ARG A NH2  4  
ATOM 9419   H H    . ARG A 1 112 ? -8.298  -3.279  -3.205  1.00 10.00 ? 267 ARG A H    4  
ATOM 9420   H HE   . ARG A 1 112 ? -5.247  -7.639  -6.776  1.00 10.00 ? 267 ARG A HE   4  
ATOM 9421   H HH11 . ARG A 1 112 ? -3.834  -6.126  -3.937  1.00 10.00 ? 267 ARG A HH11 4  
ATOM 9422   H HH12 . ARG A 1 112 ? -2.463  -7.195  -3.893  1.00 10.00 ? 267 ARG A HH12 4  
ATOM 9423   H HH21 . ARG A 1 112 ? -3.409  -9.027  -6.720  1.00 10.00 ? 267 ARG A HH21 4  
ATOM 9424   H HH22 . ARG A 1 112 ? -2.221  -8.821  -5.463  1.00 10.00 ? 267 ARG A HH22 4  
ATOM 9425   N N    . ALA A 1 113 ? -10.775 -4.620  -4.957  1.00 10.00 ? 268 ALA A N    4  
ATOM 9426   C CA   . ALA A 1 113 ? -12.131 -4.831  -5.468  1.00 10.00 ? 268 ALA A CA   4  
ATOM 9427   C C    . ALA A 1 113 ? -12.541 -3.790  -6.509  1.00 10.00 ? 268 ALA A C    4  
ATOM 9428   O O    . ALA A 1 113 ? -13.287 -4.098  -7.443  1.00 10.00 ? 268 ALA A O    4  
ATOM 9429   C CB   . ALA A 1 113 ? -13.132 -4.850  -4.323  1.00 10.00 ? 268 ALA A CB   4  
ATOM 9430   H H    . ALA A 1 113 ? -10.631 -4.657  -3.984  1.00 10.00 ? 268 ALA A H    4  
ATOM 9431   N N    . VAL A 1 114 ? -12.059 -2.563  -6.346  1.00 10.00 ? 269 VAL A N    4  
ATOM 9432   C CA   . VAL A 1 114 ? -12.377 -1.496  -7.286  1.00 10.00 ? 269 VAL A CA   4  
ATOM 9433   C C    . VAL A 1 114 ? -11.707 -1.783  -8.625  1.00 10.00 ? 269 VAL A C    4  
ATOM 9434   O O    . VAL A 1 114 ? -12.346 -1.741  -9.678  1.00 10.00 ? 269 VAL A O    4  
ATOM 9435   C CB   . VAL A 1 114 ? -11.909 -0.115  -6.772  1.00 10.00 ? 269 VAL A CB   4  
ATOM 9436   C CG1  . VAL A 1 114 ? -12.422 0.999   -7.672  1.00 10.00 ? 269 VAL A CG1  4  
ATOM 9437   C CG2  . VAL A 1 114 ? -12.359 0.113   -5.337  1.00 10.00 ? 269 VAL A CG2  4  
ATOM 9438   H H    . VAL A 1 114 ? -11.472 -2.375  -5.581  1.00 10.00 ? 269 VAL A H    4  
ATOM 9439   N N    . GLY A 1 115 ? -10.412 -2.083  -8.563  1.00 10.00 ? 270 GLY A N    4  
ATOM 9440   C CA   . GLY A 1 115 ? -9.648  -2.386  -9.757  1.00 10.00 ? 270 GLY A CA   4  
ATOM 9441   C C    . GLY A 1 115 ? -10.191 -3.567  -10.542 1.00 10.00 ? 270 GLY A C    4  
ATOM 9442   O O    . GLY A 1 115 ? -10.230 -3.526  -11.774 1.00 10.00 ? 270 GLY A O    4  
ATOM 9443   H H    . GLY A 1 115 ? -9.964  -2.057  -7.689  1.00 10.00 ? 270 GLY A H    4  
ATOM 9444   N N    . ASP A 1 116 ? -10.616 -4.616  -9.834  1.00 10.00 ? 271 ASP A N    4  
ATOM 9445   C CA   . ASP A 1 116 ? -11.150 -5.811  -10.490 1.00 10.00 ? 271 ASP A CA   4  
ATOM 9446   C C    . ASP A 1 116 ? -12.494 -5.499  -11.131 1.00 10.00 ? 271 ASP A C    4  
ATOM 9447   O O    . ASP A 1 116 ? -12.673 -5.661  -12.339 1.00 10.00 ? 271 ASP A O    4  
ATOM 9448   C CB   . ASP A 1 116 ? -11.345 -6.923  -9.449  1.00 10.00 ? 271 ASP A CB   4  
ATOM 9449   C CG   . ASP A 1 116 ? -10.452 -8.125  -9.682  1.00 10.00 ? 271 ASP A CG   4  
ATOM 9450   O OD1  . ASP A 1 116 ? -9.211  -7.963  -9.635  1.00 10.00 ? 271 ASP A OD1  4  
ATOM 9451   O OD2  . ASP A 1 116 ? -10.988 -9.233  -9.911  1.00 10.00 ? 271 ASP A OD2  4  
ATOM 9452   H H    . ASP A 1 116 ? -10.565 -4.583  -8.854  1.00 10.00 ? 271 ASP A H    4  
ATOM 9453   N N    . GLY A 1 117 ? -13.438 -5.051  -10.311 1.00 10.00 ? 272 GLY A N    4  
ATOM 9454   C CA   . GLY A 1 117 ? -14.732 -4.666  -10.832 1.00 10.00 ? 272 GLY A CA   4  
ATOM 9455   C C    . GLY A 1 117 ? -15.871 -5.262  -10.030 1.00 10.00 ? 272 GLY A C    4  
ATOM 9456   O O    . GLY A 1 117 ? -16.822 -5.799  -10.596 1.00 10.00 ? 272 GLY A O    4  
ATOM 9457   H H    . GLY A 1 117 ? -13.314 -5.155  -9.348  1.00 10.00 ? 272 GLY A H    4  
ATOM 9458   N N    . ILE A 1 118 ? -15.769 -5.175  -8.710  1.00 10.00 ? 273 ILE A N    4  
ATOM 9459   C CA   . ILE A 1 118 ? -16.796 -5.703  -7.818  1.00 10.00 ? 273 ILE A CA   4  
ATOM 9460   C C    . ILE A 1 118 ? -17.162 -4.654  -6.777  1.00 10.00 ? 273 ILE A C    4  
ATOM 9461   O O    . ILE A 1 118 ? -17.658 -4.974  -5.699  1.00 10.00 ? 273 ILE A O    4  
ATOM 9462   C CB   . ILE A 1 118 ? -16.322 -6.985  -7.094  1.00 10.00 ? 273 ILE A CB   4  
ATOM 9463   C CG1  . ILE A 1 118 ? -14.791 -7.034  -7.021  1.00 10.00 ? 273 ILE A CG1  4  
ATOM 9464   C CG2  . ILE A 1 118 ? -16.878 -8.231  -7.767  1.00 10.00 ? 273 ILE A CG2  4  
ATOM 9465   C CD1  . ILE A 1 118 ? -14.241 -8.254  -6.322  1.00 10.00 ? 273 ILE A CD1  4  
ATOM 9466   H H    . ILE A 1 118 ? -14.979 -4.739  -8.317  1.00 10.00 ? 273 ILE A H    4  
ATOM 9467   N N    . LEU A 1 119 ? -16.906 -3.398  -7.111  1.00 10.00 ? 274 LEU A N    4  
ATOM 9468   C CA   . LEU A 1 119 ? -17.191 -2.295  -6.213  1.00 10.00 ? 274 LEU A CA   4  
ATOM 9469   C C    . LEU A 1 119 ? -17.293 -0.991  -6.993  1.00 10.00 ? 274 LEU A C    4  
ATOM 9470   O O    . LEU A 1 119 ? -16.809 -0.897  -8.122  1.00 10.00 ? 274 LEU A O    4  
ATOM 9471   C CB   . LEU A 1 119 ? -16.093 -2.189  -5.151  1.00 10.00 ? 274 LEU A CB   4  
ATOM 9472   C CG   . LEU A 1 119 ? -16.440 -1.403  -3.886  1.00 10.00 ? 274 LEU A CG   4  
ATOM 9473   C CD1  . LEU A 1 119 ? -17.671 -1.988  -3.212  1.00 10.00 ? 274 LEU A CD1  4  
ATOM 9474   C CD2  . LEU A 1 119 ? -15.259 -1.399  -2.930  1.00 10.00 ? 274 LEU A CD2  4  
ATOM 9475   H H    . LEU A 1 119 ? -16.530 -3.206  -7.994  1.00 10.00 ? 274 LEU A H    4  
ATOM 9476   N N    . CYS A 1 120 ? -17.933 0.000   -6.387  1.00 10.00 ? 275 CYS A N    4  
ATOM 9477   C CA   . CYS A 1 120 ? -18.102 1.302   -7.012  1.00 10.00 ? 275 CYS A CA   4  
ATOM 9478   C C    . CYS A 1 120 ? -16.788 2.075   -7.007  1.00 10.00 ? 275 CYS A C    4  
ATOM 9479   O O    . CYS A 1 120 ? -16.008 1.985   -6.057  1.00 10.00 ? 275 CYS A O    4  
ATOM 9480   C CB   . CYS A 1 120 ? -19.185 2.097   -6.279  1.00 10.00 ? 275 CYS A CB   4  
ATOM 9481   S SG   . CYS A 1 120 ? -19.502 3.739   -6.963  1.00 10.00 ? 275 CYS A SG   4  
ATOM 9482   H H    . CYS A 1 120 ? -18.298 -0.148  -5.492  1.00 10.00 ? 275 CYS A H    4  
ATOM 9483   H HG   . CYS A 1 120 ? -20.815 3.875   -7.092  1.00 10.00 ? 275 CYS A HG   4  
ATOM 9484   N N    . ASN A 1 121 ? -16.552 2.835   -8.066  1.00 10.00 ? 276 ASN A N    4  
ATOM 9485   C CA   . ASN A 1 121 ? -15.330 3.620   -8.189  1.00 10.00 ? 276 ASN A CA   4  
ATOM 9486   C C    . ASN A 1 121 ? -15.324 4.791   -7.216  1.00 10.00 ? 276 ASN A C    4  
ATOM 9487   O O    . ASN A 1 121 ? -14.277 5.167   -6.692  1.00 10.00 ? 276 ASN A O    4  
ATOM 9488   C CB   . ASN A 1 121 ? -15.128 4.113   -9.629  1.00 10.00 ? 276 ASN A CB   4  
ATOM 9489   C CG   . ASN A 1 121 ? -16.256 5.000   -10.125 1.00 10.00 ? 276 ASN A CG   4  
ATOM 9490   O OD1  . ASN A 1 121 ? -17.312 4.511   -10.524 1.00 10.00 ? 276 ASN A OD1  4  
ATOM 9491   N ND2  . ASN A 1 121 ? -16.041 6.308   -10.110 1.00 10.00 ? 276 ASN A ND2  4  
ATOM 9492   H H    . ASN A 1 121 ? -17.221 2.878   -8.781  1.00 10.00 ? 276 ASN A H    4  
ATOM 9493   H HD21 . ASN A 1 121 ? -15.175 6.635   -9.781  1.00 10.00 ? 276 ASN A HD21 4  
ATOM 9494   H HD22 . ASN A 1 121 ? -16.758 6.899   -10.432 1.00 10.00 ? 276 ASN A HD22 4  
ATOM 9495   N N    . THR A 1 122 ? -16.493 5.357   -6.959  1.00 10.00 ? 277 THR A N    4  
ATOM 9496   C CA   . THR A 1 122 ? -16.611 6.482   -6.048  1.00 10.00 ? 277 THR A CA   4  
ATOM 9497   C C    . THR A 1 122 ? -16.959 6.004   -4.640  1.00 10.00 ? 277 THR A C    4  
ATOM 9498   O O    . THR A 1 122 ? -17.560 6.738   -3.850  1.00 10.00 ? 277 THR A O    4  
ATOM 9499   C CB   . THR A 1 122 ? -17.689 7.462   -6.544  1.00 10.00 ? 277 THR A CB   4  
ATOM 9500   O OG1  . THR A 1 122 ? -18.310 6.916   -7.718  1.00 10.00 ? 277 THR A OG1  4  
ATOM 9501   C CG2  . THR A 1 122 ? -17.068 8.806   -6.892  1.00 10.00 ? 277 THR A CG2  4  
ATOM 9502   H H    . THR A 1 122 ? -17.306 5.026   -7.400  1.00 10.00 ? 277 THR A H    4  
ATOM 9503   H HG1  . THR A 1 122 ? -18.757 7.622   -8.200  1.00 10.00 ? 277 THR A HG1  4  
ATOM 9504   N N    . TYR A 1 123 ? -16.549 4.778   -4.316  1.00 10.00 ? 278 TYR A N    4  
ATOM 9505   C CA   . TYR A 1 123 ? -16.827 4.206   -3.003  1.00 10.00 ? 278 TYR A CA   4  
ATOM 9506   C C    . TYR A 1 123 ? -16.047 4.969   -1.943  1.00 10.00 ? 278 TYR A C    4  
ATOM 9507   O O    . TYR A 1 123 ? -16.535 5.209   -0.838  1.00 10.00 ? 278 TYR A O    4  
ATOM 9508   C CB   . TYR A 1 123 ? -16.494 2.714   -2.955  1.00 10.00 ? 278 TYR A CB   4  
ATOM 9509   C CG   . TYR A 1 123 ? -17.039 2.003   -1.733  1.00 10.00 ? 278 TYR A CG   4  
ATOM 9510   C CD1  . TYR A 1 123 ? -18.408 1.856   -1.540  1.00 10.00 ? 278 TYR A CD1  4  
ATOM 9511   C CD2  . TYR A 1 123 ? -16.187 1.477   -0.771  1.00 10.00 ? 278 TYR A CD2  4  
ATOM 9512   C CE1  . TYR A 1 123 ? -18.911 1.208   -0.426  1.00 10.00 ? 278 TYR A CE1  4  
ATOM 9513   C CE2  . TYR A 1 123 ? -16.679 0.825   0.345   1.00 10.00 ? 278 TYR A CE2  4  
ATOM 9514   C CZ   . TYR A 1 123 ? -18.041 0.695   0.514   1.00 10.00 ? 278 TYR A CZ   4  
ATOM 9515   O OH   . TYR A 1 123 ? -18.536 0.049   1.626   1.00 10.00 ? 278 TYR A OH   4  
ATOM 9516   H H    . TYR A 1 123 ? -15.978 4.288   -4.946  1.00 10.00 ? 278 TYR A H    4  
ATOM 9517   H HH   . TYR A 1 123 ? -19.480 -0.109  1.517   1.00 10.00 ? 278 TYR A HH   4  
ATOM 9518   N N    . ILE A 1 124 ? -14.832 5.364   -2.307  1.00 10.00 ? 279 ILE A N    4  
ATOM 9519   C CA   . ILE A 1 124 ? -13.965 6.118   -1.416  1.00 10.00 ? 279 ILE A CA   4  
ATOM 9520   C C    . ILE A 1 124 ? -14.529 7.521   -1.234  1.00 10.00 ? 279 ILE A C    4  
ATOM 9521   O O    . ILE A 1 124 ? -14.538 8.062   -0.131  1.00 10.00 ? 279 ILE A O    4  
ATOM 9522   C CB   . ILE A 1 124 ? -12.529 6.224   -1.979  1.00 10.00 ? 279 ILE A CB   4  
ATOM 9523   C CG1  . ILE A 1 124 ? -12.018 4.858   -2.456  1.00 10.00 ? 279 ILE A CG1  4  
ATOM 9524   C CG2  . ILE A 1 124 ? -11.584 6.819   -0.944  1.00 10.00 ? 279 ILE A CG2  4  
ATOM 9525   C CD1  . ILE A 1 124 ? -11.828 3.838   -1.352  1.00 10.00 ? 279 ILE A CD1  4  
ATOM 9526   H H    . ILE A 1 124 ? -14.511 5.143   -3.205  1.00 10.00 ? 279 ILE A H    4  
ATOM 9527   N N    . ASP A 1 125 ? -15.027 8.090   -2.330  1.00 10.00 ? 280 ASP A N    4  
ATOM 9528   C CA   . ASP A 1 125 ? -15.608 9.429   -2.311  1.00 10.00 ? 280 ASP A CA   4  
ATOM 9529   C C    . ASP A 1 125 ? -16.875 9.453   -1.473  1.00 10.00 ? 280 ASP A C    4  
ATOM 9530   O O    . ASP A 1 125 ? -17.221 10.469  -0.870  1.00 10.00 ? 280 ASP A O    4  
ATOM 9531   C CB   . ASP A 1 125 ? -15.898 9.922   -3.728  1.00 10.00 ? 280 ASP A CB   4  
ATOM 9532   C CG   . ASP A 1 125 ? -15.240 11.256  -4.017  1.00 10.00 ? 280 ASP A CG   4  
ATOM 9533   O OD1  . ASP A 1 125 ? -15.698 12.282  -3.476  1.00 10.00 ? 280 ASP A OD1  4  
ATOM 9534   O OD2  . ASP A 1 125 ? -14.246 11.280  -4.765  1.00 10.00 ? 280 ASP A OD2  4  
ATOM 9535   H H    . ASP A 1 125 ? -14.992 7.600   -3.177  1.00 10.00 ? 280 ASP A H    4  
ATOM 9536   N N    . SER A 1 126 ? -17.564 8.322   -1.435  1.00 10.00 ? 281 SER A N    4  
ATOM 9537   C CA   . SER A 1 126 ? -18.784 8.194   -0.654  1.00 10.00 ? 281 SER A CA   4  
ATOM 9538   C C    . SER A 1 126 ? -18.486 8.363   0.837   1.00 10.00 ? 281 SER A C    4  
ATOM 9539   O O    . SER A 1 126 ? -19.334 8.812   1.609   1.00 10.00 ? 281 SER A O    4  
ATOM 9540   C CB   . SER A 1 126 ? -19.457 6.843   -0.922  1.00 10.00 ? 281 SER A CB   4  
ATOM 9541   O OG   . SER A 1 126 ? -19.746 6.677   -2.304  1.00 10.00 ? 281 SER A OG   4  
ATOM 9542   H H    . SER A 1 126 ? -17.252 7.558   -1.961  1.00 10.00 ? 281 SER A H    4  
ATOM 9543   H HG   . SER A 1 126 ? -18.942 6.823   -2.822  1.00 10.00 ? 281 SER A HG   4  
ATOM 9544   N N    . TYR A 1 127 ? -17.268 8.021   1.237   1.00 10.00 ? 282 TYR A N    4  
ATOM 9545   C CA   . TYR A 1 127 ? -16.865 8.136   2.628   1.00 10.00 ? 282 TYR A CA   4  
ATOM 9546   C C    . TYR A 1 127 ? -15.770 9.191   2.796   1.00 10.00 ? 282 TYR A C    4  
ATOM 9547   O O    . TYR A 1 127 ? -15.126 9.277   3.838   1.00 10.00 ? 282 TYR A O    4  
ATOM 9548   C CB   . TYR A 1 127 ? -16.431 6.776   3.179   1.00 10.00 ? 282 TYR A CB   4  
ATOM 9549   C CG   . TYR A 1 127 ? -17.591 5.908   3.622   1.00 10.00 ? 282 TYR A CG   4  
ATOM 9550   C CD1  . TYR A 1 127 ? -18.269 6.190   4.798   1.00 10.00 ? 282 TYR A CD1  4  
ATOM 9551   C CD2  . TYR A 1 127 ? -18.018 4.822   2.862   1.00 10.00 ? 282 TYR A CD2  4  
ATOM 9552   C CE1  . TYR A 1 127 ? -19.342 5.425   5.210   1.00 10.00 ? 282 TYR A CE1  4  
ATOM 9553   C CE2  . TYR A 1 127 ? -19.090 4.046   3.269   1.00 10.00 ? 282 TYR A CE2  4  
ATOM 9554   C CZ   . TYR A 1 127 ? -19.749 4.355   4.444   1.00 10.00 ? 282 TYR A CZ   4  
ATOM 9555   O OH   . TYR A 1 127 ? -20.830 3.603   4.849   1.00 10.00 ? 282 TYR A OH   4  
ATOM 9556   H H    . TYR A 1 127 ? -16.617 7.692   0.579   1.00 10.00 ? 282 TYR A H    4  
ATOM 9557   H HH   . TYR A 1 127 ? -20.609 2.651   4.800   1.00 10.00 ? 282 TYR A HH   4  
ATOM 9558   N N    . LYS A 1 128 ? -15.607 10.006  1.755   1.00 10.00 ? 283 LYS A N    4  
ATOM 9559   C CA   . LYS A 1 128 ? -14.613 11.091  1.701   1.00 10.00 ? 283 LYS A CA   4  
ATOM 9560   C C    . LYS A 1 128 ? -14.757 12.234  2.720   1.00 10.00 ? 283 LYS A C    4  
ATOM 9561   O O    . LYS A 1 128 ? -14.763 13.413  2.354   1.00 10.00 ? 283 LYS A O    4  
ATOM 9562   C CB   . LYS A 1 128 ? -14.289 11.561  0.287   1.00 10.00 ? 283 LYS A CB   4  
ATOM 9563   C CG   . LYS A 1 128 ? -12.890 11.142  -0.147  1.00 10.00 ? 283 LYS A CG   4  
ATOM 9564   C CD   . LYS A 1 128 ? -12.664 11.299  -1.638  1.00 10.00 ? 283 LYS A CD   4  
ATOM 9565   C CE   . LYS A 1 128 ? -12.389 12.745  -2.010  1.00 10.00 ? 283 LYS A CE   4  
ATOM 9566   N NZ   . LYS A 1 128 ? -13.647 13.504  -2.221  1.00 10.00 ? 283 LYS A NZ   4  
ATOM 9567   H H    . LYS A 1 128 ? -16.178 9.861   0.965   1.00 10.00 ? 283 LYS A H    4  
ATOM 9568   H HZ1  . LYS A 1 128 ? -14.130 13.661  -1.315  1.00 10.00 ? 283 LYS A HZ1  4  
ATOM 9569   H HZ2  . LYS A 1 128 ? -14.287 12.972  -2.855  1.00 10.00 ? 283 LYS A HZ2  4  
ATOM 9570   H HZ3  . LYS A 1 128 ? -13.442 14.426  -2.653  1.00 10.00 ? 283 LYS A HZ3  4  
ATOM 9571   N N    . GLY A 1 129 ? -14.973 11.875  3.970   1.00 10.00 ? 284 GLY A N    4  
ATOM 9572   C CA   . GLY A 1 129 ? -15.121 12.861  5.018   1.00 10.00 ? 284 GLY A CA   4  
ATOM 9573   C C    . GLY A 1 129 ? -16.313 12.515  5.867   1.00 10.00 ? 284 GLY A C    4  
ATOM 9574   O O    . GLY A 1 129 ? -16.640 13.199  6.840   1.00 10.00 ? 284 GLY A O    4  
ATOM 9575   H H    . GLY A 1 129 ? -15.020 10.912  4.190   1.00 10.00 ? 284 GLY A H    4  
ATOM 9576   N N    . THR A 1 130 ? -16.967 11.440  5.472   1.00 10.00 ? 285 THR A N    4  
ATOM 9577   C CA   . THR A 1 130 ? -18.142 10.946  6.155   1.00 10.00 ? 285 THR A CA   4  
ATOM 9578   C C    . THR A 1 130 ? -17.761 9.896   7.195   1.00 10.00 ? 285 THR A C    4  
ATOM 9579   O O    . THR A 1 130 ? -18.622 9.200   7.736   1.00 10.00 ? 285 THR A O    4  
ATOM 9580   C CB   . THR A 1 130 ? -19.098 10.311  5.128   1.00 10.00 ? 285 THR A CB   4  
ATOM 9581   O OG1  . THR A 1 130 ? -18.587 10.553  3.805   1.00 10.00 ? 285 THR A OG1  4  
ATOM 9582   C CG2  . THR A 1 130 ? -20.486 10.917  5.245   1.00 10.00 ? 285 THR A CG2  4  
ATOM 9583   H H    . THR A 1 130 ? -16.660 10.967  4.672   1.00 10.00 ? 285 THR A H    4  
ATOM 9584   H HG1  . THR A 1 130 ? -19.080 10.023  3.165   1.00 10.00 ? 285 THR A HG1  4  
ATOM 9585   N N    . VAL A 1 131 ? -16.466 9.780   7.473   1.00 10.00 ? 286 VAL A N    4  
ATOM 9586   C CA   . VAL A 1 131 ? -15.987 8.806   8.442   1.00 10.00 ? 286 VAL A CA   4  
ATOM 9587   C C    . VAL A 1 131 ? -15.616 9.470   9.762   1.00 10.00 ? 286 VAL A C    4  
ATOM 9588   O O    . VAL A 1 131 ? -14.791 10.385  9.805   1.00 10.00 ? 286 VAL A O    4  
ATOM 9589   C CB   . VAL A 1 131 ? -14.774 8.011   7.921   1.00 10.00 ? 286 VAL A CB   4  
ATOM 9590   C CG1  . VAL A 1 131 ? -14.507 6.821   8.822   1.00 10.00 ? 286 VAL A CG1  4  
ATOM 9591   C CG2  . VAL A 1 131 ? -15.000 7.552   6.493   1.00 10.00 ? 286 VAL A CG2  4  
ATOM 9592   H H    . VAL A 1 131 ? -15.823 10.369  7.025   1.00 10.00 ? 286 VAL A H    4  
ATOM 9593   N N    . ASP A 1 132 ? -16.230 8.993   10.833  1.00 10.00 ? 287 ASP A N    4  
ATOM 9594   C CA   . ASP A 1 132 ? -15.983 9.512   12.173  1.00 10.00 ? 287 ASP A CA   4  
ATOM 9595   C C    . ASP A 1 132 ? -15.062 8.577   12.951  1.00 10.00 ? 287 ASP A C    4  
ATOM 9596   O O    . ASP A 1 132 ? -14.961 8.657   14.177  1.00 10.00 ? 287 ASP A O    4  
ATOM 9597   C CB   . ASP A 1 132 ? -17.308 9.677   12.925  1.00 10.00 ? 287 ASP A CB   4  
ATOM 9598   C CG   . ASP A 1 132 ? -18.160 8.424   12.888  1.00 10.00 ? 287 ASP A CG   4  
ATOM 9599   O OD1  . ASP A 1 132 ? -18.862 8.206   11.874  1.00 10.00 ? 287 ASP A OD1  4  
ATOM 9600   O OD2  . ASP A 1 132 ? -18.130 7.648   13.861  1.00 10.00 ? 287 ASP A OD2  4  
ATOM 9601   H H    . ASP A 1 132 ? -16.886 8.272   10.720  1.00 10.00 ? 287 ASP A H    4  
ATOM 9602   N N    . CYS A 1 133 ? -14.390 7.692   12.231  1.00 10.00 ? 288 CYS A N    4  
ATOM 9603   C CA   . CYS A 1 133 ? -13.479 6.739   12.844  1.00 10.00 ? 288 CYS A CA   4  
ATOM 9604   C C    . CYS A 1 133 ? -12.127 6.763   12.146  1.00 10.00 ? 288 CYS A C    4  
ATOM 9605   O O    . CYS A 1 133 ? -12.059 6.801   10.920  1.00 10.00 ? 288 CYS A O    4  
ATOM 9606   C CB   . CYS A 1 133 ? -14.075 5.329   12.802  1.00 10.00 ? 288 CYS A CB   4  
ATOM 9607   S SG   . CYS A 1 133 ? -13.021 4.047   13.522  1.00 10.00 ? 288 CYS A SG   4  
ATOM 9608   H H    . CYS A 1 133 ? -14.502 7.685   11.259  1.00 10.00 ? 288 CYS A H    4  
ATOM 9609   H HG   . CYS A 1 133 ? -12.827 4.350   14.800  1.00 10.00 ? 288 CYS A HG   4  
ATOM 9610   N N    . VAL A 1 134 ? -11.056 6.724   12.929  1.00 10.00 ? 289 VAL A N    4  
ATOM 9611   C CA   . VAL A 1 134 ? -9.703  6.750   12.379  1.00 10.00 ? 289 VAL A CA   4  
ATOM 9612   C C    . VAL A 1 134 ? -9.373  5.426   11.683  1.00 10.00 ? 289 VAL A C    4  
ATOM 9613   O O    . VAL A 1 134 ? -8.836  5.411   10.573  1.00 10.00 ? 289 VAL A O    4  
ATOM 9614   C CB   . VAL A 1 134 ? -8.640  7.086   13.457  1.00 10.00 ? 289 VAL A CB   4  
ATOM 9615   C CG1  . VAL A 1 134 ? -8.757  6.166   14.665  1.00 10.00 ? 289 VAL A CG1  4  
ATOM 9616   C CG2  . VAL A 1 134 ? -7.235  7.055   12.874  1.00 10.00 ? 289 VAL A CG2  4  
ATOM 9617   H H    . VAL A 1 134 ? -11.179 6.678   13.903  1.00 10.00 ? 289 VAL A H    4  
ATOM 9618   N N    . GLN A 1 135 ? -9.703  4.320   12.346  1.00 10.00 ? 290 GLN A N    4  
ATOM 9619   C CA   . GLN A 1 135 ? -9.475  2.984   11.795  1.00 10.00 ? 290 GLN A CA   4  
ATOM 9620   C C    . GLN A 1 135 ? -10.131 2.850   10.415  1.00 10.00 ? 290 GLN A C    4  
ATOM 9621   O O    . GLN A 1 135 ? -9.562  2.272   9.493   1.00 10.00 ? 290 GLN A O    4  
ATOM 9622   C CB   . GLN A 1 135 ? -10.014 1.915   12.750  1.00 10.00 ? 290 GLN A CB   4  
ATOM 9623   C CG   . GLN A 1 135 ? -9.574  2.077   14.202  1.00 10.00 ? 290 GLN A CG   4  
ATOM 9624   C CD   . GLN A 1 135 ? -8.068  2.019   14.381  1.00 10.00 ? 290 GLN A CD   4  
ATOM 9625   O OE1  . GLN A 1 135 ? -7.363  1.410   13.584  1.00 10.00 ? 290 GLN A OE1  4  
ATOM 9626   N NE2  . GLN A 1 135 ? -7.567  2.637   15.442  1.00 10.00 ? 290 GLN A NE2  4  
ATOM 9627   H H    . GLN A 1 135 ? -10.053 4.415   13.251  1.00 10.00 ? 290 GLN A H    4  
ATOM 9628   H HE21 . GLN A 1 135 ? -8.188  3.090   16.054  1.00 10.00 ? 290 GLN A HE21 4  
ATOM 9629   H HE22 . GLN A 1 135 ? -6.596  2.621   15.570  1.00 10.00 ? 290 GLN A HE22 4  
ATOM 9630   N N    . ALA A 1 136 ? -11.323 3.416   10.289  1.00 10.00 ? 291 ALA A N    4  
ATOM 9631   C CA   . ALA A 1 136 ? -12.074 3.399   9.037   1.00 10.00 ? 291 ALA A CA   4  
ATOM 9632   C C    . ALA A 1 136 ? -11.514 4.422   8.029   1.00 10.00 ? 291 ALA A C    4  
ATOM 9633   O O    . ALA A 1 136 ? -11.688 4.287   6.816   1.00 10.00 ? 291 ALA A O    4  
ATOM 9634   C CB   . ALA A 1 136 ? -13.544 3.674   9.320   1.00 10.00 ? 291 ALA A CB   4  
ATOM 9635   H H    . ALA A 1 136 ? -11.722 3.855   11.071  1.00 10.00 ? 291 ALA A H    4  
ATOM 9636   N N    . ARG A 1 137 ? -10.824 5.418   8.568   1.00 10.00 ? 292 ARG A N    4  
ATOM 9637   C CA   . ARG A 1 137 ? -10.275 6.506   7.756   1.00 10.00 ? 292 ARG A CA   4  
ATOM 9638   C C    . ARG A 1 137 ? -9.015  6.094   6.982   1.00 10.00 ? 292 ARG A C    4  
ATOM 9639   O O    . ARG A 1 137 ? -8.972  6.195   5.755   1.00 10.00 ? 292 ARG A O    4  
ATOM 9640   C CB   . ARG A 1 137 ? -10.025 7.775   8.582   1.00 10.00 ? 292 ARG A CB   4  
ATOM 9641   C CG   . ARG A 1 137 ? -10.848 8.975   8.135   1.00 10.00 ? 292 ARG A CG   4  
ATOM 9642   C CD   . ARG A 1 137 ? -9.992  10.041  7.462   1.00 10.00 ? 292 ARG A CD   4  
ATOM 9643   N NE   . ARG A 1 137 ? -9.467  9.622   6.156   1.00 10.00 ? 292 ARG A NE   4  
ATOM 9644   C CZ   . ARG A 1 137 ? -10.054 9.897   4.988   1.00 10.00 ? 292 ARG A CZ   4  
ATOM 9645   N NH1  . ARG A 1 137 ? -11.271 10.436  4.953   1.00 10.00 ? 292 ARG A NH1  4  
ATOM 9646   N NH2  . ARG A 1 137 ? -9.429  9.600   3.855   1.00 10.00 ? 292 ARG A NH2  4  
ATOM 9647   H H    . ARG A 1 137 ? -10.566 5.285   9.504   1.00 10.00 ? 292 ARG A H    4  
ATOM 9648   H HE   . ARG A 1 137 ? -8.596  9.151   6.147   1.00 10.00 ? 292 ARG A HE   4  
ATOM 9649   H HH11 . ARG A 1 137 ? -11.759 10.636  5.806   1.00 10.00 ? 292 ARG A HH11 4  
ATOM 9650   H HH12 . ARG A 1 137 ? -11.704 10.649  4.073   1.00 10.00 ? 292 ARG A HH12 4  
ATOM 9651   H HH21 . ARG A 1 137 ? -8.512  9.168   3.886   1.00 10.00 ? 292 ARG A HH21 4  
ATOM 9652   H HH22 . ARG A 1 137 ? -9.850  9.808   2.969   1.00 10.00 ? 292 ARG A HH22 4  
ATOM 9653   N N    . ALA A 1 138 ? -8.004  5.593   7.703   1.00 10.00 ? 293 ALA A N    4  
ATOM 9654   C CA   . ALA A 1 138 ? -6.732  5.185   7.090   1.00 10.00 ? 293 ALA A CA   4  
ATOM 9655   C C    . ALA A 1 138 ? -6.909  4.105   6.032   1.00 10.00 ? 293 ALA A C    4  
ATOM 9656   O O    . ALA A 1 138 ? -6.137  4.029   5.074   1.00 10.00 ? 293 ALA A O    4  
ATOM 9657   C CB   . ALA A 1 138 ? -5.747  4.725   8.153   1.00 10.00 ? 293 ALA A CB   4  
ATOM 9658   H H    . ALA A 1 138 ? -8.105  5.524   8.677   1.00 10.00 ? 293 ALA A H    4  
ATOM 9659   N N    . ALA A 1 139 ? -7.919  3.274   6.226   1.00 10.00 ? 294 ALA A N    4  
ATOM 9660   C CA   . ALA A 1 139 ? -8.225  2.202   5.291   1.00 10.00 ? 294 ALA A CA   4  
ATOM 9661   C C    . ALA A 1 139 ? -8.542  2.779   3.914   1.00 10.00 ? 294 ALA A C    4  
ATOM 9662   O O    . ALA A 1 139 ? -8.118  2.245   2.890   1.00 10.00 ? 294 ALA A O    4  
ATOM 9663   C CB   . ALA A 1 139 ? -9.388  1.375   5.808   1.00 10.00 ? 294 ALA A CB   4  
ATOM 9664   H H    . ALA A 1 139 ? -8.459  3.381   7.034   1.00 10.00 ? 294 ALA A H    4  
ATOM 9665   N N    . LEU A 1 140 ? -9.272  3.884   3.900   1.00 10.00 ? 295 LEU A N    4  
ATOM 9666   C CA   . LEU A 1 140 ? -9.647  4.536   2.653   1.00 10.00 ? 295 LEU A CA   4  
ATOM 9667   C C    . LEU A 1 140 ? -8.462  5.287   2.053   1.00 10.00 ? 295 LEU A C    4  
ATOM 9668   O O    . LEU A 1 140 ? -8.327  5.379   0.829   1.00 10.00 ? 295 LEU A O    4  
ATOM 9669   C CB   . LEU A 1 140 ? -10.808 5.503   2.881   1.00 10.00 ? 295 LEU A CB   4  
ATOM 9670   C CG   . LEU A 1 140 ? -12.070 4.915   3.508   1.00 10.00 ? 295 LEU A CG   4  
ATOM 9671   C CD1  . LEU A 1 140 ? -13.097 6.007   3.750   1.00 10.00 ? 295 LEU A CD1  4  
ATOM 9672   C CD2  . LEU A 1 140 ? -12.650 3.814   2.632   1.00 10.00 ? 295 LEU A CD2  4  
ATOM 9673   H H    . LEU A 1 140 ? -9.568  4.274   4.750   1.00 10.00 ? 295 LEU A H    4  
ATOM 9674   N N    . ASP A 1 141 ? -7.616  5.830   2.923   1.00 10.00 ? 296 ASP A N    4  
ATOM 9675   C CA   . ASP A 1 141 ? -6.441  6.577   2.487   1.00 10.00 ? 296 ASP A CA   4  
ATOM 9676   C C    . ASP A 1 141 ? -5.509  5.685   1.687   1.00 10.00 ? 296 ASP A C    4  
ATOM 9677   O O    . ASP A 1 141 ? -5.202  5.975   0.531   1.00 10.00 ? 296 ASP A O    4  
ATOM 9678   C CB   . ASP A 1 141 ? -5.694  7.134   3.701   1.00 10.00 ? 296 ASP A CB   4  
ATOM 9679   C CG   . ASP A 1 141 ? -6.056  8.569   4.000   1.00 10.00 ? 296 ASP A CG   4  
ATOM 9680   O OD1  . ASP A 1 141 ? -7.042  8.799   4.731   1.00 10.00 ? 296 ASP A OD1  4  
ATOM 9681   O OD2  . ASP A 1 141 ? -5.362  9.477   3.498   1.00 10.00 ? 296 ASP A OD2  4  
ATOM 9682   H H    . ASP A 1 141 ? -7.785  5.727   3.883   1.00 10.00 ? 296 ASP A H    4  
ATOM 9683   N N    . LYS A 1 142 ? -5.047  4.611   2.322   1.00 10.00 ? 297 LYS A N    4  
ATOM 9684   C CA   . LYS A 1 142 ? -4.171  3.650   1.665   1.00 10.00 ? 297 LYS A CA   4  
ATOM 9685   C C    . LYS A 1 142 ? -4.764  3.152   0.349   1.00 10.00 ? 297 LYS A C    4  
ATOM 9686   O O    . LYS A 1 142 ? -4.045  2.991   -0.637  1.00 10.00 ? 297 LYS A O    4  
ATOM 9687   C CB   . LYS A 1 142 ? -3.830  2.481   2.593   1.00 10.00 ? 297 LYS A CB   4  
ATOM 9688   C CG   . LYS A 1 142 ? -2.423  1.932   2.399   1.00 10.00 ? 297 LYS A CG   4  
ATOM 9689   C CD   . LYS A 1 142 ? -2.106  0.846   3.414   1.00 10.00 ? 297 LYS A CD   4  
ATOM 9690   C CE   . LYS A 1 142 ? -0.680  0.335   3.262   1.00 10.00 ? 297 LYS A CE   4  
ATOM 9691   N NZ   . LYS A 1 142 ? 0.320   1.259   3.861   1.00 10.00 ? 297 LYS A NZ   4  
ATOM 9692   H H    . LYS A 1 142 ? -5.207  4.535   3.287   1.00 10.00 ? 297 LYS A H    4  
ATOM 9693   H HZ1  . LYS A 1 142 ? -0.023  2.249   3.811   1.00 10.00 ? 297 LYS A HZ1  4  
ATOM 9694   H HZ2  . LYS A 1 142 ? 1.220   1.200   3.340   1.00 10.00 ? 297 LYS A HZ2  4  
ATOM 9695   H HZ3  . LYS A 1 142 ? 0.496   1.014   4.862   1.00 10.00 ? 297 LYS A HZ3  4  
ATOM 9696   N N    . ALA A 1 143 ? -6.079  2.930   0.333   1.00 10.00 ? 298 ALA A N    4  
ATOM 9697   C CA   . ALA A 1 143 ? -6.760  2.472   -0.875  1.00 10.00 ? 298 ALA A CA   4  
ATOM 9698   C C    . ALA A 1 143 ? -6.564  3.494   -1.991  1.00 10.00 ? 298 ALA A C    4  
ATOM 9699   O O    . ALA A 1 143 ? -6.233  3.141   -3.123  1.00 10.00 ? 298 ALA A O    4  
ATOM 9700   C CB   . ALA A 1 143 ? -8.241  2.258   -0.602  1.00 10.00 ? 298 ALA A CB   4  
ATOM 9701   H H    . ALA A 1 143 ? -6.600  3.078   1.152   1.00 10.00 ? 298 ALA A H    4  
ATOM 9702   N N    . THR A 1 144 ? -6.803  4.758   -1.654  1.00 10.00 ? 299 THR A N    4  
ATOM 9703   C CA   . THR A 1 144 ? -6.606  5.859   -2.595  1.00 10.00 ? 299 THR A CA   4  
ATOM 9704   C C    . THR A 1 144 ? -5.194  5.805   -3.192  1.00 10.00 ? 299 THR A C    4  
ATOM 9705   O O    . THR A 1 144 ? -5.029  5.826   -4.416  1.00 10.00 ? 299 THR A O    4  
ATOM 9706   C CB   . THR A 1 144 ? -6.829  7.229   -1.917  1.00 10.00 ? 299 THR A CB   4  
ATOM 9707   O OG1  . THR A 1 144 ? -8.113  7.255   -1.272  1.00 10.00 ? 299 THR A OG1  4  
ATOM 9708   C CG2  . THR A 1 144 ? -6.762  8.354   -2.940  1.00 10.00 ? 299 THR A CG2  4  
ATOM 9709   H H    . THR A 1 144 ? -7.233  4.928   -0.790  1.00 10.00 ? 299 THR A H    4  
ATOM 9710   H HG1  . THR A 1 144 ? -8.066  6.754   -0.447  1.00 10.00 ? 299 THR A HG1  4  
ATOM 9711   N N    . VAL A 1 145 ? -4.185  5.751   -2.323  1.00 10.00 ? 300 VAL A N    4  
ATOM 9712   C CA   . VAL A 1 145 ? -2.792  5.655   -2.754  1.00 10.00 ? 300 VAL A CA   4  
ATOM 9713   C C    . VAL A 1 145 ? -2.601  4.484   -3.717  1.00 10.00 ? 300 VAL A C    4  
ATOM 9714   O O    . VAL A 1 145 ? -2.008  4.636   -4.786  1.00 10.00 ? 300 VAL A O    4  
ATOM 9715   C CB   . VAL A 1 145 ? -1.860  5.448   -1.544  1.00 10.00 ? 300 VAL A CB   4  
ATOM 9716   C CG1  . VAL A 1 145 ? -0.408  5.351   -1.986  1.00 10.00 ? 300 VAL A CG1  4  
ATOM 9717   C CG2  . VAL A 1 145 ? -2.043  6.563   -0.524  1.00 10.00 ? 300 VAL A CG2  4  
ATOM 9718   H H    . VAL A 1 145 ? -4.367  5.854   -1.361  1.00 10.00 ? 300 VAL A H    4  
ATOM 9719   N N    . LEU A 1 146 ? -3.114  3.324   -3.326  1.00 10.00 ? 301 LEU A N    4  
ATOM 9720   C CA   . LEU A 1 146 ? -3.017  2.112   -4.138  1.00 10.00 ? 301 LEU A CA   4  
ATOM 9721   C C    . LEU A 1 146 ? -3.541  2.335   -5.555  1.00 10.00 ? 301 LEU A C    4  
ATOM 9722   O O    . LEU A 1 146 ? -2.966  1.830   -6.516  1.00 10.00 ? 301 LEU A O    4  
ATOM 9723   C CB   . LEU A 1 146 ? -3.762  0.953   -3.479  1.00 10.00 ? 301 LEU A CB   4  
ATOM 9724   C CG   . LEU A 1 146 ? -2.904  -0.060  -2.721  1.00 10.00 ? 301 LEU A CG   4  
ATOM 9725   C CD1  . LEU A 1 146 ? -2.377  0.531   -1.423  1.00 10.00 ? 301 LEU A CD1  4  
ATOM 9726   C CD2  . LEU A 1 146 ? -3.692  -1.329  -2.457  1.00 10.00 ? 301 LEU A CD2  4  
ATOM 9727   H H    . LEU A 1 146 ? -3.532  3.273   -2.434  1.00 10.00 ? 301 LEU A H    4  
ATOM 9728   N N    . LEU A 1 147 ? -4.615  3.104   -5.685  1.00 10.00 ? 302 LEU A N    4  
ATOM 9729   C CA   . LEU A 1 147 ? -5.190  3.396   -6.995  1.00 10.00 ? 302 LEU A CA   4  
ATOM 9730   C C    . LEU A 1 147 ? -4.196  4.173   -7.854  1.00 10.00 ? 302 LEU A C    4  
ATOM 9731   O O    . LEU A 1 147 ? -4.092  3.957   -9.062  1.00 10.00 ? 302 LEU A O    4  
ATOM 9732   C CB   . LEU A 1 147 ? -6.487  4.190   -6.842  1.00 10.00 ? 302 LEU A CB   4  
ATOM 9733   C CG   . LEU A 1 147 ? -7.631  3.472   -6.125  1.00 10.00 ? 302 LEU A CG   4  
ATOM 9734   C CD1  . LEU A 1 147 ? -8.723  4.461   -5.741  1.00 10.00 ? 302 LEU A CD1  4  
ATOM 9735   C CD2  . LEU A 1 147 ? -8.195  2.360   -6.996  1.00 10.00 ? 302 LEU A CD2  4  
ATOM 9736   H H    . LEU A 1 147 ? -5.039  3.476   -4.879  1.00 10.00 ? 302 LEU A H    4  
ATOM 9737   N N    . SER A 1 148 ? -3.444  5.053   -7.206  1.00 10.00 ? 303 SER A N    4  
ATOM 9738   C CA   . SER A 1 148 ? -2.447  5.863   -7.887  1.00 10.00 ? 303 SER A CA   4  
ATOM 9739   C C    . SER A 1 148 ? -1.224  5.008   -8.229  1.00 10.00 ? 303 SER A C    4  
ATOM 9740   O O    . SER A 1 148 ? -0.410  5.363   -9.082  1.00 10.00 ? 303 SER A O    4  
ATOM 9741   C CB   . SER A 1 148 ? -2.059  7.050   -7.000  1.00 10.00 ? 303 SER A CB   4  
ATOM 9742   O OG   . SER A 1 148 ? -3.215  7.662   -6.437  1.00 10.00 ? 303 SER A OG   4  
ATOM 9743   H H    . SER A 1 148 ? -3.554  5.151   -6.236  1.00 10.00 ? 303 SER A H    4  
ATOM 9744   H HG   . SER A 1 148 ? -3.903  7.000   -6.307  1.00 10.00 ? 303 SER A HG   4  
ATOM 9745   N N    . MET A 1 149 ? -1.097  3.891   -7.527  1.00 10.00 ? 304 MET A N    4  
ATOM 9746   C CA   . MET A 1 149 ? 0.002   2.954   -7.730  1.00 10.00 ? 304 MET A CA   4  
ATOM 9747   C C    . MET A 1 149 ? -0.367  1.877   -8.761  1.00 10.00 ? 304 MET A C    4  
ATOM 9748   O O    . MET A 1 149 ? 0.489   1.387   -9.499  1.00 10.00 ? 304 MET A O    4  
ATOM 9749   C CB   . MET A 1 149 ? 0.356   2.293   -6.391  1.00 10.00 ? 304 MET A CB   4  
ATOM 9750   C CG   . MET A 1 149 ? 1.626   1.456   -6.406  1.00 10.00 ? 304 MET A CG   4  
ATOM 9751   S SD   . MET A 1 149 ? 1.320   -0.303  -6.145  1.00 10.00 ? 304 MET A SD   4  
ATOM 9752   C CE   . MET A 1 149 ? 0.714   -0.294  -4.458  1.00 10.00 ? 304 MET A CE   4  
ATOM 9753   H H    . MET A 1 149 ? -1.767  3.692   -6.836  1.00 10.00 ? 304 MET A H    4  
ATOM 9754   N N    . SER A 1 150 ? -1.646  1.516   -8.811  1.00 10.00 ? 305 SER A N    4  
ATOM 9755   C CA   . SER A 1 150 ? -2.125  0.479   -9.724  1.00 10.00 ? 305 SER A CA   4  
ATOM 9756   C C    . SER A 1 150 ? -2.044  0.884   -11.194 1.00 10.00 ? 305 SER A C    4  
ATOM 9757   O O    . SER A 1 150 ? -1.912  0.028   -12.068 1.00 10.00 ? 305 SER A O    4  
ATOM 9758   C CB   . SER A 1 150 ? -3.554  0.067   -9.367  1.00 10.00 ? 305 SER A CB   4  
ATOM 9759   O OG   . SER A 1 150 ? -3.649  -0.310  -8.004  1.00 10.00 ? 305 SER A OG   4  
ATOM 9760   H H    . SER A 1 150 ? -2.291  1.954   -8.209  1.00 10.00 ? 305 SER A H    4  
ATOM 9761   H HG   . SER A 1 150 ? -3.125  0.294   -7.463  1.00 10.00 ? 305 SER A HG   4  
ATOM 9762   N N    . LYS A 1 151 ? -2.124  2.177   -11.473 1.00 10.00 ? 306 LYS A N    4  
ATOM 9763   C CA   . LYS A 1 151 ? -2.068  2.655   -12.850 1.00 10.00 ? 306 LYS A CA   4  
ATOM 9764   C C    . LYS A 1 151 ? -1.069  3.793   -13.013 1.00 10.00 ? 306 LYS A C    4  
ATOM 9765   O O    . LYS A 1 151 ? -1.350  4.785   -13.680 1.00 10.00 ? 306 LYS A O    4  
ATOM 9766   C CB   . LYS A 1 151 ? -3.455  3.097   -13.337 1.00 10.00 ? 306 LYS A CB   4  
ATOM 9767   C CG   . LYS A 1 151 ? -4.402  1.955   -13.673 1.00 10.00 ? 306 LYS A CG   4  
ATOM 9768   C CD   . LYS A 1 151 ? -5.405  2.361   -14.743 1.00 10.00 ? 306 LYS A CD   4  
ATOM 9769   C CE   . LYS A 1 151 ? -6.297  3.500   -14.274 1.00 10.00 ? 306 LYS A CE   4  
ATOM 9770   N NZ   . LYS A 1 151 ? -7.187  3.988   -15.357 1.00 10.00 ? 306 LYS A NZ   4  
ATOM 9771   H H    . LYS A 1 151 ? -2.222  2.822   -10.741 1.00 10.00 ? 306 LYS A H    4  
ATOM 9772   H HZ1  . LYS A 1 151 ? -7.693  3.190   -15.793 1.00 10.00 ? 306 LYS A HZ1  4  
ATOM 9773   H HZ2  . LYS A 1 151 ? -6.629  4.470   -16.090 1.00 10.00 ? 306 LYS A HZ2  4  
ATOM 9774   H HZ3  . LYS A 1 151 ? -7.884  4.657   -14.973 1.00 10.00 ? 306 LYS A HZ3  4  
ATOM 9775   N N    . GLY A 1 152 ? 0.100   3.646   -12.411 1.00 10.00 ? 307 GLY A N    4  
ATOM 9776   C CA   . GLY A 1 152 ? 1.109   4.679   -12.516 1.00 10.00 ? 307 GLY A CA   4  
ATOM 9777   C C    . GLY A 1 152 ? 2.378   4.310   -11.783 1.00 10.00 ? 307 GLY A C    4  
ATOM 9778   O O    . GLY A 1 152 ? 2.382   3.381   -10.983 1.00 10.00 ? 307 GLY A O    4  
ATOM 9779   H H    . GLY A 1 152 ? 0.281   2.834   -11.893 1.00 10.00 ? 307 GLY A H    4  
ATOM 9780   N N    . GLY A 1 153 ? 3.453   5.030   -12.064 1.00 10.00 ? 308 GLY A N    4  
ATOM 9781   C CA   . GLY A 1 153 ? 4.726   4.765   -11.416 1.00 10.00 ? 308 GLY A CA   4  
ATOM 9782   C C    . GLY A 1 153 ? 5.348   3.448   -11.846 1.00 10.00 ? 308 GLY A C    4  
ATOM 9783   O O    . GLY A 1 153 ? 5.948   2.742   -11.035 1.00 10.00 ? 308 GLY A O    4  
ATOM 9784   H H    . GLY A 1 153 ? 3.381   5.762   -12.715 1.00 10.00 ? 308 GLY A H    4  
ATOM 9785   N N    . LYS A 1 154 ? 5.212   3.110   -13.121 1.00 10.00 ? 309 LYS A N    4  
ATOM 9786   C CA   . LYS A 1 154 ? 5.770   1.866   -13.638 1.00 10.00 ? 309 LYS A CA   4  
ATOM 9787   C C    . LYS A 1 154 ? 6.907   2.141   -14.613 1.00 10.00 ? 309 LYS A C    4  
ATOM 9788   O O    . LYS A 1 154 ? 6.774   1.948   -15.819 1.00 10.00 ? 309 LYS A O    4  
ATOM 9789   C CB   . LYS A 1 154 ? 4.688   1.002   -14.294 1.00 10.00 ? 309 LYS A CB   4  
ATOM 9790   C CG   . LYS A 1 154 ? 4.121   -0.090  -13.396 1.00 10.00 ? 309 LYS A CG   4  
ATOM 9791   C CD   . LYS A 1 154 ? 3.209   0.481   -12.321 1.00 10.00 ? 309 LYS A CD   4  
ATOM 9792   C CE   . LYS A 1 154 ? 3.782   0.257   -10.930 1.00 10.00 ? 309 LYS A CE   4  
ATOM 9793   N NZ   . LYS A 1 154 ? 3.083   1.076   -9.907  1.00 10.00 ? 309 LYS A NZ   4  
ATOM 9794   H H    . LYS A 1 154 ? 4.734   3.715   -13.732 1.00 10.00 ? 309 LYS A H    4  
ATOM 9795   H HZ1  . LYS A 1 154 ? 3.103   2.086   -10.177 1.00 10.00 ? 309 LYS A HZ1  4  
ATOM 9796   H HZ2  . LYS A 1 154 ? 3.540   0.975   -8.980  1.00 10.00 ? 309 LYS A HZ2  4  
ATOM 9797   H HZ3  . LYS A 1 154 ? 2.088   0.782   -9.822  1.00 10.00 ? 309 LYS A HZ3  4  
ATOM 9798   N N    . ARG A 1 155 ? 8.027   2.602   -14.081 1.00 10.00 ? 310 ARG A N    4  
ATOM 9799   C CA   . ARG A 1 155 ? 9.186   2.910   -14.907 1.00 10.00 ? 310 ARG A CA   4  
ATOM 9800   C C    . ARG A 1 155 ? 10.260  1.834   -14.794 1.00 10.00 ? 310 ARG A C    4  
ATOM 9801   O O    . ARG A 1 155 ? 10.876  1.451   -15.786 1.00 10.00 ? 310 ARG A O    4  
ATOM 9802   C CB   . ARG A 1 155 ? 9.752   4.285   -14.546 1.00 10.00 ? 310 ARG A CB   4  
ATOM 9803   C CG   . ARG A 1 155 ? 8.864   5.446   -14.977 1.00 10.00 ? 310 ARG A CG   4  
ATOM 9804   C CD   . ARG A 1 155 ? 8.900   6.591   -13.974 1.00 10.00 ? 310 ARG A CD   4  
ATOM 9805   N NE   . ARG A 1 155 ? 10.206  7.246   -13.916 1.00 10.00 ? 310 ARG A NE   4  
ATOM 9806   C CZ   . ARG A 1 155 ? 10.998  7.245   -12.843 1.00 10.00 ? 310 ARG A CZ   4  
ATOM 9807   N NH1  . ARG A 1 155 ? 10.621  6.634   -11.729 1.00 10.00 ? 310 ARG A NH1  4  
ATOM 9808   N NH2  . ARG A 1 155 ? 12.164  7.870   -12.880 1.00 10.00 ? 310 ARG A NH2  4  
ATOM 9809   H H    . ARG A 1 155 ? 8.073   2.740   -13.114 1.00 10.00 ? 310 ARG A H    4  
ATOM 9810   H HE   . ARG A 1 155 ? 10.508  7.724   -14.725 1.00 10.00 ? 310 ARG A HE   4  
ATOM 9811   H HH11 . ARG A 1 155 ? 9.738   6.169   -11.680 1.00 10.00 ? 310 ARG A HH11 4  
ATOM 9812   H HH12 . ARG A 1 155 ? 11.236  6.639   -10.917 1.00 10.00 ? 310 ARG A HH12 4  
ATOM 9813   H HH21 . ARG A 1 155 ? 12.454  8.348   -13.716 1.00 10.00 ? 310 ARG A HH21 4  
ATOM 9814   H HH22 . ARG A 1 155 ? 12.763  7.867   -12.073 1.00 10.00 ? 310 ARG A HH22 4  
ATOM 9815   N N    . LYS A 1 156 ? 10.463  1.322   -13.586 1.00 10.00 ? 311 LYS A N    4  
ATOM 9816   C CA   . LYS A 1 156 ? 11.474  0.295   -13.353 1.00 10.00 ? 311 LYS A CA   4  
ATOM 9817   C C    . LYS A 1 156 ? 10.893  -1.111  -13.513 1.00 10.00 ? 311 LYS A C    4  
ATOM 9818   O O    . LYS A 1 156 ? 11.398  -2.075  -12.939 1.00 10.00 ? 311 LYS A O    4  
ATOM 9819   C CB   . LYS A 1 156 ? 12.112  0.477   -11.970 1.00 10.00 ? 311 LYS A CB   4  
ATOM 9820   C CG   . LYS A 1 156 ? 12.813  1.819   -11.791 1.00 10.00 ? 311 LYS A CG   4  
ATOM 9821   C CD   . LYS A 1 156 ? 13.274  2.028   -10.356 1.00 10.00 ? 311 LYS A CD   4  
ATOM 9822   C CE   . LYS A 1 156 ? 13.724  3.464   -10.126 1.00 10.00 ? 311 LYS A CE   4  
ATOM 9823   N NZ   . LYS A 1 156 ? 14.115  3.709   -8.713  1.00 10.00 ? 311 LYS A NZ   4  
ATOM 9824   H H    . LYS A 1 156 ? 9.919   1.634   -12.836 1.00 10.00 ? 311 LYS A H    4  
ATOM 9825   H HZ1  . LYS A 1 156 ? 15.134  3.500   -8.579  1.00 10.00 ? 311 LYS A HZ1  4  
ATOM 9826   H HZ2  . LYS A 1 156 ? 13.562  3.104   -8.078  1.00 10.00 ? 311 LYS A HZ2  4  
ATOM 9827   H HZ3  . LYS A 1 156 ? 13.939  4.712   -8.459  1.00 10.00 ? 311 LYS A HZ3  4  
ATOM 9828   N N    . ASP A 1 157 ? 9.851   -1.219  -14.327 1.00 10.00 ? 312 ASP A N    4  
ATOM 9829   C CA   . ASP A 1 157 ? 9.187   -2.501  -14.570 1.00 10.00 ? 312 ASP A CA   4  
ATOM 9830   C C    . ASP A 1 157 ? 9.902   -3.294  -15.662 1.00 10.00 ? 312 ASP A C    4  
ATOM 9831   O O    . ASP A 1 157 ? 9.908   -4.526  -15.654 1.00 10.00 ? 312 ASP A O    4  
ATOM 9832   C CB   . ASP A 1 157 ? 7.718   -2.273  -14.950 1.00 10.00 ? 312 ASP A CB   4  
ATOM 9833   C CG   . ASP A 1 157 ? 6.980   -3.554  -15.296 1.00 10.00 ? 312 ASP A CG   4  
ATOM 9834   O OD1  . ASP A 1 157 ? 6.875   -4.443  -14.424 1.00 10.00 ? 312 ASP A OD1  4  
ATOM 9835   O OD2  . ASP A 1 157 ? 6.488   -3.666  -16.436 1.00 10.00 ? 312 ASP A OD2  4  
ATOM 9836   H H    . ASP A 1 157 ? 9.523   -0.419  -14.783 1.00 10.00 ? 312 ASP A H    4  
ATOM 9837   N N    . SER A 1 158 ? 10.537  -2.580  -16.582 1.00 10.00 ? 313 SER A N    4  
ATOM 9838   C CA   . SER A 1 158 ? 11.247  -3.212  -17.688 1.00 10.00 ? 313 SER A CA   4  
ATOM 9839   C C    . SER A 1 158 ? 12.710  -3.490  -17.335 1.00 10.00 ? 313 SER A C    4  
ATOM 9840   O O    . SER A 1 158 ? 13.548  -3.690  -18.217 1.00 10.00 ? 313 SER A O    4  
ATOM 9841   C CB   . SER A 1 158 ? 11.146  -2.335  -18.937 1.00 10.00 ? 313 SER A CB   4  
ATOM 9842   O OG   . SER A 1 158 ? 9.810   -1.889  -19.124 1.00 10.00 ? 313 SER A OG   4  
ATOM 9843   H H    . SER A 1 158 ? 10.530  -1.603  -16.518 1.00 10.00 ? 313 SER A H    4  
ATOM 9844   H HG   . SER A 1 158 ? 9.203   -2.618  -18.938 1.00 10.00 ? 313 SER A HG   4  
ATOM 9845   N N    . VAL A 1 159 ? 13.011  -3.507  -16.041 1.00 10.00 ? 314 VAL A N    4  
ATOM 9846   C CA   . VAL A 1 159 ? 14.367  -3.764  -15.579 1.00 10.00 ? 314 VAL A CA   4  
ATOM 9847   C C    . VAL A 1 159 ? 14.578  -5.252  -15.313 1.00 10.00 ? 314 VAL A C    4  
ATOM 9848   O O    . VAL A 1 159 ? 15.512  -5.857  -15.839 1.00 10.00 ? 314 VAL A O    4  
ATOM 9849   C CB   . VAL A 1 159 ? 14.705  -2.956  -14.307 1.00 10.00 ? 314 VAL A CB   4  
ATOM 9850   C CG1  . VAL A 1 159 ? 16.170  -3.131  -13.933 1.00 10.00 ? 314 VAL A CG1  4  
ATOM 9851   C CG2  . VAL A 1 159 ? 14.379  -1.486  -14.507 1.00 10.00 ? 314 VAL A CG2  4  
ATOM 9852   H H    . VAL A 1 159 ? 12.305  -3.342  -15.384 1.00 10.00 ? 314 VAL A H    4  
ATOM 9853   N N    . TRP A 1 160 ? 13.698  -5.850  -14.516 1.00 10.00 ? 315 TRP A N    4  
ATOM 9854   C CA   . TRP A 1 160 ? 13.817  -7.267  -14.185 1.00 10.00 ? 315 TRP A CA   4  
ATOM 9855   C C    . TRP A 1 160 ? 12.470  -7.974  -14.182 1.00 10.00 ? 315 TRP A C    4  
ATOM 9856   O O    . TRP A 1 160 ? 11.570  -7.611  -13.422 1.00 10.00 ? 315 TRP A O    4  
ATOM 9857   C CB   . TRP A 1 160 ? 14.487  -7.453  -12.821 1.00 10.00 ? 315 TRP A CB   4  
ATOM 9858   C CG   . TRP A 1 160 ? 15.976  -7.312  -12.852 1.00 10.00 ? 315 TRP A CG   4  
ATOM 9859   C CD1  . TRP A 1 160 ? 16.715  -6.315  -12.289 1.00 10.00 ? 315 TRP A CD1  4  
ATOM 9860   C CD2  . TRP A 1 160 ? 16.906  -8.197  -13.483 1.00 10.00 ? 315 TRP A CD2  4  
ATOM 9861   N NE1  . TRP A 1 160 ? 18.048  -6.526  -12.529 1.00 10.00 ? 315 TRP A NE1  4  
ATOM 9862   C CE2  . TRP A 1 160 ? 18.194  -7.673  -13.262 1.00 10.00 ? 315 TRP A CE2  4  
ATOM 9863   C CE3  . TRP A 1 160 ? 16.776  -9.379  -14.215 1.00 10.00 ? 315 TRP A CE3  4  
ATOM 9864   C CZ2  . TRP A 1 160 ? 19.344  -8.293  -13.743 1.00 10.00 ? 315 TRP A CZ2  4  
ATOM 9865   C CZ3  . TRP A 1 160 ? 17.917  -9.993  -14.693 1.00 10.00 ? 315 TRP A CZ3  4  
ATOM 9866   C CH2  . TRP A 1 160 ? 19.185  -9.449  -14.455 1.00 10.00 ? 315 TRP A CH2  4  
ATOM 9867   H H    . TRP A 1 160 ? 12.949  -5.334  -14.153 1.00 10.00 ? 315 TRP A H    4  
ATOM 9868   H HE1  . TRP A 1 160 ? 18.781  -5.944  -12.224 1.00 10.00 ? 315 TRP A HE1  4  
ATOM 9869   N N    . GLY A 1 161 ? 12.340  -8.978  -15.037 1.00 10.00 ? 316 GLY A N    4  
ATOM 9870   C CA   . GLY A 1 161 ? 11.118  -9.753  -15.102 1.00 10.00 ? 316 GLY A CA   4  
ATOM 9871   C C    . GLY A 1 161 ? 11.147  -10.898 -14.104 1.00 10.00 ? 316 GLY A C    4  
ATOM 9872   O O    . GLY A 1 161 ? 12.160  -11.111 -13.433 1.00 10.00 ? 316 GLY A O    4  
ATOM 9873   H H    . GLY A 1 161 ? 13.082  -9.190  -15.638 1.00 10.00 ? 316 GLY A H    4  
ATOM 9874   N N    . SER A 1 162 ? 10.047  -11.630 -13.992 1.00 10.00 ? 317 SER A N    4  
ATOM 9875   C CA   . SER A 1 162 ? 9.962   -12.752 -13.064 1.00 10.00 ? 317 SER A CA   4  
ATOM 9876   C C    . SER A 1 162 ? 9.113   -13.868 -13.667 1.00 10.00 ? 317 SER A C    4  
ATOM 9877   O O    . SER A 1 162 ? 8.794   -13.832 -14.857 1.00 10.00 ? 317 SER A O    4  
ATOM 9878   C CB   . SER A 1 162 ? 9.361   -12.287 -11.733 1.00 10.00 ? 317 SER A CB   4  
ATOM 9879   O OG   . SER A 1 162 ? 9.813   -10.983 -11.406 1.00 10.00 ? 317 SER A OG   4  
ATOM 9880   H H    . SER A 1 162 ? 9.268   -11.417 -14.551 1.00 10.00 ? 317 SER A H    4  
ATOM 9881   H HG   . SER A 1 162 ? 9.764   -10.428 -12.194 1.00 10.00 ? 317 SER A HG   4  
ATOM 9882   N N    . GLY A 1 163 ? 8.747   -14.852 -12.851 1.00 10.00 ? 318 GLY A N    4  
ATOM 9883   C CA   . GLY A 1 163 ? 7.939   -15.950 -13.333 1.00 10.00 ? 318 GLY A CA   4  
ATOM 9884   C C    . GLY A 1 163 ? 6.799   -16.265 -12.390 1.00 10.00 ? 318 GLY A C    4  
ATOM 9885   O O    . GLY A 1 163 ? 6.969   -16.086 -11.165 1.00 10.00 ? 318 GLY A O    4  
ATOM 9886   O OXT  . GLY A 1 163 ? 5.727   -16.685 -12.866 1.00 10.00 ? 318 GLY A OXT  4  
ATOM 9887   H H    . GLY A 1 163 ? 9.024   -14.833 -11.912 1.00 10.00 ? 318 GLY A H    4  
ATOM 9888   N N    . GLY B 2 1   ? 4.500   -17.732 -10.809 1.00 10.00 ? 319 GLY B N    4  
ATOM 9889   C CA   . GLY B 2 1   ? 3.725   -16.565 -10.332 1.00 10.00 ? 319 GLY B CA   4  
ATOM 9890   C C    . GLY B 2 1   ? 2.683   -16.942 -9.302  1.00 10.00 ? 319 GLY B C    4  
ATOM 9891   O O    . GLY B 2 1   ? 2.672   -16.404 -8.192  1.00 10.00 ? 319 GLY B O    4  
ATOM 9892   H H1   . GLY B 2 1   ? 3.859   -18.491 -11.110 1.00 10.00 ? 319 GLY B H1   4  
ATOM 9893   H H2   . GLY B 2 1   ? 5.112   -18.087 -10.051 1.00 10.00 ? 319 GLY B H2   4  
ATOM 9894   H H3   . GLY B 2 1   ? 5.095   -17.452 -11.621 1.00 10.00 ? 319 GLY B H3   4  
ATOM 9895   N N    . GLY B 2 2   ? 1.809   -17.873 -9.660  1.00 10.00 ? 320 GLY B N    4  
ATOM 9896   C CA   . GLY B 2 2   ? 0.764   -18.290 -8.751  1.00 10.00 ? 320 GLY B CA   4  
ATOM 9897   C C    . GLY B 2 2   ? -0.325  -17.244 -8.667  1.00 10.00 ? 320 GLY B C    4  
ATOM 9898   O O    . GLY B 2 2   ? -0.835  -16.788 -9.690  1.00 10.00 ? 320 GLY B O    4  
ATOM 9899   H H    . GLY B 2 2   ? 1.865   -18.276 -10.552 1.00 10.00 ? 320 GLY B H    4  
ATOM 9900   N N    . GLN B 2 3   ? -0.672  -16.843 -7.460  1.00 10.00 ? 321 GLN B N    4  
ATOM 9901   C CA   . GLN B 2 3   ? -1.699  -15.832 -7.277  1.00 10.00 ? 321 GLN B CA   4  
ATOM 9902   C C    . GLN B 2 3   ? -1.079  -14.446 -7.387  1.00 10.00 ? 321 GLN B C    4  
ATOM 9903   O O    . GLN B 2 3   ? -1.706  -13.497 -7.859  1.00 10.00 ? 321 GLN B O    4  
ATOM 9904   C CB   . GLN B 2 3   ? -2.374  -15.998 -5.917  1.00 10.00 ? 321 GLN B CB   4  
ATOM 9905   C CG   . GLN B 2 3   ? -3.692  -15.252 -5.777  1.00 10.00 ? 321 GLN B CG   4  
ATOM 9906   C CD   . GLN B 2 3   ? -4.699  -15.643 -6.841  1.00 10.00 ? 321 GLN B CD   4  
ATOM 9907   O OE1  . GLN B 2 3   ? -4.825  -14.978 -7.871  1.00 10.00 ? 321 GLN B OE1  4  
ATOM 9908   N NE2  . GLN B 2 3   ? -5.414  -16.733 -6.605  1.00 10.00 ? 321 GLN B NE2  4  
ATOM 9909   H H    . GLN B 2 3   ? -0.232  -17.235 -6.675  1.00 10.00 ? 321 GLN B H    4  
ATOM 9910   H HE21 . GLN B 2 3   ? -5.254  -17.222 -5.767  1.00 10.00 ? 321 GLN B HE21 4  
ATOM 9911   H HE22 . GLN B 2 3   ? -6.066  -17.014 -7.280  1.00 10.00 ? 321 GLN B HE22 4  
ATOM 9912   N N    . GLN B 2 4   ? 0.175   -14.349 -6.970  1.00 10.00 ? 322 GLN B N    4  
ATOM 9913   C CA   . GLN B 2 4   ? 0.896   -13.092 -7.003  1.00 10.00 ? 322 GLN B CA   4  
ATOM 9914   C C    . GLN B 2 4   ? 2.398   -13.344 -6.988  1.00 10.00 ? 322 GLN B C    4  
ATOM 9915   O O    . GLN B 2 4   ? 2.939   -13.843 -6.000  1.00 10.00 ? 322 GLN B O    4  
ATOM 9916   C CB   . GLN B 2 4   ? 0.494   -12.223 -5.806  1.00 10.00 ? 322 GLN B CB   4  
ATOM 9917   C CG   . GLN B 2 4   ? 0.986   -10.787 -5.880  1.00 10.00 ? 322 GLN B CG   4  
ATOM 9918   C CD   . GLN B 2 4   ? 0.515   -10.058 -7.125  1.00 10.00 ? 322 GLN B CD   4  
ATOM 9919   O OE1  . GLN B 2 4   ? 1.201   -9.172  -7.632  1.00 10.00 ? 322 GLN B OE1  4  
ATOM 9920   N NE2  . GLN B 2 4   ? -0.657  -10.421 -7.628  1.00 10.00 ? 322 GLN B NE2  4  
ATOM 9921   H H    . GLN B 2 4   ? 0.632   -15.150 -6.639  1.00 10.00 ? 322 GLN B H    4  
ATOM 9922   H HE21 . GLN B 2 4   ? -1.156  -11.135 -7.176  1.00 10.00 ? 322 GLN B HE21 4  
ATOM 9923   H HE22 . GLN B 2 4   ? -0.975  -9.966  -8.437  1.00 10.00 ? 322 GLN B HE22 4  
ATOM 9924   N N    . PRO B 2 5   ? 3.083   -13.029 -8.098  1.00 10.00 ? 323 PRO B N    4  
ATOM 9925   C CA   . PRO B 2 5   ? 4.532   -13.210 -8.213  1.00 10.00 ? 323 PRO B CA   4  
ATOM 9926   C C    . PRO B 2 5   ? 5.283   -12.320 -7.228  1.00 10.00 ? 323 PRO B C    4  
ATOM 9927   O O    . PRO B 2 5   ? 4.729   -11.347 -6.708  1.00 10.00 ? 323 PRO B O    4  
ATOM 9928   C CB   . PRO B 2 5   ? 4.846   -12.781 -9.654  1.00 10.00 ? 323 PRO B CB   4  
ATOM 9929   C CG   . PRO B 2 5   ? 3.536   -12.819 -10.362 1.00 10.00 ? 323 PRO B CG   4  
ATOM 9930   C CD   . PRO B 2 5   ? 2.499   -12.482 -9.331  1.00 10.00 ? 323 PRO B CD   4  
ATOM 9931   N N    . VAL B 2 6   ? 6.537   -12.667 -6.969  1.00 10.00 ? 324 VAL B N    4  
ATOM 9932   C CA   . VAL B 2 6   ? 7.377   -11.909 -6.052  1.00 10.00 ? 324 VAL B CA   4  
ATOM 9933   C C    . VAL B 2 6   ? 7.536   -10.467 -6.529  1.00 10.00 ? 324 VAL B C    4  
ATOM 9934   O O    . VAL B 2 6   ? 8.161   -10.211 -7.559  1.00 10.00 ? 324 VAL B O    4  
ATOM 9935   C CB   . VAL B 2 6   ? 8.776   -12.548 -5.915  1.00 10.00 ? 324 VAL B CB   4  
ATOM 9936   C CG1  . VAL B 2 6   ? 9.540   -11.931 -4.753  1.00 10.00 ? 324 VAL B CG1  4  
ATOM 9937   C CG2  . VAL B 2 6   ? 8.669   -14.058 -5.750  1.00 10.00 ? 324 VAL B CG2  4  
ATOM 9938   H H    . VAL B 2 6   ? 6.909   -13.458 -7.408  1.00 10.00 ? 324 VAL B H    4  
ATOM 9939   N N    . ASN B 2 7   ? 6.952   -9.530  -5.786  1.00 10.00 ? 325 ASN B N    4  
ATOM 9940   C CA   . ASN B 2 7   ? 7.038   -8.117  -6.134  1.00 10.00 ? 325 ASN B CA   4  
ATOM 9941   C C    . ASN B 2 7   ? 8.415   -7.570  -5.800  1.00 10.00 ? 325 ASN B C    4  
ATOM 9942   O O    . ASN B 2 7   ? 8.996   -7.907  -4.767  1.00 10.00 ? 325 ASN B O    4  
ATOM 9943   C CB   . ASN B 2 7   ? 5.956   -7.298  -5.422  1.00 10.00 ? 325 ASN B CB   4  
ATOM 9944   C CG   . ASN B 2 7   ? 4.766   -6.986  -6.312  1.00 10.00 ? 325 ASN B CG   4  
ATOM 9945   O OD1  . ASN B 2 7   ? 4.798   -6.049  -7.112  1.00 10.00 ? 325 ASN B OD1  4  
ATOM 9946   N ND2  . ASN B 2 7   ? 3.700   -7.757  -6.173  1.00 10.00 ? 325 ASN B ND2  4  
ATOM 9947   H H    . ASN B 2 7   ? 6.453   -9.795  -4.985  1.00 10.00 ? 325 ASN B H    4  
ATOM 9948   H HD21 . ASN B 2 7   ? 3.736   -8.480  -5.510  1.00 10.00 ? 325 ASN B HD21 4  
ATOM 9949   H HD22 . ASN B 2 7   ? 2.916   -7.575  -6.735  1.00 10.00 ? 325 ASN B HD22 4  
ATOM 9950   N N    . HIS B 2 8   ? 8.944   -6.742  -6.690  1.00 10.00 ? 326 HIS B N    4  
ATOM 9951   C CA   . HIS B 2 8   ? 10.259  -6.139  -6.502  1.00 10.00 ? 326 HIS B CA   4  
ATOM 9952   C C    . HIS B 2 8   ? 10.433  -4.961  -7.445  1.00 10.00 ? 326 HIS B C    4  
ATOM 9953   O O    . HIS B 2 8   ? 9.970   -5.019  -8.585  1.00 10.00 ? 326 HIS B O    4  
ATOM 9954   C CB   . HIS B 2 8   ? 11.386  -7.161  -6.721  1.00 10.00 ? 326 HIS B CB   4  
ATOM 9955   C CG   . HIS B 2 8   ? 11.310  -7.940  -8.007  1.00 10.00 ? 326 HIS B CG   4  
ATOM 9956   N ND1  . HIS B 2 8   ? 11.372  -7.357  -9.255  1.00 10.00 ? 326 HIS B ND1  4  
ATOM 9957   C CD2  . HIS B 2 8   ? 11.191  -9.271  -8.225  1.00 10.00 ? 326 HIS B CD2  4  
ATOM 9958   C CE1  . HIS B 2 8   ? 11.295  -8.296  -10.180 1.00 10.00 ? 326 HIS B CE1  4  
ATOM 9959   N NE2  . HIS B 2 8   ? 11.186  -9.465  -9.584  1.00 10.00 ? 326 HIS B NE2  4  
ATOM 9960   H H    . HIS B 2 8   ? 8.431   -6.520  -7.498  1.00 10.00 ? 326 HIS B H    4  
ATOM 9961   H HD1  . HIS B 2 8   ? 11.435  -6.394  -9.438  1.00 10.00 ? 326 HIS B HD1  4  
ATOM 9962   H HE2  . HIS B 2 8   ? 10.894  -10.295 -10.033 1.00 10.00 ? 326 HIS B HE2  4  
ATOM 9963   N N    . LEU B 2 9   ? 11.073  -3.890  -6.965  1.00 10.00 ? 327 LEU B N    4  
ATOM 9964   C CA   . LEU B 2 9   ? 11.313  -2.687  -7.768  1.00 10.00 ? 327 LEU B CA   4  
ATOM 9965   C C    . LEU B 2 9   ? 10.033  -1.873  -7.949  1.00 10.00 ? 327 LEU B C    4  
ATOM 9966   O O    . LEU B 2 9   ? 10.031  -0.834  -8.608  1.00 10.00 ? 327 LEU B O    4  
ATOM 9967   C CB   . LEU B 2 9   ? 11.952  -3.020  -9.126  1.00 10.00 ? 327 LEU B CB   4  
ATOM 9968   C CG   . LEU B 2 9   ? 13.405  -3.505  -9.096  1.00 10.00 ? 327 LEU B CG   4  
ATOM 9969   C CD1  . LEU B 2 9   ? 13.703  -4.358  -10.320 1.00 10.00 ? 327 LEU B CD1  4  
ATOM 9970   C CD2  . LEU B 2 9   ? 14.361  -2.324  -9.026  1.00 10.00 ? 327 LEU B CD2  4  
ATOM 9971   H H    . LEU B 2 9   ? 11.374  -3.886  -6.031  1.00 10.00 ? 327 LEU B H    4  
ATOM 9972   N N    . VAL B 2 10  ? 8.954   -2.347  -7.334  1.00 10.00 ? 328 VAL B N    4  
ATOM 9973   C CA   . VAL B 2 10  ? 7.652   -1.696  -7.412  1.00 10.00 ? 328 VAL B CA   4  
ATOM 9974   C C    . VAL B 2 10  ? 6.909   -1.872  -6.091  1.00 10.00 ? 328 VAL B C    4  
ATOM 9975   O O    . VAL B 2 10  ? 7.508   -2.280  -5.099  1.00 10.00 ? 328 VAL B O    4  
ATOM 9976   C CB   . VAL B 2 10  ? 6.783   -2.282  -8.552  1.00 10.00 ? 328 VAL B CB   4  
ATOM 9977   C CG1  . VAL B 2 10  ? 7.265   -1.802  -9.914  1.00 10.00 ? 328 VAL B CG1  4  
ATOM 9978   C CG2  . VAL B 2 10  ? 6.761   -3.803  -8.495  1.00 10.00 ? 328 VAL B CG2  4  
ATOM 9979   H H    . VAL B 2 10  ? 9.037   -3.159  -6.796  1.00 10.00 ? 328 VAL B H    4  
ATOM 9980   N N    . LYS B 2 11  ? 5.608   -1.578  -6.109  1.00 10.00 ? 329 LYS B N    4  
ATOM 9981   C CA   . LYS B 2 11  ? 4.734   -1.686  -4.935  1.00 10.00 ? 329 LYS B CA   4  
ATOM 9982   C C    . LYS B 2 11  ? 5.221   -0.863  -3.737  1.00 10.00 ? 329 LYS B C    4  
ATOM 9983   O O    . LYS B 2 11  ? 4.769   0.257   -3.537  1.00 10.00 ? 329 LYS B O    4  
ATOM 9984   C CB   . LYS B 2 11  ? 4.426   -3.147  -4.560  1.00 10.00 ? 329 LYS B CB   4  
ATOM 9985   C CG   . LYS B 2 11  ? 3.136   -3.321  -3.760  1.00 10.00 ? 329 LYS B CG   4  
ATOM 9986   C CD   . LYS B 2 11  ? 2.562   -4.727  -3.897  1.00 10.00 ? 329 LYS B CD   4  
ATOM 9987   C CE   . LYS B 2 11  ? 1.203   -4.844  -3.215  1.00 10.00 ? 329 LYS B CE   4  
ATOM 9988   N NZ   . LYS B 2 11  ? 0.605   -6.205  -3.354  1.00 10.00 ? 329 LYS B NZ   4  
ATOM 9989   H H    . LYS B 2 11  ? 5.213   -1.281  -6.951  1.00 10.00 ? 329 LYS B H    4  
ATOM 9990   H HZ1  . LYS B 2 11  ? 1.175   -6.903  -2.833  1.00 10.00 ? 329 LYS B HZ1  4  
ATOM 9991   H HZ2  . LYS B 2 11  ? 0.573   -6.483  -4.355  1.00 10.00 ? 329 LYS B HZ2  4  
ATOM 9992   H HZ3  . LYS B 2 11  ? -0.365  -6.214  -2.975  1.00 10.00 ? 329 LYS B HZ3  4  
ATOM 9993   N N    . GLU B 2 12  ? 6.157   -1.421  -2.978  1.00 10.00 ? 330 GLU B N    4  
ATOM 9994   C CA   . GLU B 2 12  ? 6.716   -0.785  -1.785  1.00 10.00 ? 330 GLU B CA   4  
ATOM 9995   C C    . GLU B 2 12  ? 7.100   0.691   -1.976  1.00 10.00 ? 330 GLU B C    4  
ATOM 9996   O O    . GLU B 2 12  ? 6.567   1.563   -1.290  1.00 10.00 ? 330 GLU B O    4  
ATOM 9997   C CB   . GLU B 2 12  ? 7.921   -1.589  -1.281  1.00 10.00 ? 330 GLU B CB   4  
ATOM 9998   C CG   . GLU B 2 12  ? 7.569   -2.779  -0.391  1.00 10.00 ? 330 GLU B CG   4  
ATOM 9999   C CD   . GLU B 2 12  ? 6.550   -3.725  -1.004  1.00 10.00 ? 330 GLU B CD   4  
ATOM 10000  O OE1  . GLU B 2 12  ? 6.681   -4.062  -2.199  1.00 10.00 ? 330 GLU B OE1  4  
ATOM 10001  O OE2  . GLU B 2 12  ? 5.610   -4.136  -0.286  1.00 10.00 ? 330 GLU B OE2  4  
ATOM 10002  H H    . GLU B 2 12  ? 6.489   -2.316  -3.225  1.00 10.00 ? 330 GLU B H    4  
ATOM 10003  N N    . ILE B 2 13  ? 8.009   0.970   -2.907  1.00 10.00 ? 331 ILE B N    4  
ATOM 10004  C CA   . ILE B 2 13  ? 8.472   2.343   -3.144  1.00 10.00 ? 331 ILE B CA   4  
ATOM 10005  C C    . ILE B 2 13  ? 7.369   3.247   -3.686  1.00 10.00 ? 331 ILE B C    4  
ATOM 10006  O O    . ILE B 2 13  ? 7.133   4.334   -3.155  1.00 10.00 ? 331 ILE B O    4  
ATOM 10007  C CB   . ILE B 2 13  ? 9.701   2.394   -4.078  1.00 10.00 ? 331 ILE B CB   4  
ATOM 10008  C CG1  . ILE B 2 13  ? 10.827  1.521   -3.510  1.00 10.00 ? 331 ILE B CG1  4  
ATOM 10009  C CG2  . ILE B 2 13  ? 10.181  3.831   -4.258  1.00 10.00 ? 331 ILE B CG2  4  
ATOM 10010  C CD1  . ILE B 2 13  ? 12.061  1.451   -4.384  1.00 10.00 ? 331 ILE B CD1  4  
ATOM 10011  H H    . ILE B 2 13  ? 8.375   0.241   -3.446  1.00 10.00 ? 331 ILE B H    4  
ATOM 10012  N N    . ASP B 2 14  ? 6.695   2.788   -4.731  1.00 10.00 ? 332 ASP B N    4  
ATOM 10013  C CA   . ASP B 2 14  ? 5.618   3.553   -5.355  1.00 10.00 ? 332 ASP B CA   4  
ATOM 10014  C C    . ASP B 2 14  ? 4.524   3.895   -4.338  1.00 10.00 ? 332 ASP B C    4  
ATOM 10015  O O    . ASP B 2 14  ? 3.879   4.942   -4.420  1.00 10.00 ? 332 ASP B O    4  
ATOM 10016  C CB   . ASP B 2 14  ? 5.029   2.758   -6.533  1.00 10.00 ? 332 ASP B CB   4  
ATOM 10017  C CG   . ASP B 2 14  ? 4.247   3.609   -7.516  1.00 10.00 ? 332 ASP B CG   4  
ATOM 10018  O OD1  . ASP B 2 14  ? 4.568   4.800   -7.671  1.00 10.00 ? 332 ASP B OD1  4  
ATOM 10019  O OD2  . ASP B 2 14  ? 3.308   3.080   -8.146  1.00 10.00 ? 332 ASP B OD2  4  
ATOM 10020  H H    . ASP B 2 14  ? 6.925   1.910   -5.095  1.00 10.00 ? 332 ASP B H    4  
ATOM 10021  N N    . MET B 2 15  ? 4.331   3.001   -3.377  1.00 10.00 ? 333 MET B N    4  
ATOM 10022  C CA   . MET B 2 15  ? 3.316   3.177   -2.350  1.00 10.00 ? 333 MET B CA   4  
ATOM 10023  C C    . MET B 2 15  ? 3.771   4.139   -1.250  1.00 10.00 ? 333 MET B C    4  
ATOM 10024  O O    . MET B 2 15  ? 3.108   5.137   -0.982  1.00 10.00 ? 333 MET B O    4  
ATOM 10025  C CB   . MET B 2 15  ? 2.917   1.824   -1.757  1.00 10.00 ? 333 MET B CB   4  
ATOM 10026  C CG   . MET B 2 15  ? 1.507   1.771   -1.194  1.00 10.00 ? 333 MET B CG   4  
ATOM 10027  S SD   . MET B 2 15  ? 1.017   0.098   -0.725  1.00 10.00 ? 333 MET B SD   4  
ATOM 10028  C CE   . MET B 2 15  ? 2.214   -0.256  0.560   1.00 10.00 ? 333 MET B CE   4  
ATOM 10029  H H    . MET B 2 15  ? 4.934   2.227   -3.324  1.00 10.00 ? 333 MET B H    4  
ATOM 10030  N N    . LEU B 2 16  ? 4.929   3.847   -0.654  1.00 10.00 ? 334 LEU B N    4  
ATOM 10031  C CA   . LEU B 2 16  ? 5.474   4.643   0.455   1.00 10.00 ? 334 LEU B CA   4  
ATOM 10032  C C    . LEU B 2 16  ? 5.561   6.135   0.159   1.00 10.00 ? 334 LEU B C    4  
ATOM 10033  O O    . LEU B 2 16  ? 5.165   6.965   0.984   1.00 10.00 ? 334 LEU B O    4  
ATOM 10034  C CB   . LEU B 2 16  ? 6.857   4.126   0.858   1.00 10.00 ? 334 LEU B CB   4  
ATOM 10035  C CG   . LEU B 2 16  ? 6.892   2.817   1.645   1.00 10.00 ? 334 LEU B CG   4  
ATOM 10036  C CD1  . LEU B 2 16  ? 8.327   2.375   1.879   1.00 10.00 ? 334 LEU B CD1  4  
ATOM 10037  C CD2  . LEU B 2 16  ? 6.151   2.967   2.963   1.00 10.00 ? 334 LEU B CD2  4  
ATOM 10038  H H    . LEU B 2 16  ? 5.438   3.067   -0.970  1.00 10.00 ? 334 LEU B H    4  
ATOM 10039  N N    . LEU B 2 17  ? 6.083   6.475   -1.008  1.00 10.00 ? 335 LEU B N    4  
ATOM 10040  C CA   . LEU B 2 17  ? 6.230   7.869   -1.396  1.00 10.00 ? 335 LEU B CA   4  
ATOM 10041  C C    . LEU B 2 17  ? 4.871   8.551   -1.550  1.00 10.00 ? 335 LEU B C    4  
ATOM 10042  O O    . LEU B 2 17  ? 4.675   9.678   -1.093  1.00 10.00 ? 335 LEU B O    4  
ATOM 10043  C CB   . LEU B 2 17  ? 7.035   7.971   -2.693  1.00 10.00 ? 335 LEU B CB   4  
ATOM 10044  C CG   . LEU B 2 17  ? 8.458   7.406   -2.638  1.00 10.00 ? 335 LEU B CG   4  
ATOM 10045  C CD1  . LEU B 2 17  ? 9.041   7.300   -4.038  1.00 10.00 ? 335 LEU B CD1  4  
ATOM 10046  C CD2  . LEU B 2 17  ? 9.347   8.260   -1.743  1.00 10.00 ? 335 LEU B CD2  4  
ATOM 10047  H H    . LEU B 2 17  ? 6.376   5.771   -1.626  1.00 10.00 ? 335 LEU B H    4  
ATOM 10048  N N    . LYS B 2 18  ? 3.930   7.855   -2.175  1.00 10.00 ? 336 LYS B N    4  
ATOM 10049  C CA   . LYS B 2 18  ? 2.598   8.404   -2.388  1.00 10.00 ? 336 LYS B CA   4  
ATOM 10050  C C    . LYS B 2 18  ? 1.779   8.481   -1.101  1.00 10.00 ? 336 LYS B C    4  
ATOM 10051  O O    . LYS B 2 18  ? 1.084   9.465   -0.874  1.00 10.00 ? 336 LYS B O    4  
ATOM 10052  C CB   . LYS B 2 18  ? 1.854   7.661   -3.498  1.00 10.00 ? 336 LYS B CB   4  
ATOM 10053  C CG   . LYS B 2 18  ? 2.232   8.137   -4.891  1.00 10.00 ? 336 LYS B CG   4  
ATOM 10054  C CD   . LYS B 2 18  ? 1.870   7.118   -5.958  1.00 10.00 ? 336 LYS B CD   4  
ATOM 10055  C CE   . LYS B 2 18  ? 2.572   7.441   -7.266  1.00 10.00 ? 336 LYS B CE   4  
ATOM 10056  N NZ   . LYS B 2 18  ? 2.499   6.322   -8.239  1.00 10.00 ? 336 LYS B NZ   4  
ATOM 10057  H H    . LYS B 2 18  ? 4.131   6.948   -2.489  1.00 10.00 ? 336 LYS B H    4  
ATOM 10058  H HZ1  . LYS B 2 18  ? 1.511   6.127   -8.496  1.00 10.00 ? 336 LYS B HZ1  4  
ATOM 10059  H HZ2  . LYS B 2 18  ? 2.923   5.457   -7.828  1.00 10.00 ? 336 LYS B HZ2  4  
ATOM 10060  H HZ3  . LYS B 2 18  ? 3.026   6.567   -9.098  1.00 10.00 ? 336 LYS B HZ3  4  
ATOM 10061  N N    . GLU B 2 19  ? 1.866   7.451   -0.262  1.00 10.00 ? 337 GLU B N    4  
ATOM 10062  C CA   . GLU B 2 19  ? 1.132   7.424   1.006   1.00 10.00 ? 337 GLU B CA   4  
ATOM 10063  C C    . GLU B 2 19  ? 1.488   8.630   1.862   1.00 10.00 ? 337 GLU B C    4  
ATOM 10064  O O    . GLU B 2 19  ? 0.619   9.312   2.396   1.00 10.00 ? 337 GLU B O    4  
ATOM 10065  C CB   . GLU B 2 19  ? 1.437   6.144   1.784   1.00 10.00 ? 337 GLU B CB   4  
ATOM 10066  C CG   . GLU B 2 19  ? 0.596   4.952   1.376   1.00 10.00 ? 337 GLU B CG   4  
ATOM 10067  C CD   . GLU B 2 19  ? 0.748   3.790   2.328   1.00 10.00 ? 337 GLU B CD   4  
ATOM 10068  O OE1  . GLU B 2 19  ? 0.126   3.819   3.412   1.00 10.00 ? 337 GLU B OE1  4  
ATOM 10069  O OE2  . GLU B 2 19  ? 1.477   2.832   1.997   1.00 10.00 ? 337 GLU B OE2  4  
ATOM 10070  H H    . GLU B 2 19  ? 2.433   6.682   -0.501  1.00 10.00 ? 337 GLU B H    4  
ATOM 10071  N N    . TYR B 2 20  ? 2.776   8.868   1.985   1.00 10.00 ? 338 TYR B N    4  
ATOM 10072  C CA   . TYR B 2 20  ? 3.267   9.997   2.762   1.00 10.00 ? 338 TYR B CA   4  
ATOM 10073  C C    . TYR B 2 20  ? 2.697   11.314  2.223   1.00 10.00 ? 338 TYR B C    4  
ATOM 10074  O O    . TYR B 2 20  ? 2.321   12.198  2.991   1.00 10.00 ? 338 TYR B O    4  
ATOM 10075  C CB   . TYR B 2 20  ? 4.793   10.024  2.819   1.00 10.00 ? 338 TYR B CB   4  
ATOM 10076  C CG   . TYR B 2 20  ? 5.338   10.617  4.100   1.00 10.00 ? 338 TYR B CG   4  
ATOM 10077  C CD1  . TYR B 2 20  ? 5.443   11.991  4.261   1.00 10.00 ? 338 TYR B CD1  4  
ATOM 10078  C CD2  . TYR B 2 20  ? 5.754   9.803   5.148   1.00 10.00 ? 338 TYR B CD2  4  
ATOM 10079  C CE1  . TYR B 2 20  ? 5.950   12.537  5.424   1.00 10.00 ? 338 TYR B CE1  4  
ATOM 10080  C CE2  . TYR B 2 20  ? 6.260   10.342  6.315   1.00 10.00 ? 338 TYR B CE2  4  
ATOM 10081  C CZ   . TYR B 2 20  ? 6.357   11.710  6.447   1.00 10.00 ? 338 TYR B CZ   4  
ATOM 10082  O OH   . TYR B 2 20  ? 6.869   12.252  7.604   1.00 10.00 ? 338 TYR B OH   4  
ATOM 10083  H H    . TYR B 2 20  ? 3.388   8.229   1.562   1.00 10.00 ? 338 TYR B H    4  
ATOM 10084  H HH   . TYR B 2 20  ? 7.739   11.870  7.776   1.00 10.00 ? 338 TYR B HH   4  
ATOM 10085  N N    . LEU B 2 21  ? 2.630   11.431  0.901   1.00 10.00 ? 339 LEU B N    4  
ATOM 10086  C CA   . LEU B 2 21  ? 2.096   12.631  0.257   1.00 10.00 ? 339 LEU B CA   4  
ATOM 10087  C C    . LEU B 2 21  ? 0.562   12.696  0.335   1.00 10.00 ? 339 LEU B C    4  
ATOM 10088  O O    . LEU B 2 21  ? -0.031  13.771  0.237   1.00 10.00 ? 339 LEU B O    4  
ATOM 10089  C CB   . LEU B 2 21  ? 2.560   12.695  -1.203  1.00 10.00 ? 339 LEU B CB   4  
ATOM 10090  C CG   . LEU B 2 21  ? 2.486   14.065  -1.885  1.00 10.00 ? 339 LEU B CG   4  
ATOM 10091  C CD1  . LEU B 2 21  ? 3.234   15.112  -1.074  1.00 10.00 ? 339 LEU B CD1  4  
ATOM 10092  C CD2  . LEU B 2 21  ? 3.039   13.985  -3.300  1.00 10.00 ? 339 LEU B CD2  4  
ATOM 10093  H H    . LEU B 2 21  ? 2.958   10.694  0.339   1.00 10.00 ? 339 LEU B H    4  
ATOM 10094  N N    . LEU B 2 22  ? -0.063  11.538  0.511   1.00 10.00 ? 340 LEU B N    4  
ATOM 10095  C CA   . LEU B 2 22  ? -1.525  11.454  0.567   1.00 10.00 ? 340 LEU B CA   4  
ATOM 10096  C C    . LEU B 2 22  ? -2.084  11.451  1.991   1.00 10.00 ? 340 LEU B C    4  
ATOM 10097  O O    . LEU B 2 22  ? -2.802  12.366  2.395   1.00 10.00 ? 340 LEU B O    4  
ATOM 10098  C CB   . LEU B 2 22  ? -2.061  10.268  -0.248  1.00 10.00 ? 340 LEU B CB   4  
ATOM 10099  C CG   . LEU B 2 22  ? -1.933  10.385  -1.774  1.00 10.00 ? 340 LEU B CG   4  
ATOM 10100  C CD1  . LEU B 2 22  ? -2.716  9.289   -2.478  1.00 10.00 ? 340 LEU B CD1  4  
ATOM 10101  C CD2  . LEU B 2 22  ? -2.385  11.754  -2.255  1.00 10.00 ? 340 LEU B CD2  4  
ATOM 10102  H H    . LEU B 2 22  ? 0.487   10.739  0.666   1.00 10.00 ? 340 LEU B H    4  
ATOM 10103  N N    . SER B 2 23  ? -1.737  10.418  2.745   1.00 10.00 ? 341 SER B N    4  
ATOM 10104  C CA   . SER B 2 23  ? -2.218  10.241  4.107   1.00 10.00 ? 341 SER B CA   4  
ATOM 10105  C C    . SER B 2 23  ? -1.401  11.031  5.124   1.00 10.00 ? 341 SER B C    4  
ATOM 10106  O O    . SER B 2 23  ? -1.893  11.352  6.206   1.00 10.00 ? 341 SER B O    4  
ATOM 10107  C CB   . SER B 2 23  ? -2.179  8.755   4.452   1.00 10.00 ? 341 SER B CB   4  
ATOM 10108  O OG   . SER B 2 23  ? -2.545  7.987   3.318   1.00 10.00 ? 341 SER B OG   4  
ATOM 10109  H H    . SER B 2 23  ? -1.126  9.745   2.374   1.00 10.00 ? 341 SER B H    4  
ATOM 10110  H HG   . SER B 2 23  ? -3.364  8.338   2.956   1.00 10.00 ? 341 SER B HG   4  
ATOM 10111  N N    . GLY B 2 24  ? -0.154  11.340  4.770   1.00 10.00 ? 342 GLY B N    4  
ATOM 10112  C CA   . GLY B 2 24  ? 0.711   12.078  5.670   1.00 10.00 ? 342 GLY B CA   4  
ATOM 10113  C C    . GLY B 2 24  ? 1.016   11.310  6.940   1.00 10.00 ? 342 GLY B C    4  
ATOM 10114  O O    . GLY B 2 24  ? 0.999   11.878  8.033   1.00 10.00 ? 342 GLY B O    4  
ATOM 10115  H H    . GLY B 2 24  ? 0.172   11.074  3.888   1.00 10.00 ? 342 GLY B H    4  
ATOM 10116  N N    . ASP B 2 25  ? 1.305   10.019  6.797   1.00 10.00 ? 343 ASP B N    4  
ATOM 10117  C CA   . ASP B 2 25  ? 1.599   9.174   7.954   1.00 10.00 ? 343 ASP B CA   4  
ATOM 10118  C C    . ASP B 2 25  ? 3.041   8.663   7.952   1.00 10.00 ? 343 ASP B C    4  
ATOM 10119  O O    . ASP B 2 25  ? 3.496   8.046   6.989   1.00 10.00 ? 343 ASP B O    4  
ATOM 10120  C CB   . ASP B 2 25  ? 0.618   8.003   8.049   1.00 10.00 ? 343 ASP B CB   4  
ATOM 10121  C CG   . ASP B 2 25  ? 0.776   7.227   9.346   1.00 10.00 ? 343 ASP B CG   4  
ATOM 10122  O OD1  . ASP B 2 25  ? 1.674   6.367   9.425   1.00 10.00 ? 343 ASP B OD1  4  
ATOM 10123  O OD2  . ASP B 2 25  ? 0.006   7.480   10.298  1.00 10.00 ? 343 ASP B OD2  4  
ATOM 10124  H H    . ASP B 2 25  ? 1.330   9.629   5.899   1.00 10.00 ? 343 ASP B H    4  
ATOM 10125  N N    . ILE B 2 26  ? 3.745   8.946   9.040   1.00 10.00 ? 344 ILE B N    4  
ATOM 10126  C CA   . ILE B 2 26  ? 5.137   8.532   9.202   1.00 10.00 ? 344 ILE B CA   4  
ATOM 10127  C C    . ILE B 2 26  ? 5.241   7.032   9.521   1.00 10.00 ? 344 ILE B C    4  
ATOM 10128  O O    . ILE B 2 26  ? 6.010   6.303   8.896   1.00 10.00 ? 344 ILE B O    4  
ATOM 10129  C CB   . ILE B 2 26  ? 5.857   9.338   10.299  1.00 10.00 ? 344 ILE B CB   4  
ATOM 10130  C CG1  . ILE B 2 26  ? 5.580   10.833  10.134  1.00 10.00 ? 344 ILE B CG1  4  
ATOM 10131  C CG2  . ILE B 2 26  ? 7.355   9.078   10.244  1.00 10.00 ? 344 ILE B CG2  4  
ATOM 10132  C CD1  . ILE B 2 26  ? 6.188   11.692  11.220  1.00 10.00 ? 344 ILE B CD1  4  
ATOM 10133  H H    . ILE B 2 26  ? 3.278   9.362   9.793   1.00 10.00 ? 344 ILE B H    4  
ATOM 10134  N N    . SER B 2 27  ? 4.448   6.599   10.499  1.00 10.00 ? 345 SER B N    4  
ATOM 10135  C CA   . SER B 2 27  ? 4.441   5.217   10.981  1.00 10.00 ? 345 SER B CA   4  
ATOM 10136  C C    . SER B 2 27  ? 4.373   4.168   9.872   1.00 10.00 ? 345 SER B C    4  
ATOM 10137  O O    . SER B 2 27  ? 5.134   3.193   9.884   1.00 10.00 ? 345 SER B O    4  
ATOM 10138  C CB   . SER B 2 27  ? 3.278   5.034   11.956  1.00 10.00 ? 345 SER B CB   4  
ATOM 10139  O OG   . SER B 2 27  ? 2.435   6.176   11.938  1.00 10.00 ? 345 SER B OG   4  
ATOM 10140  H H    . SER B 2 27  ? 3.836   7.236   10.921  1.00 10.00 ? 345 SER B H    4  
ATOM 10141  H HG   . SER B 2 27  ? 2.029   6.259   11.054  1.00 10.00 ? 345 SER B HG   4  
ATOM 10142  N N    . GLU B 2 28  ? 3.464   4.360   8.926   1.00 10.00 ? 346 GLU B N    4  
ATOM 10143  C CA   . GLU B 2 28  ? 3.304   3.414   7.832   1.00 10.00 ? 346 GLU B CA   4  
ATOM 10144  C C    . GLU B 2 28  ? 4.528   3.374   6.931   1.00 10.00 ? 346 GLU B C    4  
ATOM 10145  O O    . GLU B 2 28  ? 4.894   2.318   6.415   1.00 10.00 ? 346 GLU B O    4  
ATOM 10146  C CB   . GLU B 2 28  ? 2.041   3.691   7.020   1.00 10.00 ? 346 GLU B CB   4  
ATOM 10147  C CG   . GLU B 2 28  ? 0.915   2.710   7.299   1.00 10.00 ? 346 GLU B CG   4  
ATOM 10148  C CD   . GLU B 2 28  ? 1.380   1.265   7.287   1.00 10.00 ? 346 GLU B CD   4  
ATOM 10149  O OE1  . GLU B 2 28  ? 1.891   0.795   8.319   1.00 10.00 ? 346 GLU B OE1  4  
ATOM 10150  O OE2  . GLU B 2 28  ? 1.237   0.595   6.241   1.00 10.00 ? 346 GLU B OE2  4  
ATOM 10151  H H    . GLU B 2 28  ? 2.903   5.173   8.965   1.00 10.00 ? 346 GLU B H    4  
ATOM 10152  N N    . ALA B 2 29  ? 5.175   4.519   6.770   1.00 10.00 ? 347 ALA B N    4  
ATOM 10153  C CA   . ALA B 2 29  ? 6.357   4.609   5.930   1.00 10.00 ? 347 ALA B CA   4  
ATOM 10154  C C    . ALA B 2 29  ? 7.517   3.861   6.566   1.00 10.00 ? 347 ALA B C    4  
ATOM 10155  O O    . ALA B 2 29  ? 8.189   3.062   5.912   1.00 10.00 ? 347 ALA B O    4  
ATOM 10156  C CB   . ALA B 2 29  ? 6.730   6.061   5.678   1.00 10.00 ? 347 ALA B CB   4  
ATOM 10157  H H    . ALA B 2 29  ? 4.855   5.319   7.243   1.00 10.00 ? 347 ALA B H    4  
ATOM 10158  N N    . GLU B 2 30  ? 7.724   4.109   7.853   1.00 10.00 ? 348 GLU B N    4  
ATOM 10159  C CA   . GLU B 2 30  ? 8.803   3.472   8.595   1.00 10.00 ? 348 GLU B CA   4  
ATOM 10160  C C    . GLU B 2 30  ? 8.647   1.959   8.638   1.00 10.00 ? 348 GLU B C    4  
ATOM 10161  O O    . GLU B 2 30  ? 9.606   1.223   8.397   1.00 10.00 ? 348 GLU B O    4  
ATOM 10162  C CB   . GLU B 2 30  ? 8.880   4.019   10.021  1.00 10.00 ? 348 GLU B CB   4  
ATOM 10163  C CG   . GLU B 2 30  ? 9.198   5.500   10.109  1.00 10.00 ? 348 GLU B CG   4  
ATOM 10164  C CD   . GLU B 2 30  ? 9.443   5.951   11.535  1.00 10.00 ? 348 GLU B CD   4  
ATOM 10165  O OE1  . GLU B 2 30  ? 8.569   5.713   12.395  1.00 10.00 ? 348 GLU B OE1  4  
ATOM 10166  O OE2  . GLU B 2 30  ? 10.512  6.537   11.805  1.00 10.00 ? 348 GLU B OE2  4  
ATOM 10167  H H    . GLU B 2 30  ? 7.137   4.747   8.315   1.00 10.00 ? 348 GLU B H    4  
ATOM 10168  N N    . HIS B 2 31  ? 7.436   1.498   8.931   1.00 10.00 ? 349 HIS B N    4  
ATOM 10169  C CA   . HIS B 2 31  ? 7.182   0.068   9.026   1.00 10.00 ? 349 HIS B CA   4  
ATOM 10170  C C    . HIS B 2 31  ? 7.418   -0.662  7.709   1.00 10.00 ? 349 HIS B C    4  
ATOM 10171  O O    . HIS B 2 31  ? 8.151   -1.647  7.672   1.00 10.00 ? 349 HIS B O    4  
ATOM 10172  C CB   . HIS B 2 31  ? 5.793   -0.245  9.574   1.00 10.00 ? 349 HIS B CB   4  
ATOM 10173  C CG   . HIS B 2 31  ? 5.769   -1.528  10.342  1.00 10.00 ? 349 HIS B CG   4  
ATOM 10174  N ND1  . HIS B 2 31  ? 5.731   -2.767  9.742   1.00 10.00 ? 349 HIS B ND1  4  
ATOM 10175  C CD2  . HIS B 2 31  ? 5.831   -1.760  11.673  1.00 10.00 ? 349 HIS B CD2  4  
ATOM 10176  C CE1  . HIS B 2 31  ? 5.771   -3.702  10.672  1.00 10.00 ? 349 HIS B CE1  4  
ATOM 10177  N NE2  . HIS B 2 31  ? 5.835   -3.120  11.855  1.00 10.00 ? 349 HIS B NE2  4  
ATOM 10178  H H    . HIS B 2 31  ? 6.702   2.132   9.088   1.00 10.00 ? 349 HIS B H    4  
ATOM 10179  H HD1  . HIS B 2 31  ? 5.689   -2.942  8.763   1.00 10.00 ? 349 HIS B HD1  4  
ATOM 10180  H HE2  . HIS B 2 31  ? 6.127   -3.569  12.679  1.00 10.00 ? 349 HIS B HE2  4  
ATOM 10181  N N    . CYS B 2 32  ? 6.811   -0.174  6.634   1.00 10.00 ? 350 CYS B N    4  
ATOM 10182  C CA   . CYS B 2 32  ? 6.963   -0.808  5.326   1.00 10.00 ? 350 CYS B CA   4  
ATOM 10183  C C    . CYS B 2 32  ? 8.417   -0.793  4.852   1.00 10.00 ? 350 CYS B C    4  
ATOM 10184  O O    . CYS B 2 32  ? 8.860   -1.710  4.161   1.00 10.00 ? 350 CYS B O    4  
ATOM 10185  C CB   . CYS B 2 32  ? 6.041   -0.173  4.287   1.00 10.00 ? 350 CYS B CB   4  
ATOM 10186  S SG   . CYS B 2 32  ? 4.300   -0.121  4.766   1.00 10.00 ? 350 CYS B SG   4  
ATOM 10187  H H    . CYS B 2 32  ? 6.228   0.611   6.719   1.00 10.00 ? 350 CYS B H    4  
ATOM 10188  H HG   . CYS B 2 32  ? 4.117   0.964   5.509   1.00 10.00 ? 350 CYS B HG   4  
ATOM 10189  N N    . LEU B 2 33  ? 9.161   0.246   5.220   1.00 10.00 ? 351 LEU B N    4  
ATOM 10190  C CA   . LEU B 2 33  ? 10.564  0.340   4.835   1.00 10.00 ? 351 LEU B CA   4  
ATOM 10191  C C    . LEU B 2 33  ? 11.355  -0.744  5.551   1.00 10.00 ? 351 LEU B C    4  
ATOM 10192  O O    . LEU B 2 33  ? 12.275  -1.344  4.988   1.00 10.00 ? 351 LEU B O    4  
ATOM 10193  C CB   . LEU B 2 33  ? 11.132  1.721   5.158   1.00 10.00 ? 351 LEU B CB   4  
ATOM 10194  C CG   . LEU B 2 33  ? 11.494  2.598   3.957   1.00 10.00 ? 351 LEU B CG   4  
ATOM 10195  C CD1  . LEU B 2 33  ? 10.958  4.009   4.143   1.00 10.00 ? 351 LEU B CD1  4  
ATOM 10196  C CD2  . LEU B 2 33  ? 12.999  2.624   3.746   1.00 10.00 ? 351 LEU B CD2  4  
ATOM 10197  H H    . LEU B 2 33  ? 8.758   0.959   5.760   1.00 10.00 ? 351 LEU B H    4  
ATOM 10198  N N    . LYS B 2 34  ? 11.004  -0.956  6.812   1.00 10.00 ? 352 LYS B N    4  
ATOM 10199  C CA   . LYS B 2 34  ? 11.616  -1.984  7.637   1.00 10.00 ? 352 LYS B CA   4  
ATOM 10200  C C    . LYS B 2 34  ? 11.136  -3.394  7.271   1.00 10.00 ? 352 LYS B C    4  
ATOM 10201  O O    . LYS B 2 34  ? 11.786  -4.379  7.616   1.00 10.00 ? 352 LYS B O    4  
ATOM 10202  C CB   . LYS B 2 34  ? 11.549  -1.676  9.142   1.00 10.00 ? 352 LYS B CB   4  
ATOM 10203  C CG   . LYS B 2 34  ? 12.746  -0.857  9.621   1.00 10.00 ? 352 LYS B CG   4  
ATOM 10204  C CD   . LYS B 2 34  ? 12.742  -0.643  11.125  1.00 10.00 ? 352 LYS B CD   4  
ATOM 10205  C CE   . LYS B 2 34  ? 13.988  0.116   11.577  1.00 10.00 ? 352 LYS B CE   4  
ATOM 10206  N NZ   . LYS B 2 34  ? 15.194  -0.757  11.636  1.00 10.00 ? 352 LYS B NZ   4  
ATOM 10207  H H    . LYS B 2 34  ? 10.300  -0.392  7.209   1.00 10.00 ? 352 LYS B H    4  
ATOM 10208  H HZ1  . LYS B 2 34  ? 15.468  -1.059  10.681  1.00 10.00 ? 352 LYS B HZ1  4  
ATOM 10209  H HZ2  . LYS B 2 34  ? 14.998  -1.602  12.210  1.00 10.00 ? 352 LYS B HZ2  4  
ATOM 10210  H HZ3  . LYS B 2 34  ? 15.992  -0.242  12.062  1.00 10.00 ? 352 LYS B HZ3  4  
ATOM 10211  N N    . GLU B 2 35  ? 9.966   -3.473  6.622   1.00 10.00 ? 353 GLU B N    4  
ATOM 10212  C CA   . GLU B 2 35  ? 9.355   -4.748  6.218   1.00 10.00 ? 353 GLU B CA   4  
ATOM 10213  C C    . GLU B 2 35  ? 10.325  -5.649  5.440   1.00 10.00 ? 353 GLU B C    4  
ATOM 10214  O O    . GLU B 2 35  ? 10.542  -6.801  5.827   1.00 10.00 ? 353 GLU B O    4  
ATOM 10215  C CB   . GLU B 2 35  ? 8.138   -4.461  5.326   1.00 10.00 ? 353 GLU B CB   4  
ATOM 10216  C CG   . GLU B 2 35  ? 6.872   -5.200  5.709   1.00 10.00 ? 353 GLU B CG   4  
ATOM 10217  C CD   . GLU B 2 35  ? 6.386   -4.837  7.095   1.00 10.00 ? 353 GLU B CD   4  
ATOM 10218  O OE1  . GLU B 2 35  ? 5.782   -3.757  7.260   1.00 10.00 ? 353 GLU B OE1  4  
ATOM 10219  O OE2  . GLU B 2 35  ? 6.604   -5.634  8.028   1.00 10.00 ? 353 GLU B OE2  4  
ATOM 10220  H H    . GLU B 2 35  ? 9.483   -2.639  6.423   1.00 10.00 ? 353 GLU B H    4  
ATOM 10221  N N    . LEU B 2 36  ? 10.834  -5.148  4.310   1.00 10.00 ? 354 LEU B N    4  
ATOM 10222  C CA   . LEU B 2 36  ? 11.795  -5.894  3.474   1.00 10.00 ? 354 LEU B CA   4  
ATOM 10223  C C    . LEU B 2 36  ? 13.043  -6.402  4.217   1.00 10.00 ? 354 LEU B C    4  
ATOM 10224  O O    . LEU B 2 36  ? 13.104  -6.422  5.443   1.00 10.00 ? 354 LEU B O    4  
ATOM 10225  C CB   . LEU B 2 36  ? 12.201  -5.073  2.238   1.00 10.00 ? 354 LEU B CB   4  
ATOM 10226  C CG   . LEU B 2 36  ? 11.375  -5.290  0.962   1.00 10.00 ? 354 LEU B CG   4  
ATOM 10227  C CD1  . LEU B 2 36  ? 11.663  -6.652  0.346   1.00 10.00 ? 354 LEU B CD1  4  
ATOM 10228  C CD2  . LEU B 2 36  ? 9.889   -5.123  1.238   1.00 10.00 ? 354 LEU B CD2  4  
ATOM 10229  H H    . LEU B 2 36  ? 10.437  -4.333  3.943   1.00 10.00 ? 354 LEU B H    4  
ATOM 10230  N N    . GLU B 2 37  ? 14.059  -6.783  3.447   1.00 10.00 ? 355 GLU B N    4  
ATOM 10231  C CA   . GLU B 2 37  ? 15.284  -7.336  4.012   1.00 10.00 ? 355 GLU B CA   4  
ATOM 10232  C C    . GLU B 2 37  ? 16.516  -6.824  3.273   1.00 10.00 ? 355 GLU B C    4  
ATOM 10233  O O    . GLU B 2 37  ? 17.624  -7.329  3.460   1.00 10.00 ? 355 GLU B O    4  
ATOM 10234  C CB   . GLU B 2 37  ? 15.230  -8.871  3.968   1.00 10.00 ? 355 GLU B CB   4  
ATOM 10235  C CG   . GLU B 2 37  ? 14.789  -9.448  2.627   1.00 10.00 ? 355 GLU B CG   4  
ATOM 10236  C CD   . GLU B 2 37  ? 14.387  -10.907 2.716   1.00 10.00 ? 355 GLU B CD   4  
ATOM 10237  O OE1  . GLU B 2 37  ? 15.283  -11.772 2.820   1.00 10.00 ? 355 GLU B OE1  4  
ATOM 10238  O OE2  . GLU B 2 37  ? 13.173  -11.199 2.672   1.00 10.00 ? 355 GLU B OE2  4  
ATOM 10239  H H    . GLU B 2 37  ? 14.008  -6.633  2.482   1.00 10.00 ? 355 GLU B H    4  
ATOM 10240  N N    . VAL B 2 38  ? 16.321  -5.820  2.428   1.00 10.00 ? 356 VAL B N    4  
ATOM 10241  C CA   . VAL B 2 38  ? 17.419  -5.262  1.647   1.00 10.00 ? 356 VAL B CA   4  
ATOM 10242  C C    . VAL B 2 38  ? 17.642  -3.771  1.925   1.00 10.00 ? 356 VAL B C    4  
ATOM 10243  O O    . VAL B 2 38  ? 17.047  -2.910  1.272   1.00 10.00 ? 356 VAL B O    4  
ATOM 10244  C CB   . VAL B 2 38  ? 17.218  -5.490  0.134   1.00 10.00 ? 356 VAL B CB   4  
ATOM 10245  C CG1  . VAL B 2 38  ? 17.746  -6.859  -0.268  1.00 10.00 ? 356 VAL B CG1  4  
ATOM 10246  C CG2  . VAL B 2 38  ? 15.745  -5.356  -0.243  1.00 10.00 ? 356 VAL B CG2  4  
ATOM 10247  H H    . VAL B 2 38  ? 15.425  -5.440  2.334   1.00 10.00 ? 356 VAL B H    4  
ATOM 10248  N N    . PRO B 2 39  ? 18.485  -3.447  2.920   1.00 10.00 ? 357 PRO B N    4  
ATOM 10249  C CA   . PRO B 2 39  ? 18.800  -2.057  3.268   1.00 10.00 ? 357 PRO B CA   4  
ATOM 10250  C C    . PRO B 2 39  ? 19.472  -1.311  2.116   1.00 10.00 ? 357 PRO B C    4  
ATOM 10251  O O    . PRO B 2 39  ? 19.254  -0.113  1.935   1.00 10.00 ? 357 PRO B O    4  
ATOM 10252  C CB   . PRO B 2 39  ? 19.767  -2.185  4.451   1.00 10.00 ? 357 PRO B CB   4  
ATOM 10253  C CG   . PRO B 2 39  ? 19.524  -3.549  4.994   1.00 10.00 ? 357 PRO B CG   4  
ATOM 10254  C CD   . PRO B 2 39  ? 19.164  -4.400  3.813   1.00 10.00 ? 357 PRO B CD   4  
ATOM 10255  N N    . HIS B 2 40  ? 20.273  -2.029  1.334   1.00 10.00 ? 358 HIS B N    4  
ATOM 10256  C CA   . HIS B 2 40  ? 20.978  -1.442  0.194   1.00 10.00 ? 358 HIS B CA   4  
ATOM 10257  C C    . HIS B 2 40  ? 20.010  -1.013  -0.905  1.00 10.00 ? 358 HIS B C    4  
ATOM 10258  O O    . HIS B 2 40  ? 20.223  -0.002  -1.576  1.00 10.00 ? 358 HIS B O    4  
ATOM 10259  C CB   . HIS B 2 40  ? 22.008  -2.423  -0.374  1.00 10.00 ? 358 HIS B CB   4  
ATOM 10260  C CG   . HIS B 2 40  ? 23.423  -2.100  -0.009  1.00 10.00 ? 358 HIS B CG   4  
ATOM 10261  N ND1  . HIS B 2 40  ? 24.188  -2.884  0.828   1.00 10.00 ? 358 HIS B ND1  4  
ATOM 10262  C CD2  . HIS B 2 40  ? 24.216  -1.066  -0.377  1.00 10.00 ? 358 HIS B CD2  4  
ATOM 10263  C CE1  . HIS B 2 40  ? 25.383  -2.346  0.960   1.00 10.00 ? 358 HIS B CE1  4  
ATOM 10264  N NE2  . HIS B 2 40  ? 25.428  -1.243  0.239   1.00 10.00 ? 358 HIS B NE2  4  
ATOM 10265  H H    . HIS B 2 40  ? 20.400  -2.983  1.534   1.00 10.00 ? 358 HIS B H    4  
ATOM 10266  H HD1  . HIS B 2 40  ? 23.894  -3.712  1.270   1.00 10.00 ? 358 HIS B HD1  4  
ATOM 10267  H HE2  . HIS B 2 40  ? 26.248  -0.743  0.029   1.00 10.00 ? 358 HIS B HE2  4  
ATOM 10268  N N    . PHE B 2 41  ? 18.933  -1.774  -1.068  1.00 10.00 ? 359 PHE B N    4  
ATOM 10269  C CA   . PHE B 2 41  ? 17.929  -1.489  -2.090  1.00 10.00 ? 359 PHE B CA   4  
ATOM 10270  C C    . PHE B 2 41  ? 17.158  -0.207  -1.774  1.00 10.00 ? 359 PHE B C    4  
ATOM 10271  O O    . PHE B 2 41  ? 16.496  0.361   -2.643  1.00 10.00 ? 359 PHE B O    4  
ATOM 10272  C CB   . PHE B 2 41  ? 16.958  -2.663  -2.212  1.00 10.00 ? 359 PHE B CB   4  
ATOM 10273  C CG   . PHE B 2 41  ? 16.686  -3.100  -3.625  1.00 10.00 ? 359 PHE B CG   4  
ATOM 10274  C CD1  . PHE B 2 41  ? 16.047  -2.254  -4.516  1.00 10.00 ? 359 PHE B CD1  4  
ATOM 10275  C CD2  . PHE B 2 41  ? 17.062  -4.362  -4.059  1.00 10.00 ? 359 PHE B CD2  4  
ATOM 10276  C CE1  . PHE B 2 41  ? 15.788  -2.656  -5.811  1.00 10.00 ? 359 PHE B CE1  4  
ATOM 10277  C CE2  . PHE B 2 41  ? 16.807  -4.771  -5.355  1.00 10.00 ? 359 PHE B CE2  4  
ATOM 10278  C CZ   . PHE B 2 41  ? 16.168  -3.915  -6.231  1.00 10.00 ? 359 PHE B CZ   4  
ATOM 10279  H H    . PHE B 2 41  ? 18.810  -2.553  -0.488  1.00 10.00 ? 359 PHE B H    4  
ATOM 10280  N N    . HIS B 2 42  ? 17.266  0.257   -0.531  1.00 10.00 ? 360 HIS B N    4  
ATOM 10281  C CA   . HIS B 2 42  ? 16.574  1.471   -0.100  1.00 10.00 ? 360 HIS B CA   4  
ATOM 10282  C C    . HIS B 2 42  ? 17.098  2.701   -0.833  1.00 10.00 ? 360 HIS B C    4  
ATOM 10283  O O    . HIS B 2 42  ? 16.436  3.737   -0.876  1.00 10.00 ? 360 HIS B O    4  
ATOM 10284  C CB   . HIS B 2 42  ? 16.697  1.671   1.414   1.00 10.00 ? 360 HIS B CB   4  
ATOM 10285  C CG   . HIS B 2 42  ? 15.919  0.691   2.241   1.00 10.00 ? 360 HIS B CG   4  
ATOM 10286  N ND1  . HIS B 2 42  ? 16.295  0.322   3.515   1.00 10.00 ? 360 HIS B ND1  4  
ATOM 10287  C CD2  . HIS B 2 42  ? 14.766  0.025   1.984   1.00 10.00 ? 360 HIS B CD2  4  
ATOM 10288  C CE1  . HIS B 2 42  ? 15.407  -0.527  4.004   1.00 10.00 ? 360 HIS B CE1  4  
ATOM 10289  N NE2  . HIS B 2 42  ? 14.468  -0.725  3.098   1.00 10.00 ? 360 HIS B NE2  4  
ATOM 10290  H H    . HIS B 2 42  ? 17.833  -0.224  0.107   1.00 10.00 ? 360 HIS B H    4  
ATOM 10291  H HD1  . HIS B 2 42  ? 17.091  0.642   3.993   1.00 10.00 ? 360 HIS B HD1  4  
ATOM 10292  H HE2  . HIS B 2 42  ? 13.589  -1.126  3.289   1.00 10.00 ? 360 HIS B HE2  4  
ATOM 10293  N N    . HIS B 2 43  ? 18.276  2.566   -1.432  1.00 10.00 ? 361 HIS B N    4  
ATOM 10294  C CA   . HIS B 2 43  ? 18.907  3.653   -2.178  1.00 10.00 ? 361 HIS B CA   4  
ATOM 10295  C C    . HIS B 2 43  ? 18.039  4.122   -3.352  1.00 10.00 ? 361 HIS B C    4  
ATOM 10296  O O    . HIS B 2 43  ? 18.144  5.265   -3.804  1.00 10.00 ? 361 HIS B O    4  
ATOM 10297  C CB   . HIS B 2 43  ? 20.359  3.322   -2.582  1.00 10.00 ? 361 HIS B CB   4  
ATOM 10298  C CG   . HIS B 2 43  ? 20.568  2.725   -3.944  1.00 10.00 ? 361 HIS B CG   4  
ATOM 10299  N ND1  . HIS B 2 43  ? 21.074  3.449   -5.004  1.00 10.00 ? 361 HIS B ND1  4  
ATOM 10300  C CD2  . HIS B 2 43  ? 20.389  1.463   -4.408  1.00 10.00 ? 361 HIS B CD2  4  
ATOM 10301  C CE1  . HIS B 2 43  ? 21.197  2.661   -6.057  1.00 10.00 ? 361 HIS B CE1  4  
ATOM 10302  N NE2  . HIS B 2 43  ? 20.791  1.452   -5.723  1.00 10.00 ? 361 HIS B NE2  4  
ATOM 10303  H H    . HIS B 2 43  ? 18.736  1.700   -1.381  1.00 10.00 ? 361 HIS B H    4  
ATOM 10304  H HD1  . HIS B 2 43  ? 21.305  4.400   -4.986  1.00 10.00 ? 361 HIS B HD1  4  
ATOM 10305  H HE2  . HIS B 2 43  ? 20.665  0.706   -6.354  1.00 10.00 ? 361 HIS B HE2  4  
ATOM 10306  N N    . GLU B 2 44  ? 17.160  3.231   -3.807  1.00 10.00 ? 362 GLU B N    4  
ATOM 10307  C CA   . GLU B 2 44  ? 16.284  3.526   -4.935  1.00 10.00 ? 362 GLU B CA   4  
ATOM 10308  C C    . GLU B 2 44  ? 15.143  4.454   -4.511  1.00 10.00 ? 362 GLU B C    4  
ATOM 10309  O O    . GLU B 2 44  ? 14.703  5.302   -5.279  1.00 10.00 ? 362 GLU B O    4  
ATOM 10310  C CB   . GLU B 2 44  ? 15.731  2.242   -5.558  1.00 10.00 ? 362 GLU B CB   4  
ATOM 10311  C CG   . GLU B 2 44  ? 16.711  1.534   -6.478  1.00 10.00 ? 362 GLU B CG   4  
ATOM 10312  C CD   . GLU B 2 44  ? 17.323  2.475   -7.501  1.00 10.00 ? 362 GLU B CD   4  
ATOM 10313  O OE1  . GLU B 2 44  ? 16.603  2.910   -8.424  1.00 10.00 ? 362 GLU B OE1  4  
ATOM 10314  O OE2  . GLU B 2 44  ? 18.520  2.792   -7.377  1.00 10.00 ? 362 GLU B OE2  4  
ATOM 10315  H H    . GLU B 2 44  ? 17.005  2.426   -3.272  1.00 10.00 ? 362 GLU B H    4  
ATOM 10316  N N    . LEU B 2 45  ? 14.684  4.290   -3.269  1.00 10.00 ? 363 LEU B N    4  
ATOM 10317  C CA   . LEU B 2 45  ? 13.588  5.103   -2.726  1.00 10.00 ? 363 LEU B CA   4  
ATOM 10318  C C    . LEU B 2 45  ? 14.048  6.540   -2.503  1.00 10.00 ? 363 LEU B C    4  
ATOM 10319  O O    . LEU B 2 45  ? 13.269  7.487   -2.613  1.00 10.00 ? 363 LEU B O    4  
ATOM 10320  C CB   . LEU B 2 45  ? 13.089  4.496   -1.406  1.00 10.00 ? 363 LEU B CB   4  
ATOM 10321  C CG   . LEU B 2 45  ? 11.868  5.156   -0.754  1.00 10.00 ? 363 LEU B CG   4  
ATOM 10322  C CD1  . LEU B 2 45  ? 10.904  4.094   -0.245  1.00 10.00 ? 363 LEU B CD1  4  
ATOM 10323  C CD2  . LEU B 2 45  ? 12.293  6.071   0.385   1.00 10.00 ? 363 LEU B CD2  4  
ATOM 10324  H H    . LEU B 2 45  ? 15.098  3.612   -2.698  1.00 10.00 ? 363 LEU B H    4  
ATOM 10325  N N    . VAL B 2 46  ? 15.328  6.670   -2.209  1.00 10.00 ? 364 VAL B N    4  
ATOM 10326  C CA   . VAL B 2 46  ? 15.934  7.972   -1.960  1.00 10.00 ? 364 VAL B CA   4  
ATOM 10327  C C    . VAL B 2 46  ? 15.932  8.799   -3.242  1.00 10.00 ? 364 VAL B C    4  
ATOM 10328  O O    . VAL B 2 46  ? 15.491  9.949   -3.253  1.00 10.00 ? 364 VAL B O    4  
ATOM 10329  C CB   . VAL B 2 46  ? 17.371  7.853   -1.418  1.00 10.00 ? 364 VAL B CB   4  
ATOM 10330  C CG1  . VAL B 2 46  ? 17.953  9.233   -1.156  1.00 10.00 ? 364 VAL B CG1  4  
ATOM 10331  C CG2  . VAL B 2 46  ? 17.395  7.017   -0.147  1.00 10.00 ? 364 VAL B CG2  4  
ATOM 10332  H H    . VAL B 2 46  ? 15.857  5.847   -2.208  1.00 10.00 ? 364 VAL B H    4  
ATOM 10333  N N    . TYR B 2 47  ? 16.423  8.189   -4.318  1.00 10.00 ? 365 TYR B N    4  
ATOM 10334  C CA   . TYR B 2 47  ? 16.490  8.831   -5.625  1.00 10.00 ? 365 TYR B CA   4  
ATOM 10335  C C    . TYR B 2 47  ? 15.150  9.450   -6.036  1.00 10.00 ? 365 TYR B C    4  
ATOM 10336  O O    . TYR B 2 47  ? 15.066  10.659  -6.256  1.00 10.00 ? 365 TYR B O    4  
ATOM 10337  C CB   . TYR B 2 47  ? 16.966  7.823   -6.681  1.00 10.00 ? 365 TYR B CB   4  
ATOM 10338  C CG   . TYR B 2 47  ? 16.861  8.306   -8.110  1.00 10.00 ? 365 TYR B CG   4  
ATOM 10339  C CD1  . TYR B 2 47  ? 17.559  9.427   -8.543  1.00 10.00 ? 365 TYR B CD1  4  
ATOM 10340  C CD2  . TYR B 2 47  ? 16.062  7.638   -9.029  1.00 10.00 ? 365 TYR B CD2  4  
ATOM 10341  C CE1  . TYR B 2 47  ? 17.462  9.868   -9.849  1.00 10.00 ? 365 TYR B CE1  4  
ATOM 10342  C CE2  . TYR B 2 47  ? 15.959  8.071   -10.336 1.00 10.00 ? 365 TYR B CE2  4  
ATOM 10343  C CZ   . TYR B 2 47  ? 16.661  9.186   -10.741 1.00 10.00 ? 365 TYR B CZ   4  
ATOM 10344  O OH   . TYR B 2 47  ? 16.561  9.622   -12.043 1.00 10.00 ? 365 TYR B OH   4  
ATOM 10345  H H    . TYR B 2 47  ? 16.788  7.286   -4.212  1.00 10.00 ? 365 TYR B H    4  
ATOM 10346  H HH   . TYR B 2 47  ? 17.371  10.087  -12.288 1.00 10.00 ? 365 TYR B HH   4  
ATOM 10347  N N    . GLU B 2 48  ? 14.109  8.623   -6.124  1.00 10.00 ? 366 GLU B N    4  
ATOM 10348  C CA   . GLU B 2 48  ? 12.775  9.092   -6.511  1.00 10.00 ? 366 GLU B CA   4  
ATOM 10349  C C    . GLU B 2 48  ? 12.269  10.185  -5.570  1.00 10.00 ? 366 GLU B C    4  
ATOM 10350  O O    . GLU B 2 48  ? 11.704  11.187  -6.015  1.00 10.00 ? 366 GLU B O    4  
ATOM 10351  C CB   . GLU B 2 48  ? 11.784  7.926   -6.526  1.00 10.00 ? 366 GLU B CB   4  
ATOM 10352  C CG   . GLU B 2 48  ? 11.369  7.469   -7.915  1.00 10.00 ? 366 GLU B CG   4  
ATOM 10353  C CD   . GLU B 2 48  ? 12.463  6.717   -8.646  1.00 10.00 ? 366 GLU B CD   4  
ATOM 10354  O OE1  . GLU B 2 48  ? 13.297  6.071   -7.982  1.00 10.00 ? 366 GLU B OE1  4  
ATOM 10355  O OE2  . GLU B 2 48  ? 12.478  6.752   -9.894  1.00 10.00 ? 366 GLU B OE2  4  
ATOM 10356  H H    . GLU B 2 48  ? 14.236  7.670   -5.929  1.00 10.00 ? 366 GLU B H    4  
ATOM 10357  N N    . ALA B 2 49  ? 12.452  9.953   -4.274  1.00 10.00 ? 367 ALA B N    4  
ATOM 10358  C CA   . ALA B 2 49  ? 12.033  10.916  -3.255  1.00 10.00 ? 367 ALA B CA   4  
ATOM 10359  C C    . ALA B 2 49  ? 12.590  12.312  -3.526  1.00 10.00 ? 367 ALA B C    4  
ATOM 10360  O O    . ALA B 2 49  ? 11.853  13.292  -3.469  1.00 10.00 ? 367 ALA B O    4  
ATOM 10361  C CB   . ALA B 2 49  ? 12.431  10.446  -1.864  1.00 10.00 ? 367 ALA B CB   4  
ATOM 10362  H H    . ALA B 2 49  ? 12.724  9.046   -4.023  1.00 10.00 ? 367 ALA B H    4  
ATOM 10363  N N    . ILE B 2 50  ? 13.865  12.391  -3.887  1.00 10.00 ? 368 ILE B N    4  
ATOM 10364  C CA   . ILE B 2 50  ? 14.488  13.684  -4.170  1.00 10.00 ? 368 ILE B CA   4  
ATOM 10365  C C    . ILE B 2 50  ? 13.931  14.238  -5.479  1.00 10.00 ? 368 ILE B C    4  
ATOM 10366  O O    . ILE B 2 50  ? 13.553  15.406  -5.564  1.00 10.00 ? 368 ILE B O    4  
ATOM 10367  C CB   . ILE B 2 50  ? 16.024  13.590  -4.261  1.00 10.00 ? 368 ILE B CB   4  
ATOM 10368  C CG1  . ILE B 2 50  ? 16.591  12.993  -2.972  1.00 10.00 ? 368 ILE B CG1  4  
ATOM 10369  C CG2  . ILE B 2 50  ? 16.626  14.967  -4.517  1.00 10.00 ? 368 ILE B CG2  4  
ATOM 10370  C CD1  . ILE B 2 50  ? 18.029  12.539  -3.089  1.00 10.00 ? 368 ILE B CD1  4  
ATOM 10371  H H    . ILE B 2 50  ? 14.366  11.558  -4.021  1.00 10.00 ? 368 ILE B H    4  
ATOM 10372  N N    . VAL B 2 51  ? 13.924  13.386  -6.501  1.00 10.00 ? 369 VAL B N    4  
ATOM 10373  C CA   . VAL B 2 51  ? 13.386  13.754  -7.813  1.00 10.00 ? 369 VAL B CA   4  
ATOM 10374  C C    . VAL B 2 51  ? 12.020  14.430  -7.678  1.00 10.00 ? 369 VAL B C    4  
ATOM 10375  O O    . VAL B 2 51  ? 11.836  15.551  -8.144  1.00 10.00 ? 369 VAL B O    4  
ATOM 10376  C CB   . VAL B 2 51  ? 13.282  12.539  -8.763  1.00 10.00 ? 369 VAL B CB   4  
ATOM 10377  C CG1  . VAL B 2 51  ? 12.632  12.934  -10.079 1.00 10.00 ? 369 VAL B CG1  4  
ATOM 10378  C CG2  . VAL B 2 51  ? 14.658  11.943  -9.014  1.00 10.00 ? 369 VAL B CG2  4  
ATOM 10379  H H    . VAL B 2 51  ? 14.385  12.526  -6.386  1.00 10.00 ? 369 VAL B H    4  
ATOM 10380  N N    . MET B 2 52  ? 11.074  13.752  -7.036  1.00 10.00 ? 370 MET B N    4  
ATOM 10381  C CA   . MET B 2 52  ? 9.734   14.307  -6.832  1.00 10.00 ? 370 MET B CA   4  
ATOM 10382  C C    . MET B 2 52  ? 9.796   15.606  -6.024  1.00 10.00 ? 370 MET B C    4  
ATOM 10383  O O    . MET B 2 52  ? 9.063   16.546  -6.296  1.00 10.00 ? 370 MET B O    4  
ATOM 10384  C CB   . MET B 2 52  ? 8.827   13.285  -6.142  1.00 10.00 ? 370 MET B CB   4  
ATOM 10385  C CG   . MET B 2 52  ? 8.573   12.035  -6.970  1.00 10.00 ? 370 MET B CG   4  
ATOM 10386  S SD   . MET B 2 52  ? 7.420   10.889  -6.189  1.00 10.00 ? 370 MET B SD   4  
ATOM 10387  C CE   . MET B 2 52  ? 7.387   9.574   -7.404  1.00 10.00 ? 370 MET B CE   4  
ATOM 10388  H H    . MET B 2 52  ? 11.263  12.833  -6.735  1.00 10.00 ? 370 MET B H    4  
ATOM 10389  N N    . VAL B 2 53  ? 10.677  15.613  -5.028  1.00 10.00 ? 371 VAL B N    4  
ATOM 10390  C CA   . VAL B 2 53  ? 10.877  16.805  -4.179  1.00 10.00 ? 371 VAL B CA   4  
ATOM 10391  C C    . VAL B 2 53  ? 10.987  18.061  -5.055  1.00 10.00 ? 371 VAL B C    4  
ATOM 10392  O O    . VAL B 2 53  ? 10.319  19.064  -4.800  1.00 10.00 ? 371 VAL B O    4  
ATOM 10393  C CB   . VAL B 2 53  ? 12.118  16.702  -3.252  1.00 10.00 ? 371 VAL B CB   4  
ATOM 10394  C CG1  . VAL B 2 53  ? 12.600  18.083  -2.818  1.00 10.00 ? 371 VAL B CG1  4  
ATOM 10395  C CG2  . VAL B 2 53  ? 11.788  15.876  -2.028  1.00 10.00 ? 371 VAL B CG2  4  
ATOM 10396  H H    . VAL B 2 53  ? 11.066  14.735  -4.834  1.00 10.00 ? 371 VAL B H    4  
ATOM 10397  N N    . LEU B 2 54  ? 11.808  17.991  -6.097  1.00 10.00 ? 372 LEU B N    4  
ATOM 10398  C CA   . LEU B 2 54  ? 11.972  19.117  -7.016  1.00 10.00 ? 372 LEU B CA   4  
ATOM 10399  C C    . LEU B 2 54  ? 10.907  19.113  -8.111  1.00 10.00 ? 372 LEU B C    4  
ATOM 10400  O O    . LEU B 2 54  ? 10.369  20.154  -8.472  1.00 10.00 ? 372 LEU B O    4  
ATOM 10401  C CB   . LEU B 2 54  ? 13.354  19.069  -7.671  1.00 10.00 ? 372 LEU B CB   4  
ATOM 10402  C CG   . LEU B 2 54  ? 14.518  19.654  -6.875  1.00 10.00 ? 372 LEU B CG   4  
ATOM 10403  C CD1  . LEU B 2 54  ? 15.063  18.638  -5.884  1.00 10.00 ? 372 LEU B CD1  4  
ATOM 10404  C CD2  . LEU B 2 54  ? 15.611  20.132  -7.815  1.00 10.00 ? 372 LEU B CD2  4  
ATOM 10405  H H    . LEU B 2 54  ? 12.363  17.193  -6.218  1.00 10.00 ? 372 LEU B H    4  
ATOM 10406  N N    . GLU B 2 55  ? 10.593  17.935  -8.621  1.00 10.00 ? 373 GLU B N    4  
ATOM 10407  C CA   . GLU B 2 55  ? 9.628   17.779  -9.702  1.00 10.00 ? 373 GLU B CA   4  
ATOM 10408  C C    . GLU B 2 55  ? 8.153   17.970  -9.323  1.00 10.00 ? 373 GLU B C    4  
ATOM 10409  O O    . GLU B 2 55  ? 7.280   17.518  -10.062 1.00 10.00 ? 373 GLU B O    4  
ATOM 10410  C CB   . GLU B 2 55  ? 9.874   16.520  -10.542 1.00 10.00 ? 373 GLU B CB   4  
ATOM 10411  C CG   . GLU B 2 55  ? 11.161  16.579  -11.357 1.00 10.00 ? 373 GLU B CG   4  
ATOM 10412  C CD   . GLU B 2 55  ? 11.107  15.759  -12.632 1.00 10.00 ? 373 GLU B CD   4  
ATOM 10413  O OE1  . GLU B 2 55  ? 11.217  14.519  -12.552 1.00 10.00 ? 373 GLU B OE1  4  
ATOM 10414  O OE2  . GLU B 2 55  ? 10.976  16.352  -13.726 1.00 10.00 ? 373 GLU B OE2  4  
ATOM 10415  H H    . GLU B 2 55  ? 10.999  17.110  -8.254  1.00 10.00 ? 373 GLU B H    4  
ATOM 10416  N N    . SER B 2 56  ? 7.852   18.597  -8.172  1.00 10.00 ? 374 SER B N    4  
ATOM 10417  C CA   . SER B 2 56  ? 6.456   18.795  -7.759  1.00 10.00 ? 374 SER B CA   4  
ATOM 10418  C C    . SER B 2 56  ? 6.103   20.292  -7.738  1.00 10.00 ? 374 SER B C    4  
ATOM 10419  O O    . SER B 2 56  ? 6.879   21.122  -8.210  1.00 10.00 ? 374 SER B O    4  
ATOM 10420  C CB   . SER B 2 56  ? 6.229   18.202  -6.368  1.00 10.00 ? 374 SER B CB   4  
ATOM 10421  O OG   . SER B 2 56  ? 6.520   16.818  -6.351  1.00 10.00 ? 374 SER B OG   4  
ATOM 10422  H H    . SER B 2 56  ? 8.548   19.046  -7.642  1.00 10.00 ? 374 SER B H    4  
ATOM 10423  H HG   . SER B 2 56  ? 7.483   16.698  -6.351  1.00 10.00 ? 374 SER B HG   4  
ATOM 10424  N N    . THR B 2 57  ? 4.948   20.628  -7.157  1.00 10.00 ? 375 THR B N    4  
ATOM 10425  C CA   . THR B 2 57  ? 4.489   22.007  -7.062  1.00 10.00 ? 375 THR B CA   4  
ATOM 10426  C C    . THR B 2 57  ? 3.956   22.248  -5.644  1.00 10.00 ? 375 THR B C    4  
ATOM 10427  O O    . THR B 2 57  ? 3.198   21.431  -5.113  1.00 10.00 ? 375 THR B O    4  
ATOM 10428  C CB   . THR B 2 57  ? 3.355   22.285  -8.074  1.00 10.00 ? 375 THR B CB   4  
ATOM 10429  O OG1  . THR B 2 57  ? 2.934   21.055  -8.682  1.00 10.00 ? 375 THR B OG1  4  
ATOM 10430  C CG2  . THR B 2 57  ? 3.816   23.247  -9.158  1.00 10.00 ? 375 THR B CG2  4  
ATOM 10431  H H    . THR B 2 57  ? 4.389   19.947  -6.734  1.00 10.00 ? 375 THR B H    4  
ATOM 10432  H HG1  . THR B 2 57  ? 3.551   20.820  -9.386  1.00 10.00 ? 375 THR B HG1  4  
ATOM 10433  N N    . GLY B 2 58  ? 4.364   23.354  -5.029  1.00 10.00 ? 376 GLY B N    4  
ATOM 10434  C CA   . GLY B 2 58  ? 3.924   23.668  -3.676  1.00 10.00 ? 376 GLY B CA   4  
ATOM 10435  C C    . GLY B 2 58  ? 5.019   23.454  -2.639  1.00 10.00 ? 376 GLY B C    4  
ATOM 10436  O O    . GLY B 2 58  ? 5.969   22.710  -2.881  1.00 10.00 ? 376 GLY B O    4  
ATOM 10437  H H    . GLY B 2 58  ? 4.962   23.968  -5.497  1.00 10.00 ? 376 GLY B H    4  
ATOM 10438  N N    . GLU B 2 59  ? 4.884   24.100  -1.482  1.00 10.00 ? 377 GLU B N    4  
ATOM 10439  C CA   . GLU B 2 59  ? 5.871   23.978  -0.408  1.00 10.00 ? 377 GLU B CA   4  
ATOM 10440  C C    . GLU B 2 59  ? 5.619   22.711  0.396   1.00 10.00 ? 377 GLU B C    4  
ATOM 10441  O O    . GLU B 2 59  ? 6.520   22.165  1.034   1.00 10.00 ? 377 GLU B O    4  
ATOM 10442  C CB   . GLU B 2 59  ? 5.827   25.197  0.510   1.00 10.00 ? 377 GLU B CB   4  
ATOM 10443  C CG   . GLU B 2 59  ? 4.580   25.277  1.370   1.00 10.00 ? 377 GLU B CG   4  
ATOM 10444  C CD   . GLU B 2 59  ? 4.847   25.932  2.702   1.00 10.00 ? 377 GLU B CD   4  
ATOM 10445  O OE1  . GLU B 2 59  ? 5.437   25.279  3.584   1.00 10.00 ? 377 GLU B OE1  4  
ATOM 10446  O OE2  . GLU B 2 59  ? 4.472   27.110  2.872   1.00 10.00 ? 377 GLU B OE2  4  
ATOM 10447  H H    . GLU B 2 59  ? 4.101   24.672  -1.347  1.00 10.00 ? 377 GLU B H    4  
ATOM 10448  N N    . SER B 2 60  ? 4.373   22.253  0.352   1.00 10.00 ? 378 SER B N    4  
ATOM 10449  C CA   . SER B 2 60  ? 3.950   21.039  1.026   1.00 10.00 ? 378 SER B CA   4  
ATOM 10450  C C    . SER B 2 60  ? 4.733   19.860  0.457   1.00 10.00 ? 378 SER B C    4  
ATOM 10451  O O    . SER B 2 60  ? 4.900   18.823  1.088   1.00 10.00 ? 378 SER B O    4  
ATOM 10452  C CB   . SER B 2 60  ? 2.442   20.853  0.824   1.00 10.00 ? 378 SER B CB   4  
ATOM 10453  O OG   . SER B 2 60  ? 1.765   22.090  1.015   1.00 10.00 ? 378 SER B OG   4  
ATOM 10454  H H    . SER B 2 60  ? 3.705   22.759  -0.156  1.00 10.00 ? 378 SER B H    4  
ATOM 10455  H HG   . SER B 2 60  ? 1.149   22.236  0.290   1.00 10.00 ? 378 SER B HG   4  
ATOM 10456  N N    . ALA B 2 61  ? 5.235   20.070  -0.742  1.00 10.00 ? 379 ALA B N    4  
ATOM 10457  C CA   . ALA B 2 61  ? 5.986   19.061  -1.439  1.00 10.00 ? 379 ALA B CA   4  
ATOM 10458  C C    . ALA B 2 61  ? 7.404   18.954  -0.877  1.00 10.00 ? 379 ALA B C    4  
ATOM 10459  O O    . ALA B 2 61  ? 8.013   17.893  -0.930  1.00 10.00 ? 379 ALA B O    4  
ATOM 10460  C CB   . ALA B 2 61  ? 6.022   19.371  -2.927  1.00 10.00 ? 379 ALA B CB   4  
ATOM 10461  H H    . ALA B 2 61  ? 5.207   20.985  -1.084  1.00 10.00 ? 379 ALA B H    4  
ATOM 10462  N N    . PHE B 2 62  ? 7.931   20.056  -0.327  1.00 10.00 ? 380 PHE B N    4  
ATOM 10463  C CA   . PHE B 2 62  ? 9.308   20.067  0.185   1.00 10.00 ? 380 PHE B CA   4  
ATOM 10464  C C    . PHE B 2 62  ? 9.498   19.383  1.551   1.00 10.00 ? 380 PHE B C    4  
ATOM 10465  O O    . PHE B 2 62  ? 10.024  18.280  1.620   1.00 10.00 ? 380 PHE B O    4  
ATOM 10466  C CB   . PHE B 2 62  ? 9.805   21.517  0.266   1.00 10.00 ? 380 PHE B CB   4  
ATOM 10467  C CG   . PHE B 2 62  ? 11.293  21.668  0.414   1.00 10.00 ? 380 PHE B CG   4  
ATOM 10468  C CD1  . PHE B 2 62  ? 12.118  21.574  -0.692  1.00 10.00 ? 380 PHE B CD1  4  
ATOM 10469  C CD2  . PHE B 2 62  ? 11.865  21.917  1.654   1.00 10.00 ? 380 PHE B CD2  4  
ATOM 10470  C CE1  . PHE B 2 62  ? 13.485  21.722  -0.569  1.00 10.00 ? 380 PHE B CE1  4  
ATOM 10471  C CE2  . PHE B 2 62  ? 13.233  22.063  1.785   1.00 10.00 ? 380 PHE B CE2  4  
ATOM 10472  C CZ   . PHE B 2 62  ? 14.044  21.967  0.671   1.00 10.00 ? 380 PHE B CZ   4  
ATOM 10473  H H    . PHE B 2 62  ? 7.407   20.884  -0.258  1.00 10.00 ? 380 PHE B H    4  
ATOM 10474  N N    . LYS B 2 63  ? 9.077   20.052  2.632   1.00 10.00 ? 381 LYS B N    4  
ATOM 10475  C CA   . LYS B 2 63  ? 9.210   19.520  4.003   1.00 10.00 ? 381 LYS B CA   4  
ATOM 10476  C C    . LYS B 2 63  ? 8.633   18.120  4.162   1.00 10.00 ? 381 LYS B C    4  
ATOM 10477  O O    . LYS B 2 63  ? 9.295   17.209  4.663   1.00 10.00 ? 381 LYS B O    4  
ATOM 10478  C CB   . LYS B 2 63  ? 8.516   20.474  4.985   1.00 10.00 ? 381 LYS B CB   4  
ATOM 10479  C CG   . LYS B 2 63  ? 7.311   21.189  4.387   1.00 10.00 ? 381 LYS B CG   4  
ATOM 10480  C CD   . LYS B 2 63  ? 6.376   21.732  5.453   1.00 10.00 ? 381 LYS B CD   4  
ATOM 10481  C CE   . LYS B 2 63  ? 5.110   22.293  4.822   1.00 10.00 ? 381 LYS B CE   4  
ATOM 10482  N NZ   . LYS B 2 63  ? 4.096   22.682  5.837   1.00 10.00 ? 381 LYS B NZ   4  
ATOM 10483  H H    . LYS B 2 63  ? 8.784   20.981  2.538   1.00 10.00 ? 381 LYS B H    4  
ATOM 10484  H HZ1  . LYS B 2 63  ? 4.372   23.569  6.303   1.00 10.00 ? 381 LYS B HZ1  4  
ATOM 10485  H HZ2  . LYS B 2 63  ? 4.001   21.938  6.557   1.00 10.00 ? 381 LYS B HZ2  4  
ATOM 10486  H HZ3  . LYS B 2 63  ? 3.172   22.823  5.383   1.00 10.00 ? 381 LYS B HZ3  4  
ATOM 10487  N N    . MET B 2 64  ? 7.384   18.001  3.753   1.00 10.00 ? 382 MET B N    4  
ATOM 10488  C CA   . MET B 2 64  ? 6.669   16.733  3.827   1.00 10.00 ? 382 MET B CA   4  
ATOM 10489  C C    . MET B 2 64  ? 7.492   15.589  3.240   1.00 10.00 ? 382 MET B C    4  
ATOM 10490  O O    . MET B 2 64  ? 7.551   14.508  3.817   1.00 10.00 ? 382 MET B O    4  
ATOM 10491  C CB   . MET B 2 64  ? 5.296   16.815  3.163   1.00 10.00 ? 382 MET B CB   4  
ATOM 10492  C CG   . MET B 2 64  ? 4.240   17.480  4.029   1.00 10.00 ? 382 MET B CG   4  
ATOM 10493  S SD   . MET B 2 64  ? 3.963   16.590  5.570   1.00 10.00 ? 382 MET B SD   4  
ATOM 10494  C CE   . MET B 2 64  ? 3.193   15.093  4.954   1.00 10.00 ? 382 MET B CE   4  
ATOM 10495  H H    . MET B 2 64  ? 6.944   18.846  3.547   1.00 10.00 ? 382 MET B H    4  
ATOM 10496  N N    . ILE B 2 65  ? 8.152   15.824  2.115   1.00 10.00 ? 383 ILE B N    4  
ATOM 10497  C CA   . ILE B 2 65  ? 8.971   14.784  1.514   1.00 10.00 ? 383 ILE B CA   4  
ATOM 10498  C C    . ILE B 2 65  ? 10.390  14.754  2.102   1.00 10.00 ? 383 ILE B C    4  
ATOM 10499  O O    . ILE B 2 65  ? 11.001  13.689  2.212   1.00 10.00 ? 383 ILE B O    4  
ATOM 10500  C CB   . ILE B 2 65  ? 8.997   14.840  -0.026  1.00 10.00 ? 383 ILE B CB   4  
ATOM 10501  C CG1  . ILE B 2 65  ? 7.567   14.924  -0.577  1.00 10.00 ? 383 ILE B CG1  4  
ATOM 10502  C CG2  . ILE B 2 65  ? 9.701   13.611  -0.590  1.00 10.00 ? 383 ILE B CG2  4  
ATOM 10503  C CD1  . ILE B 2 65  ? 6.686   13.748  -0.211  1.00 10.00 ? 383 ILE B CD1  4  
ATOM 10504  H H    . ILE B 2 65  ? 8.099   16.706  1.693   1.00 10.00 ? 383 ILE B H    4  
ATOM 10505  N N    . LEU B 2 66  ? 10.910  15.913  2.508   1.00 10.00 ? 384 LEU B N    4  
ATOM 10506  C CA   . LEU B 2 66  ? 12.253  16.007  3.080   1.00 10.00 ? 384 LEU B CA   4  
ATOM 10507  C C    . LEU B 2 66  ? 12.351  15.234  4.389   1.00 10.00 ? 384 LEU B C    4  
ATOM 10508  O O    . LEU B 2 66  ? 13.294  14.473  4.604   1.00 10.00 ? 384 LEU B O    4  
ATOM 10509  C CB   . LEU B 2 66  ? 12.622  17.486  3.287   1.00 10.00 ? 384 LEU B CB   4  
ATOM 10510  C CG   . LEU B 2 66  ? 13.469  17.844  4.513   1.00 10.00 ? 384 LEU B CG   4  
ATOM 10511  C CD1  . LEU B 2 66  ? 14.946  17.607  4.245   1.00 10.00 ? 384 LEU B CD1  4  
ATOM 10512  C CD2  . LEU B 2 66  ? 13.227  19.289  4.920   1.00 10.00 ? 384 LEU B CD2  4  
ATOM 10513  H H    . LEU B 2 66  ? 10.403  16.752  2.434   1.00 10.00 ? 384 LEU B H    4  
ATOM 10514  N N    . ASP B 2 67  ? 11.387  15.431  5.273   1.00 10.00 ? 385 ASP B N    4  
ATOM 10515  C CA   . ASP B 2 67  ? 11.391  14.714  6.537   1.00 10.00 ? 385 ASP B CA   4  
ATOM 10516  C C    . ASP B 2 67  ? 11.006  13.263  6.297   1.00 10.00 ? 385 ASP B C    4  
ATOM 10517  O O    . ASP B 2 67  ? 11.371  12.379  7.055   1.00 10.00 ? 385 ASP B O    4  
ATOM 10518  C CB   . ASP B 2 67  ? 10.474  15.362  7.567   1.00 10.00 ? 385 ASP B CB   4  
ATOM 10519  C CG   . ASP B 2 67  ? 11.039  15.210  8.959   1.00 10.00 ? 385 ASP B CG   4  
ATOM 10520  O OD1  . ASP B 2 67  ? 12.120  15.777  9.225   1.00 10.00 ? 385 ASP B OD1  4  
ATOM 10521  O OD2  . ASP B 2 67  ? 10.429  14.500  9.787   1.00 10.00 ? 385 ASP B OD2  4  
ATOM 10522  H H    . ASP B 2 67  ? 10.664  16.068  5.072   1.00 10.00 ? 385 ASP B H    4  
ATOM 10523  N N    . LEU B 2 68  ? 10.249  13.067  5.227   1.00 10.00 ? 386 LEU B N    4  
ATOM 10524  C CA   . LEU B 2 68  ? 9.817   11.729  4.814   1.00 10.00 ? 386 LEU B CA   4  
ATOM 10525  C C    . LEU B 2 68  ? 11.036  10.812  4.721   1.00 10.00 ? 386 LEU B C    4  
ATOM 10526  O O    . LEU B 2 68  ? 11.068  9.748   5.343   1.00 10.00 ? 386 LEU B O    4  
ATOM 10527  C CB   . LEU B 2 68  ? 9.039   11.753  3.494   1.00 10.00 ? 386 LEU B CB   4  
ATOM 10528  C CG   . LEU B 2 68  ? 9.108   10.494  2.616   1.00 10.00 ? 386 LEU B CG   4  
ATOM 10529  C CD1  . LEU B 2 68  ? 8.525   9.276   3.324   1.00 10.00 ? 386 LEU B CD1  4  
ATOM 10530  C CD2  . LEU B 2 68  ? 8.394   10.732  1.296   1.00 10.00 ? 386 LEU B CD2  4  
ATOM 10531  H H    . LEU B 2 68  ? 9.977   13.891  4.770   1.00 10.00 ? 386 LEU B H    4  
ATOM 10532  N N    . LEU B 2 69  ? 12.041  11.235  3.962   1.00 10.00 ? 387 LEU B N    4  
ATOM 10533  C CA   . LEU B 2 69  ? 13.264  10.454  3.833   1.00 10.00 ? 387 LEU B CA   4  
ATOM 10534  C C    . LEU B 2 69  ? 14.001  10.354  5.170   1.00 10.00 ? 387 LEU B C    4  
ATOM 10535  O O    . LEU B 2 69  ? 14.341  9.260   5.616   1.00 10.00 ? 387 LEU B O    4  
ATOM 10536  C CB   . LEU B 2 69  ? 14.179  10.995  2.723   1.00 10.00 ? 387 LEU B CB   4  
ATOM 10537  C CG   . LEU B 2 69  ? 14.433  12.505  2.706   1.00 10.00 ? 387 LEU B CG   4  
ATOM 10538  C CD1  . LEU B 2 69  ? 15.818  12.829  3.253   1.00 10.00 ? 387 LEU B CD1  4  
ATOM 10539  C CD2  . LEU B 2 69  ? 14.258  13.064  1.302   1.00 10.00 ? 387 LEU B CD2  4  
ATOM 10540  H H    . LEU B 2 69  ? 11.945  12.072  3.458   1.00 10.00 ? 387 LEU B H    4  
ATOM 10541  N N    . LYS B 2 70  ? 14.227  11.483  5.838   1.00 10.00 ? 388 LYS B N    4  
ATOM 10542  C CA   . LYS B 2 70  ? 14.931  11.522  7.115   1.00 10.00 ? 388 LYS B CA   4  
ATOM 10543  C C    . LYS B 2 70  ? 14.238  10.908  8.333   1.00 10.00 ? 388 LYS B C    4  
ATOM 10544  O O    . LYS B 2 70  ? 14.917  10.674  9.335   1.00 10.00 ? 388 LYS B O    4  
ATOM 10545  C CB   . LYS B 2 70  ? 15.613  12.867  7.418   1.00 10.00 ? 388 LYS B CB   4  
ATOM 10546  C CG   . LYS B 2 70  ? 14.681  14.068  7.479   1.00 10.00 ? 388 LYS B CG   4  
ATOM 10547  C CD   . LYS B 2 70  ? 15.409  15.312  7.967   1.00 10.00 ? 388 LYS B CD   4  
ATOM 10548  C CE   . LYS B 2 70  ? 15.694  15.241  9.460   1.00 10.00 ? 388 LYS B CE   4  
ATOM 10549  N NZ   . LYS B 2 70  ? 14.540  15.706  10.276  1.00 10.00 ? 388 LYS B NZ   4  
ATOM 10550  H H    . LYS B 2 70  ? 13.972  12.374  5.500   1.00 10.00 ? 388 LYS B H    4  
ATOM 10551  H HZ1  . LYS B 2 70  ? 14.548  16.741  10.343  1.00 10.00 ? 388 LYS B HZ1  4  
ATOM 10552  H HZ2  . LYS B 2 70  ? 14.595  15.311  11.236  1.00 10.00 ? 388 LYS B HZ2  4  
ATOM 10553  H HZ3  . LYS B 2 70  ? 13.635  15.407  9.839   1.00 10.00 ? 388 LYS B HZ3  4  
ATOM 10554  N N    . SER B 2 71  ? 12.909  10.646  8.264   1.00 10.00 ? 389 SER B N    4  
ATOM 10555  C CA   . SER B 2 71  ? 12.183  10.174  9.461   1.00 10.00 ? 389 SER B CA   4  
ATOM 10556  C C    . SER B 2 71  ? 12.960  9.007   10.075  1.00 10.00 ? 389 SER B C    4  
ATOM 10557  O O    . SER B 2 71  ? 13.427  9.079   11.206  1.00 10.00 ? 389 SER B O    4  
ATOM 10558  C CB   . SER B 2 71  ? 10.775  9.681   9.077   1.00 10.00 ? 389 SER B CB   4  
ATOM 10559  O OG   . SER B 2 71  ? 10.001  10.681  8.433   1.00 10.00 ? 389 SER B OG   4  
ATOM 10560  H H    . SER B 2 71  ? 12.514  10.459  7.392   1.00 10.00 ? 389 SER B H    4  
ATOM 10561  H HG   . SER B 2 71  ? 10.585  11.288  7.959   1.00 10.00 ? 389 SER B HG   4  
ATOM 10562  N N    . LEU B 2 72  ? 13.125  7.949   9.291   1.00 10.00 ? 390 LEU B N    4  
ATOM 10563  C CA   . LEU B 2 72  ? 13.882  6.774   9.672   1.00 10.00 ? 390 LEU B CA   4  
ATOM 10564  C C    . LEU B 2 72  ? 15.398  6.907   9.551   1.00 10.00 ? 390 LEU B C    4  
ATOM 10565  O O    . LEU B 2 72  ? 16.118  6.046   10.068  1.00 10.00 ? 390 LEU B O    4  
ATOM 10566  C CB   . LEU B 2 72  ? 13.370  5.457   9.068   1.00 10.00 ? 390 LEU B CB   4  
ATOM 10567  C CG   . LEU B 2 72  ? 12.574  5.488   7.767   1.00 10.00 ? 390 LEU B CG   4  
ATOM 10568  C CD1  . LEU B 2 72  ? 13.470  5.866   6.600   1.00 10.00 ? 390 LEU B CD1  4  
ATOM 10569  C CD2  . LEU B 2 72  ? 11.951  4.125   7.537   1.00 10.00 ? 390 LEU B CD2  4  
ATOM 10570  H H    . LEU B 2 72  ? 12.679  7.891   8.418   1.00 10.00 ? 390 LEU B H    4  
ATOM 10571  N N    . TRP B 2 73  ? 15.891  7.967   8.876   1.00 10.00 ? 391 TRP B N    4  
ATOM 10572  C CA   . TRP B 2 73  ? 17.319  8.073   8.551   1.00 10.00 ? 391 TRP B CA   4  
ATOM 10573  C C    . TRP B 2 73  ? 18.246  7.843   9.745   1.00 10.00 ? 391 TRP B C    4  
ATOM 10574  O O    . TRP B 2 73  ? 18.942  6.834   9.799   1.00 10.00 ? 391 TRP B O    4  
ATOM 10575  C CB   . TRP B 2 73  ? 17.539  9.528   8.137   1.00 10.00 ? 391 TRP B CB   4  
ATOM 10576  C CG   . TRP B 2 73  ? 18.466  9.730   7.003   1.00 10.00 ? 391 TRP B CG   4  
ATOM 10577  C CD1  . TRP B 2 73  ? 18.140  10.239  5.790   1.00 10.00 ? 391 TRP B CD1  4  
ATOM 10578  C CD2  . TRP B 2 73  ? 19.866  9.442   6.967   1.00 10.00 ? 391 TRP B CD2  4  
ATOM 10579  N NE1  . TRP B 2 73  ? 19.239  10.269  4.984   1.00 10.00 ? 391 TRP B NE1  4  
ATOM 10580  C CE2  . TRP B 2 73  ? 20.317  9.788   5.684   1.00 10.00 ? 391 TRP B CE2  4  
ATOM 10581  C CE3  . TRP B 2 73  ? 20.779  8.921   7.889   1.00 10.00 ? 391 TRP B CE3  4  
ATOM 10582  C CZ2  . TRP B 2 73  ? 21.643  9.630   5.295   1.00 10.00 ? 391 TRP B CZ2  4  
ATOM 10583  C CZ3  . TRP B 2 73  ? 22.093  8.766   7.503   1.00 10.00 ? 391 TRP B CZ3  4  
ATOM 10584  C CH2  . TRP B 2 73  ? 22.514  9.119   6.218   1.00 10.00 ? 391 TRP B CH2  4  
ATOM 10585  H H    . TRP B 2 73  ? 15.405  8.810   8.844   1.00 10.00 ? 391 TRP B H    4  
ATOM 10586  H HE1  . TRP B 2 73  ? 19.255  10.592  4.055   1.00 10.00 ? 391 TRP B HE1  4  
ATOM 10587  N N    . LYS B 2 74  ? 18.274  8.760   10.704  1.00 10.00 ? 392 LYS B N    4  
ATOM 10588  C CA   . LYS B 2 74  ? 19.129  8.592   11.871  1.00 10.00 ? 392 LYS B CA   4  
ATOM 10589  C C    . LYS B 2 74  ? 18.703  7.554   12.887  1.00 10.00 ? 392 LYS B C    4  
ATOM 10590  O O    . LYS B 2 74  ? 19.249  7.542   13.986  1.00 10.00 ? 392 LYS B O    4  
ATOM 10591  C CB   . LYS B 2 74  ? 19.534  9.921   12.532  1.00 10.00 ? 392 LYS B CB   4  
ATOM 10592  C CG   . LYS B 2 74  ? 18.493  11.029  12.447  1.00 10.00 ? 392 LYS B CG   4  
ATOM 10593  C CD   . LYS B 2 74  ? 17.379  10.826  13.457  1.00 10.00 ? 392 LYS B CD   4  
ATOM 10594  C CE   . LYS B 2 74  ? 16.143  11.616  13.081  1.00 10.00 ? 392 LYS B CE   4  
ATOM 10595  N NZ   . LYS B 2 74  ? 15.043  11.423  14.062  1.00 10.00 ? 392 LYS B NZ   4  
ATOM 10596  H H    . LYS B 2 74  ? 17.899  9.662   10.595  1.00 10.00 ? 392 LYS B H    4  
ATOM 10597  H HZ1  . LYS B 2 74  ? 14.203  11.959  13.767  1.00 10.00 ? 392 LYS B HZ1  4  
ATOM 10598  H HZ2  . LYS B 2 74  ? 15.340  11.755  15.004  1.00 10.00 ? 392 LYS B HZ2  4  
ATOM 10599  H HZ3  . LYS B 2 74  ? 14.789  10.415  14.125  1.00 10.00 ? 392 LYS B HZ3  4  
ATOM 10600  N N    . SER B 2 75  ? 17.722  6.715   12.591  1.00 10.00 ? 393 SER B N    4  
ATOM 10601  C CA   . SER B 2 75  ? 17.292  5.767   13.589  1.00 10.00 ? 393 SER B CA   4  
ATOM 10602  C C    . SER B 2 75  ? 17.909  4.382   13.353  1.00 10.00 ? 393 SER B C    4  
ATOM 10603  O O    . SER B 2 75  ? 18.113  3.655   14.323  1.00 10.00 ? 393 SER B O    4  
ATOM 10604  C CB   . SER B 2 75  ? 15.771  5.682   13.530  1.00 10.00 ? 393 SER B CB   4  
ATOM 10605  O OG   . SER B 2 75  ? 15.283  6.563   12.529  1.00 10.00 ? 393 SER B OG   4  
ATOM 10606  H H    . SER B 2 75  ? 17.400  6.578   11.676  1.00 10.00 ? 393 SER B H    4  
ATOM 10607  H HG   . SER B 2 75  ? 14.511  7.033   12.857  1.00 10.00 ? 393 SER B HG   4  
ATOM 10608  N N    . SER B 2 76  ? 18.284  4.056   12.083  1.00 10.00 ? 394 SER B N    4  
ATOM 10609  C CA   . SER B 2 76  ? 18.899  2.747   11.732  1.00 10.00 ? 394 SER B CA   4  
ATOM 10610  C C    . SER B 2 76  ? 18.702  2.358   10.263  1.00 10.00 ? 394 SER B C    4  
ATOM 10611  O O    . SER B 2 76  ? 19.581  1.747   9.650   1.00 10.00 ? 394 SER B O    4  
ATOM 10612  C CB   . SER B 2 76  ? 18.384  1.588   12.604  1.00 10.00 ? 394 SER B CB   4  
ATOM 10613  O OG   . SER B 2 76  ? 16.969  1.614   12.749  1.00 10.00 ? 394 SER B OG   4  
ATOM 10614  H H    . SER B 2 76  ? 18.141  4.704   11.357  1.00 10.00 ? 394 SER B H    4  
ATOM 10615  H HG   . SER B 2 76  ? 16.755  1.838   13.663  1.00 10.00 ? 394 SER B HG   4  
ATOM 10616  N N    . THR B 2 77  ? 17.555  2.716   9.703   1.00 10.00 ? 395 THR B N    4  
ATOM 10617  C CA   . THR B 2 77  ? 17.217  2.357   8.332   1.00 10.00 ? 395 THR B CA   4  
ATOM 10618  C C    . THR B 2 77  ? 18.215  2.835   7.275   1.00 10.00 ? 395 THR B C    4  
ATOM 10619  O O    . THR B 2 77  ? 18.986  2.040   6.724   1.00 10.00 ? 395 THR B O    4  
ATOM 10620  C CB   . THR B 2 77  ? 15.788  2.808   7.970   1.00 10.00 ? 395 THR B CB   4  
ATOM 10621  O OG1  . THR B 2 77  ? 14.966  2.732   9.144   1.00 10.00 ? 395 THR B OG1  4  
ATOM 10622  C CG2  . THR B 2 77  ? 15.203  1.895   6.902   1.00 10.00 ? 395 THR B CG2  4  
ATOM 10623  H H    . THR B 2 77  ? 16.926  3.257   10.227  1.00 10.00 ? 395 THR B H    4  
ATOM 10624  H HG1  . THR B 2 77  ? 14.339  3.461   9.148   1.00 10.00 ? 395 THR B HG1  4  
ATOM 10625  N N    . ILE B 2 78  ? 18.188  4.123   6.963   1.00 10.00 ? 396 ILE B N    4  
ATOM 10626  C CA   . ILE B 2 78  ? 19.076  4.679   5.951   1.00 10.00 ? 396 ILE B CA   4  
ATOM 10627  C C    . ILE B 2 78  ? 20.508  4.849   6.444   1.00 10.00 ? 396 ILE B C    4  
ATOM 10628  O O    . ILE B 2 78  ? 20.748  5.437   7.495   1.00 10.00 ? 396 ILE B O    4  
ATOM 10629  C CB   . ILE B 2 78  ? 18.560  6.032   5.406   1.00 10.00 ? 396 ILE B CB   4  
ATOM 10630  C CG1  . ILE B 2 78  ? 17.092  5.912   4.981   1.00 10.00 ? 396 ILE B CG1  4  
ATOM 10631  C CG2  . ILE B 2 78  ? 19.414  6.499   4.235   1.00 10.00 ? 396 ILE B CG2  4  
ATOM 10632  C CD1  . ILE B 2 78  ? 16.503  7.199   4.441   1.00 10.00 ? 396 ILE B CD1  4  
ATOM 10633  H H    . ILE B 2 78  ? 17.558  4.716   7.424   1.00 10.00 ? 396 ILE B H    4  
ATOM 10634  N N    . THR B 2 79  ? 21.447  4.296   5.686   1.00 10.00 ? 397 THR B N    4  
ATOM 10635  C CA   . THR B 2 79  ? 22.851  4.414   5.999   1.00 10.00 ? 397 THR B CA   4  
ATOM 10636  C C    . THR B 2 79  ? 23.464  5.381   4.983   1.00 10.00 ? 397 THR B C    4  
ATOM 10637  O O    . THR B 2 79  ? 22.960  5.500   3.861   1.00 10.00 ? 397 THR B O    4  
ATOM 10638  C CB   . THR B 2 79  ? 23.563  3.039   5.975   1.00 10.00 ? 397 THR B CB   4  
ATOM 10639  O OG1  . THR B 2 79  ? 23.446  2.438   4.679   1.00 10.00 ? 397 THR B OG1  4  
ATOM 10640  C CG2  . THR B 2 79  ? 22.948  2.102   7.004   1.00 10.00 ? 397 THR B CG2  4  
ATOM 10641  H H    . THR B 2 79  ? 21.187  3.797   4.888   1.00 10.00 ? 397 THR B H    4  
ATOM 10642  H HG1  . THR B 2 79  ? 24.299  2.494   4.232   1.00 10.00 ? 397 THR B HG1  4  
ATOM 10643  N N    . ILE B 2 80  ? 24.526  6.073   5.371   1.00 10.00 ? 398 ILE B N    4  
ATOM 10644  C CA   . ILE B 2 80  ? 25.180  7.077   4.525   1.00 10.00 ? 398 ILE B CA   4  
ATOM 10645  C C    . ILE B 2 80  ? 25.395  6.783   3.034   1.00 10.00 ? 398 ILE B C    4  
ATOM 10646  O O    . ILE B 2 80  ? 25.151  7.675   2.216   1.00 10.00 ? 398 ILE B O    4  
ATOM 10647  C CB   . ILE B 2 80  ? 26.516  7.512   5.170   1.00 10.00 ? 398 ILE B CB   4  
ATOM 10648  C CG1  . ILE B 2 80  ? 27.165  8.652   4.396   1.00 10.00 ? 398 ILE B CG1  4  
ATOM 10649  C CG2  . ILE B 2 80  ? 27.480  6.337   5.321   1.00 10.00 ? 398 ILE B CG2  4  
ATOM 10650  C CD1  . ILE B 2 80  ? 28.267  9.340   5.164   1.00 10.00 ? 398 ILE B CD1  4  
ATOM 10651  H H    . ILE B 2 80  ? 24.771  6.116   6.316   1.00 10.00 ? 398 ILE B H    4  
ATOM 10652  N N    . ASP B 2 81  ? 25.792  5.589   2.635   1.00 10.00 ? 399 ASP B N    4  
ATOM 10653  C CA   . ASP B 2 81  ? 26.032  5.340   1.219   1.00 10.00 ? 399 ASP B CA   4  
ATOM 10654  C C    . ASP B 2 81  ? 24.730  5.211   0.448   1.00 10.00 ? 399 ASP B C    4  
ATOM 10655  O O    . ASP B 2 81  ? 24.676  5.497   -0.754  1.00 10.00 ? 399 ASP B O    4  
ATOM 10656  C CB   . ASP B 2 81  ? 26.902  4.106   1.017   1.00 10.00 ? 399 ASP B CB   4  
ATOM 10657  C CG   . ASP B 2 81  ? 28.370  4.415   1.200   1.00 10.00 ? 399 ASP B CG   4  
ATOM 10658  O OD1  . ASP B 2 81  ? 29.011  4.860   0.229   1.00 10.00 ? 399 ASP B OD1  4  
ATOM 10659  O OD2  . ASP B 2 81  ? 28.888  4.221   2.321   1.00 10.00 ? 399 ASP B OD2  4  
ATOM 10660  H H    . ASP B 2 81  ? 25.850  4.827   3.241   1.00 10.00 ? 399 ASP B H    4  
ATOM 10661  N N    . GLN B 2 82  ? 23.683  4.798   1.151   1.00 10.00 ? 400 GLN B N    4  
ATOM 10662  C CA   . GLN B 2 82  ? 22.374  4.620   0.538   1.00 10.00 ? 400 GLN B CA   4  
ATOM 10663  C C    . GLN B 2 82  ? 21.904  5.923   -0.094  1.00 10.00 ? 400 GLN B C    4  
ATOM 10664  O O    . GLN B 2 82  ? 21.533  5.950   -1.266  1.00 10.00 ? 400 GLN B O    4  
ATOM 10665  C CB   . GLN B 2 82  ? 21.351  4.068   1.533   1.00 10.00 ? 400 GLN B CB   4  
ATOM 10666  C CG   . GLN B 2 82  ? 21.220  2.550   1.508   1.00 10.00 ? 400 GLN B CG   4  
ATOM 10667  C CD   . GLN B 2 82  ? 22.497  1.844   1.080   1.00 10.00 ? 400 GLN B CD   4  
ATOM 10668  O OE1  . GLN B 2 82  ? 22.735  1.639   -0.110  1.00 10.00 ? 400 GLN B OE1  4  
ATOM 10669  N NE2  . GLN B 2 82  ? 23.320  1.458   2.044   1.00 10.00 ? 400 GLN B NE2  4  
ATOM 10670  H H    . GLN B 2 82  ? 23.787  4.649   2.116   1.00 10.00 ? 400 GLN B H    4  
ATOM 10671  H HE21 . GLN B 2 82  ? 23.067  1.647   2.978   1.00 10.00 ? 400 GLN B HE21 4  
ATOM 10672  H HE22 . GLN B 2 82  ? 24.151  1.000   1.791   1.00 10.00 ? 400 GLN B HE22 4  
ATOM 10673  N N    . MET B 2 83  ? 21.931  7.020   0.658   1.00 10.00 ? 401 MET B N    4  
ATOM 10674  C CA   . MET B 2 83  ? 21.529  8.312   0.135   1.00 10.00 ? 401 MET B CA   4  
ATOM 10675  C C    . MET B 2 83  ? 22.670  8.938   -0.672  1.00 10.00 ? 401 MET B C    4  
ATOM 10676  O O    . MET B 2 83  ? 22.449  9.841   -1.474  1.00 10.00 ? 401 MET B O    4  
ATOM 10677  C CB   . MET B 2 83  ? 21.115  9.240   1.286   1.00 10.00 ? 401 MET B CB   4  
ATOM 10678  C CG   . MET B 2 83  ? 20.457  10.539  0.843   1.00 10.00 ? 401 MET B CG   4  
ATOM 10679  S SD   . MET B 2 83  ? 19.621  11.396  2.187   1.00 10.00 ? 401 MET B SD   4  
ATOM 10680  C CE   . MET B 2 83  ? 18.868  12.752  1.297   1.00 10.00 ? 401 MET B CE   4  
ATOM 10681  H H    . MET B 2 83  ? 22.269  7.027   1.581   1.00 10.00 ? 401 MET B H    4  
ATOM 10682  N N    . LYS B 2 84  ? 23.886  8.420   -0.481  1.00 10.00 ? 402 LYS B N    4  
ATOM 10683  C CA   . LYS B 2 84  ? 25.070  8.981   -1.138  1.00 10.00 ? 402 LYS B CA   4  
ATOM 10684  C C    . LYS B 2 84  ? 24.948  8.844   -2.646  1.00 10.00 ? 402 LYS B C    4  
ATOM 10685  O O    . LYS B 2 84  ? 24.952  9.829   -3.378  1.00 10.00 ? 402 LYS B O    4  
ATOM 10686  C CB   . LYS B 2 84  ? 26.340  8.282   -0.647  1.00 10.00 ? 402 LYS B CB   4  
ATOM 10687  C CG   . LYS B 2 84  ? 27.625  9.016   -0.980  1.00 10.00 ? 402 LYS B CG   4  
ATOM 10688  C CD   . LYS B 2 84  ? 28.842  8.202   -0.580  1.00 10.00 ? 402 LYS B CD   4  
ATOM 10689  C CE   . LYS B 2 84  ? 30.129  8.956   -0.867  1.00 10.00 ? 402 LYS B CE   4  
ATOM 10690  N NZ   . LYS B 2 84  ? 30.350  9.157   -2.323  1.00 10.00 ? 402 LYS B NZ   4  
ATOM 10691  H H    . LYS B 2 84  ? 23.963  7.553   -0.032  1.00 10.00 ? 402 LYS B H    4  
ATOM 10692  H HZ1  . LYS B 2 84  ? 30.720  8.287   -2.750  1.00 10.00 ? 402 LYS B HZ1  4  
ATOM 10693  H HZ2  . LYS B 2 84  ? 31.031  9.924   -2.479  1.00 10.00 ? 402 LYS B HZ2  4  
ATOM 10694  H HZ3  . LYS B 2 84  ? 29.452  9.404   -2.799  1.00 10.00 ? 402 LYS B HZ3  4  
ATOM 10695  N N    . ARG B 2 85  ? 24.807  7.609   -3.101  1.00 10.00 ? 403 ARG B N    4  
ATOM 10696  C CA   . ARG B 2 85  ? 24.651  7.329   -4.517  1.00 10.00 ? 403 ARG B CA   4  
ATOM 10697  C C    . ARG B 2 85  ? 23.338  7.911   -5.022  1.00 10.00 ? 403 ARG B C    4  
ATOM 10698  O O    . ARG B 2 85  ? 23.135  8.067   -6.223  1.00 10.00 ? 403 ARG B O    4  
ATOM 10699  C CB   . ARG B 2 85  ? 24.719  5.825   -4.772  1.00 10.00 ? 403 ARG B CB   4  
ATOM 10700  C CG   . ARG B 2 85  ? 26.105  5.244   -4.557  1.00 10.00 ? 403 ARG B CG   4  
ATOM 10701  C CD   . ARG B 2 85  ? 26.042  3.807   -4.073  1.00 10.00 ? 403 ARG B CD   4  
ATOM 10702  N NE   . ARG B 2 85  ? 25.440  2.918   -5.064  1.00 10.00 ? 403 ARG B NE   4  
ATOM 10703  C CZ   . ARG B 2 85  ? 24.674  1.874   -4.754  1.00 10.00 ? 403 ARG B CZ   4  
ATOM 10704  N NH1  . ARG B 2 85  ? 24.431  1.580   -3.480  1.00 10.00 ? 403 ARG B NH1  4  
ATOM 10705  N NH2  . ARG B 2 85  ? 24.159  1.121   -5.719  1.00 10.00 ? 403 ARG B NH2  4  
ATOM 10706  H H    . ARG B 2 85  ? 24.821  6.859   -2.470  1.00 10.00 ? 403 ARG B H    4  
ATOM 10707  H HE   . ARG B 2 85  ? 25.625  3.108   -6.012  1.00 10.00 ? 403 ARG B HE   4  
ATOM 10708  H HH11 . ARG B 2 85  ? 24.825  2.142   -2.749  1.00 10.00 ? 403 ARG B HH11 4  
ATOM 10709  H HH12 . ARG B 2 85  ? 23.855  0.793   -3.246  1.00 10.00 ? 403 ARG B HH12 4  
ATOM 10710  H HH21 . ARG B 2 85  ? 24.346  1.339   -6.686  1.00 10.00 ? 403 ARG B HH21 4  
ATOM 10711  H HH22 . ARG B 2 85  ? 23.590  0.325   -5.491  1.00 10.00 ? 403 ARG B HH22 4  
ATOM 10712  N N    . GLY B 2 86  ? 22.451  8.238   -4.087  1.00 10.00 ? 404 GLY B N    4  
ATOM 10713  C CA   . GLY B 2 86  ? 21.173  8.803   -4.445  1.00 10.00 ? 404 GLY B CA   4  
ATOM 10714  C C    . GLY B 2 86  ? 21.318  10.285  -4.730  1.00 10.00 ? 404 GLY B C    4  
ATOM 10715  O O    . GLY B 2 86  ? 20.730  10.807  -5.673  1.00 10.00 ? 404 GLY B O    4  
ATOM 10716  H H    . GLY B 2 86  ? 22.725  8.241   -3.148  1.00 10.00 ? 404 GLY B H    4  
ATOM 10717  N N    . TYR B 2 87  ? 22.137  10.945  -3.909  1.00 10.00 ? 405 TYR B N    4  
ATOM 10718  C CA   . TYR B 2 87  ? 22.401  12.377  -4.026  1.00 10.00 ? 405 TYR B CA   4  
ATOM 10719  C C    . TYR B 2 87  ? 23.268  12.659  -5.241  1.00 10.00 ? 405 TYR B C    4  
ATOM 10720  O O    . TYR B 2 87  ? 23.075  13.655  -5.939  1.00 10.00 ? 405 TYR B O    4  
ATOM 10721  C CB   . TYR B 2 87  ? 23.143  12.864  -2.773  1.00 10.00 ? 405 TYR B CB   4  
ATOM 10722  C CG   . TYR B 2 87  ? 22.476  14.004  -2.034  1.00 10.00 ? 405 TYR B CG   4  
ATOM 10723  C CD1  . TYR B 2 87  ? 21.185  13.877  -1.541  1.00 10.00 ? 405 TYR B CD1  4  
ATOM 10724  C CD2  . TYR B 2 87  ? 23.147  15.202  -1.813  1.00 10.00 ? 405 TYR B CD2  4  
ATOM 10725  C CE1  . TYR B 2 87  ? 20.580  14.908  -0.849  1.00 10.00 ? 405 TYR B CE1  4  
ATOM 10726  C CE2  . TYR B 2 87  ? 22.547  16.239  -1.125  1.00 10.00 ? 405 TYR B CE2  4  
ATOM 10727  C CZ   . TYR B 2 87  ? 21.264  16.086  -0.644  1.00 10.00 ? 405 TYR B CZ   4  
ATOM 10728  O OH   . TYR B 2 87  ? 20.667  17.111  0.051   1.00 10.00 ? 405 TYR B OH   4  
ATOM 10729  H H    . TYR B 2 87  ? 22.584  10.445  -3.189  1.00 10.00 ? 405 TYR B H    4  
ATOM 10730  H HH   . TYR B 2 87  ? 20.837  17.940  -0.399  1.00 10.00 ? 405 TYR B HH   4  
ATOM 10731  N N    . GLU B 2 88  ? 24.208  11.761  -5.496  1.00 10.00 ? 406 GLU B N    4  
ATOM 10732  C CA   . GLU B 2 88  ? 25.120  11.901  -6.619  1.00 10.00 ? 406 GLU B CA   4  
ATOM 10733  C C    . GLU B 2 88  ? 24.395  11.610  -7.926  1.00 10.00 ? 406 GLU B C    4  
ATOM 10734  O O    . GLU B 2 88  ? 24.734  12.149  -8.979  1.00 10.00 ? 406 GLU B O    4  
ATOM 10735  C CB   . GLU B 2 88  ? 26.333  10.982  -6.442  1.00 10.00 ? 406 GLU B CB   4  
ATOM 10736  C CG   . GLU B 2 88  ? 27.198  11.344  -5.242  1.00 10.00 ? 406 GLU B CG   4  
ATOM 10737  C CD   . GLU B 2 88  ? 28.381  10.415  -5.045  1.00 10.00 ? 406 GLU B CD   4  
ATOM 10738  O OE1  . GLU B 2 88  ? 29.288  10.408  -5.899  1.00 10.00 ? 406 GLU B OE1  4  
ATOM 10739  O OE2  . GLU B 2 88  ? 28.414  9.685   -4.030  1.00 10.00 ? 406 GLU B OE2  4  
ATOM 10740  H H    . GLU B 2 88  ? 24.262  10.947  -4.951  1.00 10.00 ? 406 GLU B H    4  
ATOM 10741  N N    . ARG B 2 89  ? 23.389  10.745  -7.843  1.00 10.00 ? 407 ARG B N    4  
ATOM 10742  C CA   . ARG B 2 89  ? 22.594  10.369  -9.006  1.00 10.00 ? 407 ARG B CA   4  
ATOM 10743  C C    . ARG B 2 89  ? 21.765  11.550  -9.506  1.00 10.00 ? 407 ARG B C    4  
ATOM 10744  O O    . ARG B 2 89  ? 21.424  11.620  -10.685 1.00 10.00 ? 407 ARG B O    4  
ATOM 10745  C CB   . ARG B 2 89  ? 21.680  9.187   -8.667  1.00 10.00 ? 407 ARG B CB   4  
ATOM 10746  C CG   . ARG B 2 89  ? 21.082  8.472   -9.870  1.00 10.00 ? 407 ARG B CG   4  
ATOM 10747  C CD   . ARG B 2 89  ? 20.294  7.244   -9.438  1.00 10.00 ? 407 ARG B CD   4  
ATOM 10748  N NE   . ARG B 2 89  ? 19.564  6.626   -10.547 1.00 10.00 ? 407 ARG B NE   4  
ATOM 10749  C CZ   . ARG B 2 89  ? 18.827  5.517   -10.429 1.00 10.00 ? 407 ARG B CZ   4  
ATOM 10750  N NH1  . ARG B 2 89  ? 18.706  4.917   -9.247  1.00 10.00 ? 407 ARG B NH1  4  
ATOM 10751  N NH2  . ARG B 2 89  ? 18.204  5.020   -11.489 1.00 10.00 ? 407 ARG B NH2  4  
ATOM 10752  H H    . ARG B 2 89  ? 23.176  10.345  -6.974  1.00 10.00 ? 407 ARG B H    4  
ATOM 10753  H HE   . ARG B 2 89  ? 19.628  7.060   -11.429 1.00 10.00 ? 407 ARG B HE   4  
ATOM 10754  H HH11 . ARG B 2 89  ? 19.161  5.292   -8.443  1.00 10.00 ? 407 ARG B HH11 4  
ATOM 10755  H HH12 . ARG B 2 89  ? 18.153  4.074   -9.155  1.00 10.00 ? 407 ARG B HH12 4  
ATOM 10756  H HH21 . ARG B 2 89  ? 18.276  5.480   -12.379 1.00 10.00 ? 407 ARG B HH21 4  
ATOM 10757  H HH22 . ARG B 2 89  ? 17.676  4.170   -11.411 1.00 10.00 ? 407 ARG B HH22 4  
ATOM 10758  N N    . ILE B 2 90  ? 21.452  12.481  -8.607  1.00 10.00 ? 408 ILE B N    4  
ATOM 10759  C CA   . ILE B 2 90  ? 20.658  13.648  -8.972  1.00 10.00 ? 408 ILE B CA   4  
ATOM 10760  C C    . ILE B 2 90  ? 21.378  14.487  -10.020 1.00 10.00 ? 408 ILE B C    4  
ATOM 10761  O O    . ILE B 2 90  ? 20.838  14.730  -11.091 1.00 10.00 ? 408 ILE B O    4  
ATOM 10762  C CB   . ILE B 2 90  ? 20.337  14.538  -7.752  1.00 10.00 ? 408 ILE B CB   4  
ATOM 10763  C CG1  . ILE B 2 90  ? 19.644  13.726  -6.653  1.00 10.00 ? 408 ILE B CG1  4  
ATOM 10764  C CG2  . ILE B 2 90  ? 19.476  15.725  -8.167  1.00 10.00 ? 408 ILE B CG2  4  
ATOM 10765  C CD1  . ILE B 2 90  ? 18.383  13.022  -7.110  1.00 10.00 ? 408 ILE B CD1  4  
ATOM 10766  H H    . ILE B 2 90  ? 21.763  12.380  -7.682  1.00 10.00 ? 408 ILE B H    4  
ATOM 10767  N N    . TYR B 2 91  ? 22.583  14.955  -9.695  1.00 10.00 ? 409 TYR B N    4  
ATOM 10768  C CA   . TYR B 2 91  ? 23.381  15.734  -10.646 1.00 10.00 ? 409 TYR B CA   4  
ATOM 10769  C C    . TYR B 2 91  ? 23.576  15.027  -11.985 1.00 10.00 ? 409 TYR B C    4  
ATOM 10770  O O    . TYR B 2 91  ? 23.740  15.681  -13.013 1.00 10.00 ? 409 TYR B O    4  
ATOM 10771  C CB   . TYR B 2 91  ? 24.733  16.088  -10.018 1.00 10.00 ? 409 TYR B CB   4  
ATOM 10772  C CG   . TYR B 2 91  ? 24.639  16.388  -8.537  1.00 10.00 ? 409 TYR B CG   4  
ATOM 10773  C CD1  . TYR B 2 91  ? 23.774  17.366  -8.063  1.00 10.00 ? 409 TYR B CD1  4  
ATOM 10774  C CD2  . TYR B 2 91  ? 25.395  15.679  -7.612  1.00 10.00 ? 409 TYR B CD2  4  
ATOM 10775  C CE1  . TYR B 2 91  ? 23.667  17.633  -6.712  1.00 10.00 ? 409 TYR B CE1  4  
ATOM 10776  C CE2  . TYR B 2 91  ? 25.292  15.937  -6.258  1.00 10.00 ? 409 TYR B CE2  4  
ATOM 10777  C CZ   . TYR B 2 91  ? 24.426  16.914  -5.814  1.00 10.00 ? 409 TYR B CZ   4  
ATOM 10778  O OH   . TYR B 2 91  ? 24.323  17.174  -4.467  1.00 10.00 ? 409 TYR B OH   4  
ATOM 10779  H H    . TYR B 2 91  ? 22.853  14.999  -8.758  1.00 10.00 ? 409 TYR B H    4  
ATOM 10780  H HH   . TYR B 2 91  ? 23.398  17.278  -4.230  1.00 10.00 ? 409 TYR B HH   4  
ATOM 10781  N N    . ASN B 2 92  ? 23.538  13.705  -11.980 1.00 10.00 ? 410 ASN B N    4  
ATOM 10782  C CA   . ASN B 2 92  ? 23.688  12.942  -13.212 1.00 10.00 ? 410 ASN B CA   4  
ATOM 10783  C C    . ASN B 2 92  ? 22.453  13.134  -14.090 1.00 10.00 ? 410 ASN B C    4  
ATOM 10784  O O    . ASN B 2 92  ? 22.552  13.251  -15.312 1.00 10.00 ? 410 ASN B O    4  
ATOM 10785  C CB   . ASN B 2 92  ? 23.873  11.458  -12.894 1.00 10.00 ? 410 ASN B CB   4  
ATOM 10786  C CG   . ASN B 2 92  ? 24.277  10.641  -14.103 1.00 10.00 ? 410 ASN B CG   4  
ATOM 10787  O OD1  . ASN B 2 92  ? 25.460  10.524  -14.415 1.00 10.00 ? 410 ASN B OD1  4  
ATOM 10788  N ND2  . ASN B 2 92  ? 23.304  10.067  -14.790 1.00 10.00 ? 410 ASN B ND2  4  
ATOM 10789  H H    . ASN B 2 92  ? 23.412  13.231  -11.132 1.00 10.00 ? 410 ASN B H    4  
ATOM 10790  H HD21 . ASN B 2 92  ? 22.372  10.199  -14.488 1.00 10.00 ? 410 ASN B HD21 4  
ATOM 10791  H HD22 . ASN B 2 92  ? 23.546  9.531   -15.570 1.00 10.00 ? 410 ASN B HD22 4  
ATOM 10792  N N    . GLU B 2 93  ? 21.291  13.192  -13.447 1.00 10.00 ? 411 GLU B N    4  
ATOM 10793  C CA   . GLU B 2 93  ? 20.027  13.365  -14.153 1.00 10.00 ? 411 GLU B CA   4  
ATOM 10794  C C    . GLU B 2 93  ? 19.665  14.841  -14.260 1.00 10.00 ? 411 GLU B C    4  
ATOM 10795  O O    . GLU B 2 93  ? 18.670  15.204  -14.888 1.00 10.00 ? 411 GLU B O    4  
ATOM 10796  C CB   . GLU B 2 93  ? 18.912  12.613  -13.424 1.00 10.00 ? 411 GLU B CB   4  
ATOM 10797  C CG   . GLU B 2 93  ? 19.285  11.200  -13.010 1.00 10.00 ? 411 GLU B CG   4  
ATOM 10798  C CD   . GLU B 2 93  ? 19.484  10.276  -14.193 1.00 10.00 ? 411 GLU B CD   4  
ATOM 10799  O OE1  . GLU B 2 93  ? 20.591  10.260  -14.768 1.00 10.00 ? 411 GLU B OE1  4  
ATOM 10800  O OE2  . GLU B 2 93  ? 18.530  9.553   -14.546 1.00 10.00 ? 411 GLU B OE2  4  
ATOM 10801  H H    . GLU B 2 93  ? 21.283  13.116  -12.468 1.00 10.00 ? 411 GLU B H    4  
ATOM 10802  N N    . ILE B 2 94  ? 20.483  15.683  -13.641 1.00 10.00 ? 412 ILE B N    4  
ATOM 10803  C CA   . ILE B 2 94  ? 20.275  17.128  -13.647 1.00 10.00 ? 412 ILE B CA   4  
ATOM 10804  C C    . ILE B 2 94  ? 20.118  17.721  -15.059 1.00 10.00 ? 412 ILE B C    4  
ATOM 10805  O O    . ILE B 2 94  ? 19.154  18.444  -15.308 1.00 10.00 ? 412 ILE B O    4  
ATOM 10806  C CB   . ILE B 2 94  ? 21.332  17.885  -12.797 1.00 10.00 ? 412 ILE B CB   4  
ATOM 10807  C CG1  . ILE B 2 94  ? 20.814  18.101  -11.371 1.00 10.00 ? 412 ILE B CG1  4  
ATOM 10808  C CG2  . ILE B 2 94  ? 21.754  19.207  -13.422 1.00 10.00 ? 412 ILE B CG2  4  
ATOM 10809  C CD1  . ILE B 2 94  ? 19.527  18.898  -11.293 1.00 10.00 ? 412 ILE B CD1  4  
ATOM 10810  H H    . ILE B 2 94  ? 21.252  15.317  -13.153 1.00 10.00 ? 412 ILE B H    4  
ATOM 10811  N N    . PRO B 2 95  ? 21.037  17.424  -16.008 1.00 10.00 ? 413 PRO B N    4  
ATOM 10812  C CA   . PRO B 2 95  ? 20.944  17.947  -17.380 1.00 10.00 ? 413 PRO B CA   4  
ATOM 10813  C C    . PRO B 2 95  ? 19.629  17.569  -18.053 1.00 10.00 ? 413 PRO B C    4  
ATOM 10814  O O    . PRO B 2 95  ? 19.130  18.296  -18.909 1.00 10.00 ? 413 PRO B O    4  
ATOM 10815  C CB   . PRO B 2 95  ? 22.112  17.275  -18.105 1.00 10.00 ? 413 PRO B CB   4  
ATOM 10816  C CG   . PRO B 2 95  ? 23.075  16.949  -17.025 1.00 10.00 ? 413 PRO B CG   4  
ATOM 10817  C CD   . PRO B 2 95  ? 22.240  16.592  -15.831 1.00 10.00 ? 413 PRO B CD   4  
ATOM 10818  N N    . ASP B 2 96  ? 19.066  16.437  -17.653 1.00 10.00 ? 414 ASP B N    4  
ATOM 10819  C CA   . ASP B 2 96  ? 17.807  15.964  -18.216 1.00 10.00 ? 414 ASP B CA   4  
ATOM 10820  C C    . ASP B 2 96  ? 16.646  16.784  -17.689 1.00 10.00 ? 414 ASP B C    4  
ATOM 10821  O O    . ASP B 2 96  ? 15.775  17.218  -18.446 1.00 10.00 ? 414 ASP B O    4  
ATOM 10822  C CB   . ASP B 2 96  ? 17.575  14.495  -17.864 1.00 10.00 ? 414 ASP B CB   4  
ATOM 10823  C CG   . ASP B 2 96  ? 18.205  13.549  -18.854 1.00 10.00 ? 414 ASP B CG   4  
ATOM 10824  O OD1  . ASP B 2 96  ? 19.406  13.250  -18.713 1.00 10.00 ? 414 ASP B OD1  4  
ATOM 10825  O OD2  . ASP B 2 96  ? 17.498  13.086  -19.775 1.00 10.00 ? 414 ASP B OD2  4  
ATOM 10826  H H    . ASP B 2 96  ? 19.503  15.910  -16.950 1.00 10.00 ? 414 ASP B H    4  
ATOM 10827  N N    . ILE B 2 97  ? 16.640  16.984  -16.381 1.00 10.00 ? 415 ILE B N    4  
ATOM 10828  C CA   . ILE B 2 97  ? 15.590  17.747  -15.723 1.00 10.00 ? 415 ILE B CA   4  
ATOM 10829  C C    . ILE B 2 97  ? 15.679  19.223  -16.104 1.00 10.00 ? 415 ILE B C    4  
ATOM 10830  O O    . ILE B 2 97  ? 14.661  19.887  -16.318 1.00 10.00 ? 415 ILE B O    4  
ATOM 10831  C CB   . ILE B 2 97  ? 15.680  17.595  -14.188 1.00 10.00 ? 415 ILE B CB   4  
ATOM 10832  C CG1  . ILE B 2 97  ? 15.623  16.114  -13.804 1.00 10.00 ? 415 ILE B CG1  4  
ATOM 10833  C CG2  . ILE B 2 97  ? 14.563  18.365  -13.498 1.00 10.00 ? 415 ILE B CG2  4  
ATOM 10834  C CD1  . ILE B 2 97  ? 16.053  15.829  -12.381 1.00 10.00 ? 415 ILE B CD1  4  
ATOM 10835  H H    . ILE B 2 97  ? 17.366  16.604  -15.837 1.00 10.00 ? 415 ILE B H    4  
ATOM 10836  N N    . ASN B 2 98  ? 16.900  19.727  -16.200 1.00 10.00 ? 416 ASN B N    4  
ATOM 10837  C CA   . ASN B 2 98  ? 17.123  21.122  -16.552 1.00 10.00 ? 416 ASN B CA   4  
ATOM 10838  C C    . ASN B 2 98  ? 16.928  21.356  -18.039 1.00 10.00 ? 416 ASN B C    4  
ATOM 10839  O O    . ASN B 2 98  ? 16.018  22.081  -18.441 1.00 10.00 ? 416 ASN B O    4  
ATOM 10840  C CB   . ASN B 2 98  ? 18.524  21.579  -16.145 1.00 10.00 ? 416 ASN B CB   4  
ATOM 10841  C CG   . ASN B 2 98  ? 18.696  21.694  -14.648 1.00 10.00 ? 416 ASN B CG   4  
ATOM 10842  O OD1  . ASN B 2 98  ? 17.727  21.797  -13.899 1.00 10.00 ? 416 ASN B OD1  4  
ATOM 10843  N ND2  . ASN B 2 98  ? 19.936  21.691  -14.202 1.00 10.00 ? 416 ASN B ND2  4  
ATOM 10844  H H    . ASN B 2 98  ? 17.675  19.146  -16.023 1.00 10.00 ? 416 ASN B H    4  
ATOM 10845  H HD21 . ASN B 2 98  ? 20.667  21.616  -14.856 1.00 10.00 ? 416 ASN B HD21 4  
ATOM 10846  H HD22 . ASN B 2 98  ? 20.080  21.755  -13.237 1.00 10.00 ? 416 ASN B HD22 4  
ATOM 10847  N N    . LEU B 2 99  ? 17.781  20.724  -18.845 1.00 10.00 ? 417 LEU B N    4  
ATOM 10848  C CA   . LEU B 2 99  ? 17.738  20.870  -20.298 1.00 10.00 ? 417 LEU B CA   4  
ATOM 10849  C C    . LEU B 2 99  ? 17.926  22.336  -20.669 1.00 10.00 ? 417 LEU B C    4  
ATOM 10850  O O    . LEU B 2 99  ? 17.060  22.950  -21.297 1.00 10.00 ? 417 LEU B O    4  
ATOM 10851  C CB   . LEU B 2 99  ? 16.426  20.317  -20.867 1.00 10.00 ? 417 LEU B CB   4  
ATOM 10852  C CG   . LEU B 2 99  ? 16.386  20.084  -22.379 1.00 10.00 ? 417 LEU B CG   4  
ATOM 10853  C CD1  . LEU B 2 99  ? 17.399  19.025  -22.789 1.00 10.00 ? 417 LEU B CD1  4  
ATOM 10854  C CD2  . LEU B 2 99  ? 14.985  19.689  -22.816 1.00 10.00 ? 417 LEU B CD2  4  
ATOM 10855  H H    . LEU B 2 99  ? 18.458  20.134  -18.451 1.00 10.00 ? 417 LEU B H    4  
ATOM 10856  N N    . ASP B 2 100 ? 19.069  22.880  -20.246 1.00 10.00 ? 418 ASP B N    4  
ATOM 10857  C CA   . ASP B 2 100 ? 19.429  24.282  -20.469 1.00 10.00 ? 418 ASP B CA   4  
ATOM 10858  C C    . ASP B 2 100 ? 18.668  25.187  -19.504 1.00 10.00 ? 418 ASP B C    4  
ATOM 10859  O O    . ASP B 2 100 ? 17.533  24.885  -19.137 1.00 10.00 ? 418 ASP B O    4  
ATOM 10860  C CB   . ASP B 2 100 ? 19.241  24.715  -21.924 1.00 10.00 ? 418 ASP B CB   4  
ATOM 10861  C CG   . ASP B 2 100 ? 20.017  25.967  -22.265 1.00 10.00 ? 418 ASP B CG   4  
ATOM 10862  O OD1  . ASP B 2 100 ? 20.897  26.365  -21.474 1.00 10.00 ? 418 ASP B OD1  4  
ATOM 10863  O OD2  . ASP B 2 100 ? 19.755  26.554  -23.334 1.00 10.00 ? 418 ASP B OD2  4  
ATOM 10864  H H    . ASP B 2 100 ? 19.697  22.313  -19.754 1.00 10.00 ? 418 ASP B H    4  
ATOM 10865  N N    . VAL B 2 101 ? 19.289  26.294  -19.102 1.00 10.00 ? 419 VAL B N    4  
ATOM 10866  C CA   . VAL B 2 101 ? 18.683  27.222  -18.140 1.00 10.00 ? 419 VAL B CA   4  
ATOM 10867  C C    . VAL B 2 101 ? 18.412  26.483  -16.826 1.00 10.00 ? 419 VAL B C    4  
ATOM 10868  O O    . VAL B 2 101 ? 17.289  26.056  -16.548 1.00 10.00 ? 419 VAL B O    4  
ATOM 10869  C CB   . VAL B 2 101 ? 17.390  27.885  -18.667 1.00 10.00 ? 419 VAL B CB   4  
ATOM 10870  C CG1  . VAL B 2 101 ? 16.853  28.897  -17.662 1.00 10.00 ? 419 VAL B CG1  4  
ATOM 10871  C CG2  . VAL B 2 101 ? 17.646  28.557  -20.004 1.00 10.00 ? 419 VAL B CG2  4  
ATOM 10872  H H    . VAL B 2 101 ? 20.180  26.496  -19.464 1.00 10.00 ? 419 VAL B H    4  
ATOM 10873  N N    . PRO B 2 102 ? 19.450  26.331  -15.999 1.00 10.00 ? 420 PRO B N    4  
ATOM 10874  C CA   . PRO B 2 102 ? 19.361  25.600  -14.735 1.00 10.00 ? 420 PRO B CA   4  
ATOM 10875  C C    . PRO B 2 102 ? 18.736  26.395  -13.591 1.00 10.00 ? 420 PRO B C    4  
ATOM 10876  O O    . PRO B 2 102 ? 19.208  26.323  -12.457 1.00 10.00 ? 420 PRO B O    4  
ATOM 10877  C CB   . PRO B 2 102 ? 20.825  25.294  -14.429 1.00 10.00 ? 420 PRO B CB   4  
ATOM 10878  C CG   . PRO B 2 102 ? 21.561  26.455  -14.997 1.00 10.00 ? 420 PRO B CG   4  
ATOM 10879  C CD   . PRO B 2 102 ? 20.803  26.872  -16.226 1.00 10.00 ? 420 PRO B CD   4  
ATOM 10880  N N    . HIS B 2 103 ? 17.675  27.148  -13.876 1.00 10.00 ? 421 HIS B N    4  
ATOM 10881  C CA   . HIS B 2 103 ? 16.990  27.925  -12.842 1.00 10.00 ? 421 HIS B CA   4  
ATOM 10882  C C    . HIS B 2 103 ? 16.504  27.037  -11.695 1.00 10.00 ? 421 HIS B C    4  
ATOM 10883  O O    . HIS B 2 103 ? 16.283  27.513  -10.579 1.00 10.00 ? 421 HIS B O    4  
ATOM 10884  C CB   . HIS B 2 103 ? 15.817  28.715  -13.431 1.00 10.00 ? 421 HIS B CB   4  
ATOM 10885  C CG   . HIS B 2 103 ? 16.185  30.076  -13.941 1.00 10.00 ? 421 HIS B CG   4  
ATOM 10886  N ND1  . HIS B 2 103 ? 15.310  30.876  -14.647 1.00 10.00 ? 421 HIS B ND1  4  
ATOM 10887  C CD2  . HIS B 2 103 ? 17.339  30.778  -13.849 1.00 10.00 ? 421 HIS B CD2  4  
ATOM 10888  C CE1  . HIS B 2 103 ? 15.912  32.008  -14.967 1.00 10.00 ? 421 HIS B CE1  4  
ATOM 10889  N NE2  . HIS B 2 103 ? 17.143  31.973  -14.494 1.00 10.00 ? 421 HIS B NE2  4  
ATOM 10890  H H    . HIS B 2 103 ? 17.372  27.220  -14.809 1.00 10.00 ? 421 HIS B H    4  
ATOM 10891  H HD1  . HIS B 2 103 ? 14.382  30.648  -14.880 1.00 10.00 ? 421 HIS B HD1  4  
ATOM 10892  H HE2  . HIS B 2 103 ? 17.847  32.633  -14.696 1.00 10.00 ? 421 HIS B HE2  4  
ATOM 10893  N N    . SER B 2 104 ? 16.354  25.746  -11.974 1.00 10.00 ? 422 SER B N    4  
ATOM 10894  C CA   . SER B 2 104 ? 15.911  24.781  -10.980 1.00 10.00 ? 422 SER B CA   4  
ATOM 10895  C C    . SER B 2 104 ? 16.938  24.620  -9.858  1.00 10.00 ? 422 SER B C    4  
ATOM 10896  O O    . SER B 2 104 ? 16.651  24.005  -8.828  1.00 10.00 ? 422 SER B O    4  
ATOM 10897  C CB   . SER B 2 104 ? 15.652  23.439  -11.658 1.00 10.00 ? 422 SER B CB   4  
ATOM 10898  O OG   . SER B 2 104 ? 15.963  23.520  -13.042 1.00 10.00 ? 422 SER B OG   4  
ATOM 10899  H H    . SER B 2 104 ? 16.538  25.432  -12.885 1.00 10.00 ? 422 SER B H    4  
ATOM 10900  H HG   . SER B 2 104 ? 16.505  22.752  -13.292 1.00 10.00 ? 422 SER B HG   4  
ATOM 10901  N N    . TYR B 2 105 ? 18.135  25.176  -10.065 1.00 10.00 ? 423 TYR B N    4  
ATOM 10902  C CA   . TYR B 2 105 ? 19.201  25.120  -9.068  1.00 10.00 ? 423 TYR B CA   4  
ATOM 10903  C C    . TYR B 2 105 ? 18.761  25.815  -7.791  1.00 10.00 ? 423 TYR B C    4  
ATOM 10904  O O    . TYR B 2 105 ? 19.168  25.425  -6.695  1.00 10.00 ? 423 TYR B O    4  
ATOM 10905  C CB   . TYR B 2 105 ? 20.504  25.726  -9.598  1.00 10.00 ? 423 TYR B CB   4  
ATOM 10906  C CG   . TYR B 2 105 ? 21.284  24.796  -10.502 1.00 10.00 ? 423 TYR B CG   4  
ATOM 10907  C CD1  . TYR B 2 105 ? 20.716  23.620  -10.972 1.00 10.00 ? 423 TYR B CD1  4  
ATOM 10908  C CD2  . TYR B 2 105 ? 22.586  25.090  -10.888 1.00 10.00 ? 423 TYR B CD2  4  
ATOM 10909  C CE1  . TYR B 2 105 ? 21.415  22.766  -11.797 1.00 10.00 ? 423 TYR B CE1  4  
ATOM 10910  C CE2  . TYR B 2 105 ? 23.295  24.237  -11.717 1.00 10.00 ? 423 TYR B CE2  4  
ATOM 10911  C CZ   . TYR B 2 105 ? 22.701  23.075  -12.168 1.00 10.00 ? 423 TYR B CZ   4  
ATOM 10912  O OH   . TYR B 2 105 ? 23.391  22.220  -12.994 1.00 10.00 ? 423 TYR B OH   4  
ATOM 10913  H H    . TYR B 2 105 ? 18.306  25.634  -10.919 1.00 10.00 ? 423 TYR B H    4  
ATOM 10914  H HH   . TYR B 2 105 ? 24.334  22.305  -12.826 1.00 10.00 ? 423 TYR B HH   4  
ATOM 10915  N N    . SER B 2 106 ? 17.916  26.836  -7.953  1.00 10.00 ? 424 SER B N    4  
ATOM 10916  C CA   . SER B 2 106 ? 17.373  27.581  -6.826  1.00 10.00 ? 424 SER B CA   4  
ATOM 10917  C C    . SER B 2 106 ? 16.797  26.591  -5.815  1.00 10.00 ? 424 SER B C    4  
ATOM 10918  O O    . SER B 2 106 ? 16.983  26.729  -4.602  1.00 10.00 ? 424 SER B O    4  
ATOM 10919  C CB   . SER B 2 106 ? 16.272  28.526  -7.328  1.00 10.00 ? 424 SER B CB   4  
ATOM 10920  O OG   . SER B 2 106 ? 15.809  29.393  -6.306  1.00 10.00 ? 424 SER B OG   4  
ATOM 10921  H H    . SER B 2 106 ? 17.661  27.102  -8.863  1.00 10.00 ? 424 SER B H    4  
ATOM 10922  H HG   . SER B 2 106 ? 16.400  30.157  -6.239  1.00 10.00 ? 424 SER B HG   4  
ATOM 10923  N N    . VAL B 2 107 ? 16.099  25.587  -6.336  1.00 10.00 ? 425 VAL B N    4  
ATOM 10924  C CA   . VAL B 2 107 ? 15.516  24.539  -5.514  1.00 10.00 ? 425 VAL B CA   4  
ATOM 10925  C C    . VAL B 2 107 ? 16.568  23.487  -5.165  1.00 10.00 ? 425 VAL B C    4  
ATOM 10926  O O    . VAL B 2 107 ? 16.784  23.172  -3.993  1.00 10.00 ? 425 VAL B O    4  
ATOM 10927  C CB   . VAL B 2 107 ? 14.343  23.845  -6.234  1.00 10.00 ? 425 VAL B CB   4  
ATOM 10928  C CG1  . VAL B 2 107 ? 13.622  22.892  -5.292  1.00 10.00 ? 425 VAL B CG1  4  
ATOM 10929  C CG2  . VAL B 2 107 ? 13.379  24.875  -6.801  1.00 10.00 ? 425 VAL B CG2  4  
ATOM 10930  H H    . VAL B 2 107 ? 15.983  25.546  -7.307  1.00 10.00 ? 425 VAL B H    4  
ATOM 10931  N N    . LEU B 2 108 ? 17.201  22.932  -6.203  1.00 10.00 ? 426 LEU B N    4  
ATOM 10932  C CA   . LEU B 2 108 ? 18.231  21.903  -6.050  1.00 10.00 ? 426 LEU B CA   4  
ATOM 10933  C C    . LEU B 2 108 ? 19.246  22.070  -4.929  1.00 10.00 ? 426 LEU B C    4  
ATOM 10934  O O    . LEU B 2 108 ? 19.421  21.133  -4.153  1.00 10.00 ? 426 LEU B O    4  
ATOM 10935  C CB   . LEU B 2 108 ? 18.963  21.704  -7.386  1.00 10.00 ? 426 LEU B CB   4  
ATOM 10936  C CG   . LEU B 2 108 ? 20.192  20.788  -7.376  1.00 10.00 ? 426 LEU B CG   4  
ATOM 10937  C CD1  . LEU B 2 108 ? 19.778  19.326  -7.406  1.00 10.00 ? 426 LEU B CD1  4  
ATOM 10938  C CD2  . LEU B 2 108 ? 21.111  21.109  -8.542  1.00 10.00 ? 426 LEU B CD2  4  
ATOM 10939  H H    . LEU B 2 108 ? 16.832  23.002  -7.104  1.00 10.00 ? 426 LEU B H    4  
ATOM 10940  N N    . GLU B 2 109 ? 19.911  23.208  -4.775  1.00 10.00 ? 427 GLU B N    4  
ATOM 10941  C CA   . GLU B 2 109 ? 20.919  23.308  -3.730  1.00 10.00 ? 427 GLU B CA   4  
ATOM 10942  C C    . GLU B 2 109 ? 20.290  23.670  -2.387  1.00 10.00 ? 427 GLU B C    4  
ATOM 10943  O O    . GLU B 2 109 ? 20.882  23.454  -1.327  1.00 10.00 ? 427 GLU B O    4  
ATOM 10944  C CB   . GLU B 2 109 ? 22.065  24.245  -4.108  1.00 10.00 ? 427 GLU B CB   4  
ATOM 10945  C CG   . GLU B 2 109 ? 21.642  25.637  -4.534  1.00 10.00 ? 427 GLU B CG   4  
ATOM 10946  C CD   . GLU B 2 109 ? 22.749  26.652  -4.349  1.00 10.00 ? 427 GLU B CD   4  
ATOM 10947  O OE1  . GLU B 2 109 ? 23.873  26.258  -3.952  1.00 10.00 ? 427 GLU B OE1  4  
ATOM 10948  O OE2  . GLU B 2 109 ? 22.500  27.850  -4.594  1.00 10.00 ? 427 GLU B OE2  4  
ATOM 10949  H H    . GLU B 2 109 ? 19.657  24.065  -5.174  1.00 10.00 ? 427 GLU B H    4  
ATOM 10950  N N    . ARG B 2 110 ? 19.051  24.162  -2.452  1.00 10.00 ? 428 ARG B N    4  
ATOM 10951  C CA   . ARG B 2 110 ? 18.355  24.621  -1.251  1.00 10.00 ? 428 ARG B CA   4  
ATOM 10952  C C    . ARG B 2 110 ? 18.114  23.448  -0.309  1.00 10.00 ? 428 ARG B C    4  
ATOM 10953  O O    . ARG B 2 110 ? 18.246  23.572  0.908   1.00 10.00 ? 428 ARG B O    4  
ATOM 10954  C CB   . ARG B 2 110 ? 17.035  25.319  -1.580  1.00 10.00 ? 428 ARG B CB   4  
ATOM 10955  C CG   . ARG B 2 110 ? 16.423  26.042  -0.391  1.00 10.00 ? 428 ARG B CG   4  
ATOM 10956  C CD   . ARG B 2 110 ? 15.049  26.598  -0.720  1.00 10.00 ? 428 ARG B CD   4  
ATOM 10957  N NE   . ARG B 2 110 ? 14.522  27.429  0.364   1.00 10.00 ? 428 ARG B NE   4  
ATOM 10958  C CZ   . ARG B 2 110 ? 13.570  28.352  0.208   1.00 10.00 ? 428 ARG B CZ   4  
ATOM 10959  N NH1  . ARG B 2 110 ? 13.004  28.537  -0.981  1.00 10.00 ? 428 ARG B NH1  4  
ATOM 10960  N NH2  . ARG B 2 110 ? 13.184  29.085  1.248   1.00 10.00 ? 428 ARG B NH2  4  
ATOM 10961  H H    . ARG B 2 110 ? 18.555  23.999  -3.281  1.00 10.00 ? 428 ARG B H    4  
ATOM 10962  H HE   . ARG B 2 110 ? 14.915  27.303  1.259   1.00 10.00 ? 428 ARG B HE   4  
ATOM 10963  H HH11 . ARG B 2 110 ? 13.289  27.985  -1.769  1.00 10.00 ? 428 ARG B HH11 4  
ATOM 10964  H HH12 . ARG B 2 110 ? 12.287  29.233  -1.098  1.00 10.00 ? 428 ARG B HH12 4  
ATOM 10965  H HH21 . ARG B 2 110 ? 13.609  28.944  2.150   1.00 10.00 ? 428 ARG B HH21 4  
ATOM 10966  H HH22 . ARG B 2 110 ? 12.476  29.794  1.134   1.00 10.00 ? 428 ARG B HH22 4  
ATOM 10967  N N    . PHE B 2 111 ? 17.764  22.302  -0.882  1.00 10.00 ? 429 PHE B N    4  
ATOM 10968  C CA   . PHE B 2 111 ? 17.529  21.081  -0.122  1.00 10.00 ? 429 PHE B CA   4  
ATOM 10969  C C    . PHE B 2 111 ? 18.870  20.434  0.232   1.00 10.00 ? 429 PHE B C    4  
ATOM 10970  O O    . PHE B 2 111 ? 18.987  19.687  1.207   1.00 10.00 ? 429 PHE B O    4  
ATOM 10971  C CB   . PHE B 2 111 ? 16.671  20.146  -0.992  1.00 10.00 ? 429 PHE B CB   4  
ATOM 10972  C CG   . PHE B 2 111 ? 16.614  18.703  -0.573  1.00 10.00 ? 429 PHE B CG   4  
ATOM 10973  C CD1  . PHE B 2 111 ? 15.809  18.297  0.478   1.00 10.00 ? 429 PHE B CD1  4  
ATOM 10974  C CD2  . PHE B 2 111 ? 17.351  17.749  -1.254  1.00 10.00 ? 429 PHE B CD2  4  
ATOM 10975  C CE1  . PHE B 2 111 ? 15.743  16.963  0.841   1.00 10.00 ? 429 PHE B CE1  4  
ATOM 10976  C CE2  . PHE B 2 111 ? 17.293  16.417  -0.895  1.00 10.00 ? 429 PHE B CE2  4  
ATOM 10977  C CZ   . PHE B 2 111 ? 16.487  16.023  0.154   1.00 10.00 ? 429 PHE B CZ   4  
ATOM 10978  H H    . PHE B 2 111 ? 17.634  22.237  -1.851  1.00 10.00 ? 429 PHE B H    4  
ATOM 10979  N N    . VAL B 2 112 ? 19.883  20.751  -0.564  1.00 10.00 ? 430 VAL B N    4  
ATOM 10980  C CA   . VAL B 2 112 ? 21.220  20.211  -0.365  1.00 10.00 ? 430 VAL B CA   4  
ATOM 10981  C C    . VAL B 2 112 ? 21.823  20.821  0.899   1.00 10.00 ? 430 VAL B C    4  
ATOM 10982  O O    . VAL B 2 112 ? 22.399  20.121  1.732   1.00 10.00 ? 430 VAL B O    4  
ATOM 10983  C CB   . VAL B 2 112 ? 22.130  20.489  -1.584  1.00 10.00 ? 430 VAL B CB   4  
ATOM 10984  C CG1  . VAL B 2 112 ? 23.586  20.213  -1.252  1.00 10.00 ? 430 VAL B CG1  4  
ATOM 10985  C CG2  . VAL B 2 112 ? 21.696  19.646  -2.774  1.00 10.00 ? 430 VAL B CG2  4  
ATOM 10986  H H    . VAL B 2 112 ? 19.744  21.434  -1.250  1.00 10.00 ? 430 VAL B H    4  
ATOM 10987  N N    . GLU B 2 113 ? 21.662  22.133  1.044   1.00 10.00 ? 431 GLU B N    4  
ATOM 10988  C CA   . GLU B 2 113 ? 22.150  22.845  2.220   1.00 10.00 ? 431 GLU B CA   4  
ATOM 10989  C C    . GLU B 2 113 ? 21.314  22.472  3.445   1.00 10.00 ? 431 GLU B C    4  
ATOM 10990  O O    . GLU B 2 113 ? 21.775  22.569  4.583   1.00 10.00 ? 431 GLU B O    4  
ATOM 10991  C CB   . GLU B 2 113 ? 22.190  24.363  2.005   1.00 10.00 ? 431 GLU B CB   4  
ATOM 10992  C CG   . GLU B 2 113 ? 20.836  25.010  1.774   1.00 10.00 ? 431 GLU B CG   4  
ATOM 10993  C CD   . GLU B 2 113 ? 20.841  26.491  2.091   1.00 10.00 ? 431 GLU B CD   4  
ATOM 10994  O OE1  . GLU B 2 113 ? 21.549  26.900  3.038   1.00 10.00 ? 431 GLU B OE1  4  
ATOM 10995  O OE2  . GLU B 2 113 ? 20.131  27.251  1.406   1.00 10.00 ? 431 GLU B OE2  4  
ATOM 10996  H H    . GLU B 2 113 ? 21.211  22.643  0.330   1.00 10.00 ? 431 GLU B H    4  
ATOM 10997  N N    . GLU B 2 114 ? 20.082  22.029  3.187   1.00 10.00 ? 432 GLU B N    4  
ATOM 10998  C CA   . GLU B 2 114 ? 19.145  21.661  4.240   1.00 10.00 ? 432 GLU B CA   4  
ATOM 10999  C C    . GLU B 2 114 ? 19.650  20.419  4.969   1.00 10.00 ? 432 GLU B C    4  
ATOM 11000  O O    . GLU B 2 114 ? 19.854  20.440  6.185   1.00 10.00 ? 432 GLU B O    4  
ATOM 11001  C CB   . GLU B 2 114 ? 17.788  21.362  3.596   1.00 10.00 ? 432 GLU B CB   4  
ATOM 11002  C CG   . GLU B 2 114 ? 16.612  21.374  4.549   1.00 10.00 ? 432 GLU B CG   4  
ATOM 11003  C CD   . GLU B 2 114 ? 16.569  22.626  5.393   1.00 10.00 ? 432 GLU B CD   4  
ATOM 11004  O OE1  . GLU B 2 114 ? 16.496  23.736  4.821   1.00 10.00 ? 432 GLU B OE1  4  
ATOM 11005  O OE2  . GLU B 2 114 ? 16.607  22.507  6.634   1.00 10.00 ? 432 GLU B OE2  4  
ATOM 11006  H H    . GLU B 2 114 ? 19.827  21.858  2.259   1.00 10.00 ? 432 GLU B H    4  
ATOM 11007  N N    . CYS B 2 115 ? 19.869  19.341  4.226   1.00 10.00 ? 433 CYS B N    4  
ATOM 11008  C CA   . CYS B 2 115 ? 20.380  18.105  4.796   1.00 10.00 ? 433 CYS B CA   4  
ATOM 11009  C C    . CYS B 2 115 ? 21.788  18.270  5.371   1.00 10.00 ? 433 CYS B C    4  
ATOM 11010  O O    . CYS B 2 115 ? 22.213  17.486  6.223   1.00 10.00 ? 433 CYS B O    4  
ATOM 11011  C CB   . CYS B 2 115 ? 20.341  16.994  3.745   1.00 10.00 ? 433 CYS B CB   4  
ATOM 11012  S SG   . CYS B 2 115 ? 18.783  16.898  2.834   1.00 10.00 ? 433 CYS B SG   4  
ATOM 11013  H H    . CYS B 2 115 ? 19.596  19.312  3.286   1.00 10.00 ? 433 CYS B H    4  
ATOM 11014  H HG   . CYS B 2 115 ? 18.988  17.404  1.624   1.00 10.00 ? 433 CYS B HG   4  
ATOM 11015  N N    . PHE B 2 116 ? 22.498  19.303  4.931   1.00 10.00 ? 434 PHE B N    4  
ATOM 11016  C CA   . PHE B 2 116 ? 23.858  19.564  5.390   1.00 10.00 ? 434 PHE B CA   4  
ATOM 11017  C C    . PHE B 2 116 ? 23.784  20.120  6.818   1.00 10.00 ? 434 PHE B C    4  
ATOM 11018  O O    . PHE B 2 116 ? 24.737  20.083  7.599   1.00 10.00 ? 434 PHE B O    4  
ATOM 11019  C CB   . PHE B 2 116 ? 24.443  20.632  4.453   1.00 10.00 ? 434 PHE B CB   4  
ATOM 11020  C CG   . PHE B 2 116 ? 25.926  20.798  4.530   1.00 10.00 ? 434 PHE B CG   4  
ATOM 11021  C CD1  . PHE B 2 116 ? 26.760  19.699  4.452   1.00 10.00 ? 434 PHE B CD1  4  
ATOM 11022  C CD2  . PHE B 2 116 ? 26.483  22.055  4.679   1.00 10.00 ? 434 PHE B CD2  4  
ATOM 11023  C CE1  . PHE B 2 116 ? 28.131  19.849  4.524   1.00 10.00 ? 434 PHE B CE1  4  
ATOM 11024  C CE2  . PHE B 2 116 ? 27.849  22.216  4.752   1.00 10.00 ? 434 PHE B CE2  4  
ATOM 11025  C CZ   . PHE B 2 116 ? 28.676  21.112  4.675   1.00 10.00 ? 434 PHE B CZ   4  
ATOM 11026  H H    . PHE B 2 116 ? 22.088  19.994  4.367   1.00 10.00 ? 434 PHE B H    4  
ATOM 11027  N N    . GLN B 2 117 ? 22.588  20.582  7.125   1.00 10.00 ? 435 GLN B N    4  
ATOM 11028  C CA   . GLN B 2 117 ? 22.303  21.188  8.417   1.00 10.00 ? 435 GLN B CA   4  
ATOM 11029  C C    . GLN B 2 117 ? 21.883  20.175  9.477   1.00 10.00 ? 435 GLN B C    4  
ATOM 11030  O O    . GLN B 2 117 ? 22.282  20.262  10.642  1.00 10.00 ? 435 GLN B O    4  
ATOM 11031  C CB   . GLN B 2 117 ? 21.377  22.391  8.329   1.00 10.00 ? 435 GLN B CB   4  
ATOM 11032  C CG   . GLN B 2 117 ? 22.095  23.652  7.891   1.00 10.00 ? 435 GLN B CG   4  
ATOM 11033  C CD   . GLN B 2 117 ? 21.137  24.777  7.578   1.00 10.00 ? 435 GLN B CD   4  
ATOM 11034  O OE1  . GLN B 2 117 ? 20.820  25.602  8.437   1.00 10.00 ? 435 GLN B OE1  4  
ATOM 11035  N NE2  . GLN B 2 117 ? 20.663  24.810  6.348   1.00 10.00 ? 435 GLN B NE2  4  
ATOM 11036  H H    . GLN B 2 117 ? 21.886  20.268  6.524   1.00 10.00 ? 435 GLN B H    4  
ATOM 11037  H HE21 . GLN B 2 117 ? 20.955  24.110  5.720   1.00 10.00 ? 435 GLN B HE21 4  
ATOM 11038  H HE22 . GLN B 2 117 ? 20.040  25.532  6.108   1.00 10.00 ? 435 GLN B HE22 4  
ATOM 11039  N N    . ALA B 2 118 ? 21.072  19.211  9.054   1.00 10.00 ? 436 ALA B N    4  
ATOM 11040  C CA   . ALA B 2 118 ? 20.538  18.184  9.950   1.00 10.00 ? 436 ALA B CA   4  
ATOM 11041  C C    . ALA B 2 118 ? 21.530  17.084  10.308  1.00 10.00 ? 436 ALA B C    4  
ATOM 11042  O O    . ALA B 2 118 ? 21.214  16.195  11.107  1.00 10.00 ? 436 ALA B O    4  
ATOM 11043  C CB   . ALA B 2 118 ? 19.283  17.575  9.353   1.00 10.00 ? 436 ALA B CB   4  
ATOM 11044  H H    . ALA B 2 118 ? 20.811  19.185  8.109   1.00 10.00 ? 436 ALA B H    4  
ATOM 11045  N N    . GLY B 2 119 ? 22.705  17.108  9.704   1.00 10.00 ? 437 GLY B N    4  
ATOM 11046  C CA   . GLY B 2 119 ? 23.692  16.090  9.994   1.00 10.00 ? 437 GLY B CA   4  
ATOM 11047  C C    . GLY B 2 119 ? 23.429  14.842  9.179   1.00 10.00 ? 437 GLY B C    4  
ATOM 11048  O O    . GLY B 2 119 ? 23.734  13.728  9.606   1.00 10.00 ? 437 GLY B O    4  
ATOM 11049  H H    . GLY B 2 119 ? 22.894  17.783  9.027   1.00 10.00 ? 437 GLY B H    4  
ATOM 11050  N N    . ILE B 2 120 ? 22.838  15.038  8.005   1.00 10.00 ? 438 ILE B N    4  
ATOM 11051  C CA   . ILE B 2 120 ? 22.524  13.934  7.112   1.00 10.00 ? 438 ILE B CA   4  
ATOM 11052  C C    . ILE B 2 120 ? 23.711  13.650  6.199   1.00 10.00 ? 438 ILE B C    4  
ATOM 11053  O O    . ILE B 2 120 ? 24.376  12.625  6.332   1.00 10.00 ? 438 ILE B O    4  
ATOM 11054  C CB   . ILE B 2 120 ? 21.258  14.221  6.268   1.00 10.00 ? 438 ILE B CB   4  
ATOM 11055  C CG1  . ILE B 2 120 ? 20.013  14.231  7.162   1.00 10.00 ? 438 ILE B CG1  4  
ATOM 11056  C CG2  . ILE B 2 120 ? 21.100  13.204  5.144   1.00 10.00 ? 438 ILE B CG2  4  
ATOM 11057  C CD1  . ILE B 2 120 ? 18.762  14.727  6.470   1.00 10.00 ? 438 ILE B CD1  4  
ATOM 11058  H H    . ILE B 2 120 ? 22.624  15.957  7.740   1.00 10.00 ? 438 ILE B H    4  
ATOM 11059  N N    . ILE B 2 121 ? 23.977  14.574  5.285   1.00 10.00 ? 439 ILE B N    4  
ATOM 11060  C CA   . ILE B 2 121 ? 25.082  14.421  4.354   1.00 10.00 ? 439 ILE B CA   4  
ATOM 11061  C C    . ILE B 2 121 ? 26.394  14.872  4.990   1.00 10.00 ? 439 ILE B C    4  
ATOM 11062  O O    . ILE B 2 121 ? 26.535  14.866  6.214   1.00 10.00 ? 439 ILE B O    4  
ATOM 11063  C CB   . ILE B 2 121 ? 24.833  15.178  3.028   1.00 10.00 ? 439 ILE B CB   4  
ATOM 11064  C CG1  . ILE B 2 121 ? 24.592  16.668  3.286   1.00 10.00 ? 439 ILE B CG1  4  
ATOM 11065  C CG2  . ILE B 2 121 ? 23.652  14.567  2.282   1.00 10.00 ? 439 ILE B CG2  4  
ATOM 11066  C CD1  . ILE B 2 121 ? 24.617  17.517  2.033   1.00 10.00 ? 439 ILE B CD1  4  
ATOM 11067  H H    . ILE B 2 121 ? 23.396  15.357  5.218   1.00 10.00 ? 439 ILE B H    4  
ATOM 11068  N N    . SER B 2 122 ? 27.337  15.278  4.160   1.00 10.00 ? 440 SER B N    4  
ATOM 11069  C CA   . SER B 2 122 ? 28.638  15.715  4.622   1.00 10.00 ? 440 SER B CA   4  
ATOM 11070  C C    . SER B 2 122 ? 29.242  16.613  3.556   1.00 10.00 ? 440 SER B C    4  
ATOM 11071  O O    . SER B 2 122 ? 28.676  16.738  2.466   1.00 10.00 ? 440 SER B O    4  
ATOM 11072  C CB   . SER B 2 122 ? 29.531  14.490  4.838   1.00 10.00 ? 440 SER B CB   4  
ATOM 11073  O OG   . SER B 2 122 ? 29.420  13.586  3.747   1.00 10.00 ? 440 SER B OG   4  
ATOM 11074  H H    . SER B 2 122 ? 27.145  15.328  3.201   1.00 10.00 ? 440 SER B H    4  
ATOM 11075  H HG   . SER B 2 122 ? 29.718  12.710  4.024   1.00 10.00 ? 440 SER B HG   4  
ATOM 11076  N N    . LYS B 2 123 ? 30.377  17.238  3.854   1.00 10.00 ? 441 LYS B N    4  
ATOM 11077  C CA   . LYS B 2 123 ? 31.032  18.102  2.882   1.00 10.00 ? 441 LYS B CA   4  
ATOM 11078  C C    . LYS B 2 123 ? 31.418  17.259  1.675   1.00 10.00 ? 441 LYS B C    4  
ATOM 11079  O O    . LYS B 2 123 ? 31.107  17.599  0.544   1.00 10.00 ? 441 LYS B O    4  
ATOM 11080  C CB   . LYS B 2 123 ? 32.266  18.767  3.497   1.00 10.00 ? 441 LYS B CB   4  
ATOM 11081  C CG   . LYS B 2 123 ? 31.968  19.536  4.775   1.00 10.00 ? 441 LYS B CG   4  
ATOM 11082  C CD   . LYS B 2 123 ? 33.169  20.344  5.237   1.00 10.00 ? 441 LYS B CD   4  
ATOM 11083  C CE   . LYS B 2 123 ? 34.334  19.450  5.630   1.00 10.00 ? 441 LYS B CE   4  
ATOM 11084  N NZ   . LYS B 2 123 ? 35.410  20.220  6.307   1.00 10.00 ? 441 LYS B NZ   4  
ATOM 11085  H H    . LYS B 2 123 ? 30.785  17.107  4.737   1.00 10.00 ? 441 LYS B H    4  
ATOM 11086  H HZ1  . LYS B 2 123 ? 35.627  21.081  5.767   1.00 10.00 ? 441 LYS B HZ1  4  
ATOM 11087  H HZ2  . LYS B 2 123 ? 36.273  19.643  6.378   1.00 10.00 ? 441 LYS B HZ2  4  
ATOM 11088  H HZ3  . LYS B 2 123 ? 35.109  20.489  7.264   1.00 10.00 ? 441 LYS B HZ3  4  
ATOM 11089  N N    . GLN B 2 124 ? 32.125  16.175  1.963   1.00 10.00 ? 442 GLN B N    4  
ATOM 11090  C CA   . GLN B 2 124 ? 32.536  15.208  0.942   1.00 10.00 ? 442 GLN B CA   4  
ATOM 11091  C C    . GLN B 2 124 ? 31.404  14.898  -0.046  1.00 10.00 ? 442 GLN B C    4  
ATOM 11092  O O    . GLN B 2 124 ? 31.622  14.873  -1.259  1.00 10.00 ? 442 GLN B O    4  
ATOM 11093  C CB   . GLN B 2 124 ? 33.054  13.915  1.584   1.00 10.00 ? 442 GLN B CB   4  
ATOM 11094  C CG   . GLN B 2 124 ? 33.424  12.830  0.580   1.00 10.00 ? 442 GLN B CG   4  
ATOM 11095  C CD   . GLN B 2 124 ? 32.327  11.798  0.399   1.00 10.00 ? 442 GLN B CD   4  
ATOM 11096  O OE1  . GLN B 2 124 ? 32.059  11.342  -0.713  1.00 10.00 ? 442 GLN B OE1  4  
ATOM 11097  N NE2  . GLN B 2 124 ? 31.703  11.406  1.497   1.00 10.00 ? 442 GLN B NE2  4  
ATOM 11098  H H    . GLN B 2 124 ? 32.470  16.122  2.879   1.00 10.00 ? 442 GLN B H    4  
ATOM 11099  H HE21 . GLN B 2 124 ? 31.984  11.798  2.353   1.00 10.00 ? 442 GLN B HE21 4  
ATOM 11100  H HE22 . GLN B 2 124 ? 30.995  10.739  1.416   1.00 10.00 ? 442 GLN B HE22 4  
ATOM 11101  N N    . LEU B 2 125 ? 30.196  14.683  0.476   1.00 10.00 ? 443 LEU B N    4  
ATOM 11102  C CA   . LEU B 2 125 ? 29.045  14.373  -0.364  1.00 10.00 ? 443 LEU B CA   4  
ATOM 11103  C C    . LEU B 2 125 ? 28.510  15.615  -1.070  1.00 10.00 ? 443 LEU B C    4  
ATOM 11104  O O    . LEU B 2 125 ? 28.157  15.560  -2.243  1.00 10.00 ? 443 LEU B O    4  
ATOM 11105  C CB   . LEU B 2 125 ? 27.938  13.687  0.437   1.00 10.00 ? 443 LEU B CB   4  
ATOM 11106  C CG   . LEU B 2 125 ? 26.728  13.190  -0.364  1.00 10.00 ? 443 LEU B CG   4  
ATOM 11107  C CD1  . LEU B 2 125 ? 27.172  12.399  -1.587  1.00 10.00 ? 443 LEU B CD1  4  
ATOM 11108  C CD2  . LEU B 2 125 ? 25.821  12.341  0.516   1.00 10.00 ? 443 LEU B CD2  4  
ATOM 11109  H H    . LEU B 2 125 ? 30.078  14.740  1.447   1.00 10.00 ? 443 LEU B H    4  
ATOM 11110  N N    . ARG B 2 126 ? 28.482  16.741  -0.371  1.00 10.00 ? 444 ARG B N    4  
ATOM 11111  C CA   . ARG B 2 126 ? 28.000  17.999  -0.927  1.00 10.00 ? 444 ARG B CA   4  
ATOM 11112  C C    . ARG B 2 126 ? 28.979  18.542  -1.964  1.00 10.00 ? 444 ARG B C    4  
ATOM 11113  O O    . ARG B 2 126 ? 28.648  19.422  -2.752  1.00 10.00 ? 444 ARG B O    4  
ATOM 11114  C CB   . ARG B 2 126 ? 27.758  19.043  0.173   1.00 10.00 ? 444 ARG B CB   4  
ATOM 11115  C CG   . ARG B 2 126 ? 26.873  20.201  -0.276  1.00 10.00 ? 444 ARG B CG   4  
ATOM 11116  C CD   . ARG B 2 126 ? 27.018  21.420  0.615   1.00 10.00 ? 444 ARG B CD   4  
ATOM 11117  N NE   . ARG B 2 126 ? 26.443  22.621  -0.003  1.00 10.00 ? 444 ARG B NE   4  
ATOM 11118  C CZ   . ARG B 2 126 ? 26.411  23.816  0.586   1.00 10.00 ? 444 ARG B CZ   4  
ATOM 11119  N NH1  . ARG B 2 126 ? 26.901  23.961  1.806   1.00 10.00 ? 444 ARG B NH1  4  
ATOM 11120  N NH2  . ARG B 2 126 ? 25.889  24.865  -0.044  1.00 10.00 ? 444 ARG B NH2  4  
ATOM 11121  H H    . ARG B 2 126 ? 28.835  16.784  0.545   1.00 10.00 ? 444 ARG B H    4  
ATOM 11122  H HE   . ARG B 2 126 ? 26.067  22.530  -0.909  1.00 10.00 ? 444 ARG B HE   4  
ATOM 11123  H HH11 . ARG B 2 126 ? 27.295  23.179  2.286   1.00 10.00 ? 444 ARG B HH11 4  
ATOM 11124  H HH12 . ARG B 2 126 ? 26.872  24.859  2.257   1.00 10.00 ? 444 ARG B HH12 4  
ATOM 11125  H HH21 . ARG B 2 126 ? 25.512  24.770  -0.971  1.00 10.00 ? 444 ARG B HH21 4  
ATOM 11126  H HH22 . ARG B 2 126 ? 25.870  25.765  0.405   1.00 10.00 ? 444 ARG B HH22 4  
ATOM 11127  N N    . ASP B 2 127 ? 30.194  18.020  -1.946  1.00 10.00 ? 445 ASP B N    4  
ATOM 11128  C CA   . ASP B 2 127 ? 31.241  18.525  -2.821  1.00 10.00 ? 445 ASP B CA   4  
ATOM 11129  C C    . ASP B 2 127 ? 30.892  18.297  -4.286  1.00 10.00 ? 445 ASP B C    4  
ATOM 11130  O O    . ASP B 2 127 ? 31.238  19.100  -5.146  1.00 10.00 ? 445 ASP B O    4  
ATOM 11131  C CB   . ASP B 2 127 ? 32.574  17.854  -2.497  1.00 10.00 ? 445 ASP B CB   4  
ATOM 11132  C CG   . ASP B 2 127 ? 33.716  18.429  -3.301  1.00 10.00 ? 445 ASP B CG   4  
ATOM 11133  O OD1  . ASP B 2 127 ? 34.080  19.600  -3.064  1.00 10.00 ? 445 ASP B OD1  4  
ATOM 11134  O OD2  . ASP B 2 127 ? 34.259  17.716  -4.170  1.00 10.00 ? 445 ASP B OD2  4  
ATOM 11135  H H    . ASP B 2 127 ? 30.324  17.150  -1.519  1.00 10.00 ? 445 ASP B H    4  
ATOM 11136  N N    . LEU B 2 128 ? 30.172  17.212  -4.559  1.00 10.00 ? 446 LEU B N    4  
ATOM 11137  C CA   . LEU B 2 128 ? 29.780  16.872  -5.925  1.00 10.00 ? 446 LEU B CA   4  
ATOM 11138  C C    . LEU B 2 128 ? 28.607  17.720  -6.408  1.00 10.00 ? 446 LEU B C    4  
ATOM 11139  O O    . LEU B 2 128 ? 28.171  17.595  -7.552  1.00 10.00 ? 446 LEU B O    4  
ATOM 11140  C CB   . LEU B 2 128 ? 29.440  15.383  -6.051  1.00 10.00 ? 446 LEU B CB   4  
ATOM 11141  C CG   . LEU B 2 128 ? 30.614  14.408  -5.948  1.00 10.00 ? 446 LEU B CG   4  
ATOM 11142  C CD1  . LEU B 2 128 ? 30.635  13.741  -4.584  1.00 10.00 ? 446 LEU B CD1  4  
ATOM 11143  C CD2  . LEU B 2 128 ? 30.547  13.367  -7.055  1.00 10.00 ? 446 LEU B CD2  4  
ATOM 11144  H H    . LEU B 2 128 ? 29.891  16.628  -3.822  1.00 10.00 ? 446 LEU B H    4  
ATOM 11145  N N    . CYS B 2 129 ? 28.100  18.583  -5.537  1.00 10.00 ? 447 CYS B N    4  
ATOM 11146  C CA   . CYS B 2 129 ? 26.981  19.442  -5.887  1.00 10.00 ? 447 CYS B CA   4  
ATOM 11147  C C    . CYS B 2 129 ? 27.477  20.729  -6.536  1.00 10.00 ? 447 CYS B C    4  
ATOM 11148  O O    . CYS B 2 129 ? 28.533  21.249  -6.169  1.00 10.00 ? 447 CYS B O    4  
ATOM 11149  C CB   . CYS B 2 129 ? 26.133  19.761  -4.648  1.00 10.00 ? 447 CYS B CB   4  
ATOM 11150  S SG   . CYS B 2 129 ? 26.602  21.268  -3.763  1.00 10.00 ? 447 CYS B SG   4  
ATOM 11151  H H    . CYS B 2 129 ? 28.492  18.650  -4.641  1.00 10.00 ? 447 CYS B H    4  
ATOM 11152  H HG   . CYS B 2 129 ? 27.789  21.656  -4.222  1.00 10.00 ? 447 CYS B HG   4  
ATOM 11153  N N    . PRO B 2 130 ? 26.726  21.253  -7.517  1.00 10.00 ? 448 PRO B N    4  
ATOM 11154  C CA   . PRO B 2 130 ? 27.085  22.493  -8.211  1.00 10.00 ? 448 PRO B CA   4  
ATOM 11155  C C    . PRO B 2 130 ? 26.827  23.721  -7.337  1.00 10.00 ? 448 PRO B C    4  
ATOM 11156  O O    . PRO B 2 130 ? 25.914  24.506  -7.601  1.00 10.00 ? 448 PRO B O    4  
ATOM 11157  C CB   . PRO B 2 130 ? 26.147  22.498  -9.419  1.00 10.00 ? 448 PRO B CB   4  
ATOM 11158  C CG   . PRO B 2 130 ? 24.958  21.718  -8.975  1.00 10.00 ? 448 PRO B CG   4  
ATOM 11159  C CD   . PRO B 2 130 ? 25.478  20.667  -8.035  1.00 10.00 ? 448 PRO B CD   4  
ATOM 11160  N N    . SER B 2 131 ? 27.627  23.870  -6.293  1.00 10.00 ? 449 SER B N    4  
ATOM 11161  C CA   . SER B 2 131 ? 27.495  24.991  -5.377  1.00 10.00 ? 449 SER B CA   4  
ATOM 11162  C C    . SER B 2 131 ? 28.025  26.276  -6.012  1.00 10.00 ? 449 SER B C    4  
ATOM 11163  O O    . SER B 2 131 ? 27.246  26.967  -6.701  1.00 10.00 ? 449 SER B O    4  
ATOM 11164  C CB   . SER B 2 131 ? 28.238  24.678  -4.074  1.00 10.00 ? 449 SER B CB   4  
ATOM 11165  O OG   . SER B 2 131 ? 29.024  23.500  -4.215  1.00 10.00 ? 449 SER B OG   4  
ATOM 11166  O OXT  . SER B 2 131 ? 29.223  26.582  -5.834  1.00 10.00 ? 449 SER B OXT  4  
ATOM 11167  H H    . SER B 2 131 ? 28.325  23.198  -6.126  1.00 10.00 ? 449 SER B H    4  
ATOM 11168  H HG   . SER B 2 131 ? 29.809  23.701  -4.744  1.00 10.00 ? 449 SER B HG   4  
ATOM 11169  N N    . GLY A 1 1   ? -29.066 -4.968  6.342   1.00 10.00 ? 156 GLY A N    5  
ATOM 11170  C CA   . GLY A 1 1   ? -29.848 -5.407  7.521   1.00 10.00 ? 156 GLY A CA   5  
ATOM 11171  C C    . GLY A 1 1   ? -28.949 -5.910  8.629   1.00 10.00 ? 156 GLY A C    5  
ATOM 11172  O O    . GLY A 1 1   ? -27.757 -5.596  8.660   1.00 10.00 ? 156 GLY A O    5  
ATOM 11173  H H1   . GLY A 1 1   ? -28.438 -5.742  6.023   1.00 10.00 ? 156 GLY A H1   5  
ATOM 11174  H H2   . GLY A 1 1   ? -28.484 -4.144  6.587   1.00 10.00 ? 156 GLY A H2   5  
ATOM 11175  H H3   . GLY A 1 1   ? -29.704 -4.712  5.565   1.00 10.00 ? 156 GLY A H3   5  
ATOM 11176  N N    . LEU A 1 2   ? -29.514 -6.692  9.534   1.00 10.00 ? 157 LEU A N    5  
ATOM 11177  C CA   . LEU A 1 2   ? -28.763 -7.243  10.649  1.00 10.00 ? 157 LEU A CA   5  
ATOM 11178  C C    . LEU A 1 2   ? -28.728 -8.761  10.553  1.00 10.00 ? 157 LEU A C    5  
ATOM 11179  O O    . LEU A 1 2   ? -29.724 -9.383  10.183  1.00 10.00 ? 157 LEU A O    5  
ATOM 11180  C CB   . LEU A 1 2   ? -29.377 -6.798  11.976  1.00 10.00 ? 157 LEU A CB   5  
ATOM 11181  C CG   . LEU A 1 2   ? -29.276 -5.302  12.279  1.00 10.00 ? 157 LEU A CG   5  
ATOM 11182  C CD1  . LEU A 1 2   ? -30.033 -4.961  13.550  1.00 10.00 ? 157 LEU A CD1  5  
ATOM 11183  C CD2  . LEU A 1 2   ? -27.821 -4.874  12.388  1.00 10.00 ? 157 LEU A CD2  5  
ATOM 11184  H H    . LEU A 1 2   ? -30.467 -6.914  9.447   1.00 10.00 ? 157 LEU A H    5  
ATOM 11185  N N    . PRO A 1 3   ? -27.584 -9.376  10.873  1.00 10.00 ? 158 PRO A N    5  
ATOM 11186  C CA   . PRO A 1 3   ? -27.420 -10.825 10.803  1.00 10.00 ? 158 PRO A CA   5  
ATOM 11187  C C    . PRO A 1 3   ? -28.022 -11.528 12.013  1.00 10.00 ? 158 PRO A C    5  
ATOM 11188  O O    . PRO A 1 3   ? -27.900 -11.058 13.144  1.00 10.00 ? 158 PRO A O    5  
ATOM 11189  C CB   . PRO A 1 3   ? -25.895 -11.021 10.790  1.00 10.00 ? 158 PRO A CB   5  
ATOM 11190  C CG   . PRO A 1 3   ? -25.289 -9.653  10.866  1.00 10.00 ? 158 PRO A CG   5  
ATOM 11191  C CD   . PRO A 1 3   ? -26.362 -8.721  11.345  1.00 10.00 ? 158 PRO A CD   5  
ATOM 11192  N N    . LEU A 1 4   ? -28.676 -12.653 11.770  1.00 10.00 ? 159 LEU A N    5  
ATOM 11193  C CA   . LEU A 1 4   ? -29.283 -13.426 12.842  1.00 10.00 ? 159 LEU A CA   5  
ATOM 11194  C C    . LEU A 1 4   ? -28.375 -14.586 13.245  1.00 10.00 ? 159 LEU A C    5  
ATOM 11195  O O    . LEU A 1 4   ? -28.171 -15.519 12.467  1.00 10.00 ? 159 LEU A O    5  
ATOM 11196  C CB   . LEU A 1 4   ? -30.665 -13.947 12.427  1.00 10.00 ? 159 LEU A CB   5  
ATOM 11197  C CG   . LEU A 1 4   ? -31.835 -12.959 12.544  1.00 10.00 ? 159 LEU A CG   5  
ATOM 11198  C CD1  . LEU A 1 4   ? -31.784 -11.908 11.447  1.00 10.00 ? 159 LEU A CD1  5  
ATOM 11199  C CD2  . LEU A 1 4   ? -33.165 -13.695 12.519  1.00 10.00 ? 159 LEU A CD2  5  
ATOM 11200  H H    . LEU A 1 4   ? -28.757 -12.969 10.850  1.00 10.00 ? 159 LEU A H    5  
ATOM 11201  N N    . ASP A 1 5   ? -27.821 -14.496 14.456  1.00 10.00 ? 160 ASP A N    5  
ATOM 11202  C CA   . ASP A 1 5   ? -26.933 -15.521 15.016  1.00 10.00 ? 160 ASP A CA   5  
ATOM 11203  C C    . ASP A 1 5   ? -25.599 -15.639 14.275  1.00 10.00 ? 160 ASP A C    5  
ATOM 11204  O O    . ASP A 1 5   ? -25.394 -16.553 13.474  1.00 10.00 ? 160 ASP A O    5  
ATOM 11205  C CB   . ASP A 1 5   ? -27.628 -16.880 15.135  1.00 10.00 ? 160 ASP A CB   5  
ATOM 11206  C CG   . ASP A 1 5   ? -26.820 -17.896 15.922  1.00 10.00 ? 160 ASP A CG   5  
ATOM 11207  O OD1  . ASP A 1 5   ? -25.766 -17.532 16.499  1.00 10.00 ? 160 ASP A OD1  5  
ATOM 11208  O OD2  . ASP A 1 5   ? -27.243 -19.069 15.987  1.00 10.00 ? 160 ASP A OD2  5  
ATOM 11209  H H    . ASP A 1 5   ? -28.015 -13.704 15.001  1.00 10.00 ? 160 ASP A H    5  
ATOM 11210  N N    . GLU A 1 6   ? -24.688 -14.715 14.563  1.00 10.00 ? 161 GLU A N    5  
ATOM 11211  C CA   . GLU A 1 6   ? -23.373 -14.707 13.928  1.00 10.00 ? 161 GLU A CA   5  
ATOM 11212  C C    . GLU A 1 6   ? -22.444 -15.756 14.545  1.00 10.00 ? 161 GLU A C    5  
ATOM 11213  O O    . GLU A 1 6   ? -21.526 -16.252 13.898  1.00 10.00 ? 161 GLU A O    5  
ATOM 11214  C CB   . GLU A 1 6   ? -22.725 -13.322 13.965  1.00 10.00 ? 161 GLU A CB   5  
ATOM 11215  C CG   . GLU A 1 6   ? -23.567 -12.226 13.342  1.00 10.00 ? 161 GLU A CG   5  
ATOM 11216  C CD   . GLU A 1 6   ? -24.049 -11.229 14.371  1.00 10.00 ? 161 GLU A CD   5  
ATOM 11217  O OE1  . GLU A 1 6   ? -24.692 -11.648 15.357  1.00 10.00 ? 161 GLU A OE1  5  
ATOM 11218  O OE2  . GLU A 1 6   ? -23.779 -10.024 14.205  1.00 10.00 ? 161 GLU A OE2  5  
ATOM 11219  H H    . GLU A 1 6   ? -24.840 -14.119 15.324  1.00 10.00 ? 161 GLU A H    5  
ATOM 11220  N N    . ARG A 1 7   ? -22.694 -16.081 15.811  1.00 10.00 ? 162 ARG A N    5  
ATOM 11221  C CA   . ARG A 1 7   ? -21.865 -17.051 16.542  1.00 10.00 ? 162 ARG A CA   5  
ATOM 11222  C C    . ARG A 1 7   ? -21.858 -18.405 15.843  1.00 10.00 ? 162 ARG A C    5  
ATOM 11223  O O    . ARG A 1 7   ? -20.814 -19.050 15.707  1.00 10.00 ? 162 ARG A O    5  
ATOM 11224  C CB   . ARG A 1 7   ? -22.296 -17.170 18.004  1.00 10.00 ? 162 ARG A CB   5  
ATOM 11225  C CG   . ARG A 1 7   ? -22.163 -15.869 18.779  1.00 10.00 ? 162 ARG A CG   5  
ATOM 11226  C CD   . ARG A 1 7   ? -20.732 -15.353 18.778  1.00 10.00 ? 162 ARG A CD   5  
ATOM 11227  N NE   . ARG A 1 7   ? -20.679 -13.893 18.636  1.00 10.00 ? 162 ARG A NE   5  
ATOM 11228  C CZ   . ARG A 1 7   ? -19.764 -13.124 19.223  1.00 10.00 ? 162 ARG A CZ   5  
ATOM 11229  N NH1  . ARG A 1 7   ? -18.871 -13.659 20.043  1.00 10.00 ? 162 ARG A NH1  5  
ATOM 11230  N NH2  . ARG A 1 7   ? -19.743 -11.817 18.998  1.00 10.00 ? 162 ARG A NH2  5  
ATOM 11231  H H    . ARG A 1 7   ? -23.476 -15.670 16.242  1.00 10.00 ? 162 ARG A H    5  
ATOM 11232  H HE   . ARG A 1 7   ? -21.355 -13.469 18.052  1.00 10.00 ? 162 ARG A HE   5  
ATOM 11233  H HH11 . ARG A 1 7   ? -18.882 -14.644 20.231  1.00 10.00 ? 162 ARG A HH11 5  
ATOM 11234  H HH12 . ARG A 1 7   ? -18.174 -13.079 20.479  1.00 10.00 ? 162 ARG A HH12 5  
ATOM 11235  H HH21 . ARG A 1 7   ? -20.416 -11.396 18.381  1.00 10.00 ? 162 ARG A HH21 5  
ATOM 11236  H HH22 . ARG A 1 7   ? -19.050 -11.241 19.445  1.00 10.00 ? 162 ARG A HH22 5  
ATOM 11237  N N    . ALA A 1 8   ? -23.026 -18.823 15.399  1.00 10.00 ? 163 ALA A N    5  
ATOM 11238  C CA   . ALA A 1 8   ? -23.188 -20.070 14.666  1.00 10.00 ? 163 ALA A CA   5  
ATOM 11239  C C    . ALA A 1 8   ? -22.658 -19.891 13.250  1.00 10.00 ? 163 ALA A C    5  
ATOM 11240  O O    . ALA A 1 8   ? -22.306 -20.847 12.567  1.00 10.00 ? 163 ALA A O    5  
ATOM 11241  C CB   . ALA A 1 8   ? -24.654 -20.484 14.631  1.00 10.00 ? 163 ALA A CB   5  
ATOM 11242  H H    . ALA A 1 8   ? -23.828 -18.282 15.583  1.00 10.00 ? 163 ALA A H    5  
ATOM 11243  N N    . PHE A 1 9   ? -22.611 -18.640 12.839  1.00 10.00 ? 164 PHE A N    5  
ATOM 11244  C CA   . PHE A 1 9   ? -22.209 -18.283 11.486  1.00 10.00 ? 164 PHE A CA   5  
ATOM 11245  C C    . PHE A 1 9   ? -20.683 -18.258 11.302  1.00 10.00 ? 164 PHE A C    5  
ATOM 11246  O O    . PHE A 1 9   ? -20.160 -18.856 10.361  1.00 10.00 ? 164 PHE A O    5  
ATOM 11247  C CB   . PHE A 1 9   ? -22.827 -16.944 11.060  1.00 10.00 ? 164 PHE A CB   5  
ATOM 11248  C CG   . PHE A 1 9   ? -22.391 -16.485 9.698   1.00 10.00 ? 164 PHE A CG   5  
ATOM 11249  C CD1  . PHE A 1 9   ? -22.798 -17.163 8.559   1.00 10.00 ? 164 PHE A CD1  5  
ATOM 11250  C CD2  . PHE A 1 9   ? -21.574 -15.376 9.560   1.00 10.00 ? 164 PHE A CD2  5  
ATOM 11251  C CE1  . PHE A 1 9   ? -22.397 -16.737 7.311   1.00 10.00 ? 164 PHE A CE1  5  
ATOM 11252  C CE2  . PHE A 1 9   ? -21.171 -14.946 8.315   1.00 10.00 ? 164 PHE A CE2  5  
ATOM 11253  C CZ   . PHE A 1 9   ? -21.583 -15.628 7.189   1.00 10.00 ? 164 PHE A CZ   5  
ATOM 11254  H H    . PHE A 1 9   ? -22.715 -17.955 13.530  1.00 10.00 ? 164 PHE A H    5  
ATOM 11255  N N    . GLU A 1 10  ? -19.962 -17.604 12.215  1.00 10.00 ? 165 GLU A N    5  
ATOM 11256  C CA   . GLU A 1 10  ? -18.509 -17.474 12.099  1.00 10.00 ? 165 GLU A CA   5  
ATOM 11257  C C    . GLU A 1 10  ? -17.787 -18.795 12.339  1.00 10.00 ? 165 GLU A C    5  
ATOM 11258  O O    . GLU A 1 10  ? -16.894 -19.170 11.580  1.00 10.00 ? 165 GLU A O    5  
ATOM 11259  C CB   . GLU A 1 10  ? -17.986 -16.431 13.092  1.00 10.00 ? 165 GLU A CB   5  
ATOM 11260  C CG   . GLU A 1 10  ? -18.539 -15.031 12.899  1.00 10.00 ? 165 GLU A CG   5  
ATOM 11261  C CD   . GLU A 1 10  ? -18.160 -14.105 14.036  1.00 10.00 ? 165 GLU A CD   5  
ATOM 11262  O OE1  . GLU A 1 10  ? -16.976 -13.726 14.129  1.00 10.00 ? 165 GLU A OE1  5  
ATOM 11263  O OE2  . GLU A 1 10  ? -19.046 -13.742 14.840  1.00 10.00 ? 165 GLU A OE2  5  
ATOM 11264  H H    . GLU A 1 10  ? -20.398 -17.232 13.015  1.00 10.00 ? 165 GLU A H    5  
ATOM 11265  N N    . LYS A 1 11  ? -18.187 -19.497 13.395  1.00 10.00 ? 166 LYS A N    5  
ATOM 11266  C CA   . LYS A 1 11  ? -17.572 -20.770 13.763  1.00 10.00 ? 166 LYS A CA   5  
ATOM 11267  C C    . LYS A 1 11  ? -17.667 -21.795 12.636  1.00 10.00 ? 166 LYS A C    5  
ATOM 11268  O O    . LYS A 1 11  ? -16.731 -22.561 12.392  1.00 10.00 ? 166 LYS A O    5  
ATOM 11269  C CB   . LYS A 1 11  ? -18.233 -21.313 15.029  1.00 10.00 ? 166 LYS A CB   5  
ATOM 11270  C CG   . LYS A 1 11  ? -17.481 -22.453 15.692  1.00 10.00 ? 166 LYS A CG   5  
ATOM 11271  C CD   . LYS A 1 11  ? -18.278 -23.029 16.849  1.00 10.00 ? 166 LYS A CD   5  
ATOM 11272  C CE   . LYS A 1 11  ? -19.496 -23.790 16.355  1.00 10.00 ? 166 LYS A CE   5  
ATOM 11273  N NZ   . LYS A 1 11  ? -20.311 -24.326 17.475  1.00 10.00 ? 166 LYS A NZ   5  
ATOM 11274  H H    . LYS A 1 11  ? -18.915 -19.144 13.949  1.00 10.00 ? 166 LYS A H    5  
ATOM 11275  H HZ1  . LYS A 1 11  ? -20.600 -23.553 18.111  1.00 10.00 ? 166 LYS A HZ1  5  
ATOM 11276  H HZ2  . LYS A 1 11  ?