data_2L1M
# 
_entry.id   2L1M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L1M         
RCSB  RCSB101842   
WWPDB D_1000101842 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 16946 BMRB 'NMR assignments relating to this structure' 
unspecified 1byw  PDB  'Crystal structure of this domain'           
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L1M 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-29 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muskett, F.W.'   1 
'Mitcheson, J.S.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Mechanistic insight into human ether-a-go-go-related gene (hERG) K+ channel deactivation gating from the solution structure of the EAG domain.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                6184 
_citation.page_last                 6191 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21135103 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.199364 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muskett, F.W.'   1 
primary 'Thouta, S.'      2 
primary 'Thomson, S.J.'   3 
primary 'Bowen, A.'       4 
primary 'Stansfeld, P.J.' 5 
primary 'Mitcheson, J.S.' 6 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Potassium voltage-gated channel subfamily H member 2' 
_entity.formula_weight             17251.896 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 1-135' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related gene potassium channel 1, Ether-a-go-go-related protein 1, Eag-related protein 1, ERG-1, hERG-1, hERG1, H-ERG, Eag homolog
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAA
QIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKENLYFQSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAA
QIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEKENLYFQSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   VAL n 
1 4   ARG n 
1 5   ARG n 
1 6   GLY n 
1 7   HIS n 
1 8   VAL n 
1 9   ALA n 
1 10  PRO n 
1 11  GLN n 
1 12  ASN n 
1 13  THR n 
1 14  PHE n 
1 15  LEU n 
1 16  ASP n 
1 17  THR n 
1 18  ILE n 
1 19  ILE n 
1 20  ARG n 
1 21  LYS n 
1 22  PHE n 
1 23  GLU n 
1 24  GLY n 
1 25  GLN n 
1 26  SER n 
1 27  ARG n 
1 28  LYS n 
1 29  PHE n 
1 30  ILE n 
1 31  ILE n 
1 32  ALA n 
1 33  ASN n 
1 34  ALA n 
1 35  ARG n 
1 36  VAL n 
1 37  GLU n 
1 38  ASN n 
1 39  CYS n 
1 40  ALA n 
1 41  VAL n 
1 42  ILE n 
1 43  TYR n 
1 44  CYS n 
1 45  ASN n 
1 46  ASP n 
1 47  GLY n 
1 48  PHE n 
1 49  CYS n 
1 50  GLU n 
1 51  LEU n 
1 52  CYS n 
1 53  GLY n 
1 54  TYR n 
1 55  SER n 
1 56  ARG n 
1 57  ALA n 
1 58  GLU n 
1 59  VAL n 
1 60  MET n 
1 61  GLN n 
1 62  ARG n 
1 63  PRO n 
1 64  CYS n 
1 65  THR n 
1 66  CYS n 
1 67  ASP n 
1 68  PHE n 
1 69  LEU n 
1 70  HIS n 
1 71  GLY n 
1 72  PRO n 
1 73  ARG n 
1 74  THR n 
1 75  GLN n 
1 76  ARG n 
1 77  ARG n 
1 78  ALA n 
1 79  ALA n 
1 80  ALA n 
1 81  GLN n 
1 82  ILE n 
1 83  ALA n 
1 84  GLN n 
1 85  ALA n 
1 86  LEU n 
1 87  LEU n 
1 88  GLY n 
1 89  ALA n 
1 90  GLU n 
1 91  GLU n 
1 92  ARG n 
1 93  LYS n 
1 94  VAL n 
1 95  GLU n 
1 96  ILE n 
1 97  ALA n 
1 98  PHE n 
1 99  TYR n 
1 100 ARG n 
1 101 LYS n 
1 102 ASP n 
1 103 GLY n 
1 104 SER n 
1 105 CYS n 
1 106 PHE n 
1 107 LEU n 
1 108 CYS n 
1 109 LEU n 
1 110 VAL n 
1 111 ASP n 
1 112 VAL n 
1 113 VAL n 
1 114 PRO n 
1 115 VAL n 
1 116 LYS n 
1 117 ASN n 
1 118 GLU n 
1 119 ASP n 
1 120 GLY n 
1 121 ALA n 
1 122 VAL n 
1 123 ILE n 
1 124 MET n 
1 125 PHE n 
1 126 ILE n 
1 127 LEU n 
1 128 ASN n 
1 129 PHE n 
1 130 GLU n 
1 131 VAL n 
1 132 VAL n 
1 133 MET n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 ASN n 
1 138 LEU n 
1 139 TYR n 
1 140 PHE n 
1 141 GLN n 
1 142 SER n 
1 143 LEU n 
1 144 GLU n 
1 145 HIS n 
1 146 HIS n 
1 147 HIS n 
1 148 HIS n 
1 149 HIS n 
1 150 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KCNH2, ERG, ERG1, HERG' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'CodonPlus RIPL' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET-21a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KCNH2_HUMAN 
_struct_ref.pdbx_db_accession          Q12809 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAA
QIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2L1M 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 135 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q12809 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  135 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       135 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L1M GLU A 136 ? UNP Q12809 ? ? 'EXPRESSION TAG' 136 1  
1 2L1M ASN A 137 ? UNP Q12809 ? ? 'EXPRESSION TAG' 137 2  
1 2L1M LEU A 138 ? UNP Q12809 ? ? 'EXPRESSION TAG' 138 3  
1 2L1M TYR A 139 ? UNP Q12809 ? ? 'EXPRESSION TAG' 139 4  
1 2L1M PHE A 140 ? UNP Q12809 ? ? 'EXPRESSION TAG' 140 5  
1 2L1M GLN A 141 ? UNP Q12809 ? ? 'EXPRESSION TAG' 141 6  
1 2L1M SER A 142 ? UNP Q12809 ? ? 'EXPRESSION TAG' 142 7  
1 2L1M LEU A 143 ? UNP Q12809 ? ? 'EXPRESSION TAG' 143 8  
1 2L1M GLU A 144 ? UNP Q12809 ? ? 'EXPRESSION TAG' 144 9  
1 2L1M HIS A 145 ? UNP Q12809 ? ? 'EXPRESSION TAG' 145 10 
1 2L1M HIS A 146 ? UNP Q12809 ? ? 'EXPRESSION TAG' 146 11 
1 2L1M HIS A 147 ? UNP Q12809 ? ? 'EXPRESSION TAG' 147 12 
1 2L1M HIS A 148 ? UNP Q12809 ? ? 'EXPRESSION TAG' 148 13 
1 2L1M HIS A 149 ? UNP Q12809 ? ? 'EXPRESSION TAG' 149 14 
1 2L1M HIS A 150 ? UNP Q12809 ? ? 'EXPRESSION TAG' 150 15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 2 '2D 1H-15N HSQC'  
1 2 1 '3D CBCA(CO)NH'   
1 3 1 '3D HNCO'         
1 4 1 '3D HNCA'         
1 5 1 '3D HNCACB'       
1 6 1 '3D HBHA(CO)NH'   
1 7 2 '3D 1H-15N NOESY' 
1 8 1 '3D 1H-13C NOESY' 
1 9 1 '3D CCH-TOCSY'    
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.02 
_pdbx_nmr_exptl_sample_conditions.pH                  5.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.4 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'0.4 mM [U-100% 15N] protein, 90% H2O/10% D2O'             2 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker DRX    1 'Bruker DRX'    
800 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2L1M 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L1M 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L1M 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement           AMBER 10  1 
'Herrmann, Guntert and Wuthrich'                                          'structure solution' CYANA 2.1 2 
'Guntert, Mumenthaler and Wuthrich'                                       'structure solution' CYANA 2.1 3 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L1M 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L1M 
_struct.title                     'Solution structure of the eag domain of the hERG (Kv11.1) K+ channel' 
_struct.pdbx_descriptor           'Potassium voltage-gated channel subfamily H member 2' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L1M 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'eag domain, hERG, Kv11.1, PAS domain, TRANSPORT PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 10 ? GLU A 23 ? PRO A 10 GLU A 23 1 ? 14 
HELX_P HELX_P2 2 ASN A 45 ? GLY A 53 ? ASN A 45 GLY A 53 1 ? 9  
HELX_P HELX_P3 3 SER A 55 ? MET A 60 ? SER A 55 MET A 60 1 ? 6  
HELX_P HELX_P4 4 THR A 65 ? HIS A 70 ? THR A 65 HIS A 70 5 ? 6  
HELX_P HELX_P5 5 GLN A 75 ? GLY A 88 ? GLN A 75 GLY A 88 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 41  ? CYS A 44  ? VAL A 41  CYS A 44  
A 2 ILE A 30  ? ASN A 33  ? ILE A 30  ASN A 33  
A 3 VAL A 122 ? PHE A 125 ? VAL A 122 PHE A 125 
A 4 VAL A 115 ? LYS A 116 ? VAL A 115 LYS A 116 
B 1 ILE A 96  ? TYR A 99  ? ILE A 96  TYR A 99  
B 2 CYS A 105 ? CYS A 108 ? CYS A 105 CYS A 108 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 43  ? O TYR A 43  N ILE A 31  ? N ILE A 31  
A 2 3 N ALA A 32  ? N ALA A 32  O PHE A 125 ? O PHE A 125 
A 3 4 O MET A 124 ? O MET A 124 N VAL A 115 ? N VAL A 115 
B 1 2 N PHE A 98  ? N PHE A 98  O PHE A 106 ? O PHE A 106 
# 
_atom_sites.entry_id                    2L1M 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? -12.287 -6.176  2.904   1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? -11.512 -4.933  2.639   1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? -12.436 -3.707  2.687   1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? -13.595 -3.821  2.280   1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? -10.758 -4.980  1.291   1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? -9.505  -5.871  1.319   1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? -9.763  -7.662  1.513   1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? -10.324 -8.105  -0.156  1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? -11.684 -6.985  2.877   1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? -13.015 -6.290  2.213   1.00 0.00 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? -12.724 -6.135  3.814   1.00 0.00 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? -10.772 -4.823  3.430   1.00 0.00 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? -11.429 -5.312  0.499   1.00 0.00 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? -10.425 -3.971  1.041   1.00 0.00 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? -8.953  -5.711  0.391   1.00 0.00 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? -8.866  -5.532  2.135   1.00 0.00 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? -9.548  -7.856  -0.880  1.00 0.00 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? -10.522 -9.176  -0.201  1.00 0.00 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? -11.237 -7.563  -0.403  1.00 0.00 ? 1   MET A HE3  1  
ATOM 20    N N    . PRO A 1 2   ? -11.963 -2.529  3.155   1.00 0.00 ? 2   PRO A N    1  
ATOM 21    C CA   . PRO A 1 2   ? -12.808 -1.336  3.333   1.00 0.00 ? 2   PRO A CA   1  
ATOM 22    C C    . PRO A 1 2   ? -13.350 -0.716  2.031   1.00 0.00 ? 2   PRO A C    1  
ATOM 23    O O    . PRO A 1 2   ? -14.405 -0.078  2.043   1.00 0.00 ? 2   PRO A O    1  
ATOM 24    C CB   . PRO A 1 2   ? -11.932 -0.319  4.079   1.00 0.00 ? 2   PRO A CB   1  
ATOM 25    C CG   . PRO A 1 2   ? -10.888 -1.180  4.783   1.00 0.00 ? 2   PRO A CG   1  
ATOM 26    C CD   . PRO A 1 2   ? -10.661 -2.303  3.775   1.00 0.00 ? 2   PRO A CD   1  
ATOM 27    H HA   . PRO A 1 2   ? -13.653 -1.601  3.970   1.00 0.00 ? 2   PRO A HA   1  
ATOM 28    H HB2  . PRO A 1 2   ? -11.428 0.340   3.369   1.00 0.00 ? 2   PRO A HB2  1  
ATOM 29    H HB3  . PRO A 1 2   ? -12.514 0.268   4.790   1.00 0.00 ? 2   PRO A HB3  1  
ATOM 30    H HG2  . PRO A 1 2   ? -9.972  -0.625  4.986   1.00 0.00 ? 2   PRO A HG2  1  
ATOM 31    H HG3  . PRO A 1 2   ? -11.306 -1.589  5.704   1.00 0.00 ? 2   PRO A HG3  1  
ATOM 32    H HD2  . PRO A 1 2   ? -9.946  -1.979  3.017   1.00 0.00 ? 2   PRO A HD2  1  
ATOM 33    H HD3  . PRO A 1 2   ? -10.282 -3.180  4.299   1.00 0.00 ? 2   PRO A HD3  1  
ATOM 34    N N    . VAL A 1 3   ? -12.631 -0.884  0.915   1.00 0.00 ? 3   VAL A N    1  
ATOM 35    C CA   . VAL A 1 3   ? -12.954 -0.324  -0.412  1.00 0.00 ? 3   VAL A CA   1  
ATOM 36    C C    . VAL A 1 3   ? -12.442 -1.247  -1.530  1.00 0.00 ? 3   VAL A C    1  
ATOM 37    O O    . VAL A 1 3   ? -11.515 -2.033  -1.316  1.00 0.00 ? 3   VAL A O    1  
ATOM 38    C CB   . VAL A 1 3   ? -12.401 1.118   -0.519  1.00 0.00 ? 3   VAL A CB   1  
ATOM 39    C CG1  . VAL A 1 3   ? -10.868 1.184   -0.515  1.00 0.00 ? 3   VAL A CG1  1  
ATOM 40    C CG2  . VAL A 1 3   ? -12.931 1.875   -1.743  1.00 0.00 ? 3   VAL A CG2  1  
ATOM 41    H H    . VAL A 1 3   ? -11.779 -1.424  0.984   1.00 0.00 ? 3   VAL A H    1  
ATOM 42    H HA   . VAL A 1 3   ? -14.040 -0.272  -0.506  1.00 0.00 ? 3   VAL A HA   1  
ATOM 43    H HB   . VAL A 1 3   ? -12.750 1.668   0.356   1.00 0.00 ? 3   VAL A HB   1  
ATOM 44    H HG11 . VAL A 1 3   ? -10.477 0.724   0.393   1.00 0.00 ? 3   VAL A HG11 1  
ATOM 45    H HG12 . VAL A 1 3   ? -10.461 0.667   -1.382  1.00 0.00 ? 3   VAL A HG12 1  
ATOM 46    H HG13 . VAL A 1 3   ? -10.546 2.225   -0.538  1.00 0.00 ? 3   VAL A HG13 1  
ATOM 47    H HG21 . VAL A 1 3   ? -12.636 2.923   -1.674  1.00 0.00 ? 3   VAL A HG21 1  
ATOM 48    H HG22 . VAL A 1 3   ? -12.525 1.465   -2.666  1.00 0.00 ? 3   VAL A HG22 1  
ATOM 49    H HG23 . VAL A 1 3   ? -14.021 1.827   -1.766  1.00 0.00 ? 3   VAL A HG23 1  
ATOM 50    N N    . ARG A 1 4   ? -13.031 -1.165  -2.732  1.00 0.00 ? 4   ARG A N    1  
ATOM 51    C CA   . ARG A 1 4   ? -12.727 -2.013  -3.908  1.00 0.00 ? 4   ARG A CA   1  
ATOM 52    C C    . ARG A 1 4   ? -11.444 -1.615  -4.666  1.00 0.00 ? 4   ARG A C    1  
ATOM 53    O O    . ARG A 1 4   ? -11.451 -1.391  -5.877  1.00 0.00 ? 4   ARG A O    1  
ATOM 54    C CB   . ARG A 1 4   ? -13.991 -2.177  -4.776  1.00 0.00 ? 4   ARG A CB   1  
ATOM 55    C CG   . ARG A 1 4   ? -14.515 -0.906  -5.475  1.00 0.00 ? 4   ARG A CG   1  
ATOM 56    C CD   . ARG A 1 4   ? -15.919 -1.158  -6.048  1.00 0.00 ? 4   ARG A CD   1  
ATOM 57    N NE   . ARG A 1 4   ? -16.329 -0.129  -7.028  1.00 0.00 ? 4   ARG A NE   1  
ATOM 58    C CZ   . ARG A 1 4   ? -16.754 1.101   -6.798  1.00 0.00 ? 4   ARG A CZ   1  
ATOM 59    N NH1  . ARG A 1 4   ? -16.830 1.612   -5.602  1.00 0.00 ? 4   ARG A NH1  1  
ATOM 60    N NH2  . ARG A 1 4   ? -17.120 1.857   -7.791  1.00 0.00 ? 4   ARG A NH2  1  
ATOM 61    H H    . ARG A 1 4   ? -13.782 -0.495  -2.824  1.00 0.00 ? 4   ARG A H    1  
ATOM 62    H HA   . ARG A 1 4   ? -12.506 -3.012  -3.531  1.00 0.00 ? 4   ARG A HA   1  
ATOM 63    H HB2  . ARG A 1 4   ? -13.786 -2.932  -5.535  1.00 0.00 ? 4   ARG A HB2  1  
ATOM 64    H HB3  . ARG A 1 4   ? -14.779 -2.569  -4.131  1.00 0.00 ? 4   ARG A HB3  1  
ATOM 65    H HG2  . ARG A 1 4   ? -14.558 -0.077  -4.770  1.00 0.00 ? 4   ARG A HG2  1  
ATOM 66    H HG3  . ARG A 1 4   ? -13.845 -0.636  -6.292  1.00 0.00 ? 4   ARG A HG3  1  
ATOM 67    H HD2  . ARG A 1 4   ? -15.916 -2.125  -6.556  1.00 0.00 ? 4   ARG A HD2  1  
ATOM 68    H HD3  . ARG A 1 4   ? -16.642 -1.217  -5.233  1.00 0.00 ? 4   ARG A HD3  1  
ATOM 69    H HE   . ARG A 1 4   ? -16.303 -0.407  -7.997  1.00 0.00 ? 4   ARG A HE   1  
ATOM 70    H HH11 . ARG A 1 4   ? -16.582 1.047   -4.809  1.00 0.00 ? 4   ARG A HH11 1  
ATOM 71    H HH12 . ARG A 1 4   ? -17.143 2.558   -5.473  1.00 0.00 ? 4   ARG A HH12 1  
ATOM 72    H HH21 . ARG A 1 4   ? -17.122 1.493   -8.730  1.00 0.00 ? 4   ARG A HH21 1  
ATOM 73    H HH22 . ARG A 1 4   ? -17.415 2.812   -7.625  1.00 0.00 ? 4   ARG A HH22 1  
ATOM 74    N N    . ARG A 1 5   ? -10.337 -1.503  -3.926  1.00 0.00 ? 5   ARG A N    1  
ATOM 75    C CA   . ARG A 1 5   ? -8.987  -1.129  -4.402  1.00 0.00 ? 5   ARG A CA   1  
ATOM 76    C C    . ARG A 1 5   ? -7.953  -2.208  -4.058  1.00 0.00 ? 5   ARG A C    1  
ATOM 77    O O    . ARG A 1 5   ? -8.078  -2.899  -3.047  1.00 0.00 ? 5   ARG A O    1  
ATOM 78    C CB   . ARG A 1 5   ? -8.563  0.232   -3.813  1.00 0.00 ? 5   ARG A CB   1  
ATOM 79    C CG   . ARG A 1 5   ? -9.486  1.411   -4.168  1.00 0.00 ? 5   ARG A CG   1  
ATOM 80    C CD   . ARG A 1 5   ? -9.400  1.813   -5.645  1.00 0.00 ? 5   ARG A CD   1  
ATOM 81    N NE   . ARG A 1 5   ? -10.258 2.979   -5.925  1.00 0.00 ? 5   ARG A NE   1  
ATOM 82    C CZ   . ARG A 1 5   ? -10.206 3.763   -6.986  1.00 0.00 ? 5   ARG A CZ   1  
ATOM 83    N NH1  . ARG A 1 5   ? -9.370  3.600   -7.968  1.00 0.00 ? 5   ARG A NH1  1  
ATOM 84    N NH2  . ARG A 1 5   ? -11.023 4.759   -7.120  1.00 0.00 ? 5   ARG A NH2  1  
ATOM 85    H H    . ARG A 1 5   ? -10.443 -1.758  -2.950  1.00 0.00 ? 5   ARG A H    1  
ATOM 86    H HA   . ARG A 1 5   ? -9.001  -1.050  -5.490  1.00 0.00 ? 5   ARG A HA   1  
ATOM 87    H HB2  . ARG A 1 5   ? -8.529  0.141   -2.726  1.00 0.00 ? 5   ARG A HB2  1  
ATOM 88    H HB3  . ARG A 1 5   ? -7.553  0.470   -4.150  1.00 0.00 ? 5   ARG A HB3  1  
ATOM 89    H HG2  . ARG A 1 5   ? -10.517 1.167   -3.917  1.00 0.00 ? 5   ARG A HG2  1  
ATOM 90    H HG3  . ARG A 1 5   ? -9.187  2.268   -3.562  1.00 0.00 ? 5   ARG A HG3  1  
ATOM 91    H HD2  . ARG A 1 5   ? -8.361  2.052   -5.880  1.00 0.00 ? 5   ARG A HD2  1  
ATOM 92    H HD3  . ARG A 1 5   ? -9.721  0.975   -6.267  1.00 0.00 ? 5   ARG A HD3  1  
ATOM 93    H HE   . ARG A 1 5   ? -10.957 3.214   -5.238  1.00 0.00 ? 5   ARG A HE   1  
ATOM 94    H HH11 . ARG A 1 5   ? -8.713  2.841   -7.958  1.00 0.00 ? 5   ARG A HH11 1  
ATOM 95    H HH12 . ARG A 1 5   ? -9.470  4.210   -8.777  1.00 0.00 ? 5   ARG A HH12 1  
ATOM 96    H HH21 . ARG A 1 5   ? -11.827 4.852   -6.512  1.00 0.00 ? 5   ARG A HH21 1  
ATOM 97    H HH22 . ARG A 1 5   ? -10.956 5.285   -7.986  1.00 0.00 ? 5   ARG A HH22 1  
ATOM 98    N N    . GLY A 1 6   ? -6.917  -2.340  -4.888  1.00 0.00 ? 6   GLY A N    1  
ATOM 99    C CA   . GLY A 1 6   ? -5.859  -3.355  -4.762  1.00 0.00 ? 6   GLY A CA   1  
ATOM 100   C C    . GLY A 1 6   ? -6.286  -4.744  -5.258  1.00 0.00 ? 6   GLY A C    1  
ATOM 101   O O    . GLY A 1 6   ? -5.646  -5.302  -6.153  1.00 0.00 ? 6   GLY A O    1  
ATOM 102   H H    . GLY A 1 6   ? -6.875  -1.721  -5.684  1.00 0.00 ? 6   GLY A H    1  
ATOM 103   H HA2  . GLY A 1 6   ? -4.987  -3.035  -5.332  1.00 0.00 ? 6   GLY A HA2  1  
ATOM 104   H HA3  . GLY A 1 6   ? -5.564  -3.443  -3.715  1.00 0.00 ? 6   GLY A HA3  1  
ATOM 105   N N    . HIS A 1 7   ? -7.392  -5.283  -4.732  1.00 0.00 ? 7   HIS A N    1  
ATOM 106   C CA   . HIS A 1 7   ? -8.045  -6.502  -5.233  1.00 0.00 ? 7   HIS A CA   1  
ATOM 107   C C    . HIS A 1 7   ? -9.072  -6.197  -6.339  1.00 0.00 ? 7   HIS A C    1  
ATOM 108   O O    . HIS A 1 7   ? -9.602  -5.085  -6.424  1.00 0.00 ? 7   HIS A O    1  
ATOM 109   C CB   . HIS A 1 7   ? -8.686  -7.276  -4.068  1.00 0.00 ? 7   HIS A CB   1  
ATOM 110   C CG   . HIS A 1 7   ? -9.943  -6.640  -3.520  1.00 0.00 ? 7   HIS A CG   1  
ATOM 111   N ND1  . HIS A 1 7   ? -9.990  -5.565  -2.630  1.00 0.00 ? 7   HIS A ND1  1  
ATOM 112   C CD2  . HIS A 1 7   ? -11.220 -7.017  -3.823  1.00 0.00 ? 7   HIS A CD2  1  
ATOM 113   C CE1  . HIS A 1 7   ? -11.293 -5.313  -2.424  1.00 0.00 ? 7   HIS A CE1  1  
ATOM 114   N NE2  . HIS A 1 7   ? -12.054 -6.171  -3.125  1.00 0.00 ? 7   HIS A NE2  1  
ATOM 115   H H    . HIS A 1 7   ? -7.868  -4.764  -4.002  1.00 0.00 ? 7   HIS A H    1  
ATOM 116   H HA   . HIS A 1 7   ? -7.283  -7.151  -5.669  1.00 0.00 ? 7   HIS A HA   1  
ATOM 117   H HB2  . HIS A 1 7   ? -8.934  -8.281  -4.413  1.00 0.00 ? 7   HIS A HB2  1  
ATOM 118   H HB3  . HIS A 1 7   ? -7.959  -7.380  -3.260  1.00 0.00 ? 7   HIS A HB3  1  
ATOM 119   H HD2  . HIS A 1 7   ? -11.511 -7.822  -4.487  1.00 0.00 ? 7   HIS A HD2  1  
ATOM 120   H HE1  . HIS A 1 7   ? -11.677 -4.533  -1.777  1.00 0.00 ? 7   HIS A HE1  1  
ATOM 121   H HE2  . HIS A 1 7   ? -13.069 -6.188  -3.129  1.00 0.00 ? 7   HIS A HE2  1  
ATOM 122   N N    . VAL A 1 8   ? -9.375  -7.200  -7.170  1.00 0.00 ? 8   VAL A N    1  
ATOM 123   C CA   . VAL A 1 8   ? -10.452 -7.167  -8.180  1.00 0.00 ? 8   VAL A CA   1  
ATOM 124   C C    . VAL A 1 8   ? -11.317 -8.428  -8.039  1.00 0.00 ? 8   VAL A C    1  
ATOM 125   O O    . VAL A 1 8   ? -10.786 -9.531  -7.878  1.00 0.00 ? 8   VAL A O    1  
ATOM 126   C CB   . VAL A 1 8   ? -9.892  -7.023  -9.618  1.00 0.00 ? 8   VAL A CB   1  
ATOM 127   C CG1  . VAL A 1 8   ? -11.003 -6.740  -10.637 1.00 0.00 ? 8   VAL A CG1  1  
ATOM 128   C CG2  . VAL A 1 8   ? -8.880  -5.873  -9.742  1.00 0.00 ? 8   VAL A CG2  1  
ATOM 129   H H    . VAL A 1 8   ? -8.898  -8.083  -7.041  1.00 0.00 ? 8   VAL A H    1  
ATOM 130   H HA   . VAL A 1 8   ? -11.090 -6.304  -7.988  1.00 0.00 ? 8   VAL A HA   1  
ATOM 131   H HB   . VAL A 1 8   ? -9.388  -7.948  -9.899  1.00 0.00 ? 8   VAL A HB   1  
ATOM 132   H HG11 . VAL A 1 8   ? -11.529 -5.821  -10.376 1.00 0.00 ? 8   VAL A HG11 1  
ATOM 133   H HG12 . VAL A 1 8   ? -10.575 -6.636  -11.634 1.00 0.00 ? 8   VAL A HG12 1  
ATOM 134   H HG13 . VAL A 1 8   ? -11.712 -7.563  -10.664 1.00 0.00 ? 8   VAL A HG13 1  
ATOM 135   H HG21 . VAL A 1 8   ? -7.999  -6.077  -9.133  1.00 0.00 ? 8   VAL A HG21 1  
ATOM 136   H HG22 . VAL A 1 8   ? -8.554  -5.772  -10.777 1.00 0.00 ? 8   VAL A HG22 1  
ATOM 137   H HG23 . VAL A 1 8   ? -9.335  -4.937  -9.415  1.00 0.00 ? 8   VAL A HG23 1  
ATOM 138   N N    . ALA A 1 9   ? -12.643 -8.283  -8.095  1.00 0.00 ? 9   ALA A N    1  
ATOM 139   C CA   . ALA A 1 9   ? -13.594 -9.403  -8.112  1.00 0.00 ? 9   ALA A CA   1  
ATOM 140   C C    . ALA A 1 9   ? -13.477 -10.241 -9.412  1.00 0.00 ? 9   ALA A C    1  
ATOM 141   O O    . ALA A 1 9   ? -12.981 -9.721  -10.416 1.00 0.00 ? 9   ALA A O    1  
ATOM 142   C CB   . ALA A 1 9   ? -15.004 -8.815  -7.944  1.00 0.00 ? 9   ALA A CB   1  
ATOM 143   H H    . ALA A 1 9   ? -13.017 -7.355  -8.225  1.00 0.00 ? 9   ALA A H    1  
ATOM 144   H HA   . ALA A 1 9   ? -13.383 -10.052 -7.261  1.00 0.00 ? 9   ALA A HA   1  
ATOM 145   H HB1  . ALA A 1 9   ? -15.749 -9.610  -7.931  1.00 0.00 ? 9   ALA A HB1  1  
ATOM 146   H HB2  . ALA A 1 9   ? -15.067 -8.263  -7.005  1.00 0.00 ? 9   ALA A HB2  1  
ATOM 147   H HB3  . ALA A 1 9   ? -15.230 -8.141  -8.772  1.00 0.00 ? 9   ALA A HB3  1  
ATOM 148   N N    . PRO A 1 10  ? -13.951 -11.507 -9.453  1.00 0.00 ? 10  PRO A N    1  
ATOM 149   C CA   . PRO A 1 10  ? -14.062 -12.271 -10.700 1.00 0.00 ? 10  PRO A CA   1  
ATOM 150   C C    . PRO A 1 10  ? -14.943 -11.530 -11.711 1.00 0.00 ? 10  PRO A C    1  
ATOM 151   O O    . PRO A 1 10  ? -16.170 -11.489 -11.606 1.00 0.00 ? 10  PRO A O    1  
ATOM 152   C CB   . PRO A 1 10  ? -14.627 -13.642 -10.320 1.00 0.00 ? 10  PRO A CB   1  
ATOM 153   C CG   . PRO A 1 10  ? -15.275 -13.414 -8.952  1.00 0.00 ? 10  PRO A CG   1  
ATOM 154   C CD   . PRO A 1 10  ? -14.435 -12.300 -8.332  1.00 0.00 ? 10  PRO A CD   1  
ATOM 155   H HA   . PRO A 1 10  ? -13.069 -12.411 -11.131 1.00 0.00 ? 10  PRO A HA   1  
ATOM 156   H HB2  . PRO A 1 10  ? -15.346 -14.010 -11.052 1.00 0.00 ? 10  PRO A HB2  1  
ATOM 157   H HB3  . PRO A 1 10  ? -13.802 -14.346 -10.241 1.00 0.00 ? 10  PRO A HB3  1  
ATOM 158   H HG2  . PRO A 1 10  ? -16.296 -13.057 -9.082  1.00 0.00 ? 10  PRO A HG2  1  
ATOM 159   H HG3  . PRO A 1 10  ? -15.262 -14.318 -8.342  1.00 0.00 ? 10  PRO A HG3  1  
ATOM 160   H HD2  . PRO A 1 10  ? -15.044 -11.717 -7.643  1.00 0.00 ? 10  PRO A HD2  1  
ATOM 161   H HD3  . PRO A 1 10  ? -13.584 -12.732 -7.804  1.00 0.00 ? 10  PRO A HD3  1  
ATOM 162   N N    . GLN A 1 11  ? -14.301 -10.944 -12.717 1.00 0.00 ? 11  GLN A N    1  
ATOM 163   C CA   . GLN A 1 11  ? -14.919 -9.985  -13.631 1.00 0.00 ? 11  GLN A CA   1  
ATOM 164   C C    . GLN A 1 11  ? -16.051 -10.576 -14.482 1.00 0.00 ? 11  GLN A C    1  
ATOM 165   O O    . GLN A 1 11  ? -16.969 -9.848  -14.853 1.00 0.00 ? 11  GLN A O    1  
ATOM 166   C CB   . GLN A 1 11  ? -13.830 -9.290  -14.474 1.00 0.00 ? 11  GLN A CB   1  
ATOM 167   C CG   . GLN A 1 11  ? -13.197 -10.130 -15.600 1.00 0.00 ? 11  GLN A CG   1  
ATOM 168   C CD   . GLN A 1 11  ? -12.466 -11.389 -15.134 1.00 0.00 ? 11  GLN A CD   1  
ATOM 169   O OE1  . GLN A 1 11  ? -11.770 -11.413 -14.127 1.00 0.00 ? 11  GLN A OE1  1  
ATOM 170   N NE2  . GLN A 1 11  ? -12.622 -12.499 -15.824 1.00 0.00 ? 11  GLN A NE2  1  
ATOM 171   H H    . GLN A 1 11  ? -13.294 -11.040 -12.738 1.00 0.00 ? 11  GLN A H    1  
ATOM 172   H HA   . GLN A 1 11  ? -15.369 -9.206  -13.016 1.00 0.00 ? 11  GLN A HA   1  
ATOM 173   H HB2  . GLN A 1 11  ? -14.280 -8.410  -14.937 1.00 0.00 ? 11  GLN A HB2  1  
ATOM 174   H HB3  . GLN A 1 11  ? -13.042 -8.932  -13.810 1.00 0.00 ? 11  GLN A HB3  1  
ATOM 175   H HG2  . GLN A 1 11  ? -13.968 -10.398 -16.322 1.00 0.00 ? 11  GLN A HG2  1  
ATOM 176   H HG3  . GLN A 1 11  ? -12.471 -9.502  -16.117 1.00 0.00 ? 11  GLN A HG3  1  
ATOM 177   H HE21 . GLN A 1 11  ? -13.244 -12.519 -16.627 1.00 0.00 ? 11  GLN A HE21 1  
ATOM 178   H HE22 . GLN A 1 11  ? -12.126 -13.324 -15.524 1.00 0.00 ? 11  GLN A HE22 1  
ATOM 179   N N    . ASN A 1 12  ? -16.031 -11.886 -14.757 1.00 0.00 ? 12  ASN A N    1  
ATOM 180   C CA   . ASN A 1 12  ? -17.022 -12.526 -15.628 1.00 0.00 ? 12  ASN A CA   1  
ATOM 181   C C    . ASN A 1 12  ? -18.402 -12.568 -14.946 1.00 0.00 ? 12  ASN A C    1  
ATOM 182   O O    . ASN A 1 12  ? -19.401 -12.133 -15.517 1.00 0.00 ? 12  ASN A O    1  
ATOM 183   C CB   . ASN A 1 12  ? -16.535 -13.939 -16.003 1.00 0.00 ? 12  ASN A CB   1  
ATOM 184   C CG   . ASN A 1 12  ? -15.498 -13.968 -17.120 1.00 0.00 ? 12  ASN A CG   1  
ATOM 185   O OD1  . ASN A 1 12  ? -14.954 -12.960 -17.553 1.00 0.00 ? 12  ASN A OD1  1  
ATOM 186   N ND2  . ASN A 1 12  ? -15.168 -15.139 -17.613 1.00 0.00 ? 12  ASN A ND2  1  
ATOM 187   H H    . ASN A 1 12  ? -15.302 -12.453 -14.341 1.00 0.00 ? 12  ASN A H    1  
ATOM 188   H HA   . ASN A 1 12  ? -17.140 -11.938 -16.541 1.00 0.00 ? 12  ASN A HA   1  
ATOM 189   H HB2  . ASN A 1 12  ? -16.135 -14.449 -15.127 1.00 0.00 ? 12  ASN A HB2  1  
ATOM 190   H HB3  . ASN A 1 12  ? -17.395 -14.510 -16.355 1.00 0.00 ? 12  ASN A HB3  1  
ATOM 191   H HD21 . ASN A 1 12  ? -15.600 -15.981 -17.263 1.00 0.00 ? 12  ASN A HD21 1  
ATOM 192   H HD22 . ASN A 1 12  ? -14.486 -15.172 -18.355 1.00 0.00 ? 12  ASN A HD22 1  
ATOM 193   N N    . THR A 1 13  ? -18.448 -13.046 -13.699 1.00 0.00 ? 13  THR A N    1  
ATOM 194   C CA   . THR A 1 13  ? -19.676 -13.151 -12.888 1.00 0.00 ? 13  THR A CA   1  
ATOM 195   C C    . THR A 1 13  ? -20.095 -11.805 -12.288 1.00 0.00 ? 13  THR A C    1  
ATOM 196   O O    . THR A 1 13  ? -21.283 -11.480 -12.199 1.00 0.00 ? 13  THR A O    1  
ATOM 197   C CB   . THR A 1 13  ? -19.477 -14.211 -11.798 1.00 0.00 ? 13  THR A CB   1  
ATOM 198   O OG1  . THR A 1 13  ? -20.722 -14.663 -11.312 1.00 0.00 ? 13  THR A OG1  1  
ATOM 199   C CG2  . THR A 1 13  ? -18.640 -13.715 -10.625 1.00 0.00 ? 13  THR A CG2  1  
ATOM 200   H H    . THR A 1 13  ? -17.580 -13.367 -13.294 1.00 0.00 ? 13  THR A H    1  
ATOM 201   H HA   . THR A 1 13  ? -20.482 -13.497 -13.531 1.00 0.00 ? 13  THR A HA   1  
ATOM 202   H HB   . THR A 1 13  ? -18.944 -15.043 -12.251 1.00 0.00 ? 13  THR A HB   1  
ATOM 203   H HG1  . THR A 1 13  ? -20.550 -15.418 -10.720 1.00 0.00 ? 13  THR A HG1  1  
ATOM 204   H HG21 . THR A 1 13  ? -19.185 -12.956 -10.064 1.00 0.00 ? 13  THR A HG21 1  
ATOM 205   H HG22 . THR A 1 13  ? -18.385 -14.547 -9.970  1.00 0.00 ? 13  THR A HG22 1  
ATOM 206   H HG23 . THR A 1 13  ? -17.728 -13.272 -11.017 1.00 0.00 ? 13  THR A HG23 1  
ATOM 207   N N    . PHE A 1 14  ? -19.108 -10.970 -11.940 1.00 0.00 ? 14  PHE A N    1  
ATOM 208   C CA   . PHE A 1 14  ? -19.336 -9.597  -11.511 1.00 0.00 ? 14  PHE A CA   1  
ATOM 209   C C    . PHE A 1 14  ? -20.039 -8.814  -12.620 1.00 0.00 ? 14  PHE A C    1  
ATOM 210   O O    . PHE A 1 14  ? -21.024 -8.129  -12.353 1.00 0.00 ? 14  PHE A O    1  
ATOM 211   C CB   . PHE A 1 14  ? -17.985 -8.980  -11.153 1.00 0.00 ? 14  PHE A CB   1  
ATOM 212   C CG   . PHE A 1 14  ? -18.061 -7.572  -10.597 1.00 0.00 ? 14  PHE A CG   1  
ATOM 213   C CD1  . PHE A 1 14  ? -18.285 -7.367  -9.222  1.00 0.00 ? 14  PHE A CD1  1  
ATOM 214   C CD2  . PHE A 1 14  ? -17.914 -6.463  -11.454 1.00 0.00 ? 14  PHE A CD2  1  
ATOM 215   C CE1  . PHE A 1 14  ? -18.361 -6.061  -8.706  1.00 0.00 ? 14  PHE A CE1  1  
ATOM 216   C CE2  . PHE A 1 14  ? -17.993 -5.157  -10.937 1.00 0.00 ? 14  PHE A CE2  1  
ATOM 217   C CZ   . PHE A 1 14  ? -18.216 -4.956  -9.563  1.00 0.00 ? 14  PHE A CZ   1  
ATOM 218   H H    . PHE A 1 14  ? -18.146 -11.295 -11.987 1.00 0.00 ? 14  PHE A H    1  
ATOM 219   H HA   . PHE A 1 14  ? -19.975 -9.593  -10.626 1.00 0.00 ? 14  PHE A HA   1  
ATOM 220   H HB2  . PHE A 1 14  ? -17.509 -9.628  -10.420 1.00 0.00 ? 14  PHE A HB2  1  
ATOM 221   H HB3  . PHE A 1 14  ? -17.355 -8.982  -12.041 1.00 0.00 ? 14  PHE A HB3  1  
ATOM 222   H HD1  . PHE A 1 14  ? -18.399 -8.215  -8.560  1.00 0.00 ? 14  PHE A HD1  1  
ATOM 223   H HD2  . PHE A 1 14  ? -17.744 -6.612  -12.512 1.00 0.00 ? 14  PHE A HD2  1  
ATOM 224   H HE1  . PHE A 1 14  ? -18.533 -5.906  -7.648  1.00 0.00 ? 14  PHE A HE1  1  
ATOM 225   H HE2  . PHE A 1 14  ? -17.882 -4.306  -11.597 1.00 0.00 ? 14  PHE A HE2  1  
ATOM 226   H HZ   . PHE A 1 14  ? -18.276 -3.951  -9.166  1.00 0.00 ? 14  PHE A HZ   1  
ATOM 227   N N    . LEU A 1 15  ? -19.610 -9.004  -13.875 1.00 0.00 ? 15  LEU A N    1  
ATOM 228   C CA   . LEU A 1 15  ? -20.293 -8.422  -15.033 1.00 0.00 ? 15  LEU A CA   1  
ATOM 229   C C    . LEU A 1 15  ? -21.653 -9.085  -15.287 1.00 0.00 ? 15  LEU A C    1  
ATOM 230   O O    . LEU A 1 15  ? -22.628 -8.373  -15.466 1.00 0.00 ? 15  LEU A O    1  
ATOM 231   C CB   . LEU A 1 15  ? -19.387 -8.452  -16.275 1.00 0.00 ? 15  LEU A CB   1  
ATOM 232   C CG   . LEU A 1 15  ? -20.085 -7.946  -17.551 1.00 0.00 ? 15  LEU A CG   1  
ATOM 233   C CD1  . LEU A 1 15  ? -20.648 -6.525  -17.419 1.00 0.00 ? 15  LEU A CD1  1  
ATOM 234   C CD2  . LEU A 1 15  ? -19.107 -7.969  -18.724 1.00 0.00 ? 15  LEU A CD2  1  
ATOM 235   H H    . LEU A 1 15  ? -18.803 -9.609  -14.017 1.00 0.00 ? 15  LEU A H    1  
ATOM 236   H HA   . LEU A 1 15  ? -20.493 -7.375  -14.799 1.00 0.00 ? 15  LEU A HA   1  
ATOM 237   H HB2  . LEU A 1 15  ? -18.505 -7.841  -16.081 1.00 0.00 ? 15  LEU A HB2  1  
ATOM 238   H HB3  . LEU A 1 15  ? -19.065 -9.479  -16.451 1.00 0.00 ? 15  LEU A HB3  1  
ATOM 239   H HG   . LEU A 1 15  ? -20.905 -8.626  -17.777 1.00 0.00 ? 15  LEU A HG   1  
ATOM 240   H HD11 . LEU A 1 15  ? -21.117 -6.224  -18.355 1.00 0.00 ? 15  LEU A HD11 1  
ATOM 241   H HD12 . LEU A 1 15  ? -21.414 -6.491  -16.649 1.00 0.00 ? 15  LEU A HD12 1  
ATOM 242   H HD13 . LEU A 1 15  ? -19.856 -5.825  -17.154 1.00 0.00 ? 15  LEU A HD13 1  
ATOM 243   H HD21 . LEU A 1 15  ? -18.276 -7.290  -18.533 1.00 0.00 ? 15  LEU A HD21 1  
ATOM 244   H HD22 . LEU A 1 15  ? -18.721 -8.980  -18.860 1.00 0.00 ? 15  LEU A HD22 1  
ATOM 245   H HD23 . LEU A 1 15  ? -19.619 -7.665  -19.637 1.00 0.00 ? 15  LEU A HD23 1  
ATOM 246   N N    . ASP A 1 16  ? -21.765 -10.413 -15.252 1.00 0.00 ? 16  ASP A N    1  
ATOM 247   C CA   . ASP A 1 16  ? -23.036 -11.157 -15.357 1.00 0.00 ? 16  ASP A CA   1  
ATOM 248   C C    . ASP A 1 16  ? -24.139 -10.609 -14.430 1.00 0.00 ? 16  ASP A C    1  
ATOM 249   O O    . ASP A 1 16  ? -25.313 -10.533 -14.797 1.00 0.00 ? 16  ASP A O    1  
ATOM 250   C CB   . ASP A 1 16  ? -22.780 -12.634 -15.055 1.00 0.00 ? 16  ASP A CB   1  
ATOM 251   C CG   . ASP A 1 16  ? -24.026 -13.483 -15.320 1.00 0.00 ? 16  ASP A CG   1  
ATOM 252   O OD1  . ASP A 1 16  ? -24.227 -13.940 -16.470 1.00 0.00 ? 16  ASP A OD1  1  
ATOM 253   O OD2  . ASP A 1 16  ? -24.803 -13.685 -14.358 1.00 0.00 ? 16  ASP A OD2  1  
ATOM 254   H H    . ASP A 1 16  ? -20.909 -10.949 -15.181 1.00 0.00 ? 16  ASP A H    1  
ATOM 255   H HA   . ASP A 1 16  ? -23.398 -11.087 -16.382 1.00 0.00 ? 16  ASP A HA   1  
ATOM 256   H HB2  . ASP A 1 16  ? -21.950 -12.985 -15.663 1.00 0.00 ? 16  ASP A HB2  1  
ATOM 257   H HB3  . ASP A 1 16  ? -22.500 -12.747 -14.011 1.00 0.00 ? 16  ASP A HB3  1  
ATOM 258   N N    . THR A 1 17  ? -23.763 -10.228 -13.211 1.00 0.00 ? 17  THR A N    1  
ATOM 259   C CA   . THR A 1 17  ? -24.664 -9.531  -12.271 1.00 0.00 ? 17  THR A CA   1  
ATOM 260   C C    . THR A 1 17  ? -25.172 -8.196  -12.834 1.00 0.00 ? 17  THR A C    1  
ATOM 261   O O    . THR A 1 17  ? -26.373 -7.914  -12.801 1.00 0.00 ? 17  THR A O    1  
ATOM 262   C CB   . THR A 1 17  ? -23.991 -9.336  -10.901 1.00 0.00 ? 17  THR A CB   1  
ATOM 263   O OG1  . THR A 1 17  ? -23.585 -10.585 -10.373 1.00 0.00 ? 17  THR A OG1  1  
ATOM 264   C CG2  . THR A 1 17  ? -24.934 -8.710  -9.872  1.00 0.00 ? 17  THR A CG2  1  
ATOM 265   H H    . THR A 1 17  ? -22.773 -10.325 -12.998 1.00 0.00 ? 17  THR A H    1  
ATOM 266   H HA   . THR A 1 17  ? -25.543 -10.156 -12.127 1.00 0.00 ? 17  THR A HA   1  
ATOM 267   H HB   . THR A 1 17  ? -23.118 -8.694  -11.009 1.00 0.00 ? 17  THR A HB   1  
ATOM 268   H HG1  . THR A 1 17  ? -22.860 -10.919 -10.930 1.00 0.00 ? 17  THR A HG1  1  
ATOM 269   H HG21 . THR A 1 17  ? -25.188 -7.692  -10.169 1.00 0.00 ? 17  THR A HG21 1  
ATOM 270   H HG22 . THR A 1 17  ? -25.845 -9.302  -9.790  1.00 0.00 ? 17  THR A HG22 1  
ATOM 271   H HG23 . THR A 1 17  ? -24.439 -8.672  -8.901  1.00 0.00 ? 17  THR A HG23 1  
ATOM 272   N N    . ILE A 1 18  ? -24.282 -7.392  -13.425 1.00 0.00 ? 18  ILE A N    1  
ATOM 273   C CA   . ILE A 1 18  ? -24.637 -6.131  -14.093 1.00 0.00 ? 18  ILE A CA   1  
ATOM 274   C C    . ILE A 1 18  ? -25.488 -6.399  -15.338 1.00 0.00 ? 18  ILE A C    1  
ATOM 275   O O    . ILE A 1 18  ? -26.446 -5.664  -15.582 1.00 0.00 ? 18  ILE A O    1  
ATOM 276   C CB   . ILE A 1 18  ? -23.383 -5.311  -14.470 1.00 0.00 ? 18  ILE A CB   1  
ATOM 277   C CG1  . ILE A 1 18  ? -22.382 -5.092  -13.323 1.00 0.00 ? 18  ILE A CG1  1  
ATOM 278   C CG2  . ILE A 1 18  ? -23.754 -3.950  -15.082 1.00 0.00 ? 18  ILE A CG2  1  
ATOM 279   C CD1  . ILE A 1 18  ? -22.915 -4.281  -12.134 1.00 0.00 ? 18  ILE A CD1  1  
ATOM 280   H H    . ILE A 1 18  ? -23.340 -7.744  -13.552 1.00 0.00 ? 18  ILE A H    1  
ATOM 281   H HA   . ILE A 1 18  ? -25.239 -5.546  -13.404 1.00 0.00 ? 18  ILE A HA   1  
ATOM 282   H HB   . ILE A 1 18  ? -22.856 -5.872  -15.232 1.00 0.00 ? 18  ILE A HB   1  
ATOM 283   H HG12 . ILE A 1 18  ? -22.065 -6.055  -12.948 1.00 0.00 ? 18  ILE A HG12 1  
ATOM 284   H HG13 . ILE A 1 18  ? -21.494 -4.614  -13.742 1.00 0.00 ? 18  ILE A HG13 1  
ATOM 285   H HG21 . ILE A 1 18  ? -24.434 -3.406  -14.425 1.00 0.00 ? 18  ILE A HG21 1  
ATOM 286   H HG22 . ILE A 1 18  ? -22.856 -3.354  -15.246 1.00 0.00 ? 18  ILE A HG22 1  
ATOM 287   H HG23 . ILE A 1 18  ? -24.236 -4.096  -16.044 1.00 0.00 ? 18  ILE A HG23 1  
ATOM 288   H HD11 . ILE A 1 18  ? -23.803 -4.763  -11.722 1.00 0.00 ? 18  ILE A HD11 1  
ATOM 289   H HD12 . ILE A 1 18  ? -22.149 -4.236  -11.360 1.00 0.00 ? 18  ILE A HD12 1  
ATOM 290   H HD13 . ILE A 1 18  ? -23.161 -3.266  -12.443 1.00 0.00 ? 18  ILE A HD13 1  
ATOM 291   N N    . ILE A 1 19  ? -25.212 -7.484  -16.077 1.00 0.00 ? 19  ILE A N    1  
ATOM 292   C CA   . ILE A 1 19  ? -26.048 -7.915  -17.195 1.00 0.00 ? 19  ILE A CA   1  
ATOM 293   C C    . ILE A 1 19  ? -27.472 -8.110  -16.703 1.00 0.00 ? 19  ILE A C    1  
ATOM 294   O O    . ILE A 1 19  ? -28.363 -7.463  -17.230 1.00 0.00 ? 19  ILE A O    1  
ATOM 295   C CB   . ILE A 1 19  ? -25.558 -9.210  -17.881 1.00 0.00 ? 19  ILE A CB   1  
ATOM 296   C CG1  . ILE A 1 19  ? -24.117 -9.158  -18.426 1.00 0.00 ? 19  ILE A CG1  1  
ATOM 297   C CG2  . ILE A 1 19  ? -26.513 -9.582  -19.029 1.00 0.00 ? 19  ILE A CG2  1  
ATOM 298   C CD1  . ILE A 1 19  ? -23.786 -7.899  -19.222 1.00 0.00 ? 19  ILE A CD1  1  
ATOM 299   H H    . ILE A 1 19  ? -24.391 -8.031  -15.852 1.00 0.00 ? 19  ILE A H    1  
ATOM 300   H HA   . ILE A 1 19  ? -26.052 -7.102  -17.916 1.00 0.00 ? 19  ILE A HA   1  
ATOM 301   H HB   . ILE A 1 19  ? -25.608 -10.018 -17.156 1.00 0.00 ? 19  ILE A HB   1  
ATOM 302   H HG12 . ILE A 1 19  ? -23.419 -9.221  -17.602 1.00 0.00 ? 19  ILE A HG12 1  
ATOM 303   H HG13 . ILE A 1 19  ? -23.936 -10.030 -19.055 1.00 0.00 ? 19  ILE A HG13 1  
ATOM 304   H HG21 . ILE A 1 19  ? -26.135 -10.454 -19.562 1.00 0.00 ? 19  ILE A HG21 1  
ATOM 305   H HG22 . ILE A 1 19  ? -27.499 -9.833  -18.638 1.00 0.00 ? 19  ILE A HG22 1  
ATOM 306   H HG23 . ILE A 1 19  ? -26.609 -8.746  -19.721 1.00 0.00 ? 19  ILE A HG23 1  
ATOM 307   H HD11 . ILE A 1 19  ? -23.764 -7.045  -18.548 1.00 0.00 ? 19  ILE A HD11 1  
ATOM 308   H HD12 . ILE A 1 19  ? -22.797 -8.019  -19.663 1.00 0.00 ? 19  ILE A HD12 1  
ATOM 309   H HD13 . ILE A 1 19  ? -24.538 -7.739  -19.998 1.00 0.00 ? 19  ILE A HD13 1  
ATOM 310   N N    . ARG A 1 20  ? -27.689 -8.914  -15.651 1.00 0.00 ? 20  ARG A N    1  
ATOM 311   C CA   . ARG A 1 20  ? -29.022 -9.127  -15.051 1.00 0.00 ? 20  ARG A CA   1  
ATOM 312   C C    . ARG A 1 20  ? -29.642 -7.835  -14.531 1.00 0.00 ? 20  ARG A C    1  
ATOM 313   O O    . ARG A 1 20  ? -30.861 -7.684  -14.573 1.00 0.00 ? 20  ARG A O    1  
ATOM 314   C CB   . ARG A 1 20  ? -28.930 -10.172 -13.939 1.00 0.00 ? 20  ARG A CB   1  
ATOM 315   C CG   . ARG A 1 20  ? -28.907 -11.576 -14.553 1.00 0.00 ? 20  ARG A CG   1  
ATOM 316   C CD   . ARG A 1 20  ? -28.641 -12.618 -13.473 1.00 0.00 ? 20  ARG A CD   1  
ATOM 317   N NE   . ARG A 1 20  ? -27.230 -12.576 -13.058 1.00 0.00 ? 20  ARG A NE   1  
ATOM 318   C CZ   . ARG A 1 20  ? -26.713 -12.764 -11.861 1.00 0.00 ? 20  ARG A CZ   1  
ATOM 319   N NH1  . ARG A 1 20  ? -27.426 -12.797 -10.770 1.00 0.00 ? 20  ARG A NH1  1  
ATOM 320   N NH2  . ARG A 1 20  ? -25.431 -12.924 -11.765 1.00 0.00 ? 20  ARG A NH2  1  
ATOM 321   H H    . ARG A 1 20  ? -26.880 -9.366  -15.231 1.00 0.00 ? 20  ARG A H    1  
ATOM 322   H HA   . ARG A 1 20  ? -29.708 -9.501  -15.807 1.00 0.00 ? 20  ARG A HA   1  
ATOM 323   H HB2  . ARG A 1 20  ? -28.037 -9.995  -13.338 1.00 0.00 ? 20  ARG A HB2  1  
ATOM 324   H HB3  . ARG A 1 20  ? -29.805 -10.096 -13.290 1.00 0.00 ? 20  ARG A HB3  1  
ATOM 325   H HG2  . ARG A 1 20  ? -29.876 -11.779 -15.012 1.00 0.00 ? 20  ARG A HG2  1  
ATOM 326   H HG3  . ARG A 1 20  ? -28.135 -11.646 -15.321 1.00 0.00 ? 20  ARG A HG3  1  
ATOM 327   H HD2  . ARG A 1 20  ? -29.318 -12.441 -12.637 1.00 0.00 ? 20  ARG A HD2  1  
ATOM 328   H HD3  . ARG A 1 20  ? -28.857 -13.601 -13.895 1.00 0.00 ? 20  ARG A HD3  1  
ATOM 329   H HE   . ARG A 1 20  ? -26.551 -12.413 -13.792 1.00 0.00 ? 20  ARG A HE   1  
ATOM 330   H HH11 . ARG A 1 20  ? -28.423 -12.682 -10.830 1.00 0.00 ? 20  ARG A HH11 1  
ATOM 331   H HH12 . ARG A 1 20  ? -26.986 -12.953 -9.880  1.00 0.00 ? 20  ARG A HH12 1  
ATOM 332   H HH21 . ARG A 1 20  ? -24.935 -13.111 -12.635 1.00 0.00 ? 20  ARG A HH21 1  
ATOM 333   H HH22 . ARG A 1 20  ? -24.972 -13.006 -10.875 1.00 0.00 ? 20  ARG A HH22 1  
ATOM 334   N N    . LYS A 1 21  ? -28.807 -6.881  -14.120 1.00 0.00 ? 21  LYS A N    1  
ATOM 335   C CA   . LYS A 1 21  ? -29.250 -5.526  -13.738 1.00 0.00 ? 21  LYS A CA   1  
ATOM 336   C C    . LYS A 1 21  ? -29.881 -4.753  -14.908 1.00 0.00 ? 21  LYS A C    1  
ATOM 337   O O    . LYS A 1 21  ? -30.970 -4.205  -14.734 1.00 0.00 ? 21  LYS A O    1  
ATOM 338   C CB   . LYS A 1 21  ? -28.094 -4.743  -13.083 1.00 0.00 ? 21  LYS A CB   1  
ATOM 339   C CG   . LYS A 1 21  ? -28.519 -3.974  -11.824 1.00 0.00 ? 21  LYS A CG   1  
ATOM 340   C CD   . LYS A 1 21  ? -28.793 -4.919  -10.644 1.00 0.00 ? 21  LYS A CD   1  
ATOM 341   C CE   . LYS A 1 21  ? -29.240 -4.142  -9.402  1.00 0.00 ? 21  LYS A CE   1  
ATOM 342   N NZ   . LYS A 1 21  ? -29.829 -5.063  -8.402  1.00 0.00 ? 21  LYS A NZ   1  
ATOM 343   H H    . LYS A 1 21  ? -27.821 -7.144  -14.086 1.00 0.00 ? 21  LYS A H    1  
ATOM 344   H HA   . LYS A 1 21  ? -30.052 -5.645  -13.011 1.00 0.00 ? 21  LYS A HA   1  
ATOM 345   H HB2  . LYS A 1 21  ? -27.298 -5.426  -12.795 1.00 0.00 ? 21  LYS A HB2  1  
ATOM 346   H HB3  . LYS A 1 21  ? -27.687 -4.034  -13.807 1.00 0.00 ? 21  LYS A HB3  1  
ATOM 347   H HG2  . LYS A 1 21  ? -27.719 -3.286  -11.546 1.00 0.00 ? 21  LYS A HG2  1  
ATOM 348   H HG3  . LYS A 1 21  ? -29.413 -3.398  -12.050 1.00 0.00 ? 21  LYS A HG3  1  
ATOM 349   H HD2  . LYS A 1 21  ? -29.578 -5.625  -10.918 1.00 0.00 ? 21  LYS A HD2  1  
ATOM 350   H HD3  . LYS A 1 21  ? -27.885 -5.481  -10.412 1.00 0.00 ? 21  LYS A HD3  1  
ATOM 351   H HE2  . LYS A 1 21  ? -28.383 -3.609  -8.980  1.00 0.00 ? 21  LYS A HE2  1  
ATOM 352   H HE3  . LYS A 1 21  ? -29.991 -3.406  -9.698  1.00 0.00 ? 21  LYS A HE3  1  
ATOM 353   H HZ1  . LYS A 1 21  ? -29.191 -5.800  -8.145  1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 354   H HZ2  . LYS A 1 21  ? -30.111 -4.584  -7.545  1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 355   H HZ3  . LYS A 1 21  ? -30.677 -5.488  -8.784  1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 356   N N    . PHE A 1 22  ? -29.261 -4.757  -16.097 1.00 0.00 ? 22  PHE A N    1  
ATOM 357   C CA   . PHE A 1 22  ? -29.799 -4.102  -17.311 1.00 0.00 ? 22  PHE A CA   1  
ATOM 358   C C    . PHE A 1 22  ? -30.471 -5.052  -18.335 1.00 0.00 ? 22  PHE A C    1  
ATOM 359   O O    . PHE A 1 22  ? -30.789 -4.642  -19.452 1.00 0.00 ? 22  PHE A O    1  
ATOM 360   C CB   . PHE A 1 22  ? -28.759 -3.152  -17.942 1.00 0.00 ? 22  PHE A CB   1  
ATOM 361   C CG   . PHE A 1 22  ? -27.597 -3.781  -18.700 1.00 0.00 ? 22  PHE A CG   1  
ATOM 362   C CD1  . PHE A 1 22  ? -27.735 -4.162  -20.051 1.00 0.00 ? 22  PHE A CD1  1  
ATOM 363   C CD2  . PHE A 1 22  ? -26.339 -3.903  -18.083 1.00 0.00 ? 22  PHE A CD2  1  
ATOM 364   C CE1  . PHE A 1 22  ? -26.645 -4.701  -20.758 1.00 0.00 ? 22  PHE A CE1  1  
ATOM 365   C CE2  . PHE A 1 22  ? -25.244 -4.435  -18.789 1.00 0.00 ? 22  PHE A CE2  1  
ATOM 366   C CZ   . PHE A 1 22  ? -25.399 -4.840  -20.126 1.00 0.00 ? 22  PHE A CZ   1  
ATOM 367   H H    . PHE A 1 22  ? -28.356 -5.217  -16.153 1.00 0.00 ? 22  PHE A H    1  
ATOM 368   H HA   . PHE A 1 22  ? -30.601 -3.446  -16.977 1.00 0.00 ? 22  PHE A HA   1  
ATOM 369   H HB2  . PHE A 1 22  ? -29.285 -2.492  -18.633 1.00 0.00 ? 22  PHE A HB2  1  
ATOM 370   H HB3  . PHE A 1 22  ? -28.361 -2.510  -17.155 1.00 0.00 ? 22  PHE A HB3  1  
ATOM 371   H HD1  . PHE A 1 22  ? -28.677 -4.027  -20.562 1.00 0.00 ? 22  PHE A HD1  1  
ATOM 372   H HD2  . PHE A 1 22  ? -26.214 -3.575  -17.061 1.00 0.00 ? 22  PHE A HD2  1  
ATOM 373   H HE1  . PHE A 1 22  ? -26.763 -4.996  -21.792 1.00 0.00 ? 22  PHE A HE1  1  
ATOM 374   H HE2  . PHE A 1 22  ? -24.280 -4.529  -18.310 1.00 0.00 ? 22  PHE A HE2  1  
ATOM 375   H HZ   . PHE A 1 22  ? -24.556 -5.245  -20.671 1.00 0.00 ? 22  PHE A HZ   1  
ATOM 376   N N    . GLU A 1 23  ? -30.726 -6.312  -17.967 1.00 0.00 ? 23  GLU A N    1  
ATOM 377   C CA   . GLU A 1 23  ? -31.121 -7.404  -18.880 1.00 0.00 ? 23  GLU A CA   1  
ATOM 378   C C    . GLU A 1 23  ? -32.439 -7.129  -19.646 1.00 0.00 ? 23  GLU A C    1  
ATOM 379   O O    . GLU A 1 23  ? -32.596 -7.563  -20.791 1.00 0.00 ? 23  GLU A O    1  
ATOM 380   C CB   . GLU A 1 23  ? -31.159 -8.704  -18.042 1.00 0.00 ? 23  GLU A CB   1  
ATOM 381   C CG   . GLU A 1 23  ? -31.832 -9.925  -18.680 1.00 0.00 ? 23  GLU A CG   1  
ATOM 382   C CD   . GLU A 1 23  ? -33.255 -10.174 -18.151 1.00 0.00 ? 23  GLU A CD   1  
ATOM 383   O OE1  . GLU A 1 23  ? -34.007 -9.203  -17.897 1.00 0.00 ? 23  GLU A OE1  1  
ATOM 384   O OE2  . GLU A 1 23  ? -33.640 -11.356 -18.002 1.00 0.00 ? 23  GLU A OE2  1  
ATOM 385   H H    . GLU A 1 23  ? -30.366 -6.596  -17.067 1.00 0.00 ? 23  GLU A H    1  
ATOM 386   H HA   . GLU A 1 23  ? -30.316 -7.519  -19.617 1.00 0.00 ? 23  GLU A HA   1  
ATOM 387   H HB2  . GLU A 1 23  ? -30.132 -9.002  -17.821 1.00 0.00 ? 23  GLU A HB2  1  
ATOM 388   H HB3  . GLU A 1 23  ? -31.630 -8.505  -17.081 1.00 0.00 ? 23  GLU A HB3  1  
ATOM 389   H HG2  . GLU A 1 23  ? -31.833 -9.839  -19.767 1.00 0.00 ? 23  GLU A HG2  1  
ATOM 390   H HG3  . GLU A 1 23  ? -31.217 -10.790 -18.432 1.00 0.00 ? 23  GLU A HG3  1  
ATOM 391   N N    . GLY A 1 24  ? -33.351 -6.349  -19.052 1.00 0.00 ? 24  GLY A N    1  
ATOM 392   C CA   . GLY A 1 24  ? -34.530 -5.750  -19.699 1.00 0.00 ? 24  GLY A CA   1  
ATOM 393   C C    . GLY A 1 24  ? -35.604 -6.695  -20.259 1.00 0.00 ? 24  GLY A C    1  
ATOM 394   O O    . GLY A 1 24  ? -36.427 -6.257  -21.067 1.00 0.00 ? 24  GLY A O    1  
ATOM 395   H H    . GLY A 1 24  ? -33.161 -6.105  -18.092 1.00 0.00 ? 24  GLY A H    1  
ATOM 396   H HA2  . GLY A 1 24  ? -35.020 -5.100  -18.974 1.00 0.00 ? 24  GLY A HA2  1  
ATOM 397   H HA3  . GLY A 1 24  ? -34.184 -5.122  -20.520 1.00 0.00 ? 24  GLY A HA3  1  
ATOM 398   N N    . GLN A 1 25  ? -35.596 -7.977  -19.885 1.00 0.00 ? 25  GLN A N    1  
ATOM 399   C CA   . GLN A 1 25  ? -36.477 -9.028  -20.424 1.00 0.00 ? 25  GLN A CA   1  
ATOM 400   C C    . GLN A 1 25  ? -37.314 -9.691  -19.316 1.00 0.00 ? 25  GLN A C    1  
ATOM 401   O O    . GLN A 1 25  ? -38.524 -9.866  -19.474 1.00 0.00 ? 25  GLN A O    1  
ATOM 402   C CB   . GLN A 1 25  ? -35.613 -10.050 -21.182 1.00 0.00 ? 25  GLN A CB   1  
ATOM 403   C CG   . GLN A 1 25  ? -35.070 -9.483  -22.506 1.00 0.00 ? 25  GLN A CG   1  
ATOM 404   C CD   . GLN A 1 25  ? -33.848 -10.254 -22.993 1.00 0.00 ? 25  GLN A CD   1  
ATOM 405   O OE1  . GLN A 1 25  ? -33.937 -11.226 -23.736 1.00 0.00 ? 25  GLN A OE1  1  
ATOM 406   N NE2  . GLN A 1 25  ? -32.660 -9.858  -22.586 1.00 0.00 ? 25  GLN A NE2  1  
ATOM 407   H H    . GLN A 1 25  ? -34.892 -8.258  -19.206 1.00 0.00 ? 25  GLN A H    1  
ATOM 408   H HA   . GLN A 1 25  ? -37.184 -8.596  -21.133 1.00 0.00 ? 25  GLN A HA   1  
ATOM 409   H HB2  . GLN A 1 25  ? -34.782 -10.353 -20.546 1.00 0.00 ? 25  GLN A HB2  1  
ATOM 410   H HB3  . GLN A 1 25  ? -36.210 -10.935 -21.404 1.00 0.00 ? 25  GLN A HB3  1  
ATOM 411   H HG2  . GLN A 1 25  ? -35.853 -9.522  -23.264 1.00 0.00 ? 25  GLN A HG2  1  
ATOM 412   H HG3  . GLN A 1 25  ? -34.781 -8.440  -22.381 1.00 0.00 ? 25  GLN A HG3  1  
ATOM 413   H HE21 . GLN A 1 25  ? -32.585 -9.048  -21.973 1.00 0.00 ? 25  GLN A HE21 1  
ATOM 414   H HE22 . GLN A 1 25  ? -31.845 -10.359 -22.902 1.00 0.00 ? 25  GLN A HE22 1  
ATOM 415   N N    . SER A 1 26  ? -36.683 -10.004 -18.182 1.00 0.00 ? 26  SER A N    1  
ATOM 416   C CA   . SER A 1 26  ? -37.320 -10.417 -16.921 1.00 0.00 ? 26  SER A CA   1  
ATOM 417   C C    . SER A 1 26  ? -37.107 -9.382  -15.809 1.00 0.00 ? 26  SER A C    1  
ATOM 418   O O    . SER A 1 26  ? -37.936 -9.289  -14.899 1.00 0.00 ? 26  SER A O    1  
ATOM 419   C CB   . SER A 1 26  ? -36.808 -11.793 -16.474 1.00 0.00 ? 26  SER A CB   1  
ATOM 420   O OG   . SER A 1 26  ? -37.179 -12.797 -17.410 1.00 0.00 ? 26  SER A OG   1  
ATOM 421   H H    . SER A 1 26  ? -35.675 -9.876  -18.167 1.00 0.00 ? 26  SER A H    1  
ATOM 422   H HA   . SER A 1 26  ? -38.397 -10.502 -17.067 1.00 0.00 ? 26  SER A HA   1  
ATOM 423   H HB2  . SER A 1 26  ? -35.723 -11.762 -16.366 1.00 0.00 ? 26  SER A HB2  1  
ATOM 424   H HB3  . SER A 1 26  ? -37.245 -12.036 -15.503 1.00 0.00 ? 26  SER A HB3  1  
ATOM 425   H HG   . SER A 1 26  ? -36.799 -13.648 -17.113 1.00 0.00 ? 26  SER A HG   1  
ATOM 426   N N    . ARG A 1 27  ? -36.039 -8.571  -15.878 1.00 0.00 ? 27  ARG A N    1  
ATOM 427   C CA   . ARG A 1 27  ? -35.770 -7.437  -14.972 1.00 0.00 ? 27  ARG A CA   1  
ATOM 428   C C    . ARG A 1 27  ? -36.155 -6.081  -15.590 1.00 0.00 ? 27  ARG A C    1  
ATOM 429   O O    . ARG A 1 27  ? -36.254 -5.950  -16.811 1.00 0.00 ? 27  ARG A O    1  
ATOM 430   C CB   . ARG A 1 27  ? -34.309 -7.505  -14.489 1.00 0.00 ? 27  ARG A CB   1  
ATOM 431   C CG   . ARG A 1 27  ? -33.997 -8.750  -13.629 1.00 0.00 ? 27  ARG A CG   1  
ATOM 432   C CD   . ARG A 1 27  ? -34.925 -8.900  -12.419 1.00 0.00 ? 27  ARG A CD   1  
ATOM 433   N NE   . ARG A 1 27  ? -34.195 -9.238  -11.187 1.00 0.00 ? 27  ARG A NE   1  
ATOM 434   C CZ   . ARG A 1 27  ? -33.671 -10.379 -10.798 1.00 0.00 ? 27  ARG A CZ   1  
ATOM 435   N NH1  . ARG A 1 27  ? -33.760 -11.481 -11.488 1.00 0.00 ? 27  ARG A NH1  1  
ATOM 436   N NH2  . ARG A 1 27  ? -33.034 -10.387 -9.668  1.00 0.00 ? 27  ARG A NH2  1  
ATOM 437   H H    . ARG A 1 27  ? -35.366 -8.736  -16.626 1.00 0.00 ? 27  ARG A H    1  
ATOM 438   H HA   . ARG A 1 27  ? -36.416 -7.540  -14.102 1.00 0.00 ? 27  ARG A HA   1  
ATOM 439   H HB2  . ARG A 1 27  ? -33.642 -7.497  -15.353 1.00 0.00 ? 27  ARG A HB2  1  
ATOM 440   H HB3  . ARG A 1 27  ? -34.087 -6.619  -13.892 1.00 0.00 ? 27  ARG A HB3  1  
ATOM 441   H HG2  . ARG A 1 27  ? -34.092 -9.662  -14.214 1.00 0.00 ? 27  ARG A HG2  1  
ATOM 442   H HG3  . ARG A 1 27  ? -32.964 -8.673  -13.295 1.00 0.00 ? 27  ARG A HG3  1  
ATOM 443   H HD2  . ARG A 1 27  ? -35.435 -7.955  -12.254 1.00 0.00 ? 27  ARG A HD2  1  
ATOM 444   H HD3  . ARG A 1 27  ? -35.693 -9.641  -12.640 1.00 0.00 ? 27  ARG A HD3  1  
ATOM 445   H HE   . ARG A 1 27  ? -34.041 -8.488  -10.518 1.00 0.00 ? 27  ARG A HE   1  
ATOM 446   H HH11 . ARG A 1 27  ? -34.260 -11.477 -12.359 1.00 0.00 ? 27  ARG A HH11 1  
ATOM 447   H HH12 . ARG A 1 27  ? -33.350 -12.333 -11.143 1.00 0.00 ? 27  ARG A HH12 1  
ATOM 448   H HH21 . ARG A 1 27  ? -32.989 -9.500  -9.163  1.00 0.00 ? 27  ARG A HH21 1  
ATOM 449   H HH22 . ARG A 1 27  ? -32.607 -11.221 -9.306  1.00 0.00 ? 27  ARG A HH22 1  
ATOM 450   N N    . LYS A 1 28  ? -36.416 -5.083  -14.732 1.00 0.00 ? 28  LYS A N    1  
ATOM 451   C CA   . LYS A 1 28  ? -37.028 -3.778  -15.075 1.00 0.00 ? 28  LYS A CA   1  
ATOM 452   C C    . LYS A 1 28  ? -36.276 -2.605  -14.432 1.00 0.00 ? 28  LYS A C    1  
ATOM 453   O O    . LYS A 1 28  ? -35.792 -2.753  -13.309 1.00 0.00 ? 28  LYS A O    1  
ATOM 454   C CB   . LYS A 1 28  ? -38.507 -3.758  -14.631 1.00 0.00 ? 28  LYS A CB   1  
ATOM 455   C CG   . LYS A 1 28  ? -39.361 -4.971  -15.061 1.00 0.00 ? 28  LYS A CG   1  
ATOM 456   C CD   . LYS A 1 28  ? -39.443 -6.112  -14.034 1.00 0.00 ? 28  LYS A CD   1  
ATOM 457   C CE   . LYS A 1 28  ? -40.539 -7.094  -14.472 1.00 0.00 ? 28  LYS A CE   1  
ATOM 458   N NZ   . LYS A 1 28  ? -40.404 -8.418  -13.806 1.00 0.00 ? 28  LYS A NZ   1  
ATOM 459   H H    . LYS A 1 28  ? -36.218 -5.250  -13.756 1.00 0.00 ? 28  LYS A H    1  
ATOM 460   H HA   . LYS A 1 28  ? -36.980 -3.639  -16.154 1.00 0.00 ? 28  LYS A HA   1  
ATOM 461   H HB2  . LYS A 1 28  ? -38.563 -3.644  -13.551 1.00 0.00 ? 28  LYS A HB2  1  
ATOM 462   H HB3  . LYS A 1 28  ? -38.963 -2.859  -15.041 1.00 0.00 ? 28  LYS A HB3  1  
ATOM 463   H HG2  . LYS A 1 28  ? -40.377 -4.629  -15.218 1.00 0.00 ? 28  LYS A HG2  1  
ATOM 464   H HG3  . LYS A 1 28  ? -39.004 -5.355  -16.017 1.00 0.00 ? 28  LYS A HG3  1  
ATOM 465   H HD2  . LYS A 1 28  ? -38.488 -6.627  -13.979 1.00 0.00 ? 28  LYS A HD2  1  
ATOM 466   H HD3  . LYS A 1 28  ? -39.690 -5.713  -13.049 1.00 0.00 ? 28  LYS A HD3  1  
ATOM 467   H HE2  . LYS A 1 28  ? -41.516 -6.654  -14.251 1.00 0.00 ? 28  LYS A HE2  1  
ATOM 468   H HE3  . LYS A 1 28  ? -40.477 -7.219  -15.557 1.00 0.00 ? 28  LYS A HE3  1  
ATOM 469   H HZ1  . LYS A 1 28  ? -39.521 -8.857  -14.062 1.00 0.00 ? 28  LYS A HZ1  1  
ATOM 470   H HZ2  . LYS A 1 28  ? -40.439 -8.343  -12.800 1.00 0.00 ? 28  LYS A HZ2  1  
ATOM 471   H HZ3  . LYS A 1 28  ? -41.142 -9.047  -14.096 1.00 0.00 ? 28  LYS A HZ3  1  
ATOM 472   N N    . PHE A 1 29  ? -36.187 -1.447  -15.104 1.00 0.00 ? 29  PHE A N    1  
ATOM 473   C CA   . PHE A 1 29  ? -35.331 -0.334  -14.644 1.00 0.00 ? 29  PHE A CA   1  
ATOM 474   C C    . PHE A 1 29  ? -35.525 1.003   -15.387 1.00 0.00 ? 29  PHE A C    1  
ATOM 475   O O    . PHE A 1 29  ? -36.048 1.067   -16.509 1.00 0.00 ? 29  PHE A O    1  
ATOM 476   C CB   . PHE A 1 29  ? -33.841 -0.741  -14.732 1.00 0.00 ? 29  PHE A CB   1  
ATOM 477   C CG   . PHE A 1 29  ? -33.300 -1.034  -16.119 1.00 0.00 ? 29  PHE A CG   1  
ATOM 478   C CD1  . PHE A 1 29  ? -33.476 -2.308  -16.696 1.00 0.00 ? 29  PHE A CD1  1  
ATOM 479   C CD2  . PHE A 1 29  ? -32.571 -0.047  -16.812 1.00 0.00 ? 29  PHE A CD2  1  
ATOM 480   C CE1  . PHE A 1 29  ? -32.944 -2.582  -17.967 1.00 0.00 ? 29  PHE A CE1  1  
ATOM 481   C CE2  . PHE A 1 29  ? -32.017 -0.333  -18.073 1.00 0.00 ? 29  PHE A CE2  1  
ATOM 482   C CZ   . PHE A 1 29  ? -32.203 -1.601  -18.649 1.00 0.00 ? 29  PHE A CZ   1  
ATOM 483   H H    . PHE A 1 29  ? -36.681 -1.337  -15.983 1.00 0.00 ? 29  PHE A H    1  
ATOM 484   H HA   . PHE A 1 29  ? -35.569 -0.139  -13.599 1.00 0.00 ? 29  PHE A HA   1  
ATOM 485   H HB2  . PHE A 1 29  ? -33.237 0.052   -14.287 1.00 0.00 ? 29  PHE A HB2  1  
ATOM 486   H HB3  . PHE A 1 29  ? -33.668 -1.624  -14.120 1.00 0.00 ? 29  PHE A HB3  1  
ATOM 487   H HD1  . PHE A 1 29  ? -34.004 -3.087  -16.158 1.00 0.00 ? 29  PHE A HD1  1  
ATOM 488   H HD2  . PHE A 1 29  ? -32.419 0.927   -16.367 1.00 0.00 ? 29  PHE A HD2  1  
ATOM 489   H HE1  . PHE A 1 29  ? -33.086 -3.554  -18.416 1.00 0.00 ? 29  PHE A HE1  1  
ATOM 490   H HE2  . PHE A 1 29  ? -31.446 0.420   -18.599 1.00 0.00 ? 29  PHE A HE2  1  
ATOM 491   H HZ   . PHE A 1 29  ? -31.775 -1.826  -19.617 1.00 0.00 ? 29  PHE A HZ   1  
ATOM 492   N N    . ILE A 1 30  ? -35.061 2.079   -14.738 1.00 0.00 ? 30  ILE A N    1  
ATOM 493   C CA   . ILE A 1 30  ? -35.035 3.444   -15.284 1.00 0.00 ? 30  ILE A CA   1  
ATOM 494   C C    . ILE A 1 30  ? -33.646 4.073   -15.170 1.00 0.00 ? 30  ILE A C    1  
ATOM 495   O O    . ILE A 1 30  ? -32.762 3.507   -14.537 1.00 0.00 ? 30  ILE A O    1  
ATOM 496   C CB   . ILE A 1 30  ? -36.119 4.326   -14.624 1.00 0.00 ? 30  ILE A CB   1  
ATOM 497   C CG1  . ILE A 1 30  ? -36.172 4.288   -13.083 1.00 0.00 ? 30  ILE A CG1  1  
ATOM 498   C CG2  . ILE A 1 30  ? -37.481 3.924   -15.194 1.00 0.00 ? 30  ILE A CG2  1  
ATOM 499   C CD1  . ILE A 1 30  ? -34.843 4.612   -12.393 1.00 0.00 ? 30  ILE A CD1  1  
ATOM 500   H H    . ILE A 1 30  ? -34.625 1.959   -13.822 1.00 0.00 ? 30  ILE A H    1  
ATOM 501   H HA   . ILE A 1 30  ? -35.239 3.400   -16.351 1.00 0.00 ? 30  ILE A HA   1  
ATOM 502   H HB   . ILE A 1 30  ? -35.950 5.360   -14.922 1.00 0.00 ? 30  ILE A HB   1  
ATOM 503   H HG12 . ILE A 1 30  ? -36.911 5.017   -12.749 1.00 0.00 ? 30  ILE A HG12 1  
ATOM 504   H HG13 . ILE A 1 30  ? -36.501 3.303   -12.750 1.00 0.00 ? 30  ILE A HG13 1  
ATOM 505   H HG21 . ILE A 1 30  ? -38.239 4.640   -14.878 1.00 0.00 ? 30  ILE A HG21 1  
ATOM 506   H HG22 . ILE A 1 30  ? -37.421 3.918   -16.280 1.00 0.00 ? 30  ILE A HG22 1  
ATOM 507   H HG23 . ILE A 1 30  ? -37.755 2.928   -14.848 1.00 0.00 ? 30  ILE A HG23 1  
ATOM 508   H HD11 . ILE A 1 30  ? -34.418 5.532   -12.792 1.00 0.00 ? 30  ILE A HD11 1  
ATOM 509   H HD12 . ILE A 1 30  ? -35.027 4.742   -11.333 1.00 0.00 ? 30  ILE A HD12 1  
ATOM 510   H HD13 . ILE A 1 30  ? -34.137 3.788   -12.516 1.00 0.00 ? 30  ILE A HD13 1  
ATOM 511   N N    . ILE A 1 31  ? -33.457 5.245   -15.771 1.00 0.00 ? 31  ILE A N    1  
ATOM 512   C CA   . ILE A 1 31  ? -32.207 6.003   -15.802 1.00 0.00 ? 31  ILE A CA   1  
ATOM 513   C C    . ILE A 1 31  ? -32.506 7.438   -15.394 1.00 0.00 ? 31  ILE A C    1  
ATOM 514   O O    . ILE A 1 31  ? -33.273 8.133   -16.064 1.00 0.00 ? 31  ILE A O    1  
ATOM 515   C CB   . ILE A 1 31  ? -31.583 5.999   -17.215 1.00 0.00 ? 31  ILE A CB   1  
ATOM 516   C CG1  . ILE A 1 31  ? -31.620 4.628   -17.926 1.00 0.00 ? 31  ILE A CG1  1  
ATOM 517   C CG2  . ILE A 1 31  ? -30.157 6.578   -17.169 1.00 0.00 ? 31  ILE A CG2  1  
ATOM 518   C CD1  . ILE A 1 31  ? -30.698 3.605   -17.272 1.00 0.00 ? 31  ILE A CD1  1  
ATOM 519   H H    . ILE A 1 31  ? -34.228 5.644   -16.297 1.00 0.00 ? 31  ILE A H    1  
ATOM 520   H HA   . ILE A 1 31  ? -31.501 5.575   -15.094 1.00 0.00 ? 31  ILE A HA   1  
ATOM 521   H HB   . ILE A 1 31  ? -32.175 6.676   -17.820 1.00 0.00 ? 31  ILE A HB   1  
ATOM 522   H HG12 . ILE A 1 31  ? -32.646 4.242   -17.942 1.00 0.00 ? 31  ILE A HG12 1  
ATOM 523   H HG13 . ILE A 1 31  ? -31.294 4.751   -18.957 1.00 0.00 ? 31  ILE A HG13 1  
ATOM 524   H HG21 . ILE A 1 31  ? -30.180 7.604   -16.806 1.00 0.00 ? 31  ILE A HG21 1  
ATOM 525   H HG22 . ILE A 1 31  ? -29.520 5.992   -16.506 1.00 0.00 ? 31  ILE A HG22 1  
ATOM 526   H HG23 . ILE A 1 31  ? -29.727 6.578   -18.171 1.00 0.00 ? 31  ILE A HG23 1  
ATOM 527   H HD11 . ILE A 1 31  ? -30.920 2.613   -17.659 1.00 0.00 ? 31  ILE A HD11 1  
ATOM 528   H HD12 . ILE A 1 31  ? -29.663 3.857   -17.496 1.00 0.00 ? 31  ILE A HD12 1  
ATOM 529   H HD13 . ILE A 1 31  ? -30.846 3.635   -16.197 1.00 0.00 ? 31  ILE A HD13 1  
ATOM 530   N N    . ALA A 1 32  ? -31.873 7.888   -14.317 1.00 0.00 ? 32  ALA A N    1  
ATOM 531   C CA   . ALA A 1 32  ? -32.062 9.240   -13.783 1.00 0.00 ? 32  ALA A CA   1  
ATOM 532   C C    . ALA A 1 32  ? -30.753 9.966   -13.449 1.00 0.00 ? 32  ALA A C    1  
ATOM 533   O O    . ALA A 1 32  ? -29.735 9.342   -13.133 1.00 0.00 ? 32  ALA A O    1  
ATOM 534   C CB   . ALA A 1 32  ? -33.030 9.207   -12.589 1.00 0.00 ? 32  ALA A CB   1  
ATOM 535   H H    . ALA A 1 32  ? -31.294 7.220   -13.808 1.00 0.00 ? 32  ALA A H    1  
ATOM 536   H HA   . ALA A 1 32  ? -32.529 9.837   -14.560 1.00 0.00 ? 32  ALA A HA   1  
ATOM 537   H HB1  . ALA A 1 32  ? -32.687 8.508   -11.836 1.00 0.00 ? 32  ALA A HB1  1  
ATOM 538   H HB2  . ALA A 1 32  ? -33.095 10.196  -12.131 1.00 0.00 ? 32  ALA A HB2  1  
ATOM 539   H HB3  . ALA A 1 32  ? -34.020 8.897   -12.922 1.00 0.00 ? 32  ALA A HB3  1  
ATOM 540   N N    . ASN A 1 33  ? -30.787 11.303  -13.486 1.00 0.00 ? 33  ASN A N    1  
ATOM 541   C CA   . ASN A 1 33  ? -29.659 12.135  -13.048 1.00 0.00 ? 33  ASN A CA   1  
ATOM 542   C C    . ASN A 1 33  ? -29.641 12.300  -11.512 1.00 0.00 ? 33  ASN A C    1  
ATOM 543   O O    . ASN A 1 33  ? -30.441 13.034  -10.933 1.00 0.00 ? 33  ASN A O    1  
ATOM 544   C CB   . ASN A 1 33  ? -29.585 13.468  -13.836 1.00 0.00 ? 33  ASN A CB   1  
ATOM 545   C CG   . ASN A 1 33  ? -30.868 14.266  -14.006 1.00 0.00 ? 33  ASN A CG   1  
ATOM 546   O OD1  . ASN A 1 33  ? -31.918 13.981  -13.457 1.00 0.00 ? 33  ASN A OD1  1  
ATOM 547   N ND2  . ASN A 1 33  ? -30.822 15.306  -14.807 1.00 0.00 ? 33  ASN A ND2  1  
ATOM 548   H H    . ASN A 1 33  ? -31.673 11.759  -13.710 1.00 0.00 ? 33  ASN A H    1  
ATOM 549   H HA   . ASN A 1 33  ? -28.740 11.605  -13.304 1.00 0.00 ? 33  ASN A HA   1  
ATOM 550   H HB2  . ASN A 1 33  ? -28.850 14.117  -13.359 1.00 0.00 ? 33  ASN A HB2  1  
ATOM 551   H HB3  . ASN A 1 33  ? -29.216 13.267  -14.838 1.00 0.00 ? 33  ASN A HB3  1  
ATOM 552   H HD21 . ASN A 1 33  ? -29.968 15.552  -15.280 1.00 0.00 ? 33  ASN A HD21 1  
ATOM 553   H HD22 . ASN A 1 33  ? -31.672 15.825  -14.955 1.00 0.00 ? 33  ASN A HD22 1  
ATOM 554   N N    . ALA A 1 34  ? -28.676 11.654  -10.844 1.00 0.00 ? 34  ALA A N    1  
ATOM 555   C CA   . ALA A 1 34  ? -28.470 11.748  -9.388  1.00 0.00 ? 34  ALA A CA   1  
ATOM 556   C C    . ALA A 1 34  ? -27.914 13.114  -8.933  1.00 0.00 ? 34  ALA A C    1  
ATOM 557   O O    . ALA A 1 34  ? -27.936 13.443  -7.745  1.00 0.00 ? 34  ALA A O    1  
ATOM 558   C CB   . ALA A 1 34  ? -27.504 10.634  -8.972  1.00 0.00 ? 34  ALA A CB   1  
ATOM 559   H H    . ALA A 1 34  ? -28.039 11.071  -11.367 1.00 0.00 ? 34  ALA A H    1  
ATOM 560   H HA   . ALA A 1 34  ? -29.424 11.589  -8.882  1.00 0.00 ? 34  ALA A HA   1  
ATOM 561   H HB1  . ALA A 1 34  ? -27.399 10.622  -7.886  1.00 0.00 ? 34  ALA A HB1  1  
ATOM 562   H HB2  . ALA A 1 34  ? -27.883 9.670   -9.297  1.00 0.00 ? 34  ALA A HB2  1  
ATOM 563   H HB3  . ALA A 1 34  ? -26.523 10.806  -9.412  1.00 0.00 ? 34  ALA A HB3  1  
ATOM 564   N N    . ARG A 1 35  ? -27.388 13.898  -9.883  1.00 0.00 ? 35  ARG A N    1  
ATOM 565   C CA   . ARG A 1 35  ? -26.672 15.167  -9.653  1.00 0.00 ? 35  ARG A CA   1  
ATOM 566   C C    . ARG A 1 35  ? -27.584 16.405  -9.648  1.00 0.00 ? 35  ARG A C    1  
ATOM 567   O O    . ARG A 1 35  ? -27.093 17.514  -9.436  1.00 0.00 ? 35  ARG A O    1  
ATOM 568   C CB   . ARG A 1 35  ? -25.539 15.305  -10.691 1.00 0.00 ? 35  ARG A CB   1  
ATOM 569   C CG   . ARG A 1 35  ? -24.491 14.174  -10.716 1.00 0.00 ? 35  ARG A CG   1  
ATOM 570   C CD   . ARG A 1 35  ? -23.586 14.100  -9.475  1.00 0.00 ? 35  ARG A CD   1  
ATOM 571   N NE   . ARG A 1 35  ? -24.161 13.278  -8.388  1.00 0.00 ? 35  ARG A NE   1  
ATOM 572   C CZ   . ARG A 1 35  ? -24.428 13.634  -7.145  1.00 0.00 ? 35  ARG A CZ   1  
ATOM 573   N NH1  . ARG A 1 35  ? -24.307 14.858  -6.713  1.00 0.00 ? 35  ARG A NH1  1  
ATOM 574   N NH2  . ARG A 1 35  ? -24.823 12.726  -6.305  1.00 0.00 ? 35  ARG A NH2  1  
ATOM 575   H H    . ARG A 1 35  ? -27.445 13.549  -10.830 1.00 0.00 ? 35  ARG A H    1  
ATOM 576   H HA   . ARG A 1 35  ? -26.226 15.143  -8.660  1.00 0.00 ? 35  ARG A HA   1  
ATOM 577   H HB2  . ARG A 1 35  ? -25.990 15.366  -11.683 1.00 0.00 ? 35  ARG A HB2  1  
ATOM 578   H HB3  . ARG A 1 35  ? -25.012 16.246  -10.520 1.00 0.00 ? 35  ARG A HB3  1  
ATOM 579   H HG2  . ARG A 1 35  ? -24.974 13.211  -10.879 1.00 0.00 ? 35  ARG A HG2  1  
ATOM 580   H HG3  . ARG A 1 35  ? -23.845 14.358  -11.575 1.00 0.00 ? 35  ARG A HG3  1  
ATOM 581   H HD2  . ARG A 1 35  ? -22.646 13.634  -9.777  1.00 0.00 ? 35  ARG A HD2  1  
ATOM 582   H HD3  . ARG A 1 35  ? -23.350 15.110  -9.138  1.00 0.00 ? 35  ARG A HD3  1  
ATOM 583   H HE   . ARG A 1 35  ? -24.281 12.291  -8.572  1.00 0.00 ? 35  ARG A HE   1  
ATOM 584   H HH11 . ARG A 1 35  ? -23.969 15.571  -7.335  1.00 0.00 ? 35  ARG A HH11 1  
ATOM 585   H HH12 . ARG A 1 35  ? -24.512 15.083  -5.754  1.00 0.00 ? 35  ARG A HH12 1  
ATOM 586   H HH21 . ARG A 1 35  ? -24.858 11.765  -6.626  1.00 0.00 ? 35  ARG A HH21 1  
ATOM 587   H HH22 . ARG A 1 35  ? -25.053 12.964  -5.356  1.00 0.00 ? 35  ARG A HH22 1  
ATOM 588   N N    . VAL A 1 36  ? -28.889 16.234  -9.888  1.00 0.00 ? 36  VAL A N    1  
ATOM 589   C CA   . VAL A 1 36  ? -29.874 17.322  -10.036 1.00 0.00 ? 36  VAL A CA   1  
ATOM 590   C C    . VAL A 1 36  ? -30.908 17.271  -8.903  1.00 0.00 ? 36  VAL A C    1  
ATOM 591   O O    . VAL A 1 36  ? -31.356 16.193  -8.509  1.00 0.00 ? 36  VAL A O    1  
ATOM 592   C CB   . VAL A 1 36  ? -30.509 17.288  -11.445 1.00 0.00 ? 36  VAL A CB   1  
ATOM 593   C CG1  . VAL A 1 36  ? -31.775 16.435  -11.558 1.00 0.00 ? 36  VAL A CG1  1  
ATOM 594   C CG2  . VAL A 1 36  ? -30.820 18.682  -11.977 1.00 0.00 ? 36  VAL A CG2  1  
ATOM 595   H H    . VAL A 1 36  ? -29.222 15.289  -10.005 1.00 0.00 ? 36  VAL A H    1  
ATOM 596   H HA   . VAL A 1 36  ? -29.347 18.272  -9.945  1.00 0.00 ? 36  VAL A HA   1  
ATOM 597   H HB   . VAL A 1 36  ? -29.773 16.864  -12.129 1.00 0.00 ? 36  VAL A HB   1  
ATOM 598   H HG11 . VAL A 1 36  ? -32.579 16.867  -10.969 1.00 0.00 ? 36  VAL A HG11 1  
ATOM 599   H HG12 . VAL A 1 36  ? -32.107 16.413  -12.594 1.00 0.00 ? 36  VAL A HG12 1  
ATOM 600   H HG13 . VAL A 1 36  ? -31.569 15.421  -11.219 1.00 0.00 ? 36  VAL A HG13 1  
ATOM 601   H HG21 . VAL A 1 36  ? -29.909 19.280  -11.973 1.00 0.00 ? 36  VAL A HG21 1  
ATOM 602   H HG22 . VAL A 1 36  ? -31.166 18.590  -13.008 1.00 0.00 ? 36  VAL A HG22 1  
ATOM 603   H HG23 . VAL A 1 36  ? -31.586 19.162  -11.369 1.00 0.00 ? 36  VAL A HG23 1  
ATOM 604   N N    . GLU A 1 37  ? -31.309 18.429  -8.370  1.00 0.00 ? 37  GLU A N    1  
ATOM 605   C CA   . GLU A 1 37  ? -32.248 18.529  -7.235  1.00 0.00 ? 37  GLU A CA   1  
ATOM 606   C C    . GLU A 1 37  ? -33.626 17.885  -7.518  1.00 0.00 ? 37  GLU A C    1  
ATOM 607   O O    . GLU A 1 37  ? -34.280 17.379  -6.605  1.00 0.00 ? 37  GLU A O    1  
ATOM 608   C CB   . GLU A 1 37  ? -32.386 20.017  -6.863  1.00 0.00 ? 37  GLU A CB   1  
ATOM 609   C CG   . GLU A 1 37  ? -33.162 20.257  -5.562  1.00 0.00 ? 37  GLU A CG   1  
ATOM 610   C CD   . GLU A 1 37  ? -33.137 21.747  -5.171  1.00 0.00 ? 37  GLU A CD   1  
ATOM 611   O OE1  . GLU A 1 37  ? -34.014 22.518  -5.635  1.00 0.00 ? 37  GLU A OE1  1  
ATOM 612   O OE2  . GLU A 1 37  ? -32.243 22.163  -4.393  1.00 0.00 ? 37  GLU A OE2  1  
ATOM 613   H H    . GLU A 1 37  ? -30.899 19.285  -8.719  1.00 0.00 ? 37  GLU A H    1  
ATOM 614   H HA   . GLU A 1 37  ? -31.815 18.004  -6.382  1.00 0.00 ? 37  GLU A HA   1  
ATOM 615   H HB2  . GLU A 1 37  ? -31.386 20.436  -6.743  1.00 0.00 ? 37  GLU A HB2  1  
ATOM 616   H HB3  . GLU A 1 37  ? -32.880 20.547  -7.679  1.00 0.00 ? 37  GLU A HB3  1  
ATOM 617   H HG2  . GLU A 1 37  ? -34.197 19.931  -5.689  1.00 0.00 ? 37  GLU A HG2  1  
ATOM 618   H HG3  . GLU A 1 37  ? -32.716 19.655  -4.765  1.00 0.00 ? 37  GLU A HG3  1  
ATOM 619   N N    . ASN A 1 38  ? -34.045 17.850  -8.790  1.00 0.00 ? 38  ASN A N    1  
ATOM 620   C CA   . ASN A 1 38  ? -35.293 17.228  -9.249  1.00 0.00 ? 38  ASN A CA   1  
ATOM 621   C C    . ASN A 1 38  ? -35.194 15.701  -9.504  1.00 0.00 ? 38  ASN A C    1  
ATOM 622   O O    . ASN A 1 38  ? -36.203 15.091  -9.859  1.00 0.00 ? 38  ASN A O    1  
ATOM 623   C CB   . ASN A 1 38  ? -35.766 18.001  -10.498 1.00 0.00 ? 38  ASN A CB   1  
ATOM 624   C CG   . ASN A 1 38  ? -37.218 17.727  -10.876 1.00 0.00 ? 38  ASN A CG   1  
ATOM 625   O OD1  . ASN A 1 38  ? -38.101 17.592  -10.040 1.00 0.00 ? 38  ASN A OD1  1  
ATOM 626   N ND2  . ASN A 1 38  ? -37.525 17.689  -12.154 1.00 0.00 ? 38  ASN A ND2  1  
ATOM 627   H H    . ASN A 1 38  ? -33.464 18.305  -9.479  1.00 0.00 ? 38  ASN A H    1  
ATOM 628   H HA   . ASN A 1 38  ? -36.042 17.362  -8.465  1.00 0.00 ? 38  ASN A HA   1  
ATOM 629   H HB2  . ASN A 1 38  ? -35.682 19.073  -10.318 1.00 0.00 ? 38  ASN A HB2  1  
ATOM 630   H HB3  . ASN A 1 38  ? -35.118 17.747  -11.338 1.00 0.00 ? 38  ASN A HB3  1  
ATOM 631   H HD21 . ASN A 1 38  ? -36.816 17.833  -12.856 1.00 0.00 ? 38  ASN A HD21 1  
ATOM 632   H HD22 . ASN A 1 38  ? -38.486 17.524  -12.409 1.00 0.00 ? 38  ASN A HD22 1  
ATOM 633   N N    . CYS A 1 39  ? -34.002 15.091  -9.365  1.00 0.00 ? 39  CYS A N    1  
ATOM 634   C CA   . CYS A 1 39  ? -33.714 13.653  -9.550  1.00 0.00 ? 39  CYS A CA   1  
ATOM 635   C C    . CYS A 1 39  ? -34.497 12.987  -10.709 1.00 0.00 ? 39  CYS A C    1  
ATOM 636   O O    . CYS A 1 39  ? -35.175 11.975  -10.511 1.00 0.00 ? 39  CYS A O    1  
ATOM 637   C CB   . CYS A 1 39  ? -33.837 12.906  -8.203  1.00 0.00 ? 39  CYS A CB   1  
ATOM 638   S SG   . CYS A 1 39  ? -35.486 13.054  -7.451  1.00 0.00 ? 39  CYS A SG   1  
ATOM 639   H H    . CYS A 1 39  ? -33.226 15.660  -9.042  1.00 0.00 ? 39  CYS A H    1  
ATOM 640   H HA   . CYS A 1 39  ? -32.667 13.582  -9.845  1.00 0.00 ? 39  CYS A HA   1  
ATOM 641   H HB2  . CYS A 1 39  ? -33.627 11.851  -8.375  1.00 0.00 ? 39  CYS A HB2  1  
ATOM 642   H HB3  . CYS A 1 39  ? -33.097 13.287  -7.498  1.00 0.00 ? 39  CYS A HB3  1  
ATOM 643   H HG   . CYS A 1 39  ? -36.173 12.735  -8.558  1.00 0.00 ? 39  CYS A HG   1  
ATOM 644   N N    . ALA A 1 40  ? -34.461 13.572  -11.911 1.00 0.00 ? 40  ALA A N    1  
ATOM 645   C CA   . ALA A 1 40  ? -35.360 13.208  -13.007 1.00 0.00 ? 40  ALA A CA   1  
ATOM 646   C C    . ALA A 1 40  ? -34.898 12.039  -13.902 1.00 0.00 ? 40  ALA A C    1  
ATOM 647   O O    . ALA A 1 40  ? -33.705 11.817  -14.129 1.00 0.00 ? 40  ALA A O    1  
ATOM 648   C CB   . ALA A 1 40  ? -35.707 14.465  -13.811 1.00 0.00 ? 40  ALA A CB   1  
ATOM 649   H H    . ALA A 1 40  ? -33.801 14.319  -12.070 1.00 0.00 ? 40  ALA A H    1  
ATOM 650   H HA   . ALA A 1 40  ? -36.287 12.886  -12.541 1.00 0.00 ? 40  ALA A HA   1  
ATOM 651   H HB1  . ALA A 1 40  ? -36.481 14.229  -14.541 1.00 0.00 ? 40  ALA A HB1  1  
ATOM 652   H HB2  . ALA A 1 40  ? -36.095 15.235  -13.142 1.00 0.00 ? 40  ALA A HB2  1  
ATOM 653   H HB3  . ALA A 1 40  ? -34.821 14.838  -14.327 1.00 0.00 ? 40  ALA A HB3  1  
ATOM 654   N N    . VAL A 1 41  ? -35.883 11.316  -14.449 1.00 0.00 ? 41  VAL A N    1  
ATOM 655   C CA   . VAL A 1 41  ? -35.761 10.137  -15.310 1.00 0.00 ? 41  VAL A CA   1  
ATOM 656   C C    . VAL A 1 41  ? -35.448 10.593  -16.735 1.00 0.00 ? 41  VAL A C    1  
ATOM 657   O O    . VAL A 1 41  ? -36.335 10.847  -17.551 1.00 0.00 ? 41  VAL A O    1  
ATOM 658   C CB   . VAL A 1 41  ? -37.054 9.291   -15.240 1.00 0.00 ? 41  VAL A CB   1  
ATOM 659   C CG1  . VAL A 1 41  ? -36.981 8.041   -16.124 1.00 0.00 ? 41  VAL A CG1  1  
ATOM 660   C CG2  . VAL A 1 41  ? -37.342 8.806   -13.812 1.00 0.00 ? 41  VAL A CG2  1  
ATOM 661   H H    . VAL A 1 41  ? -36.830 11.575  -14.213 1.00 0.00 ? 41  VAL A H    1  
ATOM 662   H HA   . VAL A 1 41  ? -34.941 9.520   -14.952 1.00 0.00 ? 41  VAL A HA   1  
ATOM 663   H HB   . VAL A 1 41  ? -37.895 9.901   -15.564 1.00 0.00 ? 41  VAL A HB   1  
ATOM 664   H HG11 . VAL A 1 41  ? -37.880 7.439   -15.998 1.00 0.00 ? 41  VAL A HG11 1  
ATOM 665   H HG12 . VAL A 1 41  ? -36.907 8.318   -17.175 1.00 0.00 ? 41  VAL A HG12 1  
ATOM 666   H HG13 . VAL A 1 41  ? -36.108 7.452   -15.848 1.00 0.00 ? 41  VAL A HG13 1  
ATOM 667   H HG21 . VAL A 1 41  ? -38.276 8.242   -13.803 1.00 0.00 ? 41  VAL A HG21 1  
ATOM 668   H HG22 . VAL A 1 41  ? -36.529 8.174   -13.454 1.00 0.00 ? 41  VAL A HG22 1  
ATOM 669   H HG23 . VAL A 1 41  ? -37.463 9.653   -13.142 1.00 0.00 ? 41  VAL A HG23 1  
ATOM 670   N N    . ILE A 1 42  ? -34.158 10.711  -17.030 1.00 0.00 ? 42  ILE A N    1  
ATOM 671   C CA   . ILE A 1 42  ? -33.624 11.083  -18.346 1.00 0.00 ? 42  ILE A CA   1  
ATOM 672   C C    . ILE A 1 42  ? -33.825 9.976   -19.396 1.00 0.00 ? 42  ILE A C    1  
ATOM 673   O O    . ILE A 1 42  ? -33.883 10.271  -20.591 1.00 0.00 ? 42  ILE A O    1  
ATOM 674   C CB   . ILE A 1 42  ? -32.133 11.471  -18.216 1.00 0.00 ? 42  ILE A CB   1  
ATOM 675   C CG1  . ILE A 1 42  ? -31.280 10.298  -17.682 1.00 0.00 ? 42  ILE A CG1  1  
ATOM 676   C CG2  . ILE A 1 42  ? -31.992 12.721  -17.327 1.00 0.00 ? 42  ILE A CG2  1  
ATOM 677   C CD1  . ILE A 1 42  ? -29.786 10.592  -17.602 1.00 0.00 ? 42  ILE A CD1  1  
ATOM 678   H H    . ILE A 1 42  ? -33.499 10.494  -16.297 1.00 0.00 ? 42  ILE A H    1  
ATOM 679   H HA   . ILE A 1 42  ? -34.170 11.958  -18.703 1.00 0.00 ? 42  ILE A HA   1  
ATOM 680   H HB   . ILE A 1 42  ? -31.771 11.732  -19.212 1.00 0.00 ? 42  ILE A HB   1  
ATOM 681   H HG12 . ILE A 1 42  ? -31.611 10.026  -16.682 1.00 0.00 ? 42  ILE A HG12 1  
ATOM 682   H HG13 . ILE A 1 42  ? -31.403 9.433   -18.333 1.00 0.00 ? 42  ILE A HG13 1  
ATOM 683   H HG21 . ILE A 1 42  ? -32.205 12.478  -16.286 1.00 0.00 ? 42  ILE A HG21 1  
ATOM 684   H HG22 . ILE A 1 42  ? -30.981 13.120  -17.398 1.00 0.00 ? 42  ILE A HG22 1  
ATOM 685   H HG23 . ILE A 1 42  ? -32.684 13.496  -17.661 1.00 0.00 ? 42  ILE A HG23 1  
ATOM 686   H HD11 . ILE A 1 42  ? -29.432 10.947  -18.568 1.00 0.00 ? 42  ILE A HD11 1  
ATOM 687   H HD12 . ILE A 1 42  ? -29.594 11.334  -16.828 1.00 0.00 ? 42  ILE A HD12 1  
ATOM 688   H HD13 . ILE A 1 42  ? -29.266 9.672   -17.343 1.00 0.00 ? 42  ILE A HD13 1  
ATOM 689   N N    . TYR A 1 43  ? -33.947 8.716   -18.960 1.00 0.00 ? 43  TYR A N    1  
ATOM 690   C CA   . TYR A 1 43  ? -34.230 7.559   -19.835 1.00 0.00 ? 43  TYR A CA   1  
ATOM 691   C C    . TYR A 1 43  ? -34.909 6.407   -19.086 1.00 0.00 ? 43  TYR A C    1  
ATOM 692   O O    . TYR A 1 43  ? -34.880 6.354   -17.860 1.00 0.00 ? 43  TYR A O    1  
ATOM 693   C CB   . TYR A 1 43  ? -32.962 7.096   -20.584 1.00 0.00 ? 43  TYR A CB   1  
ATOM 694   C CG   . TYR A 1 43  ? -33.236 6.252   -21.815 1.00 0.00 ? 43  TYR A CG   1  
ATOM 695   C CD1  . TYR A 1 43  ? -33.873 6.828   -22.933 1.00 0.00 ? 43  TYR A CD1  1  
ATOM 696   C CD2  . TYR A 1 43  ? -32.857 4.894   -21.848 1.00 0.00 ? 43  TYR A CD2  1  
ATOM 697   C CE1  . TYR A 1 43  ? -34.131 6.049   -24.077 1.00 0.00 ? 43  TYR A CE1  1  
ATOM 698   C CE2  . TYR A 1 43  ? -33.102 4.116   -22.995 1.00 0.00 ? 43  TYR A CE2  1  
ATOM 699   C CZ   . TYR A 1 43  ? -33.737 4.694   -24.115 1.00 0.00 ? 43  TYR A CZ   1  
ATOM 700   O OH   . TYR A 1 43  ? -34.008 3.942   -25.218 1.00 0.00 ? 43  TYR A OH   1  
ATOM 701   H H    . TYR A 1 43  ? -33.902 8.572   -17.947 1.00 0.00 ? 43  TYR A H    1  
ATOM 702   H HA   . TYR A 1 43  ? -34.954 7.873   -20.579 1.00 0.00 ? 43  TYR A HA   1  
ATOM 703   H HB2  . TYR A 1 43  ? -32.380 7.961   -20.894 1.00 0.00 ? 43  TYR A HB2  1  
ATOM 704   H HB3  . TYR A 1 43  ? -32.322 6.535   -19.917 1.00 0.00 ? 43  TYR A HB3  1  
ATOM 705   H HD1  . TYR A 1 43  ? -34.158 7.873   -22.916 1.00 0.00 ? 43  TYR A HD1  1  
ATOM 706   H HD2  . TYR A 1 43  ? -32.370 4.443   -20.994 1.00 0.00 ? 43  TYR A HD2  1  
ATOM 707   H HE1  . TYR A 1 43  ? -34.621 6.486   -24.937 1.00 0.00 ? 43  TYR A HE1  1  
ATOM 708   H HE2  . TYR A 1 43  ? -32.809 3.076   -23.018 1.00 0.00 ? 43  TYR A HE2  1  
ATOM 709   H HH   . TYR A 1 43  ? -33.607 3.056   -25.170 1.00 0.00 ? 43  TYR A HH   1  
ATOM 710   N N    . CYS A 1 44  ? -35.579 5.500   -19.796 1.00 0.00 ? 44  CYS A N    1  
ATOM 711   C CA   . CYS A 1 44  ? -36.335 4.408   -19.177 1.00 0.00 ? 44  CYS A CA   1  
ATOM 712   C C    . CYS A 1 44  ? -36.370 3.135   -20.039 1.00 0.00 ? 44  CYS A C    1  
ATOM 713   O O    . CYS A 1 44  ? -36.415 3.216   -21.272 1.00 0.00 ? 44  CYS A O    1  
ATOM 714   C CB   . CYS A 1 44  ? -37.742 4.914   -18.811 1.00 0.00 ? 44  CYS A CB   1  
ATOM 715   S SG   . CYS A 1 44  ? -38.502 5.808   -20.192 1.00 0.00 ? 44  CYS A SG   1  
ATOM 716   H H    . CYS A 1 44  ? -35.561 5.549   -20.806 1.00 0.00 ? 44  CYS A H    1  
ATOM 717   H HA   . CYS A 1 44  ? -35.827 4.141   -18.256 1.00 0.00 ? 44  CYS A HA   1  
ATOM 718   H HB2  . CYS A 1 44  ? -38.378 4.076   -18.519 1.00 0.00 ? 44  CYS A HB2  1  
ATOM 719   H HB3  . CYS A 1 44  ? -37.662 5.600   -17.965 1.00 0.00 ? 44  CYS A HB3  1  
ATOM 720   H HG   . CYS A 1 44  ? -37.592 6.791   -20.257 1.00 0.00 ? 44  CYS A HG   1  
ATOM 721   N N    . ASN A 1 45  ? -36.358 1.955   -19.401 1.00 0.00 ? 45  ASN A N    1  
ATOM 722   C CA   . ASN A 1 45  ? -36.419 0.674   -20.113 1.00 0.00 ? 45  ASN A CA   1  
ATOM 723   C C    . ASN A 1 45  ? -37.847 0.191   -20.409 1.00 0.00 ? 45  ASN A C    1  
ATOM 724   O O    . ASN A 1 45  ? -38.796 0.507   -19.692 1.00 0.00 ? 45  ASN A O    1  
ATOM 725   C CB   . ASN A 1 45  ? -35.592 -0.379  -19.357 1.00 0.00 ? 45  ASN A CB   1  
ATOM 726   C CG   . ASN A 1 45  ? -35.214 -1.550  -20.244 1.00 0.00 ? 45  ASN A CG   1  
ATOM 727   O OD1  . ASN A 1 45  ? -35.811 -2.613  -20.172 1.00 0.00 ? 45  ASN A OD1  1  
ATOM 728   N ND2  . ASN A 1 45  ? -34.288 -1.378  -21.158 1.00 0.00 ? 45  ASN A ND2  1  
ATOM 729   H H    . ASN A 1 45  ? -36.345 1.921   -18.382 1.00 0.00 ? 45  ASN A H    1  
ATOM 730   H HA   . ASN A 1 45  ? -35.938 0.819   -21.083 1.00 0.00 ? 45  ASN A HA   1  
ATOM 731   H HB2  . ASN A 1 45  ? -34.671 0.080   -19.010 1.00 0.00 ? 45  ASN A HB2  1  
ATOM 732   H HB3  . ASN A 1 45  ? -36.144 -0.743  -18.491 1.00 0.00 ? 45  ASN A HB3  1  
ATOM 733   H HD21 . ASN A 1 45  ? -33.774 -0.513  -21.211 1.00 0.00 ? 45  ASN A HD21 1  
ATOM 734   H HD22 . ASN A 1 45  ? -34.048 -2.163  -21.744 1.00 0.00 ? 45  ASN A HD22 1  
ATOM 735   N N    . ASP A 1 46  ? -37.984 -0.661  -21.427 1.00 0.00 ? 46  ASP A N    1  
ATOM 736   C CA   . ASP A 1 46  ? -39.236 -1.368  -21.734 1.00 0.00 ? 46  ASP A CA   1  
ATOM 737   C C    . ASP A 1 46  ? -39.688 -2.271  -20.568 1.00 0.00 ? 46  ASP A C    1  
ATOM 738   O O    . ASP A 1 46  ? -40.884 -2.440  -20.336 1.00 0.00 ? 46  ASP A O    1  
ATOM 739   C CB   . ASP A 1 46  ? -39.037 -2.173  -23.024 1.00 0.00 ? 46  ASP A CB   1  
ATOM 740   C CG   . ASP A 1 46  ? -40.351 -2.788  -23.536 1.00 0.00 ? 46  ASP A CG   1  
ATOM 741   O OD1  . ASP A 1 46  ? -41.260 -2.021  -23.933 1.00 0.00 ? 46  ASP A OD1  1  
ATOM 742   O OD2  . ASP A 1 46  ? -40.459 -4.036  -23.589 1.00 0.00 ? 46  ASP A OD2  1  
ATOM 743   H H    . ASP A 1 46  ? -37.156 -0.918  -21.944 1.00 0.00 ? 46  ASP A H    1  
ATOM 744   H HA   . ASP A 1 46  ? -40.020 -0.629  -21.908 1.00 0.00 ? 46  ASP A HA   1  
ATOM 745   H HB2  . ASP A 1 46  ? -38.638 -1.512  -23.797 1.00 0.00 ? 46  ASP A HB2  1  
ATOM 746   H HB3  . ASP A 1 46  ? -38.298 -2.958  -22.844 1.00 0.00 ? 46  ASP A HB3  1  
ATOM 747   N N    . GLY A 1 47  ? -38.745 -2.758  -19.752 1.00 0.00 ? 47  GLY A N    1  
ATOM 748   C CA   . GLY A 1 47  ? -39.035 -3.453  -18.499 1.00 0.00 ? 47  GLY A CA   1  
ATOM 749   C C    . GLY A 1 47  ? -39.949 -2.649  -17.564 1.00 0.00 ? 47  GLY A C    1  
ATOM 750   O O    . GLY A 1 47  ? -40.981 -3.167  -17.148 1.00 0.00 ? 47  GLY A O    1  
ATOM 751   H H    . GLY A 1 47  ? -37.772 -2.632  -20.012 1.00 0.00 ? 47  GLY A H    1  
ATOM 752   H HA2  . GLY A 1 47  ? -39.514 -4.407  -18.719 1.00 0.00 ? 47  GLY A HA2  1  
ATOM 753   H HA3  . GLY A 1 47  ? -38.093 -3.649  -17.991 1.00 0.00 ? 47  GLY A HA3  1  
ATOM 754   N N    . PHE A 1 48  ? -39.650 -1.371  -17.280 1.00 0.00 ? 48  PHE A N    1  
ATOM 755   C CA   . PHE A 1 48  ? -40.550 -0.498  -16.495 1.00 0.00 ? 48  PHE A CA   1  
ATOM 756   C C    . PHE A 1 48  ? -41.941 -0.403  -17.169 1.00 0.00 ? 48  PHE A C    1  
ATOM 757   O O    . PHE A 1 48  ? -42.980 -0.372  -16.501 1.00 0.00 ? 48  PHE A O    1  
ATOM 758   C CB   . PHE A 1 48  ? -39.940 0.919   -16.302 1.00 0.00 ? 48  PHE A CB   1  
ATOM 759   C CG   . PHE A 1 48  ? -40.899 2.052   -16.658 1.00 0.00 ? 48  PHE A CG   1  
ATOM 760   C CD1  . PHE A 1 48  ? -41.886 2.442   -15.729 1.00 0.00 ? 48  PHE A CD1  1  
ATOM 761   C CD2  . PHE A 1 48  ? -40.950 2.557   -17.972 1.00 0.00 ? 48  PHE A CD2  1  
ATOM 762   C CE1  . PHE A 1 48  ? -42.953 3.262   -16.132 1.00 0.00 ? 48  PHE A CE1  1  
ATOM 763   C CE2  . PHE A 1 48  ? -42.024 3.368   -18.376 1.00 0.00 ? 48  PHE A CE2  1  
ATOM 764   C CZ   . PHE A 1 48  ? -43.030 3.714   -17.460 1.00 0.00 ? 48  PHE A CZ   1  
ATOM 765   H H    . PHE A 1 48  ? -38.798 -0.976  -17.648 1.00 0.00 ? 48  PHE A H    1  
ATOM 766   H HA   . PHE A 1 48  ? -40.694 -0.938  -15.509 1.00 0.00 ? 48  PHE A HA   1  
ATOM 767   H HB2  . PHE A 1 48  ? -39.628 1.027   -15.263 1.00 0.00 ? 48  PHE A HB2  1  
ATOM 768   H HB3  . PHE A 1 48  ? -39.045 1.023   -16.917 1.00 0.00 ? 48  PHE A HB3  1  
ATOM 769   H HD1  . PHE A 1 48  ? -41.864 2.060   -14.719 1.00 0.00 ? 48  PHE A HD1  1  
ATOM 770   H HD2  . PHE A 1 48  ? -40.205 2.271   -18.696 1.00 0.00 ? 48  PHE A HD2  1  
ATOM 771   H HE1  . PHE A 1 48  ? -43.721 3.534   -15.421 1.00 0.00 ? 48  PHE A HE1  1  
ATOM 772   H HE2  . PHE A 1 48  ? -42.084 3.717   -19.395 1.00 0.00 ? 48  PHE A HE2  1  
ATOM 773   H HZ   . PHE A 1 48  ? -43.849 4.346   -17.776 1.00 0.00 ? 48  PHE A HZ   1  
ATOM 774   N N    . CYS A 1 49  ? -41.960 -0.352  -18.504 1.00 0.00 ? 49  CYS A N    1  
ATOM 775   C CA   . CYS A 1 49  ? -43.206 -0.283  -19.265 1.00 0.00 ? 49  CYS A CA   1  
ATOM 776   C C    . CYS A 1 49  ? -44.091 -1.513  -18.992 1.00 0.00 ? 49  CYS A C    1  
ATOM 777   O O    . CYS A 1 49  ? -45.295 -1.375  -18.780 1.00 0.00 ? 49  CYS A O    1  
ATOM 778   C CB   . CYS A 1 49  ? -42.905 -0.052  -20.752 1.00 0.00 ? 49  CYS A CB   1  
ATOM 779   S SG   . CYS A 1 49  ? -44.371 0.644   -21.564 1.00 0.00 ? 49  CYS A SG   1  
ATOM 780   H H    . CYS A 1 49  ? -41.082 -0.505  -18.988 1.00 0.00 ? 49  CYS A H    1  
ATOM 781   H HA   . CYS A 1 49  ? -43.754 0.589   -18.901 1.00 0.00 ? 49  CYS A HA   1  
ATOM 782   H HB2  . CYS A 1 49  ? -42.080 0.654   -20.853 1.00 0.00 ? 49  CYS A HB2  1  
ATOM 783   H HB3  . CYS A 1 49  ? -42.634 -0.991  -21.235 1.00 0.00 ? 49  CYS A HB3  1  
ATOM 784   H HG   . CYS A 1 49  ? -45.213 -0.367  -21.291 1.00 0.00 ? 49  CYS A HG   1  
ATOM 785   N N    . GLU A 1 50  ? -43.496 -2.707  -18.906 1.00 0.00 ? 50  GLU A N    1  
ATOM 786   C CA   . GLU A 1 50  ? -44.207 -3.951  -18.558 1.00 0.00 ? 50  GLU A CA   1  
ATOM 787   C C    . GLU A 1 50  ? -44.496 -4.076  -17.053 1.00 0.00 ? 50  GLU A C    1  
ATOM 788   O O    . GLU A 1 50  ? -45.459 -4.731  -16.649 1.00 0.00 ? 50  GLU A O    1  
ATOM 789   C CB   . GLU A 1 50  ? -43.405 -5.174  -19.026 1.00 0.00 ? 50  GLU A CB   1  
ATOM 790   C CG   . GLU A 1 50  ? -43.128 -5.154  -20.535 1.00 0.00 ? 50  GLU A CG   1  
ATOM 791   C CD   . GLU A 1 50  ? -42.547 -6.501  -21.008 1.00 0.00 ? 50  GLU A CD   1  
ATOM 792   O OE1  . GLU A 1 50  ? -41.396 -6.842  -20.640 1.00 0.00 ? 50  GLU A OE1  1  
ATOM 793   O OE2  . GLU A 1 50  ? -43.248 -7.242  -21.742 1.00 0.00 ? 50  GLU A OE2  1  
ATOM 794   H H    . GLU A 1 50  ? -42.491 -2.754  -19.073 1.00 0.00 ? 50  GLU A H    1  
ATOM 795   H HA   . GLU A 1 50  ? -45.171 -3.964  -19.071 1.00 0.00 ? 50  GLU A HA   1  
ATOM 796   H HB2  . GLU A 1 50  ? -42.463 -5.217  -18.478 1.00 0.00 ? 50  GLU A HB2  1  
ATOM 797   H HB3  . GLU A 1 50  ? -43.979 -6.071  -18.792 1.00 0.00 ? 50  GLU A HB3  1  
ATOM 798   H HG2  . GLU A 1 50  ? -44.063 -4.944  -21.061 1.00 0.00 ? 50  GLU A HG2  1  
ATOM 799   H HG3  . GLU A 1 50  ? -42.432 -4.345  -20.762 1.00 0.00 ? 50  GLU A HG3  1  
ATOM 800   N N    . LEU A 1 51  ? -43.684 -3.436  -16.209 1.00 0.00 ? 51  LEU A N    1  
ATOM 801   C CA   . LEU A 1 51  ? -43.857 -3.383  -14.759 1.00 0.00 ? 51  LEU A CA   1  
ATOM 802   C C    . LEU A 1 51  ? -45.150 -2.652  -14.379 1.00 0.00 ? 51  LEU A C    1  
ATOM 803   O O    . LEU A 1 51  ? -46.005 -3.224  -13.703 1.00 0.00 ? 51  LEU A O    1  
ATOM 804   C CB   . LEU A 1 51  ? -42.628 -2.677  -14.166 1.00 0.00 ? 51  LEU A CB   1  
ATOM 805   C CG   . LEU A 1 51  ? -42.631 -2.490  -12.645 1.00 0.00 ? 51  LEU A CG   1  
ATOM 806   C CD1  . LEU A 1 51  ? -42.598 -3.818  -11.895 1.00 0.00 ? 51  LEU A CD1  1  
ATOM 807   C CD2  . LEU A 1 51  ? -41.428 -1.652  -12.231 1.00 0.00 ? 51  LEU A CD2  1  
ATOM 808   H H    . LEU A 1 51  ? -42.868 -2.981  -16.605 1.00 0.00 ? 51  LEU A H    1  
ATOM 809   H HA   . LEU A 1 51  ? -43.907 -4.404  -14.379 1.00 0.00 ? 51  LEU A HA   1  
ATOM 810   H HB2  . LEU A 1 51  ? -41.741 -3.208  -14.490 1.00 0.00 ? 51  LEU A HB2  1  
ATOM 811   H HB3  . LEU A 1 51  ? -42.571 -1.680  -14.580 1.00 0.00 ? 51  LEU A HB3  1  
ATOM 812   H HG   . LEU A 1 51  ? -43.540 -1.951  -12.373 1.00 0.00 ? 51  LEU A HG   1  
ATOM 813   H HD11 . LEU A 1 51  ? -41.703 -4.379  -12.165 1.00 0.00 ? 51  LEU A HD11 1  
ATOM 814   H HD12 . LEU A 1 51  ? -42.588 -3.617  -10.826 1.00 0.00 ? 51  LEU A HD12 1  
ATOM 815   H HD13 . LEU A 1 51  ? -43.486 -4.404  -12.127 1.00 0.00 ? 51  LEU A HD13 1  
ATOM 816   H HD21 . LEU A 1 51  ? -41.442 -1.505  -11.152 1.00 0.00 ? 51  LEU A HD21 1  
ATOM 817   H HD22 . LEU A 1 51  ? -40.508 -2.160  -12.517 1.00 0.00 ? 51  LEU A HD22 1  
ATOM 818   H HD23 . LEU A 1 51  ? -41.474 -0.677  -12.715 1.00 0.00 ? 51  LEU A HD23 1  
ATOM 819   N N    . CYS A 1 52  ? -45.300 -1.412  -14.852 1.00 0.00 ? 52  CYS A N    1  
ATOM 820   C CA   . CYS A 1 52  ? -46.425 -0.536  -14.510 1.00 0.00 ? 52  CYS A CA   1  
ATOM 821   C C    . CYS A 1 52  ? -47.560 -0.576  -15.552 1.00 0.00 ? 52  CYS A C    1  
ATOM 822   O O    . CYS A 1 52  ? -48.701 -0.207  -15.263 1.00 0.00 ? 52  CYS A O    1  
ATOM 823   C CB   . CYS A 1 52  ? -45.881 0.886   -14.321 1.00 0.00 ? 52  CYS A CB   1  
ATOM 824   S SG   . CYS A 1 52  ? -44.667 0.936   -12.966 1.00 0.00 ? 52  CYS A SG   1  
ATOM 825   H H    . CYS A 1 52  ? -44.530 -1.016  -15.384 1.00 0.00 ? 52  CYS A H    1  
ATOM 826   H HA   . CYS A 1 52  ? -46.859 -0.854  -13.560 1.00 0.00 ? 52  CYS A HA   1  
ATOM 827   H HB2  . CYS A 1 52  ? -45.416 1.236   -15.244 1.00 0.00 ? 52  CYS A HB2  1  
ATOM 828   H HB3  . CYS A 1 52  ? -46.710 1.547   -14.074 1.00 0.00 ? 52  CYS A HB3  1  
ATOM 829   H HG   . CYS A 1 52  ? -44.429 2.256   -13.016 1.00 0.00 ? 52  CYS A HG   1  
ATOM 830   N N    . GLY A 1 53  ? -47.271 -1.020  -16.777 1.00 0.00 ? 53  GLY A N    1  
ATOM 831   C CA   . GLY A 1 53  ? -48.237 -0.983  -17.885 1.00 0.00 ? 53  GLY A CA   1  
ATOM 832   C C    . GLY A 1 53  ? -48.535 0.434   -18.403 1.00 0.00 ? 53  GLY A C    1  
ATOM 833   O O    . GLY A 1 53  ? -49.591 0.650   -19.001 1.00 0.00 ? 53  GLY A O    1  
ATOM 834   H H    . GLY A 1 53  ? -46.317 -1.321  -16.979 1.00 0.00 ? 53  GLY A H    1  
ATOM 835   H HA2  . GLY A 1 53  ? -47.846 -1.569  -18.716 1.00 0.00 ? 53  GLY A HA2  1  
ATOM 836   H HA3  . GLY A 1 53  ? -49.174 -1.438  -17.564 1.00 0.00 ? 53  GLY A HA3  1  
ATOM 837   N N    . TYR A 1 54  ? -47.651 1.408   -18.137 1.00 0.00 ? 54  TYR A N    1  
ATOM 838   C CA   . TYR A 1 54  ? -47.793 2.809   -18.551 1.00 0.00 ? 54  TYR A CA   1  
ATOM 839   C C    . TYR A 1 54  ? -47.262 3.000   -19.996 1.00 0.00 ? 54  TYR A C    1  
ATOM 840   O O    . TYR A 1 54  ? -47.622 2.255   -20.911 1.00 0.00 ? 54  TYR A O    1  
ATOM 841   C CB   . TYR A 1 54  ? -47.099 3.727   -17.514 1.00 0.00 ? 54  TYR A CB   1  
ATOM 842   C CG   . TYR A 1 54  ? -47.519 3.685   -16.049 1.00 0.00 ? 54  TYR A CG   1  
ATOM 843   C CD1  . TYR A 1 54  ? -48.692 3.038   -15.606 1.00 0.00 ? 54  TYR A CD1  1  
ATOM 844   C CD2  . TYR A 1 54  ? -46.703 4.353   -15.113 1.00 0.00 ? 54  TYR A CD2  1  
ATOM 845   C CE1  . TYR A 1 54  ? -49.024 3.026   -14.235 1.00 0.00 ? 54  TYR A CE1  1  
ATOM 846   C CE2  . TYR A 1 54  ? -47.035 4.354   -13.746 1.00 0.00 ? 54  TYR A CE2  1  
ATOM 847   C CZ   . TYR A 1 54  ? -48.191 3.681   -13.300 1.00 0.00 ? 54  TYR A CZ   1  
ATOM 848   O OH   . TYR A 1 54  ? -48.483 3.660   -11.972 1.00 0.00 ? 54  TYR A OH   1  
ATOM 849   H H    . TYR A 1 54  ? -46.802 1.159   -17.651 1.00 0.00 ? 54  TYR A H    1  
ATOM 850   H HA   . TYR A 1 54  ? -48.851 3.078   -18.567 1.00 0.00 ? 54  TYR A HA   1  
ATOM 851   H HB2  . TYR A 1 54  ? -46.032 3.508   -17.543 1.00 0.00 ? 54  TYR A HB2  1  
ATOM 852   H HB3  . TYR A 1 54  ? -47.235 4.761   -17.834 1.00 0.00 ? 54  TYR A HB3  1  
ATOM 853   H HD1  . TYR A 1 54  ? -49.340 2.535   -16.308 1.00 0.00 ? 54  TYR A HD1  1  
ATOM 854   H HD2  . TYR A 1 54  ? -45.814 4.873   -15.447 1.00 0.00 ? 54  TYR A HD2  1  
ATOM 855   H HE1  . TYR A 1 54  ? -49.910 2.509   -13.896 1.00 0.00 ? 54  TYR A HE1  1  
ATOM 856   H HE2  . TYR A 1 54  ? -46.404 4.859   -13.029 1.00 0.00 ? 54  TYR A HE2  1  
ATOM 857   H HH   . TYR A 1 54  ? -49.257 3.111   -11.777 1.00 0.00 ? 54  TYR A HH   1  
ATOM 858   N N    . SER A 1 55  ? -46.394 3.992   -20.207 1.00 0.00 ? 55  SER A N    1  
ATOM 859   C CA   . SER A 1 55  ? -45.664 4.294   -21.442 1.00 0.00 ? 55  SER A CA   1  
ATOM 860   C C    . SER A 1 55  ? -44.454 5.160   -21.085 1.00 0.00 ? 55  SER A C    1  
ATOM 861   O O    . SER A 1 55  ? -44.487 5.905   -20.105 1.00 0.00 ? 55  SER A O    1  
ATOM 862   C CB   . SER A 1 55  ? -46.561 5.026   -22.446 1.00 0.00 ? 55  SER A CB   1  
ATOM 863   O OG   . SER A 1 55  ? -45.824 5.362   -23.611 1.00 0.00 ? 55  SER A OG   1  
ATOM 864   H H    . SER A 1 55  ? -46.158 4.577   -19.416 1.00 0.00 ? 55  SER A H    1  
ATOM 865   H HA   . SER A 1 55  ? -45.315 3.367   -21.897 1.00 0.00 ? 55  SER A HA   1  
ATOM 866   H HB2  . SER A 1 55  ? -47.397 4.381   -22.719 1.00 0.00 ? 55  SER A HB2  1  
ATOM 867   H HB3  . SER A 1 55  ? -46.953 5.935   -21.992 1.00 0.00 ? 55  SER A HB3  1  
ATOM 868   H HG   . SER A 1 55  ? -46.443 5.725   -24.274 1.00 0.00 ? 55  SER A HG   1  
ATOM 869   N N    . ARG A 1 56  ? -43.361 5.068   -21.845 1.00 0.00 ? 56  ARG A N    1  
ATOM 870   C CA   . ARG A 1 56  ? -42.122 5.836   -21.597 1.00 0.00 ? 56  ARG A CA   1  
ATOM 871   C C    . ARG A 1 56  ? -42.364 7.353   -21.606 1.00 0.00 ? 56  ARG A C    1  
ATOM 872   O O    . ARG A 1 56  ? -41.840 8.068   -20.752 1.00 0.00 ? 56  ARG A O    1  
ATOM 873   C CB   . ARG A 1 56  ? -41.039 5.383   -22.595 1.00 0.00 ? 56  ARG A CB   1  
ATOM 874   C CG   . ARG A 1 56  ? -40.724 3.882   -22.409 1.00 0.00 ? 56  ARG A CG   1  
ATOM 875   C CD   . ARG A 1 56  ? -39.314 3.475   -22.845 1.00 0.00 ? 56  ARG A CD   1  
ATOM 876   N NE   . ARG A 1 56  ? -39.043 3.733   -24.271 1.00 0.00 ? 56  ARG A NE   1  
ATOM 877   C CZ   . ARG A 1 56  ? -37.841 3.795   -24.817 1.00 0.00 ? 56  ARG A CZ   1  
ATOM 878   N NH1  . ARG A 1 56  ? -36.754 3.632   -24.120 1.00 0.00 ? 56  ARG A NH1  1  
ATOM 879   N NH2  . ARG A 1 56  ? -37.699 4.025   -26.090 1.00 0.00 ? 56  ARG A NH2  1  
ATOM 880   H H    . ARG A 1 56  ? -43.425 4.480   -22.664 1.00 0.00 ? 56  ARG A H    1  
ATOM 881   H HA   . ARG A 1 56  ? -41.757 5.624   -20.589 1.00 0.00 ? 56  ARG A HA   1  
ATOM 882   H HB2  . ARG A 1 56  ? -41.372 5.563   -23.619 1.00 0.00 ? 56  ARG A HB2  1  
ATOM 883   H HB3  . ARG A 1 56  ? -40.139 5.973   -22.428 1.00 0.00 ? 56  ARG A HB3  1  
ATOM 884   H HG2  . ARG A 1 56  ? -40.806 3.628   -21.352 1.00 0.00 ? 56  ARG A HG2  1  
ATOM 885   H HG3  . ARG A 1 56  ? -41.456 3.285   -22.954 1.00 0.00 ? 56  ARG A HG3  1  
ATOM 886   H HD2  . ARG A 1 56  ? -38.602 4.030   -22.237 1.00 0.00 ? 56  ARG A HD2  1  
ATOM 887   H HD3  . ARG A 1 56  ? -39.178 2.411   -22.640 1.00 0.00 ? 56  ARG A HD3  1  
ATOM 888   H HE   . ARG A 1 56  ? -39.833 3.854   -24.885 1.00 0.00 ? 56  ARG A HE   1  
ATOM 889   H HH11 . ARG A 1 56  ? -36.809 3.471   -23.120 1.00 0.00 ? 56  ARG A HH11 1  
ATOM 890   H HH12 . ARG A 1 56  ? -35.853 3.713   -24.565 1.00 0.00 ? 56  ARG A HH12 1  
ATOM 891   H HH21 . ARG A 1 56  ? -38.506 4.157   -26.677 1.00 0.00 ? 56  ARG A HH21 1  
ATOM 892   H HH22 . ARG A 1 56  ? -36.777 4.065   -26.494 1.00 0.00 ? 56  ARG A HH22 1  
ATOM 893   N N    . ALA A 1 57  ? -43.272 7.832   -22.456 1.00 0.00 ? 57  ALA A N    1  
ATOM 894   C CA   . ALA A 1 57  ? -43.715 9.230   -22.489 1.00 0.00 ? 57  ALA A CA   1  
ATOM 895   C C    . ALA A 1 57  ? -44.387 9.703   -21.176 1.00 0.00 ? 57  ALA A C    1  
ATOM 896   O O    . ALA A 1 57  ? -44.403 10.900  -20.887 1.00 0.00 ? 57  ALA A O    1  
ATOM 897   C CB   . ALA A 1 57  ? -44.662 9.391   -23.685 1.00 0.00 ? 57  ALA A CB   1  
ATOM 898   H H    . ALA A 1 57  ? -43.712 7.176   -23.082 1.00 0.00 ? 57  ALA A H    1  
ATOM 899   H HA   . ALA A 1 57  ? -42.843 9.865   -22.656 1.00 0.00 ? 57  ALA A HA   1  
ATOM 900   H HB1  . ALA A 1 57  ? -44.152 9.100   -24.605 1.00 0.00 ? 57  ALA A HB1  1  
ATOM 901   H HB2  . ALA A 1 57  ? -45.547 8.768   -23.549 1.00 0.00 ? 57  ALA A HB2  1  
ATOM 902   H HB3  . ALA A 1 57  ? -44.970 10.434  -23.770 1.00 0.00 ? 57  ALA A HB3  1  
ATOM 903   N N    . GLU A 1 58  ? -44.898 8.778   -20.356 1.00 0.00 ? 58  GLU A N    1  
ATOM 904   C CA   . GLU A 1 58  ? -45.484 9.047   -19.037 1.00 0.00 ? 58  GLU A CA   1  
ATOM 905   C C    . GLU A 1 58  ? -44.418 9.182   -17.935 1.00 0.00 ? 58  GLU A C    1  
ATOM 906   O O    . GLU A 1 58  ? -44.713 9.757   -16.887 1.00 0.00 ? 58  GLU A O    1  
ATOM 907   C CB   . GLU A 1 58  ? -46.496 7.949   -18.657 1.00 0.00 ? 58  GLU A CB   1  
ATOM 908   C CG   . GLU A 1 58  ? -47.609 7.711   -19.689 1.00 0.00 ? 58  GLU A CG   1  
ATOM 909   C CD   . GLU A 1 58  ? -48.692 8.806   -19.624 1.00 0.00 ? 58  GLU A CD   1  
ATOM 910   O OE1  . GLU A 1 58  ? -48.567 9.837   -20.329 1.00 0.00 ? 58  GLU A OE1  1  
ATOM 911   O OE2  . GLU A 1 58  ? -49.685 8.640   -18.873 1.00 0.00 ? 58  GLU A OE2  1  
ATOM 912   H H    . GLU A 1 58  ? -44.843 7.804   -20.628 1.00 0.00 ? 58  GLU A H    1  
ATOM 913   H HA   . GLU A 1 58  ? -46.021 9.996   -19.077 1.00 0.00 ? 58  GLU A HA   1  
ATOM 914   H HB2  . GLU A 1 58  ? -45.964 7.014   -18.493 1.00 0.00 ? 58  GLU A HB2  1  
ATOM 915   H HB3  . GLU A 1 58  ? -46.957 8.212   -17.707 1.00 0.00 ? 58  GLU A HB3  1  
ATOM 916   H HG2  . GLU A 1 58  ? -47.190 7.663   -20.695 1.00 0.00 ? 58  GLU A HG2  1  
ATOM 917   H HG3  . GLU A 1 58  ? -48.050 6.730   -19.496 1.00 0.00 ? 58  GLU A HG3  1  
ATOM 918   N N    . VAL A 1 59  ? -43.200 8.650   -18.140 1.00 0.00 ? 59  VAL A N    1  
ATOM 919   C CA   . VAL A 1 59  ? -42.062 8.767   -17.200 1.00 0.00 ? 59  VAL A CA   1  
ATOM 920   C C    . VAL A 1 59  ? -40.969 9.749   -17.632 1.00 0.00 ? 59  VAL A C    1  
ATOM 921   O O    . VAL A 1 59  ? -40.217 10.216  -16.776 1.00 0.00 ? 59  VAL A O    1  
ATOM 922   C CB   . VAL A 1 59  ? -41.470 7.399   -16.813 1.00 0.00 ? 59  VAL A CB   1  
ATOM 923   C CG1  . VAL A 1 59  ? -42.447 6.629   -15.922 1.00 0.00 ? 59  VAL A CG1  1  
ATOM 924   C CG2  . VAL A 1 59  ? -41.104 6.550   -18.021 1.00 0.00 ? 59  VAL A CG2  1  
ATOM 925   H H    . VAL A 1 59  ? -43.014 8.200   -19.036 1.00 0.00 ? 59  VAL A H    1  
ATOM 926   H HA   . VAL A 1 59  ? -42.439 9.186   -16.268 1.00 0.00 ? 59  VAL A HA   1  
ATOM 927   H HB   . VAL A 1 59  ? -40.556 7.562   -16.252 1.00 0.00 ? 59  VAL A HB   1  
ATOM 928   H HG11 . VAL A 1 59  ? -43.360 6.395   -16.469 1.00 0.00 ? 59  VAL A HG11 1  
ATOM 929   H HG12 . VAL A 1 59  ? -41.973 5.709   -15.584 1.00 0.00 ? 59  VAL A HG12 1  
ATOM 930   H HG13 . VAL A 1 59  ? -42.698 7.226   -15.045 1.00 0.00 ? 59  VAL A HG13 1  
ATOM 931   H HG21 . VAL A 1 59  ? -40.463 7.125   -18.687 1.00 0.00 ? 59  VAL A HG21 1  
ATOM 932   H HG22 . VAL A 1 59  ? -40.565 5.663   -17.690 1.00 0.00 ? 59  VAL A HG22 1  
ATOM 933   H HG23 . VAL A 1 59  ? -42.008 6.250   -18.544 1.00 0.00 ? 59  VAL A HG23 1  
ATOM 934   N N    . MET A 1 60  ? -40.924 10.145  -18.912 1.00 0.00 ? 60  MET A N    1  
ATOM 935   C CA   . MET A 1 60  ? -39.932 11.054  -19.486 1.00 0.00 ? 60  MET A CA   1  
ATOM 936   C C    . MET A 1 60  ? -39.793 12.317  -18.642 1.00 0.00 ? 60  MET A C    1  
ATOM 937   O O    . MET A 1 60  ? -40.658 13.194  -18.635 1.00 0.00 ? 60  MET A O    1  
ATOM 938   C CB   . MET A 1 60  ? -40.356 11.448  -20.919 1.00 0.00 ? 60  MET A CB   1  
ATOM 939   C CG   . MET A 1 60  ? -39.736 10.570  -22.006 1.00 0.00 ? 60  MET A CG   1  
ATOM 940   S SD   . MET A 1 60  ? -37.947 10.794  -22.217 1.00 0.00 ? 60  MET A SD   1  
ATOM 941   C CE   . MET A 1 60  ? -37.345 9.213   -21.566 1.00 0.00 ? 60  MET A CE   1  
ATOM 942   H H    . MET A 1 60  ? -41.524 9.678   -19.573 1.00 0.00 ? 60  MET A H    1  
ATOM 943   H HA   . MET A 1 60  ? -38.964 10.556  -19.517 1.00 0.00 ? 60  MET A HA   1  
ATOM 944   H HB2  . MET A 1 60  ? -41.443 11.413  -21.004 1.00 0.00 ? 60  MET A HB2  1  
ATOM 945   H HB3  . MET A 1 60  ? -40.049 12.474  -21.126 1.00 0.00 ? 60  MET A HB3  1  
ATOM 946   H HG2  . MET A 1 60  ? -39.949 9.526   -21.793 1.00 0.00 ? 60  MET A HG2  1  
ATOM 947   H HG3  . MET A 1 60  ? -40.217 10.821  -22.952 1.00 0.00 ? 60  MET A HG3  1  
ATOM 948   H HE1  . MET A 1 60  ? -36.263 9.178   -21.677 1.00 0.00 ? 60  MET A HE1  1  
ATOM 949   H HE2  . MET A 1 60  ? -37.606 9.114   -20.512 1.00 0.00 ? 60  MET A HE2  1  
ATOM 950   H HE3  . MET A 1 60  ? -37.789 8.390   -22.127 1.00 0.00 ? 60  MET A HE3  1  
ATOM 951   N N    . GLN A 1 61  ? -38.663 12.410  -17.945 1.00 0.00 ? 61  GLN A N    1  
ATOM 952   C CA   . GLN A 1 61  ? -38.209 13.585  -17.208 1.00 0.00 ? 61  GLN A CA   1  
ATOM 953   C C    . GLN A 1 61  ? -39.038 13.883  -15.937 1.00 0.00 ? 61  GLN A C    1  
ATOM 954   O O    . GLN A 1 61  ? -38.976 14.995  -15.407 1.00 0.00 ? 61  GLN A O    1  
ATOM 955   C CB   . GLN A 1 61  ? -38.008 14.764  -18.190 1.00 0.00 ? 61  GLN A CB   1  
ATOM 956   C CG   . GLN A 1 61  ? -37.202 14.382  -19.462 1.00 0.00 ? 61  GLN A CG   1  
ATOM 957   C CD   . GLN A 1 61  ? -37.717 15.071  -20.726 1.00 0.00 ? 61  GLN A CD   1  
ATOM 958   O OE1  . GLN A 1 61  ? -37.964 16.270  -20.774 1.00 0.00 ? 61  GLN A OE1  1  
ATOM 959   N NE2  . GLN A 1 61  ? -37.912 14.328  -21.800 1.00 0.00 ? 61  GLN A NE2  1  
ATOM 960   H H    . GLN A 1 61  ? -38.025 11.620  -17.966 1.00 0.00 ? 61  GLN A H    1  
ATOM 961   H HA   . GLN A 1 61  ? -37.216 13.334  -16.836 1.00 0.00 ? 61  GLN A HA   1  
ATOM 962   H HB2  . GLN A 1 61  ? -38.989 15.138  -18.484 1.00 0.00 ? 61  GLN A HB2  1  
ATOM 963   H HB3  . GLN A 1 61  ? -37.491 15.577  -17.679 1.00 0.00 ? 61  GLN A HB3  1  
ATOM 964   H HG2  . GLN A 1 61  ? -36.152 14.634  -19.315 1.00 0.00 ? 61  GLN A HG2  1  
ATOM 965   H HG3  . GLN A 1 61  ? -37.249 13.307  -19.653 1.00 0.00 ? 61  GLN A HG3  1  
ATOM 966   H HE21 . GLN A 1 61  ? -37.696 13.343  -21.786 1.00 0.00 ? 61  GLN A HE21 1  
ATOM 967   H HE22 . GLN A 1 61  ? -38.301 14.755  -22.625 1.00 0.00 ? 61  GLN A HE22 1  
ATOM 968   N N    . ARG A 1 62  ? -39.793 12.895  -15.415 1.00 0.00 ? 62  ARG A N    1  
ATOM 969   C CA   . ARG A 1 62  ? -40.415 12.955  -14.079 1.00 0.00 ? 62  ARG A CA   1  
ATOM 970   C C    . ARG A 1 62  ? -39.373 12.663  -12.988 1.00 0.00 ? 62  ARG A C    1  
ATOM 971   O O    . ARG A 1 62  ? -38.370 12.018  -13.296 1.00 0.00 ? 62  ARG A O    1  
ATOM 972   C CB   . ARG A 1 62  ? -41.559 11.924  -13.974 1.00 0.00 ? 62  ARG A CB   1  
ATOM 973   C CG   . ARG A 1 62  ? -42.934 12.451  -14.398 1.00 0.00 ? 62  ARG A CG   1  
ATOM 974   C CD   . ARG A 1 62  ? -43.263 12.319  -15.888 1.00 0.00 ? 62  ARG A CD   1  
ATOM 975   N NE   . ARG A 1 62  ? -42.661 13.373  -16.717 1.00 0.00 ? 62  ARG A NE   1  
ATOM 976   C CZ   . ARG A 1 62  ? -43.047 14.622  -16.882 1.00 0.00 ? 62  ARG A CZ   1  
ATOM 977   N NH1  . ARG A 1 62  ? -44.047 15.149  -16.233 1.00 0.00 ? 62  ARG A NH1  1  
ATOM 978   N NH2  . ARG A 1 62  ? -42.405 15.363  -17.736 1.00 0.00 ? 62  ARG A NH2  1  
ATOM 979   H H    . ARG A 1 62  ? -39.822 11.993  -15.883 1.00 0.00 ? 62  ARG A H    1  
ATOM 980   H HA   . ARG A 1 62  ? -40.785 13.965  -13.899 1.00 0.00 ? 62  ARG A HA   1  
ATOM 981   H HB2  . ARG A 1 62  ? -41.310 11.018  -14.527 1.00 0.00 ? 62  ARG A HB2  1  
ATOM 982   H HB3  . ARG A 1 62  ? -41.657 11.624  -12.930 1.00 0.00 ? 62  ARG A HB3  1  
ATOM 983   H HG2  . ARG A 1 62  ? -43.675 11.862  -13.861 1.00 0.00 ? 62  ARG A HG2  1  
ATOM 984   H HG3  . ARG A 1 62  ? -43.030 13.487  -14.085 1.00 0.00 ? 62  ARG A HG3  1  
ATOM 985   H HD2  . ARG A 1 62  ? -42.908 11.349  -16.234 1.00 0.00 ? 62  ARG A HD2  1  
ATOM 986   H HD3  . ARG A 1 62  ? -44.347 12.334  -16.014 1.00 0.00 ? 62  ARG A HD3  1  
ATOM 987   H HE   . ARG A 1 62  ? -41.888 13.096  -17.306 1.00 0.00 ? 62  ARG A HE   1  
ATOM 988   H HH11 . ARG A 1 62  ? -44.563 14.583  -15.583 1.00 0.00 ? 62  ARG A HH11 1  
ATOM 989   H HH12 . ARG A 1 62  ? -44.313 16.106  -16.392 1.00 0.00 ? 62  ARG A HH12 1  
ATOM 990   H HH21 . ARG A 1 62  ? -41.661 14.938  -18.275 1.00 0.00 ? 62  ARG A HH21 1  
ATOM 991   H HH22 . ARG A 1 62  ? -42.673 16.319  -17.896 1.00 0.00 ? 62  ARG A HH22 1  
ATOM 992   N N    . PRO A 1 63  ? -39.589 13.063  -11.721 1.00 0.00 ? 63  PRO A N    1  
ATOM 993   C CA   . PRO A 1 63  ? -38.747 12.632  -10.606 1.00 0.00 ? 63  PRO A CA   1  
ATOM 994   C C    . PRO A 1 63  ? -38.765 11.102  -10.432 1.00 0.00 ? 63  PRO A C    1  
ATOM 995   O O    . PRO A 1 63  ? -39.811 10.457  -10.534 1.00 0.00 ? 63  PRO A O    1  
ATOM 996   C CB   . PRO A 1 63  ? -39.292 13.356  -9.369  1.00 0.00 ? 63  PRO A CB   1  
ATOM 997   C CG   . PRO A 1 63  ? -40.757 13.609  -9.722  1.00 0.00 ? 63  PRO A CG   1  
ATOM 998   C CD   . PRO A 1 63  ? -40.705 13.861  -11.228 1.00 0.00 ? 63  PRO A CD   1  
ATOM 999   H HA   . PRO A 1 63  ? -37.720 12.957  -10.775 1.00 0.00 ? 63  PRO A HA   1  
ATOM 1000  H HB2  . PRO A 1 63  ? -39.192 12.761  -8.460  1.00 0.00 ? 63  PRO A HB2  1  
ATOM 1001  H HB3  . PRO A 1 63  ? -38.781 14.312  -9.251  1.00 0.00 ? 63  PRO A HB3  1  
ATOM 1002  H HG2  . PRO A 1 63  ? -41.346 12.713  -9.519  1.00 0.00 ? 63  PRO A HG2  1  
ATOM 1003  H HG3  . PRO A 1 63  ? -41.160 14.466  -9.184  1.00 0.00 ? 63  PRO A HG3  1  
ATOM 1004  H HD2  . PRO A 1 63  ? -41.653 13.575  -11.682 1.00 0.00 ? 63  PRO A HD2  1  
ATOM 1005  H HD3  . PRO A 1 63  ? -40.504 14.917  -11.417 1.00 0.00 ? 63  PRO A HD3  1  
ATOM 1006  N N    . CYS A 1 64  ? -37.602 10.522  -10.130 1.00 0.00 ? 64  CYS A N    1  
ATOM 1007  C CA   . CYS A 1 64  ? -37.399 9.093   -9.855  1.00 0.00 ? 64  CYS A CA   1  
ATOM 1008  C C    . CYS A 1 64  ? -38.071 8.615   -8.540  1.00 0.00 ? 64  CYS A C    1  
ATOM 1009  O O    . CYS A 1 64  ? -38.152 7.415   -8.273  1.00 0.00 ? 64  CYS A O    1  
ATOM 1010  C CB   . CYS A 1 64  ? -35.878 8.872   -9.867  1.00 0.00 ? 64  CYS A CB   1  
ATOM 1011  S SG   . CYS A 1 64  ? -35.457 7.111   -9.828  1.00 0.00 ? 64  CYS A SG   1  
ATOM 1012  H H    . CYS A 1 64  ? -36.774 11.109  -10.126 1.00 0.00 ? 64  CYS A H    1  
ATOM 1013  H HA   . CYS A 1 64  ? -37.835 8.506   -10.666 1.00 0.00 ? 64  CYS A HA   1  
ATOM 1014  H HB2  . CYS A 1 64  ? -35.457 9.305   -10.776 1.00 0.00 ? 64  CYS A HB2  1  
ATOM 1015  H HB3  . CYS A 1 64  ? -35.429 9.376   -9.011  1.00 0.00 ? 64  CYS A HB3  1  
ATOM 1016  H HG   . CYS A 1 64  ? -36.268 6.785   -8.806  1.00 0.00 ? 64  CYS A HG   1  
ATOM 1017  N N    . THR A 1 65  ? -38.565 9.544   -7.715  1.00 0.00 ? 65  THR A N    1  
ATOM 1018  C CA   . THR A 1 65  ? -39.228 9.335   -6.427  1.00 0.00 ? 65  THR A CA   1  
ATOM 1019  C C    . THR A 1 65  ? -40.522 8.541   -6.586  1.00 0.00 ? 65  THR A C    1  
ATOM 1020  O O    . THR A 1 65  ? -41.567 9.077   -6.956  1.00 0.00 ? 65  THR A O    1  
ATOM 1021  C CB   . THR A 1 65  ? -39.513 10.667  -5.708  1.00 0.00 ? 65  THR A CB   1  
ATOM 1022  O OG1  . THR A 1 65  ? -38.449 11.579  -5.867  1.00 0.00 ? 65  THR A OG1  1  
ATOM 1023  C CG2  . THR A 1 65  ? -39.691 10.432  -4.211  1.00 0.00 ? 65  THR A CG2  1  
ATOM 1024  H H    . THR A 1 65  ? -38.416 10.502  -7.958  1.00 0.00 ? 65  THR A H    1  
ATOM 1025  H HA   . THR A 1 65  ? -38.549 8.761   -5.797  1.00 0.00 ? 65  THR A HA   1  
ATOM 1026  H HB   . THR A 1 65  ? -40.406 11.130  -6.116  1.00 0.00 ? 65  THR A HB   1  
ATOM 1027  H HG1  . THR A 1 65  ? -38.701 12.412  -5.435  1.00 0.00 ? 65  THR A HG1  1  
ATOM 1028  H HG21 . THR A 1 65  ? -39.868 11.381  -3.704  1.00 0.00 ? 65  THR A HG21 1  
ATOM 1029  H HG22 . THR A 1 65  ? -40.542 9.776   -4.030  1.00 0.00 ? 65  THR A HG22 1  
ATOM 1030  H HG23 . THR A 1 65  ? -38.790 9.966   -3.813  1.00 0.00 ? 65  THR A HG23 1  
ATOM 1031  N N    . CYS A 1 66  ? -40.436 7.247   -6.290  1.00 0.00 ? 66  CYS A N    1  
ATOM 1032  C CA   . CYS A 1 66  ? -41.511 6.250   -6.436  1.00 0.00 ? 66  CYS A CA   1  
ATOM 1033  C C    . CYS A 1 66  ? -42.868 6.648   -5.818  1.00 0.00 ? 66  CYS A C    1  
ATOM 1034  O O    . CYS A 1 66  ? -43.912 6.183   -6.270  1.00 0.00 ? 66  CYS A O    1  
ATOM 1035  C CB   . CYS A 1 66  ? -41.044 4.929   -5.800  1.00 0.00 ? 66  CYS A CB   1  
ATOM 1036  S SG   . CYS A 1 66  ? -39.435 4.400   -6.456  1.00 0.00 ? 66  CYS A SG   1  
ATOM 1037  H H    . CYS A 1 66  ? -39.488 6.905   -6.209  1.00 0.00 ? 66  CYS A H    1  
ATOM 1038  H HA   . CYS A 1 66  ? -41.686 6.098   -7.496  1.00 0.00 ? 66  CYS A HA   1  
ATOM 1039  H HB2  . CYS A 1 66  ? -40.960 5.057   -4.719  1.00 0.00 ? 66  CYS A HB2  1  
ATOM 1040  H HB3  . CYS A 1 66  ? -41.787 4.153   -5.996  1.00 0.00 ? 66  CYS A HB3  1  
ATOM 1041  H HG   . CYS A 1 66  ? -39.806 4.258   -7.739  1.00 0.00 ? 66  CYS A HG   1  
ATOM 1042  N N    . ASP A 1 67  ? -42.867 7.553   -4.838  1.00 0.00 ? 67  ASP A N    1  
ATOM 1043  C CA   . ASP A 1 67  ? -44.061 8.204   -4.277  1.00 0.00 ? 67  ASP A CA   1  
ATOM 1044  C C    . ASP A 1 67  ? -45.025 8.729   -5.364  1.00 0.00 ? 67  ASP A C    1  
ATOM 1045  O O    . ASP A 1 67  ? -46.234 8.509   -5.284  1.00 0.00 ? 67  ASP A O    1  
ATOM 1046  C CB   . ASP A 1 67  ? -43.598 9.368   -3.387  1.00 0.00 ? 67  ASP A CB   1  
ATOM 1047  C CG   . ASP A 1 67  ? -44.780 10.074  -2.700  1.00 0.00 ? 67  ASP A CG   1  
ATOM 1048  O OD1  . ASP A 1 67  ? -45.305 9.538   -1.696  1.00 0.00 ? 67  ASP A OD1  1  
ATOM 1049  O OD2  . ASP A 1 67  ? -45.168 11.179  -3.150  1.00 0.00 ? 67  ASP A OD2  1  
ATOM 1050  H H    . ASP A 1 67  ? -41.961 7.877   -4.543  1.00 0.00 ? 67  ASP A H    1  
ATOM 1051  H HA   . ASP A 1 67  ? -44.601 7.486   -3.659  1.00 0.00 ? 67  ASP A HA   1  
ATOM 1052  H HB2  . ASP A 1 67  ? -42.911 8.990   -2.628  1.00 0.00 ? 67  ASP A HB2  1  
ATOM 1053  H HB3  . ASP A 1 67  ? -43.047 10.086  -3.998  1.00 0.00 ? 67  ASP A HB3  1  
ATOM 1054  N N    . PHE A 1 68  ? -44.494 9.338   -6.433  1.00 0.00 ? 68  PHE A N    1  
ATOM 1055  C CA   . PHE A 1 68  ? -45.280 9.896   -7.544  1.00 0.00 ? 68  PHE A CA   1  
ATOM 1056  C C    . PHE A 1 68  ? -46.088 8.835   -8.322  1.00 0.00 ? 68  PHE A C    1  
ATOM 1057  O O    . PHE A 1 68  ? -47.018 9.190   -9.050  1.00 0.00 ? 68  PHE A O    1  
ATOM 1058  C CB   . PHE A 1 68  ? -44.347 10.678  -8.487  1.00 0.00 ? 68  PHE A CB   1  
ATOM 1059  C CG   . PHE A 1 68  ? -43.957 12.065  -7.997  1.00 0.00 ? 68  PHE A CG   1  
ATOM 1060  C CD1  . PHE A 1 68  ? -43.044 12.225  -6.936  1.00 0.00 ? 68  PHE A CD1  1  
ATOM 1061  C CD2  . PHE A 1 68  ? -44.507 13.208  -8.612  1.00 0.00 ? 68  PHE A CD2  1  
ATOM 1062  C CE1  . PHE A 1 68  ? -42.684 13.510  -6.493  1.00 0.00 ? 68  PHE A CE1  1  
ATOM 1063  C CE2  . PHE A 1 68  ? -44.147 14.495  -8.169  1.00 0.00 ? 68  PHE A CE2  1  
ATOM 1064  C CZ   . PHE A 1 68  ? -43.236 14.646  -7.109  1.00 0.00 ? 68  PHE A CZ   1  
ATOM 1065  H H    . PHE A 1 68  ? -43.483 9.408   -6.488  1.00 0.00 ? 68  PHE A H    1  
ATOM 1066  H HA   . PHE A 1 68  ? -46.008 10.597  -7.133  1.00 0.00 ? 68  PHE A HA   1  
ATOM 1067  H HB2  . PHE A 1 68  ? -43.444 10.095  -8.676  1.00 0.00 ? 68  PHE A HB2  1  
ATOM 1068  H HB3  . PHE A 1 68  ? -44.847 10.794  -9.449  1.00 0.00 ? 68  PHE A HB3  1  
ATOM 1069  H HD1  . PHE A 1 68  ? -42.620 11.359  -6.453  1.00 0.00 ? 68  PHE A HD1  1  
ATOM 1070  H HD2  . PHE A 1 68  ? -45.209 13.102  -9.427  1.00 0.00 ? 68  PHE A HD2  1  
ATOM 1071  H HE1  . PHE A 1 68  ? -41.983 13.625  -5.676  1.00 0.00 ? 68  PHE A HE1  1  
ATOM 1072  H HE2  . PHE A 1 68  ? -44.573 15.369  -8.645  1.00 0.00 ? 68  PHE A HE2  1  
ATOM 1073  H HZ   . PHE A 1 68  ? -42.961 15.636  -6.769  1.00 0.00 ? 68  PHE A HZ   1  
ATOM 1074  N N    . LEU A 1 69  ? -45.757 7.545   -8.167  1.00 0.00 ? 69  LEU A N    1  
ATOM 1075  C CA   . LEU A 1 69  ? -46.497 6.400   -8.707  1.00 0.00 ? 69  LEU A CA   1  
ATOM 1076  C C    . LEU A 1 69  ? -46.944 5.385   -7.628  1.00 0.00 ? 69  LEU A C    1  
ATOM 1077  O O    . LEU A 1 69  ? -47.156 4.209   -7.938  1.00 0.00 ? 69  LEU A O    1  
ATOM 1078  C CB   . LEU A 1 69  ? -45.754 5.824   -9.936  1.00 0.00 ? 69  LEU A CB   1  
ATOM 1079  C CG   . LEU A 1 69  ? -44.277 5.412   -9.760  1.00 0.00 ? 69  LEU A CG   1  
ATOM 1080  C CD1  . LEU A 1 69  ? -44.094 4.125   -8.958  1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1081  C CD2  . LEU A 1 69  ? -43.647 5.176   -11.135 1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1082  H H    . LEU A 1 69  ? -44.996 7.332   -7.531  1.00 0.00 ? 69  LEU A H    1  
ATOM 1083  H HA   . LEU A 1 69  ? -47.443 6.779   -9.095  1.00 0.00 ? 69  LEU A HA   1  
ATOM 1084  H HB2  . LEU A 1 69  ? -46.316 4.975   -10.327 1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1085  H HB3  . LEU A 1 69  ? -45.788 6.598   -10.705 1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1086  H HG   . LEU A 1 69  ? -43.723 6.215   -9.272  1.00 0.00 ? 69  LEU A HG   1  
ATOM 1087  H HD11 . LEU A 1 69  ? -44.452 4.262   -7.941  1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1088  H HD12 . LEU A 1 69  ? -44.652 3.318   -9.431  1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1089  H HD13 . LEU A 1 69  ? -43.038 3.863   -8.919  1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1090  H HD21 . LEU A 1 69  ? -43.711 6.087   -11.732 1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1091  H HD22 . LEU A 1 69  ? -42.596 4.911   -11.022 1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1092  H HD23 . LEU A 1 69  ? -44.167 4.370   -11.653 1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1093  N N    . HIS A 1 70  ? -47.111 5.811   -6.364  1.00 0.00 ? 70  HIS A N    1  
ATOM 1094  C CA   . HIS A 1 70  ? -47.594 4.916   -5.296  1.00 0.00 ? 70  HIS A CA   1  
ATOM 1095  C C    . HIS A 1 70  ? -49.042 4.441   -5.544  1.00 0.00 ? 70  HIS A C    1  
ATOM 1096  O O    . HIS A 1 70  ? -49.845 5.148   -6.161  1.00 0.00 ? 70  HIS A O    1  
ATOM 1097  C CB   . HIS A 1 70  ? -47.449 5.560   -3.904  1.00 0.00 ? 70  HIS A CB   1  
ATOM 1098  C CG   . HIS A 1 70  ? -48.639 6.368   -3.430  1.00 0.00 ? 70  HIS A CG   1  
ATOM 1099  N ND1  . HIS A 1 70  ? -48.954 7.682   -3.788  1.00 0.00 ? 70  HIS A ND1  1  
ATOM 1100  C CD2  . HIS A 1 70  ? -49.604 5.906   -2.579  1.00 0.00 ? 70  HIS A CD2  1  
ATOM 1101  C CE1  . HIS A 1 70  ? -50.097 7.980   -3.148  1.00 0.00 ? 70  HIS A CE1  1  
ATOM 1102  N NE2  . HIS A 1 70  ? -50.510 6.931   -2.415  1.00 0.00 ? 70  HIS A NE2  1  
ATOM 1103  H H    . HIS A 1 70  ? -46.914 6.781   -6.133  1.00 0.00 ? 70  HIS A H    1  
ATOM 1104  H HA   . HIS A 1 70  ? -46.960 4.027   -5.305  1.00 0.00 ? 70  HIS A HA   1  
ATOM 1105  H HB2  . HIS A 1 70  ? -47.291 4.763   -3.183  1.00 0.00 ? 70  HIS A HB2  1  
ATOM 1106  H HB3  . HIS A 1 70  ? -46.555 6.183   -3.879  1.00 0.00 ? 70  HIS A HB3  1  
ATOM 1107  H HD2  . HIS A 1 70  ? -49.649 4.917   -2.138  1.00 0.00 ? 70  HIS A HD2  1  
ATOM 1108  H HE1  . HIS A 1 70  ? -50.617 8.930   -3.214  1.00 0.00 ? 70  HIS A HE1  1  
ATOM 1109  H HE2  . HIS A 1 70  ? -51.353 6.910   -1.850  1.00 0.00 ? 70  HIS A HE2  1  
ATOM 1110  N N    . GLY A 1 71  ? -49.381 3.252   -5.040  1.00 0.00 ? 71  GLY A N    1  
ATOM 1111  C CA   . GLY A 1 71  ? -50.714 2.643   -5.122  1.00 0.00 ? 71  GLY A CA   1  
ATOM 1112  C C    . GLY A 1 71  ? -51.292 2.234   -3.756  1.00 0.00 ? 71  GLY A C    1  
ATOM 1113  O O    . GLY A 1 71  ? -50.648 2.445   -2.722  1.00 0.00 ? 71  GLY A O    1  
ATOM 1114  H H    . GLY A 1 71  ? -48.682 2.747   -4.503  1.00 0.00 ? 71  GLY A H    1  
ATOM 1115  H HA2  . GLY A 1 71  ? -51.412 3.335   -5.592  1.00 0.00 ? 71  GLY A HA2  1  
ATOM 1116  H HA3  . GLY A 1 71  ? -50.654 1.754   -5.747  1.00 0.00 ? 71  GLY A HA3  1  
ATOM 1117  N N    . PRO A 1 72  ? -52.495 1.623   -3.720  1.00 0.00 ? 72  PRO A N    1  
ATOM 1118  C CA   . PRO A 1 72  ? -53.225 1.348   -2.472  1.00 0.00 ? 72  PRO A CA   1  
ATOM 1119  C C    . PRO A 1 72  ? -52.559 0.358   -1.495  1.00 0.00 ? 72  PRO A C    1  
ATOM 1120  O O    . PRO A 1 72  ? -52.994 0.257   -0.345  1.00 0.00 ? 72  PRO A O    1  
ATOM 1121  C CB   . PRO A 1 72  ? -54.597 0.823   -2.916  1.00 0.00 ? 72  PRO A CB   1  
ATOM 1122  C CG   . PRO A 1 72  ? -54.789 1.438   -4.300  1.00 0.00 ? 72  PRO A CG   1  
ATOM 1123  C CD   . PRO A 1 72  ? -53.373 1.406   -4.865  1.00 0.00 ? 72  PRO A CD   1  
ATOM 1124  H HA   . PRO A 1 72  ? -53.367 2.295   -1.951  1.00 0.00 ? 72  PRO A HA   1  
ATOM 1125  H HB2  . PRO A 1 72  ? -54.571 -0.265  -3.010  1.00 0.00 ? 72  PRO A HB2  1  
ATOM 1126  H HB3  . PRO A 1 72  ? -55.387 1.126   -2.228  1.00 0.00 ? 72  PRO A HB3  1  
ATOM 1127  H HG2  . PRO A 1 72  ? -55.483 0.859   -4.910  1.00 0.00 ? 72  PRO A HG2  1  
ATOM 1128  H HG3  . PRO A 1 72  ? -55.125 2.471   -4.203  1.00 0.00 ? 72  PRO A HG3  1  
ATOM 1129  H HD2  . PRO A 1 72  ? -53.171 0.426   -5.297  1.00 0.00 ? 72  PRO A HD2  1  
ATOM 1130  H HD3  . PRO A 1 72  ? -53.268 2.179   -5.626  1.00 0.00 ? 72  PRO A HD3  1  
ATOM 1131  N N    . ARG A 1 73  ? -51.491 -0.337  -1.916  1.00 0.00 ? 73  ARG A N    1  
ATOM 1132  C CA   . ARG A 1 73  ? -50.671 -1.247  -1.090  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1133  C C    . ARG A 1 73  ? -49.282 -0.677  -0.750  1.00 0.00 ? 73  ARG A C    1  
ATOM 1134  O O    . ARG A 1 73  ? -48.570 -1.258  0.072   1.00 0.00 ? 73  ARG A O    1  
ATOM 1135  C CB   . ARG A 1 73  ? -50.647 -2.625  -1.786  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1136  C CG   . ARG A 1 73  ? -49.985 -3.755  -0.982  1.00 0.00 ? 73  ARG A CG   1  
ATOM 1137  C CD   . ARG A 1 73  ? -50.399 -5.137  -1.510  1.00 0.00 ? 73  ARG A CD   1  
ATOM 1138  N NE   . ARG A 1 73  ? -51.727 -5.533  -0.996  1.00 0.00 ? 73  ARG A NE   1  
ATOM 1139  C CZ   . ARG A 1 73  ? -52.826 -5.833  -1.669  1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1140  N NH1  . ARG A 1 73  ? -52.903 -5.814  -2.969  1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1141  N NH2  . ARG A 1 73  ? -53.906 -6.168  -1.023  1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1142  H H    . ARG A 1 73  ? -51.236 -0.236  -2.891  1.00 0.00 ? 73  ARG A H    1  
ATOM 1143  H HA   . ARG A 1 73  ? -51.164 -1.383  -0.125  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1144  H HB2  . ARG A 1 73  ? -51.681 -2.908  -1.993  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1145  H HB3  . ARG A 1 73  ? -50.123 -2.544  -2.736  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1146  H HG2  . ARG A 1 73  ? -48.902 -3.659  -1.068  1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1147  H HG3  . ARG A 1 73  ? -50.257 -3.676  0.072   1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1148  H HD2  . ARG A 1 73  ? -50.374 -5.133  -2.600  1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1149  H HD3  . ARG A 1 73  ? -49.667 -5.869  -1.163  1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1150  H HE   . ARG A 1 73  ? -51.807 -5.601  0.007   1.00 0.00 ? 73  ARG A HE   1  
ATOM 1151  H HH11 . ARG A 1 73  ? -52.100 -5.568  -3.535  1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1152  H HH12 . ARG A 1 73  ? -53.762 -6.062  -3.428  1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1153  H HH21 . ARG A 1 73  ? -53.906 -6.201  -0.016  1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1154  H HH22 . ARG A 1 73  ? -54.747 -6.399  -1.524  1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1155  N N    . THR A 1 74  ? -48.884 0.464   -1.324  1.00 0.00 ? 74  THR A N    1  
ATOM 1156  C CA   . THR A 1 74  ? -47.563 1.063   -1.061  1.00 0.00 ? 74  THR A CA   1  
ATOM 1157  C C    . THR A 1 74  ? -47.491 1.651   0.340   1.00 0.00 ? 74  THR A C    1  
ATOM 1158  O O    . THR A 1 74  ? -48.360 2.415   0.768   1.00 0.00 ? 74  THR A O    1  
ATOM 1159  C CB   . THR A 1 74  ? -47.166 2.146   -2.073  1.00 0.00 ? 74  THR A CB   1  
ATOM 1160  O OG1  . THR A 1 74  ? -47.500 1.790   -3.395  1.00 0.00 ? 74  THR A OG1  1  
ATOM 1161  C CG2  . THR A 1 74  ? -45.659 2.406   -2.053  1.00 0.00 ? 74  THR A CG2  1  
ATOM 1162  H H    . THR A 1 74  ? -49.513 0.957   -1.949  1.00 0.00 ? 74  THR A H    1  
ATOM 1163  H HA   . THR A 1 74  ? -46.821 0.270   -1.116  1.00 0.00 ? 74  THR A HA   1  
ATOM 1164  H HB   . THR A 1 74  ? -47.690 3.062   -1.813  1.00 0.00 ? 74  THR A HB   1  
ATOM 1165  H HG1  . THR A 1 74  ? -46.711 1.405   -3.816  1.00 0.00 ? 74  THR A HG1  1  
ATOM 1166  H HG21 . THR A 1 74  ? -45.117 1.469   -2.171  1.00 0.00 ? 74  THR A HG21 1  
ATOM 1167  H HG22 . THR A 1 74  ? -45.388 3.085   -2.862  1.00 0.00 ? 74  THR A HG22 1  
ATOM 1168  H HG23 . THR A 1 74  ? -45.371 2.866   -1.107  1.00 0.00 ? 74  THR A HG23 1  
ATOM 1169  N N    . GLN A 1 75  ? -46.412 1.325   1.048   1.00 0.00 ? 75  GLN A N    1  
ATOM 1170  C CA   . GLN A 1 75  ? -46.189 1.810   2.403   1.00 0.00 ? 75  GLN A CA   1  
ATOM 1171  C C    . GLN A 1 75  ? -45.644 3.240   2.367   1.00 0.00 ? 75  GLN A C    1  
ATOM 1172  O O    . GLN A 1 75  ? -44.721 3.572   1.615   1.00 0.00 ? 75  GLN A O    1  
ATOM 1173  C CB   . GLN A 1 75  ? -45.267 0.864   3.185   1.00 0.00 ? 75  GLN A CB   1  
ATOM 1174  C CG   . GLN A 1 75  ? -45.730 -0.600  3.233   1.00 0.00 ? 75  GLN A CG   1  
ATOM 1175  C CD   . GLN A 1 75  ? -47.135 -0.773  3.810   1.00 0.00 ? 75  GLN A CD   1  
ATOM 1176  O OE1  . GLN A 1 75  ? -47.357 -0.649  5.008   1.00 0.00 ? 75  GLN A OE1  1  
ATOM 1177  N NE2  . GLN A 1 75  ? -48.141 -1.043  3.003   1.00 0.00 ? 75  GLN A NE2  1  
ATOM 1178  H H    . GLN A 1 75  ? -45.697 0.766   0.608   1.00 0.00 ? 75  GLN A H    1  
ATOM 1179  H HA   . GLN A 1 75  ? -47.150 1.833   2.922   1.00 0.00 ? 75  GLN A HA   1  
ATOM 1180  H HB2  . GLN A 1 75  ? -44.268 0.896   2.753   1.00 0.00 ? 75  GLN A HB2  1  
ATOM 1181  H HB3  . GLN A 1 75  ? -45.203 1.226   4.209   1.00 0.00 ? 75  GLN A HB3  1  
ATOM 1182  H HG2  . GLN A 1 75  ? -45.682 -1.033  2.235   1.00 0.00 ? 75  GLN A HG2  1  
ATOM 1183  H HG3  . GLN A 1 75  ? -45.031 -1.144  3.868   1.00 0.00 ? 75  GLN A HG3  1  
ATOM 1184  H HE21 . GLN A 1 75  ? -48.007 -1.157  2.002   1.00 0.00 ? 75  GLN A HE21 1  
ATOM 1185  H HE22 . GLN A 1 75  ? -49.056 -1.156  3.410   1.00 0.00 ? 75  GLN A HE22 1  
ATOM 1186  N N    . ARG A 1 76  ? -46.187 4.097   3.231   1.00 0.00 ? 76  ARG A N    1  
ATOM 1187  C CA   . ARG A 1 76  ? -45.775 5.503   3.323   1.00 0.00 ? 76  ARG A CA   1  
ATOM 1188  C C    . ARG A 1 76  ? -44.341 5.611   3.825   1.00 0.00 ? 76  ARG A C    1  
ATOM 1189  O O    . ARG A 1 76  ? -43.570 6.387   3.275   1.00 0.00 ? 76  ARG A O    1  
ATOM 1190  C CB   . ARG A 1 76  ? -46.766 6.318   4.159   1.00 0.00 ? 76  ARG A CB   1  
ATOM 1191  C CG   . ARG A 1 76  ? -48.248 6.151   3.761   1.00 0.00 ? 76  ARG A CG   1  
ATOM 1192  C CD   . ARG A 1 76  ? -48.500 6.336   2.255   1.00 0.00 ? 76  ARG A CD   1  
ATOM 1193  N NE   . ARG A 1 76  ? -49.941 6.480   1.960   1.00 0.00 ? 76  ARG A NE   1  
ATOM 1194  C CZ   . ARG A 1 76  ? -50.760 5.616   1.382   1.00 0.00 ? 76  ARG A CZ   1  
ATOM 1195  N NH1  . ARG A 1 76  ? -50.399 4.428   0.985   1.00 0.00 ? 76  ARG A NH1  1  
ATOM 1196  N NH2  . ARG A 1 76  ? -52.005 5.944   1.185   1.00 0.00 ? 76  ARG A NH2  1  
ATOM 1197  H H    . ARG A 1 76  ? -46.885 3.750   3.877   1.00 0.00 ? 76  ARG A H    1  
ATOM 1198  H HA   . ARG A 1 76  ? -45.760 5.927   2.316   1.00 0.00 ? 76  ARG A HA   1  
ATOM 1199  H HB2  . ARG A 1 76  ? -46.637 6.012   5.193   1.00 0.00 ? 76  ARG A HB2  1  
ATOM 1200  H HB3  . ARG A 1 76  ? -46.501 7.374   4.083   1.00 0.00 ? 76  ARG A HB3  1  
ATOM 1201  H HG2  . ARG A 1 76  ? -48.602 5.164   4.059   1.00 0.00 ? 76  ARG A HG2  1  
ATOM 1202  H HG3  . ARG A 1 76  ? -48.828 6.893   4.312   1.00 0.00 ? 76  ARG A HG3  1  
ATOM 1203  H HD2  . ARG A 1 76  ? -47.989 7.242   1.926   1.00 0.00 ? 76  ARG A HD2  1  
ATOM 1204  H HD3  . ARG A 1 76  ? -48.073 5.495   1.706   1.00 0.00 ? 76  ARG A HD3  1  
ATOM 1205  H HE   . ARG A 1 76  ? -50.354 7.362   2.217   1.00 0.00 ? 76  ARG A HE   1  
ATOM 1206  H HH11 . ARG A 1 76  ? -49.456 4.093   1.125   1.00 0.00 ? 76  ARG A HH11 1  
ATOM 1207  H HH12 . ARG A 1 76  ? -51.065 3.812   0.556   1.00 0.00 ? 76  ARG A HH12 1  
ATOM 1208  H HH21 . ARG A 1 76  ? -52.347 6.841   1.489   1.00 0.00 ? 76  ARG A HH21 1  
ATOM 1209  H HH22 . ARG A 1 76  ? -52.645 5.286   0.775   1.00 0.00 ? 76  ARG A HH22 1  
ATOM 1210  N N    . ARG A 1 77  ? -43.954 4.775   4.798   1.00 0.00 ? 77  ARG A N    1  
ATOM 1211  C CA   . ARG A 1 77  ? -42.559 4.623   5.262   1.00 0.00 ? 77  ARG A CA   1  
ATOM 1212  C C    . ARG A 1 77  ? -41.571 4.313   4.133   1.00 0.00 ? 77  ARG A C    1  
ATOM 1213  O O    . ARG A 1 77  ? -40.457 4.836   4.122   1.00 0.00 ? 77  ARG A O    1  
ATOM 1214  C CB   . ARG A 1 77  ? -42.484 3.554   6.371   1.00 0.00 ? 77  ARG A CB   1  
ATOM 1215  C CG   . ARG A 1 77  ? -42.952 2.137   5.977   1.00 0.00 ? 77  ARG A CG   1  
ATOM 1216  C CD   . ARG A 1 77  ? -42.623 1.075   7.034   1.00 0.00 ? 77  ARG A CD   1  
ATOM 1217  N NE   . ARG A 1 77  ? -43.048 -0.276  6.601   1.00 0.00 ? 77  ARG A NE   1  
ATOM 1218  C CZ   . ARG A 1 77  ? -42.431 -1.084  5.752   1.00 0.00 ? 77  ARG A CZ   1  
ATOM 1219  N NH1  . ARG A 1 77  ? -41.321 -0.785  5.147   1.00 0.00 ? 77  ARG A NH1  1  
ATOM 1220  N NH2  . ARG A 1 77  ? -42.907 -2.254  5.454   1.00 0.00 ? 77  ARG A NH2  1  
ATOM 1221  H H    . ARG A 1 77  ? -44.666 4.174   5.192   1.00 0.00 ? 77  ARG A H    1  
ATOM 1222  H HA   . ARG A 1 77  ? -42.235 5.573   5.693   1.00 0.00 ? 77  ARG A HA   1  
ATOM 1223  H HB2  . ARG A 1 77  ? -41.447 3.510   6.700   1.00 0.00 ? 77  ARG A HB2  1  
ATOM 1224  H HB3  . ARG A 1 77  ? -43.103 3.891   7.202   1.00 0.00 ? 77  ARG A HB3  1  
ATOM 1225  H HG2  . ARG A 1 77  ? -44.031 2.156   5.835   1.00 0.00 ? 77  ARG A HG2  1  
ATOM 1226  H HG3  . ARG A 1 77  ? -42.479 1.830   5.048   1.00 0.00 ? 77  ARG A HG3  1  
ATOM 1227  H HD2  . ARG A 1 77  ? -41.551 1.079   7.236   1.00 0.00 ? 77  ARG A HD2  1  
ATOM 1228  H HD3  . ARG A 1 77  ? -43.142 1.330   7.959   1.00 0.00 ? 77  ARG A HD3  1  
ATOM 1229  H HE   . ARG A 1 77  ? -43.899 -0.632  7.010   1.00 0.00 ? 77  ARG A HE   1  
ATOM 1230  H HH11 . ARG A 1 77  ? -40.845 0.074   5.342   1.00 0.00 ? 77  ARG A HH11 1  
ATOM 1231  H HH12 . ARG A 1 77  ? -40.942 -1.483  4.508   1.00 0.00 ? 77  ARG A HH12 1  
ATOM 1232  H HH21 . ARG A 1 77  ? -43.743 -2.609  5.886   1.00 0.00 ? 77  ARG A HH21 1  
ATOM 1233  H HH22 . ARG A 1 77  ? -42.378 -2.812  4.784   1.00 0.00 ? 77  ARG A HH22 1  
ATOM 1234  N N    . ALA A 1 78  ? -41.984 3.481   3.179   1.00 0.00 ? 78  ALA A N    1  
ATOM 1235  C CA   . ALA A 1 78  ? -41.187 3.086   2.022   1.00 0.00 ? 78  ALA A CA   1  
ATOM 1236  C C    . ALA A 1 78  ? -41.022 4.273   1.060   1.00 0.00 ? 78  ALA A C    1  
ATOM 1237  O O    . ALA A 1 78  ? -39.900 4.666   0.712   1.00 0.00 ? 78  ALA A O    1  
ATOM 1238  C CB   . ALA A 1 78  ? -41.867 1.874   1.364   1.00 0.00 ? 78  ALA A CB   1  
ATOM 1239  H H    . ALA A 1 78  ? -42.926 3.128   3.248   1.00 0.00 ? 78  ALA A H    1  
ATOM 1240  H HA   . ALA A 1 78  ? -40.191 2.785   2.352   1.00 0.00 ? 78  ALA A HA   1  
ATOM 1241  H HB1  . ALA A 1 78  ? -41.307 1.581   0.490   1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1242  H HB2  . ALA A 1 78  ? -41.900 1.030   2.053   1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1243  H HB3  . ALA A 1 78  ? -42.870 2.102   1.009   1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1244  N N    . ALA A 1 79  ? -42.146 4.916   0.720   1.00 0.00 ? 79  ALA A N    1  
ATOM 1245  C CA   . ALA A 1 79  ? -42.132 6.071   -0.177  1.00 0.00 ? 79  ALA A CA   1  
ATOM 1246  C C    . ALA A 1 79  ? -41.389 7.273   0.436   1.00 0.00 ? 79  ALA A C    1  
ATOM 1247  O O    . ALA A 1 79  ? -40.695 8.003   -0.275  1.00 0.00 ? 79  ALA A O    1  
ATOM 1248  C CB   . ALA A 1 79  ? -43.584 6.415   -0.515  1.00 0.00 ? 79  ALA A CB   1  
ATOM 1249  H H    . ALA A 1 79  ? -43.037 4.613   1.123   1.00 0.00 ? 79  ALA A H    1  
ATOM 1250  H HA   . ALA A 1 79  ? -41.598 5.801   -1.092  1.00 0.00 ? 79  ALA A HA   1  
ATOM 1251  H HB1  . ALA A 1 79  ? -44.114 6.708   0.392   1.00 0.00 ? 79  ALA A HB1  1  
ATOM 1252  H HB2  . ALA A 1 79  ? -43.605 7.245   -1.219  1.00 0.00 ? 79  ALA A HB2  1  
ATOM 1253  H HB3  . ALA A 1 79  ? -44.077 5.552   -0.964  1.00 0.00 ? 79  ALA A HB3  1  
ATOM 1254  N N    . ALA A 1 80  ? -41.472 7.437   1.759   1.00 0.00 ? 80  ALA A N    1  
ATOM 1255  C CA   . ALA A 1 80  ? -40.797 8.489   2.502   1.00 0.00 ? 80  ALA A CA   1  
ATOM 1256  C C    . ALA A 1 80  ? -39.283 8.274   2.530   1.00 0.00 ? 80  ALA A C    1  
ATOM 1257  O O    . ALA A 1 80  ? -38.552 9.161   2.095   1.00 0.00 ? 80  ALA A O    1  
ATOM 1258  C CB   . ALA A 1 80  ? -41.387 8.550   3.912   1.00 0.00 ? 80  ALA A CB   1  
ATOM 1259  H H    . ALA A 1 80  ? -42.080 6.816   2.285   1.00 0.00 ? 80  ALA A H    1  
ATOM 1260  H HA   . ALA A 1 80  ? -40.990 9.439   2.003   1.00 0.00 ? 80  ALA A HA   1  
ATOM 1261  H HB1  . ALA A 1 80  ? -42.452 8.778   3.851   1.00 0.00 ? 80  ALA A HB1  1  
ATOM 1262  H HB2  . ALA A 1 80  ? -41.252 7.589   4.409   1.00 0.00 ? 80  ALA A HB2  1  
ATOM 1263  H HB3  . ALA A 1 80  ? -40.886 9.330   4.486   1.00 0.00 ? 80  ALA A HB3  1  
ATOM 1264  N N    . GLN A 1 81  ? -38.806 7.106   2.985   1.00 0.00 ? 81  GLN A N    1  
ATOM 1265  C CA   . GLN A 1 81  ? -37.389 6.714   2.911   1.00 0.00 ? 81  GLN A CA   1  
ATOM 1266  C C    . GLN A 1 81  ? -36.793 6.893   1.508   1.00 0.00 ? 81  GLN A C    1  
ATOM 1267  O O    . GLN A 1 81  ? -35.677 7.402   1.384   1.00 0.00 ? 81  GLN A O    1  
ATOM 1268  C CB   . GLN A 1 81  ? -37.209 5.270   3.397   1.00 0.00 ? 81  GLN A CB   1  
ATOM 1269  C CG   . GLN A 1 81  ? -37.284 5.183   4.929   1.00 0.00 ? 81  GLN A CG   1  
ATOM 1270  C CD   . GLN A 1 81  ? -37.282 3.735   5.406   1.00 0.00 ? 81  GLN A CD   1  
ATOM 1271  O OE1  . GLN A 1 81  ? -36.288 3.196   5.876   1.00 0.00 ? 81  GLN A OE1  1  
ATOM 1272  N NE2  . GLN A 1 81  ? -38.399 3.051   5.289   1.00 0.00 ? 81  GLN A NE2  1  
ATOM 1273  H H    . GLN A 1 81  ? -39.464 6.436   3.365   1.00 0.00 ? 81  GLN A H    1  
ATOM 1274  H HA   . GLN A 1 81  ? -36.811 7.359   3.571   1.00 0.00 ? 81  GLN A HA   1  
ATOM 1275  H HB2  . GLN A 1 81  ? -37.971 4.636   2.941   1.00 0.00 ? 81  GLN A HB2  1  
ATOM 1276  H HB3  . GLN A 1 81  ? -36.229 4.905   3.088   1.00 0.00 ? 81  GLN A HB3  1  
ATOM 1277  H HG2  . GLN A 1 81  ? -36.431 5.705   5.363   1.00 0.00 ? 81  GLN A HG2  1  
ATOM 1278  H HG3  . GLN A 1 81  ? -38.194 5.667   5.286   1.00 0.00 ? 81  GLN A HG3  1  
ATOM 1279  H HE21 . GLN A 1 81  ? -39.207 3.514   4.894   1.00 0.00 ? 81  GLN A HE21 1  
ATOM 1280  H HE22 . GLN A 1 81  ? -38.410 2.092   5.597   1.00 0.00 ? 81  GLN A HE22 1  
ATOM 1281  N N    . ILE A 1 82  ? -37.538 6.565   0.445   1.00 0.00 ? 82  ILE A N    1  
ATOM 1282  C CA   . ILE A 1 82  ? -37.082 6.818   -0.924  1.00 0.00 ? 82  ILE A CA   1  
ATOM 1283  C C    . ILE A 1 82  ? -36.969 8.314   -1.195  1.00 0.00 ? 82  ILE A C    1  
ATOM 1284  O O    . ILE A 1 82  ? -35.910 8.766   -1.624  1.00 0.00 ? 82  ILE A O    1  
ATOM 1285  C CB   . ILE A 1 82  ? -37.982 6.091   -1.930  1.00 0.00 ? 82  ILE A CB   1  
ATOM 1286  C CG1  . ILE A 1 82  ? -37.573 4.606   -1.899  1.00 0.00 ? 82  ILE A CG1  1  
ATOM 1287  C CG2  . ILE A 1 82  ? -37.838 6.694   -3.335  1.00 0.00 ? 82  ILE A CG2  1  
ATOM 1288  C CD1  . ILE A 1 82  ? -38.658 3.703   -2.458  1.00 0.00 ? 82  ILE A CD1  1  
ATOM 1289  H H    . ILE A 1 82  ? -38.455 6.147   0.573   1.00 0.00 ? 82  ILE A H    1  
ATOM 1290  H HA   . ILE A 1 82  ? -36.080 6.409   -1.033  1.00 0.00 ? 82  ILE A HA   1  
ATOM 1291  H HB   . ILE A 1 82  ? -39.022 6.195   -1.617  1.00 0.00 ? 82  ILE A HB   1  
ATOM 1292  H HG12 . ILE A 1 82  ? -36.647 4.458   -2.457  1.00 0.00 ? 82  ILE A HG12 1  
ATOM 1293  H HG13 . ILE A 1 82  ? -37.403 4.292   -0.870  1.00 0.00 ? 82  ILE A HG13 1  
ATOM 1294  H HG21 . ILE A 1 82  ? -38.246 7.705   -3.334  1.00 0.00 ? 82  ILE A HG21 1  
ATOM 1295  H HG22 . ILE A 1 82  ? -36.781 6.740   -3.606  1.00 0.00 ? 82  ILE A HG22 1  
ATOM 1296  H HG23 . ILE A 1 82  ? -38.382 6.099   -4.065  1.00 0.00 ? 82  ILE A HG23 1  
ATOM 1297  H HD11 . ILE A 1 82  ? -38.795 3.882   -3.522  1.00 0.00 ? 82  ILE A HD11 1  
ATOM 1298  H HD12 . ILE A 1 82  ? -38.349 2.671   -2.299  1.00 0.00 ? 82  ILE A HD12 1  
ATOM 1299  H HD13 . ILE A 1 82  ? -39.588 3.905   -1.923  1.00 0.00 ? 82  ILE A HD13 1  
ATOM 1300  N N    . ALA A 1 83  ? -38.005 9.096   -0.887  1.00 0.00 ? 83  ALA A N    1  
ATOM 1301  C CA   . ALA A 1 83  ? -37.952 10.551  -1.000  1.00 0.00 ? 83  ALA A CA   1  
ATOM 1302  C C    . ALA A 1 83  ? -36.725 11.138  -0.289  1.00 0.00 ? 83  ALA A C    1  
ATOM 1303  O O    . ALA A 1 83  ? -36.074 12.009  -0.858  1.00 0.00 ? 83  ALA A O    1  
ATOM 1304  C CB   . ALA A 1 83  ? -39.263 11.153  -0.490  1.00 0.00 ? 83  ALA A CB   1  
ATOM 1305  H H    . ALA A 1 83  ? -38.859 8.667   -0.545  1.00 0.00 ? 83  ALA A H    1  
ATOM 1306  H HA   . ALA A 1 83  ? -37.850 10.810  -2.053  1.00 0.00 ? 83  ALA A HA   1  
ATOM 1307  H HB1  . ALA A 1 83  ? -40.103 10.717  -1.033  1.00 0.00 ? 83  ALA A HB1  1  
ATOM 1308  H HB2  . ALA A 1 83  ? -39.377 10.959  0.573   1.00 0.00 ? 83  ALA A HB2  1  
ATOM 1309  H HB3  . ALA A 1 83  ? -39.247 12.231  -0.649  1.00 0.00 ? 83  ALA A HB3  1  
ATOM 1310  N N    . GLN A 1 84  ? -36.355 10.617  0.890   1.00 0.00 ? 84  GLN A N    1  
ATOM 1311  C CA   . GLN A 1 84  ? -35.156 11.048  1.627   1.00 0.00 ? 84  GLN A CA   1  
ATOM 1312  C C    . GLN A 1 84  ? -33.863 10.605  0.918   1.00 0.00 ? 84  GLN A C    1  
ATOM 1313  O O    . GLN A 1 84  ? -32.884 11.354  0.879   1.00 0.00 ? 84  GLN A O    1  
ATOM 1314  C CB   . GLN A 1 84  ? -35.113 10.505  3.067   1.00 0.00 ? 84  GLN A CB   1  
ATOM 1315  C CG   . GLN A 1 84  ? -36.362 10.666  3.940   1.00 0.00 ? 84  GLN A CG   1  
ATOM 1316  C CD   . GLN A 1 84  ? -37.113 11.983  3.760   1.00 0.00 ? 84  GLN A CD   1  
ATOM 1317  O OE1  . GLN A 1 84  ? -36.700 13.040  4.218   1.00 0.00 ? 84  GLN A OE1  1  
ATOM 1318  N NE2  . GLN A 1 84  ? -38.244 11.960  3.086   1.00 0.00 ? 84  GLN A NE2  1  
ATOM 1319  H H    . GLN A 1 84  ? -36.899 9.831   1.232   1.00 0.00 ? 84  GLN A H    1  
ATOM 1320  H HA   . GLN A 1 84  ? -35.170 12.142  1.697   1.00 0.00 ? 84  GLN A HA   1  
ATOM 1321  H HB2  . GLN A 1 84  ? -34.860 9.444   3.046   1.00 0.00 ? 84  GLN A HB2  1  
ATOM 1322  H HB3  . GLN A 1 84  ? -34.298 11.017  3.573   1.00 0.00 ? 84  GLN A HB3  1  
ATOM 1323  H HG2  . GLN A 1 84  ? -37.024 9.843   3.728   1.00 0.00 ? 84  GLN A HG2  1  
ATOM 1324  H HG3  . GLN A 1 84  ? -36.086 10.549  4.983   1.00 0.00 ? 84  GLN A HG3  1  
ATOM 1325  H HE21 . GLN A 1 84  ? -38.564 11.082  2.693   1.00 0.00 ? 84  GLN A HE21 1  
ATOM 1326  H HE22 . GLN A 1 84  ? -38.755 12.821  2.967   1.00 0.00 ? 84  GLN A HE22 1  
ATOM 1327  N N    . ALA A 1 85  ? -33.845 9.405   0.326   1.00 0.00 ? 85  ALA A N    1  
ATOM 1328  C CA   . ALA A 1 85  ? -32.673 8.886   -0.374  1.00 0.00 ? 85  ALA A CA   1  
ATOM 1329  C C    . ALA A 1 85  ? -32.367 9.707   -1.635  1.00 0.00 ? 85  ALA A C    1  
ATOM 1330  O O    . ALA A 1 85  ? -31.201 9.936   -1.961  1.00 0.00 ? 85  ALA A O    1  
ATOM 1331  C CB   . ALA A 1 85  ? -32.901 7.402   -0.692  1.00 0.00 ? 85  ALA A CB   1  
ATOM 1332  H H    . ALA A 1 85  ? -34.690 8.836   0.311   1.00 0.00 ? 85  ALA A H    1  
ATOM 1333  H HA   . ALA A 1 85  ? -31.814 8.971   0.290   1.00 0.00 ? 85  ALA A HA   1  
ATOM 1334  H HB1  . ALA A 1 85  ? -33.081 6.849   0.230   1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1335  H HB2  . ALA A 1 85  ? -33.753 7.281   -1.360  1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1336  H HB3  . ALA A 1 85  ? -32.014 6.994   -1.178  1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1337  N N    . LEU A 1 86  ? -33.413 10.212  -2.301  1.00 0.00 ? 86  LEU A N    1  
ATOM 1338  C CA   . LEU A 1 86  ? -33.283 11.057  -3.488  1.00 0.00 ? 86  LEU A CA   1  
ATOM 1339  C C    . LEU A 1 86  ? -33.030 12.533  -3.112  1.00 0.00 ? 86  LEU A C    1  
ATOM 1340  O O    . LEU A 1 86  ? -32.334 13.246  -3.836  1.00 0.00 ? 86  LEU A O    1  
ATOM 1341  C CB   . LEU A 1 86  ? -34.496 10.875  -4.416  1.00 0.00 ? 86  LEU A CB   1  
ATOM 1342  C CG   . LEU A 1 86  ? -34.963 9.430   -4.724  1.00 0.00 ? 86  LEU A CG   1  
ATOM 1343  C CD1  . LEU A 1 86  ? -35.630 9.410   -6.095  1.00 0.00 ? 86  LEU A CD1  1  
ATOM 1344  C CD2  . LEU A 1 86  ? -33.878 8.347   -4.800  1.00 0.00 ? 86  LEU A CD2  1  
ATOM 1345  H H    . LEU A 1 86  ? -34.343 9.935   -2.001  1.00 0.00 ? 86  LEU A H    1  
ATOM 1346  H HA   . LEU A 1 86  ? -32.407 10.722  -4.043  1.00 0.00 ? 86  LEU A HA   1  
ATOM 1347  H HB2  . LEU A 1 86  ? -35.346 11.415  -3.995  1.00 0.00 ? 86  LEU A HB2  1  
ATOM 1348  H HB3  . LEU A 1 86  ? -34.239 11.367  -5.354  1.00 0.00 ? 86  LEU A HB3  1  
ATOM 1349  H HG   . LEU A 1 86  ? -35.706 9.142   -3.975  1.00 0.00 ? 86  LEU A HG   1  
ATOM 1350  H HD11 . LEU A 1 86  ? -36.381 10.192  -6.138  1.00 0.00 ? 86  LEU A HD11 1  
ATOM 1351  H HD12 . LEU A 1 86  ? -34.886 9.599   -6.867  1.00 0.00 ? 86  LEU A HD12 1  
ATOM 1352  H HD13 . LEU A 1 86  ? -36.100 8.443   -6.268  1.00 0.00 ? 86  LEU A HD13 1  
ATOM 1353  H HD21 . LEU A 1 86  ? -33.114 8.624   -5.524  1.00 0.00 ? 86  LEU A HD21 1  
ATOM 1354  H HD22 . LEU A 1 86  ? -33.416 8.185   -3.831  1.00 0.00 ? 86  LEU A HD22 1  
ATOM 1355  H HD23 . LEU A 1 86  ? -34.333 7.403   -5.097  1.00 0.00 ? 86  LEU A HD23 1  
ATOM 1356  N N    . LEU A 1 87  ? -33.526 12.971  -1.945  1.00 0.00 ? 87  LEU A N    1  
ATOM 1357  C CA   . LEU A 1 87  ? -33.219 14.240  -1.282  1.00 0.00 ? 87  LEU A CA   1  
ATOM 1358  C C    . LEU A 1 87  ? -31.738 14.294  -0.848  1.00 0.00 ? 87  LEU A C    1  
ATOM 1359  O O    . LEU A 1 87  ? -31.146 15.373  -0.804  1.00 0.00 ? 87  LEU A O    1  
ATOM 1360  C CB   . LEU A 1 87  ? -34.230 14.349  -0.117  1.00 0.00 ? 87  LEU A CB   1  
ATOM 1361  C CG   . LEU A 1 87  ? -33.861 15.102  1.164   1.00 0.00 ? 87  LEU A CG   1  
ATOM 1362  C CD1  . LEU A 1 87  ? -35.138 15.579  1.856   1.00 0.00 ? 87  LEU A CD1  1  
ATOM 1363  C CD2  . LEU A 1 87  ? -33.046 14.332  2.203   1.00 0.00 ? 87  LEU A CD2  1  
ATOM 1364  H H    . LEU A 1 87  ? -34.187 12.386  -1.449  1.00 0.00 ? 87  LEU A H    1  
ATOM 1365  H HA   . LEU A 1 87  ? -33.388 15.066  -1.974  1.00 0.00 ? 87  LEU A HA   1  
ATOM 1366  H HB2  . LEU A 1 87  ? -35.148 14.766  -0.534  1.00 0.00 ? 87  LEU A HB2  1  
ATOM 1367  H HB3  . LEU A 1 87  ? -34.456 13.354  0.222   1.00 0.00 ? 87  LEU A HB3  1  
ATOM 1368  H HG   . LEU A 1 87  ? -33.290 15.944  0.853   1.00 0.00 ? 87  LEU A HG   1  
ATOM 1369  H HD11 . LEU A 1 87  ? -35.702 16.224  1.183   1.00 0.00 ? 87  LEU A HD11 1  
ATOM 1370  H HD12 . LEU A 1 87  ? -35.752 14.721  2.128   1.00 0.00 ? 87  LEU A HD12 1  
ATOM 1371  H HD13 . LEU A 1 87  ? -34.889 16.147  2.753   1.00 0.00 ? 87  LEU A HD13 1  
ATOM 1372  H HD21 . LEU A 1 87  ? -33.586 13.448  2.534   1.00 0.00 ? 87  LEU A HD21 1  
ATOM 1373  H HD22 . LEU A 1 87  ? -32.088 14.049  1.789   1.00 0.00 ? 87  LEU A HD22 1  
ATOM 1374  H HD23 . LEU A 1 87  ? -32.857 14.971  3.066   1.00 0.00 ? 87  LEU A HD23 1  
ATOM 1375  N N    . GLY A 1 88  ? -31.134 13.129  -0.581  1.00 0.00 ? 88  GLY A N    1  
ATOM 1376  C CA   . GLY A 1 88  ? -29.696 12.955  -0.346  1.00 0.00 ? 88  GLY A CA   1  
ATOM 1377  C C    . GLY A 1 88  ? -29.315 12.609  1.097   1.00 0.00 ? 88  GLY A C    1  
ATOM 1378  O O    . GLY A 1 88  ? -28.149 12.765  1.465   1.00 0.00 ? 88  GLY A O    1  
ATOM 1379  H H    . GLY A 1 88  ? -31.726 12.305  -0.534  1.00 0.00 ? 88  GLY A H    1  
ATOM 1380  H HA2  . GLY A 1 88  ? -29.348 12.140  -0.981  1.00 0.00 ? 88  GLY A HA2  1  
ATOM 1381  H HA3  . GLY A 1 88  ? -29.155 13.856  -0.636  1.00 0.00 ? 88  GLY A HA3  1  
ATOM 1382  N N    . ALA A 1 89  ? -30.268 12.151  1.921   1.00 0.00 ? 89  ALA A N    1  
ATOM 1383  C CA   . ALA A 1 89  ? -30.014 11.743  3.305   1.00 0.00 ? 89  ALA A CA   1  
ATOM 1384  C C    . ALA A 1 89  ? -29.030 10.555  3.366   1.00 0.00 ? 89  ALA A C    1  
ATOM 1385  O O    . ALA A 1 89  ? -28.027 10.603  4.081   1.00 0.00 ? 89  ALA A O    1  
ATOM 1386  C CB   . ALA A 1 89  ? -31.350 11.403  3.979   1.00 0.00 ? 89  ALA A CB   1  
ATOM 1387  H H    . ALA A 1 89  ? -31.214 12.066  1.566   1.00 0.00 ? 89  ALA A H    1  
ATOM 1388  H HA   . ALA A 1 89  ? -29.575 12.589  3.835   1.00 0.00 ? 89  ALA A HA   1  
ATOM 1389  H HB1  . ALA A 1 89  ? -31.169 11.101  5.012   1.00 0.00 ? 89  ALA A HB1  1  
ATOM 1390  H HB2  . ALA A 1 89  ? -31.998 12.278  3.981   1.00 0.00 ? 89  ALA A HB2  1  
ATOM 1391  H HB3  . ALA A 1 89  ? -31.843 10.585  3.452   1.00 0.00 ? 89  ALA A HB3  1  
ATOM 1392  N N    . GLU A 1 90  ? -29.302 9.509   2.579   1.00 0.00 ? 90  GLU A N    1  
ATOM 1393  C CA   . GLU A 1 90  ? -28.405 8.378   2.310   1.00 0.00 ? 90  GLU A CA   1  
ATOM 1394  C C    . GLU A 1 90  ? -28.807 7.636   1.020   1.00 0.00 ? 90  GLU A C    1  
ATOM 1395  O O    . GLU A 1 90  ? -29.986 7.399   0.762   1.00 0.00 ? 90  GLU A O    1  
ATOM 1396  C CB   . GLU A 1 90  ? -28.351 7.400   3.503   1.00 0.00 ? 90  GLU A CB   1  
ATOM 1397  C CG   . GLU A 1 90  ? -29.709 6.903   4.025   1.00 0.00 ? 90  GLU A CG   1  
ATOM 1398  C CD   . GLU A 1 90  ? -29.514 5.940   5.212   1.00 0.00 ? 90  GLU A CD   1  
ATOM 1399  O OE1  . GLU A 1 90  ? -29.294 4.726   4.984   1.00 0.00 ? 90  GLU A OE1  1  
ATOM 1400  O OE2  . GLU A 1 90  ? -29.586 6.387   6.383   1.00 0.00 ? 90  GLU A OE2  1  
ATOM 1401  H H    . GLU A 1 90  ? -30.162 9.533   2.051   1.00 0.00 ? 90  GLU A H    1  
ATOM 1402  H HA   . GLU A 1 90  ? -27.397 8.768   2.160   1.00 0.00 ? 90  GLU A HA   1  
ATOM 1403  H HB2  . GLU A 1 90  ? -27.754 6.538   3.205   1.00 0.00 ? 90  GLU A HB2  1  
ATOM 1404  H HB3  . GLU A 1 90  ? -27.828 7.887   4.326   1.00 0.00 ? 90  GLU A HB3  1  
ATOM 1405  H HG2  . GLU A 1 90  ? -30.314 7.757   4.342   1.00 0.00 ? 90  GLU A HG2  1  
ATOM 1406  H HG3  . GLU A 1 90  ? -30.249 6.395   3.225   1.00 0.00 ? 90  GLU A HG3  1  
ATOM 1407  N N    . GLU A 1 91  ? -27.826 7.235   0.211   1.00 0.00 ? 91  GLU A N    1  
ATOM 1408  C CA   . GLU A 1 91  ? -28.010 6.324   -0.930  1.00 0.00 ? 91  GLU A CA   1  
ATOM 1409  C C    . GLU A 1 91  ? -28.220 4.905   -0.372  1.00 0.00 ? 91  GLU A C    1  
ATOM 1410  O O    . GLU A 1 91  ? -27.274 4.245   0.069   1.00 0.00 ? 91  GLU A O    1  
ATOM 1411  C CB   . GLU A 1 91  ? -26.775 6.452   -1.836  1.00 0.00 ? 91  GLU A CB   1  
ATOM 1412  C CG   . GLU A 1 91  ? -26.710 5.424   -2.972  1.00 0.00 ? 91  GLU A CG   1  
ATOM 1413  C CD   . GLU A 1 91  ? -25.614 4.346   -2.826  1.00 0.00 ? 91  GLU A CD   1  
ATOM 1414  O OE1  . GLU A 1 91  ? -24.475 4.654   -2.401  1.00 0.00 ? 91  GLU A OE1  1  
ATOM 1415  O OE2  . GLU A 1 91  ? -25.864 3.186   -3.234  1.00 0.00 ? 91  GLU A OE2  1  
ATOM 1416  H H    . GLU A 1 91  ? -26.875 7.455   0.473   1.00 0.00 ? 91  GLU A H    1  
ATOM 1417  H HA   . GLU A 1 91  ? -28.895 6.596   -1.527  1.00 0.00 ? 91  GLU A HA   1  
ATOM 1418  H HB2  . GLU A 1 91  ? -26.827 7.435   -2.303  1.00 0.00 ? 91  GLU A HB2  1  
ATOM 1419  H HB3  . GLU A 1 91  ? -25.868 6.417   -1.232  1.00 0.00 ? 91  GLU A HB3  1  
ATOM 1420  H HG2  . GLU A 1 91  ? -27.688 4.947   -3.065  1.00 0.00 ? 91  GLU A HG2  1  
ATOM 1421  H HG3  . GLU A 1 91  ? -26.529 5.976   -3.896  1.00 0.00 ? 91  GLU A HG3  1  
ATOM 1422  N N    . ARG A 1 92  ? -29.484 4.463   -0.342  1.00 0.00 ? 92  ARG A N    1  
ATOM 1423  C CA   . ARG A 1 92  ? -29.934 3.254   0.363   1.00 0.00 ? 92  ARG A CA   1  
ATOM 1424  C C    . ARG A 1 92  ? -31.044 2.528   -0.403  1.00 0.00 ? 92  ARG A C    1  
ATOM 1425  O O    . ARG A 1 92  ? -31.955 3.168   -0.931  1.00 0.00 ? 92  ARG A O    1  
ATOM 1426  C CB   . ARG A 1 92  ? -30.414 3.696   1.763   1.00 0.00 ? 92  ARG A CB   1  
ATOM 1427  C CG   . ARG A 1 92  ? -30.722 2.569   2.760   1.00 0.00 ? 92  ARG A CG   1  
ATOM 1428  C CD   . ARG A 1 92  ? -29.456 1.828   3.209   1.00 0.00 ? 92  ARG A CD   1  
ATOM 1429  N NE   . ARG A 1 92  ? -29.754 0.830   4.255   1.00 0.00 ? 92  ARG A NE   1  
ATOM 1430  C CZ   . ARG A 1 92  ? -29.834 1.040   5.559   1.00 0.00 ? 92  ARG A CZ   1  
ATOM 1431  N NH1  . ARG A 1 92  ? -29.681 2.214   6.102   1.00 0.00 ? 92  ARG A NH1  1  
ATOM 1432  N NH2  . ARG A 1 92  ? -30.078 0.044   6.363   1.00 0.00 ? 92  ARG A NH2  1  
ATOM 1433  H H    . ARG A 1 92  ? -30.200 5.075   -0.715  1.00 0.00 ? 92  ARG A H    1  
ATOM 1434  H HA   . ARG A 1 92  ? -29.090 2.571   0.469   1.00 0.00 ? 92  ARG A HA   1  
ATOM 1435  H HB2  . ARG A 1 92  ? -29.647 4.332   2.207   1.00 0.00 ? 92  ARG A HB2  1  
ATOM 1436  H HB3  . ARG A 1 92  ? -31.313 4.305   1.647   1.00 0.00 ? 92  ARG A HB3  1  
ATOM 1437  H HG2  . ARG A 1 92  ? -31.194 3.015   3.636   1.00 0.00 ? 92  ARG A HG2  1  
ATOM 1438  H HG3  . ARG A 1 92  ? -31.428 1.864   2.324   1.00 0.00 ? 92  ARG A HG3  1  
ATOM 1439  H HD2  . ARG A 1 92  ? -29.015 1.318   2.352   1.00 0.00 ? 92  ARG A HD2  1  
ATOM 1440  H HD3  . ARG A 1 92  ? -28.723 2.547   3.580   1.00 0.00 ? 92  ARG A HD3  1  
ATOM 1441  H HE   . ARG A 1 92  ? -29.900 -0.118  3.948   1.00 0.00 ? 92  ARG A HE   1  
ATOM 1442  H HH11 . ARG A 1 92  ? -29.512 3.037   5.518   1.00 0.00 ? 92  ARG A HH11 1  
ATOM 1443  H HH12 . ARG A 1 92  ? -29.748 2.332   7.096   1.00 0.00 ? 92  ARG A HH12 1  
ATOM 1444  H HH21 . ARG A 1 92  ? -30.204 -0.885  5.997   1.00 0.00 ? 92  ARG A HH21 1  
ATOM 1445  H HH22 . ARG A 1 92  ? -30.140 0.197   7.356   1.00 0.00 ? 92  ARG A HH22 1  
ATOM 1446  N N    . LYS A 1 93  ? -30.987 1.193   -0.419  1.00 0.00 ? 93  LYS A N    1  
ATOM 1447  C CA   . LYS A 1 93  ? -32.032 0.320   -0.980  1.00 0.00 ? 93  LYS A CA   1  
ATOM 1448  C C    . LYS A 1 93  ? -33.223 0.200   -0.024  1.00 0.00 ? 93  LYS A C    1  
ATOM 1449  O O    . LYS A 1 93  ? -33.049 -0.008  1.177   1.00 0.00 ? 93  LYS A O    1  
ATOM 1450  C CB   . LYS A 1 93  ? -31.414 -1.031  -1.349  1.00 0.00 ? 93  LYS A CB   1  
ATOM 1451  C CG   . LYS A 1 93  ? -32.348 -1.955  -2.134  1.00 0.00 ? 93  LYS A CG   1  
ATOM 1452  C CD   . LYS A 1 93  ? -31.817 -3.391  -2.141  1.00 0.00 ? 93  LYS A CD   1  
ATOM 1453  C CE   . LYS A 1 93  ? -30.445 -3.497  -2.822  1.00 0.00 ? 93  LYS A CE   1  
ATOM 1454  N NZ   . LYS A 1 93  ? -29.975 -4.903  -2.881  1.00 0.00 ? 93  LYS A NZ   1  
ATOM 1455  H H    . LYS A 1 93  ? -30.206 0.754   0.046   1.00 0.00 ? 93  LYS A H    1  
ATOM 1456  H HA   . LYS A 1 93  ? -32.395 0.758   -1.904  1.00 0.00 ? 93  LYS A HA   1  
ATOM 1457  H HB2  . LYS A 1 93  ? -30.556 -0.844  -1.990  1.00 0.00 ? 93  LYS A HB2  1  
ATOM 1458  H HB3  . LYS A 1 93  ? -31.093 -1.533  -0.437  1.00 0.00 ? 93  LYS A HB3  1  
ATOM 1459  H HG2  . LYS A 1 93  ? -33.341 -1.956  -1.691  1.00 0.00 ? 93  LYS A HG2  1  
ATOM 1460  H HG3  . LYS A 1 93  ? -32.420 -1.590  -3.155  1.00 0.00 ? 93  LYS A HG3  1  
ATOM 1461  H HD2  . LYS A 1 93  ? -31.743 -3.736  -1.109  1.00 0.00 ? 93  LYS A HD2  1  
ATOM 1462  H HD3  . LYS A 1 93  ? -32.537 -4.019  -2.662  1.00 0.00 ? 93  LYS A HD3  1  
ATOM 1463  H HE2  . LYS A 1 93  ? -30.533 -3.098  -3.837  1.00 0.00 ? 93  LYS A HE2  1  
ATOM 1464  H HE3  . LYS A 1 93  ? -29.722 -2.886  -2.273  1.00 0.00 ? 93  LYS A HE3  1  
ATOM 1465  H HZ1  . LYS A 1 93  ? -29.922 -5.326  -1.965  1.00 0.00 ? 93  LYS A HZ1  1  
ATOM 1466  H HZ2  . LYS A 1 93  ? -30.619 -5.452  -3.454  1.00 0.00 ? 93  LYS A HZ2  1  
ATOM 1467  H HZ3  . LYS A 1 93  ? -29.066 -4.968  -3.319  1.00 0.00 ? 93  LYS A HZ3  1  
ATOM 1468  N N    . VAL A 1 94  ? -34.428 0.312   -0.578  1.00 0.00 ? 94  VAL A N    1  
ATOM 1469  C CA   . VAL A 1 94  ? -35.719 0.210   0.126   1.00 0.00 ? 94  VAL A CA   1  
ATOM 1470  C C    . VAL A 1 94  ? -36.668 -0.646  -0.718  1.00 0.00 ? 94  VAL A C    1  
ATOM 1471  O O    . VAL A 1 94  ? -36.550 -0.698  -1.941  1.00 0.00 ? 94  VAL A O    1  
ATOM 1472  C CB   . VAL A 1 94  ? -36.335 1.610   0.399   1.00 0.00 ? 94  VAL A CB   1  
ATOM 1473  C CG1  . VAL A 1 94  ? -37.383 1.573   1.521   1.00 0.00 ? 94  VAL A CG1  1  
ATOM 1474  C CG2  . VAL A 1 94  ? -35.307 2.677   0.811   1.00 0.00 ? 94  VAL A CG2  1  
ATOM 1475  H H    . VAL A 1 94  ? -34.469 0.462   -1.575  1.00 0.00 ? 94  VAL A H    1  
ATOM 1476  H HA   . VAL A 1 94  ? -35.581 -0.310  1.076   1.00 0.00 ? 94  VAL A HA   1  
ATOM 1477  H HB   . VAL A 1 94  ? -36.820 1.952   -0.515  1.00 0.00 ? 94  VAL A HB   1  
ATOM 1478  H HG11 . VAL A 1 94  ? -36.926 1.241   2.454   1.00 0.00 ? 94  VAL A HG11 1  
ATOM 1479  H HG12 . VAL A 1 94  ? -37.802 2.569   1.663   1.00 0.00 ? 94  VAL A HG12 1  
ATOM 1480  H HG13 . VAL A 1 94  ? -38.203 0.908   1.263   1.00 0.00 ? 94  VAL A HG13 1  
ATOM 1481  H HG21 . VAL A 1 94  ? -35.813 3.617   1.029   1.00 0.00 ? 94  VAL A HG21 1  
ATOM 1482  H HG22 . VAL A 1 94  ? -34.760 2.349   1.696   1.00 0.00 ? 94  VAL A HG22 1  
ATOM 1483  H HG23 . VAL A 1 94  ? -34.608 2.863   -0.003  1.00 0.00 ? 94  VAL A HG23 1  
ATOM 1484  N N    . GLU A 1 95  ? -37.627 -1.301  -0.073  1.00 0.00 ? 95  GLU A N    1  
ATOM 1485  C CA   . GLU A 1 95  ? -38.741 -1.985  -0.740  1.00 0.00 ? 95  GLU A CA   1  
ATOM 1486  C C    . GLU A 1 95  ? -39.822 -0.968  -1.140  1.00 0.00 ? 95  GLU A C    1  
ATOM 1487  O O    . GLU A 1 95  ? -39.851 0.125   -0.584  1.00 0.00 ? 95  GLU A O    1  
ATOM 1488  C CB   . GLU A 1 95  ? -39.300 -3.063  0.205   1.00 0.00 ? 95  GLU A CB   1  
ATOM 1489  C CG   . GLU A 1 95  ? -40.047 -2.476  1.424   1.00 0.00 ? 95  GLU A CG   1  
ATOM 1490  C CD   . GLU A 1 95  ? -40.470 -3.506  2.492   1.00 0.00 ? 95  GLU A CD   1  
ATOM 1491  O OE1  . GLU A 1 95  ? -40.291 -4.734  2.311   1.00 0.00 ? 95  GLU A OE1  1  
ATOM 1492  O OE2  . GLU A 1 95  ? -40.995 -3.063  3.545   1.00 0.00 ? 95  GLU A OE2  1  
ATOM 1493  H H    . GLU A 1 95  ? -37.697 -1.183  0.926   1.00 0.00 ? 95  GLU A H    1  
ATOM 1494  H HA   . GLU A 1 95  ? -38.375 -2.473  -1.645  1.00 0.00 ? 95  GLU A HA   1  
ATOM 1495  H HB2  . GLU A 1 95  ? -39.981 -3.695  -0.366  1.00 0.00 ? 95  GLU A HB2  1  
ATOM 1496  H HB3  . GLU A 1 95  ? -38.456 -3.661  0.552   1.00 0.00 ? 95  GLU A HB3  1  
ATOM 1497  H HG2  . GLU A 1 95  ? -39.405 -1.733  1.905   1.00 0.00 ? 95  GLU A HG2  1  
ATOM 1498  H HG3  . GLU A 1 95  ? -40.944 -1.962  1.073   1.00 0.00 ? 95  GLU A HG3  1  
ATOM 1499  N N    . ILE A 1 96  ? -40.706 -1.294  -2.087  1.00 0.00 ? 96  ILE A N    1  
ATOM 1500  C CA   . ILE A 1 96  ? -41.907 -0.496  -2.400  1.00 0.00 ? 96  ILE A CA   1  
ATOM 1501  C C    . ILE A 1 96  ? -42.908 -1.296  -3.237  1.00 0.00 ? 96  ILE A C    1  
ATOM 1502  O O    . ILE A 1 96  ? -42.530 -2.166  -4.024  1.00 0.00 ? 96  ILE A O    1  
ATOM 1503  C CB   . ILE A 1 96  ? -41.644 0.852   -3.144  1.00 0.00 ? 96  ILE A CB   1  
ATOM 1504  C CG1  . ILE A 1 96  ? -40.306 1.017   -3.895  1.00 0.00 ? 96  ILE A CG1  1  
ATOM 1505  C CG2  . ILE A 1 96  ? -41.838 2.069   -2.229  1.00 0.00 ? 96  ILE A CG2  1  
ATOM 1506  C CD1  . ILE A 1 96  ? -39.960 -0.099  -4.874  1.00 0.00 ? 96  ILE A CD1  1  
ATOM 1507  H H    . ILE A 1 96  ? -40.657 -2.216  -2.501  1.00 0.00 ? 96  ILE A H    1  
ATOM 1508  H HA   . ILE A 1 96  ? -42.394 -0.302  -1.443  1.00 0.00 ? 96  ILE A HA   1  
ATOM 1509  H HB   . ILE A 1 96  ? -42.429 0.967   -3.888  1.00 0.00 ? 96  ILE A HB   1  
ATOM 1510  H HG12 . ILE A 1 96  ? -40.340 1.955   -4.451  1.00 0.00 ? 96  ILE A HG12 1  
ATOM 1511  H HG13 . ILE A 1 96  ? -39.495 1.076   -3.175  1.00 0.00 ? 96  ILE A HG13 1  
ATOM 1512  H HG21 . ILE A 1 96  ? -40.990 2.166   -1.559  1.00 0.00 ? 96  ILE A HG21 1  
ATOM 1513  H HG22 . ILE A 1 96  ? -41.904 2.975   -2.833  1.00 0.00 ? 96  ILE A HG22 1  
ATOM 1514  H HG23 . ILE A 1 96  ? -42.755 1.973   -1.650  1.00 0.00 ? 96  ILE A HG23 1  
ATOM 1515  H HD11 . ILE A 1 96  ? -39.458 -0.896  -4.332  1.00 0.00 ? 96  ILE A HD11 1  
ATOM 1516  H HD12 . ILE A 1 96  ? -40.859 -0.478  -5.355  1.00 0.00 ? 96  ILE A HD12 1  
ATOM 1517  H HD13 . ILE A 1 96  ? -39.271 0.280   -5.627  1.00 0.00 ? 96  ILE A HD13 1  
ATOM 1518  N N    . ALA A 1 97  ? -44.193 -0.980  -3.062  1.00 0.00 ? 97  ALA A N    1  
ATOM 1519  C CA   . ALA A 1 97  ? -45.275 -1.526  -3.879  1.00 0.00 ? 97  ALA A CA   1  
ATOM 1520  C C    . ALA A 1 97  ? -45.531 -0.666  -5.122  1.00 0.00 ? 97  ALA A C    1  
ATOM 1521  O O    . ALA A 1 97  ? -45.444 0.565   -5.060  1.00 0.00 ? 97  ALA A O    1  
ATOM 1522  C CB   . ALA A 1 97  ? -46.558 -1.707  -3.059  1.00 0.00 ? 97  ALA A CB   1  
ATOM 1523  H H    . ALA A 1 97  ? -44.412 -0.253  -2.396  1.00 0.00 ? 97  ALA A H    1  
ATOM 1524  H HA   . ALA A 1 97  ? -44.961 -2.510  -4.221  1.00 0.00 ? 97  ALA A HA   1  
ATOM 1525  H HB1  . ALA A 1 97  ? -47.066 -0.755  -2.975  1.00 0.00 ? 97  ALA A HB1  1  
ATOM 1526  H HB2  . ALA A 1 97  ? -47.241 -2.378  -3.577  1.00 0.00 ? 97  ALA A HB2  1  
ATOM 1527  H HB3  . ALA A 1 97  ? -46.345 -2.108  -2.072  1.00 0.00 ? 97  ALA A HB3  1  
ATOM 1528  N N    . PHE A 1 98  ? -45.896 -1.314  -6.225  1.00 0.00 ? 98  PHE A N    1  
ATOM 1529  C CA   . PHE A 1 98  ? -46.323 -0.660  -7.467  1.00 0.00 ? 98  PHE A CA   1  
ATOM 1530  C C    . PHE A 1 98  ? -47.770 -1.015  -7.803  1.00 0.00 ? 98  PHE A C    1  
ATOM 1531  O O    . PHE A 1 98  ? -48.294 -2.015  -7.307  1.00 0.00 ? 98  PHE A O    1  
ATOM 1532  C CB   . PHE A 1 98  ? -45.385 -1.061  -8.614  1.00 0.00 ? 98  PHE A CB   1  
ATOM 1533  C CG   . PHE A 1 98  ? -43.930 -0.706  -8.386  1.00 0.00 ? 98  PHE A CG   1  
ATOM 1534  C CD1  . PHE A 1 98  ? -43.563 0.632   -8.144  1.00 0.00 ? 98  PHE A CD1  1  
ATOM 1535  C CD2  . PHE A 1 98  ? -42.942 -1.708  -8.415  1.00 0.00 ? 98  PHE A CD2  1  
ATOM 1536  C CE1  . PHE A 1 98  ? -42.214 0.972   -7.944  1.00 0.00 ? 98  PHE A CE1  1  
ATOM 1537  C CE2  . PHE A 1 98  ? -41.594 -1.367  -8.223  1.00 0.00 ? 98  PHE A CE2  1  
ATOM 1538  C CZ   . PHE A 1 98  ? -41.231 -0.027  -7.992  1.00 0.00 ? 98  PHE A CZ   1  
ATOM 1539  H H    . PHE A 1 98  ? -46.015 -2.322  -6.159  1.00 0.00 ? 98  PHE A H    1  
ATOM 1540  H HA   . PHE A 1 98  ? -46.278 0.423   -7.351  1.00 0.00 ? 98  PHE A HA   1  
ATOM 1541  H HB2  . PHE A 1 98  ? -45.474 -2.137  -8.777  1.00 0.00 ? 98  PHE A HB2  1  
ATOM 1542  H HB3  . PHE A 1 98  ? -45.711 -0.564  -9.528  1.00 0.00 ? 98  PHE A HB3  1  
ATOM 1543  H HD1  . PHE A 1 98  ? -44.318 1.402   -8.106  1.00 0.00 ? 98  PHE A HD1  1  
ATOM 1544  H HD2  . PHE A 1 98  ? -43.209 -2.740  -8.589  1.00 0.00 ? 98  PHE A HD2  1  
ATOM 1545  H HE1  . PHE A 1 98  ? -41.932 1.999   -7.756  1.00 0.00 ? 98  PHE A HE1  1  
ATOM 1546  H HE2  . PHE A 1 98  ? -40.839 -2.138  -8.266  1.00 0.00 ? 98  PHE A HE2  1  
ATOM 1547  H HZ   . PHE A 1 98  ? -40.194 0.238   -7.844  1.00 0.00 ? 98  PHE A HZ   1  
ATOM 1548  N N    . TYR A 1 99  ? -48.416 -0.217  -8.657  1.00 0.00 ? 99  TYR A N    1  
ATOM 1549  C CA   . TYR A 1 99  ? -49.712 -0.566  -9.241  1.00 0.00 ? 99  TYR A CA   1  
ATOM 1550  C C    . TYR A 1 99  ? -49.674 -0.496  -10.769 1.00 0.00 ? 99  TYR A C    1  
ATOM 1551  O O    . TYR A 1 99  ? -49.068 0.404   -11.358 1.00 0.00 ? 99  TYR A O    1  
ATOM 1552  C CB   . TYR A 1 99  ? -50.865 0.257   -8.644  1.00 0.00 ? 99  TYR A CB   1  
ATOM 1553  C CG   . TYR A 1 99  ? -51.040 1.663   -9.193  1.00 0.00 ? 99  TYR A CG   1  
ATOM 1554  C CD1  . TYR A 1 99  ? -50.225 2.716   -8.736  1.00 0.00 ? 99  TYR A CD1  1  
ATOM 1555  C CD2  . TYR A 1 99  ? -52.034 1.915   -10.160 1.00 0.00 ? 99  TYR A CD2  1  
ATOM 1556  C CE1  . TYR A 1 99  ? -50.406 4.019   -9.239  1.00 0.00 ? 99  TYR A CE1  1  
ATOM 1557  C CE2  . TYR A 1 99  ? -52.216 3.216   -10.668 1.00 0.00 ? 99  TYR A CE2  1  
ATOM 1558  C CZ   . TYR A 1 99  ? -51.404 4.274   -10.206 1.00 0.00 ? 99  TYR A CZ   1  
ATOM 1559  O OH   . TYR A 1 99  ? -51.592 5.531   -10.695 1.00 0.00 ? 99  TYR A OH   1  
ATOM 1560  H H    . TYR A 1 99  ? -47.937 0.588   -9.036  1.00 0.00 ? 99  TYR A H    1  
ATOM 1561  H HA   . TYR A 1 99  ? -49.912 -1.604  -8.994  1.00 0.00 ? 99  TYR A HA   1  
ATOM 1562  H HB2  . TYR A 1 99  ? -51.790 -0.294  -8.818  1.00 0.00 ? 99  TYR A HB2  1  
ATOM 1563  H HB3  . TYR A 1 99  ? -50.735 0.318   -7.566  1.00 0.00 ? 99  TYR A HB3  1  
ATOM 1564  H HD1  . TYR A 1 99  ? -49.456 2.528   -7.998  1.00 0.00 ? 99  TYR A HD1  1  
ATOM 1565  H HD2  . TYR A 1 99  ? -52.662 1.108   -10.517 1.00 0.00 ? 99  TYR A HD2  1  
ATOM 1566  H HE1  . TYR A 1 99  ? -49.780 4.824   -8.886  1.00 0.00 ? 99  TYR A HE1  1  
ATOM 1567  H HE2  . TYR A 1 99  ? -52.977 3.412   -11.409 1.00 0.00 ? 99  TYR A HE2  1  
ATOM 1568  H HH   . TYR A 1 99  ? -50.977 6.175   -10.304 1.00 0.00 ? 99  TYR A HH   1  
ATOM 1569  N N    . ARG A 1 100 ? -50.332 -1.463  -11.413 1.00 0.00 ? 100 ARG A N    1  
ATOM 1570  C CA   . ARG A 1 100 ? -50.504 -1.521  -12.865 1.00 0.00 ? 100 ARG A CA   1  
ATOM 1571  C C    . ARG A 1 100 ? -51.684 -0.685  -13.349 1.00 0.00 ? 100 ARG A C    1  
ATOM 1572  O O    . ARG A 1 100 ? -52.676 -0.519  -12.639 1.00 0.00 ? 100 ARG A O    1  
ATOM 1573  C CB   . ARG A 1 100 ? -50.599 -2.987  -13.319 1.00 0.00 ? 100 ARG A CB   1  
ATOM 1574  C CG   . ARG A 1 100 ? -49.186 -3.561  -13.445 1.00 0.00 ? 100 ARG A CG   1  
ATOM 1575  C CD   . ARG A 1 100 ? -49.189 -5.058  -13.749 1.00 0.00 ? 100 ARG A CD   1  
ATOM 1576  N NE   . ARG A 1 100 ? -47.836 -5.479  -14.141 1.00 0.00 ? 100 ARG A NE   1  
ATOM 1577  C CZ   . ARG A 1 100 ? -47.437 -6.698  -14.448 1.00 0.00 ? 100 ARG A CZ   1  
ATOM 1578  N NH1  . ARG A 1 100 ? -48.178 -7.749  -14.233 1.00 0.00 ? 100 ARG A NH1  1  
ATOM 1579  N NH2  . ARG A 1 100 ? -46.275 -6.878  -15.000 1.00 0.00 ? 100 ARG A NH2  1  
ATOM 1580  H H    . ARG A 1 100 ? -50.767 -2.190  -10.853 1.00 0.00 ? 100 ARG A H    1  
ATOM 1581  H HA   . ARG A 1 100 ? -49.619 -1.078  -13.315 1.00 0.00 ? 100 ARG A HA   1  
ATOM 1582  H HB2  . ARG A 1 100 ? -51.187 -3.568  -12.605 1.00 0.00 ? 100 ARG A HB2  1  
ATOM 1583  H HB3  . ARG A 1 100 ? -51.079 -3.047  -14.297 1.00 0.00 ? 100 ARG A HB3  1  
ATOM 1584  H HG2  . ARG A 1 100 ? -48.681 -3.039  -14.258 1.00 0.00 ? 100 ARG A HG2  1  
ATOM 1585  H HG3  . ARG A 1 100 ? -48.630 -3.389  -12.523 1.00 0.00 ? 100 ARG A HG3  1  
ATOM 1586  H HD2  . ARG A 1 100 ? -49.520 -5.605  -12.864 1.00 0.00 ? 100 ARG A HD2  1  
ATOM 1587  H HD3  . ARG A 1 100 ? -49.879 -5.256  -14.573 1.00 0.00 ? 100 ARG A HD3  1  
ATOM 1588  H HE   . ARG A 1 100 ? -47.141 -4.742  -14.193 1.00 0.00 ? 100 ARG A HE   1  
ATOM 1589  H HH11 . ARG A 1 100 ? -49.080 -7.633  -13.806 1.00 0.00 ? 100 ARG A HH11 1  
ATOM 1590  H HH12 . ARG A 1 100 ? -47.850 -8.667  -14.479 1.00 0.00 ? 100 ARG A HH12 1  
ATOM 1591  H HH21 . ARG A 1 100 ? -45.806 -6.071  -15.400 1.00 0.00 ? 100 ARG A HH21 1  
ATOM 1592  H HH22 . ARG A 1 100 ? -45.974 -7.802  -15.254 1.00 0.00 ? 100 ARG A HH22 1  
ATOM 1593  N N    . LYS A 1 101 ? -51.611 -0.257  -14.612 1.00 0.00 ? 101 LYS A N    1  
ATOM 1594  C CA   . LYS A 1 101 ? -52.693 0.403   -15.369 1.00 0.00 ? 101 LYS A CA   1  
ATOM 1595  C C    . LYS A 1 101 ? -54.003 -0.408  -15.382 1.00 0.00 ? 101 LYS A C    1  
ATOM 1596  O O    . LYS A 1 101 ? -55.087 0.169   -15.439 1.00 0.00 ? 101 LYS A O    1  
ATOM 1597  C CB   . LYS A 1 101 ? -52.127 0.701   -16.771 1.00 0.00 ? 101 LYS A CB   1  
ATOM 1598  C CG   . LYS A 1 101 ? -53.129 1.242   -17.802 1.00 0.00 ? 101 LYS A CG   1  
ATOM 1599  C CD   . LYS A 1 101 ? -53.731 0.107   -18.642 1.00 0.00 ? 101 LYS A CD   1  
ATOM 1600  C CE   . LYS A 1 101 ? -54.776 0.660   -19.617 1.00 0.00 ? 101 LYS A CE   1  
ATOM 1601  N NZ   . LYS A 1 101 ? -55.330 -0.407  -20.492 1.00 0.00 ? 101 LYS A NZ   1  
ATOM 1602  H H    . LYS A 1 101 ? -50.730 -0.415  -15.090 1.00 0.00 ? 101 LYS A H    1  
ATOM 1603  H HA   . LYS A 1 101 ? -52.931 1.356   -14.895 1.00 0.00 ? 101 LYS A HA   1  
ATOM 1604  H HB2  . LYS A 1 101 ? -51.344 1.450   -16.651 1.00 0.00 ? 101 LYS A HB2  1  
ATOM 1605  H HB3  . LYS A 1 101 ? -51.651 -0.197  -17.173 1.00 0.00 ? 101 LYS A HB3  1  
ATOM 1606  H HG2  . LYS A 1 101 ? -53.914 1.811   -17.302 1.00 0.00 ? 101 LYS A HG2  1  
ATOM 1607  H HG3  . LYS A 1 101 ? -52.599 1.917   -18.476 1.00 0.00 ? 101 LYS A HG3  1  
ATOM 1608  H HD2  . LYS A 1 101 ? -52.922 -0.376  -19.192 1.00 0.00 ? 101 LYS A HD2  1  
ATOM 1609  H HD3  . LYS A 1 101 ? -54.195 -0.635  -17.995 1.00 0.00 ? 101 LYS A HD3  1  
ATOM 1610  H HE2  . LYS A 1 101 ? -55.581 1.122   -19.038 1.00 0.00 ? 101 LYS A HE2  1  
ATOM 1611  H HE3  . LYS A 1 101 ? -54.310 1.438   -20.229 1.00 0.00 ? 101 LYS A HE3  1  
ATOM 1612  H HZ1  . LYS A 1 101 ? -55.783 -1.131  -19.950 1.00 0.00 ? 101 LYS A HZ1  1  
ATOM 1613  H HZ2  . LYS A 1 101 ? -56.018 -0.031  -21.130 1.00 0.00 ? 101 LYS A HZ2  1  
ATOM 1614  H HZ3  . LYS A 1 101 ? -54.606 -0.841  -21.048 1.00 0.00 ? 101 LYS A HZ3  1  
ATOM 1615  N N    . ASP A 1 102 ? -53.911 -1.735  -15.268 1.00 0.00 ? 102 ASP A N    1  
ATOM 1616  C CA   . ASP A 1 102 ? -55.053 -2.658  -15.148 1.00 0.00 ? 102 ASP A CA   1  
ATOM 1617  C C    . ASP A 1 102 ? -55.785 -2.589  -13.782 1.00 0.00 ? 102 ASP A C    1  
ATOM 1618  O O    . ASP A 1 102 ? -56.870 -3.154  -13.630 1.00 0.00 ? 102 ASP A O    1  
ATOM 1619  C CB   . ASP A 1 102 ? -54.542 -4.077  -15.447 1.00 0.00 ? 102 ASP A CB   1  
ATOM 1620  C CG   . ASP A 1 102 ? -55.680 -5.098  -15.634 1.00 0.00 ? 102 ASP A CG   1  
ATOM 1621  O OD1  . ASP A 1 102 ? -56.490 -4.936  -16.579 1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1622  O OD2  . ASP A 1 102 ? -55.738 -6.092  -14.870 1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1623  H H    . ASP A 1 102 ? -52.986 -2.134  -15.277 1.00 0.00 ? 102 ASP A H    1  
ATOM 1624  H HA   . ASP A 1 102 ? -55.781 -2.391  -15.918 1.00 0.00 ? 102 ASP A HA   1  
ATOM 1625  H HB2  . ASP A 1 102 ? -53.950 -4.053  -16.364 1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1626  H HB3  . ASP A 1 102 ? -53.882 -4.392  -14.635 1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1627  N N    . GLY A 1 103 ? -55.223 -1.884  -12.789 1.00 0.00 ? 103 GLY A N    1  
ATOM 1628  C CA   . GLY A 1 103 ? -55.833 -1.635  -11.474 1.00 0.00 ? 103 GLY A CA   1  
ATOM 1629  C C    . GLY A 1 103 ? -55.418 -2.598  -10.350 1.00 0.00 ? 103 GLY A C    1  
ATOM 1630  O O    . GLY A 1 103 ? -56.116 -2.676  -9.337  1.00 0.00 ? 103 GLY A O    1  
ATOM 1631  H H    . GLY A 1 103 ? -54.342 -1.419  -12.977 1.00 0.00 ? 103 GLY A H    1  
ATOM 1632  H HA2  . GLY A 1 103 ? -55.552 -0.630  -11.160 1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1633  H HA3  . GLY A 1 103 ? -56.920 -1.660  -11.561 1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1634  N N    . SER A 1 104 ? -54.305 -3.326  -10.507 1.00 0.00 ? 104 SER A N    1  
ATOM 1635  C CA   . SER A 1 104 ? -53.765 -4.259  -9.492  1.00 0.00 ? 104 SER A CA   1  
ATOM 1636  C C    . SER A 1 104 ? -52.504 -3.702  -8.824  1.00 0.00 ? 104 SER A C    1  
ATOM 1637  O O    . SER A 1 104 ? -51.635 -3.178  -9.520  1.00 0.00 ? 104 SER A O    1  
ATOM 1638  C CB   . SER A 1 104 ? -53.462 -5.627  -10.116 1.00 0.00 ? 104 SER A CB   1  
ATOM 1639  O OG   . SER A 1 104 ? -54.652 -6.248  -10.577 1.00 0.00 ? 104 SER A OG   1  
ATOM 1640  H H    . SER A 1 104 ? -53.757 -3.166  -11.343 1.00 0.00 ? 104 SER A H    1  
ATOM 1641  H HA   . SER A 1 104 ? -54.508 -4.421  -8.710  1.00 0.00 ? 104 SER A HA   1  
ATOM 1642  H HB2  . SER A 1 104 ? -52.761 -5.507  -10.944 1.00 0.00 ? 104 SER A HB2  1  
ATOM 1643  H HB3  . SER A 1 104 ? -53.000 -6.269  -9.362  1.00 0.00 ? 104 SER A HB3  1  
ATOM 1644  H HG   . SER A 1 104 ? -55.019 -5.709  -11.303 1.00 0.00 ? 104 SER A HG   1  
ATOM 1645  N N    . CYS A 1 105 ? -52.381 -3.828  -7.495  1.00 0.00 ? 105 CYS A N    1  
ATOM 1646  C CA   . CYS A 1 105 ? -51.279 -3.268  -6.695  1.00 0.00 ? 105 CYS A CA   1  
ATOM 1647  C C    . CYS A 1 105 ? -50.585 -4.336  -5.825  1.00 0.00 ? 105 CYS A C    1  
ATOM 1648  O O    . CYS A 1 105 ? -51.254 -5.143  -5.173  1.00 0.00 ? 105 CYS A O    1  
ATOM 1649  C CB   . CYS A 1 105 ? -51.827 -2.087  -5.879  1.00 0.00 ? 105 CYS A CB   1  
ATOM 1650  S SG   . CYS A 1 105 ? -50.480 -1.157  -5.090  1.00 0.00 ? 105 CYS A SG   1  
ATOM 1651  H H    . CYS A 1 105 ? -53.114 -4.310  -6.993  1.00 0.00 ? 105 CYS A H    1  
ATOM 1652  H HA   . CYS A 1 105 ? -50.527 -2.882  -7.376  1.00 0.00 ? 105 CYS A HA   1  
ATOM 1653  H HB2  . CYS A 1 105 ? -52.371 -1.419  -6.549  1.00 0.00 ? 105 CYS A HB2  1  
ATOM 1654  H HB3  . CYS A 1 105 ? -52.519 -2.451  -5.117  1.00 0.00 ? 105 CYS A HB3  1  
ATOM 1655  H HG   . CYS A 1 105 ? -49.666 -1.107  -6.159  1.00 0.00 ? 105 CYS A HG   1  
ATOM 1656  N N    . PHE A 1 106 ? -49.248 -4.343  -5.802  1.00 0.00 ? 106 PHE A N    1  
ATOM 1657  C CA   . PHE A 1 106 ? -48.429 -5.425  -5.234  1.00 0.00 ? 106 PHE A CA   1  
ATOM 1658  C C    . PHE A 1 106 ? -47.081 -4.940  -4.668  1.00 0.00 ? 106 PHE A C    1  
ATOM 1659  O O    . PHE A 1 106 ? -46.401 -4.115  -5.282  1.00 0.00 ? 106 PHE A O    1  
ATOM 1660  C CB   . PHE A 1 106 ? -48.195 -6.482  -6.336  1.00 0.00 ? 106 PHE A CB   1  
ATOM 1661  C CG   . PHE A 1 106 ? -47.795 -5.918  -7.696  1.00 0.00 ? 106 PHE A CG   1  
ATOM 1662  C CD1  . PHE A 1 106 ? -46.443 -5.663  -8.001  1.00 0.00 ? 106 PHE A CD1  1  
ATOM 1663  C CD2  . PHE A 1 106 ? -48.789 -5.603  -8.645  1.00 0.00 ? 106 PHE A CD2  1  
ATOM 1664  C CE1  . PHE A 1 106 ? -46.094 -5.077  -9.232  1.00 0.00 ? 106 PHE A CE1  1  
ATOM 1665  C CE2  . PHE A 1 106 ? -48.440 -5.013  -9.872  1.00 0.00 ? 106 PHE A CE2  1  
ATOM 1666  C CZ   . PHE A 1 106 ? -47.091 -4.749  -10.167 1.00 0.00 ? 106 PHE A CZ   1  
ATOM 1667  H H    . PHE A 1 106 ? -48.760 -3.624  -6.329  1.00 0.00 ? 106 PHE A H    1  
ATOM 1668  H HA   . PHE A 1 106 ? -48.973 -5.905  -4.420  1.00 0.00 ? 106 PHE A HA   1  
ATOM 1669  H HB2  . PHE A 1 106 ? -47.434 -7.189  -6.001  1.00 0.00 ? 106 PHE A HB2  1  
ATOM 1670  H HB3  . PHE A 1 106 ? -49.118 -7.050  -6.462  1.00 0.00 ? 106 PHE A HB3  1  
ATOM 1671  H HD1  . PHE A 1 106 ? -45.671 -5.898  -7.281  1.00 0.00 ? 106 PHE A HD1  1  
ATOM 1672  H HD2  . PHE A 1 106 ? -49.829 -5.794  -8.422  1.00 0.00 ? 106 PHE A HD2  1  
ATOM 1673  H HE1  . PHE A 1 106 ? -45.058 -4.865  -9.455  1.00 0.00 ? 106 PHE A HE1  1  
ATOM 1674  H HE2  . PHE A 1 106 ? -49.213 -4.757  -10.582 1.00 0.00 ? 106 PHE A HE2  1  
ATOM 1675  H HZ   . PHE A 1 106 ? -46.818 -4.292  -11.110 1.00 0.00 ? 106 PHE A HZ   1  
ATOM 1676  N N    . LEU A 1 107 ? -46.679 -5.503  -3.518  1.00 0.00 ? 107 LEU A N    1  
ATOM 1677  C CA   . LEU A 1 107 ? -45.360 -5.352  -2.887  1.00 0.00 ? 107 LEU A CA   1  
ATOM 1678  C C    . LEU A 1 107 ? -44.527 -6.616  -3.152  1.00 0.00 ? 107 LEU A C    1  
ATOM 1679  O O    . LEU A 1 107 ? -44.948 -7.727  -2.818  1.00 0.00 ? 107 LEU A O    1  
ATOM 1680  C CB   . LEU A 1 107 ? -45.557 -5.088  -1.375  1.00 0.00 ? 107 LEU A CB   1  
ATOM 1681  C CG   . LEU A 1 107 ? -44.334 -4.689  -0.513  1.00 0.00 ? 107 LEU A CG   1  
ATOM 1682  C CD1  . LEU A 1 107 ? -43.186 -5.698  -0.472  1.00 0.00 ? 107 LEU A CD1  1  
ATOM 1683  C CD2  . LEU A 1 107 ? -43.709 -3.370  -0.928  1.00 0.00 ? 107 LEU A CD2  1  
ATOM 1684  H H    . LEU A 1 107 ? -47.294 -6.175  -3.084  1.00 0.00 ? 107 LEU A H    1  
ATOM 1685  H HA   . LEU A 1 107 ? -44.846 -4.497  -3.325  1.00 0.00 ? 107 LEU A HA   1  
ATOM 1686  H HB2  . LEU A 1 107 ? -46.297 -4.295  -1.265  1.00 0.00 ? 107 LEU A HB2  1  
ATOM 1687  H HB3  . LEU A 1 107 ? -45.997 -5.981  -0.927  1.00 0.00 ? 107 LEU A HB3  1  
ATOM 1688  H HG   . LEU A 1 107 ? -44.699 -4.539  0.497   1.00 0.00 ? 107 LEU A HG   1  
ATOM 1689  H HD11 . LEU A 1 107 ? -43.563 -6.708  -0.319  1.00 0.00 ? 107 LEU A HD11 1  
ATOM 1690  H HD12 . LEU A 1 107 ? -42.612 -5.662  -1.394  1.00 0.00 ? 107 LEU A HD12 1  
ATOM 1691  H HD13 . LEU A 1 107 ? -42.506 -5.433  0.336   1.00 0.00 ? 107 LEU A HD13 1  
ATOM 1692  H HD21 . LEU A 1 107 ? -43.297 -3.479  -1.926  1.00 0.00 ? 107 LEU A HD21 1  
ATOM 1693  H HD22 . LEU A 1 107 ? -44.461 -2.586  -0.895  1.00 0.00 ? 107 LEU A HD22 1  
ATOM 1694  H HD23 . LEU A 1 107 ? -42.908 -3.105  -0.236  1.00 0.00 ? 107 LEU A HD23 1  
ATOM 1695  N N    . CYS A 1 108 ? -43.332 -6.433  -3.713  1.00 0.00 ? 108 CYS A N    1  
ATOM 1696  C CA   . CYS A 1 108 ? -42.320 -7.477  -3.920  1.00 0.00 ? 108 CYS A CA   1  
ATOM 1697  C C    . CYS A 1 108 ? -40.953 -7.005  -3.379  1.00 0.00 ? 108 CYS A C    1  
ATOM 1698  O O    . CYS A 1 108 ? -40.808 -5.840  -2.999  1.00 0.00 ? 108 CYS A O    1  
ATOM 1699  C CB   . CYS A 1 108 ? -42.285 -7.817  -5.417  1.00 0.00 ? 108 CYS A CB   1  
ATOM 1700  S SG   . CYS A 1 108 ? -43.937 -8.319  -6.005  1.00 0.00 ? 108 CYS A SG   1  
ATOM 1701  H H    . CYS A 1 108 ? -43.055 -5.487  -3.932  1.00 0.00 ? 108 CYS A H    1  
ATOM 1702  H HA   . CYS A 1 108 ? -42.593 -8.377  -3.367  1.00 0.00 ? 108 CYS A HA   1  
ATOM 1703  H HB2  . CYS A 1 108 ? -41.954 -6.940  -5.976  1.00 0.00 ? 108 CYS A HB2  1  
ATOM 1704  H HB3  . CYS A 1 108 ? -41.584 -8.634  -5.591  1.00 0.00 ? 108 CYS A HB3  1  
ATOM 1705  H HG   . CYS A 1 108 ? -44.105 -9.358  -5.171  1.00 0.00 ? 108 CYS A HG   1  
ATOM 1706  N N    . LEU A 1 109 ? -39.927 -7.865  -3.347  1.00 0.00 ? 109 LEU A N    1  
ATOM 1707  C CA   . LEU A 1 109 ? -38.606 -7.531  -2.784  1.00 0.00 ? 109 LEU A CA   1  
ATOM 1708  C C    . LEU A 1 109 ? -37.757 -6.697  -3.775  1.00 0.00 ? 109 LEU A C    1  
ATOM 1709  O O    . LEU A 1 109 ? -36.675 -7.089  -4.209  1.00 0.00 ? 109 LEU A O    1  
ATOM 1710  C CB   . LEU A 1 109 ? -37.949 -8.835  -2.284  1.00 0.00 ? 109 LEU A CB   1  
ATOM 1711  C CG   . LEU A 1 109 ? -36.654 -8.668  -1.461  1.00 0.00 ? 109 LEU A CG   1  
ATOM 1712  C CD1  . LEU A 1 109 ? -36.864 -7.836  -0.193  1.00 0.00 ? 109 LEU A CD1  1  
ATOM 1713  C CD2  . LEU A 1 109 ? -36.142 -10.048 -1.044  1.00 0.00 ? 109 LEU A CD2  1  
ATOM 1714  H H    . LEU A 1 109 ? -40.056 -8.801  -3.720  1.00 0.00 ? 109 LEU A H    1  
ATOM 1715  H HA   . LEU A 1 109 ? -38.776 -6.897  -1.913  1.00 0.00 ? 109 LEU A HA   1  
ATOM 1716  H HB2  . LEU A 1 109 ? -38.674 -9.365  -1.665  1.00 0.00 ? 109 LEU A HB2  1  
ATOM 1717  H HB3  . LEU A 1 109 ? -37.734 -9.467  -3.145  1.00 0.00 ? 109 LEU A HB3  1  
ATOM 1718  H HG   . LEU A 1 109 ? -35.882 -8.193  -2.062  1.00 0.00 ? 109 LEU A HG   1  
ATOM 1719  H HD11 . LEU A 1 109 ? -37.105 -6.807  -0.455  1.00 0.00 ? 109 LEU A HD11 1  
ATOM 1720  H HD12 . LEU A 1 109 ? -37.672 -8.259  0.405   1.00 0.00 ? 109 LEU A HD12 1  
ATOM 1721  H HD13 . LEU A 1 109 ? -35.947 -7.828  0.397   1.00 0.00 ? 109 LEU A HD13 1  
ATOM 1722  H HD21 . LEU A 1 109 ? -36.877 -10.548 -0.413  1.00 0.00 ? 109 LEU A HD21 1  
ATOM 1723  H HD22 . LEU A 1 109 ? -35.958 -10.653 -1.932  1.00 0.00 ? 109 LEU A HD22 1  
ATOM 1724  H HD23 . LEU A 1 109 ? -35.206 -9.944  -0.495  1.00 0.00 ? 109 LEU A HD23 1  
ATOM 1725  N N    . VAL A 1 110 ? -38.283 -5.528  -4.145  1.00 0.00 ? 110 VAL A N    1  
ATOM 1726  C CA   . VAL A 1 110 ? -37.748 -4.626  -5.173  1.00 0.00 ? 110 VAL A CA   1  
ATOM 1727  C C    . VAL A 1 110 ? -36.364 -4.091  -4.790  1.00 0.00 ? 110 VAL A C    1  
ATOM 1728  O O    . VAL A 1 110 ? -36.094 -3.806  -3.621  1.00 0.00 ? 110 VAL A O    1  
ATOM 1729  C CB   . VAL A 1 110 ? -38.745 -3.503  -5.502  1.00 0.00 ? 110 VAL A CB   1  
ATOM 1730  C CG1  . VAL A 1 110 ? -38.235 -2.607  -6.636  1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1731  C CG2  . VAL A 1 110 ? -40.102 -4.045  -5.977  1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1732  H H    . VAL A 1 110 ? -39.192 -5.309  -3.760  1.00 0.00 ? 110 VAL A H    1  
ATOM 1733  H HA   . VAL A 1 110 ? -37.630 -5.214  -6.069  1.00 0.00 ? 110 VAL A HA   1  
ATOM 1734  H HB   . VAL A 1 110 ? -38.897 -2.916  -4.601  1.00 0.00 ? 110 VAL A HB   1  
ATOM 1735  H HG11 . VAL A 1 110 ? -38.979 -1.851  -6.880  1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1736  H HG12 . VAL A 1 110 ? -37.323 -2.094  -6.343  1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1737  H HG13 . VAL A 1 110 ? -38.042 -3.217  -7.516  1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1738  H HG21 . VAL A 1 110 ? -40.548 -4.690  -5.226  1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1739  H HG22 . VAL A 1 110 ? -40.789 -3.216  -6.139  1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1740  H HG23 . VAL A 1 110 ? -39.982 -4.602  -6.906  1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1741  N N    . ASP A 1 111 ? -35.483 -3.945  -5.783  1.00 0.00 ? 111 ASP A N    1  
ATOM 1742  C CA   . ASP A 1 111 ? -34.047 -3.694  -5.559  1.00 0.00 ? 111 ASP A CA   1  
ATOM 1743  C C    . ASP A 1 111 ? -33.621 -2.256  -5.930  1.00 0.00 ? 111 ASP A C    1  
ATOM 1744  O O    . ASP A 1 111 ? -32.910 -2.013  -6.907  1.00 0.00 ? 111 ASP A O    1  
ATOM 1745  C CB   . ASP A 1 111 ? -33.242 -4.801  -6.259  1.00 0.00 ? 111 ASP A CB   1  
ATOM 1746  C CG   . ASP A 1 111 ? -31.912 -5.078  -5.559  1.00 0.00 ? 111 ASP A CG   1  
ATOM 1747  O OD1  . ASP A 1 111 ? -31.886 -5.897  -4.612  1.00 0.00 ? 111 ASP A OD1  1  
ATOM 1748  O OD2  . ASP A 1 111 ? -30.881 -4.480  -5.938  1.00 0.00 ? 111 ASP A OD2  1  
ATOM 1749  H H    . ASP A 1 111 ? -35.818 -4.096  -6.731  1.00 0.00 ? 111 ASP A H    1  
ATOM 1750  H HA   . ASP A 1 111 ? -33.848 -3.804  -4.494  1.00 0.00 ? 111 ASP A HA   1  
ATOM 1751  H HB2  . ASP A 1 111 ? -33.820 -5.727  -6.257  1.00 0.00 ? 111 ASP A HB2  1  
ATOM 1752  H HB3  . ASP A 1 111 ? -33.060 -4.521  -7.294  1.00 0.00 ? 111 ASP A HB3  1  
ATOM 1753  N N    . VAL A 1 112 ? -34.066 -1.278  -5.131  1.00 0.00 ? 112 VAL A N    1  
ATOM 1754  C CA   . VAL A 1 112 ? -33.973 0.162   -5.434  1.00 0.00 ? 112 VAL A CA   1  
ATOM 1755  C C    . VAL A 1 112 ? -32.578 0.707   -5.098  1.00 0.00 ? 112 VAL A C    1  
ATOM 1756  O O    . VAL A 1 112 ? -32.404 1.453   -4.137  1.00 0.00 ? 112 VAL A O    1  
ATOM 1757  C CB   . VAL A 1 112 ? -35.115 0.917   -4.711  1.00 0.00 ? 112 VAL A CB   1  
ATOM 1758  C CG1  . VAL A 1 112 ? -35.259 2.375   -5.154  1.00 0.00 ? 112 VAL A CG1  1  
ATOM 1759  C CG2  . VAL A 1 112 ? -36.472 0.258   -4.988  1.00 0.00 ? 112 VAL A CG2  1  
ATOM 1760  H H    . VAL A 1 112 ? -34.560 -1.529  -4.280  1.00 0.00 ? 112 VAL A H    1  
ATOM 1761  H HA   . VAL A 1 112 ? -34.124 0.295   -6.506  1.00 0.00 ? 112 VAL A HA   1  
ATOM 1762  H HB   . VAL A 1 112 ? -34.938 0.893   -3.635  1.00 0.00 ? 112 VAL A HB   1  
ATOM 1763  H HG11 . VAL A 1 112 ? -36.029 2.865   -4.558  1.00 0.00 ? 112 VAL A HG11 1  
ATOM 1764  H HG12 . VAL A 1 112 ? -34.324 2.910   -5.006  1.00 0.00 ? 112 VAL A HG12 1  
ATOM 1765  H HG13 . VAL A 1 112 ? -35.551 2.413   -6.200  1.00 0.00 ? 112 VAL A HG13 1  
ATOM 1766  H HG21 . VAL A 1 112 ? -36.502 -0.750  -4.576  1.00 0.00 ? 112 VAL A HG21 1  
ATOM 1767  H HG22 . VAL A 1 112 ? -37.259 0.838   -4.509  1.00 0.00 ? 112 VAL A HG22 1  
ATOM 1768  H HG23 . VAL A 1 112 ? -36.650 0.207   -6.062  1.00 0.00 ? 112 VAL A HG23 1  
ATOM 1769  N N    . VAL A 1 113 ? -31.562 0.316   -5.875  1.00 0.00 ? 113 VAL A N    1  
ATOM 1770  C CA   . VAL A 1 113 ? -30.144 0.679   -5.636  1.00 0.00 ? 113 VAL A CA   1  
ATOM 1771  C C    . VAL A 1 113 ? -29.523 1.433   -6.834  1.00 0.00 ? 113 VAL A C    1  
ATOM 1772  O O    . VAL A 1 113 ? -29.619 0.929   -7.954  1.00 0.00 ? 113 VAL A O    1  
ATOM 1773  C CB   . VAL A 1 113 ? -29.328 -0.560  -5.213  1.00 0.00 ? 113 VAL A CB   1  
ATOM 1774  C CG1  . VAL A 1 113 ? -29.178 -1.637  -6.295  1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1775  C CG2  . VAL A 1 113 ? -27.933 -0.169  -4.717  1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1776  H H    . VAL A 1 113 ? -31.790 -0.323  -6.637  1.00 0.00 ? 113 VAL A H    1  
ATOM 1777  H HA   . VAL A 1 113 ? -30.125 1.334   -4.767  1.00 0.00 ? 113 VAL A HA   1  
ATOM 1778  H HB   . VAL A 1 113 ? -29.850 -1.017  -4.372  1.00 0.00 ? 113 VAL A HB   1  
ATOM 1779  H HG11 . VAL A 1 113 ? -28.715 -2.524  -5.864  1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1780  H HG12 . VAL A 1 113 ? -30.157 -1.912  -6.685  1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1781  H HG13 . VAL A 1 113 ? -28.551 -1.278  -7.111  1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1782  H HG21 . VAL A 1 113 ? -27.417 -1.054  -4.341  1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1783  H HG22 . VAL A 1 113 ? -27.352 0.262   -5.532  1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1784  H HG23 . VAL A 1 113 ? -28.017 0.553   -3.904  1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1785  N N    . PRO A 1 114 ? -28.915 2.631   -6.651  1.00 0.00 ? 114 PRO A N    1  
ATOM 1786  C CA   . PRO A 1 114 ? -28.428 3.481   -7.752  1.00 0.00 ? 114 PRO A CA   1  
ATOM 1787  C C    . PRO A 1 114 ? -26.970 3.147   -8.151  1.00 0.00 ? 114 PRO A C    1  
ATOM 1788  O O    . PRO A 1 114 ? -26.347 2.250   -7.571  1.00 0.00 ? 114 PRO A O    1  
ATOM 1789  C CB   . PRO A 1 114 ? -28.544 4.906   -7.218  1.00 0.00 ? 114 PRO A CB   1  
ATOM 1790  C CG   . PRO A 1 114 ? -28.194 4.723   -5.752  1.00 0.00 ? 114 PRO A CG   1  
ATOM 1791  C CD   . PRO A 1 114 ? -28.789 3.364   -5.393  1.00 0.00 ? 114 PRO A CD   1  
ATOM 1792  H HA   . PRO A 1 114 ? -29.100 3.408   -8.614  1.00 0.00 ? 114 PRO A HA   1  
ATOM 1793  H HB2  . PRO A 1 114 ? -27.866 5.593   -7.713  1.00 0.00 ? 114 PRO A HB2  1  
ATOM 1794  H HB3  . PRO A 1 114 ? -29.565 5.270   -7.315  1.00 0.00 ? 114 PRO A HB3  1  
ATOM 1795  H HG2  . PRO A 1 114 ? -27.109 4.679   -5.655  1.00 0.00 ? 114 PRO A HG2  1  
ATOM 1796  H HG3  . PRO A 1 114 ? -28.617 5.523   -5.142  1.00 0.00 ? 114 PRO A HG3  1  
ATOM 1797  H HD2  . PRO A 1 114 ? -28.134 2.838   -4.698  1.00 0.00 ? 114 PRO A HD2  1  
ATOM 1798  H HD3  . PRO A 1 114 ? -29.763 3.524   -4.930  1.00 0.00 ? 114 PRO A HD3  1  
ATOM 1799  N N    . VAL A 1 115 ? -26.388 3.905   -9.095  1.00 0.00 ? 115 VAL A N    1  
ATOM 1800  C CA   . VAL A 1 115 ? -25.042 3.668   -9.656  1.00 0.00 ? 115 VAL A CA   1  
ATOM 1801  C C    . VAL A 1 115 ? -24.046 4.809   -9.377  1.00 0.00 ? 115 VAL A C    1  
ATOM 1802  O O    . VAL A 1 115 ? -24.317 6.004   -9.556  1.00 0.00 ? 115 VAL A O    1  
ATOM 1803  C CB   . VAL A 1 115 ? -25.092 3.334   -11.159 1.00 0.00 ? 115 VAL A CB   1  
ATOM 1804  C CG1  . VAL A 1 115 ? -25.708 1.950   -11.392 1.00 0.00 ? 115 VAL A CG1  1  
ATOM 1805  C CG2  . VAL A 1 115 ? -25.825 4.370   -12.000 1.00 0.00 ? 115 VAL A CG2  1  
ATOM 1806  H H    . VAL A 1 115 ? -26.880 4.725   -9.438  1.00 0.00 ? 115 VAL A H    1  
ATOM 1807  H HA   . VAL A 1 115 ? -24.628 2.783   -9.173  1.00 0.00 ? 115 VAL A HA   1  
ATOM 1808  H HB   . VAL A 1 115 ? -24.065 3.287   -11.522 1.00 0.00 ? 115 VAL A HB   1  
ATOM 1809  H HG11 . VAL A 1 115 ? -25.136 1.195   -10.851 1.00 0.00 ? 115 VAL A HG11 1  
ATOM 1810  H HG12 . VAL A 1 115 ? -26.741 1.930   -11.044 1.00 0.00 ? 115 VAL A HG12 1  
ATOM 1811  H HG13 . VAL A 1 115 ? -25.683 1.709   -12.455 1.00 0.00 ? 115 VAL A HG13 1  
ATOM 1812  H HG21 . VAL A 1 115 ? -26.877 4.397   -11.728 1.00 0.00 ? 115 VAL A HG21 1  
ATOM 1813  H HG22 . VAL A 1 115 ? -25.375 5.341   -11.820 1.00 0.00 ? 115 VAL A HG22 1  
ATOM 1814  H HG23 . VAL A 1 115 ? -25.720 4.129   -13.057 1.00 0.00 ? 115 VAL A HG23 1  
ATOM 1815  N N    . LYS A 1 116 ? -22.850 4.400   -8.942  1.00 0.00 ? 116 LYS A N    1  
ATOM 1816  C CA   . LYS A 1 116 ? -21.745 5.243   -8.463  1.00 0.00 ? 116 LYS A CA   1  
ATOM 1817  C C    . LYS A 1 116 ? -20.434 4.932   -9.186  1.00 0.00 ? 116 LYS A C    1  
ATOM 1818  O O    . LYS A 1 116 ? -20.271 3.870   -9.789  1.00 0.00 ? 116 LYS A O    1  
ATOM 1819  C CB   . LYS A 1 116 ? -21.581 5.161   -6.925  1.00 0.00 ? 116 LYS A CB   1  
ATOM 1820  C CG   . LYS A 1 116 ? -21.692 3.774   -6.286  1.00 0.00 ? 116 LYS A CG   1  
ATOM 1821  C CD   . LYS A 1 116 ? -23.139 3.435   -5.877  1.00 0.00 ? 116 LYS A CD   1  
ATOM 1822  C CE   . LYS A 1 116 ? -23.283 1.970   -5.453  1.00 0.00 ? 116 LYS A CE   1  
ATOM 1823  N NZ   . LYS A 1 116 ? -24.707 1.625   -5.211  1.00 0.00 ? 116 LYS A NZ   1  
ATOM 1824  H H    . LYS A 1 116 ? -22.686 3.403   -8.927  1.00 0.00 ? 116 LYS A H    1  
ATOM 1825  H HA   . LYS A 1 116 ? -21.970 6.279   -8.712  1.00 0.00 ? 116 LYS A HA   1  
ATOM 1826  H HB2  . LYS A 1 116 ? -20.598 5.560   -6.665  1.00 0.00 ? 116 LYS A HB2  1  
ATOM 1827  H HB3  . LYS A 1 116 ? -22.316 5.800   -6.443  1.00 0.00 ? 116 LYS A HB3  1  
ATOM 1828  H HG2  . LYS A 1 116 ? -21.293 3.023   -6.967  1.00 0.00 ? 116 LYS A HG2  1  
ATOM 1829  H HG3  . LYS A 1 116 ? -21.073 3.799   -5.390  1.00 0.00 ? 116 LYS A HG3  1  
ATOM 1830  H HD2  . LYS A 1 116 ? -23.434 4.081   -5.049  1.00 0.00 ? 116 LYS A HD2  1  
ATOM 1831  H HD3  . LYS A 1 116 ? -23.820 3.622   -6.705  1.00 0.00 ? 116 LYS A HD3  1  
ATOM 1832  H HE2  . LYS A 1 116 ? -22.876 1.330   -6.241  1.00 0.00 ? 116 LYS A HE2  1  
ATOM 1833  H HE3  . LYS A 1 116 ? -22.695 1.806   -4.545  1.00 0.00 ? 116 LYS A HE3  1  
ATOM 1834  H HZ1  . LYS A 1 116 ? -25.272 1.777   -6.043  1.00 0.00 ? 116 LYS A HZ1  1  
ATOM 1835  H HZ2  . LYS A 1 116 ? -24.805 0.660   -4.931  1.00 0.00 ? 116 LYS A HZ2  1  
ATOM 1836  H HZ3  . LYS A 1 116 ? -25.098 2.201   -4.460  1.00 0.00 ? 116 LYS A HZ3  1  
ATOM 1837  N N    . ASN A 1 117 ? -19.508 5.884   -9.113  1.00 0.00 ? 117 ASN A N    1  
ATOM 1838  C CA   . ASN A 1 117 ? -18.199 5.813   -9.776  1.00 0.00 ? 117 ASN A CA   1  
ATOM 1839  C C    . ASN A 1 117 ? -17.129 5.156   -8.879  1.00 0.00 ? 117 ASN A C    1  
ATOM 1840  O O    . ASN A 1 117 ? -17.425 4.700   -7.771  1.00 0.00 ? 117 ASN A O    1  
ATOM 1841  C CB   . ASN A 1 117 ? -17.822 7.211   -10.308 1.00 0.00 ? 117 ASN A CB   1  
ATOM 1842  C CG   . ASN A 1 117 ? -17.201 8.122   -9.265  1.00 0.00 ? 117 ASN A CG   1  
ATOM 1843  O OD1  . ASN A 1 117 ? -15.991 8.217   -9.149  1.00 0.00 ? 117 ASN A OD1  1  
ATOM 1844  N ND2  . ASN A 1 117 ? -17.980 8.787   -8.447  1.00 0.00 ? 117 ASN A ND2  1  
ATOM 1845  H H    . ASN A 1 117 ? -19.716 6.665   -8.499  1.00 0.00 ? 117 ASN A H    1  
ATOM 1846  H HA   . ASN A 1 117 ? -18.296 5.167   -10.652 1.00 0.00 ? 117 ASN A HA   1  
ATOM 1847  H HB2  . ASN A 1 117 ? -17.096 7.095   -11.112 1.00 0.00 ? 117 ASN A HB2  1  
ATOM 1848  H HB3  . ASN A 1 117 ? -18.697 7.693   -10.742 1.00 0.00 ? 117 ASN A HB3  1  
ATOM 1849  H HD21 . ASN A 1 117 ? -18.988 8.724   -8.505  1.00 0.00 ? 117 ASN A HD21 1  
ATOM 1850  H HD22 . ASN A 1 117 ? -17.535 9.443   -7.826  1.00 0.00 ? 117 ASN A HD22 1  
ATOM 1851  N N    . GLU A 1 118 ? -15.876 5.100   -9.337  1.00 0.00 ? 118 GLU A N    1  
ATOM 1852  C CA   . GLU A 1 118 ? -14.748 4.498   -8.598  1.00 0.00 ? 118 GLU A CA   1  
ATOM 1853  C C    . GLU A 1 118 ? -14.415 5.193   -7.257  1.00 0.00 ? 118 GLU A C    1  
ATOM 1854  O O    . GLU A 1 118 ? -13.794 4.588   -6.381  1.00 0.00 ? 118 GLU A O    1  
ATOM 1855  C CB   . GLU A 1 118 ? -13.515 4.403   -9.514  1.00 0.00 ? 118 GLU A CB   1  
ATOM 1856  C CG   . GLU A 1 118 ? -12.914 5.758   -9.921  1.00 0.00 ? 118 GLU A CG   1  
ATOM 1857  C CD   . GLU A 1 118 ? -11.524 5.572   -10.555 1.00 0.00 ? 118 GLU A CD   1  
ATOM 1858  O OE1  . GLU A 1 118 ? -10.538 5.441   -9.787  1.00 0.00 ? 118 GLU A OE1  1  
ATOM 1859  O OE2  . GLU A 1 118 ? -11.408 5.550   -11.805 1.00 0.00 ? 118 GLU A OE2  1  
ATOM 1860  H H    . GLU A 1 118 ? -15.686 5.491   -10.250 1.00 0.00 ? 118 GLU A H    1  
ATOM 1861  H HA   . GLU A 1 118 ? -15.024 3.475   -8.343  1.00 0.00 ? 118 GLU A HA   1  
ATOM 1862  H HB2  . GLU A 1 118 ? -12.757 3.816   -8.998  1.00 0.00 ? 118 GLU A HB2  1  
ATOM 1863  H HB3  . GLU A 1 118 ? -13.787 3.854   -10.418 1.00 0.00 ? 118 GLU A HB3  1  
ATOM 1864  H HG2  . GLU A 1 118 ? -13.591 6.260   -10.617 1.00 0.00 ? 118 GLU A HG2  1  
ATOM 1865  H HG3  . GLU A 1 118 ? -12.811 6.395   -9.040  1.00 0.00 ? 118 GLU A HG3  1  
ATOM 1866  N N    . ASP A 1 119 ? -14.841 6.445   -7.065  1.00 0.00 ? 119 ASP A N    1  
ATOM 1867  C CA   . ASP A 1 119 ? -14.779 7.171   -5.787  1.00 0.00 ? 119 ASP A CA   1  
ATOM 1868  C C    . ASP A 1 119 ? -15.873 6.755   -4.778  1.00 0.00 ? 119 ASP A C    1  
ATOM 1869  O O    . ASP A 1 119 ? -15.742 7.013   -3.580  1.00 0.00 ? 119 ASP A O    1  
ATOM 1870  C CB   . ASP A 1 119 ? -14.828 8.681   -6.068  1.00 0.00 ? 119 ASP A CB   1  
ATOM 1871  C CG   . ASP A 1 119 ? -14.289 9.513   -4.891  1.00 0.00 ? 119 ASP A CG   1  
ATOM 1872  O OD1  . ASP A 1 119 ? -13.087 9.386   -4.553  1.00 0.00 ? 119 ASP A OD1  1  
ATOM 1873  O OD2  . ASP A 1 119 ? -15.058 10.325  -4.322  1.00 0.00 ? 119 ASP A OD2  1  
ATOM 1874  H H    . ASP A 1 119 ? -15.254 6.930   -7.856  1.00 0.00 ? 119 ASP A H    1  
ATOM 1875  H HA   . ASP A 1 119 ? -13.816 6.949   -5.324  1.00 0.00 ? 119 ASP A HA   1  
ATOM 1876  H HB2  . ASP A 1 119 ? -14.211 8.900   -6.943  1.00 0.00 ? 119 ASP A HB2  1  
ATOM 1877  H HB3  . ASP A 1 119 ? -15.854 8.970   -6.302  1.00 0.00 ? 119 ASP A HB3  1  
ATOM 1878  N N    . GLY A 1 120 ? -16.966 6.136   -5.250  1.00 0.00 ? 120 GLY A N    1  
ATOM 1879  C CA   . GLY A 1 120 ? -18.131 5.743   -4.446  1.00 0.00 ? 120 GLY A CA   1  
ATOM 1880  C C    . GLY A 1 120 ? -19.276 6.765   -4.445  1.00 0.00 ? 120 GLY A C    1  
ATOM 1881  O O    . GLY A 1 120 ? -20.317 6.514   -3.836  1.00 0.00 ? 120 GLY A O    1  
ATOM 1882  H H    . GLY A 1 120 ? -17.003 5.918   -6.240  1.00 0.00 ? 120 GLY A H    1  
ATOM 1883  H HA2  . GLY A 1 120 ? -18.524 4.807   -4.841  1.00 0.00 ? 120 GLY A HA2  1  
ATOM 1884  H HA3  . GLY A 1 120 ? -17.828 5.571   -3.412  1.00 0.00 ? 120 GLY A HA3  1  
ATOM 1885  N N    . ALA A 1 121 ? -19.123 7.892   -5.150  1.00 0.00 ? 121 ALA A N    1  
ATOM 1886  C CA   . ALA A 1 121 ? -20.172 8.897   -5.322  1.00 0.00 ? 121 ALA A CA   1  
ATOM 1887  C C    . ALA A 1 121 ? -21.161 8.501   -6.429  1.00 0.00 ? 121 ALA A C    1  
ATOM 1888  O O    . ALA A 1 121 ? -20.757 8.125   -7.536  1.00 0.00 ? 121 ALA A O    1  
ATOM 1889  C CB   . ALA A 1 121 ? -19.537 10.272  -5.563  1.00 0.00 ? 121 ALA A CB   1  
ATOM 1890  H H    . ALA A 1 121 ? -18.249 8.030   -5.632  1.00 0.00 ? 121 ALA A H    1  
ATOM 1891  H HA   . ALA A 1 121 ? -20.739 8.965   -4.394  1.00 0.00 ? 121 ALA A HA   1  
ATOM 1892  H HB1  . ALA A 1 121 ? -19.010 10.287  -6.514  1.00 0.00 ? 121 ALA A HB1  1  
ATOM 1893  H HB2  . ALA A 1 121 ? -20.317 11.035  -5.585  1.00 0.00 ? 121 ALA A HB2  1  
ATOM 1894  H HB3  . ALA A 1 121 ? -18.838 10.504  -4.758  1.00 0.00 ? 121 ALA A HB3  1  
ATOM 1895  N N    . VAL A 1 122 ? -22.456 8.592   -6.112  1.00 0.00 ? 122 VAL A N    1  
ATOM 1896  C CA   . VAL A 1 122 ? -23.598 8.260   -6.976  1.00 0.00 ? 122 VAL A CA   1  
ATOM 1897  C C    . VAL A 1 122 ? -23.779 9.307   -8.074  1.00 0.00 ? 122 VAL A C    1  
ATOM 1898  O O    . VAL A 1 122 ? -24.339 10.384  -7.861  1.00 0.00 ? 122 VAL A O    1  
ATOM 1899  C CB   . VAL A 1 122 ? -24.853 7.981   -6.121  1.00 0.00 ? 122 VAL A CB   1  
ATOM 1900  C CG1  . VAL A 1 122 ? -25.329 9.137   -5.231  1.00 0.00 ? 122 VAL A CG1  1  
ATOM 1901  C CG2  . VAL A 1 122 ? -26.026 7.503   -6.971  1.00 0.00 ? 122 VAL A CG2  1  
ATOM 1902  H H    . VAL A 1 122 ? -22.674 8.869   -5.168  1.00 0.00 ? 122 VAL A H    1  
ATOM 1903  H HA   . VAL A 1 122 ? -23.384 7.325   -7.483  1.00 0.00 ? 122 VAL A HA   1  
ATOM 1904  H HB   . VAL A 1 122 ? -24.596 7.159   -5.452  1.00 0.00 ? 122 VAL A HB   1  
ATOM 1905  H HG11 . VAL A 1 122 ? -24.499 9.545   -4.655  1.00 0.00 ? 122 VAL A HG11 1  
ATOM 1906  H HG12 . VAL A 1 122 ? -25.780 9.922   -5.834  1.00 0.00 ? 122 VAL A HG12 1  
ATOM 1907  H HG13 . VAL A 1 122 ? -26.080 8.766   -4.534  1.00 0.00 ? 122 VAL A HG13 1  
ATOM 1908  H HG21 . VAL A 1 122 ? -26.867 7.270   -6.320  1.00 0.00 ? 122 VAL A HG21 1  
ATOM 1909  H HG22 . VAL A 1 122 ? -26.326 8.270   -7.683  1.00 0.00 ? 122 VAL A HG22 1  
ATOM 1910  H HG23 . VAL A 1 122 ? -25.742 6.601   -7.510  1.00 0.00 ? 122 VAL A HG23 1  
ATOM 1911  N N    . ILE A 1 123 ? -23.264 8.994   -9.265  1.00 0.00 ? 123 ILE A N    1  
ATOM 1912  C CA   . ILE A 1 123 ? -23.346 9.870   -10.440 1.00 0.00 ? 123 ILE A CA   1  
ATOM 1913  C C    . ILE A 1 123 ? -24.657 9.670   -11.206 1.00 0.00 ? 123 ILE A C    1  
ATOM 1914  O O    . ILE A 1 123 ? -25.174 10.636  -11.766 1.00 0.00 ? 123 ILE A O    1  
ATOM 1915  C CB   . ILE A 1 123 ? -22.087 9.789   -11.338 1.00 0.00 ? 123 ILE A CB   1  
ATOM 1916  C CG1  . ILE A 1 123 ? -22.057 8.667   -12.402 1.00 0.00 ? 123 ILE A CG1  1  
ATOM 1917  C CG2  . ILE A 1 123 ? -20.799 9.789   -10.499 1.00 0.00 ? 123 ILE A CG2  1  
ATOM 1918  C CD1  . ILE A 1 123 ? -22.150 7.219   -11.907 1.00 0.00 ? 123 ILE A CD1  1  
ATOM 1919  H H    . ILE A 1 123 ? -22.765 8.123   -9.350  1.00 0.00 ? 123 ILE A H    1  
ATOM 1920  H HA   . ILE A 1 123 ? -23.368 10.895  -10.069 1.00 0.00 ? 123 ILE A HA   1  
ATOM 1921  H HB   . ILE A 1 123 ? -22.075 10.721  -11.906 1.00 0.00 ? 123 ILE A HB   1  
ATOM 1922  H HG12 . ILE A 1 123 ? -22.868 8.835   -13.105 1.00 0.00 ? 123 ILE A HG12 1  
ATOM 1923  H HG13 . ILE A 1 123 ? -21.130 8.766   -12.968 1.00 0.00 ? 123 ILE A HG13 1  
ATOM 1924  H HG21 . ILE A 1 123 ? -19.935 9.937   -11.148 1.00 0.00 ? 123 ILE A HG21 1  
ATOM 1925  H HG22 . ILE A 1 123 ? -20.830 10.597  -9.765  1.00 0.00 ? 123 ILE A HG22 1  
ATOM 1926  H HG23 . ILE A 1 123 ? -20.693 8.841   -9.976  1.00 0.00 ? 123 ILE A HG23 1  
ATOM 1927  H HD11 . ILE A 1 123 ? -22.008 6.545   -12.751 1.00 0.00 ? 123 ILE A HD11 1  
ATOM 1928  H HD12 . ILE A 1 123 ? -21.387 7.013   -11.159 1.00 0.00 ? 123 ILE A HD12 1  
ATOM 1929  H HD13 . ILE A 1 123 ? -23.140 7.032   -11.499 1.00 0.00 ? 123 ILE A HD13 1  
ATOM 1930  N N    . MET A 1 124 ? -25.246 8.466   -11.165 1.00 0.00 ? 124 MET A N    1  
ATOM 1931  C CA   . MET A 1 124 ? -26.556 8.204   -11.771 1.00 0.00 ? 124 MET A CA   1  
ATOM 1932  C C    . MET A 1 124 ? -27.482 7.398   -10.858 1.00 0.00 ? 124 MET A C    1  
ATOM 1933  O O    . MET A 1 124 ? -27.095 6.547   -10.064 1.00 0.00 ? 124 MET A O    1  
ATOM 1934  C CB   . MET A 1 124 ? -26.445 7.572   -13.177 1.00 0.00 ? 124 MET A CB   1  
ATOM 1935  C CG   . MET A 1 124 ? -26.448 8.599   -14.318 1.00 0.00 ? 124 MET A CG   1  
ATOM 1936  S SD   . MET A 1 124 ? -24.834 8.877   -15.095 1.00 0.00 ? 124 MET A SD   1  
ATOM 1937  C CE   . MET A 1 124 ? -24.830 10.686  -15.148 1.00 0.00 ? 124 MET A CE   1  
ATOM 1938  H H    . MET A 1 124 ? -24.805 7.715   -10.632 1.00 0.00 ? 124 MET A H    1  
ATOM 1939  H HA   . MET A 1 124 ? -27.064 9.160   -11.894 1.00 0.00 ? 124 MET A HA   1  
ATOM 1940  H HB2  . MET A 1 124 ? -25.546 6.962   -13.254 1.00 0.00 ? 124 MET A HB2  1  
ATOM 1941  H HB3  . MET A 1 124 ? -27.304 6.920   -13.336 1.00 0.00 ? 124 MET A HB3  1  
ATOM 1942  H HG2  . MET A 1 124 ? -27.125 8.240   -15.095 1.00 0.00 ? 124 MET A HG2  1  
ATOM 1943  H HG3  . MET A 1 124 ? -26.850 9.547   -13.961 1.00 0.00 ? 124 MET A HG3  1  
ATOM 1944  H HE1  . MET A 1 124 ? -24.868 11.075  -14.131 1.00 0.00 ? 124 MET A HE1  1  
ATOM 1945  H HE2  . MET A 1 124 ? -23.917 11.036  -15.629 1.00 0.00 ? 124 MET A HE2  1  
ATOM 1946  H HE3  . MET A 1 124 ? -25.699 11.041  -15.703 1.00 0.00 ? 124 MET A HE3  1  
ATOM 1947  N N    . PHE A 1 125 ? -28.762 7.681   -11.014 1.00 0.00 ? 125 PHE A N    1  
ATOM 1948  C CA   . PHE A 1 125 ? -29.867 7.051   -10.304 1.00 0.00 ? 125 PHE A CA   1  
ATOM 1949  C C    . PHE A 1 125 ? -30.501 6.050   -11.273 1.00 0.00 ? 125 PHE A C    1  
ATOM 1950  O O    . PHE A 1 125 ? -31.477 6.339   -11.962 1.00 0.00 ? 125 PHE A O    1  
ATOM 1951  C CB   . PHE A 1 125 ? -30.844 8.140   -9.807  1.00 0.00 ? 125 PHE A CB   1  
ATOM 1952  C CG   . PHE A 1 125 ? -30.637 8.763   -8.432  1.00 0.00 ? 125 PHE A CG   1  
ATOM 1953  C CD1  . PHE A 1 125 ? -29.574 8.412   -7.572  1.00 0.00 ? 125 PHE A CD1  1  
ATOM 1954  C CD2  . PHE A 1 125 ? -31.538 9.765   -8.027  1.00 0.00 ? 125 PHE A CD2  1  
ATOM 1955  C CE1  . PHE A 1 125 ? -29.425 9.051   -6.327  1.00 0.00 ? 125 PHE A CE1  1  
ATOM 1956  C CE2  . PHE A 1 125 ? -31.379 10.418  -6.792  1.00 0.00 ? 125 PHE A CE2  1  
ATOM 1957  C CZ   . PHE A 1 125 ? -30.324 10.057  -5.938  1.00 0.00 ? 125 PHE A CZ   1  
ATOM 1958  H H    . PHE A 1 125 ? -28.974 8.322   -11.765 1.00 0.00 ? 125 PHE A H    1  
ATOM 1959  H HA   . PHE A 1 125 ? -29.508 6.473   -9.455  1.00 0.00 ? 125 PHE A HA   1  
ATOM 1960  H HB2  . PHE A 1 125 ? -30.875 8.947   -10.539 1.00 0.00 ? 125 PHE A HB2  1  
ATOM 1961  H HB3  . PHE A 1 125 ? -31.839 7.695   -9.771  1.00 0.00 ? 125 PHE A HB3  1  
ATOM 1962  H HD1  . PHE A 1 125 ? -28.845 7.676   -7.865  1.00 0.00 ? 125 PHE A HD1  1  
ATOM 1963  H HD2  . PHE A 1 125 ? -32.354 10.041  -8.680  1.00 0.00 ? 125 PHE A HD2  1  
ATOM 1964  H HE1  . PHE A 1 125 ? -28.608 8.782   -5.672  1.00 0.00 ? 125 PHE A HE1  1  
ATOM 1965  H HE2  . PHE A 1 125 ? -32.068 11.195  -6.494  1.00 0.00 ? 125 PHE A HE2  1  
ATOM 1966  H HZ   . PHE A 1 125 ? -30.199 10.555  -4.985  1.00 0.00 ? 125 PHE A HZ   1  
ATOM 1967  N N    . ILE A 1 126 ? -29.928 4.849   -11.344 1.00 0.00 ? 126 ILE A N    1  
ATOM 1968  C CA   . ILE A 1 126 ? -30.530 3.727   -12.069 1.00 0.00 ? 126 ILE A CA   1  
ATOM 1969  C C    . ILE A 1 126 ? -31.203 2.854   -11.029 1.00 0.00 ? 126 ILE A C    1  
ATOM 1970  O O    . ILE A 1 126 ? -30.657 1.859   -10.561 1.00 0.00 ? 126 ILE A O    1  
ATOM 1971  C CB   . ILE A 1 126 ? -29.512 2.976   -12.942 1.00 0.00 ? 126 ILE A CB   1  
ATOM 1972  C CG1  . ILE A 1 126 ? -28.898 3.984   -13.934 1.00 0.00 ? 126 ILE A CG1  1  
ATOM 1973  C CG2  . ILE A 1 126 ? -30.191 1.800   -13.678 1.00 0.00 ? 126 ILE A CG2  1  
ATOM 1974  C CD1  . ILE A 1 126 ? -27.920 3.342   -14.905 1.00 0.00 ? 126 ILE A CD1  1  
ATOM 1975  H H    . ILE A 1 126 ? -29.064 4.687   -10.848 1.00 0.00 ? 126 ILE A H    1  
ATOM 1976  H HA   . ILE A 1 126 ? -31.306 4.096   -12.735 1.00 0.00 ? 126 ILE A HA   1  
ATOM 1977  H HB   . ILE A 1 126 ? -28.723 2.579   -12.303 1.00 0.00 ? 126 ILE A HB   1  
ATOM 1978  H HG12 . ILE A 1 126 ? -29.687 4.472   -14.499 1.00 0.00 ? 126 ILE A HG12 1  
ATOM 1979  H HG13 . ILE A 1 126 ? -28.362 4.760   -13.392 1.00 0.00 ? 126 ILE A HG13 1  
ATOM 1980  H HG21 . ILE A 1 126 ? -30.873 1.255   -13.029 1.00 0.00 ? 126 ILE A HG21 1  
ATOM 1981  H HG22 . ILE A 1 126 ? -30.779 2.162   -14.514 1.00 0.00 ? 126 ILE A HG22 1  
ATOM 1982  H HG23 . ILE A 1 126 ? -29.438 1.105   -14.050 1.00 0.00 ? 126 ILE A HG23 1  
ATOM 1983  H HD11 . ILE A 1 126 ? -27.442 4.131   -15.482 1.00 0.00 ? 126 ILE A HD11 1  
ATOM 1984  H HD12 . ILE A 1 126 ? -27.180 2.779   -14.338 1.00 0.00 ? 126 ILE A HD12 1  
ATOM 1985  H HD13 . ILE A 1 126 ? -28.455 2.672   -15.574 1.00 0.00 ? 126 ILE A HD13 1  
ATOM 1986  N N    . LEU A 1 127 ? -32.386 3.291   -10.611 1.00 0.00 ? 127 LEU A N    1  
ATOM 1987  C CA   . LEU A 1 127 ? -33.193 2.596   -9.620  1.00 0.00 ? 127 LEU A CA   1  
ATOM 1988  C C    . LEU A 1 127 ? -33.987 1.493   -10.313 1.00 0.00 ? 127 LEU A C    1  
ATOM 1989  O O    . LEU A 1 127 ? -35.109 1.664   -10.780 1.00 0.00 ? 127 LEU A O    1  
ATOM 1990  C CB   . LEU A 1 127 ? -33.909 3.629   -8.711  1.00 0.00 ? 127 LEU A CB   1  
ATOM 1991  C CG   . LEU A 1 127 ? -32.880 4.525   -7.970  1.00 0.00 ? 127 LEU A CG   1  
ATOM 1992  C CD1  . LEU A 1 127 ? -33.388 5.439   -6.862  1.00 0.00 ? 127 LEU A CD1  1  
ATOM 1993  C CD2  . LEU A 1 127 ? -31.865 3.633   -7.276  1.00 0.00 ? 127 LEU A CD2  1  
ATOM 1994  H H    . LEU A 1 127 ? -32.759 4.131   -11.031 1.00 0.00 ? 127 LEU A H    1  
ATOM 1995  H HA   . LEU A 1 127 ? -32.531 2.024   -8.974  1.00 0.00 ? 127 LEU A HA   1  
ATOM 1996  H HB2  . LEU A 1 127 ? -34.584 4.253   -9.288  1.00 0.00 ? 127 LEU A HB2  1  
ATOM 1997  H HB3  . LEU A 1 127 ? -34.501 3.086   -7.981  1.00 0.00 ? 127 LEU A HB3  1  
ATOM 1998  H HG   . LEU A 1 127 ? -32.357 5.149   -8.692  1.00 0.00 ? 127 LEU A HG   1  
ATOM 1999  H HD11 . LEU A 1 127 ? -33.845 4.859   -6.066  1.00 0.00 ? 127 LEU A HD11 1  
ATOM 2000  H HD12 . LEU A 1 127 ? -32.532 5.984   -6.439  1.00 0.00 ? 127 LEU A HD12 1  
ATOM 2001  H HD13 . LEU A 1 127 ? -34.100 6.151   -7.270  1.00 0.00 ? 127 LEU A HD13 1  
ATOM 2002  H HD21 . LEU A 1 127 ? -31.298 4.178   -6.530  1.00 0.00 ? 127 LEU A HD21 1  
ATOM 2003  H HD22 . LEU A 1 127 ? -32.383 2.809   -6.796  1.00 0.00 ? 127 LEU A HD22 1  
ATOM 2004  H HD23 . LEU A 1 127 ? -31.190 3.251   -8.038  1.00 0.00 ? 127 LEU A HD23 1  
ATOM 2005  N N    . ASN A 1 128 ? -33.304 0.350   -10.428 1.00 0.00 ? 128 ASN A N    1  
ATOM 2006  C CA   . ASN A 1 128 ? -33.810 -0.891  -11.003 1.00 0.00 ? 128 ASN A CA   1  
ATOM 2007  C C    . ASN A 1 128 ? -35.033 -1.363  -10.204 1.00 0.00 ? 128 ASN A C    1  
ATOM 2008  O O    . ASN A 1 128 ? -34.894 -1.903  -9.106  1.00 0.00 ? 128 ASN A O    1  
ATOM 2009  C CB   . ASN A 1 128 ? -32.693 -1.958  -10.986 1.00 0.00 ? 128 ASN A CB   1  
ATOM 2010  C CG   . ASN A 1 128 ? -31.390 -1.485  -11.602 1.00 0.00 ? 128 ASN A CG   1  
ATOM 2011  O OD1  . ASN A 1 128 ? -31.223 -1.441  -12.809 1.00 0.00 ? 128 ASN A OD1  1  
ATOM 2012  N ND2  . ASN A 1 128 ? -30.430 -1.093  -10.793 1.00 0.00 ? 128 ASN A ND2  1  
ATOM 2013  H H    . ASN A 1 128 ? -32.323 0.386   -10.169 1.00 0.00 ? 128 ASN A H    1  
ATOM 2014  H HA   . ASN A 1 128 ? -34.110 -0.712  -12.032 1.00 0.00 ? 128 ASN A HA   1  
ATOM 2015  H HB2  . ASN A 1 128 ? -32.497 -2.268  -9.958  1.00 0.00 ? 128 ASN A HB2  1  
ATOM 2016  H HB3  . ASN A 1 128 ? -33.032 -2.837  -11.534 1.00 0.00 ? 128 ASN A HB3  1  
ATOM 2017  H HD21 . ASN A 1 128 ? -30.572 -1.030  -9.798  1.00 0.00 ? 128 ASN A HD21 1  
ATOM 2018  H HD22 . ASN A 1 128 ? -29.622 -0.661  -11.211 1.00 0.00 ? 128 ASN A HD22 1  
ATOM 2019  N N    . PHE A 1 129 ? -36.246 -1.170  -10.727 1.00 0.00 ? 129 PHE A N    1  
ATOM 2020  C CA   . PHE A 1 129 ? -37.455 -1.560  -10.020 1.00 0.00 ? 129 PHE A CA   1  
ATOM 2021  C C    . PHE A 1 129 ? -37.784 -3.035  -10.273 1.00 0.00 ? 129 PHE A C    1  
ATOM 2022  O O    . PHE A 1 129 ? -38.861 -3.403  -10.742 1.00 0.00 ? 129 PHE A O    1  
ATOM 2023  C CB   . PHE A 1 129 ? -38.610 -0.624  -10.358 1.00 0.00 ? 129 PHE A CB   1  
ATOM 2024  C CG   . PHE A 1 129 ? -38.400 0.868   -10.141 1.00 0.00 ? 129 PHE A CG   1  
ATOM 2025  C CD1  . PHE A 1 129 ? -37.762 1.354   -8.981  1.00 0.00 ? 129 PHE A CD1  1  
ATOM 2026  C CD2  . PHE A 1 129 ? -38.885 1.783   -11.097 1.00 0.00 ? 129 PHE A CD2  1  
ATOM 2027  C CE1  . PHE A 1 129 ? -37.589 2.738   -8.797  1.00 0.00 ? 129 PHE A CE1  1  
ATOM 2028  C CE2  . PHE A 1 129 ? -38.723 3.167   -10.905 1.00 0.00 ? 129 PHE A CE2  1  
ATOM 2029  C CZ   . PHE A 1 129 ? -38.067 3.645   -9.758  1.00 0.00 ? 129 PHE A CZ   1  
ATOM 2030  H H    . PHE A 1 129 ? -36.360 -0.750  -11.636 1.00 0.00 ? 129 PHE A H    1  
ATOM 2031  H HA   . PHE A 1 129 ? -37.255 -1.471  -8.952  1.00 0.00 ? 129 PHE A HA   1  
ATOM 2032  H HB2  . PHE A 1 129 ? -38.891 -0.787  -11.398 1.00 0.00 ? 129 PHE A HB2  1  
ATOM 2033  H HB3  . PHE A 1 129 ? -39.417 -0.956  -9.716  1.00 0.00 ? 129 PHE A HB3  1  
ATOM 2034  H HD1  . PHE A 1 129 ? -37.398 0.669   -8.232  1.00 0.00 ? 129 PHE A HD1  1  
ATOM 2035  H HD2  . PHE A 1 129 ? -39.392 1.425   -11.982 1.00 0.00 ? 129 PHE A HD2  1  
ATOM 2036  H HE1  . PHE A 1 129 ? -37.094 3.108   -7.910  1.00 0.00 ? 129 PHE A HE1  1  
ATOM 2037  H HE2  . PHE A 1 129 ? -39.098 3.864   -11.642 1.00 0.00 ? 129 PHE A HE2  1  
ATOM 2038  H HZ   . PHE A 1 129 ? -37.934 4.709   -9.611  1.00 0.00 ? 129 PHE A HZ   1  
ATOM 2039  N N    . GLU A 1 130 ? -36.820 -3.901  -9.977  1.00 0.00 ? 130 GLU A N    1  
ATOM 2040  C CA   . GLU A 1 130 ? -36.944 -5.328  -10.238 1.00 0.00 ? 130 GLU A CA   1  
ATOM 2041  C C    . GLU A 1 130 ? -37.783 -6.003  -9.146  1.00 0.00 ? 130 GLU A C    1  
ATOM 2042  O O    . GLU A 1 130 ? -37.359 -6.261  -8.027  1.00 0.00 ? 130 GLU A O    1  
ATOM 2043  C CB   . GLU A 1 130 ? -35.564 -5.972  -10.395 1.00 0.00 ? 130 GLU A CB   1  
ATOM 2044  C CG   . GLU A 1 130 ? -34.576 -5.553  -9.310  1.00 0.00 ? 130 GLU A CG   1  
ATOM 2045  C CD   . GLU A 1 130 ? -33.313 -6.434  -9.289  1.00 0.00 ? 130 GLU A CD   1  
ATOM 2046  O OE1  . GLU A 1 130 ? -33.419 -7.658  -9.039  1.00 0.00 ? 130 GLU A OE1  1  
ATOM 2047  O OE2  . GLU A 1 130 ? -32.201 -5.911  -9.533  1.00 0.00 ? 130 GLU A OE2  1  
ATOM 2048  H H    . GLU A 1 130 ? -35.955 -3.539  -9.584  1.00 0.00 ? 130 GLU A H    1  
ATOM 2049  H HA   . GLU A 1 130 ? -37.458 -5.469  -11.191 1.00 0.00 ? 130 GLU A HA   1  
ATOM 2050  H HB2  . GLU A 1 130 ? -35.699 -7.051  -10.358 1.00 0.00 ? 130 GLU A HB2  1  
ATOM 2051  H HB3  . GLU A 1 130 ? -35.155 -5.681  -11.362 1.00 0.00 ? 130 GLU A HB3  1  
ATOM 2052  H HG2  . GLU A 1 130 ? -34.308 -4.514  -9.491  1.00 0.00 ? 130 GLU A HG2  1  
ATOM 2053  H HG3  . GLU A 1 130 ? -35.092 -5.591  -8.353  1.00 0.00 ? 130 GLU A HG3  1  
ATOM 2054  N N    . VAL A 1 131 ? -38.995 -6.351  -9.535  1.00 0.00 ? 131 VAL A N    1  
ATOM 2055  C CA   . VAL A 1 131 ? -39.936 -7.182  -8.771  1.00 0.00 ? 131 VAL A CA   1  
ATOM 2056  C C    . VAL A 1 131 ? -39.357 -8.583  -8.644  1.00 0.00 ? 131 VAL A C    1  
ATOM 2057  O O    . VAL A 1 131 ? -39.123 -9.238  -9.665  1.00 0.00 ? 131 VAL A O    1  
ATOM 2058  C CB   . VAL A 1 131 ? -41.305 -7.207  -9.475  1.00 0.00 ? 131 VAL A CB   1  
ATOM 2059  C CG1  . VAL A 1 131 ? -42.184 -8.421  -9.154  1.00 0.00 ? 131 VAL A CG1  1  
ATOM 2060  C CG2  . VAL A 1 131 ? -42.072 -5.930  -9.122  1.00 0.00 ? 131 VAL A CG2  1  
ATOM 2061  H H    . VAL A 1 131 ? -39.233 -6.030  -10.454 1.00 0.00 ? 131 VAL A H    1  
ATOM 2062  H HA   . VAL A 1 131 ? -40.060 -6.771  -7.769  1.00 0.00 ? 131 VAL A HA   1  
ATOM 2063  H HB   . VAL A 1 131 ? -41.129 -7.220  -10.549 1.00 0.00 ? 131 VAL A HB   1  
ATOM 2064  H HG11 . VAL A 1 131 ? -43.204 -8.250  -9.499  1.00 0.00 ? 131 VAL A HG11 1  
ATOM 2065  H HG12 . VAL A 1 131 ? -41.800 -9.305  -9.662  1.00 0.00 ? 131 VAL A HG12 1  
ATOM 2066  H HG13 . VAL A 1 131 ? -42.188 -8.607  -8.086  1.00 0.00 ? 131 VAL A HG13 1  
ATOM 2067  H HG21 . VAL A 1 131 ? -41.455 -5.055  -9.325  1.00 0.00 ? 131 VAL A HG21 1  
ATOM 2068  H HG22 . VAL A 1 131 ? -42.975 -5.873  -9.728  1.00 0.00 ? 131 VAL A HG22 1  
ATOM 2069  H HG23 . VAL A 1 131 ? -42.350 -5.933  -8.068  1.00 0.00 ? 131 VAL A HG23 1  
ATOM 2070  N N    . VAL A 1 132 ? -39.139 -9.047  -7.408  1.00 0.00 ? 132 VAL A N    1  
ATOM 2071  C CA   . VAL A 1 132 ? -38.682 -10.425 -7.163  1.00 0.00 ? 132 VAL A CA   1  
ATOM 2072  C C    . VAL A 1 132 ? -39.396 -11.006 -5.938  1.00 0.00 ? 132 VAL A C    1  
ATOM 2073  O O    . VAL A 1 132 ? -39.720 -10.276 -4.997  1.00 0.00 ? 132 VAL A O    1  
ATOM 2074  C CB   . VAL A 1 132 ? -37.133 -10.564 -7.085  1.00 0.00 ? 132 VAL A CB   1  
ATOM 2075  C CG1  . VAL A 1 132 ? -36.360 -9.715  -8.100  1.00 0.00 ? 132 VAL A CG1  1  
ATOM 2076  C CG2  . VAL A 1 132 ? -36.560 -10.235 -5.703  1.00 0.00 ? 132 VAL A CG2  1  
ATOM 2077  H H    . VAL A 1 132 ? -39.384 -8.475  -6.599  1.00 0.00 ? 132 VAL A H    1  
ATOM 2078  H HA   . VAL A 1 132 ? -39.002 -11.023 -8.018  1.00 0.00 ? 132 VAL A HA   1  
ATOM 2079  H HB   . VAL A 1 132 ? -36.893 -11.608 -7.287  1.00 0.00 ? 132 VAL A HB   1  
ATOM 2080  H HG11 . VAL A 1 132 ? -35.297 -9.942  -8.034  1.00 0.00 ? 132 VAL A HG11 1  
ATOM 2081  H HG12 . VAL A 1 132 ? -36.699 -9.935  -9.110  1.00 0.00 ? 132 VAL A HG12 1  
ATOM 2082  H HG13 . VAL A 1 132 ? -36.500 -8.656  -7.878  1.00 0.00 ? 132 VAL A HG13 1  
ATOM 2083  H HG21 . VAL A 1 132 ? -35.472 -10.295 -5.720  1.00 0.00 ? 132 VAL A HG21 1  
ATOM 2084  H HG22 . VAL A 1 132 ? -36.859 -9.229  -5.425  1.00 0.00 ? 132 VAL A HG22 1  
ATOM 2085  H HG23 . VAL A 1 132 ? -36.924 -10.944 -4.960  1.00 0.00 ? 132 VAL A HG23 1  
ATOM 2086  N N    . MET A 1 133 ? -39.658 -12.313 -5.948  1.00 0.00 ? 133 MET A N    1  
ATOM 2087  C CA   . MET A 1 133 ? -40.278 -13.060 -4.843  1.00 0.00 ? 133 MET A CA   1  
ATOM 2088  C C    . MET A 1 133 ? -39.651 -14.457 -4.697  1.00 0.00 ? 133 MET A C    1  
ATOM 2089  O O    . MET A 1 133 ? -39.166 -15.043 -5.668  1.00 0.00 ? 133 MET A O    1  
ATOM 2090  C CB   . MET A 1 133 ? -41.799 -13.187 -5.051  1.00 0.00 ? 133 MET A CB   1  
ATOM 2091  C CG   . MET A 1 133 ? -42.525 -11.833 -5.047  1.00 0.00 ? 133 MET A CG   1  
ATOM 2092  S SD   . MET A 1 133 ? -44.337 -11.929 -5.112  1.00 0.00 ? 133 MET A SD   1  
ATOM 2093  C CE   . MET A 1 133 ? -44.706 -12.476 -3.420  1.00 0.00 ? 133 MET A CE   1  
ATOM 2094  H H    . MET A 1 133 ? -39.383 -12.845 -6.761  1.00 0.00 ? 133 MET A H    1  
ATOM 2095  H HA   . MET A 1 133 ? -40.104 -12.525 -3.908  1.00 0.00 ? 133 MET A HA   1  
ATOM 2096  H HB2  . MET A 1 133 ? -41.997 -13.693 -5.997  1.00 0.00 ? 133 MET A HB2  1  
ATOM 2097  H HB3  . MET A 1 133 ? -42.207 -13.799 -4.247  1.00 0.00 ? 133 MET A HB3  1  
ATOM 2098  H HG2  . MET A 1 133 ? -42.238 -11.279 -4.152  1.00 0.00 ? 133 MET A HG2  1  
ATOM 2099  H HG3  . MET A 1 133 ? -42.195 -11.264 -5.915  1.00 0.00 ? 133 MET A HG3  1  
ATOM 2100  H HE1  . MET A 1 133 ? -44.295 -11.763 -2.705  1.00 0.00 ? 133 MET A HE1  1  
ATOM 2101  H HE2  . MET A 1 133 ? -45.786 -12.534 -3.285  1.00 0.00 ? 133 MET A HE2  1  
ATOM 2102  H HE3  . MET A 1 133 ? -44.273 -13.460 -3.241  1.00 0.00 ? 133 MET A HE3  1  
ATOM 2103  N N    . GLU A 1 134 ? -39.674 -15.001 -3.479  1.00 0.00 ? 134 GLU A N    1  
ATOM 2104  C CA   . GLU A 1 134 ? -39.172 -16.349 -3.164  1.00 0.00 ? 134 GLU A CA   1  
ATOM 2105  C C    . GLU A 1 134 ? -40.116 -17.466 -3.660  1.00 0.00 ? 134 GLU A C    1  
ATOM 2106  O O    . GLU A 1 134 ? -41.332 -17.269 -3.775  1.00 0.00 ? 134 GLU A O    1  
ATOM 2107  C CB   . GLU A 1 134 ? -38.925 -16.487 -1.651  1.00 0.00 ? 134 GLU A CB   1  
ATOM 2108  C CG   . GLU A 1 134 ? -37.888 -15.486 -1.123  1.00 0.00 ? 134 GLU A CG   1  
ATOM 2109  C CD   . GLU A 1 134 ? -37.548 -15.769 0.353   1.00 0.00 ? 134 GLU A CD   1  
ATOM 2110  O OE1  . GLU A 1 134 ? -38.274 -15.283 1.255   1.00 0.00 ? 134 GLU A OE1  1  
ATOM 2111  O OE2  . GLU A 1 134 ? -36.546 -16.477 0.626   1.00 0.00 ? 134 GLU A OE2  1  
ATOM 2112  H H    . GLU A 1 134 ? -40.087 -14.468 -2.729  1.00 0.00 ? 134 GLU A H    1  
ATOM 2113  H HA   . GLU A 1 134 ? -38.213 -16.487 -3.668  1.00 0.00 ? 134 GLU A HA   1  
ATOM 2114  H HB2  . GLU A 1 134 ? -39.866 -16.347 -1.116  1.00 0.00 ? 134 GLU A HB2  1  
ATOM 2115  H HB3  . GLU A 1 134 ? -38.564 -17.496 -1.450  1.00 0.00 ? 134 GLU A HB3  1  
ATOM 2116  H HG2  . GLU A 1 134 ? -36.986 -15.554 -1.736  1.00 0.00 ? 134 GLU A HG2  1  
ATOM 2117  H HG3  . GLU A 1 134 ? -38.278 -14.469 -1.221  1.00 0.00 ? 134 GLU A HG3  1  
ATOM 2118  N N    . LYS A 1 135 ? -39.553 -18.652 -3.934  1.00 0.00 ? 135 LYS A N    1  
ATOM 2119  C CA   . LYS A 1 135 ? -40.278 -19.861 -4.374  1.00 0.00 ? 135 LYS A CA   1  
ATOM 2120  C C    . LYS A 1 135 ? -40.835 -20.673 -3.194  1.00 0.00 ? 135 LYS A C    1  
ATOM 2121  O O    . LYS A 1 135 ? -40.088 -20.920 -2.219  1.00 0.00 ? 135 LYS A O    1  
ATOM 2122  C CB   . LYS A 1 135 ? -39.376 -20.724 -5.275  1.00 0.00 ? 135 LYS A CB   1  
ATOM 2123  C CG   . LYS A 1 135 ? -39.026 -20.030 -6.602  1.00 0.00 ? 135 LYS A CG   1  
ATOM 2124  C CD   . LYS A 1 135 ? -38.172 -20.947 -7.491  1.00 0.00 ? 135 LYS A CD   1  
ATOM 2125  C CE   . LYS A 1 135 ? -37.750 -20.269 -8.804  1.00 0.00 ? 135 LYS A CE   1  
ATOM 2126  N NZ   . LYS A 1 135 ? -38.892 -20.070 -9.736  1.00 0.00 ? 135 LYS A NZ   1  
ATOM 2127  H H    . LYS A 1 135 ? -38.559 -18.746 -3.779  1.00 0.00 ? 135 LYS A H    1  
ATOM 2128  H HA   . LYS A 1 135 ? -41.143 -19.557 -4.964  1.00 0.00 ? 135 LYS A HA   1  
ATOM 2129  H HB2  . LYS A 1 135 ? -38.457 -20.973 -4.740  1.00 0.00 ? 135 LYS A HB2  1  
ATOM 2130  H HB3  . LYS A 1 135 ? -39.901 -21.654 -5.499  1.00 0.00 ? 135 LYS A HB3  1  
ATOM 2131  H HG2  . LYS A 1 135 ? -39.951 -19.776 -7.121  1.00 0.00 ? 135 LYS A HG2  1  
ATOM 2132  H HG3  . LYS A 1 135 ? -38.470 -19.113 -6.402  1.00 0.00 ? 135 LYS A HG3  1  
ATOM 2133  H HD2  . LYS A 1 135 ? -37.267 -21.216 -6.943  1.00 0.00 ? 135 LYS A HD2  1  
ATOM 2134  H HD3  . LYS A 1 135 ? -38.719 -21.865 -7.711  1.00 0.00 ? 135 LYS A HD3  1  
ATOM 2135  H HE2  . LYS A 1 135 ? -37.279 -19.310 -8.571  1.00 0.00 ? 135 LYS A HE2  1  
ATOM 2136  H HE3  . LYS A 1 135 ? -36.996 -20.899 -9.285  1.00 0.00 ? 135 LYS A HE3  1  
ATOM 2137  H HZ1  . LYS A 1 135 ? -39.594 -19.460 -9.340  1.00 0.00 ? 135 LYS A HZ1  1  
ATOM 2138  H HZ2  . LYS A 1 135 ? -38.582 -19.651 -10.603 1.00 0.00 ? 135 LYS A HZ2  1  
ATOM 2139  H HZ3  . LYS A 1 135 ? -39.336 -20.948 -9.967  1.00 0.00 ? 135 LYS A HZ3  1  
ATOM 2140  N N    . MET A 1 1   ? -32.704 -10.437 8.178   1.00 0.00 ? 1   MET A N    2  
ATOM 2141  C CA   . MET A 1 1   ? -31.540 -9.916  7.413   1.00 0.00 ? 1   MET A CA   2  
ATOM 2142  C C    . MET A 1 1   ? -30.505 -11.028 7.189   1.00 0.00 ? 1   MET A C    2  
ATOM 2143  O O    . MET A 1 1   ? -30.243 -11.789 8.125   1.00 0.00 ? 1   MET A O    2  
ATOM 2144  C CB   . MET A 1 1   ? -30.904 -8.702  8.126   1.00 0.00 ? 1   MET A CB   2  
ATOM 2145  C CG   . MET A 1 1   ? -29.859 -7.977  7.264   1.00 0.00 ? 1   MET A CG   2  
ATOM 2146  S SD   . MET A 1 1   ? -29.122 -6.500  8.022   1.00 0.00 ? 1   MET A SD   2  
ATOM 2147  C CE   . MET A 1 1   ? -28.062 -7.267  9.281   1.00 0.00 ? 1   MET A CE   2  
ATOM 2148  H H1   . MET A 1 1   ? -33.391 -9.713  8.319   1.00 0.00 ? 1   MET A H1   2  
ATOM 2149  H H2   . MET A 1 1   ? -32.405 -10.777 9.081   1.00 0.00 ? 1   MET A H2   2  
ATOM 2150  H H3   . MET A 1 1   ? -33.141 -11.200 7.684   1.00 0.00 ? 1   MET A H3   2  
ATOM 2151  H HA   . MET A 1 1   ? -31.901 -9.579  6.442   1.00 0.00 ? 1   MET A HA   2  
ATOM 2152  H HB2  . MET A 1 1   ? -31.688 -7.982  8.371   1.00 0.00 ? 1   MET A HB2  2  
ATOM 2153  H HB3  . MET A 1 1   ? -30.440 -9.029  9.057   1.00 0.00 ? 1   MET A HB3  2  
ATOM 2154  H HG2  . MET A 1 1   ? -29.052 -8.665  7.013   1.00 0.00 ? 1   MET A HG2  2  
ATOM 2155  H HG3  . MET A 1 1   ? -30.340 -7.667  6.334   1.00 0.00 ? 1   MET A HG3  2  
ATOM 2156  H HE1  . MET A 1 1   ? -28.672 -7.800  10.010  1.00 0.00 ? 1   MET A HE1  2  
ATOM 2157  H HE2  . MET A 1 1   ? -27.370 -7.963  8.807   1.00 0.00 ? 1   MET A HE2  2  
ATOM 2158  H HE3  . MET A 1 1   ? -27.491 -6.492  9.796   1.00 0.00 ? 1   MET A HE3  2  
ATOM 2159  N N    . PRO A 1 2   ? -29.897 -11.142 5.988   1.00 0.00 ? 2   PRO A N    2  
ATOM 2160  C CA   . PRO A 1 2   ? -28.838 -12.120 5.706   1.00 0.00 ? 2   PRO A CA   2  
ATOM 2161  C C    . PRO A 1 2   ? -27.598 -11.974 6.607   1.00 0.00 ? 2   PRO A C    2  
ATOM 2162  O O    . PRO A 1 2   ? -27.269 -10.878 7.069   1.00 0.00 ? 2   PRO A O    2  
ATOM 2163  C CB   . PRO A 1 2   ? -28.474 -11.928 4.228   1.00 0.00 ? 2   PRO A CB   2  
ATOM 2164  C CG   . PRO A 1 2   ? -29.744 -11.332 3.626   1.00 0.00 ? 2   PRO A CG   2  
ATOM 2165  C CD   . PRO A 1 2   ? -30.259 -10.446 4.758   1.00 0.00 ? 2   PRO A CD   2  
ATOM 2166  H HA   . PRO A 1 2   ? -29.254 -13.121 5.835   1.00 0.00 ? 2   PRO A HA   2  
ATOM 2167  H HB2  . PRO A 1 2   ? -27.659 -11.209 4.130   1.00 0.00 ? 2   PRO A HB2  2  
ATOM 2168  H HB3  . PRO A 1 2   ? -28.207 -12.873 3.752   1.00 0.00 ? 2   PRO A HB3  2  
ATOM 2169  H HG2  . PRO A 1 2   ? -29.536 -10.758 2.723   1.00 0.00 ? 2   PRO A HG2  2  
ATOM 2170  H HG3  . PRO A 1 2   ? -30.464 -12.127 3.423   1.00 0.00 ? 2   PRO A HG3  2  
ATOM 2171  H HD2  . PRO A 1 2   ? -29.755 -9.479  4.722   1.00 0.00 ? 2   PRO A HD2  2  
ATOM 2172  H HD3  . PRO A 1 2   ? -31.337 -10.318 4.657   1.00 0.00 ? 2   PRO A HD3  2  
ATOM 2173  N N    . VAL A 1 3   ? -26.891 -13.085 6.833   1.00 0.00 ? 3   VAL A N    2  
ATOM 2174  C CA   . VAL A 1 3   ? -25.666 -13.168 7.652   1.00 0.00 ? 3   VAL A CA   2  
ATOM 2175  C C    . VAL A 1 3   ? -24.728 -14.266 7.125   1.00 0.00 ? 3   VAL A C    2  
ATOM 2176  O O    . VAL A 1 3   ? -25.186 -15.255 6.545   1.00 0.00 ? 3   VAL A O    2  
ATOM 2177  C CB   . VAL A 1 3   ? -26.035 -13.368 9.143   1.00 0.00 ? 3   VAL A CB   2  
ATOM 2178  C CG1  . VAL A 1 3   ? -26.674 -14.731 9.444   1.00 0.00 ? 3   VAL A CG1  2  
ATOM 2179  C CG2  . VAL A 1 3   ? -24.838 -13.164 10.078  1.00 0.00 ? 3   VAL A CG2  2  
ATOM 2180  H H    . VAL A 1 3   ? -27.208 -13.943 6.401   1.00 0.00 ? 3   VAL A H    2  
ATOM 2181  H HA   . VAL A 1 3   ? -25.137 -12.219 7.567   1.00 0.00 ? 3   VAL A HA   2  
ATOM 2182  H HB   . VAL A 1 3   ? -26.766 -12.603 9.404   1.00 0.00 ? 3   VAL A HB   2  
ATOM 2183  H HG11 . VAL A 1 3   ? -26.989 -14.762 10.487  1.00 0.00 ? 3   VAL A HG11 2  
ATOM 2184  H HG12 . VAL A 1 3   ? -27.552 -14.879 8.815   1.00 0.00 ? 3   VAL A HG12 2  
ATOM 2185  H HG13 . VAL A 1 3   ? -25.962 -15.537 9.267   1.00 0.00 ? 3   VAL A HG13 2  
ATOM 2186  H HG21 . VAL A 1 3   ? -24.112 -13.968 9.960   1.00 0.00 ? 3   VAL A HG21 2  
ATOM 2187  H HG22 . VAL A 1 3   ? -24.364 -12.205 9.871   1.00 0.00 ? 3   VAL A HG22 2  
ATOM 2188  H HG23 . VAL A 1 3   ? -25.184 -13.160 11.113  1.00 0.00 ? 3   VAL A HG23 2  
ATOM 2189  N N    . ARG A 1 4   ? -23.411 -14.106 7.317   1.00 0.00 ? 4   ARG A N    2  
ATOM 2190  C CA   . ARG A 1 4   ? -22.399 -15.112 6.940   1.00 0.00 ? 4   ARG A CA   2  
ATOM 2191  C C    . ARG A 1 4   ? -22.461 -16.323 7.884   1.00 0.00 ? 4   ARG A C    2  
ATOM 2192  O O    . ARG A 1 4   ? -22.534 -16.159 9.105   1.00 0.00 ? 4   ARG A O    2  
ATOM 2193  C CB   . ARG A 1 4   ? -20.984 -14.498 6.914   1.00 0.00 ? 4   ARG A CB   2  
ATOM 2194  C CG   . ARG A 1 4   ? -20.692 -13.627 5.678   1.00 0.00 ? 4   ARG A CG   2  
ATOM 2195  C CD   . ARG A 1 4   ? -21.268 -12.207 5.762   1.00 0.00 ? 4   ARG A CD   2  
ATOM 2196  N NE   . ARG A 1 4   ? -20.851 -11.393 4.603   1.00 0.00 ? 4   ARG A NE   2  
ATOM 2197  C CZ   . ARG A 1 4   ? -21.112 -10.113 4.398   1.00 0.00 ? 4   ARG A CZ   2  
ATOM 2198  N NH1  . ARG A 1 4   ? -21.796 -9.398  5.246   1.00 0.00 ? 4   ARG A NH1  2  
ATOM 2199  N NH2  . ARG A 1 4   ? -20.683 -9.519  3.321   1.00 0.00 ? 4   ARG A NH2  2  
ATOM 2200  H H    . ARG A 1 4   ? -23.105 -13.294 7.835   1.00 0.00 ? 4   ARG A H    2  
ATOM 2201  H HA   . ARG A 1 4   ? -22.628 -15.480 5.937   1.00 0.00 ? 4   ARG A HA   2  
ATOM 2202  H HB2  . ARG A 1 4   ? -20.800 -13.930 7.828   1.00 0.00 ? 4   ARG A HB2  2  
ATOM 2203  H HB3  . ARG A 1 4   ? -20.267 -15.320 6.894   1.00 0.00 ? 4   ARG A HB3  2  
ATOM 2204  H HG2  . ARG A 1 4   ? -19.609 -13.540 5.584   1.00 0.00 ? 4   ARG A HG2  2  
ATOM 2205  H HG3  . ARG A 1 4   ? -21.067 -14.123 4.783   1.00 0.00 ? 4   ARG A HG3  2  
ATOM 2206  H HD2  . ARG A 1 4   ? -22.357 -12.262 5.783   1.00 0.00 ? 4   ARG A HD2  2  
ATOM 2207  H HD3  . ARG A 1 4   ? -20.915 -11.739 6.683   1.00 0.00 ? 4   ARG A HD3  2  
ATOM 2208  H HE   . ARG A 1 4   ? -20.314 -11.857 3.888   1.00 0.00 ? 4   ARG A HE   2  
ATOM 2209  H HH11 . ARG A 1 4   ? -22.136 -9.826  6.089   1.00 0.00 ? 4   ARG A HH11 2  
ATOM 2210  H HH12 . ARG A 1 4   ? -21.978 -8.425  5.066   1.00 0.00 ? 4   ARG A HH12 2  
ATOM 2211  H HH21 . ARG A 1 4   ? -20.150 -10.031 2.638   1.00 0.00 ? 4   ARG A HH21 2  
ATOM 2212  H HH22 . ARG A 1 4   ? -20.881 -8.544  3.166   1.00 0.00 ? 4   ARG A HH22 2  
ATOM 2213  N N    . ARG A 1 5   ? -22.433 -17.532 7.313   1.00 0.00 ? 5   ARG A N    2  
ATOM 2214  C CA   . ARG A 1 5   ? -22.551 -18.828 8.016   1.00 0.00 ? 5   ARG A CA   2  
ATOM 2215  C C    . ARG A 1 5   ? -21.854 -19.968 7.256   1.00 0.00 ? 5   ARG A C    2  
ATOM 2216  O O    . ARG A 1 5   ? -21.481 -19.810 6.092   1.00 0.00 ? 5   ARG A O    2  
ATOM 2217  C CB   . ARG A 1 5   ? -24.046 -19.135 8.271   1.00 0.00 ? 5   ARG A CB   2  
ATOM 2218  C CG   . ARG A 1 5   ? -24.852 -19.356 6.981   1.00 0.00 ? 5   ARG A CG   2  
ATOM 2219  C CD   . ARG A 1 5   ? -26.303 -19.750 7.274   1.00 0.00 ? 5   ARG A CD   2  
ATOM 2220  N NE   . ARG A 1 5   ? -26.970 -20.198 6.038   1.00 0.00 ? 5   ARG A NE   2  
ATOM 2221  C CZ   . ARG A 1 5   ? -28.263 -20.376 5.843   1.00 0.00 ? 5   ARG A CZ   2  
ATOM 2222  N NH1  . ARG A 1 5   ? -29.143 -20.179 6.782   1.00 0.00 ? 5   ARG A NH1  2  
ATOM 2223  N NH2  . ARG A 1 5   ? -28.695 -20.768 4.680   1.00 0.00 ? 5   ARG A NH2  2  
ATOM 2224  H H    . ARG A 1 5   ? -22.331 -17.561 6.307   1.00 0.00 ? 5   ARG A H    2  
ATOM 2225  H HA   . ARG A 1 5   ? -22.054 -18.748 8.986   1.00 0.00 ? 5   ARG A HA   2  
ATOM 2226  H HB2  . ARG A 1 5   ? -24.121 -20.031 8.891   1.00 0.00 ? 5   ARG A HB2  2  
ATOM 2227  H HB3  . ARG A 1 5   ? -24.492 -18.312 8.831   1.00 0.00 ? 5   ARG A HB3  2  
ATOM 2228  H HG2  . ARG A 1 5   ? -24.849 -18.446 6.379   1.00 0.00 ? 5   ARG A HG2  2  
ATOM 2229  H HG3  . ARG A 1 5   ? -24.388 -20.154 6.407   1.00 0.00 ? 5   ARG A HG3  2  
ATOM 2230  H HD2  . ARG A 1 5   ? -26.314 -20.566 8.001   1.00 0.00 ? 5   ARG A HD2  2  
ATOM 2231  H HD3  . ARG A 1 5   ? -26.821 -18.888 7.698   1.00 0.00 ? 5   ARG A HD3  2  
ATOM 2232  H HE   . ARG A 1 5   ? -26.362 -20.440 5.262   1.00 0.00 ? 5   ARG A HE   2  
ATOM 2233  H HH11 . ARG A 1 5   ? -28.832 -19.888 7.694   1.00 0.00 ? 5   ARG A HH11 2  
ATOM 2234  H HH12 . ARG A 1 5   ? -30.123 -20.324 6.608   1.00 0.00 ? 5   ARG A HH12 2  
ATOM 2235  H HH21 . ARG A 1 5   ? -28.046 -20.888 3.921   1.00 0.00 ? 5   ARG A HH21 2  
ATOM 2236  H HH22 . ARG A 1 5   ? -29.681 -20.889 4.520   1.00 0.00 ? 5   ARG A HH22 2  
ATOM 2237  N N    . GLY A 1 6   ? -21.725 -21.130 7.897   1.00 0.00 ? 6   GLY A N    2  
ATOM 2238  C CA   . GLY A 1 6   ? -21.091 -22.339 7.342   1.00 0.00 ? 6   GLY A CA   2  
ATOM 2239  C C    . GLY A 1 6   ? -21.964 -23.205 6.413   1.00 0.00 ? 6   GLY A C    2  
ATOM 2240  O O    . GLY A 1 6   ? -21.550 -24.314 6.067   1.00 0.00 ? 6   GLY A O    2  
ATOM 2241  H H    . GLY A 1 6   ? -22.056 -21.175 8.849   1.00 0.00 ? 6   GLY A H    2  
ATOM 2242  H HA2  . GLY A 1 6   ? -20.202 -22.047 6.782   1.00 0.00 ? 6   GLY A HA2  2  
ATOM 2243  H HA3  . GLY A 1 6   ? -20.766 -22.969 8.171   1.00 0.00 ? 6   GLY A HA3  2  
ATOM 2244  N N    . HIS A 1 7   ? -23.164 -22.748 6.025   1.00 0.00 ? 7   HIS A N    2  
ATOM 2245  C CA   . HIS A 1 7   ? -24.140 -23.505 5.219   1.00 0.00 ? 7   HIS A CA   2  
ATOM 2246  C C    . HIS A 1 7   ? -24.748 -22.668 4.081   1.00 0.00 ? 7   HIS A C    2  
ATOM 2247  O O    . HIS A 1 7   ? -25.078 -21.496 4.271   1.00 0.00 ? 7   HIS A O    2  
ATOM 2248  C CB   . HIS A 1 7   ? -25.238 -24.054 6.143   1.00 0.00 ? 7   HIS A CB   2  
ATOM 2249  C CG   . HIS A 1 7   ? -26.233 -24.938 5.428   1.00 0.00 ? 7   HIS A CG   2  
ATOM 2250  N ND1  . HIS A 1 7   ? -26.026 -26.280 5.100   1.00 0.00 ? 7   HIS A ND1  2  
ATOM 2251  C CD2  . HIS A 1 7   ? -27.465 -24.558 4.976   1.00 0.00 ? 7   HIS A CD2  2  
ATOM 2252  C CE1  . HIS A 1 7   ? -27.138 -26.679 4.457   1.00 0.00 ? 7   HIS A CE1  2  
ATOM 2253  N NE2  . HIS A 1 7   ? -28.018 -25.667 4.373   1.00 0.00 ? 7   HIS A NE2  2  
ATOM 2254  H H    . HIS A 1 7   ? -23.425 -21.819 6.315   1.00 0.00 ? 7   HIS A H    2  
ATOM 2255  H HA   . HIS A 1 7   ? -23.641 -24.359 4.758   1.00 0.00 ? 7   HIS A HA   2  
ATOM 2256  H HB2  . HIS A 1 7   ? -24.774 -24.638 6.940   1.00 0.00 ? 7   HIS A HB2  2  
ATOM 2257  H HB3  . HIS A 1 7   ? -25.772 -23.223 6.605   1.00 0.00 ? 7   HIS A HB3  2  
ATOM 2258  H HD2  . HIS A 1 7   ? -27.912 -23.576 5.065   1.00 0.00 ? 7   HIS A HD2  2  
ATOM 2259  H HE1  . HIS A 1 7   ? -27.304 -27.675 4.062   1.00 0.00 ? 7   HIS A HE1  2  
ATOM 2260  H HE2  . HIS A 1 7   ? -28.928 -25.721 3.927   1.00 0.00 ? 7   HIS A HE2  2  
ATOM 2261  N N    . VAL A 1 8   ? -24.952 -23.288 2.915   1.00 0.00 ? 8   VAL A N    2  
ATOM 2262  C CA   . VAL A 1 8   ? -25.548 -22.671 1.714   1.00 0.00 ? 8   VAL A CA   2  
ATOM 2263  C C    . VAL A 1 8   ? -26.833 -23.422 1.335   1.00 0.00 ? 8   VAL A C    2  
ATOM 2264  O O    . VAL A 1 8   ? -26.889 -24.651 1.422   1.00 0.00 ? 8   VAL A O    2  
ATOM 2265  C CB   . VAL A 1 8   ? -24.545 -22.638 0.530   1.00 0.00 ? 8   VAL A CB   2  
ATOM 2266  C CG1  . VAL A 1 8   ? -25.058 -21.785 -0.638  1.00 0.00 ? 8   VAL A CG1  2  
ATOM 2267  C CG2  . VAL A 1 8   ? -23.189 -22.045 0.945   1.00 0.00 ? 8   VAL A CG2  2  
ATOM 2268  H H    . VAL A 1 8   ? -24.720 -24.271 2.857   1.00 0.00 ? 8   VAL A H    2  
ATOM 2269  H HA   . VAL A 1 8   ? -25.816 -21.638 1.938   1.00 0.00 ? 8   VAL A HA   2  
ATOM 2270  H HB   . VAL A 1 8   ? -24.379 -23.655 0.174   1.00 0.00 ? 8   VAL A HB   2  
ATOM 2271  H HG11 . VAL A 1 8   ? -25.978 -22.197 -1.043  1.00 0.00 ? 8   VAL A HG11 2  
ATOM 2272  H HG12 . VAL A 1 8   ? -25.241 -20.761 -0.308  1.00 0.00 ? 8   VAL A HG12 2  
ATOM 2273  H HG13 . VAL A 1 8   ? -24.320 -21.772 -1.439  1.00 0.00 ? 8   VAL A HG13 2  
ATOM 2274  H HG21 . VAL A 1 8   ? -23.328 -21.050 1.367   1.00 0.00 ? 8   VAL A HG21 2  
ATOM 2275  H HG22 . VAL A 1 8   ? -22.706 -22.685 1.684   1.00 0.00 ? 8   VAL A HG22 2  
ATOM 2276  H HG23 . VAL A 1 8   ? -22.530 -21.981 0.080   1.00 0.00 ? 8   VAL A HG23 2  
ATOM 2277  N N    . ALA A 1 9   ? -27.866 -22.690 0.904   1.00 0.00 ? 9   ALA A N    2  
ATOM 2278  C CA   . ALA A 1 9   ? -29.093 -23.260 0.331   1.00 0.00 ? 9   ALA A CA   2  
ATOM 2279  C C    . ALA A 1 9   ? -28.795 -24.128 -0.921  1.00 0.00 ? 9   ALA A C    2  
ATOM 2280  O O    . ALA A 1 9   ? -27.730 -23.956 -1.525  1.00 0.00 ? 9   ALA A O    2  
ATOM 2281  C CB   . ALA A 1 9   ? -30.029 -22.087 0.004   1.00 0.00 ? 9   ALA A CB   2  
ATOM 2282  H H    . ALA A 1 9   ? -27.747 -21.691 0.839   1.00 0.00 ? 9   ALA A H    2  
ATOM 2283  H HA   . ALA A 1 9   ? -29.574 -23.888 1.082   1.00 0.00 ? 9   ALA A HA   2  
ATOM 2284  H HB1  . ALA A 1 9   ? -30.239 -21.516 0.909   1.00 0.00 ? 9   ALA A HB1  2  
ATOM 2285  H HB2  . ALA A 1 9   ? -29.560 -21.433 -0.733  1.00 0.00 ? 9   ALA A HB2  2  
ATOM 2286  H HB3  . ALA A 1 9   ? -30.971 -22.452 -0.402  1.00 0.00 ? 9   ALA A HB3  2  
ATOM 2287  N N    . PRO A 1 10  ? -29.707 -25.032 -1.348  1.00 0.00 ? 10  PRO A N    2  
ATOM 2288  C CA   . PRO A 1 10  ? -29.580 -25.828 -2.577  1.00 0.00 ? 10  PRO A CA   2  
ATOM 2289  C C    . PRO A 1 10  ? -29.054 -24.999 -3.757  1.00 0.00 ? 10  PRO A C    2  
ATOM 2290  O O    . PRO A 1 10  ? -29.715 -24.101 -4.275  1.00 0.00 ? 10  PRO A O    2  
ATOM 2291  C CB   . PRO A 1 10  ? -30.961 -26.431 -2.826  1.00 0.00 ? 10  PRO A CB   2  
ATOM 2292  C CG   . PRO A 1 10  ? -31.517 -26.589 -1.411  1.00 0.00 ? 10  PRO A CG   2  
ATOM 2293  C CD   . PRO A 1 10  ? -30.941 -25.388 -0.659  1.00 0.00 ? 10  PRO A CD   2  
ATOM 2294  H HA   . PRO A 1 10  ? -28.884 -26.643 -2.375  1.00 0.00 ? 10  PRO A HA   2  
ATOM 2295  H HB2  . PRO A 1 10  ? -31.574 -25.731 -3.390  1.00 0.00 ? 10  PRO A HB2  2  
ATOM 2296  H HB3  . PRO A 1 10  ? -30.898 -27.388 -3.346  1.00 0.00 ? 10  PRO A HB3  2  
ATOM 2297  H HG2  . PRO A 1 10  ? -32.607 -26.585 -1.403  1.00 0.00 ? 10  PRO A HG2  2  
ATOM 2298  H HG3  . PRO A 1 10  ? -31.134 -27.511 -0.972  1.00 0.00 ? 10  PRO A HG3  2  
ATOM 2299  H HD2  . PRO A 1 10  ? -31.638 -24.552 -0.699  1.00 0.00 ? 10  PRO A HD2  2  
ATOM 2300  H HD3  . PRO A 1 10  ? -30.750 -25.662 0.379   1.00 0.00 ? 10  PRO A HD3  2  
ATOM 2301  N N    . GLN A 1 11  ? -27.821 -25.285 -4.162  1.00 0.00 ? 11  GLN A N    2  
ATOM 2302  C CA   . GLN A 1 11  ? -27.021 -24.432 -5.046  1.00 0.00 ? 11  GLN A CA   2  
ATOM 2303  C C    . GLN A 1 11  ? -27.640 -24.172 -6.427  1.00 0.00 ? 11  GLN A C    2  
ATOM 2304  O O    . GLN A 1 11  ? -27.439 -23.098 -6.990  1.00 0.00 ? 11  GLN A O    2  
ATOM 2305  C CB   . GLN A 1 11  ? -25.575 -24.959 -5.122  1.00 0.00 ? 11  GLN A CB   2  
ATOM 2306  C CG   . GLN A 1 11  ? -25.347 -26.198 -6.004  1.00 0.00 ? 11  GLN A CG   2  
ATOM 2307  C CD   . GLN A 1 11  ? -26.119 -27.447 -5.574  1.00 0.00 ? 11  GLN A CD   2  
ATOM 2308  O OE1  . GLN A 1 11  ? -26.257 -27.763 -4.398  1.00 0.00 ? 11  GLN A OE1  2  
ATOM 2309  N NE2  . GLN A 1 11  ? -26.694 -28.183 -6.501  1.00 0.00 ? 11  GLN A NE2  2  
ATOM 2310  H H    . GLN A 1 11  ? -27.376 -26.070 -3.714  1.00 0.00 ? 11  GLN A H    2  
ATOM 2311  H HA   . GLN A 1 11  ? -26.954 -23.463 -4.554  1.00 0.00 ? 11  GLN A HA   2  
ATOM 2312  H HB2  . GLN A 1 11  ? -24.950 -24.157 -5.519  1.00 0.00 ? 11  GLN A HB2  2  
ATOM 2313  H HB3  . GLN A 1 11  ? -25.218 -25.168 -4.111  1.00 0.00 ? 11  GLN A HB3  2  
ATOM 2314  H HG2  . GLN A 1 11  ? -25.594 -25.950 -7.036  1.00 0.00 ? 11  GLN A HG2  2  
ATOM 2315  H HG3  . GLN A 1 11  ? -24.284 -26.437 -5.969  1.00 0.00 ? 11  GLN A HG3  2  
ATOM 2316  H HE21 . GLN A 1 11  ? -26.649 -27.910 -7.478  1.00 0.00 ? 11  GLN A HE21 2  
ATOM 2317  H HE22 . GLN A 1 11  ? -27.187 -29.014 -6.213  1.00 0.00 ? 11  GLN A HE22 2  
ATOM 2318  N N    . ASN A 1 12  ? -28.446 -25.102 -6.949  1.00 0.00 ? 12  ASN A N    2  
ATOM 2319  C CA   . ASN A 1 12  ? -29.096 -24.974 -8.255  1.00 0.00 ? 12  ASN A CA   2  
ATOM 2320  C C    . ASN A 1 12  ? -30.134 -23.834 -8.233  1.00 0.00 ? 12  ASN A C    2  
ATOM 2321  O O    . ASN A 1 12  ? -30.126 -22.958 -9.097  1.00 0.00 ? 12  ASN A O    2  
ATOM 2322  C CB   . ASN A 1 12  ? -29.736 -26.326 -8.637  1.00 0.00 ? 12  ASN A CB   2  
ATOM 2323  C CG   . ASN A 1 12  ? -28.748 -27.344 -9.196  1.00 0.00 ? 12  ASN A CG   2  
ATOM 2324  O OD1  . ASN A 1 12  ? -27.535 -27.183 -9.167  1.00 0.00 ? 12  ASN A OD1  2  
ATOM 2325  N ND2  . ASN A 1 12  ? -29.239 -28.450 -9.706  1.00 0.00 ? 12  ASN A ND2  2  
ATOM 2326  H H    . ASN A 1 12  ? -28.601 -25.947 -6.417  1.00 0.00 ? 12  ASN A H    2  
ATOM 2327  H HA   . ASN A 1 12  ? -28.351 -24.707 -9.009  1.00 0.00 ? 12  ASN A HA   2  
ATOM 2328  H HB2  . ASN A 1 12  ? -30.256 -26.761 -7.784  1.00 0.00 ? 12  ASN A HB2  2  
ATOM 2329  H HB3  . ASN A 1 12  ? -30.477 -26.146 -9.417  1.00 0.00 ? 12  ASN A HB3  2  
ATOM 2330  H HD21 . ASN A 1 12  ? -30.237 -28.603 -9.733  1.00 0.00 ? 12  ASN A HD21 2  
ATOM 2331  H HD22 . ASN A 1 12  ? -28.597 -29.130 -10.083 1.00 0.00 ? 12  ASN A HD22 2  
ATOM 2332  N N    . THR A 1 13  ? -31.019 -23.826 -7.230  1.00 0.00 ? 13  THR A N    2  
ATOM 2333  C CA   . THR A 1 13  ? -32.081 -22.813 -7.069  1.00 0.00 ? 13  THR A CA   2  
ATOM 2334  C C    . THR A 1 13  ? -31.553 -21.500 -6.468  1.00 0.00 ? 13  THR A C    2  
ATOM 2335  O O    . THR A 1 13  ? -31.959 -20.402 -6.856  1.00 0.00 ? 13  THR A O    2  
ATOM 2336  C CB   . THR A 1 13  ? -33.229 -23.416 -6.249  1.00 0.00 ? 13  THR A CB   2  
ATOM 2337  O OG1  . THR A 1 13  ? -34.451 -22.796 -6.584  1.00 0.00 ? 13  THR A OG1  2  
ATOM 2338  C CG2  . THR A 1 13  ? -33.027 -23.320 -4.739  1.00 0.00 ? 13  THR A CG2  2  
ATOM 2339  H H    . THR A 1 13  ? -30.944 -24.557 -6.535  1.00 0.00 ? 13  THR A H    2  
ATOM 2340  H HA   . THR A 1 13  ? -32.482 -22.587 -8.055  1.00 0.00 ? 13  THR A HA   2  
ATOM 2341  H HB   . THR A 1 13  ? -33.301 -24.472 -6.510  1.00 0.00 ? 13  THR A HB   2  
ATOM 2342  H HG1  . THR A 1 13  ? -35.157 -23.345 -6.196  1.00 0.00 ? 13  THR A HG1  2  
ATOM 2343  H HG21 . THR A 1 13  ? -33.791 -23.900 -4.223  1.00 0.00 ? 13  THR A HG21 2  
ATOM 2344  H HG22 . THR A 1 13  ? -32.048 -23.722 -4.490  1.00 0.00 ? 13  THR A HG22 2  
ATOM 2345  H HG23 . THR A 1 13  ? -33.069 -22.280 -4.415  1.00 0.00 ? 13  THR A HG23 2  
ATOM 2346  N N    . PHE A 1 14  ? -30.564 -21.599 -5.573  1.00 0.00 ? 14  PHE A N    2  
ATOM 2347  C CA   . PHE A 1 14  ? -29.814 -20.457 -5.051  1.00 0.00 ? 14  PHE A CA   2  
ATOM 2348  C C    . PHE A 1 14  ? -29.139 -19.691 -6.195  1.00 0.00 ? 14  PHE A C    2  
ATOM 2349  O O    . PHE A 1 14  ? -29.176 -18.460 -6.226  1.00 0.00 ? 14  PHE A O    2  
ATOM 2350  C CB   . PHE A 1 14  ? -28.790 -20.990 -4.046  1.00 0.00 ? 14  PHE A CB   2  
ATOM 2351  C CG   . PHE A 1 14  ? -27.999 -19.927 -3.308  1.00 0.00 ? 14  PHE A CG   2  
ATOM 2352  C CD1  . PHE A 1 14  ? -28.628 -19.133 -2.331  1.00 0.00 ? 14  PHE A CD1  2  
ATOM 2353  C CD2  . PHE A 1 14  ? -26.630 -19.742 -3.585  1.00 0.00 ? 14  PHE A CD2  2  
ATOM 2354  C CE1  . PHE A 1 14  ? -27.892 -18.159 -1.632  1.00 0.00 ? 14  PHE A CE1  2  
ATOM 2355  C CE2  . PHE A 1 14  ? -25.895 -18.766 -2.887  1.00 0.00 ? 14  PHE A CE2  2  
ATOM 2356  C CZ   . PHE A 1 14  ? -26.526 -17.975 -1.910  1.00 0.00 ? 14  PHE A CZ   2  
ATOM 2357  H H    . PHE A 1 14  ? -30.289 -22.524 -5.258  1.00 0.00 ? 14  PHE A H    2  
ATOM 2358  H HA   . PHE A 1 14  ? -30.501 -19.779 -4.541  1.00 0.00 ? 14  PHE A HA   2  
ATOM 2359  H HB2  . PHE A 1 14  ? -29.315 -21.603 -3.316  1.00 0.00 ? 14  PHE A HB2  2  
ATOM 2360  H HB3  . PHE A 1 14  ? -28.100 -21.641 -4.577  1.00 0.00 ? 14  PHE A HB3  2  
ATOM 2361  H HD1  . PHE A 1 14  ? -29.679 -19.270 -2.114  1.00 0.00 ? 14  PHE A HD1  2  
ATOM 2362  H HD2  . PHE A 1 14  ? -26.138 -20.349 -4.332  1.00 0.00 ? 14  PHE A HD2  2  
ATOM 2363  H HE1  . PHE A 1 14  ? -28.378 -17.550 -0.880  1.00 0.00 ? 14  PHE A HE1  2  
ATOM 2364  H HE2  . PHE A 1 14  ? -24.843 -18.626 -3.100  1.00 0.00 ? 14  PHE A HE2  2  
ATOM 2365  H HZ   . PHE A 1 14  ? -25.960 -17.226 -1.372  1.00 0.00 ? 14  PHE A HZ   2  
ATOM 2366  N N    . LEU A 1 15  ? -28.601 -20.423 -7.178  1.00 0.00 ? 15  LEU A N    2  
ATOM 2367  C CA   . LEU A 1 15  ? -28.094 -19.841 -8.426  1.00 0.00 ? 15  LEU A CA   2  
ATOM 2368  C C    . LEU A 1 15  ? -29.228 -19.311 -9.316  1.00 0.00 ? 15  LEU A C    2  
ATOM 2369  O O    . LEU A 1 15  ? -29.127 -18.191 -9.794  1.00 0.00 ? 15  LEU A O    2  
ATOM 2370  C CB   . LEU A 1 15  ? -27.194 -20.843 -9.172  1.00 0.00 ? 15  LEU A CB   2  
ATOM 2371  C CG   . LEU A 1 15  ? -26.757 -20.367 -10.572 1.00 0.00 ? 15  LEU A CG   2  
ATOM 2372  C CD1  . LEU A 1 15  ? -26.009 -19.030 -10.558 1.00 0.00 ? 15  LEU A CD1  2  
ATOM 2373  C CD2  . LEU A 1 15  ? -25.852 -21.414 -11.220 1.00 0.00 ? 15  LEU A CD2  2  
ATOM 2374  H H    . LEU A 1 15  ? -28.609 -21.435 -7.059  1.00 0.00 ? 15  LEU A H    2  
ATOM 2375  H HA   . LEU A 1 15  ? -27.476 -18.982 -8.161  1.00 0.00 ? 15  LEU A HA   2  
ATOM 2376  H HB2  . LEU A 1 15  ? -26.308 -21.037 -8.565  1.00 0.00 ? 15  LEU A HB2  2  
ATOM 2377  H HB3  . LEU A 1 15  ? -27.736 -21.780 -9.294  1.00 0.00 ? 15  LEU A HB3  2  
ATOM 2378  H HG   . LEU A 1 15  ? -27.648 -20.262 -11.189 1.00 0.00 ? 15  LEU A HG   2  
ATOM 2379  H HD11 . LEU A 1 15  ? -25.764 -18.733 -11.578 1.00 0.00 ? 15  LEU A HD11 2  
ATOM 2380  H HD12 . LEU A 1 15  ? -26.638 -18.251 -10.136 1.00 0.00 ? 15  LEU A HD12 2  
ATOM 2381  H HD13 . LEU A 1 15  ? -25.100 -19.108 -9.962  1.00 0.00 ? 15  LEU A HD13 2  
ATOM 2382  H HD21 . LEU A 1 15  ? -25.587 -21.095 -12.228 1.00 0.00 ? 15  LEU A HD21 2  
ATOM 2383  H HD22 . LEU A 1 15  ? -24.944 -21.541 -10.632 1.00 0.00 ? 15  LEU A HD22 2  
ATOM 2384  H HD23 . LEU A 1 15  ? -26.378 -22.367 -11.281 1.00 0.00 ? 15  LEU A HD23 2  
ATOM 2385  N N    . ASP A 1 16  ? -30.317 -20.051 -9.519  1.00 0.00 ? 16  ASP A N    2  
ATOM 2386  C CA   . ASP A 1 16  ? -31.520 -19.604 -10.249 1.00 0.00 ? 16  ASP A CA   2  
ATOM 2387  C C    . ASP A 1 16  ? -31.993 -18.206 -9.824  1.00 0.00 ? 16  ASP A C    2  
ATOM 2388  O O    . ASP A 1 16  ? -32.357 -17.391 -10.665 1.00 0.00 ? 16  ASP A O    2  
ATOM 2389  C CB   . ASP A 1 16  ? -32.657 -20.611 -10.068 1.00 0.00 ? 16  ASP A CB   2  
ATOM 2390  C CG   . ASP A 1 16  ? -33.874 -20.291 -10.947 1.00 0.00 ? 16  ASP A CG   2  
ATOM 2391  O OD1  . ASP A 1 16  ? -33.759 -20.335 -12.195 1.00 0.00 ? 16  ASP A OD1  2  
ATOM 2392  O OD2  . ASP A 1 16  ? -34.955 -20.021 -10.370 1.00 0.00 ? 16  ASP A OD2  2  
ATOM 2393  H H    . ASP A 1 16  ? -30.287 -21.006 -9.196  1.00 0.00 ? 16  ASP A H    2  
ATOM 2394  H HA   . ASP A 1 16  ? -31.281 -19.564 -11.310 1.00 0.00 ? 16  ASP A HA   2  
ATOM 2395  H HB2  . ASP A 1 16  ? -32.281 -21.604 -10.296 1.00 0.00 ? 16  ASP A HB2  2  
ATOM 2396  H HB3  . ASP A 1 16  ? -32.979 -20.612 -9.033  1.00 0.00 ? 16  ASP A HB3  2  
ATOM 2397  N N    . THR A 1 17  ? -31.942 -17.897 -8.528  1.00 0.00 ? 17  THR A N    2  
ATOM 2398  C CA   . THR A 1 17  ? -32.242 -16.531 -8.042  1.00 0.00 ? 17  THR A CA   2  
ATOM 2399  C C    . THR A 1 17  ? -31.303 -15.489 -8.665  1.00 0.00 ? 17  THR A C    2  
ATOM 2400  O O    . THR A 1 17  ? -31.750 -14.453 -9.166  1.00 0.00 ? 17  THR A O    2  
ATOM 2401  C CB   . THR A 1 17  ? -32.159 -16.447 -6.507  1.00 0.00 ? 17  THR A CB   2  
ATOM 2402  O OG1  . THR A 1 17  ? -33.131 -17.280 -5.921  1.00 0.00 ? 17  THR A OG1  2  
ATOM 2403  C CG2  . THR A 1 17  ? -32.408 -15.044 -5.951  1.00 0.00 ? 17  THR A CG2  2  
ATOM 2404  H H    . THR A 1 17  ? -31.612 -18.624 -7.895  1.00 0.00 ? 17  THR A H    2  
ATOM 2405  H HA   . THR A 1 17  ? -33.253 -16.274 -8.358  1.00 0.00 ? 17  THR A HA   2  
ATOM 2406  H HB   . THR A 1 17  ? -31.173 -16.779 -6.183  1.00 0.00 ? 17  THR A HB   2  
ATOM 2407  H HG1  . THR A 1 17  ? -33.959 -16.774 -5.872  1.00 0.00 ? 17  THR A HG1  2  
ATOM 2408  H HG21 . THR A 1 17  ? -32.464 -15.085 -4.862  1.00 0.00 ? 17  THR A HG21 2  
ATOM 2409  H HG22 . THR A 1 17  ? -31.583 -14.383 -6.221  1.00 0.00 ? 17  THR A HG22 2  
ATOM 2410  H HG23 . THR A 1 17  ? -33.338 -14.638 -6.349  1.00 0.00 ? 17  THR A HG23 2  
ATOM 2411  N N    . ILE A 1 18  ? -30.003 -15.787 -8.709  1.00 0.00 ? 18  ILE A N    2  
ATOM 2412  C CA   . ILE A 1 18  ? -28.987 -14.930 -9.334  1.00 0.00 ? 18  ILE A CA   2  
ATOM 2413  C C    . ILE A 1 18  ? -29.208 -14.851 -10.850 1.00 0.00 ? 18  ILE A C    2  
ATOM 2414  O O    . ILE A 1 18  ? -29.083 -13.768 -11.429 1.00 0.00 ? 18  ILE A O    2  
ATOM 2415  C CB   . ILE A 1 18  ? -27.565 -15.442 -9.019  1.00 0.00 ? 18  ILE A CB   2  
ATOM 2416  C CG1  . ILE A 1 18  ? -27.290 -15.724 -7.528  1.00 0.00 ? 18  ILE A CG1  2  
ATOM 2417  C CG2  . ILE A 1 18  ? -26.491 -14.494 -9.574  1.00 0.00 ? 18  ILE A CG2  2  
ATOM 2418  C CD1  . ILE A 1 18  ? -27.371 -14.505 -6.598  1.00 0.00 ? 18  ILE A CD1  2  
ATOM 2419  H H    . ILE A 1 18  ? -29.727 -16.726 -8.438  1.00 0.00 ? 18  ILE A H    2  
ATOM 2420  H HA   . ILE A 1 18  ? -29.098 -13.925 -8.939  1.00 0.00 ? 18  ILE A HA   2  
ATOM 2421  H HB   . ILE A 1 18  ? -27.452 -16.389 -9.531  1.00 0.00 ? 18  ILE A HB   2  
ATOM 2422  H HG12 . ILE A 1 18  ? -27.999 -16.464 -7.172  1.00 0.00 ? 18  ILE A HG12 2  
ATOM 2423  H HG13 . ILE A 1 18  ? -26.301 -16.179 -7.449  1.00 0.00 ? 18  ILE A HG13 2  
ATOM 2424  H HG21 . ILE A 1 18  ? -26.527 -14.486 -10.661 1.00 0.00 ? 18  ILE A HG21 2  
ATOM 2425  H HG22 . ILE A 1 18  ? -26.649 -13.479 -9.207  1.00 0.00 ? 18  ILE A HG22 2  
ATOM 2426  H HG23 . ILE A 1 18  ? -25.500 -14.837 -9.273  1.00 0.00 ? 18  ILE A HG23 2  
ATOM 2427  H HD11 . ILE A 1 18  ? -26.610 -13.771 -6.862  1.00 0.00 ? 18  ILE A HD11 2  
ATOM 2428  H HD12 . ILE A 1 18  ? -28.358 -14.047 -6.663  1.00 0.00 ? 18  ILE A HD12 2  
ATOM 2429  H HD13 . ILE A 1 18  ? -27.202 -14.828 -5.570  1.00 0.00 ? 18  ILE A HD13 2  
ATOM 2430  N N    . ILE A 1 19  ? -29.630 -15.960 -11.479 1.00 0.00 ? 19  ILE A N    2  
ATOM 2431  C CA   . ILE A 1 19  ? -30.037 -15.965 -12.879 1.00 0.00 ? 19  ILE A CA   2  
ATOM 2432  C C    . ILE A 1 19  ? -31.116 -14.906 -13.074 1.00 0.00 ? 19  ILE A C    2  
ATOM 2433  O O    . ILE A 1 19  ? -30.866 -13.969 -13.815 1.00 0.00 ? 19  ILE A O    2  
ATOM 2434  C CB   . ILE A 1 19  ? -30.503 -17.348 -13.391 1.00 0.00 ? 19  ILE A CB   2  
ATOM 2435  C CG1  . ILE A 1 19  ? -29.469 -18.480 -13.217 1.00 0.00 ? 19  ILE A CG1  2  
ATOM 2436  C CG2  . ILE A 1 19  ? -30.894 -17.244 -14.874 1.00 0.00 ? 19  ILE A CG2  2  
ATOM 2437  C CD1  . ILE A 1 19  ? -28.061 -18.164 -13.717 1.00 0.00 ? 19  ILE A CD1  2  
ATOM 2438  H H    . ILE A 1 19  ? -29.706 -16.824 -10.955 1.00 0.00 ? 19  ILE A H    2  
ATOM 2439  H HA   . ILE A 1 19  ? -29.167 -15.658 -13.455 1.00 0.00 ? 19  ILE A HA   2  
ATOM 2440  H HB   . ILE A 1 19  ? -31.397 -17.641 -12.846 1.00 0.00 ? 19  ILE A HB   2  
ATOM 2441  H HG12 . ILE A 1 19  ? -29.393 -18.732 -12.167 1.00 0.00 ? 19  ILE A HG12 2  
ATOM 2442  H HG13 . ILE A 1 19  ? -29.830 -19.373 -13.729 1.00 0.00 ? 19  ILE A HG13 2  
ATOM 2443  H HG21 . ILE A 1 19  ? -31.146 -18.230 -15.262 1.00 0.00 ? 19  ILE A HG21 2  
ATOM 2444  H HG22 . ILE A 1 19  ? -31.767 -16.603 -14.989 1.00 0.00 ? 19  ILE A HG22 2  
ATOM 2445  H HG23 . ILE A 1 19  ? -30.069 -16.827 -15.450 1.00 0.00 ? 19  ILE A HG23 2  
ATOM 2446  H HD11 . ILE A 1 19  ? -27.619 -17.388 -13.095 1.00 0.00 ? 19  ILE A HD11 2  
ATOM 2447  H HD12 . ILE A 1 19  ? -27.454 -19.066 -13.633 1.00 0.00 ? 19  ILE A HD12 2  
ATOM 2448  H HD13 . ILE A 1 19  ? -28.094 -17.831 -14.755 1.00 0.00 ? 19  ILE A HD13 2  
ATOM 2449  N N    . ARG A 1 20  ? -32.233 -14.936 -12.327 1.00 0.00 ? 20  ARG A N    2  
ATOM 2450  C CA   . ARG A 1 20  ? -33.326 -13.938 -12.445 1.00 0.00 ? 20  ARG A CA   2  
ATOM 2451  C C    . ARG A 1 20  ? -32.836 -12.517 -12.156 1.00 0.00 ? 20  ARG A C    2  
ATOM 2452  O O    . ARG A 1 20  ? -33.343 -11.556 -12.733 1.00 0.00 ? 20  ARG A O    2  
ATOM 2453  C CB   . ARG A 1 20  ? -34.503 -14.203 -11.482 1.00 0.00 ? 20  ARG A CB   2  
ATOM 2454  C CG   . ARG A 1 20  ? -35.127 -15.602 -11.496 1.00 0.00 ? 20  ARG A CG   2  
ATOM 2455  C CD   . ARG A 1 20  ? -36.094 -15.790 -12.663 1.00 0.00 ? 20  ARG A CD   2  
ATOM 2456  N NE   . ARG A 1 20  ? -35.353 -16.320 -13.820 1.00 0.00 ? 20  ARG A NE   2  
ATOM 2457  C CZ   . ARG A 1 20  ? -35.650 -16.181 -15.096 1.00 0.00 ? 20  ARG A CZ   2  
ATOM 2458  N NH1  . ARG A 1 20  ? -36.490 -15.294 -15.533 1.00 0.00 ? 20  ARG A NH1  2  
ATOM 2459  N NH2  . ARG A 1 20  ? -35.082 -16.938 -15.988 1.00 0.00 ? 20  ARG A NH2  2  
ATOM 2460  H H    . ARG A 1 20  ? -32.308 -15.690 -11.657 1.00 0.00 ? 20  ARG A H    2  
ATOM 2461  H HA   . ARG A 1 20  ? -33.707 -13.941 -13.468 1.00 0.00 ? 20  ARG A HA   2  
ATOM 2462  H HB2  . ARG A 1 20  ? -34.138 -14.038 -10.467 1.00 0.00 ? 20  ARG A HB2  2  
ATOM 2463  H HB3  . ARG A 1 20  ? -35.285 -13.461 -11.657 1.00 0.00 ? 20  ARG A HB3  2  
ATOM 2464  H HG2  . ARG A 1 20  ? -34.376 -16.383 -11.498 1.00 0.00 ? 20  ARG A HG2  2  
ATOM 2465  H HG3  . ARG A 1 20  ? -35.707 -15.706 -10.577 1.00 0.00 ? 20  ARG A HG3  2  
ATOM 2466  H HD2  . ARG A 1 20  ? -36.853 -16.520 -12.374 1.00 0.00 ? 20  ARG A HD2  2  
ATOM 2467  H HD3  . ARG A 1 20  ? -36.593 -14.849 -12.895 1.00 0.00 ? 20  ARG A HD3  2  
ATOM 2468  H HE   . ARG A 1 20  ? -34.543 -16.881 -13.597 1.00 0.00 ? 20  ARG A HE   2  
ATOM 2469  H HH11 . ARG A 1 20  ? -36.829 -14.576 -14.904 1.00 0.00 ? 20  ARG A HH11 2  
ATOM 2470  H HH12 . ARG A 1 20  ? -36.499 -15.091 -16.530 1.00 0.00 ? 20  ARG A HH12 2  
ATOM 2471  H HH21 . ARG A 1 20  ? -34.465 -17.682 -15.710 1.00 0.00 ? 20  ARG A HH21 2  
ATOM 2472  H HH22 . ARG A 1 20  ? -35.317 -16.810 -16.960 1.00 0.00 ? 20  ARG A HH22 2  
ATOM 2473  N N    . LYS A 1 21  ? -31.820 -12.407 -11.297 1.00 0.00 ? 21  LYS A N    2  
ATOM 2474  C CA   . LYS A 1 21  ? -31.162 -11.136 -10.936 1.00 0.00 ? 21  LYS A CA   2  
ATOM 2475  C C    . LYS A 1 21  ? -30.469 -10.481 -12.135 1.00 0.00 ? 21  LYS A C    2  
ATOM 2476  O O    . LYS A 1 21  ? -30.581 -9.264  -12.288 1.00 0.00 ? 21  LYS A O    2  
ATOM 2477  C CB   . LYS A 1 21  ? -30.155 -11.350 -9.791  1.00 0.00 ? 21  LYS A CB   2  
ATOM 2478  C CG   . LYS A 1 21  ? -30.043 -10.163 -8.826  1.00 0.00 ? 21  LYS A CG   2  
ATOM 2479  C CD   . LYS A 1 21  ? -31.251 -10.087 -7.881  1.00 0.00 ? 21  LYS A CD   2  
ATOM 2480  C CE   . LYS A 1 21  ? -31.097 -8.901  -6.926  1.00 0.00 ? 21  LYS A CE   2  
ATOM 2481  N NZ   . LYS A 1 21  ? -32.337 -8.678  -6.148  1.00 0.00 ? 21  LYS A NZ   2  
ATOM 2482  H H    . LYS A 1 21  ? -31.507 -13.290 -10.898 1.00 0.00 ? 21  LYS A H    2  
ATOM 2483  H HA   . LYS A 1 21  ? -31.936 -10.441 -10.608 1.00 0.00 ? 21  LYS A HA   2  
ATOM 2484  H HB2  . LYS A 1 21  ? -30.434 -12.226 -9.209  1.00 0.00 ? 21  LYS A HB2  2  
ATOM 2485  H HB3  . LYS A 1 21  ? -29.169 -11.522 -10.226 1.00 0.00 ? 21  LYS A HB3  2  
ATOM 2486  H HG2  . LYS A 1 21  ? -29.141 -10.292 -8.225  1.00 0.00 ? 21  LYS A HG2  2  
ATOM 2487  H HG3  . LYS A 1 21  ? -29.951 -9.236  -9.393  1.00 0.00 ? 21  LYS A HG3  2  
ATOM 2488  H HD2  . LYS A 1 21  ? -32.162 -9.964  -8.466  1.00 0.00 ? 21  LYS A HD2  2  
ATOM 2489  H HD3  . LYS A 1 21  ? -31.326 -11.011 -7.305  1.00 0.00 ? 21  LYS A HD3  2  
ATOM 2490  H HE2  . LYS A 1 21  ? -30.251 -9.079  -6.257  1.00 0.00 ? 21  LYS A HE2  2  
ATOM 2491  H HE3  . LYS A 1 21  ? -30.884 -8.008  -7.519  1.00 0.00 ? 21  LYS A HE3  2  
ATOM 2492  H HZ1  . LYS A 1 21  ? -33.121 -8.542  -6.788  1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 2493  H HZ2  . LYS A 1 21  ? -32.544 -9.454  -5.536  1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 2494  H HZ3  . LYS A 1 21  ? -32.247 -7.830  -5.587  1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 2495  N N    . PHE A 1 22  ? -29.799 -11.262 -12.994 1.00 0.00 ? 22  PHE A N    2  
ATOM 2496  C CA   . PHE A 1 22  ? -29.169 -10.740 -14.225 1.00 0.00 ? 22  PHE A CA   2  
ATOM 2497  C C    . PHE A 1 22  ? -29.859 -11.124 -15.557 1.00 0.00 ? 22  PHE A C    2  
ATOM 2498  O O    . PHE A 1 22  ? -29.406 -10.698 -16.620 1.00 0.00 ? 22  PHE A O    2  
ATOM 2499  C CB   . PHE A 1 22  ? -27.662 -11.071 -14.237 1.00 0.00 ? 22  PHE A CB   2  
ATOM 2500  C CG   . PHE A 1 22  ? -27.271 -12.520 -14.502 1.00 0.00 ? 22  PHE A CG   2  
ATOM 2501  C CD1  . PHE A 1 22  ? -27.249 -13.032 -15.816 1.00 0.00 ? 22  PHE A CD1  2  
ATOM 2502  C CD2  . PHE A 1 22  ? -26.850 -13.341 -13.440 1.00 0.00 ? 22  PHE A CD2  2  
ATOM 2503  C CE1  . PHE A 1 22  ? -26.854 -14.360 -16.057 1.00 0.00 ? 22  PHE A CE1  2  
ATOM 2504  C CE2  . PHE A 1 22  ? -26.447 -14.669 -13.680 1.00 0.00 ? 22  PHE A CE2  2  
ATOM 2505  C CZ   . PHE A 1 22  ? -26.455 -15.180 -14.988 1.00 0.00 ? 22  PHE A CZ   2  
ATOM 2506  H H    . PHE A 1 22  ? -29.677 -12.246 -12.747 1.00 0.00 ? 22  PHE A H    2  
ATOM 2507  H HA   . PHE A 1 22  ? -29.222 -9.654  -14.179 1.00 0.00 ? 22  PHE A HA   2  
ATOM 2508  H HB2  . PHE A 1 22  ? -27.187 -10.454 -15.002 1.00 0.00 ? 22  PHE A HB2  2  
ATOM 2509  H HB3  . PHE A 1 22  ? -27.234 -10.757 -13.284 1.00 0.00 ? 22  PHE A HB3  2  
ATOM 2510  H HD1  . PHE A 1 22  ? -27.525 -12.404 -16.651 1.00 0.00 ? 22  PHE A HD1  2  
ATOM 2511  H HD2  . PHE A 1 22  ? -26.832 -12.950 -12.433 1.00 0.00 ? 22  PHE A HD2  2  
ATOM 2512  H HE1  . PHE A 1 22  ? -26.848 -14.747 -17.067 1.00 0.00 ? 22  PHE A HE1  2  
ATOM 2513  H HE2  . PHE A 1 22  ? -26.128 -15.295 -12.860 1.00 0.00 ? 22  PHE A HE2  2  
ATOM 2514  H HZ   . PHE A 1 22  ? -26.144 -16.199 -15.174 1.00 0.00 ? 22  PHE A HZ   2  
ATOM 2515  N N    . GLU A 1 23  ? -30.957 -11.889 -15.527 1.00 0.00 ? 23  GLU A N    2  
ATOM 2516  C CA   . GLU A 1 23  ? -31.547 -12.556 -16.706 1.00 0.00 ? 23  GLU A CA   2  
ATOM 2517  C C    . GLU A 1 23  ? -31.990 -11.585 -17.835 1.00 0.00 ? 23  GLU A C    2  
ATOM 2518  O O    . GLU A 1 23  ? -31.908 -11.907 -19.023 1.00 0.00 ? 23  GLU A O    2  
ATOM 2519  C CB   . GLU A 1 23  ? -32.748 -13.395 -16.236 1.00 0.00 ? 23  GLU A CB   2  
ATOM 2520  C CG   . GLU A 1 23  ? -33.452 -14.146 -17.375 1.00 0.00 ? 23  GLU A CG   2  
ATOM 2521  C CD   . GLU A 1 23  ? -34.859 -13.624 -17.682 1.00 0.00 ? 23  GLU A CD   2  
ATOM 2522  O OE1  . GLU A 1 23  ? -35.098 -12.408 -17.511 1.00 0.00 ? 23  GLU A OE1  2  
ATOM 2523  O OE2  . GLU A 1 23  ? -35.737 -14.444 -18.052 1.00 0.00 ? 23  GLU A OE2  2  
ATOM 2524  H H    . GLU A 1 23  ? -31.210 -12.277 -14.626 1.00 0.00 ? 23  GLU A H    2  
ATOM 2525  H HA   . GLU A 1 23  ? -30.809 -13.275 -17.071 1.00 0.00 ? 23  GLU A HA   2  
ATOM 2526  H HB2  . GLU A 1 23  ? -32.413 -14.148 -15.529 1.00 0.00 ? 23  GLU A HB2  2  
ATOM 2527  H HB3  . GLU A 1 23  ? -33.448 -12.760 -15.694 1.00 0.00 ? 23  GLU A HB3  2  
ATOM 2528  H HG2  . GLU A 1 23  ? -32.843 -14.156 -18.280 1.00 0.00 ? 23  GLU A HG2  2  
ATOM 2529  H HG3  . GLU A 1 23  ? -33.516 -15.179 -17.061 1.00 0.00 ? 23  GLU A HG3  2  
ATOM 2530  N N    . GLY A 1 24  ? -32.368 -10.357 -17.462 1.00 0.00 ? 24  GLY A N    2  
ATOM 2531  C CA   . GLY A 1 24  ? -32.609 -9.211  -18.357 1.00 0.00 ? 24  GLY A CA   2  
ATOM 2532  C C    . GLY A 1 24  ? -34.051 -8.970  -18.841 1.00 0.00 ? 24  GLY A C    2  
ATOM 2533  O O    . GLY A 1 24  ? -34.290 -7.965  -19.514 1.00 0.00 ? 24  GLY A O    2  
ATOM 2534  H H    . GLY A 1 24  ? -32.426 -10.211 -16.467 1.00 0.00 ? 24  GLY A H    2  
ATOM 2535  H HA2  . GLY A 1 24  ? -32.284 -8.307  -17.842 1.00 0.00 ? 24  GLY A HA2  2  
ATOM 2536  H HA3  . GLY A 1 24  ? -31.983 -9.320  -19.243 1.00 0.00 ? 24  GLY A HA3  2  
ATOM 2537  N N    . GLN A 1 25  ? -35.019 -9.813  -18.469 1.00 0.00 ? 25  GLN A N    2  
ATOM 2538  C CA   . GLN A 1 25  ? -36.467 -9.614  -18.666 1.00 0.00 ? 25  GLN A CA   2  
ATOM 2539  C C    . GLN A 1 25  ? -37.229 -9.652  -17.328 1.00 0.00 ? 25  GLN A C    2  
ATOM 2540  O O    . GLN A 1 25  ? -38.203 -8.916  -17.143 1.00 0.00 ? 25  GLN A O    2  
ATOM 2541  C CB   . GLN A 1 25  ? -37.018 -10.654 -19.654 1.00 0.00 ? 25  GLN A CB   2  
ATOM 2542  C CG   . GLN A 1 25  ? -36.402 -10.534 -21.060 1.00 0.00 ? 25  GLN A CG   2  
ATOM 2543  C CD   . GLN A 1 25  ? -37.002 -11.503 -22.084 1.00 0.00 ? 25  GLN A CD   2  
ATOM 2544  O OE1  . GLN A 1 25  ? -37.935 -12.258 -21.834 1.00 0.00 ? 25  GLN A OE1  2  
ATOM 2545  N NE2  . GLN A 1 25  ? -36.489 -11.516 -23.298 1.00 0.00 ? 25  GLN A NE2  2  
ATOM 2546  H H    . GLN A 1 25  ? -34.752 -10.684 -18.018 1.00 0.00 ? 25  GLN A H    2  
ATOM 2547  H HA   . GLN A 1 25  ? -36.642 -8.625  -19.089 1.00 0.00 ? 25  GLN A HA   2  
ATOM 2548  H HB2  . GLN A 1 25  ? -36.846 -11.659 -19.271 1.00 0.00 ? 25  GLN A HB2  2  
ATOM 2549  H HB3  . GLN A 1 25  ? -38.090 -10.502 -19.728 1.00 0.00 ? 25  GLN A HB3  2  
ATOM 2550  H HG2  . GLN A 1 25  ? -36.544 -9.516  -21.426 1.00 0.00 ? 25  GLN A HG2  2  
ATOM 2551  H HG3  . GLN A 1 25  ? -35.330 -10.727 -21.002 1.00 0.00 ? 25  GLN A HG3  2  
ATOM 2552  H HE21 . GLN A 1 25  ? -35.723 -10.904 -23.535 1.00 0.00 ? 25  GLN A HE21 2  
ATOM 2553  H HE22 . GLN A 1 25  ? -36.881 -12.152 -23.978 1.00 0.00 ? 25  GLN A HE22 2  
ATOM 2554  N N    . SER A 1 26  ? -36.757 -10.444 -16.356 1.00 0.00 ? 26  SER A N    2  
ATOM 2555  C CA   . SER A 1 26  ? -37.211 -10.379 -14.955 1.00 0.00 ? 26  SER A CA   2  
ATOM 2556  C C    . SER A 1 26  ? -36.845 -9.020  -14.333 1.00 0.00 ? 26  SER A C    2  
ATOM 2557  O O    . SER A 1 26  ? -37.613 -8.489  -13.528 1.00 0.00 ? 26  SER A O    2  
ATOM 2558  C CB   . SER A 1 26  ? -36.597 -11.516 -14.125 1.00 0.00 ? 26  SER A CB   2  
ATOM 2559  O OG   . SER A 1 26  ? -37.236 -12.750 -14.415 1.00 0.00 ? 26  SER A OG   2  
ATOM 2560  H H    . SER A 1 26  ? -36.061 -11.142 -16.614 1.00 0.00 ? 26  SER A H    2  
ATOM 2561  H HA   . SER A 1 26  ? -38.296 -10.478 -14.924 1.00 0.00 ? 26  SER A HA   2  
ATOM 2562  H HB2  . SER A 1 26  ? -35.530 -11.594 -14.340 1.00 0.00 ? 26  SER A HB2  2  
ATOM 2563  H HB3  . SER A 1 26  ? -36.724 -11.300 -13.063 1.00 0.00 ? 26  SER A HB3  2  
ATOM 2564  H HG   . SER A 1 26  ? -38.178 -12.670 -14.168 1.00 0.00 ? 26  SER A HG   2  
ATOM 2565  N N    . ARG A 1 27  ? -35.748 -8.397  -14.787 1.00 0.00 ? 27  ARG A N    2  
ATOM 2566  C CA   . ARG A 1 27  ? -35.364 -7.009  -14.475 1.00 0.00 ? 27  ARG A CA   2  
ATOM 2567  C C    . ARG A 1 27  ? -36.183 -5.974  -15.253 1.00 0.00 ? 27  ARG A C    2  
ATOM 2568  O O    . ARG A 1 27  ? -36.569 -6.192  -16.400 1.00 0.00 ? 27  ARG A O    2  
ATOM 2569  C CB   . ARG A 1 27  ? -33.866 -6.813  -14.780 1.00 0.00 ? 27  ARG A CB   2  
ATOM 2570  C CG   . ARG A 1 27  ? -32.961 -7.106  -13.573 1.00 0.00 ? 27  ARG A CG   2  
ATOM 2571  C CD   . ARG A 1 27  ? -32.577 -5.796  -12.873 1.00 0.00 ? 27  ARG A CD   2  
ATOM 2572  N NE   . ARG A 1 27  ? -31.875 -6.062  -11.610 1.00 0.00 ? 27  ARG A NE   2  
ATOM 2573  C CZ   . ARG A 1 27  ? -30.711 -5.620  -11.186 1.00 0.00 ? 27  ARG A CZ   2  
ATOM 2574  N NH1  . ARG A 1 27  ? -29.979 -4.769  -11.847 1.00 0.00 ? 27  ARG A NH1  2  
ATOM 2575  N NH2  . ARG A 1 27  ? -30.290 -6.046  -10.035 1.00 0.00 ? 27  ARG A NH2  2  
ATOM 2576  H H    . ARG A 1 27  ? -35.194 -8.896  -15.469 1.00 0.00 ? 27  ARG A H    2  
ATOM 2577  H HA   . ARG A 1 27  ? -35.544 -6.829  -13.414 1.00 0.00 ? 27  ARG A HA   2  
ATOM 2578  H HB2  . ARG A 1 27  ? -33.588 -7.462  -15.607 1.00 0.00 ? 27  ARG A HB2  2  
ATOM 2579  H HB3  . ARG A 1 27  ? -33.680 -5.791  -15.120 1.00 0.00 ? 27  ARG A HB3  2  
ATOM 2580  H HG2  . ARG A 1 27  ? -33.467 -7.780  -12.874 1.00 0.00 ? 27  ARG A HG2  2  
ATOM 2581  H HG3  . ARG A 1 27  ? -32.052 -7.592  -13.928 1.00 0.00 ? 27  ARG A HG3  2  
ATOM 2582  H HD2  . ARG A 1 27  ? -31.949 -5.212  -13.548 1.00 0.00 ? 27  ARG A HD2  2  
ATOM 2583  H HD3  . ARG A 1 27  ? -33.477 -5.217  -12.659 1.00 0.00 ? 27  ARG A HD3  2  
ATOM 2584  H HE   . ARG A 1 27  ? -32.317 -6.705  -10.958 1.00 0.00 ? 27  ARG A HE   2  
ATOM 2585  H HH11 . ARG A 1 27  ? -30.375 -4.317  -12.660 1.00 0.00 ? 27  ARG A HH11 2  
ATOM 2586  H HH12 . ARG A 1 27  ? -29.088 -4.475  -11.488 1.00 0.00 ? 27  ARG A HH12 2  
ATOM 2587  H HH21 . ARG A 1 27  ? -30.939 -6.640  -9.520  1.00 0.00 ? 27  ARG A HH21 2  
ATOM 2588  H HH22 . ARG A 1 27  ? -29.428 -5.725  -9.633  1.00 0.00 ? 27  ARG A HH22 2  
ATOM 2589  N N    . LYS A 1 28  ? -36.354 -4.813  -14.617 1.00 0.00 ? 28  LYS A N    2  
ATOM 2590  C CA   . LYS A 1 28  ? -36.917 -3.554  -15.129 1.00 0.00 ? 28  LYS A CA   2  
ATOM 2591  C C    . LYS A 1 28  ? -36.095 -2.382  -14.578 1.00 0.00 ? 28  LYS A C    2  
ATOM 2592  O O    . LYS A 1 28  ? -35.545 -2.511  -13.482 1.00 0.00 ? 28  LYS A O    2  
ATOM 2593  C CB   . LYS A 1 28  ? -38.378 -3.414  -14.668 1.00 0.00 ? 28  LYS A CB   2  
ATOM 2594  C CG   . LYS A 1 28  ? -39.279 -4.611  -15.009 1.00 0.00 ? 28  LYS A CG   2  
ATOM 2595  C CD   . LYS A 1 28  ? -39.552 -5.534  -13.812 1.00 0.00 ? 28  LYS A CD   2  
ATOM 2596  C CE   . LYS A 1 28  ? -40.595 -6.604  -14.165 1.00 0.00 ? 28  LYS A CE   2  
ATOM 2597  N NZ   . LYS A 1 28  ? -40.010 -7.708  -14.971 1.00 0.00 ? 28  LYS A NZ   2  
ATOM 2598  H H    . LYS A 1 28  ? -36.017 -4.777  -13.670 1.00 0.00 ? 28  LYS A H    2  
ATOM 2599  H HA   . LYS A 1 28  ? -36.867 -3.538  -16.220 1.00 0.00 ? 28  LYS A HA   2  
ATOM 2600  H HB2  . LYS A 1 28  ? -38.410 -3.235  -13.595 1.00 0.00 ? 28  LYS A HB2  2  
ATOM 2601  H HB3  . LYS A 1 28  ? -38.800 -2.530  -15.138 1.00 0.00 ? 28  LYS A HB3  2  
ATOM 2602  H HG2  . LYS A 1 28  ? -40.229 -4.211  -15.316 1.00 0.00 ? 28  LYS A HG2  2  
ATOM 2603  H HG3  . LYS A 1 28  ? -38.882 -5.169  -15.854 1.00 0.00 ? 28  LYS A HG3  2  
ATOM 2604  H HD2  . LYS A 1 28  ? -38.629 -6.000  -13.466 1.00 0.00 ? 28  LYS A HD2  2  
ATOM 2605  H HD3  . LYS A 1 28  ? -39.953 -4.933  -12.995 1.00 0.00 ? 28  LYS A HD3  2  
ATOM 2606  H HE2  . LYS A 1 28  ? -41.000 -7.008  -13.234 1.00 0.00 ? 28  LYS A HE2  2  
ATOM 2607  H HE3  . LYS A 1 28  ? -41.421 -6.133  -14.706 1.00 0.00 ? 28  LYS A HE3  2  
ATOM 2608  H HZ1  . LYS A 1 28  ? -40.703 -8.415  -15.182 1.00 0.00 ? 28  LYS A HZ1  2  
ATOM 2609  H HZ2  . LYS A 1 28  ? -39.631 -7.382  -15.853 1.00 0.00 ? 28  LYS A HZ2  2  
ATOM 2610  H HZ3  . LYS A 1 28  ? -39.255 -8.151  -14.457 1.00 0.00 ? 28  LYS A HZ3  2  
ATOM 2611  N N    . PHE A 1 29  ? -36.038 -1.238  -15.266 1.00 0.00 ? 29  PHE A N    2  
ATOM 2612  C CA   . PHE A 1 29  ? -35.233 -0.086  -14.825 1.00 0.00 ? 29  PHE A CA   2  
ATOM 2613  C C    . PHE A 1 29  ? -35.481 1.218   -15.602 1.00 0.00 ? 29  PHE A C    2  
ATOM 2614  O O    . PHE A 1 29  ? -35.986 1.248   -16.730 1.00 0.00 ? 29  PHE A O    2  
ATOM 2615  C CB   . PHE A 1 29  ? -33.722 -0.418  -14.904 1.00 0.00 ? 29  PHE A CB   2  
ATOM 2616  C CG   . PHE A 1 29  ? -33.150 -0.679  -16.287 1.00 0.00 ? 29  PHE A CG   2  
ATOM 2617  C CD1  . PHE A 1 29  ? -33.182 -1.978  -16.829 1.00 0.00 ? 29  PHE A CD1  2  
ATOM 2618  C CD2  . PHE A 1 29  ? -32.523 0.360   -17.004 1.00 0.00 ? 29  PHE A CD2  2  
ATOM 2619  C CE1  . PHE A 1 29  ? -32.593 -2.240  -18.079 1.00 0.00 ? 29  PHE A CE1  2  
ATOM 2620  C CE2  . PHE A 1 29  ? -31.932 0.097   -18.255 1.00 0.00 ? 29  PHE A CE2  2  
ATOM 2621  C CZ   . PHE A 1 29  ? -31.963 -1.203  -18.789 1.00 0.00 ? 29  PHE A CZ   2  
ATOM 2622  H H    . PHE A 1 29  ? -36.516 -1.172  -16.153 1.00 0.00 ? 29  PHE A H    2  
ATOM 2623  H HA   . PHE A 1 29  ? -35.479 0.117   -13.782 1.00 0.00 ? 29  PHE A HA   2  
ATOM 2624  H HB2  . PHE A 1 29  ? -33.160 0.399   -14.451 1.00 0.00 ? 29  PHE A HB2  2  
ATOM 2625  H HB3  . PHE A 1 29  ? -33.512 -1.292  -14.294 1.00 0.00 ? 29  PHE A HB3  2  
ATOM 2626  H HD1  . PHE A 1 29  ? -33.639 -2.787  -16.275 1.00 0.00 ? 29  PHE A HD1  2  
ATOM 2627  H HD2  . PHE A 1 29  ? -32.481 1.358   -16.590 1.00 0.00 ? 29  PHE A HD2  2  
ATOM 2628  H HE1  . PHE A 1 29  ? -32.615 -3.240  -18.490 1.00 0.00 ? 29  PHE A HE1  2  
ATOM 2629  H HE2  . PHE A 1 29  ? -31.447 0.891   -18.804 1.00 0.00 ? 29  PHE A HE2  2  
ATOM 2630  H HZ   . PHE A 1 29  ? -31.501 -1.406  -19.746 1.00 0.00 ? 29  PHE A HZ   2  
ATOM 2631  N N    . ILE A 1 30  ? -35.070 2.307   -14.958 1.00 0.00 ? 30  ILE A N    2  
ATOM 2632  C CA   . ILE A 1 30  ? -34.982 3.665   -15.496 1.00 0.00 ? 30  ILE A CA   2  
ATOM 2633  C C    . ILE A 1 30  ? -33.562 4.204   -15.412 1.00 0.00 ? 30  ILE A C    2  
ATOM 2634  O O    . ILE A 1 30  ? -32.704 3.645   -14.737 1.00 0.00 ? 30  ILE A O    2  
ATOM 2635  C CB   . ILE A 1 30  ? -35.954 4.632   -14.781 1.00 0.00 ? 30  ILE A CB   2  
ATOM 2636  C CG1  . ILE A 1 30  ? -36.098 4.455   -13.255 1.00 0.00 ? 30  ILE A CG1  2  
ATOM 2637  C CG2  . ILE A 1 30  ? -37.308 4.493   -15.461 1.00 0.00 ? 30  ILE A CG2  2  
ATOM 2638  C CD1  . ILE A 1 30  ? -34.785 4.617   -12.483 1.00 0.00 ? 30  ILE A CD1  2  
ATOM 2639  H H    . ILE A 1 30  ? -34.663 2.176   -14.043 1.00 0.00 ? 30  ILE A H    2  
ATOM 2640  H HA   . ILE A 1 30  ? -35.227 3.641   -16.556 1.00 0.00 ? 30  ILE A HA   2  
ATOM 2641  H HB   . ILE A 1 30  ? -35.630 5.656   -14.956 1.00 0.00 ? 30  ILE A HB   2  
ATOM 2642  H HG12 . ILE A 1 30  ? -36.797 5.210   -12.887 1.00 0.00 ? 30  ILE A HG12 2  
ATOM 2643  H HG13 . ILE A 1 30  ? -36.519 3.475   -13.032 1.00 0.00 ? 30  ILE A HG13 2  
ATOM 2644  H HG21 . ILE A 1 30  ? -37.673 3.475   -15.332 1.00 0.00 ? 30  ILE A HG21 2  
ATOM 2645  H HG22 . ILE A 1 30  ? -38.017 5.196   -15.026 1.00 0.00 ? 30  ILE A HG22 2  
ATOM 2646  H HG23 . ILE A 1 30  ? -37.191 4.712   -16.523 1.00 0.00 ? 30  ILE A HG23 2  
ATOM 2647  H HD11 . ILE A 1 30  ? -34.121 3.771   -12.668 1.00 0.00 ? 30  ILE A HD11 2  
ATOM 2648  H HD12 . ILE A 1 30  ? -34.291 5.546   -12.771 1.00 0.00 ? 30  ILE A HD12 2  
ATOM 2649  H HD13 . ILE A 1 30  ? -35.010 4.650   -11.422 1.00 0.00 ? 30  ILE A HD13 2  
ATOM 2650  N N    . ILE A 1 31  ? -33.348 5.328   -16.081 1.00 0.00 ? 31  ILE A N    2  
ATOM 2651  C CA   . ILE A 1 31  ? -32.158 6.155   -16.005 1.00 0.00 ? 31  ILE A CA   2  
ATOM 2652  C C    . ILE A 1 31  ? -32.606 7.515   -15.502 1.00 0.00 ? 31  ILE A C    2  
ATOM 2653  O O    . ILE A 1 31  ? -33.346 8.239   -16.174 1.00 0.00 ? 31  ILE A O    2  
ATOM 2654  C CB   . ILE A 1 31  ? -31.456 6.275   -17.370 1.00 0.00 ? 31  ILE A CB   2  
ATOM 2655  C CG1  . ILE A 1 31  ? -31.416 4.951   -18.164 1.00 0.00 ? 31  ILE A CG1  2  
ATOM 2656  C CG2  . ILE A 1 31  ? -30.056 6.867   -17.148 1.00 0.00 ? 31  ILE A CG2  2  
ATOM 2657  C CD1  . ILE A 1 31  ? -30.517 3.899   -17.518 1.00 0.00 ? 31  ILE A CD1  2  
ATOM 2658  H H    . ILE A 1 31  ? -34.112 5.707   -16.633 1.00 0.00 ? 31  ILE A H    2  
ATOM 2659  H HA   . ILE A 1 31  ? -31.467 5.728   -15.279 1.00 0.00 ? 31  ILE A HA   2  
ATOM 2660  H HB   . ILE A 1 31  ? -32.019 6.989   -17.967 1.00 0.00 ? 31  ILE A HB   2  
ATOM 2661  H HG12 . ILE A 1 31  ? -32.433 4.549   -18.257 1.00 0.00 ? 31  ILE A HG12 2  
ATOM 2662  H HG13 . ILE A 1 31  ? -31.039 5.144   -19.169 1.00 0.00 ? 31  ILE A HG13 2  
ATOM 2663  H HG21 . ILE A 1 31  ? -30.139 7.851   -16.690 1.00 0.00 ? 31  ILE A HG21 2  
ATOM 2664  H HG22 . ILE A 1 31  ? -29.471 6.232   -16.480 1.00 0.00 ? 31  ILE A HG22 2  
ATOM 2665  H HG23 . ILE A 1 31  ? -29.541 6.966   -18.104 1.00 0.00 ? 31  ILE A HG23 2  
ATOM 2666  H HD11 . ILE A 1 31  ? -30.682 2.936   -17.994 1.00 0.00 ? 31  ILE A HD11 2  
ATOM 2667  H HD12 . ILE A 1 31  ? -29.473 4.184   -17.642 1.00 0.00 ? 31  ILE A HD12 2  
ATOM 2668  H HD13 . ILE A 1 31  ? -30.746 3.837   -16.457 1.00 0.00 ? 31  ILE A HD13 2  
ATOM 2669  N N    . ALA A 1 32  ? -32.148 7.841   -14.304 1.00 0.00 ? 32  ALA A N    2  
ATOM 2670  C CA   . ALA A 1 32  ? -32.421 9.103   -13.634 1.00 0.00 ? 32  ALA A CA   2  
ATOM 2671  C C    . ALA A 1 32  ? -31.126 9.869   -13.364 1.00 0.00 ? 32  ALA A C    2  
ATOM 2672  O O    . ALA A 1 32  ? -30.057 9.294   -13.148 1.00 0.00 ? 32  ALA A O    2  
ATOM 2673  C CB   . ALA A 1 32  ? -33.295 8.903   -12.379 1.00 0.00 ? 32  ALA A CB   2  
ATOM 2674  H H    . ALA A 1 32  ? -31.520 7.175   -13.858 1.00 0.00 ? 32  ALA A H    2  
ATOM 2675  H HA   . ALA A 1 32  ? -32.995 9.723   -14.315 1.00 0.00 ? 32  ALA A HA   2  
ATOM 2676  H HB1  . ALA A 1 32  ? -33.311 9.821   -11.783 1.00 0.00 ? 32  ALA A HB1  2  
ATOM 2677  H HB2  . ALA A 1 32  ? -34.307 8.639   -12.676 1.00 0.00 ? 32  ALA A HB2  2  
ATOM 2678  H HB3  . ALA A 1 32  ? -32.930 8.103   -11.742 1.00 0.00 ? 32  ALA A HB3  2  
ATOM 2679  N N    . ASN A 1 33  ? -31.232 11.192  -13.374 1.00 0.00 ? 33  ASN A N    2  
ATOM 2680  C CA   . ASN A 1 33  ? -30.149 12.094  -13.031 1.00 0.00 ? 33  ASN A CA   2  
ATOM 2681  C C    . ASN A 1 33  ? -30.031 12.220  -11.502 1.00 0.00 ? 33  ASN A C    2  
ATOM 2682  O O    . ASN A 1 33  ? -30.917 12.775  -10.849 1.00 0.00 ? 33  ASN A O    2  
ATOM 2683  C CB   . ASN A 1 33  ? -30.476 13.406  -13.747 1.00 0.00 ? 33  ASN A CB   2  
ATOM 2684  C CG   . ASN A 1 33  ? -29.425 14.482  -13.624 1.00 0.00 ? 33  ASN A CG   2  
ATOM 2685  O OD1  . ASN A 1 33  ? -28.527 14.447  -12.796 1.00 0.00 ? 33  ASN A OD1  2  
ATOM 2686  N ND2  . ASN A 1 33  ? -29.537 15.473  -14.473 1.00 0.00 ? 33  ASN A ND2  2  
ATOM 2687  H H    . ASN A 1 33  ? -32.130 11.606  -13.604 1.00 0.00 ? 33  ASN A H    2  
ATOM 2688  H HA   . ASN A 1 33  ? -29.207 11.708  -13.429 1.00 0.00 ? 33  ASN A HA   2  
ATOM 2689  H HB2  . ASN A 1 33  ? -30.588 13.190  -14.805 1.00 0.00 ? 33  ASN A HB2  2  
ATOM 2690  H HB3  . ASN A 1 33  ? -31.422 13.798  -13.378 1.00 0.00 ? 33  ASN A HB3  2  
ATOM 2691  H HD21 . ASN A 1 33  ? -30.295 15.465  -15.139 1.00 0.00 ? 33  ASN A HD21 2  
ATOM 2692  H HD22 . ASN A 1 33  ? -28.838 16.195  -14.477 1.00 0.00 ? 33  ASN A HD22 2  
ATOM 2693  N N    . ALA A 1 34  ? -28.931 11.726  -10.928 1.00 0.00 ? 34  ALA A N    2  
ATOM 2694  C CA   . ALA A 1 34  ? -28.679 11.803  -9.483  1.00 0.00 ? 34  ALA A CA   2  
ATOM 2695  C C    . ALA A 1 34  ? -28.262 13.205  -9.000  1.00 0.00 ? 34  ALA A C    2  
ATOM 2696  O O    . ALA A 1 34  ? -28.192 13.455  -7.794  1.00 0.00 ? 34  ALA A O    2  
ATOM 2697  C CB   . ALA A 1 34  ? -27.610 10.767  -9.123  1.00 0.00 ? 34  ALA A CB   2  
ATOM 2698  H H    . ALA A 1 34  ? -28.237 11.279  -11.513 1.00 0.00 ? 34  ALA A H    2  
ATOM 2699  H HA   . ALA A 1 34  ? -29.595 11.546  -8.955  1.00 0.00 ? 34  ALA A HA   2  
ATOM 2700  H HB1  . ALA A 1 34  ? -27.914 9.781   -9.463  1.00 0.00 ? 34  ALA A HB1  2  
ATOM 2701  H HB2  . ALA A 1 34  ? -26.660 11.036  -9.581  1.00 0.00 ? 34  ALA A HB2  2  
ATOM 2702  H HB3  . ALA A 1 34  ? -27.479 10.739  -8.041  1.00 0.00 ? 34  ALA A HB3  2  
ATOM 2703  N N    . ARG A 1 35  ? -27.929 14.106  -9.935  1.00 0.00 ? 35  ARG A N    2  
ATOM 2704  C CA   . ARG A 1 35  ? -27.304 15.415  -9.665  1.00 0.00 ? 35  ARG A CA   2  
ATOM 2705  C C    . ARG A 1 35  ? -28.288 16.593  -9.681  1.00 0.00 ? 35  ARG A C    2  
ATOM 2706  O O    . ARG A 1 35  ? -27.904 17.713  -9.340  1.00 0.00 ? 35  ARG A O    2  
ATOM 2707  C CB   . ARG A 1 35  ? -26.120 15.641  -10.627 1.00 0.00 ? 35  ARG A CB   2  
ATOM 2708  C CG   . ARG A 1 35  ? -25.161 14.446  -10.822 1.00 0.00 ? 35  ARG A CG   2  
ATOM 2709  C CD   . ARG A 1 35  ? -24.676 13.739  -9.544  1.00 0.00 ? 35  ARG A CD   2  
ATOM 2710  N NE   . ARG A 1 35  ? -24.057 14.659  -8.573  1.00 0.00 ? 35  ARG A NE   2  
ATOM 2711  C CZ   . ARG A 1 35  ? -23.727 14.371  -7.326  1.00 0.00 ? 35  ARG A CZ   2  
ATOM 2712  N NH1  . ARG A 1 35  ? -23.872 13.180  -6.812  1.00 0.00 ? 35  ARG A NH1  2  
ATOM 2713  N NH2  . ARG A 1 35  ? -23.232 15.294  -6.552  1.00 0.00 ? 35  ARG A NH2  2  
ATOM 2714  H H    . ARG A 1 35  ? -28.092 13.849  -10.908 1.00 0.00 ? 35  ARG A H    2  
ATOM 2715  H HA   . ARG A 1 35  ? -26.897 15.400  -8.652  1.00 0.00 ? 35  ARG A HA   2  
ATOM 2716  H HB2  . ARG A 1 35  ? -26.511 15.915  -11.609 1.00 0.00 ? 35  ARG A HB2  2  
ATOM 2717  H HB3  . ARG A 1 35  ? -25.542 16.492  -10.264 1.00 0.00 ? 35  ARG A HB3  2  
ATOM 2718  H HG2  . ARG A 1 35  ? -25.656 13.701  -11.447 1.00 0.00 ? 35  ARG A HG2  2  
ATOM 2719  H HG3  . ARG A 1 35  ? -24.292 14.797  -11.376 1.00 0.00 ? 35  ARG A HG3  2  
ATOM 2720  H HD2  . ARG A 1 35  ? -25.516 13.226  -9.077  1.00 0.00 ? 35  ARG A HD2  2  
ATOM 2721  H HD3  . ARG A 1 35  ? -23.942 12.990  -9.835  1.00 0.00 ? 35  ARG A HD3  2  
ATOM 2722  H HE   . ARG A 1 35  ? -23.871 15.600  -8.881  1.00 0.00 ? 35  ARG A HE   2  
ATOM 2723  H HH11 . ARG A 1 35  ? -24.214 12.413  -7.381  1.00 0.00 ? 35  ARG A HH11 2  
ATOM 2724  H HH12 . ARG A 1 35  ? -23.624 13.007  -5.855  1.00 0.00 ? 35  ARG A HH12 2  
ATOM 2725  H HH21 . ARG A 1 35  ? -23.103 16.231  -6.900  1.00 0.00 ? 35  ARG A HH21 2  
ATOM 2726  H HH22 . ARG A 1 35  ? -22.978 15.081  -5.603  1.00 0.00 ? 35  ARG A HH22 2  
ATOM 2727  N N    . VAL A 1 36  ? -29.541 16.352  -10.078 1.00 0.00 ? 36  VAL A N    2  
ATOM 2728  C CA   . VAL A 1 36  ? -30.615 17.355  -10.208 1.00 0.00 ? 36  VAL A CA   2  
ATOM 2729  C C    . VAL A 1 36  ? -31.635 17.228  -9.072  1.00 0.00 ? 36  VAL A C    2  
ATOM 2730  O O    . VAL A 1 36  ? -31.995 16.121  -8.675  1.00 0.00 ? 36  VAL A O    2  
ATOM 2731  C CB   . VAL A 1 36  ? -31.245 17.282  -11.614 1.00 0.00 ? 36  VAL A CB   2  
ATOM 2732  C CG1  . VAL A 1 36  ? -32.227 16.118  -11.807 1.00 0.00 ? 36  VAL A CG1  2  
ATOM 2733  C CG2  . VAL A 1 36  ? -31.966 18.578  -11.979 1.00 0.00 ? 36  VAL A CG2  2  
ATOM 2734  H H    . VAL A 1 36  ? -29.771 15.397  -10.304 1.00 0.00 ? 36  VAL A H    2  
ATOM 2735  H HA   . VAL A 1 36  ? -30.160 18.342  -10.122 1.00 0.00 ? 36  VAL A HA   2  
ATOM 2736  H HB   . VAL A 1 36  ? -30.436 17.158  -12.334 1.00 0.00 ? 36  VAL A HB   2  
ATOM 2737  H HG11 . VAL A 1 36  ? -32.480 16.027  -12.863 1.00 0.00 ? 36  VAL A HG11 2  
ATOM 2738  H HG12 . VAL A 1 36  ? -31.770 15.190  -11.468 1.00 0.00 ? 36  VAL A HG12 2  
ATOM 2739  H HG13 . VAL A 1 36  ? -33.140 16.296  -11.242 1.00 0.00 ? 36  VAL A HG13 2  
ATOM 2740  H HG21 . VAL A 1 36  ? -32.323 18.511  -13.009 1.00 0.00 ? 36  VAL A HG21 2  
ATOM 2741  H HG22 . VAL A 1 36  ? -32.814 18.746  -11.316 1.00 0.00 ? 36  VAL A HG22 2  
ATOM 2742  H HG23 . VAL A 1 36  ? -31.271 19.414  -11.906 1.00 0.00 ? 36  VAL A HG23 2  
ATOM 2743  N N    . GLU A 1 37  ? -32.119 18.354  -8.539  1.00 0.00 ? 37  GLU A N    2  
ATOM 2744  C CA   . GLU A 1 37  ? -33.009 18.389  -7.362  1.00 0.00 ? 37  GLU A CA   2  
ATOM 2745  C C    . GLU A 1 37  ? -34.343 17.640  -7.580  1.00 0.00 ? 37  GLU A C    2  
ATOM 2746  O O    . GLU A 1 37  ? -34.884 17.043  -6.647  1.00 0.00 ? 37  GLU A O    2  
ATOM 2747  C CB   . GLU A 1 37  ? -33.246 19.863  -6.987  1.00 0.00 ? 37  GLU A CB   2  
ATOM 2748  C CG   . GLU A 1 37  ? -33.985 20.045  -5.654  1.00 0.00 ? 37  GLU A CG   2  
ATOM 2749  C CD   . GLU A 1 37  ? -34.072 21.534  -5.270  1.00 0.00 ? 37  GLU A CD   2  
ATOM 2750  O OE1  . GLU A 1 37  ? -35.032 22.222  -5.696  1.00 0.00 ? 37  GLU A OE1  2  
ATOM 2751  O OE2  . GLU A 1 37  ? -33.183 22.031  -4.534  1.00 0.00 ? 37  GLU A OE2  2  
ATOM 2752  H H    . GLU A 1 37  ? -31.782 19.237  -8.900  1.00 0.00 ? 37  GLU A H    2  
ATOM 2753  H HA   . GLU A 1 37  ? -32.498 17.904  -6.529  1.00 0.00 ? 37  GLU A HA   2  
ATOM 2754  H HB2  . GLU A 1 37  ? -32.277 20.359  -6.908  1.00 0.00 ? 37  GLU A HB2  2  
ATOM 2755  H HB3  . GLU A 1 37  ? -33.813 20.351  -7.782  1.00 0.00 ? 37  GLU A HB3  2  
ATOM 2756  H HG2  . GLU A 1 37  ? -34.992 19.630  -5.736  1.00 0.00 ? 37  GLU A HG2  2  
ATOM 2757  H HG3  . GLU A 1 37  ? -33.456 19.489  -4.876  1.00 0.00 ? 37  GLU A HG3  2  
ATOM 2758  N N    . ASN A 1 38  ? -34.845 17.608  -8.820  1.00 0.00 ? 38  ASN A N    2  
ATOM 2759  C CA   . ASN A 1 38  ? -36.066 16.884  -9.200  1.00 0.00 ? 38  ASN A CA   2  
ATOM 2760  C C    . ASN A 1 38  ? -35.861 15.354  -9.343  1.00 0.00 ? 38  ASN A C    2  
ATOM 2761  O O    . ASN A 1 38  ? -36.835 14.621  -9.509  1.00 0.00 ? 38  ASN A O    2  
ATOM 2762  C CB   . ASN A 1 38  ? -36.611 17.526  -10.492 1.00 0.00 ? 38  ASN A CB   2  
ATOM 2763  C CG   . ASN A 1 38  ? -38.056 17.152  -10.809 1.00 0.00 ? 38  ASN A CG   2  
ATOM 2764  O OD1  . ASN A 1 38  ? -38.882 16.905  -9.941  1.00 0.00 ? 38  ASN A OD1  2  
ATOM 2765  N ND2  . ASN A 1 38  ? -38.425 17.148  -12.071 1.00 0.00 ? 38  ASN A ND2  2  
ATOM 2766  H H    . ASN A 1 38  ? -34.358 18.127  -9.536  1.00 0.00 ? 38  ASN A H    2  
ATOM 2767  H HA   . ASN A 1 38  ? -36.802 17.030  -8.407  1.00 0.00 ? 38  ASN A HA   2  
ATOM 2768  H HB2  . ASN A 1 38  ? -36.580 18.612  -10.401 1.00 0.00 ? 38  ASN A HB2  2  
ATOM 2769  H HB3  . ASN A 1 38  ? -35.973 17.239  -11.329 1.00 0.00 ? 38  ASN A HB3  2  
ATOM 2770  H HD21 . ASN A 1 38  ? -37.770 17.390  -12.796 1.00 0.00 ? 38  ASN A HD21 2  
ATOM 2771  H HD22 . ASN A 1 38  ? -39.381 16.917  -12.287 1.00 0.00 ? 38  ASN A HD22 2  
ATOM 2772  N N    . CYS A 1 39  ? -34.610 14.864  -9.298  1.00 0.00 ? 39  CYS A N    2  
ATOM 2773  C CA   . CYS A 1 39  ? -34.236 13.444  -9.429  1.00 0.00 ? 39  CYS A CA   2  
ATOM 2774  C C    . CYS A 1 39  ? -34.903 12.749  -10.639 1.00 0.00 ? 39  CYS A C    2  
ATOM 2775  O O    . CYS A 1 39  ? -35.373 11.616  -10.531 1.00 0.00 ? 39  CYS A O    2  
ATOM 2776  C CB   . CYS A 1 39  ? -34.514 12.716  -8.100  1.00 0.00 ? 39  CYS A CB   2  
ATOM 2777  S SG   . CYS A 1 39  ? -33.757 13.585  -6.691  1.00 0.00 ? 39  CYS A SG   2  
ATOM 2778  H H    . CYS A 1 39  ? -33.856 15.509  -9.097  1.00 0.00 ? 39  CYS A H    2  
ATOM 2779  H HA   . CYS A 1 39  ? -33.160 13.405  -9.608  1.00 0.00 ? 39  CYS A HA   2  
ATOM 2780  H HB2  . CYS A 1 39  ? -35.593 12.652  -7.944  1.00 0.00 ? 39  CYS A HB2  2  
ATOM 2781  H HB3  . CYS A 1 39  ? -34.119 11.700  -8.165  1.00 0.00 ? 39  CYS A HB3  2  
ATOM 2782  H HG   . CYS A 1 39  ? -34.402 14.754  -6.846  1.00 0.00 ? 39  CYS A HG   2  
ATOM 2783  N N    . ALA A 1 40  ? -35.018 13.445  -11.775 1.00 0.00 ? 40  ALA A N    2  
ATOM 2784  C CA   . ALA A 1 40  ? -35.875 13.019  -12.881 1.00 0.00 ? 40  ALA A CA   2  
ATOM 2785  C C    . ALA A 1 40  ? -35.304 11.931  -13.809 1.00 0.00 ? 40  ALA A C    2  
ATOM 2786  O O    . ALA A 1 40  ? -34.089 11.795  -13.981 1.00 0.00 ? 40  ALA A O    2  
ATOM 2787  C CB   . ALA A 1 40  ? -36.360 14.257  -13.644 1.00 0.00 ? 40  ALA A CB   2  
ATOM 2788  H H    . ALA A 1 40  ? -34.593 14.357  -11.826 1.00 0.00 ? 40  ALA A H    2  
ATOM 2789  H HA   . ALA A 1 40  ? -36.756 12.585  -12.420 1.00 0.00 ? 40  ALA A HA   2  
ATOM 2790  H HB1  . ALA A 1 40  ? -37.141 13.966  -14.348 1.00 0.00 ? 40  ALA A HB1  2  
ATOM 2791  H HB2  . ALA A 1 40  ? -36.792 14.974  -12.946 1.00 0.00 ? 40  ALA A HB2  2  
ATOM 2792  H HB3  . ALA A 1 40  ? -35.530 14.719  -14.182 1.00 0.00 ? 40  ALA A HB3  2  
ATOM 2793  N N    . VAL A 1 41  ? -36.221 11.199  -14.453 1.00 0.00 ? 41  VAL A N    2  
ATOM 2794  C CA   . VAL A 1 41  ? -36.027 10.088  -15.387 1.00 0.00 ? 41  VAL A CA   2  
ATOM 2795  C C    . VAL A 1 41  ? -35.683 10.671  -16.757 1.00 0.00 ? 41  VAL A C    2  
ATOM 2796  O O    . VAL A 1 41  ? -36.550 11.031  -17.554 1.00 0.00 ? 41  VAL A O    2  
ATOM 2797  C CB   . VAL A 1 41  ? -37.301 9.211   -15.439 1.00 0.00 ? 41  VAL A CB   2  
ATOM 2798  C CG1  . VAL A 1 41  ? -37.200 8.073   -16.461 1.00 0.00 ? 41  VAL A CG1  2  
ATOM 2799  C CG2  . VAL A 1 41  ? -37.585 8.555   -14.080 1.00 0.00 ? 41  VAL A CG2  2  
ATOM 2800  H H    . VAL A 1 41  ? -37.187 11.400  -14.237 1.00 0.00 ? 41  VAL A H    2  
ATOM 2801  H HA   . VAL A 1 41  ? -35.202 9.466   -15.045 1.00 0.00 ? 41  VAL A HA   2  
ATOM 2802  H HB   . VAL A 1 41  ? -38.156 9.837   -15.701 1.00 0.00 ? 41  VAL A HB   2  
ATOM 2803  H HG11 . VAL A 1 41  ? -37.104 8.469   -17.471 1.00 0.00 ? 41  VAL A HG11 2  
ATOM 2804  H HG12 . VAL A 1 41  ? -36.334 7.457   -16.234 1.00 0.00 ? 41  VAL A HG12 2  
ATOM 2805  H HG13 . VAL A 1 41  ? -38.101 7.460   -16.425 1.00 0.00 ? 41  VAL A HG13 2  
ATOM 2806  H HG21 . VAL A 1 41  ? -37.703 9.314   -13.309 1.00 0.00 ? 41  VAL A HG21 2  
ATOM 2807  H HG22 . VAL A 1 41  ? -38.516 7.991   -14.138 1.00 0.00 ? 41  VAL A HG22 2  
ATOM 2808  H HG23 . VAL A 1 41  ? -36.768 7.888   -13.803 1.00 0.00 ? 41  VAL A HG23 2  
ATOM 2809  N N    . ILE A 1 42  ? -34.385 10.793  -17.006 1.00 0.00 ? 42  ILE A N    2  
ATOM 2810  C CA   . ILE A 1 42  ? -33.808 11.272  -18.266 1.00 0.00 ? 42  ILE A CA   2  
ATOM 2811  C C    . ILE A 1 42  ? -33.922 10.227  -19.391 1.00 0.00 ? 42  ILE A C    2  
ATOM 2812  O O    . ILE A 1 42  ? -33.916 10.590  -20.568 1.00 0.00 ? 42  ILE A O    2  
ATOM 2813  C CB   . ILE A 1 42  ? -32.343 11.706  -18.034 1.00 0.00 ? 42  ILE A CB   2  
ATOM 2814  C CG1  . ILE A 1 42  ? -31.478 10.545  -17.492 1.00 0.00 ? 42  ILE A CG1  2  
ATOM 2815  C CG2  . ILE A 1 42  ? -32.297 12.904  -17.066 1.00 0.00 ? 42  ILE A CG2  2  
ATOM 2816  C CD1  . ILE A 1 42  ? -29.992 10.870  -17.406 1.00 0.00 ? 42  ILE A CD1  2  
ATOM 2817  H H    . ILE A 1 42  ? -33.748 10.462  -16.296 1.00 0.00 ? 42  ILE A H    2  
ATOM 2818  H HA   . ILE A 1 42  ? -34.370 12.148  -18.595 1.00 0.00 ? 42  ILE A HA   2  
ATOM 2819  H HB   . ILE A 1 42  ? -31.934 12.029  -18.993 1.00 0.00 ? 42  ILE A HB   2  
ATOM 2820  H HG12 . ILE A 1 42  ? -31.809 10.281  -16.489 1.00 0.00 ? 42  ILE A HG12 2  
ATOM 2821  H HG13 . ILE A 1 42  ? -31.584 9.675   -18.139 1.00 0.00 ? 42  ILE A HG13 2  
ATOM 2822  H HG21 . ILE A 1 42  ? -31.300 13.347  -17.060 1.00 0.00 ? 42  ILE A HG21 2  
ATOM 2823  H HG22 . ILE A 1 42  ? -33.005 13.670  -17.384 1.00 0.00 ? 42  ILE A HG22 2  
ATOM 2824  H HG23 . ILE A 1 42  ? -32.549 12.579  -16.056 1.00 0.00 ? 42  ILE A HG23 2  
ATOM 2825  H HD11 . ILE A 1 42  ? -29.820 11.615  -16.632 1.00 0.00 ? 42  ILE A HD11 2  
ATOM 2826  H HD12 . ILE A 1 42  ? -29.457 9.960   -17.144 1.00 0.00 ? 42  ILE A HD12 2  
ATOM 2827  H HD13 . ILE A 1 42  ? -29.643 11.227  -18.374 1.00 0.00 ? 42  ILE A HD13 2  
ATOM 2828  N N    . TYR A 1 43  ? -34.041 8.940   -19.035 1.00 0.00 ? 43  TYR A N    2  
ATOM 2829  C CA   . TYR A 1 43  ? -34.245 7.823   -19.979 1.00 0.00 ? 43  TYR A CA   2  
ATOM 2830  C C    . TYR A 1 43  ? -34.878 6.603   -19.298 1.00 0.00 ? 43  TYR A C    2  
ATOM 2831  O O    . TYR A 1 43  ? -34.855 6.497   -18.076 1.00 0.00 ? 43  TYR A O    2  
ATOM 2832  C CB   . TYR A 1 43  ? -32.939 7.452   -20.709 1.00 0.00 ? 43  TYR A CB   2  
ATOM 2833  C CG   . TYR A 1 43  ? -33.165 6.751   -22.034 1.00 0.00 ? 43  TYR A CG   2  
ATOM 2834  C CD1  . TYR A 1 43  ? -33.493 7.508   -23.176 1.00 0.00 ? 43  TYR A CD1  2  
ATOM 2835  C CD2  . TYR A 1 43  ? -33.051 5.349   -22.129 1.00 0.00 ? 43  TYR A CD2  2  
ATOM 2836  C CE1  . TYR A 1 43  ? -33.718 6.864   -24.409 1.00 0.00 ? 43  TYR A CE1  2  
ATOM 2837  C CE2  . TYR A 1 43  ? -33.277 4.702   -23.359 1.00 0.00 ? 43  TYR A CE2  2  
ATOM 2838  C CZ   . TYR A 1 43  ? -33.613 5.459   -24.505 1.00 0.00 ? 43  TYR A CZ   2  
ATOM 2839  O OH   . TYR A 1 43  ? -33.832 4.846   -25.701 1.00 0.00 ? 43  TYR A OH   2  
ATOM 2840  H H    . TYR A 1 43  ? -34.046 8.739   -18.032 1.00 0.00 ? 43  TYR A H    2  
ATOM 2841  H HA   . TYR A 1 43  ? -34.965 8.146   -20.727 1.00 0.00 ? 43  TYR A HA   2  
ATOM 2842  H HB2  . TYR A 1 43  ? -32.345 8.347   -20.893 1.00 0.00 ? 43  TYR A HB2  2  
ATOM 2843  H HB3  . TYR A 1 43  ? -32.336 6.811   -20.079 1.00 0.00 ? 43  TYR A HB3  2  
ATOM 2844  H HD1  . TYR A 1 43  ? -33.577 8.586   -23.105 1.00 0.00 ? 43  TYR A HD1  2  
ATOM 2845  H HD2  . TYR A 1 43  ? -32.794 4.763   -21.256 1.00 0.00 ? 43  TYR A HD2  2  
ATOM 2846  H HE1  . TYR A 1 43  ? -33.973 7.440   -25.287 1.00 0.00 ? 43  TYR A HE1  2  
ATOM 2847  H HE2  . TYR A 1 43  ? -33.198 3.627   -23.429 1.00 0.00 ? 43  TYR A HE2  2  
ATOM 2848  H HH   . TYR A 1 43  ? -33.728 3.881   -25.644 1.00 0.00 ? 43  TYR A HH   2  
ATOM 2849  N N    . CYS A 1 44  ? -35.492 5.691   -20.051 1.00 0.00 ? 44  CYS A N    2  
ATOM 2850  C CA   . CYS A 1 44  ? -36.212 4.548   -19.489 1.00 0.00 ? 44  CYS A CA   2  
ATOM 2851  C C    . CYS A 1 44  ? -36.044 3.246   -20.287 1.00 0.00 ? 44  CYS A C    2  
ATOM 2852  O O    . CYS A 1 44  ? -35.889 3.270   -21.511 1.00 0.00 ? 44  CYS A O    2  
ATOM 2853  C CB   . CYS A 1 44  ? -37.697 4.917   -19.383 1.00 0.00 ? 44  CYS A CB   2  
ATOM 2854  S SG   . CYS A 1 44  ? -38.366 5.313   -21.026 1.00 0.00 ? 44  CYS A SG   2  
ATOM 2855  H H    . CYS A 1 44  ? -35.473 5.777   -21.057 1.00 0.00 ? 44  CYS A H    2  
ATOM 2856  H HA   . CYS A 1 44  ? -35.832 4.362   -18.490 1.00 0.00 ? 44  CYS A HA   2  
ATOM 2857  H HB2  . CYS A 1 44  ? -38.250 4.077   -18.962 1.00 0.00 ? 44  CYS A HB2  2  
ATOM 2858  H HB3  . CYS A 1 44  ? -37.812 5.780   -18.724 1.00 0.00 ? 44  CYS A HB3  2  
ATOM 2859  H HG   . CYS A 1 44  ? -37.933 4.207   -21.653 1.00 0.00 ? 44  CYS A HG   2  
ATOM 2860  N N    . ASN A 1 45  ? -36.131 2.101   -19.599 1.00 0.00 ? 45  ASN A N    2  
ATOM 2861  C CA   . ASN A 1 45  ? -36.275 0.799   -20.252 1.00 0.00 ? 45  ASN A CA   2  
ATOM 2862  C C    . ASN A 1 45  ? -37.748 0.433   -20.465 1.00 0.00 ? 45  ASN A C    2  
ATOM 2863  O O    . ASN A 1 45  ? -38.625 0.792   -19.676 1.00 0.00 ? 45  ASN A O    2  
ATOM 2864  C CB   . ASN A 1 45  ? -35.521 -0.293  -19.480 1.00 0.00 ? 45  ASN A CB   2  
ATOM 2865  C CG   . ASN A 1 45  ? -35.245 -1.507  -20.347 1.00 0.00 ? 45  ASN A CG   2  
ATOM 2866  O OD1  . ASN A 1 45  ? -35.946 -2.505  -20.274 1.00 0.00 ? 45  ASN A OD1  2  
ATOM 2867  N ND2  . ASN A 1 45  ? -34.278 -1.444  -21.234 1.00 0.00 ? 45  ASN A ND2  2  
ATOM 2868  H H    . ASN A 1 45  ? -36.237 2.126   -18.588 1.00 0.00 ? 45  ASN A H    2  
ATOM 2869  H HA   . ASN A 1 45  ? -35.818 0.866   -21.241 1.00 0.00 ? 45  ASN A HA   2  
ATOM 2870  H HB2  . ASN A 1 45  ? -34.566 0.109   -19.169 1.00 0.00 ? 45  ASN A HB2  2  
ATOM 2871  H HB3  . ASN A 1 45  ? -36.081 -0.595  -18.598 1.00 0.00 ? 45  ASN A HB3  2  
ATOM 2872  H HD21 . ASN A 1 45  ? -33.687 -0.630  -21.289 1.00 0.00 ? 45  ASN A HD21 2  
ATOM 2873  H HD22 . ASN A 1 45  ? -34.105 -2.256  -21.806 1.00 0.00 ? 45  ASN A HD22 2  
ATOM 2874  N N    . ASP A 1 46  ? -38.007 -0.357  -21.504 1.00 0.00 ? 46  ASP A N    2  
ATOM 2875  C CA   . ASP A 1 46  ? -39.350 -0.865  -21.804 1.00 0.00 ? 46  ASP A CA   2  
ATOM 2876  C C    . ASP A 1 46  ? -39.848 -1.830  -20.713 1.00 0.00 ? 46  ASP A C    2  
ATOM 2877  O O    . ASP A 1 46  ? -41.044 -1.884  -20.436 1.00 0.00 ? 46  ASP A O    2  
ATOM 2878  C CB   . ASP A 1 46  ? -39.365 -1.524  -23.188 1.00 0.00 ? 46  ASP A CB   2  
ATOM 2879  C CG   . ASP A 1 46  ? -39.054 -0.517  -24.308 1.00 0.00 ? 46  ASP A CG   2  
ATOM 2880  O OD1  . ASP A 1 46  ? -39.862 0.416   -24.532 1.00 0.00 ? 46  ASP A OD1  2  
ATOM 2881  O OD2  . ASP A 1 46  ? -38.003 -0.660  -24.976 1.00 0.00 ? 46  ASP A OD2  2  
ATOM 2882  H H    . ASP A 1 46  ? -37.224 -0.668  -22.064 1.00 0.00 ? 46  ASP A H    2  
ATOM 2883  H HA   . ASP A 1 46  ? -40.043 -0.022  -21.829 1.00 0.00 ? 46  ASP A HA   2  
ATOM 2884  H HB2  . ASP A 1 46  ? -38.643 -2.343  -23.204 1.00 0.00 ? 46  ASP A HB2  2  
ATOM 2885  H HB3  . ASP A 1 46  ? -40.355 -1.948  -23.365 1.00 0.00 ? 46  ASP A HB3  2  
ATOM 2886  N N    . GLY A 1 47  ? -38.941 -2.511  -20.002 1.00 0.00 ? 47  GLY A N    2  
ATOM 2887  C CA   . GLY A 1 47  ? -39.279 -3.330  -18.836 1.00 0.00 ? 47  GLY A CA   2  
ATOM 2888  C C    . GLY A 1 47  ? -40.103 -2.567  -17.794 1.00 0.00 ? 47  GLY A C    2  
ATOM 2889  O O    . GLY A 1 47  ? -41.155 -3.043  -17.375 1.00 0.00 ? 47  GLY A O    2  
ATOM 2890  H H    . GLY A 1 47  ? -37.964 -2.447  -20.272 1.00 0.00 ? 47  GLY A H    2  
ATOM 2891  H HA2  . GLY A 1 47  ? -39.846 -4.202  -19.160 1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2892  H HA3  . GLY A 1 47  ? -38.356 -3.668  -18.368 1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2893  N N    . PHE A 1 48  ? -39.674 -1.366  -17.384 1.00 0.00 ? 48  PHE A N    2  
ATOM 2894  C CA   . PHE A 1 48  ? -40.413 -0.560  -16.393 1.00 0.00 ? 48  PHE A CA   2  
ATOM 2895  C C    . PHE A 1 48  ? -41.737 -0.009  -16.977 1.00 0.00 ? 48  PHE A C    2  
ATOM 2896  O O    . PHE A 1 48  ? -42.740 0.172   -16.276 1.00 0.00 ? 48  PHE A O    2  
ATOM 2897  C CB   . PHE A 1 48  ? -39.510 0.513   -15.770 1.00 0.00 ? 48  PHE A CB   2  
ATOM 2898  C CG   . PHE A 1 48  ? -40.061 1.924   -15.743 1.00 0.00 ? 48  PHE A CG   2  
ATOM 2899  C CD1  . PHE A 1 48  ? -39.835 2.809   -16.808 1.00 0.00 ? 48  PHE A CD1  2  
ATOM 2900  C CD2  . PHE A 1 48  ? -40.781 2.356   -14.611 1.00 0.00 ? 48  PHE A CD2  2  
ATOM 2901  C CE1  . PHE A 1 48  ? -40.300 4.132   -16.721 1.00 0.00 ? 48  PHE A CE1  2  
ATOM 2902  C CE2  . PHE A 1 48  ? -41.260 3.675   -14.535 1.00 0.00 ? 48  PHE A CE2  2  
ATOM 2903  C CZ   . PHE A 1 48  ? -41.010 4.568   -15.589 1.00 0.00 ? 48  PHE A CZ   2  
ATOM 2904  H H    . PHE A 1 48  ? -38.847 -0.970  -17.813 1.00 0.00 ? 48  PHE A H    2  
ATOM 2905  H HA   . PHE A 1 48  ? -40.688 -1.227  -15.582 1.00 0.00 ? 48  PHE A HA   2  
ATOM 2906  H HB2  . PHE A 1 48  ? -39.278 0.204   -14.755 1.00 0.00 ? 48  PHE A HB2  2  
ATOM 2907  H HB3  . PHE A 1 48  ? -38.562 0.543   -16.307 1.00 0.00 ? 48  PHE A HB3  2  
ATOM 2908  H HD1  . PHE A 1 48  ? -39.284 2.483   -17.678 1.00 0.00 ? 48  PHE A HD1  2  
ATOM 2909  H HD2  . PHE A 1 48  ? -40.966 1.678   -13.791 1.00 0.00 ? 48  PHE A HD2  2  
ATOM 2910  H HE1  . PHE A 1 48  ? -40.090 4.822   -17.519 1.00 0.00 ? 48  PHE A HE1  2  
ATOM 2911  H HE2  . PHE A 1 48  ? -41.810 4.003   -13.663 1.00 0.00 ? 48  PHE A HE2  2  
ATOM 2912  H HZ   . PHE A 1 48  ? -41.362 5.589   -15.525 1.00 0.00 ? 48  PHE A HZ   2  
ATOM 2913  N N    . CYS A 1 49  ? -41.750 0.227   -18.290 1.00 0.00 ? 49  CYS A N    2  
ATOM 2914  C CA   . CYS A 1 49  ? -42.964 0.562   -19.027 1.00 0.00 ? 49  CYS A CA   2  
ATOM 2915  C C    . CYS A 1 49  ? -44.004 -0.564  -18.891 1.00 0.00 ? 49  CYS A C    2  
ATOM 2916  O O    . CYS A 1 49  ? -45.182 -0.280  -18.696 1.00 0.00 ? 49  CYS A O    2  
ATOM 2917  C CB   . CYS A 1 49  ? -42.602 0.892   -20.482 1.00 0.00 ? 49  CYS A CB   2  
ATOM 2918  S SG   . CYS A 1 49  ? -44.003 1.705   -21.285 1.00 0.00 ? 49  CYS A SG   2  
ATOM 2919  H H    . CYS A 1 49  ? -40.930 -0.031  -18.819 1.00 0.00 ? 49  CYS A H    2  
ATOM 2920  H HA   . CYS A 1 49  ? -43.395 1.457   -18.576 1.00 0.00 ? 49  CYS A HA   2  
ATOM 2921  H HB2  . CYS A 1 49  ? -41.741 1.561   -20.505 1.00 0.00 ? 49  CYS A HB2  2  
ATOM 2922  H HB3  . CYS A 1 49  ? -42.366 -0.017  -21.031 1.00 0.00 ? 49  CYS A HB3  2  
ATOM 2923  H HG   . CYS A 1 49  ? -44.902 0.723   -21.094 1.00 0.00 ? 49  CYS A HG   2  
ATOM 2924  N N    . GLU A 1 50  ? -43.589 -1.837  -18.931 1.00 0.00 ? 50  GLU A N    2  
ATOM 2925  C CA   . GLU A 1 50  ? -44.476 -2.989  -18.686 1.00 0.00 ? 50  GLU A CA   2  
ATOM 2926  C C    . GLU A 1 50  ? -44.766 -3.213  -17.191 1.00 0.00 ? 50  GLU A C    2  
ATOM 2927  O O    . GLU A 1 50  ? -45.857 -3.660  -16.836 1.00 0.00 ? 50  GLU A O    2  
ATOM 2928  C CB   . GLU A 1 50  ? -43.873 -4.268  -19.285 1.00 0.00 ? 50  GLU A CB   2  
ATOM 2929  C CG   . GLU A 1 50  ? -43.642 -4.151  -20.796 1.00 0.00 ? 50  GLU A CG   2  
ATOM 2930  C CD   . GLU A 1 50  ? -43.190 -5.498  -21.393 1.00 0.00 ? 50  GLU A CD   2  
ATOM 2931  O OE1  . GLU A 1 50  ? -41.973 -5.807  -21.372 1.00 0.00 ? 50  GLU A OE1  2  
ATOM 2932  O OE2  . GLU A 1 50  ? -44.053 -6.262  -21.892 1.00 0.00 ? 50  GLU A OE2  2  
ATOM 2933  H H    . GLU A 1 50  ? -42.599 -2.018  -19.092 1.00 0.00 ? 50  GLU A H    2  
ATOM 2934  H HA   . GLU A 1 50  ? -45.434 -2.810  -19.177 1.00 0.00 ? 50  GLU A HA   2  
ATOM 2935  H HB2  . GLU A 1 50  ? -42.936 -4.496  -18.777 1.00 0.00 ? 50  GLU A HB2  2  
ATOM 2936  H HB3  . GLU A 1 50  ? -44.565 -5.091  -19.105 1.00 0.00 ? 50  GLU A HB3  2  
ATOM 2937  H HG2  . GLU A 1 50  ? -44.569 -3.824  -21.272 1.00 0.00 ? 50  GLU A HG2  2  
ATOM 2938  H HG3  . GLU A 1 50  ? -42.890 -3.383  -20.987 1.00 0.00 ? 50  GLU A HG3  2  
ATOM 2939  N N    . LEU A 1 51  ? -43.824 -2.853  -16.310 1.00 0.00 ? 51  LEU A N    2  
ATOM 2940  C CA   . LEU A 1 51  ? -43.977 -2.881  -14.851 1.00 0.00 ? 51  LEU A CA   2  
ATOM 2941  C C    . LEU A 1 51  ? -45.192 -2.050  -14.411 1.00 0.00 ? 51  LEU A C    2  
ATOM 2942  O O    . LEU A 1 51  ? -46.066 -2.576  -13.716 1.00 0.00 ? 51  LEU A O    2  
ATOM 2943  C CB   . LEU A 1 51  ? -42.679 -2.367  -14.209 1.00 0.00 ? 51  LEU A CB   2  
ATOM 2944  C CG   . LEU A 1 51  ? -42.664 -2.255  -12.679 1.00 0.00 ? 51  LEU A CG   2  
ATOM 2945  C CD1  . LEU A 1 51  ? -42.890 -3.596  -11.991 1.00 0.00 ? 51  LEU A CD1  2  
ATOM 2946  C CD2  . LEU A 1 51  ? -41.345 -1.663  -12.214 1.00 0.00 ? 51  LEU A CD2  2  
ATOM 2947  H H    . LEU A 1 51  ? -42.925 -2.577  -16.687 1.00 0.00 ? 51  LEU A H    2  
ATOM 2948  H HA   . LEU A 1 51  ? -44.112 -3.917  -14.539 1.00 0.00 ? 51  LEU A HA   2  
ATOM 2949  H HB2  . LEU A 1 51  ? -41.859 -2.985  -14.564 1.00 0.00 ? 51  LEU A HB2  2  
ATOM 2950  H HB3  . LEU A 1 51  ? -42.512 -1.360  -14.551 1.00 0.00 ? 51  LEU A HB3  2  
ATOM 2951  H HG   . LEU A 1 51  ? -43.470 -1.575  -12.397 1.00 0.00 ? 51  LEU A HG   2  
ATOM 2952  H HD11 . LEU A 1 51  ? -42.826 -3.455  -10.911 1.00 0.00 ? 51  LEU A HD11 2  
ATOM 2953  H HD12 . LEU A 1 51  ? -43.881 -3.978  -12.229 1.00 0.00 ? 51  LEU A HD12 2  
ATOM 2954  H HD13 . LEU A 1 51  ? -42.135 -4.313  -12.308 1.00 0.00 ? 51  LEU A HD13 2  
ATOM 2955  H HD21 . LEU A 1 51  ? -40.525 -2.317  -12.508 1.00 0.00 ? 51  LEU A HD21 2  
ATOM 2956  H HD22 . LEU A 1 51  ? -41.208 -0.676  -12.653 1.00 0.00 ? 51  LEU A HD22 2  
ATOM 2957  H HD23 . LEU A 1 51  ? -41.362 -1.563  -11.129 1.00 0.00 ? 51  LEU A HD23 2  
ATOM 2958  N N    . CYS A 1 52  ? -45.270 -0.791  -14.862 1.00 0.00 ? 52  CYS A N    2  
ATOM 2959  C CA   . CYS A 1 52  ? -46.396 0.113   -14.565 1.00 0.00 ? 52  CYS A CA   2  
ATOM 2960  C C    . CYS A 1 52  ? -47.533 0.041   -15.615 1.00 0.00 ? 52  CYS A C    2  
ATOM 2961  O O    . CYS A 1 52  ? -48.688 0.383   -15.343 1.00 0.00 ? 52  CYS A O    2  
ATOM 2962  C CB   . CYS A 1 52  ? -45.858 1.544   -14.412 1.00 0.00 ? 52  CYS A CB   2  
ATOM 2963  S SG   . CYS A 1 52  ? -44.527 1.622   -13.171 1.00 0.00 ? 52  CYS A SG   2  
ATOM 2964  H H    . CYS A 1 52  ? -44.483 -0.433  -15.399 1.00 0.00 ? 52  CYS A H    2  
ATOM 2965  H HA   . CYS A 1 52  ? -46.833 -0.182  -13.609 1.00 0.00 ? 52  CYS A HA   2  
ATOM 2966  H HB2  . CYS A 1 52  ? -45.478 1.905   -15.370 1.00 0.00 ? 52  CYS A HB2  2  
ATOM 2967  H HB3  . CYS A 1 52  ? -46.673 2.193   -14.088 1.00 0.00 ? 52  CYS A HB3  2  
ATOM 2968  H HG   . CYS A 1 52  ? -43.610 0.953   -13.887 1.00 0.00 ? 52  CYS A HG   2  
ATOM 2969  N N    . GLY A 1 53  ? -47.214 -0.445  -16.816 1.00 0.00 ? 53  GLY A N    2  
ATOM 2970  C CA   . GLY A 1 53  ? -48.140 -0.709  -17.929 1.00 0.00 ? 53  GLY A CA   2  
ATOM 2971  C C    . GLY A 1 53  ? -48.525 0.494   -18.808 1.00 0.00 ? 53  GLY A C    2  
ATOM 2972  O O    . GLY A 1 53  ? -49.435 0.355   -19.627 1.00 0.00 ? 53  GLY A O    2  
ATOM 2973  H H    . GLY A 1 53  ? -46.234 -0.665  -16.976 1.00 0.00 ? 53  GLY A H    2  
ATOM 2974  H HA2  . GLY A 1 53  ? -47.683 -1.455  -18.579 1.00 0.00 ? 53  GLY A HA2  2  
ATOM 2975  H HA3  . GLY A 1 53  ? -49.059 -1.138  -17.529 1.00 0.00 ? 53  GLY A HA3  2  
ATOM 2976  N N    . TYR A 1 54  ? -47.870 1.653   -18.665 1.00 0.00 ? 54  TYR A N    2  
ATOM 2977  C CA   . TYR A 1 54  ? -48.202 2.907   -19.370 1.00 0.00 ? 54  TYR A CA   2  
ATOM 2978  C C    . TYR A 1 54  ? -47.503 3.022   -20.749 1.00 0.00 ? 54  TYR A C    2  
ATOM 2979  O O    . TYR A 1 54  ? -47.721 2.178   -21.622 1.00 0.00 ? 54  TYR A O    2  
ATOM 2980  C CB   . TYR A 1 54  ? -47.976 4.109   -18.428 1.00 0.00 ? 54  TYR A CB   2  
ATOM 2981  C CG   . TYR A 1 54  ? -48.980 4.222   -17.294 1.00 0.00 ? 54  TYR A CG   2  
ATOM 2982  C CD1  . TYR A 1 54  ? -50.230 4.830   -17.528 1.00 0.00 ? 54  TYR A CD1  2  
ATOM 2983  C CD2  . TYR A 1 54  ? -48.661 3.755   -16.004 1.00 0.00 ? 54  TYR A CD2  2  
ATOM 2984  C CE1  . TYR A 1 54  ? -51.158 4.972   -16.479 1.00 0.00 ? 54  TYR A CE1  2  
ATOM 2985  C CE2  . TYR A 1 54  ? -49.589 3.888   -14.951 1.00 0.00 ? 54  TYR A CE2  2  
ATOM 2986  C CZ   . TYR A 1 54  ? -50.840 4.501   -15.185 1.00 0.00 ? 54  TYR A CZ   2  
ATOM 2987  O OH   . TYR A 1 54  ? -51.741 4.617   -14.172 1.00 0.00 ? 54  TYR A OH   2  
ATOM 2988  H H    . TYR A 1 54  ? -47.097 1.666   -18.017 1.00 0.00 ? 54  TYR A H    2  
ATOM 2989  H HA   . TYR A 1 54  ? -49.269 2.901   -19.593 1.00 0.00 ? 54  TYR A HA   2  
ATOM 2990  H HB2  . TYR A 1 54  ? -46.964 4.066   -18.020 1.00 0.00 ? 54  TYR A HB2  2  
ATOM 2991  H HB3  . TYR A 1 54  ? -48.056 5.032   -19.003 1.00 0.00 ? 54  TYR A HB3  2  
ATOM 2992  H HD1  . TYR A 1 54  ? -50.473 5.200   -18.516 1.00 0.00 ? 54  TYR A HD1  2  
ATOM 2993  H HD2  . TYR A 1 54  ? -47.701 3.296   -15.821 1.00 0.00 ? 54  TYR A HD2  2  
ATOM 2994  H HE1  . TYR A 1 54  ? -52.115 5.440   -16.662 1.00 0.00 ? 54  TYR A HE1  2  
ATOM 2995  H HE2  . TYR A 1 54  ? -49.353 3.523   -13.962 1.00 0.00 ? 54  TYR A HE2  2  
ATOM 2996  H HH   . TYR A 1 54  ? -52.558 5.062   -14.454 1.00 0.00 ? 54  TYR A HH   2  
ATOM 2997  N N    . SER A 1 55  ? -46.675 4.053   -20.972 1.00 0.00 ? 55  SER A N    2  
ATOM 2998  C CA   . SER A 1 55  ? -45.974 4.336   -22.235 1.00 0.00 ? 55  SER A CA   2  
ATOM 2999  C C    . SER A 1 55  ? -44.774 5.255   -21.983 1.00 0.00 ? 55  SER A C    2  
ATOM 3000  O O    . SER A 1 55  ? -44.866 6.219   -21.221 1.00 0.00 ? 55  SER A O    2  
ATOM 3001  C CB   . SER A 1 55  ? -46.916 5.021   -23.233 1.00 0.00 ? 55  SER A CB   2  
ATOM 3002  O OG   . SER A 1 55  ? -46.229 5.268   -24.451 1.00 0.00 ? 55  SER A OG   2  
ATOM 3003  H H    . SER A 1 55  ? -46.550 4.728   -20.230 1.00 0.00 ? 55  SER A H    2  
ATOM 3004  H HA   . SER A 1 55  ? -45.630 3.406   -22.682 1.00 0.00 ? 55  SER A HA   2  
ATOM 3005  H HB2  . SER A 1 55  ? -47.772 4.372   -23.425 1.00 0.00 ? 55  SER A HB2  2  
ATOM 3006  H HB3  . SER A 1 55  ? -47.272 5.962   -22.816 1.00 0.00 ? 55  SER A HB3  2  
ATOM 3007  H HG   . SER A 1 55  ? -46.873 5.613   -25.102 1.00 0.00 ? 55  SER A HG   2  
ATOM 3008  N N    . ARG A 1 56  ? -43.638 4.983   -22.638 1.00 0.00 ? 56  ARG A N    2  
ATOM 3009  C CA   . ARG A 1 56  ? -42.367 5.712   -22.441 1.00 0.00 ? 56  ARG A CA   2  
ATOM 3010  C C    . ARG A 1 56  ? -42.464 7.207   -22.767 1.00 0.00 ? 56  ARG A C    2  
ATOM 3011  O O    . ARG A 1 56  ? -41.895 8.035   -22.061 1.00 0.00 ? 56  ARG A O    2  
ATOM 3012  C CB   . ARG A 1 56  ? -41.236 4.995   -23.203 1.00 0.00 ? 56  ARG A CB   2  
ATOM 3013  C CG   . ARG A 1 56  ? -41.444 4.847   -24.721 1.00 0.00 ? 56  ARG A CG   2  
ATOM 3014  C CD   . ARG A 1 56  ? -40.364 3.933   -25.318 1.00 0.00 ? 56  ARG A CD   2  
ATOM 3015  N NE   . ARG A 1 56  ? -40.503 3.831   -26.784 1.00 0.00 ? 56  ARG A NE   2  
ATOM 3016  C CZ   . ARG A 1 56  ? -40.404 2.747   -27.537 1.00 0.00 ? 56  ARG A CZ   2  
ATOM 3017  N NH1  . ARG A 1 56  ? -40.178 1.556   -27.060 1.00 0.00 ? 56  ARG A NH1  2  
ATOM 3018  N NH2  . ARG A 1 56  ? -40.534 2.845   -28.829 1.00 0.00 ? 56  ARG A NH2  2  
ATOM 3019  H H    . ARG A 1 56  ? -43.648 4.195   -23.271 1.00 0.00 ? 56  ARG A H    2  
ATOM 3020  H HA   . ARG A 1 56  ? -42.113 5.664   -21.381 1.00 0.00 ? 56  ARG A HA   2  
ATOM 3021  H HB2  . ARG A 1 56  ? -40.310 5.545   -23.044 1.00 0.00 ? 56  ARG A HB2  2  
ATOM 3022  H HB3  . ARG A 1 56  ? -41.115 4.001   -22.768 1.00 0.00 ? 56  ARG A HB3  2  
ATOM 3023  H HG2  . ARG A 1 56  ? -42.419 4.406   -24.928 1.00 0.00 ? 56  ARG A HG2  2  
ATOM 3024  H HG3  . ARG A 1 56  ? -41.391 5.829   -25.192 1.00 0.00 ? 56  ARG A HG3  2  
ATOM 3025  H HD2  . ARG A 1 56  ? -39.380 4.339   -25.080 1.00 0.00 ? 56  ARG A HD2  2  
ATOM 3026  H HD3  . ARG A 1 56  ? -40.452 2.950   -24.854 1.00 0.00 ? 56  ARG A HD3  2  
ATOM 3027  H HE   . ARG A 1 56  ? -40.672 4.692   -27.279 1.00 0.00 ? 56  ARG A HE   2  
ATOM 3028  H HH11 . ARG A 1 56  ? -40.071 1.400   -26.056 1.00 0.00 ? 56  ARG A HH11 2  
ATOM 3029  H HH12 . ARG A 1 56  ? -40.099 0.768   -27.676 1.00 0.00 ? 56  ARG A HH12 2  
ATOM 3030  H HH21 . ARG A 1 56  ? -40.710 3.740   -29.257 1.00 0.00 ? 56  ARG A HH21 2  
ATOM 3031  H HH22 . ARG A 1 56  ? -40.461 2.026   -29.410 1.00 0.00 ? 56  ARG A HH22 2  
ATOM 3032  N N    . ALA A 1 57  ? -43.298 7.575   -23.737 1.00 0.00 ? 57  ALA A N    2  
ATOM 3033  C CA   . ALA A 1 57  ? -43.599 8.965   -24.090 1.00 0.00 ? 57  ALA A CA   2  
ATOM 3034  C C    . ALA A 1 57  ? -44.222 9.780   -22.929 1.00 0.00 ? 57  ALA A C    2  
ATOM 3035  O O    . ALA A 1 57  ? -44.227 11.010  -22.969 1.00 0.00 ? 57  ALA A O    2  
ATOM 3036  C CB   . ALA A 1 57  ? -44.520 8.937   -25.314 1.00 0.00 ? 57  ALA A CB   2  
ATOM 3037  H H    . ALA A 1 57  ? -43.801 6.844   -24.213 1.00 0.00 ? 57  ALA A H    2  
ATOM 3038  H HA   . ALA A 1 57  ? -42.667 9.466   -24.363 1.00 0.00 ? 57  ALA A HA   2  
ATOM 3039  H HB1  . ALA A 1 57  ? -44.732 9.956   -25.641 1.00 0.00 ? 57  ALA A HB1  2  
ATOM 3040  H HB2  . ALA A 1 57  ? -44.036 8.398   -26.130 1.00 0.00 ? 57  ALA A HB2  2  
ATOM 3041  H HB3  . ALA A 1 57  ? -45.459 8.439   -25.063 1.00 0.00 ? 57  ALA A HB3  2  
ATOM 3042  N N    . GLU A 1 58  ? -44.728 9.106   -21.890 1.00 0.00 ? 58  GLU A N    2  
ATOM 3043  C CA   . GLU A 1 58  ? -45.304 9.699   -20.687 1.00 0.00 ? 58  GLU A CA   2  
ATOM 3044  C C    . GLU A 1 58  ? -44.299 9.768   -19.528 1.00 0.00 ? 58  GLU A C    2  
ATOM 3045  O O    . GLU A 1 58  ? -44.508 10.575  -18.622 1.00 0.00 ? 58  GLU A O    2  
ATOM 3046  C CB   . GLU A 1 58  ? -46.562 8.921   -20.264 1.00 0.00 ? 58  GLU A CB   2  
ATOM 3047  C CG   . GLU A 1 58  ? -47.640 8.862   -21.356 1.00 0.00 ? 58  GLU A CG   2  
ATOM 3048  C CD   . GLU A 1 58  ? -48.935 8.218   -20.822 1.00 0.00 ? 58  GLU A CD   2  
ATOM 3049  O OE1  . GLU A 1 58  ? -49.807 8.953   -20.295 1.00 0.00 ? 58  GLU A OE1  2  
ATOM 3050  O OE2  . GLU A 1 58  ? -49.098 6.979   -20.939 1.00 0.00 ? 58  GLU A OE2  2  
ATOM 3051  H H    . GLU A 1 58  ? -44.655 8.098   -21.885 1.00 0.00 ? 58  GLU A H    2  
ATOM 3052  H HA   . GLU A 1 58  ? -45.611 10.724  -20.901 1.00 0.00 ? 58  GLU A HA   2  
ATOM 3053  H HB2  . GLU A 1 58  ? -46.291 7.909   -19.966 1.00 0.00 ? 58  GLU A HB2  2  
ATOM 3054  H HB3  . GLU A 1 58  ? -46.981 9.417   -19.393 1.00 0.00 ? 58  GLU A HB3  2  
ATOM 3055  H HG2  . GLU A 1 58  ? -47.848 9.876   -21.703 1.00 0.00 ? 58  GLU A HG2  2  
ATOM 3056  H HG3  . GLU A 1 58  ? -47.268 8.290   -22.209 1.00 0.00 ? 58  GLU A HG3  2  
ATOM 3057  N N    . VAL A 1 59  ? -43.218 8.966   -19.522 1.00 0.00 ? 59  VAL A N    2  
ATOM 3058  C CA   . VAL A 1 59  ? -42.294 8.874   -18.359 1.00 0.00 ? 59  VAL A CA   2  
ATOM 3059  C C    . VAL A 1 59  ? -41.149 9.878   -18.423 1.00 0.00 ? 59  VAL A C    2  
ATOM 3060  O O    . VAL A 1 59  ? -40.520 10.166  -17.397 1.00 0.00 ? 59  VAL A O    2  
ATOM 3061  C CB   . VAL A 1 59  ? -41.723 7.456   -18.144 1.00 0.00 ? 59  VAL A CB   2  
ATOM 3062  C CG1  . VAL A 1 59  ? -42.835 6.401   -18.232 1.00 0.00 ? 59  VAL A CG1  2  
ATOM 3063  C CG2  . VAL A 1 59  ? -40.578 7.098   -19.094 1.00 0.00 ? 59  VAL A CG2  2  
ATOM 3064  H H    . VAL A 1 59  ? -43.026 8.388   -20.341 1.00 0.00 ? 59  VAL A H    2  
ATOM 3065  H HA   . VAL A 1 59  ? -42.857 9.123   -17.458 1.00 0.00 ? 59  VAL A HA   2  
ATOM 3066  H HB   . VAL A 1 59  ? -41.321 7.418   -17.134 1.00 0.00 ? 59  VAL A HB   2  
ATOM 3067  H HG11 . VAL A 1 59  ? -43.657 6.675   -17.569 1.00 0.00 ? 59  VAL A HG11 2  
ATOM 3068  H HG12 . VAL A 1 59  ? -43.205 6.320   -19.251 1.00 0.00 ? 59  VAL A HG12 2  
ATOM 3069  H HG13 . VAL A 1 59  ? -42.455 5.427   -17.929 1.00 0.00 ? 59  VAL A HG13 2  
ATOM 3070  H HG21 . VAL A 1 59  ? -40.730 7.539   -20.069 1.00 0.00 ? 59  VAL A HG21 2  
ATOM 3071  H HG22 . VAL A 1 59  ? -39.637 7.472   -18.691 1.00 0.00 ? 59  VAL A HG22 2  
ATOM 3072  H HG23 . VAL A 1 59  ? -40.510 6.022   -19.224 1.00 0.00 ? 59  VAL A HG23 2  
ATOM 3073  N N    . MET A 1 60  ? -40.906 10.435  -19.616 1.00 0.00 ? 60  MET A N    2  
ATOM 3074  C CA   . MET A 1 60  ? -39.858 11.415  -19.864 1.00 0.00 ? 60  MET A CA   2  
ATOM 3075  C C    . MET A 1 60  ? -39.940 12.530  -18.825 1.00 0.00 ? 60  MET A C    2  
ATOM 3076  O O    . MET A 1 60  ? -40.898 13.301  -18.778 1.00 0.00 ? 60  MET A O    2  
ATOM 3077  C CB   . MET A 1 60  ? -39.978 11.999  -21.282 1.00 0.00 ? 60  MET A CB   2  
ATOM 3078  C CG   . MET A 1 60  ? -39.625 11.023  -22.409 1.00 0.00 ? 60  MET A CG   2  
ATOM 3079  S SD   . MET A 1 60  ? -37.936 10.350  -22.390 1.00 0.00 ? 60  MET A SD   2  
ATOM 3080  C CE   . MET A 1 60  ? -38.218 8.750   -21.579 1.00 0.00 ? 60  MET A CE   2  
ATOM 3081  H H    . MET A 1 60  ? -41.484 10.151  -20.394 1.00 0.00 ? 60  MET A H    2  
ATOM 3082  H HA   . MET A 1 60  ? -38.888 10.929  -19.760 1.00 0.00 ? 60  MET A HA   2  
ATOM 3083  H HB2  . MET A 1 60  ? -40.997 12.354  -21.443 1.00 0.00 ? 60  MET A HB2  2  
ATOM 3084  H HB3  . MET A 1 60  ? -39.307 12.854  -21.364 1.00 0.00 ? 60  MET A HB3  2  
ATOM 3085  H HG2  . MET A 1 60  ? -40.342 10.209  -22.408 1.00 0.00 ? 60  MET A HG2  2  
ATOM 3086  H HG3  . MET A 1 60  ? -39.752 11.559  -23.351 1.00 0.00 ? 60  MET A HG3  2  
ATOM 3087  H HE1  . MET A 1 60  ? -38.963 8.181   -22.137 1.00 0.00 ? 60  MET A HE1  2  
ATOM 3088  H HE2  . MET A 1 60  ? -37.286 8.186   -21.554 1.00 0.00 ? 60  MET A HE2  2  
ATOM 3089  H HE3  . MET A 1 60  ? -38.570 8.898   -20.560 1.00 0.00 ? 60  MET A HE3  2  
ATOM 3090  N N    . GLN A 1 61  ? -38.891 12.604  -18.011 1.00 0.00 ? 61  GLN A N    2  
ATOM 3091  C CA   . GLN A 1 61  ? -38.625 13.667  -17.049 1.00 0.00 ? 61  GLN A CA   2  
ATOM 3092  C C    . GLN A 1 61  ? -39.543 13.646  -15.806 1.00 0.00 ? 61  GLN A C    2  
ATOM 3093  O O    . GLN A 1 61  ? -39.674 14.667  -15.126 1.00 0.00 ? 61  GLN A O    2  
ATOM 3094  C CB   . GLN A 1 61  ? -38.514 15.026  -17.782 1.00 0.00 ? 61  GLN A CB   2  
ATOM 3095  C CG   . GLN A 1 61  ? -37.610 14.988  -19.041 1.00 0.00 ? 61  GLN A CG   2  
ATOM 3096  C CD   . GLN A 1 61  ? -38.110 15.889  -20.173 1.00 0.00 ? 61  GLN A CD   2  
ATOM 3097  O OE1  . GLN A 1 61  ? -38.581 17.003  -19.978 1.00 0.00 ? 61  GLN A OE1  2  
ATOM 3098  N NE2  . GLN A 1 61  ? -38.042 15.423  -21.406 1.00 0.00 ? 61  GLN A NE2  2  
ATOM 3099  H H    . GLN A 1 61  ? -38.184 11.880  -18.095 1.00 0.00 ? 61  GLN A H    2  
ATOM 3100  H HA   . GLN A 1 61  ? -37.628 13.460  -16.657 1.00 0.00 ? 61  GLN A HA   2  
ATOM 3101  H HB2  . GLN A 1 61  ? -39.518 15.341  -18.070 1.00 0.00 ? 61  GLN A HB2  2  
ATOM 3102  H HB3  . GLN A 1 61  ? -38.124 15.778  -17.095 1.00 0.00 ? 61  GLN A HB3  2  
ATOM 3103  H HG2  . GLN A 1 61  ? -36.594 15.270  -18.768 1.00 0.00 ? 61  GLN A HG2  2  
ATOM 3104  H HG3  . GLN A 1 61  ? -37.552 13.978  -19.453 1.00 0.00 ? 61  GLN A HG3  2  
ATOM 3105  H HE21 . GLN A 1 61  ? -37.625 14.524  -21.587 1.00 0.00 ? 61  GLN A HE21 2  
ATOM 3106  H HE22 . GLN A 1 61  ? -38.454 15.958  -22.155 1.00 0.00 ? 61  GLN A HE22 2  
ATOM 3107  N N    . ARG A 1 62  ? -40.176 12.505  -15.466 1.00 0.00 ? 62  ARG A N    2  
ATOM 3108  C CA   . ARG A 1 62  ? -40.845 12.322  -14.159 1.00 0.00 ? 62  ARG A CA   2  
ATOM 3109  C C    . ARG A 1 62  ? -39.816 12.126  -13.034 1.00 0.00 ? 62  ARG A C    2  
ATOM 3110  O O    . ARG A 1 62  ? -38.732 11.625  -13.323 1.00 0.00 ? 62  ARG A O    2  
ATOM 3111  C CB   . ARG A 1 62  ? -41.776 11.097  -14.208 1.00 0.00 ? 62  ARG A CB   2  
ATOM 3112  C CG   . ARG A 1 62  ? -43.212 11.403  -14.640 1.00 0.00 ? 62  ARG A CG   2  
ATOM 3113  C CD   . ARG A 1 62  ? -43.418 11.779  -16.105 1.00 0.00 ? 62  ARG A CD   2  
ATOM 3114  N NE   . ARG A 1 62  ? -43.095 13.185  -16.392 1.00 0.00 ? 62  ARG A NE   2  
ATOM 3115  C CZ   . ARG A 1 62  ? -43.573 13.914  -17.385 1.00 0.00 ? 62  ARG A CZ   2  
ATOM 3116  N NH1  . ARG A 1 62  ? -44.345 13.406  -18.303 1.00 0.00 ? 62  ARG A NH1  2  
ATOM 3117  N NH2  . ARG A 1 62  ? -43.289 15.182  -17.468 1.00 0.00 ? 62  ARG A NH2  2  
ATOM 3118  H H    . ARG A 1 62  ? -40.120 11.689  -16.075 1.00 0.00 ? 62  ARG A H    2  
ATOM 3119  H HA   . ARG A 1 62  ? -41.397 13.225  -13.905 1.00 0.00 ? 62  ARG A HA   2  
ATOM 3120  H HB2  . ARG A 1 62  ? -41.349 10.327  -14.852 1.00 0.00 ? 62  ARG A HB2  2  
ATOM 3121  H HB3  . ARG A 1 62  ? -41.842 10.667  -13.207 1.00 0.00 ? 62  ARG A HB3  2  
ATOM 3122  H HG2  . ARG A 1 62  ? -43.784 10.495  -14.464 1.00 0.00 ? 62  ARG A HG2  2  
ATOM 3123  H HG3  . ARG A 1 62  ? -43.610 12.193  -14.008 1.00 0.00 ? 62  ARG A HG3  2  
ATOM 3124  H HD2  . ARG A 1 62  ? -42.811 11.129  -16.729 1.00 0.00 ? 62  ARG A HD2  2  
ATOM 3125  H HD3  . ARG A 1 62  ? -44.471 11.601  -16.334 1.00 0.00 ? 62  ARG A HD3  2  
ATOM 3126  H HE   . ARG A 1 62  ? -42.421 13.621  -15.791 1.00 0.00 ? 62  ARG A HE   2  
ATOM 3127  H HH11 . ARG A 1 62  ? -44.496 12.402  -18.304 1.00 0.00 ? 62  ARG A HH11 2  
ATOM 3128  H HH12 . ARG A 1 62  ? -44.692 13.971  -19.056 1.00 0.00 ? 62  ARG A HH12 2  
ATOM 3129  H HH21 . ARG A 1 62  ? -42.695 15.616  -16.782 1.00 0.00 ? 62  ARG A HH21 2  
ATOM 3130  H HH22 . ARG A 1 62  ? -43.644 15.731  -18.231 1.00 0.00 ? 62  ARG A HH22 2  
ATOM 3131  N N    . PRO A 1 63  ? -40.119 12.453  -11.765 1.00 0.00 ? 63  PRO A N    2  
ATOM 3132  C CA   . PRO A 1 63  ? -39.226 12.165  -10.641 1.00 0.00 ? 63  PRO A CA   2  
ATOM 3133  C C    . PRO A 1 63  ? -39.078 10.651  -10.407 1.00 0.00 ? 63  PRO A C    2  
ATOM 3134  O O    . PRO A 1 63  ? -40.053 9.899   -10.468 1.00 0.00 ? 63  PRO A O    2  
ATOM 3135  C CB   . PRO A 1 63  ? -39.849 12.876  -9.436  1.00 0.00 ? 63  PRO A CB   2  
ATOM 3136  C CG   . PRO A 1 63  ? -41.340 12.873  -9.766  1.00 0.00 ? 63  PRO A CG   2  
ATOM 3137  C CD   . PRO A 1 63  ? -41.360 13.049  -11.284 1.00 0.00 ? 63  PRO A CD   2  
ATOM 3138  H HA   . PRO A 1 63  ? -38.242 12.595  -10.825 1.00 0.00 ? 63  PRO A HA   2  
ATOM 3139  H HB2  . PRO A 1 63  ? -39.639 12.363  -8.495  1.00 0.00 ? 63  PRO A HB2  2  
ATOM 3140  H HB3  . PRO A 1 63  ? -39.493 13.906  -9.394  1.00 0.00 ? 63  PRO A HB3  2  
ATOM 3141  H HG2  . PRO A 1 63  ? -41.766 11.904  -9.505  1.00 0.00 ? 63  PRO A HG2  2  
ATOM 3142  H HG3  . PRO A 1 63  ? -41.873 13.677  -9.257  1.00 0.00 ? 63  PRO A HG3  2  
ATOM 3143  H HD2  . PRO A 1 63  ? -42.238 12.555  -11.703 1.00 0.00 ? 63  PRO A HD2  2  
ATOM 3144  H HD3  . PRO A 1 63  ? -41.372 14.112  -11.530 1.00 0.00 ? 63  PRO A HD3  2  
ATOM 3145  N N    . CYS A 1 64  ? -37.861 10.197  -10.095 1.00 0.00 ? 64  CYS A N    2  
ATOM 3146  C CA   . CYS A 1 64  ? -37.566 8.801   -9.741  1.00 0.00 ? 64  CYS A CA   2  
ATOM 3147  C C    . CYS A 1 64  ? -38.142 8.392   -8.365  1.00 0.00 ? 64  CYS A C    2  
ATOM 3148  O O    . CYS A 1 64  ? -38.299 7.204   -8.078  1.00 0.00 ? 64  CYS A O    2  
ATOM 3149  C CB   . CYS A 1 64  ? -36.042 8.632   -9.800  1.00 0.00 ? 64  CYS A CB   2  
ATOM 3150  S SG   . CYS A 1 64  ? -35.588 6.883   -9.663  1.00 0.00 ? 64  CYS A SG   2  
ATOM 3151  H H    . CYS A 1 64  ? -37.080 10.846  -10.120 1.00 0.00 ? 64  CYS A H    2  
ATOM 3152  H HA   . CYS A 1 64  ? -38.009 8.141   -10.490 1.00 0.00 ? 64  CYS A HA   2  
ATOM 3153  H HB2  . CYS A 1 64  ? -35.673 9.013   -10.753 1.00 0.00 ? 64  CYS A HB2  2  
ATOM 3154  H HB3  . CYS A 1 64  ? -35.575 9.201   -8.996  1.00 0.00 ? 64  CYS A HB3  2  
ATOM 3155  H HG   . CYS A 1 64  ? -36.343 6.608   -8.586  1.00 0.00 ? 64  CYS A HG   2  
ATOM 3156  N N    . THR A 1 65  ? -38.470 9.365   -7.508  1.00 0.00 ? 65  THR A N    2  
ATOM 3157  C CA   . THR A 1 65  ? -39.031 9.208   -6.165  1.00 0.00 ? 65  THR A CA   2  
ATOM 3158  C C    . THR A 1 65  ? -40.384 8.505   -6.200  1.00 0.00 ? 65  THR A C    2  
ATOM 3159  O O    . THR A 1 65  ? -41.417 9.110   -6.487  1.00 0.00 ? 65  THR A O    2  
ATOM 3160  C CB   . THR A 1 65  ? -39.162 10.560  -5.442  1.00 0.00 ? 65  THR A CB   2  
ATOM 3161  O OG1  . THR A 1 65  ? -38.049 11.392  -5.688  1.00 0.00 ? 65  THR A OG1  2  
ATOM 3162  C CG2  . THR A 1 65  ? -39.259 10.328  -3.937  1.00 0.00 ? 65  THR A CG2  2  
ATOM 3163  H H    . THR A 1 65  ? -38.232 10.304  -7.757  1.00 0.00 ? 65  THR A H    2  
ATOM 3164  H HA   . THR A 1 65  ? -38.338 8.591   -5.593  1.00 0.00 ? 65  THR A HA   2  
ATOM 3165  H HB   . THR A 1 65  ? -40.048 11.084  -5.787  1.00 0.00 ? 65  THR A HB   2  
ATOM 3166  H HG1  . THR A 1 65  ? -38.223 12.252  -5.269  1.00 0.00 ? 65  THR A HG1  2  
ATOM 3167  H HG21 . THR A 1 65  ? -39.234 11.284  -3.412  1.00 0.00 ? 65  THR A HG21 2  
ATOM 3168  H HG22 . THR A 1 65  ? -40.191 9.819   -3.694  1.00 0.00 ? 65  THR A HG22 2  
ATOM 3169  H HG23 . THR A 1 65  ? -38.422 9.708   -3.617  1.00 0.00 ? 65  THR A HG23 2  
ATOM 3170  N N    . CYS A 1 66  ? -40.356 7.211   -5.899  1.00 0.00 ? 66  CYS A N    2  
ATOM 3171  C CA   . CYS A 1 66  ? -41.485 6.272   -5.982  1.00 0.00 ? 66  CYS A CA   2  
ATOM 3172  C C    . CYS A 1 66  ? -42.795 6.712   -5.299  1.00 0.00 ? 66  CYS A C    2  
ATOM 3173  O O    . CYS A 1 66  ? -43.862 6.221   -5.662  1.00 0.00 ? 66  CYS A O    2  
ATOM 3174  C CB   . CYS A 1 66  ? -41.036 4.914   -5.419  1.00 0.00 ? 66  CYS A CB   2  
ATOM 3175  S SG   . CYS A 1 66  ? -39.601 4.277   -6.334  1.00 0.00 ? 66  CYS A SG   2  
ATOM 3176  H H    . CYS A 1 66  ? -39.426 6.816   -5.876  1.00 0.00 ? 66  CYS A H    2  
ATOM 3177  H HA   . CYS A 1 66  ? -41.727 6.151   -7.031  1.00 0.00 ? 66  CYS A HA   2  
ATOM 3178  H HB2  . CYS A 1 66  ? -40.779 5.019   -4.365  1.00 0.00 ? 66  CYS A HB2  2  
ATOM 3179  H HB3  . CYS A 1 66  ? -41.858 4.199   -5.505  1.00 0.00 ? 66  CYS A HB3  2  
ATOM 3180  H HG   . CYS A 1 66  ? -40.182 4.206   -7.542  1.00 0.00 ? 66  CYS A HG   2  
ATOM 3181  N N    . ASP A 1 67  ? -42.759 7.671   -4.371  1.00 0.00 ? 67  ASP A N    2  
ATOM 3182  C CA   . ASP A 1 67  ? -43.968 8.273   -3.780  1.00 0.00 ? 67  ASP A CA   2  
ATOM 3183  C C    . ASP A 1 67  ? -44.895 8.865   -4.861  1.00 0.00 ? 67  ASP A C    2  
ATOM 3184  O O    . ASP A 1 67  ? -46.114 8.704   -4.799  1.00 0.00 ? 67  ASP A O    2  
ATOM 3185  C CB   . ASP A 1 67  ? -43.565 9.357   -2.770  1.00 0.00 ? 67  ASP A CB   2  
ATOM 3186  C CG   . ASP A 1 67  ? -44.778 9.830   -1.956  1.00 0.00 ? 67  ASP A CG   2  
ATOM 3187  O OD1  . ASP A 1 67  ? -45.284 9.054   -1.111  1.00 0.00 ? 67  ASP A OD1  2  
ATOM 3188  O OD2  . ASP A 1 67  ? -45.236 10.981  -2.139  1.00 0.00 ? 67  ASP A OD2  2  
ATOM 3189  H H    . ASP A 1 67  ? -41.858 8.063   -4.156  1.00 0.00 ? 67  ASP A H    2  
ATOM 3190  H HA   . ASP A 1 67  ? -44.523 7.495   -3.255  1.00 0.00 ? 67  ASP A HA   2  
ATOM 3191  H HB2  . ASP A 1 67  ? -42.806 8.974   -2.088  1.00 0.00 ? 67  ASP A HB2  2  
ATOM 3192  H HB3  . ASP A 1 67  ? -43.121 10.199  -3.307  1.00 0.00 ? 67  ASP A HB3  2  
ATOM 3193  N N    . PHE A 1 68  ? -44.312 9.444   -5.919  1.00 0.00 ? 68  PHE A N    2  
ATOM 3194  C CA   . PHE A 1 68  ? -45.016 9.969   -7.096  1.00 0.00 ? 68  PHE A CA   2  
ATOM 3195  C C    . PHE A 1 68  ? -45.880 8.911   -7.816  1.00 0.00 ? 68  PHE A C    2  
ATOM 3196  O O    . PHE A 1 68  ? -46.853 9.261   -8.488  1.00 0.00 ? 68  PHE A O    2  
ATOM 3197  C CB   . PHE A 1 68  ? -43.952 10.544  -8.045  1.00 0.00 ? 68  PHE A CB   2  
ATOM 3198  C CG   . PHE A 1 68  ? -44.498 11.262  -9.265  1.00 0.00 ? 68  PHE A CG   2  
ATOM 3199  C CD1  . PHE A 1 68  ? -44.845 12.623  -9.184  1.00 0.00 ? 68  PHE A CD1  2  
ATOM 3200  C CD2  . PHE A 1 68  ? -44.644 10.575  -10.485 1.00 0.00 ? 68  PHE A CD2  2  
ATOM 3201  C CE1  . PHE A 1 68  ? -45.337 13.295  -10.318 1.00 0.00 ? 68  PHE A CE1  2  
ATOM 3202  C CE2  . PHE A 1 68  ? -45.152 11.243  -11.614 1.00 0.00 ? 68  PHE A CE2  2  
ATOM 3203  C CZ   . PHE A 1 68  ? -45.493 12.604  -11.533 1.00 0.00 ? 68  PHE A CZ   2  
ATOM 3204  H H    . PHE A 1 68  ? -43.297 9.479   -5.935  1.00 0.00 ? 68  PHE A H    2  
ATOM 3205  H HA   . PHE A 1 68  ? -45.676 10.778  -6.778  1.00 0.00 ? 68  PHE A HA   2  
ATOM 3206  H HB2  . PHE A 1 68  ? -43.330 11.246  -7.488  1.00 0.00 ? 68  PHE A HB2  2  
ATOM 3207  H HB3  . PHE A 1 68  ? -43.303 9.733   -8.380  1.00 0.00 ? 68  PHE A HB3  2  
ATOM 3208  H HD1  . PHE A 1 68  ? -44.730 13.158  -8.250  1.00 0.00 ? 68  PHE A HD1  2  
ATOM 3209  H HD2  . PHE A 1 68  ? -44.377 9.529   -10.553 1.00 0.00 ? 68  PHE A HD2  2  
ATOM 3210  H HE1  . PHE A 1 68  ? -45.602 14.343  -10.255 1.00 0.00 ? 68  PHE A HE1  2  
ATOM 3211  H HE2  . PHE A 1 68  ? -45.285 10.706  -12.543 1.00 0.00 ? 68  PHE A HE2  2  
ATOM 3212  H HZ   . PHE A 1 68  ? -45.882 13.118  -12.402 1.00 0.00 ? 68  PHE A HZ   2  
ATOM 3213  N N    . LEU A 1 69  ? -45.556 7.622   -7.649  1.00 0.00 ? 69  LEU A N    2  
ATOM 3214  C CA   . LEU A 1 69  ? -46.287 6.473   -8.194  1.00 0.00 ? 69  LEU A CA   2  
ATOM 3215  C C    . LEU A 1 69  ? -46.824 5.522   -7.103  1.00 0.00 ? 69  LEU A C    2  
ATOM 3216  O O    . LEU A 1 69  ? -47.103 4.354   -7.384  1.00 0.00 ? 69  LEU A O    2  
ATOM 3217  C CB   . LEU A 1 69  ? -45.472 5.816   -9.331  1.00 0.00 ? 69  LEU A CB   2  
ATOM 3218  C CG   . LEU A 1 69  ? -44.048 5.316   -9.001  1.00 0.00 ? 69  LEU A CG   2  
ATOM 3219  C CD1  . LEU A 1 69  ? -44.018 4.044   -8.152  1.00 0.00 ? 69  LEU A CD1  2  
ATOM 3220  C CD2  . LEU A 1 69  ? -43.306 5.007   -10.305 1.00 0.00 ? 69  LEU A CD2  2  
ATOM 3221  H H    . LEU A 1 69  ? -44.782 7.410   -7.027  1.00 0.00 ? 69  LEU A H    2  
ATOM 3222  H HA   . LEU A 1 69  ? -47.192 6.854   -8.667  1.00 0.00 ? 69  LEU A HA   2  
ATOM 3223  H HB2  . LEU A 1 69  ? -46.049 4.990   -9.750  1.00 0.00 ? 69  LEU A HB2  2  
ATOM 3224  H HB3  . LEU A 1 69  ? -45.384 6.564   -10.120 1.00 0.00 ? 69  LEU A HB3  2  
ATOM 3225  H HG   . LEU A 1 69  ? -43.498 6.102   -8.486  1.00 0.00 ? 69  LEU A HG   2  
ATOM 3226  H HD11 . LEU A 1 69  ? -44.436 4.236   -7.169  1.00 0.00 ? 69  LEU A HD11 2  
ATOM 3227  H HD12 . LEU A 1 69  ? -44.599 3.260   -8.636  1.00 0.00 ? 69  LEU A HD12 2  
ATOM 3228  H HD13 . LEU A 1 69  ? -42.992 3.704   -8.024  1.00 0.00 ? 69  LEU A HD13 2  
ATOM 3229  H HD21 . LEU A 1 69  ? -42.291 4.677   -10.084 1.00 0.00 ? 69  LEU A HD21 2  
ATOM 3230  H HD22 . LEU A 1 69  ? -43.829 4.226   -10.858 1.00 0.00 ? 69  LEU A HD22 2  
ATOM 3231  H HD23 . LEU A 1 69  ? -43.250 5.905   -10.918 1.00 0.00 ? 69  LEU A HD23 2  
ATOM 3232  N N    . HIS A 1 70  ? -47.010 6.007   -5.864  1.00 0.00 ? 70  HIS A N    2  
ATOM 3233  C CA   . HIS A 1 70  ? -47.654 5.215   -4.805  1.00 0.00 ? 70  HIS A CA   2  
ATOM 3234  C C    . HIS A 1 70  ? -49.118 4.871   -5.150  1.00 0.00 ? 70  HIS A C    2  
ATOM 3235  O O    . HIS A 1 70  ? -49.816 5.653   -5.804  1.00 0.00 ? 70  HIS A O    2  
ATOM 3236  C CB   . HIS A 1 70  ? -47.524 5.900   -3.431  1.00 0.00 ? 70  HIS A CB   2  
ATOM 3237  C CG   . HIS A 1 70  ? -48.638 6.856   -3.057  1.00 0.00 ? 70  HIS A CG   2  
ATOM 3238  N ND1  . HIS A 1 70  ? -49.467 6.716   -1.939  1.00 0.00 ? 70  HIS A ND1  2  
ATOM 3239  C CD2  . HIS A 1 70  ? -49.016 7.974   -3.741  1.00 0.00 ? 70  HIS A CD2  2  
ATOM 3240  C CE1  . HIS A 1 70  ? -50.323 7.751   -1.978  1.00 0.00 ? 70  HIS A CE1  2  
ATOM 3241  N NE2  . HIS A 1 70  ? -50.074 8.523   -3.049  1.00 0.00 ? 70  HIS A NE2  2  
ATOM 3242  H H    . HIS A 1 70  ? -46.742 6.966   -5.662  1.00 0.00 ? 70  HIS A H    2  
ATOM 3243  H HA   . HIS A 1 70  ? -47.113 4.269   -4.741  1.00 0.00 ? 70  HIS A HA   2  
ATOM 3244  H HB2  . HIS A 1 70  ? -47.502 5.120   -2.672  1.00 0.00 ? 70  HIS A HB2  2  
ATOM 3245  H HB3  . HIS A 1 70  ? -46.569 6.420   -3.367  1.00 0.00 ? 70  HIS A HB3  2  
ATOM 3246  H HD2  . HIS A 1 70  ? -48.580 8.342   -4.660  1.00 0.00 ? 70  HIS A HD2  2  
ATOM 3247  H HE1  . HIS A 1 70  ? -51.108 7.936   -1.252  1.00 0.00 ? 70  HIS A HE1  2  
ATOM 3248  H HE2  . HIS A 1 70  ? -50.591 9.359   -3.302  1.00 0.00 ? 70  HIS A HE2  2  
ATOM 3249  N N    . GLY A 1 71  ? -49.583 3.702   -4.707  1.00 0.00 ? 71  GLY A N    2  
ATOM 3250  C CA   . GLY A 1 71  ? -50.948 3.205   -4.907  1.00 0.00 ? 71  GLY A CA   2  
ATOM 3251  C C    . GLY A 1 71  ? -51.560 2.587   -3.639  1.00 0.00 ? 71  GLY A C    2  
ATOM 3252  O O    . GLY A 1 71  ? -50.941 2.634   -2.571  1.00 0.00 ? 71  GLY A O    2  
ATOM 3253  H H    . GLY A 1 71  ? -48.953 3.110   -4.175  1.00 0.00 ? 71  GLY A H    2  
ATOM 3254  H HA2  . GLY A 1 71  ? -51.600 4.016   -5.234  1.00 0.00 ? 71  GLY A HA2  2  
ATOM 3255  H HA3  . GLY A 1 71  ? -50.936 2.446   -5.689  1.00 0.00 ? 71  GLY A HA3  2  
ATOM 3256  N N    . PRO A 1 72  ? -52.757 1.969   -3.733  1.00 0.00 ? 72  PRO A N    2  
ATOM 3257  C CA   . PRO A 1 72  ? -53.519 1.481   -2.572  1.00 0.00 ? 72  PRO A CA   2  
ATOM 3258  C C    . PRO A 1 72  ? -52.847 0.382   -1.723  1.00 0.00 ? 72  PRO A C    2  
ATOM 3259  O O    . PRO A 1 72  ? -53.329 0.080   -0.627  1.00 0.00 ? 72  PRO A O    2  
ATOM 3260  C CB   . PRO A 1 72  ? -54.847 0.974   -3.150  1.00 0.00 ? 72  PRO A CB   2  
ATOM 3261  C CG   . PRO A 1 72  ? -55.022 1.793   -4.426  1.00 0.00 ? 72  PRO A CG   2  
ATOM 3262  C CD   . PRO A 1 72  ? -53.588 1.919   -4.930  1.00 0.00 ? 72  PRO A CD   2  
ATOM 3263  H HA   . PRO A 1 72  ? -53.725 2.334   -1.923  1.00 0.00 ? 72  PRO A HA   2  
ATOM 3264  H HB2  . PRO A 1 72  ? -54.762 -0.082  -3.414  1.00 0.00 ? 72  PRO A HB2  2  
ATOM 3265  H HB3  . PRO A 1 72  ? -55.674 1.128   -2.457  1.00 0.00 ? 72  PRO A HB3  2  
ATOM 3266  H HG2  . PRO A 1 72  ? -55.663 1.289   -5.150  1.00 0.00 ? 72  PRO A HG2  2  
ATOM 3267  H HG3  . PRO A 1 72  ? -55.415 2.781   -4.180  1.00 0.00 ? 72  PRO A HG3  2  
ATOM 3268  H HD2  . PRO A 1 72  ? -53.323 1.040   -5.518  1.00 0.00 ? 72  PRO A HD2  2  
ATOM 3269  H HD3  . PRO A 1 72  ? -53.494 2.819   -5.539  1.00 0.00 ? 72  PRO A HD3  2  
ATOM 3270  N N    . ARG A 1 73  ? -51.733 -0.198  -2.197  1.00 0.00 ? 73  ARG A N    2  
ATOM 3271  C CA   . ARG A 1 73  ? -50.920 -1.213  -1.497  1.00 0.00 ? 73  ARG A CA   2  
ATOM 3272  C C    . ARG A 1 73  ? -49.565 -0.679  -0.998  1.00 0.00 ? 73  ARG A C    2  
ATOM 3273  O O    . ARG A 1 73  ? -48.874 -1.374  -0.253  1.00 0.00 ? 73  ARG A O    2  
ATOM 3274  C CB   . ARG A 1 73  ? -50.793 -2.431  -2.433  1.00 0.00 ? 73  ARG A CB   2  
ATOM 3275  C CG   . ARG A 1 73  ? -50.374 -3.730  -1.724  1.00 0.00 ? 73  ARG A CG   2  
ATOM 3276  C CD   . ARG A 1 73  ? -50.463 -4.912  -2.695  1.00 0.00 ? 73  ARG A CD   2  
ATOM 3277  N NE   . ARG A 1 73  ? -50.129 -6.188  -2.034  1.00 0.00 ? 73  ARG A NE   2  
ATOM 3278  C CZ   . ARG A 1 73  ? -50.342 -7.404  -2.507  1.00 0.00 ? 73  ARG A CZ   2  
ATOM 3279  N NH1  . ARG A 1 73  ? -50.831 -7.624  -3.696  1.00 0.00 ? 73  ARG A NH1  2  
ATOM 3280  N NH2  . ARG A 1 73  ? -50.053 -8.446  -1.782  1.00 0.00 ? 73  ARG A NH2  2  
ATOM 3281  H H    . ARG A 1 73  ? -51.439 0.083   -3.121  1.00 0.00 ? 73  ARG A H    2  
ATOM 3282  H HA   . ARG A 1 73  ? -51.457 -1.535  -0.603  1.00 0.00 ? 73  ARG A HA   2  
ATOM 3283  H HB2  . ARG A 1 73  ? -51.768 -2.609  -2.892  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 3284  H HB3  . ARG A 1 73  ? -50.080 -2.206  -3.229  1.00 0.00 ? 73  ARG A HB3  2  
ATOM 3285  H HG2  . ARG A 1 73  ? -49.350 -3.646  -1.363  1.00 0.00 ? 73  ARG A HG2  2  
ATOM 3286  H HG3  . ARG A 1 73  ? -51.041 -3.912  -0.880  1.00 0.00 ? 73  ARG A HG3  2  
ATOM 3287  H HD2  . ARG A 1 73  ? -51.480 -4.964  -3.093  1.00 0.00 ? 73  ARG A HD2  2  
ATOM 3288  H HD3  . ARG A 1 73  ? -49.771 -4.734  -3.516  1.00 0.00 ? 73  ARG A HD3  2  
ATOM 3289  H HE   . ARG A 1 73  ? -49.747 -6.133  -1.102  1.00 0.00 ? 73  ARG A HE   2  
ATOM 3290  H HH11 . ARG A 1 73  ? -51.048 -6.847  -4.311  1.00 0.00 ? 73  ARG A HH11 2  
ATOM 3291  H HH12 . ARG A 1 73  ? -50.998 -8.562  -4.014  1.00 0.00 ? 73  ARG A HH12 2  
ATOM 3292  H HH21 . ARG A 1 73  ? -49.681 -8.334  -0.853  1.00 0.00 ? 73  ARG A HH21 2  
ATOM 3293  H HH22 . ARG A 1 73  ? -50.217 -9.374  -2.138  1.00 0.00 ? 73  ARG A HH22 2  
ATOM 3294  N N    . THR A 1 74  ? -49.165 0.535   -1.386  1.00 0.00 ? 74  THR A N    2  
ATOM 3295  C CA   . THR A 1 74  ? -47.843 1.107   -1.068  1.00 0.00 ? 74  THR A CA   2  
ATOM 3296  C C    . THR A 1 74  ? -47.795 1.699   0.339   1.00 0.00 ? 74  THR A C    2  
ATOM 3297  O O    . THR A 1 74  ? -48.740 2.357   0.780   1.00 0.00 ? 74  THR A O    2  
ATOM 3298  C CB   . THR A 1 74  ? -47.419 2.184   -2.084  1.00 0.00 ? 74  THR A CB   2  
ATOM 3299  O OG1  . THR A 1 74  ? -47.754 1.830   -3.408  1.00 0.00 ? 74  THR A OG1  2  
ATOM 3300  C CG2  . THR A 1 74  ? -45.909 2.429   -2.065  1.00 0.00 ? 74  THR A CG2  2  
ATOM 3301  H H    . THR A 1 74  ? -49.795 1.101   -1.942  1.00 0.00 ? 74  THR A H    2  
ATOM 3302  H HA   . THR A 1 74  ? -47.107 0.305   -1.106  1.00 0.00 ? 74  THR A HA   2  
ATOM 3303  H HB   . THR A 1 74  ? -47.939 3.110   -1.847  1.00 0.00 ? 74  THR A HB   2  
ATOM 3304  H HG1  . THR A 1 74  ? -46.974 1.421   -3.823  1.00 0.00 ? 74  THR A HG1  2  
ATOM 3305  H HG21 . THR A 1 74  ? -45.620 2.909   -1.131  1.00 0.00 ? 74  THR A HG21 2  
ATOM 3306  H HG22 . THR A 1 74  ? -45.374 1.483   -2.156  1.00 0.00 ? 74  THR A HG22 2  
ATOM 3307  H HG23 . THR A 1 74  ? -45.627 3.085   -2.888  1.00 0.00 ? 74  THR A HG23 2  
ATOM 3308  N N    . GLN A 1 75  ? -46.667 1.514   1.034   1.00 0.00 ? 75  GLN A N    2  
ATOM 3309  C CA   . GLN A 1 75  ? -46.402 2.168   2.316   1.00 0.00 ? 75  GLN A CA   2  
ATOM 3310  C C    . GLN A 1 75  ? -45.718 3.529   2.123   1.00 0.00 ? 75  GLN A C    2  
ATOM 3311  O O    . GLN A 1 75  ? -44.750 3.681   1.368   1.00 0.00 ? 75  GLN A O    2  
ATOM 3312  C CB   . GLN A 1 75  ? -45.576 1.266   3.244   1.00 0.00 ? 75  GLN A CB   2  
ATOM 3313  C CG   . GLN A 1 75  ? -46.251 -0.078  3.568   1.00 0.00 ? 75  GLN A CG   2  
ATOM 3314  C CD   . GLN A 1 75  ? -45.504 -0.881  4.636   1.00 0.00 ? 75  GLN A CD   2  
ATOM 3315  O OE1  . GLN A 1 75  ? -44.510 -0.459  5.218   1.00 0.00 ? 75  GLN A OE1  2  
ATOM 3316  N NE2  . GLN A 1 75  ? -45.959 -2.076  4.950   1.00 0.00 ? 75  GLN A NE2  2  
ATOM 3317  H H    . GLN A 1 75  ? -45.922 0.974   0.620   1.00 0.00 ? 75  GLN A H    2  
ATOM 3318  H HA   . GLN A 1 75  ? -47.354 2.349   2.819   1.00 0.00 ? 75  GLN A HA   2  
ATOM 3319  H HB2  . GLN A 1 75  ? -44.601 1.085   2.797   1.00 0.00 ? 75  GLN A HB2  2  
ATOM 3320  H HB3  . GLN A 1 75  ? -45.432 1.805   4.177   1.00 0.00 ? 75  GLN A HB3  2  
ATOM 3321  H HG2  . GLN A 1 75  ? -47.264 0.107   3.927   1.00 0.00 ? 75  GLN A HG2  2  
ATOM 3322  H HG3  . GLN A 1 75  ? -46.316 -0.681  2.662   1.00 0.00 ? 75  GLN A HG3  2  
ATOM 3323  H HE21 . GLN A 1 75  ? -46.777 -2.447  4.492   1.00 0.00 ? 75  GLN A HE21 2  
ATOM 3324  H HE22 . GLN A 1 75  ? -45.469 -2.604  5.655   1.00 0.00 ? 75  GLN A HE22 2  
ATOM 3325  N N    . ARG A 1 76  ? -46.174 4.527   2.880   1.00 0.00 ? 76  ARG A N    2  
ATOM 3326  C CA   . ARG A 1 76  ? -45.589 5.876   2.863   1.00 0.00 ? 76  ARG A CA   2  
ATOM 3327  C C    . ARG A 1 76  ? -44.208 5.888   3.494   1.00 0.00 ? 76  ARG A C    2  
ATOM 3328  O O    . ARG A 1 76  ? -43.322 6.517   2.941   1.00 0.00 ? 76  ARG A O    2  
ATOM 3329  C CB   . ARG A 1 76  ? -46.543 6.937   3.422   1.00 0.00 ? 76  ARG A CB   2  
ATOM 3330  C CG   . ARG A 1 76  ? -47.954 6.888   2.806   1.00 0.00 ? 76  ARG A CG   2  
ATOM 3331  C CD   . ARG A 1 76  ? -47.981 6.886   1.264   1.00 0.00 ? 76  ARG A CD   2  
ATOM 3332  N NE   . ARG A 1 76  ? -47.491 8.143   0.656   1.00 0.00 ? 76  ARG A NE   2  
ATOM 3333  C CZ   . ARG A 1 76  ? -48.152 9.277   0.516   1.00 0.00 ? 76  ARG A CZ   2  
ATOM 3334  N NH1  . ARG A 1 76  ? -49.339 9.476   1.021   1.00 0.00 ? 76  ARG A NH1  2  
ATOM 3335  N NH2  . ARG A 1 76  ? -47.609 10.248  -0.152  1.00 0.00 ? 76  ARG A NH2  2  
ATOM 3336  H H    . ARG A 1 76  ? -46.914 4.323   3.539   1.00 0.00 ? 76  ARG A H    2  
ATOM 3337  H HA   . ARG A 1 76  ? -45.402 6.144   1.821   1.00 0.00 ? 76  ARG A HA   2  
ATOM 3338  H HB2  . ARG A 1 76  ? -46.617 6.785   4.496   1.00 0.00 ? 76  ARG A HB2  2  
ATOM 3339  H HB3  . ARG A 1 76  ? -46.114 7.925   3.247   1.00 0.00 ? 76  ARG A HB3  2  
ATOM 3340  H HG2  . ARG A 1 76  ? -48.455 5.984   3.153   1.00 0.00 ? 76  ARG A HG2  2  
ATOM 3341  H HG3  . ARG A 1 76  ? -48.527 7.738   3.179   1.00 0.00 ? 76  ARG A HG3  2  
ATOM 3342  H HD2  . ARG A 1 76  ? -47.379 6.051   0.897   1.00 0.00 ? 76  ARG A HD2  2  
ATOM 3343  H HD3  . ARG A 1 76  ? -49.005 6.702   0.934   1.00 0.00 ? 76  ARG A HD3  2  
ATOM 3344  H HE   . ARG A 1 76  ? -46.593 8.126   0.180   1.00 0.00 ? 76  ARG A HE   2  
ATOM 3345  H HH11 . ARG A 1 76  ? -49.780 8.739   1.543   1.00 0.00 ? 76  ARG A HH11 2  
ATOM 3346  H HH12 . ARG A 1 76  ? -49.802 10.362  0.905   1.00 0.00 ? 76  ARG A HH12 2  
ATOM 3347  H HH21 . ARG A 1 76  ? -46.708 10.068  -0.600  1.00 0.00 ? 76  ARG A HH21 2  
ATOM 3348  H HH22 . ARG A 1 76  ? -48.084 11.121  -0.292  1.00 0.00 ? 76  ARG A HH22 2  
ATOM 3349  N N    . ARG A 1 77  ? -43.986 5.151   4.588   1.00 0.00 ? 77  ARG A N    2  
ATOM 3350  C CA   . ARG A 1 77  ? -42.638 4.914   5.152   1.00 0.00 ? 77  ARG A CA   2  
ATOM 3351  C C    . ARG A 1 77  ? -41.626 4.362   4.138   1.00 0.00 ? 77  ARG A C    2  
ATOM 3352  O O    . ARG A 1 77  ? -40.482 4.815   4.109   1.00 0.00 ? 77  ARG A O    2  
ATOM 3353  C CB   . ARG A 1 77  ? -42.728 4.033   6.402   1.00 0.00 ? 77  ARG A CB   2  
ATOM 3354  C CG   . ARG A 1 77  ? -43.285 2.618   6.191   1.00 0.00 ? 77  ARG A CG   2  
ATOM 3355  C CD   . ARG A 1 77  ? -43.307 1.831   7.504   1.00 0.00 ? 77  ARG A CD   2  
ATOM 3356  N NE   . ARG A 1 77  ? -41.982 1.278   7.852   1.00 0.00 ? 77  ARG A NE   2  
ATOM 3357  C CZ   . ARG A 1 77  ? -41.429 0.163   7.403   1.00 0.00 ? 77  ARG A CZ   2  
ATOM 3358  N NH1  . ARG A 1 77  ? -42.006 -0.613  6.529   1.00 0.00 ? 77  ARG A NH1  2  
ATOM 3359  N NH2  . ARG A 1 77  ? -40.255 -0.200  7.834   1.00 0.00 ? 77  ARG A NH2  2  
ATOM 3360  H H    . ARG A 1 77  ? -44.786 4.715   5.023   1.00 0.00 ? 77  ARG A H    2  
ATOM 3361  H HA   . ARG A 1 77  ? -42.238 5.870   5.486   1.00 0.00 ? 77  ARG A HA   2  
ATOM 3362  H HB2  . ARG A 1 77  ? -41.723 3.955   6.817   1.00 0.00 ? 77  ARG A HB2  2  
ATOM 3363  H HB3  . ARG A 1 77  ? -43.371 4.545   7.114   1.00 0.00 ? 77  ARG A HB3  2  
ATOM 3364  H HG2  . ARG A 1 77  ? -44.311 2.706   5.842   1.00 0.00 ? 77  ARG A HG2  2  
ATOM 3365  H HG3  . ARG A 1 77  ? -42.702 2.072   5.451   1.00 0.00 ? 77  ARG A HG3  2  
ATOM 3366  H HD2  . ARG A 1 77  ? -43.666 2.473   8.310   1.00 0.00 ? 77  ARG A HD2  2  
ATOM 3367  H HD3  . ARG A 1 77  ? -44.025 1.022   7.393   1.00 0.00 ? 77  ARG A HD3  2  
ATOM 3368  H HE   . ARG A 1 77  ? -41.446 1.792   8.533   1.00 0.00 ? 77  ARG A HE   2  
ATOM 3369  H HH11 . ARG A 1 77  ? -42.926 -0.377  6.167   1.00 0.00 ? 77  ARG A HH11 2  
ATOM 3370  H HH12 . ARG A 1 77  ? -41.555 -1.454  6.218   1.00 0.00 ? 77  ARG A HH12 2  
ATOM 3371  H HH21 . ARG A 1 77  ? -39.769 0.360   8.516   1.00 0.00 ? 77  ARG A HH21 2  
ATOM 3372  H HH22 . ARG A 1 77  ? -39.832 -1.050  7.501   1.00 0.00 ? 77  ARG A HH22 2  
ATOM 3373  N N    . ALA A 1 78  ? -42.069 3.455   3.264   1.00 0.00 ? 78  ALA A N    2  
ATOM 3374  C CA   . ALA A 1 78  ? -41.259 2.909   2.167   1.00 0.00 ? 78  ALA A CA   2  
ATOM 3375  C C    . ALA A 1 78  ? -40.911 4.026   1.160   1.00 0.00 ? 78  ALA A C    2  
ATOM 3376  O O    . ALA A 1 78  ? -39.739 4.314   0.870   1.00 0.00 ? 78  ALA A O    2  
ATOM 3377  C CB   . ALA A 1 78  ? -42.026 1.749   1.505   1.00 0.00 ? 78  ALA A CB   2  
ATOM 3378  H H    . ALA A 1 78  ? -43.041 3.192   3.327   1.00 0.00 ? 78  ALA A H    2  
ATOM 3379  H HA   . ALA A 1 78  ? -40.330 2.498   2.570   1.00 0.00 ? 78  ALA A HA   2  
ATOM 3380  H HB1  . ALA A 1 78  ? -42.166 0.926   2.206   1.00 0.00 ? 78  ALA A HB1  2  
ATOM 3381  H HB2  . ALA A 1 78  ? -42.988 2.053   1.099   1.00 0.00 ? 78  ALA A HB2  2  
ATOM 3382  H HB3  . ALA A 1 78  ? -41.461 1.385   0.659   1.00 0.00 ? 78  ALA A HB3  2  
ATOM 3383  N N    . ALA A 1 79  ? -41.955 4.725   0.699   1.00 0.00 ? 79  ALA A N    2  
ATOM 3384  C CA   . ALA A 1 79  ? -41.807 5.791   -0.289  1.00 0.00 ? 79  ALA A CA   2  
ATOM 3385  C C    . ALA A 1 79  ? -40.995 6.994   0.242   1.00 0.00 ? 79  ALA A C    2  
ATOM 3386  O O    . ALA A 1 79  ? -40.233 7.617   -0.499  1.00 0.00 ? 79  ALA A O    2  
ATOM 3387  C CB   . ALA A 1 79  ? -43.215 6.198   -0.719  1.00 0.00 ? 79  ALA A CB   2  
ATOM 3388  H H    . ALA A 1 79  ? -42.894 4.495   1.032   1.00 0.00 ? 79  ALA A H    2  
ATOM 3389  H HA   . ALA A 1 79  ? -41.279 5.393   -1.156  1.00 0.00 ? 79  ALA A HA   2  
ATOM 3390  H HB1  . ALA A 1 79  ? -43.717 6.726   0.093   1.00 0.00 ? 79  ALA A HB1  2  
ATOM 3391  H HB2  . ALA A 1 79  ? -43.136 6.854   -1.576  1.00 0.00 ? 79  ALA A HB2  2  
ATOM 3392  H HB3  . ALA A 1 79  ? -43.795 5.319   -1.006  1.00 0.00 ? 79  ALA A HB3  2  
ATOM 3393  N N    . ALA A 1 80  ? -41.120 7.294   1.535   1.00 0.00 ? 80  ALA A N    2  
ATOM 3394  C CA   . ALA A 1 80  ? -40.395 8.336   2.243   1.00 0.00 ? 80  ALA A CA   2  
ATOM 3395  C C    . ALA A 1 80  ? -38.910 7.998   2.412   1.00 0.00 ? 80  ALA A C    2  
ATOM 3396  O O    . ALA A 1 80  ? -38.074 8.821   2.056   1.00 0.00 ? 80  ALA A O    2  
ATOM 3397  C CB   . ALA A 1 80  ? -41.075 8.590   3.590   1.00 0.00 ? 80  ALA A CB   2  
ATOM 3398  H H    . ALA A 1 80  ? -41.802 6.770   2.069   1.00 0.00 ? 80  ALA A H    2  
ATOM 3399  H HA   . ALA A 1 80  ? -40.466 9.248   1.650   1.00 0.00 ? 80  ALA A HA   2  
ATOM 3400  H HB1  . ALA A 1 80  ? -40.552 9.387   4.121   1.00 0.00 ? 80  ALA A HB1  2  
ATOM 3401  H HB2  . ALA A 1 80  ? -42.109 8.894   3.425   1.00 0.00 ? 80  ALA A HB2  2  
ATOM 3402  H HB3  . ALA A 1 80  ? -41.057 7.683   4.193   1.00 0.00 ? 80  ALA A HB3  2  
ATOM 3403  N N    . GLN A 1 81  ? -38.559 6.807   2.919   1.00 0.00 ? 81  GLN A N    2  
ATOM 3404  C CA   . GLN A 1 81  ? -37.179 6.297   2.926   1.00 0.00 ? 81  GLN A CA   2  
ATOM 3405  C C    . GLN A 1 81  ? -36.514 6.392   1.541   1.00 0.00 ? 81  GLN A C    2  
ATOM 3406  O O    . GLN A 1 81  ? -35.372 6.851   1.433   1.00 0.00 ? 81  GLN A O    2  
ATOM 3407  C CB   . GLN A 1 81  ? -37.146 4.876   3.512   1.00 0.00 ? 81  GLN A CB   2  
ATOM 3408  C CG   . GLN A 1 81  ? -35.715 4.441   3.874   1.00 0.00 ? 81  GLN A CG   2  
ATOM 3409  C CD   . GLN A 1 81  ? -35.675 3.120   4.643   1.00 0.00 ? 81  GLN A CD   2  
ATOM 3410  O OE1  . GLN A 1 81  ? -35.249 2.087   4.148   1.00 0.00 ? 81  GLN A OE1  2  
ATOM 3411  N NE2  . GLN A 1 81  ? -36.100 3.098   5.889   1.00 0.00 ? 81  GLN A NE2  2  
ATOM 3412  H H    . GLN A 1 81  ? -39.285 6.203   3.284   1.00 0.00 ? 81  GLN A H    2  
ATOM 3413  H HA   . GLN A 1 81  ? -36.598 6.930   3.593   1.00 0.00 ? 81  GLN A HA   2  
ATOM 3414  H HB2  . GLN A 1 81  ? -37.747 4.865   4.423   1.00 0.00 ? 81  GLN A HB2  2  
ATOM 3415  H HB3  . GLN A 1 81  ? -37.581 4.171   2.804   1.00 0.00 ? 81  GLN A HB3  2  
ATOM 3416  H HG2  . GLN A 1 81  ? -35.121 4.340   2.965   1.00 0.00 ? 81  GLN A HG2  2  
ATOM 3417  H HG3  . GLN A 1 81  ? -35.254 5.209   4.495   1.00 0.00 ? 81  GLN A HG3  2  
ATOM 3418  H HE21 . GLN A 1 81  ? -36.448 3.937   6.329   1.00 0.00 ? 81  GLN A HE21 2  
ATOM 3419  H HE22 . GLN A 1 81  ? -36.062 2.222   6.389   1.00 0.00 ? 81  GLN A HE22 2  
ATOM 3420  N N    . ILE A 1 82  ? -37.247 6.067   0.465   1.00 0.00 ? 82  ILE A N    2  
ATOM 3421  C CA   . ILE A 1 82  ? -36.751 6.294   -0.900  1.00 0.00 ? 82  ILE A CA   2  
ATOM 3422  C C    . ILE A 1 82  ? -36.509 7.779   -1.154  1.00 0.00 ? 82  ILE A C    2  
ATOM 3423  O O    . ILE A 1 82  ? -35.418 8.147   -1.579  1.00 0.00 ? 82  ILE A O    2  
ATOM 3424  C CB   . ILE A 1 82  ? -37.710 5.692   -1.935  1.00 0.00 ? 82  ILE A CB   2  
ATOM 3425  C CG1  . ILE A 1 82  ? -37.531 4.168   -1.889  1.00 0.00 ? 82  ILE A CG1  2  
ATOM 3426  C CG2  . ILE A 1 82  ? -37.458 6.268   -3.337  1.00 0.00 ? 82  ILE A CG2  2  
ATOM 3427  C CD1  . ILE A 1 82  ? -38.678 3.440   -2.570  1.00 0.00 ? 82  ILE A CD1  2  
ATOM 3428  H H    . ILE A 1 82  ? -38.189 5.702   0.584   1.00 0.00 ? 82  ILE A H    2  
ATOM 3429  H HA   . ILE A 1 82  ? -35.784 5.799   -1.008  1.00 0.00 ? 82  ILE A HA   2  
ATOM 3430  H HB   . ILE A 1 82  ? -38.733 5.934   -1.653  1.00 0.00 ? 82  ILE A HB   2  
ATOM 3431  H HG12 . ILE A 1 82  ? -36.584 3.882   -2.352  1.00 0.00 ? 82  ILE A HG12 2  
ATOM 3432  H HG13 . ILE A 1 82  ? -37.521 3.838   -0.853  1.00 0.00 ? 82  ILE A HG13 2  
ATOM 3433  H HG21 . ILE A 1 82  ? -36.403 6.164   -3.595  1.00 0.00 ? 82  ILE A HG21 2  
ATOM 3434  H HG22 . ILE A 1 82  ? -38.070 5.760   -4.080  1.00 0.00 ? 82  ILE A HG22 2  
ATOM 3435  H HG23 . ILE A 1 82  ? -37.722 7.328   -3.345  1.00 0.00 ? 82  ILE A HG23 2  
ATOM 3436  H HD11 . ILE A 1 82  ? -38.574 2.381   -2.351  1.00 0.00 ? 82  ILE A HD11 2  
ATOM 3437  H HD12 . ILE A 1 82  ? -39.623 3.807   -2.170  1.00 0.00 ? 82  ILE A HD12 2  
ATOM 3438  H HD13 . ILE A 1 82  ? -38.640 3.592   -3.646  1.00 0.00 ? 82  ILE A HD13 2  
ATOM 3439  N N    . ALA A 1 83  ? -37.480 8.639   -0.848  1.00 0.00 ? 83  ALA A N    2  
ATOM 3440  C CA   . ALA A 1 83  ? -37.324 10.086  -0.955  1.00 0.00 ? 83  ALA A CA   2  
ATOM 3441  C C    . ALA A 1 83  ? -36.063 10.586  -0.242  1.00 0.00 ? 83  ALA A C    2  
ATOM 3442  O O    . ALA A 1 83  ? -35.368 11.423  -0.806  1.00 0.00 ? 83  ALA A O    2  
ATOM 3443  C CB   . ALA A 1 83  ? -38.594 10.781  -0.462  1.00 0.00 ? 83  ALA A CB   2  
ATOM 3444  H H    . ALA A 1 83  ? -38.370 8.278   -0.522  1.00 0.00 ? 83  ALA A H    2  
ATOM 3445  H HA   . ALA A 1 83  ? -37.192 10.335  -2.007  1.00 0.00 ? 83  ALA A HA   2  
ATOM 3446  H HB1  . ALA A 1 83  ? -39.468 10.322  -0.927  1.00 0.00 ? 83  ALA A HB1  2  
ATOM 3447  H HB2  . ALA A 1 83  ? -38.672 10.697  0.618   1.00 0.00 ? 83  ALA A HB2  2  
ATOM 3448  H HB3  . ALA A 1 83  ? -38.549 11.837  -0.724  1.00 0.00 ? 83  ALA A HB3  2  
ATOM 3449  N N    . GLN A 1 84  ? -35.726 10.043  0.934   1.00 0.00 ? 84  GLN A N    2  
ATOM 3450  C CA   . GLN A 1 84  ? -34.499 10.392  1.675   1.00 0.00 ? 84  GLN A CA   2  
ATOM 3451  C C    . GLN A 1 84  ? -33.235 9.866   0.972   1.00 0.00 ? 84  GLN A C    2  
ATOM 3452  O O    . GLN A 1 84  ? -32.192 10.528  0.980   1.00 0.00 ? 84  GLN A O    2  
ATOM 3453  C CB   . GLN A 1 84  ? -34.505 9.842   3.113   1.00 0.00 ? 84  GLN A CB   2  
ATOM 3454  C CG   . GLN A 1 84  ? -35.759 10.084  3.961   1.00 0.00 ? 84  GLN A CG   2  
ATOM 3455  C CD   . GLN A 1 84  ? -36.390 11.465  3.798   1.00 0.00 ? 84  GLN A CD   2  
ATOM 3456  O OE1  . GLN A 1 84  ? -35.880 12.477  4.261   1.00 0.00 ? 84  GLN A OE1  2  
ATOM 3457  N NE2  . GLN A 1 84  ? -37.521 11.551  3.129   1.00 0.00 ? 84  GLN A NE2  2  
ATOM 3458  H H    . GLN A 1 84  ? -36.314 9.288   1.269   1.00 0.00 ? 84  GLN A H    2  
ATOM 3459  H HA   . GLN A 1 84  ? -34.439 11.484  1.745   1.00 0.00 ? 84  GLN A HA   2  
ATOM 3460  H HB2  . GLN A 1 84  ? -34.325 8.766   3.089   1.00 0.00 ? 84  GLN A HB2  2  
ATOM 3461  H HB3  . GLN A 1 84  ? -33.663 10.295  3.632   1.00 0.00 ? 84  GLN A HB3  2  
ATOM 3462  H HG2  . GLN A 1 84  ? -36.484 9.324   3.714   1.00 0.00 ? 84  GLN A HG2  2  
ATOM 3463  H HG3  . GLN A 1 84  ? -35.518 9.921   5.006   1.00 0.00 ? 84  GLN A HG3  2  
ATOM 3464  H HE21 . GLN A 1 84  ? -37.918 10.709  2.726   1.00 0.00 ? 84  GLN A HE21 2  
ATOM 3465  H HE22 . GLN A 1 84  ? -37.952 12.455  3.020   1.00 0.00 ? 84  GLN A HE22 2  
ATOM 3466  N N    . ALA A 1 85  ? -33.318 8.692   0.331   1.00 0.00 ? 85  ALA A N    2  
ATOM 3467  C CA   . ALA A 1 85  ? -32.205 8.131   -0.431  1.00 0.00 ? 85  ALA A CA   2  
ATOM 3468  C C    . ALA A 1 85  ? -31.925 8.939   -1.709  1.00 0.00 ? 85  ALA A C    2  
ATOM 3469  O O    . ALA A 1 85  ? -30.770 9.070   -2.117  1.00 0.00 ? 85  ALA A O    2  
ATOM 3470  C CB   . ALA A 1 85  ? -32.492 6.652   -0.724  1.00 0.00 ? 85  ALA A CB   2  
ATOM 3471  H H    . ALA A 1 85  ? -34.205 8.187   0.314   1.00 0.00 ? 85  ALA A H    2  
ATOM 3472  H HA   . ALA A 1 85  ? -31.311 8.191   0.185   1.00 0.00 ? 85  ALA A HA   2  
ATOM 3473  H HB1  . ALA A 1 85  ? -31.629 6.208   -1.220  1.00 0.00 ? 85  ALA A HB1  2  
ATOM 3474  H HB2  . ALA A 1 85  ? -32.676 6.120   0.210   1.00 0.00 ? 85  ALA A HB2  2  
ATOM 3475  H HB3  . ALA A 1 85  ? -33.360 6.553   -1.373  1.00 0.00 ? 85  ALA A HB3  2  
ATOM 3476  N N    . LEU A 1 86  ? -32.967 9.536   -2.303  1.00 0.00 ? 86  LEU A N    2  
ATOM 3477  C CA   . LEU A 1 86  ? -32.842 10.400  -3.478  1.00 0.00 ? 86  LEU A CA   2  
ATOM 3478  C C    . LEU A 1 86  ? -32.451 11.841  -3.085  1.00 0.00 ? 86  LEU A C    2  
ATOM 3479  O O    . LEU A 1 86  ? -31.688 12.497  -3.795  1.00 0.00 ? 86  LEU A O    2  
ATOM 3480  C CB   . LEU A 1 86  ? -34.121 10.346  -4.334  1.00 0.00 ? 86  LEU A CB   2  
ATOM 3481  C CG   . LEU A 1 86  ? -34.682 8.949   -4.704  1.00 0.00 ? 86  LEU A CG   2  
ATOM 3482  C CD1  . LEU A 1 86  ? -35.405 9.044   -6.045  1.00 0.00 ? 86  LEU A CD1  2  
ATOM 3483  C CD2  . LEU A 1 86  ? -33.644 7.832   -4.892  1.00 0.00 ? 86  LEU A CD2  2  
ATOM 3484  H H    . LEU A 1 86  ? -33.895 9.323   -1.951  1.00 0.00 ? 86  LEU A H    2  
ATOM 3485  H HA   . LEU A 1 86  ? -32.033 10.010  -4.094  1.00 0.00 ? 86  LEU A HA   2  
ATOM 3486  H HB2  . LEU A 1 86  ? -34.911 10.899  -3.824  1.00 0.00 ? 86  LEU A HB2  2  
ATOM 3487  H HB3  . LEU A 1 86  ? -33.899 10.886  -5.254  1.00 0.00 ? 86  LEU A HB3  2  
ATOM 3488  H HG   . LEU A 1 86  ? -35.410 8.658   -3.938  1.00 0.00 ? 86  LEU A HG   2  
ATOM 3489  H HD11 . LEU A 1 86  ? -34.686 9.226   -6.844  1.00 0.00 ? 86  LEU A HD11 2  
ATOM 3490  H HD12 . LEU A 1 86  ? -35.939 8.115   -6.245  1.00 0.00 ? 86  LEU A HD12 2  
ATOM 3491  H HD13 . LEU A 1 86  ? -36.110 9.866   -6.016  1.00 0.00 ? 86  LEU A HD13 2  
ATOM 3492  H HD21 . LEU A 1 86  ? -32.868 8.154   -5.586  1.00 0.00 ? 86  LEU A HD21 2  
ATOM 3493  H HD22 . LEU A 1 86  ? -33.192 7.563   -3.942  1.00 0.00 ? 86  LEU A HD22 2  
ATOM 3494  H HD23 . LEU A 1 86  ? -34.128 6.938   -5.287  1.00 0.00 ? 86  LEU A HD23 2  
ATOM 3495  N N    . LEU A 1 87  ? -32.899 12.305  -1.911  1.00 0.00 ? 87  LEU A N    2  
ATOM 3496  C CA   . LEU A 1 87  ? -32.491 13.541  -1.242  1.00 0.00 ? 87  LEU A CA   2  
ATOM 3497  C C    . LEU A 1 87  ? -30.995 13.497  -0.874  1.00 0.00 ? 87  LEU A C    2  
ATOM 3498  O O    . LEU A 1 87  ? -30.319 14.527  -0.925  1.00 0.00 ? 87  LEU A O    2  
ATOM 3499  C CB   . LEU A 1 87  ? -33.450 13.696  -0.041  1.00 0.00 ? 87  LEU A CB   2  
ATOM 3500  C CG   . LEU A 1 87  ? -32.979 14.405  1.230   1.00 0.00 ? 87  LEU A CG   2  
ATOM 3501  C CD1  . LEU A 1 87  ? -34.174 15.079  1.902   1.00 0.00 ? 87  LEU A CD1  2  
ATOM 3502  C CD2  . LEU A 1 87  ? -32.304 13.529  2.283   1.00 0.00 ? 87  LEU A CD2  2  
ATOM 3503  H H    . LEU A 1 87  ? -33.607 11.774  -1.419  1.00 0.00 ? 87  LEU A H    2  
ATOM 3504  H HA   . LEU A 1 87  ? -32.636 14.385  -1.917  1.00 0.00 ? 87  LEU A HA   2  
ATOM 3505  H HB2  . LEU A 1 87  ? -34.358 14.170  -0.417  1.00 0.00 ? 87  LEU A HB2  2  
ATOM 3506  H HB3  . LEU A 1 87  ? -33.722 12.710  0.298   1.00 0.00 ? 87  LEU A HB3  2  
ATOM 3507  H HG   . LEU A 1 87  ? -32.273 15.141  0.922   1.00 0.00 ? 87  LEU A HG   2  
ATOM 3508  H HD11 . LEU A 1 87  ? -33.855 15.598  2.804   1.00 0.00 ? 87  LEU A HD11 2  
ATOM 3509  H HD12 . LEU A 1 87  ? -34.617 15.800  1.217   1.00 0.00 ? 87  LEU A HD12 2  
ATOM 3510  H HD13 . LEU A 1 87  ? -34.918 14.322  2.155   1.00 0.00 ? 87  LEU A HD13 2  
ATOM 3511  H HD21 . LEU A 1 87  ? -31.932 14.157  3.094   1.00 0.00 ? 87  LEU A HD21 2  
ATOM 3512  H HD22 . LEU A 1 87  ? -33.004 12.807  2.695   1.00 0.00 ? 87  LEU A HD22 2  
ATOM 3513  H HD23 . LEU A 1 87  ? -31.461 13.013  1.842   1.00 0.00 ? 87  LEU A HD23 2  
ATOM 3514  N N    . GLY A 1 88  ? -30.471 12.310  -0.548  1.00 0.00 ? 88  GLY A N    2  
ATOM 3515  C CA   . GLY A 1 88  ? -29.036 12.047  -0.399  1.00 0.00 ? 88  GLY A CA   2  
ATOM 3516  C C    . GLY A 1 88  ? -28.569 11.798  1.037   1.00 0.00 ? 88  GLY A C    2  
ATOM 3517  O O    . GLY A 1 88  ? -27.396 12.038  1.332   1.00 0.00 ? 88  GLY A O    2  
ATOM 3518  H H    . GLY A 1 88  ? -31.111 11.531  -0.434  1.00 0.00 ? 88  GLY A H    2  
ATOM 3519  H HA2  . GLY A 1 88  ? -28.797 11.156  -0.978  1.00 0.00 ? 88  GLY A HA2  2  
ATOM 3520  H HA3  . GLY A 1 88  ? -28.455 12.873  -0.811  1.00 0.00 ? 88  GLY A HA3  2  
ATOM 3521  N N    . ALA A 1 89  ? -29.454 11.362  1.946   1.00 0.00 ? 89  ALA A N    2  
ATOM 3522  C CA   . ALA A 1 89  ? -29.085 11.089  3.334   1.00 0.00 ? 89  ALA A CA   2  
ATOM 3523  C C    . ALA A 1 89  ? -28.126 9.886   3.403   1.00 0.00 ? 89  ALA A C    2  
ATOM 3524  O O    . ALA A 1 89  ? -27.040 9.971   3.979   1.00 0.00 ? 89  ALA A O    2  
ATOM 3525  C CB   . ALA A 1 89  ? -30.365 10.855  4.151   1.00 0.00 ? 89  ALA A CB   2  
ATOM 3526  H H    . ALA A 1 89  ? -30.404 11.156  1.662   1.00 0.00 ? 89  ALA A H    2  
ATOM 3527  H HA   . ALA A 1 89  ? -28.577 11.964  3.742   1.00 0.00 ? 89  ALA A HA   2  
ATOM 3528  H HB1  . ALA A 1 89  ? -30.935 10.021  3.739   1.00 0.00 ? 89  ALA A HB1  2  
ATOM 3529  H HB2  . ALA A 1 89  ? -30.099 10.627  5.185   1.00 0.00 ? 89  ALA A HB2  2  
ATOM 3530  H HB3  . ALA A 1 89  ? -30.981 11.753  4.139   1.00 0.00 ? 89  ALA A HB3  2  
ATOM 3531  N N    . GLU A 1 90  ? -28.520 8.789   2.750   1.00 0.00 ? 90  GLU A N    2  
ATOM 3532  C CA   . GLU A 1 90  ? -27.747 7.563   2.520   1.00 0.00 ? 90  GLU A CA   2  
ATOM 3533  C C    . GLU A 1 90  ? -28.239 6.909   1.218   1.00 0.00 ? 90  GLU A C    2  
ATOM 3534  O O    . GLU A 1 90  ? -29.445 6.906   0.962   1.00 0.00 ? 90  GLU A O    2  
ATOM 3535  C CB   . GLU A 1 90  ? -27.958 6.546   3.661   1.00 0.00 ? 90  GLU A CB   2  
ATOM 3536  C CG   . GLU A 1 90  ? -27.714 7.103   5.068   1.00 0.00 ? 90  GLU A CG   2  
ATOM 3537  C CD   . GLU A 1 90  ? -27.833 5.996   6.133   1.00 0.00 ? 90  GLU A CD   2  
ATOM 3538  O OE1  . GLU A 1 90  ? -26.812 5.337   6.448   1.00 0.00 ? 90  GLU A OE1  2  
ATOM 3539  O OE2  . GLU A 1 90  ? -28.946 5.779   6.673   1.00 0.00 ? 90  GLU A OE2  2  
ATOM 3540  H H    . GLU A 1 90  ? -29.426 8.822   2.303   1.00 0.00 ? 90  GLU A H    2  
ATOM 3541  H HA   . GLU A 1 90  ? -26.686 7.797   2.430   1.00 0.00 ? 90  GLU A HA   2  
ATOM 3542  H HB2  . GLU A 1 90  ? -28.982 6.169   3.619   1.00 0.00 ? 90  GLU A HB2  2  
ATOM 3543  H HB3  . GLU A 1 90  ? -27.284 5.704   3.490   1.00 0.00 ? 90  GLU A HB3  2  
ATOM 3544  H HG2  . GLU A 1 90  ? -26.719 7.549   5.105   1.00 0.00 ? 90  GLU A HG2  2  
ATOM 3545  H HG3  . GLU A 1 90  ? -28.450 7.891   5.267   1.00 0.00 ? 90  GLU A HG3  2  
ATOM 3546  N N    . GLU A 1 91  ? -27.365 6.302   0.411   1.00 0.00 ? 91  GLU A N    2  
ATOM 3547  C CA   . GLU A 1 91  ? -27.834 5.473   -0.712  1.00 0.00 ? 91  GLU A CA   2  
ATOM 3548  C C    . GLU A 1 91  ? -28.290 4.124   -0.152  1.00 0.00 ? 91  GLU A C    2  
ATOM 3549  O O    . GLU A 1 91  ? -27.500 3.363   0.417   1.00 0.00 ? 91  GLU A O    2  
ATOM 3550  C CB   . GLU A 1 91  ? -26.782 5.313   -1.814  1.00 0.00 ? 91  GLU A CB   2  
ATOM 3551  C CG   . GLU A 1 91  ? -26.756 6.556   -2.710  1.00 0.00 ? 91  GLU A CG   2  
ATOM 3552  C CD   . GLU A 1 91  ? -25.901 7.679   -2.094  1.00 0.00 ? 91  GLU A CD   2  
ATOM 3553  O OE1  . GLU A 1 91  ? -24.661 7.494   -2.016  1.00 0.00 ? 91  GLU A OE1  2  
ATOM 3554  O OE2  . GLU A 1 91  ? -26.447 8.732   -1.692  1.00 0.00 ? 91  GLU A OE2  2  
ATOM 3555  H H    . GLU A 1 91  ? -26.386 6.283   0.659   1.00 0.00 ? 91  GLU A H    2  
ATOM 3556  H HA   . GLU A 1 91  ? -28.711 5.936   -1.174  1.00 0.00 ? 91  GLU A HA   2  
ATOM 3557  H HB2  . GLU A 1 91  ? -25.799 5.103   -1.393  1.00 0.00 ? 91  GLU A HB2  2  
ATOM 3558  H HB3  . GLU A 1 91  ? -27.074 4.467   -2.439  1.00 0.00 ? 91  GLU A HB3  2  
ATOM 3559  H HG2  . GLU A 1 91  ? -26.345 6.272   -3.680  1.00 0.00 ? 91  GLU A HG2  2  
ATOM 3560  H HG3  . GLU A 1 91  ? -27.786 6.885   -2.881  1.00 0.00 ? 91  GLU A HG3  2  
ATOM 3561  N N    . ARG A 1 92  ? -29.590 3.857   -0.294  1.00 0.00 ? 92  ARG A N    2  
ATOM 3562  C CA   . ARG A 1 92  ? -30.290 2.750   0.367   1.00 0.00 ? 92  ARG A CA   2  
ATOM 3563  C C    . ARG A 1 92  ? -31.281 2.067   -0.575  1.00 0.00 ? 92  ARG A C    2  
ATOM 3564  O O    . ARG A 1 92  ? -32.049 2.730   -1.270  1.00 0.00 ? 92  ARG A O    2  
ATOM 3565  C CB   . ARG A 1 92  ? -30.977 3.306   1.635   1.00 0.00 ? 92  ARG A CB   2  
ATOM 3566  C CG   . ARG A 1 92  ? -31.857 2.299   2.391   1.00 0.00 ? 92  ARG A CG   2  
ATOM 3567  C CD   . ARG A 1 92  ? -31.087 1.155   3.060   1.00 0.00 ? 92  ARG A CD   2  
ATOM 3568  N NE   . ARG A 1 92  ? -32.019 0.069   3.423   1.00 0.00 ? 92  ARG A NE   2  
ATOM 3569  C CZ   . ARG A 1 92  ? -32.358 -0.356  4.626   1.00 0.00 ? 92  ARG A CZ   2  
ATOM 3570  N NH1  . ARG A 1 92  ? -31.847 0.136   5.719   1.00 0.00 ? 92  ARG A NH1  2  
ATOM 3571  N NH2  . ARG A 1 92  ? -33.234 -1.312  4.746   1.00 0.00 ? 92  ARG A NH2  2  
ATOM 3572  H H    . ARG A 1 92  ? -30.144 4.531   -0.811  1.00 0.00 ? 92  ARG A H    2  
ATOM 3573  H HA   . ARG A 1 92  ? -29.554 2.004   0.672   1.00 0.00 ? 92  ARG A HA   2  
ATOM 3574  H HB2  . ARG A 1 92  ? -30.217 3.692   2.318   1.00 0.00 ? 92  ARG A HB2  2  
ATOM 3575  H HB3  . ARG A 1 92  ? -31.614 4.144   1.344   1.00 0.00 ? 92  ARG A HB3  2  
ATOM 3576  H HG2  . ARG A 1 92  ? -32.421 2.830   3.158   1.00 0.00 ? 92  ARG A HG2  2  
ATOM 3577  H HG3  . ARG A 1 92  ? -32.572 1.871   1.691   1.00 0.00 ? 92  ARG A HG3  2  
ATOM 3578  H HD2  . ARG A 1 92  ? -30.349 0.753   2.366   1.00 0.00 ? 92  ARG A HD2  2  
ATOM 3579  H HD3  . ARG A 1 92  ? -30.553 1.541   3.929   1.00 0.00 ? 92  ARG A HD3  2  
ATOM 3580  H HE   . ARG A 1 92  ? -32.505 -0.371  2.649   1.00 0.00 ? 92  ARG A HE   2  
ATOM 3581  H HH11 . ARG A 1 92  ? -31.168 0.872   5.655   1.00 0.00 ? 92  ARG A HH11 2  
ATOM 3582  H HH12 . ARG A 1 92  ? -32.128 -0.215  6.619   1.00 0.00 ? 92  ARG A HH12 2  
ATOM 3583  H HH21 . ARG A 1 92  ? -33.654 -1.711  3.923   1.00 0.00 ? 92  ARG A HH21 2  
ATOM 3584  H HH22 . ARG A 1 92  ? -33.504 -1.644  5.657   1.00 0.00 ? 92  ARG A HH22 2  
ATOM 3585  N N    . LYS A 1 93  ? -31.296 0.734   -0.515  1.00 0.00 ? 93  LYS A N    2  
ATOM 3586  C CA   . LYS A 1 93  ? -32.281 -0.151  -1.149  1.00 0.00 ? 93  LYS A CA   2  
ATOM 3587  C C    . LYS A 1 93  ? -33.482 -0.344  -0.222  1.00 0.00 ? 93  LYS A C    2  
ATOM 3588  O O    . LYS A 1 93  ? -33.315 -0.661  0.958   1.00 0.00 ? 93  LYS A O    2  
ATOM 3589  C CB   . LYS A 1 93  ? -31.589 -1.462  -1.522  1.00 0.00 ? 93  LYS A CB   2  
ATOM 3590  C CG   . LYS A 1 93  ? -32.453 -2.395  -2.371  1.00 0.00 ? 93  LYS A CG   2  
ATOM 3591  C CD   . LYS A 1 93  ? -31.893 -3.820  -2.361  1.00 0.00 ? 93  LYS A CD   2  
ATOM 3592  C CE   . LYS A 1 93  ? -30.502 -3.863  -3.007  1.00 0.00 ? 93  LYS A CE   2  
ATOM 3593  N NZ   . LYS A 1 93  ? -30.010 -5.256  -3.155  1.00 0.00 ? 93  LYS A NZ   2  
ATOM 3594  H H    . LYS A 1 93  ? -30.639 0.308   0.120   1.00 0.00 ? 93  LYS A H    2  
ATOM 3595  H HA   . LYS A 1 93  ? -32.633 0.300   -2.072  1.00 0.00 ? 93  LYS A HA   2  
ATOM 3596  H HB2  . LYS A 1 93  ? -30.706 -1.223  -2.113  1.00 0.00 ? 93  LYS A HB2  2  
ATOM 3597  H HB3  . LYS A 1 93  ? -31.291 -1.975  -0.608  1.00 0.00 ? 93  LYS A HB3  2  
ATOM 3598  H HG2  . LYS A 1 93  ? -33.473 -2.410  -1.998  1.00 0.00 ? 93  LYS A HG2  2  
ATOM 3599  H HG3  . LYS A 1 93  ? -32.461 -2.020  -3.391  1.00 0.00 ? 93  LYS A HG3  2  
ATOM 3600  H HD2  . LYS A 1 93  ? -31.837 -4.171  -1.331  1.00 0.00 ? 93  LYS A HD2  2  
ATOM 3601  H HD3  . LYS A 1 93  ? -32.576 -4.465  -2.908  1.00 0.00 ? 93  LYS A HD3  2  
ATOM 3602  H HE2  . LYS A 1 93  ? -30.573 -3.389  -3.992  1.00 0.00 ? 93  LYS A HE2  2  
ATOM 3603  H HE3  . LYS A 1 93  ? -29.807 -3.280  -2.399  1.00 0.00 ? 93  LYS A HE3  2  
ATOM 3604  H HZ1  . LYS A 1 93  ? -29.086 -5.273  -3.564  1.00 0.00 ? 93  LYS A HZ1  2  
ATOM 3605  H HZ2  . LYS A 1 93  ? -29.979 -5.743  -2.271  1.00 0.00 ? 93  LYS A HZ2  2  
ATOM 3606  H HZ3  . LYS A 1 93  ? -30.624 -5.769  -3.790  1.00 0.00 ? 93  LYS A HZ3  2  
ATOM 3607  N N    . VAL A 1 94  ? -34.681 -0.143  -0.760  1.00 0.00 ? 94  VAL A N    2  
ATOM 3608  C CA   . VAL A 1 94  ? -35.956 -0.182  -0.025  1.00 0.00 ? 94  VAL A CA   2  
ATOM 3609  C C    . VAL A 1 94  ? -36.979 -0.979  -0.829  1.00 0.00 ? 94  VAL A C    2  
ATOM 3610  O O    . VAL A 1 94  ? -36.995 -0.926  -2.056  1.00 0.00 ? 94  VAL A O    2  
ATOM 3611  C CB   . VAL A 1 94  ? -36.496 1.243   0.261   1.00 0.00 ? 94  VAL A CB   2  
ATOM 3612  C CG1  . VAL A 1 94  ? -37.514 1.244   1.409   1.00 0.00 ? 94  VAL A CG1  2  
ATOM 3613  C CG2  . VAL A 1 94  ? -35.412 2.260   0.640   1.00 0.00 ? 94  VAL A CG2  2  
ATOM 3614  H H    . VAL A 1 94  ? -34.721 0.091   -1.742  1.00 0.00 ? 94  VAL A H    2  
ATOM 3615  H HA   . VAL A 1 94  ? -35.822 -0.710  0.922   1.00 0.00 ? 94  VAL A HA   2  
ATOM 3616  H HB   . VAL A 1 94  ? -36.991 1.602   -0.639  1.00 0.00 ? 94  VAL A HB   2  
ATOM 3617  H HG11 . VAL A 1 94  ? -38.348 0.586   1.185   1.00 0.00 ? 94  VAL A HG11 2  
ATOM 3618  H HG12 . VAL A 1 94  ? -37.039 0.918   2.335   1.00 0.00 ? 94  VAL A HG12 2  
ATOM 3619  H HG13 . VAL A 1 94  ? -37.914 2.247   1.543   1.00 0.00 ? 94  VAL A HG13 2  
ATOM 3620  H HG21 . VAL A 1 94  ? -34.729 2.417   -0.193  1.00 0.00 ? 94  VAL A HG21 2  
ATOM 3621  H HG22 . VAL A 1 94  ? -35.870 3.218   0.881   1.00 0.00 ? 94  VAL A HG22 2  
ATOM 3622  H HG23 . VAL A 1 94  ? -34.863 1.895   1.507   1.00 0.00 ? 94  VAL A HG23 2  
ATOM 3623  N N    . GLU A 1 95  ? -37.856 -1.694  -0.135  1.00 0.00 ? 95  GLU A N    2  
ATOM 3624  C CA   . GLU A 1 95  ? -39.014 -2.353  -0.736  1.00 0.00 ? 95  GLU A CA   2  
ATOM 3625  C C    . GLU A 1 95  ? -40.136 -1.334  -0.956  1.00 0.00 ? 95  GLU A C    2  
ATOM 3626  O O    . GLU A 1 95  ? -40.218 -0.355  -0.224  1.00 0.00 ? 95  GLU A O    2  
ATOM 3627  C CB   . GLU A 1 95  ? -39.470 -3.502  0.173   1.00 0.00 ? 95  GLU A CB   2  
ATOM 3628  C CG   . GLU A 1 95  ? -39.997 -3.044  1.548   1.00 0.00 ? 95  GLU A CG   2  
ATOM 3629  C CD   . GLU A 1 95  ? -40.357 -4.243  2.446   1.00 0.00 ? 95  GLU A CD   2  
ATOM 3630  O OE1  . GLU A 1 95  ? -39.435 -4.917  2.966   1.00 0.00 ? 95  GLU A OE1  2  
ATOM 3631  O OE2  . GLU A 1 95  ? -41.565 -4.501  2.668   1.00 0.00 ? 95  GLU A OE2  2  
ATOM 3632  H H    . GLU A 1 95  ? -37.854 -1.607  0.868   1.00 0.00 ? 95  GLU A H    2  
ATOM 3633  H HA   . GLU A 1 95  ? -38.729 -2.768  -1.705  1.00 0.00 ? 95  GLU A HA   2  
ATOM 3634  H HB2  . GLU A 1 95  ? -40.252 -4.057  -0.345  1.00 0.00 ? 95  GLU A HB2  2  
ATOM 3635  H HB3  . GLU A 1 95  ? -38.608 -4.151  0.325   1.00 0.00 ? 95  GLU A HB3  2  
ATOM 3636  H HG2  . GLU A 1 95  ? -39.229 -2.448  2.048   1.00 0.00 ? 95  GLU A HG2  2  
ATOM 3637  H HG3  . GLU A 1 95  ? -40.872 -2.399  1.415   1.00 0.00 ? 95  GLU A HG3  2  
ATOM 3638  N N    . ILE A 1 96  ? -40.995 -1.537  -1.952  1.00 0.00 ? 96  ILE A N    2  
ATOM 3639  C CA   . ILE A 1 96  ? -42.114 -0.636  -2.272  1.00 0.00 ? 96  ILE A CA   2  
ATOM 3640  C C    . ILE A 1 96  ? -43.132 -1.342  -3.165  1.00 0.00 ? 96  ILE A C    2  
ATOM 3641  O O    . ILE A 1 96  ? -42.772 -2.182  -3.995  1.00 0.00 ? 96  ILE A O    2  
ATOM 3642  C CB   . ILE A 1 96  ? -41.704 0.690   -2.987  1.00 0.00 ? 96  ILE A CB   2  
ATOM 3643  C CG1  . ILE A 1 96  ? -40.337 0.696   -3.703  1.00 0.00 ? 96  ILE A CG1  2  
ATOM 3644  C CG2  . ILE A 1 96  ? -41.771 1.897   -2.045  1.00 0.00 ? 96  ILE A CG2  2  
ATOM 3645  C CD1  . ILE A 1 96  ? -40.208 -0.350  -4.802  1.00 0.00 ? 96  ILE A CD1  2  
ATOM 3646  H H    . ILE A 1 96  ? -40.928 -2.392  -2.487  1.00 0.00 ? 96  ILE A H    2  
ATOM 3647  H HA   . ILE A 1 96  ? -42.606 -0.418  -1.324  1.00 0.00 ? 96  ILE A HA   2  
ATOM 3648  H HB   . ILE A 1 96  ? -42.458 0.904   -3.744  1.00 0.00 ? 96  ILE A HB   2  
ATOM 3649  H HG12 . ILE A 1 96  ? -40.185 1.672   -4.163  1.00 0.00 ? 96  ILE A HG12 2  
ATOM 3650  H HG13 . ILE A 1 96  ? -39.542 0.523   -2.979  1.00 0.00 ? 96  ILE A HG13 2  
ATOM 3651  H HG21 . ILE A 1 96  ? -40.916 1.891   -1.373  1.00 0.00 ? 96  ILE A HG21 2  
ATOM 3652  H HG22 . ILE A 1 96  ? -41.747 2.817   -2.631  1.00 0.00 ? 96  ILE A HG22 2  
ATOM 3653  H HG23 . ILE A 1 96  ? -42.700 1.884   -1.473  1.00 0.00 ? 96  ILE A HG23 2  
ATOM 3654  H HD11 . ILE A 1 96  ? -40.321 -1.340  -4.373  1.00 0.00 ? 96  ILE A HD11 2  
ATOM 3655  H HD12 . ILE A 1 96  ? -40.980 -0.184  -5.548  1.00 0.00 ? 96  ILE A HD12 2  
ATOM 3656  H HD13 . ILE A 1 96  ? -39.219 -0.288  -5.255  1.00 0.00 ? 96  ILE A HD13 2  
ATOM 3657  N N    . ALA A 1 97  ? -44.408 -0.993  -2.998  1.00 0.00 ? 97  ALA A N    2  
ATOM 3658  C CA   . ALA A 1 97  ? -45.463 -1.532  -3.855  1.00 0.00 ? 97  ALA A CA   2  
ATOM 3659  C C    . ALA A 1 97  ? -45.643 -0.678  -5.118  1.00 0.00 ? 97  ALA A C    2  
ATOM 3660  O O    . ALA A 1 97  ? -45.619 0.555   -5.050  1.00 0.00 ? 97  ALA A O    2  
ATOM 3661  C CB   . ALA A 1 97  ? -46.783 -1.697  -3.094  1.00 0.00 ? 97  ALA A CB   2  
ATOM 3662  H H    . ALA A 1 97  ? -44.630 -0.294  -2.301  1.00 0.00 ? 97  ALA A H    2  
ATOM 3663  H HA   . ALA A 1 97  ? -45.152 -2.529  -4.160  1.00 0.00 ? 97  ALA A HA   2  
ATOM 3664  H HB1  . ALA A 1 97  ? -46.616 -2.100  -2.098  1.00 0.00 ? 97  ALA A HB1  2  
ATOM 3665  H HB2  . ALA A 1 97  ? -47.286 -0.739  -3.026  1.00 0.00 ? 97  ALA A HB2  2  
ATOM 3666  H HB3  . ALA A 1 97  ? -47.436 -2.375  -3.644  1.00 0.00 ? 97  ALA A HB3  2  
ATOM 3667  N N    . PHE A 1 98  ? -45.889 -1.337  -6.245  1.00 0.00 ? 98  PHE A N    2  
ATOM 3668  C CA   . PHE A 1 98  ? -46.301 -0.717  -7.505  1.00 0.00 ? 98  PHE A CA   2  
ATOM 3669  C C    . PHE A 1 98  ? -47.783 -0.971  -7.789  1.00 0.00 ? 98  PHE A C    2  
ATOM 3670  O O    . PHE A 1 98  ? -48.361 -1.966  -7.337  1.00 0.00 ? 98  PHE A O    2  
ATOM 3671  C CB   . PHE A 1 98  ? -45.440 -1.241  -8.665  1.00 0.00 ? 98  PHE A CB   2  
ATOM 3672  C CG   . PHE A 1 98  ? -44.079 -0.589  -8.785  1.00 0.00 ? 98  PHE A CG   2  
ATOM 3673  C CD1  . PHE A 1 98  ? -42.963 -1.118  -8.112  1.00 0.00 ? 98  PHE A CD1  2  
ATOM 3674  C CD2  . PHE A 1 98  ? -43.933 0.557   -9.592  1.00 0.00 ? 98  PHE A CD2  2  
ATOM 3675  C CE1  . PHE A 1 98  ? -41.711 -0.489  -8.233  1.00 0.00 ? 98  PHE A CE1  2  
ATOM 3676  C CE2  . PHE A 1 98  ? -42.682 1.186   -9.708  1.00 0.00 ? 98  PHE A CE2  2  
ATOM 3677  C CZ   . PHE A 1 98  ? -41.576 0.672   -9.013  1.00 0.00 ? 98  PHE A CZ   2  
ATOM 3678  H H    . PHE A 1 98  ? -45.955 -2.348  -6.188  1.00 0.00 ? 98  PHE A H    2  
ATOM 3679  H HA   . PHE A 1 98  ? -46.163 0.365   -7.448  1.00 0.00 ? 98  PHE A HA   2  
ATOM 3680  H HB2  . PHE A 1 98  ? -45.310 -2.316  -8.552  1.00 0.00 ? 98  PHE A HB2  2  
ATOM 3681  H HB3  . PHE A 1 98  ? -45.970 -1.081  -9.605  1.00 0.00 ? 98  PHE A HB3  2  
ATOM 3682  H HD1  . PHE A 1 98  ? -43.064 -2.004  -7.500  1.00 0.00 ? 98  PHE A HD1  2  
ATOM 3683  H HD2  . PHE A 1 98  ? -44.785 0.960   -10.123 1.00 0.00 ? 98  PHE A HD2  2  
ATOM 3684  H HE1  . PHE A 1 98  ? -40.852 -0.894  -7.721  1.00 0.00 ? 98  PHE A HE1  2  
ATOM 3685  H HE2  . PHE A 1 98  ? -42.573 2.068   -10.323 1.00 0.00 ? 98  PHE A HE2  2  
ATOM 3686  H HZ   . PHE A 1 98  ? -40.622 1.172   -9.084  1.00 0.00 ? 98  PHE A HZ   2  
ATOM 3687  N N    . TYR A 1 99  ? -48.380 -0.077  -8.578  1.00 0.00 ? 99  TYR A N    2  
ATOM 3688  C CA   . TYR A 1 99  ? -49.690 -0.280  -9.189  1.00 0.00 ? 99  TYR A CA   2  
ATOM 3689  C C    . TYR A 1 99  ? -49.555 -0.171  -10.713 1.00 0.00 ? 99  TYR A C    2  
ATOM 3690  O O    . TYR A 1 99  ? -48.831 0.681   -11.238 1.00 0.00 ? 99  TYR A O    2  
ATOM 3691  C CB   . TYR A 1 99  ? -50.765 0.647   -8.601  1.00 0.00 ? 99  TYR A CB   2  
ATOM 3692  C CG   . TYR A 1 99  ? -50.785 2.073   -9.124  1.00 0.00 ? 99  TYR A CG   2  
ATOM 3693  C CD1  . TYR A 1 99  ? -49.998 3.068   -8.514  1.00 0.00 ? 99  TYR A CD1  2  
ATOM 3694  C CD2  . TYR A 1 99  ? -51.615 2.403   -10.216 1.00 0.00 ? 99  TYR A CD2  2  
ATOM 3695  C CE1  . TYR A 1 99  ? -50.045 4.394   -8.988  1.00 0.00 ? 99  TYR A CE1  2  
ATOM 3696  C CE2  . TYR A 1 99  ? -51.658 3.725   -10.695 1.00 0.00 ? 99  TYR A CE2  2  
ATOM 3697  C CZ   . TYR A 1 99  ? -50.874 4.727   -10.082 1.00 0.00 ? 99  TYR A CZ   2  
ATOM 3698  O OH   . TYR A 1 99  ? -50.929 6.007   -10.543 1.00 0.00 ? 99  TYR A OH   2  
ATOM 3699  H H    . TYR A 1 99  ? -47.843 0.713   -8.904  1.00 0.00 ? 99  TYR A H    2  
ATOM 3700  H HA   . TYR A 1 99  ? -50.012 -1.295  -8.970  1.00 0.00 ? 99  TYR A HA   2  
ATOM 3701  H HB2  . TYR A 1 99  ? -51.734 0.203   -8.827  1.00 0.00 ? 99  TYR A HB2  2  
ATOM 3702  H HB3  . TYR A 1 99  ? -50.669 0.662   -7.514  1.00 0.00 ? 99  TYR A HB3  2  
ATOM 3703  H HD1  . TYR A 1 99  ? -49.359 2.818   -7.678  1.00 0.00 ? 99  TYR A HD1  2  
ATOM 3704  H HD2  . TYR A 1 99  ? -52.222 1.641   -10.688 1.00 0.00 ? 99  TYR A HD2  2  
ATOM 3705  H HE1  . TYR A 1 99  ? -49.450 5.158   -8.512  1.00 0.00 ? 99  TYR A HE1  2  
ATOM 3706  H HE2  . TYR A 1 99  ? -52.290 3.984   -11.533 1.00 0.00 ? 99  TYR A HE2  2  
ATOM 3707  H HH   . TYR A 1 99  ? -50.357 6.607   -10.036 1.00 0.00 ? 99  TYR A HH   2  
ATOM 3708  N N    . ARG A 1 100 ? -50.240 -1.068  -11.421 1.00 0.00 ? 100 ARG A N    2  
ATOM 3709  C CA   . ARG A 1 100 ? -50.301 -1.145  -12.883 1.00 0.00 ? 100 ARG A CA   2  
ATOM 3710  C C    . ARG A 1 100 ? -51.596 -0.516  -13.399 1.00 0.00 ? 100 ARG A C    2  
ATOM 3711  O O    . ARG A 1 100 ? -52.599 -0.488  -12.681 1.00 0.00 ? 100 ARG A O    2  
ATOM 3712  C CB   . ARG A 1 100 ? -50.080 -2.612  -13.280 1.00 0.00 ? 100 ARG A CB   2  
ATOM 3713  C CG   . ARG A 1 100 ? -49.873 -2.850  -14.784 1.00 0.00 ? 100 ARG A CG   2  
ATOM 3714  C CD   . ARG A 1 100 ? -49.408 -4.283  -15.066 1.00 0.00 ? 100 ARG A CD   2  
ATOM 3715  N NE   . ARG A 1 100 ? -48.053 -4.515  -14.528 1.00 0.00 ? 100 ARG A NE   2  
ATOM 3716  C CZ   . ARG A 1 100 ? -47.481 -5.670  -14.256 1.00 0.00 ? 100 ARG A CZ   2  
ATOM 3717  N NH1  . ARG A 1 100 ? -48.048 -6.815  -14.512 1.00 0.00 ? 100 ARG A NH1  2  
ATOM 3718  N NH2  . ARG A 1 100 ? -46.308 -5.672  -13.697 1.00 0.00 ? 100 ARG A NH2  2  
ATOM 3719  H H    . ARG A 1 100 ? -50.789 -1.746  -10.898 1.00 0.00 ? 100 ARG A H    2  
ATOM 3720  H HA   . ARG A 1 100 ? -49.477 -0.560  -13.287 1.00 0.00 ? 100 ARG A HA   2  
ATOM 3721  H HB2  . ARG A 1 100 ? -49.183 -2.949  -12.759 1.00 0.00 ? 100 ARG A HB2  2  
ATOM 3722  H HB3  . ARG A 1 100 ? -50.911 -3.218  -12.921 1.00 0.00 ? 100 ARG A HB3  2  
ATOM 3723  H HG2  . ARG A 1 100 ? -50.810 -2.672  -15.312 1.00 0.00 ? 100 ARG A HG2  2  
ATOM 3724  H HG3  . ARG A 1 100 ? -49.120 -2.165  -15.166 1.00 0.00 ? 100 ARG A HG3  2  
ATOM 3725  H HD2  . ARG A 1 100 ? -50.123 -4.976  -14.619 1.00 0.00 ? 100 ARG A HD2  2  
ATOM 3726  H HD3  . ARG A 1 100 ? -49.395 -4.440  -16.147 1.00 0.00 ? 100 ARG A HD3  2  
ATOM 3727  H HE   . ARG A 1 100 ? -47.484 -3.698  -14.332 1.00 0.00 ? 100 ARG A HE   2  
ATOM 3728  H HH11 . ARG A 1 100 ? -48.948 -6.827  -14.959 1.00 0.00 ? 100 ARG A HH11 2  
ATOM 3729  H HH12 . ARG A 1 100 ? -47.583 -7.679  -14.290 1.00 0.00 ? 100 ARG A HH12 2  
ATOM 3730  H HH21 . ARG A 1 100 ? -45.893 -4.787  -13.464 1.00 0.00 ? 100 ARG A HH21 2  
ATOM 3731  H HH22 . ARG A 1 100 ? -45.857 -6.538  -13.455 1.00 0.00 ? 100 ARG A HH22 2  
ATOM 3732  N N    . LYS A 1 101 ? -51.593 0.005   -14.633 1.00 0.00 ? 101 LYS A N    2  
ATOM 3733  C CA   . LYS A 1 101 ? -52.720 0.797   -15.186 1.00 0.00 ? 101 LYS A CA   2  
ATOM 3734  C C    . LYS A 1 101 ? -54.066 0.062   -15.313 1.00 0.00 ? 101 LYS A C    2  
ATOM 3735  O O    . LYS A 1 101 ? -55.103 0.707   -15.454 1.00 0.00 ? 101 LYS A O    2  
ATOM 3736  C CB   . LYS A 1 101 ? -52.289 1.526   -16.470 1.00 0.00 ? 101 LYS A CB   2  
ATOM 3737  C CG   . LYS A 1 101 ? -51.997 0.648   -17.691 1.00 0.00 ? 101 LYS A CG   2  
ATOM 3738  C CD   . LYS A 1 101 ? -53.234 0.228   -18.500 1.00 0.00 ? 101 LYS A CD   2  
ATOM 3739  C CE   . LYS A 1 101 ? -52.875 -0.858  -19.517 1.00 0.00 ? 101 LYS A CE   2  
ATOM 3740  N NZ   . LYS A 1 101 ? -52.001 -0.358  -20.612 1.00 0.00 ? 101 LYS A NZ   2  
ATOM 3741  H H    . LYS A 1 101 ? -50.703 0.012   -15.122 1.00 0.00 ? 101 LYS A H    2  
ATOM 3742  H HA   . LYS A 1 101 ? -52.923 1.586   -14.469 1.00 0.00 ? 101 LYS A HA   2  
ATOM 3743  H HB2  . LYS A 1 101 ? -53.041 2.270   -16.737 1.00 0.00 ? 101 LYS A HB2  2  
ATOM 3744  H HB3  . LYS A 1 101 ? -51.370 2.063   -16.242 1.00 0.00 ? 101 LYS A HB3  2  
ATOM 3745  H HG2  . LYS A 1 101 ? -51.367 1.243   -18.349 1.00 0.00 ? 101 LYS A HG2  2  
ATOM 3746  H HG3  . LYS A 1 101 ? -51.437 -0.234  -17.378 1.00 0.00 ? 101 LYS A HG3  2  
ATOM 3747  H HD2  . LYS A 1 101 ? -53.991 -0.190  -17.844 1.00 0.00 ? 101 LYS A HD2  2  
ATOM 3748  H HD3  . LYS A 1 101 ? -53.663 1.098   -19.001 1.00 0.00 ? 101 LYS A HD3  2  
ATOM 3749  H HE2  . LYS A 1 101 ? -52.379 -1.660  -18.963 1.00 0.00 ? 101 LYS A HE2  2  
ATOM 3750  H HE3  . LYS A 1 101 ? -53.802 -1.259  -19.940 1.00 0.00 ? 101 LYS A HE3  2  
ATOM 3751  H HZ1  . LYS A 1 101 ? -51.807 -1.089  -21.283 1.00 0.00 ? 101 LYS A HZ1  2  
ATOM 3752  H HZ2  . LYS A 1 101 ? -52.435 0.407   -21.111 1.00 0.00 ? 101 LYS A HZ2  2  
ATOM 3753  H HZ3  . LYS A 1 101 ? -51.105 -0.034  -20.255 1.00 0.00 ? 101 LYS A HZ3  2  
ATOM 3754  N N    . ASP A 1 102 ? -54.068 -1.269  -15.233 1.00 0.00 ? 102 ASP A N    2  
ATOM 3755  C CA   . ASP A 1 102 ? -55.272 -2.114  -15.165 1.00 0.00 ? 102 ASP A CA   2  
ATOM 3756  C C    . ASP A 1 102 ? -55.927 -2.153  -13.763 1.00 0.00 ? 102 ASP A C    2  
ATOM 3757  O O    . ASP A 1 102 ? -57.040 -2.665  -13.614 1.00 0.00 ? 102 ASP A O    2  
ATOM 3758  C CB   . ASP A 1 102 ? -54.904 -3.539  -15.617 1.00 0.00 ? 102 ASP A CB   2  
ATOM 3759  C CG   . ASP A 1 102 ? -54.134 -4.315  -14.535 1.00 0.00 ? 102 ASP A CG   2  
ATOM 3760  O OD1  . ASP A 1 102 ? -53.189 -3.743  -13.945 1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3761  O OD2  . ASP A 1 102 ? -54.485 -5.483  -14.248 1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3762  H H    . ASP A 1 102 ? -53.183 -1.731  -15.084 1.00 0.00 ? 102 ASP A H    2  
ATOM 3763  H HA   . ASP A 1 102 ? -56.012 -1.721  -15.864 1.00 0.00 ? 102 ASP A HA   2  
ATOM 3764  H HB2  . ASP A 1 102 ? -55.828 -4.070  -15.855 1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3765  H HB3  . ASP A 1 102 ? -54.307 -3.491  -16.530 1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3766  N N    . GLY A 1 103 ? -55.241 -1.633  -12.740 1.00 0.00 ? 103 GLY A N    2  
ATOM 3767  C CA   . GLY A 1 103 ? -55.634 -1.666  -11.328 1.00 0.00 ? 103 GLY A CA   2  
ATOM 3768  C C    . GLY A 1 103 ? -54.945 -2.750  -10.484 1.00 0.00 ? 103 GLY A C    2  
ATOM 3769  O O    . GLY A 1 103 ? -55.250 -2.860  -9.293  1.00 0.00 ? 103 GLY A O    2  
ATOM 3770  H H    . GLY A 1 103 ? -54.327 -1.241  -12.944 1.00 0.00 ? 103 GLY A H    2  
ATOM 3771  H HA2  . GLY A 1 103 ? -55.391 -0.700  -10.885 1.00 0.00 ? 103 GLY A HA2  2  
ATOM 3772  H HA3  . GLY A 1 103 ? -56.711 -1.809  -11.248 1.00 0.00 ? 103 GLY A HA3  2  
ATOM 3773  N N    . SER A 1 104 ? -54.019 -3.544  -11.043 1.00 0.00 ? 104 SER A N    2  
ATOM 3774  C CA   . SER A 1 104 ? -53.282 -4.567  -10.275 1.00 0.00 ? 104 SER A CA   2  
ATOM 3775  C C    . SER A 1 104 ? -52.216 -3.929  -9.376  1.00 0.00 ? 104 SER A C    2  
ATOM 3776  O O    . SER A 1 104 ? -51.390 -3.152  -9.857  1.00 0.00 ? 104 SER A O    2  
ATOM 3777  C CB   . SER A 1 104 ? -52.636 -5.608  -11.198 1.00 0.00 ? 104 SER A CB   2  
ATOM 3778  O OG   . SER A 1 104 ? -53.617 -6.431  -11.806 1.00 0.00 ? 104 SER A OG   2  
ATOM 3779  H H    . SER A 1 104 ? -53.767 -3.402  -12.019 1.00 0.00 ? 104 SER A H    2  
ATOM 3780  H HA   . SER A 1 104 ? -53.988 -5.097  -9.634  1.00 0.00 ? 104 SER A HA   2  
ATOM 3781  H HB2  . SER A 1 104 ? -52.031 -5.112  -11.959 1.00 0.00 ? 104 SER A HB2  2  
ATOM 3782  H HB3  . SER A 1 104 ? -51.980 -6.243  -10.599 1.00 0.00 ? 104 SER A HB3  2  
ATOM 3783  H HG   . SER A 1 104 ? -53.894 -6.007  -12.650 1.00 0.00 ? 104 SER A HG   2  
ATOM 3784  N N    . CYS A 1 105 ? -52.210 -4.264  -8.080  1.00 0.00 ? 105 CYS A N    2  
ATOM 3785  C CA   . CYS A 1 105 ? -51.314 -3.681  -7.068  1.00 0.00 ? 105 CYS A CA   2  
ATOM 3786  C C    . CYS A 1 105 ? -50.511 -4.769  -6.334  1.00 0.00 ? 105 CYS A C    2  
ATOM 3787  O O    . CYS A 1 105 ? -51.092 -5.739  -5.838  1.00 0.00 ? 105 CYS A O    2  
ATOM 3788  C CB   . CYS A 1 105 ? -52.137 -2.848  -6.069  1.00 0.00 ? 105 CYS A CB   2  
ATOM 3789  S SG   . CYS A 1 105 ? -53.072 -1.530  -6.898  1.00 0.00 ? 105 CYS A SG   2  
ATOM 3790  H H    . CYS A 1 105 ? -52.899 -4.928  -7.757  1.00 0.00 ? 105 CYS A H    2  
ATOM 3791  H HA   . CYS A 1 105 ? -50.603 -3.015  -7.552  1.00 0.00 ? 105 CYS A HA   2  
ATOM 3792  H HB2  . CYS A 1 105 ? -52.830 -3.500  -5.533  1.00 0.00 ? 105 CYS A HB2  2  
ATOM 3793  H HB3  . CYS A 1 105 ? -51.459 -2.393  -5.345  1.00 0.00 ? 105 CYS A HB3  2  
ATOM 3794  H HG   . CYS A 1 105 ? -53.847 -2.324  -7.658  1.00 0.00 ? 105 CYS A HG   2  
ATOM 3795  N N    . PHE A 1 106 ? -49.189 -4.609  -6.223  1.00 0.00 ? 106 PHE A N    2  
ATOM 3796  C CA   . PHE A 1 106 ? -48.275 -5.649  -5.719  1.00 0.00 ? 106 PHE A CA   2  
ATOM 3797  C C    . PHE A 1 106 ? -47.035 -5.070  -5.013  1.00 0.00 ? 106 PHE A C    2  
ATOM 3798  O O    . PHE A 1 106 ? -46.432 -4.107  -5.485  1.00 0.00 ? 106 PHE A O    2  
ATOM 3799  C CB   . PHE A 1 106 ? -47.868 -6.567  -6.890  1.00 0.00 ? 106 PHE A CB   2  
ATOM 3800  C CG   . PHE A 1 106 ? -47.397 -5.845  -8.147  1.00 0.00 ? 106 PHE A CG   2  
ATOM 3801  C CD1  . PHE A 1 106 ? -48.334 -5.449  -9.124  1.00 0.00 ? 106 PHE A CD1  2  
ATOM 3802  C CD2  . PHE A 1 106 ? -46.035 -5.541  -8.329  1.00 0.00 ? 106 PHE A CD2  2  
ATOM 3803  C CE1  . PHE A 1 106 ? -47.919 -4.719  -10.251 1.00 0.00 ? 106 PHE A CE1  2  
ATOM 3804  C CE2  . PHE A 1 106 ? -45.618 -4.823  -9.465  1.00 0.00 ? 106 PHE A CE2  2  
ATOM 3805  C CZ   . PHE A 1 106 ? -46.562 -4.396  -10.417 1.00 0.00 ? 106 PHE A CZ   2  
ATOM 3806  H H    . PHE A 1 106 ? -48.768 -3.775  -6.625  1.00 0.00 ? 106 PHE A H    2  
ATOM 3807  H HA   . PHE A 1 106 ? -48.796 -6.267  -4.989  1.00 0.00 ? 106 PHE A HA   2  
ATOM 3808  H HB2  . PHE A 1 106 ? -47.086 -7.250  -6.554  1.00 0.00 ? 106 PHE A HB2  2  
ATOM 3809  H HB3  . PHE A 1 106 ? -48.730 -7.182  -7.156  1.00 0.00 ? 106 PHE A HB3  2  
ATOM 3810  H HD1  . PHE A 1 106 ? -49.381 -5.685  -8.997  1.00 0.00 ? 106 PHE A HD1  2  
ATOM 3811  H HD2  . PHE A 1 106 ? -45.307 -5.840  -7.587  1.00 0.00 ? 106 PHE A HD2  2  
ATOM 3812  H HE1  . PHE A 1 106 ? -48.648 -4.399  -10.983 1.00 0.00 ? 106 PHE A HE1  2  
ATOM 3813  H HE2  . PHE A 1 106 ? -44.576 -4.572  -9.589  1.00 0.00 ? 106 PHE A HE2  2  
ATOM 3814  H HZ   . PHE A 1 106 ? -46.245 -3.815  -11.271 1.00 0.00 ? 106 PHE A HZ   2  
ATOM 3815  N N    . LEU A 1 107 ? -46.626 -5.701  -3.904  1.00 0.00 ? 107 LEU A N    2  
ATOM 3816  C CA   . LEU A 1 107 ? -45.390 -5.444  -3.154  1.00 0.00 ? 107 LEU A CA   2  
ATOM 3817  C C    . LEU A 1 107 ? -44.435 -6.632  -3.328  1.00 0.00 ? 107 LEU A C    2  
ATOM 3818  O O    . LEU A 1 107 ? -44.838 -7.790  -3.196  1.00 0.00 ? 107 LEU A O    2  
ATOM 3819  C CB   . LEU A 1 107 ? -45.758 -5.193  -1.672  1.00 0.00 ? 107 LEU A CB   2  
ATOM 3820  C CG   . LEU A 1 107 ? -44.663 -4.783  -0.657  1.00 0.00 ? 107 LEU A CG   2  
ATOM 3821  C CD1  . LEU A 1 107 ? -43.548 -5.798  -0.427  1.00 0.00 ? 107 LEU A CD1  2  
ATOM 3822  C CD2  . LEU A 1 107 ? -43.968 -3.477  -0.987  1.00 0.00 ? 107 LEU A CD2  2  
ATOM 3823  H H    . LEU A 1 107 ? -47.175 -6.480  -3.571  1.00 0.00 ? 107 LEU A H    2  
ATOM 3824  H HA   . LEU A 1 107 ? -44.900 -4.555  -3.552  1.00 0.00 ? 107 LEU A HA   2  
ATOM 3825  H HB2  . LEU A 1 107 ? -46.522 -4.414  -1.649  1.00 0.00 ? 107 LEU A HB2  2  
ATOM 3826  H HB3  . LEU A 1 107 ? -46.234 -6.097  -1.286  1.00 0.00 ? 107 LEU A HB3  2  
ATOM 3827  H HG   . LEU A 1 107 ? -45.169 -4.614  0.287   1.00 0.00 ? 107 LEU A HG   2  
ATOM 3828  H HD11 . LEU A 1 107 ? -43.944 -6.812  -0.414  1.00 0.00 ? 107 LEU A HD11 2  
ATOM 3829  H HD12 . LEU A 1 107 ? -42.789 -5.705  -1.199  1.00 0.00 ? 107 LEU A HD12 2  
ATOM 3830  H HD13 . LEU A 1 107 ? -43.064 -5.577  0.522   1.00 0.00 ? 107 LEU A HD13 2  
ATOM 3831  H HD21 . LEU A 1 107 ? -43.446 -3.587  -1.933  1.00 0.00 ? 107 LEU A HD21 2  
ATOM 3832  H HD22 . LEU A 1 107 ? -44.708 -2.683  -1.028  1.00 0.00 ? 107 LEU A HD22 2  
ATOM 3833  H HD23 . LEU A 1 107 ? -43.247 -3.232  -0.205  1.00 0.00 ? 107 LEU A HD23 2  
ATOM 3834  N N    . CYS A 1 108 ? -43.165 -6.335  -3.589  1.00 0.00 ? 108 CYS A N    2  
ATOM 3835  C CA   . CYS A 1 108 ? -42.050 -7.282  -3.571  1.00 0.00 ? 108 CYS A CA   2  
ATOM 3836  C C    . CYS A 1 108 ? -40.811 -6.642  -2.919  1.00 0.00 ? 108 CYS A C    2  
ATOM 3837  O O    . CYS A 1 108 ? -40.781 -5.431  -2.671  1.00 0.00 ? 108 CYS A O    2  
ATOM 3838  C CB   . CYS A 1 108 ? -41.785 -7.732  -5.012  1.00 0.00 ? 108 CYS A CB   2  
ATOM 3839  S SG   . CYS A 1 108 ? -42.812 -9.186  -5.380  1.00 0.00 ? 108 CYS A SG   2  
ATOM 3840  H H    . CYS A 1 108 ? -42.919 -5.357  -3.672  1.00 0.00 ? 108 CYS A H    2  
ATOM 3841  H HA   . CYS A 1 108 ? -42.304 -8.154  -2.965  1.00 0.00 ? 108 CYS A HA   2  
ATOM 3842  H HB2  . CYS A 1 108 ? -42.010 -6.917  -5.703  1.00 0.00 ? 108 CYS A HB2  2  
ATOM 3843  H HB3  . CYS A 1 108 ? -40.739 -8.003  -5.127  1.00 0.00 ? 108 CYS A HB3  2  
ATOM 3844  H HG   . CYS A 1 108 ? -43.959 -8.692  -4.882  1.00 0.00 ? 108 CYS A HG   2  
ATOM 3845  N N    . LEU A 1 109 ? -39.762 -7.432  -2.672  1.00 0.00 ? 109 LEU A N    2  
ATOM 3846  C CA   . LEU A 1 109 ? -38.466 -6.952  -2.173  1.00 0.00 ? 109 LEU A CA   2  
ATOM 3847  C C    . LEU A 1 109 ? -37.668 -6.294  -3.318  1.00 0.00 ? 109 LEU A C    2  
ATOM 3848  O O    . LEU A 1 109 ? -36.596 -6.757  -3.709  1.00 0.00 ? 109 LEU A O    2  
ATOM 3849  C CB   . LEU A 1 109 ? -37.755 -8.119  -1.454  1.00 0.00 ? 109 LEU A CB   2  
ATOM 3850  C CG   . LEU A 1 109 ? -36.429 -7.772  -0.743  1.00 0.00 ? 109 LEU A CG   2  
ATOM 3851  C CD1  . LEU A 1 109 ? -36.565 -6.612  0.246   1.00 0.00 ? 109 LEU A CD1  2  
ATOM 3852  C CD2  . LEU A 1 109 ? -35.932 -8.998  0.025   1.00 0.00 ? 109 LEU A CD2  2  
ATOM 3853  H H    . LEU A 1 109 ? -39.817 -8.406  -2.954  1.00 0.00 ? 109 LEU A H    2  
ATOM 3854  H HA   . LEU A 1 109 ? -38.663 -6.175  -1.433  1.00 0.00 ? 109 LEU A HA   2  
ATOM 3855  H HB2  . LEU A 1 109 ? -38.443 -8.521  -0.709  1.00 0.00 ? 109 LEU A HB2  2  
ATOM 3856  H HB3  . LEU A 1 109 ? -37.560 -8.910  -2.180  1.00 0.00 ? 109 LEU A HB3  2  
ATOM 3857  H HG   . LEU A 1 109 ? -35.668 -7.511  -1.475  1.00 0.00 ? 109 LEU A HG   2  
ATOM 3858  H HD11 . LEU A 1 109 ? -35.633 -6.486  0.797   1.00 0.00 ? 109 LEU A HD11 2  
ATOM 3859  H HD12 . LEU A 1 109 ? -36.764 -5.687  -0.292  1.00 0.00 ? 109 LEU A HD12 2  
ATOM 3860  H HD13 . LEU A 1 109 ? -37.374 -6.810  0.950   1.00 0.00 ? 109 LEU A HD13 2  
ATOM 3861  H HD21 . LEU A 1 109 ? -34.969 -8.780  0.486   1.00 0.00 ? 109 LEU A HD21 2  
ATOM 3862  H HD22 . LEU A 1 109 ? -36.649 -9.274  0.800   1.00 0.00 ? 109 LEU A HD22 2  
ATOM 3863  H HD23 . LEU A 1 109 ? -35.809 -9.835  -0.663  1.00 0.00 ? 109 LEU A HD23 2  
ATOM 3864  N N    . VAL A 1 110 ? -38.248 -5.241  -3.904  1.00 0.00 ? 110 VAL A N    2  
ATOM 3865  C CA   . VAL A 1 110 ? -37.745 -4.566  -5.111  1.00 0.00 ? 110 VAL A CA   2  
ATOM 3866  C C    . VAL A 1 110 ? -36.318 -4.049  -4.883  1.00 0.00 ? 110 VAL A C    2  
ATOM 3867  O O    . VAL A 1 110 ? -35.982 -3.603  -3.783  1.00 0.00 ? 110 VAL A O    2  
ATOM 3868  C CB   . VAL A 1 110 ? -38.679 -3.423  -5.546  1.00 0.00 ? 110 VAL A CB   2  
ATOM 3869  C CG1  . VAL A 1 110 ? -38.211 -2.698  -6.814  1.00 0.00 ? 110 VAL A CG1  2  
ATOM 3870  C CG2  . VAL A 1 110 ? -40.100 -3.927  -5.839  1.00 0.00 ? 110 VAL A CG2  2  
ATOM 3871  H H    . VAL A 1 110 ? -39.141 -4.942  -3.526  1.00 0.00 ? 110 VAL A H    2  
ATOM 3872  H HA   . VAL A 1 110 ? -37.742 -5.312  -5.899  1.00 0.00 ? 110 VAL A HA   2  
ATOM 3873  H HB   . VAL A 1 110 ? -38.711 -2.704  -4.730  1.00 0.00 ? 110 VAL A HB   2  
ATOM 3874  H HG11 . VAL A 1 110 ? -38.166 -3.398  -7.646  1.00 0.00 ? 110 VAL A HG11 2  
ATOM 3875  H HG12 . VAL A 1 110 ? -38.909 -1.902  -7.066  1.00 0.00 ? 110 VAL A HG12 2  
ATOM 3876  H HG13 . VAL A 1 110 ? -37.234 -2.245  -6.666  1.00 0.00 ? 110 VAL A HG13 2  
ATOM 3877  H HG21 . VAL A 1 110 ? -40.557 -4.333  -4.942  1.00 0.00 ? 110 VAL A HG21 2  
ATOM 3878  H HG22 . VAL A 1 110 ? -40.727 -3.102  -6.182  1.00 0.00 ? 110 VAL A HG22 2  
ATOM 3879  H HG23 . VAL A 1 110 ? -40.072 -4.694  -6.613  1.00 0.00 ? 110 VAL A HG23 2  
ATOM 3880  N N    . ASP A 1 111 ? -35.466 -4.064  -5.912  1.00 0.00 ? 111 ASP A N    2  
ATOM 3881  C CA   . ASP A 1 111 ? -34.027 -3.818  -5.721  1.00 0.00 ? 111 ASP A CA   2  
ATOM 3882  C C    . ASP A 1 111 ? -33.654 -2.369  -6.088  1.00 0.00 ? 111 ASP A C    2  
ATOM 3883  O O    . ASP A 1 111 ? -32.932 -2.090  -7.047  1.00 0.00 ? 111 ASP A O    2  
ATOM 3884  C CB   . ASP A 1 111 ? -33.246 -4.899  -6.490  1.00 0.00 ? 111 ASP A CB   2  
ATOM 3885  C CG   . ASP A 1 111 ? -31.886 -5.207  -5.865  1.00 0.00 ? 111 ASP A CG   2  
ATOM 3886  O OD1  . ASP A 1 111 ? -30.887 -4.519  -6.156  1.00 0.00 ? 111 ASP A OD1  2  
ATOM 3887  O OD2  . ASP A 1 111 ? -31.815 -6.168  -5.061  1.00 0.00 ? 111 ASP A OD2  2  
ATOM 3888  H H    . ASP A 1 111 ? -35.813 -4.333  -6.826  1.00 0.00 ? 111 ASP A H    2  
ATOM 3889  H HA   . ASP A 1 111 ? -33.788 -3.953  -4.669  1.00 0.00 ? 111 ASP A HA   2  
ATOM 3890  H HB2  . ASP A 1 111 ? -33.824 -5.824  -6.466  1.00 0.00 ? 111 ASP A HB2  2  
ATOM 3891  H HB3  . ASP A 1 111 ? -33.120 -4.607  -7.531  1.00 0.00 ? 111 ASP A HB3  2  
ATOM 3892  N N    . VAL A 1 112 ? -34.108 -1.422  -5.256  1.00 0.00 ? 112 VAL A N    2  
ATOM 3893  C CA   . VAL A 1 112 ? -34.036 0.024   -5.527  1.00 0.00 ? 112 VAL A CA   2  
ATOM 3894  C C    . VAL A 1 112 ? -32.651 0.572   -5.159  1.00 0.00 ? 112 VAL A C    2  
ATOM 3895  O O    . VAL A 1 112 ? -32.500 1.311   -4.190  1.00 0.00 ? 112 VAL A O    2  
ATOM 3896  C CB   . VAL A 1 112 ? -35.181 0.760   -4.790  1.00 0.00 ? 112 VAL A CB   2  
ATOM 3897  C CG1  . VAL A 1 112 ? -35.356 2.205   -5.271  1.00 0.00 ? 112 VAL A CG1  2  
ATOM 3898  C CG2  . VAL A 1 112 ? -36.529 0.076   -5.029  1.00 0.00 ? 112 VAL A CG2  2  
ATOM 3899  H H    . VAL A 1 112 ? -34.682 -1.714  -4.467  1.00 0.00 ? 112 VAL A H    2  
ATOM 3900  H HA   . VAL A 1 112 ? -34.178 0.180   -6.598  1.00 0.00 ? 112 VAL A HA   2  
ATOM 3901  H HB   . VAL A 1 112 ? -34.990 0.759   -3.717  1.00 0.00 ? 112 VAL A HB   2  
ATOM 3902  H HG11 . VAL A 1 112 ? -36.154 2.689   -4.704  1.00 0.00 ? 112 VAL A HG11 2  
ATOM 3903  H HG12 . VAL A 1 112 ? -34.442 2.776   -5.120  1.00 0.00 ? 112 VAL A HG12 2  
ATOM 3904  H HG13 . VAL A 1 112 ? -35.624 2.207   -6.325  1.00 0.00 ? 112 VAL A HG13 2  
ATOM 3905  H HG21 . VAL A 1 112 ? -36.739 0.029   -6.094  1.00 0.00 ? 112 VAL A HG21 2  
ATOM 3906  H HG22 . VAL A 1 112 ? -36.524 -0.933  -4.620  1.00 0.00 ? 112 VAL A HG22 2  
ATOM 3907  H HG23 . VAL A 1 112 ? -37.308 0.641   -4.520  1.00 0.00 ? 112 VAL A HG23 2  
ATOM 3908  N N    . VAL A 1 113 ? -31.623 0.205   -5.929  1.00 0.00 ? 113 VAL A N    2  
ATOM 3909  C CA   . VAL A 1 113 ? -30.217 0.581   -5.666  1.00 0.00 ? 113 VAL A CA   2  
ATOM 3910  C C    . VAL A 1 113 ? -29.653 1.448   -6.814  1.00 0.00 ? 113 VAL A C    2  
ATOM 3911  O O    . VAL A 1 113 ? -29.851 1.082   -7.977  1.00 0.00 ? 113 VAL A O    2  
ATOM 3912  C CB   . VAL A 1 113 ? -29.364 -0.670  -5.370  1.00 0.00 ? 113 VAL A CB   2  
ATOM 3913  C CG1  . VAL A 1 113 ? -29.140 -1.591  -6.574  1.00 0.00 ? 113 VAL A CG1  2  
ATOM 3914  C CG2  . VAL A 1 113 ? -28.002 -0.290  -4.778  1.00 0.00 ? 113 VAL A CG2  2  
ATOM 3915  H H    . VAL A 1 113 ? -31.825 -0.434  -6.697  1.00 0.00 ? 113 VAL A H    2  
ATOM 3916  H HA   . VAL A 1 113 ? -30.213 1.153   -4.738  1.00 0.00 ? 113 VAL A HA   2  
ATOM 3917  H HB   . VAL A 1 113 ? -29.889 -1.249  -4.610  1.00 0.00 ? 113 VAL A HB   2  
ATOM 3918  H HG11 . VAL A 1 113 ? -30.096 -1.857  -7.022  1.00 0.00 ? 113 VAL A HG11 2  
ATOM 3919  H HG12 . VAL A 1 113 ? -28.514 -1.104  -7.321  1.00 0.00 ? 113 VAL A HG12 2  
ATOM 3920  H HG13 . VAL A 1 113 ? -28.646 -2.506  -6.247  1.00 0.00 ? 113 VAL A HG13 2  
ATOM 3921  H HG21 . VAL A 1 113 ? -28.144 0.304   -3.875  1.00 0.00 ? 113 VAL A HG21 2  
ATOM 3922  H HG22 . VAL A 1 113 ? -27.454 -1.195  -4.511  1.00 0.00 ? 113 VAL A HG22 2  
ATOM 3923  H HG23 . VAL A 1 113 ? -27.416 0.278   -5.501  1.00 0.00 ? 113 VAL A HG23 2  
ATOM 3924  N N    . PRO A 1 114 ? -29.006 2.607   -6.551  1.00 0.00 ? 114 PRO A N    2  
ATOM 3925  C CA   . PRO A 1 114 ? -28.554 3.536   -7.603  1.00 0.00 ? 114 PRO A CA   2  
ATOM 3926  C C    . PRO A 1 114 ? -27.162 3.144   -8.161  1.00 0.00 ? 114 PRO A C    2  
ATOM 3927  O O    . PRO A 1 114 ? -26.650 2.069   -7.834  1.00 0.00 ? 114 PRO A O    2  
ATOM 3928  C CB   . PRO A 1 114 ? -28.555 4.899   -6.917  1.00 0.00 ? 114 PRO A CB   2  
ATOM 3929  C CG   . PRO A 1 114 ? -28.139 4.566   -5.486  1.00 0.00 ? 114 PRO A CG   2  
ATOM 3930  C CD   . PRO A 1 114 ? -28.824 3.222   -5.239  1.00 0.00 ? 114 PRO A CD   2  
ATOM 3931  H HA   . PRO A 1 114 ? -29.294 3.583   -8.410  1.00 0.00 ? 114 PRO A HA   2  
ATOM 3932  H HB2  . PRO A 1 114 ? -27.877 5.589   -7.403  1.00 0.00 ? 114 PRO A HB2  2  
ATOM 3933  H HB3  . PRO A 1 114 ? -29.560 5.322   -6.922  1.00 0.00 ? 114 PRO A HB3  2  
ATOM 3934  H HG2  . PRO A 1 114 ? -27.055 4.446   -5.434  1.00 0.00 ? 114 PRO A HG2  2  
ATOM 3935  H HG3  . PRO A 1 114 ? -28.480 5.326   -4.784  1.00 0.00 ? 114 PRO A HG3  2  
ATOM 3936  H HD2  . PRO A 1 114 ? -28.208 2.602   -4.590  1.00 0.00 ? 114 PRO A HD2  2  
ATOM 3937  H HD3  . PRO A 1 114 ? -29.796 3.401   -4.777  1.00 0.00 ? 114 PRO A HD3  2  
ATOM 3938  N N    . VAL A 1 115 ? -26.513 4.000   -8.975  1.00 0.00 ? 115 VAL A N    2  
ATOM 3939  C CA   . VAL A 1 115 ? -25.165 3.740   -9.533  1.00 0.00 ? 115 VAL A CA   2  
ATOM 3940  C C    . VAL A 1 115 ? -24.143 4.864   -9.253  1.00 0.00 ? 115 VAL A C    2  
ATOM 3941  O O    . VAL A 1 115 ? -24.371 6.062   -9.486  1.00 0.00 ? 115 VAL A O    2  
ATOM 3942  C CB   . VAL A 1 115 ? -25.198 3.366   -11.028 1.00 0.00 ? 115 VAL A CB   2  
ATOM 3943  C CG1  . VAL A 1 115 ? -25.812 1.979   -11.249 1.00 0.00 ? 115 VAL A CG1  2  
ATOM 3944  C CG2  . VAL A 1 115 ? -25.928 4.383   -11.890 1.00 0.00 ? 115 VAL A CG2  2  
ATOM 3945  H H    . VAL A 1 115 ? -26.931 4.901   -9.193  1.00 0.00 ? 115 VAL A H    2  
ATOM 3946  H HA   . VAL A 1 115 ? -24.764 2.859   -9.034  1.00 0.00 ? 115 VAL A HA   2  
ATOM 3947  H HB   . VAL A 1 115 ? -24.167 3.315   -11.379 1.00 0.00 ? 115 VAL A HB   2  
ATOM 3948  H HG11 . VAL A 1 115 ? -26.852 1.969   -10.920 1.00 0.00 ? 115 VAL A HG11 2  
ATOM 3949  H HG12 . VAL A 1 115 ? -25.769 1.720   -12.306 1.00 0.00 ? 115 VAL A HG12 2  
ATOM 3950  H HG13 . VAL A 1 115 ? -25.253 1.234   -10.683 1.00 0.00 ? 115 VAL A HG13 2  
ATOM 3951  H HG21 . VAL A 1 115 ? -25.492 5.354   -11.695 1.00 0.00 ? 115 VAL A HG21 2  
ATOM 3952  H HG22 . VAL A 1 115 ? -25.796 4.139   -12.943 1.00 0.00 ? 115 VAL A HG22 2  
ATOM 3953  H HG23 . VAL A 1 115 ? -26.985 4.398   -11.638 1.00 0.00 ? 115 VAL A HG23 2  
ATOM 3954  N N    . LYS A 1 116 ? -22.980 4.427   -8.750  1.00 0.00 ? 116 LYS A N    2  
ATOM 3955  C CA   . LYS A 1 116 ? -21.841 5.235   -8.286  1.00 0.00 ? 116 LYS A CA   2  
ATOM 3956  C C    . LYS A 1 116 ? -20.603 5.076   -9.169  1.00 0.00 ? 116 LYS A C    2  
ATOM 3957  O O    . LYS A 1 116 ? -20.469 4.110   -9.922  1.00 0.00 ? 116 LYS A O    2  
ATOM 3958  C CB   . LYS A 1 116 ? -21.488 4.895   -6.819  1.00 0.00 ? 116 LYS A CB   2  
ATOM 3959  C CG   . LYS A 1 116 ? -22.618 5.142   -5.810  1.00 0.00 ? 116 LYS A CG   2  
ATOM 3960  C CD   . LYS A 1 116 ? -22.646 4.092   -4.687  1.00 0.00 ? 116 LYS A CD   2  
ATOM 3961  C CE   . LYS A 1 116 ? -23.560 4.550   -3.542  1.00 0.00 ? 116 LYS A CE   2  
ATOM 3962  N NZ   . LYS A 1 116 ? -22.865 5.490   -2.625  1.00 0.00 ? 116 LYS A NZ   2  
ATOM 3963  H H    . LYS A 1 116 ? -22.868 3.427   -8.668  1.00 0.00 ? 116 LYS A H    2  
ATOM 3964  H HA   . LYS A 1 116 ? -22.124 6.282   -8.341  1.00 0.00 ? 116 LYS A HA   2  
ATOM 3965  H HB2  . LYS A 1 116 ? -21.191 3.852   -6.767  1.00 0.00 ? 116 LYS A HB2  2  
ATOM 3966  H HB3  . LYS A 1 116 ? -20.621 5.477   -6.505  1.00 0.00 ? 116 LYS A HB3  2  
ATOM 3967  H HG2  . LYS A 1 116 ? -22.475 6.124   -5.370  1.00 0.00 ? 116 LYS A HG2  2  
ATOM 3968  H HG3  . LYS A 1 116 ? -23.575 5.149   -6.323  1.00 0.00 ? 116 LYS A HG3  2  
ATOM 3969  H HD2  . LYS A 1 116 ? -23.031 3.156   -5.098  1.00 0.00 ? 116 LYS A HD2  2  
ATOM 3970  H HD3  . LYS A 1 116 ? -21.638 3.911   -4.305  1.00 0.00 ? 116 LYS A HD3  2  
ATOM 3971  H HE2  . LYS A 1 116 ? -24.442 5.028   -3.978  1.00 0.00 ? 116 LYS A HE2  2  
ATOM 3972  H HE3  . LYS A 1 116 ? -23.900 3.674   -2.981  1.00 0.00 ? 116 LYS A HE3  2  
ATOM 3973  H HZ1  . LYS A 1 116 ? -22.425 5.003   -1.857  1.00 0.00 ? 116 LYS A HZ1  2  
ATOM 3974  H HZ2  . LYS A 1 116 ? -22.131 6.006   -3.101  1.00 0.00 ? 116 LYS A HZ2  2  
ATOM 3975  H HZ3  . LYS A 1 116 ? -23.512 6.181   -2.241  1.00 0.00 ? 116 LYS A HZ3  2  
ATOM 3976  N N    . ASN A 1 117 ? -19.691 6.032   -9.025  1.00 0.00 ? 117 ASN A N    2  
ATOM 3977  C CA   . ASN A 1 117 ? -18.347 5.996   -9.624  1.00 0.00 ? 117 ASN A CA   2  
ATOM 3978  C C    . ASN A 1 117 ? -17.296 5.397   -8.662  1.00 0.00 ? 117 ASN A C    2  
ATOM 3979  O O    . ASN A 1 117 ? -17.613 5.045   -7.526  1.00 0.00 ? 117 ASN A O    2  
ATOM 3980  C CB   . ASN A 1 117 ? -17.976 7.398   -10.147 1.00 0.00 ? 117 ASN A CB   2  
ATOM 3981  C CG   . ASN A 1 117 ? -17.421 8.326   -9.081  1.00 0.00 ? 117 ASN A CG   2  
ATOM 3982  O OD1  . ASN A 1 117 ? -16.218 8.487   -8.951  1.00 0.00 ? 117 ASN A OD1  2  
ATOM 3983  N ND2  . ASN A 1 117 ? -18.242 8.932   -8.257  1.00 0.00 ? 117 ASN A ND2  2  
ATOM 3984  H H    . ASN A 1 117 ? -19.914 6.738   -8.332  1.00 0.00 ? 117 ASN A H    2  
ATOM 3985  H HA   . ASN A 1 117 ? -18.375 5.336   -10.493 1.00 0.00 ? 117 ASN A HA   2  
ATOM 3986  H HB2  . ASN A 1 117 ? -17.208 7.289   -10.914 1.00 0.00 ? 117 ASN A HB2  2  
ATOM 3987  H HB3  . ASN A 1 117 ? -18.836 7.854   -10.631 1.00 0.00 ? 117 ASN A HB3  2  
ATOM 3988  H HD21 . ASN A 1 117 ? -19.244 8.813   -8.325  1.00 0.00 ? 117 ASN A HD21 2  
ATOM 3989  H HD22 . ASN A 1 117 ? -17.839 9.598   -7.618  1.00 0.00 ? 117 ASN A HD22 2  
ATOM 3990  N N    . GLU A 1 118 ? -16.033 5.311   -9.093  1.00 0.00 ? 118 GLU A N    2  
ATOM 3991  C CA   . GLU A 1 118 ? -14.921 4.733   -8.311  1.00 0.00 ? 118 GLU A CA   2  
ATOM 3992  C C    . GLU A 1 118 ? -14.597 5.472   -6.993  1.00 0.00 ? 118 GLU A C    2  
ATOM 3993  O O    . GLU A 1 118 ? -14.045 4.870   -6.070  1.00 0.00 ? 118 GLU A O    2  
ATOM 3994  C CB   . GLU A 1 118 ? -13.673 4.605   -9.202  1.00 0.00 ? 118 GLU A CB   2  
ATOM 3995  C CG   . GLU A 1 118 ? -13.094 5.948   -9.676  1.00 0.00 ? 118 GLU A CG   2  
ATOM 3996  C CD   . GLU A 1 118 ? -11.866 5.727   -10.580 1.00 0.00 ? 118 GLU A CD   2  
ATOM 3997  O OE1  . GLU A 1 118 ? -10.724 5.666   -10.061 1.00 0.00 ? 118 GLU A OE1  2  
ATOM 3998  O OE2  . GLU A 1 118 ? -12.029 5.617   -11.821 1.00 0.00 ? 118 GLU A OE2  2  
ATOM 3999  H H    . GLU A 1 118 ? -15.826 5.633   -10.029 1.00 0.00 ? 118 GLU A H    2  
ATOM 4000  H HA   . GLU A 1 118 ? -15.212 3.720   -8.026  1.00 0.00 ? 118 GLU A HA   2  
ATOM 4001  H HB2  . GLU A 1 118 ? -12.903 4.069   -8.647  1.00 0.00 ? 118 GLU A HB2  2  
ATOM 4002  H HB3  . GLU A 1 118 ? -13.930 4.004   -10.077 1.00 0.00 ? 118 GLU A HB3  2  
ATOM 4003  H HG2  . GLU A 1 118 ? -13.860 6.501   -10.224 1.00 0.00 ? 118 GLU A HG2  2  
ATOM 4004  H HG3  . GLU A 1 118 ? -12.808 6.547   -8.808  1.00 0.00 ? 118 GLU A HG3  2  
ATOM 4005  N N    . ASP A 1 119 ? -14.981 6.747   -6.861  1.00 0.00 ? 119 ASP A N    2  
ATOM 4006  C CA   . ASP A 1 119 ? -14.933 7.508   -5.599  1.00 0.00 ? 119 ASP A CA   2  
ATOM 4007  C C    . ASP A 1 119 ? -15.977 7.050   -4.557  1.00 0.00 ? 119 ASP A C    2  
ATOM 4008  O O    . ASP A 1 119 ? -15.844 7.341   -3.366  1.00 0.00 ? 119 ASP A O    2  
ATOM 4009  C CB   . ASP A 1 119 ? -15.086 9.006   -5.906  1.00 0.00 ? 119 ASP A CB   2  
ATOM 4010  C CG   . ASP A 1 119 ? -14.569 9.892   -4.759  1.00 0.00 ? 119 ASP A CG   2  
ATOM 4011  O OD1  . ASP A 1 119 ? -13.354 9.842   -4.447  1.00 0.00 ? 119 ASP A OD1  2  
ATOM 4012  O OD2  . ASP A 1 119 ? -15.370 10.671  -4.187  1.00 0.00 ? 119 ASP A OD2  2  
ATOM 4013  H H    . ASP A 1 119 ? -15.373 7.213   -7.673  1.00 0.00 ? 119 ASP A H    2  
ATOM 4014  H HA   . ASP A 1 119 ? -13.947 7.354   -5.158  1.00 0.00 ? 119 ASP A HA   2  
ATOM 4015  H HB2  . ASP A 1 119 ? -14.511 9.249   -6.802  1.00 0.00 ? 119 ASP A HB2  2  
ATOM 4016  H HB3  . ASP A 1 119 ? -16.135 9.225   -6.114  1.00 0.00 ? 119 ASP A HB3  2  
ATOM 4017  N N    . GLY A 1 120 ? -17.033 6.356   -5.001  1.00 0.00 ? 120 GLY A N    2  
ATOM 4018  C CA   . GLY A 1 120 ? -18.163 5.887   -4.190  1.00 0.00 ? 120 GLY A CA   2  
ATOM 4019  C C    . GLY A 1 120 ? -19.398 6.793   -4.240  1.00 0.00 ? 120 GLY A C    2  
ATOM 4020  O O    . GLY A 1 120 ? -20.410 6.480   -3.609  1.00 0.00 ? 120 GLY A O    2  
ATOM 4021  H H    . GLY A 1 120 ? -17.050 6.109   -5.986  1.00 0.00 ? 120 GLY A H    2  
ATOM 4022  H HA2  . GLY A 1 120 ? -18.460 4.901   -4.550  1.00 0.00 ? 120 GLY A HA2  2  
ATOM 4023  H HA3  . GLY A 1 120 ? -17.856 5.787   -3.148  1.00 0.00 ? 120 GLY A HA3  2  
ATOM 4024  N N    . ALA A 1 121 ? -19.354 7.896   -4.996  1.00 0.00 ? 121 ALA A N    2  
ATOM 4025  C CA   . ALA A 1 121 ? -20.453 8.855   -5.111  1.00 0.00 ? 121 ALA A CA   2  
ATOM 4026  C C    . ALA A 1 121 ? -21.430 8.523   -6.243  1.00 0.00 ? 121 ALA A C    2  
ATOM 4027  O O    . ALA A 1 121 ? -21.011 8.122   -7.333  1.00 0.00 ? 121 ALA A O    2  
ATOM 4028  C CB   . ALA A 1 121 ? -19.877 10.270  -5.243  1.00 0.00 ? 121 ALA A CB   2  
ATOM 4029  H H    . ALA A 1 121 ? -18.501 8.087   -5.500  1.00 0.00 ? 121 ALA A H    2  
ATOM 4030  H HA   . ALA A 1 121 ? -21.036 8.801   -4.196  1.00 0.00 ? 121 ALA A HA   2  
ATOM 4031  H HB1  . ALA A 1 121 ? -20.685 11.003  -5.202  1.00 0.00 ? 121 ALA A HB1  2  
ATOM 4032  H HB2  . ALA A 1 121 ? -19.179 10.465  -4.427  1.00 0.00 ? 121 ALA A HB2  2  
ATOM 4033  H HB3  . ALA A 1 121 ? -19.359 10.376  -6.197  1.00 0.00 ? 121 ALA A HB3  2  
ATOM 4034  N N    . VAL A 1 122 ? -22.729 8.702   -5.970  1.00 0.00 ? 122 VAL A N    2  
ATOM 4035  C CA   . VAL A 1 122 ? -23.843 8.375   -6.871  1.00 0.00 ? 122 VAL A CA   2  
ATOM 4036  C C    . VAL A 1 122 ? -23.927 9.412   -7.990  1.00 0.00 ? 122 VAL A C    2  
ATOM 4037  O O    . VAL A 1 122 ? -24.422 10.528  -7.811  1.00 0.00 ? 122 VAL A O    2  
ATOM 4038  C CB   . VAL A 1 122 ? -25.152 8.152   -6.075  1.00 0.00 ? 122 VAL A CB   2  
ATOM 4039  C CG1  . VAL A 1 122 ? -25.646 9.340   -5.241  1.00 0.00 ? 122 VAL A CG1  2  
ATOM 4040  C CG2  . VAL A 1 122 ? -26.300 7.662   -6.957  1.00 0.00 ? 122 VAL A CG2  2  
ATOM 4041  H H    . VAL A 1 122 ? -22.974 9.072   -5.063  1.00 0.00 ? 122 VAL A H    2  
ATOM 4042  H HA   . VAL A 1 122 ? -23.625 7.419   -7.340  1.00 0.00 ? 122 VAL A HA   2  
ATOM 4043  H HB   . VAL A 1 122 ? -24.943 7.347   -5.370  1.00 0.00 ? 122 VAL A HB   2  
ATOM 4044  H HG11 . VAL A 1 122 ? -26.495 9.025   -4.634  1.00 0.00 ? 122 VAL A HG11 2  
ATOM 4045  H HG12 . VAL A 1 122 ? -24.860 9.692   -4.575  1.00 0.00 ? 122 VAL A HG12 2  
ATOM 4046  H HG13 . VAL A 1 122 ? -25.972 10.157  -5.883  1.00 0.00 ? 122 VAL A HG13 2  
ATOM 4047  H HG21 . VAL A 1 122 ? -25.985 6.786   -7.520  1.00 0.00 ? 122 VAL A HG21 2  
ATOM 4048  H HG22 . VAL A 1 122 ? -27.154 7.382   -6.334  1.00 0.00 ? 122 VAL A HG22 2  
ATOM 4049  H HG23 . VAL A 1 122 ? -26.614 8.437   -7.653  1.00 0.00 ? 122 VAL A HG23 2  
ATOM 4050  N N    . ILE A 1 123 ? -23.376 9.060   -9.153  1.00 0.00 ? 123 ILE A N    2  
ATOM 4051  C CA   . ILE A 1 123 ? -23.380 9.935   -10.326 1.00 0.00 ? 123 ILE A CA   2  
ATOM 4052  C C    . ILE A 1 123 ? -24.663 9.759   -11.129 1.00 0.00 ? 123 ILE A C    2  
ATOM 4053  O O    . ILE A 1 123 ? -25.136 10.741  -11.695 1.00 0.00 ? 123 ILE A O    2  
ATOM 4054  C CB   . ILE A 1 123 ? -22.096 9.830   -11.182 1.00 0.00 ? 123 ILE A CB   2  
ATOM 4055  C CG1  . ILE A 1 123 ? -22.048 8.719   -12.259 1.00 0.00 ? 123 ILE A CG1  2  
ATOM 4056  C CG2  . ILE A 1 123 ? -20.849 9.797   -10.283 1.00 0.00 ? 123 ILE A CG2  2  
ATOM 4057  C CD1  . ILE A 1 123 ? -22.187 7.268   -11.790 1.00 0.00 ? 123 ILE A CD1  2  
ATOM 4058  H H    . ILE A 1 123 ? -22.948 8.153   -9.238  1.00 0.00 ? 123 ILE A H    2  
ATOM 4059  H HA   . ILE A 1 123 ? -23.390 10.960  -9.963  1.00 0.00 ? 123 ILE A HA   2  
ATOM 4060  H HB   . ILE A 1 123 ? -22.041 10.768  -11.738 1.00 0.00 ? 123 ILE A HB   2  
ATOM 4061  H HG12 . ILE A 1 123 ? -22.829 8.909   -12.994 1.00 0.00 ? 123 ILE A HG12 2  
ATOM 4062  H HG13 . ILE A 1 123 ? -21.097 8.806   -12.785 1.00 0.00 ? 123 ILE A HG13 2  
ATOM 4063  H HG21 . ILE A 1 123 ? -19.956 9.948   -10.890 1.00 0.00 ? 123 ILE A HG21 2  
ATOM 4064  H HG22 . ILE A 1 123 ? -20.901 10.592  -9.535  1.00 0.00 ? 123 ILE A HG22 2  
ATOM 4065  H HG23 . ILE A 1 123 ? -20.783 8.839   -9.773  1.00 0.00 ? 123 ILE A HG23 2  
ATOM 4066  H HD11 . ILE A 1 123 ? -21.469 7.048   -11.004 1.00 0.00 ? 123 ILE A HD11 2  
ATOM 4067  H HD12 . ILE A 1 123 ? -23.196 7.083   -11.437 1.00 0.00 ? 123 ILE A HD12 2  
ATOM 4068  H HD13 . ILE A 1 123 ? -22.002 6.602   -12.633 1.00 0.00 ? 123 ILE A HD13 2  
ATOM 4069  N N    . MET A 1 124 ? -25.269 8.561   -11.113 1.00 0.00 ? 124 MET A N    2  
ATOM 4070  C CA   . MET A 1 124 ? -26.528 8.311   -11.813 1.00 0.00 ? 124 MET A CA   2  
ATOM 4071  C C    . MET A 1 124 ? -27.486 7.496   -10.940 1.00 0.00 ? 124 MET A C    2  
ATOM 4072  O O    . MET A 1 124 ? -27.118 6.686   -10.091 1.00 0.00 ? 124 MET A O    2  
ATOM 4073  C CB   . MET A 1 124 ? -26.288 7.647   -13.187 1.00 0.00 ? 124 MET A CB   2  
ATOM 4074  C CG   . MET A 1 124 ? -25.868 8.628   -14.283 1.00 0.00 ? 124 MET A CG   2  
ATOM 4075  S SD   . MET A 1 124 ? -26.909 10.093  -14.536 1.00 0.00 ? 124 MET A SD   2  
ATOM 4076  C CE   . MET A 1 124 ? -25.569 11.284  -14.812 1.00 0.00 ? 124 MET A CE   2  
ATOM 4077  H H    . MET A 1 124 ? -24.871 7.804   -10.562 1.00 0.00 ? 124 MET A H    2  
ATOM 4078  H HA   . MET A 1 124 ? -27.032 9.261   -11.983 1.00 0.00 ? 124 MET A HA   2  
ATOM 4079  H HB2  . MET A 1 124 ? -25.510 6.892   -13.117 1.00 0.00 ? 124 MET A HB2  2  
ATOM 4080  H HB3  . MET A 1 124 ? -27.210 7.165   -13.516 1.00 0.00 ? 124 MET A HB3  2  
ATOM 4081  H HG2  . MET A 1 124 ? -24.861 8.964   -14.042 1.00 0.00 ? 124 MET A HG2  2  
ATOM 4082  H HG3  . MET A 1 124 ? -25.805 8.087   -15.229 1.00 0.00 ? 124 MET A HG3  2  
ATOM 4083  H HE1  . MET A 1 124 ? -25.971 12.296  -14.826 1.00 0.00 ? 124 MET A HE1  2  
ATOM 4084  H HE2  . MET A 1 124 ? -24.835 11.195  -14.007 1.00 0.00 ? 124 MET A HE2  2  
ATOM 4085  H HE3  . MET A 1 124 ? -25.076 11.067  -15.758 1.00 0.00 ? 124 MET A HE3  2  
ATOM 4086  N N    . PHE A 1 125 ? -28.764 7.734   -11.163 1.00 0.00 ? 125 PHE A N    2  
ATOM 4087  C CA   . PHE A 1 125 ? -29.873 7.122   -10.454 1.00 0.00 ? 125 PHE A CA   2  
ATOM 4088  C C    . PHE A 1 125 ? -30.490 6.065   -11.384 1.00 0.00 ? 125 PHE A C    2  
ATOM 4089  O O    . PHE A 1 125 ? -31.495 6.285   -12.047 1.00 0.00 ? 125 PHE A O    2  
ATOM 4090  C CB   . PHE A 1 125 ? -30.839 8.238   -9.984  1.00 0.00 ? 125 PHE A CB   2  
ATOM 4091  C CG   . PHE A 1 125 ? -30.644 8.888   -8.621  1.00 0.00 ? 125 PHE A CG   2  
ATOM 4092  C CD1  . PHE A 1 125 ? -29.647 8.487   -7.706  1.00 0.00 ? 125 PHE A CD1  2  
ATOM 4093  C CD2  . PHE A 1 125 ? -31.514 9.939   -8.269  1.00 0.00 ? 125 PHE A CD2  2  
ATOM 4094  C CE1  . PHE A 1 125 ? -29.505 9.155   -6.475  1.00 0.00 ? 125 PHE A CE1  2  
ATOM 4095  C CE2  . PHE A 1 125 ? -31.359 10.612  -7.045  1.00 0.00 ? 125 PHE A CE2  2  
ATOM 4096  C CZ   . PHE A 1 125 ? -30.346 10.230  -6.154  1.00 0.00 ? 125 PHE A CZ   2  
ATOM 4097  H H    . PHE A 1 125 ? -28.985 8.362   -11.925 1.00 0.00 ? 125 PHE A H    2  
ATOM 4098  H HA   . PHE A 1 125 ? -29.520 6.578   -9.582  1.00 0.00 ? 125 PHE A HA   2  
ATOM 4099  H HB2  . PHE A 1 125 ? -30.857 9.033   -10.725 1.00 0.00 ? 125 PHE A HB2  2  
ATOM 4100  H HB3  . PHE A 1 125 ? -31.842 7.829   -9.950  1.00 0.00 ? 125 PHE A HB3  2  
ATOM 4101  H HD1  . PHE A 1 125 ? -28.966 7.689   -7.942  1.00 0.00 ? 125 PHE A HD1  2  
ATOM 4102  H HD2  . PHE A 1 125 ? -32.288 10.249  -8.956  1.00 0.00 ? 125 PHE A HD2  2  
ATOM 4103  H HE1  . PHE A 1 125 ? -28.738 8.859   -5.775  1.00 0.00 ? 125 PHE A HE1  2  
ATOM 4104  H HE2  . PHE A 1 125 ? -32.009 11.435  -6.790  1.00 0.00 ? 125 PHE A HE2  2  
ATOM 4105  H HZ   . PHE A 1 125 ? -30.211 10.759  -5.221  1.00 0.00 ? 125 PHE A HZ   2  
ATOM 4106  N N    . ILE A 1 126 ? -29.886 4.878   -11.445 1.00 0.00 ? 126 ILE A N    2  
ATOM 4107  C CA   . ILE A 1 126 ? -30.462 3.731   -12.168 1.00 0.00 ? 126 ILE A CA   2  
ATOM 4108  C C    . ILE A 1 126 ? -31.127 2.791   -11.169 1.00 0.00 ? 126 ILE A C    2  
ATOM 4109  O O    . ILE A 1 126 ? -30.642 1.701   -10.864 1.00 0.00 ? 126 ILE A O    2  
ATOM 4110  C CB   . ILE A 1 126 ? -29.450 3.055   -13.099 1.00 0.00 ? 126 ILE A CB   2  
ATOM 4111  C CG1  . ILE A 1 126 ? -28.844 4.130   -14.024 1.00 0.00 ? 126 ILE A CG1  2  
ATOM 4112  C CG2  . ILE A 1 126 ? -30.127 1.949   -13.937 1.00 0.00 ? 126 ILE A CG2  2  
ATOM 4113  C CD1  . ILE A 1 126 ? -27.864 3.529   -15.015 1.00 0.00 ? 126 ILE A CD1  2  
ATOM 4114  H H    . ILE A 1 126 ? -29.016 4.752   -10.945 1.00 0.00 ? 126 ILE A H    2  
ATOM 4115  H HA   . ILE A 1 126 ? -31.255 4.090   -12.823 1.00 0.00 ? 126 ILE A HA   2  
ATOM 4116  H HB   . ILE A 1 126 ? -28.658 2.609   -12.497 1.00 0.00 ? 126 ILE A HB   2  
ATOM 4117  H HG12 . ILE A 1 126 ? -29.636 4.639   -14.570 1.00 0.00 ? 126 ILE A HG12 2  
ATOM 4118  H HG13 . ILE A 1 126 ? -28.307 4.877   -13.443 1.00 0.00 ? 126 ILE A HG13 2  
ATOM 4119  H HG21 . ILE A 1 126 ? -29.381 1.219   -14.250 1.00 0.00 ? 126 ILE A HG21 2  
ATOM 4120  H HG22 . ILE A 1 126 ? -30.914 1.445   -13.382 1.00 0.00 ? 126 ILE A HG22 2  
ATOM 4121  H HG23 . ILE A 1 126 ? -30.596 2.374   -14.819 1.00 0.00 ? 126 ILE A HG23 2  
ATOM 4122  H HD11 . ILE A 1 126 ? -27.142 2.927   -14.466 1.00 0.00 ? 126 ILE A HD11 2  
ATOM 4123  H HD12 . ILE A 1 126 ? -28.406 2.902   -15.717 1.00 0.00 ? 126 ILE A HD12 2  
ATOM 4124  H HD13 . ILE A 1 126 ? -27.379 4.346   -15.546 1.00 0.00 ? 126 ILE A HD13 2  
ATOM 4125  N N    . LEU A 1 127 ? -32.248 3.256   -10.623 1.00 0.00 ? 127 LEU A N    2  
ATOM 4126  C CA   . LEU A 1 127 ? -33.034 2.532   -9.632  1.00 0.00 ? 127 LEU A CA   2  
ATOM 4127  C C    . LEU A 1 127 ? -33.851 1.440   -10.330 1.00 0.00 ? 127 LEU A C    2  
ATOM 4128  O O    . LEU A 1 127 ? -34.991 1.614   -10.754 1.00 0.00 ? 127 LEU A O    2  
ATOM 4129  C CB   . LEU A 1 127 ? -33.821 3.497   -8.728  1.00 0.00 ? 127 LEU A CB   2  
ATOM 4130  C CG   . LEU A 1 127 ? -32.966 4.495   -7.915  1.00 0.00 ? 127 LEU A CG   2  
ATOM 4131  C CD1  . LEU A 1 127 ? -31.966 3.832   -7.012  1.00 0.00 ? 127 LEU A CD1  2  
ATOM 4132  C CD2  . LEU A 1 127 ? -32.225 5.551   -8.705  1.00 0.00 ? 127 LEU A CD2  2  
ATOM 4133  H H    . LEU A 1 127 ? -32.577 4.165   -10.923 1.00 0.00 ? 127 LEU A H    2  
ATOM 4134  H HA   . LEU A 1 127 ? -32.339 2.005   -8.975  1.00 0.00 ? 127 LEU A HA   2  
ATOM 4135  H HB2  . LEU A 1 127 ? -34.538 4.055   -9.326  1.00 0.00 ? 127 LEU A HB2  2  
ATOM 4136  H HB3  . LEU A 1 127 ? -34.393 2.896   -8.026  1.00 0.00 ? 127 LEU A HB3  2  
ATOM 4137  H HG   . LEU A 1 127 ? -33.574 5.035   -7.242  1.00 0.00 ? 127 LEU A HG   2  
ATOM 4138  H HD11 . LEU A 1 127 ? -31.234 3.374   -7.654  1.00 0.00 ? 127 LEU A HD11 2  
ATOM 4139  H HD12 . LEU A 1 127 ? -31.515 4.596   -6.378  1.00 0.00 ? 127 LEU A HD12 2  
ATOM 4140  H HD13 . LEU A 1 127 ? -32.459 3.094   -6.392  1.00 0.00 ? 127 LEU A HD13 2  
ATOM 4141  H HD21 . LEU A 1 127 ? -31.995 6.385   -8.042  1.00 0.00 ? 127 LEU A HD21 2  
ATOM 4142  H HD22 . LEU A 1 127 ? -31.298 5.136   -9.082  1.00 0.00 ? 127 LEU A HD22 2  
ATOM 4143  H HD23 . LEU A 1 127 ? -32.859 5.901   -9.519  1.00 0.00 ? 127 LEU A HD23 2  
ATOM 4144  N N    . ASN A 1 128 ? -33.172 0.311   -10.491 1.00 0.00 ? 128 ASN A N    2  
ATOM 4145  C CA   . ASN A 1 128 ? -33.668 -0.929  -11.103 1.00 0.00 ? 128 ASN A CA   2  
ATOM 4146  C C    . ASN A 1 128 ? -34.886 -1.479  -10.330 1.00 0.00 ? 128 ASN A C    2  
ATOM 4147  O O    . ASN A 1 128 ? -34.733 -2.107  -9.282  1.00 0.00 ? 128 ASN A O    2  
ATOM 4148  C CB   . ASN A 1 128 ? -32.540 -1.983  -11.106 1.00 0.00 ? 128 ASN A CB   2  
ATOM 4149  C CG   . ASN A 1 128 ? -31.507 -1.847  -12.212 1.00 0.00 ? 128 ASN A CG   2  
ATOM 4150  O OD1  . ASN A 1 128 ? -31.462 -2.643  -13.139 1.00 0.00 ? 128 ASN A OD1  2  
ATOM 4151  N ND2  . ASN A 1 128 ? -30.608 -0.894  -12.153 1.00 0.00 ? 128 ASN A ND2  2  
ATOM 4152  H H    . ASN A 1 128 ? -32.199 0.396   -10.220 1.00 0.00 ? 128 ASN A H    2  
ATOM 4153  H HA   . ASN A 1 128 ? -33.980 -0.735  -12.127 1.00 0.00 ? 128 ASN A HA   2  
ATOM 4154  H HB2  . ASN A 1 128 ? -32.041 -1.977  -10.140 1.00 0.00 ? 128 ASN A HB2  2  
ATOM 4155  H HB3  . ASN A 1 128 ? -32.992 -2.969  -11.226 1.00 0.00 ? 128 ASN A HB3  2  
ATOM 4156  H HD21 . ASN A 1 128 ? -30.618 -0.185  -11.430 1.00 0.00 ? 128 ASN A HD21 2  
ATOM 4157  H HD22 . ASN A 1 128 ? -29.934 -0.846  -12.899 1.00 0.00 ? 128 ASN A HD22 2  
ATOM 4158  N N    . PHE A 1 129 ? -36.106 -1.303  -10.843 1.00 0.00 ? 129 PHE A N    2  
ATOM 4159  C CA   . PHE A 1 129 ? -37.310 -1.776  -10.174 1.00 0.00 ? 129 PHE A CA   2  
ATOM 4160  C C    . PHE A 1 129 ? -37.611 -3.241  -10.512 1.00 0.00 ? 129 PHE A C    2  
ATOM 4161  O O    . PHE A 1 129 ? -38.653 -3.572  -11.078 1.00 0.00 ? 129 PHE A O    2  
ATOM 4162  C CB   . PHE A 1 129 ? -38.486 -0.840  -10.460 1.00 0.00 ? 129 PHE A CB   2  
ATOM 4163  C CG   . PHE A 1 129 ? -38.265 0.644   -10.216 1.00 0.00 ? 129 PHE A CG   2  
ATOM 4164  C CD1  . PHE A 1 129 ? -37.812 1.105   -8.965  1.00 0.00 ? 129 PHE A CD1  2  
ATOM 4165  C CD2  . PHE A 1 129 ? -38.585 1.576   -11.225 1.00 0.00 ? 129 PHE A CD2  2  
ATOM 4166  C CE1  . PHE A 1 129 ? -37.669 2.484   -8.729  1.00 0.00 ? 129 PHE A CE1  2  
ATOM 4167  C CE2  . PHE A 1 129 ? -38.451 2.956   -10.985 1.00 0.00 ? 129 PHE A CE2  2  
ATOM 4168  C CZ   . PHE A 1 129 ? -37.986 3.410   -9.738  1.00 0.00 ? 129 PHE A CZ   2  
ATOM 4169  H H    . PHE A 1 129 ? -36.229 -0.844  -11.730 1.00 0.00 ? 129 PHE A H    2  
ATOM 4170  H HA   . PHE A 1 129 ? -37.125 -1.752  -9.101  1.00 0.00 ? 129 PHE A HA   2  
ATOM 4171  H HB2  . PHE A 1 129 ? -38.780 -0.974  -11.501 1.00 0.00 ? 129 PHE A HB2  2  
ATOM 4172  H HB3  . PHE A 1 129 ? -39.301 -1.174  -9.818  1.00 0.00 ? 129 PHE A HB3  2  
ATOM 4173  H HD1  . PHE A 1 129 ? -37.587 0.400   -8.179  1.00 0.00 ? 129 PHE A HD1  2  
ATOM 4174  H HD2  . PHE A 1 129 ? -38.950 1.237   -12.184 1.00 0.00 ? 129 PHE A HD2  2  
ATOM 4175  H HE1  . PHE A 1 129 ? -37.330 2.838   -7.767  1.00 0.00 ? 129 PHE A HE1  2  
ATOM 4176  H HE2  . PHE A 1 129 ? -38.706 3.666   -11.758 1.00 0.00 ? 129 PHE A HE2  2  
ATOM 4177  H HZ   . PHE A 1 129 ? -37.882 4.471   -9.552  1.00 0.00 ? 129 PHE A HZ   2  
ATOM 4178  N N    . GLU A 1 130 ? -36.710 -4.149  -10.139 1.00 0.00 ? 130 GLU A N    2  
ATOM 4179  C CA   . GLU A 1 130 ? -36.961 -5.583  -10.320 1.00 0.00 ? 130 GLU A CA   2  
ATOM 4180  C C    . GLU A 1 130 ? -37.868 -6.108  -9.210  1.00 0.00 ? 130 GLU A C    2  
ATOM 4181  O O    . GLU A 1 130 ? -37.656 -5.867  -8.029  1.00 0.00 ? 130 GLU A O    2  
ATOM 4182  C CB   . GLU A 1 130 ? -35.676 -6.411  -10.379 1.00 0.00 ? 130 GLU A CB   2  
ATOM 4183  C CG   . GLU A 1 130 ? -34.708 -6.115  -9.233  1.00 0.00 ? 130 GLU A CG   2  
ATOM 4184  C CD   . GLU A 1 130 ? -33.813 -7.309  -8.871  1.00 0.00 ? 130 GLU A CD   2  
ATOM 4185  O OE1  . GLU A 1 130 ? -34.255 -8.197  -8.107  1.00 0.00 ? 130 GLU A OE1  2  
ATOM 4186  O OE2  . GLU A 1 130 ? -32.632 -7.332  -9.288  1.00 0.00 ? 130 GLU A OE2  2  
ATOM 4187  H H    . GLU A 1 130 ? -35.869 -3.832  -9.661  1.00 0.00 ? 130 GLU A H    2  
ATOM 4188  H HA   . GLU A 1 130 ? -37.474 -5.735  -11.270 1.00 0.00 ? 130 GLU A HA   2  
ATOM 4189  H HB2  . GLU A 1 130 ? -35.957 -7.467  -10.375 1.00 0.00 ? 130 GLU A HB2  2  
ATOM 4190  H HB3  . GLU A 1 130 ? -35.175 -6.171  -11.313 1.00 0.00 ? 130 GLU A HB3  2  
ATOM 4191  H HG2  . GLU A 1 130 ? -34.112 -5.263  -9.546  1.00 0.00 ? 130 GLU A HG2  2  
ATOM 4192  H HG3  . GLU A 1 130 ? -35.248 -5.806  -8.341  1.00 0.00 ? 130 GLU A HG3  2  
ATOM 4193  N N    . VAL A 1 131 ? -38.899 -6.837  -9.601  1.00 0.00 ? 131 VAL A N    2  
ATOM 4194  C CA   . VAL A 1 131 ? -39.921 -7.385  -8.701  1.00 0.00 ? 131 VAL A CA   2  
ATOM 4195  C C    . VAL A 1 131 ? -39.497 -8.797  -8.305  1.00 0.00 ? 131 VAL A C    2  
ATOM 4196  O O    . VAL A 1 131 ? -39.396 -9.673  -9.169  1.00 0.00 ? 131 VAL A O    2  
ATOM 4197  C CB   . VAL A 1 131 ? -41.271 -7.348  -9.424  1.00 0.00 ? 131 VAL A CB   2  
ATOM 4198  C CG1  . VAL A 1 131 ? -42.389 -8.128  -8.734  1.00 0.00 ? 131 VAL A CG1  2  
ATOM 4199  C CG2  . VAL A 1 131 ? -41.760 -5.904  -9.595  1.00 0.00 ? 131 VAL A CG2  2  
ATOM 4200  H H    . VAL A 1 131 ? -38.962 -7.034  -10.587 1.00 0.00 ? 131 VAL A H    2  
ATOM 4201  H HA   . VAL A 1 131 ? -39.997 -6.777  -7.799  1.00 0.00 ? 131 VAL A HA   2  
ATOM 4202  H HB   . VAL A 1 131 ? -41.105 -7.778  -10.402 1.00 0.00 ? 131 VAL A HB   2  
ATOM 4203  H HG11 . VAL A 1 131 ? -42.092 -9.167  -8.588  1.00 0.00 ? 131 VAL A HG11 2  
ATOM 4204  H HG12 . VAL A 1 131 ? -42.620 -7.668  -7.777  1.00 0.00 ? 131 VAL A HG12 2  
ATOM 4205  H HG13 . VAL A 1 131 ? -43.281 -8.112  -9.359  1.00 0.00 ? 131 VAL A HG13 2  
ATOM 4206  H HG21 . VAL A 1 131 ? -41.942 -5.449  -8.619  1.00 0.00 ? 131 VAL A HG21 2  
ATOM 4207  H HG22 . VAL A 1 131 ? -41.018 -5.310  -10.130 1.00 0.00 ? 131 VAL A HG22 2  
ATOM 4208  H HG23 . VAL A 1 131 ? -42.684 -5.903  -10.170 1.00 0.00 ? 131 VAL A HG23 2  
ATOM 4209  N N    . VAL A 1 132 ? -39.198 -9.016  -7.020  1.00 0.00 ? 132 VAL A N    2  
ATOM 4210  C CA   . VAL A 1 132 ? -38.686 -10.309 -6.536  1.00 0.00 ? 132 VAL A CA   2  
ATOM 4211  C C    . VAL A 1 132 ? -39.287 -10.696 -5.180  1.00 0.00 ? 132 VAL A C    2  
ATOM 4212  O O    . VAL A 1 132 ? -39.393 -9.874  -4.268  1.00 0.00 ? 132 VAL A O    2  
ATOM 4213  C CB   . VAL A 1 132 ? -37.139 -10.332 -6.558  1.00 0.00 ? 132 VAL A CB   2  
ATOM 4214  C CG1  . VAL A 1 132 ? -36.495 -9.254  -5.683  1.00 0.00 ? 132 VAL A CG1  2  
ATOM 4215  C CG2  . VAL A 1 132 ? -36.572 -11.703 -6.166  1.00 0.00 ? 132 VAL A CG2  2  
ATOM 4216  H H    . VAL A 1 132 ? -39.344 -8.280  -6.336  1.00 0.00 ? 132 VAL A H    2  
ATOM 4217  H HA   . VAL A 1 132 ? -39.011 -11.073 -7.242  1.00 0.00 ? 132 VAL A HA   2  
ATOM 4218  H HB   . VAL A 1 132 ? -36.827 -10.143 -7.586  1.00 0.00 ? 132 VAL A HB   2  
ATOM 4219  H HG11 . VAL A 1 132 ? -36.773 -9.393  -4.640  1.00 0.00 ? 132 VAL A HG11 2  
ATOM 4220  H HG12 . VAL A 1 132 ? -35.411 -9.311  -5.770  1.00 0.00 ? 132 VAL A HG12 2  
ATOM 4221  H HG13 . VAL A 1 132 ? -36.810 -8.265  -6.016  1.00 0.00 ? 132 VAL A HG13 2  
ATOM 4222  H HG21 . VAL A 1 132 ? -36.769 -11.915 -5.115  1.00 0.00 ? 132 VAL A HG21 2  
ATOM 4223  H HG22 . VAL A 1 132 ? -37.021 -12.480 -6.785  1.00 0.00 ? 132 VAL A HG22 2  
ATOM 4224  H HG23 . VAL A 1 132 ? -35.493 -11.710 -6.329  1.00 0.00 ? 132 VAL A HG23 2  
ATOM 4225  N N    . MET A 1 133 ? -39.661 -11.968 -5.050  1.00 0.00 ? 133 MET A N    2  
ATOM 4226  C CA   . MET A 1 133 ? -40.132 -12.608 -3.818  1.00 0.00 ? 133 MET A CA   2  
ATOM 4227  C C    . MET A 1 133 ? -39.348 -13.900 -3.523  1.00 0.00 ? 133 MET A C    2  
ATOM 4228  O O    . MET A 1 133 ? -38.648 -14.438 -4.384  1.00 0.00 ? 133 MET A O    2  
ATOM 4229  C CB   . MET A 1 133 ? -41.651 -12.853 -3.891  1.00 0.00 ? 133 MET A CB   2  
ATOM 4230  C CG   . MET A 1 133 ? -42.064 -13.822 -5.008  1.00 0.00 ? 133 MET A CG   2  
ATOM 4231  S SD   . MET A 1 133 ? -43.840 -14.196 -5.081  1.00 0.00 ? 133 MET A SD   2  
ATOM 4232  C CE   . MET A 1 133 ? -44.016 -15.246 -3.610  1.00 0.00 ? 133 MET A CE   2  
ATOM 4233  H H    . MET A 1 133 ? -39.539 -12.571 -5.847  1.00 0.00 ? 133 MET A H    2  
ATOM 4234  H HA   . MET A 1 133 ? -39.953 -11.934 -2.979  1.00 0.00 ? 133 MET A HA   2  
ATOM 4235  H HB2  . MET A 1 133 ? -41.985 -13.250 -2.933  1.00 0.00 ? 133 MET A HB2  2  
ATOM 4236  H HB3  . MET A 1 133 ? -42.155 -11.899 -4.049  1.00 0.00 ? 133 MET A HB3  2  
ATOM 4237  H HG2  . MET A 1 133 ? -41.777 -13.386 -5.967  1.00 0.00 ? 133 MET A HG2  2  
ATOM 4238  H HG3  . MET A 1 133 ? -41.524 -14.762 -4.891  1.00 0.00 ? 133 MET A HG3  2  
ATOM 4239  H HE1  . MET A 1 133 ? -43.801 -14.669 -2.710  1.00 0.00 ? 133 MET A HE1  2  
ATOM 4240  H HE2  . MET A 1 133 ? -45.037 -15.622 -3.552  1.00 0.00 ? 133 MET A HE2  2  
ATOM 4241  H HE3  . MET A 1 133 ? -43.327 -16.089 -3.674  1.00 0.00 ? 133 MET A HE3  2  
ATOM 4242  N N    . GLU A 1 134 ? -39.463 -14.395 -2.292  1.00 0.00 ? 134 GLU A N    2  
ATOM 4243  C CA   . GLU A 1 134 ? -38.761 -15.595 -1.809  1.00 0.00 ? 134 GLU A CA   2  
ATOM 4244  C C    . GLU A 1 134 ? -39.254 -16.912 -2.451  1.00 0.00 ? 134 GLU A C    2  
ATOM 4245  O O    . GLU A 1 134 ? -40.410 -17.030 -2.876  1.00 0.00 ? 134 GLU A O    2  
ATOM 4246  C CB   . GLU A 1 134 ? -38.804 -15.652 -0.271  1.00 0.00 ? 134 GLU A CB   2  
ATOM 4247  C CG   . GLU A 1 134 ? -40.213 -15.829 0.318   1.00 0.00 ? 134 GLU A CG   2  
ATOM 4248  C CD   . GLU A 1 134 ? -40.175 -15.788 1.857   1.00 0.00 ? 134 GLU A CD   2  
ATOM 4249  O OE1  . GLU A 1 134 ? -40.005 -16.856 2.498   1.00 0.00 ? 134 GLU A OE1  2  
ATOM 4250  O OE2  . GLU A 1 134 ? -40.322 -14.687 2.445   1.00 0.00 ? 134 GLU A OE2  2  
ATOM 4251  H H    . GLU A 1 134 ? -40.070 -13.908 -1.652  1.00 0.00 ? 134 GLU A H    2  
ATOM 4252  H HA   . GLU A 1 134 ? -37.711 -15.488 -2.086  1.00 0.00 ? 134 GLU A HA   2  
ATOM 4253  H HB2  . GLU A 1 134 ? -38.177 -16.477 0.066   1.00 0.00 ? 134 GLU A HB2  2  
ATOM 4254  H HB3  . GLU A 1 134 ? -38.375 -14.727 0.120   1.00 0.00 ? 134 GLU A HB3  2  
ATOM 4255  H HG2  . GLU A 1 134 ? -40.866 -15.035 -0.053  1.00 0.00 ? 134 GLU A HG2  2  
ATOM 4256  H HG3  . GLU A 1 134 ? -40.626 -16.783 -0.016  1.00 0.00 ? 134 GLU A HG3  2  
ATOM 4257  N N    . LYS A 1 135 ? -38.362 -17.912 -2.499  1.00 0.00 ? 135 LYS A N    2  
ATOM 4258  C CA   . LYS A 1 135 ? -38.616 -19.279 -2.996  1.00 0.00 ? 135 LYS A CA   2  
ATOM 4259  C C    . LYS A 1 135 ? -39.246 -20.179 -1.921  1.00 0.00 ? 135 LYS A C    2  
ATOM 4260  O O    . LYS A 1 135 ? -40.259 -20.850 -2.228  1.00 0.00 ? 135 LYS A O    2  
ATOM 4261  C CB   . LYS A 1 135 ? -37.307 -19.883 -3.538  1.00 0.00 ? 135 LYS A CB   2  
ATOM 4262  C CG   . LYS A 1 135 ? -36.918 -19.311 -4.911  1.00 0.00 ? 135 LYS A CG   2  
ATOM 4263  C CD   . LYS A 1 135 ? -35.499 -19.755 -5.301  1.00 0.00 ? 135 LYS A CD   2  
ATOM 4264  C CE   . LYS A 1 135 ? -35.165 -19.428 -6.764  1.00 0.00 ? 135 LYS A CE   2  
ATOM 4265  N NZ   . LYS A 1 135 ? -35.717 -20.433 -7.704  1.00 0.00 ? 135 LYS A NZ   2  
ATOM 4266  H H    . LYS A 1 135 ? -37.450 -17.736 -2.102  1.00 0.00 ? 135 LYS A H    2  
ATOM 4267  H HA   . LYS A 1 135 ? -39.335 -19.234 -3.813  1.00 0.00 ? 135 LYS A HA   2  
ATOM 4268  H HB2  . LYS A 1 135 ? -36.503 -19.709 -2.820  1.00 0.00 ? 135 LYS A HB2  2  
ATOM 4269  H HB3  . LYS A 1 135 ? -37.434 -20.962 -3.645  1.00 0.00 ? 135 LYS A HB3  2  
ATOM 4270  H HG2  . LYS A 1 135 ? -37.635 -19.663 -5.653  1.00 0.00 ? 135 LYS A HG2  2  
ATOM 4271  H HG3  . LYS A 1 135 ? -36.947 -18.221 -4.886  1.00 0.00 ? 135 LYS A HG3  2  
ATOM 4272  H HD2  . LYS A 1 135 ? -34.788 -19.233 -4.659  1.00 0.00 ? 135 LYS A HD2  2  
ATOM 4273  H HD3  . LYS A 1 135 ? -35.383 -20.824 -5.125  1.00 0.00 ? 135 LYS A HD3  2  
ATOM 4274  H HE2  . LYS A 1 135 ? -35.537 -18.429 -7.005  1.00 0.00 ? 135 LYS A HE2  2  
ATOM 4275  H HE3  . LYS A 1 135 ? -34.076 -19.407 -6.864  1.00 0.00 ? 135 LYS A HE3  2  
ATOM 4276  H HZ1  . LYS A 1 135 ? -36.723 -20.488 -7.647  1.00 0.00 ? 135 LYS A HZ1  2  
ATOM 4277  H HZ2  . LYS A 1 135 ? -35.470 -20.208 -8.670  1.00 0.00 ? 135 LYS A HZ2  2  
ATOM 4278  H HZ3  . LYS A 1 135 ? -35.331 -21.350 -7.495  1.00 0.00 ? 135 LYS A HZ3  2  
ATOM 4279  N N    . MET A 1 1   ? -9.489  -18.925 -2.204  1.00 0.00 ? 1   MET A N    3  
ATOM 4280  C CA   . MET A 1 1   ? -10.919 -18.780 -2.596  1.00 0.00 ? 1   MET A CA   3  
ATOM 4281  C C    . MET A 1 1   ? -11.829 -18.905 -1.367  1.00 0.00 ? 1   MET A C    3  
ATOM 4282  O O    . MET A 1 1   ? -11.503 -19.672 -0.455  1.00 0.00 ? 1   MET A O    3  
ATOM 4283  C CB   . MET A 1 1   ? -11.343 -19.807 -3.669  1.00 0.00 ? 1   MET A CB   3  
ATOM 4284  C CG   . MET A 1 1   ? -10.691 -19.550 -5.036  1.00 0.00 ? 1   MET A CG   3  
ATOM 4285  S SD   . MET A 1 1   ? -11.304 -20.595 -6.392  1.00 0.00 ? 1   MET A SD   3  
ATOM 4286  C CE   . MET A 1 1   ? -10.654 -22.218 -5.902  1.00 0.00 ? 1   MET A CE   3  
ATOM 4287  H H1   . MET A 1 1   ? -9.242  -18.231 -1.513  1.00 0.00 ? 1   MET A H1   3  
ATOM 4288  H H2   . MET A 1 1   ? -8.882  -18.805 -3.001  1.00 0.00 ? 1   MET A H2   3  
ATOM 4289  H H3   . MET A 1 1   ? -9.327  -19.836 -1.804  1.00 0.00 ? 1   MET A H3   3  
ATOM 4290  H HA   . MET A 1 1   ? -11.062 -17.781 -3.008  1.00 0.00 ? 1   MET A HA   3  
ATOM 4291  H HB2  . MET A 1 1   ? -11.097 -20.815 -3.330  1.00 0.00 ? 1   MET A HB2  3  
ATOM 4292  H HB3  . MET A 1 1   ? -12.424 -19.755 -3.803  1.00 0.00 ? 1   MET A HB3  3  
ATOM 4293  H HG2  . MET A 1 1   ? -10.877 -18.512 -5.313  1.00 0.00 ? 1   MET A HG2  3  
ATOM 4294  H HG3  . MET A 1 1   ? -9.612  -19.689 -4.959  1.00 0.00 ? 1   MET A HG3  3  
ATOM 4295  H HE1  . MET A 1 1   ? -10.900 -22.953 -6.668  1.00 0.00 ? 1   MET A HE1  3  
ATOM 4296  H HE2  . MET A 1 1   ? -9.571  -22.165 -5.792  1.00 0.00 ? 1   MET A HE2  3  
ATOM 4297  H HE3  . MET A 1 1   ? -11.101 -22.531 -4.957  1.00 0.00 ? 1   MET A HE3  3  
ATOM 4298  N N    . PRO A 1 2   ? -12.967 -18.183 -1.316  1.00 0.00 ? 2   PRO A N    3  
ATOM 4299  C CA   . PRO A 1 2   ? -13.938 -18.281 -0.221  1.00 0.00 ? 2   PRO A CA   3  
ATOM 4300  C C    . PRO A 1 2   ? -14.678 -19.632 -0.208  1.00 0.00 ? 2   PRO A C    3  
ATOM 4301  O O    . PRO A 1 2   ? -14.801 -20.305 -1.236  1.00 0.00 ? 2   PRO A O    3  
ATOM 4302  C CB   . PRO A 1 2   ? -14.897 -17.103 -0.425  1.00 0.00 ? 2   PRO A CB   3  
ATOM 4303  C CG   . PRO A 1 2   ? -14.882 -16.903 -1.939  1.00 0.00 ? 2   PRO A CG   3  
ATOM 4304  C CD   . PRO A 1 2   ? -13.433 -17.220 -2.310  1.00 0.00 ? 2   PRO A CD   3  
ATOM 4305  H HA   . PRO A 1 2   ? -13.428 -18.158 0.737   1.00 0.00 ? 2   PRO A HA   3  
ATOM 4306  H HB2  . PRO A 1 2   ? -15.902 -17.312 -0.053  1.00 0.00 ? 2   PRO A HB2  3  
ATOM 4307  H HB3  . PRO A 1 2   ? -14.491 -16.215 0.063   1.00 0.00 ? 2   PRO A HB3  3  
ATOM 4308  H HG2  . PRO A 1 2   ? -15.550 -17.623 -2.413  1.00 0.00 ? 2   PRO A HG2  3  
ATOM 4309  H HG3  . PRO A 1 2   ? -15.156 -15.885 -2.216  1.00 0.00 ? 2   PRO A HG3  3  
ATOM 4310  H HD2  . PRO A 1 2   ? -13.393 -17.624 -3.322  1.00 0.00 ? 2   PRO A HD2  3  
ATOM 4311  H HD3  . PRO A 1 2   ? -12.834 -16.309 -2.243  1.00 0.00 ? 2   PRO A HD3  3  
ATOM 4312  N N    . VAL A 1 3   ? -15.196 -20.017 0.965   1.00 0.00 ? 3   VAL A N    3  
ATOM 4313  C CA   . VAL A 1 3   ? -15.928 -21.278 1.209   1.00 0.00 ? 3   VAL A CA   3  
ATOM 4314  C C    . VAL A 1 3   ? -17.194 -20.996 2.028   1.00 0.00 ? 3   VAL A C    3  
ATOM 4315  O O    . VAL A 1 3   ? -17.174 -20.168 2.946   1.00 0.00 ? 3   VAL A O    3  
ATOM 4316  C CB   . VAL A 1 3   ? -15.027 -22.320 1.915   1.00 0.00 ? 3   VAL A CB   3  
ATOM 4317  C CG1  . VAL A 1 3   ? -15.718 -23.685 2.048   1.00 0.00 ? 3   VAL A CG1  3  
ATOM 4318  C CG2  . VAL A 1 3   ? -13.711 -22.565 1.158   1.00 0.00 ? 3   VAL A CG2  3  
ATOM 4319  H H    . VAL A 1 3   ? -15.077 -19.398 1.756   1.00 0.00 ? 3   VAL A H    3  
ATOM 4320  H HA   . VAL A 1 3   ? -16.238 -21.700 0.252   1.00 0.00 ? 3   VAL A HA   3  
ATOM 4321  H HB   . VAL A 1 3   ? -14.781 -21.959 2.914   1.00 0.00 ? 3   VAL A HB   3  
ATOM 4322  H HG11 . VAL A 1 3   ? -16.017 -24.056 1.067   1.00 0.00 ? 3   VAL A HG11 3  
ATOM 4323  H HG12 . VAL A 1 3   ? -15.038 -24.403 2.507   1.00 0.00 ? 3   VAL A HG12 3  
ATOM 4324  H HG13 . VAL A 1 3   ? -16.594 -23.607 2.690   1.00 0.00 ? 3   VAL A HG13 3  
ATOM 4325  H HG21 . VAL A 1 3   ? -13.920 -22.875 0.134   1.00 0.00 ? 3   VAL A HG21 3  
ATOM 4326  H HG22 . VAL A 1 3   ? -13.108 -21.657 1.145   1.00 0.00 ? 3   VAL A HG22 3  
ATOM 4327  H HG23 . VAL A 1 3   ? -13.132 -23.342 1.657   1.00 0.00 ? 3   VAL A HG23 3  
ATOM 4328  N N    . ARG A 1 4   ? -18.305 -21.676 1.711   1.00 0.00 ? 4   ARG A N    3  
ATOM 4329  C CA   . ARG A 1 4   ? -19.593 -21.547 2.423   1.00 0.00 ? 4   ARG A CA   3  
ATOM 4330  C C    . ARG A 1 4   ? -19.501 -22.050 3.871   1.00 0.00 ? 4   ARG A C    3  
ATOM 4331  O O    . ARG A 1 4   ? -18.800 -23.024 4.154   1.00 0.00 ? 4   ARG A O    3  
ATOM 4332  C CB   . ARG A 1 4   ? -20.706 -22.308 1.678   1.00 0.00 ? 4   ARG A CB   3  
ATOM 4333  C CG   . ARG A 1 4   ? -21.019 -21.731 0.289   1.00 0.00 ? 4   ARG A CG   3  
ATOM 4334  C CD   . ARG A 1 4   ? -22.170 -22.517 -0.353  1.00 0.00 ? 4   ARG A CD   3  
ATOM 4335  N NE   . ARG A 1 4   ? -22.447 -22.063 -1.730  1.00 0.00 ? 4   ARG A NE   3  
ATOM 4336  C CZ   . ARG A 1 4   ? -23.298 -21.130 -2.119  1.00 0.00 ? 4   ARG A CZ   3  
ATOM 4337  N NH1  . ARG A 1 4   ? -24.023 -20.444 -1.282  1.00 0.00 ? 4   ARG A NH1  3  
ATOM 4338  N NH2  . ARG A 1 4   ? -23.439 -20.856 -3.382  1.00 0.00 ? 4   ARG A NH2  3  
ATOM 4339  H H    . ARG A 1 4   ? -18.241 -22.353 0.963   1.00 0.00 ? 4   ARG A H    3  
ATOM 4340  H HA   . ARG A 1 4   ? -19.865 -20.489 2.461   1.00 0.00 ? 4   ARG A HA   3  
ATOM 4341  H HB2  . ARG A 1 4   ? -20.417 -23.356 1.577   1.00 0.00 ? 4   ARG A HB2  3  
ATOM 4342  H HB3  . ARG A 1 4   ? -21.617 -22.268 2.279   1.00 0.00 ? 4   ARG A HB3  3  
ATOM 4343  H HG2  . ARG A 1 4   ? -21.304 -20.682 0.384   1.00 0.00 ? 4   ARG A HG2  3  
ATOM 4344  H HG3  . ARG A 1 4   ? -20.138 -21.804 -0.349  1.00 0.00 ? 4   ARG A HG3  3  
ATOM 4345  H HD2  . ARG A 1 4   ? -21.888 -23.570 -0.385  1.00 0.00 ? 4   ARG A HD2  3  
ATOM 4346  H HD3  . ARG A 1 4   ? -23.063 -22.430 0.268   1.00 0.00 ? 4   ARG A HD3  3  
ATOM 4347  H HE   . ARG A 1 4   ? -21.929 -22.520 -2.465  1.00 0.00 ? 4   ARG A HE   3  
ATOM 4348  H HH11 . ARG A 1 4   ? -23.920 -20.599 -0.294  1.00 0.00 ? 4   ARG A HH11 3  
ATOM 4349  H HH12 . ARG A 1 4   ? -24.656 -19.739 -1.621  1.00 0.00 ? 4   ARG A HH12 3  
ATOM 4350  H HH21 . ARG A 1 4   ? -22.887 -21.342 -4.070  1.00 0.00 ? 4   ARG A HH21 3  
ATOM 4351  H HH22 . ARG A 1 4   ? -24.071 -20.127 -3.669  1.00 0.00 ? 4   ARG A HH22 3  
ATOM 4352  N N    . ARG A 1 5   ? -20.244 -21.405 4.779   1.00 0.00 ? 5   ARG A N    3  
ATOM 4353  C CA   . ARG A 1 5   ? -20.414 -21.828 6.183   1.00 0.00 ? 5   ARG A CA   3  
ATOM 4354  C C    . ARG A 1 5   ? -21.667 -22.702 6.319   1.00 0.00 ? 5   ARG A C    3  
ATOM 4355  O O    . ARG A 1 5   ? -22.661 -22.474 5.625   1.00 0.00 ? 5   ARG A O    3  
ATOM 4356  C CB   . ARG A 1 5   ? -20.447 -20.610 7.127   1.00 0.00 ? 5   ARG A CB   3  
ATOM 4357  C CG   . ARG A 1 5   ? -19.081 -19.925 7.348   1.00 0.00 ? 5   ARG A CG   3  
ATOM 4358  C CD   . ARG A 1 5   ? -18.504 -19.152 6.149   1.00 0.00 ? 5   ARG A CD   3  
ATOM 4359  N NE   . ARG A 1 5   ? -19.392 -18.051 5.725   1.00 0.00 ? 5   ARG A NE   3  
ATOM 4360  C CZ   . ARG A 1 5   ? -19.439 -17.466 4.540   1.00 0.00 ? 5   ARG A CZ   3  
ATOM 4361  N NH1  . ARG A 1 5   ? -18.710 -17.849 3.530   1.00 0.00 ? 5   ARG A NH1  3  
ATOM 4362  N NH2  . ARG A 1 5   ? -20.245 -16.462 4.342   1.00 0.00 ? 5   ARG A NH2  3  
ATOM 4363  H H    . ARG A 1 5   ? -20.816 -20.642 4.449   1.00 0.00 ? 5   ARG A H    3  
ATOM 4364  H HA   . ARG A 1 5   ? -19.566 -22.452 6.477   1.00 0.00 ? 5   ARG A HA   3  
ATOM 4365  H HB2  . ARG A 1 5   ? -21.176 -19.883 6.767   1.00 0.00 ? 5   ARG A HB2  3  
ATOM 4366  H HB3  . ARG A 1 5   ? -20.791 -20.952 8.105   1.00 0.00 ? 5   ARG A HB3  3  
ATOM 4367  H HG2  . ARG A 1 5   ? -19.185 -19.225 8.178   1.00 0.00 ? 5   ARG A HG2  3  
ATOM 4368  H HG3  . ARG A 1 5   ? -18.357 -20.682 7.651   1.00 0.00 ? 5   ARG A HG3  3  
ATOM 4369  H HD2  . ARG A 1 5   ? -17.542 -18.732 6.446   1.00 0.00 ? 5   ARG A HD2  3  
ATOM 4370  H HD3  . ARG A 1 5   ? -18.318 -19.843 5.330   1.00 0.00 ? 5   ARG A HD3  3  
ATOM 4371  H HE   . ARG A 1 5   ? -19.995 -17.661 6.432   1.00 0.00 ? 5   ARG A HE   3  
ATOM 4372  H HH11 . ARG A 1 5   ? -18.079 -18.636 3.628   1.00 0.00 ? 5   ARG A HH11 3  
ATOM 4373  H HH12 . ARG A 1 5   ? -18.762 -17.362 2.653   1.00 0.00 ? 5   ARG A HH12 3  
ATOM 4374  H HH21 . ARG A 1 5   ? -20.828 -16.123 5.090   1.00 0.00 ? 5   ARG A HH21 3  
ATOM 4375  H HH22 . ARG A 1 5   ? -20.284 -16.011 3.444   1.00 0.00 ? 5   ARG A HH22 3  
ATOM 4376  N N    . GLY A 1 6   ? -21.625 -23.701 7.203   1.00 0.00 ? 6   GLY A N    3  
ATOM 4377  C CA   . GLY A 1 6   ? -22.654 -24.748 7.285   1.00 0.00 ? 6   GLY A CA   3  
ATOM 4378  C C    . GLY A 1 6   ? -22.636 -25.680 6.062   1.00 0.00 ? 6   GLY A C    3  
ATOM 4379  O O    . GLY A 1 6   ? -21.575 -25.939 5.483   1.00 0.00 ? 6   GLY A O    3  
ATOM 4380  H H    . GLY A 1 6   ? -20.784 -23.818 7.749   1.00 0.00 ? 6   GLY A H    3  
ATOM 4381  H HA2  . GLY A 1 6   ? -22.497 -25.351 8.180   1.00 0.00 ? 6   GLY A HA2  3  
ATOM 4382  H HA3  . GLY A 1 6   ? -23.638 -24.283 7.364   1.00 0.00 ? 6   GLY A HA3  3  
ATOM 4383  N N    . HIS A 1 7   ? -23.803 -26.187 5.659   1.00 0.00 ? 7   HIS A N    3  
ATOM 4384  C CA   . HIS A 1 7   ? -23.972 -27.016 4.453   1.00 0.00 ? 7   HIS A CA   3  
ATOM 4385  C C    . HIS A 1 7   ? -23.889 -26.199 3.149   1.00 0.00 ? 7   HIS A C    3  
ATOM 4386  O O    . HIS A 1 7   ? -24.112 -24.984 3.137   1.00 0.00 ? 7   HIS A O    3  
ATOM 4387  C CB   . HIS A 1 7   ? -25.297 -27.791 4.544   1.00 0.00 ? 7   HIS A CB   3  
ATOM 4388  C CG   . HIS A 1 7   ? -26.527 -26.913 4.505   1.00 0.00 ? 7   HIS A CG   3  
ATOM 4389  N ND1  . HIS A 1 7   ? -27.047 -26.195 5.588   1.00 0.00 ? 7   HIS A ND1  3  
ATOM 4390  C CD2  . HIS A 1 7   ? -27.307 -26.685 3.409   1.00 0.00 ? 7   HIS A CD2  3  
ATOM 4391  C CE1  . HIS A 1 7   ? -28.128 -25.549 5.116   1.00 0.00 ? 7   HIS A CE1  3  
ATOM 4392  N NE2  . HIS A 1 7   ? -28.307 -25.826 3.813   1.00 0.00 ? 7   HIS A NE2  3  
ATOM 4393  H H    . HIS A 1 7   ? -24.642 -25.923 6.159   1.00 0.00 ? 7   HIS A H    3  
ATOM 4394  H HA   . HIS A 1 7   ? -23.163 -27.749 4.426   1.00 0.00 ? 7   HIS A HA   3  
ATOM 4395  H HB2  . HIS A 1 7   ? -25.349 -28.501 3.717   1.00 0.00 ? 7   HIS A HB2  3  
ATOM 4396  H HB3  . HIS A 1 7   ? -25.308 -28.370 5.469   1.00 0.00 ? 7   HIS A HB3  3  
ATOM 4397  H HD2  . HIS A 1 7   ? -27.161 -27.100 2.419   1.00 0.00 ? 7   HIS A HD2  3  
ATOM 4398  H HE1  . HIS A 1 7   ? -28.768 -24.899 5.703   1.00 0.00 ? 7   HIS A HE1  3  
ATOM 4399  H HE2  . HIS A 1 7   ? -29.059 -25.460 3.237   1.00 0.00 ? 7   HIS A HE2  3  
ATOM 4400  N N    . VAL A 1 8   ? -23.598 -26.872 2.031   1.00 0.00 ? 8   VAL A N    3  
ATOM 4401  C CA   . VAL A 1 8   ? -23.588 -26.262 0.687   1.00 0.00 ? 8   VAL A CA   3  
ATOM 4402  C C    . VAL A 1 8   ? -25.025 -26.132 0.165   1.00 0.00 ? 8   VAL A C    3  
ATOM 4403  O O    . VAL A 1 8   ? -25.745 -27.127 0.045   1.00 0.00 ? 8   VAL A O    3  
ATOM 4404  C CB   . VAL A 1 8   ? -22.691 -27.061 -0.285  1.00 0.00 ? 8   VAL A CB   3  
ATOM 4405  C CG1  . VAL A 1 8   ? -22.683 -26.486 -1.706  1.00 0.00 ? 8   VAL A CG1  3  
ATOM 4406  C CG2  . VAL A 1 8   ? -21.236 -27.076 0.210   1.00 0.00 ? 8   VAL A CG2  3  
ATOM 4407  H H    . VAL A 1 8   ? -23.442 -27.868 2.098   1.00 0.00 ? 8   VAL A H    3  
ATOM 4408  H HA   . VAL A 1 8   ? -23.165 -25.261 0.765   1.00 0.00 ? 8   VAL A HA   3  
ATOM 4409  H HB   . VAL A 1 8   ? -23.052 -28.087 -0.334  1.00 0.00 ? 8   VAL A HB   3  
ATOM 4410  H HG11 . VAL A 1 8   ? -23.664 -26.612 -2.161  1.00 0.00 ? 8   VAL A HG11 3  
ATOM 4411  H HG12 . VAL A 1 8   ? -22.419 -25.430 -1.694  1.00 0.00 ? 8   VAL A HG12 3  
ATOM 4412  H HG13 . VAL A 1 8   ? -21.964 -27.027 -2.323  1.00 0.00 ? 8   VAL A HG13 3  
ATOM 4413  H HG21 . VAL A 1 8   ? -21.171 -27.551 1.188   1.00 0.00 ? 8   VAL A HG21 3  
ATOM 4414  H HG22 . VAL A 1 8   ? -20.616 -27.645 -0.483  1.00 0.00 ? 8   VAL A HG22 3  
ATOM 4415  H HG23 . VAL A 1 8   ? -20.852 -26.058 0.281   1.00 0.00 ? 8   VAL A HG23 3  
ATOM 4416  N N    . ALA A 1 9   ? -25.445 -24.903 -0.143  1.00 0.00 ? 9   ALA A N    3  
ATOM 4417  C CA   . ALA A 1 9   ? -26.735 -24.608 -0.778  1.00 0.00 ? 9   ALA A CA   3  
ATOM 4418  C C    . ALA A 1 9   ? -26.764 -25.084 -2.252  1.00 0.00 ? 9   ALA A C    3  
ATOM 4419  O O    . ALA A 1 9   ? -25.696 -25.227 -2.857  1.00 0.00 ? 9   ALA A O    3  
ATOM 4420  C CB   . ALA A 1 9   ? -26.965 -23.092 -0.661  1.00 0.00 ? 9   ALA A CB   3  
ATOM 4421  H H    . ALA A 1 9   ? -24.805 -24.138 -0.004  1.00 0.00 ? 9   ALA A H    3  
ATOM 4422  H HA   . ALA A 1 9   ? -27.523 -25.124 -0.228  1.00 0.00 ? 9   ALA A HA   3  
ATOM 4423  H HB1  . ALA A 1 9   ? -27.929 -22.817 -1.089  1.00 0.00 ? 9   ALA A HB1  3  
ATOM 4424  H HB2  . ALA A 1 9   ? -26.955 -22.796 0.389   1.00 0.00 ? 9   ALA A HB2  3  
ATOM 4425  H HB3  . ALA A 1 9   ? -26.182 -22.553 -1.196  1.00 0.00 ? 9   ALA A HB3  3  
ATOM 4426  N N    . PRO A 1 10  ? -27.945 -25.279 -2.877  1.00 0.00 ? 10  PRO A N    3  
ATOM 4427  C CA   . PRO A 1 10  ? -28.039 -25.721 -4.271  1.00 0.00 ? 10  PRO A CA   3  
ATOM 4428  C C    . PRO A 1 10  ? -27.486 -24.671 -5.241  1.00 0.00 ? 10  PRO A C    3  
ATOM 4429  O O    . PRO A 1 10  ? -28.119 -23.664 -5.565  1.00 0.00 ? 10  PRO A O    3  
ATOM 4430  C CB   . PRO A 1 10  ? -29.512 -26.049 -4.516  1.00 0.00 ? 10  PRO A CB   3  
ATOM 4431  C CG   . PRO A 1 10  ? -30.253 -25.249 -3.444  1.00 0.00 ? 10  PRO A CG   3  
ATOM 4432  C CD   . PRO A 1 10  ? -29.270 -25.229 -2.275  1.00 0.00 ? 10  PRO A CD   3  
ATOM 4433  H HA   . PRO A 1 10  ? -27.465 -26.640 -4.394  1.00 0.00 ? 10  PRO A HA   3  
ATOM 4434  H HB2  . PRO A 1 10  ? -29.832 -25.783 -5.524  1.00 0.00 ? 10  PRO A HB2  3  
ATOM 4435  H HB3  . PRO A 1 10  ? -29.656 -27.117 -4.357  1.00 0.00 ? 10  PRO A HB3  3  
ATOM 4436  H HG2  . PRO A 1 10  ? -30.416 -24.228 -3.790  1.00 0.00 ? 10  PRO A HG2  3  
ATOM 4437  H HG3  . PRO A 1 10  ? -31.199 -25.716 -3.170  1.00 0.00 ? 10  PRO A HG3  3  
ATOM 4438  H HD2  . PRO A 1 10  ? -29.420 -24.328 -1.682  1.00 0.00 ? 10  PRO A HD2  3  
ATOM 4439  H HD3  . PRO A 1 10  ? -29.419 -26.114 -1.656  1.00 0.00 ? 10  PRO A HD3  3  
ATOM 4440  N N    . GLN A 1 11  ? -26.281 -24.933 -5.735  1.00 0.00 ? 11  GLN A N    3  
ATOM 4441  C CA   . GLN A 1 11  ? -25.484 -23.973 -6.501  1.00 0.00 ? 11  GLN A CA   3  
ATOM 4442  C C    . GLN A 1 11  ? -26.114 -23.604 -7.855  1.00 0.00 ? 11  GLN A C    3  
ATOM 4443  O O    . GLN A 1 11  ? -25.914 -22.490 -8.341  1.00 0.00 ? 11  GLN A O    3  
ATOM 4444  C CB   . GLN A 1 11  ? -24.035 -24.488 -6.629  1.00 0.00 ? 11  GLN A CB   3  
ATOM 4445  C CG   . GLN A 1 11  ? -23.803 -25.667 -7.595  1.00 0.00 ? 11  GLN A CG   3  
ATOM 4446  C CD   . GLN A 1 11  ? -24.555 -26.951 -7.245  1.00 0.00 ? 11  GLN A CD   3  
ATOM 4447  O OE1  . GLN A 1 11  ? -24.677 -27.351 -6.094  1.00 0.00 ? 11  GLN A OE1  3  
ATOM 4448  N NE2  . GLN A 1 11  ? -25.121 -27.634 -8.217  1.00 0.00 ? 11  GLN A NE2  3  
ATOM 4449  H H    . GLN A 1 11  ? -25.833 -25.787 -5.422  1.00 0.00 ? 11  GLN A H    3  
ATOM 4450  H HA   . GLN A 1 11  ? -25.435 -23.057 -5.915  1.00 0.00 ? 11  GLN A HA   3  
ATOM 4451  H HB2  . GLN A 1 11  ? -23.417 -23.657 -6.972  1.00 0.00 ? 11  GLN A HB2  3  
ATOM 4452  H HB3  . GLN A 1 11  ? -23.670 -24.766 -5.637  1.00 0.00 ? 11  GLN A HB3  3  
ATOM 4453  H HG2  . GLN A 1 11  ? -24.063 -25.354 -8.606  1.00 0.00 ? 11  GLN A HG2  3  
ATOM 4454  H HG3  . GLN A 1 11  ? -22.739 -25.902 -7.589  1.00 0.00 ? 11  GLN A HG3  3  
ATOM 4455  H HE21 . GLN A 1 11  ? -25.084 -27.291 -9.173  1.00 0.00 ? 11  GLN A HE21 3  
ATOM 4456  H HE22 . GLN A 1 11  ? -25.599 -28.491 -7.986  1.00 0.00 ? 11  GLN A HE22 3  
ATOM 4457  N N    . ASN A 1 12  ? -26.916 -24.501 -8.442  1.00 0.00 ? 12  ASN A N    3  
ATOM 4458  C CA   . ASN A 1 12  ? -27.511 -24.295 -9.765  1.00 0.00 ? 12  ASN A CA   3  
ATOM 4459  C C    . ASN A 1 12  ? -28.582 -23.196 -9.703  1.00 0.00 ? 12  ASN A C    3  
ATOM 4460  O O    . ASN A 1 12  ? -28.534 -22.241 -10.473 1.00 0.00 ? 12  ASN A O    3  
ATOM 4461  C CB   . ASN A 1 12  ? -28.095 -25.625 -10.279 1.00 0.00 ? 12  ASN A CB   3  
ATOM 4462  C CG   . ASN A 1 12  ? -27.062 -26.578 -10.868 1.00 0.00 ? 12  ASN A CG   3  
ATOM 4463  O OD1  . ASN A 1 12  ? -25.855 -26.396 -10.772 1.00 0.00 ? 12  ASN A OD1  3  
ATOM 4464  N ND2  . ASN A 1 12  ? -27.504 -27.650 -11.483 1.00 0.00 ? 12  ASN A ND2  3  
ATOM 4465  H H    . ASN A 1 12  ? -27.132 -25.353 -7.945  1.00 0.00 ? 12  ASN A H    3  
ATOM 4466  H HA   . ASN A 1 12  ? -26.744 -23.951 -10.462 1.00 0.00 ? 12  ASN A HA   3  
ATOM 4467  H HB2  . ASN A 1 12  ? -28.643 -26.133 -9.485  1.00 0.00 ? 12  ASN A HB2  3  
ATOM 4468  H HB3  . ASN A 1 12  ? -28.804 -25.396 -11.075 1.00 0.00 ? 12  ASN A HB3  3  
ATOM 4469  H HD21 . ASN A 1 12  ? -28.495 -27.820 -11.565 1.00 0.00 ? 12  ASN A HD21 3  
ATOM 4470  H HD22 . ASN A 1 12  ? -26.831 -28.287 -11.882 1.00 0.00 ? 12  ASN A HD22 3  
ATOM 4471  N N    . THR A 1 13  ? -29.512 -23.292 -8.745  1.00 0.00 ? 13  THR A N    3  
ATOM 4472  C CA   . THR A 1 13  ? -30.566 -22.283 -8.522  1.00 0.00 ? 13  THR A CA   3  
ATOM 4473  C C    . THR A 1 13  ? -30.029 -21.011 -7.868  1.00 0.00 ? 13  THR A C    3  
ATOM 4474  O O    . THR A 1 13  ? -30.464 -19.901 -8.191  1.00 0.00 ? 13  THR A O    3  
ATOM 4475  C CB   . THR A 1 13  ? -31.713 -22.879 -7.698  1.00 0.00 ? 13  THR A CB   3  
ATOM 4476  O OG1  . THR A 1 13  ? -32.891 -22.115 -7.861  1.00 0.00 ? 13  THR A OG1  3  
ATOM 4477  C CG2  . THR A 1 13  ? -31.418 -22.948 -6.208  1.00 0.00 ? 13  THR A CG2  3  
ATOM 4478  H H    . THR A 1 13  ? -29.480 -24.099 -8.136  1.00 0.00 ? 13  THR A H    3  
ATOM 4479  H HA   . THR A 1 13  ? -30.979 -22.015 -9.491  1.00 0.00 ? 13  THR A HA   3  
ATOM 4480  H HB   . THR A 1 13  ? -31.872 -23.898 -8.045  1.00 0.00 ? 13  THR A HB   3  
ATOM 4481  H HG1  . THR A 1 13  ? -33.311 -22.399 -8.695  1.00 0.00 ? 13  THR A HG1  3  
ATOM 4482  H HG21 . THR A 1 13  ? -32.208 -23.496 -5.699  1.00 0.00 ? 13  THR A HG21 3  
ATOM 4483  H HG22 . THR A 1 13  ? -30.472 -23.461 -6.077  1.00 0.00 ? 13  THR A HG22 3  
ATOM 4484  H HG23 . THR A 1 13  ? -31.330 -21.947 -5.788  1.00 0.00 ? 13  THR A HG23 3  
ATOM 4485  N N    . PHE A 1 14  ? -29.045 -21.159 -6.971  1.00 0.00 ? 14  PHE A N    3  
ATOM 4486  C CA   . PHE A 1 14  ? -28.354 -20.036 -6.347  1.00 0.00 ? 14  PHE A CA   3  
ATOM 4487  C C    . PHE A 1 14  ? -27.714 -19.157 -7.421  1.00 0.00 ? 14  PHE A C    3  
ATOM 4488  O O    . PHE A 1 14  ? -27.841 -17.935 -7.371  1.00 0.00 ? 14  PHE A O    3  
ATOM 4489  C CB   . PHE A 1 14  ? -27.308 -20.596 -5.382  1.00 0.00 ? 14  PHE A CB   3  
ATOM 4490  C CG   . PHE A 1 14  ? -26.547 -19.557 -4.581  1.00 0.00 ? 14  PHE A CG   3  
ATOM 4491  C CD1  . PHE A 1 14  ? -25.408 -18.932 -5.128  1.00 0.00 ? 14  PHE A CD1  3  
ATOM 4492  C CD2  . PHE A 1 14  ? -26.976 -19.213 -3.285  1.00 0.00 ? 14  PHE A CD2  3  
ATOM 4493  C CE1  . PHE A 1 14  ? -24.708 -17.966 -4.384  1.00 0.00 ? 14  PHE A CE1  3  
ATOM 4494  C CE2  . PHE A 1 14  ? -26.276 -18.245 -2.542  1.00 0.00 ? 14  PHE A CE2  3  
ATOM 4495  C CZ   . PHE A 1 14  ? -25.141 -17.621 -3.092  1.00 0.00 ? 14  PHE A CZ   3  
ATOM 4496  H H    . PHE A 1 14  ? -28.764 -22.098 -6.696  1.00 0.00 ? 14  PHE A H    3  
ATOM 4497  H HA   . PHE A 1 14  ? -29.069 -19.431 -5.785  1.00 0.00 ? 14  PHE A HA   3  
ATOM 4498  H HB2  . PHE A 1 14  ? -27.818 -21.272 -4.700  1.00 0.00 ? 14  PHE A HB2  3  
ATOM 4499  H HB3  . PHE A 1 14  ? -26.596 -21.190 -5.952  1.00 0.00 ? 14  PHE A HB3  3  
ATOM 4500  H HD1  . PHE A 1 14  ? -25.073 -19.188 -6.125  1.00 0.00 ? 14  PHE A HD1  3  
ATOM 4501  H HD2  . PHE A 1 14  ? -27.853 -19.684 -2.860  1.00 0.00 ? 14  PHE A HD2  3  
ATOM 4502  H HE1  . PHE A 1 14  ? -23.840 -17.477 -4.810  1.00 0.00 ? 14  PHE A HE1  3  
ATOM 4503  H HE2  . PHE A 1 14  ? -26.620 -17.968 -1.552  1.00 0.00 ? 14  PHE A HE2  3  
ATOM 4504  H HZ   . PHE A 1 14  ? -24.609 -16.867 -2.525  1.00 0.00 ? 14  PHE A HZ   3  
ATOM 4505  N N    . LEU A 1 15  ? -27.113 -19.783 -8.440  1.00 0.00 ? 15  LEU A N    3  
ATOM 4506  C CA   . LEU A 1 15  ? -26.572 -19.059 -9.591  1.00 0.00 ? 15  LEU A CA   3  
ATOM 4507  C C    . LEU A 1 15  ? -27.671 -18.578 -10.550 1.00 0.00 ? 15  LEU A C    3  
ATOM 4508  O O    . LEU A 1 15  ? -27.642 -17.420 -10.940 1.00 0.00 ? 15  LEU A O    3  
ATOM 4509  C CB   . LEU A 1 15  ? -25.492 -19.895 -10.296 1.00 0.00 ? 15  LEU A CB   3  
ATOM 4510  C CG   . LEU A 1 15  ? -24.930 -19.207 -11.555 1.00 0.00 ? 15  LEU A CG   3  
ATOM 4511  C CD1  . LEU A 1 15  ? -24.342 -17.814 -11.290 1.00 0.00 ? 15  LEU A CD1  3  
ATOM 4512  C CD2  . LEU A 1 15  ? -23.842 -20.077 -12.183 1.00 0.00 ? 15  LEU A CD2  3  
ATOM 4513  H H    . LEU A 1 15  ? -27.063 -20.802 -8.412  1.00 0.00 ? 15  LEU A H    3  
ATOM 4514  H HA   . LEU A 1 15  ? -26.084 -18.164 -9.204  1.00 0.00 ? 15  LEU A HA   3  
ATOM 4515  H HB2  . LEU A 1 15  ? -24.678 -20.083 -9.595  1.00 0.00 ? 15  LEU A HB2  3  
ATOM 4516  H HB3  . LEU A 1 15  ? -25.923 -20.854 -10.591 1.00 0.00 ? 15  LEU A HB3  3  
ATOM 4517  H HG   . LEU A 1 15  ? -25.742 -19.111 -12.275 1.00 0.00 ? 15  LEU A HG   3  
ATOM 4518  H HD11 . LEU A 1 15  ? -23.511 -17.880 -10.588 1.00 0.00 ? 15  LEU A HD11 3  
ATOM 4519  H HD12 . LEU A 1 15  ? -24.004 -17.373 -12.228 1.00 0.00 ? 15  LEU A HD12 3  
ATOM 4520  H HD13 . LEU A 1 15  ? -25.094 -17.147 -10.873 1.00 0.00 ? 15  LEU A HD13 3  
ATOM 4521  H HD21 . LEU A 1 15  ? -23.487 -19.614 -13.104 1.00 0.00 ? 15  LEU A HD21 3  
ATOM 4522  H HD22 . LEU A 1 15  ? -23.008 -20.192 -11.490 1.00 0.00 ? 15  LEU A HD22 3  
ATOM 4523  H HD23 . LEU A 1 15  ? -24.251 -21.060 -12.420 1.00 0.00 ? 15  LEU A HD23 3  
ATOM 4524  N N    . ASP A 1 16  ? -28.661 -19.400 -10.899 1.00 0.00 ? 16  ASP A N    3  
ATOM 4525  C CA   . ASP A 1 16  ? -29.827 -19.041 -11.735 1.00 0.00 ? 16  ASP A CA   3  
ATOM 4526  C C    . ASP A 1 16  ? -30.503 -17.730 -11.299 1.00 0.00 ? 16  ASP A C    3  
ATOM 4527  O O    . ASP A 1 16  ? -30.935 -16.915 -12.116 1.00 0.00 ? 16  ASP A O    3  
ATOM 4528  C CB   . ASP A 1 16  ? -30.847 -20.178 -11.699 1.00 0.00 ? 16  ASP A CB   3  
ATOM 4529  C CG   . ASP A 1 16  ? -32.016 -19.919 -12.654 1.00 0.00 ? 16  ASP A CG   3  
ATOM 4530  O OD1  . ASP A 1 16  ? -31.901 -20.233 -13.862 1.00 0.00 ? 16  ASP A OD1  3  
ATOM 4531  O OD2  . ASP A 1 16  ? -33.053 -19.402 -12.179 1.00 0.00 ? 16  ASP A OD2  3  
ATOM 4532  H H    . ASP A 1 16  ? -28.594 -20.357 -10.579 1.00 0.00 ? 16  ASP A H    3  
ATOM 4533  H HA   . ASP A 1 16  ? -29.497 -18.922 -12.766 1.00 0.00 ? 16  ASP A HA   3  
ATOM 4534  H HB2  . ASP A 1 16  ? -30.356 -21.111 -11.964 1.00 0.00 ? 16  ASP A HB2  3  
ATOM 4535  H HB3  . ASP A 1 16  ? -31.236 -20.272 -10.687 1.00 0.00 ? 16  ASP A HB3  3  
ATOM 4536  N N    . THR A 1 17  ? -30.604 -17.531 -9.987  1.00 0.00 ? 17  THR A N    3  
ATOM 4537  C CA   . THR A 1 17  ? -31.105 -16.276 -9.403  1.00 0.00 ? 17  THR A CA   3  
ATOM 4538  C C    . THR A 1 17  ? -30.240 -15.075 -9.812  1.00 0.00 ? 17  THR A C    3  
ATOM 4539  O O    . THR A 1 17  ? -30.754 -14.042 -10.250 1.00 0.00 ? 17  THR A O    3  
ATOM 4540  C CB   . THR A 1 17  ? -31.169 -16.384 -7.870  1.00 0.00 ? 17  THR A CB   3  
ATOM 4541  O OG1  . THR A 1 17  ? -31.903 -17.533 -7.492  1.00 0.00 ? 17  THR A OG1  3  
ATOM 4542  C CG2  . THR A 1 17  ? -31.836 -15.168 -7.231  1.00 0.00 ? 17  THR A CG2  3  
ATOM 4543  H H    . THR A 1 17  ? -30.224 -18.262 -9.390  1.00 0.00 ? 17  THR A H    3  
ATOM 4544  H HA   . THR A 1 17  ? -32.107 -16.100 -9.793  1.00 0.00 ? 17  THR A HA   3  
ATOM 4545  H HB   . THR A 1 17  ? -30.157 -16.474 -7.474  1.00 0.00 ? 17  THR A HB   3  
ATOM 4546  H HG1  . THR A 1 17  ? -31.373 -18.301 -7.777  1.00 0.00 ? 17  THR A HG1  3  
ATOM 4547  H HG21 . THR A 1 17  ? -31.911 -15.320 -6.155  1.00 0.00 ? 17  THR A HG21 3  
ATOM 4548  H HG22 . THR A 1 17  ? -31.232 -14.277 -7.418  1.00 0.00 ? 17  THR A HG22 3  
ATOM 4549  H HG23 . THR A 1 17  ? -32.833 -15.028 -7.649  1.00 0.00 ? 17  THR A HG23 3  
ATOM 4550  N N    . ILE A 1 18  ? -28.915 -15.224 -9.745  1.00 0.00 ? 18  ILE A N    3  
ATOM 4551  C CA   . ILE A 1 18  ? -27.952 -14.203 -10.178 1.00 0.00 ? 18  ILE A CA   3  
ATOM 4552  C C    . ILE A 1 18  ? -27.978 -14.037 -11.700 1.00 0.00 ? 18  ILE A C    3  
ATOM 4553  O O    . ILE A 1 18  ? -27.876 -12.910 -12.188 1.00 0.00 ? 18  ILE A O    3  
ATOM 4554  C CB   . ILE A 1 18  ? -26.521 -14.547 -9.711  1.00 0.00 ? 18  ILE A CB   3  
ATOM 4555  C CG1  . ILE A 1 18  ? -26.404 -14.882 -8.214  1.00 0.00 ? 18  ILE A CG1  3  
ATOM 4556  C CG2  . ILE A 1 18  ? -25.515 -13.441 -10.071 1.00 0.00 ? 18  ILE A CG2  3  
ATOM 4557  C CD1  . ILE A 1 18  ? -26.734 -13.723 -7.262  1.00 0.00 ? 18  ILE A CD1  3  
ATOM 4558  H H    . ILE A 1 18  ? -28.553 -16.140 -9.504  1.00 0.00 ? 18  ILE A H    3  
ATOM 4559  H HA   . ILE A 1 18  ? -28.260 -13.258 -9.736  1.00 0.00 ? 18  ILE A HA   3  
ATOM 4560  H HB   . ILE A 1 18  ? -26.218 -15.440 -10.247 1.00 0.00 ? 18  ILE A HB   3  
ATOM 4561  H HG12 . ILE A 1 18  ? -27.074 -15.701 -7.981  1.00 0.00 ? 18  ILE A HG12 3  
ATOM 4562  H HG13 . ILE A 1 18  ? -25.390 -15.250 -8.036  1.00 0.00 ? 18  ILE A HG13 3  
ATOM 4563  H HG21 . ILE A 1 18  ? -25.865 -12.472 -9.712  1.00 0.00 ? 18  ILE A HG21 3  
ATOM 4564  H HG22 . ILE A 1 18  ? -24.542 -13.659 -9.631  1.00 0.00 ? 18  ILE A HG22 3  
ATOM 4565  H HG23 . ILE A 1 18  ? -25.389 -13.394 -11.149 1.00 0.00 ? 18  ILE A HG23 3  
ATOM 4566  H HD11 . ILE A 1 18  ? -27.740 -13.352 -7.458  1.00 0.00 ? 18  ILE A HD11 3  
ATOM 4567  H HD12 . ILE A 1 18  ? -26.685 -14.080 -6.233  1.00 0.00 ? 18  ILE A HD12 3  
ATOM 4568  H HD13 . ILE A 1 18  ? -26.018 -12.912 -7.386  1.00 0.00 ? 18  ILE A HD13 3  
ATOM 4569  N N    . ILE A 1 19  ? -28.201 -15.124 -12.453 1.00 0.00 ? 19  ILE A N    3  
ATOM 4570  C CA   . ILE A 1 19  ? -28.421 -15.048 -13.894 1.00 0.00 ? 19  ILE A CA   3  
ATOM 4571  C C    . ILE A 1 19  ? -29.565 -14.084 -14.157 1.00 0.00 ? 19  ILE A C    3  
ATOM 4572  O O    . ILE A 1 19  ? -29.340 -13.072 -14.800 1.00 0.00 ? 19  ILE A O    3  
ATOM 4573  C CB   . ILE A 1 19  ? -28.704 -16.416 -14.557 1.00 0.00 ? 19  ILE A CB   3  
ATOM 4574  C CG1  . ILE A 1 19  ? -27.596 -17.469 -14.362 1.00 0.00 ? 19  ILE A CG1  3  
ATOM 4575  C CG2  . ILE A 1 19  ? -28.951 -16.224 -16.062 1.00 0.00 ? 19  ILE A CG2  3  
ATOM 4576  C CD1  . ILE A 1 19  ? -26.184 -16.962 -14.640 1.00 0.00 ? 19  ILE A CD1  3  
ATOM 4577  H H    . ILE A 1 19  ? -28.232 -16.032 -12.006 1.00 0.00 ? 19  ILE A H    3  
ATOM 4578  H HA   . ILE A 1 19  ? -27.523 -14.614 -14.326 1.00 0.00 ? 19  ILE A HA   3  
ATOM 4579  H HB   . ILE A 1 19  ? -29.621 -16.822 -14.135 1.00 0.00 ? 19  ILE A HB   3  
ATOM 4580  H HG12 . ILE A 1 19  ? -27.621 -17.832 -13.343 1.00 0.00 ? 19  ILE A HG12 3  
ATOM 4581  H HG13 . ILE A 1 19  ? -27.795 -18.327 -15.005 1.00 0.00 ? 19  ILE A HG13 3  
ATOM 4582  H HG21 . ILE A 1 19  ? -29.870 -15.662 -16.224 1.00 0.00 ? 19  ILE A HG21 3  
ATOM 4583  H HG22 . ILE A 1 19  ? -28.119 -15.686 -16.514 1.00 0.00 ? 19  ILE A HG22 3  
ATOM 4584  H HG23 . ILE A 1 19  ? -29.064 -17.194 -16.548 1.00 0.00 ? 19  ILE A HG23 3  
ATOM 4585  H HD11 . ILE A 1 19  ? -25.902 -16.248 -13.869 1.00 0.00 ? 19  ILE A HD11 3  
ATOM 4586  H HD12 . ILE A 1 19  ? -25.499 -17.808 -14.599 1.00 0.00 ? 19  ILE A HD12 3  
ATOM 4587  H HD13 . ILE A 1 19  ? -26.145 -16.480 -15.620 1.00 0.00 ? 19  ILE A HD13 3  
ATOM 4588  N N    . ARG A 1 20  ? -30.750 -14.313 -13.573 1.00 0.00 ? 20  ARG A N    3  
ATOM 4589  C CA   . ARG A 1 20  ? -31.912 -13.415 -13.700 1.00 0.00 ? 20  ARG A CA   3  
ATOM 4590  C C    . ARG A 1 20  ? -31.651 -12.012 -13.159 1.00 0.00 ? 20  ARG A C    3  
ATOM 4591  O O    . ARG A 1 20  ? -32.232 -11.061 -13.675 1.00 0.00 ? 20  ARG A O    3  
ATOM 4592  C CB   . ARG A 1 20  ? -33.141 -14.045 -13.037 1.00 0.00 ? 20  ARG A CB   3  
ATOM 4593  C CG   . ARG A 1 20  ? -33.761 -15.095 -13.969 1.00 0.00 ? 20  ARG A CG   3  
ATOM 4594  C CD   . ARG A 1 20  ? -34.983 -15.745 -13.319 1.00 0.00 ? 20  ARG A CD   3  
ATOM 4595  N NE   . ARG A 1 20  ? -34.581 -16.664 -12.241 1.00 0.00 ? 20  ARG A NE   3  
ATOM 4596  C CZ   . ARG A 1 20  ? -35.362 -17.185 -11.316 1.00 0.00 ? 20  ARG A CZ   3  
ATOM 4597  N NH1  . ARG A 1 20  ? -36.574 -16.755 -11.093 1.00 0.00 ? 20  ARG A NH1  3  
ATOM 4598  N NH2  . ARG A 1 20  ? -34.930 -18.178 -10.604 1.00 0.00 ? 20  ARG A NH2  3  
ATOM 4599  H H    . ARG A 1 20  ? -30.824 -15.139 -12.988 1.00 0.00 ? 20  ARG A H    3  
ATOM 4600  H HA   . ARG A 1 20  ? -32.140 -13.274 -14.756 1.00 0.00 ? 20  ARG A HA   3  
ATOM 4601  H HB2  . ARG A 1 20  ? -32.863 -14.491 -12.081 1.00 0.00 ? 20  ARG A HB2  3  
ATOM 4602  H HB3  . ARG A 1 20  ? -33.888 -13.271 -12.854 1.00 0.00 ? 20  ARG A HB3  3  
ATOM 4603  H HG2  . ARG A 1 20  ? -34.079 -14.608 -14.891 1.00 0.00 ? 20  ARG A HG2  3  
ATOM 4604  H HG3  . ARG A 1 20  ? -33.027 -15.864 -14.217 1.00 0.00 ? 20  ARG A HG3  3  
ATOM 4605  H HD2  . ARG A 1 20  ? -35.641 -14.962 -12.942 1.00 0.00 ? 20  ARG A HD2  3  
ATOM 4606  H HD3  . ARG A 1 20  ? -35.519 -16.310 -14.084 1.00 0.00 ? 20  ARG A HD3  3  
ATOM 4607  H HE   . ARG A 1 20  ? -33.628 -17.006 -12.266 1.00 0.00 ? 20  ARG A HE   3  
ATOM 4608  H HH11 . ARG A 1 20  ? -36.937 -16.002 -11.649 1.00 0.00 ? 20  ARG A HH11 3  
ATOM 4609  H HH12 . ARG A 1 20  ? -37.147 -17.179 -10.384 1.00 0.00 ? 20  ARG A HH12 3  
ATOM 4610  H HH21 . ARG A 1 20  ? -34.110 -18.668 -10.969 1.00 0.00 ? 20  ARG A HH21 3  
ATOM 4611  H HH22 . ARG A 1 20  ? -35.534 -18.637 -9.950  1.00 0.00 ? 20  ARG A HH22 3  
ATOM 4612  N N    . LYS A 1 21  ? -30.738 -11.863 -12.193 1.00 0.00 ? 21  LYS A N    3  
ATOM 4613  C CA   . LYS A 1 21  ? -30.273 -10.544 -11.705 1.00 0.00 ? 21  LYS A CA   3  
ATOM 4614  C C    . LYS A 1 21  ? -29.560 -9.738  -12.800 1.00 0.00 ? 21  LYS A C    3  
ATOM 4615  O O    . LYS A 1 21  ? -29.828 -8.543  -12.926 1.00 0.00 ? 21  LYS A O    3  
ATOM 4616  C CB   . LYS A 1 21  ? -29.353 -10.700 -10.479 1.00 0.00 ? 21  LYS A CB   3  
ATOM 4617  C CG   . LYS A 1 21  ? -29.242 -9.447  -9.594  1.00 0.00 ? 21  LYS A CG   3  
ATOM 4618  C CD   . LYS A 1 21  ? -30.488 -9.229  -8.721  1.00 0.00 ? 21  LYS A CD   3  
ATOM 4619  C CE   . LYS A 1 21  ? -30.338 -8.052  -7.745  1.00 0.00 ? 21  LYS A CE   3  
ATOM 4620  N NZ   . LYS A 1 21  ? -30.266 -6.740  -8.435  1.00 0.00 ? 21  LYS A NZ   3  
ATOM 4621  H H    . LYS A 1 21  ? -30.354 -12.727 -11.814 1.00 0.00 ? 21  LYS A H    3  
ATOM 4622  H HA   . LYS A 1 21  ? -31.153 -9.969  -11.418 1.00 0.00 ? 21  LYS A HA   3  
ATOM 4623  H HB2  . LYS A 1 21  ? -29.698 -11.529 -9.861  1.00 0.00 ? 21  LYS A HB2  3  
ATOM 4624  H HB3  . LYS A 1 21  ? -28.347 -10.919 -10.836 1.00 0.00 ? 21  LYS A HB3  3  
ATOM 4625  H HG2  . LYS A 1 21  ? -28.383 -9.575  -8.936  1.00 0.00 ? 21  LYS A HG2  3  
ATOM 4626  H HG3  . LYS A 1 21  ? -29.063 -8.573  -10.221 1.00 0.00 ? 21  LYS A HG3  3  
ATOM 4627  H HD2  . LYS A 1 21  ? -31.360 -9.065  -9.353  1.00 0.00 ? 21  LYS A HD2  3  
ATOM 4628  H HD3  . LYS A 1 21  ? -30.655 -10.135 -8.133  1.00 0.00 ? 21  LYS A HD3  3  
ATOM 4629  H HE2  . LYS A 1 21  ? -31.204 -8.054  -7.078  1.00 0.00 ? 21  LYS A HE2  3  
ATOM 4630  H HE3  . LYS A 1 21  ? -29.446 -8.204  -7.131  1.00 0.00 ? 21  LYS A HE3  3  
ATOM 4631  H HZ1  . LYS A 1 21  ? -31.081 -6.603  -9.036  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 4632  H HZ2  . LYS A 1 21  ? -30.293 -5.975  -7.760  1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 4633  H HZ3  . LYS A 1 21  ? -29.434 -6.646  -8.997  1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 4634  N N    . PHE A 1 22  ? -28.687 -10.372 -13.599 1.00 0.00 ? 22  PHE A N    3  
ATOM 4635  C CA   . PHE A 1 22  ? -27.954 -9.700  -14.693 1.00 0.00 ? 22  PHE A CA   3  
ATOM 4636  C C    . PHE A 1 22  ? -28.461 -9.999  -16.125 1.00 0.00 ? 22  PHE A C    3  
ATOM 4637  O O    . PHE A 1 22  ? -27.926 -9.452  -17.090 1.00 0.00 ? 22  PHE A O    3  
ATOM 4638  C CB   . PHE A 1 22  ? -26.435 -9.918  -14.547 1.00 0.00 ? 22  PHE A CB   3  
ATOM 4639  C CG   . PHE A 1 22  ? -25.886 -11.306 -14.858 1.00 0.00 ? 22  PHE A CG   3  
ATOM 4640  C CD1  . PHE A 1 22  ? -25.737 -11.746 -16.189 1.00 0.00 ? 22  PHE A CD1  3  
ATOM 4641  C CD2  . PHE A 1 22  ? -25.431 -12.129 -13.811 1.00 0.00 ? 22  PHE A CD2  3  
ATOM 4642  C CE1  . PHE A 1 22  ? -25.176 -13.005 -16.467 1.00 0.00 ? 22  PHE A CE1  3  
ATOM 4643  C CE2  . PHE A 1 22  ? -24.863 -13.388 -14.086 1.00 0.00 ? 22  PHE A CE2  3  
ATOM 4644  C CZ   . PHE A 1 22  ? -24.737 -13.826 -15.415 1.00 0.00 ? 22  PHE A CZ   3  
ATOM 4645  H H    . PHE A 1 22  ? -28.476 -11.346 -13.392 1.00 0.00 ? 22  PHE A H    3  
ATOM 4646  H HA   . PHE A 1 22  ? -28.098 -8.630  -14.558 1.00 0.00 ? 22  PHE A HA   3  
ATOM 4647  H HB2  . PHE A 1 22  ? -25.928 -9.211  -15.206 1.00 0.00 ? 22  PHE A HB2  3  
ATOM 4648  H HB3  . PHE A 1 22  ? -26.148 -9.644  -13.531 1.00 0.00 ? 22  PHE A HB3  3  
ATOM 4649  H HD1  . PHE A 1 22  ? -26.034 -11.111 -17.011 1.00 0.00 ? 22  PHE A HD1  3  
ATOM 4650  H HD2  . PHE A 1 22  ? -25.515 -11.790 -12.789 1.00 0.00 ? 22  PHE A HD2  3  
ATOM 4651  H HE1  . PHE A 1 22  ? -25.068 -13.336 -17.492 1.00 0.00 ? 22  PHE A HE1  3  
ATOM 4652  H HE2  . PHE A 1 22  ? -24.516 -14.016 -13.277 1.00 0.00 ? 22  PHE A HE2  3  
ATOM 4653  H HZ   . PHE A 1 22  ? -24.292 -14.789 -15.629 1.00 0.00 ? 22  PHE A HZ   3  
ATOM 4654  N N    . GLU A 1 23  ? -29.502 -10.824 -16.281 1.00 0.00 ? 23  GLU A N    3  
ATOM 4655  C CA   . GLU A 1 23  ? -29.943 -11.416 -17.560 1.00 0.00 ? 23  GLU A CA   3  
ATOM 4656  C C    . GLU A 1 23  ? -30.331 -10.369 -18.630 1.00 0.00 ? 23  GLU A C    3  
ATOM 4657  O O    . GLU A 1 23  ? -30.200 -10.611 -19.832 1.00 0.00 ? 23  GLU A O    3  
ATOM 4658  C CB   . GLU A 1 23  ? -31.187 -12.282 -17.266 1.00 0.00 ? 23  GLU A CB   3  
ATOM 4659  C CG   . GLU A 1 23  ? -31.798 -12.990 -18.483 1.00 0.00 ? 23  GLU A CG   3  
ATOM 4660  C CD   . GLU A 1 23  ? -33.055 -13.768 -18.066 1.00 0.00 ? 23  GLU A CD   3  
ATOM 4661  O OE1  . GLU A 1 23  ? -34.051 -13.105 -17.690 1.00 0.00 ? 23  GLU A OE1  3  
ATOM 4662  O OE2  . GLU A 1 23  ? -33.053 -15.021 -18.116 1.00 0.00 ? 23  GLU A OE2  3  
ATOM 4663  H H    . GLU A 1 23  ? -29.813 -11.305 -15.445 1.00 0.00 ? 23  GLU A H    3  
ATOM 4664  H HA   . GLU A 1 23  ? -29.150 -12.080 -17.920 1.00 0.00 ? 23  GLU A HA   3  
ATOM 4665  H HB2  . GLU A 1 23  ? -30.937 -13.057 -16.545 1.00 0.00 ? 23  GLU A HB2  3  
ATOM 4666  H HB3  . GLU A 1 23  ? -31.950 -11.644 -16.816 1.00 0.00 ? 23  GLU A HB3  3  
ATOM 4667  H HG2  . GLU A 1 23  ? -32.085 -12.259 -19.239 1.00 0.00 ? 23  GLU A HG2  3  
ATOM 4668  H HG3  . GLU A 1 23  ? -31.053 -13.660 -18.918 1.00 0.00 ? 23  GLU A HG3  3  
ATOM 4669  N N    . GLY A 1 24  ? -30.809 -9.197  -18.194 1.00 0.00 ? 24  GLY A N    3  
ATOM 4670  C CA   . GLY A 1 24  ? -31.305 -8.111  -19.051 1.00 0.00 ? 24  GLY A CA   3  
ATOM 4671  C C    . GLY A 1 24  ? -32.715 -8.312  -19.636 1.00 0.00 ? 24  GLY A C    3  
ATOM 4672  O O    . GLY A 1 24  ? -33.193 -7.431  -20.351 1.00 0.00 ? 24  GLY A O    3  
ATOM 4673  H H    . GLY A 1 24  ? -30.829 -9.057  -17.193 1.00 0.00 ? 24  GLY A H    3  
ATOM 4674  H HA2  . GLY A 1 24  ? -31.315 -7.190  -18.469 1.00 0.00 ? 24  GLY A HA2  3  
ATOM 4675  H HA3  . GLY A 1 24  ? -30.614 -7.973  -19.882 1.00 0.00 ? 24  GLY A HA3  3  
ATOM 4676  N N    . GLN A 1 25  ? -33.393 -9.433  -19.341 1.00 0.00 ? 25  GLN A N    3  
ATOM 4677  C CA   . GLN A 1 25  ? -34.733 -9.764  -19.860 1.00 0.00 ? 25  GLN A CA   3  
ATOM 4678  C C    . GLN A 1 25  ? -35.808 -9.815  -18.759 1.00 0.00 ? 25  GLN A C    3  
ATOM 4679  O O    . GLN A 1 25  ? -36.858 -9.185  -18.894 1.00 0.00 ? 25  GLN A O    3  
ATOM 4680  C CB   . GLN A 1 25  ? -34.679 -11.075 -20.663 1.00 0.00 ? 25  GLN A CB   3  
ATOM 4681  C CG   . GLN A 1 25  ? -33.760 -10.985 -21.896 1.00 0.00 ? 25  GLN A CG   3  
ATOM 4682  C CD   . GLN A 1 25  ? -33.744 -12.257 -22.748 1.00 0.00 ? 25  GLN A CD   3  
ATOM 4683  O OE1  . GLN A 1 25  ? -34.411 -13.252 -22.486 1.00 0.00 ? 25  GLN A OE1  3  
ATOM 4684  N NE2  . GLN A 1 25  ? -32.975 -12.277 -23.817 1.00 0.00 ? 25  GLN A NE2  3  
ATOM 4685  H H    . GLN A 1 25  ? -32.924 -10.130 -18.785 1.00 0.00 ? 25  GLN A H    3  
ATOM 4686  H HA   . GLN A 1 25  ? -35.055 -8.986  -20.548 1.00 0.00 ? 25  GLN A HA   3  
ATOM 4687  H HB2  . GLN A 1 25  ? -34.338 -11.884 -20.020 1.00 0.00 ? 25  GLN A HB2  3  
ATOM 4688  H HB3  . GLN A 1 25  ? -35.689 -11.308 -20.995 1.00 0.00 ? 25  GLN A HB3  3  
ATOM 4689  H HG2  . GLN A 1 25  ? -34.088 -10.154 -22.523 1.00 0.00 ? 25  GLN A HG2  3  
ATOM 4690  H HG3  . GLN A 1 25  ? -32.739 -10.782 -21.575 1.00 0.00 ? 25  GLN A HG3  3  
ATOM 4691  H HE21 . GLN A 1 25  ? -32.414 -11.472 -24.058 1.00 0.00 ? 25  GLN A HE21 3  
ATOM 4692  H HE22 . GLN A 1 25  ? -32.961 -13.112 -24.383 1.00 0.00 ? 25  GLN A HE22 3  
ATOM 4693  N N    . SER A 1 26  ? -35.534 -10.492 -17.638 1.00 0.00 ? 26  SER A N    3  
ATOM 4694  C CA   . SER A 1 26  ? -36.431 -10.558 -16.462 1.00 0.00 ? 26  SER A CA   3  
ATOM 4695  C C    . SER A 1 26  ? -36.385 -9.311  -15.557 1.00 0.00 ? 26  SER A C    3  
ATOM 4696  O O    . SER A 1 26  ? -37.018 -9.298  -14.494 1.00 0.00 ? 26  SER A O    3  
ATOM 4697  C CB   . SER A 1 26  ? -36.144 -11.815 -15.624 1.00 0.00 ? 26  SER A CB   3  
ATOM 4698  O OG   . SER A 1 26  ? -36.306 -12.993 -16.389 1.00 0.00 ? 26  SER A OG   3  
ATOM 4699  H H    . SER A 1 26  ? -34.719 -11.096 -17.646 1.00 0.00 ? 26  SER A H    3  
ATOM 4700  H HA   . SER A 1 26  ? -37.457 -10.640 -16.822 1.00 0.00 ? 26  SER A HA   3  
ATOM 4701  H HB2  . SER A 1 26  ? -35.126 -11.772 -15.230 1.00 0.00 ? 26  SER A HB2  3  
ATOM 4702  H HB3  . SER A 1 26  ? -36.841 -11.852 -14.784 1.00 0.00 ? 26  SER A HB3  3  
ATOM 4703  H HG   . SER A 1 26  ? -35.483 -13.085 -16.932 1.00 0.00 ? 26  SER A HG   3  
ATOM 4704  N N    . ARG A 1 27  ? -35.618 -8.274  -15.918 1.00 0.00 ? 27  ARG A N    3  
ATOM 4705  C CA   . ARG A 1 27  ? -35.363 -7.071  -15.102 1.00 0.00 ? 27  ARG A CA   3  
ATOM 4706  C C    . ARG A 1 27  ? -35.820 -5.769  -15.779 1.00 0.00 ? 27  ARG A C    3  
ATOM 4707  O O    . ARG A 1 27  ? -35.881 -5.681  -17.004 1.00 0.00 ? 27  ARG A O    3  
ATOM 4708  C CB   . ARG A 1 27  ? -33.887 -7.079  -14.667 1.00 0.00 ? 27  ARG A CB   3  
ATOM 4709  C CG   . ARG A 1 27  ? -33.586 -8.239  -13.695 1.00 0.00 ? 27  ARG A CG   3  
ATOM 4710  C CD   . ARG A 1 27  ? -34.236 -7.997  -12.332 1.00 0.00 ? 27  ARG A CD   3  
ATOM 4711  N NE   . ARG A 1 27  ? -34.021 -9.080  -11.358 1.00 0.00 ? 27  ARG A NE   3  
ATOM 4712  C CZ   . ARG A 1 27  ? -34.644 -10.240 -11.287 1.00 0.00 ? 27  ARG A CZ   3  
ATOM 4713  N NH1  . ARG A 1 27  ? -35.544 -10.620 -12.154 1.00 0.00 ? 27  ARG A NH1  3  
ATOM 4714  N NH2  . ARG A 1 27  ? -34.384 -11.046 -10.299 1.00 0.00 ? 27  ARG A NH2  3  
ATOM 4715  H H    . ARG A 1 27  ? -35.108 -8.356  -16.786 1.00 0.00 ? 27  ARG A H    3  
ATOM 4716  H HA   . ARG A 1 27  ? -35.978 -7.131  -14.209 1.00 0.00 ? 27  ARG A HA   3  
ATOM 4717  H HB2  . ARG A 1 27  ? -33.252 -7.180  -15.549 1.00 0.00 ? 27  ARG A HB2  3  
ATOM 4718  H HB3  . ARG A 1 27  ? -33.636 -6.134  -14.180 1.00 0.00 ? 27  ARG A HB3  3  
ATOM 4719  H HG2  . ARG A 1 27  ? -33.959 -9.184  -14.086 1.00 0.00 ? 27  ARG A HG2  3  
ATOM 4720  H HG3  . ARG A 1 27  ? -32.509 -8.316  -13.576 1.00 0.00 ? 27  ARG A HG3  3  
ATOM 4721  H HD2  . ARG A 1 27  ? -33.810 -7.077  -11.934 1.00 0.00 ? 27  ARG A HD2  3  
ATOM 4722  H HD3  . ARG A 1 27  ? -35.310 -7.853  -12.447 1.00 0.00 ? 27  ARG A HD3  3  
ATOM 4723  H HE   . ARG A 1 27  ? -33.514 -8.814  -10.519 1.00 0.00 ? 27  ARG A HE   3  
ATOM 4724  H HH11 . ARG A 1 27  ? -35.830 -9.991  -12.888 1.00 0.00 ? 27  ARG A HH11 3  
ATOM 4725  H HH12 . ARG A 1 27  ? -36.033 -11.489 -12.028 1.00 0.00 ? 27  ARG A HH12 3  
ATOM 4726  H HH21 . ARG A 1 27  ? -33.740 -10.757 -9.581  1.00 0.00 ? 27  ARG A HH21 3  
ATOM 4727  H HH22 . ARG A 1 27  ? -34.856 -11.929 -10.217 1.00 0.00 ? 27  ARG A HH22 3  
ATOM 4728  N N    . LYS A 1 28  ? -36.185 -4.780  -14.950 1.00 0.00 ? 28  LYS A N    3  
ATOM 4729  C CA   . LYS A 1 28  ? -36.899 -3.541  -15.325 1.00 0.00 ? 28  LYS A CA   3  
ATOM 4730  C C    . LYS A 1 28  ? -36.264 -2.308  -14.678 1.00 0.00 ? 28  LYS A C    3  
ATOM 4731  O O    . LYS A 1 28  ? -35.832 -2.394  -13.526 1.00 0.00 ? 28  LYS A O    3  
ATOM 4732  C CB   . LYS A 1 28  ? -38.379 -3.656  -14.895 1.00 0.00 ? 28  LYS A CB   3  
ATOM 4733  C CG   . LYS A 1 28  ? -39.102 -4.944  -15.346 1.00 0.00 ? 28  LYS A CG   3  
ATOM 4734  C CD   . LYS A 1 28  ? -39.115 -6.066  -14.293 1.00 0.00 ? 28  LYS A CD   3  
ATOM 4735  C CE   . LYS A 1 28  ? -40.037 -7.196  -14.768 1.00 0.00 ? 28  LYS A CE   3  
ATOM 4736  N NZ   . LYS A 1 28  ? -39.790 -8.466  -14.031 1.00 0.00 ? 28  LYS A NZ   3  
ATOM 4737  H H    . LYS A 1 28  ? -36.001 -4.912  -13.966 1.00 0.00 ? 28  LYS A H    3  
ATOM 4738  H HA   . LYS A 1 28  ? -36.852 -3.409  -16.408 1.00 0.00 ? 28  LYS A HA   3  
ATOM 4739  H HB2  . LYS A 1 28  ? -38.450 -3.563  -13.813 1.00 0.00 ? 28  LYS A HB2  3  
ATOM 4740  H HB3  . LYS A 1 28  ? -38.914 -2.799  -15.300 1.00 0.00 ? 28  LYS A HB3  3  
ATOM 4741  H HG2  . LYS A 1 28  ? -40.136 -4.702  -15.562 1.00 0.00 ? 28  LYS A HG2  3  
ATOM 4742  H HG3  . LYS A 1 28  ? -38.665 -5.310  -16.275 1.00 0.00 ? 28  LYS A HG3  3  
ATOM 4743  H HD2  . LYS A 1 28  ? -38.109 -6.450  -14.153 1.00 0.00 ? 28  LYS A HD2  3  
ATOM 4744  H HD3  . LYS A 1 28  ? -39.479 -5.680  -13.340 1.00 0.00 ? 28  LYS A HD3  3  
ATOM 4745  H HE2  . LYS A 1 28  ? -41.077 -6.879  -14.640 1.00 0.00 ? 28  LYS A HE2  3  
ATOM 4746  H HE3  . LYS A 1 28  ? -39.876 -7.342  -15.839 1.00 0.00 ? 28  LYS A HE3  3  
ATOM 4747  H HZ1  . LYS A 1 28  ? -38.831 -8.787  -14.151 1.00 0.00 ? 28  LYS A HZ1  3  
ATOM 4748  H HZ2  . LYS A 1 28  ? -39.962 -8.363  -13.040 1.00 0.00 ? 28  LYS A HZ2  3  
ATOM 4749  H HZ3  . LYS A 1 28  ? -40.397 -9.203  -14.368 1.00 0.00 ? 28  LYS A HZ3  3  
ATOM 4750  N N    . PHE A 1 29  ? -36.216 -1.164  -15.375 1.00 0.00 ? 29  PHE A N    3  
ATOM 4751  C CA   . PHE A 1 29  ? -35.431 -0.004  -14.912 1.00 0.00 ? 29  PHE A CA   3  
ATOM 4752  C C    . PHE A 1 29  ? -35.658 1.314   -15.675 1.00 0.00 ? 29  PHE A C    3  
ATOM 4753  O O    . PHE A 1 29  ? -36.150 1.367   -16.808 1.00 0.00 ? 29  PHE A O    3  
ATOM 4754  C CB   . PHE A 1 29  ? -33.920 -0.341  -14.948 1.00 0.00 ? 29  PHE A CB   3  
ATOM 4755  C CG   . PHE A 1 29  ? -33.327 -0.652  -16.313 1.00 0.00 ? 29  PHE A CG   3  
ATOM 4756  C CD1  . PHE A 1 29  ? -33.366 -1.967  -16.817 1.00 0.00 ? 29  PHE A CD1  3  
ATOM 4757  C CD2  . PHE A 1 29  ? -32.685 0.358   -17.055 1.00 0.00 ? 29  PHE A CD2  3  
ATOM 4758  C CE1  . PHE A 1 29  ? -32.775 -2.270  -18.057 1.00 0.00 ? 29  PHE A CE1  3  
ATOM 4759  C CE2  . PHE A 1 29  ? -32.085 0.053   -18.292 1.00 0.00 ? 29  PHE A CE2  3  
ATOM 4760  C CZ   . PHE A 1 29  ? -32.130 -1.261  -18.791 1.00 0.00 ? 29  PHE A CZ   3  
ATOM 4761  H H    . PHE A 1 29  ? -36.675 -1.107  -16.278 1.00 0.00 ? 29  PHE A H    3  
ATOM 4762  H HA   . PHE A 1 29  ? -35.703 0.188   -13.872 1.00 0.00 ? 29  PHE A HA   3  
ATOM 4763  H HB2  . PHE A 1 29  ? -33.361 0.487   -14.511 1.00 0.00 ? 29  PHE A HB2  3  
ATOM 4764  H HB3  . PHE A 1 29  ? -33.727 -1.193  -14.302 1.00 0.00 ? 29  PHE A HB3  3  
ATOM 4765  H HD1  . PHE A 1 29  ? -33.834 -2.755  -16.245 1.00 0.00 ? 29  PHE A HD1  3  
ATOM 4766  H HD2  . PHE A 1 29  ? -32.638 1.368   -16.669 1.00 0.00 ? 29  PHE A HD2  3  
ATOM 4767  H HE1  . PHE A 1 29  ? -32.807 -3.281  -18.440 1.00 0.00 ? 29  PHE A HE1  3  
ATOM 4768  H HE2  . PHE A 1 29  ? -31.587 0.826   -18.860 1.00 0.00 ? 29  PHE A HE2  3  
ATOM 4769  H HZ   . PHE A 1 29  ? -31.667 -1.495  -19.741 1.00 0.00 ? 29  PHE A HZ   3  
ATOM 4770  N N    . ILE A 1 30  ? -35.231 2.387   -15.007 1.00 0.00 ? 30  ILE A N    3  
ATOM 4771  C CA   . ILE A 1 30  ? -35.132 3.769   -15.486 1.00 0.00 ? 30  ILE A CA   3  
ATOM 4772  C C    . ILE A 1 30  ? -33.705 4.300   -15.352 1.00 0.00 ? 30  ILE A C    3  
ATOM 4773  O O    . ILE A 1 30  ? -32.868 3.686   -14.699 1.00 0.00 ? 30  ILE A O    3  
ATOM 4774  C CB   . ILE A 1 30  ? -36.123 4.690   -14.739 1.00 0.00 ? 30  ILE A CB   3  
ATOM 4775  C CG1  . ILE A 1 30  ? -36.251 4.471   -13.214 1.00 0.00 ? 30  ILE A CG1  3  
ATOM 4776  C CG2  . ILE A 1 30  ? -37.488 4.538   -15.411 1.00 0.00 ? 30  ILE A CG2  3  
ATOM 4777  C CD1  . ILE A 1 30  ? -34.939 4.590   -12.425 1.00 0.00 ? 30  ILE A CD1  3  
ATOM 4778  H H    . ILE A 1 30  ? -34.826 2.222   -14.097 1.00 0.00 ? 30  ILE A H    3  
ATOM 4779  H HA   . ILE A 1 30  ? -35.361 3.793   -16.549 1.00 0.00 ? 30  ILE A HA   3  
ATOM 4780  H HB   . ILE A 1 30  ? -35.817 5.725   -14.895 1.00 0.00 ? 30  ILE A HB   3  
ATOM 4781  H HG12 . ILE A 1 30  ? -36.939 5.224   -12.823 1.00 0.00 ? 30  ILE A HG12 3  
ATOM 4782  H HG13 . ILE A 1 30  ? -36.687 3.492   -13.015 1.00 0.00 ? 30  ILE A HG13 3  
ATOM 4783  H HG21 . ILE A 1 30  ? -37.853 3.518   -15.290 1.00 0.00 ? 30  ILE A HG21 3  
ATOM 4784  H HG22 . ILE A 1 30  ? -38.195 5.238   -14.967 1.00 0.00 ? 30  ILE A HG22 3  
ATOM 4785  H HG23 . ILE A 1 30  ? -37.377 4.762   -16.470 1.00 0.00 ? 30  ILE A HG23 3  
ATOM 4786  H HD11 . ILE A 1 30  ? -35.165 4.648   -11.360 1.00 0.00 ? 30  ILE A HD11 3  
ATOM 4787  H HD12 . ILE A 1 30  ? -34.303 3.719   -12.602 1.00 0.00 ? 30  ILE A HD12 3  
ATOM 4788  H HD13 . ILE A 1 30  ? -34.409 5.494   -12.720 1.00 0.00 ? 30  ILE A HD13 3  
ATOM 4789  N N    . ILE A 1 31  ? -33.446 5.454   -15.960 1.00 0.00 ? 31  ILE A N    3  
ATOM 4790  C CA   . ILE A 1 31  ? -32.182 6.184   -15.923 1.00 0.00 ? 31  ILE A CA   3  
ATOM 4791  C C    . ILE A 1 31  ? -32.469 7.617   -15.516 1.00 0.00 ? 31  ILE A C    3  
ATOM 4792  O O    . ILE A 1 31  ? -33.247 8.311   -16.176 1.00 0.00 ? 31  ILE A O    3  
ATOM 4793  C CB   . ILE A 1 31  ? -31.481 6.207   -17.295 1.00 0.00 ? 31  ILE A CB   3  
ATOM 4794  C CG1  . ILE A 1 31  ? -31.549 4.875   -18.069 1.00 0.00 ? 31  ILE A CG1  3  
ATOM 4795  C CG2  . ILE A 1 31  ? -30.034 6.696   -17.105 1.00 0.00 ? 31  ILE A CG2  3  
ATOM 4796  C CD1  . ILE A 1 31  ? -30.710 3.785   -17.420 1.00 0.00 ? 31  ILE A CD1  3  
ATOM 4797  H H    . ILE A 1 31  ? -34.188 5.884   -16.503 1.00 0.00 ? 31  ILE A H    3  
ATOM 4798  H HA   . ILE A 1 31  ? -31.523 5.728   -15.185 1.00 0.00 ? 31  ILE A HA   3  
ATOM 4799  H HB   . ILE A 1 31  ? -31.990 6.945   -17.910 1.00 0.00 ? 31  ILE A HB   3  
ATOM 4800  H HG12 . ILE A 1 31  ? -32.595 4.545   -18.145 1.00 0.00 ? 31  ILE A HG12 3  
ATOM 4801  H HG13 . ILE A 1 31  ? -31.162 5.029   -19.073 1.00 0.00 ? 31  ILE A HG13 3  
ATOM 4802  H HG21 . ILE A 1 31  ? -29.507 6.061   -16.391 1.00 0.00 ? 31  ILE A HG21 3  
ATOM 4803  H HG22 . ILE A 1 31  ? -29.511 6.684   -18.062 1.00 0.00 ? 31  ILE A HG22 3  
ATOM 4804  H HG23 . ILE A 1 31  ? -30.032 7.714   -16.720 1.00 0.00 ? 31  ILE A HG23 3  
ATOM 4805  H HD11 . ILE A 1 31  ? -30.945 2.826   -17.873 1.00 0.00 ? 31  ILE A HD11 3  
ATOM 4806  H HD12 . ILE A 1 31  ? -29.654 4.005   -17.572 1.00 0.00 ? 31  ILE A HD12 3  
ATOM 4807  H HD13 . ILE A 1 31  ? -30.924 3.770   -16.357 1.00 0.00 ? 31  ILE A HD13 3  
ATOM 4808  N N    . ALA A 1 32  ? -31.801 8.066   -14.461 1.00 0.00 ? 32  ALA A N    3  
ATOM 4809  C CA   . ALA A 1 32  ? -32.000 9.406   -13.910 1.00 0.00 ? 32  ALA A CA   3  
ATOM 4810  C C    . ALA A 1 32  ? -30.716 10.127  -13.503 1.00 0.00 ? 32  ALA A C    3  
ATOM 4811  O O    . ALA A 1 32  ? -29.716 9.501   -13.145 1.00 0.00 ? 32  ALA A O    3  
ATOM 4812  C CB   . ALA A 1 32  ? -32.992 9.340   -12.749 1.00 0.00 ? 32  ALA A CB   3  
ATOM 4813  H H    . ALA A 1 32  ? -31.217 7.390   -13.968 1.00 0.00 ? 32  ALA A H    3  
ATOM 4814  H HA   . ALA A 1 32  ? -32.446 10.022  -14.684 1.00 0.00 ? 32  ALA A HA   3  
ATOM 4815  H HB1  . ALA A 1 32  ? -32.708 8.562   -12.048 1.00 0.00 ? 32  ALA A HB1  3  
ATOM 4816  H HB2  . ALA A 1 32  ? -33.020 10.293  -12.219 1.00 0.00 ? 32  ALA A HB2  3  
ATOM 4817  H HB3  . ALA A 1 32  ? -33.981 9.120   -13.145 1.00 0.00 ? 32  ALA A HB3  3  
ATOM 4818  N N    . ASN A 1 33  ? -30.774 11.463  -13.508 1.00 0.00 ? 33  ASN A N    3  
ATOM 4819  C CA   . ASN A 1 33  ? -29.677 12.295  -12.997 1.00 0.00 ? 33  ASN A CA   3  
ATOM 4820  C C    . ASN A 1 33  ? -29.678 12.343  -11.453 1.00 0.00 ? 33  ASN A C    3  
ATOM 4821  O O    . ASN A 1 33  ? -30.512 13.001  -10.831 1.00 0.00 ? 33  ASN A O    3  
ATOM 4822  C CB   . ASN A 1 33  ? -29.635 13.683  -13.684 1.00 0.00 ? 33  ASN A CB   3  
ATOM 4823  C CG   . ASN A 1 33  ? -30.951 14.427  -13.854 1.00 0.00 ? 33  ASN A CG   3  
ATOM 4824  O OD1  . ASN A 1 33  ? -31.989 14.097  -13.310 1.00 0.00 ? 33  ASN A OD1  3  
ATOM 4825  N ND2  . ASN A 1 33  ? -30.947 15.476  -14.645 1.00 0.00 ? 33  ASN A ND2  3  
ATOM 4826  H H    . ASN A 1 33  ? -31.667 11.906  -13.743 1.00 0.00 ? 33  ASN A H    3  
ATOM 4827  H HA   . ASN A 1 33  ? -28.741 11.810  -13.279 1.00 0.00 ? 33  ASN A HA   3  
ATOM 4828  H HB2  . ASN A 1 33  ? -28.952 14.331  -13.134 1.00 0.00 ? 33  ASN A HB2  3  
ATOM 4829  H HB3  . ASN A 1 33  ? -29.216 13.569  -14.680 1.00 0.00 ? 33  ASN A HB3  3  
ATOM 4830  H HD21 . ASN A 1 33  ? -30.102 15.762  -15.115 1.00 0.00 ? 33  ASN A HD21 3  
ATOM 4831  H HD22 . ASN A 1 33  ? -31.817 15.962  -14.789 1.00 0.00 ? 33  ASN A HD22 3  
ATOM 4832  N N    . ALA A 1 34  ? -28.702 11.676  -10.822 1.00 0.00 ? 34  ALA A N    3  
ATOM 4833  C CA   . ALA A 1 34  ? -28.558 11.623  -9.356  1.00 0.00 ? 34  ALA A CA   3  
ATOM 4834  C C    . ALA A 1 34  ? -28.126 12.959  -8.725  1.00 0.00 ? 34  ALA A C    3  
ATOM 4835  O O    . ALA A 1 34  ? -28.275 13.163  -7.519  1.00 0.00 ? 34  ALA A O    3  
ATOM 4836  C CB   . ALA A 1 34  ? -27.528 10.542  -9.004  1.00 0.00 ? 34  ALA A CB   3  
ATOM 4837  H H    . ALA A 1 34  ? -28.045 11.146  -11.377 1.00 0.00 ? 34  ALA A H    3  
ATOM 4838  H HA   . ALA A 1 34  ? -29.516 11.349  -8.917  1.00 0.00 ? 34  ALA A HA   3  
ATOM 4839  H HB1  . ALA A 1 34  ? -26.547 10.809  -9.393  1.00 0.00 ? 34  ALA A HB1  3  
ATOM 4840  H HB2  . ALA A 1 34  ? -27.446 10.452  -7.918  1.00 0.00 ? 34  ALA A HB2  3  
ATOM 4841  H HB3  . ALA A 1 34  ? -27.836 9.581   -9.411  1.00 0.00 ? 34  ALA A HB3  3  
ATOM 4842  N N    . ARG A 1 35  ? -27.553 13.858  -9.538  1.00 0.00 ? 35  ARG A N    3  
ATOM 4843  C CA   . ARG A 1 35  ? -26.886 15.095  -9.086  1.00 0.00 ? 35  ARG A CA   3  
ATOM 4844  C C    . ARG A 1 35  ? -27.793 16.335  -9.101  1.00 0.00 ? 35  ARG A C    3  
ATOM 4845  O O    . ARG A 1 35  ? -27.326 17.433  -8.793  1.00 0.00 ? 35  ARG A O    3  
ATOM 4846  C CB   . ARG A 1 35  ? -25.583 15.318  -9.883  1.00 0.00 ? 35  ARG A CB   3  
ATOM 4847  C CG   . ARG A 1 35  ? -24.634 14.107  -9.992  1.00 0.00 ? 35  ARG A CG   3  
ATOM 4848  C CD   . ARG A 1 35  ? -24.371 13.330  -8.692  1.00 0.00 ? 35  ARG A CD   3  
ATOM 4849  N NE   . ARG A 1 35  ? -23.873 14.178  -7.593  1.00 0.00 ? 35  ARG A NE   3  
ATOM 4850  C CZ   . ARG A 1 35  ? -23.639 13.777  -6.357  1.00 0.00 ? 35  ARG A CZ   3  
ATOM 4851  N NH1  . ARG A 1 35  ? -23.793 12.535  -5.985  1.00 0.00 ? 35  ARG A NH1  3  
ATOM 4852  N NH2  . ARG A 1 35  ? -23.239 14.628  -5.456  1.00 0.00 ? 35  ARG A NH2  3  
ATOM 4853  H H    . ARG A 1 35  ? -27.506 13.615  -10.518 1.00 0.00 ? 35  ARG A H    3  
ATOM 4854  H HA   . ARG A 1 35  ? -26.607 14.970  -8.037  1.00 0.00 ? 35  ARG A HA   3  
ATOM 4855  H HB2  . ARG A 1 35  ? -25.839 15.636  -10.895 1.00 0.00 ? 35  ARG A HB2  3  
ATOM 4856  H HB3  . ARG A 1 35  ? -25.033 16.138  -9.417  1.00 0.00 ? 35  ARG A HB3  3  
ATOM 4857  H HG2  . ARG A 1 35  ? -25.045 13.407  -10.721 1.00 0.00 ? 35  ARG A HG2  3  
ATOM 4858  H HG3  . ARG A 1 35  ? -23.678 14.457  -10.386 1.00 0.00 ? 35  ARG A HG3  3  
ATOM 4859  H HD2  . ARG A 1 35  ? -25.290 12.833  -8.380  1.00 0.00 ? 35  ARG A HD2  3  
ATOM 4860  H HD3  . ARG A 1 35  ? -23.626 12.564  -8.903  1.00 0.00 ? 35  ARG A HD3  3  
ATOM 4861  H HE   . ARG A 1 35  ? -23.693 15.148  -7.798  1.00 0.00 ? 35  ARG A HE   3  
ATOM 4862  H HH11 . ARG A 1 35  ? -24.064 11.837  -6.669  1.00 0.00 ? 35  ARG A HH11 3  
ATOM 4863  H HH12 . ARG A 1 35  ? -23.621 12.264  -5.034  1.00 0.00 ? 35  ARG A HH12 3  
ATOM 4864  H HH21 . ARG A 1 35  ? -23.107 15.597  -5.696  1.00 0.00 ? 35  ARG A HH21 3  
ATOM 4865  H HH22 . ARG A 1 35  ? -23.059 14.324  -4.514  1.00 0.00 ? 35  ARG A HH22 3  
ATOM 4866  N N    . VAL A 1 36  ? -29.071 16.177  -9.461  1.00 0.00 ? 36  VAL A N    3  
ATOM 4867  C CA   . VAL A 1 36  ? -30.062 17.260  -9.581  1.00 0.00 ? 36  VAL A CA   3  
ATOM 4868  C C    . VAL A 1 36  ? -31.157 17.107  -8.517  1.00 0.00 ? 36  VAL A C    3  
ATOM 4869  O O    . VAL A 1 36  ? -31.620 15.997  -8.244  1.00 0.00 ? 36  VAL A O    3  
ATOM 4870  C CB   . VAL A 1 36  ? -30.613 17.325  -11.024 1.00 0.00 ? 36  VAL A CB   3  
ATOM 4871  C CG1  . VAL A 1 36  ? -31.855 16.467  -11.276 1.00 0.00 ? 36  VAL A CG1  3  
ATOM 4872  C CG2  . VAL A 1 36  ? -30.925 18.751  -11.462 1.00 0.00 ? 36  VAL A CG2  3  
ATOM 4873  H H    . VAL A 1 36  ? -29.386 15.238  -9.657  1.00 0.00 ? 36  VAL A H    3  
ATOM 4874  H HA   . VAL A 1 36  ? -29.556 18.207  -9.388  1.00 0.00 ? 36  VAL A HA   3  
ATOM 4875  H HB   . VAL A 1 36  ? -29.830 16.966  -11.696 1.00 0.00 ? 36  VAL A HB   3  
ATOM 4876  H HG11 . VAL A 1 36  ? -31.653 15.432  -11.000 1.00 0.00 ? 36  VAL A HG11 3  
ATOM 4877  H HG12 . VAL A 1 36  ? -32.702 16.843  -10.708 1.00 0.00 ? 36  VAL A HG12 3  
ATOM 4878  H HG13 . VAL A 1 36  ? -32.122 16.516  -12.330 1.00 0.00 ? 36  VAL A HG13 3  
ATOM 4879  H HG21 . VAL A 1 36  ? -30.030 19.364  -11.361 1.00 0.00 ? 36  VAL A HG21 3  
ATOM 4880  H HG22 . VAL A 1 36  ? -31.213 18.735  -12.515 1.00 0.00 ? 36  VAL A HG22 3  
ATOM 4881  H HG23 . VAL A 1 36  ? -31.733 19.168  -10.862 1.00 0.00 ? 36  VAL A HG23 3  
ATOM 4882  N N    . GLU A 1 37  ? -31.604 18.215  -7.920  1.00 0.00 ? 37  GLU A N    3  
ATOM 4883  C CA   . GLU A 1 37  ? -32.592 18.209  -6.821  1.00 0.00 ? 37  GLU A CA   3  
ATOM 4884  C C    . GLU A 1 37  ? -33.958 17.599  -7.198  1.00 0.00 ? 37  GLU A C    3  
ATOM 4885  O O    . GLU A 1 37  ? -34.686 17.105  -6.335  1.00 0.00 ? 37  GLU A O    3  
ATOM 4886  C CB   . GLU A 1 37  ? -32.758 19.635  -6.271  1.00 0.00 ? 37  GLU A CB   3  
ATOM 4887  C CG   . GLU A 1 37  ? -33.347 20.641  -7.273  1.00 0.00 ? 37  GLU A CG   3  
ATOM 4888  C CD   . GLU A 1 37  ? -33.434 22.049  -6.653  1.00 0.00 ? 37  GLU A CD   3  
ATOM 4889  O OE1  . GLU A 1 37  ? -34.475 22.385  -6.036  1.00 0.00 ? 37  GLU A OE1  3  
ATOM 4890  O OE2  . GLU A 1 37  ? -32.464 22.836  -6.781  1.00 0.00 ? 37  GLU A OE2  3  
ATOM 4891  H H    . GLU A 1 37  ? -31.182 19.099  -8.171  1.00 0.00 ? 37  GLU A H    3  
ATOM 4892  H HA   . GLU A 1 37  ? -32.192 17.594  -6.012  1.00 0.00 ? 37  GLU A HA   3  
ATOM 4893  H HB2  . GLU A 1 37  ? -33.409 19.592  -5.399  1.00 0.00 ? 37  GLU A HB2  3  
ATOM 4894  H HB3  . GLU A 1 37  ? -31.781 19.994  -5.947  1.00 0.00 ? 37  GLU A HB3  3  
ATOM 4895  H HG2  . GLU A 1 37  ? -32.723 20.671  -8.169  1.00 0.00 ? 37  GLU A HG2  3  
ATOM 4896  H HG3  . GLU A 1 37  ? -34.344 20.310  -7.574  1.00 0.00 ? 37  GLU A HG3  3  
ATOM 4897  N N    . ASN A 1 38  ? -34.290 17.602  -8.494  1.00 0.00 ? 38  ASN A N    3  
ATOM 4898  C CA   . ASN A 1 38  ? -35.513 17.024  -9.057  1.00 0.00 ? 38  ASN A CA   3  
ATOM 4899  C C    . ASN A 1 38  ? -35.406 15.516  -9.396  1.00 0.00 ? 38  ASN A C    3  
ATOM 4900  O O    . ASN A 1 38  ? -36.422 14.911  -9.730  1.00 0.00 ? 38  ASN A O    3  
ATOM 4901  C CB   . ASN A 1 38  ? -35.918 17.890  -10.267 1.00 0.00 ? 38  ASN A CB   3  
ATOM 4902  C CG   . ASN A 1 38  ? -37.346 17.643  -10.734 1.00 0.00 ? 38  ASN A CG   3  
ATOM 4903  O OD1  . ASN A 1 38  ? -37.599 17.088  -11.792 1.00 0.00 ? 38  ASN A OD1  3  
ATOM 4904  N ND2  . ASN A 1 38  ? -38.327 18.079  -9.974  1.00 0.00 ? 38  ASN A ND2  3  
ATOM 4905  H H    . ASN A 1 38  ? -33.656 18.077  -9.119  1.00 0.00 ? 38  ASN A H    3  
ATOM 4906  H HA   . ASN A 1 38  ? -36.301 17.109  -8.305  1.00 0.00 ? 38  ASN A HA   3  
ATOM 4907  H HB2  . ASN A 1 38  ? -35.837 18.945  -10.001 1.00 0.00 ? 38  ASN A HB2  3  
ATOM 4908  H HB3  . ASN A 1 38  ? -35.239 17.697  -11.098 1.00 0.00 ? 38  ASN A HB3  3  
ATOM 4909  H HD21 . ASN A 1 38  ? -38.134 18.568  -9.115  1.00 0.00 ? 38  ASN A HD21 3  
ATOM 4910  H HD22 . ASN A 1 38  ? -39.274 17.938  -10.292 1.00 0.00 ? 38  ASN A HD22 3  
ATOM 4911  N N    . CYS A 1 39  ? -34.211 14.904  -9.303  1.00 0.00 ? 39  CYS A N    3  
ATOM 4912  C CA   . CYS A 1 39  ? -33.923 13.475  -9.549  1.00 0.00 ? 39  CYS A CA   3  
ATOM 4913  C C    . CYS A 1 39  ? -34.614 12.865  -10.796 1.00 0.00 ? 39  CYS A C    3  
ATOM 4914  O O    . CYS A 1 39  ? -35.172 11.764  -10.747 1.00 0.00 ? 39  CYS A O    3  
ATOM 4915  C CB   . CYS A 1 39  ? -34.116 12.671  -8.246  1.00 0.00 ? 39  CYS A CB   3  
ATOM 4916  S SG   . CYS A 1 39  ? -35.853 12.528  -7.725  1.00 0.00 ? 39  CYS A SG   3  
ATOM 4917  H H    . CYS A 1 39  ? -33.431 15.462  -8.969  1.00 0.00 ? 39  CYS A H    3  
ATOM 4918  H HA   . CYS A 1 39  ? -32.858 13.422  -9.777  1.00 0.00 ? 39  CYS A HA   3  
ATOM 4919  H HB2  . CYS A 1 39  ? -33.726 11.666  -8.394  1.00 0.00 ? 39  CYS A HB2  3  
ATOM 4920  H HB3  . CYS A 1 39  ? -33.544 13.145  -7.447  1.00 0.00 ? 39  CYS A HB3  3  
ATOM 4921  H HG   . CYS A 1 39  ? -36.203 13.799  -7.980  1.00 0.00 ? 39  CYS A HG   3  
ATOM 4922  N N    . ALA A 1 40  ? -34.615 13.591  -11.918 1.00 0.00 ? 40  ALA A N    3  
ATOM 4923  C CA   . ALA A 1 40  ? -35.443 13.265  -13.076 1.00 0.00 ? 40  ALA A CA   3  
ATOM 4924  C C    . ALA A 1 40  ? -34.926 12.124  -13.979 1.00 0.00 ? 40  ALA A C    3  
ATOM 4925  O O    . ALA A 1 40  ? -33.722 11.928  -14.174 1.00 0.00 ? 40  ALA A O    3  
ATOM 4926  C CB   . ALA A 1 40  ? -35.720 14.545  -13.871 1.00 0.00 ? 40  ALA A CB   3  
ATOM 4927  H H    . ALA A 1 40  ? -34.054 14.429  -11.958 1.00 0.00 ? 40  ALA A H    3  
ATOM 4928  H HA   . ALA A 1 40  ? -36.400 12.940  -12.676 1.00 0.00 ? 40  ALA A HA   3  
ATOM 4929  H HB1  . ALA A 1 40  ? -36.433 14.334  -14.667 1.00 0.00 ? 40  ALA A HB1  3  
ATOM 4930  H HB2  . ALA A 1 40  ? -36.154 15.300  -13.216 1.00 0.00 ? 40  ALA A HB2  3  
ATOM 4931  H HB3  . ALA A 1 40  ? -34.793 14.925  -14.304 1.00 0.00 ? 40  ALA A HB3  3  
ATOM 4932  N N    . VAL A 1 41  ? -35.891 11.428  -14.596 1.00 0.00 ? 41  VAL A N    3  
ATOM 4933  C CA   . VAL A 1 41  ? -35.756 10.283  -15.502 1.00 0.00 ? 41  VAL A CA   3  
ATOM 4934  C C    . VAL A 1 41  ? -35.391 10.790  -16.897 1.00 0.00 ? 41  VAL A C    3  
ATOM 4935  O O    . VAL A 1 41  ? -36.248 11.094  -17.727 1.00 0.00 ? 41  VAL A O    3  
ATOM 4936  C CB   . VAL A 1 41  ? -37.064 9.456   -15.503 1.00 0.00 ? 41  VAL A CB   3  
ATOM 4937  C CG1  . VAL A 1 41  ? -37.043 8.282   -16.490 1.00 0.00 ? 41  VAL A CG1  3  
ATOM 4938  C CG2  . VAL A 1 41  ? -37.342 8.834   -14.129 1.00 0.00 ? 41  VAL A CG2  3  
ATOM 4939  H H    . VAL A 1 41  ? -36.844 11.664  -14.357 1.00 0.00 ? 41  VAL A H    3  
ATOM 4940  H HA   . VAL A 1 41  ? -34.958 9.641   -15.142 1.00 0.00 ? 41  VAL A HA   3  
ATOM 4941  H HB   . VAL A 1 41  ? -37.894 10.114  -15.757 1.00 0.00 ? 41  VAL A HB   3  
ATOM 4942  H HG11 . VAL A 1 41  ? -36.939 8.634   -17.515 1.00 0.00 ? 41  VAL A HG11 3  
ATOM 4943  H HG12 . VAL A 1 41  ? -36.210 7.626   -16.248 1.00 0.00 ? 41  VAL A HG12 3  
ATOM 4944  H HG13 . VAL A 1 41  ? -37.973 7.720   -16.421 1.00 0.00 ? 41  VAL A HG13 3  
ATOM 4945  H HG21 . VAL A 1 41  ? -37.350 9.596   -13.352 1.00 0.00 ? 41  VAL A HG21 3  
ATOM 4946  H HG22 . VAL A 1 41  ? -38.320 8.352   -14.138 1.00 0.00 ? 41  VAL A HG22 3  
ATOM 4947  H HG23 . VAL A 1 41  ? -36.577 8.095   -13.894 1.00 0.00 ? 41  VAL A HG23 3  
ATOM 4948  N N    . ILE A 1 42  ? -34.090 10.900  -17.145 1.00 0.00 ? 42  ILE A N    3  
ATOM 4949  C CA   . ILE A 1 42  ? -33.509 11.278  -18.438 1.00 0.00 ? 42  ILE A CA   3  
ATOM 4950  C C    . ILE A 1 42  ? -33.683 10.181  -19.504 1.00 0.00 ? 42  ILE A C    3  
ATOM 4951  O O    . ILE A 1 42  ? -33.700 10.488  -20.697 1.00 0.00 ? 42  ILE A O    3  
ATOM 4952  C CB   . ILE A 1 42  ? -32.021 11.658  -18.261 1.00 0.00 ? 42  ILE A CB   3  
ATOM 4953  C CG1  . ILE A 1 42  ? -31.196 10.479  -17.695 1.00 0.00 ? 42  ILE A CG1  3  
ATOM 4954  C CG2  . ILE A 1 42  ? -31.901 12.915  -17.378 1.00 0.00 ? 42  ILE A CG2  3  
ATOM 4955  C CD1  . ILE A 1 42  ? -29.700 10.750  -17.585 1.00 0.00 ? 42  ILE A CD1  3  
ATOM 4956  H H    . ILE A 1 42  ? -33.458 10.640  -16.401 1.00 0.00 ? 42  ILE A H    3  
ATOM 4957  H HA   . ILE A 1 42  ? -34.037 12.158  -18.808 1.00 0.00 ? 42  ILE A HA   3  
ATOM 4958  H HB   . ILE A 1 42  ? -31.623 11.909  -19.247 1.00 0.00 ? 42  ILE A HB   3  
ATOM 4959  H HG12 . ILE A 1 42  ? -31.553 10.226  -16.702 1.00 0.00 ? 42  ILE A HG12 3  
ATOM 4960  H HG13 . ILE A 1 42  ? -31.319 9.607   -18.338 1.00 0.00 ? 42  ILE A HG13 3  
ATOM 4961  H HG21 . ILE A 1 42  ? -32.174 12.691  -16.347 1.00 0.00 ? 42  ILE A HG21 3  
ATOM 4962  H HG22 . ILE A 1 42  ? -30.879 13.294  -17.400 1.00 0.00 ? 42  ILE A HG22 3  
ATOM 4963  H HG23 . ILE A 1 42  ? -32.558 13.698  -17.757 1.00 0.00 ? 42  ILE A HG23 3  
ATOM 4964  H HD11 . ILE A 1 42  ? -29.204 9.824   -17.300 1.00 0.00 ? 42  ILE A HD11 3  
ATOM 4965  H HD12 . ILE A 1 42  ? -29.319 11.081  -18.550 1.00 0.00 ? 42  ILE A HD12 3  
ATOM 4966  H HD13 . ILE A 1 42  ? -29.513 11.501  -16.820 1.00 0.00 ? 42  ILE A HD13 3  
ATOM 4967  N N    . TYR A 1 43  ? -33.837 8.916   -19.088 1.00 0.00 ? 43  TYR A N    3  
ATOM 4968  C CA   . TYR A 1 43  ? -34.148 7.786   -19.989 1.00 0.00 ? 43  TYR A CA   3  
ATOM 4969  C C    . TYR A 1 43  ? -34.885 6.643   -19.279 1.00 0.00 ? 43  TYR A C    3  
ATOM 4970  O O    . TYR A 1 43  ? -34.862 6.547   -18.057 1.00 0.00 ? 43  TYR A O    3  
ATOM 4971  C CB   . TYR A 1 43  ? -32.887 7.280   -20.720 1.00 0.00 ? 43  TYR A CB   3  
ATOM 4972  C CG   . TYR A 1 43  ? -33.183 6.350   -21.885 1.00 0.00 ? 43  TYR A CG   3  
ATOM 4973  C CD1  . TYR A 1 43  ? -33.888 6.831   -23.006 1.00 0.00 ? 43  TYR A CD1  3  
ATOM 4974  C CD2  . TYR A 1 43  ? -32.794 4.995   -21.831 1.00 0.00 ? 43  TYR A CD2  3  
ATOM 4975  C CE1  . TYR A 1 43  ? -34.217 5.958   -24.061 1.00 0.00 ? 43  TYR A CE1  3  
ATOM 4976  C CE2  . TYR A 1 43  ? -33.110 4.123   -22.890 1.00 0.00 ? 43  TYR A CE2  3  
ATOM 4977  C CZ   . TYR A 1 43  ? -33.830 4.602   -24.005 1.00 0.00 ? 43  TYR A CZ   3  
ATOM 4978  O OH   . TYR A 1 43  ? -34.169 3.756   -25.017 1.00 0.00 ? 43  TYR A OH   3  
ATOM 4979  H H    . TYR A 1 43  ? -33.823 8.756   -18.077 1.00 0.00 ? 43  TYR A H    3  
ATOM 4980  H HA   . TYR A 1 43  ? -34.841 8.142   -20.743 1.00 0.00 ? 43  TYR A HA   3  
ATOM 4981  H HB2  . TYR A 1 43  ? -32.311 8.122   -21.095 1.00 0.00 ? 43  TYR A HB2  3  
ATOM 4982  H HB3  . TYR A 1 43  ? -32.242 6.767   -20.020 1.00 0.00 ? 43  TYR A HB3  3  
ATOM 4983  H HD1  . TYR A 1 43  ? -34.178 7.873   -23.059 1.00 0.00 ? 43  TYR A HD1  3  
ATOM 4984  H HD2  . TYR A 1 43  ? -32.257 4.614   -20.976 1.00 0.00 ? 43  TYR A HD2  3  
ATOM 4985  H HE1  . TYR A 1 43  ? -34.757 6.324   -24.924 1.00 0.00 ? 43  TYR A HE1  3  
ATOM 4986  H HE2  . TYR A 1 43  ? -32.815 3.085   -22.843 1.00 0.00 ? 43  TYR A HE2  3  
ATOM 4987  H HH   . TYR A 1 43  ? -33.735 2.890   -24.924 1.00 0.00 ? 43  TYR A HH   3  
ATOM 4988  N N    . CYS A 1 44  ? -35.573 5.782   -20.028 1.00 0.00 ? 44  CYS A N    3  
ATOM 4989  C CA   . CYS A 1 44  ? -36.370 4.685   -19.473 1.00 0.00 ? 44  CYS A CA   3  
ATOM 4990  C C    . CYS A 1 44  ? -36.309 3.412   -20.335 1.00 0.00 ? 44  CYS A C    3  
ATOM 4991  O O    . CYS A 1 44  ? -36.285 3.490   -21.566 1.00 0.00 ? 44  CYS A O    3  
ATOM 4992  C CB   . CYS A 1 44  ? -37.810 5.178   -19.246 1.00 0.00 ? 44  CYS A CB   3  
ATOM 4993  S SG   . CYS A 1 44  ? -38.480 5.985   -20.730 1.00 0.00 ? 44  CYS A SG   3  
ATOM 4994  H H    . CYS A 1 44  ? -35.521 5.855   -21.035 1.00 0.00 ? 44  CYS A H    3  
ATOM 4995  H HA   . CYS A 1 44  ? -35.951 4.425   -18.506 1.00 0.00 ? 44  CYS A HA   3  
ATOM 4996  H HB2  . CYS A 1 44  ? -38.448 4.338   -18.962 1.00 0.00 ? 44  CYS A HB2  3  
ATOM 4997  H HB3  . CYS A 1 44  ? -37.812 5.904   -18.431 1.00 0.00 ? 44  CYS A HB3  3  
ATOM 4998  H HG   . CYS A 1 44  ? -37.575 6.973   -20.787 1.00 0.00 ? 44  CYS A HG   3  
ATOM 4999  N N    . ASN A 1 45  ? -36.297 2.233   -19.697 1.00 0.00 ? 45  ASN A N    3  
ATOM 5000  C CA   . ASN A 1 45  ? -36.383 0.947   -20.396 1.00 0.00 ? 45  ASN A CA   3  
ATOM 5001  C C    . ASN A 1 45  ? -37.826 0.465   -20.589 1.00 0.00 ? 45  ASN A C    3  
ATOM 5002  O O    . ASN A 1 45  ? -38.717 0.764   -19.795 1.00 0.00 ? 45  ASN A O    3  
ATOM 5003  C CB   . ASN A 1 45  ? -35.524 -0.097  -19.668 1.00 0.00 ? 45  ASN A CB   3  
ATOM 5004  C CG   . ASN A 1 45  ? -35.179 -1.274  -20.560 1.00 0.00 ? 45  ASN A CG   3  
ATOM 5005  O OD1  . ASN A 1 45  ? -35.798 -2.324  -20.484 1.00 0.00 ? 45  ASN A OD1  3  
ATOM 5006  N ND2  . ASN A 1 45  ? -34.245 -1.123  -21.471 1.00 0.00 ? 45  ASN A ND2  3  
ATOM 5007  H H    . ASN A 1 45  ? -36.319 2.203   -18.680 1.00 0.00 ? 45  ASN A H    3  
ATOM 5008  H HA   . ASN A 1 45  ? -35.958 1.080   -21.392 1.00 0.00 ? 45  ASN A HA   3  
ATOM 5009  H HB2  . ASN A 1 45  ? -34.592 0.371   -19.374 1.00 0.00 ? 45  ASN A HB2  3  
ATOM 5010  H HB3  . ASN A 1 45  ? -36.032 -0.453  -18.773 1.00 0.00 ? 45  ASN A HB3  3  
ATOM 5011  H HD21 . ASN A 1 45  ? -33.716 -0.268  -21.527 1.00 0.00 ? 45  ASN A HD21 3  
ATOM 5012  H HD22 . ASN A 1 45  ? -34.023 -1.913  -22.059 1.00 0.00 ? 45  ASN A HD22 3  
ATOM 5013  N N    . ASP A 1 46  ? -38.041 -0.368  -21.607 1.00 0.00 ? 46  ASP A N    3  
ATOM 5014  C CA   . ASP A 1 46  ? -39.342 -1.008  -21.854 1.00 0.00 ? 46  ASP A CA   3  
ATOM 5015  C C    . ASP A 1 46  ? -39.715 -2.016  -20.751 1.00 0.00 ? 46  ASP A C    3  
ATOM 5016  O O    . ASP A 1 46  ? -40.895 -2.281  -20.534 1.00 0.00 ? 46  ASP A O    3  
ATOM 5017  C CB   . ASP A 1 46  ? -39.359 -1.648  -23.247 1.00 0.00 ? 46  ASP A CB   3  
ATOM 5018  C CG   . ASP A 1 46  ? -39.150 -0.591  -24.337 1.00 0.00 ? 46  ASP A CG   3  
ATOM 5019  O OD1  . ASP A 1 46  ? -40.012 0.302   -24.508 1.00 0.00 ? 46  ASP A OD1  3  
ATOM 5020  O OD2  . ASP A 1 46  ? -38.083 -0.596  -24.993 1.00 0.00 ? 46  ASP A OD2  3  
ATOM 5021  H H    . ASP A 1 46  ? -37.250 -0.633  -22.179 1.00 0.00 ? 46  ASP A H    3  
ATOM 5022  H HA   . ASP A 1 46  ? -40.109 -0.233  -21.842 1.00 0.00 ? 46  ASP A HA   3  
ATOM 5023  H HB2  . ASP A 1 46  ? -38.580 -2.412  -23.303 1.00 0.00 ? 46  ASP A HB2  3  
ATOM 5024  H HB3  . ASP A 1 46  ? -40.325 -2.135  -23.403 1.00 0.00 ? 46  ASP A HB3  3  
ATOM 5025  N N    . GLY A 1 47  ? -38.739 -2.501  -19.975 1.00 0.00 ? 47  GLY A N    3  
ATOM 5026  C CA   . GLY A 1 47  ? -38.984 -3.277  -18.759 1.00 0.00 ? 47  GLY A CA   3  
ATOM 5027  C C    . GLY A 1 47  ? -39.920 -2.549  -17.785 1.00 0.00 ? 47  GLY A C    3  
ATOM 5028  O O    . GLY A 1 47  ? -40.927 -3.121  -17.376 1.00 0.00 ? 47  GLY A O    3  
ATOM 5029  H H    . GLY A 1 47  ? -37.777 -2.305  -20.230 1.00 0.00 ? 47  GLY A H    3  
ATOM 5030  H HA2  . GLY A 1 47  ? -39.431 -4.235  -19.024 1.00 0.00 ? 47  GLY A HA2  3  
ATOM 5031  H HA3  . GLY A 1 47  ? -38.032 -3.462  -18.266 1.00 0.00 ? 47  GLY A HA3  3  
ATOM 5032  N N    . PHE A 1 48  ? -39.660 -1.271  -17.463 1.00 0.00 ? 48  PHE A N    3  
ATOM 5033  C CA   . PHE A 1 48  ? -40.585 -0.445  -16.660 1.00 0.00 ? 48  PHE A CA   3  
ATOM 5034  C C    . PHE A 1 48  ? -41.982 -0.381  -17.320 1.00 0.00 ? 48  PHE A C    3  
ATOM 5035  O O    . PHE A 1 48  ? -43.009 -0.412  -16.637 1.00 0.00 ? 48  PHE A O    3  
ATOM 5036  C CB   . PHE A 1 48  ? -40.016 0.984   -16.437 1.00 0.00 ? 48  PHE A CB   3  
ATOM 5037  C CG   . PHE A 1 48  ? -41.004 2.099   -16.769 1.00 0.00 ? 48  PHE A CG   3  
ATOM 5038  C CD1  . PHE A 1 48  ? -42.007 2.447   -15.840 1.00 0.00 ? 48  PHE A CD1  3  
ATOM 5039  C CD2  . PHE A 1 48  ? -41.044 2.647   -18.066 1.00 0.00 ? 48  PHE A CD2  3  
ATOM 5040  C CE1  . PHE A 1 48  ? -43.082 3.265   -16.233 1.00 0.00 ? 48  PHE A CE1  3  
ATOM 5041  C CE2  . PHE A 1 48  ? -42.121 3.461   -18.459 1.00 0.00 ? 48  PHE A CE2  3  
ATOM 5042  C CZ   . PHE A 1 48  ? -43.149 3.756   -17.548 1.00 0.00 ? 48  PHE A CZ   3  
ATOM 5043  H H    . PHE A 1 48  ? -38.833 -0.833  -17.840 1.00 0.00 ? 48  PHE A H    3  
ATOM 5044  H HA   . PHE A 1 48  ? -40.704 -0.912  -15.681 1.00 0.00 ? 48  PHE A HA   3  
ATOM 5045  H HB2  . PHE A 1 48  ? -39.710 1.080   -15.394 1.00 0.00 ? 48  PHE A HB2  3  
ATOM 5046  H HB3  . PHE A 1 48  ? -39.122 1.126   -17.045 1.00 0.00 ? 48  PHE A HB3  3  
ATOM 5047  H HD1  . PHE A 1 48  ? -41.990 2.037   -14.840 1.00 0.00 ? 48  PHE A HD1  3  
ATOM 5048  H HD2  . PHE A 1 48  ? -40.281 2.401   -18.786 1.00 0.00 ? 48  PHE A HD2  3  
ATOM 5049  H HE1  . PHE A 1 48  ? -43.863 3.508   -15.525 1.00 0.00 ? 48  PHE A HE1  3  
ATOM 5050  H HE2  . PHE A 1 48  ? -42.161 3.852   -19.465 1.00 0.00 ? 48  PHE A HE2  3  
ATOM 5051  H HZ   . PHE A 1 48  ? -43.977 4.381   -17.852 1.00 0.00 ? 48  PHE A HZ   3  
ATOM 5052  N N    . CYS A 1 49  ? -42.022 -0.282  -18.652 1.00 0.00 ? 49  CYS A N    3  
ATOM 5053  C CA   . CYS A 1 49  ? -43.275 -0.222  -19.404 1.00 0.00 ? 49  CYS A CA   3  
ATOM 5054  C C    . CYS A 1 49  ? -44.126 -1.482  -19.174 1.00 0.00 ? 49  CYS A C    3  
ATOM 5055  O O    . CYS A 1 49  ? -45.330 -1.385  -18.953 1.00 0.00 ? 49  CYS A O    3  
ATOM 5056  C CB   . CYS A 1 49  ? -42.984 0.065   -20.884 1.00 0.00 ? 49  CYS A CB   3  
ATOM 5057  S SG   . CYS A 1 49  ? -44.473 0.717   -21.687 1.00 0.00 ? 49  CYS A SG   3  
ATOM 5058  H H    . CYS A 1 49  ? -41.151 -0.395  -19.155 1.00 0.00 ? 49  CYS A H    3  
ATOM 5059  H HA   . CYS A 1 49  ? -43.847 0.622   -19.011 1.00 0.00 ? 49  CYS A HA   3  
ATOM 5060  H HB2  . CYS A 1 49  ? -42.191 0.812   -20.962 1.00 0.00 ? 49  CYS A HB2  3  
ATOM 5061  H HB3  . CYS A 1 49  ? -42.668 -0.846  -21.392 1.00 0.00 ? 49  CYS A HB3  3  
ATOM 5062  H HG   . CYS A 1 49  ? -45.277 -0.330  -21.433 1.00 0.00 ? 49  CYS A HG   3  
ATOM 5063  N N    . GLU A 1 50  ? -43.502 -2.664  -19.145 1.00 0.00 ? 50  GLU A N    3  
ATOM 5064  C CA   . GLU A 1 50  ? -44.184 -3.941  -18.876 1.00 0.00 ? 50  GLU A CA   3  
ATOM 5065  C C    . GLU A 1 50  ? -44.497 -4.143  -17.383 1.00 0.00 ? 50  GLU A C    3  
ATOM 5066  O O    . GLU A 1 50  ? -45.497 -4.772  -17.029 1.00 0.00 ? 50  GLU A O    3  
ATOM 5067  C CB   . GLU A 1 50  ? -43.331 -5.109  -19.393 1.00 0.00 ? 50  GLU A CB   3  
ATOM 5068  C CG   . GLU A 1 50  ? -43.077 -5.019  -20.903 1.00 0.00 ? 50  GLU A CG   3  
ATOM 5069  C CD   . GLU A 1 50  ? -42.381 -6.291  -21.425 1.00 0.00 ? 50  GLU A CD   3  
ATOM 5070  O OE1  . GLU A 1 50  ? -41.128 -6.369  -21.391 1.00 0.00 ? 50  GLU A OE1  3  
ATOM 5071  O OE2  . GLU A 1 50  ? -43.083 -7.228  -21.880 1.00 0.00 ? 50  GLU A OE2  3  
ATOM 5072  H H    . GLU A 1 50  ? -42.497 -2.680  -19.318 1.00 0.00 ? 50  GLU A H    3  
ATOM 5073  H HA   . GLU A 1 50  ? -45.137 -3.956  -19.410 1.00 0.00 ? 50  GLU A HA   3  
ATOM 5074  H HB2  . GLU A 1 50  ? -42.379 -5.125  -18.860 1.00 0.00 ? 50  GLU A HB2  3  
ATOM 5075  H HB3  . GLU A 1 50  ? -43.857 -6.041  -19.184 1.00 0.00 ? 50  GLU A HB3  3  
ATOM 5076  H HG2  . GLU A 1 50  ? -44.033 -4.883  -21.416 1.00 0.00 ? 50  GLU A HG2  3  
ATOM 5077  H HG3  . GLU A 1 50  ? -42.464 -4.141  -21.116 1.00 0.00 ? 50  GLU A HG3  3  
ATOM 5078  N N    . LEU A 1 51  ? -43.664 -3.579  -16.502 1.00 0.00 ? 51  LEU A N    3  
ATOM 5079  C CA   . LEU A 1 51  ? -43.809 -3.613  -15.047 1.00 0.00 ? 51  LEU A CA   3  
ATOM 5080  C C    . LEU A 1 51  ? -45.069 -2.880  -14.574 1.00 0.00 ? 51  LEU A C    3  
ATOM 5081  O O    . LEU A 1 51  ? -45.883 -3.451  -13.845 1.00 0.00 ? 51  LEU A O    3  
ATOM 5082  C CB   . LEU A 1 51  ? -42.550 -2.959  -14.455 1.00 0.00 ? 51  LEU A CB   3  
ATOM 5083  C CG   . LEU A 1 51  ? -42.517 -2.815  -12.927 1.00 0.00 ? 51  LEU A CG   3  
ATOM 5084  C CD1  . LEU A 1 51  ? -42.440 -4.168  -12.226 1.00 0.00 ? 51  LEU A CD1  3  
ATOM 5085  C CD2  . LEU A 1 51  ? -41.329 -1.959  -12.508 1.00 0.00 ? 51  LEU A CD2  3  
ATOM 5086  H H    . LEU A 1 51  ? -42.835 -3.127  -16.877 1.00 0.00 ? 51  LEU A H    3  
ATOM 5087  H HA   . LEU A 1 51  ? -43.865 -4.653  -14.726 1.00 0.00 ? 51  LEU A HA   3  
ATOM 5088  H HB2  . LEU A 1 51  ? -41.691 -3.517  -14.808 1.00 0.00 ? 51  LEU A HB2  3  
ATOM 5089  H HB3  . LEU A 1 51  ? -42.467 -1.957  -14.857 1.00 0.00 ? 51  LEU A HB3  3  
ATOM 5090  H HG   . LEU A 1 51  ? -43.426 -2.309  -12.606 1.00 0.00 ? 51  LEU A HG   3  
ATOM 5091  H HD11 . LEU A 1 51  ? -43.318 -4.766  -12.466 1.00 0.00 ? 51  LEU A HD11 3  
ATOM 5092  H HD12 . LEU A 1 51  ? -41.538 -4.696  -12.526 1.00 0.00 ? 51  LEU A HD12 3  
ATOM 5093  H HD13 . LEU A 1 51  ? -42.419 -3.999  -11.151 1.00 0.00 ? 51  LEU A HD13 3  
ATOM 5094  H HD21 . LEU A 1 51  ? -41.333 -1.844  -11.424 1.00 0.00 ? 51  LEU A HD21 3  
ATOM 5095  H HD22 . LEU A 1 51  ? -40.399 -2.428  -12.821 1.00 0.00 ? 51  LEU A HD22 3  
ATOM 5096  H HD23 . LEU A 1 51  ? -41.413 -0.971  -12.962 1.00 0.00 ? 51  LEU A HD23 3  
ATOM 5097  N N    . CYS A 1 52  ? -45.214 -1.622  -14.991 1.00 0.00 ? 52  CYS A N    3  
ATOM 5098  C CA   . CYS A 1 52  ? -46.272 -0.711  -14.551 1.00 0.00 ? 52  CYS A CA   3  
ATOM 5099  C C    . CYS A 1 52  ? -47.414 -0.583  -15.577 1.00 0.00 ? 52  CYS A C    3  
ATOM 5100  O O    . CYS A 1 52  ? -48.528 -0.195  -15.224 1.00 0.00 ? 52  CYS A O    3  
ATOM 5101  C CB   . CYS A 1 52  ? -45.634 0.646   -14.224 1.00 0.00 ? 52  CYS A CB   3  
ATOM 5102  S SG   . CYS A 1 52  ? -44.395 0.487   -12.904 1.00 0.00 ? 52  CYS A SG   3  
ATOM 5103  H H    . CYS A 1 52  ? -44.461 -1.232  -15.550 1.00 0.00 ? 52  CYS A H    3  
ATOM 5104  H HA   . CYS A 1 52  ? -46.719 -1.094  -13.632 1.00 0.00 ? 52  CYS A HA   3  
ATOM 5105  H HB2  . CYS A 1 52  ? -45.167 1.063   -15.119 1.00 0.00 ? 52  CYS A HB2  3  
ATOM 5106  H HB3  . CYS A 1 52  ? -46.416 1.320   -13.880 1.00 0.00 ? 52  CYS A HB3  3  
ATOM 5107  H HG   . CYS A 1 52  ? -44.075 1.789   -12.822 1.00 0.00 ? 52  CYS A HG   3  
ATOM 5108  N N    . GLY A 1 53  ? -47.167 -0.932  -16.843 1.00 0.00 ? 53  GLY A N    3  
ATOM 5109  C CA   . GLY A 1 53  ? -48.184 -0.920  -17.906 1.00 0.00 ? 53  GLY A CA   3  
ATOM 5110  C C    . GLY A 1 53  ? -48.502 0.462   -18.503 1.00 0.00 ? 53  GLY A C    3  
ATOM 5111  O O    . GLY A 1 53  ? -49.501 0.584   -19.215 1.00 0.00 ? 53  GLY A O    3  
ATOM 5112  H H    . GLY A 1 53  ? -46.232 -1.257  -17.089 1.00 0.00 ? 53  GLY A H    3  
ATOM 5113  H HA2  . GLY A 1 53  ? -47.849 -1.563  -18.719 1.00 0.00 ? 53  GLY A HA2  3  
ATOM 5114  H HA3  . GLY A 1 53  ? -49.111 -1.342  -17.517 1.00 0.00 ? 53  GLY A HA3  3  
ATOM 5115  N N    . TYR A 1 54  ? -47.698 1.494   -18.214 1.00 0.00 ? 54  TYR A N    3  
ATOM 5116  C CA   . TYR A 1 54  ? -47.914 2.874   -18.675 1.00 0.00 ? 54  TYR A CA   3  
ATOM 5117  C C    . TYR A 1 54  ? -47.207 3.135   -20.024 1.00 0.00 ? 54  TYR A C    3  
ATOM 5118  O O    . TYR A 1 54  ? -47.487 2.445   -21.007 1.00 0.00 ? 54  TYR A O    3  
ATOM 5119  C CB   . TYR A 1 54  ? -47.578 3.856   -17.534 1.00 0.00 ? 54  TYR A CB   3  
ATOM 5120  C CG   . TYR A 1 54  ? -48.403 3.636   -16.274 1.00 0.00 ? 54  TYR A CG   3  
ATOM 5121  C CD1  . TYR A 1 54  ? -49.810 3.709   -16.329 1.00 0.00 ? 54  TYR A CD1  3  
ATOM 5122  C CD2  . TYR A 1 54  ? -47.769 3.326   -15.056 1.00 0.00 ? 54  TYR A CD2  3  
ATOM 5123  C CE1  . TYR A 1 54  ? -50.580 3.410   -15.188 1.00 0.00 ? 54  TYR A CE1  3  
ATOM 5124  C CE2  . TYR A 1 54  ? -48.535 3.018   -13.912 1.00 0.00 ? 54  TYR A CE2  3  
ATOM 5125  C CZ   . TYR A 1 54  ? -49.945 3.034   -13.986 1.00 0.00 ? 54  TYR A CZ   3  
ATOM 5126  O OH   . TYR A 1 54  ? -50.695 2.686   -12.906 1.00 0.00 ? 54  TYR A OH   3  
ATOM 5127  H H    . TYR A 1 54  ? -46.887 1.322   -17.638 1.00 0.00 ? 54  TYR A H    3  
ATOM 5128  H HA   . TYR A 1 54  ? -48.976 3.005   -18.885 1.00 0.00 ? 54  TYR A HA   3  
ATOM 5129  H HB2  . TYR A 1 54  ? -46.517 3.769   -17.291 1.00 0.00 ? 54  TYR A HB2  3  
ATOM 5130  H HB3  . TYR A 1 54  ? -47.758 4.876   -17.872 1.00 0.00 ? 54  TYR A HB3  3  
ATOM 5131  H HD1  . TYR A 1 54  ? -50.304 3.973   -17.255 1.00 0.00 ? 54  TYR A HD1  3  
ATOM 5132  H HD2  . TYR A 1 54  ? -46.688 3.307   -15.000 1.00 0.00 ? 54  TYR A HD2  3  
ATOM 5133  H HE1  . TYR A 1 54  ? -51.659 3.443   -15.232 1.00 0.00 ? 54  TYR A HE1  3  
ATOM 5134  H HE2  . TYR A 1 54  ? -48.052 2.755   -12.983 1.00 0.00 ? 54  TYR A HE2  3  
ATOM 5135  H HH   . TYR A 1 54  ? -50.146 2.404   -12.158 1.00 0.00 ? 54  TYR A HH   3  
ATOM 5136  N N    . SER A 1 55  ? -46.306 4.120   -20.098 1.00 0.00 ? 55  SER A N    3  
ATOM 5137  C CA   . SER A 1 55  ? -45.578 4.506   -21.317 1.00 0.00 ? 55  SER A CA   3  
ATOM 5138  C C    . SER A 1 55  ? -44.311 5.291   -20.976 1.00 0.00 ? 55  SER A C    3  
ATOM 5139  O O    . SER A 1 55  ? -44.282 6.034   -19.993 1.00 0.00 ? 55  SER A O    3  
ATOM 5140  C CB   . SER A 1 55  ? -46.476 5.366   -22.218 1.00 0.00 ? 55  SER A CB   3  
ATOM 5141  O OG   . SER A 1 55  ? -45.779 5.754   -23.392 1.00 0.00 ? 55  SER A OG   3  
ATOM 5142  H H    . SER A 1 55  ? -46.126 4.668   -19.268 1.00 0.00 ? 55  SER A H    3  
ATOM 5143  H HA   . SER A 1 55  ? -45.294 3.609   -21.867 1.00 0.00 ? 55  SER A HA   3  
ATOM 5144  H HB2  . SER A 1 55  ? -47.362 4.793   -22.496 1.00 0.00 ? 55  SER A HB2  3  
ATOM 5145  H HB3  . SER A 1 55  ? -46.788 6.258   -21.674 1.00 0.00 ? 55  SER A HB3  3  
ATOM 5146  H HG   . SER A 1 55  ? -46.424 6.140   -24.017 1.00 0.00 ? 55  SER A HG   3  
ATOM 5147  N N    . ARG A 1 56  ? -43.277 5.188   -21.819 1.00 0.00 ? 56  ARG A N    3  
ATOM 5148  C CA   . ARG A 1 56  ? -42.064 6.030   -21.765 1.00 0.00 ? 56  ARG A CA   3  
ATOM 5149  C C    . ARG A 1 56  ? -42.426 7.521   -21.689 1.00 0.00 ? 56  ARG A C    3  
ATOM 5150  O O    . ARG A 1 56  ? -41.914 8.244   -20.836 1.00 0.00 ? 56  ARG A O    3  
ATOM 5151  C CB   . ARG A 1 56  ? -41.227 5.761   -23.032 1.00 0.00 ? 56  ARG A CB   3  
ATOM 5152  C CG   . ARG A 1 56  ? -40.647 4.336   -23.137 1.00 0.00 ? 56  ARG A CG   3  
ATOM 5153  C CD   . ARG A 1 56  ? -40.018 4.144   -24.524 1.00 0.00 ? 56  ARG A CD   3  
ATOM 5154  N NE   . ARG A 1 56  ? -39.082 3.001   -24.573 1.00 0.00 ? 56  ARG A NE   3  
ATOM 5155  C CZ   . ARG A 1 56  ? -37.767 3.063   -24.697 1.00 0.00 ? 56  ARG A CZ   3  
ATOM 5156  N NH1  . ARG A 1 56  ? -37.108 4.186   -24.670 1.00 0.00 ? 56  ARG A NH1  3  
ATOM 5157  N NH2  . ARG A 1 56  ? -37.062 1.987   -24.874 1.00 0.00 ? 56  ARG A NH2  3  
ATOM 5158  H H    . ARG A 1 56  ? -43.403 4.583   -22.620 1.00 0.00 ? 56  ARG A H    3  
ATOM 5159  H HA   . ARG A 1 56  ? -41.474 5.805   -20.871 1.00 0.00 ? 56  ARG A HA   3  
ATOM 5160  H HB2  . ARG A 1 56  ? -41.849 5.950   -23.909 1.00 0.00 ? 56  ARG A HB2  3  
ATOM 5161  H HB3  . ARG A 1 56  ? -40.396 6.470   -23.058 1.00 0.00 ? 56  ARG A HB3  3  
ATOM 5162  H HG2  . ARG A 1 56  ? -39.893 4.192   -22.365 1.00 0.00 ? 56  ARG A HG2  3  
ATOM 5163  H HG3  . ARG A 1 56  ? -41.430 3.590   -23.000 1.00 0.00 ? 56  ARG A HG3  3  
ATOM 5164  H HD2  . ARG A 1 56  ? -40.818 3.980   -25.249 1.00 0.00 ? 56  ARG A HD2  3  
ATOM 5165  H HD3  . ARG A 1 56  ? -39.506 5.062   -24.815 1.00 0.00 ? 56  ARG A HD3  3  
ATOM 5166  H HE   . ARG A 1 56  ? -39.487 2.066   -24.587 1.00 0.00 ? 56  ARG A HE   3  
ATOM 5167  H HH11 . ARG A 1 56  ? -37.598 5.040   -24.476 1.00 0.00 ? 56  ARG A HH11 3  
ATOM 5168  H HH12 . ARG A 1 56  ? -36.102 4.173   -24.745 1.00 0.00 ? 56  ARG A HH12 3  
ATOM 5169  H HH21 . ARG A 1 56  ? -37.524 1.081   -24.957 1.00 0.00 ? 56  ARG A HH21 3  
ATOM 5170  H HH22 . ARG A 1 56  ? -36.069 2.055   -24.996 1.00 0.00 ? 56  ARG A HH22 3  
ATOM 5171  N N    . ALA A 1 57  ? -43.394 7.960   -22.496 1.00 0.00 ? 57  ALA A N    3  
ATOM 5172  C CA   . ALA A 1 57  ? -43.885 9.342   -22.525 1.00 0.00 ? 57  ALA A CA   3  
ATOM 5173  C C    . ALA A 1 57  ? -44.555 9.795   -21.206 1.00 0.00 ? 57  ALA A C    3  
ATOM 5174  O O    . ALA A 1 57  ? -44.656 10.994  -20.944 1.00 0.00 ? 57  ALA A O    3  
ATOM 5175  C CB   . ALA A 1 57  ? -44.851 9.468   -23.709 1.00 0.00 ? 57  ALA A CB   3  
ATOM 5176  H H    . ALA A 1 57  ? -43.823 7.290   -23.117 1.00 0.00 ? 57  ALA A H    3  
ATOM 5177  H HA   . ALA A 1 57  ? -43.038 10.006  -22.703 1.00 0.00 ? 57  ALA A HA   3  
ATOM 5178  H HB1  . ALA A 1 57  ? -45.717 8.821   -23.557 1.00 0.00 ? 57  ALA A HB1  3  
ATOM 5179  H HB2  . ALA A 1 57  ? -45.190 10.500  -23.798 1.00 0.00 ? 57  ALA A HB2  3  
ATOM 5180  H HB3  . ALA A 1 57  ? -44.346 9.184   -24.634 1.00 0.00 ? 57  ALA A HB3  3  
ATOM 5181  N N    . GLU A 1 58  ? -44.976 8.854   -20.354 1.00 0.00 ? 58  GLU A N    3  
ATOM 5182  C CA   . GLU A 1 58  ? -45.515 9.100   -19.014 1.00 0.00 ? 58  GLU A CA   3  
ATOM 5183  C C    . GLU A 1 58  ? -44.417 9.193   -17.936 1.00 0.00 ? 58  GLU A C    3  
ATOM 5184  O O    . GLU A 1 58  ? -44.679 9.755   -16.872 1.00 0.00 ? 58  GLU A O    3  
ATOM 5185  C CB   . GLU A 1 58  ? -46.612 8.076   -18.673 1.00 0.00 ? 58  GLU A CB   3  
ATOM 5186  C CG   . GLU A 1 58  ? -47.848 8.262   -19.568 1.00 0.00 ? 58  GLU A CG   3  
ATOM 5187  C CD   . GLU A 1 58  ? -48.966 7.266   -19.214 1.00 0.00 ? 58  GLU A CD   3  
ATOM 5188  O OE1  . GLU A 1 58  ? -49.761 7.548   -18.284 1.00 0.00 ? 58  GLU A OE1  3  
ATOM 5189  O OE2  . GLU A 1 58  ? -49.071 6.207   -19.878 1.00 0.00 ? 58  GLU A OE2  3  
ATOM 5190  H H    . GLU A 1 58  ? -44.846 7.880   -20.604 1.00 0.00 ? 58  GLU A H    3  
ATOM 5191  H HA   . GLU A 1 58  ? -45.996 10.080  -19.015 1.00 0.00 ? 58  GLU A HA   3  
ATOM 5192  H HB2  . GLU A 1 58  ? -46.233 7.061   -18.774 1.00 0.00 ? 58  GLU A HB2  3  
ATOM 5193  H HB3  . GLU A 1 58  ? -46.913 8.220   -17.638 1.00 0.00 ? 58  GLU A HB3  3  
ATOM 5194  H HG2  . GLU A 1 58  ? -48.217 9.285   -19.453 1.00 0.00 ? 58  GLU A HG2  3  
ATOM 5195  H HG3  . GLU A 1 58  ? -47.563 8.137   -20.616 1.00 0.00 ? 58  GLU A HG3  3  
ATOM 5196  N N    . VAL A 1 59  ? -43.208 8.655   -18.177 1.00 0.00 ? 59  VAL A N    3  
ATOM 5197  C CA   . VAL A 1 59  ? -42.041 8.782   -17.271 1.00 0.00 ? 59  VAL A CA   3  
ATOM 5198  C C    . VAL A 1 59  ? -40.994 9.812   -17.701 1.00 0.00 ? 59  VAL A C    3  
ATOM 5199  O O    . VAL A 1 59  ? -40.252 10.294  -16.844 1.00 0.00 ? 59  VAL A O    3  
ATOM 5200  C CB   . VAL A 1 59  ? -41.379 7.427   -16.958 1.00 0.00 ? 59  VAL A CB   3  
ATOM 5201  C CG1  . VAL A 1 59  ? -42.294 6.587   -16.067 1.00 0.00 ? 59  VAL A CG1  3  
ATOM 5202  C CG2  . VAL A 1 59  ? -41.008 6.631   -18.206 1.00 0.00 ? 59  VAL A CG2  3  
ATOM 5203  H H    . VAL A 1 59  ? -43.044 8.216   -19.081 1.00 0.00 ? 59  VAL A H    3  
ATOM 5204  H HA   . VAL A 1 59  ? -42.400 9.153   -16.311 1.00 0.00 ? 59  VAL A HA   3  
ATOM 5205  H HB   . VAL A 1 59  ? -40.456 7.606   -16.420 1.00 0.00 ? 59  VAL A HB   3  
ATOM 5206  H HG11 . VAL A 1 59  ? -41.790 5.658   -15.807 1.00 0.00 ? 59  VAL A HG11 3  
ATOM 5207  H HG12 . VAL A 1 59  ? -42.512 7.130   -15.147 1.00 0.00 ? 59  VAL A HG12 3  
ATOM 5208  H HG13 . VAL A 1 59  ? -43.230 6.371   -16.581 1.00 0.00 ? 59  VAL A HG13 3  
ATOM 5209  H HG21 . VAL A 1 59  ? -40.375 7.235   -18.854 1.00 0.00 ? 59  VAL A HG21 3  
ATOM 5210  H HG22 . VAL A 1 59  ? -40.460 5.736   -17.914 1.00 0.00 ? 59  VAL A HG22 3  
ATOM 5211  H HG23 . VAL A 1 59  ? -41.909 6.338   -18.739 1.00 0.00 ? 59  VAL A HG23 3  
ATOM 5212  N N    . MET A 1 60  ? -40.971 10.227  -18.974 1.00 0.00 ? 60  MET A N    3  
ATOM 5213  C CA   . MET A 1 60  ? -39.996 11.156  -19.548 1.00 0.00 ? 60  MET A CA   3  
ATOM 5214  C C    . MET A 1 60  ? -39.850 12.412  -18.692 1.00 0.00 ? 60  MET A C    3  
ATOM 5215  O O    . MET A 1 60  ? -40.717 13.286  -18.672 1.00 0.00 ? 60  MET A O    3  
ATOM 5216  C CB   . MET A 1 60  ? -40.438 11.555  -20.973 1.00 0.00 ? 60  MET A CB   3  
ATOM 5217  C CG   . MET A 1 60  ? -39.752 10.744  -22.073 1.00 0.00 ? 60  MET A CG   3  
ATOM 5218  S SD   . MET A 1 60  ? -37.975 11.077  -22.236 1.00 0.00 ? 60  MET A SD   3  
ATOM 5219  C CE   . MET A 1 60  ? -37.302 9.513   -21.618 1.00 0.00 ? 60  MET A CE   3  
ATOM 5220  H H    . MET A 1 60  ? -41.548 9.739   -19.641 1.00 0.00 ? 60  MET A H    3  
ATOM 5221  H HA   . MET A 1 60  ? -39.025 10.666  -19.593 1.00 0.00 ? 60  MET A HA   3  
ATOM 5222  H HB2  . MET A 1 60  ? -41.521 11.448  -21.071 1.00 0.00 ? 60  MET A HB2  3  
ATOM 5223  H HB3  . MET A 1 60  ? -40.200 12.603  -21.157 1.00 0.00 ? 60  MET A HB3  3  
ATOM 5224  H HG2  . MET A 1 60  ? -39.910 9.685   -21.894 1.00 0.00 ? 60  MET A HG2  3  
ATOM 5225  H HG3  . MET A 1 60  ? -40.227 10.997  -23.022 1.00 0.00 ? 60  MET A HG3  3  
ATOM 5226  H HE1  . MET A 1 60  ? -37.639 8.694   -22.254 1.00 0.00 ? 60  MET A HE1  3  
ATOM 5227  H HE2  . MET A 1 60  ? -36.214 9.562   -21.641 1.00 0.00 ? 60  MET A HE2  3  
ATOM 5228  H HE3  . MET A 1 60  ? -37.636 9.336   -20.595 1.00 0.00 ? 60  MET A HE3  3  
ATOM 5229  N N    . GLN A 1 61  ? -38.715 12.502  -18.005 1.00 0.00 ? 61  GLN A N    3  
ATOM 5230  C CA   . GLN A 1 61  ? -38.256 13.673  -17.262 1.00 0.00 ? 61  GLN A CA   3  
ATOM 5231  C C    . GLN A 1 61  ? -39.058 13.947  -15.970 1.00 0.00 ? 61  GLN A C    3  
ATOM 5232  O O    . GLN A 1 61  ? -38.982 15.047  -15.419 1.00 0.00 ? 61  GLN A O    3  
ATOM 5233  C CB   . GLN A 1 61  ? -38.082 14.867  -18.229 1.00 0.00 ? 61  GLN A CB   3  
ATOM 5234  C CG   . GLN A 1 61  ? -37.291 14.513  -19.517 1.00 0.00 ? 61  GLN A CG   3  
ATOM 5235  C CD   . GLN A 1 61  ? -37.812 15.239  -20.758 1.00 0.00 ? 61  GLN A CD   3  
ATOM 5236  O OE1  . GLN A 1 61  ? -38.036 16.443  -20.775 1.00 0.00 ? 61  GLN A OE1  3  
ATOM 5237  N NE2  . GLN A 1 61  ? -38.041 14.523  -21.843 1.00 0.00 ? 61  GLN A NE2  3  
ATOM 5238  H H    . GLN A 1 61  ? -38.075 11.714  -18.035 1.00 0.00 ? 61  GLN A H    3  
ATOM 5239  H HA   . GLN A 1 61  ? -37.253 13.426  -16.913 1.00 0.00 ? 61  GLN A HA   3  
ATOM 5240  H HB2  . GLN A 1 61  ? -39.071 15.235  -18.506 1.00 0.00 ? 61  GLN A HB2  3  
ATOM 5241  H HB3  . GLN A 1 61  ? -37.568 15.679  -17.715 1.00 0.00 ? 61  GLN A HB3  3  
ATOM 5242  H HG2  . GLN A 1 61  ? -36.238 14.752  -19.374 1.00 0.00 ? 61  GLN A HG2  3  
ATOM 5243  H HG3  . GLN A 1 61  ? -37.348 13.443  -19.735 1.00 0.00 ? 61  GLN A HG3  3  
ATOM 5244  H HE21 . GLN A 1 61  ? -37.845 13.533  -21.854 1.00 0.00 ? 61  GLN A HE21 3  
ATOM 5245  H HE22 . GLN A 1 61  ? -38.432 14.975  -22.654 1.00 0.00 ? 61  GLN A HE22 3  
ATOM 5246  N N    . ARG A 1 62  ? -39.804 12.951  -15.453 1.00 0.00 ? 62  ARG A N    3  
ATOM 5247  C CA   . ARG A 1 62  ? -40.403 12.982  -14.105 1.00 0.00 ? 62  ARG A CA   3  
ATOM 5248  C C    . ARG A 1 62  ? -39.367 12.609  -13.030 1.00 0.00 ? 62  ARG A C    3  
ATOM 5249  O O    . ARG A 1 62  ? -38.419 11.893  -13.355 1.00 0.00 ? 62  ARG A O    3  
ATOM 5250  C CB   . ARG A 1 62  ? -41.576 11.985  -14.009 1.00 0.00 ? 62  ARG A CB   3  
ATOM 5251  C CG   . ARG A 1 62  ? -42.943 12.540  -14.427 1.00 0.00 ? 62  ARG A CG   3  
ATOM 5252  C CD   . ARG A 1 62  ? -43.290 12.381  -15.910 1.00 0.00 ? 62  ARG A CD   3  
ATOM 5253  N NE   . ARG A 1 62  ? -42.716 13.435  -16.757 1.00 0.00 ? 62  ARG A NE   3  
ATOM 5254  C CZ   . ARG A 1 62  ? -43.125 14.677  -16.928 1.00 0.00 ? 62  ARG A CZ   3  
ATOM 5255  N NH1  . ARG A 1 62  ? -44.129 15.191  -16.276 1.00 0.00 ? 62  ARG A NH1  3  
ATOM 5256  N NH2  . ARG A 1 62  ? -42.502 15.423  -17.792 1.00 0.00 ? 62  ARG A NH2  3  
ATOM 5257  H H    . ARG A 1 62  ? -39.860 12.068  -15.954 1.00 0.00 ? 62  ARG A H    3  
ATOM 5258  H HA   . ARG A 1 62  ? -40.746 13.994  -13.898 1.00 0.00 ? 62  ARG A HA   3  
ATOM 5259  H HB2  . ARG A 1 62  ? -41.344 11.077  -14.567 1.00 0.00 ? 62  ARG A HB2  3  
ATOM 5260  H HB3  . ARG A 1 62  ? -41.682 11.688  -12.965 1.00 0.00 ? 62  ARG A HB3  3  
ATOM 5261  H HG2  . ARG A 1 62  ? -43.693 11.983  -13.869 1.00 0.00 ? 62  ARG A HG2  3  
ATOM 5262  H HG3  . ARG A 1 62  ? -43.010 13.586  -14.134 1.00 0.00 ? 62  ARG A HG3  3  
ATOM 5263  H HD2  . ARG A 1 62  ? -42.925 11.411  -16.249 1.00 0.00 ? 62  ARG A HD2  3  
ATOM 5264  H HD3  . ARG A 1 62  ? -44.376 12.378  -16.022 1.00 0.00 ? 62  ARG A HD3  3  
ATOM 5265  H HE   . ARG A 1 62  ? -41.943 13.167  -17.350 1.00 0.00 ? 62  ARG A HE   3  
ATOM 5266  H HH11 . ARG A 1 62  ? -44.630 14.621  -15.617 1.00 0.00 ? 62  ARG A HH11 3  
ATOM 5267  H HH12 . ARG A 1 62  ? -44.412 16.142  -16.438 1.00 0.00 ? 62  ARG A HH12 3  
ATOM 5268  H HH21 . ARG A 1 62  ? -41.753 15.007  -18.331 1.00 0.00 ? 62  ARG A HH21 3  
ATOM 5269  H HH22 . ARG A 1 62  ? -42.788 16.373  -17.958 1.00 0.00 ? 62  ARG A HH22 3  
ATOM 5270  N N    . PRO A 1 63  ? -39.547 13.008  -11.757 1.00 0.00 ? 63  PRO A N    3  
ATOM 5271  C CA   . PRO A 1 63  ? -38.752 12.518  -10.627 1.00 0.00 ? 63  PRO A CA   3  
ATOM 5272  C C    . PRO A 1 63  ? -38.812 10.988  -10.472 1.00 0.00 ? 63  PRO A C    3  
ATOM 5273  O O    . PRO A 1 63  ? -39.881 10.388  -10.603 1.00 0.00 ? 63  PRO A O    3  
ATOM 5274  C CB   . PRO A 1 63  ? -39.322 13.208  -9.380  1.00 0.00 ? 63  PRO A CB   3  
ATOM 5275  C CG   . PRO A 1 63  ? -39.980 14.468  -9.937  1.00 0.00 ? 63  PRO A CG   3  
ATOM 5276  C CD   . PRO A 1 63  ? -40.508 13.998  -11.289 1.00 0.00 ? 63  PRO A CD   3  
ATOM 5277  H HA   . PRO A 1 63  ? -37.717 12.831  -10.764 1.00 0.00 ? 63  PRO A HA   3  
ATOM 5278  H HB2  . PRO A 1 63  ? -40.086 12.581  -8.921  1.00 0.00 ? 63  PRO A HB2  3  
ATOM 5279  H HB3  . PRO A 1 63  ? -38.546 13.446  -8.655  1.00 0.00 ? 63  PRO A HB3  3  
ATOM 5280  H HG2  . PRO A 1 63  ? -40.781 14.829  -9.292  1.00 0.00 ? 63  PRO A HG2  3  
ATOM 5281  H HG3  . PRO A 1 63  ? -39.225 15.240  -10.086 1.00 0.00 ? 63  PRO A HG3  3  
ATOM 5282  H HD2  . PRO A 1 63  ? -41.485 13.529  -11.164 1.00 0.00 ? 63  PRO A HD2  3  
ATOM 5283  H HD3  . PRO A 1 63  ? -40.579 14.850  -11.966 1.00 0.00 ? 63  PRO A HD3  3  
ATOM 5284  N N    . CYS A 1 64  ? -37.684 10.351  -10.142 1.00 0.00 ? 64  CYS A N    3  
ATOM 5285  C CA   . CYS A 1 64  ? -37.622 8.921   -9.796  1.00 0.00 ? 64  CYS A CA   3  
ATOM 5286  C C    . CYS A 1 64  ? -38.415 8.524   -8.533  1.00 0.00 ? 64  CYS A C    3  
ATOM 5287  O O    . CYS A 1 64  ? -38.617 7.332   -8.295  1.00 0.00 ? 64  CYS A O    3  
ATOM 5288  C CB   . CYS A 1 64  ? -36.152 8.519   -9.625  1.00 0.00 ? 64  CYS A CB   3  
ATOM 5289  S SG   . CYS A 1 64  ? -35.527 7.879   -11.190 1.00 0.00 ? 64  CYS A SG   3  
ATOM 5290  H H    . CYS A 1 64  ? -36.822 10.886  -10.111 1.00 0.00 ? 64  CYS A H    3  
ATOM 5291  H HA   . CYS A 1 64  ? -38.040 8.332   -10.617 1.00 0.00 ? 64  CYS A HA   3  
ATOM 5292  H HB2  . CYS A 1 64  ? -35.552 9.368   -9.292  1.00 0.00 ? 64  CYS A HB2  3  
ATOM 5293  H HB3  . CYS A 1 64  ? -36.076 7.725   -8.882  1.00 0.00 ? 64  CYS A HB3  3  
ATOM 5294  H HG   . CYS A 1 64  ? -35.642 9.029   -11.873 1.00 0.00 ? 64  CYS A HG   3  
ATOM 5295  N N    . THR A 1 65  ? -38.847 9.484   -7.707  1.00 0.00 ? 65  THR A N    3  
ATOM 5296  C CA   . THR A 1 65  ? -39.497 9.261   -6.413  1.00 0.00 ? 65  THR A CA   3  
ATOM 5297  C C    . THR A 1 65  ? -40.853 8.587   -6.594  1.00 0.00 ? 65  THR A C    3  
ATOM 5298  O O    . THR A 1 65  ? -41.865 9.216   -6.906  1.00 0.00 ? 65  THR A O    3  
ATOM 5299  C CB   . THR A 1 65  ? -39.642 10.556  -5.595  1.00 0.00 ? 65  THR A CB   3  
ATOM 5300  O OG1  . THR A 1 65  ? -38.514 11.387  -5.740  1.00 0.00 ? 65  THR A OG1  3  
ATOM 5301  C CG2  . THR A 1 65  ? -39.773 10.229  -4.110  1.00 0.00 ? 65  THR A CG2  3  
ATOM 5302  H H    . THR A 1 65  ? -38.582 10.431  -7.899  1.00 0.00 ? 65  THR A H    3  
ATOM 5303  H HA   . THR A 1 65  ? -38.856 8.590   -5.840  1.00 0.00 ? 65  THR A HA   3  
ATOM 5304  H HB   . THR A 1 65  ? -40.513 11.111  -5.923  1.00 0.00 ? 65  THR A HB   3  
ATOM 5305  H HG1  . THR A 1 65  ? -38.684 12.211  -5.254  1.00 0.00 ? 65  THR A HG1  3  
ATOM 5306  H HG21 . THR A 1 65  ? -38.893 9.674   -3.783  1.00 0.00 ? 65  THR A HG21 3  
ATOM 5307  H HG22 . THR A 1 65  ? -39.860 11.151  -3.537  1.00 0.00 ? 65  THR A HG22 3  
ATOM 5308  H HG23 . THR A 1 65  ? -40.662 9.624   -3.934  1.00 0.00 ? 65  THR A HG23 3  
ATOM 5309  N N    . CYS A 1 66  ? -40.849 7.275   -6.375  1.00 0.00 ? 66  CYS A N    3  
ATOM 5310  C CA   . CYS A 1 66  ? -41.995 6.372   -6.538  1.00 0.00 ? 66  CYS A CA   3  
ATOM 5311  C C    . CYS A 1 66  ? -43.269 6.793   -5.780  1.00 0.00 ? 66  CYS A C    3  
ATOM 5312  O O    . CYS A 1 66  ? -44.360 6.362   -6.141  1.00 0.00 ? 66  CYS A O    3  
ATOM 5313  C CB   . CYS A 1 66  ? -41.565 4.955   -6.145  1.00 0.00 ? 66  CYS A CB   3  
ATOM 5314  S SG   . CYS A 1 66  ? -41.141 4.921   -4.380  1.00 0.00 ? 66  CYS A SG   3  
ATOM 5315  H H    . CYS A 1 66  ? -39.931 6.871   -6.268  1.00 0.00 ? 66  CYS A H    3  
ATOM 5316  H HA   . CYS A 1 66  ? -42.260 6.371   -7.591  1.00 0.00 ? 66  CYS A HA   3  
ATOM 5317  H HB2  . CYS A 1 66  ? -42.388 4.262   -6.334  1.00 0.00 ? 66  CYS A HB2  3  
ATOM 5318  H HB3  . CYS A 1 66  ? -40.703 4.649   -6.742  1.00 0.00 ? 66  CYS A HB3  3  
ATOM 5319  H HG   . CYS A 1 66  ? -40.802 3.624   -4.327  1.00 0.00 ? 66  CYS A HG   3  
ATOM 5320  N N    . ASP A 1 67  ? -43.157 7.684   -4.790  1.00 0.00 ? 67  ASP A N    3  
ATOM 5321  C CA   . ASP A 1 67  ? -44.283 8.357   -4.135  1.00 0.00 ? 67  ASP A CA   3  
ATOM 5322  C C    . ASP A 1 67  ? -45.274 8.946   -5.163  1.00 0.00 ? 67  ASP A C    3  
ATOM 5323  O O    . ASP A 1 67  ? -46.483 8.738   -5.049  1.00 0.00 ? 67  ASP A O    3  
ATOM 5324  C CB   . ASP A 1 67  ? -43.729 9.470   -3.235  1.00 0.00 ? 67  ASP A CB   3  
ATOM 5325  C CG   . ASP A 1 67  ? -44.849 10.186  -2.461  1.00 0.00 ? 67  ASP A CG   3  
ATOM 5326  O OD1  . ASP A 1 67  ? -45.341 9.627   -1.453  1.00 0.00 ? 67  ASP A OD1  3  
ATOM 5327  O OD2  . ASP A 1 67  ? -45.228 11.317  -2.851  1.00 0.00 ? 67  ASP A OD2  3  
ATOM 5328  H H    . ASP A 1 67  ? -42.221 7.963   -4.548  1.00 0.00 ? 67  ASP A H    3  
ATOM 5329  H HA   . ASP A 1 67  ? -44.814 7.640   -3.510  1.00 0.00 ? 67  ASP A HA   3  
ATOM 5330  H HB2  . ASP A 1 67  ? -43.017 9.041   -2.527  1.00 0.00 ? 67  ASP A HB2  3  
ATOM 5331  H HB3  . ASP A 1 67  ? -43.186 10.191  -3.850  1.00 0.00 ? 67  ASP A HB3  3  
ATOM 5332  N N    . PHE A 1 68  ? -44.766 9.580   -6.229  1.00 0.00 ? 68  PHE A N    3  
ATOM 5333  C CA   . PHE A 1 68  ? -45.587 10.188  -7.288  1.00 0.00 ? 68  PHE A CA   3  
ATOM 5334  C C    . PHE A 1 68  ? -46.420 9.161   -8.087  1.00 0.00 ? 68  PHE A C    3  
ATOM 5335  O O    . PHE A 1 68  ? -47.369 9.546   -8.776  1.00 0.00 ? 68  PHE A O    3  
ATOM 5336  C CB   . PHE A 1 68  ? -44.674 10.991  -8.233  1.00 0.00 ? 68  PHE A CB   3  
ATOM 5337  C CG   . PHE A 1 68  ? -44.089 12.255  -7.626  1.00 0.00 ? 68  PHE A CG   3  
ATOM 5338  C CD1  . PHE A 1 68  ? -44.937 13.309  -7.231  1.00 0.00 ? 68  PHE A CD1  3  
ATOM 5339  C CD2  . PHE A 1 68  ? -42.696 12.389  -7.467  1.00 0.00 ? 68  PHE A CD2  3  
ATOM 5340  C CE1  . PHE A 1 68  ? -44.395 14.479  -6.666  1.00 0.00 ? 68  PHE A CE1  3  
ATOM 5341  C CE2  . PHE A 1 68  ? -42.155 13.555  -6.897  1.00 0.00 ? 68  PHE A CE2  3  
ATOM 5342  C CZ   . PHE A 1 68  ? -43.004 14.601  -6.495  1.00 0.00 ? 68  PHE A CZ   3  
ATOM 5343  H H    . PHE A 1 68  ? -43.755 9.646   -6.317  1.00 0.00 ? 68  PHE A H    3  
ATOM 5344  H HA   . PHE A 1 68  ? -46.298 10.873  -6.825  1.00 0.00 ? 68  PHE A HA   3  
ATOM 5345  H HB2  . PHE A 1 68  ? -43.873 10.343  -8.593  1.00 0.00 ? 68  PHE A HB2  3  
ATOM 5346  H HB3  . PHE A 1 68  ? -45.258 11.293  -9.104  1.00 0.00 ? 68  PHE A HB3  3  
ATOM 5347  H HD1  . PHE A 1 68  ? -46.006 13.223  -7.360  1.00 0.00 ? 68  PHE A HD1  3  
ATOM 5348  H HD2  . PHE A 1 68  ? -42.038 11.595  -7.787  1.00 0.00 ? 68  PHE A HD2  3  
ATOM 5349  H HE1  . PHE A 1 68  ? -45.049 15.285  -6.360  1.00 0.00 ? 68  PHE A HE1  3  
ATOM 5350  H HE2  . PHE A 1 68  ? -41.085 13.650  -6.768  1.00 0.00 ? 68  PHE A HE2  3  
ATOM 5351  H HZ   . PHE A 1 68  ? -42.589 15.500  -6.059  1.00 0.00 ? 68  PHE A HZ   3  
ATOM 5352  N N    . LEU A 1 69  ? -46.086 7.869   -7.990  1.00 0.00 ? 69  LEU A N    3  
ATOM 5353  C CA   . LEU A 1 69  ? -46.826 6.735   -8.556  1.00 0.00 ? 69  LEU A CA   3  
ATOM 5354  C C    . LEU A 1 69  ? -47.243 5.685   -7.501  1.00 0.00 ? 69  LEU A C    3  
ATOM 5355  O O    . LEU A 1 69  ? -47.481 4.526   -7.847  1.00 0.00 ? 69  LEU A O    3  
ATOM 5356  C CB   . LEU A 1 69  ? -46.088 6.193   -9.804  1.00 0.00 ? 69  LEU A CB   3  
ATOM 5357  C CG   . LEU A 1 69  ? -44.621 5.741   -9.634  1.00 0.00 ? 69  LEU A CG   3  
ATOM 5358  C CD1  . LEU A 1 69  ? -44.463 4.405   -8.906  1.00 0.00 ? 69  LEU A CD1  3  
ATOM 5359  C CD2  . LEU A 1 69  ? -43.980 5.573   -11.014 1.00 0.00 ? 69  LEU A CD2  3  
ATOM 5360  H H    . LEU A 1 69  ? -45.312 7.636   -7.377  1.00 0.00 ? 69  LEU A H    3  
ATOM 5361  H HA   . LEU A 1 69  ? -47.780 7.119   -8.924  1.00 0.00 ? 69  LEU A HA   3  
ATOM 5362  H HB2  . LEU A 1 69  ? -46.666 5.372   -10.231 1.00 0.00 ? 69  LEU A HB2  3  
ATOM 5363  H HB3  . LEU A 1 69  ? -46.100 6.998   -10.540 1.00 0.00 ? 69  LEU A HB3  3  
ATOM 5364  H HG   . LEU A 1 69  ? -44.060 6.506   -9.098  1.00 0.00 ? 69  LEU A HG   3  
ATOM 5365  H HD11 . LEU A 1 69  ? -45.040 3.633   -9.415  1.00 0.00 ? 69  LEU A HD11 3  
ATOM 5366  H HD12 . LEU A 1 69  ? -43.413 4.116   -8.887  1.00 0.00 ? 69  LEU A HD12 3  
ATOM 5367  H HD13 . LEU A 1 69  ? -44.810 4.492   -7.879  1.00 0.00 ? 69  LEU A HD13 3  
ATOM 5368  H HD21 . LEU A 1 69  ? -42.936 5.281   -10.905 1.00 0.00 ? 69  LEU A HD21 3  
ATOM 5369  H HD22 . LEU A 1 69  ? -44.510 4.811   -11.584 1.00 0.00 ? 69  LEU A HD22 3  
ATOM 5370  H HD23 . LEU A 1 69  ? -44.018 6.518   -11.555 1.00 0.00 ? 69  LEU A HD23 3  
ATOM 5371  N N    . HIS A 1 70  ? -47.345 6.063   -6.216  1.00 0.00 ? 70  HIS A N    3  
ATOM 5372  C CA   . HIS A 1 70  ? -47.734 5.121   -5.152  1.00 0.00 ? 70  HIS A CA   3  
ATOM 5373  C C    . HIS A 1 70  ? -49.179 4.608   -5.315  1.00 0.00 ? 70  HIS A C    3  
ATOM 5374  O O    . HIS A 1 70  ? -50.069 5.340   -5.761  1.00 0.00 ? 70  HIS A O    3  
ATOM 5375  C CB   . HIS A 1 70  ? -47.476 5.712   -3.755  1.00 0.00 ? 70  HIS A CB   3  
ATOM 5376  C CG   . HIS A 1 70  ? -48.588 6.556   -3.169  1.00 0.00 ? 70  HIS A CG   3  
ATOM 5377  N ND1  . HIS A 1 70  ? -49.195 6.328   -1.930  1.00 0.00 ? 70  HIS A ND1  3  
ATOM 5378  C CD2  . HIS A 1 70  ? -49.171 7.648   -3.744  1.00 0.00 ? 70  HIS A CD2  3  
ATOM 5379  C CE1  . HIS A 1 70  ? -50.129 7.285   -1.791  1.00 0.00 ? 70  HIS A CE1  3  
ATOM 5380  N NE2  . HIS A 1 70  ? -50.136 8.091   -2.866  1.00 0.00 ? 70  HIS A NE2  3  
ATOM 5381  H H    . HIS A 1 70  ? -47.096 7.013   -5.954  1.00 0.00 ? 70  HIS A H    3  
ATOM 5382  H HA   . HIS A 1 70  ? -47.080 4.253   -5.247  1.00 0.00 ? 70  HIS A HA   3  
ATOM 5383  H HB2  . HIS A 1 70  ? -47.308 4.879   -3.074  1.00 0.00 ? 70  HIS A HB2  3  
ATOM 5384  H HB3  . HIS A 1 70  ? -46.555 6.291   -3.770  1.00 0.00 ? 70  HIS A HB3  3  
ATOM 5385  H HD2  . HIS A 1 70  ? -48.926 8.071   -4.710  1.00 0.00 ? 70  HIS A HD2  3  
ATOM 5386  H HE1  . HIS A 1 70  ? -50.785 7.392   -0.934  1.00 0.00 ? 70  HIS A HE1  3  
ATOM 5387  H HE2  . HIS A 1 70  ? -50.753 8.887   -2.997  1.00 0.00 ? 70  HIS A HE2  3  
ATOM 5388  N N    . GLY A 1 71  ? -49.407 3.343   -4.958  1.00 0.00 ? 71  GLY A N    3  
ATOM 5389  C CA   . GLY A 1 71  ? -50.709 2.674   -5.015  1.00 0.00 ? 71  GLY A CA   3  
ATOM 5390  C C    . GLY A 1 71  ? -51.393 2.549   -3.646  1.00 0.00 ? 71  GLY A C    3  
ATOM 5391  O O    . GLY A 1 71  ? -50.771 2.808   -2.610  1.00 0.00 ? 71  GLY A O    3  
ATOM 5392  H H    . GLY A 1 71  ? -48.651 2.826   -4.522  1.00 0.00 ? 71  GLY A H    3  
ATOM 5393  H HA2  . GLY A 1 71  ? -51.377 3.210   -5.691  1.00 0.00 ? 71  GLY A HA2  3  
ATOM 5394  H HA3  . GLY A 1 71  ? -50.569 1.670   -5.416  1.00 0.00 ? 71  GLY A HA3  3  
ATOM 5395  N N    . PRO A 1 72  ? -52.654 2.077   -3.603  1.00 0.00 ? 72  PRO A N    3  
ATOM 5396  C CA   . PRO A 1 72  ? -53.413 1.905   -2.357  1.00 0.00 ? 72  PRO A CA   3  
ATOM 5397  C C    . PRO A 1 72  ? -52.835 0.824   -1.419  1.00 0.00 ? 72  PRO A C    3  
ATOM 5398  O O    . PRO A 1 72  ? -53.240 0.739   -0.256  1.00 0.00 ? 72  PRO A O    3  
ATOM 5399  C CB   . PRO A 1 72  ? -54.838 1.561   -2.813  1.00 0.00 ? 72  PRO A CB   3  
ATOM 5400  C CG   . PRO A 1 72  ? -54.626 0.874   -4.163  1.00 0.00 ? 72  PRO A CG   3  
ATOM 5401  C CD   . PRO A 1 72  ? -53.449 1.653   -4.749  1.00 0.00 ? 72  PRO A CD   3  
ATOM 5402  H HA   . PRO A 1 72  ? -53.435 2.847   -1.809  1.00 0.00 ? 72  PRO A HA   3  
ATOM 5403  H HB2  . PRO A 1 72  ? -55.358 0.911   -2.109  1.00 0.00 ? 72  PRO A HB2  3  
ATOM 5404  H HB3  . PRO A 1 72  ? -55.402 2.482   -2.962  1.00 0.00 ? 72  PRO A HB3  3  
ATOM 5405  H HG2  . PRO A 1 72  ? -54.339 -0.167  -4.007  1.00 0.00 ? 72  PRO A HG2  3  
ATOM 5406  H HG3  . PRO A 1 72  ? -55.511 0.941   -4.797  1.00 0.00 ? 72  PRO A HG3  3  
ATOM 5407  H HD2  . PRO A 1 72  ? -52.879 1.015   -5.424  1.00 0.00 ? 72  PRO A HD2  3  
ATOM 5408  H HD3  . PRO A 1 72  ? -53.817 2.531   -5.281  1.00 0.00 ? 72  PRO A HD3  3  
ATOM 5409  N N    . ARG A 1 73  ? -51.863 0.028   -1.897  1.00 0.00 ? 73  ARG A N    3  
ATOM 5410  C CA   . ARG A 1 73  ? -51.111 -0.983  -1.132  1.00 0.00 ? 73  ARG A CA   3  
ATOM 5411  C C    . ARG A 1 73  ? -49.696 -0.524  -0.726  1.00 0.00 ? 73  ARG A C    3  
ATOM 5412  O O    . ARG A 1 73  ? -49.010 -1.251  -0.006  1.00 0.00 ? 73  ARG A O    3  
ATOM 5413  C CB   . ARG A 1 73  ? -51.146 -2.303  -1.937  1.00 0.00 ? 73  ARG A CB   3  
ATOM 5414  C CG   . ARG A 1 73  ? -50.789 -3.558  -1.119  1.00 0.00 ? 73  ARG A CG   3  
ATOM 5415  C CD   . ARG A 1 73  ? -49.372 -4.075  -1.405  1.00 0.00 ? 73  ARG A CD   3  
ATOM 5416  N NE   . ARG A 1 73  ? -48.970 -5.103  -0.425  1.00 0.00 ? 73  ARG A NE   3  
ATOM 5417  C CZ   . ARG A 1 73  ? -48.415 -4.898  0.757   1.00 0.00 ? 73  ARG A CZ   3  
ATOM 5418  N NH1  . ARG A 1 73  ? -48.169 -3.704  1.220   1.00 0.00 ? 73  ARG A NH1  3  
ATOM 5419  N NH2  . ARG A 1 73  ? -48.085 -5.909  1.508   1.00 0.00 ? 73  ARG A NH2  3  
ATOM 5420  H H    . ARG A 1 73  ? -51.635 0.135   -2.875  1.00 0.00 ? 73  ARG A H    3  
ATOM 5421  H HA   . ARG A 1 73  ? -51.636 -1.158  -0.191  1.00 0.00 ? 73  ARG A HA   3  
ATOM 5422  H HB2  . ARG A 1 73  ? -52.165 -2.444  -2.300  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 5423  H HB3  . ARG A 1 73  ? -50.496 -2.222  -2.810  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 5424  H HG2  . ARG A 1 73  ? -50.900 -3.347  -0.055  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 5425  H HG3  . ARG A 1 73  ? -51.491 -4.353  -1.372  1.00 0.00 ? 73  ARG A HG3  3  
ATOM 5426  H HD2  . ARG A 1 73  ? -49.353 -4.503  -2.410  1.00 0.00 ? 73  ARG A HD2  3  
ATOM 5427  H HD3  . ARG A 1 73  ? -48.660 -3.251  -1.389  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 5428  H HE   . ARG A 1 73  ? -49.149 -6.064  -0.675  1.00 0.00 ? 73  ARG A HE   3  
ATOM 5429  H HH11 . ARG A 1 73  ? -48.463 -2.889  0.690   1.00 0.00 ? 73  ARG A HH11 3  
ATOM 5430  H HH12 . ARG A 1 73  ? -47.756 -3.584  2.127   1.00 0.00 ? 73  ARG A HH12 3  
ATOM 5431  H HH21 . ARG A 1 73  ? -48.265 -6.850  1.201   1.00 0.00 ? 73  ARG A HH21 3  
ATOM 5432  H HH22 . ARG A 1 73  ? -47.670 -5.757  2.412   1.00 0.00 ? 73  ARG A HH22 3  
ATOM 5433  N N    . THR A 1 74  ? -49.241 0.656   -1.159  1.00 0.00 ? 74  THR A N    3  
ATOM 5434  C CA   . THR A 1 74  ? -47.897 1.185   -0.844  1.00 0.00 ? 74  THR A CA   3  
ATOM 5435  C C    . THR A 1 74  ? -47.844 1.815   0.550   1.00 0.00 ? 74  THR A C    3  
ATOM 5436  O O    . THR A 1 74  ? -48.795 2.469   0.980   1.00 0.00 ? 74  THR A O    3  
ATOM 5437  C CB   . THR A 1 74  ? -47.417 2.205   -1.895  1.00 0.00 ? 74  THR A CB   3  
ATOM 5438  O OG1  . THR A 1 74  ? -47.689 1.770   -3.209  1.00 0.00 ? 74  THR A OG1  3  
ATOM 5439  C CG2  . THR A 1 74  ? -45.905 2.437   -1.823  1.00 0.00 ? 74  THR A CG2  3  
ATOM 5440  H H    . THR A 1 74  ? -49.849 1.241   -1.721  1.00 0.00 ? 74  THR A H    3  
ATOM 5441  H HA   . THR A 1 74  ? -47.196 0.353   -0.843  1.00 0.00 ? 74  THR A HA   3  
ATOM 5442  H HB   . THR A 1 74  ? -47.938 3.149   -1.735  1.00 0.00 ? 74  THR A HB   3  
ATOM 5443  H HG1  . THR A 1 74  ? -46.859 1.436   -3.596  1.00 0.00 ? 74  THR A HG1  3  
ATOM 5444  H HG21 . THR A 1 74  ? -45.655 2.988   -0.918  1.00 0.00 ? 74  THR A HG21 3  
ATOM 5445  H HG22 . THR A 1 74  ? -45.378 1.483   -1.819  1.00 0.00 ? 74  THR A HG22 3  
ATOM 5446  H HG23 . THR A 1 74  ? -45.579 3.028   -2.681  1.00 0.00 ? 74  THR A HG23 3  
ATOM 5447  N N    . GLN A 1 75  ? -46.716 1.643   1.252   1.00 0.00 ? 75  GLN A N    3  
ATOM 5448  C CA   . GLN A 1 75  ? -46.473 2.261   2.559   1.00 0.00 ? 75  GLN A CA   3  
ATOM 5449  C C    . GLN A 1 75  ? -45.743 3.604   2.489   1.00 0.00 ? 75  GLN A C    3  
ATOM 5450  O O    . GLN A 1 75  ? -44.841 3.847   1.682   1.00 0.00 ? 75  GLN A O    3  
ATOM 5451  C CB   . GLN A 1 75  ? -45.773 1.286   3.524   1.00 0.00 ? 75  GLN A CB   3  
ATOM 5452  C CG   . GLN A 1 75  ? -46.681 0.135   3.988   1.00 0.00 ? 75  GLN A CG   3  
ATOM 5453  C CD   . GLN A 1 75  ? -47.815 0.571   4.925   1.00 0.00 ? 75  GLN A CD   3  
ATOM 5454  O OE1  . GLN A 1 75  ? -48.041 1.743   5.212   1.00 0.00 ? 75  GLN A OE1  3  
ATOM 5455  N NE2  . GLN A 1 75  ? -48.582 -0.361  5.448   1.00 0.00 ? 75  GLN A NE2  3  
ATOM 5456  H H    . GLN A 1 75  ? -45.966 1.105   0.842   1.00 0.00 ? 75  GLN A H    3  
ATOM 5457  H HA   . GLN A 1 75  ? -47.446 2.502   2.987   1.00 0.00 ? 75  GLN A HA   3  
ATOM 5458  H HB2  . GLN A 1 75  ? -44.894 0.869   3.030   1.00 0.00 ? 75  GLN A HB2  3  
ATOM 5459  H HB3  . GLN A 1 75  ? -45.430 1.828   4.407   1.00 0.00 ? 75  GLN A HB3  3  
ATOM 5460  H HG2  . GLN A 1 75  ? -47.104 -0.366  3.118   1.00 0.00 ? 75  GLN A HG2  3  
ATOM 5461  H HG3  . GLN A 1 75  ? -46.065 -0.591  4.519   1.00 0.00 ? 75  GLN A HG3  3  
ATOM 5462  H HE21 . GLN A 1 75  ? -48.417 -1.336  5.240   1.00 0.00 ? 75  GLN A HE21 3  
ATOM 5463  H HE22 . GLN A 1 75  ? -49.310 -0.082  6.088   1.00 0.00 ? 75  GLN A HE22 3  
ATOM 5464  N N    . ARG A 1 76  ? -46.134 4.470   3.424   1.00 0.00 ? 76  ARG A N    3  
ATOM 5465  C CA   . ARG A 1 76  ? -45.674 5.855   3.532   1.00 0.00 ? 76  ARG A CA   3  
ATOM 5466  C C    . ARG A 1 76  ? -44.219 5.910   3.969   1.00 0.00 ? 76  ARG A C    3  
ATOM 5467  O O    . ARG A 1 76  ? -43.438 6.637   3.372   1.00 0.00 ? 76  ARG A O    3  
ATOM 5468  C CB   . ARG A 1 76  ? -46.577 6.636   4.495   1.00 0.00 ? 76  ARG A CB   3  
ATOM 5469  C CG   . ARG A 1 76  ? -48.088 6.496   4.211   1.00 0.00 ? 76  ARG A CG   3  
ATOM 5470  C CD   . ARG A 1 76  ? -48.774 5.391   5.032   1.00 0.00 ? 76  ARG A CD   3  
ATOM 5471  N NE   . ARG A 1 76  ? -50.223 5.344   4.754   1.00 0.00 ? 76  ARG A NE   3  
ATOM 5472  C CZ   . ARG A 1 76  ? -51.014 4.284   4.757   1.00 0.00 ? 76  ARG A CZ   3  
ATOM 5473  N NH1  . ARG A 1 76  ? -50.591 3.073   4.995   1.00 0.00 ? 76  ARG A NH1  3  
ATOM 5474  N NH2  . ARG A 1 76  ? -52.286 4.427   4.515   1.00 0.00 ? 76  ARG A NH2  3  
ATOM 5475  H H    . ARG A 1 76  ? -46.801 4.138   4.107   1.00 0.00 ? 76  ARG A H    3  
ATOM 5476  H HA   . ARG A 1 76  ? -45.728 6.327   2.547   1.00 0.00 ? 76  ARG A HA   3  
ATOM 5477  H HB2  . ARG A 1 76  ? -46.352 6.303   5.504   1.00 0.00 ? 76  ARG A HB2  3  
ATOM 5478  H HB3  . ARG A 1 76  ? -46.311 7.692   4.424   1.00 0.00 ? 76  ARG A HB3  3  
ATOM 5479  H HG2  . ARG A 1 76  ? -48.569 7.444   4.453   1.00 0.00 ? 76  ARG A HG2  3  
ATOM 5480  H HG3  . ARG A 1 76  ? -48.241 6.293   3.149   1.00 0.00 ? 76  ARG A HG3  3  
ATOM 5481  H HD2  . ARG A 1 76  ? -48.321 4.430   4.792   1.00 0.00 ? 76  ARG A HD2  3  
ATOM 5482  H HD3  . ARG A 1 76  ? -48.620 5.590   6.095   1.00 0.00 ? 76  ARG A HD3  3  
ATOM 5483  H HE   . ARG A 1 76  ? -50.672 6.225   4.563   1.00 0.00 ? 76  ARG A HE   3  
ATOM 5484  H HH11 . ARG A 1 76  ? -49.608 2.894   5.168   1.00 0.00 ? 76  ARG A HH11 3  
ATOM 5485  H HH12 . ARG A 1 76  ? -51.235 2.303   4.982   1.00 0.00 ? 76  ARG A HH12 3  
ATOM 5486  H HH21 . ARG A 1 76  ? -52.668 5.340   4.327   1.00 0.00 ? 76  ARG A HH21 3  
ATOM 5487  H HH22 . ARG A 1 76  ? -52.897 3.627   4.518   1.00 0.00 ? 76  ARG A HH22 3  
ATOM 5488  N N    . ARG A 1 77  ? -43.829 5.075   4.941   1.00 0.00 ? 77  ARG A N    3  
ATOM 5489  C CA   . ARG A 1 77  ? -42.434 4.908   5.392   1.00 0.00 ? 77  ARG A CA   3  
ATOM 5490  C C    . ARG A 1 77  ? -41.490 4.434   4.289   1.00 0.00 ? 77  ARG A C    3  
ATOM 5491  O O    . ARG A 1 77  ? -40.361 4.915   4.194   1.00 0.00 ? 77  ARG A O    3  
ATOM 5492  C CB   . ARG A 1 77  ? -42.376 4.013   6.635   1.00 0.00 ? 77  ARG A CB   3  
ATOM 5493  C CG   . ARG A 1 77  ? -42.834 2.559   6.440   1.00 0.00 ? 77  ARG A CG   3  
ATOM 5494  C CD   . ARG A 1 77  ? -42.702 1.759   7.739   1.00 0.00 ? 77  ARG A CD   3  
ATOM 5495  N NE   . ARG A 1 77  ? -43.669 2.183   8.774   1.00 0.00 ? 77  ARG A NE   3  
ATOM 5496  C CZ   . ARG A 1 77  ? -43.739 1.733   10.015  1.00 0.00 ? 77  ARG A CZ   3  
ATOM 5497  N NH1  . ARG A 1 77  ? -42.927 0.821   10.470  1.00 0.00 ? 77  ARG A NH1  3  
ATOM 5498  N NH2  . ARG A 1 77  ? -44.640 2.197   10.834  1.00 0.00 ? 77  ARG A NH2  3  
ATOM 5499  H H    . ARG A 1 77  ? -44.556 4.544   5.398   1.00 0.00 ? 77  ARG A H    3  
ATOM 5500  H HA   . ARG A 1 77  ? -42.057 5.877   5.709   1.00 0.00 ? 77  ARG A HA   3  
ATOM 5501  H HB2  . ARG A 1 77  ? -41.342 4.001   6.981   1.00 0.00 ? 77  ARG A HB2  3  
ATOM 5502  H HB3  . ARG A 1 77  ? -43.001 4.475   7.396   1.00 0.00 ? 77  ARG A HB3  3  
ATOM 5503  H HG2  . ARG A 1 77  ? -43.871 2.529   6.104   1.00 0.00 ? 77  ARG A HG2  3  
ATOM 5504  H HG3  . ARG A 1 77  ? -42.208 2.077   5.690   1.00 0.00 ? 77  ARG A HG3  3  
ATOM 5505  H HD2  . ARG A 1 77  ? -42.879 0.716   7.487   1.00 0.00 ? 77  ARG A HD2  3  
ATOM 5506  H HD3  . ARG A 1 77  ? -41.681 1.857   8.113   1.00 0.00 ? 77  ARG A HD3  3  
ATOM 5507  H HE   . ARG A 1 77  ? -44.351 2.877   8.513   1.00 0.00 ? 77  ARG A HE   3  
ATOM 5508  H HH11 . ARG A 1 77  ? -42.225 0.440   9.859   1.00 0.00 ? 77  ARG A HH11 3  
ATOM 5509  H HH12 . ARG A 1 77  ? -43.001 0.495   11.419  1.00 0.00 ? 77  ARG A HH12 3  
ATOM 5510  H HH21 . ARG A 1 77  ? -45.289 2.903   10.529  1.00 0.00 ? 77  ARG A HH21 3  
ATOM 5511  H HH22 . ARG A 1 77  ? -44.690 1.853   11.778  1.00 0.00 ? 77  ARG A HH22 3  
ATOM 5512  N N    . ALA A 1 78  ? -41.965 3.528   3.436   1.00 0.00 ? 78  ALA A N    3  
ATOM 5513  C CA   . ALA A 1 78  ? -41.236 3.046   2.264   1.00 0.00 ? 78  ALA A CA   3  
ATOM 5514  C C    . ALA A 1 78  ? -41.004 4.208   1.272   1.00 0.00 ? 78  ALA A C    3  
ATOM 5515  O O    . ALA A 1 78  ? -39.861 4.549   0.924   1.00 0.00 ? 78  ALA A O    3  
ATOM 5516  C CB   . ALA A 1 78  ? -42.039 1.878   1.658   1.00 0.00 ? 78  ALA A CB   3  
ATOM 5517  H H    . ALA A 1 78  ? -42.900 3.186   3.593   1.00 0.00 ? 78  ALA A H    3  
ATOM 5518  H HA   . ALA A 1 78  ? -40.267 2.658   2.584   1.00 0.00 ? 78  ALA A HA   3  
ATOM 5519  H HB1  . ALA A 1 78  ? -42.120 1.056   2.370   1.00 0.00 ? 78  ALA A HB1  3  
ATOM 5520  H HB2  . ALA A 1 78  ? -43.033 2.185   1.342   1.00 0.00 ? 78  ALA A HB2  3  
ATOM 5521  H HB3  . ALA A 1 78  ? -41.539 1.505   0.775   1.00 0.00 ? 78  ALA A HB3  3  
ATOM 5522  N N    . ALA A 1 79  ? -42.096 4.896   0.911   1.00 0.00 ? 79  ALA A N    3  
ATOM 5523  C CA   . ALA A 1 79  ? -42.045 6.003   -0.046  1.00 0.00 ? 79  ALA A CA   3  
ATOM 5524  C C    . ALA A 1 79  ? -41.244 7.208   0.486   1.00 0.00 ? 79  ALA A C    3  
ATOM 5525  O O    . ALA A 1 79  ? -40.529 7.866   -0.271  1.00 0.00 ? 79  ALA A O    3  
ATOM 5526  C CB   . ALA A 1 79  ? -43.488 6.387   -0.385  1.00 0.00 ? 79  ALA A CB   3  
ATOM 5527  H H    . ALA A 1 79  ? -43.001 4.646   1.318   1.00 0.00 ? 79  ALA A H    3  
ATOM 5528  H HA   . ALA A 1 79  ? -41.542 5.660   -0.954  1.00 0.00 ? 79  ALA A HA   3  
ATOM 5529  H HB1  . ALA A 1 79  ? -43.489 7.182   -1.128  1.00 0.00 ? 79  ALA A HB1  3  
ATOM 5530  H HB2  . ALA A 1 79  ? -44.019 5.523   -0.788  1.00 0.00 ? 79  ALA A HB2  3  
ATOM 5531  H HB3  . ALA A 1 79  ? -44.001 6.737   0.513   1.00 0.00 ? 79  ALA A HB3  3  
ATOM 5532  N N    . ALA A 1 80  ? -41.313 7.463   1.794   1.00 0.00 ? 80  ALA A N    3  
ATOM 5533  C CA   . ALA A 1 80  ? -40.603 8.538   2.473   1.00 0.00 ? 80  ALA A CA   3  
ATOM 5534  C C    . ALA A 1 80  ? -39.096 8.281   2.530   1.00 0.00 ? 80  ALA A C    3  
ATOM 5535  O O    . ALA A 1 80  ? -38.338 9.132   2.073   1.00 0.00 ? 80  ALA A O    3  
ATOM 5536  C CB   . ALA A 1 80  ? -41.194 8.719   3.872   1.00 0.00 ? 80  ALA A CB   3  
ATOM 5537  H H    . ALA A 1 80  ? -41.961 6.915   2.347   1.00 0.00 ? 80  ALA A H    3  
ATOM 5538  H HA   . ALA A 1 80  ? -40.762 9.460   1.912   1.00 0.00 ? 80  ALA A HA   3  
ATOM 5539  H HB1  . ALA A 1 80  ? -41.095 7.791   4.437   1.00 0.00 ? 80  ALA A HB1  3  
ATOM 5540  H HB2  . ALA A 1 80  ? -40.664 9.517   4.393   1.00 0.00 ? 80  ALA A HB2  3  
ATOM 5541  H HB3  . ALA A 1 80  ? -42.248 8.985   3.791   1.00 0.00 ? 80  ALA A HB3  3  
ATOM 5542  N N    . GLN A 1 81  ? -38.649 7.120   3.032   1.00 0.00 ? 81  GLN A N    3  
ATOM 5543  C CA   . GLN A 1 81  ? -37.243 6.688   2.963   1.00 0.00 ? 81  GLN A CA   3  
ATOM 5544  C C    . GLN A 1 81  ? -36.673 6.799   1.542   1.00 0.00 ? 81  GLN A C    3  
ATOM 5545  O O    . GLN A 1 81  ? -35.562 7.308   1.363   1.00 0.00 ? 81  GLN A O    3  
ATOM 5546  C CB   . GLN A 1 81  ? -37.099 5.254   3.489   1.00 0.00 ? 81  GLN A CB   3  
ATOM 5547  C CG   . GLN A 1 81  ? -37.197 5.196   5.021   1.00 0.00 ? 81  GLN A CG   3  
ATOM 5548  C CD   . GLN A 1 81  ? -37.243 3.756   5.523   1.00 0.00 ? 81  GLN A CD   3  
ATOM 5549  O OE1  . GLN A 1 81  ? -36.279 3.205   6.036   1.00 0.00 ? 81  GLN A OE1  3  
ATOM 5550  N NE2  . GLN A 1 81  ? -38.371 3.094   5.379   1.00 0.00 ? 81  GLN A NE2  3  
ATOM 5551  H H    . GLN A 1 81  ? -39.323 6.477   3.431   1.00 0.00 ? 81  GLN A H    3  
ATOM 5552  H HA   . GLN A 1 81  ? -36.639 7.339   3.593   1.00 0.00 ? 81  GLN A HA   3  
ATOM 5553  H HB2  . GLN A 1 81  ? -37.866 4.625   3.036   1.00 0.00 ? 81  GLN A HB2  3  
ATOM 5554  H HB3  . GLN A 1 81  ? -36.122 4.863   3.201   1.00 0.00 ? 81  GLN A HB3  3  
ATOM 5555  H HG2  . GLN A 1 81  ? -36.336 5.702   5.458   1.00 0.00 ? 81  GLN A HG2  3  
ATOM 5556  H HG3  . GLN A 1 81  ? -38.098 5.711   5.356   1.00 0.00 ? 81  GLN A HG3  3  
ATOM 5557  H HE21 . GLN A 1 81  ? -39.154 3.566   4.945   1.00 0.00 ? 81  GLN A HE21 3  
ATOM 5558  H HE22 . GLN A 1 81  ? -38.419 2.138   5.696   1.00 0.00 ? 81  GLN A HE22 3  
ATOM 5559  N N    . ILE A 1 82  ? -37.448 6.417   0.519   1.00 0.00 ? 82  ILE A N    3  
ATOM 5560  C CA   . ILE A 1 82  ? -37.012 6.608   -0.871  1.00 0.00 ? 82  ILE A CA   3  
ATOM 5561  C C    . ILE A 1 82  ? -36.860 8.088   -1.211  1.00 0.00 ? 82  ILE A C    3  
ATOM 5562  O O    . ILE A 1 82  ? -35.801 8.492   -1.683  1.00 0.00 ? 82  ILE A O    3  
ATOM 5563  C CB   . ILE A 1 82  ? -37.953 5.875   -1.832  1.00 0.00 ? 82  ILE A CB   3  
ATOM 5564  C CG1  . ILE A 1 82  ? -37.623 4.377   -1.706  1.00 0.00 ? 82  ILE A CG1  3  
ATOM 5565  C CG2  . ILE A 1 82  ? -37.785 6.395   -3.268  1.00 0.00 ? 82  ILE A CG2  3  
ATOM 5566  C CD1  . ILE A 1 82  ? -38.731 3.503   -2.261  1.00 0.00 ? 82  ILE A CD1  3  
ATOM 5567  H H    . ILE A 1 82  ? -38.359 5.997   0.695   1.00 0.00 ? 82  ILE A H    3  
ATOM 5568  H HA   . ILE A 1 82  ? -36.024 6.164   -0.983  1.00 0.00 ? 82  ILE A HA   3  
ATOM 5569  H HB   . ILE A 1 82  ? -38.984 6.050   -1.523  1.00 0.00 ? 82  ILE A HB   3  
ATOM 5570  H HG12 . ILE A 1 82  ? -36.683 4.150   -2.211  1.00 0.00 ? 82  ILE A HG12 3  
ATOM 5571  H HG13 . ILE A 1 82  ? -37.516 4.115   -0.654  1.00 0.00 ? 82  ILE A HG13 3  
ATOM 5572  H HG21 . ILE A 1 82  ? -38.357 5.788   -3.966  1.00 0.00 ? 82  ILE A HG21 3  
ATOM 5573  H HG22 . ILE A 1 82  ? -38.152 7.422   -3.320  1.00 0.00 ? 82  ILE A HG22 3  
ATOM 5574  H HG23 . ILE A 1 82  ? -36.730 6.378   -3.545  1.00 0.00 ? 82  ILE A HG23 3  
ATOM 5575  H HD11 . ILE A 1 82  ? -39.682 3.837   -1.847  1.00 0.00 ? 82  ILE A HD11 3  
ATOM 5576  H HD12 . ILE A 1 82  ? -38.747 3.566   -3.348  1.00 0.00 ? 82  ILE A HD12 3  
ATOM 5577  H HD13 . ILE A 1 82  ? -38.544 2.477   -1.956  1.00 0.00 ? 82  ILE A HD13 3  
ATOM 5578  N N    . ALA A 1 83  ? -37.864 8.912   -0.913  1.00 0.00 ? 83  ALA A N    3  
ATOM 5579  C CA   . ALA A 1 83  ? -37.788 10.357  -1.087  1.00 0.00 ? 83  ALA A CA   3  
ATOM 5580  C C    . ALA A 1 83  ? -36.528 10.947  -0.437  1.00 0.00 ? 83  ALA A C    3  
ATOM 5581  O O    . ALA A 1 83  ? -35.881 11.791  -1.051  1.00 0.00 ? 83  ALA A O    3  
ATOM 5582  C CB   . ALA A 1 83  ? -39.075 10.994  -0.564  1.00 0.00 ? 83  ALA A CB   3  
ATOM 5583  H H    . ALA A 1 83  ? -38.717 8.521   -0.527  1.00 0.00 ? 83  ALA A H    3  
ATOM 5584  H HA   . ALA A 1 83  ? -37.715 10.570  -2.153  1.00 0.00 ? 83  ALA A HA   3  
ATOM 5585  H HB1  . ALA A 1 83  ? -39.933 10.509  -1.031  1.00 0.00 ? 83  ALA A HB1  3  
ATOM 5586  H HB2  . ALA A 1 83  ? -39.138 10.881  0.516   1.00 0.00 ? 83  ALA A HB2  3  
ATOM 5587  H HB3  . ALA A 1 83  ? -39.075 12.057  -0.807  1.00 0.00 ? 83  ALA A HB3  3  
ATOM 5588  N N    . GLN A 1 84  ? -36.133 10.464  0.749   1.00 0.00 ? 84  GLN A N    3  
ATOM 5589  C CA   . GLN A 1 84  ? -34.898 10.895  1.419   1.00 0.00 ? 84  GLN A CA   3  
ATOM 5590  C C    . GLN A 1 84  ? -33.645 10.439  0.651   1.00 0.00 ? 84  GLN A C    3  
ATOM 5591  O O    . GLN A 1 84  ? -32.680 11.198  0.513   1.00 0.00 ? 84  GLN A O    3  
ATOM 5592  C CB   . GLN A 1 84  ? -34.793 10.386  2.869   1.00 0.00 ? 84  GLN A CB   3  
ATOM 5593  C CG   . GLN A 1 84  ? -36.005 10.579  3.786   1.00 0.00 ? 84  GLN A CG   3  
ATOM 5594  C CD   . GLN A 1 84  ? -36.726 11.916  3.633   1.00 0.00 ? 84  GLN A CD   3  
ATOM 5595  O OE1  . GLN A 1 84  ? -36.271 12.962  4.075   1.00 0.00 ? 84  GLN A OE1  3  
ATOM 5596  N NE2  . GLN A 1 84  ? -37.881 11.926  2.999   1.00 0.00 ? 84  GLN A NE2  3  
ATOM 5597  H H    . GLN A 1 84  ? -36.674 9.697   1.137   1.00 0.00 ? 84  GLN A H    3  
ATOM 5598  H HA   . GLN A 1 84  ? -34.905 11.984  1.460   1.00 0.00 ? 84  GLN A HA   3  
ATOM 5599  H HB2  . GLN A 1 84  ? -34.548 9.323   2.862   1.00 0.00 ? 84  GLN A HB2  3  
ATOM 5600  H HB3  . GLN A 1 84  ? -33.952 10.903  3.325   1.00 0.00 ? 84  GLN A HB3  3  
ATOM 5601  H HG2  . GLN A 1 84  ? -36.695 9.770   3.609   1.00 0.00 ? 84  GLN A HG2  3  
ATOM 5602  H HG3  . GLN A 1 84  ? -35.691 10.460  4.818   1.00 0.00 ? 84  GLN A HG3  3  
ATOM 5603  H HE21 . GLN A 1 84  ? -38.242 11.057  2.623   1.00 0.00 ? 84  GLN A HE21 3  
ATOM 5604  H HE22 . GLN A 1 84  ? -38.372 12.801  2.898   1.00 0.00 ? 84  GLN A HE22 3  
ATOM 5605  N N    . ALA A 1 85  ? -33.664 9.216   0.109   1.00 0.00 ? 85  ALA A N    3  
ATOM 5606  C CA   . ALA A 1 85  ? -32.546 8.667   -0.650  1.00 0.00 ? 85  ALA A CA   3  
ATOM 5607  C C    . ALA A 1 85  ? -32.358 9.377   -2.002  1.00 0.00 ? 85  ALA A C    3  
ATOM 5608  O O    . ALA A 1 85  ? -31.233 9.462   -2.499  1.00 0.00 ? 85  ALA A O    3  
ATOM 5609  C CB   . ALA A 1 85  ? -32.759 7.157   -0.816  1.00 0.00 ? 85  ALA A CB   3  
ATOM 5610  H H    . ALA A 1 85  ? -34.511 8.650   0.175   1.00 0.00 ? 85  ALA A H    3  
ATOM 5611  H HA   . ALA A 1 85  ? -31.635 8.823   -0.073  1.00 0.00 ? 85  ALA A HA   3  
ATOM 5612  H HB1  . ALA A 1 85  ? -31.897 6.722   -1.324  1.00 0.00 ? 85  ALA A HB1  3  
ATOM 5613  H HB2  . ALA A 1 85  ? -32.862 6.686   0.163   1.00 0.00 ? 85  ALA A HB2  3  
ATOM 5614  H HB3  . ALA A 1 85  ? -33.652 6.961   -1.407  1.00 0.00 ? 85  ALA A HB3  3  
ATOM 5615  N N    . LEU A 1 86  ? -33.435 9.937   -2.572  1.00 0.00 ? 86  LEU A N    3  
ATOM 5616  C CA   . LEU A 1 86  ? -33.384 10.665  -3.843  1.00 0.00 ? 86  LEU A CA   3  
ATOM 5617  C C    . LEU A 1 86  ? -33.071 12.154  -3.624  1.00 0.00 ? 86  LEU A C    3  
ATOM 5618  O O    . LEU A 1 86  ? -32.382 12.772  -4.437  1.00 0.00 ? 86  LEU A O    3  
ATOM 5619  C CB   . LEU A 1 86  ? -34.670 10.455  -4.656  1.00 0.00 ? 86  LEU A CB   3  
ATOM 5620  C CG   . LEU A 1 86  ? -35.149 9.001   -4.871  1.00 0.00 ? 86  LEU A CG   3  
ATOM 5621  C CD1  . LEU A 1 86  ? -35.916 8.932   -6.184  1.00 0.00 ? 86  LEU A CD1  3  
ATOM 5622  C CD2  . LEU A 1 86  ? -34.052 7.933   -4.991  1.00 0.00 ? 86  LEU A CD2  3  
ATOM 5623  H H    . LEU A 1 86  ? -34.333 9.828   -2.110  1.00 0.00 ? 86  LEU A H    3  
ATOM 5624  H HA   . LEU A 1 86  ? -32.567 10.256  -4.436  1.00 0.00 ? 86  LEU A HA   3  
ATOM 5625  H HB2  . LEU A 1 86  ? -35.484 11.010  -4.187  1.00 0.00 ? 86  LEU A HB2  3  
ATOM 5626  H HB3  . LEU A 1 86  ? -34.491 10.910  -5.629  1.00 0.00 ? 86  LEU A HB3  3  
ATOM 5627  H HG   . LEU A 1 86  ? -35.839 8.745   -4.063  1.00 0.00 ? 86  LEU A HG   3  
ATOM 5628  H HD11 . LEU A 1 86  ? -36.412 7.966   -6.278  1.00 0.00 ? 86  LEU A HD11 3  
ATOM 5629  H HD12 . LEU A 1 86  ? -36.655 9.726   -6.199  1.00 0.00 ? 86  LEU A HD12 3  
ATOM 5630  H HD13 . LEU A 1 86  ? -35.228 9.080   -7.015  1.00 0.00 ? 86  LEU A HD13 3  
ATOM 5631  H HD21 . LEU A 1 86  ? -34.492 6.980   -5.283  1.00 0.00 ? 86  LEU A HD21 3  
ATOM 5632  H HD22 . LEU A 1 86  ? -33.315 8.233   -5.736  1.00 0.00 ? 86  LEU A HD22 3  
ATOM 5633  H HD23 . LEU A 1 86  ? -33.559 7.784   -4.035  1.00 0.00 ? 86  LEU A HD23 3  
ATOM 5634  N N    . LEU A 1 87  ? -33.514 12.708  -2.489  1.00 0.00 ? 87  LEU A N    3  
ATOM 5635  C CA   . LEU A 1 87  ? -33.145 14.020  -1.966  1.00 0.00 ? 87  LEU A CA   3  
ATOM 5636  C C    . LEU A 1 87  ? -31.628 14.066  -1.690  1.00 0.00 ? 87  LEU A C    3  
ATOM 5637  O O    . LEU A 1 87  ? -30.989 15.094  -1.922  1.00 0.00 ? 87  LEU A O    3  
ATOM 5638  C CB   . LEU A 1 87  ? -34.007 14.220  -0.699  1.00 0.00 ? 87  LEU A CB   3  
ATOM 5639  C CG   . LEU A 1 87  ? -33.456 15.083  0.449   1.00 0.00 ? 87  LEU A CG   3  
ATOM 5640  C CD1  . LEU A 1 87  ? -34.123 16.438  0.280   1.00 0.00 ? 87  LEU A CD1  3  
ATOM 5641  C CD2  . LEU A 1 87  ? -33.849 14.552  1.827   1.00 0.00 ? 87  LEU A CD2  3  
ATOM 5642  H H    . LEU A 1 87  ? -34.190 12.201  -1.932  1.00 0.00 ? 87  LEU A H    3  
ATOM 5643  H HA   . LEU A 1 87  ? -33.385 14.797  -2.693  1.00 0.00 ? 87  LEU A HA   3  
ATOM 5644  H HB2  . LEU A 1 87  ? -35.017 14.515  -0.985  1.00 0.00 ? 87  LEU A HB2  3  
ATOM 5645  H HB3  . LEU A 1 87  ? -34.100 13.239  -0.247  1.00 0.00 ? 87  LEU A HB3  3  
ATOM 5646  H HG   . LEU A 1 87  ? -32.377 15.167  0.427   1.00 0.00 ? 87  LEU A HG   3  
ATOM 5647  H HD11 . LEU A 1 87  ? -35.202 16.318  0.371   1.00 0.00 ? 87  LEU A HD11 3  
ATOM 5648  H HD12 . LEU A 1 87  ? -33.750 17.135  1.027   1.00 0.00 ? 87  LEU A HD12 3  
ATOM 5649  H HD13 . LEU A 1 87  ? -33.893 16.800  -0.722  1.00 0.00 ? 87  LEU A HD13 3  
ATOM 5650  H HD21 . LEU A 1 87  ? -33.529 15.253  2.598   1.00 0.00 ? 87  LEU A HD21 3  
ATOM 5651  H HD22 . LEU A 1 87  ? -34.929 14.417  1.890   1.00 0.00 ? 87  LEU A HD22 3  
ATOM 5652  H HD23 . LEU A 1 87  ? -33.351 13.598  2.004   1.00 0.00 ? 87  LEU A HD23 3  
ATOM 5653  N N    . GLY A 1 88  ? -31.057 12.945  -1.231  1.00 0.00 ? 88  GLY A N    3  
ATOM 5654  C CA   . GLY A 1 88  ? -29.612 12.742  -1.080  1.00 0.00 ? 88  GLY A CA   3  
ATOM 5655  C C    . GLY A 1 88  ? -29.131 12.592  0.368   1.00 0.00 ? 88  GLY A C    3  
ATOM 5656  O O    . GLY A 1 88  ? -27.955 12.836  0.642   1.00 0.00 ? 88  GLY A O    3  
ATOM 5657  H H    . GLY A 1 88  ? -31.674 12.175  -0.988  1.00 0.00 ? 88  GLY A H    3  
ATOM 5658  H HA2  . GLY A 1 88  ? -29.342 11.829  -1.611  1.00 0.00 ? 88  GLY A HA2  3  
ATOM 5659  H HA3  . GLY A 1 88  ? -29.062 13.566  -1.538  1.00 0.00 ? 88  GLY A HA3  3  
ATOM 5660  N N    . ALA A 1 89  ? -30.015 12.202  1.295   1.00 0.00 ? 89  ALA A N    3  
ATOM 5661  C CA   . ALA A 1 89  ? -29.652 11.914  2.686   1.00 0.00 ? 89  ALA A CA   3  
ATOM 5662  C C    . ALA A 1 89  ? -28.641 10.751  2.775   1.00 0.00 ? 89  ALA A C    3  
ATOM 5663  O O    . ALA A 1 89  ? -27.593 10.878  3.412   1.00 0.00 ? 89  ALA A O    3  
ATOM 5664  C CB   . ALA A 1 89  ? -30.932 11.625  3.479   1.00 0.00 ? 89  ALA A CB   3  
ATOM 5665  H H    . ALA A 1 89  ? -30.970 12.023  1.010   1.00 0.00 ? 89  ALA A H    3  
ATOM 5666  H HA   . ALA A 1 89  ? -29.178 12.799  3.114   1.00 0.00 ? 89  ALA A HA   3  
ATOM 5667  H HB1  . ALA A 1 89  ? -30.680 11.440  4.524   1.00 0.00 ? 89  ALA A HB1  3  
ATOM 5668  H HB2  . ALA A 1 89  ? -31.603 12.484  3.427   1.00 0.00 ? 89  ALA A HB2  3  
ATOM 5669  H HB3  . ALA A 1 89  ? -31.437 10.746  3.076   1.00 0.00 ? 89  ALA A HB3  3  
ATOM 5670  N N    . GLU A 1 90  ? -28.938 9.632   2.104   1.00 0.00 ? 90  GLU A N    3  
ATOM 5671  C CA   . GLU A 1 90  ? -28.031 8.495   1.900   1.00 0.00 ? 90  GLU A CA   3  
ATOM 5672  C C    . GLU A 1 90  ? -28.459 7.613   0.709   1.00 0.00 ? 90  GLU A C    3  
ATOM 5673  O O    . GLU A 1 90  ? -29.645 7.462   0.420   1.00 0.00 ? 90  GLU A O    3  
ATOM 5674  C CB   . GLU A 1 90  ? -27.924 7.638   3.179   1.00 0.00 ? 90  GLU A CB   3  
ATOM 5675  C CG   . GLU A 1 90  ? -29.260 7.119   3.734   1.00 0.00 ? 90  GLU A CG   3  
ATOM 5676  C CD   . GLU A 1 90  ? -29.028 6.265   4.991   1.00 0.00 ? 90  GLU A CD   3  
ATOM 5677  O OE1  . GLU A 1 90  ? -28.739 5.051   4.852   1.00 0.00 ? 90  GLU A OE1  3  
ATOM 5678  O OE2  . GLU A 1 90  ? -29.130 6.793   6.125   1.00 0.00 ? 90  GLU A OE2  3  
ATOM 5679  H H    . GLU A 1 90  ? -29.827 9.589   1.627   1.00 0.00 ? 90  GLU A H    3  
ATOM 5680  H HA   . GLU A 1 90  ? -27.035 8.882   1.677   1.00 0.00 ? 90  GLU A HA   3  
ATOM 5681  H HB2  . GLU A 1 90  ? -27.280 6.786   2.966   1.00 0.00 ? 90  GLU A HB2  3  
ATOM 5682  H HB3  . GLU A 1 90  ? -27.436 8.227   3.957   1.00 0.00 ? 90  GLU A HB3  3  
ATOM 5683  H HG2  . GLU A 1 90  ? -29.911 7.963   3.977   1.00 0.00 ? 90  GLU A HG2  3  
ATOM 5684  H HG3  . GLU A 1 90  ? -29.764 6.518   2.973   1.00 0.00 ? 90  GLU A HG3  3  
ATOM 5685  N N    . GLU A 1 91  ? -27.492 6.997   0.025   1.00 0.00 ? 91  GLU A N    3  
ATOM 5686  C CA   . GLU A 1 91  ? -27.727 5.933   -0.964  1.00 0.00 ? 91  GLU A CA   3  
ATOM 5687  C C    . GLU A 1 91  ? -28.172 4.669   -0.204  1.00 0.00 ? 91  GLU A C    3  
ATOM 5688  O O    . GLU A 1 91  ? -27.389 4.089   0.555   1.00 0.00 ? 91  GLU A O    3  
ATOM 5689  C CB   . GLU A 1 91  ? -26.420 5.729   -1.753  1.00 0.00 ? 91  GLU A CB   3  
ATOM 5690  C CG   . GLU A 1 91  ? -26.441 4.535   -2.717  1.00 0.00 ? 91  GLU A CG   3  
ATOM 5691  C CD   . GLU A 1 91  ? -25.745 3.283   -2.151  1.00 0.00 ? 91  GLU A CD   3  
ATOM 5692  O OE1  . GLU A 1 91  ? -24.505 3.324   -1.957  1.00 0.00 ? 91  GLU A OE1  3  
ATOM 5693  O OE2  . GLU A 1 91  ? -26.417 2.241   -1.966  1.00 0.00 ? 91  GLU A OE2  3  
ATOM 5694  H H    . GLU A 1 91  ? -26.536 7.157   0.305   1.00 0.00 ? 91  GLU A H    3  
ATOM 5695  H HA   . GLU A 1 91  ? -28.512 6.213   -1.684  1.00 0.00 ? 91  GLU A HA   3  
ATOM 5696  H HB2  . GLU A 1 91  ? -26.250 6.632   -2.341  1.00 0.00 ? 91  GLU A HB2  3  
ATOM 5697  H HB3  . GLU A 1 91  ? -25.581 5.628   -1.063  1.00 0.00 ? 91  GLU A HB3  3  
ATOM 5698  H HG2  . GLU A 1 91  ? -27.476 4.312   -2.984  1.00 0.00 ? 91  GLU A HG2  3  
ATOM 5699  H HG3  . GLU A 1 91  ? -25.918 4.833   -3.629  1.00 0.00 ? 91  GLU A HG3  3  
ATOM 5700  N N    . ARG A 1 92  ? -29.443 4.270   -0.366  1.00 0.00 ? 92  ARG A N    3  
ATOM 5701  C CA   . ARG A 1 92  ? -30.064 3.153   0.365   1.00 0.00 ? 92  ARG A CA   3  
ATOM 5702  C C    . ARG A 1 92  ? -31.120 2.446   -0.488  1.00 0.00 ? 92  ARG A C    3  
ATOM 5703  O O    . ARG A 1 92  ? -31.955 3.101   -1.114  1.00 0.00 ? 92  ARG A O    3  
ATOM 5704  C CB   . ARG A 1 92  ? -30.677 3.702   1.671   1.00 0.00 ? 92  ARG A CB   3  
ATOM 5705  C CG   . ARG A 1 92  ? -31.254 2.636   2.621   1.00 0.00 ? 92  ARG A CG   3  
ATOM 5706  C CD   . ARG A 1 92  ? -30.213 1.669   3.205   1.00 0.00 ? 92  ARG A CD   3  
ATOM 5707  N NE   . ARG A 1 92  ? -29.210 2.373   4.024   1.00 0.00 ? 92  ARG A NE   3  
ATOM 5708  C CZ   . ARG A 1 92  ? -28.174 1.861   4.655   1.00 0.00 ? 92  ARG A CZ   3  
ATOM 5709  N NH1  . ARG A 1 92  ? -27.886 0.590   4.637   1.00 0.00 ? 92  ARG A NH1  3  
ATOM 5710  N NH2  . ARG A 1 92  ? -27.411 2.664   5.331   1.00 0.00 ? 92  ARG A NH2  3  
ATOM 5711  H H    . ARG A 1 92  ? -30.049 4.820   -0.963  1.00 0.00 ? 92  ARG A H    3  
ATOM 5712  H HA   . ARG A 1 92  ? -29.286 2.430   0.612   1.00 0.00 ? 92  ARG A HA   3  
ATOM 5713  H HB2  . ARG A 1 92  ? -29.914 4.267   2.207   1.00 0.00 ? 92  ARG A HB2  3  
ATOM 5714  H HB3  . ARG A 1 92  ? -31.477 4.400   1.416   1.00 0.00 ? 92  ARG A HB3  3  
ATOM 5715  H HG2  . ARG A 1 92  ? -31.752 3.145   3.448   1.00 0.00 ? 92  ARG A HG2  3  
ATOM 5716  H HG3  . ARG A 1 92  ? -32.008 2.056   2.091   1.00 0.00 ? 92  ARG A HG3  3  
ATOM 5717  H HD2  . ARG A 1 92  ? -30.736 0.940   3.827   1.00 0.00 ? 92  ARG A HD2  3  
ATOM 5718  H HD3  . ARG A 1 92  ? -29.718 1.132   2.394   1.00 0.00 ? 92  ARG A HD3  3  
ATOM 5719  H HE   . ARG A 1 92  ? -29.304 3.381   4.135   1.00 0.00 ? 92  ARG A HE   3  
ATOM 5720  H HH11 . ARG A 1 92  ? -28.479 -0.042  4.126   1.00 0.00 ? 92  ARG A HH11 3  
ATOM 5721  H HH12 . ARG A 1 92  ? -27.086 0.240   5.137   1.00 0.00 ? 92  ARG A HH12 3  
ATOM 5722  H HH21 . ARG A 1 92  ? -27.677 3.650   5.329   1.00 0.00 ? 92  ARG A HH21 3  
ATOM 5723  H HH22 . ARG A 1 92  ? -26.608 2.334   5.836   1.00 0.00 ? 92  ARG A HH22 3  
ATOM 5724  N N    . LYS A 1 93  ? -31.112 1.111   -0.454  1.00 0.00 ? 93  LYS A N    3  
ATOM 5725  C CA   . LYS A 1 93  ? -32.143 0.240   -1.040  1.00 0.00 ? 93  LYS A CA   3  
ATOM 5726  C C    . LYS A 1 93  ? -33.317 0.068   -0.072  1.00 0.00 ? 93  LYS A C    3  
ATOM 5727  O O    . LYS A 1 93  ? -33.116 -0.191  1.115   1.00 0.00 ? 93  LYS A O    3  
ATOM 5728  C CB   . LYS A 1 93  ? -31.501 -1.086  -1.449  1.00 0.00 ? 93  LYS A CB   3  
ATOM 5729  C CG   . LYS A 1 93  ? -32.430 -2.020  -2.226  1.00 0.00 ? 93  LYS A CG   3  
ATOM 5730  C CD   . LYS A 1 93  ? -31.882 -3.449  -2.238  1.00 0.00 ? 93  LYS A CD   3  
ATOM 5731  C CE   . LYS A 1 93  ? -30.505 -3.529  -2.912  1.00 0.00 ? 93  LYS A CE   3  
ATOM 5732  N NZ   . LYS A 1 93  ? -30.026 -4.930  -3.001  1.00 0.00 ? 93  LYS A NZ   3  
ATOM 5733  H H    . LYS A 1 93  ? -30.393 0.673   0.100   1.00 0.00 ? 93  LYS A H    3  
ATOM 5734  H HA   . LYS A 1 93  ? -32.522 0.696   -1.949  1.00 0.00 ? 93  LYS A HA   3  
ATOM 5735  H HB2  . LYS A 1 93  ? -30.663 -0.865  -2.109  1.00 0.00 ? 93  LYS A HB2  3  
ATOM 5736  H HB3  . LYS A 1 93  ? -31.143 -1.595  -0.554  1.00 0.00 ? 93  LYS A HB3  3  
ATOM 5737  H HG2  . LYS A 1 93  ? -33.421 -2.033  -1.779  1.00 0.00 ? 93  LYS A HG2  3  
ATOM 5738  H HG3  . LYS A 1 93  ? -32.510 -1.657  -3.247  1.00 0.00 ? 93  LYS A HG3  3  
ATOM 5739  H HD2  . LYS A 1 93  ? -31.809 -3.798  -1.208  1.00 0.00 ? 93  LYS A HD2  3  
ATOM 5740  H HD3  . LYS A 1 93  ? -32.592 -4.082  -2.766  1.00 0.00 ? 93  LYS A HD3  3  
ATOM 5741  H HE2  . LYS A 1 93  ? -30.591 -3.107  -3.918  1.00 0.00 ? 93  LYS A HE2  3  
ATOM 5742  H HE3  . LYS A 1 93  ? -29.792 -2.925  -2.345  1.00 0.00 ? 93  LYS A HE3  3  
ATOM 5743  H HZ1  . LYS A 1 93  ? -30.654 -5.456  -3.613  1.00 0.00 ? 93  LYS A HZ1  3  
ATOM 5744  H HZ2  . LYS A 1 93  ? -29.103 -4.981  -3.409  1.00 0.00 ? 93  LYS A HZ2  3  
ATOM 5745  H HZ3  . LYS A 1 93  ? -30.004 -5.382  -2.099  1.00 0.00 ? 93  LYS A HZ3  3  
ATOM 5746  N N    . VAL A 1 94  ? -34.535 0.207   -0.591  1.00 0.00 ? 94  VAL A N    3  
ATOM 5747  C CA   . VAL A 1 94  ? -35.799 0.135   0.164   1.00 0.00 ? 94  VAL A CA   3  
ATOM 5748  C C    . VAL A 1 94  ? -36.825 -0.654  -0.650  1.00 0.00 ? 94  VAL A C    3  
ATOM 5749  O O    . VAL A 1 94  ? -36.840 -0.589  -1.878  1.00 0.00 ? 94  VAL A O    3  
ATOM 5750  C CB   . VAL A 1 94  ? -36.346 1.547   0.490   1.00 0.00 ? 94  VAL A CB   3  
ATOM 5751  C CG1  . VAL A 1 94  ? -37.380 1.515   1.623   1.00 0.00 ? 94  VAL A CG1  3  
ATOM 5752  C CG2  . VAL A 1 94  ? -35.271 2.558   0.918   1.00 0.00 ? 94  VAL A CG2  3  
ATOM 5753  H H    . VAL A 1 94  ? -34.604 0.398   -1.580  1.00 0.00 ? 94  VAL A H    3  
ATOM 5754  H HA   . VAL A 1 94  ? -35.640 -0.412  1.095   1.00 0.00 ? 94  VAL A HA   3  
ATOM 5755  H HB   . VAL A 1 94  ? -36.830 1.923   -0.408  1.00 0.00 ? 94  VAL A HB   3  
ATOM 5756  H HG11 . VAL A 1 94  ? -36.925 1.145   2.541   1.00 0.00 ? 94  VAL A HG11 3  
ATOM 5757  H HG12 . VAL A 1 94  ? -37.767 2.520   1.795   1.00 0.00 ? 94  VAL A HG12 3  
ATOM 5758  H HG13 . VAL A 1 94  ? -38.222 0.882   1.357   1.00 0.00 ? 94  VAL A HG13 3  
ATOM 5759  H HG21 . VAL A 1 94  ? -34.574 2.739   0.100   1.00 0.00 ? 94  VAL A HG21 3  
ATOM 5760  H HG22 . VAL A 1 94  ? -35.737 3.510   1.169   1.00 0.00 ? 94  VAL A HG22 3  
ATOM 5761  H HG23 . VAL A 1 94  ? -34.730 2.180   1.786   1.00 0.00 ? 94  VAL A HG23 3  
ATOM 5762  N N    . GLU A 1 95  ? -37.692 -1.396  0.032   1.00 0.00 ? 95  GLU A N    3  
ATOM 5763  C CA   . GLU A 1 95  ? -38.833 -2.088  -0.574  1.00 0.00 ? 95  GLU A CA   3  
ATOM 5764  C C    . GLU A 1 95  ? -39.995 -1.113  -0.805  1.00 0.00 ? 95  GLU A C    3  
ATOM 5765  O O    . GLU A 1 95  ? -40.094 -0.115  -0.100  1.00 0.00 ? 95  GLU A O    3  
ATOM 5766  C CB   . GLU A 1 95  ? -39.238 -3.271  0.317   1.00 0.00 ? 95  GLU A CB   3  
ATOM 5767  C CG   . GLU A 1 95  ? -39.781 -2.850  1.697   1.00 0.00 ? 95  GLU A CG   3  
ATOM 5768  C CD   . GLU A 1 95  ? -40.064 -4.072  2.592   1.00 0.00 ? 95  GLU A CD   3  
ATOM 5769  O OE1  . GLU A 1 95  ? -39.099 -4.687  3.110   1.00 0.00 ? 95  GLU A OE1  3  
ATOM 5770  O OE2  . GLU A 1 95  ? -41.253 -4.410  2.811   1.00 0.00 ? 95  GLU A OE2  3  
ATOM 5771  H H    . GLU A 1 95  ? -37.697 -1.320  1.037   1.00 0.00 ? 95  GLU A H    3  
ATOM 5772  H HA   . GLU A 1 95  ? -38.525 -2.475  -1.546  1.00 0.00 ? 95  GLU A HA   3  
ATOM 5773  H HB2  . GLU A 1 95  ? -39.994 -3.859  -0.203  1.00 0.00 ? 95  GLU A HB2  3  
ATOM 5774  H HB3  . GLU A 1 95  ? -38.350 -3.888  0.462   1.00 0.00 ? 95  GLU A HB3  3  
ATOM 5775  H HG2  . GLU A 1 95  ? -39.048 -2.210  2.195   1.00 0.00 ? 95  GLU A HG2  3  
ATOM 5776  H HG3  . GLU A 1 95  ? -40.694 -2.260  1.569   1.00 0.00 ? 95  GLU A HG3  3  
ATOM 5777  N N    . ILE A 1 96  ? -40.872 -1.380  -1.776  1.00 0.00 ? 96  ILE A N    3  
ATOM 5778  C CA   . ILE A 1 96  ? -42.040 -0.537  -2.090  1.00 0.00 ? 96  ILE A CA   3  
ATOM 5779  C C    . ILE A 1 96  ? -43.054 -1.287  -2.955  1.00 0.00 ? 96  ILE A C    3  
ATOM 5780  O O    . ILE A 1 96  ? -42.690 -2.146  -3.761  1.00 0.00 ? 96  ILE A O    3  
ATOM 5781  C CB   . ILE A 1 96  ? -41.710 0.798   -2.827  1.00 0.00 ? 96  ILE A CB   3  
ATOM 5782  C CG1  . ILE A 1 96  ? -40.359 0.865   -3.569  1.00 0.00 ? 96  ILE A CG1  3  
ATOM 5783  C CG2  . ILE A 1 96  ? -41.839 2.000   -1.887  1.00 0.00 ? 96  ILE A CG2  3  
ATOM 5784  C CD1  . ILE A 1 96  ? -40.210 -0.189  -4.657  1.00 0.00 ? 96  ILE A CD1  3  
ATOM 5785  H H    . ILE A 1 96  ? -40.792 -2.252  -2.283  1.00 0.00 ? 96  ILE A H    3  
ATOM 5786  H HA   . ILE A 1 96  ? -42.518 -0.326  -1.132  1.00 0.00 ? 96  ILE A HA   3  
ATOM 5787  H HB   . ILE A 1 96  ? -42.483 0.966   -3.577  1.00 0.00 ? 96  ILE A HB   3  
ATOM 5788  H HG12 . ILE A 1 96  ? -40.266 1.841   -4.044  1.00 0.00 ? 96  ILE A HG12 3  
ATOM 5789  H HG13 . ILE A 1 96  ? -39.540 0.742   -2.863  1.00 0.00 ? 96  ILE A HG13 3  
ATOM 5790  H HG21 . ILE A 1 96  ? -40.981 2.039   -1.221  1.00 0.00 ? 96  ILE A HG21 3  
ATOM 5791  H HG22 . ILE A 1 96  ? -41.870 2.920   -2.466  1.00 0.00 ? 96  ILE A HG22 3  
ATOM 5792  H HG23 . ILE A 1 96  ? -42.761 1.936   -1.309  1.00 0.00 ? 96  ILE A HG23 3  
ATOM 5793  H HD11 . ILE A 1 96  ? -39.254 -0.068  -5.166  1.00 0.00 ? 96  ILE A HD11 3  
ATOM 5794  H HD12 . ILE A 1 96  ? -40.226 -1.173  -4.206  1.00 0.00 ? 96  ILE A HD12 3  
ATOM 5795  H HD13 . ILE A 1 96  ? -41.032 -0.104  -5.361  1.00 0.00 ? 96  ILE A HD13 3  
ATOM 5796  N N    . ALA A 1 97  ? -44.332 -0.942  -2.792  1.00 0.00 ? 97  ALA A N    3  
ATOM 5797  C CA   . ALA A 1 97  ? -45.409 -1.477  -3.621  1.00 0.00 ? 97  ALA A CA   3  
ATOM 5798  C C    . ALA A 1 97  ? -45.658 -0.598  -4.856  1.00 0.00 ? 97  ALA A C    3  
ATOM 5799  O O    . ALA A 1 97  ? -45.571 0.632   -4.775  1.00 0.00 ? 97  ALA A O    3  
ATOM 5800  C CB   . ALA A 1 97  ? -46.693 -1.680  -2.809  1.00 0.00 ? 97  ALA A CB   3  
ATOM 5801  H H    . ALA A 1 97  ? -44.551 -0.220  -2.120  1.00 0.00 ? 97  ALA A H    3  
ATOM 5802  H HA   . ALA A 1 97  ? -45.090 -2.460  -3.963  1.00 0.00 ? 97  ALA A HA   3  
ATOM 5803  H HB1  . ALA A 1 97  ? -47.213 -0.735  -2.704  1.00 0.00 ? 97  ALA A HB1  3  
ATOM 5804  H HB2  . ALA A 1 97  ? -47.355 -2.363  -3.340  1.00 0.00 ? 97  ALA A HB2  3  
ATOM 5805  H HB3  . ALA A 1 97  ? -46.475 -2.087  -1.824  1.00 0.00 ? 97  ALA A HB3  3  
ATOM 5806  N N    . PHE A 1 98  ? -46.017 -1.223  -5.974  1.00 0.00 ? 98  PHE A N    3  
ATOM 5807  C CA   . PHE A 1 98  ? -46.471 -0.551  -7.195  1.00 0.00 ? 98  PHE A CA   3  
ATOM 5808  C C    . PHE A 1 98  ? -47.922 -0.918  -7.529  1.00 0.00 ? 98  PHE A C    3  
ATOM 5809  O O    . PHE A 1 98  ? -48.448 -1.930  -7.047  1.00 0.00 ? 98  PHE A O    3  
ATOM 5810  C CB   . PHE A 1 98  ? -45.549 -0.927  -8.366  1.00 0.00 ? 98  PHE A CB   3  
ATOM 5811  C CG   . PHE A 1 98  ? -44.089 -0.550  -8.199  1.00 0.00 ? 98  PHE A CG   3  
ATOM 5812  C CD1  . PHE A 1 98  ? -43.723 0.803   -8.052  1.00 0.00 ? 98  PHE A CD1  3  
ATOM 5813  C CD2  . PHE A 1 98  ? -43.091 -1.545  -8.229  1.00 0.00 ? 98  PHE A CD2  3  
ATOM 5814  C CE1  . PHE A 1 98  ? -42.368 1.160   -7.938  1.00 0.00 ? 98  PHE A CE1  3  
ATOM 5815  C CE2  . PHE A 1 98  ? -41.737 -1.185  -8.122  1.00 0.00 ? 98  PHE A CE2  3  
ATOM 5816  C CZ   . PHE A 1 98  ? -41.377 0.166   -7.977  1.00 0.00 ? 98  PHE A CZ   3  
ATOM 5817  H H    . PHE A 1 98  ? -46.109 -2.233  -5.936  1.00 0.00 ? 98  PHE A H    3  
ATOM 5818  H HA   . PHE A 1 98  ? -46.431 0.530   -7.062  1.00 0.00 ? 98  PHE A HA   3  
ATOM 5819  H HB2  . PHE A 1 98  ? -45.624 -2.000  -8.529  1.00 0.00 ? 98  PHE A HB2  3  
ATOM 5820  H HB3  . PHE A 1 98  ? -45.913 -0.437  -9.271  1.00 0.00 ? 98  PHE A HB3  3  
ATOM 5821  H HD1  . PHE A 1 98  ? -44.483 1.571   -8.032  1.00 0.00 ? 98  PHE A HD1  3  
ATOM 5822  H HD2  . PHE A 1 98  ? -43.354 -2.587  -8.341  1.00 0.00 ? 98  PHE A HD2  3  
ATOM 5823  H HE1  . PHE A 1 98  ? -42.088 2.197   -7.825  1.00 0.00 ? 98  PHE A HE1  3  
ATOM 5824  H HE2  . PHE A 1 98  ? -40.977 -1.953  -8.158  1.00 0.00 ? 98  PHE A HE2  3  
ATOM 5825  H HZ   . PHE A 1 98  ? -40.338 0.442   -7.882  1.00 0.00 ? 98  PHE A HZ   3  
ATOM 5826  N N    . TYR A 1 99  ? -48.556 -0.108  -8.383  1.00 0.00 ? 99  TYR A N    3  
ATOM 5827  C CA   . TYR A 1 99  ? -49.834 -0.446  -9.010  1.00 0.00 ? 99  TYR A CA   3  
ATOM 5828  C C    . TYR A 1 99  ? -49.739 -0.311  -10.536 1.00 0.00 ? 99  TYR A C    3  
ATOM 5829  O O    . TYR A 1 99  ? -49.129 0.624   -11.067 1.00 0.00 ? 99  TYR A O    3  
ATOM 5830  C CB   . TYR A 1 99  ? -51.020 0.327   -8.415  1.00 0.00 ? 99  TYR A CB   3  
ATOM 5831  C CG   . TYR A 1 99  ? -51.224 1.752   -8.897  1.00 0.00 ? 99  TYR A CG   3  
ATOM 5832  C CD1  . TYR A 1 99  ? -50.381 2.792   -8.461  1.00 0.00 ? 99  TYR A CD1  3  
ATOM 5833  C CD2  . TYR A 1 99  ? -52.289 2.039   -9.776  1.00 0.00 ? 99  TYR A CD2  3  
ATOM 5834  C CE1  . TYR A 1 99  ? -50.607 4.112   -8.895  1.00 0.00 ? 99  TYR A CE1  3  
ATOM 5835  C CE2  . TYR A 1 99  ? -52.517 3.358   -10.212 1.00 0.00 ? 99  TYR A CE2  3  
ATOM 5836  C CZ   . TYR A 1 99  ? -51.674 4.402   -9.772  1.00 0.00 ? 99  TYR A CZ   3  
ATOM 5837  O OH   . TYR A 1 99  ? -51.884 5.683   -10.182 1.00 0.00 ? 99  TYR A OH   3  
ATOM 5838  H H    . TYR A 1 99  ? -48.066 0.699   -8.744  1.00 0.00 ? 99  TYR A H    3  
ATOM 5839  H HA   . TYR A 1 99  ? -50.025 -1.495  -8.803  1.00 0.00 ? 99  TYR A HA   3  
ATOM 5840  H HB2  . TYR A 1 99  ? -51.920 -0.239  -8.655  1.00 0.00 ? 99  TYR A HB2  3  
ATOM 5841  H HB3  . TYR A 1 99  ? -50.930 0.328   -7.329  1.00 0.00 ? 99  TYR A HB3  3  
ATOM 5842  H HD1  . TYR A 1 99  ? -49.559 2.581   -7.789  1.00 0.00 ? 99  TYR A HD1  3  
ATOM 5843  H HD2  . TYR A 1 99  ? -52.936 1.243   -10.123 1.00 0.00 ? 99  TYR A HD2  3  
ATOM 5844  H HE1  . TYR A 1 99  ? -49.971 4.915   -8.556  1.00 0.00 ? 99  TYR A HE1  3  
ATOM 5845  H HE2  . TYR A 1 99  ? -53.332 3.572   -10.890 1.00 0.00 ? 99  TYR A HE2  3  
ATOM 5846  H HH   . TYR A 1 99  ? -52.645 5.758   -10.783 1.00 0.00 ? 99  TYR A HH   3  
ATOM 5847  N N    . ARG A 1 100 ? -50.327 -1.282  -11.235 1.00 0.00 ? 100 ARG A N    3  
ATOM 5848  C CA   . ARG A 1 100 ? -50.313 -1.432  -12.694 1.00 0.00 ? 100 ARG A CA   3  
ATOM 5849  C C    . ARG A 1 100 ? -51.529 -0.766  -13.343 1.00 0.00 ? 100 ARG A C    3  
ATOM 5850  O O    . ARG A 1 100 ? -52.576 -0.620  -12.710 1.00 0.00 ? 100 ARG A O    3  
ATOM 5851  C CB   . ARG A 1 100 ? -50.186 -2.937  -12.996 1.00 0.00 ? 100 ARG A CB   3  
ATOM 5852  C CG   . ARG A 1 100 ? -49.913 -3.296  -14.467 1.00 0.00 ? 100 ARG A CG   3  
ATOM 5853  C CD   . ARG A 1 100 ? -49.563 -4.780  -14.621 1.00 0.00 ? 100 ARG A CD   3  
ATOM 5854  N NE   . ARG A 1 100 ? -48.214 -5.069  -14.099 1.00 0.00 ? 100 ARG A NE   3  
ATOM 5855  C CZ   . ARG A 1 100 ? -47.751 -6.218  -13.649 1.00 0.00 ? 100 ARG A CZ   3  
ATOM 5856  N NH1  . ARG A 1 100 ? -48.476 -7.301  -13.609 1.00 0.00 ? 100 ARG A NH1  3  
ATOM 5857  N NH2  . ARG A 1 100 ? -46.525 -6.274  -13.223 1.00 0.00 ? 100 ARG A NH2  3  
ATOM 5858  H H    . ARG A 1 100 ? -50.801 -2.003  -10.699 1.00 0.00 ? 100 ARG A H    3  
ATOM 5859  H HA   . ARG A 1 100 ? -49.425 -0.928  -13.077 1.00 0.00 ? 100 ARG A HA   3  
ATOM 5860  H HB2  . ARG A 1 100 ? -49.355 -3.317  -12.401 1.00 0.00 ? 100 ARG A HB2  3  
ATOM 5861  H HB3  . ARG A 1 100 ? -51.093 -3.443  -12.667 1.00 0.00 ? 100 ARG A HB3  3  
ATOM 5862  H HG2  . ARG A 1 100 ? -50.803 -3.087  -15.060 1.00 0.00 ? 100 ARG A HG2  3  
ATOM 5863  H HG3  . ARG A 1 100 ? -49.086 -2.702  -14.850 1.00 0.00 ? 100 ARG A HG3  3  
ATOM 5864  H HD2  . ARG A 1 100 ? -50.315 -5.374  -14.098 1.00 0.00 ? 100 ARG A HD2  3  
ATOM 5865  H HD3  . ARG A 1 100 ? -49.594 -5.038  -15.682 1.00 0.00 ? 100 ARG A HD3  3  
ATOM 5866  H HE   . ARG A 1 100 ? -47.538 -4.311  -14.099 1.00 0.00 ? 100 ARG A HE   3  
ATOM 5867  H HH11 . ARG A 1 100 ? -49.420 -7.268  -13.953 1.00 0.00 ? 100 ARG A HH11 3  
ATOM 5868  H HH12 . ARG A 1 100 ? -48.091 -8.163  -13.262 1.00 0.00 ? 100 ARG A HH12 3  
ATOM 5869  H HH21 . ARG A 1 100 ? -45.974 -5.428  -13.247 1.00 0.00 ? 100 ARG A HH21 3  
ATOM 5870  H HH22 . ARG A 1 100 ? -46.145 -7.129  -12.856 1.00 0.00 ? 100 ARG A HH22 3  
ATOM 5871  N N    . LYS A 1 101 ? -51.414 -0.428  -14.630 1.00 0.00 ? 101 LYS A N    3  
ATOM 5872  C CA   . LYS A 1 101 ? -52.462 0.188   -15.463 1.00 0.00 ? 101 LYS A CA   3  
ATOM 5873  C C    . LYS A 1 101 ? -53.771 -0.618  -15.502 1.00 0.00 ? 101 LYS A C    3  
ATOM 5874  O O    . LYS A 1 101 ? -54.850 -0.036  -15.605 1.00 0.00 ? 101 LYS A O    3  
ATOM 5875  C CB   . LYS A 1 101 ? -51.827 0.408   -16.849 1.00 0.00 ? 101 LYS A CB   3  
ATOM 5876  C CG   . LYS A 1 101 ? -52.768 0.962   -17.929 1.00 0.00 ? 101 LYS A CG   3  
ATOM 5877  C CD   . LYS A 1 101 ? -53.356 -0.181  -18.769 1.00 0.00 ? 101 LYS A CD   3  
ATOM 5878  C CE   . LYS A 1 101 ? -54.351 0.368   -19.798 1.00 0.00 ? 101 LYS A CE   3  
ATOM 5879  N NZ   . LYS A 1 101 ? -54.891 -0.707  -20.671 1.00 0.00 ? 101 LYS A NZ   3  
ATOM 5880  H H    . LYS A 1 101 ? -50.507 -0.557  -15.059 1.00 0.00 ? 101 LYS A H    3  
ATOM 5881  H HA   . LYS A 1 101 ? -52.714 1.163   -15.045 1.00 0.00 ? 101 LYS A HA   3  
ATOM 5882  H HB2  . LYS A 1 101 ? -51.007 1.117   -16.729 1.00 0.00 ? 101 LYS A HB2  3  
ATOM 5883  H HB3  . LYS A 1 101 ? -51.387 -0.527  -17.201 1.00 0.00 ? 101 LYS A HB3  3  
ATOM 5884  H HG2  . LYS A 1 101 ? -53.562 1.554   -17.471 1.00 0.00 ? 101 LYS A HG2  3  
ATOM 5885  H HG3  . LYS A 1 101 ? -52.197 1.613   -18.591 1.00 0.00 ? 101 LYS A HG3  3  
ATOM 5886  H HD2  . LYS A 1 101 ? -52.535 -0.692  -19.273 1.00 0.00 ? 101 LYS A HD2  3  
ATOM 5887  H HD3  . LYS A 1 101 ? -53.857 -0.899  -18.120 1.00 0.00 ? 101 LYS A HD3  3  
ATOM 5888  H HE2  . LYS A 1 101 ? -55.168 0.861   -19.262 1.00 0.00 ? 101 LYS A HE2  3  
ATOM 5889  H HE3  . LYS A 1 101 ? -53.844 1.124   -20.406 1.00 0.00 ? 101 LYS A HE3  3  
ATOM 5890  H HZ1  . LYS A 1 101 ? -55.543 -0.332  -21.345 1.00 0.00 ? 101 LYS A HZ1  3  
ATOM 5891  H HZ2  . LYS A 1 101 ? -54.152 -1.167  -21.185 1.00 0.00 ? 101 LYS A HZ2  3  
ATOM 5892  H HZ3  . LYS A 1 101 ? -55.380 -1.408  -20.132 1.00 0.00 ? 101 LYS A HZ3  3  
ATOM 5893  N N    . ASP A 1 102 ? -53.690 -1.944  -15.379 1.00 0.00 ? 102 ASP A N    3  
ATOM 5894  C CA   . ASP A 1 102 ? -54.845 -2.855  -15.293 1.00 0.00 ? 102 ASP A CA   3  
ATOM 5895  C C    . ASP A 1 102 ? -55.542 -2.885  -13.909 1.00 0.00 ? 102 ASP A C    3  
ATOM 5896  O O    . ASP A 1 102 ? -56.623 -3.464  -13.775 1.00 0.00 ? 102 ASP A O    3  
ATOM 5897  C CB   . ASP A 1 102 ? -54.451 -4.258  -15.790 1.00 0.00 ? 102 ASP A CB   3  
ATOM 5898  C CG   . ASP A 1 102 ? -53.374 -4.976  -14.958 1.00 0.00 ? 102 ASP A CG   3  
ATOM 5899  O OD1  . ASP A 1 102 ? -53.245 -4.711  -13.739 1.00 0.00 ? 102 ASP A OD1  3  
ATOM 5900  O OD2  . ASP A 1 102 ? -52.646 -5.818  -15.534 1.00 0.00 ? 102 ASP A OD2  3  
ATOM 5901  H H    . ASP A 1 102 ? -52.769 -2.346  -15.305 1.00 0.00 ? 102 ASP A H    3  
ATOM 5902  H HA   . ASP A 1 102 ? -55.597 -2.486  -15.992 1.00 0.00 ? 102 ASP A HA   3  
ATOM 5903  H HB2  . ASP A 1 102 ? -55.344 -4.884  -15.813 1.00 0.00 ? 102 ASP A HB2  3  
ATOM 5904  H HB3  . ASP A 1 102 ? -54.099 -4.162  -16.820 1.00 0.00 ? 102 ASP A HB3  3  
ATOM 5905  N N    . GLY A 1 103 ? -54.941 -2.267  -12.884 1.00 0.00 ? 103 GLY A N    3  
ATOM 5906  C CA   . GLY A 1 103 ? -55.434 -2.196  -11.505 1.00 0.00 ? 103 GLY A CA   3  
ATOM 5907  C C    . GLY A 1 103 ? -54.745 -3.146  -10.511 1.00 0.00 ? 103 GLY A C    3  
ATOM 5908  O O    . GLY A 1 103 ? -55.079 -3.117  -9.323  1.00 0.00 ? 103 GLY A O    3  
ATOM 5909  H H    . GLY A 1 103 ? -54.063 -1.796  -13.073 1.00 0.00 ? 103 GLY A H    3  
ATOM 5910  H HA2  . GLY A 1 103 ? -55.286 -1.179  -11.143 1.00 0.00 ? 103 GLY A HA2  3  
ATOM 5911  H HA3  . GLY A 1 103 ? -56.503 -2.406  -11.483 1.00 0.00 ? 103 GLY A HA3  3  
ATOM 5912  N N    . SER A 1 104 ? -53.786 -3.971  -10.949 1.00 0.00 ? 104 SER A N    3  
ATOM 5913  C CA   . SER A 1 104 ? -53.063 -4.908  -10.068 1.00 0.00 ? 104 SER A CA   3  
ATOM 5914  C C    . SER A 1 104 ? -52.125 -4.166  -9.108  1.00 0.00 ? 104 SER A C    3  
ATOM 5915  O O    . SER A 1 104 ? -51.336 -3.335  -9.555  1.00 0.00 ? 104 SER A O    3  
ATOM 5916  C CB   . SER A 1 104 ? -52.243 -5.923  -10.880 1.00 0.00 ? 104 SER A CB   3  
ATOM 5917  O OG   . SER A 1 104 ? -53.043 -6.586  -11.841 1.00 0.00 ? 104 SER A OG   3  
ATOM 5918  H H    . SER A 1 104 ? -53.557 -3.967  -11.941 1.00 0.00 ? 104 SER A H    3  
ATOM 5919  H HA   . SER A 1 104 ? -53.791 -5.466  -9.479  1.00 0.00 ? 104 SER A HA   3  
ATOM 5920  H HB2  . SER A 1 104 ? -51.427 -5.410  -11.391 1.00 0.00 ? 104 SER A HB2  3  
ATOM 5921  H HB3  . SER A 1 104 ? -51.815 -6.659  -10.199 1.00 0.00 ? 104 SER A HB3  3  
ATOM 5922  H HG   . SER A 1 104 ? -53.167 -5.945  -12.581 1.00 0.00 ? 104 SER A HG   3  
ATOM 5923  N N    . CYS A 1 105 ? -52.171 -4.473  -7.807  1.00 0.00 ? 105 CYS A N    3  
ATOM 5924  C CA   . CYS A 1 105 ? -51.341 -3.842  -6.765  1.00 0.00 ? 105 CYS A CA   3  
ATOM 5925  C C    . CYS A 1 105 ? -50.463 -4.887  -6.052  1.00 0.00 ? 105 CYS A C    3  
ATOM 5926  O O    . CYS A 1 105 ? -50.974 -5.921  -5.613  1.00 0.00 ? 105 CYS A O    3  
ATOM 5927  C CB   . CYS A 1 105 ? -52.245 -3.112  -5.758  1.00 0.00 ? 105 CYS A CB   3  
ATOM 5928  S SG   . CYS A 1 105 ? -53.225 -1.811  -6.564  1.00 0.00 ? 105 CYS A SG   3  
ATOM 5929  H H    . CYS A 1 105 ? -52.827 -5.180  -7.507  1.00 0.00 ? 105 CYS A H    3  
ATOM 5930  H HA   . CYS A 1 105 ? -50.679 -3.104  -7.217  1.00 0.00 ? 105 CYS A HA   3  
ATOM 5931  H HB2  . CYS A 1 105 ? -52.916 -3.830  -5.281  1.00 0.00 ? 105 CYS A HB2  3  
ATOM 5932  H HB3  . CYS A 1 105 ? -51.623 -2.657  -4.985  1.00 0.00 ? 105 CYS A HB3  3  
ATOM 5933  H HG   . CYS A 1 105 ? -53.879 -2.604  -7.431  1.00 0.00 ? 105 CYS A HG   3  
ATOM 5934  N N    . PHE A 1 106 ? -49.152 -4.638  -5.935  1.00 0.00 ? 106 PHE A N    3  
ATOM 5935  C CA   . PHE A 1 106 ? -48.186 -5.627  -5.422  1.00 0.00 ? 106 PHE A CA   3  
ATOM 5936  C C    . PHE A 1 106 ? -46.962 -5.008  -4.721  1.00 0.00 ? 106 PHE A C    3  
ATOM 5937  O O    . PHE A 1 106 ? -46.386 -4.036  -5.208  1.00 0.00 ? 106 PHE A O    3  
ATOM 5938  C CB   . PHE A 1 106 ? -47.739 -6.544  -6.583  1.00 0.00 ? 106 PHE A CB   3  
ATOM 5939  C CG   . PHE A 1 106 ? -47.461 -5.844  -7.908  1.00 0.00 ? 106 PHE A CG   3  
ATOM 5940  C CD1  . PHE A 1 106 ? -46.199 -5.277  -8.175  1.00 0.00 ? 106 PHE A CD1  3  
ATOM 5941  C CD2  . PHE A 1 106 ? -48.486 -5.737  -8.869  1.00 0.00 ? 106 PHE A CD2  3  
ATOM 5942  C CE1  . PHE A 1 106 ? -45.973 -4.594  -9.386  1.00 0.00 ? 106 PHE A CE1  3  
ATOM 5943  C CE2  . PHE A 1 106 ? -48.261 -5.049  -10.075 1.00 0.00 ? 106 PHE A CE2  3  
ATOM 5944  C CZ   . PHE A 1 106 ? -47.007 -4.469  -10.331 1.00 0.00 ? 106 PHE A CZ   3  
ATOM 5945  H H    . PHE A 1 106 ? -48.784 -3.770  -6.316  1.00 0.00 ? 106 PHE A H    3  
ATOM 5946  H HA   . PHE A 1 106 ? -48.682 -6.256  -4.683  1.00 0.00 ? 106 PHE A HA   3  
ATOM 5947  H HB2  . PHE A 1 106 ? -46.852 -7.104  -6.280  1.00 0.00 ? 106 PHE A HB2  3  
ATOM 5948  H HB3  . PHE A 1 106 ? -48.528 -7.279  -6.751  1.00 0.00 ? 106 PHE A HB3  3  
ATOM 5949  H HD1  . PHE A 1 106 ? -45.405 -5.354  -7.446  1.00 0.00 ? 106 PHE A HD1  3  
ATOM 5950  H HD2  . PHE A 1 106 ? -49.456 -6.173  -8.676  1.00 0.00 ? 106 PHE A HD2  3  
ATOM 5951  H HE1  . PHE A 1 106 ? -45.009 -4.150  -9.586  1.00 0.00 ? 106 PHE A HE1  3  
ATOM 5952  H HE2  . PHE A 1 106 ? -49.058 -4.962  -10.800 1.00 0.00 ? 106 PHE A HE2  3  
ATOM 5953  H HZ   . PHE A 1 106 ? -46.837 -3.928  -11.251 1.00 0.00 ? 106 PHE A HZ   3  
ATOM 5954  N N    . LEU A 1 107 ? -46.530 -5.627  -3.613  1.00 0.00 ? 107 LEU A N    3  
ATOM 5955  C CA   . LEU A 1 107 ? -45.270 -5.385  -2.893  1.00 0.00 ? 107 LEU A CA   3  
ATOM 5956  C C    . LEU A 1 107 ? -44.368 -6.614  -3.081  1.00 0.00 ? 107 LEU A C    3  
ATOM 5957  O O    . LEU A 1 107 ? -44.809 -7.746  -2.872  1.00 0.00 ? 107 LEU A O    3  
ATOM 5958  C CB   . LEU A 1 107 ? -45.592 -5.124  -1.403  1.00 0.00 ? 107 LEU A CB   3  
ATOM 5959  C CG   . LEU A 1 107 ? -44.466 -4.729  -0.418  1.00 0.00 ? 107 LEU A CG   3  
ATOM 5960  C CD1  . LEU A 1 107 ? -43.317 -5.723  -0.275  1.00 0.00 ? 107 LEU A CD1  3  
ATOM 5961  C CD2  . LEU A 1 107 ? -43.813 -3.399  -0.732  1.00 0.00 ? 107 LEU A CD2  3  
ATOM 5962  H H    . LEU A 1 107 ? -47.068 -6.411  -3.274  1.00 0.00 ? 107 LEU A H    3  
ATOM 5963  H HA   . LEU A 1 107 ? -44.767 -4.512  -3.308  1.00 0.00 ? 107 LEU A HA   3  
ATOM 5964  H HB2  . LEU A 1 107 ? -46.339 -4.333  -1.363  1.00 0.00 ? 107 LEU A HB2  3  
ATOM 5965  H HB3  . LEU A 1 107 ? -46.068 -6.021  -1.004  1.00 0.00 ? 107 LEU A HB3  3  
ATOM 5966  H HG   . LEU A 1 107 ? -44.937 -4.604  0.550   1.00 0.00 ? 107 LEU A HG   3  
ATOM 5967  H HD11 . LEU A 1 107 ? -42.762 -5.490  0.635   1.00 0.00 ? 107 LEU A HD11 3  
ATOM 5968  H HD12 . LEU A 1 107 ? -43.690 -6.744  -0.229  1.00 0.00 ? 107 LEU A HD12 3  
ATOM 5969  H HD13 . LEU A 1 107 ? -42.623 -5.618  -1.104  1.00 0.00 ? 107 LEU A HD13 3  
ATOM 5970  H HD21 . LEU A 1 107 ? -44.569 -2.620  -0.748  1.00 0.00 ? 107 LEU A HD21 3  
ATOM 5971  H HD22 . LEU A 1 107 ? -43.083 -3.152  0.041   1.00 0.00 ? 107 LEU A HD22 3  
ATOM 5972  H HD23 . LEU A 1 107 ? -43.304 -3.484  -1.686  1.00 0.00 ? 107 LEU A HD23 3  
ATOM 5973  N N    . CYS A 1 108 ? -43.108 -6.388  -3.444  1.00 0.00 ? 108 CYS A N    3  
ATOM 5974  C CA   . CYS A 1 108 ? -42.044 -7.397  -3.476  1.00 0.00 ? 108 CYS A CA   3  
ATOM 5975  C C    . CYS A 1 108 ? -40.721 -6.819  -2.938  1.00 0.00 ? 108 CYS A C    3  
ATOM 5976  O O    . CYS A 1 108 ? -40.647 -5.641  -2.580  1.00 0.00 ? 108 CYS A O    3  
ATOM 5977  C CB   . CYS A 1 108 ? -41.931 -7.904  -4.920  1.00 0.00 ? 108 CYS A CB   3  
ATOM 5978  S SG   . CYS A 1 108 ? -43.130 -9.247  -5.173  1.00 0.00 ? 108 CYS A SG   3  
ATOM 5979  H H    . CYS A 1 108 ? -42.822 -5.428  -3.577  1.00 0.00 ? 108 CYS A H    3  
ATOM 5980  H HA   . CYS A 1 108 ? -42.298 -8.237  -2.826  1.00 0.00 ? 108 CYS A HA   3  
ATOM 5981  H HB2  . CYS A 1 108 ? -42.119 -7.081  -5.612  1.00 0.00 ? 108 CYS A HB2  3  
ATOM 5982  H HB3  . CYS A 1 108 ? -40.936 -8.296  -5.109  1.00 0.00 ? 108 CYS A HB3  3  
ATOM 5983  H HG   . CYS A 1 108 ? -44.168 -8.645  -4.566  1.00 0.00 ? 108 CYS A HG   3  
ATOM 5984  N N    . LEU A 1 109 ? -39.659 -7.628  -2.889  1.00 0.00 ? 109 LEU A N    3  
ATOM 5985  C CA   . LEU A 1 109 ? -38.326 -7.213  -2.429  1.00 0.00 ? 109 LEU A CA   3  
ATOM 5986  C C    . LEU A 1 109 ? -37.596 -6.405  -3.524  1.00 0.00 ? 109 LEU A C    3  
ATOM 5987  O O    . LEU A 1 109 ? -36.539 -6.800  -4.018  1.00 0.00 ? 109 LEU A O    3  
ATOM 5988  C CB   . LEU A 1 109 ? -37.537 -8.455  -1.957  1.00 0.00 ? 109 LEU A CB   3  
ATOM 5989  C CG   . LEU A 1 109 ? -38.215 -9.295  -0.857  1.00 0.00 ? 109 LEU A CG   3  
ATOM 5990  C CD1  . LEU A 1 109 ? -37.336 -10.498 -0.514  1.00 0.00 ? 109 LEU A CD1  3  
ATOM 5991  C CD2  . LEU A 1 109 ? -38.461 -8.496  0.425   1.00 0.00 ? 109 LEU A CD2  3  
ATOM 5992  H H    . LEU A 1 109 ? -39.750 -8.574  -3.247  1.00 0.00 ? 109 LEU A H    3  
ATOM 5993  H HA   . LEU A 1 109 ? -38.440 -6.543  -1.577  1.00 0.00 ? 109 LEU A HA   3  
ATOM 5994  H HB2  . LEU A 1 109 ? -37.359 -9.101  -2.817  1.00 0.00 ? 109 LEU A HB2  3  
ATOM 5995  H HB3  . LEU A 1 109 ? -36.565 -8.122  -1.587  1.00 0.00 ? 109 LEU A HB3  3  
ATOM 5996  H HG   . LEU A 1 109 ? -39.171 -9.672  -1.222  1.00 0.00 ? 109 LEU A HG   3  
ATOM 5997  H HD11 . LEU A 1 109 ? -37.832 -11.115 0.236   1.00 0.00 ? 109 LEU A HD11 3  
ATOM 5998  H HD12 . LEU A 1 109 ? -37.172 -11.099 -1.408  1.00 0.00 ? 109 LEU A HD12 3  
ATOM 5999  H HD13 . LEU A 1 109 ? -36.374 -10.162 -0.125  1.00 0.00 ? 109 LEU A HD13 3  
ATOM 6000  H HD21 . LEU A 1 109 ? -39.173 -7.694  0.235   1.00 0.00 ? 109 LEU A HD21 3  
ATOM 6001  H HD22 . LEU A 1 109 ? -38.881 -9.149  1.190   1.00 0.00 ? 109 LEU A HD22 3  
ATOM 6002  H HD23 . LEU A 1 109 ? -37.525 -8.073  0.789   1.00 0.00 ? 109 LEU A HD23 3  
ATOM 6003  N N    . VAL A 1 110 ? -38.196 -5.277  -3.927  1.00 0.00 ? 110 VAL A N    3  
ATOM 6004  C CA   . VAL A 1 110 ? -37.745 -4.443  -5.054  1.00 0.00 ? 110 VAL A CA   3  
ATOM 6005  C C    . VAL A 1 110 ? -36.328 -3.921  -4.809  1.00 0.00 ? 110 VAL A C    3  
ATOM 6006  O O    . VAL A 1 110 ? -35.973 -3.566  -3.682  1.00 0.00 ? 110 VAL A O    3  
ATOM 6007  C CB   . VAL A 1 110 ? -38.717 -3.293  -5.357  1.00 0.00 ? 110 VAL A CB   3  
ATOM 6008  C CG1  . VAL A 1 110 ? -38.337 -2.558  -6.647  1.00 0.00 ? 110 VAL A CG1  3  
ATOM 6009  C CG2  . VAL A 1 110 ? -40.158 -3.790  -5.559  1.00 0.00 ? 110 VAL A CG2  3  
ATOM 6010  H H    . VAL A 1 110 ? -39.064 -5.029  -3.465  1.00 0.00 ? 110 VAL A H    3  
ATOM 6011  H HA   . VAL A 1 110 ? -37.724 -5.079  -5.927  1.00 0.00 ? 110 VAL A HA   3  
ATOM 6012  H HB   . VAL A 1 110 ? -38.683 -2.599  -4.522  1.00 0.00 ? 110 VAL A HB   3  
ATOM 6013  H HG11 . VAL A 1 110 ? -38.338 -3.261  -7.478  1.00 0.00 ? 110 VAL A HG11 3  
ATOM 6014  H HG12 . VAL A 1 110 ? -39.054 -1.765  -6.850  1.00 0.00 ? 110 VAL A HG12 3  
ATOM 6015  H HG13 . VAL A 1 110 ? -37.356 -2.097  -6.556  1.00 0.00 ? 110 VAL A HG13 3  
ATOM 6016  H HG21 . VAL A 1 110 ? -40.554 -4.197  -4.635  1.00 0.00 ? 110 VAL A HG21 3  
ATOM 6017  H HG22 . VAL A 1 110 ? -40.803 -2.960  -5.849  1.00 0.00 ? 110 VAL A HG22 3  
ATOM 6018  H HG23 . VAL A 1 110 ? -40.188 -4.551  -6.338  1.00 0.00 ? 110 VAL A HG23 3  
ATOM 6019  N N    . ASP A 1 111 ? -35.510 -3.853  -5.861  1.00 0.00 ? 111 ASP A N    3  
ATOM 6020  C CA   . ASP A 1 111 ? -34.066 -3.615  -5.698  1.00 0.00 ? 111 ASP A CA   3  
ATOM 6021  C C    . ASP A 1 111 ? -33.712 -2.158  -6.037  1.00 0.00 ? 111 ASP A C    3  
ATOM 6022  O O    . ASP A 1 111 ? -33.020 -1.863  -7.012  1.00 0.00 ? 111 ASP A O    3  
ATOM 6023  C CB   . ASP A 1 111 ? -33.310 -4.675  -6.521  1.00 0.00 ? 111 ASP A CB   3  
ATOM 6024  C CG   . ASP A 1 111 ? -31.926 -5.017  -5.964  1.00 0.00 ? 111 ASP A CG   3  
ATOM 6025  O OD1  . ASP A 1 111 ? -31.860 -5.655  -4.890  1.00 0.00 ? 111 ASP A OD1  3  
ATOM 6026  O OD2  . ASP A 1 111 ? -30.900 -4.725  -6.618  1.00 0.00 ? 111 ASP A OD2  3  
ATOM 6027  H H    . ASP A 1 111 ? -35.903 -3.973  -6.791  1.00 0.00 ? 111 ASP A H    3  
ATOM 6028  H HA   . ASP A 1 111 ? -33.796 -3.778  -4.656  1.00 0.00 ? 111 ASP A HA   3  
ATOM 6029  H HB2  . ASP A 1 111 ? -33.885 -5.604  -6.510  1.00 0.00 ? 111 ASP A HB2  3  
ATOM 6030  H HB3  . ASP A 1 111 ? -33.223 -4.347  -7.555  1.00 0.00 ? 111 ASP A HB3  3  
ATOM 6031  N N    . VAL A 1 112 ? -34.145 -1.227  -5.177  1.00 0.00 ? 112 VAL A N    3  
ATOM 6032  C CA   . VAL A 1 112 ? -34.090 0.221   -5.447  1.00 0.00 ? 112 VAL A CA   3  
ATOM 6033  C C    . VAL A 1 112 ? -32.702 0.761   -5.096  1.00 0.00 ? 112 VAL A C    3  
ATOM 6034  O O    . VAL A 1 112 ? -32.519 1.500   -4.132  1.00 0.00 ? 112 VAL A O    3  
ATOM 6035  C CB   . VAL A 1 112 ? -35.226 0.944   -4.690  1.00 0.00 ? 112 VAL A CB   3  
ATOM 6036  C CG1  . VAL A 1 112 ? -35.396 2.410   -5.112  1.00 0.00 ? 112 VAL A CG1  3  
ATOM 6037  C CG2  . VAL A 1 112 ? -36.570 0.260   -4.953  1.00 0.00 ? 112 VAL A CG2  3  
ATOM 6038  H H    . VAL A 1 112 ? -34.676 -1.524  -4.363  1.00 0.00 ? 112 VAL A H    3  
ATOM 6039  H HA   . VAL A 1 112 ? -34.250 0.382   -6.515  1.00 0.00 ? 112 VAL A HA   3  
ATOM 6040  H HB   . VAL A 1 112 ? -35.031 0.905   -3.617  1.00 0.00 ? 112 VAL A HB   3  
ATOM 6041  H HG11 . VAL A 1 112 ? -36.158 2.883   -4.492  1.00 0.00 ? 112 VAL A HG11 3  
ATOM 6042  H HG12 . VAL A 1 112 ? -34.465 2.960   -4.985  1.00 0.00 ? 112 VAL A HG12 3  
ATOM 6043  H HG13 . VAL A 1 112 ? -35.710 2.463   -6.152  1.00 0.00 ? 112 VAL A HG13 3  
ATOM 6044  H HG21 . VAL A 1 112 ? -36.765 0.215   -6.024  1.00 0.00 ? 112 VAL A HG21 3  
ATOM 6045  H HG22 . VAL A 1 112 ? -36.574 -0.754  -4.552  1.00 0.00 ? 112 VAL A HG22 3  
ATOM 6046  H HG23 . VAL A 1 112 ? -37.356 0.822   -4.451  1.00 0.00 ? 112 VAL A HG23 3  
ATOM 6047  N N    . VAL A 1 113 ? -31.707 0.379   -5.895  1.00 0.00 ? 113 VAL A N    3  
ATOM 6048  C CA   . VAL A 1 113 ? -30.285 0.695   -5.675  1.00 0.00 ? 113 VAL A CA   3  
ATOM 6049  C C    . VAL A 1 113 ? -29.717 1.447   -6.892  1.00 0.00 ? 113 VAL A C    3  
ATOM 6050  O O    . VAL A 1 113 ? -30.014 1.052   -8.022  1.00 0.00 ? 113 VAL A O    3  
ATOM 6051  C CB   . VAL A 1 113 ? -29.495 -0.583  -5.319  1.00 0.00 ? 113 VAL A CB   3  
ATOM 6052  C CG1  . VAL A 1 113 ? -29.354 -1.587  -6.469  1.00 0.00 ? 113 VAL A CG1  3  
ATOM 6053  C CG2  . VAL A 1 113 ? -28.099 -0.267  -4.777  1.00 0.00 ? 113 VAL A CG2  3  
ATOM 6054  H H    . VAL A 1 113 ? -31.946 -0.271  -6.642  1.00 0.00 ? 113 VAL A H    3  
ATOM 6055  H HA   . VAL A 1 113 ? -30.235 1.338   -4.795  1.00 0.00 ? 113 VAL A HA   3  
ATOM 6056  H HB   . VAL A 1 113 ? -30.038 -1.082  -4.517  1.00 0.00 ? 113 VAL A HB   3  
ATOM 6057  H HG11 . VAL A 1 113 ? -30.334 -1.831  -6.877  1.00 0.00 ? 113 VAL A HG11 3  
ATOM 6058  H HG12 . VAL A 1 113 ? -28.728 -1.177  -7.261  1.00 0.00 ? 113 VAL A HG12 3  
ATOM 6059  H HG13 . VAL A 1 113 ? -28.898 -2.505  -6.101  1.00 0.00 ? 113 VAL A HG13 3  
ATOM 6060  H HG21 . VAL A 1 113 ? -28.181 0.385   -3.906  1.00 0.00 ? 113 VAL A HG21 3  
ATOM 6061  H HG22 . VAL A 1 113 ? -27.607 -1.189  -4.469  1.00 0.00 ? 113 VAL A HG22 3  
ATOM 6062  H HG23 . VAL A 1 113 ? -27.492 0.218   -5.542  1.00 0.00 ? 113 VAL A HG23 3  
ATOM 6063  N N    . PRO A 1 114 ? -28.955 2.546   -6.712  1.00 0.00 ? 114 PRO A N    3  
ATOM 6064  C CA   . PRO A 1 114 ? -28.506 3.397   -7.816  1.00 0.00 ? 114 PRO A CA   3  
ATOM 6065  C C    . PRO A 1 114 ? -27.175 2.901   -8.428  1.00 0.00 ? 114 PRO A C    3  
ATOM 6066  O O    . PRO A 1 114 ? -26.738 1.780   -8.155  1.00 0.00 ? 114 PRO A O    3  
ATOM 6067  C CB   . PRO A 1 114 ? -28.363 4.767   -7.162  1.00 0.00 ? 114 PRO A CB   3  
ATOM 6068  C CG   . PRO A 1 114 ? -27.808 4.427   -5.789  1.00 0.00 ? 114 PRO A CG   3  
ATOM 6069  C CD   . PRO A 1 114 ? -28.609 3.172   -5.439  1.00 0.00 ? 114 PRO A CD   3  
ATOM 6070  H HA   . PRO A 1 114 ? -29.279 3.457   -8.588  1.00 0.00 ? 114 PRO A HA   3  
ATOM 6071  H HB2  . PRO A 1 114 ? -27.730 5.427   -7.737  1.00 0.00 ? 114 PRO A HB2  3  
ATOM 6072  H HB3  . PRO A 1 114 ? -29.331 5.236   -7.023  1.00 0.00 ? 114 PRO A HB3  3  
ATOM 6073  H HG2  . PRO A 1 114 ? -26.744 4.191   -5.862  1.00 0.00 ? 114 PRO A HG2  3  
ATOM 6074  H HG3  . PRO A 1 114 ? -27.987 5.235   -5.080  1.00 0.00 ? 114 PRO A HG3  3  
ATOM 6075  H HD2  . PRO A 1 114 ? -28.008 2.511   -4.815  1.00 0.00 ? 114 PRO A HD2  3  
ATOM 6076  H HD3  . PRO A 1 114 ? -29.521 3.462   -4.914  1.00 0.00 ? 114 PRO A HD3  3  
ATOM 6077  N N    . VAL A 1 115 ? -26.494 3.745   -9.222  1.00 0.00 ? 115 VAL A N    3  
ATOM 6078  C CA   . VAL A 1 115 ? -25.157 3.466   -9.782  1.00 0.00 ? 115 VAL A CA   3  
ATOM 6079  C C    . VAL A 1 115 ? -24.124 4.559   -9.444  1.00 0.00 ? 115 VAL A C    3  
ATOM 6080  O O    . VAL A 1 115 ? -24.359 5.772   -9.570  1.00 0.00 ? 115 VAL A O    3  
ATOM 6081  C CB   . VAL A 1 115 ? -25.206 3.171   -11.293 1.00 0.00 ? 115 VAL A CB   3  
ATOM 6082  C CG1  . VAL A 1 115 ? -25.870 1.821   -11.579 1.00 0.00 ? 115 VAL A CG1  3  
ATOM 6083  C CG2  . VAL A 1 115 ? -25.912 4.255   -12.088 1.00 0.00 ? 115 VAL A CG2  3  
ATOM 6084  H H    . VAL A 1 115 ? -26.870 4.672   -9.396  1.00 0.00 ? 115 VAL A H    3  
ATOM 6085  H HA   . VAL A 1 115 ? -24.781 2.555   -9.317  1.00 0.00 ? 115 VAL A HA   3  
ATOM 6086  H HB   . VAL A 1 115 ? -24.179 3.108   -11.655 1.00 0.00 ? 115 VAL A HB   3  
ATOM 6087  H HG11 . VAL A 1 115 ? -25.844 1.615   -12.650 1.00 0.00 ? 115 VAL A HG11 3  
ATOM 6088  H HG12 . VAL A 1 115 ? -25.333 1.028   -11.059 1.00 0.00 ? 115 VAL A HG12 3  
ATOM 6089  H HG13 . VAL A 1 115 ? -26.907 1.826   -11.241 1.00 0.00 ? 115 VAL A HG13 3  
ATOM 6090  H HG21 . VAL A 1 115 ? -25.776 4.085   -13.155 1.00 0.00 ? 115 VAL A HG21 3  
ATOM 6091  H HG22 . VAL A 1 115 ? -26.971 4.273   -11.841 1.00 0.00 ? 115 VAL A HG22 3  
ATOM 6092  H HG23 . VAL A 1 115 ? -25.463 5.202   -11.817 1.00 0.00 ? 115 VAL A HG23 3  
ATOM 6093  N N    . LYS A 1 116 ? -22.953 4.088   -8.997  1.00 0.00 ? 116 LYS A N    3  
ATOM 6094  C CA   . LYS A 1 116 ? -21.843 4.875   -8.441  1.00 0.00 ? 116 LYS A CA   3  
ATOM 6095  C C    . LYS A 1 116 ? -20.570 4.733   -9.279  1.00 0.00 ? 116 LYS A C    3  
ATOM 6096  O O    . LYS A 1 116 ? -20.413 3.775   -10.040 1.00 0.00 ? 116 LYS A O    3  
ATOM 6097  C CB   . LYS A 1 116 ? -21.569 4.461   -6.977  1.00 0.00 ? 116 LYS A CB   3  
ATOM 6098  C CG   . LYS A 1 116 ? -22.792 4.584   -6.044  1.00 0.00 ? 116 LYS A CG   3  
ATOM 6099  C CD   . LYS A 1 116 ? -23.222 3.246   -5.416  1.00 0.00 ? 116 LYS A CD   3  
ATOM 6100  C CE   . LYS A 1 116 ? -22.178 2.625   -4.471  1.00 0.00 ? 116 LYS A CE   3  
ATOM 6101  N NZ   . LYS A 1 116 ? -22.034 3.389   -3.206  1.00 0.00 ? 116 LYS A NZ   3  
ATOM 6102  H H    . LYS A 1 116 ? -22.822 3.088   -9.011  1.00 0.00 ? 116 LYS A H    3  
ATOM 6103  H HA   . LYS A 1 116 ? -22.120 5.926   -8.455  1.00 0.00 ? 116 LYS A HA   3  
ATOM 6104  H HB2  . LYS A 1 116 ? -21.193 3.441   -6.964  1.00 0.00 ? 116 LYS A HB2  3  
ATOM 6105  H HB3  . LYS A 1 116 ? -20.765 5.081   -6.578  1.00 0.00 ? 116 LYS A HB3  3  
ATOM 6106  H HG2  . LYS A 1 116 ? -22.571 5.300   -5.254  1.00 0.00 ? 116 LYS A HG2  3  
ATOM 6107  H HG3  . LYS A 1 116 ? -23.640 4.979   -6.599  1.00 0.00 ? 116 LYS A HG3  3  
ATOM 6108  H HD2  . LYS A 1 116 ? -24.154 3.395   -4.870  1.00 0.00 ? 116 LYS A HD2  3  
ATOM 6109  H HD3  . LYS A 1 116 ? -23.425 2.538   -6.221  1.00 0.00 ? 116 LYS A HD3  3  
ATOM 6110  H HE2  . LYS A 1 116 ? -22.499 1.605   -4.237  1.00 0.00 ? 116 LYS A HE2  3  
ATOM 6111  H HE3  . LYS A 1 116 ? -21.215 2.556   -4.986  1.00 0.00 ? 116 LYS A HE3  3  
ATOM 6112  H HZ1  . LYS A 1 116 ? -21.691 4.332   -3.369  1.00 0.00 ? 116 LYS A HZ1  3  
ATOM 6113  H HZ2  . LYS A 1 116 ? -22.930 3.446   -2.718  1.00 0.00 ? 116 LYS A HZ2  3  
ATOM 6114  H HZ3  . LYS A 1 116 ? -21.387 2.934   -2.578  1.00 0.00 ? 116 LYS A HZ3  3  
ATOM 6115  N N    . ASN A 1 117 ? -19.654 5.681   -9.103  1.00 0.00 ? 117 ASN A N    3  
ATOM 6116  C CA   . ASN A 1 117 ? -18.308 5.648   -9.697  1.00 0.00 ? 117 ASN A CA   3  
ATOM 6117  C C    . ASN A 1 117 ? -17.286 4.945   -8.775  1.00 0.00 ? 117 ASN A C    3  
ATOM 6118  O O    . ASN A 1 117 ? -17.627 4.517   -7.672  1.00 0.00 ? 117 ASN A O    3  
ATOM 6119  C CB   . ASN A 1 117 ? -17.893 7.070   -10.116 1.00 0.00 ? 117 ASN A CB   3  
ATOM 6120  C CG   . ASN A 1 117 ? -17.322 7.904   -8.983  1.00 0.00 ? 117 ASN A CG   3  
ATOM 6121  O OD1  . ASN A 1 117 ? -16.117 8.010   -8.822  1.00 0.00 ? 117 ASN A OD1  3  
ATOM 6122  N ND2  . ASN A 1 117 ? -18.138 8.488   -8.136  1.00 0.00 ? 117 ASN A ND2  3  
ATOM 6123  H H    . ASN A 1 117 ? -19.875 6.384   -8.409  1.00 0.00 ? 117 ASN A H    3  
ATOM 6124  H HA   . ASN A 1 117 ? -18.352 5.054   -10.613 1.00 0.00 ? 117 ASN A HA   3  
ATOM 6125  H HB2  . ASN A 1 117 ? -17.120 6.995   -10.883 1.00 0.00 ? 117 ASN A HB2  3  
ATOM 6126  H HB3  . ASN A 1 117 ? -18.735 7.586   -10.572 1.00 0.00 ? 117 ASN A HB3  3  
ATOM 6127  H HD21 . ASN A 1 117 ? -19.141 8.412   -8.229  1.00 0.00 ? 117 ASN A HD21 3  
ATOM 6128  H HD22 . ASN A 1 117 ? -17.724 9.091   -7.445  1.00 0.00 ? 117 ASN A HD22 3  
ATOM 6129  N N    . GLU A 1 118 ? -16.023 4.849   -9.202  1.00 0.00 ? 118 GLU A N    3  
ATOM 6130  C CA   . GLU A 1 118 ? -14.940 4.183   -8.452  1.00 0.00 ? 118 GLU A CA   3  
ATOM 6131  C C    . GLU A 1 118 ? -14.619 4.810   -7.075  1.00 0.00 ? 118 GLU A C    3  
ATOM 6132  O O    . GLU A 1 118 ? -14.097 4.126   -6.193  1.00 0.00 ? 118 GLU A O    3  
ATOM 6133  C CB   . GLU A 1 118 ? -13.679 4.092   -9.331  1.00 0.00 ? 118 GLU A CB   3  
ATOM 6134  C CG   . GLU A 1 118 ? -13.060 5.452   -9.689  1.00 0.00 ? 118 GLU A CG   3  
ATOM 6135  C CD   . GLU A 1 118 ? -11.824 5.270   -10.593 1.00 0.00 ? 118 GLU A CD   3  
ATOM 6136  O OE1  . GLU A 1 118 ? -10.692 5.134   -10.065 1.00 0.00 ? 118 GLU A OE1  3  
ATOM 6137  O OE2  . GLU A 1 118 ? -11.972 5.265   -11.840 1.00 0.00 ? 118 GLU A OE2  3  
ATOM 6138  H H    . GLU A 1 118 ? -15.795 5.232   -10.108 1.00 0.00 ? 118 GLU A H    3  
ATOM 6139  H HA   . GLU A 1 118 ? -15.261 3.159   -8.249  1.00 0.00 ? 118 GLU A HA   3  
ATOM 6140  H HB2  . GLU A 1 118 ? -12.933 3.494   -8.808  1.00 0.00 ? 118 GLU A HB2  3  
ATOM 6141  H HB3  . GLU A 1 118 ? -13.938 3.568   -10.253 1.00 0.00 ? 118 GLU A HB3  3  
ATOM 6142  H HG2  . GLU A 1 118 ? -13.803 6.067   -10.203 1.00 0.00 ? 118 GLU A HG2  3  
ATOM 6143  H HG3  . GLU A 1 118 ? -12.772 5.973   -8.774  1.00 0.00 ? 118 GLU A HG3  3  
ATOM 6144  N N    . ASP A 1 119 ? -14.975 6.081   -6.851  1.00 0.00 ? 119 ASP A N    3  
ATOM 6145  C CA   . ASP A 1 119 ? -14.927 6.744   -5.537  1.00 0.00 ? 119 ASP A CA   3  
ATOM 6146  C C    . ASP A 1 119 ? -16.004 6.248   -4.547  1.00 0.00 ? 119 ASP A C    3  
ATOM 6147  O O    . ASP A 1 119 ? -15.877 6.448   -3.337  1.00 0.00 ? 119 ASP A O    3  
ATOM 6148  C CB   . ASP A 1 119 ? -15.023 8.264   -5.735  1.00 0.00 ? 119 ASP A CB   3  
ATOM 6149  C CG   . ASP A 1 119 ? -14.500 9.047   -4.517  1.00 0.00 ? 119 ASP A CG   3  
ATOM 6150  O OD1  . ASP A 1 119 ? -13.294 8.932   -4.188  1.00 0.00 ? 119 ASP A OD1  3  
ATOM 6151  O OD2  . ASP A 1 119 ? -15.287 9.810   -3.904  1.00 0.00 ? 119 ASP A OD2  3  
ATOM 6152  H H    . ASP A 1 119 ? -15.341 6.617   -7.632  1.00 0.00 ? 119 ASP A H    3  
ATOM 6153  H HA   . ASP A 1 119 ? -13.954 6.524   -5.093  1.00 0.00 ? 119 ASP A HA   3  
ATOM 6154  H HB2  . ASP A 1 119 ? -14.423 8.552   -6.600  1.00 0.00 ? 119 ASP A HB2  3  
ATOM 6155  H HB3  . ASP A 1 119 ? -16.060 8.534   -5.945  1.00 0.00 ? 119 ASP A HB3  3  
ATOM 6156  N N    . GLY A 1 120 ? -17.078 5.624   -5.051  1.00 0.00 ? 120 GLY A N    3  
ATOM 6157  C CA   . GLY A 1 120 ? -18.230 5.139   -4.280  1.00 0.00 ? 120 GLY A CA   3  
ATOM 6158  C C    . GLY A 1 120 ? -19.433 6.089   -4.278  1.00 0.00 ? 120 GLY A C    3  
ATOM 6159  O O    . GLY A 1 120 ? -20.475 5.739   -3.718  1.00 0.00 ? 120 GLY A O    3  
ATOM 6160  H H    . GLY A 1 120 ? -17.102 5.450   -6.051  1.00 0.00 ? 120 GLY A H    3  
ATOM 6161  H HA2  . GLY A 1 120 ? -18.553 4.189   -4.707  1.00 0.00 ? 120 GLY A HA2  3  
ATOM 6162  H HA3  . GLY A 1 120 ? -17.936 4.961   -3.245  1.00 0.00 ? 120 GLY A HA3  3  
ATOM 6163  N N    . ALA A 1 121 ? -19.327 7.256   -4.921  1.00 0.00 ? 121 ALA A N    3  
ATOM 6164  C CA   . ALA A 1 121 ? -20.394 8.255   -5.004  1.00 0.00 ? 121 ALA A CA   3  
ATOM 6165  C C    . ALA A 1 121 ? -21.368 8.005   -6.160  1.00 0.00 ? 121 ALA A C    3  
ATOM 6166  O O    . ALA A 1 121 ? -20.952 7.657   -7.270  1.00 0.00 ? 121 ALA A O    3  
ATOM 6167  C CB   . ALA A 1 121 ? -19.776 9.657   -5.077  1.00 0.00 ? 121 ALA A CB   3  
ATOM 6168  H H    . ALA A 1 121 ? -18.448 7.468   -5.368  1.00 0.00 ? 121 ALA A H    3  
ATOM 6169  H HA   . ALA A 1 121 ? -20.986 8.187   -4.093  1.00 0.00 ? 121 ALA A HA   3  
ATOM 6170  H HB1  . ALA A 1 121 ? -19.266 9.792   -6.031  1.00 0.00 ? 121 ALA A HB1  3  
ATOM 6171  H HB2  . ALA A 1 121 ? -20.562 10.409  -4.998  1.00 0.00 ? 121 ALA A HB2  3  
ATOM 6172  H HB3  . ALA A 1 121 ? -19.067 9.797   -4.259  1.00 0.00 ? 121 ALA A HB3  3  
ATOM 6173  N N    . VAL A 1 122 ? -22.661 8.215   -5.891  1.00 0.00 ? 122 VAL A N    3  
ATOM 6174  C CA   . VAL A 1 122 ? -23.777 7.994   -6.816  1.00 0.00 ? 122 VAL A CA   3  
ATOM 6175  C C    . VAL A 1 122 ? -23.820 9.093   -7.874  1.00 0.00 ? 122 VAL A C    3  
ATOM 6176  O O    . VAL A 1 122 ? -24.267 10.216  -7.625  1.00 0.00 ? 122 VAL A O    3  
ATOM 6177  C CB   . VAL A 1 122 ? -25.097 7.777   -6.045  1.00 0.00 ? 122 VAL A CB   3  
ATOM 6178  C CG1  . VAL A 1 122 ? -25.508 8.905   -5.090  1.00 0.00 ? 122 VAL A CG1  3  
ATOM 6179  C CG2  . VAL A 1 122 ? -26.255 7.482   -6.991  1.00 0.00 ? 122 VAL A CG2  3  
ATOM 6180  H H    . VAL A 1 122 ? -22.902 8.573   -4.978  1.00 0.00 ? 122 VAL A H    3  
ATOM 6181  H HA   . VAL A 1 122 ? -23.592 7.064   -7.346  1.00 0.00 ? 122 VAL A HA   3  
ATOM 6182  H HB   . VAL A 1 122 ? -24.957 6.886   -5.430  1.00 0.00 ? 122 VAL A HB   3  
ATOM 6183  H HG11 . VAL A 1 122 ? -25.766 9.805   -5.647  1.00 0.00 ? 122 VAL A HG11 3  
ATOM 6184  H HG12 . VAL A 1 122 ? -26.380 8.591   -4.516  1.00 0.00 ? 122 VAL A HG12 3  
ATOM 6185  H HG13 . VAL A 1 122 ? -24.702 9.127   -4.393  1.00 0.00 ? 122 VAL A HG13 3  
ATOM 6186  H HG21 . VAL A 1 122 ? -27.135 7.186   -6.416  1.00 0.00 ? 122 VAL A HG21 3  
ATOM 6187  H HG22 . VAL A 1 122 ? -26.504 8.357   -7.586  1.00 0.00 ? 122 VAL A HG22 3  
ATOM 6188  H HG23 . VAL A 1 122 ? -25.974 6.672   -7.661  1.00 0.00 ? 122 VAL A HG23 3  
ATOM 6189  N N    . ILE A 1 123 ? -23.298 8.776   -9.060  1.00 0.00 ? 123 ILE A N    3  
ATOM 6190  C CA   . ILE A 1 123 ? -23.300 9.690   -10.203 1.00 0.00 ? 123 ILE A CA   3  
ATOM 6191  C C    . ILE A 1 123 ? -24.580 9.554   -11.021 1.00 0.00 ? 123 ILE A C    3  
ATOM 6192  O O    . ILE A 1 123 ? -25.040 10.563  -11.552 1.00 0.00 ? 123 ILE A O    3  
ATOM 6193  C CB   . ILE A 1 123 ? -22.009 9.611   -11.051 1.00 0.00 ? 123 ILE A CB   3  
ATOM 6194  C CG1  . ILE A 1 123 ? -21.967 8.552   -12.179 1.00 0.00 ? 123 ILE A CG1  3  
ATOM 6195  C CG2  . ILE A 1 123 ? -20.767 9.527   -10.146 1.00 0.00 ? 123 ILE A CG2  3  
ATOM 6196  C CD1  . ILE A 1 123 ? -22.129 7.082   -11.781 1.00 0.00 ? 123 ILE A CD1  3  
ATOM 6197  H H    . ILE A 1 123 ? -22.892 7.862   -9.178  1.00 0.00 ? 123 ILE A H    3  
ATOM 6198  H HA   . ILE A 1 123 ? -23.310 10.702  -9.808  1.00 0.00 ? 123 ILE A HA   3  
ATOM 6199  H HB   . ILE A 1 123 ? -21.939 10.573  -11.563 1.00 0.00 ? 123 ILE A HB   3  
ATOM 6200  H HG12 . ILE A 1 123 ? -22.739 8.787   -12.911 1.00 0.00 ? 123 ILE A HG12 3  
ATOM 6201  H HG13 . ILE A 1 123 ? -21.010 8.650   -12.694 1.00 0.00 ? 123 ILE A HG13 3  
ATOM 6202  H HG21 . ILE A 1 123 ? -19.868 9.695   -10.740 1.00 0.00 ? 123 ILE A HG21 3  
ATOM 6203  H HG22 . ILE A 1 123 ? -20.816 10.286  -9.363  1.00 0.00 ? 123 ILE A HG22 3  
ATOM 6204  H HG23 . ILE A 1 123 ? -20.712 8.547   -9.678  1.00 0.00 ? 123 ILE A HG23 3  
ATOM 6205  H HD11 . ILE A 1 123 ? -23.145 6.894   -11.449 1.00 0.00 ? 123 ILE A HD11 3  
ATOM 6206  H HD12 . ILE A 1 123 ? -21.946 6.453   -12.653 1.00 0.00 ? 123 ILE A HD12 3  
ATOM 6207  H HD13 . ILE A 1 123 ? -21.424 6.816   -10.999 1.00 0.00 ? 123 ILE A HD13 3  
ATOM 6208  N N    . MET A 1 124 ? -25.202 8.364   -11.061 1.00 0.00 ? 124 MET A N    3  
ATOM 6209  C CA   . MET A 1 124 ? -26.457 8.170   -11.794 1.00 0.00 ? 124 MET A CA   3  
ATOM 6210  C C    . MET A 1 124 ? -27.455 7.342   -10.971 1.00 0.00 ? 124 MET A C    3  
ATOM 6211  O O    . MET A 1 124 ? -27.118 6.469   -10.174 1.00 0.00 ? 124 MET A O    3  
ATOM 6212  C CB   . MET A 1 124 ? -26.201 7.557   -13.189 1.00 0.00 ? 124 MET A CB   3  
ATOM 6213  C CG   . MET A 1 124 ? -25.735 8.562   -14.247 1.00 0.00 ? 124 MET A CG   3  
ATOM 6214  S SD   . MET A 1 124 ? -26.712 10.072  -14.476 1.00 0.00 ? 124 MET A SD   3  
ATOM 6215  C CE   . MET A 1 124 ? -25.324 11.219  -14.690 1.00 0.00 ? 124 MET A CE   3  
ATOM 6216  H H    . MET A 1 124 ? -24.806 7.571   -10.558 1.00 0.00 ? 124 MET A H    3  
ATOM 6217  H HA   . MET A 1 124 ? -26.939 9.136   -11.940 1.00 0.00 ? 124 MET A HA   3  
ATOM 6218  H HB2  . MET A 1 124 ? -25.438 6.787   -13.135 1.00 0.00 ? 124 MET A HB2  3  
ATOM 6219  H HB3  . MET A 1 124 ? -27.125 7.105   -13.552 1.00 0.00 ? 124 MET A HB3  3  
ATOM 6220  H HG2  . MET A 1 124 ? -24.721 8.854   -13.979 1.00 0.00 ? 124 MET A HG2  3  
ATOM 6221  H HG3  . MET A 1 124 ? -25.673 8.049   -15.207 1.00 0.00 ? 124 MET A HG3  3  
ATOM 6222  H HE1  . MET A 1 124 ? -24.625 11.101  -13.859 1.00 0.00 ? 124 MET A HE1  3  
ATOM 6223  H HE2  . MET A 1 124 ? -24.803 10.994  -15.620 1.00 0.00 ? 124 MET A HE2  3  
ATOM 6224  H HE3  . MET A 1 124 ? -25.691 12.245  -14.713 1.00 0.00 ? 124 MET A HE3  3  
ATOM 6225  N N    . PHE A 1 125 ? -28.726 7.638   -11.177 1.00 0.00 ? 125 PHE A N    3  
ATOM 6226  C CA   . PHE A 1 125 ? -29.867 7.024   -10.507 1.00 0.00 ? 125 PHE A CA   3  
ATOM 6227  C C    . PHE A 1 125 ? -30.509 6.030   -11.477 1.00 0.00 ? 125 PHE A C    3  
ATOM 6228  O O    . PHE A 1 125 ? -31.431 6.353   -12.222 1.00 0.00 ? 125 PHE A O    3  
ATOM 6229  C CB   . PHE A 1 125 ? -30.840 8.122   -10.027 1.00 0.00 ? 125 PHE A CB   3  
ATOM 6230  C CG   . PHE A 1 125 ? -30.672 8.723   -8.639  1.00 0.00 ? 125 PHE A CG   3  
ATOM 6231  C CD1  . PHE A 1 125 ? -29.673 8.315   -7.730  1.00 0.00 ? 125 PHE A CD1  3  
ATOM 6232  C CD2  . PHE A 1 125 ? -31.564 9.744   -8.262  1.00 0.00 ? 125 PHE A CD2  3  
ATOM 6233  C CE1  . PHE A 1 125 ? -29.568 8.932   -6.469  1.00 0.00 ? 125 PHE A CE1  3  
ATOM 6234  C CE2  . PHE A 1 125 ? -31.448 10.371  -7.008  1.00 0.00 ? 125 PHE A CE2  3  
ATOM 6235  C CZ   . PHE A 1 125 ? -30.447 9.966   -6.112  1.00 0.00 ? 125 PHE A CZ   3  
ATOM 6236  H H    . PHE A 1 125 ? -28.909 8.314   -11.905 1.00 0.00 ? 125 PHE A H    3  
ATOM 6237  H HA   . PHE A 1 125 ? -29.541 6.440   -9.648  1.00 0.00 ? 125 PHE A HA   3  
ATOM 6238  H HB2  . PHE A 1 125 ? -30.829 8.940   -10.745 1.00 0.00 ? 125 PHE A HB2  3  
ATOM 6239  H HB3  . PHE A 1 125 ? -31.845 7.707   -10.042 1.00 0.00 ? 125 PHE A HB3  3  
ATOM 6240  H HD1  . PHE A 1 125 ? -28.965 7.547   -7.991  1.00 0.00 ? 125 PHE A HD1  3  
ATOM 6241  H HD2  . PHE A 1 125 ? -32.334 10.056  -8.953  1.00 0.00 ? 125 PHE A HD2  3  
ATOM 6242  H HE1  . PHE A 1 125 ? -28.801 8.624   -5.772  1.00 0.00 ? 125 PHE A HE1  3  
ATOM 6243  H HE2  . PHE A 1 125 ? -32.123 11.167  -6.731  1.00 0.00 ? 125 PHE A HE2  3  
ATOM 6244  H HZ   . PHE A 1 125 ? -30.350 10.449  -5.148  1.00 0.00 ? 125 PHE A HZ   3  
ATOM 6245  N N    . ILE A 1 126 ? -29.999 4.799   -11.477 1.00 0.00 ? 126 ILE A N    3  
ATOM 6246  C CA   . ILE A 1 126 ? -30.618 3.670   -12.183 1.00 0.00 ? 126 ILE A CA   3  
ATOM 6247  C C    . ILE A 1 126 ? -31.254 2.752   -11.150 1.00 0.00 ? 126 ILE A C    3  
ATOM 6248  O O    . ILE A 1 126 ? -30.781 1.646   -10.875 1.00 0.00 ? 126 ILE A O    3  
ATOM 6249  C CB   . ILE A 1 126 ? -29.623 2.962   -13.113 1.00 0.00 ? 126 ILE A CB   3  
ATOM 6250  C CG1  . ILE A 1 126 ? -28.977 3.999   -14.052 1.00 0.00 ? 126 ILE A CG1  3  
ATOM 6251  C CG2  . ILE A 1 126 ? -30.327 1.853   -13.925 1.00 0.00 ? 126 ILE A CG2  3  
ATOM 6252  C CD1  . ILE A 1 126 ? -27.987 3.358   -15.011 1.00 0.00 ? 126 ILE A CD1  3  
ATOM 6253  H H    . ILE A 1 126 ? -29.165 4.623   -10.935 1.00 0.00 ? 126 ILE A H    3  
ATOM 6254  H HA   . ILE A 1 126 ? -31.426 4.040   -12.810 1.00 0.00 ? 126 ILE A HA   3  
ATOM 6255  H HB   . ILE A 1 126 ? -28.841 2.506   -12.502 1.00 0.00 ? 126 ILE A HB   3  
ATOM 6256  H HG12 . ILE A 1 126 ? -29.749 4.513   -14.618 1.00 0.00 ? 126 ILE A HG12 3  
ATOM 6257  H HG13 . ILE A 1 126 ? -28.437 4.751   -13.480 1.00 0.00 ? 126 ILE A HG13 3  
ATOM 6258  H HG21 . ILE A 1 126 ? -31.088 1.343   -13.339 1.00 0.00 ? 126 ILE A HG21 3  
ATOM 6259  H HG22 . ILE A 1 126 ? -30.839 2.279   -14.781 1.00 0.00 ? 126 ILE A HG22 3  
ATOM 6260  H HG23 . ILE A 1 126 ? -29.594 1.127   -14.272 1.00 0.00 ? 126 ILE A HG23 3  
ATOM 6261  H HD11 . ILE A 1 126 ? -27.469 4.151   -15.547 1.00 0.00 ? 126 ILE A HD11 3  
ATOM 6262  H HD12 . ILE A 1 126 ? -27.286 2.757   -14.434 1.00 0.00 ? 126 ILE A HD12 3  
ATOM 6263  H HD13 . ILE A 1 126 ? -28.520 2.721   -15.713 1.00 0.00 ? 126 ILE A HD13 3  
ATOM 6264  N N    . LEU A 1 127 ? -32.332 3.244   -10.543 1.00 0.00 ? 127 LEU A N    3  
ATOM 6265  C CA   . LEU A 1 127 ? -33.055 2.501   -9.523  1.00 0.00 ? 127 LEU A CA   3  
ATOM 6266  C C    . LEU A 1 127 ? -33.896 1.412   -10.208 1.00 0.00 ? 127 LEU A C    3  
ATOM 6267  O O    . LEU A 1 127 ? -35.040 1.620   -10.606 1.00 0.00 ? 127 LEU A O    3  
ATOM 6268  C CB   . LEU A 1 127 ? -33.865 3.439   -8.615  1.00 0.00 ? 127 LEU A CB   3  
ATOM 6269  C CG   . LEU A 1 127 ? -33.133 4.633   -7.956  1.00 0.00 ? 127 LEU A CG   3  
ATOM 6270  C CD1  . LEU A 1 127 ? -31.632 4.615   -7.827  1.00 0.00 ? 127 LEU A CD1  3  
ATOM 6271  C CD2  . LEU A 1 127 ? -33.562 5.957   -8.576  1.00 0.00 ? 127 LEU A CD2  3  
ATOM 6272  H H    . LEU A 1 127 ? -32.651 4.171   -10.790 1.00 0.00 ? 127 LEU A H    3  
ATOM 6273  H HA   . LEU A 1 127 ? -32.328 1.998   -8.882  1.00 0.00 ? 127 LEU A HA   3  
ATOM 6274  H HB2  . LEU A 1 127 ? -34.731 3.810   -9.163  1.00 0.00 ? 127 LEU A HB2  3  
ATOM 6275  H HB3  . LEU A 1 127 ? -34.255 2.818   -7.812  1.00 0.00 ? 127 LEU A HB3  3  
ATOM 6276  H HG   . LEU A 1 127 ? -33.389 4.641   -6.918  1.00 0.00 ? 127 LEU A HG   3  
ATOM 6277  H HD11 . LEU A 1 127 ? -31.328 3.670   -7.385  1.00 0.00 ? 127 LEU A HD11 3  
ATOM 6278  H HD12 . LEU A 1 127 ? -31.146 4.784   -8.782  1.00 0.00 ? 127 LEU A HD12 3  
ATOM 6279  H HD13 . LEU A 1 127 ? -31.367 5.412   -7.126  1.00 0.00 ? 127 LEU A HD13 3  
ATOM 6280  H HD21 . LEU A 1 127 ? -34.639 6.065   -8.466  1.00 0.00 ? 127 LEU A HD21 3  
ATOM 6281  H HD22 . LEU A 1 127 ? -33.075 6.784   -8.061  1.00 0.00 ? 127 LEU A HD22 3  
ATOM 6282  H HD23 . LEU A 1 127 ? -33.305 5.973   -9.633  1.00 0.00 ? 127 LEU A HD23 3  
ATOM 6283  N N    . ASN A 1 128 ? -33.274 0.249   -10.386 1.00 0.00 ? 128 ASN A N    3  
ATOM 6284  C CA   . ASN A 1 128 ? -33.869 -0.941  -11.003 1.00 0.00 ? 128 ASN A CA   3  
ATOM 6285  C C    . ASN A 1 128 ? -35.105 -1.395  -10.201 1.00 0.00 ? 128 ASN A C    3  
ATOM 6286  O O    . ASN A 1 128 ? -34.984 -1.959  -9.112  1.00 0.00 ? 128 ASN A O    3  
ATOM 6287  C CB   . ASN A 1 128 ? -32.813 -2.066  -11.043 1.00 0.00 ? 128 ASN A CB   3  
ATOM 6288  C CG   . ASN A 1 128 ? -31.802 -1.962  -12.175 1.00 0.00 ? 128 ASN A CG   3  
ATOM 6289  O OD1  . ASN A 1 128 ? -31.840 -2.720  -13.133 1.00 0.00 ? 128 ASN A OD1  3  
ATOM 6290  N ND2  . ASN A 1 128 ? -30.856 -1.050  -12.123 1.00 0.00 ? 128 ASN A ND2  3  
ATOM 6291  H H    . ASN A 1 128 ? -32.283 0.259   -10.182 1.00 0.00 ? 128 ASN A H    3  
ATOM 6292  H HA   . ASN A 1 128 ? -34.186 -0.712  -12.021 1.00 0.00 ? 128 ASN A HA   3  
ATOM 6293  H HB2  . ASN A 1 128 ? -32.284 -2.110  -10.091 1.00 0.00 ? 128 ASN A HB2  3  
ATOM 6294  H HB3  . ASN A 1 128 ? -33.328 -3.019  -11.169 1.00 0.00 ? 128 ASN A HB3  3  
ATOM 6295  H HD21 . ASN A 1 128 ? -30.810 -0.362  -11.383 1.00 0.00 ? 128 ASN A HD21 3  
ATOM 6296  H HD22 . ASN A 1 128 ? -30.202 -1.020  -12.886 1.00 0.00 ? 128 ASN A HD22 3  
ATOM 6297  N N    . PHE A 1 129 ? -36.315 -1.185  -10.728 1.00 0.00 ? 129 PHE A N    3  
ATOM 6298  C CA   . PHE A 1 129 ? -37.554 -1.509  -10.020 1.00 0.00 ? 129 PHE A CA   3  
ATOM 6299  C C    . PHE A 1 129 ? -37.955 -2.979  -10.198 1.00 0.00 ? 129 PHE A C    3  
ATOM 6300  O O    . PHE A 1 129 ? -39.069 -3.316  -10.597 1.00 0.00 ? 129 PHE A O    3  
ATOM 6301  C CB   . PHE A 1 129 ? -38.675 -0.537  -10.387 1.00 0.00 ? 129 PHE A CB   3  
ATOM 6302  C CG   . PHE A 1 129 ? -38.434 0.943   -10.123 1.00 0.00 ? 129 PHE A CG   3  
ATOM 6303  C CD1  . PHE A 1 129 ? -37.947 1.387   -8.876  1.00 0.00 ? 129 PHE A CD1  3  
ATOM 6304  C CD2  . PHE A 1 129 ? -38.771 1.892   -11.109 1.00 0.00 ? 129 PHE A CD2  3  
ATOM 6305  C CE1  . PHE A 1 129 ? -37.791 2.763   -8.622  1.00 0.00 ? 129 PHE A CE1  3  
ATOM 6306  C CE2  . PHE A 1 129 ? -38.616 3.268   -10.854 1.00 0.00 ? 129 PHE A CE2  3  
ATOM 6307  C CZ   . PHE A 1 129 ? -38.122 3.704   -9.612  1.00 0.00 ? 129 PHE A CZ   3  
ATOM 6308  H H    . PHE A 1 129 ? -36.392 -0.777  -11.647 1.00 0.00 ? 129 PHE A H    3  
ATOM 6309  H HA   . PHE A 1 129 ? -37.367 -1.392  -8.954  1.00 0.00 ? 129 PHE A HA   3  
ATOM 6310  H HB2  . PHE A 1 129 ? -38.930 -0.678  -11.438 1.00 0.00 ? 129 PHE A HB2  3  
ATOM 6311  H HB3  . PHE A 1 129 ? -39.519 -0.851  -9.781  1.00 0.00 ? 129 PHE A HB3  3  
ATOM 6312  H HD1  . PHE A 1 129 ? -37.705 0.675   -8.104  1.00 0.00 ? 129 PHE A HD1  3  
ATOM 6313  H HD2  . PHE A 1 129 ? -39.163 1.568   -12.063 1.00 0.00 ? 129 PHE A HD2  3  
ATOM 6314  H HE1  . PHE A 1 129 ? -37.423 3.100   -7.663  1.00 0.00 ? 129 PHE A HE1  3  
ATOM 6315  H HE2  . PHE A 1 129 ? -38.882 3.992   -11.613 1.00 0.00 ? 129 PHE A HE2  3  
ATOM 6316  H HZ   . PHE A 1 129 ? -38.003 4.762   -9.417  1.00 0.00 ? 129 PHE A HZ   3  
ATOM 6317  N N    . GLU A 1 130 ? -37.022 -3.882  -9.916  1.00 0.00 ? 130 GLU A N    3  
ATOM 6318  C CA   . GLU A 1 130 ? -37.236 -5.315  -10.104 1.00 0.00 ? 130 GLU A CA   3  
ATOM 6319  C C    . GLU A 1 130 ? -38.041 -5.948  -8.961  1.00 0.00 ? 130 GLU A C    3  
ATOM 6320  O O    . GLU A 1 130 ? -37.568 -6.222  -7.865  1.00 0.00 ? 130 GLU A O    3  
ATOM 6321  C CB   . GLU A 1 130 ? -35.910 -6.033  -10.338 1.00 0.00 ? 130 GLU A CB   3  
ATOM 6322  C CG   . GLU A 1 130 ? -34.854 -5.650  -9.306  1.00 0.00 ? 130 GLU A CG   3  
ATOM 6323  C CD   . GLU A 1 130 ? -33.627 -6.577  -9.335  1.00 0.00 ? 130 GLU A CD   3  
ATOM 6324  O OE1  . GLU A 1 130 ? -33.709 -7.744  -8.889  1.00 0.00 ? 130 GLU A OE1  3  
ATOM 6325  O OE2  . GLU A 1 130 ? -32.561 -6.154  -9.836  1.00 0.00 ? 130 GLU A OE2  3  
ATOM 6326  H H    . GLU A 1 130 ? -36.126 -3.548  -9.563  1.00 0.00 ? 130 GLU A H    3  
ATOM 6327  H HA   . GLU A 1 130 ? -37.811 -5.456  -11.022 1.00 0.00 ? 130 GLU A HA   3  
ATOM 6328  H HB2  . GLU A 1 130 ? -36.098 -7.108  -10.312 1.00 0.00 ? 130 GLU A HB2  3  
ATOM 6329  H HB3  . GLU A 1 130 ? -35.550 -5.742  -11.323 1.00 0.00 ? 130 GLU A HB3  3  
ATOM 6330  H HG2  . GLU A 1 130 ? -34.547 -4.626  -9.516  1.00 0.00 ? 130 GLU A HG2  3  
ATOM 6331  H HG3  . GLU A 1 130 ? -35.318 -5.644  -8.322  1.00 0.00 ? 130 GLU A HG3  3  
ATOM 6332  N N    . VAL A 1 131 ? -39.282 -6.263  -9.281  1.00 0.00 ? 131 VAL A N    3  
ATOM 6333  C CA   . VAL A 1 131 ? -40.202 -7.070  -8.466  1.00 0.00 ? 131 VAL A CA   3  
ATOM 6334  C C    . VAL A 1 131 ? -39.628 -8.479  -8.349  1.00 0.00 ? 131 VAL A C    3  
ATOM 6335  O O    . VAL A 1 131 ? -39.520 -9.189  -9.354  1.00 0.00 ? 131 VAL A O    3  
ATOM 6336  C CB   . VAL A 1 131 ? -41.586 -7.070  -9.132  1.00 0.00 ? 131 VAL A CB   3  
ATOM 6337  C CG1  . VAL A 1 131 ? -42.555 -8.157  -8.666  1.00 0.00 ? 131 VAL A CG1  3  
ATOM 6338  C CG2  . VAL A 1 131 ? -42.263 -5.716  -8.888  1.00 0.00 ? 131 VAL A CG2  3  
ATOM 6339  H H    . VAL A 1 131 ? -39.564 -5.950  -10.191 1.00 0.00 ? 131 VAL A H    3  
ATOM 6340  H HA   . VAL A 1 131 ? -40.286 -6.642  -7.467  1.00 0.00 ? 131 VAL A HA   3  
ATOM 6341  H HB   . VAL A 1 131 ? -41.435 -7.205  -10.200 1.00 0.00 ? 131 VAL A HB   3  
ATOM 6342  H HG11 . VAL A 1 131 ? -42.136 -9.146  -8.848  1.00 0.00 ? 131 VAL A HG11 3  
ATOM 6343  H HG12 . VAL A 1 131 ? -42.765 -8.034  -7.610  1.00 0.00 ? 131 VAL A HG12 3  
ATOM 6344  H HG13 . VAL A 1 131 ? -43.488 -8.074  -9.223  1.00 0.00 ? 131 VAL A HG13 3  
ATOM 6345  H HG21 . VAL A 1 131 ? -41.609 -4.902  -9.202  1.00 0.00 ? 131 VAL A HG21 3  
ATOM 6346  H HG22 . VAL A 1 131 ? -43.189 -5.666  -9.462  1.00 0.00 ? 131 VAL A HG22 3  
ATOM 6347  H HG23 . VAL A 1 131 ? -42.491 -5.590  -7.828  1.00 0.00 ? 131 VAL A HG23 3  
ATOM 6348  N N    . VAL A 1 132 ? -39.211 -8.872  -7.141  1.00 0.00 ? 132 VAL A N    3  
ATOM 6349  C CA   . VAL A 1 132 ? -38.694 -10.224 -6.884  1.00 0.00 ? 132 VAL A CA   3  
ATOM 6350  C C    . VAL A 1 132 ? -39.183 -10.752 -5.529  1.00 0.00 ? 132 VAL A C    3  
ATOM 6351  O O    . VAL A 1 132 ? -39.270 -10.004 -4.554  1.00 0.00 ? 132 VAL A O    3  
ATOM 6352  C CB   . VAL A 1 132 ? -37.159 -10.284 -7.086  1.00 0.00 ? 132 VAL A CB   3  
ATOM 6353  C CG1  . VAL A 1 132 ? -36.378 -9.342  -6.165  1.00 0.00 ? 132 VAL A CG1  3  
ATOM 6354  C CG2  . VAL A 1 132 ? -36.608 -11.706 -6.932  1.00 0.00 ? 132 VAL A CG2  3  
ATOM 6355  H H    . VAL A 1 132 ? -39.335 -8.250  -6.344  1.00 0.00 ? 132 VAL A H    3  
ATOM 6356  H HA   . VAL A 1 132 ? -39.128 -10.881 -7.638  1.00 0.00 ? 132 VAL A HA   3  
ATOM 6357  H HB   . VAL A 1 132 ? -36.952 -9.974  -8.112  1.00 0.00 ? 132 VAL A HB   3  
ATOM 6358  H HG11 . VAL A 1 132 ? -36.536 -9.612  -5.122  1.00 0.00 ? 132 VAL A HG11 3  
ATOM 6359  H HG12 . VAL A 1 132 ? -35.314 -9.402  -6.393  1.00 0.00 ? 132 VAL A HG12 3  
ATOM 6360  H HG13 . VAL A 1 132 ? -36.700 -8.314  -6.323  1.00 0.00 ? 132 VAL A HG13 3  
ATOM 6361  H HG21 . VAL A 1 132 ? -37.146 -12.386 -7.593  1.00 0.00 ? 132 VAL A HG21 3  
ATOM 6362  H HG22 . VAL A 1 132 ? -35.551 -11.721 -7.204  1.00 0.00 ? 132 VAL A HG22 3  
ATOM 6363  H HG23 . VAL A 1 132 ? -36.706 -12.047 -5.901  1.00 0.00 ? 132 VAL A HG23 3  
ATOM 6364  N N    . MET A 1 133 ? -39.518 -12.040 -5.471  1.00 0.00 ? 133 MET A N    3  
ATOM 6365  C CA   . MET A 1 133 ? -40.008 -12.744 -4.279  1.00 0.00 ? 133 MET A CA   3  
ATOM 6366  C C    . MET A 1 133 ? -39.349 -14.125 -4.107  1.00 0.00 ? 133 MET A C    3  
ATOM 6367  O O    . MET A 1 133 ? -38.602 -14.595 -4.969  1.00 0.00 ? 133 MET A O    3  
ATOM 6368  C CB   . MET A 1 133 ? -41.545 -12.842 -4.329  1.00 0.00 ? 133 MET A CB   3  
ATOM 6369  C CG   . MET A 1 133 ? -42.072 -13.666 -5.514  1.00 0.00 ? 133 MET A CG   3  
ATOM 6370  S SD   . MET A 1 133 ? -43.874 -13.890 -5.548  1.00 0.00 ? 133 MET A SD   3  
ATOM 6371  C CE   . MET A 1 133 ? -44.083 -15.072 -4.185  1.00 0.00 ? 133 MET A CE   3  
ATOM 6372  H H    . MET A 1 133 ? -39.424 -12.588 -6.311  1.00 0.00 ? 133 MET A H    3  
ATOM 6373  H HA   . MET A 1 133 ? -39.748 -12.163 -3.393  1.00 0.00 ? 133 MET A HA   3  
ATOM 6374  H HB2  . MET A 1 133 ? -41.900 -13.286 -3.400  1.00 0.00 ? 133 MET A HB2  3  
ATOM 6375  H HB3  . MET A 1 133 ? -41.960 -11.837 -4.390  1.00 0.00 ? 133 MET A HB3  3  
ATOM 6376  H HG2  . MET A 1 133 ? -41.782 -13.165 -6.438  1.00 0.00 ? 133 MET A HG2  3  
ATOM 6377  H HG3  . MET A 1 133 ? -41.607 -14.651 -5.506  1.00 0.00 ? 133 MET A HG3  3  
ATOM 6378  H HE1  . MET A 1 133 ? -43.473 -15.957 -4.366  1.00 0.00 ? 133 MET A HE1  3  
ATOM 6379  H HE2  . MET A 1 133 ? -43.784 -14.614 -3.242  1.00 0.00 ? 133 MET A HE2  3  
ATOM 6380  H HE3  . MET A 1 133 ? -45.130 -15.368 -4.118  1.00 0.00 ? 133 MET A HE3  3  
ATOM 6381  N N    . GLU A 1 134 ? -39.631 -14.778 -2.980  1.00 0.00 ? 134 GLU A N    3  
ATOM 6382  C CA   . GLU A 1 134 ? -39.139 -16.125 -2.643  1.00 0.00 ? 134 GLU A CA   3  
ATOM 6383  C C    . GLU A 1 134 ? -39.650 -17.231 -3.596  1.00 0.00 ? 134 GLU A C    3  
ATOM 6384  O O    . GLU A 1 134 ? -40.707 -17.100 -4.226  1.00 0.00 ? 134 GLU A O    3  
ATOM 6385  C CB   . GLU A 1 134 ? -39.448 -16.448 -1.169  1.00 0.00 ? 134 GLU A CB   3  
ATOM 6386  C CG   . GLU A 1 134 ? -40.947 -16.546 -0.844  1.00 0.00 ? 134 GLU A CG   3  
ATOM 6387  C CD   . GLU A 1 134 ? -41.168 -16.810 0.658   1.00 0.00 ? 134 GLU A CD   3  
ATOM 6388  O OE1  . GLU A 1 134 ? -41.204 -17.994 1.076   1.00 0.00 ? 134 GLU A OE1  3  
ATOM 6389  O OE2  . GLU A 1 134 ? -41.312 -15.835 1.437   1.00 0.00 ? 134 GLU A OE2  3  
ATOM 6390  H H    . GLU A 1 134 ? -40.259 -14.331 -2.330  1.00 0.00 ? 134 GLU A H    3  
ATOM 6391  H HA   . GLU A 1 134 ? -38.052 -16.107 -2.740  1.00 0.00 ? 134 GLU A HA   3  
ATOM 6392  H HB2  . GLU A 1 134 ? -38.971 -17.395 -0.912  1.00 0.00 ? 134 GLU A HB2  3  
ATOM 6393  H HB3  . GLU A 1 134 ? -39.002 -15.672 -0.545  1.00 0.00 ? 134 GLU A HB3  3  
ATOM 6394  H HG2  . GLU A 1 134 ? -41.443 -15.615 -1.130  1.00 0.00 ? 134 GLU A HG2  3  
ATOM 6395  H HG3  . GLU A 1 134 ? -41.393 -17.354 -1.429  1.00 0.00 ? 134 GLU A HG3  3  
ATOM 6396  N N    . LYS A 1 135 ? -38.884 -18.327 -3.693  1.00 0.00 ? 135 LYS A N    3  
ATOM 6397  C CA   . LYS A 1 135 ? -39.109 -19.465 -4.605  1.00 0.00 ? 135 LYS A CA   3  
ATOM 6398  C C    . LYS A 1 135 ? -39.836 -20.632 -3.921  1.00 0.00 ? 135 LYS A C    3  
ATOM 6399  O O    . LYS A 1 135 ? -39.408 -21.051 -2.820  1.00 0.00 ? 135 LYS A O    3  
ATOM 6400  C CB   . LYS A 1 135 ? -37.767 -19.908 -5.216  1.00 0.00 ? 135 LYS A CB   3  
ATOM 6401  C CG   . LYS A 1 135 ? -37.132 -18.817 -6.101  1.00 0.00 ? 135 LYS A CG   3  
ATOM 6402  C CD   . LYS A 1 135 ? -35.794 -19.241 -6.728  1.00 0.00 ? 135 LYS A CD   3  
ATOM 6403  C CE   . LYS A 1 135 ? -34.722 -19.498 -5.662  1.00 0.00 ? 135 LYS A CE   3  
ATOM 6404  N NZ   . LYS A 1 135 ? -33.387 -19.717 -6.271  1.00 0.00 ? 135 LYS A NZ   3  
ATOM 6405  H H    . LYS A 1 135 ? -38.067 -18.379 -3.101  1.00 0.00 ? 135 LYS A H    3  
ATOM 6406  H HA   . LYS A 1 135 ? -39.755 -19.142 -5.422  1.00 0.00 ? 135 LYS A HA   3  
ATOM 6407  H HB2  . LYS A 1 135 ? -37.084 -20.177 -4.409  1.00 0.00 ? 135 LYS A HB2  3  
ATOM 6408  H HB3  . LYS A 1 135 ? -37.939 -20.794 -5.826  1.00 0.00 ? 135 LYS A HB3  3  
ATOM 6409  H HG2  . LYS A 1 135 ? -37.828 -18.574 -6.907  1.00 0.00 ? 135 LYS A HG2  3  
ATOM 6410  H HG3  . LYS A 1 135 ? -36.965 -17.913 -5.515  1.00 0.00 ? 135 LYS A HG3  3  
ATOM 6411  H HD2  . LYS A 1 135 ? -35.941 -20.142 -7.326  1.00 0.00 ? 135 LYS A HD2  3  
ATOM 6412  H HD3  . LYS A 1 135 ? -35.458 -18.437 -7.384  1.00 0.00 ? 135 LYS A HD3  3  
ATOM 6413  H HE2  . LYS A 1 135 ? -34.682 -18.634 -4.992  1.00 0.00 ? 135 LYS A HE2  3  
ATOM 6414  H HE3  . LYS A 1 135 ? -35.008 -20.372 -5.070  1.00 0.00 ? 135 LYS A HE3  3  
ATOM 6415  H HZ1  . LYS A 1 135 ? -33.093 -18.899 -6.799  1.00 0.00 ? 135 LYS A HZ1  3  
ATOM 6416  H HZ2  . LYS A 1 135 ? -32.691 -19.875 -5.558  1.00 0.00 ? 135 LYS A HZ2  3  
ATOM 6417  H HZ3  . LYS A 1 135 ? -33.384 -20.523 -6.893  1.00 0.00 ? 135 LYS A HZ3  3  
ATOM 6418  N N    . MET A 1 1   ? -47.896 -3.295  -46.244 1.00 0.00 ? 1   MET A N    4  
ATOM 6419  C CA   . MET A 1 1   ? -47.059 -4.450  -45.817 1.00 0.00 ? 1   MET A CA   4  
ATOM 6420  C C    . MET A 1 1   ? -47.119 -5.581  -46.852 1.00 0.00 ? 1   MET A C    4  
ATOM 6421  O O    . MET A 1 1   ? -48.156 -5.750  -47.501 1.00 0.00 ? 1   MET A O    4  
ATOM 6422  C CB   . MET A 1 1   ? -47.479 -5.007  -44.440 1.00 0.00 ? 1   MET A CB   4  
ATOM 6423  C CG   . MET A 1 1   ? -47.115 -4.088  -43.267 1.00 0.00 ? 1   MET A CG   4  
ATOM 6424  S SD   . MET A 1 1   ? -47.463 -4.826  -41.646 1.00 0.00 ? 1   MET A SD   4  
ATOM 6425  C CE   . MET A 1 1   ? -46.899 -3.480  -40.570 1.00 0.00 ? 1   MET A CE   4  
ATOM 6426  H H1   . MET A 1 1   ? -47.590 -2.950  -47.141 1.00 0.00 ? 1   MET A H1   4  
ATOM 6427  H H2   . MET A 1 1   ? -47.836 -2.540  -45.578 1.00 0.00 ? 1   MET A H2   4  
ATOM 6428  H H3   . MET A 1 1   ? -48.861 -3.576  -46.330 1.00 0.00 ? 1   MET A H3   4  
ATOM 6429  H HA   . MET A 1 1   ? -46.022 -4.120  -45.752 1.00 0.00 ? 1   MET A HA   4  
ATOM 6430  H HB2  . MET A 1 1   ? -48.554 -5.197  -44.428 1.00 0.00 ? 1   MET A HB2  4  
ATOM 6431  H HB3  . MET A 1 1   ? -46.974 -5.960  -44.274 1.00 0.00 ? 1   MET A HB3  4  
ATOM 6432  H HG2  . MET A 1 1   ? -46.050 -3.857  -43.317 1.00 0.00 ? 1   MET A HG2  4  
ATOM 6433  H HG3  . MET A 1 1   ? -47.675 -3.156  -43.350 1.00 0.00 ? 1   MET A HG3  4  
ATOM 6434  H HE1  . MET A 1 1   ? -47.474 -2.577  -40.776 1.00 0.00 ? 1   MET A HE1  4  
ATOM 6435  H HE2  . MET A 1 1   ? -47.039 -3.763  -39.526 1.00 0.00 ? 1   MET A HE2  4  
ATOM 6436  H HE3  . MET A 1 1   ? -45.841 -3.283  -40.748 1.00 0.00 ? 1   MET A HE3  4  
ATOM 6437  N N    . PRO A 1 2   ? -46.044 -6.384  -47.002 1.00 0.00 ? 2   PRO A N    4  
ATOM 6438  C CA   . PRO A 1 2   ? -46.065 -7.622  -47.789 1.00 0.00 ? 2   PRO A CA   4  
ATOM 6439  C C    . PRO A 1 2   ? -46.920 -8.713  -47.112 1.00 0.00 ? 2   PRO A C    4  
ATOM 6440  O O    . PRO A 1 2   ? -47.328 -8.579  -45.955 1.00 0.00 ? 2   PRO A O    4  
ATOM 6441  C CB   . PRO A 1 2   ? -44.593 -8.037  -47.906 1.00 0.00 ? 2   PRO A CB   4  
ATOM 6442  C CG   . PRO A 1 2   ? -43.991 -7.533  -46.596 1.00 0.00 ? 2   PRO A CG   4  
ATOM 6443  C CD   . PRO A 1 2   ? -44.740 -6.222  -46.362 1.00 0.00 ? 2   PRO A CD   4  
ATOM 6444  H HA   . PRO A 1 2   ? -46.464 -7.434  -48.787 1.00 0.00 ? 2   PRO A HA   4  
ATOM 6445  H HB2  . PRO A 1 2   ? -44.465 -9.115  -48.021 1.00 0.00 ? 2   PRO A HB2  4  
ATOM 6446  H HB3  . PRO A 1 2   ? -44.132 -7.512  -48.743 1.00 0.00 ? 2   PRO A HB3  4  
ATOM 6447  H HG2  . PRO A 1 2   ? -44.215 -8.236  -45.792 1.00 0.00 ? 2   PRO A HG2  4  
ATOM 6448  H HG3  . PRO A 1 2   ? -42.915 -7.375  -46.678 1.00 0.00 ? 2   PRO A HG3  4  
ATOM 6449  H HD2  . PRO A 1 2   ? -44.827 -6.037  -45.292 1.00 0.00 ? 2   PRO A HD2  4  
ATOM 6450  H HD3  . PRO A 1 2   ? -44.200 -5.405  -46.843 1.00 0.00 ? 2   PRO A HD3  4  
ATOM 6451  N N    . VAL A 1 3   ? -47.176 -9.819  -47.821 1.00 0.00 ? 3   VAL A N    4  
ATOM 6452  C CA   . VAL A 1 3   ? -47.917 -10.980 -47.285 1.00 0.00 ? 3   VAL A CA   4  
ATOM 6453  C C    . VAL A 1 3   ? -47.140 -11.613 -46.120 1.00 0.00 ? 3   VAL A C    4  
ATOM 6454  O O    . VAL A 1 3   ? -45.947 -11.898 -46.239 1.00 0.00 ? 3   VAL A O    4  
ATOM 6455  C CB   . VAL A 1 3   ? -48.221 -12.017 -48.389 1.00 0.00 ? 3   VAL A CB   4  
ATOM 6456  C CG1  . VAL A 1 3   ? -49.045 -13.197 -47.854 1.00 0.00 ? 3   VAL A CG1  4  
ATOM 6457  C CG2  . VAL A 1 3   ? -49.023 -11.389 -49.538 1.00 0.00 ? 3   VAL A CG2  4  
ATOM 6458  H H    . VAL A 1 3   ? -46.802 -9.882  -48.758 1.00 0.00 ? 3   VAL A H    4  
ATOM 6459  H HA   . VAL A 1 3   ? -48.872 -10.620 -46.900 1.00 0.00 ? 3   VAL A HA   4  
ATOM 6460  H HB   . VAL A 1 3   ? -47.283 -12.401 -48.792 1.00 0.00 ? 3   VAL A HB   4  
ATOM 6461  H HG11 . VAL A 1 3   ? -48.471 -13.763 -47.123 1.00 0.00 ? 3   VAL A HG11 4  
ATOM 6462  H HG12 . VAL A 1 3   ? -49.967 -12.835 -47.398 1.00 0.00 ? 3   VAL A HG12 4  
ATOM 6463  H HG13 . VAL A 1 3   ? -49.295 -13.873 -48.672 1.00 0.00 ? 3   VAL A HG13 4  
ATOM 6464  H HG21 . VAL A 1 3   ? -49.251 -12.147 -50.288 1.00 0.00 ? 3   VAL A HG21 4  
ATOM 6465  H HG22 . VAL A 1 3   ? -49.956 -10.971 -49.159 1.00 0.00 ? 3   VAL A HG22 4  
ATOM 6466  H HG23 . VAL A 1 3   ? -48.447 -10.601 -50.021 1.00 0.00 ? 3   VAL A HG23 4  
ATOM 6467  N N    . ARG A 1 4   ? -47.817 -11.843 -44.985 1.00 0.00 ? 4   ARG A N    4  
ATOM 6468  C CA   . ARG A 1 4   ? -47.215 -12.282 -43.703 1.00 0.00 ? 4   ARG A CA   4  
ATOM 6469  C C    . ARG A 1 4   ? -47.216 -13.812 -43.501 1.00 0.00 ? 4   ARG A C    4  
ATOM 6470  O O    . ARG A 1 4   ? -47.133 -14.291 -42.368 1.00 0.00 ? 4   ARG A O    4  
ATOM 6471  C CB   . ARG A 1 4   ? -47.866 -11.515 -42.531 1.00 0.00 ? 4   ARG A CB   4  
ATOM 6472  C CG   . ARG A 1 4   ? -47.702 -9.986  -42.646 1.00 0.00 ? 4   ARG A CG   4  
ATOM 6473  C CD   . ARG A 1 4   ? -48.307 -9.236  -41.449 1.00 0.00 ? 4   ARG A CD   4  
ATOM 6474  N NE   . ARG A 1 4   ? -47.594 -9.516  -40.184 1.00 0.00 ? 4   ARG A NE   4  
ATOM 6475  C CZ   . ARG A 1 4   ? -46.528 -8.896  -39.707 1.00 0.00 ? 4   ARG A CZ   4  
ATOM 6476  N NH1  . ARG A 1 4   ? -45.959 -7.903  -40.330 1.00 0.00 ? 4   ARG A NH1  4  
ATOM 6477  N NH2  . ARG A 1 4   ? -46.004 -9.270  -38.574 1.00 0.00 ? 4   ARG A NH2  4  
ATOM 6478  H H    . ARG A 1 4   ? -48.796 -11.585 -44.976 1.00 0.00 ? 4   ARG A H    4  
ATOM 6479  H HA   . ARG A 1 4   ? -46.159 -12.005 -43.712 1.00 0.00 ? 4   ARG A HA   4  
ATOM 6480  H HB2  . ARG A 1 4   ? -48.929 -11.760 -42.484 1.00 0.00 ? 4   ARG A HB2  4  
ATOM 6481  H HB3  . ARG A 1 4   ? -47.399 -11.839 -41.600 1.00 0.00 ? 4   ARG A HB3  4  
ATOM 6482  H HG2  . ARG A 1 4   ? -46.642 -9.740  -42.728 1.00 0.00 ? 4   ARG A HG2  4  
ATOM 6483  H HG3  . ARG A 1 4   ? -48.207 -9.636  -43.545 1.00 0.00 ? 4   ARG A HG3  4  
ATOM 6484  H HD2  . ARG A 1 4   ? -48.292 -8.165  -41.659 1.00 0.00 ? 4   ARG A HD2  4  
ATOM 6485  H HD3  . ARG A 1 4   ? -49.353 -9.529  -41.345 1.00 0.00 ? 4   ARG A HD3  4  
ATOM 6486  H HE   . ARG A 1 4   ? -47.966 -10.260 -39.613 1.00 0.00 ? 4   ARG A HE   4  
ATOM 6487  H HH11 . ARG A 1 4   ? -46.358 -7.572  -41.191 1.00 0.00 ? 4   ARG A HH11 4  
ATOM 6488  H HH12 . ARG A 1 4   ? -45.153 -7.446  -39.939 1.00 0.00 ? 4   ARG A HH12 4  
ATOM 6489  H HH21 . ARG A 1 4   ? -46.409 -10.032 -38.055 1.00 0.00 ? 4   ARG A HH21 4  
ATOM 6490  H HH22 . ARG A 1 4   ? -45.194 -8.798  -38.211 1.00 0.00 ? 4   ARG A HH22 4  
ATOM 6491  N N    . ARG A 1 5   ? -47.348 -14.578 -44.591 1.00 0.00 ? 5   ARG A N    4  
ATOM 6492  C CA   . ARG A 1 5   ? -47.447 -16.052 -44.628 1.00 0.00 ? 5   ARG A CA   4  
ATOM 6493  C C    . ARG A 1 5   ? -46.485 -16.659 -45.659 1.00 0.00 ? 5   ARG A C    4  
ATOM 6494  O O    . ARG A 1 5   ? -46.122 -16.006 -46.639 1.00 0.00 ? 5   ARG A O    4  
ATOM 6495  C CB   . ARG A 1 5   ? -48.896 -16.499 -44.927 1.00 0.00 ? 5   ARG A CB   4  
ATOM 6496  C CG   . ARG A 1 5   ? -49.929 -16.194 -43.824 1.00 0.00 ? 5   ARG A CG   4  
ATOM 6497  C CD   . ARG A 1 5   ? -50.599 -14.812 -43.901 1.00 0.00 ? 5   ARG A CD   4  
ATOM 6498  N NE   . ARG A 1 5   ? -51.413 -14.652 -45.124 1.00 0.00 ? 5   ARG A NE   4  
ATOM 6499  C CZ   . ARG A 1 5   ? -52.152 -13.606 -45.449 1.00 0.00 ? 5   ARG A CZ   4  
ATOM 6500  N NH1  . ARG A 1 5   ? -52.247 -12.556 -44.682 1.00 0.00 ? 5   ARG A NH1  4  
ATOM 6501  N NH2  . ARG A 1 5   ? -52.816 -13.592 -46.569 1.00 0.00 ? 5   ARG A NH2  4  
ATOM 6502  H H    . ARG A 1 5   ? -47.333 -14.095 -45.476 1.00 0.00 ? 5   ARG A H    4  
ATOM 6503  H HA   . ARG A 1 5   ? -47.158 -16.458 -43.656 1.00 0.00 ? 5   ARG A HA   4  
ATOM 6504  H HB2  . ARG A 1 5   ? -49.223 -16.074 -45.877 1.00 0.00 ? 5   ARG A HB2  4  
ATOM 6505  H HB3  . ARG A 1 5   ? -48.887 -17.584 -45.052 1.00 0.00 ? 5   ARG A HB3  4  
ATOM 6506  H HG2  . ARG A 1 5   ? -50.719 -16.945 -43.880 1.00 0.00 ? 5   ARG A HG2  4  
ATOM 6507  H HG3  . ARG A 1 5   ? -49.452 -16.302 -42.849 1.00 0.00 ? 5   ARG A HG3  4  
ATOM 6508  H HD2  . ARG A 1 5   ? -51.244 -14.704 -43.027 1.00 0.00 ? 5   ARG A HD2  4  
ATOM 6509  H HD3  . ARG A 1 5   ? -49.841 -14.032 -43.861 1.00 0.00 ? 5   ARG A HD3  4  
ATOM 6510  H HE   . ARG A 1 5   ? -51.428 -15.425 -45.770 1.00 0.00 ? 5   ARG A HE   4  
ATOM 6511  H HH11 . ARG A 1 5   ? -51.787 -12.558 -43.789 1.00 0.00 ? 5   ARG A HH11 4  
ATOM 6512  H HH12 . ARG A 1 5   ? -52.832 -11.781 -44.945 1.00 0.00 ? 5   ARG A HH12 4  
ATOM 6513  H HH21 . ARG A 1 5   ? -52.781 -14.384 -47.192 1.00 0.00 ? 5   ARG A HH21 4  
ATOM 6514  H HH22 . ARG A 1 5   ? -53.384 -12.798 -46.813 1.00 0.00 ? 5   ARG A HH22 4  
ATOM 6515  N N    . GLY A 1 6   ? -46.109 -17.924 -45.454 1.00 0.00 ? 6   GLY A N    4  
ATOM 6516  C CA   . GLY A 1 6   ? -45.239 -18.703 -46.351 1.00 0.00 ? 6   GLY A CA   4  
ATOM 6517  C C    . GLY A 1 6   ? -43.728 -18.550 -46.108 1.00 0.00 ? 6   GLY A C    4  
ATOM 6518  O O    . GLY A 1 6   ? -42.930 -19.133 -46.846 1.00 0.00 ? 6   GLY A O    4  
ATOM 6519  H H    . GLY A 1 6   ? -46.482 -18.396 -44.641 1.00 0.00 ? 6   GLY A H    4  
ATOM 6520  H HA2  . GLY A 1 6   ? -45.485 -19.760 -46.239 1.00 0.00 ? 6   GLY A HA2  4  
ATOM 6521  H HA3  . GLY A 1 6   ? -45.444 -18.424 -47.386 1.00 0.00 ? 6   GLY A HA3  4  
ATOM 6522  N N    . HIS A 1 7   ? -43.322 -17.791 -45.083 1.00 0.00 ? 7   HIS A N    4  
ATOM 6523  C CA   . HIS A 1 7   ? -41.926 -17.585 -44.663 1.00 0.00 ? 7   HIS A CA   4  
ATOM 6524  C C    . HIS A 1 7   ? -41.792 -17.480 -43.132 1.00 0.00 ? 7   HIS A C    4  
ATOM 6525  O O    . HIS A 1 7   ? -42.792 -17.429 -42.410 1.00 0.00 ? 7   HIS A O    4  
ATOM 6526  C CB   . HIS A 1 7   ? -41.358 -16.337 -45.365 1.00 0.00 ? 7   HIS A CB   4  
ATOM 6527  C CG   . HIS A 1 7   ? -41.910 -15.025 -44.856 1.00 0.00 ? 7   HIS A CG   4  
ATOM 6528  N ND1  . HIS A 1 7   ? -43.142 -14.465 -45.207 1.00 0.00 ? 7   HIS A ND1  4  
ATOM 6529  C CD2  . HIS A 1 7   ? -41.276 -14.182 -43.989 1.00 0.00 ? 7   HIS A CD2  4  
ATOM 6530  C CE1  . HIS A 1 7   ? -43.217 -13.295 -44.550 1.00 0.00 ? 7   HIS A CE1  4  
ATOM 6531  N NE2  . HIS A 1 7   ? -42.113 -13.102 -43.808 1.00 0.00 ? 7   HIS A NE2  4  
ATOM 6532  H H    . HIS A 1 7   ? -44.034 -17.345 -44.524 1.00 0.00 ? 7   HIS A H    4  
ATOM 6533  H HA   . HIS A 1 7   ? -41.331 -18.445 -44.975 1.00 0.00 ? 7   HIS A HA   4  
ATOM 6534  H HB2  . HIS A 1 7   ? -40.275 -16.326 -45.238 1.00 0.00 ? 7   HIS A HB2  4  
ATOM 6535  H HB3  . HIS A 1 7   ? -41.552 -16.407 -46.437 1.00 0.00 ? 7   HIS A HB3  4  
ATOM 6536  H HD2  . HIS A 1 7   ? -40.299 -14.334 -43.546 1.00 0.00 ? 7   HIS A HD2  4  
ATOM 6537  H HE1  . HIS A 1 7   ? -44.044 -12.598 -44.620 1.00 0.00 ? 7   HIS A HE1  4  
ATOM 6538  H HE2  . HIS A 1 7   ? -41.931 -12.287 -43.231 1.00 0.00 ? 7   HIS A HE2  4  
ATOM 6539  N N    . VAL A 1 8   ? -40.550 -17.430 -42.638 1.00 0.00 ? 8   VAL A N    4  
ATOM 6540  C CA   . VAL A 1 8   ? -40.198 -17.239 -41.218 1.00 0.00 ? 8   VAL A CA   4  
ATOM 6541  C C    . VAL A 1 8   ? -39.156 -16.122 -41.055 1.00 0.00 ? 8   VAL A C    4  
ATOM 6542  O O    . VAL A 1 8   ? -38.354 -15.872 -41.961 1.00 0.00 ? 8   VAL A O    4  
ATOM 6543  C CB   . VAL A 1 8   ? -39.756 -18.583 -40.588 1.00 0.00 ? 8   VAL A CB   4  
ATOM 6544  C CG1  . VAL A 1 8   ? -38.412 -19.100 -41.118 1.00 0.00 ? 8   VAL A CG1  4  
ATOM 6545  C CG2  . VAL A 1 8   ? -39.711 -18.533 -39.057 1.00 0.00 ? 8   VAL A CG2  4  
ATOM 6546  H H    . VAL A 1 8   ? -39.782 -17.461 -43.295 1.00 0.00 ? 8   VAL A H    4  
ATOM 6547  H HA   . VAL A 1 8   ? -41.092 -16.915 -40.683 1.00 0.00 ? 8   VAL A HA   4  
ATOM 6548  H HB   . VAL A 1 8   ? -40.514 -19.324 -40.850 1.00 0.00 ? 8   VAL A HB   4  
ATOM 6549  H HG11 . VAL A 1 8   ? -38.212 -20.086 -40.701 1.00 0.00 ? 8   VAL A HG11 4  
ATOM 6550  H HG12 . VAL A 1 8   ? -38.446 -19.184 -42.204 1.00 0.00 ? 8   VAL A HG12 4  
ATOM 6551  H HG13 . VAL A 1 8   ? -37.604 -18.426 -40.833 1.00 0.00 ? 8   VAL A HG13 4  
ATOM 6552  H HG21 . VAL A 1 8   ? -38.899 -17.893 -38.714 1.00 0.00 ? 8   VAL A HG21 4  
ATOM 6553  H HG22 . VAL A 1 8   ? -40.659 -18.164 -38.669 1.00 0.00 ? 8   VAL A HG22 4  
ATOM 6554  H HG23 . VAL A 1 8   ? -39.545 -19.538 -38.668 1.00 0.00 ? 8   VAL A HG23 4  
ATOM 6555  N N    . ALA A 1 9   ? -39.161 -15.440 -39.906 1.00 0.00 ? 9   ALA A N    4  
ATOM 6556  C CA   . ALA A 1 9   ? -38.121 -14.479 -39.522 1.00 0.00 ? 9   ALA A CA   4  
ATOM 6557  C C    . ALA A 1 9   ? -36.745 -15.169 -39.331 1.00 0.00 ? 9   ALA A C    4  
ATOM 6558  O O    . ALA A 1 9   ? -36.707 -16.381 -39.089 1.00 0.00 ? 9   ALA A O    4  
ATOM 6559  C CB   . ALA A 1 9   ? -38.591 -13.784 -38.234 1.00 0.00 ? 9   ALA A CB   4  
ATOM 6560  H H    . ALA A 1 9   ? -39.850 -15.682 -39.210 1.00 0.00 ? 9   ALA A H    4  
ATOM 6561  H HA   . ALA A 1 9   ? -38.030 -13.730 -40.312 1.00 0.00 ? 9   ALA A HA   4  
ATOM 6562  H HB1  . ALA A 1 9   ? -37.860 -13.044 -37.909 1.00 0.00 ? 9   ALA A HB1  4  
ATOM 6563  H HB2  . ALA A 1 9   ? -39.542 -13.279 -38.411 1.00 0.00 ? 9   ALA A HB2  4  
ATOM 6564  H HB3  . ALA A 1 9   ? -38.718 -14.520 -37.438 1.00 0.00 ? 9   ALA A HB3  4  
ATOM 6565  N N    . PRO A 1 10  ? -35.611 -14.435 -39.379 1.00 0.00 ? 10  PRO A N    4  
ATOM 6566  C CA   . PRO A 1 10  ? -34.287 -14.986 -39.074 1.00 0.00 ? 10  PRO A CA   4  
ATOM 6567  C C    . PRO A 1 10  ? -34.239 -15.560 -37.651 1.00 0.00 ? 10  PRO A C    4  
ATOM 6568  O O    . PRO A 1 10  ? -34.225 -14.837 -36.653 1.00 0.00 ? 10  PRO A O    4  
ATOM 6569  C CB   . PRO A 1 10  ? -33.287 -13.844 -39.292 1.00 0.00 ? 10  PRO A CB   4  
ATOM 6570  C CG   . PRO A 1 10  ? -34.142 -12.577 -39.232 1.00 0.00 ? 10  PRO A CG   4  
ATOM 6571  C CD   . PRO A 1 10  ? -35.495 -13.037 -39.766 1.00 0.00 ? 10  PRO A CD   4  
ATOM 6572  H HA   . PRO A 1 10  ? -34.057 -15.785 -39.781 1.00 0.00 ? 10  PRO A HA   4  
ATOM 6573  H HB2  . PRO A 1 10  ? -32.497 -13.833 -38.540 1.00 0.00 ? 10  PRO A HB2  4  
ATOM 6574  H HB3  . PRO A 1 10  ? -32.846 -13.946 -40.282 1.00 0.00 ? 10  PRO A HB3  4  
ATOM 6575  H HG2  . PRO A 1 10  ? -34.262 -12.257 -38.198 1.00 0.00 ? 10  PRO A HG2  4  
ATOM 6576  H HG3  . PRO A 1 10  ? -33.721 -11.773 -39.835 1.00 0.00 ? 10  PRO A HG3  4  
ATOM 6577  H HD2  . PRO A 1 10  ? -36.287 -12.419 -39.342 1.00 0.00 ? 10  PRO A HD2  4  
ATOM 6578  H HD3  . PRO A 1 10  ? -35.506 -12.961 -40.854 1.00 0.00 ? 10  PRO A HD3  4  
ATOM 6579  N N    . GLN A 1 11  ? -34.198 -16.888 -37.557 1.00 0.00 ? 11  GLN A N    4  
ATOM 6580  C CA   . GLN A 1 11  ? -34.388 -17.624 -36.306 1.00 0.00 ? 11  GLN A CA   4  
ATOM 6581  C C    . GLN A 1 11  ? -33.297 -17.363 -35.256 1.00 0.00 ? 11  GLN A C    4  
ATOM 6582  O O    . GLN A 1 11  ? -33.572 -17.448 -34.061 1.00 0.00 ? 11  GLN A O    4  
ATOM 6583  C CB   . GLN A 1 11  ? -34.584 -19.124 -36.606 1.00 0.00 ? 11  GLN A CB   4  
ATOM 6584  C CG   . GLN A 1 11  ? -33.322 -19.911 -37.009 1.00 0.00 ? 11  GLN A CG   4  
ATOM 6585  C CD   . GLN A 1 11  ? -32.648 -19.431 -38.295 1.00 0.00 ? 11  GLN A CD   4  
ATOM 6586  O OE1  . GLN A 1 11  ? -33.282 -19.085 -39.283 1.00 0.00 ? 11  GLN A OE1  4  
ATOM 6587  N NE2  . GLN A 1 11  ? -31.335 -19.355 -38.325 1.00 0.00 ? 11  GLN A NE2  4  
ATOM 6588  H H    . GLN A 1 11  ? -34.203 -17.416 -38.421 1.00 0.00 ? 11  GLN A H    4  
ATOM 6589  H HA   . GLN A 1 11  ? -35.326 -17.276 -35.874 1.00 0.00 ? 11  GLN A HA   4  
ATOM 6590  H HB2  . GLN A 1 11  ? -34.987 -19.592 -35.706 1.00 0.00 ? 11  GLN A HB2  4  
ATOM 6591  H HB3  . GLN A 1 11  ? -35.339 -19.234 -37.387 1.00 0.00 ? 11  GLN A HB3  4  
ATOM 6592  H HG2  . GLN A 1 11  ? -32.607 -19.884 -36.187 1.00 0.00 ? 11  GLN A HG2  4  
ATOM 6593  H HG3  . GLN A 1 11  ? -33.609 -20.952 -37.158 1.00 0.00 ? 11  GLN A HG3  4  
ATOM 6594  H HE21 . GLN A 1 11  ? -30.788 -19.580 -37.499 1.00 0.00 ? 11  GLN A HE21 4  
ATOM 6595  H HE22 . GLN A 1 11  ? -30.891 -19.056 -39.180 1.00 0.00 ? 11  GLN A HE22 4  
ATOM 6596  N N    . ASN A 1 12  ? -32.080 -16.997 -35.677 1.00 0.00 ? 12  ASN A N    4  
ATOM 6597  C CA   . ASN A 1 12  ? -30.947 -16.794 -34.768 1.00 0.00 ? 12  ASN A CA   4  
ATOM 6598  C C    . ASN A 1 12  ? -31.160 -15.534 -33.911 1.00 0.00 ? 12  ASN A C    4  
ATOM 6599  O O    . ASN A 1 12  ? -31.066 -15.581 -32.686 1.00 0.00 ? 12  ASN A O    4  
ATOM 6600  C CB   . ASN A 1 12  ? -29.641 -16.717 -35.585 1.00 0.00 ? 12  ASN A CB   4  
ATOM 6601  C CG   . ASN A 1 12  ? -29.088 -18.071 -36.011 1.00 0.00 ? 12  ASN A CG   4  
ATOM 6602  O OD1  . ASN A 1 12  ? -29.714 -19.116 -35.888 1.00 0.00 ? 12  ASN A OD1  4  
ATOM 6603  N ND2  . ASN A 1 12  ? -27.894 -18.096 -36.556 1.00 0.00 ? 12  ASN A ND2  4  
ATOM 6604  H H    . ASN A 1 12  ? -31.936 -16.865 -36.669 1.00 0.00 ? 12  ASN A H    4  
ATOM 6605  H HA   . ASN A 1 12  ? -30.881 -17.638 -34.075 1.00 0.00 ? 12  ASN A HA   4  
ATOM 6606  H HB2  . ASN A 1 12  ? -29.778 -16.091 -36.468 1.00 0.00 ? 12  ASN A HB2  4  
ATOM 6607  H HB3  . ASN A 1 12  ? -28.878 -16.245 -34.963 1.00 0.00 ? 12  ASN A HB3  4  
ATOM 6608  H HD21 . ASN A 1 12  ? -27.366 -17.244 -36.671 1.00 0.00 ? 12  ASN A HD21 4  
ATOM 6609  H HD22 . ASN A 1 12  ? -27.515 -18.987 -36.838 1.00 0.00 ? 12  ASN A HD22 4  
ATOM 6610  N N    . THR A 1 13  ? -31.497 -14.410 -34.554 1.00 0.00 ? 13  THR A N    4  
ATOM 6611  C CA   . THR A 1 13  ? -31.764 -13.121 -33.885 1.00 0.00 ? 13  THR A CA   4  
ATOM 6612  C C    . THR A 1 13  ? -33.150 -13.081 -33.231 1.00 0.00 ? 13  THR A C    4  
ATOM 6613  O O    . THR A 1 13  ? -33.334 -12.510 -32.151 1.00 0.00 ? 13  THR A O    4  
ATOM 6614  C CB   . THR A 1 13  ? -31.586 -11.977 -34.893 1.00 0.00 ? 13  THR A CB   4  
ATOM 6615  O OG1  . THR A 1 13  ? -31.366 -10.745 -34.240 1.00 0.00 ? 13  THR A OG1  4  
ATOM 6616  C CG2  . THR A 1 13  ? -32.779 -11.812 -35.826 1.00 0.00 ? 13  THR A CG2  4  
ATOM 6617  H H    . THR A 1 13  ? -31.572 -14.452 -35.560 1.00 0.00 ? 13  THR A H    4  
ATOM 6618  H HA   . THR A 1 13  ? -31.020 -12.985 -33.104 1.00 0.00 ? 13  THR A HA   4  
ATOM 6619  H HB   . THR A 1 13  ? -30.725 -12.219 -35.512 1.00 0.00 ? 13  THR A HB   4  
ATOM 6620  H HG1  . THR A 1 13  ? -30.454 -10.746 -33.897 1.00 0.00 ? 13  THR A HG1  4  
ATOM 6621  H HG21 . THR A 1 13  ? -32.537 -11.101 -36.613 1.00 0.00 ? 13  THR A HG21 4  
ATOM 6622  H HG22 . THR A 1 13  ? -33.004 -12.779 -36.267 1.00 0.00 ? 13  THR A HG22 4  
ATOM 6623  H HG23 . THR A 1 13  ? -33.651 -11.466 -35.271 1.00 0.00 ? 13  THR A HG23 4  
ATOM 6624  N N    . PHE A 1 14  ? -34.128 -13.758 -33.843 1.00 0.00 ? 14  PHE A N    4  
ATOM 6625  C CA   . PHE A 1 14  ? -35.452 -13.949 -33.261 1.00 0.00 ? 14  PHE A CA   4  
ATOM 6626  C C    . PHE A 1 14  ? -35.341 -14.697 -31.930 1.00 0.00 ? 14  PHE A C    4  
ATOM 6627  O O    . PHE A 1 14  ? -35.958 -14.294 -30.946 1.00 0.00 ? 14  PHE A O    4  
ATOM 6628  C CB   . PHE A 1 14  ? -36.305 -14.717 -34.270 1.00 0.00 ? 14  PHE A CB   4  
ATOM 6629  C CG   . PHE A 1 14  ? -37.751 -14.907 -33.858 1.00 0.00 ? 14  PHE A CG   4  
ATOM 6630  C CD1  . PHE A 1 14  ? -38.703 -13.910 -34.144 1.00 0.00 ? 14  PHE A CD1  4  
ATOM 6631  C CD2  . PHE A 1 14  ? -38.146 -16.079 -33.182 1.00 0.00 ? 14  PHE A CD2  4  
ATOM 6632  C CE1  . PHE A 1 14  ? -40.045 -14.082 -33.756 1.00 0.00 ? 14  PHE A CE1  4  
ATOM 6633  C CE2  . PHE A 1 14  ? -39.487 -16.249 -32.792 1.00 0.00 ? 14  PHE A CE2  4  
ATOM 6634  C CZ   . PHE A 1 14  ? -40.436 -15.251 -33.079 1.00 0.00 ? 14  PHE A CZ   4  
ATOM 6635  H H    . PHE A 1 14  ? -33.950 -14.167 -34.757 1.00 0.00 ? 14  PHE A H    4  
ATOM 6636  H HA   . PHE A 1 14  ? -35.911 -12.977 -33.074 1.00 0.00 ? 14  PHE A HA   4  
ATOM 6637  H HB2  . PHE A 1 14  ? -36.270 -14.175 -35.213 1.00 0.00 ? 14  PHE A HB2  4  
ATOM 6638  H HB3  . PHE A 1 14  ? -35.849 -15.690 -34.441 1.00 0.00 ? 14  PHE A HB3  4  
ATOM 6639  H HD1  . PHE A 1 14  ? -38.405 -13.009 -34.662 1.00 0.00 ? 14  PHE A HD1  4  
ATOM 6640  H HD2  . PHE A 1 14  ? -37.421 -16.849 -32.957 1.00 0.00 ? 14  PHE A HD2  4  
ATOM 6641  H HE1  . PHE A 1 14  ? -40.775 -13.315 -33.976 1.00 0.00 ? 14  PHE A HE1  4  
ATOM 6642  H HE2  . PHE A 1 14  ? -39.790 -17.148 -32.271 1.00 0.00 ? 14  PHE A HE2  4  
ATOM 6643  H HZ   . PHE A 1 14  ? -41.468 -15.383 -32.779 1.00 0.00 ? 14  PHE A HZ   4  
ATOM 6644  N N    . LEU A 1 15  ? -34.472 -15.713 -31.869 1.00 0.00 ? 15  LEU A N    4  
ATOM 6645  C CA   . LEU A 1 15  ? -34.154 -16.410 -30.619 1.00 0.00 ? 15  LEU A CA   4  
ATOM 6646  C C    . LEU A 1 15  ? -33.321 -15.538 -29.669 1.00 0.00 ? 15  LEU A C    4  
ATOM 6647  O O    . LEU A 1 15  ? -33.662 -15.454 -28.500 1.00 0.00 ? 15  LEU A O    4  
ATOM 6648  C CB   . LEU A 1 15  ? -33.487 -17.766 -30.903 1.00 0.00 ? 15  LEU A CB   4  
ATOM 6649  C CG   . LEU A 1 15  ? -33.024 -18.498 -29.628 1.00 0.00 ? 15  LEU A CG   4  
ATOM 6650  C CD1  . LEU A 1 15  ? -34.150 -18.746 -28.616 1.00 0.00 ? 15  LEU A CD1  4  
ATOM 6651  C CD2  . LEU A 1 15  ? -32.404 -19.844 -29.996 1.00 0.00 ? 15  LEU A CD2  4  
ATOM 6652  H H    . LEU A 1 15  ? -33.995 -15.978 -32.728 1.00 0.00 ? 15  LEU A H    4  
ATOM 6653  H HA   . LEU A 1 15  ? -35.098 -16.611 -30.112 1.00 0.00 ? 15  LEU A HA   4  
ATOM 6654  H HB2  . LEU A 1 15  ? -34.193 -18.398 -31.444 1.00 0.00 ? 15  LEU A HB2  4  
ATOM 6655  H HB3  . LEU A 1 15  ? -32.614 -17.605 -31.536 1.00 0.00 ? 15  LEU A HB3  4  
ATOM 6656  H HG   . LEU A 1 15  ? -32.255 -17.891 -29.152 1.00 0.00 ? 15  LEU A HG   4  
ATOM 6657  H HD11 . LEU A 1 15  ? -34.583 -17.804 -28.289 1.00 0.00 ? 15  LEU A HD11 4  
ATOM 6658  H HD12 . LEU A 1 15  ? -34.937 -19.353 -29.063 1.00 0.00 ? 15  LEU A HD12 4  
ATOM 6659  H HD13 . LEU A 1 15  ? -33.749 -19.240 -27.731 1.00 0.00 ? 15  LEU A HD13 4  
ATOM 6660  H HD21 . LEU A 1 15  ? -32.029 -20.335 -29.098 1.00 0.00 ? 15  LEU A HD21 4  
ATOM 6661  H HD22 . LEU A 1 15  ? -33.150 -20.483 -30.471 1.00 0.00 ? 15  LEU A HD22 4  
ATOM 6662  H HD23 . LEU A 1 15  ? -31.573 -19.690 -30.685 1.00 0.00 ? 15  LEU A HD23 4  
ATOM 6663  N N    . ASP A 1 16  ? -32.283 -14.842 -30.134 1.00 0.00 ? 16  ASP A N    4  
ATOM 6664  C CA   . ASP A 1 16  ? -31.499 -13.866 -29.351 1.00 0.00 ? 16  ASP A CA   4  
ATOM 6665  C C    . ASP A 1 16  ? -32.375 -12.866 -28.572 1.00 0.00 ? 16  ASP A C    4  
ATOM 6666  O O    . ASP A 1 16  ? -32.083 -12.502 -27.431 1.00 0.00 ? 16  ASP A O    4  
ATOM 6667  C CB   . ASP A 1 16  ? -30.547 -13.118 -30.285 1.00 0.00 ? 16  ASP A CB   4  
ATOM 6668  C CG   . ASP A 1 16  ? -29.586 -12.219 -29.502 1.00 0.00 ? 16  ASP A CG   4  
ATOM 6669  O OD1  . ASP A 1 16  ? -28.510 -12.698 -29.070 1.00 0.00 ? 16  ASP A OD1  4  
ATOM 6670  O OD2  . ASP A 1 16  ? -29.924 -11.027 -29.328 1.00 0.00 ? 16  ASP A OD2  4  
ATOM 6671  H H    . ASP A 1 16  ? -31.992 -15.026 -31.087 1.00 0.00 ? 16  ASP A H    4  
ATOM 6672  H HA   . ASP A 1 16  ? -30.890 -14.407 -28.629 1.00 0.00 ? 16  ASP A HA   4  
ATOM 6673  H HB2  . ASP A 1 16  ? -29.990 -13.839 -30.878 1.00 0.00 ? 16  ASP A HB2  4  
ATOM 6674  H HB3  . ASP A 1 16  ? -31.123 -12.497 -30.966 1.00 0.00 ? 16  ASP A HB3  4  
ATOM 6675  N N    . THR A 1 17  ? -33.460 -12.407 -29.193 1.00 0.00 ? 17  THR A N    4  
ATOM 6676  C CA   . THR A 1 17  ? -34.480 -11.577 -28.523 1.00 0.00 ? 17  THR A CA   4  
ATOM 6677  C C    . THR A 1 17  ? -35.130 -12.299 -27.332 1.00 0.00 ? 17  THR A C    4  
ATOM 6678  O O    . THR A 1 17  ? -35.261 -11.731 -26.246 1.00 0.00 ? 17  THR A O    4  
ATOM 6679  C CB   . THR A 1 17  ? -35.545 -11.098 -29.525 1.00 0.00 ? 17  THR A CB   4  
ATOM 6680  O OG1  . THR A 1 17  ? -34.937 -10.375 -30.578 1.00 0.00 ? 17  THR A OG1  4  
ATOM 6681  C CG2  . THR A 1 17  ? -36.573 -10.162 -28.885 1.00 0.00 ? 17  THR A CG2  4  
ATOM 6682  H H    . THR A 1 17  ? -33.618 -12.757 -30.136 1.00 0.00 ? 17  THR A H    4  
ATOM 6683  H HA   . THR A 1 17  ? -33.984 -10.699 -28.115 1.00 0.00 ? 17  THR A HA   4  
ATOM 6684  H HB   . THR A 1 17  ? -36.071 -11.957 -29.940 1.00 0.00 ? 17  THR A HB   4  
ATOM 6685  H HG1  . THR A 1 17  ? -34.404 -11.003 -31.098 1.00 0.00 ? 17  THR A HG1  4  
ATOM 6686  H HG21 . THR A 1 17  ? -37.250 -9.784  -29.652 1.00 0.00 ? 17  THR A HG21 4  
ATOM 6687  H HG22 . THR A 1 17  ? -37.161 -10.705 -28.143 1.00 0.00 ? 17  THR A HG22 4  
ATOM 6688  H HG23 . THR A 1 17  ? -36.067 -9.324  -28.404 1.00 0.00 ? 17  THR A HG23 4  
ATOM 6689  N N    . ILE A 1 18  ? -35.476 -13.579 -27.492 1.00 0.00 ? 18  ILE A N    4  
ATOM 6690  C CA   . ILE A 1 18  ? -36.014 -14.425 -26.414 1.00 0.00 ? 18  ILE A CA   4  
ATOM 6691  C C    . ILE A 1 18  ? -34.942 -14.713 -25.357 1.00 0.00 ? 18  ILE A C    4  
ATOM 6692  O O    . ILE A 1 18  ? -35.254 -14.714 -24.165 1.00 0.00 ? 18  ILE A O    4  
ATOM 6693  C CB   . ILE A 1 18  ? -36.579 -15.750 -26.970 1.00 0.00 ? 18  ILE A CB   4  
ATOM 6694  C CG1  . ILE A 1 18  ? -37.575 -15.587 -28.131 1.00 0.00 ? 18  ILE A CG1  4  
ATOM 6695  C CG2  . ILE A 1 18  ? -37.217 -16.610 -25.867 1.00 0.00 ? 18  ILE A CG2  4  
ATOM 6696  C CD1  . ILE A 1 18  ? -38.867 -14.838 -27.778 1.00 0.00 ? 18  ILE A CD1  4  
ATOM 6697  H H    . ILE A 1 18  ? -35.221 -14.032 -28.361 1.00 0.00 ? 18  ILE A H    4  
ATOM 6698  H HA   . ILE A 1 18  ? -36.818 -13.879 -25.926 1.00 0.00 ? 18  ILE A HA   4  
ATOM 6699  H HB   . ILE A 1 18  ? -35.740 -16.309 -27.366 1.00 0.00 ? 18  ILE A HB   4  
ATOM 6700  H HG12 . ILE A 1 18  ? -37.092 -15.050 -28.938 1.00 0.00 ? 18  ILE A HG12 4  
ATOM 6701  H HG13 . ILE A 1 18  ? -37.803 -16.585 -28.516 1.00 0.00 ? 18  ILE A HG13 4  
ATOM 6702  H HG21 . ILE A 1 18  ? -37.954 -16.033 -25.308 1.00 0.00 ? 18  ILE A HG21 4  
ATOM 6703  H HG22 . ILE A 1 18  ? -37.697 -17.486 -26.304 1.00 0.00 ? 18  ILE A HG22 4  
ATOM 6704  H HG23 . ILE A 1 18  ? -36.448 -16.961 -25.183 1.00 0.00 ? 18  ILE A HG23 4  
ATOM 6705  H HD11 . ILE A 1 18  ? -38.631 -13.846 -27.389 1.00 0.00 ? 18  ILE A HD11 4  
ATOM 6706  H HD12 . ILE A 1 18  ? -39.475 -14.727 -28.677 1.00 0.00 ? 18  ILE A HD12 4  
ATOM 6707  H HD13 . ILE A 1 18  ? -39.440 -15.392 -27.035 1.00 0.00 ? 18  ILE A HD13 4  
ATOM 6708  N N    . ILE A 1 19  ? -33.672 -14.867 -25.762 1.00 0.00 ? 19  ILE A N    4  
ATOM 6709  C CA   . ILE A 1 19  ? -32.556 -14.964 -24.824 1.00 0.00 ? 19  ILE A CA   4  
ATOM 6710  C C    . ILE A 1 19  ? -32.572 -13.741 -23.922 1.00 0.00 ? 19  ILE A C    4  
ATOM 6711  O O    . ILE A 1 19  ? -32.682 -13.903 -22.718 1.00 0.00 ? 19  ILE A O    4  
ATOM 6712  C CB   . ILE A 1 19  ? -31.172 -15.090 -25.500 1.00 0.00 ? 19  ILE A CB   4  
ATOM 6713  C CG1  . ILE A 1 19  ? -31.025 -16.282 -26.465 1.00 0.00 ? 19  ILE A CG1  4  
ATOM 6714  C CG2  . ILE A 1 19  ? -30.081 -15.173 -24.419 1.00 0.00 ? 19  ILE A CG2  4  
ATOM 6715  C CD1  . ILE A 1 19  ? -31.500 -17.619 -25.903 1.00 0.00 ? 19  ILE A CD1  4  
ATOM 6716  H H    . ILE A 1 19  ? -33.474 -14.899 -26.754 1.00 0.00 ? 19  ILE A H    4  
ATOM 6717  H HA   . ILE A 1 19  ? -32.739 -15.842 -24.209 1.00 0.00 ? 19  ILE A HA   4  
ATOM 6718  H HB   . ILE A 1 19  ? -30.984 -14.182 -26.066 1.00 0.00 ? 19  ILE A HB   4  
ATOM 6719  H HG12 . ILE A 1 19  ? -31.593 -16.086 -27.366 1.00 0.00 ? 19  ILE A HG12 4  
ATOM 6720  H HG13 . ILE A 1 19  ? -29.981 -16.376 -26.764 1.00 0.00 ? 19  ILE A HG13 4  
ATOM 6721  H HG21 . ILE A 1 19  ? -30.027 -14.238 -23.859 1.00 0.00 ? 19  ILE A HG21 4  
ATOM 6722  H HG22 . ILE A 1 19  ? -30.300 -15.985 -23.726 1.00 0.00 ? 19  ILE A HG22 4  
ATOM 6723  H HG23 . ILE A 1 19  ? -29.110 -15.341 -24.883 1.00 0.00 ? 19  ILE A HG23 4  
ATOM 6724  H HD11 . ILE A 1 19  ? -31.020 -17.811 -24.941 1.00 0.00 ? 19  ILE A HD11 4  
ATOM 6725  H HD12 . ILE A 1 19  ? -32.581 -17.593 -25.779 1.00 0.00 ? 19  ILE A HD12 4  
ATOM 6726  H HD13 . ILE A 1 19  ? -31.250 -18.402 -26.619 1.00 0.00 ? 19  ILE A HD13 4  
ATOM 6727  N N    . ARG A 1 20  ? -32.570 -12.524 -24.484 1.00 0.00 ? 20  ARG A N    4  
ATOM 6728  C CA   . ARG A 1 20  ? -32.667 -11.271 -23.712 1.00 0.00 ? 20  ARG A CA   4  
ATOM 6729  C C    . ARG A 1 20  ? -33.953 -11.171 -22.900 1.00 0.00 ? 20  ARG A C    4  
ATOM 6730  O O    . ARG A 1 20  ? -33.945 -10.556 -21.837 1.00 0.00 ? 20  ARG A O    4  
ATOM 6731  C CB   . ARG A 1 20  ? -32.519 -10.072 -24.646 1.00 0.00 ? 20  ARG A CB   4  
ATOM 6732  C CG   . ARG A 1 20  ? -31.039 -9.857  -24.982 1.00 0.00 ? 20  ARG A CG   4  
ATOM 6733  C CD   . ARG A 1 20  ? -30.895 -8.776  -26.048 1.00 0.00 ? 20  ARG A CD   4  
ATOM 6734  N NE   . ARG A 1 20  ? -31.334 -9.290  -27.357 1.00 0.00 ? 20  ARG A NE   4  
ATOM 6735  C CZ   . ARG A 1 20  ? -31.954 -8.653  -28.328 1.00 0.00 ? 20  ARG A CZ   4  
ATOM 6736  N NH1  . ARG A 1 20  ? -32.498 -7.478  -28.179 1.00 0.00 ? 20  ARG A NH1  4  
ATOM 6737  N NH2  . ARG A 1 20  ? -32.030 -9.225  -29.488 1.00 0.00 ? 20  ARG A NH2  4  
ATOM 6738  H H    . ARG A 1 20  ? -32.531 -12.474 -25.499 1.00 0.00 ? 20  ARG A H    4  
ATOM 6739  H HA   . ARG A 1 20  ? -31.858 -11.232 -22.983 1.00 0.00 ? 20  ARG A HA   4  
ATOM 6740  H HB2  . ARG A 1 20  ? -33.105 -10.235 -25.552 1.00 0.00 ? 20  ARG A HB2  4  
ATOM 6741  H HB3  . ARG A 1 20  ? -32.891 -9.172  -24.151 1.00 0.00 ? 20  ARG A HB3  4  
ATOM 6742  H HG2  . ARG A 1 20  ? -30.511 -9.539  -24.081 1.00 0.00 ? 20  ARG A HG2  4  
ATOM 6743  H HG3  . ARG A 1 20  ? -30.588 -10.782 -25.344 1.00 0.00 ? 20  ARG A HG3  4  
ATOM 6744  H HD2  . ARG A 1 20  ? -31.468 -7.901  -25.743 1.00 0.00 ? 20  ARG A HD2  4  
ATOM 6745  H HD3  . ARG A 1 20  ? -29.842 -8.502  -26.110 1.00 0.00 ? 20  ARG A HD3  4  
ATOM 6746  H HE   . ARG A 1 20  ? -31.108 -10.257 -27.556 1.00 0.00 ? 20  ARG A HE   4  
ATOM 6747  H HH11 . ARG A 1 20  ? -32.444 -7.019  -27.286 1.00 0.00 ? 20  ARG A HH11 4  
ATOM 6748  H HH12 . ARG A 1 20  ? -32.955 -7.027  -28.954 1.00 0.00 ? 20  ARG A HH12 4  
ATOM 6749  H HH21 . ARG A 1 20  ? -31.413 -10.023 -29.636 1.00 0.00 ? 20  ARG A HH21 4  
ATOM 6750  H HH22 . ARG A 1 20  ? -32.543 -8.815  -30.248 1.00 0.00 ? 20  ARG A HH22 4  
ATOM 6751  N N    . LYS A 1 21  ? -35.028 -11.825 -23.340 1.00 0.00 ? 21  LYS A N    4  
ATOM 6752  C CA   . LYS A 1 21  ? -36.275 -11.938 -22.553 1.00 0.00 ? 21  LYS A CA   4  
ATOM 6753  C C    . LYS A 1 21  ? -36.090 -12.747 -21.258 1.00 0.00 ? 21  LYS A C    4  
ATOM 6754  O O    . LYS A 1 21  ? -36.626 -12.340 -20.226 1.00 0.00 ? 21  LYS A O    4  
ATOM 6755  C CB   . LYS A 1 21  ? -37.416 -12.527 -23.403 1.00 0.00 ? 21  LYS A CB   4  
ATOM 6756  C CG   . LYS A 1 21  ? -38.811 -12.056 -22.956 1.00 0.00 ? 21  LYS A CG   4  
ATOM 6757  C CD   . LYS A 1 21  ? -39.114 -10.614 -23.394 1.00 0.00 ? 21  LYS A CD   4  
ATOM 6758  C CE   . LYS A 1 21  ? -40.454 -10.148 -22.811 1.00 0.00 ? 21  LYS A CE   4  
ATOM 6759  N NZ   . LYS A 1 21  ? -40.727 -8.727  -23.142 1.00 0.00 ? 21  LYS A NZ   4  
ATOM 6760  H H    . LYS A 1 21  ? -34.936 -12.250 -24.261 1.00 0.00 ? 21  LYS A H    4  
ATOM 6761  H HA   . LYS A 1 21  ? -36.550 -10.931 -22.242 1.00 0.00 ? 21  LYS A HA   4  
ATOM 6762  H HB2  . LYS A 1 21  ? -37.282 -12.256 -24.450 1.00 0.00 ? 21  LYS A HB2  4  
ATOM 6763  H HB3  . LYS A 1 21  ? -37.384 -13.614 -23.309 1.00 0.00 ? 21  LYS A HB3  4  
ATOM 6764  H HG2  . LYS A 1 21  ? -39.555 -12.715 -23.405 1.00 0.00 ? 21  LYS A HG2  4  
ATOM 6765  H HG3  . LYS A 1 21  ? -38.892 -12.140 -21.872 1.00 0.00 ? 21  LYS A HG3  4  
ATOM 6766  H HD2  . LYS A 1 21  ? -38.326 -9.947  -23.046 1.00 0.00 ? 21  LYS A HD2  4  
ATOM 6767  H HD3  . LYS A 1 21  ? -39.153 -10.577 -24.485 1.00 0.00 ? 21  LYS A HD3  4  
ATOM 6768  H HE2  . LYS A 1 21  ? -41.255 -10.785 -23.199 1.00 0.00 ? 21  LYS A HE2  4  
ATOM 6769  H HE3  . LYS A 1 21  ? -40.425 -10.270 -21.725 1.00 0.00 ? 21  LYS A HE3  4  
ATOM 6770  H HZ1  . LYS A 1 21  ? -41.583 -8.393  -22.697 1.00 0.00 ? 21  LYS A HZ1  4  
ATOM 6771  H HZ2  . LYS A 1 21  ? -39.998 -8.117  -22.794 1.00 0.00 ? 21  LYS A HZ2  4  
ATOM 6772  H HZ3  . LYS A 1 21  ? -40.819 -8.582  -24.137 1.00 0.00 ? 21  LYS A HZ3  4  
ATOM 6773  N N    . PHE A 1 22  ? -35.328 -13.850 -21.289 1.00 0.00 ? 22  PHE A N    4  
ATOM 6774  C CA   . PHE A 1 22  ? -35.059 -14.695 -20.105 1.00 0.00 ? 22  PHE A CA   4  
ATOM 6775  C C    . PHE A 1 22  ? -33.640 -14.580 -19.494 1.00 0.00 ? 22  PHE A C    4  
ATOM 6776  O O    . PHE A 1 22  ? -33.339 -15.265 -18.514 1.00 0.00 ? 22  PHE A O    4  
ATOM 6777  C CB   . PHE A 1 22  ? -35.485 -16.154 -20.363 1.00 0.00 ? 22  PHE A CB   4  
ATOM 6778  C CG   . PHE A 1 22  ? -34.628 -16.991 -21.304 1.00 0.00 ? 22  PHE A CG   4  
ATOM 6779  C CD1  . PHE A 1 22  ? -33.396 -17.529 -20.878 1.00 0.00 ? 22  PHE A CD1  4  
ATOM 6780  C CD2  . PHE A 1 22  ? -35.113 -17.324 -22.584 1.00 0.00 ? 22  PHE A CD2  4  
ATOM 6781  C CE1  . PHE A 1 22  ? -32.645 -18.359 -21.729 1.00 0.00 ? 22  PHE A CE1  4  
ATOM 6782  C CE2  . PHE A 1 22  ? -34.367 -18.160 -23.434 1.00 0.00 ? 22  PHE A CE2  4  
ATOM 6783  C CZ   . PHE A 1 22  ? -33.133 -18.678 -23.008 1.00 0.00 ? 22  PHE A CZ   4  
ATOM 6784  H H    . PHE A 1 22  ? -34.979 -14.155 -22.196 1.00 0.00 ? 22  PHE A H    4  
ATOM 6785  H HA   . PHE A 1 22  ? -35.729 -14.348 -19.320 1.00 0.00 ? 22  PHE A HA   4  
ATOM 6786  H HB2  . PHE A 1 22  ? -35.515 -16.671 -19.403 1.00 0.00 ? 22  PHE A HB2  4  
ATOM 6787  H HB3  . PHE A 1 22  ? -36.512 -16.147 -20.734 1.00 0.00 ? 22  PHE A HB3  4  
ATOM 6788  H HD1  . PHE A 1 22  ? -33.027 -17.328 -19.884 1.00 0.00 ? 22  PHE A HD1  4  
ATOM 6789  H HD2  . PHE A 1 22  ? -36.069 -16.941 -22.909 1.00 0.00 ? 22  PHE A HD2  4  
ATOM 6790  H HE1  . PHE A 1 22  ? -31.700 -18.766 -21.394 1.00 0.00 ? 22  PHE A HE1  4  
ATOM 6791  H HE2  . PHE A 1 22  ? -34.745 -18.415 -24.415 1.00 0.00 ? 22  PHE A HE2  4  
ATOM 6792  H HZ   . PHE A 1 22  ? -32.564 -19.330 -23.657 1.00 0.00 ? 22  PHE A HZ   4  
ATOM 6793  N N    . GLU A 1 23  ? -32.776 -13.709 -20.027 1.00 0.00 ? 23  GLU A N    4  
ATOM 6794  C CA   . GLU A 1 23  ? -31.324 -13.632 -19.757 1.00 0.00 ? 23  GLU A CA   4  
ATOM 6795  C C    . GLU A 1 23  ? -30.962 -13.475 -18.257 1.00 0.00 ? 23  GLU A C    4  
ATOM 6796  O O    . GLU A 1 23  ? -29.911 -13.945 -17.815 1.00 0.00 ? 23  GLU A O    4  
ATOM 6797  C CB   . GLU A 1 23  ? -30.746 -12.461 -20.590 1.00 0.00 ? 23  GLU A CB   4  
ATOM 6798  C CG   . GLU A 1 23  ? -29.236 -12.248 -20.421 1.00 0.00 ? 23  GLU A CG   4  
ATOM 6799  C CD   . GLU A 1 23  ? -28.724 -11.157 -21.379 1.00 0.00 ? 23  GLU A CD   4  
ATOM 6800  O OE1  . GLU A 1 23  ? -28.826 -9.953  -21.040 1.00 0.00 ? 23  GLU A OE1  4  
ATOM 6801  O OE2  . GLU A 1 23  ? -28.203 -11.496 -22.470 1.00 0.00 ? 23  GLU A OE2  4  
ATOM 6802  H H    . GLU A 1 23  ? -33.081 -13.264 -20.883 1.00 0.00 ? 23  GLU A H    4  
ATOM 6803  H HA   . GLU A 1 23  ? -30.875 -14.559 -20.136 1.00 0.00 ? 23  GLU A HA   4  
ATOM 6804  H HB2  . GLU A 1 23  ? -30.937 -12.629 -21.652 1.00 0.00 ? 23  GLU A HB2  4  
ATOM 6805  H HB3  . GLU A 1 23  ? -31.258 -11.542 -20.313 1.00 0.00 ? 23  GLU A HB3  4  
ATOM 6806  H HG2  . GLU A 1 23  ? -29.022 -11.950 -19.391 1.00 0.00 ? 23  GLU A HG2  4  
ATOM 6807  H HG3  . GLU A 1 23  ? -28.720 -13.192 -20.616 1.00 0.00 ? 23  GLU A HG3  4  
ATOM 6808  N N    . GLY A 1 24  ? -31.841 -12.853 -17.462 1.00 0.00 ? 24  GLY A N    4  
ATOM 6809  C CA   . GLY A 1 24  ? -31.778 -12.794 -15.990 1.00 0.00 ? 24  GLY A CA   4  
ATOM 6810  C C    . GLY A 1 24  ? -31.082 -11.566 -15.385 1.00 0.00 ? 24  GLY A C    4  
ATOM 6811  O O    . GLY A 1 24  ? -31.086 -11.403 -14.164 1.00 0.00 ? 24  GLY A O    4  
ATOM 6812  H H    . GLY A 1 24  ? -32.684 -12.512 -17.904 1.00 0.00 ? 24  GLY A H    4  
ATOM 6813  H HA2  . GLY A 1 24  ? -32.797 -12.819 -15.604 1.00 0.00 ? 24  GLY A HA2  4  
ATOM 6814  H HA3  . GLY A 1 24  ? -31.265 -13.683 -15.619 1.00 0.00 ? 24  GLY A HA3  4  
ATOM 6815  N N    . GLN A 1 25  ? -30.557 -10.661 -16.218 1.00 0.00 ? 25  GLN A N    4  
ATOM 6816  C CA   . GLN A 1 25  ? -30.065 -9.323  -15.834 1.00 0.00 ? 25  GLN A CA   4  
ATOM 6817  C C    . GLN A 1 25  ? -30.827 -8.194  -16.559 1.00 0.00 ? 25  GLN A C    4  
ATOM 6818  O O    . GLN A 1 25  ? -30.778 -7.035  -16.145 1.00 0.00 ? 25  GLN A O    4  
ATOM 6819  C CB   . GLN A 1 25  ? -28.552 -9.228  -16.098 1.00 0.00 ? 25  GLN A CB   4  
ATOM 6820  C CG   . GLN A 1 25  ? -27.709 -10.037 -15.093 1.00 0.00 ? 25  GLN A CG   4  
ATOM 6821  C CD   . GLN A 1 25  ? -27.492 -9.343  -13.743 1.00 0.00 ? 25  GLN A CD   4  
ATOM 6822  O OE1  . GLN A 1 25  ? -28.001 -8.268  -13.446 1.00 0.00 ? 25  GLN A OE1  4  
ATOM 6823  N NE2  . GLN A 1 25  ? -26.724 -9.939  -12.855 1.00 0.00 ? 25  GLN A NE2  4  
ATOM 6824  H H    . GLN A 1 25  ? -30.497 -10.920 -17.191 1.00 0.00 ? 25  GLN A H    4  
ATOM 6825  H HA   . GLN A 1 25  ? -30.233 -9.164  -14.769 1.00 0.00 ? 25  GLN A HA   4  
ATOM 6826  H HB2  . GLN A 1 25  ? -28.351 -9.602  -17.103 1.00 0.00 ? 25  GLN A HB2  4  
ATOM 6827  H HB3  . GLN A 1 25  ? -28.235 -8.186  -16.072 1.00 0.00 ? 25  GLN A HB3  4  
ATOM 6828  H HG2  . GLN A 1 25  ? -28.155 -11.019 -14.929 1.00 0.00 ? 25  GLN A HG2  4  
ATOM 6829  H HG3  . GLN A 1 25  ? -26.726 -10.199 -15.536 1.00 0.00 ? 25  GLN A HG3  4  
ATOM 6830  H HE21 . GLN A 1 25  ? -26.292 -10.827 -13.068 1.00 0.00 ? 25  GLN A HE21 4  
ATOM 6831  H HE22 . GLN A 1 25  ? -26.577 -9.485  -11.967 1.00 0.00 ? 25  GLN A HE22 4  
ATOM 6832  N N    . SER A 1 26  ? -31.597 -8.539  -17.592 1.00 0.00 ? 26  SER A N    4  
ATOM 6833  C CA   . SER A 1 26  ? -32.400 -7.661  -18.456 1.00 0.00 ? 26  SER A CA   4  
ATOM 6834  C C    . SER A 1 26  ? -33.711 -7.149  -17.828 1.00 0.00 ? 26  SER A C    4  
ATOM 6835  O O    . SER A 1 26  ? -34.538 -6.541  -18.517 1.00 0.00 ? 26  SER A O    4  
ATOM 6836  C CB   . SER A 1 26  ? -32.699 -8.438  -19.742 1.00 0.00 ? 26  SER A CB   4  
ATOM 6837  O OG   . SER A 1 26  ? -33.265 -9.696  -19.411 1.00 0.00 ? 26  SER A OG   4  
ATOM 6838  H H    . SER A 1 26  ? -31.645 -9.518  -17.834 1.00 0.00 ? 26  SER A H    4  
ATOM 6839  H HA   . SER A 1 26  ? -31.805 -6.785  -18.717 1.00 0.00 ? 26  SER A HA   4  
ATOM 6840  H HB2  . SER A 1 26  ? -33.380 -7.872  -20.380 1.00 0.00 ? 26  SER A HB2  4  
ATOM 6841  H HB3  . SER A 1 26  ? -31.768 -8.598  -20.288 1.00 0.00 ? 26  SER A HB3  4  
ATOM 6842  H HG   . SER A 1 26  ? -33.563 -10.095 -20.257 1.00 0.00 ? 26  SER A HG   4  
ATOM 6843  N N    . ARG A 1 27  ? -33.920 -7.391  -16.525 1.00 0.00 ? 27  ARG A N    4  
ATOM 6844  C CA   . ARG A 1 27  ? -35.095 -6.947  -15.753 1.00 0.00 ? 27  ARG A CA   4  
ATOM 6845  C C    . ARG A 1 27  ? -35.275 -5.417  -15.725 1.00 0.00 ? 27  ARG A C    4  
ATOM 6846  O O    . ARG A 1 27  ? -34.370 -4.659  -16.064 1.00 0.00 ? 27  ARG A O    4  
ATOM 6847  C CB   . ARG A 1 27  ? -35.150 -7.642  -14.377 1.00 0.00 ? 27  ARG A CB   4  
ATOM 6848  C CG   . ARG A 1 27  ? -33.856 -7.653  -13.554 1.00 0.00 ? 27  ARG A CG   4  
ATOM 6849  C CD   . ARG A 1 27  ? -33.253 -6.261  -13.342 1.00 0.00 ? 27  ARG A CD   4  
ATOM 6850  N NE   . ARG A 1 27  ? -32.293 -6.305  -12.229 1.00 0.00 ? 27  ARG A NE   4  
ATOM 6851  C CZ   . ARG A 1 27  ? -31.001 -6.559  -12.267 1.00 0.00 ? 27  ARG A CZ   4  
ATOM 6852  N NH1  . ARG A 1 27  ? -30.303 -6.625  -13.363 1.00 0.00 ? 27  ARG A NH1  4  
ATOM 6853  N NH2  . ARG A 1 27  ? -30.397 -6.793  -11.143 1.00 0.00 ? 27  ARG A NH2  4  
ATOM 6854  H H    . ARG A 1 27  ? -33.198 -7.903  -16.042 1.00 0.00 ? 27  ARG A H    4  
ATOM 6855  H HA   . ARG A 1 27  ? -35.968 -7.301  -16.294 1.00 0.00 ? 27  ARG A HA   4  
ATOM 6856  H HB2  . ARG A 1 27  ? -35.940 -7.192  -13.775 1.00 0.00 ? 27  ARG A HB2  4  
ATOM 6857  H HB3  . ARG A 1 27  ? -35.434 -8.684  -14.540 1.00 0.00 ? 27  ARG A HB3  4  
ATOM 6858  H HG2  . ARG A 1 27  ? -34.089 -8.091  -12.581 1.00 0.00 ? 27  ARG A HG2  4  
ATOM 6859  H HG3  . ARG A 1 27  ? -33.115 -8.293  -14.033 1.00 0.00 ? 27  ARG A HG3  4  
ATOM 6860  H HD2  . ARG A 1 27  ? -32.784 -5.925  -14.268 1.00 0.00 ? 27  ARG A HD2  4  
ATOM 6861  H HD3  . ARG A 1 27  ? -34.055 -5.562  -13.098 1.00 0.00 ? 27  ARG A HD3  4  
ATOM 6862  H HE   . ARG A 1 27  ? -32.678 -6.344  -11.287 1.00 0.00 ? 27  ARG A HE   4  
ATOM 6863  H HH11 . ARG A 1 27  ? -30.735 -6.450  -14.259 1.00 0.00 ? 27  ARG A HH11 4  
ATOM 6864  H HH12 . ARG A 1 27  ? -29.351 -6.975  -13.332 1.00 0.00 ? 27  ARG A HH12 4  
ATOM 6865  H HH21 . ARG A 1 27  ? -30.982 -6.820  -10.306 1.00 0.00 ? 27  ARG A HH21 4  
ATOM 6866  H HH22 . ARG A 1 27  ? -29.419 -7.018  -11.115 1.00 0.00 ? 27  ARG A HH22 4  
ATOM 6867  N N    . LYS A 1 28  ? -36.477 -4.985  -15.339 1.00 0.00 ? 28  LYS A N    4  
ATOM 6868  C CA   . LYS A 1 28  ? -37.012 -3.614  -15.468 1.00 0.00 ? 28  LYS A CA   4  
ATOM 6869  C C    . LYS A 1 28  ? -36.168 -2.518  -14.801 1.00 0.00 ? 28  LYS A C    4  
ATOM 6870  O O    . LYS A 1 28  ? -35.621 -2.739  -13.721 1.00 0.00 ? 28  LYS A O    4  
ATOM 6871  C CB   . LYS A 1 28  ? -38.462 -3.570  -14.941 1.00 0.00 ? 28  LYS A CB   4  
ATOM 6872  C CG   . LYS A 1 28  ? -39.348 -4.779  -15.329 1.00 0.00 ? 28  LYS A CG   4  
ATOM 6873  C CD   . LYS A 1 28  ? -39.542 -5.797  -14.190 1.00 0.00 ? 28  LYS A CD   4  
ATOM 6874  C CE   . LYS A 1 28  ? -40.728 -6.738  -14.467 1.00 0.00 ? 28  LYS A CE   4  
ATOM 6875  N NZ   . LYS A 1 28  ? -40.444 -7.731  -15.540 1.00 0.00 ? 28  LYS A NZ   4  
ATOM 6876  H H    . LYS A 1 28  ? -37.115 -5.694  -15.019 1.00 0.00 ? 28  LYS A H    4  
ATOM 6877  H HA   . LYS A 1 28  ? -37.022 -3.381  -16.530 1.00 0.00 ? 28  LYS A HA   4  
ATOM 6878  H HB2  . LYS A 1 28  ? -38.448 -3.460  -13.859 1.00 0.00 ? 28  LYS A HB2  4  
ATOM 6879  H HB3  . LYS A 1 28  ? -38.931 -2.662  -15.319 1.00 0.00 ? 28  LYS A HB3  4  
ATOM 6880  H HG2  . LYS A 1 28  ? -40.329 -4.412  -15.589 1.00 0.00 ? 28  LYS A HG2  4  
ATOM 6881  H HG3  . LYS A 1 28  ? -38.959 -5.271  -16.221 1.00 0.00 ? 28  LYS A HG3  4  
ATOM 6882  H HD2  . LYS A 1 28  ? -38.632 -6.374  -14.024 1.00 0.00 ? 28  LYS A HD2  4  
ATOM 6883  H HD3  . LYS A 1 28  ? -39.766 -5.253  -13.271 1.00 0.00 ? 28  LYS A HD3  4  
ATOM 6884  H HE2  . LYS A 1 28  ? -40.973 -7.260  -13.538 1.00 0.00 ? 28  LYS A HE2  4  
ATOM 6885  H HE3  . LYS A 1 28  ? -41.600 -6.134  -14.734 1.00 0.00 ? 28  LYS A HE3  4  
ATOM 6886  H HZ1  . LYS A 1 28  ? -40.247 -7.282  -16.425 1.00 0.00 ? 28  LYS A HZ1  4  
ATOM 6887  H HZ2  . LYS A 1 28  ? -39.661 -8.326  -15.301 1.00 0.00 ? 28  LYS A HZ2  4  
ATOM 6888  H HZ3  . LYS A 1 28  ? -41.241 -8.339  -15.685 1.00 0.00 ? 28  LYS A HZ3  4  
ATOM 6889  N N    . PHE A 1 29  ? -36.141 -1.316  -15.398 1.00 0.00 ? 29  PHE A N    4  
ATOM 6890  C CA   . PHE A 1 29  ? -35.379 -0.166  -14.869 1.00 0.00 ? 29  PHE A CA   4  
ATOM 6891  C C    . PHE A 1 29  ? -35.672 1.177   -15.556 1.00 0.00 ? 29  PHE A C    4  
ATOM 6892  O O    . PHE A 1 29  ? -36.196 1.264   -16.674 1.00 0.00 ? 29  PHE A O    4  
ATOM 6893  C CB   . PHE A 1 29  ? -33.849 -0.420  -14.926 1.00 0.00 ? 29  PHE A CB   4  
ATOM 6894  C CG   . PHE A 1 29  ? -33.190 -0.559  -16.291 1.00 0.00 ? 29  PHE A CG   4  
ATOM 6895  C CD1  . PHE A 1 29  ? -32.877 0.572   -17.072 1.00 0.00 ? 29  PHE A CD1  4  
ATOM 6896  C CD2  . PHE A 1 29  ? -32.795 -1.832  -16.741 1.00 0.00 ? 29  PHE A CD2  4  
ATOM 6897  C CE1  . PHE A 1 29  ? -32.222 0.418   -18.310 1.00 0.00 ? 29  PHE A CE1  4  
ATOM 6898  C CE2  . PHE A 1 29  ? -32.138 -1.988  -17.974 1.00 0.00 ? 29  PHE A CE2  4  
ATOM 6899  C CZ   . PHE A 1 29  ? -31.854 -0.861  -18.762 1.00 0.00 ? 29  PHE A CZ   4  
ATOM 6900  H H    . PHE A 1 29  ? -36.704 -1.171  -16.232 1.00 0.00 ? 29  PHE A H    4  
ATOM 6901  H HA   . PHE A 1 29  ? -35.657 -0.043  -13.822 1.00 0.00 ? 29  PHE A HA   4  
ATOM 6902  H HB2  . PHE A 1 29  ? -33.343 0.388   -14.397 1.00 0.00 ? 29  PHE A HB2  4  
ATOM 6903  H HB3  . PHE A 1 29  ? -33.626 -1.321  -14.363 1.00 0.00 ? 29  PHE A HB3  4  
ATOM 6904  H HD1  . PHE A 1 29  ? -33.132 1.563   -16.725 1.00 0.00 ? 29  PHE A HD1  4  
ATOM 6905  H HD2  . PHE A 1 29  ? -32.971 -2.696  -16.121 1.00 0.00 ? 29  PHE A HD2  4  
ATOM 6906  H HE1  . PHE A 1 29  ? -32.002 1.282   -18.921 1.00 0.00 ? 29  PHE A HE1  4  
ATOM 6907  H HE2  . PHE A 1 29  ? -31.843 -2.973  -18.309 1.00 0.00 ? 29  PHE A HE2  4  
ATOM 6908  H HZ   . PHE A 1 29  ? -31.345 -0.977  -19.709 1.00 0.00 ? 29  PHE A HZ   4  
ATOM 6909  N N    . ILE A 1 30  ? -35.264 2.239   -14.857 1.00 0.00 ? 30  ILE A N    4  
ATOM 6910  C CA   . ILE A 1 30  ? -35.210 3.614   -15.357 1.00 0.00 ? 30  ILE A CA   4  
ATOM 6911  C C    . ILE A 1 30  ? -33.795 4.171   -15.263 1.00 0.00 ? 30  ILE A C    4  
ATOM 6912  O O    . ILE A 1 30  ? -32.923 3.580   -14.635 1.00 0.00 ? 30  ILE A O    4  
ATOM 6913  C CB   . ILE A 1 30  ? -36.219 4.523   -14.623 1.00 0.00 ? 30  ILE A CB   4  
ATOM 6914  C CG1  . ILE A 1 30  ? -36.315 4.325   -13.097 1.00 0.00 ? 30  ILE A CG1  4  
ATOM 6915  C CG2  . ILE A 1 30  ? -37.585 4.319   -15.277 1.00 0.00 ? 30  ILE A CG2  4  
ATOM 6916  C CD1  . ILE A 1 30  ? -34.974 4.453   -12.365 1.00 0.00 ? 30  ILE A CD1  4  
ATOM 6917  H H    . ILE A 1 30  ? -34.831 2.085   -13.948 1.00 0.00 ? 30  ILE A H    4  
ATOM 6918  H HA   . ILE A 1 30  ? -35.451 3.616   -16.418 1.00 0.00 ? 30  ILE A HA   4  
ATOM 6919  H HB   . ILE A 1 30  ? -35.945 5.563   -14.800 1.00 0.00 ? 30  ILE A HB   4  
ATOM 6920  H HG12 . ILE A 1 30  ? -36.994 5.078   -12.695 1.00 0.00 ? 30  ILE A HG12 4  
ATOM 6921  H HG13 . ILE A 1 30  ? -36.737 3.344   -12.877 1.00 0.00 ? 30  ILE A HG13 4  
ATOM 6922  H HG21 . ILE A 1 30  ? -37.487 4.517   -16.343 1.00 0.00 ? 30  ILE A HG21 4  
ATOM 6923  H HG22 . ILE A 1 30  ? -37.922 3.293   -15.130 1.00 0.00 ? 30  ILE A HG22 4  
ATOM 6924  H HG23 . ILE A 1 30  ? -38.308 5.011   -14.847 1.00 0.00 ? 30  ILE A HG23 4  
ATOM 6925  H HD11 . ILE A 1 30  ? -34.332 3.598   -12.585 1.00 0.00 ? 30  ILE A HD11 4  
ATOM 6926  H HD12 . ILE A 1 30  ? -34.471 5.378   -12.648 1.00 0.00 ? 30  ILE A HD12 4  
ATOM 6927  H HD13 . ILE A 1 30  ? -35.158 4.461   -11.296 1.00 0.00 ? 30  ILE A HD13 4  
ATOM 6928  N N    . ILE A 1 31  ? -33.583 5.325   -15.877 1.00 0.00 ? 31  ILE A N    4  
ATOM 6929  C CA   . ILE A 1 31  ? -32.361 6.111   -15.824 1.00 0.00 ? 31  ILE A CA   4  
ATOM 6930  C C    . ILE A 1 31  ? -32.740 7.485   -15.316 1.00 0.00 ? 31  ILE A C    4  
ATOM 6931  O O    . ILE A 1 31  ? -33.454 8.235   -15.983 1.00 0.00 ? 31  ILE A O    4  
ATOM 6932  C CB   . ILE A 1 31  ? -31.687 6.230   -17.207 1.00 0.00 ? 31  ILE A CB   4  
ATOM 6933  C CG1  . ILE A 1 31  ? -31.687 4.916   -18.014 1.00 0.00 ? 31  ILE A CG1  4  
ATOM 6934  C CG2  . ILE A 1 31  ? -30.271 6.806   -17.026 1.00 0.00 ? 31  ILE A CG2  4  
ATOM 6935  C CD1  . ILE A 1 31  ? -30.766 3.868   -17.402 1.00 0.00 ? 31  ILE A CD1  4  
ATOM 6936  H H    . ILE A 1 31  ? -34.350 5.737   -16.402 1.00 0.00 ? 31  ILE A H    4  
ATOM 6937  H HA   . ILE A 1 31  ? -31.669 5.664   -15.112 1.00 0.00 ? 31  ILE A HA   4  
ATOM 6938  H HB   . ILE A 1 31  ? -32.254 6.951   -17.790 1.00 0.00 ? 31  ILE A HB   4  
ATOM 6939  H HG12 . ILE A 1 31  ? -32.711 4.523   -18.080 1.00 0.00 ? 31  ILE A HG12 4  
ATOM 6940  H HG13 . ILE A 1 31  ? -31.333 5.116   -19.024 1.00 0.00 ? 31  ILE A HG13 4  
ATOM 6941  H HG21 . ILE A 1 31  ? -29.667 6.160   -16.387 1.00 0.00 ? 31  ILE A HG21 4  
ATOM 6942  H HG22 . ILE A 1 31  ? -29.787 6.911   -17.997 1.00 0.00 ? 31  ILE A HG22 4  
ATOM 6943  H HG23 . ILE A 1 31  ? -30.326 7.785   -16.554 1.00 0.00 ? 31  ILE A HG23 4  
ATOM 6944  H HD11 . ILE A 1 31  ? -30.969 3.800   -16.337 1.00 0.00 ? 31  ILE A HD11 4  
ATOM 6945  H HD12 . ILE A 1 31  ? -30.931 2.910   -17.882 1.00 0.00 ? 31  ILE A HD12 4  
ATOM 6946  H HD13 . ILE A 1 31  ? -29.731 4.164   -17.557 1.00 0.00 ? 31  ILE A HD13 4  
ATOM 6947  N N    . ALA A 1 32  ? -32.236 7.809   -14.138 1.00 0.00 ? 32  ALA A N    4  
ATOM 6948  C CA   . ALA A 1 32  ? -32.409 9.125   -13.539 1.00 0.00 ? 32  ALA A CA   4  
ATOM 6949  C C    . ALA A 1 32  ? -31.069 9.773   -13.221 1.00 0.00 ? 32  ALA A C    4  
ATOM 6950  O O    . ALA A 1 32  ? -30.069 9.090   -12.984 1.00 0.00 ? 32  ALA A O    4  
ATOM 6951  C CB   . ALA A 1 32  ? -33.333 9.052   -12.322 1.00 0.00 ? 32  ALA A CB   4  
ATOM 6952  H H    . ALA A 1 32  ? -31.657 7.115   -13.665 1.00 0.00 ? 32  ALA A H    4  
ATOM 6953  H HA   . ALA A 1 32  ? -32.885 9.775   -14.268 1.00 0.00 ? 32  ALA A HA   4  
ATOM 6954  H HB1  . ALA A 1 32  ? -33.358 10.021  -11.815 1.00 0.00 ? 32  ALA A HB1  4  
ATOM 6955  H HB2  . ALA A 1 32  ? -34.333 8.773   -12.647 1.00 0.00 ? 32  ALA A HB2  4  
ATOM 6956  H HB3  . ALA A 1 32  ? -32.971 8.305   -11.624 1.00 0.00 ? 32  ALA A HB3  4  
ATOM 6957  N N    . ASN A 1 33  ? -31.048 11.103  -13.205 1.00 0.00 ? 33  ASN A N    4  
ATOM 6958  C CA   . ASN A 1 33  ? -29.849 11.842  -12.890 1.00 0.00 ? 33  ASN A CA   4  
ATOM 6959  C C    . ASN A 1 33  ? -29.736 11.982  -11.359 1.00 0.00 ? 33  ASN A C    4  
ATOM 6960  O O    . ASN A 1 33  ? -30.635 12.512  -10.704 1.00 0.00 ? 33  ASN A O    4  
ATOM 6961  C CB   . ASN A 1 33  ? -29.967 13.118  -13.724 1.00 0.00 ? 33  ASN A CB   4  
ATOM 6962  C CG   . ASN A 1 33  ? -28.792 14.055  -13.642 1.00 0.00 ? 33  ASN A CG   4  
ATOM 6963  O OD1  . ASN A 1 33  ? -27.914 13.950  -12.798 1.00 0.00 ? 33  ASN A OD1  4  
ATOM 6964  N ND2  . ASN A 1 33  ? -28.777 15.003  -14.547 1.00 0.00 ? 33  ASN A ND2  4  
ATOM 6965  H H    . ASN A 1 33  ? -31.892 11.652  -13.380 1.00 0.00 ? 33  ASN A H    4  
ATOM 6966  H HA   . ASN A 1 33  ? -28.973 11.297  -13.245 1.00 0.00 ? 33  ASN A HA   4  
ATOM 6967  H HB2  . ASN A 1 33  ? -30.059 12.824  -14.767 1.00 0.00 ? 33  ASN A HB2  4  
ATOM 6968  H HB3  . ASN A 1 33  ? -30.876 13.652  -13.467 1.00 0.00 ? 33  ASN A HB3  4  
ATOM 6969  H HD21 . ASN A 1 33  ? -29.541 15.067  -15.203 1.00 0.00 ? 33  ASN A HD21 4  
ATOM 6970  H HD22 . ASN A 1 33  ? -28.002 15.640  -14.581 1.00 0.00 ? 33  ASN A HD22 4  
ATOM 6971  N N    . ALA A 1 34  ? -28.645 11.476  -10.775 1.00 0.00 ? 34  ALA A N    4  
ATOM 6972  C CA   . ALA A 1 34  ? -28.407 11.531  -9.325  1.00 0.00 ? 34  ALA A CA   4  
ATOM 6973  C C    . ALA A 1 34  ? -27.910 12.914  -8.851  1.00 0.00 ? 34  ALA A C    4  
ATOM 6974  O O    . ALA A 1 34  ? -27.808 13.168  -7.648  1.00 0.00 ? 34  ALA A O    4  
ATOM 6975  C CB   . ALA A 1 34  ? -27.416 10.419  -8.950  1.00 0.00 ? 34  ALA A CB   4  
ATOM 6976  H H    . ALA A 1 34  ? -27.941 11.046  -11.357 1.00 0.00 ? 34  ALA A H    4  
ATOM 6977  H HA   . ALA A 1 34  ? -29.346 11.330  -8.809  1.00 0.00 ? 34  ALA A HA   4  
ATOM 6978  H HB1  . ALA A 1 34  ? -27.323 10.357  -7.864  1.00 0.00 ? 34  ALA A HB1  4  
ATOM 6979  H HB2  . ALA A 1 34  ? -27.764 9.457   -9.327  1.00 0.00 ? 34  ALA A HB2  4  
ATOM 6980  H HB3  . ALA A 1 34  ? -26.432 10.640  -9.358  1.00 0.00 ? 34  ALA A HB3  4  
ATOM 6981  N N    . ARG A 1 35  ? -27.571 13.802  -9.798  1.00 0.00 ? 35  ARG A N    4  
ATOM 6982  C CA   . ARG A 1 35  ? -26.932 15.115  -9.566  1.00 0.00 ? 35  ARG A CA   4  
ATOM 6983  C C    . ARG A 1 35  ? -27.905 16.307  -9.604  1.00 0.00 ? 35  ARG A C    4  
ATOM 6984  O O    . ARG A 1 35  ? -27.470 17.458  -9.540  1.00 0.00 ? 35  ARG A O    4  
ATOM 6985  C CB   . ARG A 1 35  ? -25.745 15.301  -10.538 1.00 0.00 ? 35  ARG A CB   4  
ATOM 6986  C CG   . ARG A 1 35  ? -24.757 14.118  -10.616 1.00 0.00 ? 35  ARG A CG   4  
ATOM 6987  C CD   . ARG A 1 35  ? -24.152 13.690  -9.268  1.00 0.00 ? 35  ARG A CD   4  
ATOM 6988  N NE   . ARG A 1 35  ? -23.396 14.779  -8.611  1.00 0.00 ? 35  ARG A NE   4  
ATOM 6989  C CZ   . ARG A 1 35  ? -22.152 15.157  -8.852  1.00 0.00 ? 35  ARG A CZ   4  
ATOM 6990  N NH1  . ARG A 1 35  ? -21.410 14.585  -9.760  1.00 0.00 ? 35  ARG A NH1  4  
ATOM 6991  N NH2  . ARG A 1 35  ? -21.620 16.133  -8.174  1.00 0.00 ? 35  ARG A NH2  4  
ATOM 6992  H H    . ARG A 1 35  ? -27.742 13.523  -10.762 1.00 0.00 ? 35  ARG A H    4  
ATOM 6993  H HA   . ARG A 1 35  ? -26.527 15.125  -8.552  1.00 0.00 ? 35  ARG A HA   4  
ATOM 6994  H HB2  . ARG A 1 35  ? -26.135 15.482  -11.539 1.00 0.00 ? 35  ARG A HB2  4  
ATOM 6995  H HB3  . ARG A 1 35  ? -25.188 16.193  -10.244 1.00 0.00 ? 35  ARG A HB3  4  
ATOM 6996  H HG2  . ARG A 1 35  ? -25.264 13.258  -11.055 1.00 0.00 ? 35  ARG A HG2  4  
ATOM 6997  H HG3  . ARG A 1 35  ? -23.948 14.394  -11.295 1.00 0.00 ? 35  ARG A HG3  4  
ATOM 6998  H HD2  . ARG A 1 35  ? -24.953 13.360  -8.606  1.00 0.00 ? 35  ARG A HD2  4  
ATOM 6999  H HD3  . ARG A 1 35  ? -23.499 12.830  -9.429  1.00 0.00 ? 35  ARG A HD3  4  
ATOM 7000  H HE   . ARG A 1 35  ? -23.874 15.280  -7.878  1.00 0.00 ? 35  ARG A HE   4  
ATOM 7001  H HH11 . ARG A 1 35  ? -21.792 13.831  -10.303 1.00 0.00 ? 35  ARG A HH11 4  
ATOM 7002  H HH12 . ARG A 1 35  ? -20.467 14.896  -9.921  1.00 0.00 ? 35  ARG A HH12 4  
ATOM 7003  H HH21 . ARG A 1 35  ? -22.153 16.606  -7.463  1.00 0.00 ? 35  ARG A HH21 4  
ATOM 7004  H HH22 . ARG A 1 35  ? -20.672 16.421  -8.357  1.00 0.00 ? 35  ARG A HH22 4  
ATOM 7005  N N    . VAL A 1 36  ? -29.210 16.042  -9.720  1.00 0.00 ? 36  VAL A N    4  
ATOM 7006  C CA   . VAL A 1 36  ? -30.289 17.037  -9.890  1.00 0.00 ? 36  VAL A CA   4  
ATOM 7007  C C    . VAL A 1 36  ? -31.301 16.976  -8.745  1.00 0.00 ? 36  VAL A C    4  
ATOM 7008  O O    . VAL A 1 36  ? -31.710 15.902  -8.308  1.00 0.00 ? 36  VAL A O    4  
ATOM 7009  C CB   . VAL A 1 36  ? -30.996 16.885  -11.256 1.00 0.00 ? 36  VAL A CB   4  
ATOM 7010  C CG1  . VAL A 1 36  ? -30.085 17.365  -12.389 1.00 0.00 ? 36  VAL A CG1  4  
ATOM 7011  C CG2  . VAL A 1 36  ? -31.448 15.464  -11.539 1.00 0.00 ? 36  VAL A CG2  4  
ATOM 7012  H H    . VAL A 1 36  ? -29.478 15.069  -9.716  1.00 0.00 ? 36  VAL A H    4  
ATOM 7013  H HA   . VAL A 1 36  ? -29.854 18.036  -9.866  1.00 0.00 ? 36  VAL A HA   4  
ATOM 7014  H HB   . VAL A 1 36  ? -31.908 17.467  -11.280 1.00 0.00 ? 36  VAL A HB   4  
ATOM 7015  H HG11 . VAL A 1 36  ? -29.166 16.780  -12.405 1.00 0.00 ? 36  VAL A HG11 4  
ATOM 7016  H HG12 . VAL A 1 36  ? -30.597 17.258  -13.345 1.00 0.00 ? 36  VAL A HG12 4  
ATOM 7017  H HG13 . VAL A 1 36  ? -29.837 18.416  -12.240 1.00 0.00 ? 36  VAL A HG13 4  
ATOM 7018  H HG21 . VAL A 1 36  ? -32.090 15.120  -10.735 1.00 0.00 ? 36  VAL A HG21 4  
ATOM 7019  H HG22 . VAL A 1 36  ? -32.006 15.438  -12.476 1.00 0.00 ? 36  VAL A HG22 4  
ATOM 7020  H HG23 . VAL A 1 36  ? -30.575 14.826  -11.603 1.00 0.00 ? 36  VAL A HG23 4  
ATOM 7021  N N    . GLU A 1 37  ? -31.759 18.141  -8.291  1.00 0.00 ? 37  GLU A N    4  
ATOM 7022  C CA   . GLU A 1 37  ? -32.695 18.271  -7.156  1.00 0.00 ? 37  GLU A CA   4  
ATOM 7023  C C    . GLU A 1 37  ? -34.101 17.723  -7.465  1.00 0.00 ? 37  GLU A C    4  
ATOM 7024  O O    . GLU A 1 37  ? -34.825 17.290  -6.567  1.00 0.00 ? 37  GLU A O    4  
ATOM 7025  C CB   . GLU A 1 37  ? -32.750 19.734  -6.686  1.00 0.00 ? 37  GLU A CB   4  
ATOM 7026  C CG   . GLU A 1 37  ? -33.316 20.718  -7.722  1.00 0.00 ? 37  GLU A CG   4  
ATOM 7027  C CD   . GLU A 1 37  ? -33.290 22.162  -7.182  1.00 0.00 ? 37  GLU A CD   4  
ATOM 7028  O OE1  . GLU A 1 37  ? -34.275 22.590  -6.532  1.00 0.00 ? 37  GLU A OE1  4  
ATOM 7029  O OE2  . GLU A 1 37  ? -32.287 22.883  -7.410  1.00 0.00 ? 37  GLU A OE2  4  
ATOM 7030  H H    . GLU A 1 37  ? -31.408 18.981  -8.725  1.00 0.00 ? 37  GLU A H    4  
ATOM 7031  H HA   . GLU A 1 37  ? -32.307 17.679  -6.325  1.00 0.00 ? 37  GLU A HA   4  
ATOM 7032  H HB2  . GLU A 1 37  ? -33.366 19.784  -5.789  1.00 0.00 ? 37  GLU A HB2  4  
ATOM 7033  H HB3  . GLU A 1 37  ? -31.740 20.047  -6.420  1.00 0.00 ? 37  GLU A HB3  4  
ATOM 7034  H HG2  . GLU A 1 37  ? -32.727 20.657  -8.641  1.00 0.00 ? 37  GLU A HG2  4  
ATOM 7035  H HG3  . GLU A 1 37  ? -34.342 20.435  -7.968  1.00 0.00 ? 37  GLU A HG3  4  
ATOM 7036  N N    . ASN A 1 38  ? -34.460 17.685  -8.752  1.00 0.00 ? 38  ASN A N    4  
ATOM 7037  C CA   . ASN A 1 38  ? -35.688 17.078  -9.267  1.00 0.00 ? 38  ASN A CA   4  
ATOM 7038  C C    . ASN A 1 38  ? -35.599 15.533  -9.338  1.00 0.00 ? 38  ASN A C    4  
ATOM 7039  O O    . ASN A 1 38  ? -36.616 14.880  -9.574  1.00 0.00 ? 38  ASN A O    4  
ATOM 7040  C CB   . ASN A 1 38  ? -35.969 17.720  -10.646 1.00 0.00 ? 38  ASN A CB   4  
ATOM 7041  C CG   . ASN A 1 38  ? -37.439 17.755  -11.049 1.00 0.00 ? 38  ASN A CG   4  
ATOM 7042  O OD1  . ASN A 1 38  ? -38.023 18.810  -11.250 1.00 0.00 ? 38  ASN A OD1  4  
ATOM 7043  N ND2  . ASN A 1 38  ? -38.088 16.625  -11.203 1.00 0.00 ? 38  ASN A ND2  4  
ATOM 7044  H H    . ASN A 1 38  ? -33.821 18.099  -9.414  1.00 0.00 ? 38  ASN A H    4  
ATOM 7045  H HA   . ASN A 1 38  ? -36.508 17.329  -8.591  1.00 0.00 ? 38  ASN A HA   4  
ATOM 7046  H HB2  . ASN A 1 38  ? -35.627 18.757  -10.635 1.00 0.00 ? 38  ASN A HB2  4  
ATOM 7047  H HB3  . ASN A 1 38  ? -35.405 17.196  -11.417 1.00 0.00 ? 38  ASN A HB3  4  
ATOM 7048  H HD21 . ASN A 1 38  ? -37.653 15.757  -10.914 1.00 0.00 ? 38  ASN A HD21 4  
ATOM 7049  H HD22 . ASN A 1 38  ? -39.053 16.669  -11.486 1.00 0.00 ? 38  ASN A HD22 4  
ATOM 7050  N N    . CYS A 1 39  ? -34.400 14.944  -9.185  1.00 0.00 ? 39  CYS A N    4  
ATOM 7051  C CA   . CYS A 1 39  ? -34.122 13.501  -9.316  1.00 0.00 ? 39  CYS A CA   4  
ATOM 7052  C C    . CYS A 1 39  ? -34.758 12.882  -10.579 1.00 0.00 ? 39  CYS A C    4  
ATOM 7053  O O    . CYS A 1 39  ? -35.306 11.778  -10.531 1.00 0.00 ? 39  CYS A O    4  
ATOM 7054  C CB   . CYS A 1 39  ? -34.538 12.776  -8.024  1.00 0.00 ? 39  CYS A CB   4  
ATOM 7055  S SG   . CYS A 1 39  ? -33.789 13.571  -6.571  1.00 0.00 ? 39  CYS A SG   4  
ATOM 7056  H H    . CYS A 1 39  ? -33.609 15.528  -8.927  1.00 0.00 ? 39  CYS A H    4  
ATOM 7057  H HA   . CYS A 1 39  ? -33.043 13.378  -9.427  1.00 0.00 ? 39  CYS A HA   4  
ATOM 7058  H HB2  . CYS A 1 39  ? -35.625 12.796  -7.930  1.00 0.00 ? 39  CYS A HB2  4  
ATOM 7059  H HB3  . CYS A 1 39  ? -34.215 11.733  -8.083  1.00 0.00 ? 39  CYS A HB3  4  
ATOM 7060  H HG   . CYS A 1 39  ? -34.349 14.780  -6.739  1.00 0.00 ? 39  CYS A HG   4  
ATOM 7061  N N    . ALA A 1 40  ? -34.760 13.621  -11.694 1.00 0.00 ? 40  ALA A N    4  
ATOM 7062  C CA   . ALA A 1 40  ? -35.581 13.285  -12.853 1.00 0.00 ? 40  ALA A CA   4  
ATOM 7063  C C    . ALA A 1 40  ? -35.085 12.091  -13.687 1.00 0.00 ? 40  ALA A C    4  
ATOM 7064  O O    . ALA A 1 40  ? -33.880 11.865  -13.836 1.00 0.00 ? 40  ALA A O    4  
ATOM 7065  C CB   . ALA A 1 40  ? -35.770 14.545  -13.705 1.00 0.00 ? 40  ALA A CB   4  
ATOM 7066  H H    . ALA A 1 40  ? -34.271 14.502  -11.693 1.00 0.00 ? 40  ALA A H    4  
ATOM 7067  H HA   . ALA A 1 40  ? -36.559 13.020  -12.462 1.00 0.00 ? 40  ALA A HA   4  
ATOM 7068  H HB1  . ALA A 1 40  ? -36.469 14.333  -14.514 1.00 0.00 ? 40  ALA A HB1  4  
ATOM 7069  H HB2  . ALA A 1 40  ? -36.198 15.344  -13.098 1.00 0.00 ? 40  ALA A HB2  4  
ATOM 7070  H HB3  . ALA A 1 40  ? -34.812 14.865  -14.122 1.00 0.00 ? 40  ALA A HB3  4  
ATOM 7071  N N    . VAL A 1 41  ? -36.050 11.394  -14.301 1.00 0.00 ? 41  VAL A N    4  
ATOM 7072  C CA   . VAL A 1 41  ? -35.919 10.240  -15.192 1.00 0.00 ? 41  VAL A CA   4  
ATOM 7073  C C    . VAL A 1 41  ? -35.560 10.741  -16.590 1.00 0.00 ? 41  VAL A C    4  
ATOM 7074  O O    . VAL A 1 41  ? -36.421 11.053  -17.412 1.00 0.00 ? 41  VAL A O    4  
ATOM 7075  C CB   . VAL A 1 41  ? -37.221 9.405   -15.180 1.00 0.00 ? 41  VAL A CB   4  
ATOM 7076  C CG1  . VAL A 1 41  ? -37.170 8.207   -16.135 1.00 0.00 ? 41  VAL A CG1  4  
ATOM 7077  C CG2  . VAL A 1 41  ? -37.510 8.832   -13.784 1.00 0.00 ? 41  VAL A CG2  4  
ATOM 7078  H H    . VAL A 1 41  ? -37.002 11.660  -14.096 1.00 0.00 ? 41  VAL A H    4  
ATOM 7079  H HA   . VAL A 1 41  ? -35.117 9.602   -14.830 1.00 0.00 ? 41  VAL A HA   4  
ATOM 7080  H HB   . VAL A 1 41  ? -38.055 10.046  -15.465 1.00 0.00 ? 41  VAL A HB   4  
ATOM 7081  H HG11 . VAL A 1 41  ? -36.316 7.581   -15.886 1.00 0.00 ? 41  VAL A HG11 4  
ATOM 7082  H HG12 . VAL A 1 41  ? -38.085 7.623   -16.049 1.00 0.00 ? 41  VAL A HG12 4  
ATOM 7083  H HG13 . VAL A 1 41  ? -37.080 8.542   -17.168 1.00 0.00 ? 41  VAL A HG13 4  
ATOM 7084  H HG21 . VAL A 1 41  ? -36.722 8.140   -13.488 1.00 0.00 ? 41  VAL A HG21 4  
ATOM 7085  H HG22 . VAL A 1 41  ? -37.575 9.631   -13.051 1.00 0.00 ? 41  VAL A HG22 4  
ATOM 7086  H HG23 . VAL A 1 41  ? -38.467 8.313   -13.798 1.00 0.00 ? 41  VAL A HG23 4  
ATOM 7087  N N    . ILE A 1 42  ? -34.259 10.851  -16.841 1.00 0.00 ? 42  ILE A N    4  
ATOM 7088  C CA   . ILE A 1 42  ? -33.678 11.279  -18.119 1.00 0.00 ? 42  ILE A CA   4  
ATOM 7089  C C    . ILE A 1 42  ? -33.869 10.224  -19.229 1.00 0.00 ? 42  ILE A C    4  
ATOM 7090  O O    . ILE A 1 42  ? -33.888 10.576  -20.409 1.00 0.00 ? 42  ILE A O    4  
ATOM 7091  C CB   . ILE A 1 42  ? -32.186 11.637  -17.916 1.00 0.00 ? 42  ILE A CB   4  
ATOM 7092  C CG1  . ILE A 1 42  ? -31.370 10.420  -17.426 1.00 0.00 ? 42  ILE A CG1  4  
ATOM 7093  C CG2  . ILE A 1 42  ? -32.044 12.826  -16.944 1.00 0.00 ? 42  ILE A CG2  4  
ATOM 7094  C CD1  . ILE A 1 42  ? -29.875 10.686  -17.298 1.00 0.00 ? 42  ILE A CD1  4  
ATOM 7095  H H    . ILE A 1 42  ? -33.626 10.573  -16.106 1.00 0.00 ? 42  ILE A H    4  
ATOM 7096  H HA   . ILE A 1 42  ? -34.198 12.180  -18.449 1.00 0.00 ? 42  ILE A HA   4  
ATOM 7097  H HB   . ILE A 1 42  ? -31.788 11.951  -18.882 1.00 0.00 ? 42  ILE A HB   4  
ATOM 7098  H HG12 . ILE A 1 42  ? -31.727 10.106  -16.447 1.00 0.00 ? 42  ILE A HG12 4  
ATOM 7099  H HG13 . ILE A 1 42  ? -31.493 9.594   -18.126 1.00 0.00 ? 42  ILE A HG13 4  
ATOM 7100  H HG21 . ILE A 1 42  ? -32.284 12.517  -15.926 1.00 0.00 ? 42  ILE A HG21 4  
ATOM 7101  H HG22 . ILE A 1 42  ? -31.023 13.214  -16.962 1.00 0.00 ? 42  ILE A HG22 4  
ATOM 7102  H HG23 . ILE A 1 42  ? -32.713 13.633  -17.240 1.00 0.00 ? 42  ILE A HG23 4  
ATOM 7103  H HD11 . ILE A 1 42  ? -29.365 9.741   -17.125 1.00 0.00 ? 42  ILE A HD11 4  
ATOM 7104  H HD12 . ILE A 1 42  ? -29.501 11.134  -18.217 1.00 0.00 ? 42  ILE A HD12 4  
ATOM 7105  H HD13 . ILE A 1 42  ? -29.692 11.339  -16.447 1.00 0.00 ? 42  ILE A HD13 4  
ATOM 7106  N N    . TYR A 1 43  ? -34.042 8.948   -18.859 1.00 0.00 ? 43  TYR A N    4  
ATOM 7107  C CA   . TYR A 1 43  ? -34.384 7.841   -19.779 1.00 0.00 ? 43  TYR A CA   4  
ATOM 7108  C C    . TYR A 1 43  ? -35.085 6.673   -19.074 1.00 0.00 ? 43  TYR A C    4  
ATOM 7109  O O    . TYR A 1 43  ? -35.032 6.553   -17.855 1.00 0.00 ? 43  TYR A O    4  
ATOM 7110  C CB   . TYR A 1 43  ? -33.163 7.356   -20.588 1.00 0.00 ? 43  TYR A CB   4  
ATOM 7111  C CG   . TYR A 1 43  ? -33.539 6.465   -21.762 1.00 0.00 ? 43  TYR A CG   4  
ATOM 7112  C CD1  . TYR A 1 43  ? -34.316 6.988   -22.816 1.00 0.00 ? 43  TYR A CD1  4  
ATOM 7113  C CD2  . TYR A 1 43  ? -33.179 5.102   -21.768 1.00 0.00 ? 43  TYR A CD2  4  
ATOM 7114  C CE1  . TYR A 1 43  ? -34.741 6.149   -23.864 1.00 0.00 ? 43  TYR A CE1  4  
ATOM 7115  C CE2  . TYR A 1 43  ? -33.592 4.263   -22.822 1.00 0.00 ? 43  TYR A CE2  4  
ATOM 7116  C CZ   . TYR A 1 43  ? -34.381 4.785   -23.872 1.00 0.00 ? 43  TYR A CZ   4  
ATOM 7117  O OH   . TYR A 1 43  ? -34.793 3.982   -24.892 1.00 0.00 ? 43  TYR A OH   4  
ATOM 7118  H H    . TYR A 1 43  ? -34.017 8.759   -17.854 1.00 0.00 ? 43  TYR A H    4  
ATOM 7119  H HA   . TYR A 1 43  ? -35.117 8.218   -20.486 1.00 0.00 ? 43  TYR A HA   4  
ATOM 7120  H HB2  . TYR A 1 43  ? -32.603 8.207   -20.967 1.00 0.00 ? 43  TYR A HB2  4  
ATOM 7121  H HB3  . TYR A 1 43  ? -32.486 6.818   -19.937 1.00 0.00 ? 43  TYR A HB3  4  
ATOM 7122  H HD1  . TYR A 1 43  ? -34.593 8.035   -22.820 1.00 0.00 ? 43  TYR A HD1  4  
ATOM 7123  H HD2  . TYR A 1 43  ? -32.590 4.690   -20.961 1.00 0.00 ? 43  TYR A HD2  4  
ATOM 7124  H HE1  . TYR A 1 43  ? -35.340 6.544   -24.673 1.00 0.00 ? 43  TYR A HE1  4  
ATOM 7125  H HE2  . TYR A 1 43  ? -33.313 3.220   -22.825 1.00 0.00 ? 43  TYR A HE2  4  
ATOM 7126  H HH   . TYR A 1 43  ? -34.441 3.079   -24.819 1.00 0.00 ? 43  TYR A HH   4  
ATOM 7127  N N    . CYS A 1 44  ? -35.797 5.823   -19.815 1.00 0.00 ? 44  CYS A N    4  
ATOM 7128  C CA   . CYS A 1 44  ? -36.581 4.720   -19.257 1.00 0.00 ? 44  CYS A CA   4  
ATOM 7129  C C    . CYS A 1 44  ? -36.550 3.458   -20.138 1.00 0.00 ? 44  CYS A C    4  
ATOM 7130  O O    . CYS A 1 44  ? -36.623 3.556   -21.369 1.00 0.00 ? 44  CYS A O    4  
ATOM 7131  C CB   . CYS A 1 44  ? -38.006 5.232   -18.989 1.00 0.00 ? 44  CYS A CB   4  
ATOM 7132  S SG   . CYS A 1 44  ? -38.662 6.117   -20.433 1.00 0.00 ? 44  CYS A SG   4  
ATOM 7133  H H    . CYS A 1 44  ? -35.807 5.943   -20.818 1.00 0.00 ? 44  CYS A H    4  
ATOM 7134  H HA   . CYS A 1 44  ? -36.140 4.444   -18.303 1.00 0.00 ? 44  CYS A HA   4  
ATOM 7135  H HB2  . CYS A 1 44  ? -38.661 4.399   -18.729 1.00 0.00 ? 44  CYS A HB2  4  
ATOM 7136  H HB3  . CYS A 1 44  ? -37.981 5.926   -18.147 1.00 0.00 ? 44  CYS A HB3  4  
ATOM 7137  H HG   . CYS A 1 44  ? -38.551 5.092   -21.291 1.00 0.00 ? 44  CYS A HG   4  
ATOM 7138  N N    . ASN A 1 45  ? -36.457 2.265   -19.528 1.00 0.00 ? 45  ASN A N    4  
ATOM 7139  C CA   . ASN A 1 45  ? -36.448 0.996   -20.267 1.00 0.00 ? 45  ASN A CA   4  
ATOM 7140  C C    . ASN A 1 45  ? -37.852 0.480   -20.618 1.00 0.00 ? 45  ASN A C    4  
ATOM 7141  O O    . ASN A 1 45  ? -38.834 0.768   -19.936 1.00 0.00 ? 45  ASN A O    4  
ATOM 7142  C CB   . ASN A 1 45  ? -35.640 -0.051  -19.484 1.00 0.00 ? 45  ASN A CB   4  
ATOM 7143  C CG   . ASN A 1 45  ? -35.177 -1.202  -20.358 1.00 0.00 ? 45  ASN A CG   4  
ATOM 7144  O OD1  . ASN A 1 45  ? -35.773 -2.268  -20.363 1.00 0.00 ? 45  ASN A OD1  4  
ATOM 7145  N ND2  . ASN A 1 45  ? -34.167 -1.009  -21.172 1.00 0.00 ? 45  ASN A ND2  4  
ATOM 7146  H H    . ASN A 1 45  ? -36.423 2.205   -18.511 1.00 0.00 ? 45  ASN A H    4  
ATOM 7147  H HA   . ASN A 1 45  ? -35.927 1.168   -21.210 1.00 0.00 ? 45  ASN A HA   4  
ATOM 7148  H HB2  . ASN A 1 45  ? -34.757 0.430   -19.079 1.00 0.00 ? 45  ASN A HB2  4  
ATOM 7149  H HB3  . ASN A 1 45  ? -36.229 -0.443  -18.657 1.00 0.00 ? 45  ASN A HB3  4  
ATOM 7150  H HD21 . ASN A 1 45  ? -33.651 -0.144  -21.156 1.00 0.00 ? 45  ASN A HD21 4  
ATOM 7151  H HD22 . ASN A 1 45  ? -33.868 -1.781  -21.749 1.00 0.00 ? 45  ASN A HD22 4  
ATOM 7152  N N    . ASP A 1 46  ? -37.928 -0.375  -21.638 1.00 0.00 ? 46  ASP A N    4  
ATOM 7153  C CA   . ASP A 1 46  ? -39.152 -1.102  -21.998 1.00 0.00 ? 46  ASP A CA   4  
ATOM 7154  C C    . ASP A 1 46  ? -39.620 -2.016  -20.853 1.00 0.00 ? 46  ASP A C    4  
ATOM 7155  O O    . ASP A 1 46  ? -40.819 -2.204  -20.658 1.00 0.00 ? 46  ASP A O    4  
ATOM 7156  C CB   . ASP A 1 46  ? -38.911 -1.904  -23.285 1.00 0.00 ? 46  ASP A CB   4  
ATOM 7157  C CG   . ASP A 1 46  ? -38.568 -0.977  -24.456 1.00 0.00 ? 46  ASP A CG   4  
ATOM 7158  O OD1  . ASP A 1 46  ? -39.491 -0.492  -25.150 1.00 0.00 ? 46  ASP A OD1  4  
ATOM 7159  O OD2  . ASP A 1 46  ? -37.375 -0.639  -24.636 1.00 0.00 ? 46  ASP A OD2  4  
ATOM 7160  H H    . ASP A 1 46  ? -37.076 -0.609  -22.130 1.00 0.00 ? 46  ASP A H    4  
ATOM 7161  H HA   . ASP A 1 46  ? -39.948 -0.381  -22.191 1.00 0.00 ? 46  ASP A HA   4  
ATOM 7162  H HB2  . ASP A 1 46  ? -38.096 -2.614  -23.123 1.00 0.00 ? 46  ASP A HB2  4  
ATOM 7163  H HB3  . ASP A 1 46  ? -39.811 -2.473  -23.524 1.00 0.00 ? 46  ASP A HB3  4  
ATOM 7164  N N    . GLY A 1 47  ? -38.697 -2.496  -20.014 1.00 0.00 ? 47  GLY A N    4  
ATOM 7165  C CA   . GLY A 1 47  ? -39.015 -3.208  -18.780 1.00 0.00 ? 47  GLY A CA   4  
ATOM 7166  C C    . GLY A 1 47  ? -39.948 -2.422  -17.849 1.00 0.00 ? 47  GLY A C    4  
ATOM 7167  O O    . GLY A 1 47  ? -40.979 -2.960  -17.456 1.00 0.00 ? 47  GLY A O    4  
ATOM 7168  H H    . GLY A 1 47  ? -37.719 -2.348  -20.241 1.00 0.00 ? 47  GLY A H    4  
ATOM 7169  H HA2  . GLY A 1 47  ? -39.494 -4.156  -19.029 1.00 0.00 ? 47  GLY A HA2  4  
ATOM 7170  H HA3  . GLY A 1 47  ? -38.086 -3.422  -18.261 1.00 0.00 ? 47  GLY A HA3  4  
ATOM 7171  N N    . PHE A 1 48  ? -39.669 -1.145  -17.538 1.00 0.00 ? 48  PHE A N    4  
ATOM 7172  C CA   . PHE A 1 48  ? -40.606 -0.286  -16.778 1.00 0.00 ? 48  PHE A CA   4  
ATOM 7173  C C    . PHE A 1 48  ? -41.989 -0.247  -17.465 1.00 0.00 ? 48  PHE A C    4  
ATOM 7174  O O    . PHE A 1 48  ? -43.034 -0.286  -16.806 1.00 0.00 ? 48  PHE A O    4  
ATOM 7175  C CB   . PHE A 1 48  ? -40.047 1.156   -16.611 1.00 0.00 ? 48  PHE A CB   4  
ATOM 7176  C CG   . PHE A 1 48  ? -41.032 2.258   -17.000 1.00 0.00 ? 48  PHE A CG   4  
ATOM 7177  C CD1  . PHE A 1 48  ? -42.086 2.598   -16.125 1.00 0.00 ? 48  PHE A CD1  4  
ATOM 7178  C CD2  . PHE A 1 48  ? -41.016 2.804   -18.299 1.00 0.00 ? 48  PHE A CD2  4  
ATOM 7179  C CE1  . PHE A 1 48  ? -43.146 3.407   -16.572 1.00 0.00 ? 48  PHE A CE1  4  
ATOM 7180  C CE2  . PHE A 1 48  ? -42.073 3.617   -18.745 1.00 0.00 ? 48  PHE A CE2  4  
ATOM 7181  C CZ   . PHE A 1 48  ? -43.146 3.907   -17.886 1.00 0.00 ? 48  PHE A CZ   4  
ATOM 7182  H H    . PHE A 1 48  ? -38.820 -0.732  -17.893 1.00 0.00 ? 48  PHE A H    4  
ATOM 7183  H HA   . PHE A 1 48  ? -40.748 -0.712  -15.785 1.00 0.00 ? 48  PHE A HA   4  
ATOM 7184  H HB2  . PHE A 1 48  ? -39.752 1.297   -15.571 1.00 0.00 ? 48  PHE A HB2  4  
ATOM 7185  H HB3  . PHE A 1 48  ? -39.145 1.273   -17.215 1.00 0.00 ? 48  PHE A HB3  4  
ATOM 7186  H HD1  . PHE A 1 48  ? -42.116 2.190   -15.126 1.00 0.00 ? 48  PHE A HD1  4  
ATOM 7187  H HD2  . PHE A 1 48  ? -40.218 2.559   -18.982 1.00 0.00 ? 48  PHE A HD2  4  
ATOM 7188  H HE1  . PHE A 1 48  ? -43.964 3.641   -15.905 1.00 0.00 ? 48  PHE A HE1  4  
ATOM 7189  H HE2  . PHE A 1 48  ? -42.065 4.009   -19.752 1.00 0.00 ? 48  PHE A HE2  4  
ATOM 7190  H HZ   . PHE A 1 48  ? -43.960 4.531   -18.229 1.00 0.00 ? 48  PHE A HZ   4  
ATOM 7191  N N    . CYS A 1 49  ? -41.990 -0.170  -18.797 1.00 0.00 ? 49  CYS A N    4  
ATOM 7192  C CA   . CYS A 1 49  ? -43.222 -0.140  -19.584 1.00 0.00 ? 49  CYS A CA   4  
ATOM 7193  C C    . CYS A 1 49  ? -44.058 -1.415  -19.354 1.00 0.00 ? 49  CYS A C    4  
ATOM 7194  O O    . CYS A 1 49  ? -45.269 -1.342  -19.162 1.00 0.00 ? 49  CYS A O    4  
ATOM 7195  C CB   . CYS A 1 49  ? -42.888 0.127   -21.060 1.00 0.00 ? 49  CYS A CB   4  
ATOM 7196  S SG   . CYS A 1 49  ? -44.363 0.741   -21.919 1.00 0.00 ? 49  CYS A SG   4  
ATOM 7197  H H    . CYS A 1 49  ? -41.095 -0.270  -19.264 1.00 0.00 ? 49  CYS A H    4  
ATOM 7198  H HA   . CYS A 1 49  ? -43.814 0.703   -19.220 1.00 0.00 ? 49  CYS A HA   4  
ATOM 7199  H HB2  . CYS A 1 49  ? -42.102 0.882   -21.124 1.00 0.00 ? 49  CYS A HB2  4  
ATOM 7200  H HB3  . CYS A 1 49  ? -42.549 -0.789  -21.541 1.00 0.00 ? 49  CYS A HB3  4  
ATOM 7201  H HG   . CYS A 1 49  ? -43.804 0.855   -23.137 1.00 0.00 ? 49  CYS A HG   4  
ATOM 7202  N N    . GLU A 1 50  ? -43.409 -2.582  -19.276 1.00 0.00 ? 50  GLU A N    4  
ATOM 7203  C CA   . GLU A 1 50  ? -44.063 -3.869  -18.990 1.00 0.00 ? 50  GLU A CA   4  
ATOM 7204  C C    . GLU A 1 50  ? -44.427 -4.029  -17.505 1.00 0.00 ? 50  GLU A C    4  
ATOM 7205  O O    . GLU A 1 50  ? -45.419 -4.679  -17.175 1.00 0.00 ? 50  GLU A O    4  
ATOM 7206  C CB   . GLU A 1 50  ? -43.167 -5.036  -19.434 1.00 0.00 ? 50  GLU A CB   4  
ATOM 7207  C CG   . GLU A 1 50  ? -42.863 -4.994  -20.937 1.00 0.00 ? 50  GLU A CG   4  
ATOM 7208  C CD   . GLU A 1 50  ? -42.084 -6.242  -21.390 1.00 0.00 ? 50  GLU A CD   4  
ATOM 7209  O OE1  . GLU A 1 50  ? -40.833 -6.261  -21.311 1.00 0.00 ? 50  GLU A OE1  4  
ATOM 7210  O OE2  . GLU A 1 50  ? -42.709 -7.224  -21.859 1.00 0.00 ? 50  GLU A OE2  4  
ATOM 7211  H H    . GLU A 1 50  ? -42.397 -2.575  -19.395 1.00 0.00 ? 50  GLU A H    4  
ATOM 7212  H HA   . GLU A 1 50  ? -44.995 -3.927  -19.557 1.00 0.00 ? 50  GLU A HA   4  
ATOM 7213  H HB2  . GLU A 1 50  ? -42.238 -5.013  -18.862 1.00 0.00 ? 50  GLU A HB2  4  
ATOM 7214  H HB3  . GLU A 1 50  ? -43.681 -5.972  -19.211 1.00 0.00 ? 50  GLU A HB3  4  
ATOM 7215  H HG2  . GLU A 1 50  ? -43.806 -4.929  -21.485 1.00 0.00 ? 50  GLU A HG2  4  
ATOM 7216  H HG3  . GLU A 1 50  ? -42.290 -4.095  -21.166 1.00 0.00 ? 50  GLU A HG3  4  
ATOM 7217  N N    . LEU A 1 51  ? -43.663 -3.410  -16.604 1.00 0.00 ? 51  LEU A N    4  
ATOM 7218  C CA   . LEU A 1 51  ? -43.905 -3.406  -15.163 1.00 0.00 ? 51  LEU A CA   4  
ATOM 7219  C C    . LEU A 1 51  ? -45.214 -2.695  -14.810 1.00 0.00 ? 51  LEU A C    4  
ATOM 7220  O O    . LEU A 1 51  ? -46.092 -3.284  -14.180 1.00 0.00 ? 51  LEU A O    4  
ATOM 7221  C CB   . LEU A 1 51  ? -42.722 -2.696  -14.490 1.00 0.00 ? 51  LEU A CB   4  
ATOM 7222  C CG   . LEU A 1 51  ? -42.808 -2.582  -12.961 1.00 0.00 ? 51  LEU A CG   4  
ATOM 7223  C CD1  . LEU A 1 51  ? -42.798 -3.937  -12.256 1.00 0.00 ? 51  LEU A CD1  4  
ATOM 7224  C CD2  . LEU A 1 51  ? -41.649 -1.744  -12.451 1.00 0.00 ? 51  LEU A CD2  4  
ATOM 7225  H H    . LEU A 1 51  ? -42.831 -2.938  -16.946 1.00 0.00 ? 51  LEU A H    4  
ATOM 7226  H HA   . LEU A 1 51  ? -43.953 -4.440  -14.813 1.00 0.00 ? 51  LEU A HA   4  
ATOM 7227  H HB2  . LEU A 1 51  ? -41.815 -3.199  -14.792 1.00 0.00 ? 51  LEU A HB2  4  
ATOM 7228  H HB3  . LEU A 1 51  ? -42.658 -1.684  -14.871 1.00 0.00 ? 51  LEU A HB3  4  
ATOM 7229  H HG   . LEU A 1 51  ? -43.736 -2.070  -12.710 1.00 0.00 ? 51  LEU A HG   4  
ATOM 7230  H HD11 . LEU A 1 51  ? -41.881 -4.475  -12.491 1.00 0.00 ? 51  LEU A HD11 4  
ATOM 7231  H HD12 . LEU A 1 51  ? -42.851 -3.775  -11.180 1.00 0.00 ? 51  LEU A HD12 4  
ATOM 7232  H HD13 . LEU A 1 51  ? -43.662 -4.526  -12.557 1.00 0.00 ? 51  LEU A HD13 4  
ATOM 7233  H HD21 . LEU A 1 51  ? -41.728 -1.641  -11.369 1.00 0.00 ? 51  LEU A HD21 4  
ATOM 7234  H HD22 . LEU A 1 51  ? -40.710 -2.227  -12.711 1.00 0.00 ? 51  LEU A HD22 4  
ATOM 7235  H HD23 . LEU A 1 51  ? -41.697 -0.753  -12.902 1.00 0.00 ? 51  LEU A HD23 4  
ATOM 7236  N N    . CYS A 1 52  ? -45.350 -1.440  -15.243 1.00 0.00 ? 52  CYS A N    4  
ATOM 7237  C CA   . CYS A 1 52  ? -46.461 -0.564  -14.862 1.00 0.00 ? 52  CYS A CA   4  
ATOM 7238  C C    . CYS A 1 52  ? -47.560 -0.493  -15.937 1.00 0.00 ? 52  CYS A C    4  
ATOM 7239  O O    . CYS A 1 52  ? -48.698 -0.131  -15.640 1.00 0.00 ? 52  CYS A O    4  
ATOM 7240  C CB   . CYS A 1 52  ? -45.899 0.822   -14.522 1.00 0.00 ? 52  CYS A CB   4  
ATOM 7241  S SG   . CYS A 1 52  ? -44.666 0.725   -13.187 1.00 0.00 ? 52  CYS A SG   4  
ATOM 7242  H H    . CYS A 1 52  ? -44.566 -1.026  -15.739 1.00 0.00 ? 52  CYS A H    4  
ATOM 7243  H HA   . CYS A 1 52  ? -46.933 -0.953  -13.959 1.00 0.00 ? 52  CYS A HA   4  
ATOM 7244  H HB2  . CYS A 1 52  ? -45.441 1.266   -15.409 1.00 0.00 ? 52  CYS A HB2  4  
ATOM 7245  H HB3  . CYS A 1 52  ? -46.722 1.453   -14.186 1.00 0.00 ? 52  CYS A HB3  4  
ATOM 7246  H HG   . CYS A 1 52  ? -44.391 2.038   -13.123 1.00 0.00 ? 52  CYS A HG   4  
ATOM 7247  N N    . GLY A 1 53  ? -47.246 -0.846  -17.186 1.00 0.00 ? 53  GLY A N    4  
ATOM 7248  C CA   . GLY A 1 53  ? -48.212 -0.841  -18.297 1.00 0.00 ? 53  GLY A CA   4  
ATOM 7249  C C    . GLY A 1 53  ? -48.541 0.545   -18.880 1.00 0.00 ? 53  GLY A C    4  
ATOM 7250  O O    . GLY A 1 53  ? -49.539 0.669   -19.595 1.00 0.00 ? 53  GLY A O    4  
ATOM 7251  H H    . GLY A 1 53  ? -46.292 -1.153  -17.381 1.00 0.00 ? 53  GLY A H    4  
ATOM 7252  H HA2  . GLY A 1 53  ? -47.813 -1.452  -19.106 1.00 0.00 ? 53  GLY A HA2  4  
ATOM 7253  H HA3  . GLY A 1 53  ? -49.143 -1.298  -17.963 1.00 0.00 ? 53  GLY A HA3  4  
ATOM 7254  N N    . TYR A 1 54  ? -47.748 1.581   -18.572 1.00 0.00 ? 54  TYR A N    4  
ATOM 7255  C CA   . TYR A 1 54  ? -47.939 2.955   -19.064 1.00 0.00 ? 54  TYR A CA   4  
ATOM 7256  C C    . TYR A 1 54  ? -47.189 3.197   -20.395 1.00 0.00 ? 54  TYR A C    4  
ATOM 7257  O O    . TYR A 1 54  ? -47.368 2.448   -21.357 1.00 0.00 ? 54  TYR A O    4  
ATOM 7258  C CB   . TYR A 1 54  ? -47.610 3.960   -17.937 1.00 0.00 ? 54  TYR A CB   4  
ATOM 7259  C CG   . TYR A 1 54  ? -48.518 3.868   -16.723 1.00 0.00 ? 54  TYR A CG   4  
ATOM 7260  C CD1  . TYR A 1 54  ? -49.891 4.157   -16.850 1.00 0.00 ? 54  TYR A CD1  4  
ATOM 7261  C CD2  . TYR A 1 54  ? -47.990 3.516   -15.466 1.00 0.00 ? 54  TYR A CD2  4  
ATOM 7262  C CE1  . TYR A 1 54  ? -50.742 4.049   -15.733 1.00 0.00 ? 54  TYR A CE1  4  
ATOM 7263  C CE2  . TYR A 1 54  ? -48.840 3.389   -14.348 1.00 0.00 ? 54  TYR A CE2  4  
ATOM 7264  C CZ   . TYR A 1 54  ? -50.223 3.644   -14.485 1.00 0.00 ? 54  TYR A CZ   4  
ATOM 7265  O OH   . TYR A 1 54  ? -51.059 3.508   -13.423 1.00 0.00 ? 54  TYR A OH   4  
ATOM 7266  H H    . TYR A 1 54  ? -46.944 1.405   -17.988 1.00 0.00 ? 54  TYR A H    4  
ATOM 7267  H HA   . TYR A 1 54  ? -48.995 3.095   -19.299 1.00 0.00 ? 54  TYR A HA   4  
ATOM 7268  H HB2  . TYR A 1 54  ? -46.572 3.824   -17.629 1.00 0.00 ? 54  TYR A HB2  4  
ATOM 7269  H HB3  . TYR A 1 54  ? -47.711 4.973   -18.323 1.00 0.00 ? 54  TYR A HB3  4  
ATOM 7270  H HD1  . TYR A 1 54  ? -50.298 4.456   -17.807 1.00 0.00 ? 54  TYR A HD1  4  
ATOM 7271  H HD2  . TYR A 1 54  ? -46.928 3.344   -15.359 1.00 0.00 ? 54  TYR A HD2  4  
ATOM 7272  H HE1  . TYR A 1 54  ? -51.797 4.260   -15.826 1.00 0.00 ? 54  TYR A HE1  4  
ATOM 7273  H HE2  . TYR A 1 54  ? -48.439 3.100   -13.386 1.00 0.00 ? 54  TYR A HE2  4  
ATOM 7274  H HH   . TYR A 1 54  ? -50.591 3.233   -12.619 1.00 0.00 ? 54  TYR A HH   4  
ATOM 7275  N N    . SER A 1 55  ? -46.387 4.263   -20.480 1.00 0.00 ? 55  SER A N    4  
ATOM 7276  C CA   . SER A 1 55  ? -45.652 4.715   -21.670 1.00 0.00 ? 55  SER A CA   4  
ATOM 7277  C C    . SER A 1 55  ? -44.498 5.631   -21.250 1.00 0.00 ? 55  SER A C    4  
ATOM 7278  O O    . SER A 1 55  ? -44.589 6.313   -20.228 1.00 0.00 ? 55  SER A O    4  
ATOM 7279  C CB   . SER A 1 55  ? -46.587 5.460   -22.631 1.00 0.00 ? 55  SER A CB   4  
ATOM 7280  O OG   . SER A 1 55  ? -45.866 5.929   -23.760 1.00 0.00 ? 55  SER A OG   4  
ATOM 7281  H H    . SER A 1 55  ? -46.278 4.836   -19.654 1.00 0.00 ? 55  SER A H    4  
ATOM 7282  H HA   . SER A 1 55  ? -45.238 3.849   -22.188 1.00 0.00 ? 55  SER A HA   4  
ATOM 7283  H HB2  . SER A 1 55  ? -47.375 4.782   -22.961 1.00 0.00 ? 55  SER A HB2  4  
ATOM 7284  H HB3  . SER A 1 55  ? -47.046 6.305   -22.117 1.00 0.00 ? 55  SER A HB3  4  
ATOM 7285  H HG   . SER A 1 55  ? -46.505 6.297   -24.402 1.00 0.00 ? 55  SER A HG   4  
ATOM 7286  N N    . ARG A 1 56  ? -43.403 5.657   -22.016 1.00 0.00 ? 56  ARG A N    4  
ATOM 7287  C CA   . ARG A 1 56  ? -42.232 6.528   -21.769 1.00 0.00 ? 56  ARG A CA   4  
ATOM 7288  C C    . ARG A 1 56  ? -42.624 7.996   -21.570 1.00 0.00 ? 56  ARG A C    4  
ATOM 7289  O O    . ARG A 1 56  ? -42.129 8.646   -20.654 1.00 0.00 ? 56  ARG A O    4  
ATOM 7290  C CB   . ARG A 1 56  ? -41.235 6.422   -22.937 1.00 0.00 ? 56  ARG A CB   4  
ATOM 7291  C CG   . ARG A 1 56  ? -40.604 5.026   -23.083 1.00 0.00 ? 56  ARG A CG   4  
ATOM 7292  C CD   . ARG A 1 56  ? -39.362 5.098   -23.990 1.00 0.00 ? 56  ARG A CD   4  
ATOM 7293  N NE   . ARG A 1 56  ? -38.392 4.029   -23.690 1.00 0.00 ? 56  ARG A NE   4  
ATOM 7294  C CZ   . ARG A 1 56  ? -38.365 2.793   -24.147 1.00 0.00 ? 56  ARG A CZ   4  
ATOM 7295  N NH1  . ARG A 1 56  ? -39.282 2.300   -24.928 1.00 0.00 ? 56  ARG A NH1  4  
ATOM 7296  N NH2  . ARG A 1 56  ? -37.382 2.024   -23.798 1.00 0.00 ? 56  ARG A NH2  4  
ATOM 7297  H H    . ARG A 1 56  ? -43.449 5.126   -22.874 1.00 0.00 ? 56  ARG A H    4  
ATOM 7298  H HA   . ARG A 1 56  ? -41.730 6.226   -20.844 1.00 0.00 ? 56  ARG A HA   4  
ATOM 7299  H HB2  . ARG A 1 56  ? -41.727 6.692   -23.874 1.00 0.00 ? 56  ARG A HB2  4  
ATOM 7300  H HB3  . ARG A 1 56  ? -40.440 7.148   -22.755 1.00 0.00 ? 56  ARG A HB3  4  
ATOM 7301  H HG2  . ARG A 1 56  ? -40.318 4.656   -22.101 1.00 0.00 ? 56  ARG A HG2  4  
ATOM 7302  H HG3  . ARG A 1 56  ? -41.327 4.330   -23.506 1.00 0.00 ? 56  ARG A HG3  4  
ATOM 7303  H HD2  . ARG A 1 56  ? -39.668 5.064   -25.037 1.00 0.00 ? 56  ARG A HD2  4  
ATOM 7304  H HD3  . ARG A 1 56  ? -38.855 6.049   -23.828 1.00 0.00 ? 56  ARG A HD3  4  
ATOM 7305  H HE   . ARG A 1 56  ? -37.633 4.261   -23.062 1.00 0.00 ? 56  ARG A HE   4  
ATOM 7306  H HH11 . ARG A 1 56  ? -40.052 2.874   -25.214 1.00 0.00 ? 56  ARG A HH11 4  
ATOM 7307  H HH12 . ARG A 1 56  ? -39.271 1.306   -25.155 1.00 0.00 ? 56  ARG A HH12 4  
ATOM 7308  H HH21 . ARG A 1 56  ? -36.682 2.394   -23.175 1.00 0.00 ? 56  ARG A HH21 4  
ATOM 7309  H HH22 . ARG A 1 56  ? -37.313 1.082   -24.184 1.00 0.00 ? 56  ARG A HH22 4  
ATOM 7310  N N    . ALA A 1 57  ? -43.578 8.495   -22.354 1.00 0.00 ? 57  ALA A N    4  
ATOM 7311  C CA   . ALA A 1 57  ? -44.088 9.868   -22.266 1.00 0.00 ? 57  ALA A CA   4  
ATOM 7312  C C    . ALA A 1 57  ? -44.724 10.204  -20.897 1.00 0.00 ? 57  ALA A C    4  
ATOM 7313  O O    . ALA A 1 57  ? -44.800 11.373  -20.515 1.00 0.00 ? 57  ALA A O    4  
ATOM 7314  C CB   . ALA A 1 57  ? -45.094 10.057  -23.408 1.00 0.00 ? 57  ALA A CB   4  
ATOM 7315  H H    . ALA A 1 57  ? -43.983 7.879   -23.040 1.00 0.00 ? 57  ALA A H    4  
ATOM 7316  H HA   . ALA A 1 57  ? -43.258 10.559  -22.421 1.00 0.00 ? 57  ALA A HA   4  
ATOM 7317  H HB1  . ALA A 1 57  ? -44.610 9.860   -24.365 1.00 0.00 ? 57  ALA A HB1  4  
ATOM 7318  H HB2  . ALA A 1 57  ? -45.936 9.374   -23.281 1.00 0.00 ? 57  ALA A HB2  4  
ATOM 7319  H HB3  . ALA A 1 57  ? -45.464 11.083  -23.404 1.00 0.00 ? 57  ALA A HB3  4  
ATOM 7320  N N    . GLU A 1 58  ? -45.140 9.187   -20.137 1.00 0.00 ? 58  GLU A N    4  
ATOM 7321  C CA   . GLU A 1 58  ? -45.715 9.304   -18.794 1.00 0.00 ? 58  GLU A CA   4  
ATOM 7322  C C    . GLU A 1 58  ? -44.634 9.356   -17.698 1.00 0.00 ? 58  GLU A C    4  
ATOM 7323  O O    . GLU A 1 58  ? -44.917 9.825   -16.596 1.00 0.00 ? 58  GLU A O    4  
ATOM 7324  C CB   . GLU A 1 58  ? -46.679 8.129   -18.539 1.00 0.00 ? 58  GLU A CB   4  
ATOM 7325  C CG   . GLU A 1 58  ? -47.750 7.926   -19.625 1.00 0.00 ? 58  GLU A CG   4  
ATOM 7326  C CD   . GLU A 1 58  ? -48.870 8.980   -19.530 1.00 0.00 ? 58  GLU A CD   4  
ATOM 7327  O OE1  . GLU A 1 58  ? -49.865 8.751   -18.798 1.00 0.00 ? 58  GLU A OE1  4  
ATOM 7328  O OE2  . GLU A 1 58  ? -48.773 10.041  -20.193 1.00 0.00 ? 58  GLU A OE2  4  
ATOM 7329  H H    . GLU A 1 58  ? -45.036 8.245   -20.497 1.00 0.00 ? 58  GLU A H    4  
ATOM 7330  H HA   . GLU A 1 58  ? -46.286 10.231  -18.730 1.00 0.00 ? 58  GLU A HA   4  
ATOM 7331  H HB2  . GLU A 1 58  ? -46.099 7.212   -18.449 1.00 0.00 ? 58  GLU A HB2  4  
ATOM 7332  H HB3  . GLU A 1 58  ? -47.175 8.283   -17.582 1.00 0.00 ? 58  GLU A HB3  4  
ATOM 7333  H HG2  . GLU A 1 58  ? -47.300 7.949   -20.618 1.00 0.00 ? 58  GLU A HG2  4  
ATOM 7334  H HG3  . GLU A 1 58  ? -48.164 6.921   -19.518 1.00 0.00 ? 58  GLU A HG3  4  
ATOM 7335  N N    . VAL A 1 59  ? -43.408 8.877   -17.977 1.00 0.00 ? 59  VAL A N    4  
ATOM 7336  C CA   . VAL A 1 59  ? -42.245 8.944   -17.061 1.00 0.00 ? 59  VAL A CA   4  
ATOM 7337  C C    . VAL A 1 59  ? -41.186 9.986   -17.435 1.00 0.00 ? 59  VAL A C    4  
ATOM 7338  O O    . VAL A 1 59  ? -40.442 10.423  -16.556 1.00 0.00 ? 59  VAL A O    4  
ATOM 7339  C CB   . VAL A 1 59  ? -41.598 7.563   -16.844 1.00 0.00 ? 59  VAL A CB   4  
ATOM 7340  C CG1  . VAL A 1 59  ? -42.517 6.663   -16.016 1.00 0.00 ? 59  VAL A CG1  4  
ATOM 7341  C CG2  . VAL A 1 59  ? -41.238 6.852   -18.145 1.00 0.00 ? 59  VAL A CG2  4  
ATOM 7342  H H    . VAL A 1 59  ? -43.239 8.520   -18.917 1.00 0.00 ? 59  VAL A H    4  
ATOM 7343  H HA   . VAL A 1 59  ? -42.602 9.258   -16.082 1.00 0.00 ? 59  VAL A HA   4  
ATOM 7344  H HB   . VAL A 1 59  ? -40.673 7.696   -16.294 1.00 0.00 ? 59  VAL A HB   4  
ATOM 7345  H HG11 . VAL A 1 59  ? -42.002 5.729   -15.795 1.00 0.00 ? 59  VAL A HG11 4  
ATOM 7346  H HG12 . VAL A 1 59  ? -42.763 7.151   -15.073 1.00 0.00 ? 59  VAL A HG12 4  
ATOM 7347  H HG13 . VAL A 1 59  ? -43.437 6.453   -16.562 1.00 0.00 ? 59  VAL A HG13 4  
ATOM 7348  H HG21 . VAL A 1 59  ? -40.692 5.937   -17.915 1.00 0.00 ? 59  VAL A HG21 4  
ATOM 7349  H HG22 . VAL A 1 59  ? -42.143 6.595   -18.692 1.00 0.00 ? 59  VAL A HG22 4  
ATOM 7350  H HG23 . VAL A 1 59  ? -40.605 7.494   -18.754 1.00 0.00 ? 59  VAL A HG23 4  
ATOM 7351  N N    . MET A 1 60  ? -41.148 10.445  -18.693 1.00 0.00 ? 60  MET A N    4  
ATOM 7352  C CA   . MET A 1 60  ? -40.143 11.355  -19.243 1.00 0.00 ? 60  MET A CA   4  
ATOM 7353  C C    . MET A 1 60  ? -39.952 12.575  -18.349 1.00 0.00 ? 60  MET A C    4  
ATOM 7354  O O    . MET A 1 60  ? -40.793 13.472  -18.299 1.00 0.00 ? 60  MET A O    4  
ATOM 7355  C CB   . MET A 1 60  ? -40.566 11.811  -20.657 1.00 0.00 ? 60  MET A CB   4  
ATOM 7356  C CG   . MET A 1 60  ? -39.916 11.002  -21.780 1.00 0.00 ? 60  MET A CG   4  
ATOM 7357  S SD   . MET A 1 60  ? -38.123 11.241  -21.934 1.00 0.00 ? 60  MET A SD   4  
ATOM 7358  C CE   . MET A 1 60  ? -37.533 9.624   -21.365 1.00 0.00 ? 60  MET A CE   4  
ATOM 7359  H H    . MET A 1 60  ? -41.742 9.998   -19.374 1.00 0.00 ? 60  MET A H    4  
ATOM 7360  H HA   . MET A 1 60  ? -39.190 10.832  -19.303 1.00 0.00 ? 60  MET A HA   4  
ATOM 7361  H HB2  . MET A 1 60  ? -41.652 11.756  -20.755 1.00 0.00 ? 60  MET A HB2  4  
ATOM 7362  H HB3  . MET A 1 60  ? -40.281 12.852  -20.811 1.00 0.00 ? 60  MET A HB3  4  
ATOM 7363  H HG2  . MET A 1 60  ? -40.126 9.947   -21.635 1.00 0.00 ? 60  MET A HG2  4  
ATOM 7364  H HG3  . MET A 1 60  ? -40.375 11.306  -22.722 1.00 0.00 ? 60  MET A HG3  4  
ATOM 7365  H HE1  . MET A 1 60  ? -37.935 8.838   -22.005 1.00 0.00 ? 60  MET A HE1  4  
ATOM 7366  H HE2  . MET A 1 60  ? -36.445 9.610   -21.420 1.00 0.00 ? 60  MET A HE2  4  
ATOM 7367  H HE3  . MET A 1 60  ? -37.847 9.444   -20.337 1.00 0.00 ? 60  MET A HE3  4  
ATOM 7368  N N    . GLN A 1 61  ? -38.812 12.610  -17.667 1.00 0.00 ? 61  GLN A N    4  
ATOM 7369  C CA   . GLN A 1 61  ? -38.321 13.750  -16.900 1.00 0.00 ? 61  GLN A CA   4  
ATOM 7370  C C    . GLN A 1 61  ? -39.136 14.028  -15.616 1.00 0.00 ? 61  GLN A C    4  
ATOM 7371  O O    . GLN A 1 61  ? -39.036 15.116  -15.042 1.00 0.00 ? 61  GLN A O    4  
ATOM 7372  C CB   . GLN A 1 61  ? -38.100 14.956  -17.845 1.00 0.00 ? 61  GLN A CB   4  
ATOM 7373  C CG   . GLN A 1 61  ? -37.307 14.600  -19.131 1.00 0.00 ? 61  GLN A CG   4  
ATOM 7374  C CD   . GLN A 1 61  ? -37.784 15.374  -20.360 1.00 0.00 ? 61  GLN A CD   4  
ATOM 7375  O OE1  . GLN A 1 61  ? -37.948 16.589  -20.355 1.00 0.00 ? 61  GLN A OE1  4  
ATOM 7376  N NE2  . GLN A 1 61  ? -38.042 14.691  -21.460 1.00 0.00 ? 61  GLN A NE2  4  
ATOM 7377  H H    . GLN A 1 61  ? -38.201 11.799  -17.711 1.00 0.00 ? 61  GLN A H    4  
ATOM 7378  H HA   . GLN A 1 61  ? -37.331 13.464  -16.545 1.00 0.00 ? 61  GLN A HA   4  
ATOM 7379  H HB2  . GLN A 1 61  ? -39.075 15.358  -18.125 1.00 0.00 ? 61  GLN A HB2  4  
ATOM 7380  H HB3  . GLN A 1 61  ? -37.566 15.743  -17.311 1.00 0.00 ? 61  GLN A HB3  4  
ATOM 7381  H HG2  . GLN A 1 61  ? -36.247 14.796  -18.969 1.00 0.00 ? 61  GLN A HG2  4  
ATOM 7382  H HG3  . GLN A 1 61  ? -37.403 13.538  -19.373 1.00 0.00 ? 61  GLN A HG3  4  
ATOM 7383  H HE21 . GLN A 1 61  ? -37.895 13.693  -21.488 1.00 0.00 ? 61  GLN A HE21 4  
ATOM 7384  H HE22 . GLN A 1 61  ? -38.403 15.178  -22.264 1.00 0.00 ? 61  GLN A HE22 4  
ATOM 7385  N N    . ARG A 1 62  ? -39.918 13.044  -15.131 1.00 0.00 ? 62  ARG A N    4  
ATOM 7386  C CA   . ARG A 1 62  ? -40.534 13.068  -13.790 1.00 0.00 ? 62  ARG A CA   4  
ATOM 7387  C C    . ARG A 1 62  ? -39.525 12.614  -12.725 1.00 0.00 ? 62  ARG A C    4  
ATOM 7388  O O    . ARG A 1 62  ? -38.557 11.944  -13.085 1.00 0.00 ? 62  ARG A O    4  
ATOM 7389  C CB   . ARG A 1 62  ? -41.764 12.137  -13.742 1.00 0.00 ? 62  ARG A CB   4  
ATOM 7390  C CG   . ARG A 1 62  ? -43.085 12.786  -14.177 1.00 0.00 ? 62  ARG A CG   4  
ATOM 7391  C CD   . ARG A 1 62  ? -43.500 12.485  -15.621 1.00 0.00 ? 62  ARG A CD   4  
ATOM 7392  N NE   . ARG A 1 62  ? -42.975 13.476  -16.570 1.00 0.00 ? 62  ARG A NE   4  
ATOM 7393  C CZ   . ARG A 1 62  ? -43.473 14.659  -16.879 1.00 0.00 ? 62  ARG A CZ   4  
ATOM 7394  N NH1  . ARG A 1 62  ? -44.552 15.139  -16.325 1.00 0.00 ? 62  ARG A NH1  4  
ATOM 7395  N NH2  . ARG A 1 62  ? -42.865 15.381  -17.770 1.00 0.00 ? 62  ARG A NH2  4  
ATOM 7396  H H    . ARG A 1 62  ? -39.957 12.161  -15.633 1.00 0.00 ? 62  ARG A H    4  
ATOM 7397  H HA   . ARG A 1 62  ? -40.808 14.094  -13.548 1.00 0.00 ? 62  ARG A HA   4  
ATOM 7398  H HB2  . ARG A 1 62  ? -41.569 11.231  -14.317 1.00 0.00 ? 62  ARG A HB2  4  
ATOM 7399  H HB3  . ARG A 1 62  ? -41.912 11.814  -12.710 1.00 0.00 ? 62  ARG A HB3  4  
ATOM 7400  H HG2  . ARG A 1 62  ? -43.864 12.388  -13.530 1.00 0.00 ? 62  ARG A HG2  4  
ATOM 7401  H HG3  . ARG A 1 62  ? -43.039 13.861  -14.013 1.00 0.00 ? 62  ARG A HG3  4  
ATOM 7402  H HD2  . ARG A 1 62  ? -43.144 11.491  -15.895 1.00 0.00 ? 62  ARG A HD2  4  
ATOM 7403  H HD3  . ARG A 1 62  ? -44.590 12.461  -15.680 1.00 0.00 ? 62  ARG A HD3  4  
ATOM 7404  H HE   . ARG A 1 62  ? -42.137 13.229  -17.078 1.00 0.00 ? 62  ARG A HE   4  
ATOM 7405  H HH11 . ARG A 1 62  ? -45.037 14.592  -15.637 1.00 0.00 ? 62  ARG A HH11 4  
ATOM 7406  H HH12 . ARG A 1 62  ? -44.902 16.045  -16.589 1.00 0.00 ? 62  ARG A HH12 4  
ATOM 7407  H HH21 . ARG A 1 62  ? -42.035 14.998  -18.208 1.00 0.00 ? 62  ARG A HH21 4  
ATOM 7408  H HH22 . ARG A 1 62  ? -43.216 16.287  -18.034 1.00 0.00 ? 62  ARG A HH22 4  
ATOM 7409  N N    . PRO A 1 63  ? -39.734 12.908  -11.427 1.00 0.00 ? 63  PRO A N    4  
ATOM 7410  C CA   . PRO A 1 63  ? -38.917 12.359  -10.344 1.00 0.00 ? 63  PRO A CA   4  
ATOM 7411  C C    . PRO A 1 63  ? -38.881 10.822  -10.333 1.00 0.00 ? 63  PRO A C    4  
ATOM 7412  O O    . PRO A 1 63  ? -39.906 10.159  -10.509 1.00 0.00 ? 63  PRO A O    4  
ATOM 7413  C CB   . PRO A 1 63  ? -39.519 12.898  -9.040  1.00 0.00 ? 63  PRO A CB   4  
ATOM 7414  C CG   . PRO A 1 63  ? -40.270 14.154  -9.477  1.00 0.00 ? 63  PRO A CG   4  
ATOM 7415  C CD   . PRO A 1 63  ? -40.752 13.797  -10.881 1.00 0.00 ? 63  PRO A CD   4  
ATOM 7416  H HA   . PRO A 1 63  ? -37.903 12.745  -10.449 1.00 0.00 ? 63  PRO A HA   4  
ATOM 7417  H HB2  . PRO A 1 63  ? -40.234 12.184  -8.626  1.00 0.00 ? 63  PRO A HB2  4  
ATOM 7418  H HB3  . PRO A 1 63  ? -38.745 13.128  -8.306  1.00 0.00 ? 63  PRO A HB3  4  
ATOM 7419  H HG2  . PRO A 1 63  ? -41.102 14.381  -8.809  1.00 0.00 ? 63  PRO A HG2  4  
ATOM 7420  H HG3  . PRO A 1 63  ? -39.579 14.995  -9.523  1.00 0.00 ? 63  PRO A HG3  4  
ATOM 7421  H HD2  . PRO A 1 63  ? -41.703 13.268  -10.819 1.00 0.00 ? 63  PRO A HD2  4  
ATOM 7422  H HD3  . PRO A 1 63  ? -40.863 14.704  -11.475 1.00 0.00 ? 63  PRO A HD3  4  
ATOM 7423  N N    . CYS A 1 64  ? -37.707 10.255  -10.053 1.00 0.00 ? 64  CYS A N    4  
ATOM 7424  C CA   . CYS A 1 64  ? -37.499 8.823   -9.799  1.00 0.00 ? 64  CYS A CA   4  
ATOM 7425  C C    . CYS A 1 64  ? -38.154 8.336   -8.480  1.00 0.00 ? 64  CYS A C    4  
ATOM 7426  O O    . CYS A 1 64  ? -38.234 7.136   -8.219  1.00 0.00 ? 64  CYS A O    4  
ATOM 7427  C CB   . CYS A 1 64  ? -35.980 8.604   -9.829  1.00 0.00 ? 64  CYS A CB   4  
ATOM 7428  S SG   . CYS A 1 64  ? -35.552 6.844   -9.791  1.00 0.00 ? 64  CYS A SG   4  
ATOM 7429  H H    . CYS A 1 64  ? -36.891 10.858  -10.007 1.00 0.00 ? 64  CYS A H    4  
ATOM 7430  H HA   . CYS A 1 64  ? -37.951 8.249   -10.609 1.00 0.00 ? 64  CYS A HA   4  
ATOM 7431  H HB2  . CYS A 1 64  ? -35.578 9.042   -10.742 1.00 0.00 ? 64  CYS A HB2  4  
ATOM 7432  H HB3  . CYS A 1 64  ? -35.521 9.110   -8.982  1.00 0.00 ? 64  CYS A HB3  4  
ATOM 7433  H HG   . CYS A 1 64  ? -36.354 6.514   -8.764  1.00 0.00 ? 64  CYS A HG   4  
ATOM 7434  N N    . THR A 1 65  ? -38.632 9.264   -7.645  1.00 0.00 ? 65  THR A N    4  
ATOM 7435  C CA   . THR A 1 65  ? -39.296 9.061   -6.357  1.00 0.00 ? 65  THR A CA   4  
ATOM 7436  C C    . THR A 1 65  ? -40.581 8.259   -6.529  1.00 0.00 ? 65  THR A C    4  
ATOM 7437  O O    . THR A 1 65  ? -41.617 8.792   -6.931  1.00 0.00 ? 65  THR A O    4  
ATOM 7438  C CB   . THR A 1 65  ? -39.596 10.405  -5.660  1.00 0.00 ? 65  THR A CB   4  
ATOM 7439  O OG1  . THR A 1 65  ? -38.561 11.342  -5.874  1.00 0.00 ? 65  THR A OG1  4  
ATOM 7440  C CG2  . THR A 1 65  ? -39.737 10.213  -4.152  1.00 0.00 ? 65  THR A CG2  4  
ATOM 7441  H H    . THR A 1 65  ? -38.485 10.223  -7.889  1.00 0.00 ? 65  THR A H    4  
ATOM 7442  H HA   . THR A 1 65  ? -38.619 8.498   -5.716  1.00 0.00 ? 65  THR A HA   4  
ATOM 7443  H HB   . THR A 1 65  ? -40.513 10.834  -6.056  1.00 0.00 ? 65  THR A HB   4  
ATOM 7444  H HG1  . THR A 1 65  ? -38.821 12.174  -5.445  1.00 0.00 ? 65  THR A HG1  4  
ATOM 7445  H HG21 . THR A 1 65  ? -39.935 11.173  -3.674  1.00 0.00 ? 65  THR A HG21 4  
ATOM 7446  H HG22 . THR A 1 65  ? -40.564 9.540   -3.933  1.00 0.00 ? 65  THR A HG22 4  
ATOM 7447  H HG23 . THR A 1 65  ? -38.815 9.793   -3.748  1.00 0.00 ? 65  THR A HG23 4  
ATOM 7448  N N    . CYS A 1 66  ? -40.497 6.964   -6.231  1.00 0.00 ? 66  CYS A N    4  
ATOM 7449  C CA   . CYS A 1 66  ? -41.577 5.964   -6.351  1.00 0.00 ? 66  CYS A CA   4  
ATOM 7450  C C    . CYS A 1 66  ? -42.929 6.350   -5.709  1.00 0.00 ? 66  CYS A C    4  
ATOM 7451  O O    . CYS A 1 66  ? -43.939 5.711   -5.993  1.00 0.00 ? 66  CYS A O    4  
ATOM 7452  C CB   . CYS A 1 66  ? -41.110 4.612   -5.787  1.00 0.00 ? 66  CYS A CB   4  
ATOM 7453  S SG   . CYS A 1 66  ? -39.510 4.110   -6.486  1.00 0.00 ? 66  CYS A SG   4  
ATOM 7454  H H    . CYS A 1 66  ? -39.550 6.623   -6.139  1.00 0.00 ? 66  CYS A H    4  
ATOM 7455  H HA   . CYS A 1 66  ? -41.778 5.837   -7.413  1.00 0.00 ? 66  CYS A HA   4  
ATOM 7456  H HB2  . CYS A 1 66  ? -41.023 4.681   -4.701  1.00 0.00 ? 66  CYS A HB2  4  
ATOM 7457  H HB3  . CYS A 1 66  ? -41.863 3.854   -6.027  1.00 0.00 ? 66  CYS A HB3  4  
ATOM 7458  H HG   . CYS A 1 66  ? -39.889 4.060   -7.773  1.00 0.00 ? 66  CYS A HG   4  
ATOM 7459  N N    . ASP A 1 67  ? -42.978 7.396   -4.879  1.00 0.00 ? 67  ASP A N    4  
ATOM 7460  C CA   . ASP A 1 67  ? -44.214 8.038   -4.409  1.00 0.00 ? 67  ASP A CA   4  
ATOM 7461  C C    . ASP A 1 67  ? -45.137 8.436   -5.585  1.00 0.00 ? 67  ASP A C    4  
ATOM 7462  O O    . ASP A 1 67  ? -46.349 8.233   -5.524  1.00 0.00 ? 67  ASP A O    4  
ATOM 7463  C CB   . ASP A 1 67  ? -43.821 9.285   -3.602  1.00 0.00 ? 67  ASP A CB   4  
ATOM 7464  C CG   . ASP A 1 67  ? -45.045 9.996   -3.001  1.00 0.00 ? 67  ASP A CG   4  
ATOM 7465  O OD1  . ASP A 1 67  ? -45.570 9.522   -1.965  1.00 0.00 ? 67  ASP A OD1  4  
ATOM 7466  O OD2  . ASP A 1 67  ? -45.460 11.048  -3.544  1.00 0.00 ? 67  ASP A OD2  4  
ATOM 7467  H H    . ASP A 1 67  ? -42.105 7.856   -4.680  1.00 0.00 ? 67  ASP A H    4  
ATOM 7468  H HA   . ASP A 1 67  ? -44.756 7.350   -3.758  1.00 0.00 ? 67  ASP A HA   4  
ATOM 7469  H HB2  . ASP A 1 67  ? -43.141 8.997   -2.799  1.00 0.00 ? 67  ASP A HB2  4  
ATOM 7470  H HB3  . ASP A 1 67  ? -43.279 9.974   -4.254  1.00 0.00 ? 67  ASP A HB3  4  
ATOM 7471  N N    . PHE A 1 68  ? -44.559 8.887   -6.708  1.00 0.00 ? 68  PHE A N    4  
ATOM 7472  C CA   . PHE A 1 68  ? -45.256 9.150   -7.982  1.00 0.00 ? 68  PHE A CA   4  
ATOM 7473  C C    . PHE A 1 68  ? -46.032 7.924   -8.521  1.00 0.00 ? 68  PHE A C    4  
ATOM 7474  O O    . PHE A 1 68  ? -46.981 8.068   -9.295  1.00 0.00 ? 68  PHE A O    4  
ATOM 7475  C CB   . PHE A 1 68  ? -44.195 9.614   -8.997  1.00 0.00 ? 68  PHE A CB   4  
ATOM 7476  C CG   . PHE A 1 68  ? -44.702 9.873   -10.406 1.00 0.00 ? 68  PHE A CG   4  
ATOM 7477  C CD1  . PHE A 1 68  ? -45.548 10.968  -10.666 1.00 0.00 ? 68  PHE A CD1  4  
ATOM 7478  C CD2  . PHE A 1 68  ? -44.332 9.014   -11.461 1.00 0.00 ? 68  PHE A CD2  4  
ATOM 7479  C CE1  . PHE A 1 68  ? -46.034 11.194  -11.966 1.00 0.00 ? 68  PHE A CE1  4  
ATOM 7480  C CE2  . PHE A 1 68  ? -44.814 9.243   -12.763 1.00 0.00 ? 68  PHE A CE2  4  
ATOM 7481  C CZ   . PHE A 1 68  ? -45.670 10.329  -13.015 1.00 0.00 ? 68  PHE A CZ   4  
ATOM 7482  H H    . PHE A 1 68  ? -43.550 8.995   -6.705  1.00 0.00 ? 68  PHE A H    4  
ATOM 7483  H HA   . PHE A 1 68  ? -45.977 9.955   -7.831  1.00 0.00 ? 68  PHE A HA   4  
ATOM 7484  H HB2  . PHE A 1 68  ? -43.736 10.533  -8.626  1.00 0.00 ? 68  PHE A HB2  4  
ATOM 7485  H HB3  . PHE A 1 68  ? -43.409 8.858   -9.046  1.00 0.00 ? 68  PHE A HB3  4  
ATOM 7486  H HD1  . PHE A 1 68  ? -45.833 11.634  -9.862  1.00 0.00 ? 68  PHE A HD1  4  
ATOM 7487  H HD2  . PHE A 1 68  ? -43.680 8.171   -11.274 1.00 0.00 ? 68  PHE A HD2  4  
ATOM 7488  H HE1  . PHE A 1 68  ? -46.690 12.032  -12.161 1.00 0.00 ? 68  PHE A HE1  4  
ATOM 7489  H HE2  . PHE A 1 68  ? -44.533 8.580   -13.572 1.00 0.00 ? 68  PHE A HE2  4  
ATOM 7490  H HZ   . PHE A 1 68  ? -46.044 10.501  -14.016 1.00 0.00 ? 68  PHE A HZ   4  
ATOM 7491  N N    . LEU A 1 69  ? -45.648 6.722   -8.082  1.00 0.00 ? 69  LEU A N    4  
ATOM 7492  C CA   . LEU A 1 69  ? -46.196 5.419   -8.455  1.00 0.00 ? 69  LEU A CA   4  
ATOM 7493  C C    . LEU A 1 69  ? -46.852 4.701   -7.245  1.00 0.00 ? 69  LEU A C    4  
ATOM 7494  O O    . LEU A 1 69  ? -47.021 3.480   -7.274  1.00 0.00 ? 69  LEU A O    4  
ATOM 7495  C CB   . LEU A 1 69  ? -45.056 4.612   -9.133  1.00 0.00 ? 69  LEU A CB   4  
ATOM 7496  C CG   . LEU A 1 69  ? -45.402 3.785   -10.390 1.00 0.00 ? 69  LEU A CG   4  
ATOM 7497  C CD1  . LEU A 1 69  ? -46.420 2.679   -10.134 1.00 0.00 ? 69  LEU A CD1  4  
ATOM 7498  C CD2  . LEU A 1 69  ? -45.900 4.655   -11.547 1.00 0.00 ? 69  LEU A CD2  4  
ATOM 7499  H H    . LEU A 1 69  ? -44.901 6.702   -7.399  1.00 0.00 ? 69  LEU A H    4  
ATOM 7500  H HA   . LEU A 1 69  ? -46.992 5.581   -9.180  1.00 0.00 ? 69  LEU A HA   4  
ATOM 7501  H HB2  . LEU A 1 69  ? -44.266 5.301   -9.439  1.00 0.00 ? 69  LEU A HB2  4  
ATOM 7502  H HB3  . LEU A 1 69  ? -44.604 3.951   -8.393  1.00 0.00 ? 69  LEU A HB3  4  
ATOM 7503  H HG   . LEU A 1 69  ? -44.479 3.305   -10.718 1.00 0.00 ? 69  LEU A HG   4  
ATOM 7504  H HD11 . LEU A 1 69  ? -46.075 2.069   -9.304  1.00 0.00 ? 69  LEU A HD11 4  
ATOM 7505  H HD12 . LEU A 1 69  ? -47.392 3.109   -9.895  1.00 0.00 ? 69  LEU A HD12 4  
ATOM 7506  H HD13 . LEU A 1 69  ? -46.512 2.053   -11.021 1.00 0.00 ? 69  LEU A HD13 4  
ATOM 7507  H HD21 . LEU A 1 69  ? -46.870 5.090   -11.315 1.00 0.00 ? 69  LEU A HD21 4  
ATOM 7508  H HD22 . LEU A 1 69  ? -45.185 5.454   -11.740 1.00 0.00 ? 69  LEU A HD22 4  
ATOM 7509  H HD23 . LEU A 1 69  ? -45.994 4.046   -12.445 1.00 0.00 ? 69  LEU A HD23 4  
ATOM 7510  N N    . HIS A 1 70  ? -47.228 5.414   -6.166  1.00 0.00 ? 70  HIS A N    4  
ATOM 7511  C CA   . HIS A 1 70  ? -47.886 4.773   -5.015  1.00 0.00 ? 70  HIS A CA   4  
ATOM 7512  C C    . HIS A 1 70  ? -49.338 4.378   -5.348  1.00 0.00 ? 70  HIS A C    4  
ATOM 7513  O O    . HIS A 1 70  ? -50.057 5.116   -6.027  1.00 0.00 ? 70  HIS A O    4  
ATOM 7514  C CB   . HIS A 1 70  ? -47.811 5.632   -3.738  1.00 0.00 ? 70  HIS A CB   4  
ATOM 7515  C CG   . HIS A 1 70  ? -48.954 6.603   -3.518  1.00 0.00 ? 70  HIS A CG   4  
ATOM 7516  N ND1  . HIS A 1 70  ? -49.064 7.903   -4.022  1.00 0.00 ? 70  HIS A ND1  4  
ATOM 7517  C CD2  . HIS A 1 70  ? -50.065 6.331   -2.769  1.00 0.00 ? 70  HIS A CD2  4  
ATOM 7518  C CE1  . HIS A 1 70  ? -50.237 8.380   -3.570  1.00 0.00 ? 70  HIS A CE1  4  
ATOM 7519  N NE2  . HIS A 1 70  ? -50.859 7.457   -2.816  1.00 0.00 ? 70  HIS A NE2  4  
ATOM 7520  H H    . HIS A 1 70  ? -47.043 6.411   -6.123  1.00 0.00 ? 70  HIS A H    4  
ATOM 7521  H HA   . HIS A 1 70  ? -47.341 3.852   -4.806  1.00 0.00 ? 70  HIS A HA   4  
ATOM 7522  H HB2  . HIS A 1 70  ? -47.794 4.957   -2.888  1.00 0.00 ? 70  HIS A HB2  4  
ATOM 7523  H HB3  . HIS A 1 70  ? -46.867 6.176   -3.720  1.00 0.00 ? 70  HIS A HB3  4  
ATOM 7524  H HD2  . HIS A 1 70  ? -50.277 5.404   -2.252  1.00 0.00 ? 70  HIS A HD2  4  
ATOM 7525  H HE1  . HIS A 1 70  ? -50.629 9.368   -3.785  1.00 0.00 ? 70  HIS A HE1  4  
ATOM 7526  H HE2  . HIS A 1 70  ? -51.764 7.578   -2.374  1.00 0.00 ? 70  HIS A HE2  4  
ATOM 7527  N N    . GLY A 1 71  ? -49.778 3.227   -4.841  1.00 0.00 ? 71  GLY A N    4  
ATOM 7528  C CA   . GLY A 1 71  ? -51.130 2.682   -5.004  1.00 0.00 ? 71  GLY A CA   4  
ATOM 7529  C C    . GLY A 1 71  ? -51.717 2.123   -3.698  1.00 0.00 ? 71  GLY A C    4  
ATOM 7530  O O    . GLY A 1 71  ? -51.124 2.305   -2.628  1.00 0.00 ? 71  GLY A O    4  
ATOM 7531  H H    . GLY A 1 71  ? -49.135 2.688   -4.271  1.00 0.00 ? 71  GLY A H    4  
ATOM 7532  H HA2  . GLY A 1 71  ? -51.806 3.452   -5.375  1.00 0.00 ? 71  GLY A HA2  4  
ATOM 7533  H HA3  . GLY A 1 71  ? -51.094 1.881   -5.740  1.00 0.00 ? 71  GLY A HA3  4  
ATOM 7534  N N    . PRO A 1 72  ? -52.864 1.415   -3.755  1.00 0.00 ? 72  PRO A N    4  
ATOM 7535  C CA   . PRO A 1 72  ? -53.623 1.009   -2.561  1.00 0.00 ? 72  PRO A CA   4  
ATOM 7536  C C    . PRO A 1 72  ? -52.919 0.023   -1.608  1.00 0.00 ? 72  PRO A C    4  
ATOM 7537  O O    . PRO A 1 72  ? -53.398 -0.190  -0.491  1.00 0.00 ? 72  PRO A O    4  
ATOM 7538  C CB   . PRO A 1 72  ? -54.920 0.393   -3.103  1.00 0.00 ? 72  PRO A CB   4  
ATOM 7539  C CG   . PRO A 1 72  ? -55.102 1.062   -4.462  1.00 0.00 ? 72  PRO A CG   4  
ATOM 7540  C CD   . PRO A 1 72  ? -53.665 1.193   -4.954  1.00 0.00 ? 72  PRO A CD   4  
ATOM 7541  H HA   . PRO A 1 72  ? -53.873 1.910   -1.997  1.00 0.00 ? 72  PRO A HA   4  
ATOM 7542  H HB2  . PRO A 1 72  ? -54.794 -0.682  -3.248  1.00 0.00 ? 72  PRO A HB2  4  
ATOM 7543  H HB3  . PRO A 1 72  ? -55.766 0.588   -2.442  1.00 0.00 ? 72  PRO A HB3  4  
ATOM 7544  H HG2  . PRO A 1 72  ? -55.709 0.457   -5.136  1.00 0.00 ? 72  PRO A HG2  4  
ATOM 7545  H HG3  . PRO A 1 72  ? -55.540 2.053   -4.331  1.00 0.00 ? 72  PRO A HG3  4  
ATOM 7546  H HD2  . PRO A 1 72  ? -53.351 0.265   -5.435  1.00 0.00 ? 72  PRO A HD2  4  
ATOM 7547  H HD3  . PRO A 1 72  ? -53.596 2.022   -5.659  1.00 0.00 ? 72  PRO A HD3  4  
ATOM 7548  N N    . ARG A 1 73  ? -51.778 -0.554  -2.016  1.00 0.00 ? 73  ARG A N    4  
ATOM 7549  C CA   . ARG A 1 73  ? -50.917 -1.438  -1.204  1.00 0.00 ? 73  ARG A CA   4  
ATOM 7550  C C    . ARG A 1 73  ? -49.567 -0.820  -0.807  1.00 0.00 ? 73  ARG A C    4  
ATOM 7551  O O    . ARG A 1 73  ? -48.797 -1.470  -0.098  1.00 0.00 ? 73  ARG A O    4  
ATOM 7552  C CB   . ARG A 1 73  ? -50.767 -2.798  -1.918  1.00 0.00 ? 73  ARG A CB   4  
ATOM 7553  C CG   . ARG A 1 73  ? -52.075 -3.605  -1.841  1.00 0.00 ? 73  ARG A CG   4  
ATOM 7554  C CD   . ARG A 1 73  ? -51.961 -4.944  -2.577  1.00 0.00 ? 73  ARG A CD   4  
ATOM 7555  N NE   . ARG A 1 73  ? -53.183 -5.753  -2.389  1.00 0.00 ? 73  ARG A NE   4  
ATOM 7556  C CZ   . ARG A 1 73  ? -53.763 -6.565  -3.257  1.00 0.00 ? 73  ARG A CZ   4  
ATOM 7557  N NH1  . ARG A 1 73  ? -53.319 -6.750  -4.468  1.00 0.00 ? 73  ARG A NH1  4  
ATOM 7558  N NH2  . ARG A 1 73  ? -54.829 -7.228  -2.912  1.00 0.00 ? 73  ARG A NH2  4  
ATOM 7559  H H    . ARG A 1 73  ? -51.487 -0.357  -2.963  1.00 0.00 ? 73  ARG A H    4  
ATOM 7560  H HA   . ARG A 1 73  ? -51.408 -1.627  -0.247  1.00 0.00 ? 73  ARG A HA   4  
ATOM 7561  H HB2  . ARG A 1 73  ? -50.487 -2.639  -2.961  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 7562  H HB3  . ARG A 1 73  ? -49.982 -3.382  -1.436  1.00 0.00 ? 73  ARG A HB3  4  
ATOM 7563  H HG2  . ARG A 1 73  ? -52.310 -3.794  -0.793  1.00 0.00 ? 73  ARG A HG2  4  
ATOM 7564  H HG3  . ARG A 1 73  ? -52.891 -3.032  -2.285  1.00 0.00 ? 73  ARG A HG3  4  
ATOM 7565  H HD2  . ARG A 1 73  ? -51.794 -4.739  -3.632  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 7566  H HD3  . ARG A 1 73  ? -51.104 -5.496  -2.188  1.00 0.00 ? 73  ARG A HD3  4  
ATOM 7567  H HE   . ARG A 1 73  ? -53.620 -5.698  -1.483  1.00 0.00 ? 73  ARG A HE   4  
ATOM 7568  H HH11 . ARG A 1 73  ? -52.507 -6.235  -4.795  1.00 0.00 ? 73  ARG A HH11 4  
ATOM 7569  H HH12 . ARG A 1 73  ? -53.786 -7.383  -5.092  1.00 0.00 ? 73  ARG A HH12 4  
ATOM 7570  H HH21 . ARG A 1 73  ? -55.215 -7.125  -1.987  1.00 0.00 ? 73  ARG A HH21 4  
ATOM 7571  H HH22 . ARG A 1 73  ? -55.276 -7.847  -3.567  1.00 0.00 ? 73  ARG A HH22 4  
ATOM 7572  N N    . THR A 1 74  ? -49.248 0.407   -1.235  1.00 0.00 ? 74  THR A N    4  
ATOM 7573  C CA   . THR A 1 74  ? -47.934 1.024   -0.970  1.00 0.00 ? 74  THR A CA   4  
ATOM 7574  C C    . THR A 1 74  ? -47.828 1.574   0.451   1.00 0.00 ? 74  THR A C    4  
ATOM 7575  O O    . THR A 1 74  ? -48.738 2.236   0.955   1.00 0.00 ? 74  THR A O    4  
ATOM 7576  C CB   . THR A 1 74  ? -47.573 2.127   -1.977  1.00 0.00 ? 74  THR A CB   4  
ATOM 7577  O OG1  . THR A 1 74  ? -47.870 1.739   -3.297  1.00 0.00 ? 74  THR A OG1  4  
ATOM 7578  C CG2  . THR A 1 74  ? -46.080 2.463   -1.959  1.00 0.00 ? 74  THR A CG2  4  
ATOM 7579  H H    . THR A 1 74  ? -49.922 0.932   -1.781  1.00 0.00 ? 74  THR A H    4  
ATOM 7580  H HA   . THR A 1 74  ? -47.179 0.247   -1.063  1.00 0.00 ? 74  THR A HA   4  
ATOM 7581  H HB   . THR A 1 74  ? -48.146 3.019   -1.737  1.00 0.00 ? 74  THR A HB   4  
ATOM 7582  H HG1  . THR A 1 74  ? -47.056 1.399   -3.705  1.00 0.00 ? 74  THR A HG1  4  
ATOM 7583  H HG21 . THR A 1 74  ? -45.487 1.551   -2.043  1.00 0.00 ? 74  THR A HG21 4  
ATOM 7584  H HG22 . THR A 1 74  ? -45.838 3.129   -2.789  1.00 0.00 ? 74  THR A HG22 4  
ATOM 7585  H HG23 . THR A 1 74  ? -45.822 2.971   -1.030  1.00 0.00 ? 74  THR A HG23 4  
ATOM 7586  N N    . GLN A 1 75  ? -46.673 1.341   1.075   1.00 0.00 ? 75  GLN A N    4  
ATOM 7587  C CA   . GLN A 1 75  ? -46.315 1.910   2.372   1.00 0.00 ? 75  GLN A CA   4  
ATOM 7588  C C    . GLN A 1 75  ? -45.766 3.333   2.204   1.00 0.00 ? 75  GLN A C    4  
ATOM 7589  O O    . GLN A 1 75  ? -44.849 3.606   1.420   1.00 0.00 ? 75  GLN A O    4  
ATOM 7590  C CB   . GLN A 1 75  ? -45.285 1.020   3.071   1.00 0.00 ? 75  GLN A CB   4  
ATOM 7591  C CG   . GLN A 1 75  ? -45.809 -0.349  3.528   1.00 0.00 ? 75  GLN A CG   4  
ATOM 7592  C CD   . GLN A 1 75  ? -44.657 -1.315  3.804   1.00 0.00 ? 75  GLN A CD   4  
ATOM 7593  O OE1  . GLN A 1 75  ? -44.079 -1.330  4.884   1.00 0.00 ? 75  GLN A OE1  4  
ATOM 7594  N NE2  . GLN A 1 75  ? -44.261 -2.120  2.843   1.00 0.00 ? 75  GLN A NE2  4  
ATOM 7595  H H    . GLN A 1 75  ? -45.964 0.825   0.578   1.00 0.00 ? 75  GLN A H    4  
ATOM 7596  H HA   . GLN A 1 75  ? -47.206 1.951   3.003   1.00 0.00 ? 75  GLN A HA   4  
ATOM 7597  H HB2  . GLN A 1 75  ? -44.463 0.888   2.382   1.00 0.00 ? 75  GLN A HB2  4  
ATOM 7598  H HB3  . GLN A 1 75  ? -44.900 1.539   3.944   1.00 0.00 ? 75  GLN A HB3  4  
ATOM 7599  H HG2  . GLN A 1 75  ? -46.386 -0.217  4.446   1.00 0.00 ? 75  GLN A HG2  4  
ATOM 7600  H HG3  . GLN A 1 75  ? -46.459 -0.779  2.766   1.00 0.00 ? 75  GLN A HG3  4  
ATOM 7601  H HE21 . GLN A 1 75  ? -44.733 -2.129  1.955   1.00 0.00 ? 75  GLN A HE21 4  
ATOM 7602  H HE22 . GLN A 1 75  ? -43.463 -2.738  3.009   1.00 0.00 ? 75  GLN A HE22 4  
ATOM 7603  N N    . ARG A 1 76  ? -46.281 4.245   3.023   1.00 0.00 ? 76  ARG A N    4  
ATOM 7604  C CA   . ARG A 1 76  ? -45.860 5.657   3.036   1.00 0.00 ? 76  ARG A CA   4  
ATOM 7605  C C    . ARG A 1 76  ? -44.449 5.806   3.593   1.00 0.00 ? 76  ARG A C    4  
ATOM 7606  O O    . ARG A 1 76  ? -43.644 6.528   3.017   1.00 0.00 ? 76  ARG A O    4  
ATOM 7607  C CB   . ARG A 1 76  ? -46.882 6.535   3.771   1.00 0.00 ? 76  ARG A CB   4  
ATOM 7608  C CG   . ARG A 1 76  ? -48.344 6.347   3.319   1.00 0.00 ? 76  ARG A CG   4  
ATOM 7609  C CD   . ARG A 1 76  ? -48.533 6.483   1.799   1.00 0.00 ? 76  ARG A CD   4  
ATOM 7610  N NE   . ARG A 1 76  ? -49.943 6.285   1.409   1.00 0.00 ? 76  ARG A NE   4  
ATOM 7611  C CZ   . ARG A 1 76  ? -50.882 7.208   1.283   1.00 0.00 ? 76  ARG A CZ   4  
ATOM 7612  N NH1  . ARG A 1 76  ? -50.652 8.473   1.503   1.00 0.00 ? 76  ARG A NH1  4  
ATOM 7613  N NH2  . ARG A 1 76  ? -52.090 6.872   0.934   1.00 0.00 ? 76  ARG A NH2  4  
ATOM 7614  H H    . ARG A 1 76  ? -46.970 3.914   3.682   1.00 0.00 ? 76  ARG A H    4  
ATOM 7615  H HA   . ARG A 1 76  ? -45.797 6.010   2.004   1.00 0.00 ? 76  ARG A HA   4  
ATOM 7616  H HB2  . ARG A 1 76  ? -46.812 6.306   4.832   1.00 0.00 ? 76  ARG A HB2  4  
ATOM 7617  H HB3  . ARG A 1 76  ? -46.606 7.583   3.634   1.00 0.00 ? 76  ARG A HB3  4  
ATOM 7618  H HG2  . ARG A 1 76  ? -48.695 5.363   3.631   1.00 0.00 ? 76  ARG A HG2  4  
ATOM 7619  H HG3  . ARG A 1 76  ? -48.960 7.093   3.822   1.00 0.00 ? 76  ARG A HG3  4  
ATOM 7620  H HD2  . ARG A 1 76  ? -48.173 7.459   1.472   1.00 0.00 ? 76  ARG A HD2  4  
ATOM 7621  H HD3  . ARG A 1 76  ? -47.932 5.723   1.297   1.00 0.00 ? 76  ARG A HD3  4  
ATOM 7622  H HE   . ARG A 1 76  ? -50.227 5.336   1.220   1.00 0.00 ? 76  ARG A HE   4  
ATOM 7623  H HH11 . ARG A 1 76  ? -49.730 8.764   1.775   1.00 0.00 ? 76  ARG A HH11 4  
ATOM 7624  H HH12 . ARG A 1 76  ? -51.387 9.153   1.402   1.00 0.00 ? 76  ARG A HH12 4  
ATOM 7625  H HH21 . ARG A 1 76  ? -52.321 5.905   0.773   1.00 0.00 ? 76  ARG A HH21 4  
ATOM 7626  H HH22 . ARG A 1 76  ? -52.811 7.570   0.864   1.00 0.00 ? 76  ARG A HH22 4  
ATOM 7627  N N    . ARG A 1 77  ? -44.111 5.044   4.642   1.00 0.00 ? 77  ARG A N    4  
ATOM 7628  C CA   . ARG A 1 77  ? -42.738 4.900   5.169   1.00 0.00 ? 77  ARG A CA   4  
ATOM 7629  C C    . ARG A 1 77  ? -41.730 4.408   4.127   1.00 0.00 ? 77  ARG A C    4  
ATOM 7630  O O    . ARG A 1 77  ? -40.581 4.845   4.130   1.00 0.00 ? 77  ARG A O    4  
ATOM 7631  C CB   . ARG A 1 77  ? -42.743 3.988   6.408   1.00 0.00 ? 77  ARG A CB   4  
ATOM 7632  C CG   . ARG A 1 77  ? -43.197 2.535   6.169   1.00 0.00 ? 77  ARG A CG   4  
ATOM 7633  C CD   . ARG A 1 77  ? -43.241 1.727   7.469   1.00 0.00 ? 77  ARG A CD   4  
ATOM 7634  N NE   . ARG A 1 77  ? -43.488 0.298   7.203   1.00 0.00 ? 77  ARG A NE   4  
ATOM 7635  C CZ   . ARG A 1 77  ? -43.557 -0.682  8.085   1.00 0.00 ? 77  ARG A CZ   4  
ATOM 7636  N NH1  . ARG A 1 77  ? -43.419 -0.487  9.366   1.00 0.00 ? 77  ARG A NH1  4  
ATOM 7637  N NH2  . ARG A 1 77  ? -43.773 -1.893  7.666   1.00 0.00 ? 77  ARG A NH2  4  
ATOM 7638  H H    . ARG A 1 77  ? -44.859 4.530   5.086   1.00 0.00 ? 77  ARG A H    4  
ATOM 7639  H HA   . ARG A 1 77  ? -42.386 5.885   5.486   1.00 0.00 ? 77  ARG A HA   4  
ATOM 7640  H HB2  . ARG A 1 77  ? -41.730 3.970   6.806   1.00 0.00 ? 77  ARG A HB2  4  
ATOM 7641  H HB3  . ARG A 1 77  ? -43.403 4.437   7.146   1.00 0.00 ? 77  ARG A HB3  4  
ATOM 7642  H HG2  . ARG A 1 77  ? -44.197 2.539   5.744   1.00 0.00 ? 77  ARG A HG2  4  
ATOM 7643  H HG3  . ARG A 1 77  ? -42.508 2.046   5.480   1.00 0.00 ? 77  ARG A HG3  4  
ATOM 7644  H HD2  . ARG A 1 77  ? -42.288 1.838   7.990   1.00 0.00 ? 77  ARG A HD2  4  
ATOM 7645  H HD3  . ARG A 1 77  ? -44.045 2.120   8.095   1.00 0.00 ? 77  ARG A HD3  4  
ATOM 7646  H HE   . ARG A 1 77  ? -43.611 0.008   6.239   1.00 0.00 ? 77  ARG A HE   4  
ATOM 7647  H HH11 . ARG A 1 77  ? -43.255 0.445   9.705   1.00 0.00 ? 77  ARG A HH11 4  
ATOM 7648  H HH12 . ARG A 1 77  ? -43.478 -1.257  10.011  1.00 0.00 ? 77  ARG A HH12 4  
ATOM 7649  H HH21 . ARG A 1 77  ? -43.883 -2.037  6.667   1.00 0.00 ? 77  ARG A HH21 4  
ATOM 7650  H HH22 . ARG A 1 77  ? -43.831 -2.664  8.308   1.00 0.00 ? 77  ARG A HH22 4  
ATOM 7651  N N    . ALA A 1 78  ? -42.157 3.527   3.227   1.00 0.00 ? 78  ALA A N    4  
ATOM 7652  C CA   . ALA A 1 78  ? -41.340 3.047   2.110   1.00 0.00 ? 78  ALA A CA   4  
ATOM 7653  C C    . ALA A 1 78  ? -41.090 4.171   1.090   1.00 0.00 ? 78  ALA A C    4  
ATOM 7654  O O    . ALA A 1 78  ? -39.941 4.485   0.753   1.00 0.00 ? 78  ALA A O    4  
ATOM 7655  C CB   . ALA A 1 78  ? -42.026 1.832   1.469   1.00 0.00 ? 78  ALA A CB   4  
ATOM 7656  H H    . ALA A 1 78  ? -43.109 3.210   3.312   1.00 0.00 ? 78  ALA A H    4  
ATOM 7657  H HA   . ALA A 1 78  ? -40.370 2.721   2.492   1.00 0.00 ? 78  ALA A HA   4  
ATOM 7658  H HB1  . ALA A 1 78  ? -41.408 1.474   0.661   1.00 0.00 ? 78  ALA A HB1  4  
ATOM 7659  H HB2  . ALA A 1 78  ? -42.145 1.029   2.195   1.00 0.00 ? 78  ALA A HB2  4  
ATOM 7660  H HB3  . ALA A 1 78  ? -42.984 2.080   1.015   1.00 0.00 ? 78  ALA A HB3  4  
ATOM 7661  N N    . ALA A 1 79  ? -42.170 4.846   0.673   1.00 0.00 ? 79  ALA A N    4  
ATOM 7662  C CA   . ALA A 1 79  ? -42.067 5.958   -0.277  1.00 0.00 ? 79  ALA A CA   4  
ATOM 7663  C C    . ALA A 1 79  ? -41.254 7.138   0.295   1.00 0.00 ? 79  ALA A C    4  
ATOM 7664  O O    . ALA A 1 79  ? -40.481 7.777   -0.422  1.00 0.00 ? 79  ALA A O    4  
ATOM 7665  C CB   . ALA A 1 79  ? -43.485 6.383   -0.667  1.00 0.00 ? 79  ALA A CB   4  
ATOM 7666  H H    . ALA A 1 79  ? -43.088 4.591   1.046   1.00 0.00 ? 79  ALA A H    4  
ATOM 7667  H HA   . ALA A 1 79  ? -41.541 5.609   -1.169  1.00 0.00 ? 79  ALA A HA   4  
ATOM 7668  H HB1  . ALA A 1 79  ? -44.013 6.764   0.208   1.00 0.00 ? 79  ALA A HB1  4  
ATOM 7669  H HB2  . ALA A 1 79  ? -43.433 7.171   -1.415  1.00 0.00 ? 79  ALA A HB2  4  
ATOM 7670  H HB3  . ALA A 1 79  ? -44.031 5.533   -1.080  1.00 0.00 ? 79  ALA A HB3  4  
ATOM 7671  N N    . ALA A 1 80  ? -41.371 7.377   1.604   1.00 0.00 ? 80  ALA A N    4  
ATOM 7672  C CA   . ALA A 1 80  ? -40.635 8.400   2.331   1.00 0.00 ? 80  ALA A CA   4  
ATOM 7673  C C    . ALA A 1 80  ? -39.138 8.078   2.419   1.00 0.00 ? 80  ALA A C    4  
ATOM 7674  O O    . ALA A 1 80  ? -38.331 8.915   2.021   1.00 0.00 ? 80  ALA A O    4  
ATOM 7675  C CB   . ALA A 1 80  ? -41.262 8.559   3.717   1.00 0.00 ? 80  ALA A CB   4  
ATOM 7676  H H    . ALA A 1 80  ? -42.071 6.854   2.119   1.00 0.00 ? 80  ALA A H    4  
ATOM 7677  H HA   . ALA A 1 80  ? -40.746 9.342   1.793   1.00 0.00 ? 80  ALA A HA   4  
ATOM 7678  H HB1  . ALA A 1 80  ? -42.309 8.844   3.613   1.00 0.00 ? 80  ALA A HB1  4  
ATOM 7679  H HB2  . ALA A 1 80  ? -41.198 7.616   4.261   1.00 0.00 ? 80  ALA A HB2  4  
ATOM 7680  H HB3  . ALA A 1 80  ? -40.733 9.333   4.272   1.00 0.00 ? 80  ALA A HB3  4  
ATOM 7681  N N    . GLN A 1 81  ? -38.748 6.885   2.892   1.00 0.00 ? 81  GLN A N    4  
ATOM 7682  C CA   . GLN A 1 81  ? -37.355 6.399   2.853   1.00 0.00 ? 81  GLN A CA   4  
ATOM 7683  C C    . GLN A 1 81  ? -36.720 6.529   1.461   1.00 0.00 ? 81  GLN A C    4  
ATOM 7684  O O    . GLN A 1 81  ? -35.575 6.973   1.340   1.00 0.00 ? 81  GLN A O    4  
ATOM 7685  C CB   . GLN A 1 81  ? -37.287 4.948   3.350   1.00 0.00 ? 81  GLN A CB   4  
ATOM 7686  C CG   . GLN A 1 81  ? -37.380 4.869   4.880   1.00 0.00 ? 81  GLN A CG   4  
ATOM 7687  C CD   . GLN A 1 81  ? -37.529 3.428   5.357   1.00 0.00 ? 81  GLN A CD   4  
ATOM 7688  O OE1  . GLN A 1 81  ? -36.590 2.779   5.801   1.00 0.00 ? 81  GLN A OE1  4  
ATOM 7689  N NE2  . GLN A 1 81  ? -38.719 2.874   5.270   1.00 0.00 ? 81  GLN A NE2  4  
ATOM 7690  H H    . GLN A 1 81  ? -39.460 6.250   3.237   1.00 0.00 ? 81  GLN A H    4  
ATOM 7691  H HA   . GLN A 1 81  ? -36.750 7.007   3.525   1.00 0.00 ? 81  GLN A HA   4  
ATOM 7692  H HB2  . GLN A 1 81  ? -38.090 4.370   2.891   1.00 0.00 ? 81  GLN A HB2  4  
ATOM 7693  H HB3  . GLN A 1 81  ? -36.334 4.509   3.050   1.00 0.00 ? 81  GLN A HB3  4  
ATOM 7694  H HG2  . GLN A 1 81  ? -36.480 5.302   5.320   1.00 0.00 ? 81  GLN A HG2  4  
ATOM 7695  H HG3  . GLN A 1 81  ? -38.237 5.445   5.232   1.00 0.00 ? 81  GLN A HG3  4  
ATOM 7696  H HE21 . GLN A 1 81  ? -39.480 3.428   4.899   1.00 0.00 ? 81  GLN A HE21 4  
ATOM 7697  H HE22 . GLN A 1 81  ? -38.836 1.922   5.577   1.00 0.00 ? 81  GLN A HE22 4  
ATOM 7698  N N    . ILE A 1 82  ? -37.473 6.226   0.397   1.00 0.00 ? 82  ILE A N    4  
ATOM 7699  C CA   . ILE A 1 82  ? -36.985 6.431   -0.971  1.00 0.00 ? 82  ILE A CA   4  
ATOM 7700  C C    . ILE A 1 82  ? -36.743 7.910   -1.251  1.00 0.00 ? 82  ILE A C    4  
ATOM 7701  O O    . ILE A 1 82  ? -35.647 8.266   -1.673  1.00 0.00 ? 82  ILE A O    4  
ATOM 7702  C CB   . ILE A 1 82  ? -37.934 5.775   -1.980  1.00 0.00 ? 82  ILE A CB   4  
ATOM 7703  C CG1  . ILE A 1 82  ? -37.643 4.264   -1.944  1.00 0.00 ? 82  ILE A CG1  4  
ATOM 7704  C CG2  . ILE A 1 82  ? -37.747 6.365   -3.388  1.00 0.00 ? 82  ILE A CG2  4  
ATOM 7705  C CD1  . ILE A 1 82  ? -38.787 3.449   -2.522  1.00 0.00 ? 82  ILE A CD1  4  
ATOM 7706  H H    . ILE A 1 82  ? -38.414 5.865   0.533   1.00 0.00 ? 82  ILE A H    4  
ATOM 7707  H HA   . ILE A 1 82  ? -36.017 5.941   -1.068  1.00 0.00 ? 82  ILE A HA   4  
ATOM 7708  H HB   . ILE A 1 82  ? -38.964 5.960   -1.670  1.00 0.00 ? 82  ILE A HB   4  
ATOM 7709  H HG12 . ILE A 1 82  ? -36.722 4.044   -2.487  1.00 0.00 ? 82  ILE A HG12 4  
ATOM 7710  H HG13 . ILE A 1 82  ? -37.515 3.938   -0.913  1.00 0.00 ? 82  ILE A HG13 4  
ATOM 7711  H HG21 . ILE A 1 82  ? -38.343 5.818   -4.115  1.00 0.00 ? 82  ILE A HG21 4  
ATOM 7712  H HG22 . ILE A 1 82  ? -38.071 7.408   -3.387  1.00 0.00 ? 82  ILE A HG22 4  
ATOM 7713  H HG23 . ILE A 1 82  ? -36.693 6.323   -3.665  1.00 0.00 ? 82  ILE A HG23 4  
ATOM 7714  H HD11 . ILE A 1 82  ? -38.572 2.395   -2.354  1.00 0.00 ? 82  ILE A HD11 4  
ATOM 7715  H HD12 . ILE A 1 82  ? -39.706 3.733   -2.010  1.00 0.00 ? 82  ILE A HD12 4  
ATOM 7716  H HD13 . ILE A 1 82  ? -38.884 3.633   -3.590  1.00 0.00 ? 82  ILE A HD13 4  
ATOM 7717  N N    . ALA A 1 83  ? -37.708 8.782   -0.953  1.00 0.00 ? 83  ALA A N    4  
ATOM 7718  C CA   . ALA A 1 83  ? -37.518 10.228  -1.062  1.00 0.00 ? 83  ALA A CA   4  
ATOM 7719  C C    . ALA A 1 83  ? -36.258 10.700  -0.318  1.00 0.00 ? 83  ALA A C    4  
ATOM 7720  O O    . ALA A 1 83  ? -35.504 11.503  -0.864  1.00 0.00 ? 83  ALA A O    4  
ATOM 7721  C CB   . ALA A 1 83  ? -38.770 10.943  -0.552  1.00 0.00 ? 83  ALA A CB   4  
ATOM 7722  H H    . ALA A 1 83  ? -38.599 8.427   -0.622  1.00 0.00 ? 83  ALA A H    4  
ATOM 7723  H HA   . ALA A 1 83  ? -37.384 10.480  -2.114  1.00 0.00 ? 83  ALA A HA   4  
ATOM 7724  H HB1  . ALA A 1 83  ? -39.647 10.565  -1.076  1.00 0.00 ? 83  ALA A HB1  4  
ATOM 7725  H HB2  . ALA A 1 83  ? -38.888 10.779  0.516   1.00 0.00 ? 83  ALA A HB2  4  
ATOM 7726  H HB3  . ALA A 1 83  ? -38.664 12.015  -0.726  1.00 0.00 ? 83  ALA A HB3  4  
ATOM 7727  N N    . GLN A 1 84  ? -35.980 10.139  0.869   1.00 0.00 ? 84  GLN A N    4  
ATOM 7728  C CA   . GLN A 1 84  ? -34.759 10.434  1.634   1.00 0.00 ? 84  GLN A CA   4  
ATOM 7729  C C    . GLN A 1 84  ? -33.496 9.992   0.878   1.00 0.00 ? 84  GLN A C    4  
ATOM 7730  O O    . GLN A 1 84  ? -32.498 10.724  0.833   1.00 0.00 ? 84  GLN A O    4  
ATOM 7731  C CB   . GLN A 1 84  ? -34.771 9.831   3.053   1.00 0.00 ? 84  GLN A CB   4  
ATOM 7732  C CG   . GLN A 1 84  ? -35.999 10.075  3.940   1.00 0.00 ? 84  GLN A CG   4  
ATOM 7733  C CD   . GLN A 1 84  ? -36.606 11.470  3.817   1.00 0.00 ? 84  GLN A CD   4  
ATOM 7734  O OE1  . GLN A 1 84  ? -36.091 12.454  4.330   1.00 0.00 ? 84  GLN A OE1  4  
ATOM 7735  N NE2  . GLN A 1 84  ? -37.722 11.603  3.131   1.00 0.00 ? 84  GLN A NE2  4  
ATOM 7736  H H    . GLN A 1 84  ? -36.607 9.410   1.189   1.00 0.00 ? 84  GLN A H    4  
ATOM 7737  H HA   . GLN A 1 84  ? -34.708 11.510  1.769   1.00 0.00 ? 84  GLN A HA   4  
ATOM 7738  H HB2  . GLN A 1 84  ? -34.605 8.756   2.993   1.00 0.00 ? 84  GLN A HB2  4  
ATOM 7739  H HB3  . GLN A 1 84  ? -33.922 10.252  3.580   1.00 0.00 ? 84  GLN A HB3  4  
ATOM 7740  H HG2  . GLN A 1 84  ? -36.745 9.330   3.714   1.00 0.00 ? 84  GLN A HG2  4  
ATOM 7741  H HG3  . GLN A 1 84  ? -35.721 9.908   4.979   1.00 0.00 ? 84  GLN A HG3  4  
ATOM 7742  H HE21 . GLN A 1 84  ? -38.132 10.786  2.693   1.00 0.00 ? 84  GLN A HE21 4  
ATOM 7743  H HE22 . GLN A 1 84  ? -38.136 12.519  3.052   1.00 0.00 ? 84  GLN A HE22 4  
ATOM 7744  N N    . ALA A 1 85  ? -33.548 8.831   0.217   1.00 0.00 ? 85  ALA A N    4  
ATOM 7745  C CA   . ALA A 1 85  ? -32.433 8.337   -0.581  1.00 0.00 ? 85  ALA A CA   4  
ATOM 7746  C C    . ALA A 1 85  ? -32.193 9.170   -1.847  1.00 0.00 ? 85  ALA A C    4  
ATOM 7747  O O    . ALA A 1 85  ? -31.050 9.285   -2.293  1.00 0.00 ? 85  ALA A O    4  
ATOM 7748  C CB   . ALA A 1 85  ? -32.657 6.851   -0.892  1.00 0.00 ? 85  ALA A CB   4  
ATOM 7749  H H    . ALA A 1 85  ? -34.416 8.293   0.211   1.00 0.00 ? 85  ALA A H    4  
ATOM 7750  H HA   . ALA A 1 85  ? -31.532 8.448   0.012   1.00 0.00 ? 85  ALA A HA   4  
ATOM 7751  H HB1  . ALA A 1 85  ? -32.773 6.293   0.039   1.00 0.00 ? 85  ALA A HB1  4  
ATOM 7752  H HB2  . ALA A 1 85  ? -33.549 6.720   -1.503  1.00 0.00 ? 85  ALA A HB2  4  
ATOM 7753  H HB3  . ALA A 1 85  ? -31.798 6.460   -1.436  1.00 0.00 ? 85  ALA A HB3  4  
ATOM 7754  N N    . LEU A 1 86  ? -33.245 9.789   -2.393  1.00 0.00 ? 86  LEU A N    4  
ATOM 7755  C CA   . LEU A 1 86  ? -33.142 10.583  -3.615  1.00 0.00 ? 86  LEU A CA   4  
ATOM 7756  C C    . LEU A 1 86  ? -32.680 12.019  -3.329  1.00 0.00 ? 86  LEU A C    4  
ATOM 7757  O O    . LEU A 1 86  ? -31.811 12.529  -4.039  1.00 0.00 ? 86  LEU A O    4  
ATOM 7758  C CB   . LEU A 1 86  ? -34.448 10.532  -4.419  1.00 0.00 ? 86  LEU A CB   4  
ATOM 7759  C CG   . LEU A 1 86  ? -35.027 9.136   -4.735  1.00 0.00 ? 86  LEU A CG   4  
ATOM 7760  C CD1  . LEU A 1 86  ? -35.733 9.195   -6.085  1.00 0.00 ? 86  LEU A CD1  4  
ATOM 7761  C CD2  . LEU A 1 86  ? -34.026 7.981   -4.863  1.00 0.00 ? 86  LEU A CD2  4  
ATOM 7762  H H    . LEU A 1 86  ? -34.165 9.591   -2.011  1.00 0.00 ? 86  LEU A H    4  
ATOM 7763  H HA   . LEU A 1 86  ? -32.373 10.132  -4.240  1.00 0.00 ? 86  LEU A HA   4  
ATOM 7764  H HB2  . LEU A 1 86  ? -35.214 11.108  -3.899  1.00 0.00 ? 86  LEU A HB2  4  
ATOM 7765  H HB3  . LEU A 1 86  ? -34.245 11.042  -5.360  1.00 0.00 ? 86  LEU A HB3  4  
ATOM 7766  H HG   . LEU A 1 86  ? -35.765 8.893   -3.969  1.00 0.00 ? 86  LEU A HG   4  
ATOM 7767  H HD11 . LEU A 1 86  ? -36.440 10.019  -6.083  1.00 0.00 ? 86  LEU A HD11 4  
ATOM 7768  H HD12 . LEU A 1 86  ? -34.998 9.362   -6.871  1.00 0.00 ? 86  LEU A HD12 4  
ATOM 7769  H HD13 . LEU A 1 86  ? -36.258 8.259   -6.269  1.00 0.00 ? 86  LEU A HD13 4  
ATOM 7770  H HD21 . LEU A 1 86  ? -34.552 7.083   -5.176  1.00 0.00 ? 86  LEU A HD21 4  
ATOM 7771  H HD22 . LEU A 1 86  ? -33.254 8.228   -5.591  1.00 0.00 ? 86  LEU A HD22 4  
ATOM 7772  H HD23 . LEU A 1 86  ? -33.566 7.761   -3.905  1.00 0.00 ? 86  LEU A HD23 4  
ATOM 7773  N N    . LEU A 1 87  ? -33.171 12.646  -2.247  1.00 0.00 ? 87  LEU A N    4  
ATOM 7774  C CA   . LEU A 1 87  ? -32.610 13.926  -1.774  1.00 0.00 ? 87  LEU A CA   4  
ATOM 7775  C C    . LEU A 1 87  ? -31.171 13.776  -1.267  1.00 0.00 ? 87  LEU A C    4  
ATOM 7776  O O    . LEU A 1 87  ? -30.390 14.726  -1.362  1.00 0.00 ? 87  LEU A O    4  
ATOM 7777  C CB   . LEU A 1 87  ? -33.500 14.640  -0.739  1.00 0.00 ? 87  LEU A CB   4  
ATOM 7778  C CG   . LEU A 1 87  ? -33.893 13.875  0.535   1.00 0.00 ? 87  LEU A CG   4  
ATOM 7779  C CD1  . LEU A 1 87  ? -33.044 14.252  1.745   1.00 0.00 ? 87  LEU A CD1  4  
ATOM 7780  C CD2  . LEU A 1 87  ? -35.343 14.200  0.916   1.00 0.00 ? 87  LEU A CD2  4  
ATOM 7781  H H    . LEU A 1 87  ? -33.898 12.178  -1.713  1.00 0.00 ? 87  LEU A H    4  
ATOM 7782  H HA   . LEU A 1 87  ? -32.552 14.591  -2.637  1.00 0.00 ? 87  LEU A HA   4  
ATOM 7783  H HB2  . LEU A 1 87  ? -32.971 15.537  -0.423  1.00 0.00 ? 87  LEU A HB2  4  
ATOM 7784  H HB3  . LEU A 1 87  ? -34.404 14.945  -1.262  1.00 0.00 ? 87  LEU A HB3  4  
ATOM 7785  H HG   . LEU A 1 87  ? -33.793 12.816  0.358   1.00 0.00 ? 87  LEU A HG   4  
ATOM 7786  H HD11 . LEU A 1 87  ? -33.174 15.308  1.979   1.00 0.00 ? 87  LEU A HD11 4  
ATOM 7787  H HD12 . LEU A 1 87  ? -33.367 13.655  2.598   1.00 0.00 ? 87  LEU A HD12 4  
ATOM 7788  H HD13 . LEU A 1 87  ? -31.995 14.055  1.540   1.00 0.00 ? 87  LEU A HD13 4  
ATOM 7789  H HD21 . LEU A 1 87  ? -36.012 13.906  0.108   1.00 0.00 ? 87  LEU A HD21 4  
ATOM 7790  H HD22 . LEU A 1 87  ? -35.626 13.657  1.815   1.00 0.00 ? 87  LEU A HD22 4  
ATOM 7791  H HD23 . LEU A 1 87  ? -35.453 15.270  1.095   1.00 0.00 ? 87  LEU A HD23 4  
ATOM 7792  N N    . GLY A 1 88  ? -30.808 12.595  -0.757  1.00 0.00 ? 88  GLY A N    4  
ATOM 7793  C CA   . GLY A 1 88  ? -29.417 12.253  -0.456  1.00 0.00 ? 88  GLY A CA   4  
ATOM 7794  C C    . GLY A 1 88  ? -29.110 12.163  1.035   1.00 0.00 ? 88  GLY A C    4  
ATOM 7795  O O    . GLY A 1 88  ? -27.938 12.237  1.410   1.00 0.00 ? 88  GLY A O    4  
ATOM 7796  H H    . GLY A 1 88  ? -31.520 11.881  -0.611  1.00 0.00 ? 88  GLY A H    4  
ATOM 7797  H HA2  . GLY A 1 88  ? -29.207 11.276  -0.894  1.00 0.00 ? 88  GLY A HA2  4  
ATOM 7798  H HA3  . GLY A 1 88  ? -28.733 12.973  -0.907  1.00 0.00 ? 88  GLY A HA3  4  
ATOM 7799  N N    . ALA A 1 89  ? -30.133 12.010  1.888   1.00 0.00 ? 89  ALA A N    4  
ATOM 7800  C CA   . ALA A 1 89  ? -29.931 11.698  3.307   1.00 0.00 ? 89  ALA A CA   4  
ATOM 7801  C C    . ALA A 1 89  ? -29.033 10.449  3.459   1.00 0.00 ? 89  ALA A C    4  
ATOM 7802  O O    . ALA A 1 89  ? -28.032 10.472  4.178   1.00 0.00 ? 89  ALA A O    4  
ATOM 7803  C CB   . ALA A 1 89  ? -31.287 11.493  3.986   1.00 0.00 ? 89  ALA A CB   4  
ATOM 7804  H H    . ALA A 1 89  ? -31.081 11.999  1.515   1.00 0.00 ? 89  ALA A H    4  
ATOM 7805  H HA   . ALA A 1 89  ? -29.443 12.552  3.774   1.00 0.00 ? 89  ALA A HA   4  
ATOM 7806  H HB1  . ALA A 1 89  ? -31.786 10.634  3.545   1.00 0.00 ? 89  ALA A HB1  4  
ATOM 7807  H HB2  . ALA A 1 89  ? -31.135 11.304  5.050   1.00 0.00 ? 89  ALA A HB2  4  
ATOM 7808  H HB3  . ALA A 1 89  ? -31.903 12.383  3.872   1.00 0.00 ? 89  ALA A HB3  4  
ATOM 7809  N N    . GLU A 1 90  ? -29.380 9.374   2.738   1.00 0.00 ? 90  GLU A N    4  
ATOM 7810  C CA   . GLU A 1 90  ? -28.558 8.177   2.527   1.00 0.00 ? 90  GLU A CA   4  
ATOM 7811  C C    . GLU A 1 90  ? -29.061 7.346   1.333   1.00 0.00 ? 90  GLU A C    4  
ATOM 7812  O O    . GLU A 1 90  ? -30.233 6.991   1.247   1.00 0.00 ? 90  GLU A O    4  
ATOM 7813  C CB   . GLU A 1 90  ? -28.483 7.292   3.783   1.00 0.00 ? 90  GLU A CB   4  
ATOM 7814  C CG   . GLU A 1 90  ? -29.834 6.955   4.436   1.00 0.00 ? 90  GLU A CG   4  
ATOM 7815  C CD   . GLU A 1 90  ? -29.625 6.152   5.735   1.00 0.00 ? 90  GLU A CD   4  
ATOM 7816  O OE1  . GLU A 1 90  ? -29.472 4.907   5.669   1.00 0.00 ? 90  GLU A OE1  4  
ATOM 7817  O OE2  . GLU A 1 90  ? -29.617 6.756   6.835   1.00 0.00 ? 90  GLU A OE2  4  
ATOM 7818  H H    . GLU A 1 90  ? -30.242 9.428   2.214   1.00 0.00 ? 90  GLU A H    4  
ATOM 7819  H HA   . GLU A 1 90  ? -27.540 8.499   2.298   1.00 0.00 ? 90  GLU A HA   4  
ATOM 7820  H HB2  . GLU A 1 90  ? -27.975 6.372   3.492   1.00 0.00 ? 90  GLU A HB2  4  
ATOM 7821  H HB3  . GLU A 1 90  ? -27.857 7.793   4.521   1.00 0.00 ? 90  GLU A HB3  4  
ATOM 7822  H HG2  . GLU A 1 90  ? -30.375 7.881   4.656   1.00 0.00 ? 90  GLU A HG2  4  
ATOM 7823  H HG3  . GLU A 1 90  ? -30.445 6.375   3.743   1.00 0.00 ? 90  GLU A HG3  4  
ATOM 7824  N N    . GLU A 1 91  ? -28.157 6.985   0.424   1.00 0.00 ? 91  GLU A N    4  
ATOM 7825  C CA   . GLU A 1 91  ? -28.403 6.065   -0.698  1.00 0.00 ? 91  GLU A CA   4  
ATOM 7826  C C    . GLU A 1 91  ? -28.619 4.650   -0.135  1.00 0.00 ? 91  GLU A C    4  
ATOM 7827  O O    . GLU A 1 91  ? -27.734 4.074   0.505   1.00 0.00 ? 91  GLU A O    4  
ATOM 7828  C CB   . GLU A 1 91  ? -27.202 6.161   -1.651  1.00 0.00 ? 91  GLU A CB   4  
ATOM 7829  C CG   . GLU A 1 91  ? -27.183 5.092   -2.747  1.00 0.00 ? 91  GLU A CG   4  
ATOM 7830  C CD   . GLU A 1 91  ? -26.293 3.867   -2.447  1.00 0.00 ? 91  GLU A CD   4  
ATOM 7831  O OE1  . GLU A 1 91  ? -25.145 4.026   -1.971  1.00 0.00 ? 91  GLU A OE1  4  
ATOM 7832  O OE2  . GLU A 1 91  ? -26.696 2.735   -2.808  1.00 0.00 ? 91  GLU A OE2  4  
ATOM 7833  H H    . GLU A 1 91  ? -27.197 7.217   0.627   1.00 0.00 ? 91  GLU A H    4  
ATOM 7834  H HA   . GLU A 1 91  ? -29.302 6.348   -1.277  1.00 0.00 ? 91  GLU A HA   4  
ATOM 7835  H HB2  . GLU A 1 91  ? -27.265 7.130   -2.147  1.00 0.00 ? 91  GLU A HB2  4  
ATOM 7836  H HB3  . GLU A 1 91  ? -26.270 6.144   -1.086  1.00 0.00 ? 91  GLU A HB3  4  
ATOM 7837  H HG2  . GLU A 1 91  ? -28.209 4.771   -2.936  1.00 0.00 ? 91  GLU A HG2  4  
ATOM 7838  H HG3  . GLU A 1 91  ? -26.816 5.566   -3.659  1.00 0.00 ? 91  GLU A HG3  4  
ATOM 7839  N N    . ARG A 1 92  ? -29.826 4.118   -0.346  1.00 0.00 ? 92  ARG A N    4  
ATOM 7840  C CA   . ARG A 1 92  ? -30.325 2.888   0.288   1.00 0.00 ? 92  ARG A CA   4  
ATOM 7841  C C    . ARG A 1 92  ? -31.353 2.171   -0.596  1.00 0.00 ? 92  ARG A C    4  
ATOM 7842  O O    . ARG A 1 92  ? -32.201 2.817   -1.214  1.00 0.00 ? 92  ARG A O    4  
ATOM 7843  C CB   . ARG A 1 92  ? -30.924 3.281   1.662   1.00 0.00 ? 92  ARG A CB   4  
ATOM 7844  C CG   . ARG A 1 92  ? -31.608 2.147   2.441   1.00 0.00 ? 92  ARG A CG   4  
ATOM 7845  C CD   . ARG A 1 92  ? -30.654 1.031   2.892   1.00 0.00 ? 92  ARG A CD   4  
ATOM 7846  N NE   . ARG A 1 92  ? -31.390 -0.234  3.078   1.00 0.00 ? 92  ARG A NE   4  
ATOM 7847  C CZ   . ARG A 1 92  ? -31.109 -1.226  3.902   1.00 0.00 ? 92  ARG A CZ   4  
ATOM 7848  N NH1  . ARG A 1 92  ? -30.093 -1.195  4.717   1.00 0.00 ? 92  ARG A NH1  4  
ATOM 7849  N NH2  . ARG A 1 92  ? -31.862 -2.287  3.912   1.00 0.00 ? 92  ARG A NH2  4  
ATOM 7850  H H    . ARG A 1 92  ? -30.481 4.664   -0.890  1.00 0.00 ? 92  ARG A H    4  
ATOM 7851  H HA   . ARG A 1 92  ? -29.483 2.211   0.442   1.00 0.00 ? 92  ARG A HA   4  
ATOM 7852  H HB2  . ARG A 1 92  ? -30.136 3.705   2.286   1.00 0.00 ? 92  ARG A HB2  4  
ATOM 7853  H HB3  . ARG A 1 92  ? -31.670 4.063   1.501   1.00 0.00 ? 92  ARG A HB3  4  
ATOM 7854  H HG2  . ARG A 1 92  ? -32.085 2.568   3.327   1.00 0.00 ? 92  ARG A HG2  4  
ATOM 7855  H HG3  . ARG A 1 92  ? -32.397 1.729   1.821   1.00 0.00 ? 92  ARG A HG3  4  
ATOM 7856  H HD2  . ARG A 1 92  ? -29.880 0.871   2.140   1.00 0.00 ? 92  ARG A HD2  4  
ATOM 7857  H HD3  . ARG A 1 92  ? -30.170 1.345   3.818   1.00 0.00 ? 92  ARG A HD3  4  
ATOM 7858  H HE   . ARG A 1 92  ? -32.186 -0.385  2.467   1.00 0.00 ? 92  ARG A HE   4  
ATOM 7859  H HH11 . ARG A 1 92  ? -29.492 -0.389  4.722   1.00 0.00 ? 92  ARG A HH11 4  
ATOM 7860  H HH12 . ARG A 1 92  ? -29.905 -1.969  5.333   1.00 0.00 ? 92  ARG A HH12 4  
ATOM 7861  H HH21 . ARG A 1 92  ? -32.653 -2.344  3.289   1.00 0.00 ? 92  ARG A HH21 4  
ATOM 7862  H HH22 . ARG A 1 92  ? -31.660 -3.051  4.534   1.00 0.00 ? 92  ARG A HH22 4  
ATOM 7863  N N    . LYS A 1 93  ? -31.314 0.833   -0.588  1.00 0.00 ? 93  LYS A N    4  
ATOM 7864  C CA   . LYS A 1 93  ? -32.328 -0.055  -1.183  1.00 0.00 ? 93  LYS A CA   4  
ATOM 7865  C C    . LYS A 1 93  ? -33.492 -0.267  -0.213  1.00 0.00 ? 93  LYS A C    4  
ATOM 7866  O O    . LYS A 1 93  ? -33.280 -0.591  0.958   1.00 0.00 ? 93  LYS A O    4  
ATOM 7867  C CB   . LYS A 1 93  ? -31.661 -1.365  -1.608  1.00 0.00 ? 93  LYS A CB   4  
ATOM 7868  C CG   . LYS A 1 93  ? -32.583 -2.317  -2.374  1.00 0.00 ? 93  LYS A CG   4  
ATOM 7869  C CD   . LYS A 1 93  ? -32.030 -3.745  -2.367  1.00 0.00 ? 93  LYS A CD   4  
ATOM 7870  C CE   . LYS A 1 93  ? -30.650 -3.833  -3.033  1.00 0.00 ? 93  LYS A CE   4  
ATOM 7871  N NZ   . LYS A 1 93  ? -30.187 -5.239  -3.141  1.00 0.00 ? 93  LYS A NZ   4  
ATOM 7872  H H    . LYS A 1 93  ? -30.586 0.401   -0.037  1.00 0.00 ? 93  LYS A H    4  
ATOM 7873  H HA   . LYS A 1 93  ? -32.721 0.402   -2.088  1.00 0.00 ? 93  LYS A HA   4  
ATOM 7874  H HB2  . LYS A 1 93  ? -30.840 -1.124  -2.280  1.00 0.00 ? 93  LYS A HB2  4  
ATOM 7875  H HB3  . LYS A 1 93  ? -31.279 -1.869  -0.722  1.00 0.00 ? 93  LYS A HB3  4  
ATOM 7876  H HG2  . LYS A 1 93  ? -33.576 -2.330  -1.930  1.00 0.00 ? 93  LYS A HG2  4  
ATOM 7877  H HG3  . LYS A 1 93  ? -32.663 -1.967  -3.400  1.00 0.00 ? 93  LYS A HG3  4  
ATOM 7878  H HD2  . LYS A 1 93  ? -31.964 -4.082  -1.333  1.00 0.00 ? 93  LYS A HD2  4  
ATOM 7879  H HD3  . LYS A 1 93  ? -32.736 -4.385  -2.892  1.00 0.00 ? 93  LYS A HD3  4  
ATOM 7880  H HE2  . LYS A 1 93  ? -30.721 -3.394  -4.032  1.00 0.00 ? 93  LYS A HE2  4  
ATOM 7881  H HE3  . LYS A 1 93  ? -29.933 -3.246  -2.451  1.00 0.00 ? 93  LYS A HE3  4  
ATOM 7882  H HZ1  . LYS A 1 93  ? -29.270 -5.292  -3.563  1.00 0.00 ? 93  LYS A HZ1  4  
ATOM 7883  H HZ2  . LYS A 1 93  ? -30.155 -5.699  -2.242  1.00 0.00 ? 93  LYS A HZ2  4  
ATOM 7884  H HZ3  . LYS A 1 93  ? -30.823 -5.760  -3.748  1.00 0.00 ? 93  LYS A HZ3  4  
ATOM 7885  N N    . VAL A 1 94  ? -34.714 -0.092  -0.705  1.00 0.00 ? 94  VAL A N    4  
ATOM 7886  C CA   . VAL A 1 94  ? -35.969 -0.184  0.065   1.00 0.00 ? 94  VAL A CA   4  
ATOM 7887  C C    . VAL A 1 94  ? -36.991 -0.990  -0.739  1.00 0.00 ? 94  VAL A C    4  
ATOM 7888  O O    . VAL A 1 94  ? -36.959 -0.997  -1.970  1.00 0.00 ? 94  VAL A O    4  
ATOM 7889  C CB   . VAL A 1 94  ? -36.529 1.224   0.408   1.00 0.00 ? 94  VAL A CB   4  
ATOM 7890  C CG1  . VAL A 1 94  ? -37.516 1.187   1.585   1.00 0.00 ? 94  VAL A CG1  4  
ATOM 7891  C CG2  . VAL A 1 94  ? -35.451 2.251   0.793   1.00 0.00 ? 94  VAL A CG2  4  
ATOM 7892  H H    . VAL A 1 94  ? -34.792 0.142   -1.685  1.00 0.00 ? 94  VAL A H    4  
ATOM 7893  H HA   . VAL A 1 94  ? -35.799 -0.738  0.991   1.00 0.00 ? 94  VAL A HA   4  
ATOM 7894  H HB   . VAL A 1 94  ? -37.053 1.605   -0.468  1.00 0.00 ? 94  VAL A HB   4  
ATOM 7895  H HG11 . VAL A 1 94  ? -37.900 2.189   1.773   1.00 0.00 ? 94  VAL A HG11 4  
ATOM 7896  H HG12 . VAL A 1 94  ? -38.366 0.551   1.358   1.00 0.00 ? 94  VAL A HG12 4  
ATOM 7897  H HG13 . VAL A 1 94  ? -37.019 0.819   2.483   1.00 0.00 ? 94  VAL A HG13 4  
ATOM 7898  H HG21 . VAL A 1 94  ? -34.879 1.891   1.647   1.00 0.00 ? 94  VAL A HG21 4  
ATOM 7899  H HG22 . VAL A 1 94  ? -34.783 2.434   -0.049  1.00 0.00 ? 94  VAL A HG22 4  
ATOM 7900  H HG23 . VAL A 1 94  ? -35.919 3.201   1.047   1.00 0.00 ? 94  VAL A HG23 4  
ATOM 7901  N N    . GLU A 1 95  ? -37.926 -1.636  -0.050  1.00 0.00 ? 95  GLU A N    4  
ATOM 7902  C CA   . GLU A 1 95  ? -39.089 -2.273  -0.670  1.00 0.00 ? 95  GLU A CA   4  
ATOM 7903  C C    . GLU A 1 95  ? -40.150 -1.210  -0.979  1.00 0.00 ? 95  GLU A C    4  
ATOM 7904  O O    . GLU A 1 95  ? -40.125 -0.137  -0.386  1.00 0.00 ? 95  GLU A O    4  
ATOM 7905  C CB   . GLU A 1 95  ? -39.635 -3.353  0.278   1.00 0.00 ? 95  GLU A CB   4  
ATOM 7906  C CG   . GLU A 1 95  ? -40.247 -2.797  1.581   1.00 0.00 ? 95  GLU A CG   4  
ATOM 7907  C CD   . GLU A 1 95  ? -40.803 -3.904  2.497   1.00 0.00 ? 95  GLU A CD   4  
ATOM 7908  O OE1  . GLU A 1 95  ? -40.036 -4.811  2.904   1.00 0.00 ? 95  GLU A OE1  4  
ATOM 7909  O OE2  . GLU A 1 95  ? -42.006 -3.845  2.850   1.00 0.00 ? 95  GLU A OE2  4  
ATOM 7910  H H    . GLU A 1 95  ? -37.952 -1.524  0.951   1.00 0.00 ? 95  GLU A H    4  
ATOM 7911  H HA   . GLU A 1 95  ? -38.790 -2.747  -1.605  1.00 0.00 ? 95  GLU A HA   4  
ATOM 7912  H HB2  . GLU A 1 95  ? -40.395 -3.923  -0.253  1.00 0.00 ? 95  GLU A HB2  4  
ATOM 7913  H HB3  . GLU A 1 95  ? -38.803 -4.009  0.532   1.00 0.00 ? 95  GLU A HB3  4  
ATOM 7914  H HG2  . GLU A 1 95  ? -39.485 -2.233  2.125   1.00 0.00 ? 95  GLU A HG2  4  
ATOM 7915  H HG3  . GLU A 1 95  ? -41.056 -2.105  1.332   1.00 0.00 ? 95  GLU A HG3  4  
ATOM 7916  N N    . ILE A 1 96  ? -41.073 -1.478  -1.901  1.00 0.00 ? 96  ILE A N    4  
ATOM 7917  C CA   . ILE A 1 96  ? -42.205 -0.594  -2.228  1.00 0.00 ? 96  ILE A CA   4  
ATOM 7918  C C    . ILE A 1 96  ? -43.230 -1.346  -3.076  1.00 0.00 ? 96  ILE A C    4  
ATOM 7919  O O    . ILE A 1 96  ? -42.880 -2.249  -3.840  1.00 0.00 ? 96  ILE A O    4  
ATOM 7920  C CB   . ILE A 1 96  ? -41.833 0.713   -2.999  1.00 0.00 ? 96  ILE A CB   4  
ATOM 7921  C CG1  . ILE A 1 96  ? -40.486 0.725   -3.754  1.00 0.00 ? 96  ILE A CG1  4  
ATOM 7922  C CG2  . ILE A 1 96  ? -41.922 1.953   -2.101  1.00 0.00 ? 96  ILE A CG2  4  
ATOM 7923  C CD1  . ILE A 1 96  ? -40.369 -0.371  -4.807  1.00 0.00 ? 96  ILE A CD1  4  
ATOM 7924  H H    . ILE A 1 96  ? -41.072 -2.391  -2.337  1.00 0.00 ? 96  ILE A H    4  
ATOM 7925  H HA   . ILE A 1 96  ? -42.682 -0.349  -1.279  1.00 0.00 ? 96  ILE A HA   4  
ATOM 7926  H HB   . ILE A 1 96  ? -42.607 0.884   -3.746  1.00 0.00 ? 96  ILE A HB   4  
ATOM 7927  H HG12 . ILE A 1 96  ? -40.373 1.685   -4.259  1.00 0.00 ? 96  ILE A HG12 4  
ATOM 7928  H HG13 . ILE A 1 96  ? -39.666 0.608   -3.049  1.00 0.00 ? 96  ILE A HG13 4  
ATOM 7929  H HG21 . ILE A 1 96  ? -41.076 1.979   -1.420  1.00 0.00 ? 96  ILE A HG21 4  
ATOM 7930  H HG22 . ILE A 1 96  ? -41.900 2.853   -2.717  1.00 0.00 ? 96  ILE A HG22 4  
ATOM 7931  H HG23 . ILE A 1 96  ? -42.854 1.950   -1.536  1.00 0.00 ? 96  ILE A HG23 4  
ATOM 7932  H HD11 . ILE A 1 96  ? -41.203 -0.303  -5.499  1.00 0.00 ? 96  ILE A HD11 4  
ATOM 7933  H HD12 . ILE A 1 96  ? -39.422 -0.280  -5.341  1.00 0.00 ? 96  ILE A HD12 4  
ATOM 7934  H HD13 . ILE A 1 96  ? -40.390 -1.339  -4.322  1.00 0.00 ? 96  ILE A HD13 4  
ATOM 7935  N N    . ALA A 1 97  ? -44.501 -0.962  -2.943  1.00 0.00 ? 97  ALA A N    4  
ATOM 7936  C CA   . ALA A 1 97  ? -45.559 -1.487  -3.806  1.00 0.00 ? 97  ALA A CA   4  
ATOM 7937  C C    . ALA A 1 97  ? -45.760 -0.600  -5.044  1.00 0.00 ? 97  ALA A C    4  
ATOM 7938  O O    . ALA A 1 97  ? -45.672 0.627   -4.950  1.00 0.00 ? 97  ALA A O    4  
ATOM 7939  C CB   . ALA A 1 97  ? -46.870 -1.689  -3.039  1.00 0.00 ? 97  ALA A CB   4  
ATOM 7940  H H    . ALA A 1 97  ? -44.707 -0.209  -2.300  1.00 0.00 ? 97  ALA A H    4  
ATOM 7941  H HA   . ALA A 1 97  ? -45.236 -2.471  -4.141  1.00 0.00 ? 97  ALA A HA   4  
ATOM 7942  H HB1  . ALA A 1 97  ? -47.410 -0.753  -2.986  1.00 0.00 ? 97  ALA A HB1  4  
ATOM 7943  H HB2  . ALA A 1 97  ? -47.504 -2.396  -3.573  1.00 0.00 ? 97  ALA A HB2  4  
ATOM 7944  H HB3  . ALA A 1 97  ? -46.684 -2.067  -2.037  1.00 0.00 ? 97  ALA A HB3  4  
ATOM 7945  N N    . PHE A 1 98  ? -46.091 -1.217  -6.177  1.00 0.00 ? 98  PHE A N    4  
ATOM 7946  C CA   . PHE A 1 98  ? -46.470 -0.536  -7.421  1.00 0.00 ? 98  PHE A CA   4  
ATOM 7947  C C    . PHE A 1 98  ? -47.931 -0.819  -7.787  1.00 0.00 ? 98  PHE A C    4  
ATOM 7948  O O    . PHE A 1 98  ? -48.518 -1.798  -7.310  1.00 0.00 ? 98  PHE A O    4  
ATOM 7949  C CB   . PHE A 1 98  ? -45.541 -0.985  -8.561  1.00 0.00 ? 98  PHE A CB   4  
ATOM 7950  C CG   . PHE A 1 98  ? -44.065 -0.692  -8.366  1.00 0.00 ? 98  PHE A CG   4  
ATOM 7951  C CD1  . PHE A 1 98  ? -43.625 0.624   -8.118  1.00 0.00 ? 98  PHE A CD1  4  
ATOM 7952  C CD2  . PHE A 1 98  ? -43.122 -1.734  -8.475  1.00 0.00 ? 98  PHE A CD2  4  
ATOM 7953  C CE1  . PHE A 1 98  ? -42.252 0.901   -8.000  1.00 0.00 ? 98  PHE A CE1  4  
ATOM 7954  C CE2  . PHE A 1 98  ? -41.751 -1.456  -8.353  1.00 0.00 ? 98  PHE A CE2  4  
ATOM 7955  C CZ   . PHE A 1 98  ? -41.316 -0.139  -8.125  1.00 0.00 ? 98  PHE A CZ   4  
ATOM 7956  H H    . PHE A 1 98  ? -46.193 -2.227  -6.147  1.00 0.00 ? 98  PHE A H    4  
ATOM 7957  H HA   . PHE A 1 98  ? -46.371 0.542   -7.299  1.00 0.00 ? 98  PHE A HA   4  
ATOM 7958  H HB2  . PHE A 1 98  ? -45.679 -2.057  -8.714  1.00 0.00 ? 98  PHE A HB2  4  
ATOM 7959  H HB3  . PHE A 1 98  ? -45.853 -0.490  -9.482  1.00 0.00 ? 98  PHE A HB3  4  
ATOM 7960  H HD1  . PHE A 1 98  ? -44.336 1.428   -8.019  1.00 0.00 ? 98  PHE A HD1  4  
ATOM 7961  H HD2  . PHE A 1 98  ? -43.442 -2.749  -8.661  1.00 0.00 ? 98  PHE A HD2  4  
ATOM 7962  H HE1  . PHE A 1 98  ? -41.915 1.911   -7.814  1.00 0.00 ? 98  PHE A HE1  4  
ATOM 7963  H HE2  . PHE A 1 98  ? -41.035 -2.260  -8.444  1.00 0.00 ? 98  PHE A HE2  4  
ATOM 7964  H HZ   . PHE A 1 98  ? -40.262 0.077   -8.025  1.00 0.00 ? 98  PHE A HZ   4  
ATOM 7965  N N    . TYR A 1 99  ? -48.504 0.008   -8.669  1.00 0.00 ? 99  TYR A N    4  
ATOM 7966  C CA   . TYR A 1 99  ? -49.801 -0.247  -9.304  1.00 0.00 ? 99  TYR A CA   4  
ATOM 7967  C C    . TYR A 1 99  ? -49.737 -0.027  -10.823 1.00 0.00 ? 99  TYR A C    4  
ATOM 7968  O O    . TYR A 1 99  ? -49.080 0.897   -11.314 1.00 0.00 ? 99  TYR A O    4  
ATOM 7969  C CB   . TYR A 1 99  ? -50.937 0.558   -8.654  1.00 0.00 ? 99  TYR A CB   4  
ATOM 7970  C CG   . TYR A 1 99  ? -51.046 2.010   -9.086  1.00 0.00 ? 99  TYR A CG   4  
ATOM 7971  C CD1  . TYR A 1 99  ? -50.122 2.963   -8.620  1.00 0.00 ? 99  TYR A CD1  4  
ATOM 7972  C CD2  . TYR A 1 99  ? -52.068 2.401   -9.976  1.00 0.00 ? 99  TYR A CD2  4  
ATOM 7973  C CE1  . TYR A 1 99  ? -50.210 4.304   -9.047  1.00 0.00 ? 99  TYR A CE1  4  
ATOM 7974  C CE2  . TYR A 1 99  ? -52.170 3.743   -10.388 1.00 0.00 ? 99  TYR A CE2  4  
ATOM 7975  C CZ   . TYR A 1 99  ? -51.240 4.700   -9.928  1.00 0.00 ? 99  TYR A CZ   4  
ATOM 7976  O OH   . TYR A 1 99  ? -51.344 5.996   -10.333 1.00 0.00 ? 99  TYR A OH   4  
ATOM 7977  H H    . TYR A 1 99  ? -47.969 0.790   -9.020  1.00 0.00 ? 99  TYR A H    4  
ATOM 7978  H HA   . TYR A 1 99  ? -50.032 -1.297  -9.150  1.00 0.00 ? 99  TYR A HA   4  
ATOM 7979  H HB2  . TYR A 1 99  ? -51.876 0.059   -8.897  1.00 0.00 ? 99  TYR A HB2  4  
ATOM 7980  H HB3  . TYR A 1 99  ? -50.826 0.515   -7.570  1.00 0.00 ? 99  TYR A HB3  4  
ATOM 7981  H HD1  . TYR A 1 99  ? -49.342 2.665   -7.936  1.00 0.00 ? 99  TYR A HD1  4  
ATOM 7982  H HD2  . TYR A 1 99  ? -52.774 1.670   -10.350 1.00 0.00 ? 99  TYR A HD2  4  
ATOM 7983  H HE1  . TYR A 1 99  ? -49.501 5.033   -8.687  1.00 0.00 ? 99  TYR A HE1  4  
ATOM 7984  H HE2  . TYR A 1 99  ? -52.952 4.047   -11.071 1.00 0.00 ? 99  TYR A HE2  4  
ATOM 7985  H HH   . TYR A 1 99  ? -50.655 6.560   -9.947  1.00 0.00 ? 99  TYR A HH   4  
ATOM 7986  N N    . ARG A 1 100 ? -50.408 -0.905  -11.574 1.00 0.00 ? 100 ARG A N    4  
ATOM 7987  C CA   . ARG A 1 100 ? -50.456 -0.904  -13.037 1.00 0.00 ? 100 ARG A CA   4  
ATOM 7988  C C    . ARG A 1 100 ? -51.587 -0.046  -13.607 1.00 0.00 ? 100 ARG A C    4  
ATOM 7989  O O    . ARG A 1 100 ? -52.555 0.282   -12.918 1.00 0.00 ? 100 ARG A O    4  
ATOM 7990  C CB   . ARG A 1 100 ? -50.568 -2.342  -13.559 1.00 0.00 ? 100 ARG A CB   4  
ATOM 7991  C CG   . ARG A 1 100 ? -49.499 -3.288  -12.997 1.00 0.00 ? 100 ARG A CG   4  
ATOM 7992  C CD   . ARG A 1 100 ? -49.390 -4.551  -13.856 1.00 0.00 ? 100 ARG A CD   4  
ATOM 7993  N NE   . ARG A 1 100 ? -48.606 -4.293  -15.077 1.00 0.00 ? 100 ARG A NE   4  
ATOM 7994  C CZ   . ARG A 1 100 ? -49.020 -4.339  -16.332 1.00 0.00 ? 100 ARG A CZ   4  
ATOM 7995  N NH1  . ARG A 1 100 ? -50.271 -4.441  -16.675 1.00 0.00 ? 100 ARG A NH1  4  
ATOM 7996  N NH2  . ARG A 1 100 ? -48.164 -4.279  -17.306 1.00 0.00 ? 100 ARG A NH2  4  
ATOM 7997  H H    . ARG A 1 100 ? -50.880 -1.665  -11.095 1.00 0.00 ? 100 ARG A H    4  
ATOM 7998  H HA   . ARG A 1 100 ? -49.522 -0.478  -13.403 1.00 0.00 ? 100 ARG A HA   4  
ATOM 7999  H HB2  . ARG A 1 100 ? -51.551 -2.740  -13.300 1.00 0.00 ? 100 ARG A HB2  4  
ATOM 8000  H HB3  . ARG A 1 100 ? -50.483 -2.315  -14.646 1.00 0.00 ? 100 ARG A HB3  4  
ATOM 8001  H HG2  . ARG A 1 100 ? -48.531 -2.786  -12.964 1.00 0.00 ? 100 ARG A HG2  4  
ATOM 8002  H HG3  . ARG A 1 100 ? -49.777 -3.571  -11.982 1.00 0.00 ? 100 ARG A HG3  4  
ATOM 8003  H HD2  . ARG A 1 100 ? -48.867 -5.315  -13.281 1.00 0.00 ? 100 ARG A HD2  4  
ATOM 8004  H HD3  . ARG A 1 100 ? -50.386 -4.933  -14.086 1.00 0.00 ? 100 ARG A HD3  4  
ATOM 8005  H HE   . ARG A 1 100 ? -47.630 -4.059  -14.915 1.00 0.00 ? 100 ARG A HE   4  
ATOM 8006  H HH11 . ARG A 1 100 ? -51.012 -4.398  -15.971 1.00 0.00 ? 100 ARG A HH11 4  
ATOM 8007  H HH12 . ARG A 1 100 ? -50.535 -4.489  -17.641 1.00 0.00 ? 100 ARG A HH12 4  
ATOM 8008  H HH21 . ARG A 1 100 ? -47.171 -4.345  -17.105 1.00 0.00 ? 100 ARG A HH21 4  
ATOM 8009  H HH22 . ARG A 1 100 ? -48.475 -4.350  -18.258 1.00 0.00 ? 100 ARG A HH22 4  
ATOM 8010  N N    . LYS A 1 101 ? -51.503 0.209   -14.914 1.00 0.00 ? 101 LYS A N    4  
ATOM 8011  C CA   . LYS A 1 101 ? -52.495 0.906   -15.746 1.00 0.00 ? 101 LYS A CA   4  
ATOM 8012  C C    . LYS A 1 101 ? -53.874 0.234   -15.719 1.00 0.00 ? 101 LYS A C    4  
ATOM 8013  O O    . LYS A 1 101 ? -54.896 0.915   -15.761 1.00 0.00 ? 101 LYS A O    4  
ATOM 8014  C CB   . LYS A 1 101 ? -51.881 0.993   -17.157 1.00 0.00 ? 101 LYS A CB   4  
ATOM 8015  C CG   . LYS A 1 101 ? -52.780 1.642   -18.219 1.00 0.00 ? 101 LYS A CG   4  
ATOM 8016  C CD   . LYS A 1 101 ? -53.544 0.573   -19.013 1.00 0.00 ? 101 LYS A CD   4  
ATOM 8017  C CE   . LYS A 1 101 ? -54.519 1.232   -19.995 1.00 0.00 ? 101 LYS A CE   4  
ATOM 8018  N NZ   . LYS A 1 101 ? -55.221 0.224   -20.833 1.00 0.00 ? 101 LYS A NZ   4  
ATOM 8019  H H    . LYS A 1 101 ? -50.677 -0.141  -15.380 1.00 0.00 ? 101 LYS A H    4  
ATOM 8020  H HA   . LYS A 1 101 ? -52.632 1.918   -15.365 1.00 0.00 ? 101 LYS A HA   4  
ATOM 8021  H HB2  . LYS A 1 101 ? -50.967 1.585   -17.087 1.00 0.00 ? 101 LYS A HB2  4  
ATOM 8022  H HB3  . LYS A 1 101 ? -51.584 -0.003  -17.491 1.00 0.00 ? 101 LYS A HB3  4  
ATOM 8023  H HG2  . LYS A 1 101 ? -53.472 2.341   -17.749 1.00 0.00 ? 101 LYS A HG2  4  
ATOM 8024  H HG3  . LYS A 1 101 ? -52.151 2.198   -18.916 1.00 0.00 ? 101 LYS A HG3  4  
ATOM 8025  H HD2  . LYS A 1 101 ? -52.819 -0.036  -19.553 1.00 0.00 ? 101 LYS A HD2  4  
ATOM 8026  H HD3  . LYS A 1 101 ? -54.095 -0.075  -18.332 1.00 0.00 ? 101 LYS A HD3  4  
ATOM 8027  H HE2  . LYS A 1 101 ? -55.249 1.813   -19.422 1.00 0.00 ? 101 LYS A HE2  4  
ATOM 8028  H HE3  . LYS A 1 101 ? -53.962 1.924   -20.633 1.00 0.00 ? 101 LYS A HE3  4  
ATOM 8029  H HZ1  . LYS A 1 101 ? -55.758 -0.419  -20.267 1.00 0.00 ? 101 LYS A HZ1  4  
ATOM 8030  H HZ2  . LYS A 1 101 ? -55.861 0.670   -21.476 1.00 0.00 ? 101 LYS A HZ2  4  
ATOM 8031  H HZ3  . LYS A 1 101 ? -54.567 -0.317  -21.384 1.00 0.00 ? 101 LYS A HZ3  4  
ATOM 8032  N N    . ASP A 1 102 ? -53.909 -1.095  -15.601 1.00 0.00 ? 102 ASP A N    4  
ATOM 8033  C CA   . ASP A 1 102 ? -55.136 -1.893  -15.452 1.00 0.00 ? 102 ASP A CA   4  
ATOM 8034  C C    . ASP A 1 102 ? -55.752 -1.853  -14.031 1.00 0.00 ? 102 ASP A C    4  
ATOM 8035  O O    . ASP A 1 102 ? -56.878 -2.316  -13.833 1.00 0.00 ? 102 ASP A O    4  
ATOM 8036  C CB   . ASP A 1 102 ? -54.847 -3.336  -15.893 1.00 0.00 ? 102 ASP A CB   4  
ATOM 8037  C CG   . ASP A 1 102 ? -53.832 -4.025  -14.973 1.00 0.00 ? 102 ASP A CG   4  
ATOM 8038  O OD1  . ASP A 1 102 ? -54.219 -4.467  -13.870 1.00 0.00 ? 102 ASP A OD1  4  
ATOM 8039  O OD2  . ASP A 1 102 ? -52.636 -4.079  -15.339 1.00 0.00 ? 102 ASP A OD2  4  
ATOM 8040  H H    . ASP A 1 102 ? -53.026 -1.587  -15.615 1.00 0.00 ? 102 ASP A H    4  
ATOM 8041  H HA   . ASP A 1 102 ? -55.886 -1.489  -16.134 1.00 0.00 ? 102 ASP A HA   4  
ATOM 8042  H HB2  . ASP A 1 102 ? -55.779 -3.905  -15.894 1.00 0.00 ? 102 ASP A HB2  4  
ATOM 8043  H HB3  . ASP A 1 102 ? -54.469 -3.326  -16.918 1.00 0.00 ? 102 ASP A HB3  4  
ATOM 8044  N N    . GLY A 1 103 ? -55.035 -1.291  -13.047 1.00 0.00 ? 103 GLY A N    4  
ATOM 8045  C CA   . GLY A 1 103 ? -55.464 -1.152  -11.650 1.00 0.00 ? 103 GLY A CA   4  
ATOM 8046  C C    . GLY A 1 103 ? -54.946 -2.226  -10.680 1.00 0.00 ? 103 GLY A C    4  
ATOM 8047  O O    . GLY A 1 103 ? -55.235 -2.136  -9.484  1.00 0.00 ? 103 GLY A O    4  
ATOM 8048  H H    . GLY A 1 103 ? -54.140 -0.883  -13.288 1.00 0.00 ? 103 GLY A H    4  
ATOM 8049  H HA2  . GLY A 1 103 ? -55.114 -0.186  -11.286 1.00 0.00 ? 103 GLY A HA2  4  
ATOM 8050  H HA3  . GLY A 1 103 ? -56.552 -1.150  -11.599 1.00 0.00 ? 103 GLY A HA3  4  
ATOM 8051  N N    . SER A 1 104 ? -54.176 -3.221  -11.140 1.00 0.00 ? 104 SER A N    4  
ATOM 8052  C CA   . SER A 1 104 ? -53.573 -4.243  -10.256 1.00 0.00 ? 104 SER A CA   4  
ATOM 8053  C C    . SER A 1 104 ? -52.419 -3.655  -9.439  1.00 0.00 ? 104 SER A C    4  
ATOM 8054  O O    . SER A 1 104 ? -51.621 -2.894  -9.983  1.00 0.00 ? 104 SER A O    4  
ATOM 8055  C CB   . SER A 1 104 ? -53.056 -5.451  -11.049 1.00 0.00 ? 104 SER A CB   4  
ATOM 8056  O OG   . SER A 1 104 ? -54.098 -6.066  -11.780 1.00 0.00 ? 104 SER A OG   4  
ATOM 8057  H H    . SER A 1 104 ? -53.970 -3.258  -12.135 1.00 0.00 ? 104 SER A H    4  
ATOM 8058  H HA   . SER A 1 104 ? -54.335 -4.603  -9.562  1.00 0.00 ? 104 SER A HA   4  
ATOM 8059  H HB2  . SER A 1 104 ? -52.269 -5.129  -11.735 1.00 0.00 ? 104 SER A HB2  4  
ATOM 8060  H HB3  . SER A 1 104 ? -52.633 -6.177  -10.352 1.00 0.00 ? 104 SER A HB3  4  
ATOM 8061  H HG   . SER A 1 104 ? -54.228 -5.504  -12.584 1.00 0.00 ? 104 SER A HG   4  
ATOM 8062  N N    . CYS A 1 105 ? -52.289 -4.012  -8.156  1.00 0.00 ? 105 CYS A N    4  
ATOM 8063  C CA   . CYS A 1 105 ? -51.242 -3.491  -7.264  1.00 0.00 ? 105 CYS A CA   4  
ATOM 8064  C C    . CYS A 1 105 ? -50.578 -4.577  -6.396  1.00 0.00 ? 105 CYS A C    4  
ATOM 8065  O O    . CYS A 1 105 ? -51.244 -5.505  -5.928  1.00 0.00 ? 105 CYS A O    4  
ATOM 8066  C CB   . CYS A 1 105 ? -51.779 -2.307  -6.441  1.00 0.00 ? 105 CYS A CB   4  
ATOM 8067  S SG   . CYS A 1 105 ? -53.157 -2.785  -5.357  1.00 0.00 ? 105 CYS A SG   4  
ATOM 8068  H H    . CYS A 1 105 ? -52.952 -4.665  -7.762  1.00 0.00 ? 105 CYS A H    4  
ATOM 8069  H HA   . CYS A 1 105 ? -50.444 -3.104  -7.893  1.00 0.00 ? 105 CYS A HA   4  
ATOM 8070  H HB2  . CYS A 1 105 ? -50.969 -1.894  -5.837  1.00 0.00 ? 105 CYS A HB2  4  
ATOM 8071  H HB3  . CYS A 1 105 ? -52.126 -1.530  -7.123  1.00 0.00 ? 105 CYS A HB3  4  
ATOM 8072  H HG   . CYS A 1 105 ? -54.033 -3.085  -6.332  1.00 0.00 ? 105 CYS A HG   4  
ATOM 8073  N N    . PHE A 1 106 ? -49.257 -4.490  -6.219  1.00 0.00 ? 106 PHE A N    4  
ATOM 8074  C CA   . PHE A 1 106 ? -48.438 -5.516  -5.551  1.00 0.00 ? 106 PHE A CA   4  
ATOM 8075  C C    . PHE A 1 106 ? -47.190 -4.943  -4.855  1.00 0.00 ? 106 PHE A C    4  
ATOM 8076  O O    . PHE A 1 106 ? -46.525 -4.057  -5.395  1.00 0.00 ? 106 PHE A O    4  
ATOM 8077  C CB   . PHE A 1 106 ? -48.039 -6.603  -6.571  1.00 0.00 ? 106 PHE A CB   4  
ATOM 8078  C CG   . PHE A 1 106 ? -47.640 -6.093  -7.948  1.00 0.00 ? 106 PHE A CG   4  
ATOM 8079  C CD1  . PHE A 1 106 ? -46.351 -5.579  -8.188  1.00 0.00 ? 106 PHE A CD1  4  
ATOM 8080  C CD2  . PHE A 1 106 ? -48.585 -6.109  -8.993  1.00 0.00 ? 106 PHE A CD2  4  
ATOM 8081  C CE1  . PHE A 1 106 ? -46.017 -5.067  -9.456  1.00 0.00 ? 106 PHE A CE1  4  
ATOM 8082  C CE2  . PHE A 1 106 ? -48.247 -5.608  -10.261 1.00 0.00 ? 106 PHE A CE2  4  
ATOM 8083  C CZ   . PHE A 1 106 ? -46.966 -5.080  -10.493 1.00 0.00 ? 106 PHE A CZ   4  
ATOM 8084  H H    . PHE A 1 106 ? -48.773 -3.687  -6.617  1.00 0.00 ? 106 PHE A H    4  
ATOM 8085  H HA   . PHE A 1 106 ? -49.038 -5.995  -4.776  1.00 0.00 ? 106 PHE A HA   4  
ATOM 8086  H HB2  . PHE A 1 106 ? -47.223 -7.202  -6.161  1.00 0.00 ? 106 PHE A HB2  4  
ATOM 8087  H HB3  . PHE A 1 106 ? -48.890 -7.276  -6.690  1.00 0.00 ? 106 PHE A HB3  4  
ATOM 8088  H HD1  . PHE A 1 106 ? -45.616 -5.564  -7.395  1.00 0.00 ? 106 PHE A HD1  4  
ATOM 8089  H HD2  . PHE A 1 106 ? -49.577 -6.503  -8.819  1.00 0.00 ? 106 PHE A HD2  4  
ATOM 8090  H HE1  . PHE A 1 106 ? -45.031 -4.660  -9.632  1.00 0.00 ? 106 PHE A HE1  4  
ATOM 8091  H HE2  . PHE A 1 106 ? -48.980 -5.631  -11.054 1.00 0.00 ? 106 PHE A HE2  4  
ATOM 8092  H HZ   . PHE A 1 106 ? -46.707 -4.688  -11.469 1.00 0.00 ? 106 PHE A HZ   4  
ATOM 8093  N N    . LEU A 1 107 ? -46.850 -5.494  -3.682  1.00 0.00 ? 107 LEU A N    4  
ATOM 8094  C CA   . LEU A 1 107 ? -45.600 -5.267  -2.940  1.00 0.00 ? 107 LEU A CA   4  
ATOM 8095  C C    . LEU A 1 107 ? -44.658 -6.462  -3.133  1.00 0.00 ? 107 LEU A C    4  
ATOM 8096  O O    . LEU A 1 107 ? -45.071 -7.618  -3.013  1.00 0.00 ? 107 LEU A O    4  
ATOM 8097  C CB   . LEU A 1 107 ? -45.944 -5.036  -1.447  1.00 0.00 ? 107 LEU A CB   4  
ATOM 8098  C CG   . LEU A 1 107 ? -44.830 -4.652  -0.441  1.00 0.00 ? 107 LEU A CG   4  
ATOM 8099  C CD1  . LEU A 1 107 ? -43.726 -5.688  -0.246  1.00 0.00 ? 107 LEU A CD1  4  
ATOM 8100  C CD2  . LEU A 1 107 ? -44.125 -3.346  -0.755  1.00 0.00 ? 107 LEU A CD2  4  
ATOM 8101  H H    . LEU A 1 107 ? -47.453 -6.215  -3.312  1.00 0.00 ? 107 LEU A H    4  
ATOM 8102  H HA   . LEU A 1 107 ? -45.103 -4.381  -3.329  1.00 0.00 ? 107 LEU A HA   4  
ATOM 8103  H HB2  . LEU A 1 107 ? -46.703 -4.256  -1.396  1.00 0.00 ? 107 LEU A HB2  4  
ATOM 8104  H HB3  . LEU A 1 107 ? -46.418 -5.944  -1.070  1.00 0.00 ? 107 LEU A HB3  4  
ATOM 8105  H HG   . LEU A 1 107 ? -45.321 -4.499  0.516   1.00 0.00 ? 107 LEU A HG   4  
ATOM 8106  H HD11 . LEU A 1 107 ? -43.244 -5.517  0.716   1.00 0.00 ? 107 LEU A HD11 4  
ATOM 8107  H HD12 . LEU A 1 107 ? -44.132 -6.697  -0.282  1.00 0.00 ? 107 LEU A HD12 4  
ATOM 8108  H HD13 . LEU A 1 107 ? -42.964 -5.565  -1.011  1.00 0.00 ? 107 LEU A HD13 4  
ATOM 8109  H HD21 . LEU A 1 107 ? -43.595 -3.459  -1.694  1.00 0.00 ? 107 LEU A HD21 4  
ATOM 8110  H HD22 . LEU A 1 107 ? -44.854 -2.542  -0.804  1.00 0.00 ? 107 LEU A HD22 4  
ATOM 8111  H HD23 . LEU A 1 107 ? -43.404 -3.115  0.031   1.00 0.00 ? 107 LEU A HD23 4  
ATOM 8112  N N    . CYS A 1 108 ? -43.385 -6.170  -3.391  1.00 0.00 ? 108 CYS A N    4  
ATOM 8113  C CA   . CYS A 1 108 ? -42.275 -7.125  -3.364  1.00 0.00 ? 108 CYS A CA   4  
ATOM 8114  C C    . CYS A 1 108 ? -41.031 -6.478  -2.729  1.00 0.00 ? 108 CYS A C    4  
ATOM 8115  O O    . CYS A 1 108 ? -40.985 -5.260  -2.526  1.00 0.00 ? 108 CYS A O    4  
ATOM 8116  C CB   . CYS A 1 108 ? -42.016 -7.612  -4.794  1.00 0.00 ? 108 CYS A CB   4  
ATOM 8117  S SG   . CYS A 1 108 ? -43.048 -9.073  -5.105  1.00 0.00 ? 108 CYS A SG   4  
ATOM 8118  H H    . CYS A 1 108 ? -43.132 -5.194  -3.470  1.00 0.00 ? 108 CYS A H    4  
ATOM 8119  H HA   . CYS A 1 108 ? -42.532 -7.981  -2.737  1.00 0.00 ? 108 CYS A HA   4  
ATOM 8120  H HB2  . CYS A 1 108 ? -42.245 -6.818  -5.507  1.00 0.00 ? 108 CYS A HB2  4  
ATOM 8121  H HB3  . CYS A 1 108 ? -40.971 -7.891  -4.908  1.00 0.00 ? 108 CYS A HB3  4  
ATOM 8122  H HG   . CYS A 1 108 ? -44.190 -8.559  -4.615  1.00 0.00 ? 108 CYS A HG   4  
ATOM 8123  N N    . LEU A 1 109 ? -39.995 -7.273  -2.448  1.00 0.00 ? 109 LEU A N    4  
ATOM 8124  C CA   . LEU A 1 109 ? -38.691 -6.786  -1.982  1.00 0.00 ? 109 LEU A CA   4  
ATOM 8125  C C    . LEU A 1 109 ? -37.896 -6.214  -3.174  1.00 0.00 ? 109 LEU A C    4  
ATOM 8126  O O    . LEU A 1 109 ? -36.832 -6.712  -3.539  1.00 0.00 ? 109 LEU A O    4  
ATOM 8127  C CB   . LEU A 1 109 ? -37.992 -7.925  -1.207  1.00 0.00 ? 109 LEU A CB   4  
ATOM 8128  C CG   . LEU A 1 109 ? -36.657 -7.561  -0.524  1.00 0.00 ? 109 LEU A CG   4  
ATOM 8129  C CD1  . LEU A 1 109 ? -36.765 -6.343  0.398   1.00 0.00 ? 109 LEU A CD1  4  
ATOM 8130  C CD2  . LEU A 1 109 ? -36.174 -8.749  0.308   1.00 0.00 ? 109 LEU A CD2  4  
ATOM 8131  H H    . LEU A 1 109 ? -40.056 -8.254  -2.704  1.00 0.00 ? 109 LEU A H    4  
ATOM 8132  H HA   . LEU A 1 109 ? -38.868 -5.965  -1.286  1.00 0.00 ? 109 LEU A HA   4  
ATOM 8133  H HB2  . LEU A 1 109 ? -38.681 -8.276  -0.436  1.00 0.00 ? 109 LEU A HB2  4  
ATOM 8134  H HB3  . LEU A 1 109 ? -37.813 -8.756  -1.891  1.00 0.00 ? 109 LEU A HB3  4  
ATOM 8135  H HG   . LEU A 1 109 ? -35.896 -7.354  -1.275  1.00 0.00 ? 109 LEU A HG   4  
ATOM 8136  H HD11 . LEU A 1 109 ? -36.950 -5.447  -0.193  1.00 0.00 ? 109 LEU A HD11 4  
ATOM 8137  H HD12 . LEU A 1 109 ? -37.575 -6.485  1.113   1.00 0.00 ? 109 LEU A HD12 4  
ATOM 8138  H HD13 . LEU A 1 109 ? -35.829 -6.204  0.937   1.00 0.00 ? 109 LEU A HD13 4  
ATOM 8139  H HD21 . LEU A 1 109 ? -36.069 -9.625  -0.332  1.00 0.00 ? 109 LEU A HD21 4  
ATOM 8140  H HD22 . LEU A 1 109 ? -35.204 -8.522  0.750   1.00 0.00 ? 109 LEU A HD22 4  
ATOM 8141  H HD23 . LEU A 1 109 ? -36.889 -8.967  1.102   1.00 0.00 ? 109 LEU A HD23 4  
ATOM 8142  N N    . VAL A 1 110 ? -38.468 -5.190  -3.819  1.00 0.00 ? 110 VAL A N    4  
ATOM 8143  C CA   . VAL A 1 110 ? -37.963 -4.590  -5.068  1.00 0.00 ? 110 VAL A CA   4  
ATOM 8144  C C    . VAL A 1 110 ? -36.520 -4.102  -4.886  1.00 0.00 ? 110 VAL A C    4  
ATOM 8145  O O    . VAL A 1 110 ? -36.146 -3.651  -3.800  1.00 0.00 ? 110 VAL A O    4  
ATOM 8146  C CB   . VAL A 1 110 ? -38.868 -3.438  -5.534  1.00 0.00 ? 110 VAL A CB   4  
ATOM 8147  C CG1  . VAL A 1 110 ? -38.431 -2.775  -6.848  1.00 0.00 ? 110 VAL A CG1  4  
ATOM 8148  C CG2  . VAL A 1 110 ? -40.316 -3.903  -5.754  1.00 0.00 ? 110 VAL A CG2  4  
ATOM 8149  H H    . VAL A 1 110 ? -39.356 -4.860  -3.452  1.00 0.00 ? 110 VAL A H    4  
ATOM 8150  H HA   . VAL A 1 110 ? -37.990 -5.372  -5.821  1.00 0.00 ? 110 VAL A HA   4  
ATOM 8151  H HB   . VAL A 1 110 ? -38.840 -2.687  -4.751  1.00 0.00 ? 110 VAL A HB   4  
ATOM 8152  H HG11 . VAL A 1 110 ? -39.093 -1.942  -7.075  1.00 0.00 ? 110 VAL A HG11 4  
ATOM 8153  H HG12 . VAL A 1 110 ? -37.422 -2.378  -6.771  1.00 0.00 ? 110 VAL A HG12 4  
ATOM 8154  H HG13 . VAL A 1 110 ? -38.479 -3.492  -7.664  1.00 0.00 ? 110 VAL A HG13 4  
ATOM 8155  H HG21 . VAL A 1 110 ? -40.348 -4.690  -6.506  1.00 0.00 ? 110 VAL A HG21 4  
ATOM 8156  H HG22 . VAL A 1 110 ? -40.750 -4.268  -4.829  1.00 0.00 ? 110 VAL A HG22 4  
ATOM 8157  H HG23 . VAL A 1 110 ? -40.931 -3.066  -6.089  1.00 0.00 ? 110 VAL A HG23 4  
ATOM 8158  N N    . ASP A 1 111 ? -35.695 -4.149  -5.937  1.00 0.00 ? 111 ASP A N    4  
ATOM 8159  C CA   . ASP A 1 111 ? -34.246 -3.924  -5.776  1.00 0.00 ? 111 ASP A CA   4  
ATOM 8160  C C    . ASP A 1 111 ? -33.859 -2.485  -6.169  1.00 0.00 ? 111 ASP A C    4  
ATOM 8161  O O    . ASP A 1 111 ? -33.166 -2.223  -7.151  1.00 0.00 ? 111 ASP A O    4  
ATOM 8162  C CB   . ASP A 1 111 ? -33.474 -5.030  -6.516  1.00 0.00 ? 111 ASP A CB   4  
ATOM 8163  C CG   . ASP A 1 111 ? -32.115 -5.318  -5.870  1.00 0.00 ? 111 ASP A CG   4  
ATOM 8164  O OD1  . ASP A 1 111 ? -32.055 -6.176  -4.957  1.00 0.00 ? 111 ASP A OD1  4  
ATOM 8165  O OD2  . ASP A 1 111 ? -31.101 -4.680  -6.229  1.00 0.00 ? 111 ASP A OD2  4  
ATOM 8166  H H    . ASP A 1 111 ? -36.082 -4.371  -6.850  1.00 0.00 ? 111 ASP A H    4  
ATOM 8167  H HA   . ASP A 1 111 ? -33.993 -4.038  -4.722  1.00 0.00 ? 111 ASP A HA   4  
ATOM 8168  H HB2  . ASP A 1 111 ? -34.055 -5.953  -6.479  1.00 0.00 ? 111 ASP A HB2  4  
ATOM 8169  H HB3  . ASP A 1 111 ? -33.340 -4.758  -7.561  1.00 0.00 ? 111 ASP A HB3  4  
ATOM 8170  N N    . VAL A 1 112 ? -34.287 -1.527  -5.338  1.00 0.00 ? 112 VAL A N    4  
ATOM 8171  C CA   . VAL A 1 112 ? -34.227 -0.088  -5.624  1.00 0.00 ? 112 VAL A CA   4  
ATOM 8172  C C    . VAL A 1 112 ? -32.838 0.473   -5.284  1.00 0.00 ? 112 VAL A C    4  
ATOM 8173  O O    . VAL A 1 112 ? -32.680 1.212   -4.315  1.00 0.00 ? 112 VAL A O    4  
ATOM 8174  C CB   . VAL A 1 112 ? -35.376 0.616   -4.863  1.00 0.00 ? 112 VAL A CB   4  
ATOM 8175  C CG1  . VAL A 1 112 ? -35.588 2.066   -5.298  1.00 0.00 ? 112 VAL A CG1  4  
ATOM 8176  C CG2  . VAL A 1 112 ? -36.717 -0.088  -5.095  1.00 0.00 ? 112 VAL A CG2  4  
ATOM 8177  H H    . VAL A 1 112 ? -34.848 -1.795  -4.532  1.00 0.00 ? 112 VAL A H    4  
ATOM 8178  H HA   . VAL A 1 112 ? -34.394 0.063   -6.692  1.00 0.00 ? 112 VAL A HA   4  
ATOM 8179  H HB   . VAL A 1 112 ? -35.167 0.595   -3.792  1.00 0.00 ? 112 VAL A HB   4  
ATOM 8180  H HG11 . VAL A 1 112 ? -35.904 2.093   -6.338  1.00 0.00 ? 112 VAL A HG11 4  
ATOM 8181  H HG12 . VAL A 1 112 ? -36.364 2.526   -4.684  1.00 0.00 ? 112 VAL A HG12 4  
ATOM 8182  H HG13 . VAL A 1 112 ? -34.670 2.630   -5.166  1.00 0.00 ? 112 VAL A HG13 4  
ATOM 8183  H HG21 . VAL A 1 112 ? -36.703 -1.101  -4.696  1.00 0.00 ? 112 VAL A HG21 4  
ATOM 8184  H HG22 . VAL A 1 112 ? -37.496 0.461   -4.571  1.00 0.00 ? 112 VAL A HG22 4  
ATOM 8185  H HG23 . VAL A 1 112 ? -36.940 -0.131  -6.161  1.00 0.00 ? 112 VAL A HG23 4  
ATOM 8186  N N    . VAL A 1 113 ? -31.814 0.107   -6.065  1.00 0.00 ? 113 VAL A N    4  
ATOM 8187  C CA   . VAL A 1 113 ? -30.400 0.471   -5.790  1.00 0.00 ? 113 VAL A CA   4  
ATOM 8188  C C    . VAL A 1 113 ? -29.744 1.262   -6.950  1.00 0.00 ? 113 VAL A C    4  
ATOM 8189  O O    . VAL A 1 113 ? -29.843 0.819   -8.097  1.00 0.00 ? 113 VAL A O    4  
ATOM 8190  C CB   . VAL A 1 113 ? -29.587 -0.775  -5.382  1.00 0.00 ? 113 VAL A CB   4  
ATOM 8191  C CG1  . VAL A 1 113 ? -29.356 -1.786  -6.510  1.00 0.00 ? 113 VAL A CG1  4  
ATOM 8192  C CG2  . VAL A 1 113 ? -28.232 -0.391  -4.782  1.00 0.00 ? 113 VAL A CG2  4  
ATOM 8193  H H    . VAL A 1 113 ? -32.023 -0.541  -6.826  1.00 0.00 ? 113 VAL A H    4  
ATOM 8194  H HA   . VAL A 1 113 ? -30.409 1.099   -4.900  1.00 0.00 ? 113 VAL A HA   4  
ATOM 8195  H HB   . VAL A 1 113 ? -30.149 -1.285  -4.600  1.00 0.00 ? 113 VAL A HB   4  
ATOM 8196  H HG11 . VAL A 1 113 ? -28.905 -2.690  -6.101  1.00 0.00 ? 113 VAL A HG11 4  
ATOM 8197  H HG12 . VAL A 1 113 ? -30.304 -2.051  -6.974  1.00 0.00 ? 113 VAL A HG12 4  
ATOM 8198  H HG13 . VAL A 1 113 ? -28.687 -1.375  -7.266  1.00 0.00 ? 113 VAL A HG13 4  
ATOM 8199  H HG21 . VAL A 1 113 ? -28.376 0.283   -3.937  1.00 0.00 ? 113 VAL A HG21 4  
ATOM 8200  H HG22 . VAL A 1 113 ? -27.723 -1.286  -4.424  1.00 0.00 ? 113 VAL A HG22 4  
ATOM 8201  H HG23 . VAL A 1 113 ? -27.607 0.092   -5.534  1.00 0.00 ? 113 VAL A HG23 4  
ATOM 8202  N N    . PRO A 1 114 ? -29.098 2.429   -6.709  1.00 0.00 ? 114 PRO A N    4  
ATOM 8203  C CA   . PRO A 1 114 ? -28.542 3.290   -7.768  1.00 0.00 ? 114 PRO A CA   4  
ATOM 8204  C C    . PRO A 1 114 ? -27.096 2.907   -8.148  1.00 0.00 ? 114 PRO A C    4  
ATOM 8205  O O    . PRO A 1 114 ? -26.506 2.000   -7.548  1.00 0.00 ? 114 PRO A O    4  
ATOM 8206  C CB   . PRO A 1 114 ? -28.599 4.705   -7.201  1.00 0.00 ? 114 PRO A CB   4  
ATOM 8207  C CG   . PRO A 1 114 ? -28.350 4.473   -5.721  1.00 0.00 ? 114 PRO A CG   4  
ATOM 8208  C CD   . PRO A 1 114 ? -29.031 3.135   -5.433  1.00 0.00 ? 114 PRO A CD   4  
ATOM 8209  H HA   . PRO A 1 114 ? -29.192 3.271   -8.649  1.00 0.00 ? 114 PRO A HA   4  
ATOM 8210  H HB2  . PRO A 1 114 ? -27.854 5.355   -7.643  1.00 0.00 ? 114 PRO A HB2  4  
ATOM 8211  H HB3  . PRO A 1 114 ? -29.583 5.143   -7.350  1.00 0.00 ? 114 PRO A HB3  4  
ATOM 8212  H HG2  . PRO A 1 114 ? -27.277 4.378   -5.553  1.00 0.00 ? 114 PRO A HG2  4  
ATOM 8213  H HG3  . PRO A 1 114 ? -28.774 5.282   -5.126  1.00 0.00 ? 114 PRO A HG3  4  
ATOM 8214  H HD2  . PRO A 1 114 ? -28.457 2.567   -4.703  1.00 0.00 ? 114 PRO A HD2  4  
ATOM 8215  H HD3  . PRO A 1 114 ? -30.034 3.324   -5.047  1.00 0.00 ? 114 PRO A HD3  4  
ATOM 8216  N N    . VAL A 1 115 ? -26.489 3.635   -9.097  1.00 0.00 ? 115 VAL A N    4  
ATOM 8217  C CA   . VAL A 1 115 ? -25.179 3.318   -9.699  1.00 0.00 ? 115 VAL A CA   4  
ATOM 8218  C C    . VAL A 1 115 ? -24.112 4.409   -9.489  1.00 0.00 ? 115 VAL A C    4  
ATOM 8219  O O    . VAL A 1 115 ? -24.355 5.621   -9.602  1.00 0.00 ? 115 VAL A O    4  
ATOM 8220  C CB   . VAL A 1 115 ? -25.311 2.966   -11.191 1.00 0.00 ? 115 VAL A CB   4  
ATOM 8221  C CG1  . VAL A 1 115 ? -26.009 1.614   -11.384 1.00 0.00 ? 115 VAL A CG1  4  
ATOM 8222  C CG2  . VAL A 1 115 ? -26.033 4.027   -12.000 1.00 0.00 ? 115 VAL A CG2  4  
ATOM 8223  H H    . VAL A 1 115 ? -26.953 4.469   -9.445  1.00 0.00 ? 115 VAL A H    4  
ATOM 8224  H HA   . VAL A 1 115 ? -24.793 2.420   -9.215  1.00 0.00 ? 115 VAL A HA   4  
ATOM 8225  H HB   . VAL A 1 115 ? -24.305 2.866   -11.600 1.00 0.00 ? 115 VAL A HB   4  
ATOM 8226  H HG11 . VAL A 1 115 ? -26.043 1.366   -12.446 1.00 0.00 ? 115 VAL A HG11 4  
ATOM 8227  H HG12 . VAL A 1 115 ? -25.455 0.834   -10.861 1.00 0.00 ? 115 VAL A HG12 4  
ATOM 8228  H HG13 . VAL A 1 115 ? -27.026 1.651   -10.994 1.00 0.00 ? 115 VAL A HG13 4  
ATOM 8229  H HG21 . VAL A 1 115 ? -25.929 3.816   -13.063 1.00 0.00 ? 115 VAL A HG21 4  
ATOM 8230  H HG22 . VAL A 1 115 ? -27.083 4.062   -11.724 1.00 0.00 ? 115 VAL A HG22 4  
ATOM 8231  H HG23 . VAL A 1 115 ? -25.566 4.979   -11.781 1.00 0.00 ? 115 VAL A HG23 4  
ATOM 8232  N N    . LYS A 1 116 ? -22.896 3.934   -9.188  1.00 0.00 ? 116 LYS A N    4  
ATOM 8233  C CA   . LYS A 1 116 ? -21.734 4.705   -8.731  1.00 0.00 ? 116 LYS A CA   4  
ATOM 8234  C C    . LYS A 1 116 ? -20.550 4.600   -9.694  1.00 0.00 ? 116 LYS A C    4  
ATOM 8235  O O    . LYS A 1 116 ? -20.481 3.691   -10.523 1.00 0.00 ? 116 LYS A O    4  
ATOM 8236  C CB   . LYS A 1 116 ? -21.295 4.273   -7.312  1.00 0.00 ? 116 LYS A CB   4  
ATOM 8237  C CG   . LYS A 1 116 ? -22.396 4.287   -6.239  1.00 0.00 ? 116 LYS A CG   4  
ATOM 8238  C CD   . LYS A 1 116 ? -23.155 2.957   -6.098  1.00 0.00 ? 116 LYS A CD   4  
ATOM 8239  C CE   . LYS A 1 116 ? -24.241 3.102   -5.031  1.00 0.00 ? 116 LYS A CE   4  
ATOM 8240  N NZ   . LYS A 1 116 ? -25.125 1.910   -4.966  1.00 0.00 ? 116 LYS A NZ   4  
ATOM 8241  H H    . LYS A 1 116 ? -22.766 2.933   -9.239  1.00 0.00 ? 116 LYS A H    4  
ATOM 8242  H HA   . LYS A 1 116 ? -22.019 5.755   -8.697  1.00 0.00 ? 116 LYS A HA   4  
ATOM 8243  H HB2  . LYS A 1 116 ? -20.840 3.286   -7.341  1.00 0.00 ? 116 LYS A HB2  4  
ATOM 8244  H HB3  . LYS A 1 116 ? -20.507 4.952   -6.982  1.00 0.00 ? 116 LYS A HB3  4  
ATOM 8245  H HG2  . LYS A 1 116 ? -21.919 4.516   -5.288  1.00 0.00 ? 116 LYS A HG2  4  
ATOM 8246  H HG3  . LYS A 1 116 ? -23.105 5.081   -6.455  1.00 0.00 ? 116 LYS A HG3  4  
ATOM 8247  H HD2  . LYS A 1 116 ? -23.622 2.684   -7.042  1.00 0.00 ? 116 LYS A HD2  4  
ATOM 8248  H HD3  . LYS A 1 116 ? -22.459 2.168   -5.807  1.00 0.00 ? 116 LYS A HD3  4  
ATOM 8249  H HE2  . LYS A 1 116 ? -23.761 3.263   -4.061  1.00 0.00 ? 116 LYS A HE2  4  
ATOM 8250  H HE3  . LYS A 1 116 ? -24.841 3.990   -5.255  1.00 0.00 ? 116 LYS A HE3  4  
ATOM 8251  H HZ1  . LYS A 1 116 ? -25.635 1.783   -5.837  1.00 0.00 ? 116 LYS A HZ1  4  
ATOM 8252  H HZ2  . LYS A 1 116 ? -24.596 1.071   -4.775  1.00 0.00 ? 116 LYS A HZ2  4  
ATOM 8253  H HZ3  . LYS A 1 116 ? -25.798 2.028   -4.205  1.00 0.00 ? 116 LYS A HZ3  4  
ATOM 8254  N N    . ASN A 1 117 ? -19.607 5.527   -9.542  1.00 0.00 ? 117 ASN A N    4  
ATOM 8255  C CA   . ASN A 1 117 ? -18.313 5.513   -10.242 1.00 0.00 ? 117 ASN A CA   4  
ATOM 8256  C C    . ASN A 1 117 ? -17.207 4.843   -9.397  1.00 0.00 ? 117 ASN A C    4  
ATOM 8257  O O    . ASN A 1 117 ? -17.450 4.426   -8.264  1.00 0.00 ? 117 ASN A O    4  
ATOM 8258  C CB   . ASN A 1 117 ? -17.964 6.940   -10.708 1.00 0.00 ? 117 ASN A CB   4  
ATOM 8259  C CG   . ASN A 1 117 ? -17.327 7.797   -9.631  1.00 0.00 ? 117 ASN A CG   4  
ATOM 8260  O OD1  . ASN A 1 117 ? -16.116 7.934   -9.567  1.00 0.00 ? 117 ASN A OD1  4  
ATOM 8261  N ND2  . ASN A 1 117 ? -18.088 8.370   -8.727  1.00 0.00 ? 117 ASN A ND2  4  
ATOM 8262  H H    . ASN A 1 117 ? -19.754 6.184   -8.784  1.00 0.00 ? 117 ASN A H    4  
ATOM 8263  H HA   . ASN A 1 117 ? -18.415 4.907   -11.145 1.00 0.00 ? 117 ASN A HA   4  
ATOM 8264  H HB2  . ASN A 1 117 ? -17.253 6.871   -11.532 1.00 0.00 ? 117 ASN A HB2  4  
ATOM 8265  H HB3  . ASN A 1 117 ? -18.851 7.432   -11.101 1.00 0.00 ? 117 ASN A HB3  4  
ATOM 8266  H HD21 . ASN A 1 117 ? -19.093 8.270   -8.744  1.00 0.00 ? 117 ASN A HD21 4  
ATOM 8267  H HD22 . ASN A 1 117 ? -17.636 8.993   -8.077  1.00 0.00 ? 117 ASN A HD22 4  
ATOM 8268  N N    . GLU A 1 118 ? -15.980 4.767   -9.922  1.00 0.00 ? 118 GLU A N    4  
ATOM 8269  C CA   . GLU A 1 118 ? -14.827 4.131   -9.252  1.00 0.00 ? 118 GLU A CA   4  
ATOM 8270  C C    . GLU A 1 118 ? -14.412 4.782   -7.913  1.00 0.00 ? 118 GLU A C    4  
ATOM 8271  O O    . GLU A 1 118 ? -13.805 4.120   -7.069  1.00 0.00 ? 118 GLU A O    4  
ATOM 8272  C CB   . GLU A 1 118 ? -13.639 4.054   -10.228 1.00 0.00 ? 118 GLU A CB   4  
ATOM 8273  C CG   . GLU A 1 118 ? -13.077 5.421   -10.649 1.00 0.00 ? 118 GLU A CG   4  
ATOM 8274  C CD   . GLU A 1 118 ? -11.913 5.252   -11.645 1.00 0.00 ? 118 GLU A CD   4  
ATOM 8275  O OE1  . GLU A 1 118 ? -10.741 5.145   -11.206 1.00 0.00 ? 118 GLU A OE1  4  
ATOM 8276  O OE2  . GLU A 1 118 ? -12.158 5.229   -12.876 1.00 0.00 ? 118 GLU A OE2  4  
ATOM 8277  H H    . GLU A 1 118 ? -15.833 5.142   -10.848 1.00 0.00 ? 118 GLU A H    4  
ATOM 8278  H HA   . GLU A 1 118 ? -15.111 3.104   -9.014  1.00 0.00 ? 118 GLU A HA   4  
ATOM 8279  H HB2  . GLU A 1 118 ? -12.841 3.476   -9.759  1.00 0.00 ? 118 GLU A HB2  4  
ATOM 8280  H HB3  . GLU A 1 118 ? -13.959 3.514   -11.121 1.00 0.00 ? 118 GLU A HB3  4  
ATOM 8281  H HG2  . GLU A 1 118 ? -13.871 6.015   -11.109 1.00 0.00 ? 118 GLU A HG2  4  
ATOM 8282  H HG3  . GLU A 1 118 ? -12.730 5.959   -9.764  1.00 0.00 ? 118 GLU A HG3  4  
ATOM 8283  N N    . ASP A 1 119 ? -14.779 6.047   -7.674  1.00 0.00 ? 119 ASP A N    4  
ATOM 8284  C CA   . ASP A 1 119 ? -14.637 6.728   -6.376  1.00 0.00 ? 119 ASP A CA   4  
ATOM 8285  C C    . ASP A 1 119 ? -15.617 6.223   -5.294  1.00 0.00 ? 119 ASP A C    4  
ATOM 8286  O O    . ASP A 1 119 ? -15.396 6.442   -4.102  1.00 0.00 ? 119 ASP A O    4  
ATOM 8287  C CB   . ASP A 1 119 ? -14.784 8.243   -6.583  1.00 0.00 ? 119 ASP A CB   4  
ATOM 8288  C CG   . ASP A 1 119 ? -14.182 9.054   -5.422  1.00 0.00 ? 119 ASP A CG   4  
ATOM 8289  O OD1  . ASP A 1 119 ? -12.951 8.969   -5.191  1.00 0.00 ? 119 ASP A OD1  4  
ATOM 8290  O OD2  . ASP A 1 119 ? -14.931 9.809   -4.756  1.00 0.00 ? 119 ASP A OD2  4  
ATOM 8291  H H    . ASP A 1 119 ? -15.219 6.565   -8.428  1.00 0.00 ? 119 ASP A H    4  
ATOM 8292  H HA   . ASP A 1 119 ? -13.626 6.536   -6.011  1.00 0.00 ? 119 ASP A HA   4  
ATOM 8293  H HB2  . ASP A 1 119 ? -14.265 8.531   -7.499  1.00 0.00 ? 119 ASP A HB2  4  
ATOM 8294  H HB3  . ASP A 1 119 ? -15.842 8.487   -6.709  1.00 0.00 ? 119 ASP A HB3  4  
ATOM 8295  N N    . GLY A 1 120 ? -16.715 5.569   -5.699  1.00 0.00 ? 120 GLY A N    4  
ATOM 8296  C CA   . GLY A 1 120 ? -17.789 5.082   -4.827  1.00 0.00 ? 120 GLY A CA   4  
ATOM 8297  C C    . GLY A 1 120 ? -18.982 6.038   -4.695  1.00 0.00 ? 120 GLY A C    4  
ATOM 8298  O O    . GLY A 1 120 ? -19.895 5.763   -3.915  1.00 0.00 ? 120 GLY A O    4  
ATOM 8299  H H    . GLY A 1 120 ? -16.816 5.377   -6.691  1.00 0.00 ? 120 GLY A H    4  
ATOM 8300  H HA2  . GLY A 1 120 ? -18.161 4.141   -5.232  1.00 0.00 ? 120 GLY A HA2  4  
ATOM 8301  H HA3  . GLY A 1 120 ? -17.396 4.885   -3.827  1.00 0.00 ? 120 GLY A HA3  4  
ATOM 8302  N N    . ALA A 1 121 ? -18.998 7.144   -5.451  1.00 0.00 ? 121 ALA A N    4  
ATOM 8303  C CA   . ALA A 1 121 ? -20.084 8.128   -5.448  1.00 0.00 ? 121 ALA A CA   4  
ATOM 8304  C C    . ALA A 1 121 ? -21.141 7.857   -6.523  1.00 0.00 ? 121 ALA A C    4  
ATOM 8305  O O    . ALA A 1 121 ? -20.804 7.511   -7.661  1.00 0.00 ? 121 ALA A O    4  
ATOM 8306  C CB   . ALA A 1 121 ? -19.499 9.539   -5.567  1.00 0.00 ? 121 ALA A CB   4  
ATOM 8307  H H    . ALA A 1 121 ? -18.217 7.305   -6.068  1.00 0.00 ? 121 ALA A H    4  
ATOM 8308  H HA   . ALA A 1 121 ? -20.604 8.054   -4.497  1.00 0.00 ? 121 ALA A HA   4  
ATOM 8309  H HB1  . ALA A 1 121 ? -18.727 9.689   -4.810  1.00 0.00 ? 121 ALA A HB1  4  
ATOM 8310  H HB2  . ALA A 1 121 ? -19.070 9.685   -6.559  1.00 0.00 ? 121 ALA A HB2  4  
ATOM 8311  H HB3  . ALA A 1 121 ? -20.288 10.278  -5.422  1.00 0.00 ? 121 ALA A HB3  4  
ATOM 8312  N N    . VAL A 1 122 ? -22.414 8.048   -6.157  1.00 0.00 ? 122 VAL A N    4  
ATOM 8313  C CA   . VAL A 1 122 ? -23.595 7.826   -7.000  1.00 0.00 ? 122 VAL A CA   4  
ATOM 8314  C C    . VAL A 1 122 ? -23.720 8.926   -8.052  1.00 0.00 ? 122 VAL A C    4  
ATOM 8315  O O    . VAL A 1 122 ? -24.163 10.042  -7.776  1.00 0.00 ? 122 VAL A O    4  
ATOM 8316  C CB   . VAL A 1 122 ? -24.858 7.599   -6.139  1.00 0.00 ? 122 VAL A CB   4  
ATOM 8317  C CG1  . VAL A 1 122 ? -25.228 8.730   -5.172  1.00 0.00 ? 122 VAL A CG1  4  
ATOM 8318  C CG2  . VAL A 1 122 ? -26.068 7.273   -7.006  1.00 0.00 ? 122 VAL A CG2  4  
ATOM 8319  H H    . VAL A 1 122 ? -22.588 8.402   -5.228  1.00 0.00 ? 122 VAL A H    4  
ATOM 8320  H HA   . VAL A 1 122 ? -23.443 6.899   -7.547  1.00 0.00 ? 122 VAL A HA   4  
ATOM 8321  H HB   . VAL A 1 122 ? -24.667 6.718   -5.525  1.00 0.00 ? 122 VAL A HB   4  
ATOM 8322  H HG11 . VAL A 1 122 ? -26.045 8.402   -4.528  1.00 0.00 ? 122 VAL A HG11 4  
ATOM 8323  H HG12 . VAL A 1 122 ? -24.377 8.985   -4.542  1.00 0.00 ? 122 VAL A HG12 4  
ATOM 8324  H HG13 . VAL A 1 122 ? -25.552 9.614   -5.718  1.00 0.00 ? 122 VAL A HG13 4  
ATOM 8325  H HG21 . VAL A 1 122 ? -26.911 7.029   -6.361  1.00 0.00 ? 122 VAL A HG21 4  
ATOM 8326  H HG22 . VAL A 1 122 ? -26.332 8.122   -7.635  1.00 0.00 ? 122 VAL A HG22 4  
ATOM 8327  H HG23 . VAL A 1 122 ? -25.842 6.416   -7.638  1.00 0.00 ? 122 VAL A HG23 4  
ATOM 8328  N N    . ILE A 1 123 ? -23.286 8.609   -9.273  1.00 0.00 ? 123 ILE A N    4  
ATOM 8329  C CA   . ILE A 1 123 ? -23.384 9.517   -10.419 1.00 0.00 ? 123 ILE A CA   4  
ATOM 8330  C C    . ILE A 1 123 ? -24.720 9.356   -11.140 1.00 0.00 ? 123 ILE A C    4  
ATOM 8331  O O    . ILE A 1 123 ? -25.228 10.348  -11.655 1.00 0.00 ? 123 ILE A O    4  
ATOM 8332  C CB   . ILE A 1 123 ? -22.159 9.441   -11.362 1.00 0.00 ? 123 ILE A CB   4  
ATOM 8333  C CG1  . ILE A 1 123 ? -22.185 8.357   -12.466 1.00 0.00 ? 123 ILE A CG1  4  
ATOM 8334  C CG2  . ILE A 1 123 ? -20.853 9.386   -10.550 1.00 0.00 ? 123 ILE A CG2  4  
ATOM 8335  C CD1  . ILE A 1 123 ? -22.289 6.895   -12.021 1.00 0.00 ? 123 ILE A CD1  4  
ATOM 8336  H H    . ILE A 1 123 ? -22.883 7.698   -9.419  1.00 0.00 ? 123 ILE A H    4  
ATOM 8337  H HA   . ILE A 1 123 ? -23.381 10.534  -10.030 1.00 0.00 ? 123 ILE A HA   4  
ATOM 8338  H HB   . ILE A 1 123 ? -22.143 10.393  -11.896 1.00 0.00 ? 123 ILE A HB   4  
ATOM 8339  H HG12 . ILE A 1 123 ? -23.017 8.557   -13.138 1.00 0.00 ? 123 ILE A HG12 4  
ATOM 8340  H HG13 . ILE A 1 123 ? -21.273 8.459   -13.056 1.00 0.00 ? 123 ILE A HG13 4  
ATOM 8341  H HG21 . ILE A 1 123 ? -20.002 9.551   -11.210 1.00 0.00 ? 123 ILE A HG21 4  
ATOM 8342  H HG22 . ILE A 1 123 ? -20.852 10.160  -9.779  1.00 0.00 ? 123 ILE A HG22 4  
ATOM 8343  H HG23 . ILE A 1 123 ? -20.752 8.416   -10.068 1.00 0.00 ? 123 ILE A HG23 4  
ATOM 8344  H HD11 . ILE A 1 123 ? -21.506 6.657   -11.307 1.00 0.00 ? 123 ILE A HD11 4  
ATOM 8345  H HD12 . ILE A 1 123 ? -23.264 6.704   -11.586 1.00 0.00 ? 123 ILE A HD12 4  
ATOM 8346  H HD13 . ILE A 1 123 ? -22.181 6.249   -12.893 1.00 0.00 ? 123 ILE A HD13 4  
ATOM 8347  N N    . MET A 1 124 ? -25.325 8.155   -11.125 1.00 0.00 ? 124 MET A N    4  
ATOM 8348  C CA   . MET A 1 124 ? -26.617 7.933   -11.784 1.00 0.00 ? 124 MET A CA   4  
ATOM 8349  C C    . MET A 1 124 ? -27.569 7.125   -10.890 1.00 0.00 ? 124 MET A C    4  
ATOM 8350  O O    . MET A 1 124 ? -27.192 6.258   -10.105 1.00 0.00 ? 124 MET A O    4  
ATOM 8351  C CB   . MET A 1 124 ? -26.431 7.290   -13.177 1.00 0.00 ? 124 MET A CB   4  
ATOM 8352  C CG   . MET A 1 124 ? -26.037 8.276   -14.280 1.00 0.00 ? 124 MET A CG   4  
ATOM 8353  S SD   . MET A 1 124 ? -27.083 9.736   -14.513 1.00 0.00 ? 124 MET A SD   4  
ATOM 8354  C CE   . MET A 1 124 ? -25.759 10.943  -14.787 1.00 0.00 ? 124 MET A CE   4  
ATOM 8355  H H    . MET A 1 124 ? -24.889 7.375   -10.633 1.00 0.00 ? 124 MET A H    4  
ATOM 8356  H HA   . MET A 1 124 ? -27.112 8.893   -11.928 1.00 0.00 ? 124 MET A HA   4  
ATOM 8357  H HB2  . MET A 1 124 ? -25.657 6.531   -13.147 1.00 0.00 ? 124 MET A HB2  4  
ATOM 8358  H HB3  . MET A 1 124 ? -27.368 6.822   -13.480 1.00 0.00 ? 124 MET A HB3  4  
ATOM 8359  H HG2  . MET A 1 124 ? -25.026 8.614   -14.061 1.00 0.00 ? 124 MET A HG2  4  
ATOM 8360  H HG3  . MET A 1 124 ? -25.992 7.735   -15.226 1.00 0.00 ? 124 MET A HG3  4  
ATOM 8361  H HE1  . MET A 1 124 ? -26.173 11.950  -14.799 1.00 0.00 ? 124 MET A HE1  4  
ATOM 8362  H HE2  . MET A 1 124 ? -25.023 10.861  -13.983 1.00 0.00 ? 124 MET A HE2  4  
ATOM 8363  H HE3  . MET A 1 124 ? -25.264 10.736  -15.735 1.00 0.00 ? 124 MET A HE3  4  
ATOM 8364  N N    . PHE A 1 125 ? -28.848 7.426   -11.027 1.00 0.00 ? 125 PHE A N    4  
ATOM 8365  C CA   . PHE A 1 125 ? -29.961 6.845   -10.282 1.00 0.00 ? 125 PHE A CA   4  
ATOM 8366  C C    . PHE A 1 125 ? -30.667 5.854   -11.218 1.00 0.00 ? 125 PHE A C    4  
ATOM 8367  O O    . PHE A 1 125 ? -31.681 6.156   -11.846 1.00 0.00 ? 125 PHE A O    4  
ATOM 8368  C CB   . PHE A 1 125 ? -30.890 7.978   -9.784  1.00 0.00 ? 125 PHE A CB   4  
ATOM 8369  C CG   . PHE A 1 125 ? -30.642 8.623   -8.429  1.00 0.00 ? 125 PHE A CG   4  
ATOM 8370  C CD1  . PHE A 1 125 ? -29.583 8.248   -7.575  1.00 0.00 ? 125 PHE A CD1  4  
ATOM 8371  C CD2  . PHE A 1 125 ? -31.500 9.671   -8.038  1.00 0.00 ? 125 PHE A CD2  4  
ATOM 8372  C CE1  . PHE A 1 125 ? -29.396 8.907   -6.346  1.00 0.00 ? 125 PHE A CE1  4  
ATOM 8373  C CE2  . PHE A 1 125 ? -31.300 10.341  -6.819  1.00 0.00 ? 125 PHE A CE2  4  
ATOM 8374  C CZ   . PHE A 1 125 ? -30.249 9.957   -5.970  1.00 0.00 ? 125 PHE A CZ   4  
ATOM 8375  H H    . PHE A 1 125 ? -29.062 8.089   -11.754 1.00 0.00 ? 125 PHE A H    4  
ATOM 8376  H HA   . PHE A 1 125 ? -29.600 6.265   -9.434  1.00 0.00 ? 125 PHE A HA   4  
ATOM 8377  H HB2  . PHE A 1 125 ? -30.923 8.769   -10.531 1.00 0.00 ? 125 PHE A HB2  4  
ATOM 8378  H HB3  . PHE A 1 125 ? -31.895 7.565   -9.712  1.00 0.00 ? 125 PHE A HB3  4  
ATOM 8379  H HD1  . PHE A 1 125 ? -28.888 7.477   -7.861  1.00 0.00 ? 125 PHE A HD1  4  
ATOM 8380  H HD2  . PHE A 1 125 ? -32.307 9.976   -8.689  1.00 0.00 ? 125 PHE A HD2  4  
ATOM 8381  H HE1  . PHE A 1 125 ? -28.582 8.620   -5.693  1.00 0.00 ? 125 PHE A HE1  4  
ATOM 8382  H HE2  . PHE A 1 125 ? -31.951 11.157  -6.534  1.00 0.00 ? 125 PHE A HE2  4  
ATOM 8383  H HZ   . PHE A 1 125 ? -30.094 10.472  -5.031  1.00 0.00 ? 125 PHE A HZ   4  
ATOM 8384  N N    . ILE A 1 126 ? -30.097 4.657   -11.347 1.00 0.00 ? 126 ILE A N    4  
ATOM 8385  C CA   . ILE A 1 126 ? -30.693 3.560   -12.129 1.00 0.00 ? 126 ILE A CA   4  
ATOM 8386  C C    . ILE A 1 126 ? -31.386 2.594   -11.179 1.00 0.00 ? 126 ILE A C    4  
ATOM 8387  O O    . ILE A 1 126 ? -30.905 1.497   -10.885 1.00 0.00 ? 126 ILE A O    4  
ATOM 8388  C CB   . ILE A 1 126 ? -29.683 2.893   -13.075 1.00 0.00 ? 126 ILE A CB   4  
ATOM 8389  C CG1  . ILE A 1 126 ? -29.070 3.987   -13.969 1.00 0.00 ? 126 ILE A CG1  4  
ATOM 8390  C CG2  . ILE A 1 126 ? -30.362 1.803   -13.937 1.00 0.00 ? 126 ILE A CG2  4  
ATOM 8391  C CD1  . ILE A 1 126 ? -28.122 3.423   -15.013 1.00 0.00 ? 126 ILE A CD1  4  
ATOM 8392  H H    . ILE A 1 126 ? -29.208 4.507   -10.892 1.00 0.00 ? 126 ILE A H    4  
ATOM 8393  H HA   . ILE A 1 126 ? -31.469 3.973   -12.770 1.00 0.00 ? 126 ILE A HA   4  
ATOM 8394  H HB   . ILE A 1 126 ? -28.894 2.429   -12.481 1.00 0.00 ? 126 ILE A HB   4  
ATOM 8395  H HG12 . ILE A 1 126 ? -29.861 4.538   -14.474 1.00 0.00 ? 126 ILE A HG12 4  
ATOM 8396  H HG13 . ILE A 1 126 ? -28.511 4.699   -13.364 1.00 0.00 ? 126 ILE A HG13 4  
ATOM 8397  H HG21 . ILE A 1 126 ? -30.878 2.251   -14.779 1.00 0.00 ? 126 ILE A HG21 4  
ATOM 8398  H HG22 . ILE A 1 126 ? -29.614 1.107   -14.316 1.00 0.00 ? 126 ILE A HG22 4  
ATOM 8399  H HG23 . ILE A 1 126 ? -31.110 1.248   -13.378 1.00 0.00 ? 126 ILE A HG23 4  
ATOM 8400  H HD11 . ILE A 1 126 ? -27.636 4.256   -15.516 1.00 0.00 ? 126 ILE A HD11 4  
ATOM 8401  H HD12 . ILE A 1 126 ? -27.395 2.783   -14.518 1.00 0.00 ? 126 ILE A HD12 4  
ATOM 8402  H HD13 . ILE A 1 126 ? -28.687 2.838   -15.735 1.00 0.00 ? 126 ILE A HD13 4  
ATOM 8403  N N    . LEU A 1 127 ? -32.527 3.041   -10.657 1.00 0.00 ? 127 LEU A N    4  
ATOM 8404  C CA   . LEU A 1 127 ? -33.317 2.283   -9.695  1.00 0.00 ? 127 LEU A CA   4  
ATOM 8405  C C    . LEU A 1 127 ? -34.105 1.199   -10.442 1.00 0.00 ? 127 LEU A C    4  
ATOM 8406  O O    . LEU A 1 127 ? -35.231 1.389   -10.895 1.00 0.00 ? 127 LEU A O    4  
ATOM 8407  C CB   . LEU A 1 127 ? -34.060 3.250   -8.727  1.00 0.00 ? 127 LEU A CB   4  
ATOM 8408  C CG   . LEU A 1 127 ? -33.089 4.255   -8.044  1.00 0.00 ? 127 LEU A CG   4  
ATOM 8409  C CD1  . LEU A 1 127 ? -33.575 5.080   -6.851  1.00 0.00 ? 127 LEU A CD1  4  
ATOM 8410  C CD2  . LEU A 1 127 ? -31.917 3.490   -7.469  1.00 0.00 ? 127 LEU A CD2  4  
ATOM 8411  H H    . LEU A 1 127 ? -32.862 3.949   -10.951 1.00 0.00 ? 127 LEU A H    4  
ATOM 8412  H HA   . LEU A 1 127 ? -32.629 1.710   -9.072  1.00 0.00 ? 127 LEU A HA   4  
ATOM 8413  H HB2  . LEU A 1 127 ? -34.836 3.800   -9.253  1.00 0.00 ? 127 LEU A HB2  4  
ATOM 8414  H HB3  . LEU A 1 127 ? -34.540 2.648   -7.961  1.00 0.00 ? 127 LEU A HB3  4  
ATOM 8415  H HG   . LEU A 1 127 ? -32.718 4.954   -8.790  1.00 0.00 ? 127 LEU A HG   4  
ATOM 8416  H HD11 . LEU A 1 127 ? -33.792 4.442   -5.998  1.00 0.00 ? 127 LEU A HD11 4  
ATOM 8417  H HD12 . LEU A 1 127 ? -32.766 5.750   -6.529  1.00 0.00 ? 127 LEU A HD12 4  
ATOM 8418  H HD13 . LEU A 1 127 ? -34.448 5.663   -7.129  1.00 0.00 ? 127 LEU A HD13 4  
ATOM 8419  H HD21 . LEU A 1 127 ? -31.285 3.172   -8.293  1.00 0.00 ? 127 LEU A HD21 4  
ATOM 8420  H HD22 . LEU A 1 127 ? -31.345 4.109   -6.790  1.00 0.00 ? 127 LEU A HD22 4  
ATOM 8421  H HD23 . LEU A 1 127 ? -32.287 2.628   -6.925  1.00 0.00 ? 127 LEU A HD23 4  
ATOM 8422  N N    . ASN A 1 128 ? -33.428 0.059   -10.620 1.00 0.00 ? 128 ASN A N    4  
ATOM 8423  C CA   . ASN A 1 128 ? -33.941 -1.159  -11.247 1.00 0.00 ? 128 ASN A CA   4  
ATOM 8424  C C    . ASN A 1 128 ? -35.160 -1.679  -10.465 1.00 0.00 ? 128 ASN A C    4  
ATOM 8425  O O    . ASN A 1 128 ? -35.015 -2.287  -9.403  1.00 0.00 ? 128 ASN A O    4  
ATOM 8426  C CB   . ASN A 1 128 ? -32.831 -2.235  -11.250 1.00 0.00 ? 128 ASN A CB   4  
ATOM 8427  C CG   . ASN A 1 128 ? -31.761 -2.087  -12.322 1.00 0.00 ? 128 ASN A CG   4  
ATOM 8428  O OD1  . ASN A 1 128 ? -31.709 -2.847  -13.276 1.00 0.00 ? 128 ASN A OD1  4  
ATOM 8429  N ND2  . ASN A 1 128 ? -30.852 -1.145  -12.209 1.00 0.00 ? 128 ASN A ND2  4  
ATOM 8430  H H    . ASN A 1 128 ? -32.442 0.092   -10.380 1.00 0.00 ? 128 ASN A H    4  
ATOM 8431  H HA   . ASN A 1 128 ? -34.251 -0.954  -12.267 1.00 0.00 ? 128 ASN A HA   4  
ATOM 8432  H HB2  . ASN A 1 128 ? -32.354 -2.266  -10.271 1.00 0.00 ? 128 ASN A HB2  4  
ATOM 8433  H HB3  . ASN A 1 128 ? -33.298 -3.207  -11.410 1.00 0.00 ? 128 ASN A HB3  4  
ATOM 8434  H HD21 . ASN A 1 128 ? -30.864 -0.464  -11.461 1.00 0.00 ? 128 ASN A HD21 4  
ATOM 8435  H HD22 . ASN A 1 128 ? -30.153 -1.091  -12.931 1.00 0.00 ? 128 ASN A HD22 4  
ATOM 8436  N N    . PHE A 1 129 ? -36.377 -1.467  -10.974 1.00 0.00 ? 129 PHE A N    4  
ATOM 8437  C CA   . PHE A 1 129 ? -37.589 -1.868  -10.274 1.00 0.00 ? 129 PHE A CA   4  
ATOM 8438  C C    . PHE A 1 129 ? -37.933 -3.335  -10.557 1.00 0.00 ? 129 PHE A C    4  
ATOM 8439  O O    . PHE A 1 129 ? -38.985 -3.664  -11.107 1.00 0.00 ? 129 PHE A O    4  
ATOM 8440  C CB   . PHE A 1 129 ? -38.741 -0.916  -10.588 1.00 0.00 ? 129 PHE A CB   4  
ATOM 8441  C CG   . PHE A 1 129 ? -38.528 0.572   -10.346 1.00 0.00 ? 129 PHE A CG   4  
ATOM 8442  C CD1  . PHE A 1 129 ? -37.897 1.040   -9.175  1.00 0.00 ? 129 PHE A CD1  4  
ATOM 8443  C CD2  . PHE A 1 129 ? -39.020 1.502   -11.285 1.00 0.00 ? 129 PHE A CD2  4  
ATOM 8444  C CE1  . PHE A 1 129 ? -37.741 2.422   -8.961  1.00 0.00 ? 129 PHE A CE1  4  
ATOM 8445  C CE2  . PHE A 1 129 ? -38.870 2.883   -11.065 1.00 0.00 ? 129 PHE A CE2  4  
ATOM 8446  C CZ   . PHE A 1 129 ? -38.224 3.344   -9.904  1.00 0.00 ? 129 PHE A CZ   4  
ATOM 8447  H H    . PHE A 1 129 ? -36.489 -1.009  -11.864 1.00 0.00 ? 129 PHE A H    4  
ATOM 8448  H HA   . PHE A 1 129 ? -37.395 -1.806  -9.203  1.00 0.00 ? 129 PHE A HA   4  
ATOM 8449  H HB2  . PHE A 1 129 ? -39.022 -1.055  -11.631 1.00 0.00 ? 129 PHE A HB2  4  
ATOM 8450  H HB3  . PHE A 1 129 ? -39.560 -1.249  -9.957  1.00 0.00 ? 129 PHE A HB3  4  
ATOM 8451  H HD1  . PHE A 1 129 ? -37.528 0.342   -8.438  1.00 0.00 ? 129 PHE A HD1  4  
ATOM 8452  H HD2  . PHE A 1 129 ? -39.523 1.157   -12.176 1.00 0.00 ? 129 PHE A HD2  4  
ATOM 8453  H HE1  . PHE A 1 129 ? -37.254 2.781   -8.066  1.00 0.00 ? 129 PHE A HE1  4  
ATOM 8454  H HE2  . PHE A 1 129 ? -39.249 3.592   -11.789 1.00 0.00 ? 129 PHE A HE2  4  
ATOM 8455  H HZ   . PHE A 1 129 ? -38.101 4.406   -9.735  1.00 0.00 ? 129 PHE A HZ   4  
ATOM 8456  N N    . GLU A 1 130 ? -37.031 -4.238  -10.178 1.00 0.00 ? 130 GLU A N    4  
ATOM 8457  C CA   . GLU A 1 130 ? -37.285 -5.674  -10.296 1.00 0.00 ? 130 GLU A CA   4  
ATOM 8458  C C    . GLU A 1 130 ? -38.161 -6.164  -9.143  1.00 0.00 ? 130 GLU A C    4  
ATOM 8459  O O    . GLU A 1 130 ? -37.882 -5.932  -7.973  1.00 0.00 ? 130 GLU A O    4  
ATOM 8460  C CB   . GLU A 1 130 ? -35.995 -6.489  -10.389 1.00 0.00 ? 130 GLU A CB   4  
ATOM 8461  C CG   . GLU A 1 130 ? -34.984 -6.160  -9.288  1.00 0.00 ? 130 GLU A CG   4  
ATOM 8462  C CD   . GLU A 1 130 ? -33.849 -7.196  -9.209  1.00 0.00 ? 130 GLU A CD   4  
ATOM 8463  O OE1  . GLU A 1 130 ? -34.103 -8.366  -8.841  1.00 0.00 ? 130 GLU A OE1  4  
ATOM 8464  O OE2  . GLU A 1 130 ? -32.691 -6.839  -9.537  1.00 0.00 ? 130 GLU A OE2  4  
ATOM 8465  H H    . GLU A 1 130 ? -36.180 -3.908  -9.722  1.00 0.00 ? 130 GLU A H    4  
ATOM 8466  H HA   . GLU A 1 130 ? -37.828 -5.855  -11.225 1.00 0.00 ? 130 GLU A HA   4  
ATOM 8467  H HB2  . GLU A 1 130 ? -36.271 -7.546  -10.347 1.00 0.00 ? 130 GLU A HB2  4  
ATOM 8468  H HB3  . GLU A 1 130 ? -35.537 -6.274  -11.350 1.00 0.00 ? 130 GLU A HB3  4  
ATOM 8469  H HG2  . GLU A 1 130 ? -34.579 -5.173  -9.508  1.00 0.00 ? 130 GLU A HG2  4  
ATOM 8470  H HG3  . GLU A 1 130 ? -35.482 -6.089  -8.321  1.00 0.00 ? 130 GLU A HG3  4  
ATOM 8471  N N    . VAL A 1 131 ? -39.236 -6.857  -9.483  1.00 0.00 ? 131 VAL A N    4  
ATOM 8472  C CA   . VAL A 1 131 ? -40.219 -7.395  -8.534  1.00 0.00 ? 131 VAL A CA   4  
ATOM 8473  C C    . VAL A 1 131 ? -39.750 -8.781  -8.099  1.00 0.00 ? 131 VAL A C    4  
ATOM 8474  O O    . VAL A 1 131 ? -39.656 -9.687  -8.932  1.00 0.00 ? 131 VAL A O    4  
ATOM 8475  C CB   . VAL A 1 131 ? -41.590 -7.422  -9.220  1.00 0.00 ? 131 VAL A CB   4  
ATOM 8476  C CG1  . VAL A 1 131 ? -42.664 -8.212  -8.482  1.00 0.00 ? 131 VAL A CG1  4  
ATOM 8477  C CG2  . VAL A 1 131 ? -42.122 -5.994  -9.408  1.00 0.00 ? 131 VAL A CG2  4  
ATOM 8478  H H    . VAL A 1 131 ? -39.359 -7.052  -10.462 1.00 0.00 ? 131 VAL A H    4  
ATOM 8479  H HA   . VAL A 1 131 ? -40.285 -6.755  -7.654  1.00 0.00 ? 131 VAL A HA   4  
ATOM 8480  H HB   . VAL A 1 131 ? -41.442 -7.876  -10.192 1.00 0.00 ? 131 VAL A HB   4  
ATOM 8481  H HG11 . VAL A 1 131 ? -42.330 -9.235  -8.308  1.00 0.00 ? 131 VAL A HG11 4  
ATOM 8482  H HG12 . VAL A 1 131 ? -42.888 -7.725  -7.538  1.00 0.00 ? 131 VAL A HG12 4  
ATOM 8483  H HG13 . VAL A 1 131 ? -43.569 -8.245  -9.088  1.00 0.00 ? 131 VAL A HG13 4  
ATOM 8484  H HG21 . VAL A 1 131 ? -41.407 -5.391  -9.965  1.00 0.00 ? 131 VAL A HG21 4  
ATOM 8485  H HG22 . VAL A 1 131 ? -43.057 -6.027  -9.968  1.00 0.00 ? 131 VAL A HG22 4  
ATOM 8486  H HG23 . VAL A 1 131 ? -42.304 -5.527  -8.438  1.00 0.00 ? 131 VAL A HG23 4  
ATOM 8487  N N    . VAL A 1 132 ? -39.400 -8.940  -6.818  1.00 0.00 ? 132 VAL A N    4  
ATOM 8488  C CA   . VAL A 1 132 ? -38.846 -10.200 -6.300  1.00 0.00 ? 132 VAL A CA   4  
ATOM 8489  C C    . VAL A 1 132 ? -39.391 -10.536 -4.907  1.00 0.00 ? 132 VAL A C    4  
ATOM 8490  O O    . VAL A 1 132 ? -39.474 -9.673  -4.031  1.00 0.00 ? 132 VAL A O    4  
ATOM 8491  C CB   . VAL A 1 132 ? -37.300 -10.200 -6.398  1.00 0.00 ? 132 VAL A CB   4  
ATOM 8492  C CG1  . VAL A 1 132 ? -36.625 -9.075  -5.610  1.00 0.00 ? 132 VAL A CG1  4  
ATOM 8493  C CG2  . VAL A 1 132 ? -36.698 -11.541 -5.963  1.00 0.00 ? 132 VAL A CG2  4  
ATOM 8494  H H    . VAL A 1 132 ? -39.543 -8.179  -6.159  1.00 0.00 ? 132 VAL A H    4  
ATOM 8495  H HA   . VAL A 1 132 ? -39.191 -10.999 -6.957  1.00 0.00 ? 132 VAL A HA   4  
ATOM 8496  H HB   . VAL A 1 132 ? -37.040 -10.059 -7.448  1.00 0.00 ? 132 VAL A HB   4  
ATOM 8497  H HG11 . VAL A 1 132 ? -35.548 -9.109  -5.771  1.00 0.00 ? 132 VAL A HG11 4  
ATOM 8498  H HG12 . VAL A 1 132 ? -36.990 -8.107  -5.952  1.00 0.00 ? 132 VAL A HG12 4  
ATOM 8499  H HG13 . VAL A 1 132 ? -36.829 -9.187  -4.546  1.00 0.00 ? 132 VAL A HG13 4  
ATOM 8500  H HG21 . VAL A 1 132 ? -37.163 -12.355 -6.518  1.00 0.00 ? 132 VAL A HG21 4  
ATOM 8501  H HG22 . VAL A 1 132 ? -35.628 -11.545 -6.174  1.00 0.00 ? 132 VAL A HG22 4  
ATOM 8502  H HG23 . VAL A 1 132 ? -36.844 -11.699 -4.894  1.00 0.00 ? 132 VAL A HG23 4  
ATOM 8503  N N    . MET A 1 133 ? -39.761 -11.801 -4.704  1.00 0.00 ? 133 MET A N    4  
ATOM 8504  C CA   . MET A 1 133 ? -40.196 -12.371 -3.428  1.00 0.00 ? 133 MET A CA   4  
ATOM 8505  C C    . MET A 1 133 ? -39.069 -13.184 -2.777  1.00 0.00 ? 133 MET A C    4  
ATOM 8506  O O    . MET A 1 133 ? -38.233 -13.792 -3.450  1.00 0.00 ? 133 MET A O    4  
ATOM 8507  C CB   . MET A 1 133 ? -41.444 -13.247 -3.625  1.00 0.00 ? 133 MET A CB   4  
ATOM 8508  C CG   . MET A 1 133 ? -42.653 -12.448 -4.129  1.00 0.00 ? 133 MET A CG   4  
ATOM 8509  S SD   . MET A 1 133 ? -44.174 -13.414 -4.362  1.00 0.00 ? 133 MET A SD   4  
ATOM 8510  C CE   . MET A 1 133 ? -44.629 -13.752 -2.638  1.00 0.00 ? 133 MET A CE   4  
ATOM 8511  H H    . MET A 1 133 ? -39.657 -12.448 -5.465  1.00 0.00 ? 133 MET A H    4  
ATOM 8512  H HA   . MET A 1 133 ? -40.462 -11.562 -2.745  1.00 0.00 ? 133 MET A HA   4  
ATOM 8513  H HB2  . MET A 1 133 ? -41.221 -14.044 -4.337  1.00 0.00 ? 133 MET A HB2  4  
ATOM 8514  H HB3  . MET A 1 133 ? -41.702 -13.706 -2.670  1.00 0.00 ? 133 MET A HB3  4  
ATOM 8515  H HG2  . MET A 1 133 ? -42.858 -11.638 -3.428  1.00 0.00 ? 133 MET A HG2  4  
ATOM 8516  H HG3  . MET A 1 133 ? -42.394 -12.003 -5.090  1.00 0.00 ? 133 MET A HG3  4  
ATOM 8517  H HE1  . MET A 1 133 ? -44.729 -12.814 -2.091  1.00 0.00 ? 133 MET A HE1  4  
ATOM 8518  H HE2  . MET A 1 133 ? -45.579 -14.285 -2.610  1.00 0.00 ? 133 MET A HE2  4  
ATOM 8519  H HE3  . MET A 1 133 ? -43.864 -14.368 -2.163  1.00 0.00 ? 133 MET A HE3  4  
ATOM 8520  N N    . GLU A 1 134 ? -39.072 -13.215 -1.449  1.00 0.00 ? 134 GLU A N    4  
ATOM 8521  C CA   . GLU A 1 134 ? -38.150 -14.014 -0.626  1.00 0.00 ? 134 GLU A CA   4  
ATOM 8522  C C    . GLU A 1 134 ? -38.424 -15.531 -0.732  1.00 0.00 ? 134 GLU A C    4  
ATOM 8523  O O    . GLU A 1 134 ? -39.561 -15.959 -0.971  1.00 0.00 ? 134 GLU A O    4  
ATOM 8524  C CB   . GLU A 1 134 ? -38.217 -13.564 0.843   1.00 0.00 ? 134 GLU A CB   4  
ATOM 8525  C CG   . GLU A 1 134 ? -37.800 -12.101 1.040   1.00 0.00 ? 134 GLU A CG   4  
ATOM 8526  C CD   . GLU A 1 134 ? -37.737 -11.749 2.540   1.00 0.00 ? 134 GLU A CD   4  
ATOM 8527  O OE1  . GLU A 1 134 ? -38.770 -11.325 3.113   1.00 0.00 ? 134 GLU A OE1  4  
ATOM 8528  O OE2  . GLU A 1 134 ? -36.654 -11.897 3.160   1.00 0.00 ? 134 GLU A OE2  4  
ATOM 8529  H H    . GLU A 1 134 ? -39.791 -12.682 -0.988  1.00 0.00 ? 134 GLU A H    4  
ATOM 8530  H HA   . GLU A 1 134 ? -37.132 -13.841 -0.982  1.00 0.00 ? 134 GLU A HA   4  
ATOM 8531  H HB2  . GLU A 1 134 ? -39.232 -13.703 1.219   1.00 0.00 ? 134 GLU A HB2  4  
ATOM 8532  H HB3  . GLU A 1 134 ? -37.547 -14.195 1.429   1.00 0.00 ? 134 GLU A HB3  4  
ATOM 8533  H HG2  . GLU A 1 134 ? -36.823 -11.948 0.577   1.00 0.00 ? 134 GLU A HG2  4  
ATOM 8534  H HG3  . GLU A 1 134 ? -38.513 -11.444 0.536   1.00 0.00 ? 134 GLU A HG3  4  
ATOM 8535  N N    . LYS A 1 135 ? -37.379 -16.348 -0.532  1.00 0.00 ? 135 LYS A N    4  
ATOM 8536  C CA   . LYS A 1 135 ? -37.442 -17.823 -0.536  1.00 0.00 ? 135 LYS A CA   4  
ATOM 8537  C C    . LYS A 1 135 ? -38.001 -18.422 0.768   1.00 0.00 ? 135 LYS A C    4  
ATOM 8538  O O    . LYS A 1 135 ? -37.831 -17.813 1.850   1.00 0.00 ? 135 LYS A O    4  
ATOM 8539  C CB   . LYS A 1 135 ? -36.077 -18.415 -0.938  1.00 0.00 ? 135 LYS A CB   4  
ATOM 8540  C CG   . LYS A 1 135 ? -34.928 -18.110 0.043   1.00 0.00 ? 135 LYS A CG   4  
ATOM 8541  C CD   . LYS A 1 135 ? -33.629 -18.856 -0.310  1.00 0.00 ? 135 LYS A CD   4  
ATOM 8542  C CE   . LYS A 1 135 ? -33.036 -18.518 -1.688  1.00 0.00 ? 135 LYS A CE   4  
ATOM 8543  N NZ   . LYS A 1 135 ? -32.521 -17.125 -1.763  1.00 0.00 ? 135 LYS A NZ   4  
ATOM 8544  H H    . LYS A 1 135 ? -36.490 -15.929 -0.306  1.00 0.00 ? 135 LYS A H    4  
ATOM 8545  H HA   . LYS A 1 135 ? -38.150 -18.120 -1.310  1.00 0.00 ? 135 LYS A HA   4  
ATOM 8546  H HB2  . LYS A 1 135 ? -36.191 -19.497 -1.013  1.00 0.00 ? 135 LYS A HB2  4  
ATOM 8547  H HB3  . LYS A 1 135 ? -35.817 -18.039 -1.928  1.00 0.00 ? 135 LYS A HB3  4  
ATOM 8548  H HG2  . LYS A 1 135 ? -34.735 -17.037 0.065   1.00 0.00 ? 135 LYS A HG2  4  
ATOM 8549  H HG3  . LYS A 1 135 ? -35.222 -18.421 1.045   1.00 0.00 ? 135 LYS A HG3  4  
ATOM 8550  H HD2  . LYS A 1 135 ? -32.883 -18.649 0.459   1.00 0.00 ? 135 LYS A HD2  4  
ATOM 8551  H HD3  . LYS A 1 135 ? -33.832 -19.929 -0.282  1.00 0.00 ? 135 LYS A HD3  4  
ATOM 8552  H HE2  . LYS A 1 135 ? -32.218 -19.216 -1.886  1.00 0.00 ? 135 LYS A HE2  4  
ATOM 8553  H HE3  . LYS A 1 135 ? -33.797 -18.683 -2.457  1.00 0.00 ? 135 LYS A HE3  4  
ATOM 8554  H HZ1  . LYS A 1 135 ? -33.256 -16.446 -1.625  1.00 0.00 ? 135 LYS A HZ1  4  
ATOM 8555  H HZ2  . LYS A 1 135 ? -31.808 -16.960 -1.065  1.00 0.00 ? 135 LYS A HZ2  4  
ATOM 8556  H HZ3  . LYS A 1 135 ? -32.105 -16.941 -2.667  1.00 0.00 ? 135 LYS A HZ3  4  
ATOM 8557  N N    . MET A 1 1   ? -13.316 -0.762  2.666   1.00 0.00 ? 1   MET A N    5  
ATOM 8558  C CA   . MET A 1 1   ? -14.263 -1.410  1.720   1.00 0.00 ? 1   MET A CA   5  
ATOM 8559  C C    . MET A 1 1   ? -13.704 -2.758  1.243   1.00 0.00 ? 1   MET A C    5  
ATOM 8560  O O    . MET A 1 1   ? -12.541 -2.806  0.830   1.00 0.00 ? 1   MET A O    5  
ATOM 8561  C CB   . MET A 1 1   ? -14.582 -0.482  0.528   1.00 0.00 ? 1   MET A CB   5  
ATOM 8562  C CG   . MET A 1 1   ? -15.733 -0.999  -0.346  1.00 0.00 ? 1   MET A CG   5  
ATOM 8563  S SD   . MET A 1 1   ? -16.144 0.085   -1.742  1.00 0.00 ? 1   MET A SD   5  
ATOM 8564  C CE   . MET A 1 1   ? -17.456 -0.905  -2.509  1.00 0.00 ? 1   MET A CE   5  
ATOM 8565  H H1   . MET A 1 1   ? -13.149 -1.354  3.466   1.00 0.00 ? 1   MET A H1   5  
ATOM 8566  H H2   . MET A 1 1   ? -13.686 0.117   2.993   1.00 0.00 ? 1   MET A H2   5  
ATOM 8567  H H3   . MET A 1 1   ? -12.431 -0.589  2.210   1.00 0.00 ? 1   MET A H3   5  
ATOM 8568  H HA   . MET A 1 1   ? -15.194 -1.596  2.257   1.00 0.00 ? 1   MET A HA   5  
ATOM 8569  H HB2  . MET A 1 1   ? -14.868 0.499   0.909   1.00 0.00 ? 1   MET A HB2  5  
ATOM 8570  H HB3  . MET A 1 1   ? -13.692 -0.360  -0.092  1.00 0.00 ? 1   MET A HB3  5  
ATOM 8571  H HG2  . MET A 1 1   ? -15.467 -1.977  -0.746  1.00 0.00 ? 1   MET A HG2  5  
ATOM 8572  H HG3  . MET A 1 1   ? -16.624 -1.110  0.274   1.00 0.00 ? 1   MET A HG3  5  
ATOM 8573  H HE1  . MET A 1 1   ? -18.274 -1.046  -1.803  1.00 0.00 ? 1   MET A HE1  5  
ATOM 8574  H HE2  . MET A 1 1   ? -17.830 -0.391  -3.396  1.00 0.00 ? 1   MET A HE2  5  
ATOM 8575  H HE3  . MET A 1 1   ? -17.060 -1.879  -2.802  1.00 0.00 ? 1   MET A HE3  5  
ATOM 8576  N N    . PRO A 1 2   ? -14.486 -3.856  1.287   1.00 0.00 ? 2   PRO A N    5  
ATOM 8577  C CA   . PRO A 1 2   ? -14.054 -5.172  0.804   1.00 0.00 ? 2   PRO A CA   5  
ATOM 8578  C C    . PRO A 1 2   ? -13.935 -5.229  -0.730  1.00 0.00 ? 2   PRO A C    5  
ATOM 8579  O O    . PRO A 1 2   ? -14.619 -4.497  -1.451  1.00 0.00 ? 2   PRO A O    5  
ATOM 8580  C CB   . PRO A 1 2   ? -15.097 -6.161  1.334   1.00 0.00 ? 2   PRO A CB   5  
ATOM 8581  C CG   . PRO A 1 2   ? -16.370 -5.318  1.398   1.00 0.00 ? 2   PRO A CG   5  
ATOM 8582  C CD   . PRO A 1 2   ? -15.847 -3.941  1.809   1.00 0.00 ? 2   PRO A CD   5  
ATOM 8583  H HA   . PRO A 1 2   ? -13.084 -5.424  1.236   1.00 0.00 ? 2   PRO A HA   5  
ATOM 8584  H HB2  . PRO A 1 2   ? -15.219 -7.030  0.686   1.00 0.00 ? 2   PRO A HB2  5  
ATOM 8585  H HB3  . PRO A 1 2   ? -14.821 -6.477  2.342   1.00 0.00 ? 2   PRO A HB3  5  
ATOM 8586  H HG2  . PRO A 1 2   ? -16.824 -5.259  0.408   1.00 0.00 ? 2   PRO A HG2  5  
ATOM 8587  H HG3  . PRO A 1 2   ? -17.082 -5.712  2.124   1.00 0.00 ? 2   PRO A HG3  5  
ATOM 8588  H HD2  . PRO A 1 2   ? -16.493 -3.167  1.395   1.00 0.00 ? 2   PRO A HD2  5  
ATOM 8589  H HD3  . PRO A 1 2   ? -15.825 -3.871  2.897   1.00 0.00 ? 2   PRO A HD3  5  
ATOM 8590  N N    . VAL A 1 3   ? -13.077 -6.124  -1.231  1.00 0.00 ? 3   VAL A N    5  
ATOM 8591  C CA   . VAL A 1 3   ? -12.809 -6.347  -2.667  1.00 0.00 ? 3   VAL A CA   5  
ATOM 8592  C C    . VAL A 1 3   ? -12.726 -7.852  -2.954  1.00 0.00 ? 3   VAL A C    5  
ATOM 8593  O O    . VAL A 1 3   ? -12.127 -8.603  -2.179  1.00 0.00 ? 3   VAL A O    5  
ATOM 8594  C CB   . VAL A 1 3   ? -11.505 -5.638  -3.111  1.00 0.00 ? 3   VAL A CB   5  
ATOM 8595  C CG1  . VAL A 1 3   ? -11.257 -5.783  -4.619  1.00 0.00 ? 3   VAL A CG1  5  
ATOM 8596  C CG2  . VAL A 1 3   ? -11.517 -4.133  -2.803  1.00 0.00 ? 3   VAL A CG2  5  
ATOM 8597  H H    . VAL A 1 3   ? -12.574 -6.710  -0.575  1.00 0.00 ? 3   VAL A H    5  
ATOM 8598  H HA   . VAL A 1 3   ? -13.632 -5.937  -3.253  1.00 0.00 ? 3   VAL A HA   5  
ATOM 8599  H HB   . VAL A 1 3   ? -10.664 -6.081  -2.579  1.00 0.00 ? 3   VAL A HB   5  
ATOM 8600  H HG11 . VAL A 1 3   ? -12.105 -5.391  -5.181  1.00 0.00 ? 3   VAL A HG11 5  
ATOM 8601  H HG12 . VAL A 1 3   ? -10.362 -5.228  -4.903  1.00 0.00 ? 3   VAL A HG12 5  
ATOM 8602  H HG13 . VAL A 1 3   ? -11.097 -6.828  -4.884  1.00 0.00 ? 3   VAL A HG13 5  
ATOM 8603  H HG21 . VAL A 1 3   ? -10.603 -3.669  -3.174  1.00 0.00 ? 3   VAL A HG21 5  
ATOM 8604  H HG22 . VAL A 1 3   ? -12.378 -3.660  -3.275  1.00 0.00 ? 3   VAL A HG22 5  
ATOM 8605  H HG23 . VAL A 1 3   ? -11.560 -3.968  -1.726  1.00 0.00 ? 3   VAL A HG23 5  
ATOM 8606  N N    . ARG A 1 4   ? -13.291 -8.305  -4.083  1.00 0.00 ? 4   ARG A N    5  
ATOM 8607  C CA   . ARG A 1 4   ? -13.246 -9.709  -4.543  1.00 0.00 ? 4   ARG A CA   5  
ATOM 8608  C C    . ARG A 1 4   ? -11.920 -10.006 -5.254  1.00 0.00 ? 4   ARG A C    5  
ATOM 8609  O O    . ARG A 1 4   ? -11.846 -10.065 -6.482  1.00 0.00 ? 4   ARG A O    5  
ATOM 8610  C CB   . ARG A 1 4   ? -14.518 -10.017 -5.358  1.00 0.00 ? 4   ARG A CB   5  
ATOM 8611  C CG   . ARG A 1 4   ? -14.847 -11.517 -5.488  1.00 0.00 ? 4   ARG A CG   5  
ATOM 8612  C CD   . ARG A 1 4   ? -14.262 -12.232 -6.716  1.00 0.00 ? 4   ARG A CD   5  
ATOM 8613  N NE   . ARG A 1 4   ? -14.935 -11.829 -7.971  1.00 0.00 ? 4   ARG A NE   5  
ATOM 8614  C CZ   . ARG A 1 4   ? -14.464 -11.057 -8.937  1.00 0.00 ? 4   ARG A CZ   5  
ATOM 8615  N NH1  . ARG A 1 4   ? -13.316 -10.449 -8.862  1.00 0.00 ? 4   ARG A NH1  5  
ATOM 8616  N NH2  . ARG A 1 4   ? -15.156 -10.885 -10.026 1.00 0.00 ? 4   ARG A NH2  5  
ATOM 8617  H H    . ARG A 1 4   ? -13.764 -7.633  -4.672  1.00 0.00 ? 4   ARG A H    5  
ATOM 8618  H HA   . ARG A 1 4   ? -13.274 -10.351 -3.659  1.00 0.00 ? 4   ARG A HA   5  
ATOM 8619  H HB2  . ARG A 1 4   ? -15.352 -9.563  -4.824  1.00 0.00 ? 4   ARG A HB2  5  
ATOM 8620  H HB3  . ARG A 1 4   ? -14.461 -9.543  -6.337  1.00 0.00 ? 4   ARG A HB3  5  
ATOM 8621  H HG2  . ARG A 1 4   ? -14.512 -12.036 -4.589  1.00 0.00 ? 4   ARG A HG2  5  
ATOM 8622  H HG3  . ARG A 1 4   ? -15.931 -11.624 -5.529  1.00 0.00 ? 4   ARG A HG3  5  
ATOM 8623  H HD2  . ARG A 1 4   ? -13.186 -12.080 -6.771  1.00 0.00 ? 4   ARG A HD2  5  
ATOM 8624  H HD3  . ARG A 1 4   ? -14.420 -13.303 -6.578  1.00 0.00 ? 4   ARG A HD3  5  
ATOM 8625  H HE   . ARG A 1 4   ? -15.857 -12.208 -8.126  1.00 0.00 ? 4   ARG A HE   5  
ATOM 8626  H HH11 . ARG A 1 4   ? -12.782 -10.490 -8.001  1.00 0.00 ? 4   ARG A HH11 5  
ATOM 8627  H HH12 . ARG A 1 4   ? -12.994 -9.867  -9.615  1.00 0.00 ? 4   ARG A HH12 5  
ATOM 8628  H HH21 . ARG A 1 4   ? -16.056 -11.326 -10.130 1.00 0.00 ? 4   ARG A HH21 5  
ATOM 8629  H HH22 . ARG A 1 4   ? -14.800 -10.302 -10.764 1.00 0.00 ? 4   ARG A HH22 5  
ATOM 8630  N N    . ARG A 1 5   ? -10.865 -10.133 -4.449  1.00 0.00 ? 5   ARG A N    5  
ATOM 8631  C CA   . ARG A 1 5   ? -9.460  -10.373 -4.848  1.00 0.00 ? 5   ARG A CA   5  
ATOM 8632  C C    . ARG A 1 5   ? -8.808  -11.500 -4.036  1.00 0.00 ? 5   ARG A C    5  
ATOM 8633  O O    . ARG A 1 5   ? -9.332  -11.915 -3.001  1.00 0.00 ? 5   ARG A O    5  
ATOM 8634  C CB   . ARG A 1 5   ? -8.664  -9.052  -4.792  1.00 0.00 ? 5   ARG A CB   5  
ATOM 8635  C CG   . ARG A 1 5   ? -8.541  -8.449  -3.382  1.00 0.00 ? 5   ARG A CG   5  
ATOM 8636  C CD   . ARG A 1 5   ? -7.810  -7.103  -3.428  1.00 0.00 ? 5   ARG A CD   5  
ATOM 8637  N NE   . ARG A 1 5   ? -7.767  -6.470  -2.095  1.00 0.00 ? 5   ARG A NE   5  
ATOM 8638  C CZ   . ARG A 1 5   ? -7.433  -5.219  -1.823  1.00 0.00 ? 5   ARG A CZ   5  
ATOM 8639  N NH1  . ARG A 1 5   ? -7.071  -4.378  -2.752  1.00 0.00 ? 5   ARG A NH1  5  
ATOM 8640  N NH2  . ARG A 1 5   ? -7.456  -4.784  -0.597  1.00 0.00 ? 5   ARG A NH2  5  
ATOM 8641  H H    . ARG A 1 5   ? -11.075 -10.041 -3.463  1.00 0.00 ? 5   ARG A H    5  
ATOM 8642  H HA   . ARG A 1 5   ? -9.453  -10.710 -5.888  1.00 0.00 ? 5   ARG A HA   5  
ATOM 8643  H HB2  . ARG A 1 5   ? -7.662  -9.223  -5.188  1.00 0.00 ? 5   ARG A HB2  5  
ATOM 8644  H HB3  . ARG A 1 5   ? -9.155  -8.327  -5.444  1.00 0.00 ? 5   ARG A HB3  5  
ATOM 8645  H HG2  . ARG A 1 5   ? -9.534  -8.294  -2.962  1.00 0.00 ? 5   ARG A HG2  5  
ATOM 8646  H HG3  . ARG A 1 5   ? -7.988  -9.133  -2.736  1.00 0.00 ? 5   ARG A HG3  5  
ATOM 8647  H HD2  . ARG A 1 5   ? -6.793  -7.262  -3.791  1.00 0.00 ? 5   ARG A HD2  5  
ATOM 8648  H HD3  . ARG A 1 5   ? -8.334  -6.448  -4.128  1.00 0.00 ? 5   ARG A HD3  5  
ATOM 8649  H HE   . ARG A 1 5   ? -8.010  -7.047  -1.305  1.00 0.00 ? 5   ARG A HE   5  
ATOM 8650  H HH11 . ARG A 1 5   ? -7.018  -4.692  -3.705  1.00 0.00 ? 5   ARG A HH11 5  
ATOM 8651  H HH12 . ARG A 1 5   ? -6.815  -3.435  -2.517  1.00 0.00 ? 5   ARG A HH12 5  
ATOM 8652  H HH21 . ARG A 1 5   ? -7.722  -5.400  0.155   1.00 0.00 ? 5   ARG A HH21 5  
ATOM 8653  H HH22 . ARG A 1 5   ? -7.198  -3.834  -0.390  1.00 0.00 ? 5   ARG A HH22 5  
ATOM 8654  N N    . GLY A 1 6   ? -7.688  -12.029 -4.531  1.00 0.00 ? 6   GLY A N    5  
ATOM 8655  C CA   . GLY A 1 6   ? -7.002  -13.223 -4.001  1.00 0.00 ? 6   GLY A CA   5  
ATOM 8656  C C    . GLY A 1 6   ? -7.624  -14.558 -4.452  1.00 0.00 ? 6   GLY A C    5  
ATOM 8657  O O    . GLY A 1 6   ? -6.920  -15.563 -4.572  1.00 0.00 ? 6   GLY A O    5  
ATOM 8658  H H    . GLY A 1 6   ? -7.315  -11.618 -5.376  1.00 0.00 ? 6   GLY A H    5  
ATOM 8659  H HA2  . GLY A 1 6   ? -5.959  -13.205 -4.322  1.00 0.00 ? 6   GLY A HA2  5  
ATOM 8660  H HA3  . GLY A 1 6   ? -7.020  -13.194 -2.912  1.00 0.00 ? 6   GLY A HA3  5  
ATOM 8661  N N    . HIS A 1 7   ? -8.923  -14.555 -4.770  1.00 0.00 ? 7   HIS A N    5  
ATOM 8662  C CA   . HIS A 1 7   ? -9.677  -15.632 -5.423  1.00 0.00 ? 7   HIS A CA   5  
ATOM 8663  C C    . HIS A 1 7   ? -10.722 -15.029 -6.375  1.00 0.00 ? 7   HIS A C    5  
ATOM 8664  O O    . HIS A 1 7   ? -11.212 -13.920 -6.135  1.00 0.00 ? 7   HIS A O    5  
ATOM 8665  C CB   . HIS A 1 7   ? -10.338 -16.523 -4.359  1.00 0.00 ? 7   HIS A CB   5  
ATOM 8666  C CG   . HIS A 1 7   ? -11.081 -17.702 -4.944  1.00 0.00 ? 7   HIS A CG   5  
ATOM 8667  N ND1  . HIS A 1 7   ? -10.489 -18.892 -5.375  1.00 0.00 ? 7   HIS A ND1  5  
ATOM 8668  C CD2  . HIS A 1 7   ? -12.427 -17.771 -5.171  1.00 0.00 ? 7   HIS A CD2  5  
ATOM 8669  C CE1  . HIS A 1 7   ? -11.491 -19.652 -5.851  1.00 0.00 ? 7   HIS A CE1  5  
ATOM 8670  N NE2  . HIS A 1 7   ? -12.664 -19.004 -5.739  1.00 0.00 ? 7   HIS A NE2  5  
ATOM 8671  H H    . HIS A 1 7   ? -9.432  -13.697 -4.608  1.00 0.00 ? 7   HIS A H    5  
ATOM 8672  H HA   . HIS A 1 7   ? -8.996  -16.248 -6.015  1.00 0.00 ? 7   HIS A HA   5  
ATOM 8673  H HB2  . HIS A 1 7   ? -9.569  -16.904 -3.685  1.00 0.00 ? 7   HIS A HB2  5  
ATOM 8674  H HB3  . HIS A 1 7   ? -11.034 -15.924 -3.768  1.00 0.00 ? 7   HIS A HB3  5  
ATOM 8675  H HD2  . HIS A 1 7   ? -13.157 -16.999 -4.964  1.00 0.00 ? 7   HIS A HD2  5  
ATOM 8676  H HE1  . HIS A 1 7   ? -11.374 -20.645 -6.271  1.00 0.00 ? 7   HIS A HE1  5  
ATOM 8677  H HE2  . HIS A 1 7   ? -13.562 -19.369 -6.037  1.00 0.00 ? 7   HIS A HE2  5  
ATOM 8678  N N    . VAL A 1 8   ? -11.075 -15.750 -7.443  1.00 0.00 ? 8   VAL A N    5  
ATOM 8679  C CA   . VAL A 1 8   ? -12.121 -15.359 -8.405  1.00 0.00 ? 8   VAL A CA   5  
ATOM 8680  C C    . VAL A 1 8   ? -13.110 -16.508 -8.642  1.00 0.00 ? 8   VAL A C    5  
ATOM 8681  O O    . VAL A 1 8   ? -12.715 -17.667 -8.789  1.00 0.00 ? 8   VAL A O    5  
ATOM 8682  C CB   . VAL A 1 8   ? -11.489 -14.799 -9.702  1.00 0.00 ? 8   VAL A CB   5  
ATOM 8683  C CG1  . VAL A 1 8   ? -10.838 -15.861 -10.596 1.00 0.00 ? 8   VAL A CG1  5  
ATOM 8684  C CG2  . VAL A 1 8   ? -12.492 -13.986 -10.526 1.00 0.00 ? 8   VAL A CG2  5  
ATOM 8685  H H    . VAL A 1 8   ? -10.662 -16.666 -7.556  1.00 0.00 ? 8   VAL A H    5  
ATOM 8686  H HA   . VAL A 1 8   ? -12.692 -14.543 -7.964  1.00 0.00 ? 8   VAL A HA   5  
ATOM 8687  H HB   . VAL A 1 8   ? -10.703 -14.104 -9.404  1.00 0.00 ? 8   VAL A HB   5  
ATOM 8688  H HG11 . VAL A 1 8   ? -10.311 -15.374 -11.416 1.00 0.00 ? 8   VAL A HG11 5  
ATOM 8689  H HG12 . VAL A 1 8   ? -10.121 -16.444 -10.019 1.00 0.00 ? 8   VAL A HG12 5  
ATOM 8690  H HG13 . VAL A 1 8   ? -11.595 -16.526 -11.012 1.00 0.00 ? 8   VAL A HG13 5  
ATOM 8691  H HG21 . VAL A 1 8   ? -13.291 -14.623 -10.898 1.00 0.00 ? 8   VAL A HG21 5  
ATOM 8692  H HG22 . VAL A 1 8   ? -12.916 -13.196 -9.910  1.00 0.00 ? 8   VAL A HG22 5  
ATOM 8693  H HG23 . VAL A 1 8   ? -11.983 -13.529 -11.375 1.00 0.00 ? 8   VAL A HG23 5  
ATOM 8694  N N    . ALA A 1 9   ? -14.406 -16.189 -8.679  1.00 0.00 ? 9   ALA A N    5  
ATOM 8695  C CA   . ALA A 1 9   ? -15.459 -17.117 -9.102  1.00 0.00 ? 9   ALA A CA   5  
ATOM 8696  C C    . ALA A 1 9   ? -15.340 -17.440 -10.612 1.00 0.00 ? 9   ALA A C    5  
ATOM 8697  O O    . ALA A 1 9   ? -14.726 -16.660 -11.347 1.00 0.00 ? 9   ALA A O    5  
ATOM 8698  C CB   . ALA A 1 9   ? -16.812 -16.474 -8.767  1.00 0.00 ? 9   ALA A CB   5  
ATOM 8699  H H    . ALA A 1 9   ? -14.665 -15.226 -8.543  1.00 0.00 ? 9   ALA A H    5  
ATOM 8700  H HA   . ALA A 1 9   ? -15.371 -18.044 -8.534  1.00 0.00 ? 9   ALA A HA   5  
ATOM 8701  H HB1  . ALA A 1 9   ? -16.873 -16.270 -7.696  1.00 0.00 ? 9   ALA A HB1  5  
ATOM 8702  H HB2  . ALA A 1 9   ? -16.925 -15.539 -9.319  1.00 0.00 ? 9   ALA A HB2  5  
ATOM 8703  H HB3  . ALA A 1 9   ? -17.627 -17.145 -9.040  1.00 0.00 ? 9   ALA A HB3  5  
ATOM 8704  N N    . PRO A 1 10  ? -15.945 -18.538 -11.112 1.00 0.00 ? 10  PRO A N    5  
ATOM 8705  C CA   . PRO A 1 10  ? -16.064 -18.805 -12.548 1.00 0.00 ? 10  PRO A CA   5  
ATOM 8706  C C    . PRO A 1 10  ? -16.659 -17.593 -13.284 1.00 0.00 ? 10  PRO A C    5  
ATOM 8707  O O    . PRO A 1 10  ? -17.831 -17.243 -13.135 1.00 0.00 ? 10  PRO A O    5  
ATOM 8708  C CB   . PRO A 1 10  ? -16.917 -20.070 -12.670 1.00 0.00 ? 10  PRO A CB   5  
ATOM 8709  C CG   . PRO A 1 10  ? -16.702 -20.778 -11.332 1.00 0.00 ? 10  PRO A CG   5  
ATOM 8710  C CD   . PRO A 1 10  ? -16.509 -19.632 -10.340 1.00 0.00 ? 10  PRO A CD   5  
ATOM 8711  H HA   . PRO A 1 10  ? -15.069 -19.018 -12.941 1.00 0.00 ? 10  PRO A HA   5  
ATOM 8712  H HB2  . PRO A 1 10  ? -17.966 -19.806 -12.775 1.00 0.00 ? 10  PRO A HB2  5  
ATOM 8713  H HB3  . PRO A 1 10  ? -16.601 -20.690 -13.510 1.00 0.00 ? 10  PRO A HB3  5  
ATOM 8714  H HG2  . PRO A 1 10  ? -17.552 -21.406 -11.064 1.00 0.00 ? 10  PRO A HG2  5  
ATOM 8715  H HG3  . PRO A 1 10  ? -15.788 -21.373 -11.380 1.00 0.00 ? 10  PRO A HG3  5  
ATOM 8716  H HD2  . PRO A 1 10  ? -17.464 -19.324 -9.914  1.00 0.00 ? 10  PRO A HD2  5  
ATOM 8717  H HD3  . PRO A 1 10  ? -15.834 -19.949 -9.544  1.00 0.00 ? 10  PRO A HD3  5  
ATOM 8718  N N    . GLN A 1 11  ? -15.830 -16.924 -14.079 1.00 0.00 ? 11  GLN A N    5  
ATOM 8719  C CA   . GLN A 1 11  ? -16.126 -15.602 -14.639 1.00 0.00 ? 11  GLN A CA   5  
ATOM 8720  C C    . GLN A 1 11  ? -17.313 -15.585 -15.615 1.00 0.00 ? 11  GLN A C    5  
ATOM 8721  O O    . GLN A 1 11  ? -18.024 -14.585 -15.698 1.00 0.00 ? 11  GLN A O    5  
ATOM 8722  C CB   . GLN A 1 11  ? -14.846 -14.980 -15.232 1.00 0.00 ? 11  GLN A CB   5  
ATOM 8723  C CG   . GLN A 1 11  ? -14.366 -15.554 -16.578 1.00 0.00 ? 11  GLN A CG   5  
ATOM 8724  C CD   . GLN A 1 11  ? -14.006 -17.041 -16.554 1.00 0.00 ? 11  GLN A CD   5  
ATOM 8725  O OE1  . GLN A 1 11  ? -13.411 -17.559 -15.617 1.00 0.00 ? 11  GLN A OE1  5  
ATOM 8726  N NE2  . GLN A 1 11  ? -14.387 -17.797 -17.560 1.00 0.00 ? 11  GLN A NE2  5  
ATOM 8727  H H    . GLN A 1 11  ? -14.889 -17.284 -14.166 1.00 0.00 ? 11  GLN A H    5  
ATOM 8728  H HA   . GLN A 1 11  ? -16.411 -14.965 -13.802 1.00 0.00 ? 11  GLN A HA   5  
ATOM 8729  H HB2  . GLN A 1 11  ? -15.033 -13.915 -15.379 1.00 0.00 ? 11  GLN A HB2  5  
ATOM 8730  H HB3  . GLN A 1 11  ? -14.040 -15.064 -14.500 1.00 0.00 ? 11  GLN A HB3  5  
ATOM 8731  H HG2  . GLN A 1 11  ? -15.128 -15.373 -17.336 1.00 0.00 ? 11  GLN A HG2  5  
ATOM 8732  H HG3  . GLN A 1 11  ? -13.472 -15.005 -16.876 1.00 0.00 ? 11  GLN A HG3  5  
ATOM 8733  H HE21 . GLN A 1 11  ? -14.933 -17.403 -18.321 1.00 0.00 ? 11  GLN A HE21 5  
ATOM 8734  H HE22 . GLN A 1 11  ? -14.131 -18.772 -17.550 1.00 0.00 ? 11  GLN A HE22 5  
ATOM 8735  N N    . ASN A 1 12  ? -17.572 -16.701 -16.306 1.00 0.00 ? 12  ASN A N    5  
ATOM 8736  C CA   . ASN A 1 12  ? -18.643 -16.801 -17.298 1.00 0.00 ? 12  ASN A CA   5  
ATOM 8737  C C    . ASN A 1 12  ? -20.017 -16.720 -16.612 1.00 0.00 ? 12  ASN A C    5  
ATOM 8738  O O    . ASN A 1 12  ? -20.857 -15.914 -17.005 1.00 0.00 ? 12  ASN A O    5  
ATOM 8739  C CB   . ASN A 1 12  ? -18.484 -18.112 -18.093 1.00 0.00 ? 12  ASN A CB   5  
ATOM 8740  C CG   . ASN A 1 12  ? -17.434 -18.052 -19.195 1.00 0.00 ? 12  ASN A CG   5  
ATOM 8741  O OD1  . ASN A 1 12  ? -16.651 -17.118 -19.321 1.00 0.00 ? 12  ASN A OD1  5  
ATOM 8742  N ND2  . ASN A 1 12  ? -17.364 -19.067 -20.025 1.00 0.00 ? 12  ASN A ND2  5  
ATOM 8743  H H    . ASN A 1 12  ? -16.986 -17.508 -16.149 1.00 0.00 ? 12  ASN A H    5  
ATOM 8744  H HA   . ASN A 1 12  ? -18.583 -15.956 -17.989 1.00 0.00 ? 12  ASN A HA   5  
ATOM 8745  H HB2  . ASN A 1 12  ? -18.255 -18.939 -17.420 1.00 0.00 ? 12  ASN A HB2  5  
ATOM 8746  H HB3  . ASN A 1 12  ? -19.437 -18.332 -18.574 1.00 0.00 ? 12  ASN A HB3  5  
ATOM 8747  H HD21 . ASN A 1 12  ? -17.997 -19.848 -19.932 1.00 0.00 ? 12  ASN A HD21 5  
ATOM 8748  H HD22 . ASN A 1 12  ? -16.675 -19.038 -20.761 1.00 0.00 ? 12  ASN A HD22 5  
ATOM 8749  N N    . THR A 1 13  ? -20.234 -17.517 -15.559 1.00 0.00 ? 13  THR A N    5  
ATOM 8750  C CA   . THR A 1 13  ? -21.495 -17.544 -14.792 1.00 0.00 ? 13  THR A CA   5  
ATOM 8751  C C    . THR A 1 13  ? -21.636 -16.334 -13.858 1.00 0.00 ? 13  THR A C    5  
ATOM 8752  O O    . THR A 1 13  ? -22.724 -15.766 -13.702 1.00 0.00 ? 13  THR A O    5  
ATOM 8753  C CB   . THR A 1 13  ? -21.607 -18.869 -14.023 1.00 0.00 ? 13  THR A CB   5  
ATOM 8754  O OG1  . THR A 1 13  ? -22.959 -19.170 -13.760 1.00 0.00 ? 13  THR A OG1  5  
ATOM 8755  C CG2  . THR A 1 13  ? -20.847 -18.877 -12.700 1.00 0.00 ? 13  THR A CG2  5  
ATOM 8756  H H    . THR A 1 13  ? -19.488 -18.138 -15.279 1.00 0.00 ? 13  THR A H    5  
ATOM 8757  H HA   . THR A 1 13  ? -22.321 -17.516 -15.499 1.00 0.00 ? 13  THR A HA   5  
ATOM 8758  H HB   . THR A 1 13  ? -21.181 -19.648 -14.655 1.00 0.00 ? 13  THR A HB   5  
ATOM 8759  H HG1  . THR A 1 13  ? -22.994 -20.071 -13.390 1.00 0.00 ? 13  THR A HG1  5  
ATOM 8760  H HG21 . THR A 1 13  ? -21.328 -18.213 -11.982 1.00 0.00 ? 13  THR A HG21 5  
ATOM 8761  H HG22 . THR A 1 13  ? -20.802 -19.888 -12.299 1.00 0.00 ? 13  THR A HG22 5  
ATOM 8762  H HG23 . THR A 1 13  ? -19.838 -18.517 -12.879 1.00 0.00 ? 13  THR A HG23 5  
ATOM 8763  N N    . PHE A 1 14  ? -20.509 -15.880 -13.290 1.00 0.00 ? 14  PHE A N    5  
ATOM 8764  C CA   . PHE A 1 14  ? -20.443 -14.657 -12.495 1.00 0.00 ? 14  PHE A CA   5  
ATOM 8765  C C    . PHE A 1 14  ? -20.914 -13.464 -13.329 1.00 0.00 ? 14  PHE A C    5  
ATOM 8766  O O    . PHE A 1 14  ? -21.711 -12.660 -12.851 1.00 0.00 ? 14  PHE A O    5  
ATOM 8767  C CB   . PHE A 1 14  ? -19.003 -14.465 -12.013 1.00 0.00 ? 14  PHE A CB   5  
ATOM 8768  C CG   . PHE A 1 14  ? -18.799 -13.275 -11.092 1.00 0.00 ? 14  PHE A CG   5  
ATOM 8769  C CD1  . PHE A 1 14  ? -18.945 -13.424 -9.699  1.00 0.00 ? 14  PHE A CD1  5  
ATOM 8770  C CD2  . PHE A 1 14  ? -18.483 -12.011 -11.627 1.00 0.00 ? 14  PHE A CD2  5  
ATOM 8771  C CE1  . PHE A 1 14  ? -18.775 -12.317 -8.847  1.00 0.00 ? 14  PHE A CE1  5  
ATOM 8772  C CE2  . PHE A 1 14  ? -18.330 -10.901 -10.776 1.00 0.00 ? 14  PHE A CE2  5  
ATOM 8773  C CZ   . PHE A 1 14  ? -18.473 -11.054 -9.386  1.00 0.00 ? 14  PHE A CZ   5  
ATOM 8774  H H    . PHE A 1 14  ? -19.648 -16.405 -13.418 1.00 0.00 ? 14  PHE A H    5  
ATOM 8775  H HA   . PHE A 1 14  ? -21.099 -14.752 -11.628 1.00 0.00 ? 14  PHE A HA   5  
ATOM 8776  H HB2  . PHE A 1 14  ? -18.697 -15.373 -11.498 1.00 0.00 ? 14  PHE A HB2  5  
ATOM 8777  H HB3  . PHE A 1 14  ? -18.355 -14.354 -12.881 1.00 0.00 ? 14  PHE A HB3  5  
ATOM 8778  H HD1  . PHE A 1 14  ? -19.198 -14.389 -9.281  1.00 0.00 ? 14  PHE A HD1  5  
ATOM 8779  H HD2  . PHE A 1 14  ? -18.376 -11.885 -12.697 1.00 0.00 ? 14  PHE A HD2  5  
ATOM 8780  H HE1  . PHE A 1 14  ? -18.898 -12.435 -7.778  1.00 0.00 ? 14  PHE A HE1  5  
ATOM 8781  H HE2  . PHE A 1 14  ? -18.110 -9.925  -11.193 1.00 0.00 ? 14  PHE A HE2  5  
ATOM 8782  H HZ   . PHE A 1 14  ? -18.363 -10.198 -8.731  1.00 0.00 ? 14  PHE A HZ   5  
ATOM 8783  N N    . LEU A 1 15  ? -20.499 -13.407 -14.600 1.00 0.00 ? 15  LEU A N    5  
ATOM 8784  C CA   . LEU A 1 15  ? -20.990 -12.400 -15.545 1.00 0.00 ? 15  LEU A CA   5  
ATOM 8785  C C    . LEU A 1 15  ? -22.434 -12.676 -15.992 1.00 0.00 ? 15  LEU A C    5  
ATOM 8786  O O    . LEU A 1 15  ? -23.240 -11.755 -15.994 1.00 0.00 ? 15  LEU A O    5  
ATOM 8787  C CB   . LEU A 1 15  ? -20.028 -12.259 -16.738 1.00 0.00 ? 15  LEU A CB   5  
ATOM 8788  C CG   . LEU A 1 15  ? -20.549 -11.297 -17.825 1.00 0.00 ? 15  LEU A CG   5  
ATOM 8789  C CD1  . LEU A 1 15  ? -20.841 -9.883  -17.307 1.00 0.00 ? 15  LEU A CD1  5  
ATOM 8790  C CD2  . LEU A 1 15  ? -19.532 -11.191 -18.960 1.00 0.00 ? 15  LEU A CD2  5  
ATOM 8791  H H    . LEU A 1 15  ? -19.848 -14.125 -14.917 1.00 0.00 ? 15  LEU A H    5  
ATOM 8792  H HA   . LEU A 1 15  ? -21.002 -11.444 -15.020 1.00 0.00 ? 15  LEU A HA   5  
ATOM 8793  H HB2  . LEU A 1 15  ? -19.064 -11.904 -16.373 1.00 0.00 ? 15  LEU A HB2  5  
ATOM 8794  H HB3  . LEU A 1 15  ? -19.885 -13.240 -17.193 1.00 0.00 ? 15  LEU A HB3  5  
ATOM 8795  H HG   . LEU A 1 15  ? -21.468 -11.714 -18.234 1.00 0.00 ? 15  LEU A HG   5  
ATOM 8796  H HD11 . LEU A 1 15  ? -19.931 -9.417  -16.934 1.00 0.00 ? 15  LEU A HD11 5  
ATOM 8797  H HD12 . LEU A 1 15  ? -21.275 -9.280  -18.106 1.00 0.00 ? 15  LEU A HD12 5  
ATOM 8798  H HD13 . LEU A 1 15  ? -21.567 -9.914  -16.499 1.00 0.00 ? 15  LEU A HD13 5  
ATOM 8799  H HD21 . LEU A 1 15  ? -19.343 -12.180 -19.377 1.00 0.00 ? 15  LEU A HD21 5  
ATOM 8800  H HD22 . LEU A 1 15  ? -19.927 -10.549 -19.749 1.00 0.00 ? 15  LEU A HD22 5  
ATOM 8801  H HD23 . LEU A 1 15  ? -18.597 -10.772 -18.588 1.00 0.00 ? 15  LEU A HD23 5  
ATOM 8802  N N    . ASP A 1 16  ? -22.799 -13.914 -16.326 1.00 0.00 ? 16  ASP A N    5  
ATOM 8803  C CA   . ASP A 1 16  ? -24.170 -14.306 -16.701 1.00 0.00 ? 16  ASP A CA   5  
ATOM 8804  C C    . ASP A 1 16  ? -25.222 -13.786 -15.706 1.00 0.00 ? 16  ASP A C    5  
ATOM 8805  O O    . ASP A 1 16  ? -26.261 -13.260 -16.103 1.00 0.00 ? 16  ASP A O    5  
ATOM 8806  C CB   . ASP A 1 16  ? -24.242 -15.835 -16.797 1.00 0.00 ? 16  ASP A CB   5  
ATOM 8807  C CG   . ASP A 1 16  ? -25.568 -16.323 -17.390 1.00 0.00 ? 16  ASP A CG   5  
ATOM 8808  O OD1  . ASP A 1 16  ? -25.808 -16.115 -18.605 1.00 0.00 ? 16  ASP A OD1  5  
ATOM 8809  O OD2  . ASP A 1 16  ? -26.377 -16.926 -16.646 1.00 0.00 ? 16  ASP A OD2  5  
ATOM 8810  H H    . ASP A 1 16  ? -22.073 -14.615 -16.393 1.00 0.00 ? 16  ASP A H    5  
ATOM 8811  H HA   . ASP A 1 16  ? -24.400 -13.901 -17.685 1.00 0.00 ? 16  ASP A HA   5  
ATOM 8812  H HB2  . ASP A 1 16  ? -23.425 -16.190 -17.420 1.00 0.00 ? 16  ASP A HB2  5  
ATOM 8813  H HB3  . ASP A 1 16  ? -24.118 -16.262 -15.803 1.00 0.00 ? 16  ASP A HB3  5  
ATOM 8814  N N    . THR A 1 17  ? -24.913 -13.828 -14.409 1.00 0.00 ? 17  THR A N    5  
ATOM 8815  C CA   . THR A 1 17  ? -25.770 -13.246 -13.352 1.00 0.00 ? 17  THR A CA   5  
ATOM 8816  C C    . THR A 1 17  ? -25.978 -11.733 -13.532 1.00 0.00 ? 17  THR A C    5  
ATOM 8817  O O    . THR A 1 17  ? -27.097 -11.217 -13.438 1.00 0.00 ? 17  THR A O    5  
ATOM 8818  C CB   . THR A 1 17  ? -25.185 -13.546 -11.959 1.00 0.00 ? 17  THR A CB   5  
ATOM 8819  O OG1  . THR A 1 17  ? -25.055 -14.941 -11.767 1.00 0.00 ? 17  THR A OG1  5  
ATOM 8820  C CG2  . THR A 1 17  ? -26.072 -13.032 -10.822 1.00 0.00 ? 17  THR A CG2  5  
ATOM 8821  H H    . THR A 1 17  ? -24.004 -14.221 -14.177 1.00 0.00 ? 17  THR A H    5  
ATOM 8822  H HA   . THR A 1 17  ? -26.753 -13.709 -13.425 1.00 0.00 ? 17  THR A HA   5  
ATOM 8823  H HB   . THR A 1 17  ? -24.202 -13.083 -11.871 1.00 0.00 ? 17  THR A HB   5  
ATOM 8824  H HG1  . THR A 1 17  ? -24.370 -15.265 -12.379 1.00 0.00 ? 17  THR A HG1  5  
ATOM 8825  H HG21 . THR A 1 17  ? -25.659 -13.352 -9.865  1.00 0.00 ? 17  THR A HG21 5  
ATOM 8826  H HG22 . THR A 1 17  ? -26.103 -11.942 -10.834 1.00 0.00 ? 17  THR A HG22 5  
ATOM 8827  H HG23 . THR A 1 17  ? -27.083 -13.425 -10.929 1.00 0.00 ? 17  THR A HG23 5  
ATOM 8828  N N    . ILE A 1 18  ? -24.907 -11.010 -13.866 1.00 0.00 ? 18  ILE A N    5  
ATOM 8829  C CA   . ILE A 1 18  ? -24.940 -9.572  -14.158 1.00 0.00 ? 18  ILE A CA   5  
ATOM 8830  C C    . ILE A 1 18  ? -25.680 -9.313  -15.473 1.00 0.00 ? 18  ILE A C    5  
ATOM 8831  O O    . ILE A 1 18  ? -26.367 -8.294  -15.580 1.00 0.00 ? 18  ILE A O    5  
ATOM 8832  C CB   . ILE A 1 18  ? -23.516 -8.984  -14.223 1.00 0.00 ? 18  ILE A CB   5  
ATOM 8833  C CG1  . ILE A 1 18  ? -22.638 -9.320  -13.006 1.00 0.00 ? 18  ILE A CG1  5  
ATOM 8834  C CG2  . ILE A 1 18  ? -23.521 -7.463  -14.444 1.00 0.00 ? 18  ILE A CG2  5  
ATOM 8835  C CD1  . ILE A 1 18  ? -23.155 -8.769  -11.670 1.00 0.00 ? 18  ILE A CD1  5  
ATOM 8836  H H    . ILE A 1 18  ? -24.062 -11.514 -14.109 1.00 0.00 ? 18  ILE A H    5  
ATOM 8837  H HA   . ILE A 1 18  ? -25.487 -9.069  -13.363 1.00 0.00 ? 18  ILE A HA   5  
ATOM 8838  H HB   . ILE A 1 18  ? -23.029 -9.427  -15.083 1.00 0.00 ? 18  ILE A HB   5  
ATOM 8839  H HG12 . ILE A 1 18  ? -22.565 -10.396 -12.912 1.00 0.00 ? 18  ILE A HG12 5  
ATOM 8840  H HG13 . ILE A 1 18  ? -21.629 -8.955  -13.211 1.00 0.00 ? 18  ILE A HG13 5  
ATOM 8841  H HG21 . ILE A 1 18  ? -24.167 -6.971  -13.715 1.00 0.00 ? 18  ILE A HG21 5  
ATOM 8842  H HG22 . ILE A 1 18  ? -22.510 -7.066  -14.359 1.00 0.00 ? 18  ILE A HG22 5  
ATOM 8843  H HG23 . ILE A 1 18  ? -23.880 -7.241  -15.445 1.00 0.00 ? 18  ILE A HG23 5  
ATOM 8844  H HD11 . ILE A 1 18  ? -23.169 -7.680  -11.686 1.00 0.00 ? 18  ILE A HD11 5  
ATOM 8845  H HD12 . ILE A 1 18  ? -24.163 -9.143  -11.477 1.00 0.00 ? 18  ILE A HD12 5  
ATOM 8846  H HD13 . ILE A 1 18  ? -22.498 -9.102  -10.867 1.00 0.00 ? 18  ILE A HD13 5  
ATOM 8847  N N    . ILE A 1 19  ? -25.632 -10.250 -16.435 1.00 0.00 ? 19  ILE A N    5  
ATOM 8848  C CA   . ILE A 1 19  ? -26.443 -10.153 -17.635 1.00 0.00 ? 19  ILE A CA   5  
ATOM 8849  C C    . ILE A 1 19  ? -27.896 -10.133 -17.199 1.00 0.00 ? 19  ILE A C    5  
ATOM 8850  O O    . ILE A 1 19  ? -28.566 -9.160  -17.511 1.00 0.00 ? 19  ILE A O    5  
ATOM 8851  C CB   . ILE A 1 19  ? -26.191 -11.269 -18.668 1.00 0.00 ? 19  ILE A CB   5  
ATOM 8852  C CG1  . ILE A 1 19  ? -24.721 -11.418 -19.107 1.00 0.00 ? 19  ILE A CG1  5  
ATOM 8853  C CG2  . ILE A 1 19  ? -27.073 -11.020 -19.903 1.00 0.00 ? 19  ILE A CG2  5  
ATOM 8854  C CD1  . ILE A 1 19  ? -24.038 -10.121 -19.538 1.00 0.00 ? 19  ILE A CD1  5  
ATOM 8855  H H    . ILE A 1 19  ? -25.144 -11.120 -16.273 1.00 0.00 ? 19  ILE A H    5  
ATOM 8856  H HA   . ILE A 1 19  ? -26.207 -9.192  -18.092 1.00 0.00 ? 19  ILE A HA   5  
ATOM 8857  H HB   . ILE A 1 19  ? -26.503 -12.215 -18.232 1.00 0.00 ? 19  ILE A HB   5  
ATOM 8858  H HG12 . ILE A 1 19  ? -24.147 -11.830 -18.286 1.00 0.00 ? 19  ILE A HG12 5  
ATOM 8859  H HG13 . ILE A 1 19  ? -24.664 -12.135 -19.927 1.00 0.00 ? 19  ILE A HG13 5  
ATOM 8860  H HG21 . ILE A 1 19  ? -28.128 -11.085 -19.632 1.00 0.00 ? 19  ILE A HG21 5  
ATOM 8861  H HG22 . ILE A 1 19  ? -26.882 -10.027 -20.309 1.00 0.00 ? 19  ILE A HG22 5  
ATOM 8862  H HG23 . ILE A 1 19  ? -26.868 -11.770 -20.664 1.00 0.00 ? 19  ILE A HG23 5  
ATOM 8863  H HD11 . ILE A 1 19  ? -23.940 -9.459  -18.679 1.00 0.00 ? 19  ILE A HD11 5  
ATOM 8864  H HD12 . ILE A 1 19  ? -23.041 -10.360 -19.906 1.00 0.00 ? 19  ILE A HD12 5  
ATOM 8865  H HD13 . ILE A 1 19  ? -24.621 -9.629  -20.317 1.00 0.00 ? 19  ILE A HD13 5  
ATOM 8866  N N    . ARG A 1 20  ? -28.357 -11.087 -16.367 1.00 0.00 ? 20  ARG A N    5  
ATOM 8867  C CA   . ARG A 1 20  ? -29.751 -11.082 -15.879 1.00 0.00 ? 20  ARG A CA   5  
ATOM 8868  C C    . ARG A 1 20  ? -30.075 -9.807  -15.096 1.00 0.00 ? 20  ARG A C    5  
ATOM 8869  O O    . ARG A 1 20  ? -31.203 -9.327  -15.170 1.00 0.00 ? 20  ARG A O    5  
ATOM 8870  C CB   . ARG A 1 20  ? -30.099 -12.291 -14.988 1.00 0.00 ? 20  ARG A CB   5  
ATOM 8871  C CG   . ARG A 1 20  ? -29.590 -13.668 -15.423 1.00 0.00 ? 20  ARG A CG   5  
ATOM 8872  C CD   . ARG A 1 20  ? -30.440 -14.302 -16.522 1.00 0.00 ? 20  ARG A CD   5  
ATOM 8873  N NE   . ARG A 1 20  ? -29.924 -13.882 -17.839 1.00 0.00 ? 20  ARG A NE   5  
ATOM 8874  C CZ   . ARG A 1 20  ? -29.071 -14.523 -18.610 1.00 0.00 ? 20  ARG A CZ   5  
ATOM 8875  N NH1  . ARG A 1 20  ? -28.524 -15.648 -18.268 1.00 0.00 ? 20  ARG A NH1  5  
ATOM 8876  N NH2  . ARG A 1 20  ? -28.751 -14.006 -19.755 1.00 0.00 ? 20  ARG A NH2  5  
ATOM 8877  H H    . ARG A 1 20  ? -27.737 -11.849 -16.106 1.00 0.00 ? 20  ARG A H    5  
ATOM 8878  H HA   . ARG A 1 20  ? -30.419 -11.106 -16.738 1.00 0.00 ? 20  ARG A HA   5  
ATOM 8879  H HB2  . ARG A 1 20  ? -29.631 -12.103 -14.023 1.00 0.00 ? 20  ARG A HB2  5  
ATOM 8880  H HB3  . ARG A 1 20  ? -31.178 -12.328 -14.825 1.00 0.00 ? 20  ARG A HB3  5  
ATOM 8881  H HG2  . ARG A 1 20  ? -28.553 -13.634 -15.716 1.00 0.00 ? 20  ARG A HG2  5  
ATOM 8882  H HG3  . ARG A 1 20  ? -29.658 -14.320 -14.552 1.00 0.00 ? 20  ARG A HG3  5  
ATOM 8883  H HD2  . ARG A 1 20  ? -30.395 -15.388 -16.430 1.00 0.00 ? 20  ARG A HD2  5  
ATOM 8884  H HD3  . ARG A 1 20  ? -31.483 -14.001 -16.413 1.00 0.00 ? 20  ARG A HD3  5  
ATOM 8885  H HE   . ARG A 1 20  ? -30.146 -12.949 -18.169 1.00 0.00 ? 20  ARG A HE   5  
ATOM 8886  H HH11 . ARG A 1 20  ? -28.703 -16.017 -17.353 1.00 0.00 ? 20  ARG A HH11 5  
ATOM 8887  H HH12 . ARG A 1 20  ? -27.652 -15.926 -18.711 1.00 0.00 ? 20  ARG A HH12 5  
ATOM 8888  H HH21 . ARG A 1 20  ? -29.310 -13.205 -20.056 1.00 0.00 ? 20  ARG A HH21 5  
ATOM 8889  H HH22 . ARG A 1 20  ? -28.143 -14.496 -20.385 1.00 0.00 ? 20  ARG A HH22 5  
ATOM 8890  N N    . LYS A 1 21  ? -29.080 -9.210  -14.428 1.00 0.00 ? 21  LYS A N    5  
ATOM 8891  C CA   . LYS A 1 21  ? -29.233 -7.943  -13.688 1.00 0.00 ? 21  LYS A CA   5  
ATOM 8892  C C    . LYS A 1 21  ? -29.567 -6.762  -14.608 1.00 0.00 ? 21  LYS A C    5  
ATOM 8893  O O    . LYS A 1 21  ? -30.486 -6.007  -14.292 1.00 0.00 ? 21  LYS A O    5  
ATOM 8894  C CB   . LYS A 1 21  ? -27.974 -7.646  -12.851 1.00 0.00 ? 21  LYS A CB   5  
ATOM 8895  C CG   . LYS A 1 21  ? -28.241 -6.772  -11.614 1.00 0.00 ? 21  LYS A CG   5  
ATOM 8896  C CD   . LYS A 1 21  ? -28.945 -7.556  -10.493 1.00 0.00 ? 21  LYS A CD   5  
ATOM 8897  C CE   . LYS A 1 21  ? -29.120 -6.741  -9.203  1.00 0.00 ? 21  LYS A CE   5  
ATOM 8898  N NZ   . LYS A 1 21  ? -30.018 -5.576  -9.381  1.00 0.00 ? 21  LYS A NZ   5  
ATOM 8899  H H    . LYS A 1 21  ? -28.188 -9.701  -14.422 1.00 0.00 ? 21  LYS A H    5  
ATOM 8900  H HA   . LYS A 1 21  ? -30.084 -8.059  -13.016 1.00 0.00 ? 21  LYS A HA   5  
ATOM 8901  H HB2  . LYS A 1 21  ? -27.522 -8.581  -12.518 1.00 0.00 ? 21  LYS A HB2  5  
ATOM 8902  H HB3  . LYS A 1 21  ? -27.256 -7.120  -13.483 1.00 0.00 ? 21  LYS A HB3  5  
ATOM 8903  H HG2  . LYS A 1 21  ? -27.282 -6.417  -11.235 1.00 0.00 ? 21  LYS A HG2  5  
ATOM 8904  H HG3  . LYS A 1 21  ? -28.837 -5.905  -11.903 1.00 0.00 ? 21  LYS A HG3  5  
ATOM 8905  H HD2  . LYS A 1 21  ? -29.925 -7.897  -10.829 1.00 0.00 ? 21  LYS A HD2  5  
ATOM 8906  H HD3  . LYS A 1 21  ? -28.339 -8.433  -10.258 1.00 0.00 ? 21  LYS A HD3  5  
ATOM 8907  H HE2  . LYS A 1 21  ? -29.541 -7.402  -8.441  1.00 0.00 ? 21  LYS A HE2  5  
ATOM 8908  H HE3  . LYS A 1 21  ? -28.139 -6.410  -8.851  1.00 0.00 ? 21  LYS A HE3  5  
ATOM 8909  H HZ1  . LYS A 1 21  ? -30.263 -5.172  -8.475  1.00 0.00 ? 21  LYS A HZ1  5  
ATOM 8910  H HZ2  . LYS A 1 21  ? -29.601 -4.858  -9.951  1.00 0.00 ? 21  LYS A HZ2  5  
ATOM 8911  H HZ3  . LYS A 1 21  ? -30.902 -5.849  -9.814  1.00 0.00 ? 21  LYS A HZ3  5  
ATOM 8912  N N    . PHE A 1 22  ? -28.869 -6.615  -15.743 1.00 0.00 ? 22  PHE A N    5  
ATOM 8913  C CA   . PHE A 1 22  ? -29.131 -5.538  -16.720 1.00 0.00 ? 22  PHE A CA   5  
ATOM 8914  C C    . PHE A 1 22  ? -29.944 -5.958  -17.964 1.00 0.00 ? 22  PHE A C    5  
ATOM 8915  O O    . PHE A 1 22  ? -30.184 -5.129  -18.842 1.00 0.00 ? 22  PHE A O    5  
ATOM 8916  C CB   . PHE A 1 22  ? -27.840 -4.776  -17.078 1.00 0.00 ? 22  PHE A CB   5  
ATOM 8917  C CG   . PHE A 1 22  ? -26.832 -5.480  -17.976 1.00 0.00 ? 22  PHE A CG   5  
ATOM 8918  C CD1  . PHE A 1 22  ? -27.015 -5.527  -19.374 1.00 0.00 ? 22  PHE A CD1  5  
ATOM 8919  C CD2  . PHE A 1 22  ? -25.650 -6.006  -17.425 1.00 0.00 ? 22  PHE A CD2  5  
ATOM 8920  C CE1  . PHE A 1 22  ? -26.052 -6.133  -20.201 1.00 0.00 ? 22  PHE A CE1  5  
ATOM 8921  C CE2  . PHE A 1 22  ? -24.681 -6.607  -18.250 1.00 0.00 ? 22  PHE A CE2  5  
ATOM 8922  C CZ   . PHE A 1 22  ? -24.884 -6.674  -19.638 1.00 0.00 ? 22  PHE A CZ   5  
ATOM 8923  H H    . PHE A 1 22  ? -28.100 -7.260  -15.918 1.00 0.00 ? 22  PHE A H    5  
ATOM 8924  H HA   . PHE A 1 22  ? -29.754 -4.802  -16.214 1.00 0.00 ? 22  PHE A HA   5  
ATOM 8925  H HB2  . PHE A 1 22  ? -28.124 -3.845  -17.570 1.00 0.00 ? 22  PHE A HB2  5  
ATOM 8926  H HB3  . PHE A 1 22  ? -27.345 -4.487  -16.149 1.00 0.00 ? 22  PHE A HB3  5  
ATOM 8927  H HD1  . PHE A 1 22  ? -27.890 -5.082  -19.825 1.00 0.00 ? 22  PHE A HD1  5  
ATOM 8928  H HD2  . PHE A 1 22  ? -25.485 -5.940  -16.359 1.00 0.00 ? 22  PHE A HD2  5  
ATOM 8929  H HE1  . PHE A 1 22  ? -26.203 -6.168  -21.272 1.00 0.00 ? 22  PHE A HE1  5  
ATOM 8930  H HE2  . PHE A 1 22  ? -23.776 -7.011  -17.819 1.00 0.00 ? 22  PHE A HE2  5  
ATOM 8931  H HZ   . PHE A 1 22  ? -24.137 -7.129  -20.275 1.00 0.00 ? 22  PHE A HZ   5  
ATOM 8932  N N    . GLU A 1 23  ? -30.402 -7.214  -18.046 1.00 0.00 ? 23  GLU A N    5  
ATOM 8933  C CA   . GLU A 1 23  ? -30.964 -7.836  -19.261 1.00 0.00 ? 23  GLU A CA   5  
ATOM 8934  C C    . GLU A 1 23  ? -32.173 -7.065  -19.840 1.00 0.00 ? 23  GLU A C    5  
ATOM 8935  O O    . GLU A 1 23  ? -32.406 -7.071  -21.051 1.00 0.00 ? 23  GLU A O    5  
ATOM 8936  C CB   . GLU A 1 23  ? -31.373 -9.290  -18.944 1.00 0.00 ? 23  GLU A CB   5  
ATOM 8937  C CG   . GLU A 1 23  ? -31.969 -10.034 -20.147 1.00 0.00 ? 23  GLU A CG   5  
ATOM 8938  C CD   . GLU A 1 23  ? -31.867 -11.557 -19.964 1.00 0.00 ? 23  GLU A CD   5  
ATOM 8939  O OE1  . GLU A 1 23  ? -30.724 -12.076 -19.915 1.00 0.00 ? 23  GLU A OE1  5  
ATOM 8940  O OE2  . GLU A 1 23  ? -32.914 -12.242 -19.884 1.00 0.00 ? 23  GLU A OE2  5  
ATOM 8941  H H    . GLU A 1 23  ? -30.080 -7.856  -17.332 1.00 0.00 ? 23  GLU A H    5  
ATOM 8942  H HA   . GLU A 1 23  ? -30.157 -7.886  -20.000 1.00 0.00 ? 23  GLU A HA   5  
ATOM 8943  H HB2  . GLU A 1 23  ? -30.500 -9.841  -18.607 1.00 0.00 ? 23  GLU A HB2  5  
ATOM 8944  H HB3  . GLU A 1 23  ? -32.098 -9.299  -18.131 1.00 0.00 ? 23  GLU A HB3  5  
ATOM 8945  H HG2  . GLU A 1 23  ? -33.012 -9.731  -20.279 1.00 0.00 ? 23  GLU A HG2  5  
ATOM 8946  H HG3  . GLU A 1 23  ? -31.416 -9.757  -21.048 1.00 0.00 ? 23  GLU A HG3  5  
ATOM 8947  N N    . GLY A 1 24  ? -32.930 -6.374  -18.978 1.00 0.00 ? 24  GLY A N    5  
ATOM 8948  C CA   . GLY A 1 24  ? -34.000 -5.447  -19.364 1.00 0.00 ? 24  GLY A CA   5  
ATOM 8949  C C    . GLY A 1 24  ? -35.358 -6.089  -19.668 1.00 0.00 ? 24  GLY A C    5  
ATOM 8950  O O    . GLY A 1 24  ? -36.254 -5.403  -20.166 1.00 0.00 ? 24  GLY A O    5  
ATOM 8951  H H    . GLY A 1 24  ? -32.662 -6.405  -18.004 1.00 0.00 ? 24  GLY A H    5  
ATOM 8952  H HA2  . GLY A 1 24  ? -34.151 -4.743  -18.548 1.00 0.00 ? 24  GLY A HA2  5  
ATOM 8953  H HA3  . GLY A 1 24  ? -33.681 -4.890  -20.245 1.00 0.00 ? 24  GLY A HA3  5  
ATOM 8954  N N    . GLN A 1 25  ? -35.524 -7.386  -19.392 1.00 0.00 ? 25  GLN A N    5  
ATOM 8955  C CA   . GLN A 1 25  ? -36.790 -8.105  -19.527 1.00 0.00 ? 25  GLN A CA   5  
ATOM 8956  C C    . GLN A 1 25  ? -37.192 -8.809  -18.228 1.00 0.00 ? 25  GLN A C    5  
ATOM 8957  O O    . GLN A 1 25  ? -38.238 -8.496  -17.653 1.00 0.00 ? 25  GLN A O    5  
ATOM 8958  C CB   . GLN A 1 25  ? -36.723 -9.064  -20.725 1.00 0.00 ? 25  GLN A CB   5  
ATOM 8959  C CG   . GLN A 1 25  ? -36.523 -8.349  -22.076 1.00 0.00 ? 25  GLN A CG   5  
ATOM 8960  C CD   . GLN A 1 25  ? -37.834 -7.770  -22.600 1.00 0.00 ? 25  GLN A CD   5  
ATOM 8961  O OE1  . GLN A 1 25  ? -38.561 -8.389  -23.370 1.00 0.00 ? 25  GLN A OE1  5  
ATOM 8962  N NE2  . GLN A 1 25  ? -38.195 -6.578  -22.173 1.00 0.00 ? 25  GLN A NE2  5  
ATOM 8963  H H    . GLN A 1 25  ? -34.729 -7.907  -19.066 1.00 0.00 ? 25  GLN A H    5  
ATOM 8964  H HA   . GLN A 1 25  ? -37.590 -7.395  -19.715 1.00 0.00 ? 25  GLN A HA   5  
ATOM 8965  H HB2  . GLN A 1 25  ? -35.885 -9.747  -20.576 1.00 0.00 ? 25  GLN A HB2  5  
ATOM 8966  H HB3  . GLN A 1 25  ? -37.631 -9.658  -20.753 1.00 0.00 ? 25  GLN A HB3  5  
ATOM 8967  H HG2  . GLN A 1 25  ? -35.762 -7.573  -22.011 1.00 0.00 ? 25  GLN A HG2  5  
ATOM 8968  H HG3  . GLN A 1 25  ? -36.171 -9.085  -22.799 1.00 0.00 ? 25  GLN A HG3  5  
ATOM 8969  H HE21 . GLN A 1 25  ? -37.602 -6.069  -21.527 1.00 0.00 ? 25  GLN A HE21 5  
ATOM 8970  H HE22 . GLN A 1 25  ? -39.142 -6.253  -22.381 1.00 0.00 ? 25  GLN A HE22 5  
ATOM 8971  N N    . SER A 1 26  ? -36.346 -9.702  -17.709 1.00 0.00 ? 26  SER A N    5  
ATOM 8972  C CA   . SER A 1 26  ? -36.574 -10.361 -16.410 1.00 0.00 ? 26  SER A CA   5  
ATOM 8973  C C    . SER A 1 26  ? -36.398 -9.395  -15.229 1.00 0.00 ? 26  SER A C    5  
ATOM 8974  O O    . SER A 1 26  ? -37.162 -9.462  -14.263 1.00 0.00 ? 26  SER A O    5  
ATOM 8975  C CB   . SER A 1 26  ? -35.612 -11.544 -16.267 1.00 0.00 ? 26  SER A CB   5  
ATOM 8976  O OG   . SER A 1 26  ? -34.270 -11.105 -16.413 1.00 0.00 ? 26  SER A OG   5  
ATOM 8977  H H    . SER A 1 26  ? -35.508 -9.937  -18.222 1.00 0.00 ? 26  SER A H    5  
ATOM 8978  H HA   . SER A 1 26  ? -37.591 -10.751 -16.378 1.00 0.00 ? 26  SER A HA   5  
ATOM 8979  H HB2  . SER A 1 26  ? -35.746 -12.011 -15.288 1.00 0.00 ? 26  SER A HB2  5  
ATOM 8980  H HB3  . SER A 1 26  ? -35.837 -12.281 -17.039 1.00 0.00 ? 26  SER A HB3  5  
ATOM 8981  H HG   . SER A 1 26  ? -33.690 -11.890 -16.402 1.00 0.00 ? 26  SER A HG   5  
ATOM 8982  N N    . ARG A 1 27  ? -35.527 -8.388  -15.377 1.00 0.00 ? 27  ARG A N    5  
ATOM 8983  C CA   . ARG A 1 27  ? -35.341 -7.232  -14.481 1.00 0.00 ? 27  ARG A CA   5  
ATOM 8984  C C    . ARG A 1 27  ? -35.664 -5.935  -15.246 1.00 0.00 ? 27  ARG A C    5  
ATOM 8985  O O    . ARG A 1 27  ? -35.512 -5.884  -16.468 1.00 0.00 ? 27  ARG A O    5  
ATOM 8986  C CB   . ARG A 1 27  ? -33.920 -7.269  -13.877 1.00 0.00 ? 27  ARG A CB   5  
ATOM 8987  C CG   . ARG A 1 27  ? -33.541 -8.618  -13.224 1.00 0.00 ? 27  ARG A CG   5  
ATOM 8988  C CD   . ARG A 1 27  ? -34.430 -9.075  -12.060 1.00 0.00 ? 27  ARG A CD   5  
ATOM 8989  N NE   . ARG A 1 27  ? -34.125 -10.467 -11.674 1.00 0.00 ? 27  ARG A NE   5  
ATOM 8990  C CZ   . ARG A 1 27  ? -33.586 -10.914 -10.551 1.00 0.00 ? 27  ARG A CZ   5  
ATOM 8991  N NH1  . ARG A 1 27  ? -33.230 -10.148 -9.561  1.00 0.00 ? 27  ARG A NH1  5  
ATOM 8992  N NH2  . ARG A 1 27  ? -33.384 -12.192 -10.401 1.00 0.00 ? 27  ARG A NH2  5  
ATOM 8993  H H    . ARG A 1 27  ? -34.927 -8.439  -16.190 1.00 0.00 ? 27  ARG A H    5  
ATOM 8994  H HA   . ARG A 1 27  ? -36.055 -7.299  -13.660 1.00 0.00 ? 27  ARG A HA   5  
ATOM 8995  H HB2  . ARG A 1 27  ? -33.200 -7.070  -14.673 1.00 0.00 ? 27  ARG A HB2  5  
ATOM 8996  H HB3  . ARG A 1 27  ? -33.819 -6.476  -13.136 1.00 0.00 ? 27  ARG A HB3  5  
ATOM 8997  H HG2  . ARG A 1 27  ? -33.564 -9.399  -13.982 1.00 0.00 ? 27  ARG A HG2  5  
ATOM 8998  H HG3  . ARG A 1 27  ? -32.517 -8.543  -12.865 1.00 0.00 ? 27  ARG A HG3  5  
ATOM 8999  H HD2  . ARG A 1 27  ? -34.289 -8.402  -11.224 1.00 0.00 ? 27  ARG A HD2  5  
ATOM 9000  H HD3  . ARG A 1 27  ? -35.478 -9.026  -12.358 1.00 0.00 ? 27  ARG A HD3  5  
ATOM 9001  H HE   . ARG A 1 27  ? -34.362 -11.173 -12.352 1.00 0.00 ? 27  ARG A HE   5  
ATOM 9002  H HH11 . ARG A 1 27  ? -33.377 -9.136  -9.598  1.00 0.00 ? 27  ARG A HH11 5  
ATOM 9003  H HH12 . ARG A 1 27  ? -32.821 -10.540 -8.734  1.00 0.00 ? 27  ARG A HH12 5  
ATOM 9004  H HH21 . ARG A 1 27  ? -33.639 -12.838 -11.130 1.00 0.00 ? 27  ARG A HH21 5  
ATOM 9005  H HH22 . ARG A 1 27  ? -32.971 -12.544 -9.554  1.00 0.00 ? 27  ARG A HH22 5  
ATOM 9006  N N    . LYS A 1 28  ? -36.149 -4.902  -14.544 1.00 0.00 ? 28  LYS A N    5  
ATOM 9007  C CA   . LYS A 1 28  ? -36.767 -3.685  -15.124 1.00 0.00 ? 28  LYS A CA   5  
ATOM 9008  C C    . LYS A 1 28  ? -36.169 -2.399  -14.540 1.00 0.00 ? 28  LYS A C    5  
ATOM 9009  O O    . LYS A 1 28  ? -35.765 -2.407  -13.376 1.00 0.00 ? 28  LYS A O    5  
ATOM 9010  C CB   . LYS A 1 28  ? -38.289 -3.735  -14.888 1.00 0.00 ? 28  LYS A CB   5  
ATOM 9011  C CG   . LYS A 1 28  ? -38.986 -5.051  -15.313 1.00 0.00 ? 28  LYS A CG   5  
ATOM 9012  C CD   . LYS A 1 28  ? -39.178 -6.043  -14.150 1.00 0.00 ? 28  LYS A CD   5  
ATOM 9013  C CE   . LYS A 1 28  ? -40.234 -7.113  -14.469 1.00 0.00 ? 28  LYS A CE   5  
ATOM 9014  N NZ   . LYS A 1 28  ? -39.672 -8.275  -15.208 1.00 0.00 ? 28  LYS A NZ   5  
ATOM 9015  H H    . LYS A 1 28  ? -36.130 -4.973  -13.538 1.00 0.00 ? 28  LYS A H    5  
ATOM 9016  H HA   . LYS A 1 28  ? -36.602 -3.657  -16.202 1.00 0.00 ? 28  LYS A HA   5  
ATOM 9017  H HB2  . LYS A 1 28  ? -38.501 -3.523  -13.843 1.00 0.00 ? 28  LYS A HB2  5  
ATOM 9018  H HB3  . LYS A 1 28  ? -38.736 -2.914  -15.441 1.00 0.00 ? 28  LYS A HB3  5  
ATOM 9019  H HG2  . LYS A 1 28  ? -39.973 -4.804  -15.690 1.00 0.00 ? 28  LYS A HG2  5  
ATOM 9020  H HG3  . LYS A 1 28  ? -38.441 -5.524  -16.129 1.00 0.00 ? 28  LYS A HG3  5  
ATOM 9021  H HD2  . LYS A 1 28  ? -38.237 -6.517  -13.880 1.00 0.00 ? 28  LYS A HD2  5  
ATOM 9022  H HD3  . LYS A 1 28  ? -39.525 -5.490  -13.279 1.00 0.00 ? 28  LYS A HD3  5  
ATOM 9023  H HE2  . LYS A 1 28  ? -40.662 -7.459  -13.524 1.00 0.00 ? 28  LYS A HE2  5  
ATOM 9024  H HE3  . LYS A 1 28  ? -41.048 -6.654  -15.041 1.00 0.00 ? 28  LYS A HE3  5  
ATOM 9025  H HZ1  . LYS A 1 28  ? -40.387 -8.967  -15.389 1.00 0.00 ? 28  LYS A HZ1  5  
ATOM 9026  H HZ2  . LYS A 1 28  ? -39.280 -8.010  -16.108 1.00 0.00 ? 28  LYS A HZ2  5  
ATOM 9027  H HZ3  . LYS A 1 28  ? -38.939 -8.732  -14.672 1.00 0.00 ? 28  LYS A HZ3  5  
ATOM 9028  N N    . PHE A 1 29  ? -36.132 -1.295  -15.303 1.00 0.00 ? 29  PHE A N    5  
ATOM 9029  C CA   . PHE A 1 29  ? -35.401 -0.083  -14.888 1.00 0.00 ? 29  PHE A CA   5  
ATOM 9030  C C    . PHE A 1 29  ? -35.634 1.191   -15.728 1.00 0.00 ? 29  PHE A C    5  
ATOM 9031  O O    . PHE A 1 29  ? -36.112 1.195   -16.869 1.00 0.00 ? 29  PHE A O    5  
ATOM 9032  C CB   . PHE A 1 29  ? -33.879 -0.371  -14.842 1.00 0.00 ? 29  PHE A CB   5  
ATOM 9033  C CG   . PHE A 1 29  ? -33.202 -0.712  -16.158 1.00 0.00 ? 29  PHE A CG   5  
ATOM 9034  C CD1  . PHE A 1 29  ? -33.080 -2.057  -16.563 1.00 0.00 ? 29  PHE A CD1  5  
ATOM 9035  C CD2  . PHE A 1 29  ? -32.617 0.303   -16.939 1.00 0.00 ? 29  PHE A CD2  5  
ATOM 9036  C CE1  . PHE A 1 29  ? -32.388 -2.381  -17.743 1.00 0.00 ? 29  PHE A CE1  5  
ATOM 9037  C CE2  . PHE A 1 29  ? -31.925 -0.023  -18.120 1.00 0.00 ? 29  PHE A CE2  5  
ATOM 9038  C CZ   . PHE A 1 29  ? -31.814 -1.364  -18.524 1.00 0.00 ? 29  PHE A CZ   5  
ATOM 9039  H H    . PHE A 1 29  ? -36.563 -1.304  -16.219 1.00 0.00 ? 29  PHE A H    5  
ATOM 9040  H HA   . PHE A 1 29  ? -35.719 0.159   -13.872 1.00 0.00 ? 29  PHE A HA   5  
ATOM 9041  H HB2  . PHE A 1 29  ? -33.368 0.490   -14.410 1.00 0.00 ? 29  PHE A HB2  5  
ATOM 9042  H HB3  . PHE A 1 29  ? -33.694 -1.192  -14.154 1.00 0.00 ? 29  PHE A HB3  5  
ATOM 9043  H HD1  . PHE A 1 29  ? -33.495 -2.848  -15.951 1.00 0.00 ? 29  PHE A HD1  5  
ATOM 9044  H HD2  . PHE A 1 29  ? -32.683 1.337   -16.625 1.00 0.00 ? 29  PHE A HD2  5  
ATOM 9045  H HE1  . PHE A 1 29  ? -32.275 -3.414  -18.043 1.00 0.00 ? 29  PHE A HE1  5  
ATOM 9046  H HE2  . PHE A 1 29  ? -31.473 0.757   -18.719 1.00 0.00 ? 29  PHE A HE2  5  
ATOM 9047  H HZ   . PHE A 1 29  ? -31.276 -1.616  -19.429 1.00 0.00 ? 29  PHE A HZ   5  
ATOM 9048  N N    . ILE A 1 30  ? -35.237 2.298   -15.103 1.00 0.00 ? 30  ILE A N    5  
ATOM 9049  C CA   . ILE A 1 30  ? -35.190 3.665   -15.624 1.00 0.00 ? 30  ILE A CA   5  
ATOM 9050  C C    . ILE A 1 30  ? -33.797 4.268   -15.434 1.00 0.00 ? 30  ILE A C    5  
ATOM 9051  O O    . ILE A 1 30  ? -32.957 3.706   -14.736 1.00 0.00 ? 30  ILE A O    5  
ATOM 9052  C CB   . ILE A 1 30  ? -36.266 4.547   -14.950 1.00 0.00 ? 30  ILE A CB   5  
ATOM 9053  C CG1  . ILE A 1 30  ? -36.438 4.365   -13.424 1.00 0.00 ? 30  ILE A CG1  5  
ATOM 9054  C CG2  . ILE A 1 30  ? -37.597 4.304   -15.663 1.00 0.00 ? 30  ILE A CG2  5  
ATOM 9055  C CD1  . ILE A 1 30  ? -35.165 4.594   -12.599 1.00 0.00 ? 30  ILE A CD1  5  
ATOM 9056  H H    . ILE A 1 30  ? -34.833 2.181   -14.184 1.00 0.00 ? 30  ILE A H    5  
ATOM 9057  H HA   . ILE A 1 30  ? -35.369 3.648   -16.699 1.00 0.00 ? 30  ILE A HA   5  
ATOM 9058  H HB   . ILE A 1 30  ? -36.014 5.591   -15.117 1.00 0.00 ? 30  ILE A HB   5  
ATOM 9059  H HG12 . ILE A 1 30  ? -37.185 5.084   -13.084 1.00 0.00 ? 30  ILE A HG12 5  
ATOM 9060  H HG13 . ILE A 1 30  ? -36.821 3.366   -13.209 1.00 0.00 ? 30  ILE A HG13 5  
ATOM 9061  H HG21 . ILE A 1 30  ? -38.362 4.959   -15.247 1.00 0.00 ? 30  ILE A HG21 5  
ATOM 9062  H HG22 . ILE A 1 30  ? -37.476 4.529   -16.723 1.00 0.00 ? 30  ILE A HG22 5  
ATOM 9063  H HG23 . ILE A 1 30  ? -37.900 3.265   -15.544 1.00 0.00 ? 30  ILE A HG23 5  
ATOM 9064  H HD11 . ILE A 1 30  ? -34.706 5.544   -12.875 1.00 0.00 ? 30  ILE A HD11 5  
ATOM 9065  H HD12 . ILE A 1 30  ? -35.431 4.624   -11.545 1.00 0.00 ? 30  ILE A HD12 5  
ATOM 9066  H HD13 . ILE A 1 30  ? -34.447 3.781   -12.745 1.00 0.00 ? 30  ILE A HD13 5  
ATOM 9067  N N    . ILE A 1 31  ? -33.566 5.424   -16.043 1.00 0.00 ? 31  ILE A N    5  
ATOM 9068  C CA   . ILE A 1 31  ? -32.335 6.203   -15.967 1.00 0.00 ? 31  ILE A CA   5  
ATOM 9069  C C    . ILE A 1 31  ? -32.699 7.598   -15.484 1.00 0.00 ? 31  ILE A C    5  
ATOM 9070  O O    . ILE A 1 31  ? -33.429 8.331   -16.153 1.00 0.00 ? 31  ILE A O    5  
ATOM 9071  C CB   . ILE A 1 31  ? -31.629 6.289   -17.336 1.00 0.00 ? 31  ILE A CB   5  
ATOM 9072  C CG1  . ILE A 1 31  ? -31.616 4.961   -18.125 1.00 0.00 ? 31  ILE A CG1  5  
ATOM 9073  C CG2  . ILE A 1 31  ? -30.213 6.860   -17.148 1.00 0.00 ? 31  ILE A CG2  5  
ATOM 9074  C CD1  . ILE A 1 31  ? -30.741 3.896   -17.475 1.00 0.00 ? 31  ILE A CD1  5  
ATOM 9075  H H    . ILE A 1 31  ? -34.306 5.821   -16.613 1.00 0.00 ? 31  ILE A H    5  
ATOM 9076  H HA   . ILE A 1 31  ? -31.662 5.750   -15.243 1.00 0.00 ? 31  ILE A HA   5  
ATOM 9077  H HB   . ILE A 1 31  ? -32.182 7.004   -17.937 1.00 0.00 ? 31  ILE A HB   5  
ATOM 9078  H HG12 . ILE A 1 31  ? -32.638 4.577   -18.224 1.00 0.00 ? 31  ILE A HG12 5  
ATOM 9079  H HG13 . ILE A 1 31  ? -31.228 5.141   -19.128 1.00 0.00 ? 31  ILE A HG13 5  
ATOM 9080  H HG21 . ILE A 1 31  ? -29.709 6.927   -18.113 1.00 0.00 ? 31  ILE A HG21 5  
ATOM 9081  H HG22 . ILE A 1 31  ? -30.265 7.858   -16.715 1.00 0.00 ? 31  ILE A HG22 5  
ATOM 9082  H HG23 . ILE A 1 31  ? -29.626 6.230   -16.478 1.00 0.00 ? 31  ILE A HG23 5  
ATOM 9083  H HD11 . ILE A 1 31  ? -30.923 2.936   -17.954 1.00 0.00 ? 31  ILE A HD11 5  
ATOM 9084  H HD12 . ILE A 1 31  ? -29.694 4.165   -17.597 1.00 0.00 ? 31  ILE A HD12 5  
ATOM 9085  H HD13 . ILE A 1 31  ? -30.978 3.841   -16.417 1.00 0.00 ? 31  ILE A HD13 5  
ATOM 9086  N N    . ALA A 1 32  ? -32.167 7.960   -14.328 1.00 0.00 ? 32  ALA A N    5  
ATOM 9087  C CA   . ALA A 1 32  ? -32.395 9.248   -13.681 1.00 0.00 ? 32  ALA A CA   5  
ATOM 9088  C C    . ALA A 1 32  ? -31.085 9.986   -13.400 1.00 0.00 ? 32  ALA A C    5  
ATOM 9089  O O    . ALA A 1 32  ? -30.010 9.399   -13.242 1.00 0.00 ? 32  ALA A O    5  
ATOM 9090  C CB   . ALA A 1 32  ? -33.296 9.103   -12.438 1.00 0.00 ? 32  ALA A CB   5  
ATOM 9091  H H    . ALA A 1 32  ? -31.558 7.285   -13.874 1.00 0.00 ? 32  ALA A H    5  
ATOM 9092  H HA   . ALA A 1 32  ? -32.937 9.883   -14.378 1.00 0.00 ? 32  ALA A HA   5  
ATOM 9093  H HB1  . ALA A 1 32  ? -33.285 10.029  -11.857 1.00 0.00 ? 32  ALA A HB1  5  
ATOM 9094  H HB2  . ALA A 1 32  ? -34.313 8.873   -12.748 1.00 0.00 ? 32  ALA A HB2  5  
ATOM 9095  H HB3  . ALA A 1 32  ? -32.979 8.301   -11.776 1.00 0.00 ? 32  ALA A HB3  5  
ATOM 9096  N N    . ASN A 1 33  ? -31.194 11.307  -13.335 1.00 0.00 ? 33  ASN A N    5  
ATOM 9097  C CA   . ASN A 1 33  ? -30.110 12.211  -13.001 1.00 0.00 ? 33  ASN A CA   5  
ATOM 9098  C C    . ASN A 1 33  ? -29.961 12.324  -11.475 1.00 0.00 ? 33  ASN A C    5  
ATOM 9099  O O    . ASN A 1 33  ? -30.805 12.915  -10.801 1.00 0.00 ? 33  ASN A O    5  
ATOM 9100  C CB   . ASN A 1 33  ? -30.472 13.526  -13.693 1.00 0.00 ? 33  ASN A CB   5  
ATOM 9101  C CG   . ASN A 1 33  ? -29.431 14.615  -13.600 1.00 0.00 ? 33  ASN A CG   5  
ATOM 9102  O OD1  . ASN A 1 33  ? -28.492 14.575  -12.818 1.00 0.00 ? 33  ASN A OD1  5  
ATOM 9103  N ND2  . ASN A 1 33  ? -29.599 15.620  -14.425 1.00 0.00 ? 33  ASN A ND2  5  
ATOM 9104  H H    . ASN A 1 33  ? -32.099 11.724  -13.525 1.00 0.00 ? 33  ASN A H    5  
ATOM 9105  H HA   . ASN A 1 33  ? -29.174 11.841  -13.426 1.00 0.00 ? 33  ASN A HA   5  
ATOM 9106  H HB2  . ASN A 1 33  ? -30.617 13.319  -14.748 1.00 0.00 ? 33  ASN A HB2  5  
ATOM 9107  H HB3  . ASN A 1 33  ? -31.409 13.907  -13.288 1.00 0.00 ? 33  ASN A HB3  5  
ATOM 9108  H HD21 . ASN A 1 33  ? -30.398 15.617  -15.045 1.00 0.00 ? 33  ASN A HD21 5  
ATOM 9109  H HD22 . ASN A 1 33  ? -28.917 16.357  -14.444 1.00 0.00 ? 33  ASN A HD22 5  
ATOM 9110  N N    . ALA A 1 34  ? -28.871 11.779  -10.928 1.00 0.00 ? 34  ALA A N    5  
ATOM 9111  C CA   . ALA A 1 34  ? -28.574 11.846  -9.491  1.00 0.00 ? 34  ALA A CA   5  
ATOM 9112  C C    . ALA A 1 34  ? -28.080 13.229  -9.024  1.00 0.00 ? 34  ALA A C    5  
ATOM 9113  O O    . ALA A 1 34  ? -27.971 13.480  -7.821  1.00 0.00 ? 34  ALA A O    5  
ATOM 9114  C CB   . ALA A 1 34  ? -27.539 10.769  -9.157  1.00 0.00 ? 34  ALA A CB   5  
ATOM 9115  H H    . ALA A 1 34  ? -28.215 11.306  -11.534 1.00 0.00 ? 34  ALA A H    5  
ATOM 9116  H HA   . ALA A 1 34  ? -29.483 11.631  -8.934  1.00 0.00 ? 34  ALA A HA   5  
ATOM 9117  H HB1  . ALA A 1 34  ? -27.894 9.796   -9.483  1.00 0.00 ? 34  ALA A HB1  5  
ATOM 9118  H HB2  . ALA A 1 34  ? -26.593 10.997  -9.646  1.00 0.00 ? 34  ALA A HB2  5  
ATOM 9119  H HB3  . ALA A 1 34  ? -27.376 10.740  -8.079  1.00 0.00 ? 34  ALA A HB3  5  
ATOM 9120  N N    . ARG A 1 35  ? -27.732 14.110  -9.971  1.00 0.00 ? 35  ARG A N    5  
ATOM 9121  C CA   . ARG A 1 35  ? -27.037 15.387  -9.719  1.00 0.00 ? 35  ARG A CA   5  
ATOM 9122  C C    . ARG A 1 35  ? -27.967 16.608  -9.713  1.00 0.00 ? 35  ARG A C    5  
ATOM 9123  O O    . ARG A 1 35  ? -27.513 17.716  -9.416  1.00 0.00 ? 35  ARG A O    5  
ATOM 9124  C CB   . ARG A 1 35  ? -25.871 15.557  -10.713 1.00 0.00 ? 35  ARG A CB   5  
ATOM 9125  C CG   . ARG A 1 35  ? -24.970 14.320  -10.924 1.00 0.00 ? 35  ARG A CG   5  
ATOM 9126  C CD   . ARG A 1 35  ? -24.487 13.597  -9.655  1.00 0.00 ? 35  ARG A CD   5  
ATOM 9127  N NE   . ARG A 1 35  ? -23.810 14.493  -8.699  1.00 0.00 ? 35  ARG A NE   5  
ATOM 9128  C CZ   . ARG A 1 35  ? -23.488 14.205  -7.450  1.00 0.00 ? 35  ARG A CZ   5  
ATOM 9129  N NH1  . ARG A 1 35  ? -23.704 13.034  -6.913  1.00 0.00 ? 35  ARG A NH1  5  
ATOM 9130  N NH2  . ARG A 1 35  ? -22.928 15.109  -6.697  1.00 0.00 ? 35  ARG A NH2  5  
ATOM 9131  H H    . ARG A 1 35  ? -27.928 13.857  -10.938 1.00 0.00 ? 35  ARG A H    5  
ATOM 9132  H HA   . ARG A 1 35  ? -26.605 15.354  -8.717  1.00 0.00 ? 35  ARG A HA   5  
ATOM 9133  H HB2  . ARG A 1 35  ? -26.276 15.841  -11.686 1.00 0.00 ? 35  ARG A HB2  5  
ATOM 9134  H HB3  . ARG A 1 35  ? -25.247 16.383  -10.372 1.00 0.00 ? 35  ARG A HB3  5  
ATOM 9135  H HG2  . ARG A 1 35  ? -25.511 13.595  -11.534 1.00 0.00 ? 35  ARG A HG2  5  
ATOM 9136  H HG3  . ARG A 1 35  ? -24.099 14.631  -11.500 1.00 0.00 ? 35  ARG A HG3  5  
ATOM 9137  H HD2  . ARG A 1 35  ? -25.337 13.119  -9.169  1.00 0.00 ? 35  ARG A HD2  5  
ATOM 9138  H HD3  . ARG A 1 35  ? -23.790 12.819  -9.961  1.00 0.00 ? 35  ARG A HD3  5  
ATOM 9139  H HE   . ARG A 1 35  ? -23.567 15.414  -9.024  1.00 0.00 ? 35  ARG A HE   5  
ATOM 9140  H HH11 . ARG A 1 35  ? -24.103 12.281  -7.461  1.00 0.00 ? 35  ARG A HH11 5  
ATOM 9141  H HH12 . ARG A 1 35  ? -23.459 12.864  -5.954  1.00 0.00 ? 35  ARG A HH12 5  
ATOM 9142  H HH21 . ARG A 1 35  ? -22.741 16.028  -7.062  1.00 0.00 ? 35  ARG A HH21 5  
ATOM 9143  H HH22 . ARG A 1 35  ? -22.679 14.895  -5.746  1.00 0.00 ? 35  ARG A HH22 5  
ATOM 9144  N N    . VAL A 1 36  ? -29.250 16.420  -10.033 1.00 0.00 ? 36  VAL A N    5  
ATOM 9145  C CA   . VAL A 1 36  ? -30.275 17.474  -10.133 1.00 0.00 ? 36  VAL A CA   5  
ATOM 9146  C C    . VAL A 1 36  ? -31.285 17.381  -8.983  1.00 0.00 ? 36  VAL A C    5  
ATOM 9147  O O    . VAL A 1 36  ? -31.712 16.289  -8.606  1.00 0.00 ? 36  VAL A O    5  
ATOM 9148  C CB   . VAL A 1 36  ? -30.927 17.447  -11.533 1.00 0.00 ? 36  VAL A CB   5  
ATOM 9149  C CG1  . VAL A 1 36  ? -31.980 16.349  -11.725 1.00 0.00 ? 36  VAL A CG1  5  
ATOM 9150  C CG2  . VAL A 1 36  ? -31.566 18.788  -11.887 1.00 0.00 ? 36  VAL A CG2  5  
ATOM 9151  H H    . VAL A 1 36  ? -29.538 15.475  -10.236 1.00 0.00 ? 36  VAL A H    5  
ATOM 9152  H HA   . VAL A 1 36  ? -29.774 18.438  -10.041 1.00 0.00 ? 36  VAL A HA   5  
ATOM 9153  H HB   . VAL A 1 36  ? -30.134 17.272  -12.260 1.00 0.00 ? 36  VAL A HB   5  
ATOM 9154  H HG11 . VAL A 1 36  ? -32.237 16.274  -12.781 1.00 0.00 ? 36  VAL A HG11 5  
ATOM 9155  H HG12 . VAL A 1 36  ? -31.586 15.393  -11.385 1.00 0.00 ? 36  VAL A HG12 5  
ATOM 9156  H HG13 . VAL A 1 36  ? -32.881 16.589  -11.166 1.00 0.00 ? 36  VAL A HG13 5  
ATOM 9157  H HG21 . VAL A 1 36  ? -32.390 19.012  -11.211 1.00 0.00 ? 36  VAL A HG21 5  
ATOM 9158  H HG22 . VAL A 1 36  ? -30.815 19.577  -11.825 1.00 0.00 ? 36  VAL A HG22 5  
ATOM 9159  H HG23 . VAL A 1 36  ? -31.941 18.745  -12.910 1.00 0.00 ? 36  VAL A HG23 5  
ATOM 9160  N N    . GLU A 1 37  ? -31.701 18.523  -8.432  1.00 0.00 ? 37  GLU A N    5  
ATOM 9161  C CA   . GLU A 1 37  ? -32.596 18.590  -7.258  1.00 0.00 ? 37  GLU A CA   5  
ATOM 9162  C C    . GLU A 1 37  ? -33.994 17.984  -7.495  1.00 0.00 ? 37  GLU A C    5  
ATOM 9163  O O    . GLU A 1 37  ? -34.653 17.540  -6.554  1.00 0.00 ? 37  GLU A O    5  
ATOM 9164  C CB   . GLU A 1 37  ? -32.699 20.047  -6.773  1.00 0.00 ? 37  GLU A CB   5  
ATOM 9165  C CG   . GLU A 1 37  ? -33.354 21.010  -7.776  1.00 0.00 ? 37  GLU A CG   5  
ATOM 9166  C CD   . GLU A 1 37  ? -33.377 22.448  -7.222  1.00 0.00 ? 37  GLU A CD   5  
ATOM 9167  O OE1  . GLU A 1 37  ? -34.361 22.827  -6.541  1.00 0.00 ? 37  GLU A OE1  5  
ATOM 9168  O OE2  . GLU A 1 37  ? -32.413 23.215  -7.470  1.00 0.00 ? 37  GLU A OE2  5  
ATOM 9169  H H    . GLU A 1 37  ? -31.309 19.391  -8.774  1.00 0.00 ? 37  GLU A H    5  
ATOM 9170  H HA   . GLU A 1 37  ? -32.140 18.012  -6.453  1.00 0.00 ? 37  GLU A HA   5  
ATOM 9171  H HB2  . GLU A 1 37  ? -33.279 20.059  -5.849  1.00 0.00 ? 37  GLU A HB2  5  
ATOM 9172  H HB3  . GLU A 1 37  ? -31.695 20.405  -6.546  1.00 0.00 ? 37  GLU A HB3  5  
ATOM 9173  H HG2  . GLU A 1 37  ? -32.800 20.985  -8.718  1.00 0.00 ? 37  GLU A HG2  5  
ATOM 9174  H HG3  . GLU A 1 37  ? -34.374 20.679  -7.982  1.00 0.00 ? 37  GLU A HG3  5  
ATOM 9175  N N    . ASN A 1 38  ? -34.427 17.930  -8.759  1.00 0.00 ? 38  ASN A N    5  
ATOM 9176  C CA   . ASN A 1 38  ? -35.687 17.321  -9.194  1.00 0.00 ? 38  ASN A CA   5  
ATOM 9177  C C    . ASN A 1 38  ? -35.589 15.796  -9.441  1.00 0.00 ? 38  ASN A C    5  
ATOM 9178  O O    . ASN A 1 38  ? -36.609 15.162  -9.700  1.00 0.00 ? 38  ASN A O    5  
ATOM 9179  C CB   . ASN A 1 38  ? -36.172 18.110  -10.429 1.00 0.00 ? 38  ASN A CB   5  
ATOM 9180  C CG   . ASN A 1 38  ? -37.623 17.836  -10.793 1.00 0.00 ? 38  ASN A CG   5  
ATOM 9181  O OD1  . ASN A 1 38  ? -37.936 17.228  -11.806 1.00 0.00 ? 38  ASN A OD1  5  
ATOM 9182  N ND2  . ASN A 1 38  ? -38.561 18.304  -9.997  1.00 0.00 ? 38  ASN A ND2  5  
ATOM 9183  H H    . ASN A 1 38  ? -33.841 18.364  -9.456  1.00 0.00 ? 38  ASN A H    5  
ATOM 9184  H HA   . ASN A 1 38  ? -36.421 17.456  -8.397  1.00 0.00 ? 38  ASN A HA   5  
ATOM 9185  H HB2  . ASN A 1 38  ? -36.081 19.180  -10.232 1.00 0.00 ? 38  ASN A HB2  5  
ATOM 9186  H HB3  . ASN A 1 38  ? -35.542 17.870  -11.286 1.00 0.00 ? 38  ASN A HB3  5  
ATOM 9187  H HD21 . ASN A 1 38  ? -38.318 18.836  -9.176  1.00 0.00 ? 38  ASN A HD21 5  
ATOM 9188  H HD22 . ASN A 1 38  ? -39.523 18.142  -10.249 1.00 0.00 ? 38  ASN A HD22 5  
ATOM 9189  N N    . CYS A 1 39  ? -34.384 15.205  -9.362  1.00 0.00 ? 39  CYS A N    5  
ATOM 9190  C CA   . CYS A 1 39  ? -34.058 13.777  -9.547  1.00 0.00 ? 39  CYS A CA   5  
ATOM 9191  C C    . CYS A 1 39  ? -34.730 13.075  -10.752 1.00 0.00 ? 39  CYS A C    5  
ATOM 9192  O O    . CYS A 1 39  ? -35.062 11.892  -10.675 1.00 0.00 ? 39  CYS A O    5  
ATOM 9193  C CB   . CYS A 1 39  ? -34.220 13.012  -8.216  1.00 0.00 ? 39  CYS A CB   5  
ATOM 9194  S SG   . CYS A 1 39  ? -35.952 12.841  -7.688  1.00 0.00 ? 39  CYS A SG   5  
ATOM 9195  H H    . CYS A 1 39  ? -33.606 15.796  -9.089  1.00 0.00 ? 39  CYS A H    5  
ATOM 9196  H HA   . CYS A 1 39  ? -32.993 13.747  -9.779  1.00 0.00 ? 39  CYS A HA   5  
ATOM 9197  H HB2  . CYS A 1 39  ? -33.803 12.012  -8.340  1.00 0.00 ? 39  CYS A HB2  5  
ATOM 9198  H HB3  . CYS A 1 39  ? -33.656 13.524  -7.435  1.00 0.00 ? 39  CYS A HB3  5  
ATOM 9199  H HG   . CYS A 1 39  ? -36.333 14.096  -7.969  1.00 0.00 ? 39  CYS A HG   5  
ATOM 9200  N N    . ALA A 1 40  ? -34.971 13.779  -11.863 1.00 0.00 ? 40  ALA A N    5  
ATOM 9201  C CA   . ALA A 1 40  ? -35.830 13.265  -12.930 1.00 0.00 ? 40  ALA A CA   5  
ATOM 9202  C C    . ALA A 1 40  ? -35.227 12.178  -13.845 1.00 0.00 ? 40  ALA A C    5  
ATOM 9203  O O    . ALA A 1 40  ? -34.010 12.059  -14.016 1.00 0.00 ? 40  ALA A O    5  
ATOM 9204  C CB   . ALA A 1 40  ? -36.464 14.427  -13.706 1.00 0.00 ? 40  ALA A CB   5  
ATOM 9205  H H    . ALA A 1 40  ? -34.676 14.742  -11.905 1.00 0.00 ? 40  ALA A H    5  
ATOM 9206  H HA   . ALA A 1 40  ? -36.647 12.771  -12.415 1.00 0.00 ? 40  ALA A HA   5  
ATOM 9207  H HB1  . ALA A 1 40  ? -35.694 15.033  -14.190 1.00 0.00 ? 40  ALA A HB1  5  
ATOM 9208  H HB2  . ALA A 1 40  ? -37.138 14.030  -14.463 1.00 0.00 ? 40  ALA A HB2  5  
ATOM 9209  H HB3  . ALA A 1 40  ? -37.071 15.033  -13.035 1.00 0.00 ? 40  ALA A HB3  5  
ATOM 9210  N N    . VAL A 1 41  ? -36.131 11.398  -14.449 1.00 0.00 ? 41  VAL A N    5  
ATOM 9211  C CA   . VAL A 1 41  ? -35.924 10.255  -15.335 1.00 0.00 ? 41  VAL A CA   5  
ATOM 9212  C C    . VAL A 1 41  ? -35.604 10.762  -16.741 1.00 0.00 ? 41  VAL A C    5  
ATOM 9213  O O    . VAL A 1 41  ? -36.483 11.028  -17.562 1.00 0.00 ? 41  VAL A O    5  
ATOM 9214  C CB   . VAL A 1 41  ? -37.169 9.341   -15.310 1.00 0.00 ? 41  VAL A CB   5  
ATOM 9215  C CG1  . VAL A 1 41  ? -37.025 8.153   -16.261 1.00 0.00 ? 41  VAL A CG1  5  
ATOM 9216  C CG2  . VAL A 1 41  ? -37.421 8.761   -13.911 1.00 0.00 ? 41  VAL A CG2  5  
ATOM 9217  H H    . VAL A 1 41  ? -37.099 11.580  -14.231 1.00 0.00 ? 41  VAL A H    5  
ATOM 9218  H HA   . VAL A 1 41  ? -35.082 9.673   -14.970 1.00 0.00 ? 41  VAL A HA   5  
ATOM 9219  H HB   . VAL A 1 41  ? -38.044 9.920   -15.603 1.00 0.00 ? 41  VAL A HB   5  
ATOM 9220  H HG11 . VAL A 1 41  ? -36.111 7.611   -16.027 1.00 0.00 ? 41  VAL A HG11 5  
ATOM 9221  H HG12 . VAL A 1 41  ? -37.884 7.489   -16.165 1.00 0.00 ? 41  VAL A HG12 5  
ATOM 9222  H HG13 . VAL A 1 41  ? -36.975 8.503   -17.290 1.00 0.00 ? 41  VAL A HG13 5  
ATOM 9223  H HG21 . VAL A 1 41  ? -36.578 8.144   -13.600 1.00 0.00 ? 41  VAL A HG21 5  
ATOM 9224  H HG22 . VAL A 1 41  ? -37.564 9.563   -13.192 1.00 0.00 ? 41  VAL A HG22 5  
ATOM 9225  H HG23 . VAL A 1 41  ? -38.330 8.160   -13.926 1.00 0.00 ? 41  VAL A HG23 5  
ATOM 9226  N N    . ILE A 1 42  ? -34.314 10.928  -17.000 1.00 0.00 ? 42  ILE A N    5  
ATOM 9227  C CA   . ILE A 1 42  ? -33.739 11.372  -18.273 1.00 0.00 ? 42  ILE A CA   5  
ATOM 9228  C C    . ILE A 1 42  ? -33.868 10.320  -19.391 1.00 0.00 ? 42  ILE A C    5  
ATOM 9229  O O    . ILE A 1 42  ? -33.859 10.676  -20.571 1.00 0.00 ? 42  ILE A O    5  
ATOM 9230  C CB   . ILE A 1 42  ? -32.264 11.777  -18.046 1.00 0.00 ? 42  ILE A CB   5  
ATOM 9231  C CG1  . ILE A 1 42  ? -31.435 10.616  -17.449 1.00 0.00 ? 42  ILE A CG1  5  
ATOM 9232  C CG2  . ILE A 1 42  ? -32.200 13.003  -17.115 1.00 0.00 ? 42  ILE A CG2  5  
ATOM 9233  C CD1  . ILE A 1 42  ? -29.944 10.907  -17.323 1.00 0.00 ? 42  ILE A CD1  5  
ATOM 9234  H H    . ILE A 1 42  ? -33.670 10.682  -16.262 1.00 0.00 ? 42  ILE A H    5  
ATOM 9235  H HA   . ILE A 1 42  ? -34.285 12.255  -18.610 1.00 0.00 ? 42  ILE A HA   5  
ATOM 9236  H HB   . ILE A 1 42  ? -31.837 12.059  -19.010 1.00 0.00 ? 42  ILE A HB   5  
ATOM 9237  H HG12 . ILE A 1 42  ? -31.795 10.389  -16.448 1.00 0.00 ? 42  ILE A HG12 5  
ATOM 9238  H HG13 . ILE A 1 42  ? -31.544 9.731   -18.075 1.00 0.00 ? 42  ILE A HG13 5  
ATOM 9239  H HG21 . ILE A 1 42  ? -31.192 13.418  -17.107 1.00 0.00 ? 42  ILE A HG21 5  
ATOM 9240  H HG22 . ILE A 1 42  ? -32.883 13.777  -17.467 1.00 0.00 ? 42  ILE A HG22 5  
ATOM 9241  H HG23 . ILE A 1 42  ? -32.475 12.715  -16.099 1.00 0.00 ? 42  ILE A HG23 5  
ATOM 9242  H HD11 . ILE A 1 42  ? -29.556 11.238  -18.284 1.00 0.00 ? 42  ILE A HD11 5  
ATOM 9243  H HD12 . ILE A 1 42  ? -29.781 11.663  -16.556 1.00 0.00 ? 42  ILE A HD12 5  
ATOM 9244  H HD13 . ILE A 1 42  ? -29.440 9.991   -17.024 1.00 0.00 ? 42  ILE A HD13 5  
ATOM 9245  N N    . TYR A 1 43  ? -34.000 9.035   -19.034 1.00 0.00 ? 43  TYR A N    5  
ATOM 9246  C CA   . TYR A 1 43  ? -34.194 7.913   -19.978 1.00 0.00 ? 43  TYR A CA   5  
ATOM 9247  C C    . TYR A 1 43  ? -34.882 6.701   -19.333 1.00 0.00 ? 43  TYR A C    5  
ATOM 9248  O O    . TYR A 1 43  ? -34.942 6.598   -18.112 1.00 0.00 ? 43  TYR A O    5  
ATOM 9249  C CB   . TYR A 1 43  ? -32.893 7.516   -20.706 1.00 0.00 ? 43  TYR A CB   5  
ATOM 9250  C CG   . TYR A 1 43  ? -33.156 6.754   -21.994 1.00 0.00 ? 43  TYR A CG   5  
ATOM 9251  C CD1  . TYR A 1 43  ? -33.676 7.433   -23.114 1.00 0.00 ? 43  TYR A CD1  5  
ATOM 9252  C CD2  . TYR A 1 43  ? -32.948 5.361   -22.053 1.00 0.00 ? 43  TYR A CD2  5  
ATOM 9253  C CE1  . TYR A 1 43  ? -33.995 6.723   -24.287 1.00 0.00 ? 43  TYR A CE1  5  
ATOM 9254  C CE2  . TYR A 1 43  ? -33.269 4.649   -23.225 1.00 0.00 ? 43  TYR A CE2  5  
ATOM 9255  C CZ   . TYR A 1 43  ? -33.794 5.326   -24.346 1.00 0.00 ? 43  TYR A CZ   5  
ATOM 9256  O OH   . TYR A 1 43  ? -34.113 4.626   -25.469 1.00 0.00 ? 43  TYR A OH   5  
ATOM 9257  H H    . TYR A 1 43  ? -34.005 8.841   -18.029 1.00 0.00 ? 43  TYR A H    5  
ATOM 9258  H HA   . TYR A 1 43  ? -34.891 8.256   -20.740 1.00 0.00 ? 43  TYR A HA   5  
ATOM 9259  H HB2  . TYR A 1 43  ? -32.311 8.404   -20.944 1.00 0.00 ? 43  TYR A HB2  5  
ATOM 9260  H HB3  . TYR A 1 43  ? -32.272 6.910   -20.061 1.00 0.00 ? 43  TYR A HB3  5  
ATOM 9261  H HD1  . TYR A 1 43  ? -33.839 8.503   -23.068 1.00 0.00 ? 43  TYR A HD1  5  
ATOM 9262  H HD2  . TYR A 1 43  ? -32.558 4.829   -21.195 1.00 0.00 ? 43  TYR A HD2  5  
ATOM 9263  H HE1  . TYR A 1 43  ? -34.397 7.247   -25.145 1.00 0.00 ? 43  TYR A HE1  5  
ATOM 9264  H HE2  . TYR A 1 43  ? -33.124 3.578   -23.271 1.00 0.00 ? 43  TYR A HE2  5  
ATOM 9265  H HH   . TYR A 1 43  ? -34.456 5.199   -26.177 1.00 0.00 ? 43  TYR A HH   5  
ATOM 9266  N N    . CYS A 1 44  ? -35.476 5.805   -20.125 1.00 0.00 ? 44  CYS A N    5  
ATOM 9267  C CA   . CYS A 1 44  ? -36.344 4.731   -19.630 1.00 0.00 ? 44  CYS A CA   5  
ATOM 9268  C C    . CYS A 1 44  ? -36.096 3.421   -20.386 1.00 0.00 ? 44  CYS A C    5  
ATOM 9269  O O    . CYS A 1 44  ? -35.944 3.451   -21.612 1.00 0.00 ? 44  CYS A O    5  
ATOM 9270  C CB   . CYS A 1 44  ? -37.821 5.139   -19.802 1.00 0.00 ? 44  CYS A CB   5  
ATOM 9271  S SG   . CYS A 1 44  ? -38.101 6.886   -19.395 1.00 0.00 ? 44  CYS A SG   5  
ATOM 9272  H H    . CYS A 1 44  ? -35.378 5.901   -21.123 1.00 0.00 ? 44  CYS A H    5  
ATOM 9273  H HA   . CYS A 1 44  ? -36.144 4.567   -18.574 1.00 0.00 ? 44  CYS A HA   5  
ATOM 9274  H HB2  . CYS A 1 44  ? -38.124 4.981   -20.840 1.00 0.00 ? 44  CYS A HB2  5  
ATOM 9275  H HB3  . CYS A 1 44  ? -38.450 4.511   -19.168 1.00 0.00 ? 44  CYS A HB3  5  
ATOM 9276  H HG   . CYS A 1 44  ? -37.523 6.851   -18.184 1.00 0.00 ? 44  CYS A HG   5  
ATOM 9277  N N    . ASN A 1 45  ? -36.110 2.271   -19.698 1.00 0.00 ? 45  ASN A N    5  
ATOM 9278  C CA   . ASN A 1 45  ? -36.104 0.971   -20.377 1.00 0.00 ? 45  ASN A CA   5  
ATOM 9279  C C    . ASN A 1 45  ? -37.511 0.411   -20.601 1.00 0.00 ? 45  ASN A C    5  
ATOM 9280  O O    . ASN A 1 45  ? -38.438 0.676   -19.835 1.00 0.00 ? 45  ASN A O    5  
ATOM 9281  C CB   . ASN A 1 45  ? -35.166 -0.016  -19.671 1.00 0.00 ? 45  ASN A CB   5  
ATOM 9282  C CG   . ASN A 1 45  ? -34.769 -1.161  -20.585 1.00 0.00 ? 45  ASN A CG   5  
ATOM 9283  O OD1  . ASN A 1 45  ? -34.342 -0.979  -21.715 1.00 0.00 ? 45  ASN A OD1  5  
ATOM 9284  N ND2  . ASN A 1 45  ? -34.989 -2.383  -20.164 1.00 0.00 ? 45  ASN A ND2  5  
ATOM 9285  H H    . ASN A 1 45  ? -36.266 2.271   -18.688 1.00 0.00 ? 45  ASN A H    5  
ATOM 9286  H HA   . ASN A 1 45  ? -35.680 1.124   -21.372 1.00 0.00 ? 45  ASN A HA   5  
ATOM 9287  H HB2  . ASN A 1 45  ? -34.254 0.504   -19.400 1.00 0.00 ? 45  ASN A HB2  5  
ATOM 9288  H HB3  . ASN A 1 45  ? -35.634 -0.400  -18.766 1.00 0.00 ? 45  ASN A HB3  5  
ATOM 9289  H HD21 . ASN A 1 45  ? -35.250 -2.553  -19.207 1.00 0.00 ? 45  ASN A HD21 5  
ATOM 9290  H HD22 . ASN A 1 45  ? -34.775 -3.140  -20.793 1.00 0.00 ? 45  ASN A HD22 5  
ATOM 9291  N N    . ASP A 1 46  ? -37.661 -0.422  -21.631 1.00 0.00 ? 46  ASP A N    5  
ATOM 9292  C CA   . ASP A 1 46  ? -38.942 -1.072  -21.948 1.00 0.00 ? 46  ASP A CA   5  
ATOM 9293  C C    . ASP A 1 46  ? -39.372 -2.049  -20.837 1.00 0.00 ? 46  ASP A C    5  
ATOM 9294  O O    . ASP A 1 46  ? -40.564 -2.256  -20.620 1.00 0.00 ? 46  ASP A O    5  
ATOM 9295  C CB   . ASP A 1 46  ? -38.864 -1.761  -23.316 1.00 0.00 ? 46  ASP A CB   5  
ATOM 9296  C CG   . ASP A 1 46  ? -38.614 -0.776  -24.474 1.00 0.00 ? 46  ASP A CG   5  
ATOM 9297  O OD1  . ASP A 1 46  ? -39.148 0.361   -24.449 1.00 0.00 ? 46  ASP A OD1  5  
ATOM 9298  O OD2  . ASP A 1 46  ? -37.870 -1.135  -25.417 1.00 0.00 ? 46  ASP A OD2  5  
ATOM 9299  H H    . ASP A 1 46  ? -36.846 -0.650  -22.185 1.00 0.00 ? 46  ASP A H    5  
ATOM 9300  H HA   . ASP A 1 46  ? -39.715 -0.304  -22.004 1.00 0.00 ? 46  ASP A HA   5  
ATOM 9301  H HB2  . ASP A 1 46  ? -38.072 -2.513  -23.288 1.00 0.00 ? 46  ASP A HB2  5  
ATOM 9302  H HB3  . ASP A 1 46  ? -39.809 -2.275  -23.501 1.00 0.00 ? 46  ASP A HB3  5  
ATOM 9303  N N    . GLY A 1 47  ? -38.418 -2.560  -20.047 1.00 0.00 ? 47  GLY A N    5  
ATOM 9304  C CA   . GLY A 1 47  ? -38.697 -3.314  -18.825 1.00 0.00 ? 47  GLY A CA   5  
ATOM 9305  C C    . GLY A 1 47  ? -39.648 -2.568  -17.878 1.00 0.00 ? 47  GLY A C    5  
ATOM 9306  O O    . GLY A 1 47  ? -40.659 -3.136  -17.475 1.00 0.00 ? 47  GLY A O    5  
ATOM 9307  H H    . GLY A 1 47  ? -37.455 -2.399  -20.306 1.00 0.00 ? 47  GLY A H    5  
ATOM 9308  H HA2  . GLY A 1 47  ? -39.144 -4.273  -19.087 1.00 0.00 ? 47  GLY A HA2  5  
ATOM 9309  H HA3  . GLY A 1 47  ? -37.759 -3.499  -18.306 1.00 0.00 ? 47  GLY A HA3  5  
ATOM 9310  N N    . PHE A 1 48  ? -39.393 -1.289  -17.559 1.00 0.00 ? 48  PHE A N    5  
ATOM 9311  C CA   . PHE A 1 48  ? -40.308 -0.472  -16.736 1.00 0.00 ? 48  PHE A CA   5  
ATOM 9312  C C    . PHE A 1 48  ? -41.704 -0.366  -17.401 1.00 0.00 ? 48  PHE A C    5  
ATOM 9313  O O    . PHE A 1 48  ? -42.741 -0.407  -16.729 1.00 0.00 ? 48  PHE A O    5  
ATOM 9314  C CB   . PHE A 1 48  ? -39.717 0.942   -16.478 1.00 0.00 ? 48  PHE A CB   5  
ATOM 9315  C CG   . PHE A 1 48  ? -40.685 2.081   -16.781 1.00 0.00 ? 48  PHE A CG   5  
ATOM 9316  C CD1  . PHE A 1 48  ? -40.725 2.644   -18.073 1.00 0.00 ? 48  PHE A CD1  5  
ATOM 9317  C CD2  . PHE A 1 48  ? -41.682 2.427   -15.846 1.00 0.00 ? 48  PHE A CD2  5  
ATOM 9318  C CE1  . PHE A 1 48  ? -41.801 3.463   -18.455 1.00 0.00 ? 48  PHE A CE1  5  
ATOM 9319  C CE2  . PHE A 1 48  ? -42.751 3.259   -16.226 1.00 0.00 ? 48  PHE A CE2  5  
ATOM 9320  C CZ   . PHE A 1 48  ? -42.822 3.757   -17.537 1.00 0.00 ? 48  PHE A CZ   5  
ATOM 9321  H H    . PHE A 1 48  ? -38.566 -0.848  -17.933 1.00 0.00 ? 48  PHE A H    5  
ATOM 9322  H HA   . PHE A 1 48  ? -40.424 -0.970  -15.771 1.00 0.00 ? 48  PHE A HA   5  
ATOM 9323  H HB2  . PHE A 1 48  ? -39.407 1.006   -15.434 1.00 0.00 ? 48  PHE A HB2  5  
ATOM 9324  H HB3  . PHE A 1 48  ? -38.824 1.085   -17.087 1.00 0.00 ? 48  PHE A HB3  5  
ATOM 9325  H HD1  . PHE A 1 48  ? -39.968 2.393   -18.799 1.00 0.00 ? 48  PHE A HD1  5  
ATOM 9326  H HD2  . PHE A 1 48  ? -41.668 2.007   -14.851 1.00 0.00 ? 48  PHE A HD2  5  
ATOM 9327  H HE1  . PHE A 1 48  ? -41.849 3.851   -19.461 1.00 0.00 ? 48  PHE A HE1  5  
ATOM 9328  H HE2  . PHE A 1 48  ? -43.529 3.498   -15.513 1.00 0.00 ? 48  PHE A HE2  5  
ATOM 9329  H HZ   . PHE A 1 48  ? -43.653 4.383   -17.836 1.00 0.00 ? 48  PHE A HZ   5  
ATOM 9330  N N    . CYS A 1 49  ? -41.734 -0.221  -18.730 1.00 0.00 ? 49  CYS A N    5  
ATOM 9331  C CA   . CYS A 1 49  ? -42.975 -0.114  -19.494 1.00 0.00 ? 49  CYS A CA   5  
ATOM 9332  C C    . CYS A 1 49  ? -43.840 -1.374  -19.309 1.00 0.00 ? 49  CYS A C    5  
ATOM 9333  O O    . CYS A 1 49  ? -45.048 -1.281  -19.088 1.00 0.00 ? 49  CYS A O    5  
ATOM 9334  C CB   . CYS A 1 49  ? -42.639 0.183   -20.962 1.00 0.00 ? 49  CYS A CB   5  
ATOM 9335  S SG   . CYS A 1 49  ? -44.134 0.692   -21.851 1.00 0.00 ? 49  CYS A SG   5  
ATOM 9336  H H    . CYS A 1 49  ? -40.856 -0.280  -19.229 1.00 0.00 ? 49  CYS A H    5  
ATOM 9337  H HA   . CYS A 1 49  ? -43.541 0.733   -19.097 1.00 0.00 ? 49  CYS A HA   5  
ATOM 9338  H HB2  . CYS A 1 49  ? -41.903 0.987   -21.013 1.00 0.00 ? 49  CYS A HB2  5  
ATOM 9339  H HB3  . CYS A 1 49  ? -42.228 -0.707  -21.439 1.00 0.00 ? 49  CYS A HB3  5  
ATOM 9340  H HG   . CYS A 1 49  ? -43.564 0.823   -23.062 1.00 0.00 ? 49  CYS A HG   5  
ATOM 9341  N N    . GLU A 1 50  ? -43.216 -2.555  -19.302 1.00 0.00 ? 50  GLU A N    5  
ATOM 9342  C CA   . GLU A 1 50  ? -43.892 -3.842  -19.086 1.00 0.00 ? 50  GLU A CA   5  
ATOM 9343  C C    . GLU A 1 50  ? -44.195 -4.104  -17.605 1.00 0.00 ? 50  GLU A C    5  
ATOM 9344  O O    . GLU A 1 50  ? -45.186 -4.758  -17.277 1.00 0.00 ? 50  GLU A O    5  
ATOM 9345  C CB   . GLU A 1 50  ? -43.043 -4.982  -19.664 1.00 0.00 ? 50  GLU A CB   5  
ATOM 9346  C CG   . GLU A 1 50  ? -42.814 -4.811  -21.175 1.00 0.00 ? 50  GLU A CG   5  
ATOM 9347  C CD   . GLU A 1 50  ? -41.998 -5.974  -21.773 1.00 0.00 ? 50  GLU A CD   5  
ATOM 9348  O OE1  . GLU A 1 50  ? -42.484 -7.132  -21.762 1.00 0.00 ? 50  GLU A OE1  5  
ATOM 9349  O OE2  . GLU A 1 50  ? -40.878 -5.735  -22.288 1.00 0.00 ? 50  GLU A OE2  5  
ATOM 9350  H H    . GLU A 1 50  ? -42.206 -2.563  -19.441 1.00 0.00 ? 50  GLU A H    5  
ATOM 9351  H HA   . GLU A 1 50  ? -44.848 -3.835  -19.612 1.00 0.00 ? 50  GLU A HA   5  
ATOM 9352  H HB2  . GLU A 1 50  ? -42.090 -5.016  -19.133 1.00 0.00 ? 50  GLU A HB2  5  
ATOM 9353  H HB3  . GLU A 1 50  ? -43.564 -5.924  -19.490 1.00 0.00 ? 50  GLU A HB3  5  
ATOM 9354  H HG2  . GLU A 1 50  ? -43.785 -4.759  -21.674 1.00 0.00 ? 50  GLU A HG2  5  
ATOM 9355  H HG3  . GLU A 1 50  ? -42.304 -3.864  -21.362 1.00 0.00 ? 50  GLU A HG3  5  
ATOM 9356  N N    . LEU A 1 51  ? -43.383 -3.556  -16.698 1.00 0.00 ? 51  LEU A N    5  
ATOM 9357  C CA   . LEU A 1 51  ? -43.583 -3.622  -15.252 1.00 0.00 ? 51  LEU A CA   5  
ATOM 9358  C C    . LEU A 1 51  ? -44.887 -2.935  -14.836 1.00 0.00 ? 51  LEU A C    5  
ATOM 9359  O O    . LEU A 1 51  ? -45.746 -3.556  -14.211 1.00 0.00 ? 51  LEU A O    5  
ATOM 9360  C CB   . LEU A 1 51  ? -42.385 -2.931  -14.582 1.00 0.00 ? 51  LEU A CB   5  
ATOM 9361  C CG   . LEU A 1 51  ? -42.446 -2.796  -13.052 1.00 0.00 ? 51  LEU A CG   5  
ATOM 9362  C CD1  . LEU A 1 51  ? -42.357 -4.136  -12.334 1.00 0.00 ? 51  LEU A CD1  5  
ATOM 9363  C CD2  . LEU A 1 51  ? -41.330 -1.872  -12.581 1.00 0.00 ? 51  LEU A CD2  5  
ATOM 9364  H H    . LEU A 1 51  ? -42.551 -3.086  -17.039 1.00 0.00 ? 51  LEU A H    5  
ATOM 9365  H HA   . LEU A 1 51  ? -43.616 -4.672  -14.962 1.00 0.00 ? 51  LEU A HA   5  
ATOM 9366  H HB2  . LEU A 1 51  ? -41.487 -3.440  -14.902 1.00 0.00 ? 51  LEU A HB2  5  
ATOM 9367  H HB3  . LEU A 1 51  ? -42.319 -1.922  -14.964 1.00 0.00 ? 51  LEU A HB3  5  
ATOM 9368  H HG   . LEU A 1 51  ? -43.391 -2.333  -12.772 1.00 0.00 ? 51  LEU A HG   5  
ATOM 9369  H HD11 . LEU A 1 51  ? -41.398 -4.605  -12.531 1.00 0.00 ? 51  LEU A HD11 5  
ATOM 9370  H HD12 . LEU A 1 51  ? -42.457 -3.962  -11.264 1.00 0.00 ? 51  LEU A HD12 5  
ATOM 9371  H HD13 . LEU A 1 51  ? -43.164 -4.792  -12.655 1.00 0.00 ? 51  LEU A HD13 5  
ATOM 9372  H HD21 . LEU A 1 51  ? -41.476 -0.880  -13.008 1.00 0.00 ? 51  LEU A HD21 5  
ATOM 9373  H HD22 . LEU A 1 51  ? -41.360 -1.792  -11.496 1.00 0.00 ? 51  LEU A HD22 5  
ATOM 9374  H HD23 . LEU A 1 51  ? -40.366 -2.265  -12.896 1.00 0.00 ? 51  LEU A HD23 5  
ATOM 9375  N N    . CYS A 1 52  ? -45.037 -1.663  -15.210 1.00 0.00 ? 52  CYS A N    5  
ATOM 9376  C CA   . CYS A 1 52  ? -46.147 -0.820  -14.764 1.00 0.00 ? 52  CYS A CA   5  
ATOM 9377  C C    . CYS A 1 52  ? -47.293 -0.752  -15.788 1.00 0.00 ? 52  CYS A C    5  
ATOM 9378  O O    . CYS A 1 52  ? -48.429 -0.437  -15.430 1.00 0.00 ? 52  CYS A O    5  
ATOM 9379  C CB   . CYS A 1 52  ? -45.591 0.569   -14.427 1.00 0.00 ? 52  CYS A CB   5  
ATOM 9380  S SG   . CYS A 1 52  ? -44.323 0.457   -13.129 1.00 0.00 ? 52  CYS A SG   5  
ATOM 9381  H H    . CYS A 1 52  ? -44.268 -1.221  -15.705 1.00 0.00 ? 52  CYS A H    5  
ATOM 9382  H HA   . CYS A 1 52  ? -46.572 -1.233  -13.847 1.00 0.00 ? 52  CYS A HA   5  
ATOM 9383  H HB2  . CYS A 1 52  ? -45.162 1.027   -15.320 1.00 0.00 ? 52  CYS A HB2  5  
ATOM 9384  H HB3  . CYS A 1 52  ? -46.408 1.189   -14.060 1.00 0.00 ? 52  CYS A HB3  5  
ATOM 9385  H HG   . CYS A 1 52  ? -44.075 1.773   -13.031 1.00 0.00 ? 52  CYS A HG   5  
ATOM 9386  N N    . GLY A 1 53  ? -47.022 -1.072  -17.057 1.00 0.00 ? 53  GLY A N    5  
ATOM 9387  C CA   . GLY A 1 53  ? -48.019 -1.058  -18.134 1.00 0.00 ? 53  GLY A CA   5  
ATOM 9388  C C    . GLY A 1 53  ? -48.363 0.330   -18.698 1.00 0.00 ? 53  GLY A C    5  
ATOM 9389  O O    . GLY A 1 53  ? -49.364 0.449   -19.408 1.00 0.00 ? 53  GLY A O    5  
ATOM 9390  H H    . GLY A 1 53  ? -46.066 -1.331  -17.303 1.00 0.00 ? 53  GLY A H    5  
ATOM 9391  H HA2  . GLY A 1 53  ? -47.645 -1.665  -18.959 1.00 0.00 ? 53  GLY A HA2  5  
ATOM 9392  H HA3  . GLY A 1 53  ? -48.941 -1.518  -17.775 1.00 0.00 ? 53  GLY A HA3  5  
ATOM 9393  N N    . TYR A 1 54  ? -47.580 1.376   -18.386 1.00 0.00 ? 54  TYR A N    5  
ATOM 9394  C CA   . TYR A 1 54  ? -47.789 2.742   -18.887 1.00 0.00 ? 54  TYR A CA   5  
ATOM 9395  C C    . TYR A 1 54  ? -47.051 2.962   -20.228 1.00 0.00 ? 54  TYR A C    5  
ATOM 9396  O O    . TYR A 1 54  ? -47.284 2.231   -21.194 1.00 0.00 ? 54  TYR A O    5  
ATOM 9397  C CB   . TYR A 1 54  ? -47.453 3.761   -17.775 1.00 0.00 ? 54  TYR A CB   5  
ATOM 9398  C CG   . TYR A 1 54  ? -48.287 3.614   -16.511 1.00 0.00 ? 54  TYR A CG   5  
ATOM 9399  C CD1  . TYR A 1 54  ? -49.679 3.825   -16.556 1.00 0.00 ? 54  TYR A CD1  5  
ATOM 9400  C CD2  . TYR A 1 54  ? -47.671 3.273   -15.290 1.00 0.00 ? 54  TYR A CD2  5  
ATOM 9401  C CE1  . TYR A 1 54  ? -50.459 3.651   -15.396 1.00 0.00 ? 54  TYR A CE1  5  
ATOM 9402  C CE2  . TYR A 1 54  ? -48.450 3.082   -14.131 1.00 0.00 ? 54  TYR A CE2  5  
ATOM 9403  C CZ   . TYR A 1 54  ? -49.850 3.254   -14.186 1.00 0.00 ? 54  TYR A CZ   5  
ATOM 9404  O OH   . TYR A 1 54  ? -50.616 3.046   -13.081 1.00 0.00 ? 54  TYR A OH   5  
ATOM 9405  H H    . TYR A 1 54  ? -46.765 1.217   -17.813 1.00 0.00 ? 54  TYR A H    5  
ATOM 9406  H HA   . TYR A 1 54  ? -48.848 2.874   -19.111 1.00 0.00 ? 54  TYR A HA   5  
ATOM 9407  H HB2  . TYR A 1 54  ? -46.395 3.674   -17.520 1.00 0.00 ? 54  TYR A HB2  5  
ATOM 9408  H HB3  . TYR A 1 54  ? -47.622 4.767   -18.156 1.00 0.00 ? 54  TYR A HB3  5  
ATOM 9409  H HD1  . TYR A 1 54  ? -50.155 4.113   -17.485 1.00 0.00 ? 54  TYR A HD1  5  
ATOM 9410  H HD2  . TYR A 1 54  ? -46.597 3.153   -15.244 1.00 0.00 ? 54  TYR A HD2  5  
ATOM 9411  H HE1  . TYR A 1 54  ? -51.528 3.802   -15.428 1.00 0.00 ? 54  TYR A HE1  5  
ATOM 9412  H HE2  . TYR A 1 54  ? -47.982 2.801   -13.198 1.00 0.00 ? 54  TYR A HE2  5  
ATOM 9413  H HH   . TYR A 1 54  ? -50.092 2.746   -12.321 1.00 0.00 ? 54  TYR A HH   5  
ATOM 9414  N N    . SER A 1 55  ? -46.183 3.974   -20.314 1.00 0.00 ? 55  SER A N    5  
ATOM 9415  C CA   . SER A 1 55  ? -45.379 4.333   -21.490 1.00 0.00 ? 55  SER A CA   5  
ATOM 9416  C C    . SER A 1 55  ? -44.189 5.191   -21.058 1.00 0.00 ? 55  SER A C    5  
ATOM 9417  O O    . SER A 1 55  ? -44.284 5.935   -20.082 1.00 0.00 ? 55  SER A O    5  
ATOM 9418  C CB   . SER A 1 55  ? -46.224 5.095   -22.519 1.00 0.00 ? 55  SER A CB   5  
ATOM 9419  O OG   . SER A 1 55  ? -45.419 5.527   -23.606 1.00 0.00 ? 55  SER A OG   5  
ATOM 9420  H H    . SER A 1 55  ? -46.039 4.543   -19.492 1.00 0.00 ? 55  SER A H    5  
ATOM 9421  H HA   . SER A 1 55  ? -45.000 3.427   -21.962 1.00 0.00 ? 55  SER A HA   5  
ATOM 9422  H HB2  . SER A 1 55  ? -47.013 4.439   -22.891 1.00 0.00 ? 55  SER A HB2  5  
ATOM 9423  H HB3  . SER A 1 55  ? -46.684 5.962   -22.046 1.00 0.00 ? 55  SER A HB3  5  
ATOM 9424  H HG   . SER A 1 55  ? -46.009 5.855   -24.313 1.00 0.00 ? 55  SER A HG   5  
ATOM 9425  N N    . ARG A 1 56  ? -43.063 5.124   -21.777 1.00 0.00 ? 56  ARG A N    5  
ATOM 9426  C CA   . ARG A 1 56  ? -41.913 6.031   -21.571 1.00 0.00 ? 56  ARG A CA   5  
ATOM 9427  C C    . ARG A 1 56  ? -42.322 7.510   -21.595 1.00 0.00 ? 56  ARG A C    5  
ATOM 9428  O O    . ARG A 1 56  ? -41.884 8.281   -20.744 1.00 0.00 ? 56  ARG A O    5  
ATOM 9429  C CB   . ARG A 1 56  ? -40.770 5.699   -22.550 1.00 0.00 ? 56  ARG A CB   5  
ATOM 9430  C CG   . ARG A 1 56  ? -41.158 5.667   -24.043 1.00 0.00 ? 56  ARG A CG   5  
ATOM 9431  C CD   . ARG A 1 56  ? -39.960 5.388   -24.965 1.00 0.00 ? 56  ARG A CD   5  
ATOM 9432  N NE   . ARG A 1 56  ? -39.319 4.085   -24.677 1.00 0.00 ? 56  ARG A NE   5  
ATOM 9433  C CZ   . ARG A 1 56  ? -38.191 3.881   -24.018 1.00 0.00 ? 56  ARG A CZ   5  
ATOM 9434  N NH1  . ARG A 1 56  ? -37.427 4.847   -23.598 1.00 0.00 ? 56  ARG A NH1  5  
ATOM 9435  N NH2  . ARG A 1 56  ? -37.794 2.680   -23.733 1.00 0.00 ? 56  ARG A NH2  5  
ATOM 9436  H H    . ARG A 1 56  ? -43.076 4.514   -22.582 1.00 0.00 ? 56  ARG A H    5  
ATOM 9437  H HA   . ARG A 1 56  ? -41.519 5.861   -20.570 1.00 0.00 ? 56  ARG A HA   5  
ATOM 9438  H HB2  . ARG A 1 56  ? -39.970 6.427   -22.407 1.00 0.00 ? 56  ARG A HB2  5  
ATOM 9439  H HB3  . ARG A 1 56  ? -40.378 4.720   -22.272 1.00 0.00 ? 56  ARG A HB3  5  
ATOM 9440  H HG2  . ARG A 1 56  ? -41.910 4.894   -24.211 1.00 0.00 ? 56  ARG A HG2  5  
ATOM 9441  H HG3  . ARG A 1 56  ? -41.586 6.629   -24.326 1.00 0.00 ? 56  ARG A HG3  5  
ATOM 9442  H HD2  . ARG A 1 56  ? -40.316 5.381   -25.996 1.00 0.00 ? 56  ARG A HD2  5  
ATOM 9443  H HD3  . ARG A 1 56  ? -39.244 6.207   -24.876 1.00 0.00 ? 56  ARG A HD3  5  
ATOM 9444  H HE   . ARG A 1 56  ? -39.808 3.254   -24.975 1.00 0.00 ? 56  ARG A HE   5  
ATOM 9445  H HH11 . ARG A 1 56  ? -37.647 5.798   -23.830 1.00 0.00 ? 56  ARG A HH11 5  
ATOM 9446  H HH12 . ARG A 1 56  ? -36.598 4.609   -23.071 1.00 0.00 ? 56  ARG A HH12 5  
ATOM 9447  H HH21 . ARG A 1 56  ? -38.339 1.869   -24.033 1.00 0.00 ? 56  ARG A HH21 5  
ATOM 9448  H HH22 . ARG A 1 56  ? -36.957 2.569   -23.184 1.00 0.00 ? 56  ARG A HH22 5  
ATOM 9449  N N    . ALA A 1 57  ? -43.265 7.889   -22.458 1.00 0.00 ? 57  ALA A N    5  
ATOM 9450  C CA   . ALA A 1 57  ? -43.813 9.247   -22.536 1.00 0.00 ? 57  ALA A CA   5  
ATOM 9451  C C    . ALA A 1 57  ? -44.530 9.705   -21.242 1.00 0.00 ? 57  ALA A C    5  
ATOM 9452  O O    . ALA A 1 57  ? -44.674 10.904  -21.004 1.00 0.00 ? 57  ALA A O    5  
ATOM 9453  C CB   . ALA A 1 57  ? -44.757 9.301   -23.743 1.00 0.00 ? 57  ALA A CB   5  
ATOM 9454  H H    . ALA A 1 57  ? -43.655 7.182   -23.064 1.00 0.00 ? 57  ALA A H    5  
ATOM 9455  H HA   . ALA A 1 57  ? -42.990 9.942   -22.715 1.00 0.00 ? 57  ALA A HA   5  
ATOM 9456  H HB1  . ALA A 1 57  ? -44.220 9.017   -24.649 1.00 0.00 ? 57  ALA A HB1  5  
ATOM 9457  H HB2  . ALA A 1 57  ? -45.598 8.623   -23.593 1.00 0.00 ? 57  ALA A HB2  5  
ATOM 9458  H HB3  . ALA A 1 57  ? -45.138 10.317  -23.866 1.00 0.00 ? 57  ALA A HB3  5  
ATOM 9459  N N    . GLU A 1 58  ? -44.945 8.764   -20.388 1.00 0.00 ? 58  GLU A N    5  
ATOM 9460  C CA   . GLU A 1 58  ? -45.575 9.010   -19.087 1.00 0.00 ? 58  GLU A CA   5  
ATOM 9461  C C    . GLU A 1 58  ? -44.545 9.201   -17.959 1.00 0.00 ? 58  GLU A C    5  
ATOM 9462  O O    . GLU A 1 58  ? -44.901 9.762   -16.922 1.00 0.00 ? 58  GLU A O    5  
ATOM 9463  C CB   . GLU A 1 58  ? -46.544 7.862   -18.743 1.00 0.00 ? 58  GLU A CB   5  
ATOM 9464  C CG   . GLU A 1 58  ? -47.636 7.610   -19.796 1.00 0.00 ? 58  GLU A CG   5  
ATOM 9465  C CD   . GLU A 1 58  ? -48.820 8.585   -19.636 1.00 0.00 ? 58  GLU A CD   5  
ATOM 9466  O OE1  . GLU A 1 58  ? -48.755 9.720   -20.165 1.00 0.00 ? 58  GLU A OE1  5  
ATOM 9467  O OE2  . GLU A 1 58  ? -49.829 8.218   -18.987 1.00 0.00 ? 58  GLU A OE2  5  
ATOM 9468  H H    . GLU A 1 58  ? -44.789 7.793   -20.629 1.00 0.00 ? 58  GLU A H    5  
ATOM 9469  H HA   . GLU A 1 58  ? -46.156 9.931   -19.142 1.00 0.00 ? 58  GLU A HA   5  
ATOM 9470  H HB2  . GLU A 1 58  ? -45.975 6.946   -18.604 1.00 0.00 ? 58  GLU A HB2  5  
ATOM 9471  H HB3  . GLU A 1 58  ? -47.023 8.079   -17.790 1.00 0.00 ? 58  GLU A HB3  5  
ATOM 9472  H HG2  . GLU A 1 58  ? -47.227 7.693   -20.803 1.00 0.00 ? 58  GLU A HG2  5  
ATOM 9473  H HG3  . GLU A 1 58  ? -47.977 6.577   -19.695 1.00 0.00 ? 58  GLU A HG3  5  
ATOM 9474  N N    . VAL A 1 59  ? -43.297 8.727   -18.128 1.00 0.00 ? 59  VAL A N    5  
ATOM 9475  C CA   . VAL A 1 59  ? -42.179 8.894   -17.164 1.00 0.00 ? 59  VAL A CA   5  
ATOM 9476  C C    . VAL A 1 59  ? -41.121 9.927   -17.591 1.00 0.00 ? 59  VAL A C    5  
ATOM 9477  O O    . VAL A 1 59  ? -40.387 10.451  -16.743 1.00 0.00 ? 59  VAL A O    5  
ATOM 9478  C CB   . VAL A 1 59  ? -41.539 7.542   -16.783 1.00 0.00 ? 59  VAL A CB   5  
ATOM 9479  C CG1  . VAL A 1 59  ? -42.504 6.730   -15.917 1.00 0.00 ? 59  VAL A CG1  5  
ATOM 9480  C CG2  . VAL A 1 59  ? -41.164 6.711   -18.002 1.00 0.00 ? 59  VAL A CG2  5  
ATOM 9481  H H    . VAL A 1 59  ? -43.070 8.291   -19.021 1.00 0.00 ? 59  VAL A H    5  
ATOM 9482  H HA   . VAL A 1 59  ? -42.587 9.290   -16.238 1.00 0.00 ? 59  VAL A HA   5  
ATOM 9483  H HB   . VAL A 1 59  ? -40.638 7.736   -16.203 1.00 0.00 ? 59  VAL A HB   5  
ATOM 9484  H HG11 . VAL A 1 59  ? -42.002 5.831   -15.561 1.00 0.00 ? 59  VAL A HG11 5  
ATOM 9485  H HG12 . VAL A 1 59  ? -42.813 7.325   -15.061 1.00 0.00 ? 59  VAL A HG12 5  
ATOM 9486  H HG13 . VAL A 1 59  ? -43.390 6.450   -16.488 1.00 0.00 ? 59  VAL A HG13 5  
ATOM 9487  H HG21 . VAL A 1 59  ? -42.065 6.331   -18.480 1.00 0.00 ? 59  VAL A HG21 5  
ATOM 9488  H HG22 . VAL A 1 59  ? -40.627 7.335   -18.706 1.00 0.00 ? 59  VAL A HG22 5  
ATOM 9489  H HG23 . VAL A 1 59  ? -40.534 5.876   -17.695 1.00 0.00 ? 59  VAL A HG23 5  
ATOM 9490  N N    . MET A 1 60  ? -41.096 10.293  -18.878 1.00 0.00 ? 60  MET A N    5  
ATOM 9491  C CA   . MET A 1 60  ? -40.121 11.186  -19.492 1.00 0.00 ? 60  MET A CA   5  
ATOM 9492  C C    . MET A 1 60  ? -39.966 12.471  -18.687 1.00 0.00 ? 60  MET A C    5  
ATOM 9493  O O    . MET A 1 60  ? -40.863 13.314  -18.623 1.00 0.00 ? 60  MET A O    5  
ATOM 9494  C CB   . MET A 1 60  ? -40.569 11.541  -20.930 1.00 0.00 ? 60  MET A CB   5  
ATOM 9495  C CG   . MET A 1 60  ? -39.861 10.735  -22.020 1.00 0.00 ? 60  MET A CG   5  
ATOM 9496  S SD   . MET A 1 60  ? -38.100 11.124  -22.222 1.00 0.00 ? 60  MET A SD   5  
ATOM 9497  C CE   . MET A 1 60  ? -37.359 9.659   -21.457 1.00 0.00 ? 60  MET A CE   5  
ATOM 9498  H H    . MET A 1 60  ? -41.650 9.757   -19.529 1.00 0.00 ? 60  MET A H    5  
ATOM 9499  H HA   . MET A 1 60  ? -39.158 10.684  -19.523 1.00 0.00 ? 60  MET A HA   5  
ATOM 9500  H HB2  . MET A 1 60  ? -41.647 11.400  -21.026 1.00 0.00 ? 60  MET A HB2  5  
ATOM 9501  H HB3  . MET A 1 60  ? -40.364 12.592  -21.133 1.00 0.00 ? 60  MET A HB3  5  
ATOM 9502  H HG2  . MET A 1 60  ? -39.977 9.673   -21.822 1.00 0.00 ? 60  MET A HG2  5  
ATOM 9503  H HG3  . MET A 1 60  ? -40.358 10.951  -22.967 1.00 0.00 ? 60  MET A HG3  5  
ATOM 9504  H HE1  . MET A 1 60  ? -37.702 8.762   -21.972 1.00 0.00 ? 60  MET A HE1  5  
ATOM 9505  H HE2  . MET A 1 60  ? -36.276 9.730   -21.530 1.00 0.00 ? 60  MET A HE2  5  
ATOM 9506  H HE3  . MET A 1 60  ? -37.647 9.595   -20.408 1.00 0.00 ? 60  MET A HE3  5  
ATOM 9507  N N    . GLN A 1 61  ? -38.771 12.609  -18.113 1.00 0.00 ? 61  GLN A N    5  
ATOM 9508  C CA   . GLN A 1 61  ? -38.272 13.814  -17.465 1.00 0.00 ? 61  GLN A CA   5  
ATOM 9509  C C    . GLN A 1 61  ? -39.047 14.152  -16.182 1.00 0.00 ? 61  GLN A C    5  
ATOM 9510  O O    . GLN A 1 61  ? -39.141 15.321  -15.793 1.00 0.00 ? 61  GLN A O    5  
ATOM 9511  C CB   . GLN A 1 61  ? -38.182 14.956  -18.493 1.00 0.00 ? 61  GLN A CB   5  
ATOM 9512  C CG   . GLN A 1 61  ? -37.440 14.560  -19.795 1.00 0.00 ? 61  GLN A CG   5  
ATOM 9513  C CD   . GLN A 1 61  ? -37.994 15.264  -21.033 1.00 0.00 ? 61  GLN A CD   5  
ATOM 9514  O OE1  . GLN A 1 61  ? -38.198 16.471  -21.074 1.00 0.00 ? 61  GLN A OE1  5  
ATOM 9515  N NE2  . GLN A 1 61  ? -38.273 14.524  -22.091 1.00 0.00 ? 61  GLN A NE2  5  
ATOM 9516  H H    . GLN A 1 61  ? -38.140 11.815  -18.133 1.00 0.00 ? 61  GLN A H    5  
ATOM 9517  H HA   . GLN A 1 61  ? -37.252 13.597  -17.144 1.00 0.00 ? 61  GLN A HA   5  
ATOM 9518  H HB2  . GLN A 1 61  ? -39.200 15.268  -18.732 1.00 0.00 ? 61  GLN A HB2  5  
ATOM 9519  H HB3  . GLN A 1 61  ? -37.670 15.800  -18.028 1.00 0.00 ? 61  GLN A HB3  5  
ATOM 9520  H HG2  . GLN A 1 61  ? -36.378 14.788  -19.693 1.00 0.00 ? 61  GLN A HG2  5  
ATOM 9521  H HG3  . GLN A 1 61  ? -37.522 13.486  -19.980 1.00 0.00 ? 61  GLN A HG3  5  
ATOM 9522  H HE21 . GLN A 1 61  ? -38.093 13.531  -22.079 1.00 0.00 ? 61  GLN A HE21 5  
ATOM 9523  H HE22 . GLN A 1 61  ? -38.686 14.960  -22.900 1.00 0.00 ? 61  GLN A HE22 5  
ATOM 9524  N N    . ARG A 1 62  ? -39.576 13.125  -15.496 1.00 0.00 ? 62  ARG A N    5  
ATOM 9525  C CA   . ARG A 1 62  ? -40.270 13.258  -14.206 1.00 0.00 ? 62  ARG A CA   5  
ATOM 9526  C C    . ARG A 1 62  ? -39.436 12.738  -13.033 1.00 0.00 ? 62  ARG A C    5  
ATOM 9527  O O    . ARG A 1 62  ? -38.626 11.845  -13.270 1.00 0.00 ? 62  ARG A O    5  
ATOM 9528  C CB   . ARG A 1 62  ? -41.548 12.447  -14.294 1.00 0.00 ? 62  ARG A CB   5  
ATOM 9529  C CG   . ARG A 1 62  ? -42.483 12.981  -15.389 1.00 0.00 ? 62  ARG A CG   5  
ATOM 9530  C CD   . ARG A 1 62  ? -43.737 12.129  -15.402 1.00 0.00 ? 62  ARG A CD   5  
ATOM 9531  N NE   . ARG A 1 62  ? -44.414 12.245  -14.106 1.00 0.00 ? 62  ARG A NE   5  
ATOM 9532  C CZ   . ARG A 1 62  ? -45.518 11.620  -13.738 1.00 0.00 ? 62  ARG A CZ   5  
ATOM 9533  N NH1  . ARG A 1 62  ? -46.110 10.758  -14.516 1.00 0.00 ? 62  ARG A NH1  5  
ATOM 9534  N NH2  . ARG A 1 62  ? -46.051 11.849  -12.572 1.00 0.00 ? 62  ARG A NH2  5  
ATOM 9535  H H    . ARG A 1 62  ? -39.552 12.187  -15.903 1.00 0.00 ? 62  ARG A H    5  
ATOM 9536  H HA   . ARG A 1 62  ? -40.520 14.303  -14.025 1.00 0.00 ? 62  ARG A HA   5  
ATOM 9537  H HB2  . ARG A 1 62  ? -41.296 11.407  -14.508 1.00 0.00 ? 62  ARG A HB2  5  
ATOM 9538  H HB3  . ARG A 1 62  ? -42.035 12.486  -13.320 1.00 0.00 ? 62  ARG A HB3  5  
ATOM 9539  H HG2  . ARG A 1 62  ? -42.740 14.024  -15.195 1.00 0.00 ? 62  ARG A HG2  5  
ATOM 9540  H HG3  . ARG A 1 62  ? -42.013 12.903  -16.366 1.00 0.00 ? 62  ARG A HG3  5  
ATOM 9541  H HD2  . ARG A 1 62  ? -44.382 12.462  -16.216 1.00 0.00 ? 62  ARG A HD2  5  
ATOM 9542  H HD3  . ARG A 1 62  ? -43.433 11.097  -15.572 1.00 0.00 ? 62  ARG A HD3  5  
ATOM 9543  H HE   . ARG A 1 62  ? -43.917 12.810  -13.428 1.00 0.00 ? 62  ARG A HE   5  
ATOM 9544  H HH11 . ARG A 1 62  ? -45.670 10.512  -15.399 1.00 0.00 ? 62  ARG A HH11 5  
ATOM 9545  H HH12 . ARG A 1 62  ? -46.948 10.290  -14.225 1.00 0.00 ? 62  ARG A HH12 5  
ATOM 9546  H HH21 . ARG A 1 62  ? -45.641 12.531  -11.955 1.00 0.00 ? 62  ARG A HH21 5  
ATOM 9547  H HH22 . ARG A 1 62  ? -46.905 11.390  -12.306 1.00 0.00 ? 62  ARG A HH22 5  
ATOM 9548  N N    . PRO A 1 63  ? -39.629 13.217  -11.787 1.00 0.00 ? 63  PRO A N    5  
ATOM 9549  C CA   . PRO A 1 63  ? -38.896 12.737  -10.611 1.00 0.00 ? 63  PRO A CA   5  
ATOM 9550  C C    . PRO A 1 63  ? -38.860 11.208  -10.481 1.00 0.00 ? 63  PRO A C    5  
ATOM 9551  O O    . PRO A 1 63  ? -39.883 10.535  -10.625 1.00 0.00 ? 63  PRO A O    5  
ATOM 9552  C CB   . PRO A 1 63  ? -39.588 13.378  -9.403  1.00 0.00 ? 63  PRO A CB   5  
ATOM 9553  C CG   . PRO A 1 63  ? -40.132 14.682  -9.976  1.00 0.00 ? 63  PRO A CG   5  
ATOM 9554  C CD   . PRO A 1 63  ? -40.529 14.297  -11.401 1.00 0.00 ? 63  PRO A CD   5  
ATOM 9555  H HA   . PRO A 1 63  ? -37.877 13.118  -10.662 1.00 0.00 ? 63  PRO A HA   5  
ATOM 9556  H HB2  . PRO A 1 63  ? -40.419 12.756  -9.067  1.00 0.00 ? 63  PRO A HB2  5  
ATOM 9557  H HB3  . PRO A 1 63  ? -38.890 13.556  -8.585  1.00 0.00 ? 63  PRO A HB3  5  
ATOM 9558  H HG2  . PRO A 1 63  ? -40.984 15.053  -9.405  1.00 0.00 ? 63  PRO A HG2  5  
ATOM 9559  H HG3  . PRO A 1 63  ? -39.338 15.428  -10.006 1.00 0.00 ? 63  PRO A HG3  5  
ATOM 9560  H HD2  . PRO A 1 63  ? -41.558 13.935  -11.410 1.00 0.00 ? 63  PRO A HD2  5  
ATOM 9561  H HD3  . PRO A 1 63  ? -40.425 15.162  -12.056 1.00 0.00 ? 63  PRO A HD3  5  
ATOM 9562  N N    . CYS A 1 64  ? -37.683 10.657  -10.169 1.00 0.00 ? 64  CYS A N    5  
ATOM 9563  C CA   . CYS A 1 64  ? -37.473 9.222   -9.958  1.00 0.00 ? 64  CYS A CA   5  
ATOM 9564  C C    . CYS A 1 64  ? -38.168 8.684   -8.684  1.00 0.00 ? 64  CYS A C    5  
ATOM 9565  O O    . CYS A 1 64  ? -38.222 7.470   -8.478  1.00 0.00 ? 64  CYS A O    5  
ATOM 9566  C CB   . CYS A 1 64  ? -35.963 8.956   -9.989  1.00 0.00 ? 64  CYS A CB   5  
ATOM 9567  S SG   . CYS A 1 64  ? -35.630 7.181   -10.132 1.00 0.00 ? 64  CYS A SG   5  
ATOM 9568  H H    . CYS A 1 64  ? -36.870 11.260  -10.097 1.00 0.00 ? 64  CYS A H    5  
ATOM 9569  H HA   . CYS A 1 64  ? -37.909 8.681   -10.802 1.00 0.00 ? 64  CYS A HA   5  
ATOM 9570  H HB2  . CYS A 1 64  ? -35.533 9.454   -10.856 1.00 0.00 ? 64  CYS A HB2  5  
ATOM 9571  H HB3  . CYS A 1 64  ? -35.492 9.357   -9.093  1.00 0.00 ? 64  CYS A HB3  5  
ATOM 9572  H HG   . CYS A 1 64  ? -36.442 6.800   -9.131  1.00 0.00 ? 64  CYS A HG   5  
ATOM 9573  N N    . THR A 1 65  ? -38.696 9.564   -7.821  1.00 0.00 ? 65  THR A N    5  
ATOM 9574  C CA   . THR A 1 65  ? -39.472 9.248   -6.611  1.00 0.00 ? 65  THR A CA   5  
ATOM 9575  C C    . THR A 1 65  ? -40.768 8.505   -6.971  1.00 0.00 ? 65  THR A C    5  
ATOM 9576  O O    . THR A 1 65  ? -41.848 9.071   -7.185  1.00 0.00 ? 65  THR A O    5  
ATOM 9577  C CB   . THR A 1 65  ? -39.732 10.499  -5.736  1.00 0.00 ? 65  THR A CB   5  
ATOM 9578  O OG1  . THR A 1 65  ? -39.028 11.637  -6.201  1.00 0.00 ? 65  THR A OG1  5  
ATOM 9579  C CG2  . THR A 1 65  ? -39.300 10.260  -4.287  1.00 0.00 ? 65  THR A CG2  5  
ATOM 9580  H H    . THR A 1 65  ? -38.517 10.547  -7.970  1.00 0.00 ? 65  THR A H    5  
ATOM 9581  H HA   . THR A 1 65  ? -38.871 8.561   -6.015  1.00 0.00 ? 65  THR A HA   5  
ATOM 9582  H HB   . THR A 1 65  ? -40.787 10.742  -5.738  1.00 0.00 ? 65  THR A HB   5  
ATOM 9583  H HG1  . THR A 1 65  ? -39.289 12.391  -5.645  1.00 0.00 ? 65  THR A HG1  5  
ATOM 9584  H HG21 . THR A 1 65  ? -38.229 10.072  -4.233  1.00 0.00 ? 65  THR A HG21 5  
ATOM 9585  H HG22 . THR A 1 65  ? -39.541 11.134  -3.683  1.00 0.00 ? 65  THR A HG22 5  
ATOM 9586  H HG23 . THR A 1 65  ? -39.834 9.401   -3.882  1.00 0.00 ? 65  THR A HG23 5  
ATOM 9587  N N    . CYS A 1 66  ? -40.618 7.183   -7.056  1.00 0.00 ? 66  CYS A N    5  
ATOM 9588  C CA   . CYS A 1 66  ? -41.587 6.205   -7.547  1.00 0.00 ? 66  CYS A CA   5  
ATOM 9589  C C    . CYS A 1 66  ? -42.957 6.257   -6.858  1.00 0.00 ? 66  CYS A C    5  
ATOM 9590  O O    . CYS A 1 66  ? -43.917 5.693   -7.380  1.00 0.00 ? 66  CYS A O    5  
ATOM 9591  C CB   . CYS A 1 66  ? -40.945 4.817   -7.503  1.00 0.00 ? 66  CYS A CB   5  
ATOM 9592  S SG   . CYS A 1 66  ? -40.421 4.399   -5.813  1.00 0.00 ? 66  CYS A SG   5  
ATOM 9593  H H    . CYS A 1 66  ? -39.674 6.838   -6.941  1.00 0.00 ? 66  CYS A H    5  
ATOM 9594  H HA   . CYS A 1 66  ? -41.782 6.440   -8.593  1.00 0.00 ? 66  CYS A HA   5  
ATOM 9595  H HB2  . CYS A 1 66  ? -41.654 4.078   -7.875  1.00 0.00 ? 66  CYS A HB2  5  
ATOM 9596  H HB3  . CYS A 1 66  ? -40.077 4.813   -8.162  1.00 0.00 ? 66  CYS A HB3  5  
ATOM 9597  H HG   . CYS A 1 66  ? -39.842 3.227   -6.115  1.00 0.00 ? 66  CYS A HG   5  
ATOM 9598  N N    . ASP A 1 67  ? -43.073 6.967   -5.730  1.00 0.00 ? 67  ASP A N    5  
ATOM 9599  C CA   . ASP A 1 67  ? -44.357 7.304   -5.122  1.00 0.00 ? 67  ASP A CA   5  
ATOM 9600  C C    . ASP A 1 67  ? -45.357 7.945   -6.095  1.00 0.00 ? 67  ASP A C    5  
ATOM 9601  O O    . ASP A 1 67  ? -46.564 7.765   -5.900  1.00 0.00 ? 67  ASP A O    5  
ATOM 9602  C CB   . ASP A 1 67  ? -44.172 8.117   -3.835  1.00 0.00 ? 67  ASP A CB   5  
ATOM 9603  C CG   . ASP A 1 67  ? -43.812 9.590   -4.080  1.00 0.00 ? 67  ASP A CG   5  
ATOM 9604  O OD1  . ASP A 1 67  ? -44.729 10.406  -4.342  1.00 0.00 ? 67  ASP A OD1  5  
ATOM 9605  O OD2  . ASP A 1 67  ? -42.615 9.937   -3.968  1.00 0.00 ? 67  ASP A OD2  5  
ATOM 9606  H H    . ASP A 1 67  ? -42.243 7.409   -5.369  1.00 0.00 ? 67  ASP A H    5  
ATOM 9607  H HA   . ASP A 1 67  ? -44.809 6.370   -4.844  1.00 0.00 ? 67  ASP A HA   5  
ATOM 9608  H HB2  . ASP A 1 67  ? -45.103 8.072   -3.264  1.00 0.00 ? 67  ASP A HB2  5  
ATOM 9609  H HB3  . ASP A 1 67  ? -43.399 7.642   -3.228  1.00 0.00 ? 67  ASP A HB3  5  
ATOM 9610  N N    . PHE A 1 68  ? -44.890 8.559   -7.198  1.00 0.00 ? 68  PHE A N    5  
ATOM 9611  C CA   . PHE A 1 68  ? -45.788 8.990   -8.283  1.00 0.00 ? 68  PHE A CA   5  
ATOM 9612  C C    . PHE A 1 68  ? -46.709 7.868   -8.833  1.00 0.00 ? 68  PHE A C    5  
ATOM 9613  O O    . PHE A 1 68  ? -47.773 8.178   -9.375  1.00 0.00 ? 68  PHE A O    5  
ATOM 9614  C CB   . PHE A 1 68  ? -44.988 9.697   -9.398  1.00 0.00 ? 68  PHE A CB   5  
ATOM 9615  C CG   . PHE A 1 68  ? -44.252 8.804   -10.388 1.00 0.00 ? 68  PHE A CG   5  
ATOM 9616  C CD1  . PHE A 1 68  ? -44.947 8.165   -11.436 1.00 0.00 ? 68  PHE A CD1  5  
ATOM 9617  C CD2  . PHE A 1 68  ? -42.856 8.651   -10.299 1.00 0.00 ? 68  PHE A CD2  5  
ATOM 9618  C CE1  . PHE A 1 68  ? -44.258 7.344   -12.346 1.00 0.00 ? 68  PHE A CE1  5  
ATOM 9619  C CE2  . PHE A 1 68  ? -42.168 7.816   -11.197 1.00 0.00 ? 68  PHE A CE2  5  
ATOM 9620  C CZ   . PHE A 1 68  ? -42.872 7.149   -12.212 1.00 0.00 ? 68  PHE A CZ   5  
ATOM 9621  H H    . PHE A 1 68  ? -43.885 8.696   -7.296  1.00 0.00 ? 68  PHE A H    5  
ATOM 9622  H HA   . PHE A 1 68  ? -46.453 9.740   -7.852  1.00 0.00 ? 68  PHE A HA   5  
ATOM 9623  H HB2  . PHE A 1 68  ? -45.692 10.302  -9.970  1.00 0.00 ? 68  PHE A HB2  5  
ATOM 9624  H HB3  . PHE A 1 68  ? -44.283 10.392  -8.941  1.00 0.00 ? 68  PHE A HB3  5  
ATOM 9625  H HD1  . PHE A 1 68  ? -46.014 8.304   -11.545 1.00 0.00 ? 68  PHE A HD1  5  
ATOM 9626  H HD2  . PHE A 1 68  ? -42.299 9.190   -9.550  1.00 0.00 ? 68  PHE A HD2  5  
ATOM 9627  H HE1  . PHE A 1 68  ? -44.796 6.856   -13.147 1.00 0.00 ? 68  PHE A HE1  5  
ATOM 9628  H HE2  . PHE A 1 68  ? -41.095 7.700   -11.113 1.00 0.00 ? 68  PHE A HE2  5  
ATOM 9629  H HZ   . PHE A 1 68  ? -42.345 6.502   -12.899 1.00 0.00 ? 68  PHE A HZ   5  
ATOM 9630  N N    . LEU A 1 69  ? -46.334 6.587   -8.681  1.00 0.00 ? 69  LEU A N    5  
ATOM 9631  C CA   . LEU A 1 69  ? -47.161 5.403   -8.966  1.00 0.00 ? 69  LEU A CA   5  
ATOM 9632  C C    . LEU A 1 69  ? -47.364 4.418   -7.781  1.00 0.00 ? 69  LEU A C    5  
ATOM 9633  O O    . LEU A 1 69  ? -47.667 3.240   -8.003  1.00 0.00 ? 69  LEU A O    5  
ATOM 9634  C CB   . LEU A 1 69  ? -46.749 4.769   -10.315 1.00 0.00 ? 69  LEU A CB   5  
ATOM 9635  C CG   . LEU A 1 69  ? -45.275 4.353   -10.497 1.00 0.00 ? 69  LEU A CG   5  
ATOM 9636  C CD1  . LEU A 1 69  ? -44.838 3.228   -9.566  1.00 0.00 ? 69  LEU A CD1  5  
ATOM 9637  C CD2  . LEU A 1 69  ? -45.069 3.855   -11.930 1.00 0.00 ? 69  LEU A CD2  5  
ATOM 9638  H H    . LEU A 1 69  ? -45.435 6.416   -8.243  1.00 0.00 ? 69  LEU A H    5  
ATOM 9639  H HA   . LEU A 1 69  ? -48.174 5.770   -9.134  1.00 0.00 ? 69  LEU A HA   5  
ATOM 9640  H HB2  . LEU A 1 69  ? -47.387 3.905   -10.507 1.00 0.00 ? 69  LEU A HB2  5  
ATOM 9641  H HB3  . LEU A 1 69  ? -46.978 5.502   -11.090 1.00 0.00 ? 69  LEU A HB3  5  
ATOM 9642  H HG   . LEU A 1 69  ? -44.629 5.215   -10.334 1.00 0.00 ? 69  LEU A HG   5  
ATOM 9643  H HD11 . LEU A 1 69  ? -44.884 3.569   -8.534  1.00 0.00 ? 69  LEU A HD11 5  
ATOM 9644  H HD12 . LEU A 1 69  ? -45.490 2.363   -9.689  1.00 0.00 ? 69  LEU A HD12 5  
ATOM 9645  H HD13 . LEU A 1 69  ? -43.811 2.941   -9.784  1.00 0.00 ? 69  LEU A HD13 5  
ATOM 9646  H HD21 . LEU A 1 69  ? -45.663 2.958   -12.099 1.00 0.00 ? 69  LEU A HD21 5  
ATOM 9647  H HD22 . LEU A 1 69  ? -45.379 4.622   -12.638 1.00 0.00 ? 69  LEU A HD22 5  
ATOM 9648  H HD23 . LEU A 1 69  ? -44.014 3.636   -12.093 1.00 0.00 ? 69  LEU A HD23 5  
ATOM 9649  N N    . HIS A 1 70  ? -47.241 4.861   -6.517  1.00 0.00 ? 70  HIS A N    5  
ATOM 9650  C CA   . HIS A 1 70  ? -47.643 4.045   -5.356  1.00 0.00 ? 70  HIS A CA   5  
ATOM 9651  C C    . HIS A 1 70  ? -49.160 3.826   -5.287  1.00 0.00 ? 70  HIS A C    5  
ATOM 9652  O O    . HIS A 1 70  ? -49.946 4.706   -5.651  1.00 0.00 ? 70  HIS A O    5  
ATOM 9653  C CB   . HIS A 1 70  ? -47.162 4.677   -4.047  1.00 0.00 ? 70  HIS A CB   5  
ATOM 9654  C CG   . HIS A 1 70  ? -45.701 4.459   -3.763  1.00 0.00 ? 70  HIS A CG   5  
ATOM 9655  N ND1  . HIS A 1 70  ? -44.785 3.804   -4.590  1.00 0.00 ? 70  HIS A ND1  5  
ATOM 9656  C CD2  . HIS A 1 70  ? -45.041 4.951   -2.677  1.00 0.00 ? 70  HIS A CD2  5  
ATOM 9657  C CE1  . HIS A 1 70  ? -43.596 3.913   -3.984  1.00 0.00 ? 70  HIS A CE1  5  
ATOM 9658  N NE2  . HIS A 1 70  ? -43.719 4.595   -2.833  1.00 0.00 ? 70  HIS A NE2  5  
ATOM 9659  H H    . HIS A 1 70  ? -46.929 5.806   -6.335  1.00 0.00 ? 70  HIS A H    5  
ATOM 9660  H HA   . HIS A 1 70  ? -47.180 3.060   -5.443  1.00 0.00 ? 70  HIS A HA   5  
ATOM 9661  H HB2  . HIS A 1 70  ? -47.371 5.748   -4.060  1.00 0.00 ? 70  HIS A HB2  5  
ATOM 9662  H HB3  . HIS A 1 70  ? -47.722 4.247   -3.218  1.00 0.00 ? 70  HIS A HB3  5  
ATOM 9663  H HD2  . HIS A 1 70  ? -45.482 5.528   -1.876  1.00 0.00 ? 70  HIS A HD2  5  
ATOM 9664  H HE1  . HIS A 1 70  ? -42.669 3.513   -4.369  1.00 0.00 ? 70  HIS A HE1  5  
ATOM 9665  H HE2  . HIS A 1 70  ? -42.959 4.814   -2.203  1.00 0.00 ? 70  HIS A HE2  5  
ATOM 9666  N N    . GLY A 1 71  ? -49.567 2.655   -4.793  1.00 0.00 ? 71  GLY A N    5  
ATOM 9667  C CA   . GLY A 1 71  ? -50.967 2.247   -4.645  1.00 0.00 ? 71  GLY A CA   5  
ATOM 9668  C C    . GLY A 1 71  ? -51.469 2.262   -3.190  1.00 0.00 ? 71  GLY A C    5  
ATOM 9669  O O    . GLY A 1 71  ? -50.711 2.567   -2.263  1.00 0.00 ? 71  GLY A O    5  
ATOM 9670  H H    . GLY A 1 71  ? -48.866 2.040   -4.395  1.00 0.00 ? 71  GLY A H    5  
ATOM 9671  H HA2  . GLY A 1 71  ? -51.614 2.893   -5.238  1.00 0.00 ? 71  GLY A HA2  5  
ATOM 9672  H HA3  . GLY A 1 71  ? -51.071 1.236   -5.033  1.00 0.00 ? 71  GLY A HA3  5  
ATOM 9673  N N    . PRO A 1 72  ? -52.741 1.880   -2.954  1.00 0.00 ? 72  PRO A N    5  
ATOM 9674  C CA   . PRO A 1 72  ? -53.349 1.862   -1.618  1.00 0.00 ? 72  PRO A CA   5  
ATOM 9675  C C    . PRO A 1 72  ? -52.720 0.840   -0.647  1.00 0.00 ? 72  PRO A C    5  
ATOM 9676  O O    . PRO A 1 72  ? -52.995 0.888   0.555   1.00 0.00 ? 72  PRO A O    5  
ATOM 9677  C CB   . PRO A 1 72  ? -54.836 1.575   -1.864  1.00 0.00 ? 72  PRO A CB   5  
ATOM 9678  C CG   . PRO A 1 72  ? -54.841 0.797   -3.180  1.00 0.00 ? 72  PRO A CG   5  
ATOM 9679  C CD   . PRO A 1 72  ? -53.713 1.468   -3.959  1.00 0.00 ? 72  PRO A CD   5  
ATOM 9680  H HA   . PRO A 1 72  ? -53.253 2.849   -1.165  1.00 0.00 ? 72  PRO A HA   5  
ATOM 9681  H HB2  . PRO A 1 72  ? -55.293 1.001   -1.056  1.00 0.00 ? 72  PRO A HB2  5  
ATOM 9682  H HB3  . PRO A 1 72  ? -55.369 2.517   -2.000  1.00 0.00 ? 72  PRO A HB3  5  
ATOM 9683  H HG2  . PRO A 1 72  ? -54.592 -0.248  -2.994  1.00 0.00 ? 72  PRO A HG2  5  
ATOM 9684  H HG3  . PRO A 1 72  ? -55.797 0.881   -3.698  1.00 0.00 ? 72  PRO A HG3  5  
ATOM 9685  H HD2  . PRO A 1 72  ? -53.290 0.769   -4.680  1.00 0.00 ? 72  PRO A HD2  5  
ATOM 9686  H HD3  . PRO A 1 72  ? -54.096 2.350   -4.475  1.00 0.00 ? 72  PRO A HD3  5  
ATOM 9687  N N    . ARG A 1 73  ? -51.850 -0.058  -1.139  1.00 0.00 ? 73  ARG A N    5  
ATOM 9688  C CA   . ARG A 1 73  ? -51.078 -1.019  -0.330  1.00 0.00 ? 73  ARG A CA   5  
ATOM 9689  C C    . ARG A 1 73  ? -49.717 -0.467  0.126   1.00 0.00 ? 73  ARG A C    5  
ATOM 9690  O O    . ARG A 1 73  ? -49.065 -1.095  0.963   1.00 0.00 ? 73  ARG A O    5  
ATOM 9691  C CB   . ARG A 1 73  ? -50.852 -2.297  -1.163  1.00 0.00 ? 73  ARG A CB   5  
ATOM 9692  C CG   . ARG A 1 73  ? -52.142 -3.106  -1.385  1.00 0.00 ? 73  ARG A CG   5  
ATOM 9693  C CD   . ARG A 1 73  ? -51.870 -4.377  -2.204  1.00 0.00 ? 73  ARG A CD   5  
ATOM 9694  N NE   . ARG A 1 73  ? -51.308 -5.462  -1.373  1.00 0.00 ? 73  ARG A NE   5  
ATOM 9695  C CZ   . ARG A 1 73  ? -51.068 -6.704  -1.755  1.00 0.00 ? 73  ARG A CZ   5  
ATOM 9696  N NH1  . ARG A 1 73  ? -51.222 -7.100  -2.986  1.00 0.00 ? 73  ARG A NH1  5  
ATOM 9697  N NH2  . ARG A 1 73  ? -50.652 -7.585  -0.893  1.00 0.00 ? 73  ARG A NH2  5  
ATOM 9698  H H    . ARG A 1 73  ? -51.693 -0.050  -2.137  1.00 0.00 ? 73  ARG A H    5  
ATOM 9699  H HA   . ARG A 1 73  ? -51.629 -1.278  0.577   1.00 0.00 ? 73  ARG A HA   5  
ATOM 9700  H HB2  . ARG A 1 73  ? -50.407 -2.034  -2.123  1.00 0.00 ? 73  ARG A HB2  5  
ATOM 9701  H HB3  . ARG A 1 73  ? -50.144 -2.940  -0.636  1.00 0.00 ? 73  ARG A HB3  5  
ATOM 9702  H HG2  . ARG A 1 73  ? -52.593 -3.369  -0.428  1.00 0.00 ? 73  ARG A HG2  5  
ATOM 9703  H HG3  . ARG A 1 73  ? -52.849 -2.491  -1.941  1.00 0.00 ? 73  ARG A HG3  5  
ATOM 9704  H HD2  . ARG A 1 73  ? -52.817 -4.715  -2.630  1.00 0.00 ? 73  ARG A HD2  5  
ATOM 9705  H HD3  . ARG A 1 73  ? -51.189 -4.139  -3.022  1.00 0.00 ? 73  ARG A HD3  5  
ATOM 9706  H HE   . ARG A 1 73  ? -51.146 -5.256  -0.400  1.00 0.00 ? 73  ARG A HE   5  
ATOM 9707  H HH11 . ARG A 1 73  ? -51.489 -6.432  -3.701  1.00 0.00 ? 73  ARG A HH11 5  
ATOM 9708  H HH12 . ARG A 1 73  ? -51.066 -8.061  -3.238  1.00 0.00 ? 73  ARG A HH12 5  
ATOM 9709  H HH21 . ARG A 1 73  ? -50.527 -7.331  0.074   1.00 0.00 ? 73  ARG A HH21 5  
ATOM 9710  H HH22 . ARG A 1 73  ? -50.476 -8.534  -1.179  1.00 0.00 ? 73  ARG A HH22 5  
ATOM 9711  N N    . THR A 1 74  ? -49.269 0.683   -0.389  1.00 0.00 ? 74  THR A N    5  
ATOM 9712  C CA   . THR A 1 74  ? -47.882 1.149   -0.195  1.00 0.00 ? 74  THR A CA   5  
ATOM 9713  C C    . THR A 1 74  ? -47.651 1.898   1.119   1.00 0.00 ? 74  THR A C    5  
ATOM 9714  O O    . THR A 1 74  ? -48.502 2.658   1.584   1.00 0.00 ? 74  THR A O    5  
ATOM 9715  C CB   . THR A 1 74  ? -47.372 1.974   -1.388  1.00 0.00 ? 74  THR A CB   5  
ATOM 9716  O OG1  . THR A 1 74  ? -47.802 1.425   -2.617  1.00 0.00 ? 74  THR A OG1  5  
ATOM 9717  C CG2  . THR A 1 74  ? -45.842 1.992   -1.411  1.00 0.00 ? 74  THR A CG2  5  
ATOM 9718  H H    . THR A 1 74  ? -49.838 1.180   -1.066  1.00 0.00 ? 74  THR A H    5  
ATOM 9719  H HA   . THR A 1 74  ? -47.263 0.255   -0.145  1.00 0.00 ? 74  THR A HA   5  
ATOM 9720  H HB   . THR A 1 74  ? -47.748 2.995   -1.318  1.00 0.00 ? 74  THR A HB   5  
ATOM 9721  H HG1  . THR A 1 74  ? -47.023 1.361   -3.199  1.00 0.00 ? 74  THR A HG1  5  
ATOM 9722  H HG21 . THR A 1 74  ? -45.440 1.021   -1.121  1.00 0.00 ? 74  THR A HG21 5  
ATOM 9723  H HG22 . THR A 1 74  ? -45.487 2.244   -2.410  1.00 0.00 ? 74  THR A HG22 5  
ATOM 9724  H HG23 . THR A 1 74  ? -45.475 2.753   -0.722  1.00 0.00 ? 74  THR A HG23 5  
ATOM 9725  N N    . GLN A 1 75  ? -46.469 1.694   1.714   1.00 0.00 ? 75  GLN A N    5  
ATOM 9726  C CA   . GLN A 1 75  ? -46.058 2.309   2.977   1.00 0.00 ? 75  GLN A CA   5  
ATOM 9727  C C    . GLN A 1 75  ? -45.463 3.718   2.784   1.00 0.00 ? 75  GLN A C    5  
ATOM 9728  O O    . GLN A 1 75  ? -44.611 3.971   1.922   1.00 0.00 ? 75  GLN A O    5  
ATOM 9729  C CB   . GLN A 1 75  ? -45.053 1.398   3.701   1.00 0.00 ? 75  GLN A CB   5  
ATOM 9730  C CG   . GLN A 1 75  ? -45.561 -0.000  4.088   1.00 0.00 ? 75  GLN A CG   5  
ATOM 9731  C CD   . GLN A 1 75  ? -46.597 0.038   5.206   1.00 0.00 ? 75  GLN A CD   5  
ATOM 9732  O OE1  . GLN A 1 75  ? -46.260 0.139   6.379   1.00 0.00 ? 75  GLN A OE1  5  
ATOM 9733  N NE2  . GLN A 1 75  ? -47.876 -0.015  4.903   1.00 0.00 ? 75  GLN A NE2  5  
ATOM 9734  H H    . GLN A 1 75  ? -45.807 1.077   1.264   1.00 0.00 ? 75  GLN A H    5  
ATOM 9735  H HA   . GLN A 1 75  ? -46.937 2.406   3.614   1.00 0.00 ? 75  GLN A HA   5  
ATOM 9736  H HB2  . GLN A 1 75  ? -44.185 1.276   3.063   1.00 0.00 ? 75  GLN A HB2  5  
ATOM 9737  H HB3  . GLN A 1 75  ? -44.724 1.899   4.609   1.00 0.00 ? 75  GLN A HB3  5  
ATOM 9738  H HG2  . GLN A 1 75  ? -45.970 -0.511  3.215   1.00 0.00 ? 75  GLN A HG2  5  
ATOM 9739  H HG3  . GLN A 1 75  ? -44.710 -0.581  4.445   1.00 0.00 ? 75  GLN A HG3  5  
ATOM 9740  H HE21 . GLN A 1 75  ? -48.175 -0.124  3.945   1.00 0.00 ? 75  GLN A HE21 5  
ATOM 9741  H HE22 . GLN A 1 75  ? -48.545 0.011   5.657   1.00 0.00 ? 75  GLN A HE22 5  
ATOM 9742  N N    . ARG A 1 76  ? -45.840 4.631   3.681   1.00 0.00 ? 76  ARG A N    5  
ATOM 9743  C CA   . ARG A 1 76  ? -45.325 6.012   3.700   1.00 0.00 ? 76  ARG A CA   5  
ATOM 9744  C C    . ARG A 1 76  ? -43.864 6.049   4.125   1.00 0.00 ? 76  ARG A C    5  
ATOM 9745  O O    . ARG A 1 76  ? -43.074 6.748   3.508   1.00 0.00 ? 76  ARG A O    5  
ATOM 9746  C CB   . ARG A 1 76  ? -46.199 6.918   4.579   1.00 0.00 ? 76  ARG A CB   5  
ATOM 9747  C CG   . ARG A 1 76  ? -47.710 6.844   4.289   1.00 0.00 ? 76  ARG A CG   5  
ATOM 9748  C CD   . ARG A 1 76  ? -48.038 7.031   2.800   1.00 0.00 ? 76  ARG A CD   5  
ATOM 9749  N NE   . ARG A 1 76  ? -49.495 6.996   2.555   1.00 0.00 ? 76  ARG A NE   5  
ATOM 9750  C CZ   . ARG A 1 76  ? -50.345 8.007   2.613   1.00 0.00 ? 76  ARG A CZ   5  
ATOM 9751  N NH1  . ARG A 1 76  ? -49.971 9.219   2.918   1.00 0.00 ? 76  ARG A NH1  5  
ATOM 9752  N NH2  . ARG A 1 76  ? -51.610 7.816   2.364   1.00 0.00 ? 76  ARG A NH2  5  
ATOM 9753  H H    . ARG A 1 76  ? -46.475 4.339   4.413   1.00 0.00 ? 76  ARG A H    5  
ATOM 9754  H HA   . ARG A 1 76  ? -45.341 6.408   2.681   1.00 0.00 ? 76  ARG A HA   5  
ATOM 9755  H HB2  . ARG A 1 76  ? -46.026 6.636   5.615   1.00 0.00 ? 76  ARG A HB2  5  
ATOM 9756  H HB3  . ARG A 1 76  ? -45.869 7.951   4.451   1.00 0.00 ? 76  ARG A HB3  5  
ATOM 9757  H HG2  . ARG A 1 76  ? -48.097 5.878   4.617   1.00 0.00 ? 76  ARG A HG2  5  
ATOM 9758  H HG3  . ARG A 1 76  ? -48.211 7.619   4.870   1.00 0.00 ? 76  ARG A HG3  5  
ATOM 9759  H HD2  . ARG A 1 76  ? -47.609 7.970   2.447   1.00 0.00 ? 76  ARG A HD2  5  
ATOM 9760  H HD3  . ARG A 1 76  ? -47.573 6.221   2.233   1.00 0.00 ? 76  ARG A HD3  5  
ATOM 9761  H HE   . ARG A 1 76  ? -49.888 6.101   2.309   1.00 0.00 ? 76  ARG A HE   5  
ATOM 9762  H HH11 . ARG A 1 76  ? -49.003 9.400   3.116   1.00 0.00 ? 76  ARG A HH11 5  
ATOM 9763  H HH12 . ARG A 1 76  ? -50.642 9.969   2.953   1.00 0.00 ? 76  ARG A HH12 5  
ATOM 9764  H HH21 . ARG A 1 76  ? -51.946 6.898   2.126   1.00 0.00 ? 76  ARG A HH21 5  
ATOM 9765  H HH22 . ARG A 1 76  ? -52.258 8.586   2.409   1.00 0.00 ? 76  ARG A HH22 5  
ATOM 9766  N N    . ARG A 1 77  ? -43.486 5.229   5.112   1.00 0.00 ? 77  ARG A N    5  
ATOM 9767  C CA   . ARG A 1 77  ? -42.089 4.984   5.529   1.00 0.00 ? 77  ARG A CA   5  
ATOM 9768  C C    . ARG A 1 77  ? -41.190 4.463   4.404   1.00 0.00 ? 77  ARG A C    5  
ATOM 9769  O O    . ARG A 1 77  ? -40.034 4.874   4.298   1.00 0.00 ? 77  ARG A O    5  
ATOM 9770  C CB   . ARG A 1 77  ? -42.083 4.051   6.754   1.00 0.00 ? 77  ARG A CB   5  
ATOM 9771  C CG   . ARG A 1 77  ? -42.856 2.727   6.603   1.00 0.00 ? 77  ARG A CG   5  
ATOM 9772  C CD   . ARG A 1 77  ? -42.756 1.859   7.864   1.00 0.00 ? 77  ARG A CD   5  
ATOM 9773  N NE   . ARG A 1 77  ? -43.769 0.786   7.857   1.00 0.00 ? 77  ARG A NE   5  
ATOM 9774  C CZ   . ARG A 1 77  ? -43.847 -0.249  8.673   1.00 0.00 ? 77  ARG A CZ   5  
ATOM 9775  N NH1  . ARG A 1 77  ? -42.960 -0.484  9.599   1.00 0.00 ? 77  ARG A NH1  5  
ATOM 9776  N NH2  . ARG A 1 77  ? -44.848 -1.071  8.559   1.00 0.00 ? 77  ARG A NH2  5  
ATOM 9777  H H    . ARG A 1 77  ? -44.225 4.740   5.593   1.00 0.00 ? 77  ARG A H    5  
ATOM 9778  H HA   . ARG A 1 77  ? -41.649 5.935   5.840   1.00 0.00 ? 77  ARG A HA   5  
ATOM 9779  H HB2  . ARG A 1 77  ? -41.048 3.841   7.026   1.00 0.00 ? 77  ARG A HB2  5  
ATOM 9780  H HB3  . ARG A 1 77  ? -42.555 4.601   7.564   1.00 0.00 ? 77  ARG A HB3  5  
ATOM 9781  H HG2  . ARG A 1 77  ? -43.908 2.958   6.436   1.00 0.00 ? 77  ARG A HG2  5  
ATOM 9782  H HG3  . ARG A 1 77  ? -42.472 2.158   5.757   1.00 0.00 ? 77  ARG A HG3  5  
ATOM 9783  H HD2  . ARG A 1 77  ? -41.753 1.431   7.911   1.00 0.00 ? 77  ARG A HD2  5  
ATOM 9784  H HD3  . ARG A 1 77  ? -42.917 2.487   8.743   1.00 0.00 ? 77  ARG A HD3  5  
ATOM 9785  H HE   . ARG A 1 77  ? -44.536 0.861   7.200   1.00 0.00 ? 77  ARG A HE   5  
ATOM 9786  H HH11 . ARG A 1 77  ? -42.184 0.146   9.710   1.00 0.00 ? 77  ARG A HH11 5  
ATOM 9787  H HH12 . ARG A 1 77  ? -43.052 -1.282  10.205  1.00 0.00 ? 77  ARG A HH12 5  
ATOM 9788  H HH21 . ARG A 1 77  ? -45.551 -0.874  7.855   1.00 0.00 ? 77  ARG A HH21 5  
ATOM 9789  H HH22 . ARG A 1 77  ? -44.939 -1.865  9.168   1.00 0.00 ? 77  ARG A HH22 5  
ATOM 9790  N N    . ALA A 1 78  ? -41.731 3.608   3.537   1.00 0.00 ? 78  ALA A N    5  
ATOM 9791  C CA   . ALA A 1 78  ? -41.050 3.129   2.328   1.00 0.00 ? 78  ALA A CA   5  
ATOM 9792  C C    . ALA A 1 78  ? -40.790 4.306   1.366   1.00 0.00 ? 78  ALA A C    5  
ATOM 9793  O O    . ALA A 1 78  ? -39.647 4.604   0.985   1.00 0.00 ? 78  ALA A O    5  
ATOM 9794  C CB   . ALA A 1 78  ? -41.898 2.024   1.675   1.00 0.00 ? 78  ALA A CB   5  
ATOM 9795  H H    . ALA A 1 78  ? -42.696 3.356   3.690   1.00 0.00 ? 78  ALA A H    5  
ATOM 9796  H HA   . ALA A 1 78  ? -40.091 2.682   2.599   1.00 0.00 ? 78  ALA A HA   5  
ATOM 9797  H HB1  . ALA A 1 78  ? -42.891 2.364   1.392   1.00 0.00 ? 78  ALA A HB1  5  
ATOM 9798  H HB2  . ALA A 1 78  ? -41.432 1.709   0.754   1.00 0.00 ? 78  ALA A HB2  5  
ATOM 9799  H HB3  . ALA A 1 78  ? -41.971 1.158   2.331   1.00 0.00 ? 78  ALA A HB3  5  
ATOM 9800  N N    . ALA A 1 79  ? -41.865 5.042   1.054   1.00 0.00 ? 79  ALA A N    5  
ATOM 9801  C CA   . ALA A 1 79  ? -41.786 6.180   0.137   1.00 0.00 ? 79  ALA A CA   5  
ATOM 9802  C C    . ALA A 1 79  ? -40.896 7.321   0.668   1.00 0.00 ? 79  ALA A C    5  
ATOM 9803  O O    . ALA A 1 79  ? -40.162 7.953   -0.094  1.00 0.00 ? 79  ALA A O    5  
ATOM 9804  C CB   . ALA A 1 79  ? -43.220 6.643   -0.112  1.00 0.00 ? 79  ALA A CB   5  
ATOM 9805  H H    . ALA A 1 79  ? -42.772 4.800   1.460   1.00 0.00 ? 79  ALA A H    5  
ATOM 9806  H HA   . ALA A 1 79  ? -41.345 5.842   -0.803  1.00 0.00 ? 79  ALA A HA   5  
ATOM 9807  H HB1  . ALA A 1 79  ? -43.628 7.102   0.790   1.00 0.00 ? 79  ALA A HB1  5  
ATOM 9808  H HB2  . ALA A 1 79  ? -43.237 7.373   -0.921  1.00 0.00 ? 79  ALA A HB2  5  
ATOM 9809  H HB3  . ALA A 1 79  ? -43.829 5.779   -0.374  1.00 0.00 ? 79  ALA A HB3  5  
ATOM 9810  N N    . ALA A 1 80  ? -40.908 7.536   1.984   1.00 0.00 ? 80  ALA A N    5  
ATOM 9811  C CA   . ALA A 1 80  ? -40.107 8.531   2.677   1.00 0.00 ? 80  ALA A CA   5  
ATOM 9812  C C    . ALA A 1 80  ? -38.619 8.183   2.638   1.00 0.00 ? 80  ALA A C    5  
ATOM 9813  O O    . ALA A 1 80  ? -37.835 9.009   2.179   1.00 0.00 ? 80  ALA A O    5  
ATOM 9814  C CB   . ALA A 1 80  ? -40.620 8.655   4.112   1.00 0.00 ? 80  ALA A CB   5  
ATOM 9815  H H    . ALA A 1 80  ? -41.573 7.011   2.540   1.00 0.00 ? 80  ALA A H    5  
ATOM 9816  H HA   . ALA A 1 80  ? -40.239 9.492   2.178   1.00 0.00 ? 80  ALA A HA   5  
ATOM 9817  H HB1  . ALA A 1 80  ? -40.028 9.396   4.650   1.00 0.00 ? 80  ALA A HB1  5  
ATOM 9818  H HB2  . ALA A 1 80  ? -41.663 8.970   4.100   1.00 0.00 ? 80  ALA A HB2  5  
ATOM 9819  H HB3  . ALA A 1 80  ? -40.539 7.692   4.616   1.00 0.00 ? 80  ALA A HB3  5  
ATOM 9820  N N    . GLN A 1 81  ? -38.217 6.979   3.070   1.00 0.00 ? 81  GLN A N    5  
ATOM 9821  C CA   . GLN A 1 81  ? -36.839 6.484   2.903   1.00 0.00 ? 81  GLN A CA   5  
ATOM 9822  C C    . GLN A 1 81  ? -36.327 6.622   1.457   1.00 0.00 ? 81  GLN A C    5  
ATOM 9823  O O    . GLN A 1 81  ? -35.194 7.067   1.243   1.00 0.00 ? 81  GLN A O    5  
ATOM 9824  C CB   . GLN A 1 81  ? -36.740 5.034   3.396   1.00 0.00 ? 81  GLN A CB   5  
ATOM 9825  C CG   . GLN A 1 81  ? -36.778 4.945   4.929   1.00 0.00 ? 81  GLN A CG   5  
ATOM 9826  C CD   . GLN A 1 81  ? -36.899 3.499   5.398   1.00 0.00 ? 81  GLN A CD   5  
ATOM 9827  O OE1  . GLN A 1 81  ? -35.946 2.860   5.824   1.00 0.00 ? 81  GLN A OE1  5  
ATOM 9828  N NE2  . GLN A 1 81  ? -38.082 2.928   5.322   1.00 0.00 ? 81  GLN A NE2  5  
ATOM 9829  H H    . GLN A 1 81  ? -38.909 6.345   3.459   1.00 0.00 ? 81  GLN A H    5  
ATOM 9830  H HA   . GLN A 1 81  ? -36.178 7.090   3.523   1.00 0.00 ? 81  GLN A HA   5  
ATOM 9831  H HB2  . GLN A 1 81  ? -37.557 4.456   2.967   1.00 0.00 ? 81  GLN A HB2  5  
ATOM 9832  H HB3  . GLN A 1 81  ? -35.795 4.605   3.060   1.00 0.00 ? 81  GLN A HB3  5  
ATOM 9833  H HG2  . GLN A 1 81  ? -35.866 5.382   5.338   1.00 0.00 ? 81  GLN A HG2  5  
ATOM 9834  H HG3  . GLN A 1 81  ? -37.627 5.508   5.314   1.00 0.00 ? 81  GLN A HG3  5  
ATOM 9835  H HE21 . GLN A 1 81  ? -38.857 3.470   4.962   1.00 0.00 ? 81  GLN A HE21 5  
ATOM 9836  H HE22 . GLN A 1 81  ? -38.183 1.971   5.624   1.00 0.00 ? 81  GLN A HE22 5  
ATOM 9837  N N    . ILE A 1 82  ? -37.168 6.335   0.453   1.00 0.00 ? 82  ILE A N    5  
ATOM 9838  C CA   . ILE A 1 82  ? -36.779 6.557   -0.948  1.00 0.00 ? 82  ILE A CA   5  
ATOM 9839  C C    . ILE A 1 82  ? -36.543 8.036   -1.233  1.00 0.00 ? 82  ILE A C    5  
ATOM 9840  O O    . ILE A 1 82  ? -35.483 8.387   -1.745  1.00 0.00 ? 82  ILE A O    5  
ATOM 9841  C CB   . ILE A 1 82  ? -37.801 5.927   -1.902  1.00 0.00 ? 82  ILE A CB   5  
ATOM 9842  C CG1  . ILE A 1 82  ? -37.499 4.418   -1.919  1.00 0.00 ? 82  ILE A CG1  5  
ATOM 9843  C CG2  . ILE A 1 82  ? -37.719 6.538   -3.310  1.00 0.00 ? 82  ILE A CG2  5  
ATOM 9844  C CD1  . ILE A 1 82  ? -38.684 3.597   -2.391  1.00 0.00 ? 82  ILE A CD1  5  
ATOM 9845  H H    . ILE A 1 82  ? -38.100 5.978   0.654   1.00 0.00 ? 82  ILE A H    5  
ATOM 9846  H HA   . ILE A 1 82  ? -35.824 6.062   -1.119  1.00 0.00 ? 82  ILE A HA   5  
ATOM 9847  H HB   . ILE A 1 82  ? -38.805 6.101   -1.512  1.00 0.00 ? 82  ILE A HB   5  
ATOM 9848  H HG12 . ILE A 1 82  ? -36.631 4.212   -2.547  1.00 0.00 ? 82  ILE A HG12 5  
ATOM 9849  H HG13 . ILE A 1 82  ? -37.277 4.088   -0.908  1.00 0.00 ? 82  ILE A HG13 5  
ATOM 9850  H HG21 . ILE A 1 82  ? -38.375 6.006   -3.998  1.00 0.00 ? 82  ILE A HG21 5  
ATOM 9851  H HG22 . ILE A 1 82  ? -38.037 7.581   -3.270  1.00 0.00 ? 82  ILE A HG22 5  
ATOM 9852  H HG23 . ILE A 1 82  ? -36.690 6.496   -3.671  1.00 0.00 ? 82  ILE A HG23 5  
ATOM 9853  H HD11 . ILE A 1 82  ? -38.433 2.539   -2.305  1.00 0.00 ? 82  ILE A HD11 5  
ATOM 9854  H HD12 . ILE A 1 82  ? -39.534 3.842   -1.751  1.00 0.00 ? 82  ILE A HD12 5  
ATOM 9855  H HD13 . ILE A 1 82  ? -38.917 3.827   -3.427  1.00 0.00 ? 82  ILE A HD13 5  
ATOM 9856  N N    . ALA A 1 83  ? -37.471 8.911   -0.846  1.00 0.00 ? 83  ALA A N    5  
ATOM 9857  C CA   . ALA A 1 83  ? -37.286 10.357  -0.954  1.00 0.00 ? 83  ALA A CA   5  
ATOM 9858  C C    . ALA A 1 83  ? -35.962 10.810  -0.314  1.00 0.00 ? 83  ALA A C    5  
ATOM 9859  O O    . ALA A 1 83  ? -35.255 11.621  -0.910  1.00 0.00 ? 83  ALA A O    5  
ATOM 9860  C CB   . ALA A 1 83  ? -38.486 11.071  -0.332  1.00 0.00 ? 83  ALA A CB   5  
ATOM 9861  H H    . ALA A 1 83  ? -38.332 8.557   -0.446  1.00 0.00 ? 83  ALA A H    5  
ATOM 9862  H HA   . ALA A 1 83  ? -37.244 10.619  -2.013  1.00 0.00 ? 83  ALA A HA   5  
ATOM 9863  H HB1  . ALA A 1 83  ? -38.520 10.886  0.739   1.00 0.00 ? 83  ALA A HB1  5  
ATOM 9864  H HB2  . ALA A 1 83  ? -38.387 12.145  -0.494  1.00 0.00 ? 83  ALA A HB2  5  
ATOM 9865  H HB3  . ALA A 1 83  ? -39.405 10.708  -0.793  1.00 0.00 ? 83  ALA A HB3  5  
ATOM 9866  N N    . GLN A 1 84  ? -35.586 10.232  0.837   1.00 0.00 ? 84  GLN A N    5  
ATOM 9867  C CA   . GLN A 1 84  ? -34.303 10.509  1.499   1.00 0.00 ? 84  GLN A CA   5  
ATOM 9868  C C    . GLN A 1 84  ? -33.107 10.073  0.633   1.00 0.00 ? 84  GLN A C    5  
ATOM 9869  O O    . GLN A 1 84  ? -32.117 10.808  0.518   1.00 0.00 ? 84  GLN A O    5  
ATOM 9870  C CB   . GLN A 1 84  ? -34.194 9.886   2.905   1.00 0.00 ? 84  GLN A CB   5  
ATOM 9871  C CG   . GLN A 1 84  ? -35.340 10.126  3.897   1.00 0.00 ? 84  GLN A CG   5  
ATOM 9872  C CD   . GLN A 1 84  ? -35.943 11.528  3.848   1.00 0.00 ? 84  GLN A CD   5  
ATOM 9873  O OE1  . GLN A 1 84  ? -35.376 12.500  4.329   1.00 0.00 ? 84  GLN A OE1  5  
ATOM 9874  N NE2  . GLN A 1 84  ? -37.112 11.680  3.262   1.00 0.00 ? 84  GLN A NE2  5  
ATOM 9875  H H    . GLN A 1 84  ? -36.186 9.501   1.201   1.00 0.00 ? 84  GLN A H    5  
ATOM 9876  H HA   . GLN A 1 84  ? -34.235 11.582  1.644   1.00 0.00 ? 84  GLN A HA   5  
ATOM 9877  H HB2  . GLN A 1 84  ? -34.044 8.811   2.816   1.00 0.00 ? 84  GLN A HB2  5  
ATOM 9878  H HB3  . GLN A 1 84  ? -33.299 10.293  3.362   1.00 0.00 ? 84  GLN A HB3  5  
ATOM 9879  H HG2  . GLN A 1 84  ? -36.111 9.391   3.726   1.00 0.00 ? 84  GLN A HG2  5  
ATOM 9880  H HG3  . GLN A 1 84  ? -34.979 9.939   4.906   1.00 0.00 ? 84  GLN A HG3  5  
ATOM 9881  H HE21 . GLN A 1 84  ? -37.564 10.873  2.848   1.00 0.00 ? 84  GLN A HE21 5  
ATOM 9882  H HE22 . GLN A 1 84  ? -37.522 12.601  3.230   1.00 0.00 ? 84  GLN A HE22 5  
ATOM 9883  N N    . ALA A 1 85  ? -33.217 8.921   -0.037  1.00 0.00 ? 85  ALA A N    5  
ATOM 9884  C CA   . ALA A 1 85  ? -32.174 8.448   -0.945  1.00 0.00 ? 85  ALA A CA   5  
ATOM 9885  C C    . ALA A 1 85  ? -32.056 9.323   -2.207  1.00 0.00 ? 85  ALA A C    5  
ATOM 9886  O O    . ALA A 1 85  ? -30.955 9.483   -2.737  1.00 0.00 ? 85  ALA A O    5  
ATOM 9887  C CB   . ALA A 1 85  ? -32.430 6.972   -1.277  1.00 0.00 ? 85  ALA A CB   5  
ATOM 9888  H H    . ALA A 1 85  ? -34.085 8.382   0.024   1.00 0.00 ? 85  ALA A H    5  
ATOM 9889  H HA   . ALA A 1 85  ? -31.220 8.518   -0.427  1.00 0.00 ? 85  ALA A HA   5  
ATOM 9890  H HB1  . ALA A 1 85  ? -33.363 6.861   -1.828  1.00 0.00 ? 85  ALA A HB1  5  
ATOM 9891  H HB2  . ALA A 1 85  ? -31.612 6.590   -1.888  1.00 0.00 ? 85  ALA A HB2  5  
ATOM 9892  H HB3  . ALA A 1 85  ? -32.483 6.389   -0.356  1.00 0.00 ? 85  ALA A HB3  5  
ATOM 9893  N N    . LEU A 1 86  ? -33.162 9.931   -2.660  1.00 0.00 ? 86  LEU A N    5  
ATOM 9894  C CA   . LEU A 1 86  ? -33.180 10.761  -3.869  1.00 0.00 ? 86  LEU A CA   5  
ATOM 9895  C C    . LEU A 1 86  ? -32.717 12.202  -3.608  1.00 0.00 ? 86  LEU A C    5  
ATOM 9896  O O    . LEU A 1 86  ? -32.030 12.784  -4.450  1.00 0.00 ? 86  LEU A O    5  
ATOM 9897  C CB   . LEU A 1 86  ? -34.551 10.730  -4.553  1.00 0.00 ? 86  LEU A CB   5  
ATOM 9898  C CG   . LEU A 1 86  ? -35.141 9.339   -4.865  1.00 0.00 ? 86  LEU A CG   5  
ATOM 9899  C CD1  . LEU A 1 86  ? -36.013 9.454   -6.104  1.00 0.00 ? 86  LEU A CD1  5  
ATOM 9900  C CD2  . LEU A 1 86  ? -34.133 8.222   -5.176  1.00 0.00 ? 86  LEU A CD2  5  
ATOM 9901  H H    . LEU A 1 86  ? -34.043 9.707   -2.208  1.00 0.00 ? 86  LEU A H    5  
ATOM 9902  H HA   . LEU A 1 86  ? -32.469 10.333  -4.574  1.00 0.00 ? 86  LEU A HA   5  
ATOM 9903  H HB2  . LEU A 1 86  ? -35.271 11.275  -3.940  1.00 0.00 ? 86  LEU A HB2  5  
ATOM 9904  H HB3  . LEU A 1 86  ? -34.439 11.283  -5.487  1.00 0.00 ? 86  LEU A HB3  5  
ATOM 9905  H HG   . LEU A 1 86  ? -35.775 9.048   -4.026  1.00 0.00 ? 86  LEU A HG   5  
ATOM 9906  H HD11 . LEU A 1 86  ? -35.392 9.688   -6.966  1.00 0.00 ? 86  LEU A HD11 5  
ATOM 9907  H HD12 . LEU A 1 86  ? -36.535 8.513   -6.274  1.00 0.00 ? 86  LEU A HD12 5  
ATOM 9908  H HD13 . LEU A 1 86  ? -36.731 10.259  -5.969  1.00 0.00 ? 86  LEU A HD13 5  
ATOM 9909  H HD21 . LEU A 1 86  ? -33.446 8.545   -5.959  1.00 0.00 ? 86  LEU A HD21 5  
ATOM 9910  H HD22 . LEU A 1 86  ? -33.569 7.962   -4.284  1.00 0.00 ? 86  LEU A HD22 5  
ATOM 9911  H HD23 . LEU A 1 86  ? -34.659 7.326   -5.504  1.00 0.00 ? 86  LEU A HD23 5  
ATOM 9912  N N    . LEU A 1 87  ? -33.037 12.770  -2.439  1.00 0.00 ? 87  LEU A N    5  
ATOM 9913  C CA   . LEU A 1 87  ? -32.423 14.038  -2.001  1.00 0.00 ? 87  LEU A CA   5  
ATOM 9914  C C    . LEU A 1 87  ? -30.943 13.860  -1.629  1.00 0.00 ? 87  LEU A C    5  
ATOM 9915  O O    . LEU A 1 87  ? -30.162 14.805  -1.768  1.00 0.00 ? 87  LEU A O    5  
ATOM 9916  C CB   . LEU A 1 87  ? -33.219 14.755  -0.894  1.00 0.00 ? 87  LEU A CB   5  
ATOM 9917  C CG   . LEU A 1 87  ? -33.534 13.979  0.394   1.00 0.00 ? 87  LEU A CG   5  
ATOM 9918  C CD1  . LEU A 1 87  ? -32.586 14.325  1.538   1.00 0.00 ? 87  LEU A CD1  5  
ATOM 9919  C CD2  . LEU A 1 87  ? -34.945 14.314  0.885   1.00 0.00 ? 87  LEU A CD2  5  
ATOM 9920  H H    . LEU A 1 87  ? -33.684 12.271  -1.833  1.00 0.00 ? 87  LEU A H    5  
ATOM 9921  H HA   . LEU A 1 87  ? -32.429 14.715  -2.857  1.00 0.00 ? 87  LEU A HA   5  
ATOM 9922  H HB2  . LEU A 1 87  ? -32.650 15.637  -0.609  1.00 0.00 ? 87  LEU A HB2  5  
ATOM 9923  H HB3  . LEU A 1 87  ? -34.153 15.085  -1.344  1.00 0.00 ? 87  LEU A HB3  5  
ATOM 9924  H HG   . LEU A 1 87  ? -33.459 12.921  0.196   1.00 0.00 ? 87  LEU A HG   5  
ATOM 9925  H HD11 . LEU A 1 87  ? -32.666 15.383  1.785   1.00 0.00 ? 87  LEU A HD11 5  
ATOM 9926  H HD12 . LEU A 1 87  ? -32.861 13.735  2.411   1.00 0.00 ? 87  LEU A HD12 5  
ATOM 9927  H HD13 . LEU A 1 87  ? -31.561 14.097  1.255   1.00 0.00 ? 87  LEU A HD13 5  
ATOM 9928  H HD21 . LEU A 1 87  ? -35.029 15.382  1.090   1.00 0.00 ? 87  LEU A HD21 5  
ATOM 9929  H HD22 . LEU A 1 87  ? -35.676 14.041  0.123   1.00 0.00 ? 87  LEU A HD22 5  
ATOM 9930  H HD23 . LEU A 1 87  ? -35.169 13.756  1.793   1.00 0.00 ? 87  LEU A HD23 5  
ATOM 9931  N N    . GLY A 1 88  ? -30.547 12.661  -1.188  1.00 0.00 ? 88  GLY A N    5  
ATOM 9932  C CA   . GLY A 1 88  ? -29.140 12.287  -1.026  1.00 0.00 ? 88  GLY A CA   5  
ATOM 9933  C C    . GLY A 1 88  ? -28.693 12.142  0.427   1.00 0.00 ? 88  GLY A C    5  
ATOM 9934  O O    . GLY A 1 88  ? -27.488 12.149  0.687   1.00 0.00 ? 88  GLY A O    5  
ATOM 9935  H H    . GLY A 1 88  ? -31.253 11.953  -0.995  1.00 0.00 ? 88  GLY A H    5  
ATOM 9936  H HA2  . GLY A 1 88  ? -28.989 11.323  -1.513  1.00 0.00 ? 88  GLY A HA2  5  
ATOM 9937  H HA3  . GLY A 1 88  ? -28.489 13.011  -1.516  1.00 0.00 ? 88  GLY A HA3  5  
ATOM 9938  N N    . ALA A 1 89  ? -29.636 12.029  1.373   1.00 0.00 ? 89  ALA A N    5  
ATOM 9939  C CA   . ALA A 1 89  ? -29.325 11.785  2.787   1.00 0.00 ? 89  ALA A CA   5  
ATOM 9940  C C    . ALA A 1 89  ? -28.407 10.555  2.974   1.00 0.00 ? 89  ALA A C    5  
ATOM 9941  O O    . ALA A 1 89  ? -27.379 10.633  3.650   1.00 0.00 ? 89  ALA A O    5  
ATOM 9942  C CB   . ALA A 1 89  ? -30.629 11.613  3.570   1.00 0.00 ? 89  ALA A CB   5  
ATOM 9943  H H    . ALA A 1 89  ? -30.613 12.067  1.083   1.00 0.00 ? 89  ALA A H    5  
ATOM 9944  H HA   . ALA A 1 89  ? -28.811 12.662  3.177   1.00 0.00 ? 89  ALA A HA   5  
ATOM 9945  H HB1  . ALA A 1 89  ? -31.246 12.505  3.471   1.00 0.00 ? 89  ALA A HB1  5  
ATOM 9946  H HB2  . ALA A 1 89  ? -31.167 10.745  3.194   1.00 0.00 ? 89  ALA A HB2  5  
ATOM 9947  H HB3  . ALA A 1 89  ? -30.403 11.461  4.626   1.00 0.00 ? 89  ALA A HB3  5  
ATOM 9948  N N    . GLU A 1 90  ? -28.771 9.425   2.354   1.00 0.00 ? 90  GLU A N    5  
ATOM 9949  C CA   . GLU A 1 90  ? -27.961 8.203   2.258   1.00 0.00 ? 90  GLU A CA   5  
ATOM 9950  C C    . GLU A 1 90  ? -28.358 7.352   1.035   1.00 0.00 ? 90  GLU A C    5  
ATOM 9951  O O    . GLU A 1 90  ? -29.539 7.221   0.714   1.00 0.00 ? 90  GLU A O    5  
ATOM 9952  C CB   . GLU A 1 90  ? -28.065 7.377   3.558   1.00 0.00 ? 90  GLU A CB   5  
ATOM 9953  C CG   . GLU A 1 90  ? -29.490 6.951   3.951   1.00 0.00 ? 90  GLU A CG   5  
ATOM 9954  C CD   . GLU A 1 90  ? -29.489 6.259   5.327   1.00 0.00 ? 90  GLU A CD   5  
ATOM 9955  O OE1  . GLU A 1 90  ? -29.218 5.035   5.398   1.00 0.00 ? 90  GLU A OE1  5  
ATOM 9956  O OE2  . GLU A 1 90  ? -29.761 6.931   6.352   1.00 0.00 ? 90  GLU A OE2  5  
ATOM 9957  H H    . GLU A 1 90  ? -29.641 9.433   1.840   1.00 0.00 ? 90  GLU A H    5  
ATOM 9958  H HA   . GLU A 1 90  ? -26.916 8.488   2.132   1.00 0.00 ? 90  GLU A HA   5  
ATOM 9959  H HB2  . GLU A 1 90  ? -27.451 6.483   3.447   1.00 0.00 ? 90  GLU A HB2  5  
ATOM 9960  H HB3  . GLU A 1 90  ? -27.644 7.964   4.375   1.00 0.00 ? 90  GLU A HB3  5  
ATOM 9961  H HG2  . GLU A 1 90  ? -30.140 7.830   3.981   1.00 0.00 ? 90  GLU A HG2  5  
ATOM 9962  H HG3  . GLU A 1 90  ? -29.887 6.268   3.197   1.00 0.00 ? 90  GLU A HG3  5  
ATOM 9963  N N    . GLU A 1 91  ? -27.385 6.739   0.357   1.00 0.00 ? 91  GLU A N    5  
ATOM 9964  C CA   . GLU A 1 91  ? -27.633 5.734   -0.690  1.00 0.00 ? 91  GLU A CA   5  
ATOM 9965  C C    . GLU A 1 91  ? -27.949 4.383   -0.028  1.00 0.00 ? 91  GLU A C    5  
ATOM 9966  O O    . GLU A 1 91  ? -27.074 3.775   0.598   1.00 0.00 ? 91  GLU A O    5  
ATOM 9967  C CB   . GLU A 1 91  ? -26.415 5.676   -1.629  1.00 0.00 ? 91  GLU A CB   5  
ATOM 9968  C CG   . GLU A 1 91  ? -26.572 4.680   -2.785  1.00 0.00 ? 91  GLU A CG   5  
ATOM 9969  C CD   . GLU A 1 91  ? -26.089 3.256   -2.447  1.00 0.00 ? 91  GLU A CD   5  
ATOM 9970  O OE1  . GLU A 1 91  ? -24.857 3.050   -2.322  1.00 0.00 ? 91  GLU A OE1  5  
ATOM 9971  O OE2  . GLU A 1 91  ? -26.929 2.329   -2.373  1.00 0.00 ? 91  GLU A OE2  5  
ATOM 9972  H H    . GLU A 1 91  ? -26.429 6.870   0.658   1.00 0.00 ? 91  GLU A H    5  
ATOM 9973  H HA   . GLU A 1 91  ? -28.496 6.029   -1.298  1.00 0.00 ? 91  GLU A HA   5  
ATOM 9974  H HB2  . GLU A 1 91  ? -26.296 6.667   -2.070  1.00 0.00 ? 91  GLU A HB2  5  
ATOM 9975  H HB3  . GLU A 1 91  ? -25.509 5.451   -1.065  1.00 0.00 ? 91  GLU A HB3  5  
ATOM 9976  H HG2  . GLU A 1 91  ? -27.621 4.661   -3.084  1.00 0.00 ? 91  GLU A HG2  5  
ATOM 9977  H HG3  . GLU A 1 91  ? -25.994 5.049   -3.634  1.00 0.00 ? 91  GLU A HG3  5  
ATOM 9978  N N    . ARG A 1 92  ? -29.210 3.932   -0.126  1.00 0.00 ? 92  ARG A N    5  
ATOM 9979  C CA   . ARG A 1 92  ? -29.693 2.679   0.479   1.00 0.00 ? 92  ARG A CA   5  
ATOM 9980  C C    . ARG A 1 92  ? -30.926 2.144   -0.262  1.00 0.00 ? 92  ARG A C    5  
ATOM 9981  O O    . ARG A 1 92  ? -31.770 2.923   -0.709  1.00 0.00 ? 92  ARG A O    5  
ATOM 9982  C CB   . ARG A 1 92  ? -29.984 2.931   1.980   1.00 0.00 ? 92  ARG A CB   5  
ATOM 9983  C CG   . ARG A 1 92  ? -29.754 1.714   2.894   1.00 0.00 ? 92  ARG A CG   5  
ATOM 9984  C CD   . ARG A 1 92  ? -30.996 0.838   3.060   1.00 0.00 ? 92  ARG A CD   5  
ATOM 9985  N NE   . ARG A 1 92  ? -30.859 -0.128  4.165   1.00 0.00 ? 92  ARG A NE   5  
ATOM 9986  C CZ   . ARG A 1 92  ? -31.674 -1.139  4.415   1.00 0.00 ? 92  ARG A CZ   5  
ATOM 9987  N NH1  . ARG A 1 92  ? -32.700 -1.408  3.657   1.00 0.00 ? 92  ARG A NH1  5  
ATOM 9988  N NH2  . ARG A 1 92  ? -31.470 -1.911  5.444   1.00 0.00 ? 92  ARG A NH2  5  
ATOM 9989  H H    . ARG A 1 92  ? -29.888 4.498   -0.625  1.00 0.00 ? 92  ARG A H    5  
ATOM 9990  H HA   . ARG A 1 92  ? -28.895 1.939   0.386   1.00 0.00 ? 92  ARG A HA   5  
ATOM 9991  H HB2  . ARG A 1 92  ? -29.300 3.703   2.336   1.00 0.00 ? 92  ARG A HB2  5  
ATOM 9992  H HB3  . ARG A 1 92  ? -30.993 3.327   2.112   1.00 0.00 ? 92  ARG A HB3  5  
ATOM 9993  H HG2  . ARG A 1 92  ? -28.935 1.107   2.505   1.00 0.00 ? 92  ARG A HG2  5  
ATOM 9994  H HG3  . ARG A 1 92  ? -29.471 2.088   3.879   1.00 0.00 ? 92  ARG A HG3  5  
ATOM 9995  H HD2  . ARG A 1 92  ? -31.870 1.467   3.237   1.00 0.00 ? 92  ARG A HD2  5  
ATOM 9996  H HD3  . ARG A 1 92  ? -31.130 0.283   2.137   1.00 0.00 ? 92  ARG A HD3  5  
ATOM 9997  H HE   . ARG A 1 92  ? -30.092 0.004   4.805   1.00 0.00 ? 92  ARG A HE   5  
ATOM 9998  H HH11 . ARG A 1 92  ? -32.874 -0.837  2.835   1.00 0.00 ? 92  ARG A HH11 5  
ATOM 9999  H HH12 . ARG A 1 92  ? -33.305 -2.182  3.868   1.00 0.00 ? 92  ARG A HH12 5  
ATOM 10000 H HH21 . ARG A 1 92  ? -30.690 -1.739  6.059   1.00 0.00 ? 92  ARG A HH21 5  
ATOM 10001 H HH22 . ARG A 1 92  ? -32.090 -2.679  5.635   1.00 0.00 ? 92  ARG A HH22 5  
ATOM 10002 N N    . LYS A 1 93  ? -31.047 0.816   -0.353  1.00 0.00 ? 93  LYS A N    5  
ATOM 10003 C CA   . LYS A 1 93  ? -32.191 0.106   -0.961  1.00 0.00 ? 93  LYS A CA   5  
ATOM 10004 C C    . LYS A 1 93  ? -33.408 0.094   -0.030  1.00 0.00 ? 93  LYS A C    5  
ATOM 10005 O O    . LYS A 1 93  ? -33.268 -0.078  1.182   1.00 0.00 ? 93  LYS A O    5  
ATOM 10006 C CB   . LYS A 1 93  ? -31.761 -1.326  -1.291  1.00 0.00 ? 93  LYS A CB   5  
ATOM 10007 C CG   . LYS A 1 93  ? -32.739 -2.107  -2.176  1.00 0.00 ? 93  LYS A CG   5  
ATOM 10008 C CD   . LYS A 1 93  ? -32.519 -3.616  -2.043  1.00 0.00 ? 93  LYS A CD   5  
ATOM 10009 C CE   . LYS A 1 93  ? -31.076 -4.005  -2.389  1.00 0.00 ? 93  LYS A CE   5  
ATOM 10010 N NZ   . LYS A 1 93  ? -30.903 -5.474  -2.482  1.00 0.00 ? 93  LYS A NZ   5  
ATOM 10011 H H    . LYS A 1 93  ? -30.298 0.266   0.045   1.00 0.00 ? 93  LYS A H    5  
ATOM 10012 H HA   . LYS A 1 93  ? -32.466 0.601   -1.894  1.00 0.00 ? 93  LYS A HA   5  
ATOM 10013 H HB2  . LYS A 1 93  ? -30.819 -1.285  -1.829  1.00 0.00 ? 93  LYS A HB2  5  
ATOM 10014 H HB3  . LYS A 1 93  ? -31.615 -1.868  -0.359  1.00 0.00 ? 93  LYS A HB3  5  
ATOM 10015 H HG2  . LYS A 1 93  ? -33.769 -1.887  -1.910  1.00 0.00 ? 93  LYS A HG2  5  
ATOM 10016 H HG3  . LYS A 1 93  ? -32.580 -1.809  -3.209  1.00 0.00 ? 93  LYS A HG3  5  
ATOM 10017 H HD2  . LYS A 1 93  ? -32.741 -3.909  -1.017  1.00 0.00 ? 93  LYS A HD2  5  
ATOM 10018 H HD3  . LYS A 1 93  ? -33.214 -4.127  -2.706  1.00 0.00 ? 93  LYS A HD3  5  
ATOM 10019 H HE2  . LYS A 1 93  ? -30.826 -3.552  -3.354  1.00 0.00 ? 93  LYS A HE2  5  
ATOM 10020 H HE3  . LYS A 1 93  ? -30.407 -3.591  -1.630  1.00 0.00 ? 93  LYS A HE3  5  
ATOM 10021 H HZ1  . LYS A 1 93  ? -29.927 -5.725  -2.556  1.00 0.00 ? 93  LYS A HZ1  5  
ATOM 10022 H HZ2  . LYS A 1 93  ? -31.301 -5.959  -1.691  1.00 0.00 ? 93  LYS A HZ2  5  
ATOM 10023 H HZ3  . LYS A 1 93  ? -31.352 -5.801  -3.340  1.00 0.00 ? 93  LYS A HZ3  5  
ATOM 10024 N N    . VAL A 1 94  ? -34.607 0.212   -0.594  1.00 0.00 ? 94  VAL A N    5  
ATOM 10025 C CA   . VAL A 1 94  ? -35.877 0.169   0.153   1.00 0.00 ? 94  VAL A CA   5  
ATOM 10026 C C    . VAL A 1 94  ? -36.895 -0.694  -0.591  1.00 0.00 ? 94  VAL A C    5  
ATOM 10027 O O    . VAL A 1 94  ? -36.929 -0.713  -1.820  1.00 0.00 ? 94  VAL A O    5  
ATOM 10028 C CB   . VAL A 1 94  ? -36.436 1.590   0.386   1.00 0.00 ? 94  VAL A CB   5  
ATOM 10029 C CG1  . VAL A 1 94  ? -37.446 1.620   1.540   1.00 0.00 ? 94  VAL A CG1  5  
ATOM 10030 C CG2  . VAL A 1 94  ? -35.366 2.639   0.727   1.00 0.00 ? 94  VAL A CG2  5  
ATOM 10031 H H    . VAL A 1 94  ? -34.652 0.329   -1.596  1.00 0.00 ? 94  VAL A H    5  
ATOM 10032 H HA   . VAL A 1 94  ? -35.713 -0.305  1.122   1.00 0.00 ? 94  VAL A HA   5  
ATOM 10033 H HB   . VAL A 1 94  ? -36.943 1.900   -0.524  1.00 0.00 ? 94  VAL A HB   5  
ATOM 10034 H HG11 . VAL A 1 94  ? -36.959 1.350   2.478   1.00 0.00 ? 94  VAL A HG11 5  
ATOM 10035 H HG12 . VAL A 1 94  ? -37.866 2.620   1.627   1.00 0.00 ? 94  VAL A HG12 5  
ATOM 10036 H HG13 . VAL A 1 94  ? -38.268 0.936   1.352   1.00 0.00 ? 94  VAL A HG13 5  
ATOM 10037 H HG21 . VAL A 1 94  ? -35.837 3.600   0.922   1.00 0.00 ? 94  VAL A HG21 5  
ATOM 10038 H HG22 . VAL A 1 94  ? -34.803 2.326   1.607   1.00 0.00 ? 94  VAL A HG22 5  
ATOM 10039 H HG23 . VAL A 1 94  ? -34.686 2.775   -0.114  1.00 0.00 ? 94  VAL A HG23 5  
ATOM 10040 N N    . GLU A 1 95  ? -37.735 -1.405  0.159   1.00 0.00 ? 95  GLU A N    5  
ATOM 10041 C CA   . GLU A 1 95  ? -38.892 -2.130  -0.367  1.00 0.00 ? 95  GLU A CA   5  
ATOM 10042 C C    . GLU A 1 95  ? -40.068 -1.164  -0.572  1.00 0.00 ? 95  GLU A C    5  
ATOM 10043 O O    . GLU A 1 95  ? -40.199 -0.199  0.173   1.00 0.00 ? 95  GLU A O    5  
ATOM 10044 C CB   . GLU A 1 95  ? -39.242 -3.290  0.579   1.00 0.00 ? 95  GLU A CB   5  
ATOM 10045 C CG   . GLU A 1 95  ? -39.774 -2.839  1.951   1.00 0.00 ? 95  GLU A CG   5  
ATOM 10046 C CD   . GLU A 1 95  ? -40.022 -4.047  2.875   1.00 0.00 ? 95  GLU A CD   5  
ATOM 10047 O OE1  . GLU A 1 95  ? -39.076 -4.481  3.579   1.00 0.00 ? 95  GLU A OE1  5  
ATOM 10048 O OE2  . GLU A 1 95  ? -41.166 -4.562  2.921   1.00 0.00 ? 95  GLU A OE2  5  
ATOM 10049 H H    . GLU A 1 95  ? -37.714 -1.262  1.156   1.00 0.00 ? 95  GLU A H    5  
ATOM 10050 H HA   . GLU A 1 95  ? -38.628 -2.552  -1.338  1.00 0.00 ? 95  GLU A HA   5  
ATOM 10051 H HB2  . GLU A 1 95  ? -39.987 -3.922  0.098   1.00 0.00 ? 95  GLU A HB2  5  
ATOM 10052 H HB3  . GLU A 1 95  ? -38.334 -3.876  0.732   1.00 0.00 ? 95  GLU A HB3  5  
ATOM 10053 H HG2  . GLU A 1 95  ? -39.048 -2.170  2.417   1.00 0.00 ? 95  GLU A HG2  5  
ATOM 10054 H HG3  . GLU A 1 95  ? -40.702 -2.273  1.821   1.00 0.00 ? 95  GLU A HG3  5  
ATOM 10055 N N    . ILE A 1 96  ? -40.919 -1.403  -1.567  1.00 0.00 ? 96  ILE A N    5  
ATOM 10056 C CA   . ILE A 1 96  ? -42.048 -0.532  -1.943  1.00 0.00 ? 96  ILE A CA   5  
ATOM 10057 C C    . ILE A 1 96  ? -43.096 -1.330  -2.729  1.00 0.00 ? 96  ILE A C    5  
ATOM 10058 O O    . ILE A 1 96  ? -42.794 -2.366  -3.329  1.00 0.00 ? 96  ILE A O    5  
ATOM 10059 C CB   . ILE A 1 96  ? -41.646 0.723   -2.779  1.00 0.00 ? 96  ILE A CB   5  
ATOM 10060 C CG1  . ILE A 1 96  ? -40.317 0.654   -3.557  1.00 0.00 ? 96  ILE A CG1  5  
ATOM 10061 C CG2  . ILE A 1 96  ? -41.619 1.988   -1.913  1.00 0.00 ? 96  ILE A CG2  5  
ATOM 10062 C CD1  . ILE A 1 96  ? -40.247 -0.518  -4.528  1.00 0.00 ? 96  ILE A CD1  5  
ATOM 10063 H H    . ILE A 1 96  ? -40.825 -2.267  -2.085  1.00 0.00 ? 96  ILE A H    5  
ATOM 10064 H HA   . ILE A 1 96  ? -42.512 -0.200  -1.014  1.00 0.00 ? 96  ILE A HA   5  
ATOM 10065 H HB   . ILE A 1 96  ? -42.431 0.905   -3.515  1.00 0.00 ? 96  ILE A HB   5  
ATOM 10066 H HG12 . ILE A 1 96  ? -40.198 1.573   -4.133  1.00 0.00 ? 96  ILE A HG12 5  
ATOM 10067 H HG13 . ILE A 1 96  ? -39.482 0.576   -2.861  1.00 0.00 ? 96  ILE A HG13 5  
ATOM 10068 H HG21 . ILE A 1 96  ? -42.551 2.109   -1.359  1.00 0.00 ? 96  ILE A HG21 5  
ATOM 10069 H HG22 . ILE A 1 96  ? -40.773 1.938   -1.231  1.00 0.00 ? 96  ILE A HG22 5  
ATOM 10070 H HG23 . ILE A 1 96  ? -41.486 2.865   -2.542  1.00 0.00 ? 96  ILE A HG23 5  
ATOM 10071 H HD11 . ILE A 1 96  ? -41.143 -0.545  -5.142  1.00 0.00 ? 96  ILE A HD11 5  
ATOM 10072 H HD12 . ILE A 1 96  ? -39.360 -0.426  -5.153  1.00 0.00 ? 96  ILE A HD12 5  
ATOM 10073 H HD13 . ILE A 1 96  ? -40.184 -1.443  -3.969  1.00 0.00 ? 96  ILE A HD13 5  
ATOM 10074 N N    . ALA A 1 97  ? -44.335 -0.834  -2.716  1.00 0.00 ? 97  ALA A N    5  
ATOM 10075 C CA   . ALA A 1 97  ? -45.453 -1.392  -3.486  1.00 0.00 ? 97  ALA A CA   5  
ATOM 10076 C C    . ALA A 1 97  ? -45.886 -0.475  -4.636  1.00 0.00 ? 97  ALA A C    5  
ATOM 10077 O O    . ALA A 1 97  ? -45.881 0.749   -4.502  1.00 0.00 ? 97  ALA A O    5  
ATOM 10078 C CB   . ALA A 1 97  ? -46.631 -1.737  -2.564  1.00 0.00 ? 97  ALA A CB   5  
ATOM 10079 H H    . ALA A 1 97  ? -44.481 0.022   -2.197  1.00 0.00 ? 97  ALA A H    5  
ATOM 10080 H HA   . ALA A 1 97  ? -45.121 -2.321  -3.946  1.00 0.00 ? 97  ALA A HA   5  
ATOM 10081 H HB1  . ALA A 1 97  ? -46.912 -0.876  -1.973  1.00 0.00 ? 97  ALA A HB1  5  
ATOM 10082 H HB2  . ALA A 1 97  ? -47.489 -2.048  -3.161  1.00 0.00 ? 97  ALA A HB2  5  
ATOM 10083 H HB3  . ALA A 1 97  ? -46.364 -2.549  -1.897  1.00 0.00 ? 97  ALA A HB3  5  
ATOM 10084 N N    . PHE A 1 98  ? -46.308 -1.074  -5.747  1.00 0.00 ? 98  PHE A N    5  
ATOM 10085 C CA   . PHE A 1 98  ? -46.702 -0.378  -6.975  1.00 0.00 ? 98  PHE A CA   5  
ATOM 10086 C C    . PHE A 1 98  ? -48.056 -0.872  -7.489  1.00 0.00 ? 98  PHE A C    5  
ATOM 10087 O O    . PHE A 1 98  ? -48.439 -2.015  -7.216  1.00 0.00 ? 98  PHE A O    5  
ATOM 10088 C CB   . PHE A 1 98  ? -45.624 -0.594  -8.053  1.00 0.00 ? 98  PHE A CB   5  
ATOM 10089 C CG   . PHE A 1 98  ? -44.232 -0.078  -7.727  1.00 0.00 ? 98  PHE A CG   5  
ATOM 10090 C CD1  . PHE A 1 98  ? -44.064 1.193   -7.143  1.00 0.00 ? 98  PHE A CD1  5  
ATOM 10091 C CD2  . PHE A 1 98  ? -43.093 -0.842  -8.055  1.00 0.00 ? 98  PHE A CD2  5  
ATOM 10092 C CE1  . PHE A 1 98  ? -42.779 1.704   -6.910  1.00 0.00 ? 98  PHE A CE1  5  
ATOM 10093 C CE2  . PHE A 1 98  ? -41.807 -0.324  -7.827  1.00 0.00 ? 98  PHE A CE2  5  
ATOM 10094 C CZ   . PHE A 1 98  ? -41.648 0.956   -7.269  1.00 0.00 ? 98  PHE A CZ   5  
ATOM 10095 H H    . PHE A 1 98  ? -46.374 -2.089  -5.738  1.00 0.00 ? 98  PHE A H    5  
ATOM 10096 H HA   . PHE A 1 98  ? -46.803 0.691   -6.786  1.00 0.00 ? 98  PHE A HA   5  
ATOM 10097 H HB2  . PHE A 1 98  ? -45.563 -1.662  -8.266  1.00 0.00 ? 98  PHE A HB2  5  
ATOM 10098 H HB3  . PHE A 1 98  ? -45.949 -0.099  -8.969  1.00 0.00 ? 98  PHE A HB3  5  
ATOM 10099 H HD1  . PHE A 1 98  ? -44.921 1.796   -6.879  1.00 0.00 ? 98  PHE A HD1  5  
ATOM 10100 H HD2  . PHE A 1 98  ? -43.192 -1.827  -8.492  1.00 0.00 ? 98  PHE A HD2  5  
ATOM 10101 H HE1  . PHE A 1 98  ? -42.673 2.680   -6.467  1.00 0.00 ? 98  PHE A HE1  5  
ATOM 10102 H HE2  . PHE A 1 98  ? -40.940 -0.915  -8.076  1.00 0.00 ? 98  PHE A HE2  5  
ATOM 10103 H HZ   . PHE A 1 98  ? -40.659 1.356   -7.096  1.00 0.00 ? 98  PHE A HZ   5  
ATOM 10104 N N    . TYR A 1 99  ? -48.754 -0.036  -8.269  1.00 0.00 ? 99  TYR A N    5  
ATOM 10105 C CA   . TYR A 1 99  ? -49.941 -0.455  -9.020  1.00 0.00 ? 99  TYR A CA   5  
ATOM 10106 C C    . TYR A 1 99  ? -49.765 -0.249  -10.532 1.00 0.00 ? 99  TYR A C    5  
ATOM 10107 O O    . TYR A 1 99  ? -49.224 0.763   -10.991 1.00 0.00 ? 99  TYR A O    5  
ATOM 10108 C CB   . TYR A 1 99  ? -51.237 0.176   -8.485  1.00 0.00 ? 99  TYR A CB   5  
ATOM 10109 C CG   . TYR A 1 99  ? -51.515 1.603   -8.923  1.00 0.00 ? 99  TYR A CG   5  
ATOM 10110 C CD1  . TYR A 1 99  ? -50.838 2.677   -8.317  1.00 0.00 ? 99  TYR A CD1  5  
ATOM 10111 C CD2  . TYR A 1 99  ? -52.453 1.857   -9.945  1.00 0.00 ? 99  TYR A CD2  5  
ATOM 10112 C CE1  . TYR A 1 99  ? -51.090 3.999   -8.730  1.00 0.00 ? 99  TYR A CE1  5  
ATOM 10113 C CE2  . TYR A 1 99  ? -52.710 3.178   -10.361 1.00 0.00 ? 99  TYR A CE2  5  
ATOM 10114 C CZ   . TYR A 1 99  ? -52.025 4.255   -9.756  1.00 0.00 ? 99  TYR A CZ   5  
ATOM 10115 O OH   . TYR A 1 99  ? -52.264 5.537   -10.148 1.00 0.00 ? 99  TYR A OH   5  
ATOM 10116 H H    . TYR A 1 99  ? -48.382 0.887   -8.454  1.00 0.00 ? 99  TYR A H    5  
ATOM 10117 H HA   . TYR A 1 99  ? -50.048 -1.523  -8.872  1.00 0.00 ? 99  TYR A HA   5  
ATOM 10118 H HB2  . TYR A 1 99  ? -52.069 -0.450  -8.812  1.00 0.00 ? 99  TYR A HB2  5  
ATOM 10119 H HB3  . TYR A 1 99  ? -51.226 0.137   -7.396  1.00 0.00 ? 99  TYR A HB3  5  
ATOM 10120 H HD1  . TYR A 1 99  ? -50.117 2.481   -7.540  1.00 0.00 ? 99  TYR A HD1  5  
ATOM 10121 H HD2  . TYR A 1 99  ? -52.971 1.036   -10.421 1.00 0.00 ? 99  TYR A HD2  5  
ATOM 10122 H HE1  . TYR A 1 99  ? -50.569 4.824   -8.268  1.00 0.00 ? 99  TYR A HE1  5  
ATOM 10123 H HE2  . TYR A 1 99  ? -53.422 3.367   -11.152 1.00 0.00 ? 99  TYR A HE2  5  
ATOM 10124 H HH   . TYR A 1 99  ? -52.926 5.586   -10.859 1.00 0.00 ? 99  TYR A HH   5  
ATOM 10125 N N    . ARG A 1 100 ? -50.223 -1.235  -11.309 1.00 0.00 ? 100 ARG A N    5  
ATOM 10126 C CA   . ARG A 1 100 ? -50.207 -1.238  -12.775 1.00 0.00 ? 100 ARG A CA   5  
ATOM 10127 C C    . ARG A 1 100 ? -51.357 -0.434  -13.383 1.00 0.00 ? 100 ARG A C    5  
ATOM 10128 O O    . ARG A 1 100 ? -52.362 -0.158  -12.726 1.00 0.00 ? 100 ARG A O    5  
ATOM 10129 C CB   . ARG A 1 100 ? -50.250 -2.682  -13.294 1.00 0.00 ? 100 ARG A CB   5  
ATOM 10130 C CG   . ARG A 1 100 ? -49.139 -3.576  -12.733 1.00 0.00 ? 100 ARG A CG   5  
ATOM 10131 C CD   . ARG A 1 100 ? -49.034 -4.872  -13.544 1.00 0.00 ? 100 ARG A CD   5  
ATOM 10132 N NE   . ARG A 1 100 ? -48.310 -4.646  -14.807 1.00 0.00 ? 100 ARG A NE   5  
ATOM 10133 C CZ   . ARG A 1 100 ? -48.767 -4.749  -16.045 1.00 0.00 ? 100 ARG A CZ   5  
ATOM 10134 N NH1  . ARG A 1 100 ? -50.024 -4.916  -16.335 1.00 0.00 ? 100 ARG A NH1  5  
ATOM 10135 N NH2  . ARG A 1 100 ? -47.954 -4.680  -17.056 1.00 0.00 ? 100 ARG A NH2  5  
ATOM 10136 H H    . ARG A 1 100 ? -50.600 -2.058  -10.847 1.00 0.00 ? 100 ARG A H    5  
ATOM 10137 H HA   . ARG A 1 100 ? -49.279 -0.774  -13.113 1.00 0.00 ? 100 ARG A HA   5  
ATOM 10138 H HB2  . ARG A 1 100 ? -51.213 -3.122  -13.030 1.00 0.00 ? 100 ARG A HB2  5  
ATOM 10139 H HB3  . ARG A 1 100 ? -50.168 -2.655  -14.382 1.00 0.00 ? 100 ARG A HB3  5  
ATOM 10140 H HG2  . ARG A 1 100 ? -48.182 -3.051  -12.759 1.00 0.00 ? 100 ARG A HG2  5  
ATOM 10141 H HG3  . ARG A 1 100 ? -49.372 -3.824  -11.697 1.00 0.00 ? 100 ARG A HG3  5  
ATOM 10142 H HD2  . ARG A 1 100 ? -48.471 -5.599  -12.958 1.00 0.00 ? 100 ARG A HD2  5  
ATOM 10143 H HD3  . ARG A 1 100 ? -50.029 -5.285  -13.717 1.00 0.00 ? 100 ARG A HD3  5  
ATOM 10144 H HE   . ARG A 1 100 ? -47.336 -4.379  -14.701 1.00 0.00 ? 100 ARG A HE   5  
ATOM 10145 H HH11 . ARG A 1 100 ? -50.740 -4.850  -15.609 1.00 0.00 ? 100 ARG A HH11 5  
ATOM 10146 H HH12 . ARG A 1 100 ? -50.321 -5.002  -17.289 1.00 0.00 ? 100 ARG A HH12 5  
ATOM 10147 H HH21 . ARG A 1 100 ? -46.950 -4.656  -16.908 1.00 0.00 ? 100 ARG A HH21 5  
ATOM 10148 H HH22 . ARG A 1 100 ? -48.302 -4.789  -17.991 1.00 0.00 ? 100 ARG A HH22 5  
ATOM 10149 N N    . LYS A 1 101 ? -51.250 -0.163  -14.685 1.00 0.00 ? 101 LYS A N    5  
ATOM 10150 C CA   . LYS A 1 101 ? -52.255 0.501   -15.528 1.00 0.00 ? 101 LYS A CA   5  
ATOM 10151 C C    . LYS A 1 101 ? -53.617 -0.210  -15.516 1.00 0.00 ? 101 LYS A C    5  
ATOM 10152 O O    . LYS A 1 101 ? -54.655 0.446   -15.587 1.00 0.00 ? 101 LYS A O    5  
ATOM 10153 C CB   . LYS A 1 101 ? -51.629 0.613   -16.932 1.00 0.00 ? 101 LYS A CB   5  
ATOM 10154 C CG   . LYS A 1 101 ? -52.538 1.225   -18.006 1.00 0.00 ? 101 LYS A CG   5  
ATOM 10155 C CD   . LYS A 1 101 ? -53.251 0.127   -18.807 1.00 0.00 ? 101 LYS A CD   5  
ATOM 10156 C CE   . LYS A 1 101 ? -54.228 0.748   -19.812 1.00 0.00 ? 101 LYS A CE   5  
ATOM 10157 N NZ   . LYS A 1 101 ? -54.885 -0.288  -20.652 1.00 0.00 ? 101 LYS A NZ   5  
ATOM 10158 H H    . LYS A 1 101 ? -50.399 -0.470  -15.137 1.00 0.00 ? 101 LYS A H    5  
ATOM 10159 H HA   . LYS A 1 101 ? -52.426 1.507   -15.147 1.00 0.00 ? 101 LYS A HA   5  
ATOM 10160 H HB2  . LYS A 1 101 ? -50.740 1.238   -16.850 1.00 0.00 ? 101 LYS A HB2  5  
ATOM 10161 H HB3  . LYS A 1 101 ? -51.290 -0.372  -17.262 1.00 0.00 ? 101 LYS A HB3  5  
ATOM 10162 H HG2  . LYS A 1 101 ? -53.262 1.900   -17.547 1.00 0.00 ? 101 LYS A HG2  5  
ATOM 10163 H HG3  . LYS A 1 101 ? -51.922 1.806   -18.695 1.00 0.00 ? 101 LYS A HG3  5  
ATOM 10164 H HD2  . LYS A 1 101 ? -52.495 -0.460  -19.330 1.00 0.00 ? 101 LYS A HD2  5  
ATOM 10165 H HD3  . LYS A 1 101 ? -53.791 -0.535  -18.132 1.00 0.00 ? 101 LYS A HD3  5  
ATOM 10166 H HE2  . LYS A 1 101 ? -54.984 1.312   -19.258 1.00 0.00 ? 101 LYS A HE2  5  
ATOM 10167 H HE3  . LYS A 1 101 ? -53.680 1.450   -20.447 1.00 0.00 ? 101 LYS A HE3  5  
ATOM 10168 H HZ1  . LYS A 1 101 ? -54.205 -0.814  -21.185 1.00 0.00 ? 101 LYS A HZ1  5  
ATOM 10169 H HZ2  . LYS A 1 101 ? -55.414 -0.939  -20.089 1.00 0.00 ? 101 LYS A HZ2  5  
ATOM 10170 H HZ3  . LYS A 1 101 ? -55.526 0.133   -21.311 1.00 0.00 ? 101 LYS A HZ3  5  
ATOM 10171 N N    . ASP A 1 102 ? -53.626 -1.537  -15.379 1.00 0.00 ? 102 ASP A N    5  
ATOM 10172 C CA   . ASP A 1 102 ? -54.844 -2.356  -15.249 1.00 0.00 ? 102 ASP A CA   5  
ATOM 10173 C C    . ASP A 1 102 ? -55.480 -2.331  -13.837 1.00 0.00 ? 102 ASP A C    5  
ATOM 10174 O O    . ASP A 1 102 ? -56.601 -2.813  -13.657 1.00 0.00 ? 102 ASP A O    5  
ATOM 10175 C CB   . ASP A 1 102 ? -54.528 -3.795  -15.685 1.00 0.00 ? 102 ASP A CB   5  
ATOM 10176 C CG   . ASP A 1 102 ? -53.568 -4.489  -14.712 1.00 0.00 ? 102 ASP A CG   5  
ATOM 10177 O OD1  . ASP A 1 102 ? -54.029 -5.017  -13.676 1.00 0.00 ? 102 ASP A OD1  5  
ATOM 10178 O OD2  . ASP A 1 102 ? -52.344 -4.469  -14.965 1.00 0.00 ? 102 ASP A OD2  5  
ATOM 10179 H H    . ASP A 1 102 ? -52.735 -2.013  -15.364 1.00 0.00 ? 102 ASP A H    5  
ATOM 10180 H HA   . ASP A 1 102 ? -55.591 -1.964  -15.941 1.00 0.00 ? 102 ASP A HA   5  
ATOM 10181 H HB2  . ASP A 1 102 ? -55.458 -4.362  -15.742 1.00 0.00 ? 102 ASP A HB2  5  
ATOM 10182 H HB3  . ASP A 1 102 ? -54.093 -3.778  -16.687 1.00 0.00 ? 102 ASP A HB3  5  
ATOM 10183 N N    . GLY A 1 103 ? -54.786 -1.762  -12.841 1.00 0.00 ? 103 GLY A N    5  
ATOM 10184 C CA   . GLY A 1 103 ? -55.226 -1.651  -11.445 1.00 0.00 ? 103 GLY A CA   5  
ATOM 10185 C C    . GLY A 1 103 ? -54.662 -2.706  -10.479 1.00 0.00 ? 103 GLY A C    5  
ATOM 10186 O O    . GLY A 1 103 ? -54.962 -2.636  -9.285  1.00 0.00 ? 103 GLY A O    5  
ATOM 10187 H H    . GLY A 1 103 ? -53.900 -1.330  -13.071 1.00 0.00 ? 103 GLY A H    5  
ATOM 10188 H HA2  . GLY A 1 103 ? -54.924 -0.671  -11.074 1.00 0.00 ? 103 GLY A HA2  5  
ATOM 10189 H HA3  . GLY A 1 103 ? -56.314 -1.701  -11.399 1.00 0.00 ? 103 GLY A HA3  5  
ATOM 10190 N N    . SER A 1 104 ? -53.842 -3.659  -10.940 1.00 0.00 ? 104 SER A N    5  
ATOM 10191 C CA   . SER A 1 104 ? -53.217 -4.672  -10.061 1.00 0.00 ? 104 SER A CA   5  
ATOM 10192 C C    . SER A 1 104 ? -52.153 -4.037  -9.160  1.00 0.00 ? 104 SER A C    5  
ATOM 10193 O O    . SER A 1 104 ? -51.271 -3.347  -9.667  1.00 0.00 ? 104 SER A O    5  
ATOM 10194 C CB   . SER A 1 104 ? -52.580 -5.809  -10.869 1.00 0.00 ? 104 SER A CB   5  
ATOM 10195 O OG   . SER A 1 104 ? -53.563 -6.538  -11.580 1.00 0.00 ? 104 SER A OG   5  
ATOM 10196 H H    . SER A 1 104 ? -53.631 -3.681  -11.932 1.00 0.00 ? 104 SER A H    5  
ATOM 10197 H HA   . SER A 1 104 ? -53.989 -5.109  -9.425  1.00 0.00 ? 104 SER A HA   5  
ATOM 10198 H HB2  . SER A 1 104 ? -51.846 -5.401  -11.567 1.00 0.00 ? 104 SER A HB2  5  
ATOM 10199 H HB3  . SER A 1 104 ? -52.069 -6.488  -10.184 1.00 0.00 ? 104 SER A HB3  5  
ATOM 10200 H HG   . SER A 1 104 ? -53.796 -5.992  -12.373 1.00 0.00 ? 104 SER A HG   5  
ATOM 10201 N N    . CYS A 1 105 ? -52.218 -4.269  -7.842  1.00 0.00 ? 105 CYS A N    5  
ATOM 10202 C CA   . CYS A 1 105 ? -51.402 -3.583  -6.830  1.00 0.00 ? 105 CYS A CA   5  
ATOM 10203 C C    . CYS A 1 105 ? -50.690 -4.573  -5.887  1.00 0.00 ? 105 CYS A C    5  
ATOM 10204 O O    . CYS A 1 105 ? -51.343 -5.436  -5.292  1.00 0.00 ? 105 CYS A O    5  
ATOM 10205 C CB   . CYS A 1 105 ? -52.322 -2.622  -6.064  1.00 0.00 ? 105 CYS A CB   5  
ATOM 10206 S SG   . CYS A 1 105 ? -51.363 -1.625  -4.889  1.00 0.00 ? 105 CYS A SG   5  
ATOM 10207 H H    . CYS A 1 105 ? -52.946 -4.881  -7.504  1.00 0.00 ? 105 CYS A H    5  
ATOM 10208 H HA   . CYS A 1 105 ? -50.636 -2.990  -7.325  1.00 0.00 ? 105 CYS A HA   5  
ATOM 10209 H HB2  . CYS A 1 105 ? -52.826 -1.960  -6.770  1.00 0.00 ? 105 CYS A HB2  5  
ATOM 10210 H HB3  . CYS A 1 105 ? -53.077 -3.195  -5.523  1.00 0.00 ? 105 CYS A HB3  5  
ATOM 10211 H HG   . CYS A 1 105 ? -52.420 -1.000  -4.345  1.00 0.00 ? 105 CYS A HG   5  
ATOM 10212 N N    . PHE A 1 106 ? -49.362 -4.470  -5.758  1.00 0.00 ? 106 PHE A N    5  
ATOM 10213 C CA   . PHE A 1 106 ? -48.521 -5.445  -5.039  1.00 0.00 ? 106 PHE A CA   5  
ATOM 10214 C C    . PHE A 1 106 ? -47.237 -4.865  -4.407  1.00 0.00 ? 106 PHE A C    5  
ATOM 10215 O O    . PHE A 1 106 ? -46.630 -3.938  -4.950  1.00 0.00 ? 106 PHE A O    5  
ATOM 10216 C CB   . PHE A 1 106 ? -48.170 -6.601  -5.998  1.00 0.00 ? 106 PHE A CB   5  
ATOM 10217 C CG   . PHE A 1 106 ? -47.772 -6.182  -7.407  1.00 0.00 ? 106 PHE A CG   5  
ATOM 10218 C CD1  . PHE A 1 106 ? -46.494 -5.650  -7.669  1.00 0.00 ? 106 PHE A CD1  5  
ATOM 10219 C CD2  . PHE A 1 106 ? -48.702 -6.298  -8.460  1.00 0.00 ? 106 PHE A CD2  5  
ATOM 10220 C CE1  . PHE A 1 106 ? -46.155 -5.224  -8.967  1.00 0.00 ? 106 PHE A CE1  5  
ATOM 10221 C CE2  . PHE A 1 106 ? -48.360 -5.885  -9.759  1.00 0.00 ? 106 PHE A CE2  5  
ATOM 10222 C CZ   . PHE A 1 106 ? -47.087 -5.343  -10.013 1.00 0.00 ? 106 PHE A CZ   5  
ATOM 10223 H H    . PHE A 1 106 ? -48.888 -3.719  -6.254  1.00 0.00 ? 106 PHE A H    5  
ATOM 10224 H HA   . PHE A 1 106 ? -49.100 -5.864  -4.216  1.00 0.00 ? 106 PHE A HA   5  
ATOM 10225 H HB2  . PHE A 1 106 ? -47.367 -7.202  -5.567  1.00 0.00 ? 106 PHE A HB2  5  
ATOM 10226 H HB3  . PHE A 1 106 ? -49.042 -7.253  -6.068  1.00 0.00 ? 106 PHE A HB3  5  
ATOM 10227 H HD1  . PHE A 1 106 ? -45.771 -5.553  -6.872  1.00 0.00 ? 106 PHE A HD1  5  
ATOM 10228 H HD2  . PHE A 1 106 ? -49.687 -6.703  -8.271  1.00 0.00 ? 106 PHE A HD2  5  
ATOM 10229 H HE1  . PHE A 1 106 ? -45.179 -4.803  -9.159  1.00 0.00 ? 106 PHE A HE1  5  
ATOM 10230 H HE2  . PHE A 1 106 ? -49.079 -5.982  -10.560 1.00 0.00 ? 106 PHE A HE2  5  
ATOM 10231 H HZ   . PHE A 1 106 ? -46.822 -5.019  -11.011 1.00 0.00 ? 106 PHE A HZ   5  
ATOM 10232 N N    . LEU A 1 107 ? -46.799 -5.469  -3.291  1.00 0.00 ? 107 LEU A N    5  
ATOM 10233 C CA   . LEU A 1 107 ? -45.482 -5.291  -2.655  1.00 0.00 ? 107 LEU A CA   5  
ATOM 10234 C C    . LEU A 1 107 ? -44.609 -6.490  -3.073  1.00 0.00 ? 107 LEU A C    5  
ATOM 10235 O O    . LEU A 1 107 ? -44.994 -7.639  -2.847  1.00 0.00 ? 107 LEU A O    5  
ATOM 10236 C CB   . LEU A 1 107 ? -45.645 -5.234  -1.113  1.00 0.00 ? 107 LEU A CB   5  
ATOM 10237 C CG   . LEU A 1 107 ? -44.447 -4.761  -0.244  1.00 0.00 ? 107 LEU A CG   5  
ATOM 10238 C CD1  . LEU A 1 107 ? -43.055 -5.185  -0.711  1.00 0.00 ? 107 LEU A CD1  5  
ATOM 10239 C CD2  . LEU A 1 107 ? -44.432 -3.251  -0.047  1.00 0.00 ? 107 LEU A CD2  5  
ATOM 10240 H H    . LEU A 1 107 ? -47.363 -6.216  -2.912  1.00 0.00 ? 107 LEU A H    5  
ATOM 10241 H HA   . LEU A 1 107 ? -45.020 -4.366  -3.001  1.00 0.00 ? 107 LEU A HA   5  
ATOM 10242 H HB2  . LEU A 1 107 ? -46.504 -4.607  -0.873  1.00 0.00 ? 107 LEU A HB2  5  
ATOM 10243 H HB3  . LEU A 1 107 ? -45.909 -6.236  -0.773  1.00 0.00 ? 107 LEU A HB3  5  
ATOM 10244 H HG   . LEU A 1 107 ? -44.595 -5.164  0.750   1.00 0.00 ? 107 LEU A HG   5  
ATOM 10245 H HD11 . LEU A 1 107 ? -42.790 -4.652  -1.623  1.00 0.00 ? 107 LEU A HD11 5  
ATOM 10246 H HD12 . LEU A 1 107 ? -42.317 -4.941  0.050   1.00 0.00 ? 107 LEU A HD12 5  
ATOM 10247 H HD13 . LEU A 1 107 ? -43.012 -6.261  -0.887  1.00 0.00 ? 107 LEU A HD13 5  
ATOM 10248 H HD21 . LEU A 1 107 ? -45.375 -2.922  0.388   1.00 0.00 ? 107 LEU A HD21 5  
ATOM 10249 H HD22 . LEU A 1 107 ? -43.620 -2.971  0.625   1.00 0.00 ? 107 LEU A HD22 5  
ATOM 10250 H HD23 . LEU A 1 107 ? -44.284 -2.777  -1.003  1.00 0.00 ? 107 LEU A HD23 5  
ATOM 10251 N N    . CYS A 1 108 ? -43.435 -6.227  -3.646  1.00 0.00 ? 108 CYS A N    5  
ATOM 10252 C CA   . CYS A 1 108 ? -42.393 -7.230  -3.912  1.00 0.00 ? 108 CYS A CA   5  
ATOM 10253 C C    . CYS A 1 108 ? -41.054 -6.789  -3.288  1.00 0.00 ? 108 CYS A C    5  
ATOM 10254 O O    . CYS A 1 108 ? -40.902 -5.632  -2.890  1.00 0.00 ? 108 CYS A O    5  
ATOM 10255 C CB   . CYS A 1 108 ? -42.296 -7.446  -5.428  1.00 0.00 ? 108 CYS A CB   5  
ATOM 10256 S SG   . CYS A 1 108 ? -43.890 -8.043  -6.072  1.00 0.00 ? 108 CYS A SG   5  
ATOM 10257 H H    . CYS A 1 108 ? -43.174 -5.258  -3.767  1.00 0.00 ? 108 CYS A H    5  
ATOM 10258 H HA   . CYS A 1 108 ? -42.661 -8.181  -3.450  1.00 0.00 ? 108 CYS A HA   5  
ATOM 10259 H HB2  . CYS A 1 108 ? -42.032 -6.504  -5.914  1.00 0.00 ? 108 CYS A HB2  5  
ATOM 10260 H HB3  . CYS A 1 108 ? -41.526 -8.188  -5.645  1.00 0.00 ? 108 CYS A HB3  5  
ATOM 10261 H HG   . CYS A 1 108 ? -44.636 -7.036  -5.594  1.00 0.00 ? 108 CYS A HG   5  
ATOM 10262 N N    . LEU A 1 109 ? -40.051 -7.670  -3.221  1.00 0.00 ? 109 LEU A N    5  
ATOM 10263 C CA   . LEU A 1 109 ? -38.723 -7.340  -2.679  1.00 0.00 ? 109 LEU A CA   5  
ATOM 10264 C C    . LEU A 1 109 ? -37.891 -6.574  -3.732  1.00 0.00 ? 109 LEU A C    5  
ATOM 10265 O O    . LEU A 1 109 ? -36.848 -7.032  -4.197  1.00 0.00 ? 109 LEU A O    5  
ATOM 10266 C CB   . LEU A 1 109 ? -38.073 -8.627  -2.115  1.00 0.00 ? 109 LEU A CB   5  
ATOM 10267 C CG   . LEU A 1 109 ? -37.079 -8.449  -0.945  1.00 0.00 ? 109 LEU A CG   5  
ATOM 10268 C CD1  . LEU A 1 109 ? -35.891 -7.539  -1.252  1.00 0.00 ? 109 LEU A CD1  5  
ATOM 10269 C CD2  . LEU A 1 109 ? -37.766 -7.923  0.318   1.00 0.00 ? 109 LEU A CD2  5  
ATOM 10270 H H    . LEU A 1 109 ? -40.174 -8.594  -3.623  1.00 0.00 ? 109 LEU A H    5  
ATOM 10271 H HA   . LEU A 1 109 ? -38.874 -6.654  -1.845  1.00 0.00 ? 109 LEU A HA   5  
ATOM 10272 H HB2  . LEU A 1 109 ? -38.864 -9.285  -1.754  1.00 0.00 ? 109 LEU A HB2  5  
ATOM 10273 H HB3  . LEU A 1 109 ? -37.575 -9.164  -2.923  1.00 0.00 ? 109 LEU A HB3  5  
ATOM 10274 H HG   . LEU A 1 109 ? -36.682 -9.438  -0.710  1.00 0.00 ? 109 LEU A HG   5  
ATOM 10275 H HD11 . LEU A 1 109 ? -36.225 -6.516  -1.427  1.00 0.00 ? 109 LEU A HD11 5  
ATOM 10276 H HD12 . LEU A 1 109 ? -35.197 -7.545  -0.410  1.00 0.00 ? 109 LEU A HD12 5  
ATOM 10277 H HD13 . LEU A 1 109 ? -35.368 -7.908  -2.135  1.00 0.00 ? 109 LEU A HD13 5  
ATOM 10278 H HD21 . LEU A 1 109 ? -38.096 -6.894  0.182   1.00 0.00 ? 109 LEU A HD21 5  
ATOM 10279 H HD22 . LEU A 1 109 ? -38.626 -8.549  0.557   1.00 0.00 ? 109 LEU A HD22 5  
ATOM 10280 H HD23 . LEU A 1 109 ? -37.068 -7.960  1.154   1.00 0.00 ? 109 LEU A HD23 5  
ATOM 10281 N N    . VAL A 1 110 ? -38.405 -5.415  -4.160  1.00 0.00 ? 110 VAL A N    5  
ATOM 10282 C CA   . VAL A 1 110 ? -37.865 -4.616  -5.272  1.00 0.00 ? 110 VAL A CA   5  
ATOM 10283 C C    . VAL A 1 110 ? -36.447 -4.121  -4.962  1.00 0.00 ? 110 VAL A C    5  
ATOM 10284 O O    . VAL A 1 110 ? -36.115 -3.836  -3.808  1.00 0.00 ? 110 VAL A O    5  
ATOM 10285 C CB   . VAL A 1 110 ? -38.792 -3.446  -5.634  1.00 0.00 ? 110 VAL A CB   5  
ATOM 10286 C CG1  . VAL A 1 110 ? -38.344 -2.714  -6.902  1.00 0.00 ? 110 VAL A CG1  5  
ATOM 10287 C CG2  . VAL A 1 110 ? -40.241 -3.890  -5.893  1.00 0.00 ? 110 VAL A CG2  5  
ATOM 10288 H H    . VAL A 1 110 ? -39.275 -5.114  -3.725  1.00 0.00 ? 110 VAL A H    5  
ATOM 10289 H HA   . VAL A 1 110 ? -37.809 -5.270  -6.135  1.00 0.00 ? 110 VAL A HA   5  
ATOM 10290 H HB   . VAL A 1 110 ? -38.765 -2.751  -4.803  1.00 0.00 ? 110 VAL A HB   5  
ATOM 10291 H HG11 . VAL A 1 110 ? -39.059 -1.932  -7.152  1.00 0.00 ? 110 VAL A HG11 5  
ATOM 10292 H HG12 . VAL A 1 110 ? -37.378 -2.237  -6.751  1.00 0.00 ? 110 VAL A HG12 5  
ATOM 10293 H HG13 . VAL A 1 110 ? -38.287 -3.423  -7.726  1.00 0.00 ? 110 VAL A HG13 5  
ATOM 10294 H HG21 . VAL A 1 110 ? -40.843 -3.038  -6.211  1.00 0.00 ? 110 VAL A HG21 5  
ATOM 10295 H HG22 . VAL A 1 110 ? -40.266 -4.651  -6.670  1.00 0.00 ? 110 VAL A HG22 5  
ATOM 10296 H HG23 . VAL A 1 110 ? -40.689 -4.276  -4.984  1.00 0.00 ? 110 VAL A HG23 5  
ATOM 10297 N N    . ASP A 1 111 ? -35.605 -3.995  -5.989  1.00 0.00 ? 111 ASP A N    5  
ATOM 10298 C CA   . ASP A 1 111 ? -34.162 -3.768  -5.797  1.00 0.00 ? 111 ASP A CA   5  
ATOM 10299 C C    . ASP A 1 111 ? -33.776 -2.304  -6.063  1.00 0.00 ? 111 ASP A C    5  
ATOM 10300 O O    . ASP A 1 111 ? -33.069 -1.984  -7.020  1.00 0.00 ? 111 ASP A O    5  
ATOM 10301 C CB   . ASP A 1 111 ? -33.393 -4.782  -6.660  1.00 0.00 ? 111 ASP A CB   5  
ATOM 10302 C CG   . ASP A 1 111 ? -31.959 -5.021  -6.181  1.00 0.00 ? 111 ASP A CG   5  
ATOM 10303 O OD1  . ASP A 1 111 ? -31.796 -5.547  -5.056  1.00 0.00 ? 111 ASP A OD1  5  
ATOM 10304 O OD2  . ASP A 1 111 ? -31.001 -4.737  -6.936  1.00 0.00 ? 111 ASP A OD2  5  
ATOM 10305 H H    . ASP A 1 111 ? -35.984 -4.065  -6.929  1.00 0.00 ? 111 ASP A H    5  
ATOM 10306 H HA   . ASP A 1 111 ? -33.907 -3.984  -4.762  1.00 0.00 ? 111 ASP A HA   5  
ATOM 10307 H HB2  . ASP A 1 111 ? -33.913 -5.742  -6.633  1.00 0.00 ? 111 ASP A HB2  5  
ATOM 10308 H HB3  . ASP A 1 111 ? -33.379 -4.432  -7.690  1.00 0.00 ? 111 ASP A HB3  5  
ATOM 10309 N N    . VAL A 1 112 ? -34.201 -1.394  -5.175  1.00 0.00 ? 112 VAL A N    5  
ATOM 10310 C CA   . VAL A 1 112 ? -34.119 0.057   -5.409  1.00 0.00 ? 112 VAL A CA   5  
ATOM 10311 C C    . VAL A 1 112 ? -32.728 0.592   -5.053  1.00 0.00 ? 112 VAL A C    5  
ATOM 10312 O O    . VAL A 1 112 ? -32.552 1.330   -4.086  1.00 0.00 ? 112 VAL A O    5  
ATOM 10313 C CB   . VAL A 1 112 ? -35.267 0.773   -4.661  1.00 0.00 ? 112 VAL A CB   5  
ATOM 10314 C CG1  . VAL A 1 112 ? -35.418 2.241   -5.076  1.00 0.00 ? 112 VAL A CG1  5  
ATOM 10315 C CG2  . VAL A 1 112 ? -36.605 0.086   -4.965  1.00 0.00 ? 112 VAL A CG2  5  
ATOM 10316 H H    . VAL A 1 112 ? -34.742 -1.698  -4.370  1.00 0.00 ? 112 VAL A H    5  
ATOM 10317 H HA   . VAL A 1 112 ? -34.269 0.238   -6.474  1.00 0.00 ? 112 VAL A HA   5  
ATOM 10318 H HB   . VAL A 1 112 ? -35.095 0.723   -3.585  1.00 0.00 ? 112 VAL A HB   5  
ATOM 10319 H HG11 . VAL A 1 112 ? -34.523 2.806   -4.821  1.00 0.00 ? 112 VAL A HG11 5  
ATOM 10320 H HG12 . VAL A 1 112 ? -35.596 2.304   -6.147  1.00 0.00 ? 112 VAL A HG12 5  
ATOM 10321 H HG13 . VAL A 1 112 ? -36.259 2.691   -4.548  1.00 0.00 ? 112 VAL A HG13 5  
ATOM 10322 H HG21 . VAL A 1 112 ? -36.747 0.010   -6.042  1.00 0.00 ? 112 VAL A HG21 5  
ATOM 10323 H HG22 . VAL A 1 112 ? -36.624 -0.918  -4.535  1.00 0.00 ? 112 VAL A HG22 5  
ATOM 10324 H HG23 . VAL A 1 112 ? -37.418 0.656   -4.519  1.00 0.00 ? 112 VAL A HG23 5  
ATOM 10325 N N    . VAL A 1 113 ? -31.729 0.229   -5.859  1.00 0.00 ? 113 VAL A N    5  
ATOM 10326 C CA   . VAL A 1 113 ? -30.331 0.691   -5.728  1.00 0.00 ? 113 VAL A CA   5  
ATOM 10327 C C    . VAL A 1 113 ? -29.948 1.580   -6.920  1.00 0.00 ? 113 VAL A C    5  
ATOM 10328 O O    . VAL A 1 113 ? -30.302 1.227   -8.047  1.00 0.00 ? 113 VAL A O    5  
ATOM 10329 C CB   . VAL A 1 113 ? -29.313 -0.463  -5.599  1.00 0.00 ? 113 VAL A CB   5  
ATOM 10330 C CG1  . VAL A 1 113 ? -29.464 -1.156  -4.246  1.00 0.00 ? 113 VAL A CG1  5  
ATOM 10331 C CG2  . VAL A 1 113 ? -29.399 -1.528  -6.700  1.00 0.00 ? 113 VAL A CG2  5  
ATOM 10332 H H    . VAL A 1 113 ? -31.967 -0.404  -6.623  1.00 0.00 ? 113 VAL A H    5  
ATOM 10333 H HA   . VAL A 1 113 ? -30.261 1.264   -4.801  1.00 0.00 ? 113 VAL A HA   5  
ATOM 10334 H HB   . VAL A 1 113 ? -28.312 -0.031  -5.629  1.00 0.00 ? 113 VAL A HB   5  
ATOM 10335 H HG11 . VAL A 1 113 ? -28.695 -1.920  -4.132  1.00 0.00 ? 113 VAL A HG11 5  
ATOM 10336 H HG12 . VAL A 1 113 ? -29.349 -0.423  -3.447  1.00 0.00 ? 113 VAL A HG12 5  
ATOM 10337 H HG13 . VAL A 1 113 ? -30.446 -1.621  -4.184  1.00 0.00 ? 113 VAL A HG13 5  
ATOM 10338 H HG21 . VAL A 1 113 ? -30.380 -2.000  -6.698  1.00 0.00 ? 113 VAL A HG21 5  
ATOM 10339 H HG22 . VAL A 1 113 ? -29.215 -1.081  -7.676  1.00 0.00 ? 113 VAL A HG22 5  
ATOM 10340 H HG23 . VAL A 1 113 ? -28.642 -2.294  -6.530  1.00 0.00 ? 113 VAL A HG23 5  
ATOM 10341 N N    . PRO A 1 114 ? -29.256 2.722   -6.726  1.00 0.00 ? 114 PRO A N    5  
ATOM 10342 C CA   . PRO A 1 114 ? -28.847 3.608   -7.823  1.00 0.00 ? 114 PRO A CA   5  
ATOM 10343 C C    . PRO A 1 114 ? -27.492 3.134   -8.414  1.00 0.00 ? 114 PRO A C    5  
ATOM 10344 O O    . PRO A 1 114 ? -27.075 1.999   -8.164  1.00 0.00 ? 114 PRO A O    5  
ATOM 10345 C CB   . PRO A 1 114 ? -28.781 4.985   -7.171  1.00 0.00 ? 114 PRO A CB   5  
ATOM 10346 C CG   . PRO A 1 114 ? -28.266 4.674   -5.769  1.00 0.00 ? 114 PRO A CG   5  
ATOM 10347 C CD   . PRO A 1 114 ? -28.927 3.332   -5.444  1.00 0.00 ? 114 PRO A CD   5  
ATOM 10348 H HA   . PRO A 1 114 ? -29.631 3.652   -8.589  1.00 0.00 ? 114 PRO A HA   5  
ATOM 10349 H HB2  . PRO A 1 114 ? -28.139 5.663   -7.718  1.00 0.00 ? 114 PRO A HB2  5  
ATOM 10350 H HB3  . PRO A 1 114 ? -29.780 5.417   -7.106  1.00 0.00 ? 114 PRO A HB3  5  
ATOM 10351 H HG2  . PRO A 1 114 ? -27.181 4.554   -5.796  1.00 0.00 ? 114 PRO A HG2  5  
ATOM 10352 H HG3  . PRO A 1 114 ? -28.555 5.448   -5.058  1.00 0.00 ? 114 PRO A HG3  5  
ATOM 10353 H HD2  . PRO A 1 114 ? -28.245 2.702   -4.873  1.00 0.00 ? 114 PRO A HD2  5  
ATOM 10354 H HD3  . PRO A 1 114 ? -29.840 3.512   -4.874  1.00 0.00 ? 114 PRO A HD3  5  
ATOM 10355 N N    . VAL A 1 115 ? -26.761 3.986   -9.155  1.00 0.00 ? 115 VAL A N    5  
ATOM 10356 C CA   . VAL A 1 115 ? -25.393 3.686   -9.637  1.00 0.00 ? 115 VAL A CA   5  
ATOM 10357 C C    . VAL A 1 115 ? -24.371 4.779   -9.271  1.00 0.00 ? 115 VAL A C    5  
ATOM 10358 O O    . VAL A 1 115 ? -24.567 5.983   -9.482  1.00 0.00 ? 115 VAL A O    5  
ATOM 10359 C CB   . VAL A 1 115 ? -25.348 3.349   -11.141 1.00 0.00 ? 115 VAL A CB   5  
ATOM 10360 C CG1  . VAL A 1 115 ? -26.000 1.992   -11.430 1.00 0.00 ? 115 VAL A CG1  5  
ATOM 10361 C CG2  . VAL A 1 115 ? -25.981 4.414   -12.025 1.00 0.00 ? 115 VAL A CG2  5  
ATOM 10362 H H    . VAL A 1 115 ? -27.106 4.927   -9.323  1.00 0.00 ? 115 VAL A H    5  
ATOM 10363 H HA   . VAL A 1 115 ? -25.048 2.787   -9.128  1.00 0.00 ? 115 VAL A HA   5  
ATOM 10364 H HB   . VAL A 1 115 ? -24.301 3.264   -11.430 1.00 0.00 ? 115 VAL A HB   5  
ATOM 10365 H HG11 . VAL A 1 115 ? -25.503 1.213   -10.852 1.00 0.00 ? 115 VAL A HG11 5  
ATOM 10366 H HG12 . VAL A 1 115 ? -27.056 2.013   -11.162 1.00 0.00 ? 115 VAL A HG12 5  
ATOM 10367 H HG13 . VAL A 1 115 ? -25.905 1.753   -12.490 1.00 0.00 ? 115 VAL A HG13 5  
ATOM 10368 H HG21 . VAL A 1 115 ? -25.490 5.360   -11.822 1.00 0.00 ? 115 VAL A HG21 5  
ATOM 10369 H HG22 . VAL A 1 115 ? -25.838 4.161   -13.075 1.00 0.00 ? 115 VAL A HG22 5  
ATOM 10370 H HG23 . VAL A 1 115 ? -27.043 4.498   -11.806 1.00 0.00 ? 115 VAL A HG23 5  
ATOM 10371 N N    . LYS A 1 116 ? -23.243 4.318   -8.716  1.00 0.00 ? 116 LYS A N    5  
ATOM 10372 C CA   . LYS A 1 116 ? -22.125 5.116   -8.195  1.00 0.00 ? 116 LYS A CA   5  
ATOM 10373 C C    . LYS A 1 116 ? -20.802 4.776   -8.881  1.00 0.00 ? 116 LYS A C    5  
ATOM 10374 O O    . LYS A 1 116 ? -20.648 3.706   -9.473  1.00 0.00 ? 116 LYS A O    5  
ATOM 10375 C CB   . LYS A 1 116 ? -22.031 5.014   -6.653  1.00 0.00 ? 116 LYS A CB   5  
ATOM 10376 C CG   . LYS A 1 116 ? -21.939 3.608   -6.039  1.00 0.00 ? 116 LYS A CG   5  
ATOM 10377 C CD   . LYS A 1 116 ? -23.310 2.985   -5.712  1.00 0.00 ? 116 LYS A CD   5  
ATOM 10378 C CE   . LYS A 1 116 ? -23.175 1.615   -5.033  1.00 0.00 ? 116 LYS A CE   5  
ATOM 10379 N NZ   . LYS A 1 116 ? -22.790 1.732   -3.602  1.00 0.00 ? 116 LYS A NZ   5  
ATOM 10380 H H    . LYS A 1 116 ? -23.133 3.315   -8.667  1.00 0.00 ? 116 LYS A H    5  
ATOM 10381 H HA   . LYS A 1 116 ? -22.308 6.160   -8.441  1.00 0.00 ? 116 LYS A HA   5  
ATOM 10382 H HB2  . LYS A 1 116 ? -21.120 5.536   -6.345  1.00 0.00 ? 116 LYS A HB2  5  
ATOM 10383 H HB3  . LYS A 1 116 ? -22.872 5.535   -6.198  1.00 0.00 ? 116 LYS A HB3  5  
ATOM 10384 H HG2  . LYS A 1 116 ? -21.368 2.950   -6.695  1.00 0.00 ? 116 LYS A HG2  5  
ATOM 10385 H HG3  . LYS A 1 116 ? -21.392 3.718   -5.104  1.00 0.00 ? 116 LYS A HG3  5  
ATOM 10386 H HD2  . LYS A 1 116 ? -23.882 3.657   -5.071  1.00 0.00 ? 116 LYS A HD2  5  
ATOM 10387 H HD3  . LYS A 1 116 ? -23.872 2.843   -6.633  1.00 0.00 ? 116 LYS A HD3  5  
ATOM 10388 H HE2  . LYS A 1 116 ? -24.140 1.103   -5.100  1.00 0.00 ? 116 LYS A HE2  5  
ATOM 10389 H HE3  . LYS A 1 116 ? -22.441 1.014   -5.579  1.00 0.00 ? 116 LYS A HE3  5  
ATOM 10390 H HZ1  . LYS A 1 116 ? -22.711 0.822   -3.169  1.00 0.00 ? 116 LYS A HZ1  5  
ATOM 10391 H HZ2  . LYS A 1 116 ? -21.911 2.213   -3.484  1.00 0.00 ? 116 LYS A HZ2  5  
ATOM 10392 H HZ3  . LYS A 1 116 ? -23.505 2.247   -3.083  1.00 0.00 ? 116 LYS A HZ3  5  
ATOM 10393 N N    . ASN A 1 117 ? -19.852 5.703   -8.780  1.00 0.00 ? 117 ASN A N    5  
ATOM 10394 C CA   . ASN A 1 117 ? -18.501 5.551   -9.333  1.00 0.00 ? 117 ASN A CA   5  
ATOM 10395 C C    . ASN A 1 117 ? -17.539 4.908   -8.309  1.00 0.00 ? 117 ASN A C    5  
ATOM 10396 O O    . ASN A 1 117 ? -17.934 4.601   -7.185  1.00 0.00 ? 117 ASN A O    5  
ATOM 10397 C CB   . ASN A 1 117 ? -18.018 6.911   -9.878  1.00 0.00 ? 117 ASN A CB   5  
ATOM 10398 C CG   . ASN A 1 117 ? -17.437 7.828   -8.816  1.00 0.00 ? 117 ASN A CG   5  
ATOM 10399 O OD1  . ASN A 1 117 ? -16.233 7.885   -8.620  1.00 0.00 ? 117 ASN A OD1  5  
ATOM 10400 N ND2  . ASN A 1 117 ? -18.243 8.543   -8.069  1.00 0.00 ? 117 ASN A ND2  5  
ATOM 10401 H H    . ASN A 1 117 ? -20.069 6.519   -8.220  1.00 0.00 ? 117 ASN A H    5  
ATOM 10402 H HA   . ASN A 1 117 ? -18.548 4.869   -10.184 1.00 0.00 ? 117 ASN A HA   5  
ATOM 10403 H HB2  . ASN A 1 117 ? -17.234 6.730   -10.615 1.00 0.00 ? 117 ASN A HB2  5  
ATOM 10404 H HB3  . ASN A 1 117 ? -18.829 7.415   -10.399 1.00 0.00 ? 117 ASN A HB3  5  
ATOM 10405 H HD21 . ASN A 1 117 ? -19.248 8.509   -8.185  1.00 0.00 ? 117 ASN A HD21 5  
ATOM 10406 H HD22 . ASN A 1 117 ? -17.817 9.189   -7.426  1.00 0.00 ? 117 ASN A HD22 5  
ATOM 10407 N N    . GLU A 1 118 ? -16.270 4.723   -8.681  1.00 0.00 ? 118 GLU A N    5  
ATOM 10408 C CA   . GLU A 1 118 ? -15.239 4.097   -7.829  1.00 0.00 ? 118 GLU A CA   5  
ATOM 10409 C C    . GLU A 1 118 ? -14.971 4.828   -6.492  1.00 0.00 ? 118 GLU A C    5  
ATOM 10410 O O    . GLU A 1 118 ? -14.507 4.207   -5.533  1.00 0.00 ? 118 GLU A O    5  
ATOM 10411 C CB   . GLU A 1 118 ? -13.941 3.914   -8.637  1.00 0.00 ? 118 GLU A CB   5  
ATOM 10412 C CG   . GLU A 1 118 ? -13.276 5.229   -9.072  1.00 0.00 ? 118 GLU A CG   5  
ATOM 10413 C CD   . GLU A 1 118 ? -12.002 4.953   -9.895  1.00 0.00 ? 118 GLU A CD   5  
ATOM 10414 O OE1  . GLU A 1 118 ? -12.089 4.840   -11.142 1.00 0.00 ? 118 GLU A OE1  5  
ATOM 10415 O OE2  . GLU A 1 118 ? -10.899 4.851   -9.302  1.00 0.00 ? 118 GLU A OE2  5  
ATOM 10416 H H    . GLU A 1 118 ? -16.004 5.007   -9.613  1.00 0.00 ? 118 GLU A H    5  
ATOM 10417 H HA   . GLU A 1 118 ? -15.592 3.099   -7.563  1.00 0.00 ? 118 GLU A HA   5  
ATOM 10418 H HB2  . GLU A 1 118 ? -13.233 3.347   -8.030  1.00 0.00 ? 118 GLU A HB2  5  
ATOM 10419 H HB3  . GLU A 1 118 ? -14.166 3.322   -9.524  1.00 0.00 ? 118 GLU A HB3  5  
ATOM 10420 H HG2  . GLU A 1 118 ? -13.980 5.813   -9.670  1.00 0.00 ? 118 GLU A HG2  5  
ATOM 10421 H HG3  . GLU A 1 118 ? -13.022 5.818   -8.188  1.00 0.00 ? 118 GLU A HG3  5  
ATOM 10422 N N    . ASP A 1 119 ? -15.307 6.119   -6.391  1.00 0.00 ? 119 ASP A N    5  
ATOM 10423 C CA   . ASP A 1 119 ? -15.286 6.895   -5.141  1.00 0.00 ? 119 ASP A CA   5  
ATOM 10424 C C    . ASP A 1 119 ? -16.436 6.554   -4.166  1.00 0.00 ? 119 ASP A C    5  
ATOM 10425 O O    . ASP A 1 119 ? -16.348 6.864   -2.976  1.00 0.00 ? 119 ASP A O    5  
ATOM 10426 C CB   . ASP A 1 119 ? -15.278 8.393   -5.484  1.00 0.00 ? 119 ASP A CB   5  
ATOM 10427 C CG   . ASP A 1 119 ? -14.773 9.259   -4.316  1.00 0.00 ? 119 ASP A CG   5  
ATOM 10428 O OD1  . ASP A 1 119 ? -13.593 9.112   -3.911  1.00 0.00 ? 119 ASP A OD1  5  
ATOM 10429 O OD2  . ASP A 1 119 ? -15.544 10.116  -3.820  1.00 0.00 ? 119 ASP A OD2  5  
ATOM 10430 H H    . ASP A 1 119 ? -15.622 6.594   -7.231  1.00 0.00 ? 119 ASP A H    5  
ATOM 10431 H HA   . ASP A 1 119 ? -14.351 6.667   -4.627  1.00 0.00 ? 119 ASP A HA   5  
ATOM 10432 H HB2  . ASP A 1 119 ? -14.614 8.561   -6.336  1.00 0.00 ? 119 ASP A HB2  5  
ATOM 10433 H HB3  . ASP A 1 119 ? -16.284 8.700   -5.779  1.00 0.00 ? 119 ASP A HB3  5  
ATOM 10434 N N    . GLY A 1 120 ? -17.526 5.945   -4.655  1.00 0.00 ? 120 GLY A N    5  
ATOM 10435 C CA   . GLY A 1 120 ? -18.734 5.617   -3.889  1.00 0.00 ? 120 GLY A CA   5  
ATOM 10436 C C    . GLY A 1 120 ? -19.863 6.646   -4.027  1.00 0.00 ? 120 GLY A C    5  
ATOM 10437 O O    . GLY A 1 120 ? -20.965 6.416   -3.527  1.00 0.00 ? 120 GLY A O    5  
ATOM 10438 H H    . GLY A 1 120 ? -17.534 5.679   -5.635  1.00 0.00 ? 120 GLY A H    5  
ATOM 10439 H HA2  . GLY A 1 120 ? -19.113 4.656   -4.237  1.00 0.00 ? 120 GLY A HA2  5  
ATOM 10440 H HA3  . GLY A 1 120 ? -18.490 5.519   -2.831  1.00 0.00 ? 120 GLY A HA3  5  
ATOM 10441 N N    . ALA A 1 121 ? -19.625 7.757   -4.735  1.00 0.00 ? 121 ALA A N    5  
ATOM 10442 C CA   . ALA A 1 121 ? -20.633 8.778   -5.017  1.00 0.00 ? 121 ALA A CA   5  
ATOM 10443 C C    . ALA A 1 121 ? -21.554 8.373   -6.177  1.00 0.00 ? 121 ALA A C    5  
ATOM 10444 O O    . ALA A 1 121 ? -21.090 7.993   -7.259  1.00 0.00 ? 121 ALA A O    5  
ATOM 10445 C CB   . ALA A 1 121 ? -19.946 10.130  -5.248  1.00 0.00 ? 121 ALA A CB   5  
ATOM 10446 H H    . ALA A 1 121 ? -18.702 7.882   -5.121  1.00 0.00 ? 121 ALA A H    5  
ATOM 10447 H HA   . ALA A 1 121 ? -21.265 8.889   -4.138  1.00 0.00 ? 121 ALA A HA   5  
ATOM 10448 H HB1  . ALA A 1 121 ? -20.699 10.908  -5.380  1.00 0.00 ? 121 ALA A HB1  5  
ATOM 10449 H HB2  . ALA A 1 121 ? -19.326 10.382  -4.386  1.00 0.00 ? 121 ALA A HB2  5  
ATOM 10450 H HB3  . ALA A 1 121 ? -19.321 10.094  -6.139  1.00 0.00 ? 121 ALA A HB3  5  
ATOM 10451 N N    . VAL A 1 122 ? -22.864 8.471   -5.927  1.00 0.00 ? 122 VAL A N    5  
ATOM 10452 C CA   . VAL A 1 122 ? -23.966 8.201   -6.862  1.00 0.00 ? 122 VAL A CA   5  
ATOM 10453 C C    . VAL A 1 122 ? -23.990 9.248   -7.980  1.00 0.00 ? 122 VAL A C    5  
ATOM 10454 O O    . VAL A 1 122 ? -24.441 10.383  -7.805  1.00 0.00 ? 122 VAL A O    5  
ATOM 10455 C CB   . VAL A 1 122 ? -25.293 8.027   -6.084  1.00 0.00 ? 122 VAL A CB   5  
ATOM 10456 C CG1  . VAL A 1 122 ? -25.741 9.233   -5.246  1.00 0.00 ? 122 VAL A CG1  5  
ATOM 10457 C CG2  . VAL A 1 122 ? -26.450 7.597   -6.986  1.00 0.00 ? 122 VAL A CG2  5  
ATOM 10458 H H    . VAL A 1 122 ? -23.125 8.741   -4.993  1.00 0.00 ? 122 VAL A H    5  
ATOM 10459 H HA   . VAL A 1 122 ? -23.781 7.241   -7.334  1.00 0.00 ? 122 VAL A HA   5  
ATOM 10460 H HB   . VAL A 1 122 ? -25.130 7.206   -5.386  1.00 0.00 ? 122 VAL A HB   5  
ATOM 10461 H HG11 . VAL A 1 122 ? -26.055 10.054  -5.888  1.00 0.00 ? 122 VAL A HG11 5  
ATOM 10462 H HG12 . VAL A 1 122 ? -26.584 8.943   -4.617  1.00 0.00 ? 122 VAL A HG12 5  
ATOM 10463 H HG13 . VAL A 1 122 ? -24.934 9.570   -4.597  1.00 0.00 ? 122 VAL A HG13 5  
ATOM 10464 H HG21 . VAL A 1 122 ? -27.331 7.366   -6.382  1.00 0.00 ? 122 VAL A HG21 5  
ATOM 10465 H HG22 . VAL A 1 122 ? -26.706 8.383   -7.695  1.00 0.00 ? 122 VAL A HG22 5  
ATOM 10466 H HG23 . VAL A 1 122 ? -26.171 6.701   -7.537  1.00 0.00 ? 122 VAL A HG23 5  
ATOM 10467 N N    . ILE A 1 123 ? -23.441 8.874   -9.139  1.00 0.00 ? 123 ILE A N    5  
ATOM 10468 C CA   . ILE A 1 123 ? -23.383 9.746   -10.321 1.00 0.00 ? 123 ILE A CA   5  
ATOM 10469 C C    . ILE A 1 123 ? -24.649 9.635   -11.171 1.00 0.00 ? 123 ILE A C    5  
ATOM 10470 O O    . ILE A 1 123 ? -25.061 10.631  -11.765 1.00 0.00 ? 123 ILE A O    5  
ATOM 10471 C CB   . ILE A 1 123 ? -22.081 9.586   -11.144 1.00 0.00 ? 123 ILE A CB   5  
ATOM 10472 C CG1  . ILE A 1 123 ? -22.052 8.459   -12.200 1.00 0.00 ? 123 ILE A CG1  5  
ATOM 10473 C CG2  . ILE A 1 123 ? -20.847 9.530   -10.233 1.00 0.00 ? 123 ILE A CG2  5  
ATOM 10474 C CD1  . ILE A 1 123 ? -22.254 7.021   -11.711 1.00 0.00 ? 123 ILE A CD1  5  
ATOM 10475 H H    . ILE A 1 123 ? -23.031 7.957   -9.198  1.00 0.00 ? 123 ILE A H    5  
ATOM 10476 H HA   . ILE A 1 123 ? -23.357 10.767  -9.946  1.00 0.00 ? 123 ILE A HA   5  
ATOM 10477 H HB   . ILE A 1 123 ? -21.987 10.511  -11.716 1.00 0.00 ? 123 ILE A HB   5  
ATOM 10478 H HG12 . ILE A 1 123 ? -22.807 8.667   -12.954 1.00 0.00 ? 123 ILE A HG12 5  
ATOM 10479 H HG13 . ILE A 1 123 ? -21.087 8.502   -12.709 1.00 0.00 ? 123 ILE A HG13 5  
ATOM 10480 H HG21 . ILE A 1 123 ? -19.942 9.631   -10.834 1.00 0.00 ? 123 ILE A HG21 5  
ATOM 10481 H HG22 . ILE A 1 123 ? -20.881 10.347  -9.511  1.00 0.00 ? 123 ILE A HG22 5  
ATOM 10482 H HG23 . ILE A 1 123 ? -20.822 8.583   -9.702  1.00 0.00 ? 123 ILE A HG23 5  
ATOM 10483 H HD11 . ILE A 1 123 ? -22.067 6.333   -12.535 1.00 0.00 ? 123 ILE A HD11 5  
ATOM 10484 H HD12 . ILE A 1 123 ? -21.571 6.788   -10.895 1.00 0.00 ? 123 ILE A HD12 5  
ATOM 10485 H HD13 . ILE A 1 123 ? -23.285 6.885   -11.395 1.00 0.00 ? 123 ILE A HD13 5  
ATOM 10486 N N    . MET A 1 124 ? -25.310 8.470   -11.167 1.00 0.00 ? 124 MET A N    5  
ATOM 10487 C CA   . MET A 1 124 ? -26.592 8.268   -11.847 1.00 0.00 ? 124 MET A CA   5  
ATOM 10488 C C    . MET A 1 124 ? -27.580 7.499   -10.973 1.00 0.00 ? 124 MET A C    5  
ATOM 10489 O O    . MET A 1 124 ? -27.250 6.669   -10.131 1.00 0.00 ? 124 MET A O    5  
ATOM 10490 C CB   . MET A 1 124 ? -26.441 7.616   -13.241 1.00 0.00 ? 124 MET A CB   5  
ATOM 10491 C CG   . MET A 1 124 ? -26.328 8.626   -14.390 1.00 0.00 ? 124 MET A CG   5  
ATOM 10492 S SD   . MET A 1 124 ? -24.650 8.853   -15.038 1.00 0.00 ? 124 MET A SD   5  
ATOM 10493 C CE   . MET A 1 124 ? -24.593 10.661  -15.093 1.00 0.00 ? 124 MET A CE   5  
ATOM 10494 H H    . MET A 1 124 ? -24.961 7.713   -10.582 1.00 0.00 ? 124 MET A H    5  
ATOM 10495 H HA   . MET A 1 124 ? -27.052 9.245   -11.996 1.00 0.00 ? 124 MET A HA   5  
ATOM 10496 H HB2  . MET A 1 124 ? -25.578 6.955   -13.268 1.00 0.00 ? 124 MET A HB2  5  
ATOM 10497 H HB3  . MET A 1 124 ? -27.327 7.012   -13.440 1.00 0.00 ? 124 MET A HB3  5  
ATOM 10498 H HG2  . MET A 1 124 ? -26.946 8.271   -15.215 1.00 0.00 ? 124 MET A HG2  5  
ATOM 10499 H HG3  . MET A 1 124 ? -26.735 9.588   -14.077 1.00 0.00 ? 124 MET A HG3  5  
ATOM 10500 H HE1  . MET A 1 124 ? -24.720 11.054  -14.086 1.00 0.00 ? 124 MET A HE1  5  
ATOM 10501 H HE2  . MET A 1 124 ? -23.628 10.984  -15.482 1.00 0.00 ? 124 MET A HE2  5  
ATOM 10502 H HE3  . MET A 1 124 ? -25.394 11.035  -15.729 1.00 0.00 ? 124 MET A HE3  5  
ATOM 10503 N N    . PHE A 1 125 ? -28.844 7.801   -11.194 1.00 0.00 ? 125 PHE A N    5  
ATOM 10504 C CA   . PHE A 1 125 ? -29.978 7.233   -10.480 1.00 0.00 ? 125 PHE A CA   5  
ATOM 10505 C C    . PHE A 1 125 ? -30.632 6.184   -11.395 1.00 0.00 ? 125 PHE A C    5  
ATOM 10506 O O    . PHE A 1 125 ? -31.641 6.424   -12.044 1.00 0.00 ? 125 PHE A O    5  
ATOM 10507 C CB   . PHE A 1 125 ? -30.909 8.384   -10.031 1.00 0.00 ? 125 PHE A CB   5  
ATOM 10508 C CG   . PHE A 1 125 ? -30.703 9.049   -8.679  1.00 0.00 ? 125 PHE A CG   5  
ATOM 10509 C CD1  . PHE A 1 125 ? -29.730 8.629   -7.748  1.00 0.00 ? 125 PHE A CD1  5  
ATOM 10510 C CD2  . PHE A 1 125 ? -31.536 10.138  -8.354  1.00 0.00 ? 125 PHE A CD2  5  
ATOM 10511 C CE1  . PHE A 1 125 ? -29.580 9.306   -6.524  1.00 0.00 ? 125 PHE A CE1  5  
ATOM 10512 C CE2  . PHE A 1 125 ? -31.376 10.820  -7.135  1.00 0.00 ? 125 PHE A CE2  5  
ATOM 10513 C CZ   . PHE A 1 125 ? -30.391 10.409  -6.224  1.00 0.00 ? 125 PHE A CZ   5  
ATOM 10514 H H    . PHE A 1 125 ? -29.025 8.430   -11.967 1.00 0.00 ? 125 PHE A H    5  
ATOM 10515 H HA   . PHE A 1 125 ? -29.646 6.689   -9.600  1.00 0.00 ? 125 PHE A HA   5  
ATOM 10516 H HB2  . PHE A 1 125 ? -30.905 9.165   -10.787 1.00 0.00 ? 125 PHE A HB2  5  
ATOM 10517 H HB3  . PHE A 1 125 ? -31.921 7.999   -9.985  1.00 0.00 ? 125 PHE A HB3  5  
ATOM 10518 H HD1  . PHE A 1 125 ? -29.075 7.805   -7.967  1.00 0.00 ? 125 PHE A HD1  5  
ATOM 10519 H HD2  . PHE A 1 125 ? -32.289 10.463  -9.058  1.00 0.00 ? 125 PHE A HD2  5  
ATOM 10520 H HE1  . PHE A 1 125 ? -28.833 8.989   -5.811  1.00 0.00 ? 125 PHE A HE1  5  
ATOM 10521 H HE2  . PHE A 1 125 ? -32.002 11.668  -6.898  1.00 0.00 ? 125 PHE A HE2  5  
ATOM 10522 H HZ   . PHE A 1 125 ? -30.260 10.935  -5.289  1.00 0.00 ? 125 PHE A HZ   5  
ATOM 10523 N N    . ILE A 1 126 ? -30.063 4.982   -11.460 1.00 0.00 ? 126 ILE A N    5  
ATOM 10524 C CA   . ILE A 1 126 ? -30.695 3.850   -12.159 1.00 0.00 ? 126 ILE A CA   5  
ATOM 10525 C C    . ILE A 1 126 ? -31.363 2.960   -11.122 1.00 0.00 ? 126 ILE A C    5  
ATOM 10526 O O    . ILE A 1 126 ? -30.891 1.868   -10.800 1.00 0.00 ? 126 ILE A O    5  
ATOM 10527 C CB   . ILE A 1 126 ? -29.713 3.114   -13.078 1.00 0.00 ? 126 ILE A CB   5  
ATOM 10528 C CG1  . ILE A 1 126 ? -29.067 4.131   -14.039 1.00 0.00 ? 126 ILE A CG1  5  
ATOM 10529 C CG2  . ILE A 1 126 ? -30.409 1.986   -13.871 1.00 0.00 ? 126 ILE A CG2  5  
ATOM 10530 C CD1  . ILE A 1 126 ? -28.103 3.475   -15.012 1.00 0.00 ? 126 ILE A CD1  5  
ATOM 10531 H H    . ILE A 1 126 ? -29.193 4.827   -10.971 1.00 0.00 ? 126 ILE A H    5  
ATOM 10532 H HA   . ILE A 1 126 ? -31.491 4.216   -12.806 1.00 0.00 ? 126 ILE A HA   5  
ATOM 10533 H HB   . ILE A 1 126 ? -28.943 2.673   -12.452 1.00 0.00 ? 126 ILE A HB   5  
ATOM 10534 H HG12 . ILE A 1 126 ? -29.842 4.648   -14.600 1.00 0.00 ? 126 ILE A HG12 5  
ATOM 10535 H HG13 . ILE A 1 126 ? -28.510 4.880   -13.481 1.00 0.00 ? 126 ILE A HG13 5  
ATOM 10536 H HG21 . ILE A 1 126 ? -29.671 1.245   -14.175 1.00 0.00 ? 126 ILE A HG21 5  
ATOM 10537 H HG22 . ILE A 1 126 ? -31.184 1.498   -13.287 1.00 0.00 ? 126 ILE A HG22 5  
ATOM 10538 H HG23 . ILE A 1 126 ? -30.889 2.386   -14.759 1.00 0.00 ? 126 ILE A HG23 5  
ATOM 10539 H HD11 . ILE A 1 126 ? -27.599 4.259   -15.575 1.00 0.00 ? 126 ILE A HD11 5  
ATOM 10540 H HD12 . ILE A 1 126 ? -27.389 2.877   -14.448 1.00 0.00 ? 126 ILE A HD12 5  
ATOM 10541 H HD13 . ILE A 1 126 ? -28.657 2.833   -15.693 1.00 0.00 ? 126 ILE A HD13 5  
ATOM 10542 N N    . LEU A 1 127 ? -32.457 3.465   -10.558 1.00 0.00 ? 127 LEU A N    5  
ATOM 10543 C CA   . LEU A 1 127 ? -33.252 2.760   -9.562  1.00 0.00 ? 127 LEU A CA   5  
ATOM 10544 C C    . LEU A 1 127 ? -34.063 1.657   -10.245 1.00 0.00 ? 127 LEU A C    5  
ATOM 10545 O O    . LEU A 1 127 ? -35.192 1.830   -10.697 1.00 0.00 ? 127 LEU A O    5  
ATOM 10546 C CB   . LEU A 1 127 ? -34.042 3.731   -8.667  1.00 0.00 ? 127 LEU A CB   5  
ATOM 10547 C CG   . LEU A 1 127 ? -33.190 4.732   -7.855  1.00 0.00 ? 127 LEU A CG   5  
ATOM 10548 C CD1  . LEU A 1 127 ? -32.208 4.080   -6.926  1.00 0.00 ? 127 LEU A CD1  5  
ATOM 10549 C CD2  . LEU A 1 127 ? -32.434 5.777   -8.652  1.00 0.00 ? 127 LEU A CD2  5  
ATOM 10550 H H    . LEU A 1 127 ? -32.773 4.376   -10.866 1.00 0.00 ? 127 LEU A H    5  
ATOM 10551 H HA   . LEU A 1 127 ? -32.562 2.244   -8.895  1.00 0.00 ? 127 LEU A HA   5  
ATOM 10552 H HB2  . LEU A 1 127 ? -34.744 4.294   -9.283  1.00 0.00 ? 127 LEU A HB2  5  
ATOM 10553 H HB3  . LEU A 1 127 ? -34.631 3.141   -7.970  1.00 0.00 ? 127 LEU A HB3  5  
ATOM 10554 H HG   . LEU A 1 127 ? -33.811 5.282   -7.203  1.00 0.00 ? 127 LEU A HG   5  
ATOM 10555 H HD11 . LEU A 1 127 ? -32.710 3.351   -6.299  1.00 0.00 ? 127 LEU A HD11 5  
ATOM 10556 H HD12 . LEU A 1 127 ? -31.480 3.612   -7.560  1.00 0.00 ? 127 LEU A HD12 5  
ATOM 10557 H HD13 . LEU A 1 127 ? -31.751 4.853   -6.307  1.00 0.00 ? 127 LEU A HD13 5  
ATOM 10558 H HD21 . LEU A 1 127 ? -32.187 6.612   -7.996  1.00 0.00 ? 127 LEU A HD21 5  
ATOM 10559 H HD22 . LEU A 1 127 ? -31.515 5.351   -9.038  1.00 0.00 ? 127 LEU A HD22 5  
ATOM 10560 H HD23 . LEU A 1 127 ? -33.062 6.136   -9.464  1.00 0.00 ? 127 LEU A HD23 5  
ATOM 10561 N N    . ASN A 1 128 ? -33.391 0.517   -10.357 1.00 0.00 ? 128 ASN A N    5  
ATOM 10562 C CA   . ASN A 1 128 ? -33.891 -0.724  -10.955 1.00 0.00 ? 128 ASN A CA   5  
ATOM 10563 C C    . ASN A 1 128 ? -35.140 -1.218  -10.198 1.00 0.00 ? 128 ASN A C    5  
ATOM 10564 O O    . ASN A 1 128 ? -35.034 -1.811  -9.124  1.00 0.00 ? 128 ASN A O    5  
ATOM 10565 C CB   . ASN A 1 128 ? -32.781 -1.795  -10.906 1.00 0.00 ? 128 ASN A CB   5  
ATOM 10566 C CG   . ASN A 1 128 ? -31.717 -1.691  -11.985 1.00 0.00 ? 128 ASN A CG   5  
ATOM 10567 O OD1  . ASN A 1 128 ? -31.697 -2.456  -12.937 1.00 0.00 ? 128 ASN A OD1  5  
ATOM 10568 N ND2  . ASN A 1 128 ? -30.777 -0.780  -11.888 1.00 0.00 ? 128 ASN A ND2  5  
ATOM 10569 H H    . ASN A 1 128 ? -32.420 0.597   -10.074 1.00 0.00 ? 128 ASN A H    5  
ATOM 10570 H HA   . ASN A 1 128 ? -34.172 -0.547  -11.993 1.00 0.00 ? 128 ASN A HA   5  
ATOM 10571 H HB2  . ASN A 1 128 ? -32.309 -1.783  -9.925  1.00 0.00 ? 128 ASN A HB2  5  
ATOM 10572 H HB3  . ASN A 1 128 ? -33.244 -2.775  -11.025 1.00 0.00 ? 128 ASN A HB3  5  
ATOM 10573 H HD21 . ASN A 1 128 ? -30.792 -0.066  -11.169 1.00 0.00 ? 128 ASN A HD21 5  
ATOM 10574 H HD22 . ASN A 1 128 ? -30.088 -0.746  -12.620 1.00 0.00 ? 128 ASN A HD22 5  
ATOM 10575 N N    . PHE A 1 129 ? -36.341 -1.024  -10.751 1.00 0.00 ? 129 PHE A N    5  
ATOM 10576 C CA   . PHE A 1 129 ? -37.581 -1.446  -10.102 1.00 0.00 ? 129 PHE A CA   5  
ATOM 10577 C C    . PHE A 1 129 ? -37.937 -2.899  -10.437 1.00 0.00 ? 129 PHE A C    5  
ATOM 10578 O O    . PHE A 1 129 ? -39.029 -3.230  -10.893 1.00 0.00 ? 129 PHE A O    5  
ATOM 10579 C CB   . PHE A 1 129 ? -38.713 -0.449  -10.351 1.00 0.00 ? 129 PHE A CB   5  
ATOM 10580 C CG   . PHE A 1 129 ? -38.446 0.963   -9.853  1.00 0.00 ? 129 PHE A CG   5  
ATOM 10581 C CD1  . PHE A 1 129 ? -38.218 1.195   -8.481  1.00 0.00 ? 129 PHE A CD1  5  
ATOM 10582 C CD2  . PHE A 1 129 ? -38.423 2.048   -10.752 1.00 0.00 ? 129 PHE A CD2  5  
ATOM 10583 C CE1  . PHE A 1 129 ? -37.942 2.494   -8.017  1.00 0.00 ? 129 PHE A CE1  5  
ATOM 10584 C CE2  . PHE A 1 129 ? -38.148 3.347   -10.285 1.00 0.00 ? 129 PHE A CE2  5  
ATOM 10585 C CZ   . PHE A 1 129 ? -37.892 3.568   -8.922  1.00 0.00 ? 129 PHE A CZ   5  
ATOM 10586 H H    . PHE A 1 129 ? -36.409 -0.594  -11.659 1.00 0.00 ? 129 PHE A H    5  
ATOM 10587 H HA   . PHE A 1 129 ? -37.395 -1.444  -9.031  1.00 0.00 ? 129 PHE A HA   5  
ATOM 10588 H HB2  . PHE A 1 129 ? -38.950 -0.429  -11.416 1.00 0.00 ? 129 PHE A HB2  5  
ATOM 10589 H HB3  . PHE A 1 129 ? -39.571 -0.843  -9.813  1.00 0.00 ? 129 PHE A HB3  5  
ATOM 10590 H HD1  . PHE A 1 129 ? -38.257 0.375   -7.782  1.00 0.00 ? 129 PHE A HD1  5  
ATOM 10591 H HD2  . PHE A 1 129 ? -38.604 1.884   -11.804 1.00 0.00 ? 129 PHE A HD2  5  
ATOM 10592 H HE1  . PHE A 1 129 ? -37.769 2.668   -6.964  1.00 0.00 ? 129 PHE A HE1  5  
ATOM 10593 H HE2  . PHE A 1 129 ? -38.122 4.177   -10.977 1.00 0.00 ? 129 PHE A HE2  5  
ATOM 10594 H HZ   . PHE A 1 129 ? -37.671 4.566   -8.568  1.00 0.00 ? 129 PHE A HZ   5  
ATOM 10595 N N    . GLU A 1 130 ? -36.984 -3.794  -10.205 1.00 0.00 ? 130 GLU A N    5  
ATOM 10596 C CA   . GLU A 1 130 ? -37.152 -5.222  -10.462 1.00 0.00 ? 130 GLU A CA   5  
ATOM 10597 C C    . GLU A 1 130 ? -37.936 -5.917  -9.339  1.00 0.00 ? 130 GLU A C    5  
ATOM 10598 O O    . GLU A 1 130 ? -37.459 -6.176  -8.238  1.00 0.00 ? 130 GLU A O    5  
ATOM 10599 C CB   . GLU A 1 130 ? -35.802 -5.892  -10.730 1.00 0.00 ? 130 GLU A CB   5  
ATOM 10600 C CG   . GLU A 1 130 ? -34.755 -5.482  -9.700  1.00 0.00 ? 130 GLU A CG   5  
ATOM 10601 C CD   . GLU A 1 130 ? -33.490 -6.346  -9.776  1.00 0.00 ? 130 GLU A CD   5  
ATOM 10602 O OE1  . GLU A 1 130 ? -33.453 -7.433  -9.156  1.00 0.00 ? 130 GLU A OE1  5  
ATOM 10603 O OE2  . GLU A 1 130 ? -32.521 -5.951  -10.462 1.00 0.00 ? 130 GLU A OE2  5  
ATOM 10604 H H    . GLU A 1 130 ? -36.111 -3.461  -9.801  1.00 0.00 ? 130 GLU A H    5  
ATOM 10605 H HA   . GLU A 1 130 ? -37.728 -5.339  -11.379 1.00 0.00 ? 130 GLU A HA   5  
ATOM 10606 H HB2  . GLU A 1 130 ? -35.947 -6.974  -10.714 1.00 0.00 ? 130 GLU A HB2  5  
ATOM 10607 H HB3  . GLU A 1 130 ? -35.459 -5.575  -11.711 1.00 0.00 ? 130 GLU A HB3  5  
ATOM 10608 H HG2  . GLU A 1 130 ? -34.499 -4.439  -9.873  1.00 0.00 ? 130 GLU A HG2  5  
ATOM 10609 H HG3  . GLU A 1 130 ? -35.212 -5.539  -8.714  1.00 0.00 ? 130 GLU A HG3  5  
ATOM 10610 N N    . VAL A 1 131 ? -39.172 -6.253  -9.668  1.00 0.00 ? 131 VAL A N    5  
ATOM 10611 C CA   . VAL A 1 131 ? -40.061 -7.116  -8.875  1.00 0.00 ? 131 VAL A CA   5  
ATOM 10612 C C    . VAL A 1 131 ? -39.406 -8.485  -8.714  1.00 0.00 ? 131 VAL A C    5  
ATOM 10613 O O    . VAL A 1 131 ? -39.135 -9.166  -9.707  1.00 0.00 ? 131 VAL A O    5  
ATOM 10614 C CB   . VAL A 1 131 ? -41.436 -7.225  -9.565  1.00 0.00 ? 131 VAL A CB   5  
ATOM 10615 C CG1  . VAL A 1 131 ? -42.243 -8.479  -9.204  1.00 0.00 ? 131 VAL A CG1  5  
ATOM 10616 C CG2  . VAL A 1 131 ? -42.269 -5.986  -9.220  1.00 0.00 ? 131 VAL A CG2  5  
ATOM 10617 H H    . VAL A 1 131 ? -39.459 -5.935  -10.575 1.00 0.00 ? 131 VAL A H    5  
ATOM 10618 H HA   . VAL A 1 131 ? -40.198 -6.684  -7.884  1.00 0.00 ? 131 VAL A HA   5  
ATOM 10619 H HB   . VAL A 1 131 ? -41.276 -7.247  -10.642 1.00 0.00 ? 131 VAL A HB   5  
ATOM 10620 H HG11 . VAL A 1 131 ? -43.277 -8.368  -9.528  1.00 0.00 ? 131 VAL A HG11 5  
ATOM 10621 H HG12 . VAL A 1 131 ? -41.824 -9.349  -9.711  1.00 0.00 ? 131 VAL A HG12 5  
ATOM 10622 H HG13 . VAL A 1 131 ? -42.213 -8.650  -8.132  1.00 0.00 ? 131 VAL A HG13 5  
ATOM 10623 H HG21 . VAL A 1 131 ? -42.559 -6.007  -8.170  1.00 0.00 ? 131 VAL A HG21 5  
ATOM 10624 H HG22 . VAL A 1 131 ? -41.691 -5.081  -9.408  1.00 0.00 ? 131 VAL A HG22 5  
ATOM 10625 H HG23 . VAL A 1 131 ? -43.167 -5.969  -9.837  1.00 0.00 ? 131 VAL A HG23 5  
ATOM 10626 N N    . VAL A 1 132 ? -39.133 -8.885  -7.469  1.00 0.00 ? 132 VAL A N    5  
ATOM 10627 C CA   . VAL A 1 132 ? -38.693 -10.254 -7.158  1.00 0.00 ? 132 VAL A CA   5  
ATOM 10628 C C    . VAL A 1 132 ? -39.347 -10.750 -5.861  1.00 0.00 ? 132 VAL A C    5  
ATOM 10629 O O    . VAL A 1 132 ? -39.597 -9.958  -4.950  1.00 0.00 ? 132 VAL A O    5  
ATOM 10630 C CB   . VAL A 1 132 ? -37.151 -10.380 -7.201  1.00 0.00 ? 132 VAL A CB   5  
ATOM 10631 C CG1  . VAL A 1 132 ? -36.430 -9.469  -6.208  1.00 0.00 ? 132 VAL A CG1  5  
ATOM 10632 C CG2  . VAL A 1 132 ? -36.672 -11.821 -6.995  1.00 0.00 ? 132 VAL A CG2  5  
ATOM 10633 H H    . VAL A 1 132 ? -39.369 -8.279  -6.684  1.00 0.00 ? 132 VAL A H    5  
ATOM 10634 H HA   . VAL A 1 132 ? -39.066 -10.890 -7.962  1.00 0.00 ? 132 VAL A HA   5  
ATOM 10635 H HB   . VAL A 1 132 ? -36.827 -10.082 -8.199  1.00 0.00 ? 132 VAL A HB   5  
ATOM 10636 H HG11 . VAL A 1 132 ? -36.731 -9.705  -5.187  1.00 0.00 ? 132 VAL A HG11 5  
ATOM 10637 H HG12 . VAL A 1 132 ? -35.352 -9.597  -6.302  1.00 0.00 ? 132 VAL A HG12 5  
ATOM 10638 H HG13 . VAL A 1 132 ? -36.668 -8.428  -6.426  1.00 0.00 ? 132 VAL A HG13 5  
ATOM 10639 H HG21 . VAL A 1 132 ? -37.179 -12.485 -7.695  1.00 0.00 ? 132 VAL A HG21 5  
ATOM 10640 H HG22 . VAL A 1 132 ? -35.599 -11.878 -7.181  1.00 0.00 ? 132 VAL A HG22 5  
ATOM 10641 H HG23 . VAL A 1 132 ? -36.866 -12.149 -5.973  1.00 0.00 ? 132 VAL A HG23 5  
ATOM 10642 N N    . MET A 1 133 ? -39.647 -12.047 -5.778  1.00 0.00 ? 133 MET A N    5  
ATOM 10643 C CA   . MET A 1 133 ? -40.203 -12.725 -4.597  1.00 0.00 ? 133 MET A CA   5  
ATOM 10644 C C    . MET A 1 133 ? -39.613 -14.137 -4.443  1.00 0.00 ? 133 MET A C    5  
ATOM 10645 O O    . MET A 1 133 ? -39.181 -14.755 -5.421  1.00 0.00 ? 133 MET A O    5  
ATOM 10646 C CB   . MET A 1 133 ? -41.737 -12.805 -4.692  1.00 0.00 ? 133 MET A CB   5  
ATOM 10647 C CG   . MET A 1 133 ? -42.406 -11.427 -4.613  1.00 0.00 ? 133 MET A CG   5  
ATOM 10648 S SD   . MET A 1 133 ? -44.213 -11.468 -4.446  1.00 0.00 ? 133 MET A SD   5  
ATOM 10649 C CE   . MET A 1 133 ? -44.679 -11.963 -6.128  1.00 0.00 ? 133 MET A CE   5  
ATOM 10650 H H    . MET A 1 133 ? -39.420 -12.639 -6.562  1.00 0.00 ? 133 MET A H    5  
ATOM 10651 H HA   . MET A 1 133 ? -39.940 -12.161 -3.700  1.00 0.00 ? 133 MET A HA   5  
ATOM 10652 H HB2  . MET A 1 133 ? -42.020 -13.296 -5.624  1.00 0.00 ? 133 MET A HB2  5  
ATOM 10653 H HB3  . MET A 1 133 ? -42.108 -13.407 -3.861  1.00 0.00 ? 133 MET A HB3  5  
ATOM 10654 H HG2  . MET A 1 133 ? -41.998 -10.905 -3.749  1.00 0.00 ? 133 MET A HG2  5  
ATOM 10655 H HG3  . MET A 1 133 ? -42.154 -10.850 -5.503  1.00 0.00 ? 133 MET A HG3  5  
ATOM 10656 H HE1  . MET A 1 133 ? -44.290 -11.239 -6.845  1.00 0.00 ? 133 MET A HE1  5  
ATOM 10657 H HE2  . MET A 1 133 ? -44.271 -12.950 -6.351  1.00 0.00 ? 133 MET A HE2  5  
ATOM 10658 H HE3  . MET A 1 133 ? -45.764 -12.000 -6.209  1.00 0.00 ? 133 MET A HE3  5  
ATOM 10659 N N    . GLU A 1 134 ? -39.606 -14.662 -3.217  1.00 0.00 ? 134 GLU A N    5  
ATOM 10660 C CA   . GLU A 1 134 ? -39.134 -16.021 -2.902  1.00 0.00 ? 134 GLU A CA   5  
ATOM 10661 C C    . GLU A 1 134 ? -40.115 -17.115 -3.376  1.00 0.00 ? 134 GLU A C    5  
ATOM 10662 O O    . GLU A 1 134 ? -41.331 -16.893 -3.448  1.00 0.00 ? 134 GLU A O    5  
ATOM 10663 C CB   . GLU A 1 134 ? -38.866 -16.158 -1.393  1.00 0.00 ? 134 GLU A CB   5  
ATOM 10664 C CG   . GLU A 1 134 ? -37.787 -15.189 -0.889  1.00 0.00 ? 134 GLU A CG   5  
ATOM 10665 C CD   . GLU A 1 134 ? -37.433 -15.471 0.584   1.00 0.00 ? 134 GLU A CD   5  
ATOM 10666 O OE1  . GLU A 1 134 ? -38.124 -14.949 1.493   1.00 0.00 ? 134 GLU A OE1  5  
ATOM 10667 O OE2  . GLU A 1 134 ? -36.455 -16.214 0.846   1.00 0.00 ? 134 GLU A OE2  5  
ATOM 10668 H H    . GLU A 1 134 ? -39.977 -14.107 -2.459  1.00 0.00 ? 134 GLU A H    5  
ATOM 10669 H HA   . GLU A 1 134 ? -38.188 -16.186 -3.421  1.00 0.00 ? 134 GLU A HA   5  
ATOM 10670 H HB2  . GLU A 1 134 ? -39.792 -15.985 -0.843  1.00 0.00 ? 134 GLU A HB2  5  
ATOM 10671 H HB3  . GLU A 1 134 ? -38.534 -17.178 -1.193  1.00 0.00 ? 134 GLU A HB3  5  
ATOM 10672 H HG2  . GLU A 1 134 ? -36.897 -15.292 -1.515  1.00 0.00 ? 134 GLU A HG2  5  
ATOM 10673 H HG3  . GLU A 1 134 ? -38.145 -14.161 -0.990  1.00 0.00 ? 134 GLU A HG3  5  
ATOM 10674 N N    . LYS A 1 135 ? -39.585 -18.309 -3.680  1.00 0.00 ? 135 LYS A N    5  
ATOM 10675 C CA   . LYS A 1 135 ? -40.346 -19.497 -4.113  1.00 0.00 ? 135 LYS A CA   5  
ATOM 10676 C C    . LYS A 1 135 ? -40.855 -20.325 -2.920  1.00 0.00 ? 135 LYS A C    5  
ATOM 10677 O O    . LYS A 1 135 ? -40.037 -20.699 -2.049  1.00 0.00 ? 135 LYS A O    5  
ATOM 10678 C CB   . LYS A 1 135 ? -39.485 -20.317 -5.092  1.00 0.00 ? 135 LYS A CB   5  
ATOM 10679 C CG   . LYS A 1 135 ? -40.270 -21.468 -5.740  1.00 0.00 ? 135 LYS A CG   5  
ATOM 10680 C CD   . LYS A 1 135 ? -39.403 -22.223 -6.756  1.00 0.00 ? 135 LYS A CD   5  
ATOM 10681 C CE   . LYS A 1 135 ? -40.207 -23.367 -7.388  1.00 0.00 ? 135 LYS A CE   5  
ATOM 10682 N NZ   . LYS A 1 135 ? -39.399 -24.124 -8.380  1.00 0.00 ? 135 LYS A NZ   5  
ATOM 10683 H H    . LYS A 1 135 ? -38.588 -18.420 -3.561  1.00 0.00 ? 135 LYS A H    5  
ATOM 10684 H HA   . LYS A 1 135 ? -41.230 -19.162 -4.655  1.00 0.00 ? 135 LYS A HA   5  
ATOM 10685 H HB2  . LYS A 1 135 ? -39.126 -19.654 -5.884  1.00 0.00 ? 135 LYS A HB2  5  
ATOM 10686 H HB3  . LYS A 1 135 ? -38.619 -20.722 -4.565  1.00 0.00 ? 135 LYS A HB3  5  
ATOM 10687 H HG2  . LYS A 1 135 ? -40.599 -22.166 -4.968  1.00 0.00 ? 135 LYS A HG2  5  
ATOM 10688 H HG3  . LYS A 1 135 ? -41.147 -21.063 -6.248  1.00 0.00 ? 135 LYS A HG3  5  
ATOM 10689 H HD2  . LYS A 1 135 ? -39.077 -21.533 -7.537  1.00 0.00 ? 135 LYS A HD2  5  
ATOM 10690 H HD3  . LYS A 1 135 ? -38.525 -22.631 -6.250  1.00 0.00 ? 135 LYS A HD3  5  
ATOM 10691 H HE2  . LYS A 1 135 ? -40.546 -24.038 -6.594  1.00 0.00 ? 135 LYS A HE2  5  
ATOM 10692 H HE3  . LYS A 1 135 ? -41.094 -22.947 -7.872  1.00 0.00 ? 135 LYS A HE3  5  
ATOM 10693 H HZ1  . LYS A 1 135 ? -39.938 -24.875 -8.790  1.00 0.00 ? 135 LYS A HZ1  5  
ATOM 10694 H HZ2  . LYS A 1 135 ? -39.089 -23.526 -9.133  1.00 0.00 ? 135 LYS A HZ2  5  
ATOM 10695 H HZ3  . LYS A 1 135 ? -38.581 -24.535 -7.951  1.00 0.00 ? 135 LYS A HZ3  5  
ATOM 10696 N N    . MET A 1 1   ? -35.527 -15.728 1.246   1.00 0.00 ? 1   MET A N    6  
ATOM 10697 C CA   . MET A 1 1   ? -35.090 -16.267 -0.069  1.00 0.00 ? 1   MET A CA   6  
ATOM 10698 C C    . MET A 1 1   ? -34.553 -17.706 0.016   1.00 0.00 ? 1   MET A C    6  
ATOM 10699 O O    . MET A 1 1   ? -35.126 -18.556 -0.669  1.00 0.00 ? 1   MET A O    6  
ATOM 10700 C CB   . MET A 1 1   ? -34.215 -15.281 -0.877  1.00 0.00 ? 1   MET A CB   6  
ATOM 10701 C CG   . MET A 1 1   ? -33.975 -15.747 -2.321  1.00 0.00 ? 1   MET A CG   6  
ATOM 10702 S SD   . MET A 1 1   ? -35.450 -15.975 -3.361  1.00 0.00 ? 1   MET A SD   6  
ATOM 10703 C CE   . MET A 1 1   ? -36.097 -14.283 -3.458  1.00 0.00 ? 1   MET A CE   6  
ATOM 10704 H H1   . MET A 1 1   ? -34.780 -15.731 1.922   1.00 0.00 ? 1   MET A H1   6  
ATOM 10705 H H2   . MET A 1 1   ? -36.301 -16.286 1.595   1.00 0.00 ? 1   MET A H2   6  
ATOM 10706 H H3   . MET A 1 1   ? -35.868 -14.784 1.144   1.00 0.00 ? 1   MET A H3   6  
ATOM 10707 H HA   . MET A 1 1   ? -36.004 -16.366 -0.655  1.00 0.00 ? 1   MET A HA   6  
ATOM 10708 H HB2  . MET A 1 1   ? -34.708 -14.309 -0.906  1.00 0.00 ? 1   MET A HB2  6  
ATOM 10709 H HB3  . MET A 1 1   ? -33.248 -15.138 -0.400  1.00 0.00 ? 1   MET A HB3  6  
ATOM 10710 H HG2  . MET A 1 1   ? -33.332 -15.014 -2.807  1.00 0.00 ? 1   MET A HG2  6  
ATOM 10711 H HG3  . MET A 1 1   ? -33.430 -16.690 -2.297  1.00 0.00 ? 1   MET A HG3  6  
ATOM 10712 H HE1  . MET A 1 1   ? -36.961 -14.271 -4.123  1.00 0.00 ? 1   MET A HE1  6  
ATOM 10713 H HE2  . MET A 1 1   ? -36.408 -13.942 -2.470  1.00 0.00 ? 1   MET A HE2  6  
ATOM 10714 H HE3  . MET A 1 1   ? -35.332 -13.614 -3.852  1.00 0.00 ? 1   MET A HE3  6  
ATOM 10715 N N    . PRO A 1 2   ? -33.485 -18.042 0.781   1.00 0.00 ? 2   PRO A N    6  
ATOM 10716 C CA   . PRO A 1 2   ? -32.920 -19.401 0.782   1.00 0.00 ? 2   PRO A CA   6  
ATOM 10717 C C    . PRO A 1 2   ? -33.903 -20.472 1.283   1.00 0.00 ? 2   PRO A C    6  
ATOM 10718 O O    . PRO A 1 2   ? -34.568 -20.289 2.307   1.00 0.00 ? 2   PRO A O    6  
ATOM 10719 C CB   . PRO A 1 2   ? -31.653 -19.349 1.646   1.00 0.00 ? 2   PRO A CB   6  
ATOM 10720 C CG   . PRO A 1 2   ? -31.277 -17.871 1.635   1.00 0.00 ? 2   PRO A CG   6  
ATOM 10721 C CD   . PRO A 1 2   ? -32.642 -17.189 1.615   1.00 0.00 ? 2   PRO A CD   6  
ATOM 10722 H HA   . PRO A 1 2   ? -32.622 -19.637 -0.238  1.00 0.00 ? 2   PRO A HA   6  
ATOM 10723 H HB2  . PRO A 1 2   ? -31.877 -19.652 2.670   1.00 0.00 ? 2   PRO A HB2  6  
ATOM 10724 H HB3  . PRO A 1 2   ? -30.858 -19.970 1.232   1.00 0.00 ? 2   PRO A HB3  6  
ATOM 10725 H HG2  . PRO A 1 2   ? -30.697 -17.592 2.516   1.00 0.00 ? 2   PRO A HG2  6  
ATOM 10726 H HG3  . PRO A 1 2   ? -30.730 -17.631 0.722   1.00 0.00 ? 2   PRO A HG3  6  
ATOM 10727 H HD2  . PRO A 1 2   ? -33.045 -17.162 2.628   1.00 0.00 ? 2   PRO A HD2  6  
ATOM 10728 H HD3  . PRO A 1 2   ? -32.531 -16.179 1.231   1.00 0.00 ? 2   PRO A HD3  6  
ATOM 10729 N N    . VAL A 1 3   ? -33.976 -21.610 0.586   1.00 0.00 ? 3   VAL A N    6  
ATOM 10730 C CA   . VAL A 1 3   ? -34.940 -22.693 0.866   1.00 0.00 ? 3   VAL A CA   6  
ATOM 10731 C C    . VAL A 1 3   ? -34.640 -23.427 2.184   1.00 0.00 ? 3   VAL A C    6  
ATOM 10732 O O    . VAL A 1 3   ? -33.485 -23.523 2.613   1.00 0.00 ? 3   VAL A O    6  
ATOM 10733 C CB   . VAL A 1 3   ? -35.054 -23.640 -0.351  1.00 0.00 ? 3   VAL A CB   6  
ATOM 10734 C CG1  . VAL A 1 3   ? -33.817 -24.519 -0.561  1.00 0.00 ? 3   VAL A CG1  6  
ATOM 10735 C CG2  . VAL A 1 3   ? -36.294 -24.537 -0.286  1.00 0.00 ? 3   VAL A CG2  6  
ATOM 10736 H H    . VAL A 1 3   ? -33.379 -21.709 -0.223  1.00 0.00 ? 3   VAL A H    6  
ATOM 10737 H HA   . VAL A 1 3   ? -35.915 -22.219 0.982   1.00 0.00 ? 3   VAL A HA   6  
ATOM 10738 H HB   . VAL A 1 3   ? -35.167 -23.015 -1.238  1.00 0.00 ? 3   VAL A HB   6  
ATOM 10739 H HG11 . VAL A 1 3   ? -33.689 -25.208 0.274   1.00 0.00 ? 3   VAL A HG11 6  
ATOM 10740 H HG12 . VAL A 1 3   ? -33.931 -25.097 -1.479  1.00 0.00 ? 3   VAL A HG12 6  
ATOM 10741 H HG13 . VAL A 1 3   ? -32.928 -23.898 -0.657  1.00 0.00 ? 3   VAL A HG13 6  
ATOM 10742 H HG21 . VAL A 1 3   ? -36.405 -25.069 -1.233  1.00 0.00 ? 3   VAL A HG21 6  
ATOM 10743 H HG22 . VAL A 1 3   ? -36.199 -25.273 0.512   1.00 0.00 ? 3   VAL A HG22 6  
ATOM 10744 H HG23 . VAL A 1 3   ? -37.187 -23.932 -0.125  1.00 0.00 ? 3   VAL A HG23 6  
ATOM 10745 N N    . ARG A 1 4   ? -35.683 -23.938 2.850   1.00 0.00 ? 4   ARG A N    6  
ATOM 10746 C CA   . ARG A 1 4   ? -35.568 -24.735 4.086   1.00 0.00 ? 4   ARG A CA   6  
ATOM 10747 C C    . ARG A 1 4   ? -35.078 -26.161 3.789   1.00 0.00 ? 4   ARG A C    6  
ATOM 10748 O O    . ARG A 1 4   ? -35.432 -26.742 2.761   1.00 0.00 ? 4   ARG A O    6  
ATOM 10749 C CB   . ARG A 1 4   ? -36.911 -24.764 4.841   1.00 0.00 ? 4   ARG A CB   6  
ATOM 10750 C CG   . ARG A 1 4   ? -37.508 -23.394 5.217   1.00 0.00 ? 4   ARG A CG   6  
ATOM 10751 C CD   . ARG A 1 4   ? -36.616 -22.538 6.128   1.00 0.00 ? 4   ARG A CD   6  
ATOM 10752 N NE   . ARG A 1 4   ? -35.642 -21.730 5.365   1.00 0.00 ? 4   ARG A NE   6  
ATOM 10753 C CZ   . ARG A 1 4   ? -34.663 -20.995 5.864   1.00 0.00 ? 4   ARG A CZ   6  
ATOM 10754 N NH1  . ARG A 1 4   ? -34.393 -20.964 7.139   1.00 0.00 ? 4   ARG A NH1  6  
ATOM 10755 N NH2  . ARG A 1 4   ? -33.932 -20.264 5.075   1.00 0.00 ? 4   ARG A NH2  6  
ATOM 10756 H H    . ARG A 1 4   ? -36.600 -23.847 2.431   1.00 0.00 ? 4   ARG A H    6  
ATOM 10757 H HA   . ARG A 1 4   ? -34.822 -24.269 4.732   1.00 0.00 ? 4   ARG A HA   6  
ATOM 10758 H HB2  . ARG A 1 4   ? -37.644 -25.292 4.228   1.00 0.00 ? 4   ARG A HB2  6  
ATOM 10759 H HB3  . ARG A 1 4   ? -36.781 -25.340 5.759   1.00 0.00 ? 4   ARG A HB3  6  
ATOM 10760 H HG2  . ARG A 1 4   ? -37.763 -22.833 4.316   1.00 0.00 ? 4   ARG A HG2  6  
ATOM 10761 H HG3  . ARG A 1 4   ? -38.439 -23.585 5.751   1.00 0.00 ? 4   ARG A HG3  6  
ATOM 10762 H HD2  . ARG A 1 4   ? -37.260 -21.858 6.689   1.00 0.00 ? 4   ARG A HD2  6  
ATOM 10763 H HD3  . ARG A 1 4   ? -36.104 -23.189 6.839   1.00 0.00 ? 4   ARG A HD3  6  
ATOM 10764 H HE   . ARG A 1 4   ? -35.769 -21.672 4.367   1.00 0.00 ? 4   ARG A HE   6  
ATOM 10765 H HH11 . ARG A 1 4   ? -34.954 -21.509 7.771   1.00 0.00 ? 4   ARG A HH11 6  
ATOM 10766 H HH12 . ARG A 1 4   ? -33.644 -20.394 7.493   1.00 0.00 ? 4   ARG A HH12 6  
ATOM 10767 H HH21 . ARG A 1 4   ? -34.155 -20.227 4.085   1.00 0.00 ? 4   ARG A HH21 6  
ATOM 10768 H HH22 . ARG A 1 4   ? -33.208 -19.677 5.452   1.00 0.00 ? 4   ARG A HH22 6  
ATOM 10769 N N    . ARG A 1 5   ? -34.269 -26.722 4.696   1.00 0.00 ? 5   ARG A N    6  
ATOM 10770 C CA   . ARG A 1 5   ? -33.669 -28.071 4.603   1.00 0.00 ? 5   ARG A CA   6  
ATOM 10771 C C    . ARG A 1 5   ? -33.337 -28.651 5.984   1.00 0.00 ? 5   ARG A C    6  
ATOM 10772 O O    . ARG A 1 5   ? -32.999 -27.903 6.904   1.00 0.00 ? 5   ARG A O    6  
ATOM 10773 C CB   . ARG A 1 5   ? -32.433 -28.070 3.670   1.00 0.00 ? 5   ARG A CB   6  
ATOM 10774 C CG   . ARG A 1 5   ? -31.211 -27.224 4.087   1.00 0.00 ? 5   ARG A CG   6  
ATOM 10775 C CD   . ARG A 1 5   ? -31.414 -25.709 3.946   1.00 0.00 ? 5   ARG A CD   6  
ATOM 10776 N NE   . ARG A 1 5   ? -30.163 -24.965 4.183   1.00 0.00 ? 5   ARG A NE   6  
ATOM 10777 C CZ   . ARG A 1 5   ? -30.013 -23.653 4.143   1.00 0.00 ? 5   ARG A CZ   6  
ATOM 10778 N NH1  . ARG A 1 5   ? -30.978 -22.848 3.797   1.00 0.00 ? 5   ARG A NH1  6  
ATOM 10779 N NH2  . ARG A 1 5   ? -28.869 -23.115 4.454   1.00 0.00 ? 5   ARG A NH2  6  
ATOM 10780 H H    . ARG A 1 5   ? -34.076 -26.190 5.533   1.00 0.00 ? 5   ARG A H    6  
ATOM 10781 H HA   . ARG A 1 5   ? -34.411 -28.737 4.158   1.00 0.00 ? 5   ARG A HA   6  
ATOM 10782 H HB2  . ARG A 1 5   ? -32.093 -29.102 3.574   1.00 0.00 ? 5   ARG A HB2  6  
ATOM 10783 H HB3  . ARG A 1 5   ? -32.745 -27.754 2.673   1.00 0.00 ? 5   ARG A HB3  6  
ATOM 10784 H HG2  . ARG A 1 5   ? -30.925 -27.461 5.112   1.00 0.00 ? 5   ARG A HG2  6  
ATOM 10785 H HG3  . ARG A 1 5   ? -30.382 -27.508 3.436   1.00 0.00 ? 5   ARG A HG3  6  
ATOM 10786 H HD2  . ARG A 1 5   ? -31.781 -25.503 2.940   1.00 0.00 ? 5   ARG A HD2  6  
ATOM 10787 H HD3  . ARG A 1 5   ? -32.154 -25.372 4.670   1.00 0.00 ? 5   ARG A HD3  6  
ATOM 10788 H HE   . ARG A 1 5   ? -29.352 -25.502 4.445   1.00 0.00 ? 5   ARG A HE   6  
ATOM 10789 H HH11 . ARG A 1 5   ? -31.866 -23.232 3.487   1.00 0.00 ? 5   ARG A HH11 6  
ATOM 10790 H HH12 . ARG A 1 5   ? -30.838 -21.855 3.806   1.00 0.00 ? 5   ARG A HH12 6  
ATOM 10791 H HH21 . ARG A 1 5   ? -28.094 -23.695 4.733   1.00 0.00 ? 5   ARG A HH21 6  
ATOM 10792 H HH22 . ARG A 1 5   ? -28.753 -22.116 4.434   1.00 0.00 ? 5   ARG A HH22 6  
ATOM 10793 N N    . GLY A 1 6   ? -33.412 -29.978 6.122   1.00 0.00 ? 6   GLY A N    6  
ATOM 10794 C CA   . GLY A 1 6   ? -33.105 -30.699 7.369   1.00 0.00 ? 6   GLY A CA   6  
ATOM 10795 C C    . GLY A 1 6   ? -31.605 -30.915 7.630   1.00 0.00 ? 6   GLY A C    6  
ATOM 10796 O O    . GLY A 1 6   ? -31.191 -31.057 8.782   1.00 0.00 ? 6   GLY A O    6  
ATOM 10797 H H    . GLY A 1 6   ? -33.719 -30.518 5.325   1.00 0.00 ? 6   GLY A H    6  
ATOM 10798 H HA2  . GLY A 1 6   ? -33.530 -30.159 8.218   1.00 0.00 ? 6   GLY A HA2  6  
ATOM 10799 H HA3  . GLY A 1 6   ? -33.577 -31.681 7.327   1.00 0.00 ? 6   GLY A HA3  6  
ATOM 10800 N N    . HIS A 1 7   ? -30.786 -30.911 6.572   1.00 0.00 ? 7   HIS A N    6  
ATOM 10801 C CA   . HIS A 1 7   ? -29.318 -31.012 6.612   1.00 0.00 ? 7   HIS A CA   6  
ATOM 10802 C C    . HIS A 1 7   ? -28.681 -30.142 5.515   1.00 0.00 ? 7   HIS A C    6  
ATOM 10803 O O    . HIS A 1 7   ? -29.309 -29.877 4.487   1.00 0.00 ? 7   HIS A O    6  
ATOM 10804 C CB   . HIS A 1 7   ? -28.906 -32.488 6.482   1.00 0.00 ? 7   HIS A CB   6  
ATOM 10805 C CG   . HIS A 1 7   ? -27.413 -32.702 6.544   1.00 0.00 ? 7   HIS A CG   6  
ATOM 10806 N ND1  . HIS A 1 7   ? -26.647 -32.737 7.713   1.00 0.00 ? 7   HIS A ND1  6  
ATOM 10807 C CD2  . HIS A 1 7   ? -26.585 -32.851 5.469   1.00 0.00 ? 7   HIS A CD2  6  
ATOM 10808 C CE1  . HIS A 1 7   ? -25.373 -32.903 7.314   1.00 0.00 ? 7   HIS A CE1  6  
ATOM 10809 N NE2  . HIS A 1 7   ? -25.308 -32.971 5.973   1.00 0.00 ? 7   HIS A NE2  6  
ATOM 10810 H H    . HIS A 1 7   ? -31.205 -30.781 5.662   1.00 0.00 ? 7   HIS A H    6  
ATOM 10811 H HA   . HIS A 1 7   ? -28.955 -30.643 7.572   1.00 0.00 ? 7   HIS A HA   6  
ATOM 10812 H HB2  . HIS A 1 7   ? -29.368 -33.060 7.287   1.00 0.00 ? 7   HIS A HB2  6  
ATOM 10813 H HB3  . HIS A 1 7   ? -29.278 -32.883 5.535   1.00 0.00 ? 7   HIS A HB3  6  
ATOM 10814 H HD2  . HIS A 1 7   ? -26.877 -32.844 4.426   1.00 0.00 ? 7   HIS A HD2  6  
ATOM 10815 H HE1  . HIS A 1 7   ? -24.517 -32.966 7.978   1.00 0.00 ? 7   HIS A HE1  6  
ATOM 10816 H HE2  . HIS A 1 7   ? -24.455 -33.077 5.433   1.00 0.00 ? 7   HIS A HE2  6  
ATOM 10817 N N    . VAL A 1 8   ? -27.436 -29.696 5.717   1.00 0.00 ? 8   VAL A N    6  
ATOM 10818 C CA   . VAL A 1 8   ? -26.715 -28.829 4.770   1.00 0.00 ? 8   VAL A CA   6  
ATOM 10819 C C    . VAL A 1 8   ? -26.209 -29.605 3.542   1.00 0.00 ? 8   VAL A C    6  
ATOM 10820 O O    . VAL A 1 8   ? -25.290 -30.422 3.618   1.00 0.00 ? 8   VAL A O    6  
ATOM 10821 C CB   . VAL A 1 8   ? -25.623 -27.997 5.486   1.00 0.00 ? 8   VAL A CB   6  
ATOM 10822 C CG1  . VAL A 1 8   ? -24.565 -28.817 6.240   1.00 0.00 ? 8   VAL A CG1  6  
ATOM 10823 C CG2  . VAL A 1 8   ? -24.917 -27.028 4.534   1.00 0.00 ? 8   VAL A CG2  6  
ATOM 10824 H H    . VAL A 1 8   ? -26.954 -29.995 6.554   1.00 0.00 ? 8   VAL A H    6  
ATOM 10825 H HA   . VAL A 1 8   ? -27.433 -28.097 4.400   1.00 0.00 ? 8   VAL A HA   6  
ATOM 10826 H HB   . VAL A 1 8   ? -26.136 -27.388 6.231   1.00 0.00 ? 8   VAL A HB   6  
ATOM 10827 H HG11 . VAL A 1 8   ? -25.040 -29.489 6.954   1.00 0.00 ? 8   VAL A HG11 6  
ATOM 10828 H HG12 . VAL A 1 8   ? -23.960 -29.398 5.545   1.00 0.00 ? 8   VAL A HG12 6  
ATOM 10829 H HG13 . VAL A 1 8   ? -23.909 -28.143 6.791   1.00 0.00 ? 8   VAL A HG13 6  
ATOM 10830 H HG21 . VAL A 1 8   ? -24.292 -26.342 5.108   1.00 0.00 ? 8   VAL A HG21 6  
ATOM 10831 H HG22 . VAL A 1 8   ? -24.284 -27.576 3.836   1.00 0.00 ? 8   VAL A HG22 6  
ATOM 10832 H HG23 . VAL A 1 8   ? -25.652 -26.447 3.977   1.00 0.00 ? 8   VAL A HG23 6  
ATOM 10833 N N    . ALA A 1 9   ? -26.821 -29.337 2.386   1.00 0.00 ? 9   ALA A N    6  
ATOM 10834 C CA   . ALA A 1 9   ? -26.337 -29.771 1.071   1.00 0.00 ? 9   ALA A CA   6  
ATOM 10835 C C    . ALA A 1 9   ? -25.045 -29.002 0.697   1.00 0.00 ? 9   ALA A C    6  
ATOM 10836 O O    . ALA A 1 9   ? -24.816 -27.926 1.261   1.00 0.00 ? 9   ALA A O    6  
ATOM 10837 C CB   . ALA A 1 9   ? -27.465 -29.532 0.057   1.00 0.00 ? 9   ALA A CB   6  
ATOM 10838 H H    . ALA A 1 9   ? -27.605 -28.702 2.403   1.00 0.00 ? 9   ALA A H    6  
ATOM 10839 H HA   . ALA A 1 9   ? -26.115 -30.838 1.095   1.00 0.00 ? 9   ALA A HA   6  
ATOM 10840 H HB1  . ALA A 1 9   ? -28.352 -30.095 0.351   1.00 0.00 ? 9   ALA A HB1  6  
ATOM 10841 H HB2  . ALA A 1 9   ? -27.710 -28.470 0.017   1.00 0.00 ? 9   ALA A HB2  6  
ATOM 10842 H HB3  . ALA A 1 9   ? -27.157 -29.859 -0.936  1.00 0.00 ? 9   ALA A HB3  6  
ATOM 10843 N N    . PRO A 1 10  ? -24.214 -29.494 -0.250  1.00 0.00 ? 10  PRO A N    6  
ATOM 10844 C CA   . PRO A 1 10  ? -23.025 -28.791 -0.750  1.00 0.00 ? 10  PRO A CA   6  
ATOM 10845 C C    . PRO A 1 10  ? -23.317 -27.311 -1.041  1.00 0.00 ? 10  PRO A C    6  
ATOM 10846 O O    . PRO A 1 10  ? -24.046 -26.952 -1.967  1.00 0.00 ? 10  PRO A O    6  
ATOM 10847 C CB   . PRO A 1 10  ? -22.572 -29.573 -1.983  1.00 0.00 ? 10  PRO A CB   6  
ATOM 10848 C CG   . PRO A 1 10  ? -23.027 -30.998 -1.670  1.00 0.00 ? 10  PRO A CG   6  
ATOM 10849 C CD   . PRO A 1 10  ? -24.324 -30.799 -0.883  1.00 0.00 ? 10  PRO A CD   6  
ATOM 10850 H HA   . PRO A 1 10  ? -22.245 -28.863 0.009   1.00 0.00 ? 10  PRO A HA   6  
ATOM 10851 H HB2  . PRO A 1 10  ? -23.091 -29.206 -2.864  1.00 0.00 ? 10  PRO A HB2  6  
ATOM 10852 H HB3  . PRO A 1 10  ? -21.492 -29.515 -2.124  1.00 0.00 ? 10  PRO A HB3  6  
ATOM 10853 H HG2  . PRO A 1 10  ? -23.191 -31.580 -2.577  1.00 0.00 ? 10  PRO A HG2  6  
ATOM 10854 H HG3  . PRO A 1 10  ? -22.287 -31.484 -1.032  1.00 0.00 ? 10  PRO A HG3  6  
ATOM 10855 H HD2  . PRO A 1 10  ? -25.181 -30.808 -1.555  1.00 0.00 ? 10  PRO A HD2  6  
ATOM 10856 H HD3  . PRO A 1 10  ? -24.427 -31.593 -0.141  1.00 0.00 ? 10  PRO A HD3  6  
ATOM 10857 N N    . GLN A 1 11  ? -22.747 -26.441 -0.213  1.00 0.00 ? 11  GLN A N    6  
ATOM 10858 C CA   . GLN A 1 11  ? -23.140 -25.034 -0.108  1.00 0.00 ? 11  GLN A CA   6  
ATOM 10859 C C    . GLN A 1 11  ? -22.931 -24.198 -1.378  1.00 0.00 ? 11  GLN A C    6  
ATOM 10860 O O    . GLN A 1 11  ? -23.698 -23.268 -1.614  1.00 0.00 ? 11  GLN A O    6  
ATOM 10861 C CB   . GLN A 1 11  ? -22.506 -24.402 1.146   1.00 0.00 ? 11  GLN A CB   6  
ATOM 10862 C CG   . GLN A 1 11  ? -21.012 -24.046 1.050   1.00 0.00 ? 11  GLN A CG   6  
ATOM 10863 C CD   . GLN A 1 11  ? -20.083 -25.232 0.781   1.00 0.00 ? 11  GLN A CD   6  
ATOM 10864 O OE1  . GLN A 1 11  ? -20.240 -26.326 1.309   1.00 0.00 ? 11  GLN A OE1  6  
ATOM 10865 N NE2  . GLN A 1 11  ? -19.103 -25.077 -0.083  1.00 0.00 ? 11  GLN A NE2  6  
ATOM 10866 H H    . GLN A 1 11  ? -22.126 -26.819 0.488   1.00 0.00 ? 11  GLN A H    6  
ATOM 10867 H HA   . GLN A 1 11  ? -24.214 -25.033 0.074   1.00 0.00 ? 11  GLN A HA   6  
ATOM 10868 H HB2  . GLN A 1 11  ? -23.048 -23.480 1.363   1.00 0.00 ? 11  GLN A HB2  6  
ATOM 10869 H HB3  . GLN A 1 11  ? -22.660 -25.069 1.996   1.00 0.00 ? 11  GLN A HB3  6  
ATOM 10870 H HG2  . GLN A 1 11  ? -20.876 -23.290 0.278   1.00 0.00 ? 11  GLN A HG2  6  
ATOM 10871 H HG3  . GLN A 1 11  ? -20.715 -23.603 2.000   1.00 0.00 ? 11  GLN A HG3  6  
ATOM 10872 H HE21 . GLN A 1 11  ? -18.988 -24.196 -0.577  1.00 0.00 ? 11  GLN A HE21 6  
ATOM 10873 H HE22 . GLN A 1 11  ? -18.481 -25.854 -0.246  1.00 0.00 ? 11  GLN A HE22 6  
ATOM 10874 N N    . ASN A 1 12  ? -21.950 -24.533 -2.223  1.00 0.00 ? 12  ASN A N    6  
ATOM 10875 C CA   . ASN A 1 12  ? -21.633 -23.747 -3.419  1.00 0.00 ? 12  ASN A CA   6  
ATOM 10876 C C    . ASN A 1 12  ? -22.750 -23.882 -4.472  1.00 0.00 ? 12  ASN A C    6  
ATOM 10877 O O    . ASN A 1 12  ? -23.268 -22.884 -4.970  1.00 0.00 ? 12  ASN A O    6  
ATOM 10878 C CB   . ASN A 1 12  ? -20.271 -24.202 -3.980  1.00 0.00 ? 12  ASN A CB   6  
ATOM 10879 C CG   . ASN A 1 12  ? -19.067 -23.621 -3.247  1.00 0.00 ? 12  ASN A CG   6  
ATOM 10880 O OD1  . ASN A 1 12  ? -19.160 -23.006 -2.193  1.00 0.00 ? 12  ASN A OD1  6  
ATOM 10881 N ND2  . ASN A 1 12  ? -17.881 -23.821 -3.773  1.00 0.00 ? 12  ASN A ND2  6  
ATOM 10882 H H    . ASN A 1 12  ? -21.381 -25.339 -2.005  1.00 0.00 ? 12  ASN A H    6  
ATOM 10883 H HA   . ASN A 1 12  ? -21.573 -22.689 -3.157  1.00 0.00 ? 12  ASN A HA   6  
ATOM 10884 H HB2  . ASN A 1 12  ? -20.203 -25.290 -3.980  1.00 0.00 ? 12  ASN A HB2  6  
ATOM 10885 H HB3  . ASN A 1 12  ? -20.203 -23.866 -5.016  1.00 0.00 ? 12  ASN A HB3  6  
ATOM 10886 H HD21 . ASN A 1 12  ? -17.784 -24.333 -4.638  1.00 0.00 ? 12  ASN A HD21 6  
ATOM 10887 H HD22 . ASN A 1 12  ? -17.076 -23.438 -3.300  1.00 0.00 ? 12  ASN A HD22 6  
ATOM 10888 N N    . THR A 1 13  ? -23.153 -25.118 -4.780  1.00 0.00 ? 13  THR A N    6  
ATOM 10889 C CA   . THR A 1 13  ? -24.212 -25.437 -5.757  1.00 0.00 ? 13  THR A CA   6  
ATOM 10890 C C    . THR A 1 13  ? -25.616 -25.196 -5.195  1.00 0.00 ? 13  THR A C    6  
ATOM 10891 O O    . THR A 1 13  ? -26.508 -24.703 -5.892  1.00 0.00 ? 13  THR A O    6  
ATOM 10892 C CB   . THR A 1 13  ? -24.044 -26.887 -6.234  1.00 0.00 ? 13  THR A CB   6  
ATOM 10893 O OG1  . THR A 1 13  ? -24.682 -27.077 -7.478  1.00 0.00 ? 13  THR A OG1  6  
ATOM 10894 C CG2  . THR A 1 13  ? -24.581 -27.921 -5.250  1.00 0.00 ? 13  THR A CG2  6  
ATOM 10895 H H    . THR A 1 13  ? -22.686 -25.885 -4.318  1.00 0.00 ? 13  THR A H    6  
ATOM 10896 H HA   . THR A 1 13  ? -24.086 -24.791 -6.625  1.00 0.00 ? 13  THR A HA   6  
ATOM 10897 H HB   . THR A 1 13  ? -22.978 -27.066 -6.343  1.00 0.00 ? 13  THR A HB   6  
ATOM 10898 H HG1  . THR A 1 13  ? -24.441 -27.964 -7.800  1.00 0.00 ? 13  THR A HG1  6  
ATOM 10899 H HG21 . THR A 1 13  ? -24.272 -28.921 -5.550  1.00 0.00 ? 13  THR A HG21 6  
ATOM 10900 H HG22 . THR A 1 13  ? -24.177 -27.702 -4.266  1.00 0.00 ? 13  THR A HG22 6  
ATOM 10901 H HG23 . THR A 1 13  ? -25.669 -27.869 -5.200  1.00 0.00 ? 13  THR A HG23 6  
ATOM 10902 N N    . PHE A 1 14  ? -25.800 -25.464 -3.896  1.00 0.00 ? 14  PHE A N    6  
ATOM 10903 C CA   . PHE A 1 14  ? -27.010 -25.104 -3.169  1.00 0.00 ? 14  PHE A CA   6  
ATOM 10904 C C    . PHE A 1 14  ? -27.255 -23.601 -3.268  1.00 0.00 ? 14  PHE A C    6  
ATOM 10905 O O    . PHE A 1 14  ? -28.353 -23.183 -3.627  1.00 0.00 ? 14  PHE A O    6  
ATOM 10906 C CB   . PHE A 1 14  ? -26.855 -25.538 -1.713  1.00 0.00 ? 14  PHE A CB   6  
ATOM 10907 C CG   . PHE A 1 14  ? -28.064 -25.208 -0.857  1.00 0.00 ? 14  PHE A CG   6  
ATOM 10908 C CD1  . PHE A 1 14  ? -29.196 -26.045 -0.867  1.00 0.00 ? 14  PHE A CD1  6  
ATOM 10909 C CD2  . PHE A 1 14  ? -28.081 -24.018 -0.103  1.00 0.00 ? 14  PHE A CD2  6  
ATOM 10910 C CE1  . PHE A 1 14  ? -30.340 -25.691 -0.132  1.00 0.00 ? 14  PHE A CE1  6  
ATOM 10911 C CE2  . PHE A 1 14  ? -29.230 -23.658 0.623   1.00 0.00 ? 14  PHE A CE2  6  
ATOM 10912 C CZ   . PHE A 1 14  ? -30.361 -24.493 0.605   1.00 0.00 ? 14  PHE A CZ   6  
ATOM 10913 H H    . PHE A 1 14  ? -25.050 -25.906 -3.372  1.00 0.00 ? 14  PHE A H    6  
ATOM 10914 H HA   . PHE A 1 14  ? -27.865 -25.621 -3.606  1.00 0.00 ? 14  PHE A HA   6  
ATOM 10915 H HB2  . PHE A 1 14  ? -26.675 -26.611 -1.698  1.00 0.00 ? 14  PHE A HB2  6  
ATOM 10916 H HB3  . PHE A 1 14  ? -25.973 -25.056 -1.295  1.00 0.00 ? 14  PHE A HB3  6  
ATOM 10917 H HD1  . PHE A 1 14  ? -29.193 -26.954 -1.455  1.00 0.00 ? 14  PHE A HD1  6  
ATOM 10918 H HD2  . PHE A 1 14  ? -27.220 -23.364 -0.100  1.00 0.00 ? 14  PHE A HD2  6  
ATOM 10919 H HE1  . PHE A 1 14  ? -31.213 -26.330 -0.147  1.00 0.00 ? 14  PHE A HE1  6  
ATOM 10920 H HE2  . PHE A 1 14  ? -29.247 -22.734 1.186   1.00 0.00 ? 14  PHE A HE2  6  
ATOM 10921 H HZ   . PHE A 1 14  ? -31.248 -24.207 1.150   1.00 0.00 ? 14  PHE A HZ   6  
ATOM 10922 N N    . LEU A 1 15  ? -26.209 -22.796 -3.064  1.00 0.00 ? 15  LEU A N    6  
ATOM 10923 C CA   . LEU A 1 15  ? -26.308 -21.343 -3.206  1.00 0.00 ? 15  LEU A CA   6  
ATOM 10924 C C    . LEU A 1 15  ? -26.486 -20.940 -4.672  1.00 0.00 ? 15  LEU A C    6  
ATOM 10925 O O    . LEU A 1 15  ? -27.344 -20.117 -4.951  1.00 0.00 ? 15  LEU A O    6  
ATOM 10926 C CB   . LEU A 1 15  ? -25.107 -20.651 -2.548  1.00 0.00 ? 15  LEU A CB   6  
ATOM 10927 C CG   . LEU A 1 15  ? -25.091 -19.126 -2.753  1.00 0.00 ? 15  LEU A CG   6  
ATOM 10928 C CD1  . LEU A 1 15  ? -26.379 -18.422 -2.304  1.00 0.00 ? 15  LEU A CD1  6  
ATOM 10929 C CD2  . LEU A 1 15  ? -23.909 -18.527 -1.991  1.00 0.00 ? 15  LEU A CD2  6  
ATOM 10930 H H    . LEU A 1 15  ? -25.317 -23.222 -2.816  1.00 0.00 ? 15  LEU A H    6  
ATOM 10931 H HA   . LEU A 1 15  ? -27.205 -21.015 -2.678  1.00 0.00 ? 15  LEU A HA   6  
ATOM 10932 H HB2  . LEU A 1 15  ? -25.120 -20.869 -1.479  1.00 0.00 ? 15  LEU A HB2  6  
ATOM 10933 H HB3  . LEU A 1 15  ? -24.189 -21.057 -2.975  1.00 0.00 ? 15  LEU A HB3  6  
ATOM 10934 H HG   . LEU A 1 15  ? -24.948 -18.940 -3.819  1.00 0.00 ? 15  LEU A HG   6  
ATOM 10935 H HD11 . LEU A 1 15  ? -26.775 -18.874 -1.392  1.00 0.00 ? 15  LEU A HD11 6  
ATOM 10936 H HD12 . LEU A 1 15  ? -26.198 -17.359 -2.144  1.00 0.00 ? 15  LEU A HD12 6  
ATOM 10937 H HD13 . LEU A 1 15  ? -27.126 -18.497 -3.089  1.00 0.00 ? 15  LEU A HD13 6  
ATOM 10938 H HD21 . LEU A 1 15  ? -23.835 -17.460 -2.203  1.00 0.00 ? 15  LEU A HD21 6  
ATOM 10939 H HD22 . LEU A 1 15  ? -24.043 -18.675 -0.919  1.00 0.00 ? 15  LEU A HD22 6  
ATOM 10940 H HD23 . LEU A 1 15  ? -22.984 -19.009 -2.309  1.00 0.00 ? 15  LEU A HD23 6  
ATOM 10941 N N    . ASP A 1 16  ? -25.770 -21.541 -5.623  1.00 0.00 ? 16  ASP A N    6  
ATOM 10942 C CA   . ASP A 1 16  ? -25.993 -21.332 -7.064  1.00 0.00 ? 16  ASP A CA   6  
ATOM 10943 C C    . ASP A 1 16  ? -27.468 -21.493 -7.476  1.00 0.00 ? 16  ASP A C    6  
ATOM 10944 O O    . ASP A 1 16  ? -27.986 -20.741 -8.301  1.00 0.00 ? 16  ASP A O    6  
ATOM 10945 C CB   . ASP A 1 16  ? -25.103 -22.268 -7.888  1.00 0.00 ? 16  ASP A CB   6  
ATOM 10946 C CG   . ASP A 1 16  ? -25.046 -21.834 -9.364  1.00 0.00 ? 16  ASP A CG   6  
ATOM 10947 O OD1  . ASP A 1 16  ? -24.968 -20.611 -9.635  1.00 0.00 ? 16  ASP A OD1  6  
ATOM 10948 O OD2  . ASP A 1 16  ? -25.087 -22.713 -10.255 1.00 0.00 ? 16  ASP A OD2  6  
ATOM 10949 H H    . ASP A 1 16  ? -25.016 -22.153 -5.337  1.00 0.00 ? 16  ASP A H    6  
ATOM 10950 H HA   . ASP A 1 16  ? -25.697 -20.310 -7.294  1.00 0.00 ? 16  ASP A HA   6  
ATOM 10951 H HB2  . ASP A 1 16  ? -24.098 -22.267 -7.470  1.00 0.00 ? 16  ASP A HB2  6  
ATOM 10952 H HB3  . ASP A 1 16  ? -25.490 -23.285 -7.822  1.00 0.00 ? 16  ASP A HB3  6  
ATOM 10953 N N    . THR A 1 17  ? -28.154 -22.478 -6.899  1.00 0.00 ? 17  THR A N    6  
ATOM 10954 C CA   . THR A 1 17  ? -29.616 -22.648 -7.050  1.00 0.00 ? 17  THR A CA   6  
ATOM 10955 C C    . THR A 1 17  ? -30.406 -21.434 -6.534  1.00 0.00 ? 17  THR A C    6  
ATOM 10956 O O    . THR A 1 17  ? -31.336 -20.956 -7.188  1.00 0.00 ? 17  THR A O    6  
ATOM 10957 C CB   . THR A 1 17  ? -30.108 -23.945 -6.383  1.00 0.00 ? 17  THR A CB   6  
ATOM 10958 O OG1  . THR A 1 17  ? -29.408 -25.062 -6.898  1.00 0.00 ? 17  THR A OG1  6  
ATOM 10959 C CG2  . THR A 1 17  ? -31.595 -24.203 -6.634  1.00 0.00 ? 17  THR A CG2  6  
ATOM 10960 H H    . THR A 1 17  ? -27.646 -23.020 -6.201  1.00 0.00 ? 17  THR A H    6  
ATOM 10961 H HA   . THR A 1 17  ? -29.828 -22.723 -8.116  1.00 0.00 ? 17  THR A HA   6  
ATOM 10962 H HB   . THR A 1 17  ? -29.950 -23.892 -5.310  1.00 0.00 ? 17  THR A HB   6  
ATOM 10963 H HG1  . THR A 1 17  ? -28.471 -24.961 -6.653  1.00 0.00 ? 17  THR A HG1  6  
ATOM 10964 H HG21 . THR A 1 17  ? -31.873 -25.172 -6.218  1.00 0.00 ? 17  THR A HG21 6  
ATOM 10965 H HG22 . THR A 1 17  ? -32.194 -23.435 -6.144  1.00 0.00 ? 17  THR A HG22 6  
ATOM 10966 H HG23 . THR A 1 17  ? -31.802 -24.196 -7.705  1.00 0.00 ? 17  THR A HG23 6  
ATOM 10967 N N    . ILE A 1 18  ? -30.011 -20.879 -5.385  1.00 0.00 ? 18  ILE A N    6  
ATOM 10968 C CA   . ILE A 1 18  ? -30.627 -19.671 -4.820  1.00 0.00 ? 18  ILE A CA   6  
ATOM 10969 C C    . ILE A 1 18  ? -30.301 -18.454 -5.699  1.00 0.00 ? 18  ILE A C    6  
ATOM 10970 O O    . ILE A 1 18  ? -31.175 -17.614 -5.920  1.00 0.00 ? 18  ILE A O    6  
ATOM 10971 C CB   . ILE A 1 18  ? -30.180 -19.428 -3.361  1.00 0.00 ? 18  ILE A CB   6  
ATOM 10972 C CG1  . ILE A 1 18  ? -30.300 -20.634 -2.414  1.00 0.00 ? 18  ILE A CG1  6  
ATOM 10973 C CG2  . ILE A 1 18  ? -30.958 -18.256 -2.736  1.00 0.00 ? 18  ILE A CG2  6  
ATOM 10974 C CD1  . ILE A 1 18  ? -31.663 -21.341 -2.395  1.00 0.00 ? 18  ILE A CD1  6  
ATOM 10975 H H    . ILE A 1 18  ? -29.158 -21.222 -4.959  1.00 0.00 ? 18  ILE A H    6  
ATOM 10976 H HA   . ILE A 1 18  ? -31.706 -19.808 -4.836  1.00 0.00 ? 18  ILE A HA   6  
ATOM 10977 H HB   . ILE A 1 18  ? -29.130 -19.160 -3.386  1.00 0.00 ? 18  ILE A HB   6  
ATOM 10978 H HG12 . ILE A 1 18  ? -29.555 -21.363 -2.701  1.00 0.00 ? 18  ILE A HG12 6  
ATOM 10979 H HG13 . ILE A 1 18  ? -30.020 -20.311 -1.409  1.00 0.00 ? 18  ILE A HG13 6  
ATOM 10980 H HG21 . ILE A 1 18  ? -30.721 -17.333 -3.258  1.00 0.00 ? 18  ILE A HG21 6  
ATOM 10981 H HG22 . ILE A 1 18  ? -32.030 -18.436 -2.798  1.00 0.00 ? 18  ILE A HG22 6  
ATOM 10982 H HG23 . ILE A 1 18  ? -30.672 -18.124 -1.692  1.00 0.00 ? 18  ILE A HG23 6  
ATOM 10983 H HD11 . ILE A 1 18  ? -31.852 -21.814 -3.360  1.00 0.00 ? 18  ILE A HD11 6  
ATOM 10984 H HD12 . ILE A 1 18  ? -31.651 -22.112 -1.626  1.00 0.00 ? 18  ILE A HD12 6  
ATOM 10985 H HD13 . ILE A 1 18  ? -32.465 -20.636 -2.187  1.00 0.00 ? 18  ILE A HD13 6  
ATOM 10986 N N    . ILE A 1 19  ? -29.099 -18.395 -6.292  1.00 0.00 ? 19  ILE A N    6  
ATOM 10987 C CA   . ILE A 1 19  ? -28.774 -17.392 -7.302  1.00 0.00 ? 19  ILE A CA   6  
ATOM 10988 C C    . ILE A 1 19  ? -29.790 -17.494 -8.439  1.00 0.00 ? 19  ILE A C    6  
ATOM 10989 O O    . ILE A 1 19  ? -30.453 -16.504 -8.703  1.00 0.00 ? 19  ILE A O    6  
ATOM 10990 C CB   . ILE A 1 19  ? -27.335 -17.495 -7.848  1.00 0.00 ? 19  ILE A CB   6  
ATOM 10991 C CG1  . ILE A 1 19  ? -26.215 -17.513 -6.786  1.00 0.00 ? 19  ILE A CG1  6  
ATOM 10992 C CG2  . ILE A 1 19  ? -27.090 -16.327 -8.818  1.00 0.00 ? 19  ILE A CG2  6  
ATOM 10993 C CD1  . ILE A 1 19  ? -26.328 -16.472 -5.674  1.00 0.00 ? 19  ILE A CD1  6  
ATOM 10994 H H    . ILE A 1 19  ? -28.396 -19.085 -6.055  1.00 0.00 ? 19  ILE A H    6  
ATOM 10995 H HA   . ILE A 1 19  ? -28.887 -16.418 -6.825  1.00 0.00 ? 19  ILE A HA   6  
ATOM 10996 H HB   . ILE A 1 19  ? -27.259 -18.418 -8.417  1.00 0.00 ? 19  ILE A HB   6  
ATOM 10997 H HG12 . ILE A 1 19  ? -26.195 -18.486 -6.312  1.00 0.00 ? 19  ILE A HG12 6  
ATOM 10998 H HG13 . ILE A 1 19  ? -25.250 -17.393 -7.281  1.00 0.00 ? 19  ILE A HG13 6  
ATOM 10999 H HG21 . ILE A 1 19  ? -26.065 -16.359 -9.187  1.00 0.00 ? 19  ILE A HG21 6  
ATOM 11000 H HG22 . ILE A 1 19  ? -27.761 -16.396 -9.675  1.00 0.00 ? 19  ILE A HG22 6  
ATOM 11001 H HG23 . ILE A 1 19  ? -27.262 -15.379 -8.309  1.00 0.00 ? 19  ILE A HG23 6  
ATOM 11002 H HD11 . ILE A 1 19  ? -27.215 -16.672 -5.076  1.00 0.00 ? 19  ILE A HD11 6  
ATOM 11003 H HD12 . ILE A 1 19  ? -25.453 -16.559 -5.030  1.00 0.00 ? 19  ILE A HD12 6  
ATOM 11004 H HD13 . ILE A 1 19  ? -26.383 -15.470 -6.101  1.00 0.00 ? 19  ILE A HD13 6  
ATOM 11005 N N    . ARG A 1 20  ? -30.042 -18.683 -9.015  1.00 0.00 ? 20  ARG A N    6  
ATOM 11006 C CA   . ARG A 1 20  ? -31.071 -18.886 -10.053 1.00 0.00 ? 20  ARG A CA   6  
ATOM 11007 C C    . ARG A 1 20  ? -32.483 -18.521 -9.574  1.00 0.00 ? 20  ARG A C    6  
ATOM 11008 O O    . ARG A 1 20  ? -33.305 -18.093 -10.388 1.00 0.00 ? 20  ARG A O    6  
ATOM 11009 C CB   . ARG A 1 20  ? -31.058 -20.361 -10.513 1.00 0.00 ? 20  ARG A CB   6  
ATOM 11010 C CG   . ARG A 1 20  ? -30.289 -20.595 -11.820 1.00 0.00 ? 20  ARG A CG   6  
ATOM 11011 C CD   . ARG A 1 20  ? -28.899 -21.231 -11.675 1.00 0.00 ? 20  ARG A CD   6  
ATOM 11012 N NE   . ARG A 1 20  ? -27.878 -20.329 -11.113 1.00 0.00 ? 20  ARG A NE   6  
ATOM 11013 C CZ   . ARG A 1 20  ? -27.314 -19.288 -11.695 1.00 0.00 ? 20  ARG A CZ   6  
ATOM 11014 N NH1  . ARG A 1 20  ? -27.735 -18.810 -12.826 1.00 0.00 ? 20  ARG A NH1  6  
ATOM 11015 N NH2  . ARG A 1 20  ? -26.298 -18.707 -11.139 1.00 0.00 ? 20  ARG A NH2  6  
ATOM 11016 H H    . ARG A 1 20  ? -29.466 -19.479 -8.764  1.00 0.00 ? 20  ARG A H    6  
ATOM 11017 H HA   . ARG A 1 20  ? -30.867 -18.227 -10.899 1.00 0.00 ? 20  ARG A HA   6  
ATOM 11018 H HB2  . ARG A 1 20  ? -30.671 -21.014 -9.729  1.00 0.00 ? 20  ARG A HB2  6  
ATOM 11019 H HB3  . ARG A 1 20  ? -32.087 -20.673 -10.699 1.00 0.00 ? 20  ARG A HB3  6  
ATOM 11020 H HG2  . ARG A 1 20  ? -30.884 -21.276 -12.425 1.00 0.00 ? 20  ARG A HG2  6  
ATOM 11021 H HG3  . ARG A 1 20  ? -30.214 -19.657 -12.361 1.00 0.00 ? 20  ARG A HG3  6  
ATOM 11022 H HD2  . ARG A 1 20  ? -28.981 -22.116 -11.043 1.00 0.00 ? 20  ARG A HD2  6  
ATOM 11023 H HD3  . ARG A 1 20  ? -28.568 -21.559 -12.661 1.00 0.00 ? 20  ARG A HD3  6  
ATOM 11024 H HE   . ARG A 1 20  ? -27.540 -20.552 -10.185 1.00 0.00 ? 20  ARG A HE   6  
ATOM 11025 H HH11 . ARG A 1 20  ? -28.528 -19.231 -13.271 1.00 0.00 ? 20  ARG A HH11 6  
ATOM 11026 H HH12 . ARG A 1 20  ? -27.489 -17.857 -13.095 1.00 0.00 ? 20  ARG A HH12 6  
ATOM 11027 H HH21 . ARG A 1 20  ? -25.797 -19.236 -10.423 1.00 0.00 ? 20  ARG A HH21 6  
ATOM 11028 H HH22 . ARG A 1 20  ? -25.846 -17.946 -11.611 1.00 0.00 ? 20  ARG A HH22 6  
ATOM 11029 N N    . LYS A 1 21  ? -32.751 -18.625 -8.271  1.00 0.00 ? 21  LYS A N    6  
ATOM 11030 C CA   . LYS A 1 21  ? -34.015 -18.194 -7.638  1.00 0.00 ? 21  LYS A CA   6  
ATOM 11031 C C    . LYS A 1 21  ? -34.206 -16.670 -7.687  1.00 0.00 ? 21  LYS A C    6  
ATOM 11032 O O    . LYS A 1 21  ? -35.304 -16.223 -8.020  1.00 0.00 ? 21  LYS A O    6  
ATOM 11033 C CB   . LYS A 1 21  ? -34.091 -18.700 -6.185  1.00 0.00 ? 21  LYS A CB   6  
ATOM 11034 C CG   . LYS A 1 21  ? -35.520 -18.890 -5.659  1.00 0.00 ? 21  LYS A CG   6  
ATOM 11035 C CD   . LYS A 1 21  ? -36.184 -20.167 -6.195  1.00 0.00 ? 21  LYS A CD   6  
ATOM 11036 C CE   . LYS A 1 21  ? -37.570 -20.314 -5.558  1.00 0.00 ? 21  LYS A CE   6  
ATOM 11037 N NZ   . LYS A 1 21  ? -38.237 -21.580 -5.952  1.00 0.00 ? 21  LYS A NZ   6  
ATOM 11038 H H    . LYS A 1 21  ? -32.011 -19.031 -7.705  1.00 0.00 ? 21  LYS A H    6  
ATOM 11039 H HA   . LYS A 1 21  ? -34.835 -18.632 -8.207  1.00 0.00 ? 21  LYS A HA   6  
ATOM 11040 H HB2  . LYS A 1 21  ? -33.564 -19.650 -6.094  1.00 0.00 ? 21  LYS A HB2  6  
ATOM 11041 H HB3  . LYS A 1 21  ? -33.604 -17.968 -5.539  1.00 0.00 ? 21  LYS A HB3  6  
ATOM 11042 H HG2  . LYS A 1 21  ? -35.471 -18.960 -4.571  1.00 0.00 ? 21  LYS A HG2  6  
ATOM 11043 H HG3  . LYS A 1 21  ? -36.127 -18.019 -5.915  1.00 0.00 ? 21  LYS A HG3  6  
ATOM 11044 H HD2  . LYS A 1 21  ? -36.283 -20.113 -7.279  1.00 0.00 ? 21  LYS A HD2  6  
ATOM 11045 H HD3  . LYS A 1 21  ? -35.568 -21.029 -5.931  1.00 0.00 ? 21  LYS A HD3  6  
ATOM 11046 H HE2  . LYS A 1 21  ? -37.459 -20.284 -4.470  1.00 0.00 ? 21  LYS A HE2  6  
ATOM 11047 H HE3  . LYS A 1 21  ? -38.184 -19.461 -5.861  1.00 0.00 ? 21  LYS A HE3  6  
ATOM 11048 H HZ1  . LYS A 1 21  ? -38.399 -21.624 -6.949  1.00 0.00 ? 21  LYS A HZ1  6  
ATOM 11049 H HZ2  . LYS A 1 21  ? -37.694 -22.388 -5.680  1.00 0.00 ? 21  LYS A HZ2  6  
ATOM 11050 H HZ3  . LYS A 1 21  ? -39.144 -21.654 -5.485  1.00 0.00 ? 21  LYS A HZ3  6  
ATOM 11051 N N    . PHE A 1 22  ? -33.160 -15.883 -7.394  1.00 0.00 ? 22  PHE A N    6  
ATOM 11052 C CA   . PHE A 1 22  ? -33.225 -14.405 -7.396  1.00 0.00 ? 22  PHE A CA   6  
ATOM 11053 C C    . PHE A 1 22  ? -32.494 -13.695 -8.563  1.00 0.00 ? 22  PHE A C    6  
ATOM 11054 O O    . PHE A 1 22  ? -32.416 -12.467 -8.574  1.00 0.00 ? 22  PHE A O    6  
ATOM 11055 C CB   . PHE A 1 22  ? -32.849 -13.833 -6.013  1.00 0.00 ? 22  PHE A CB   6  
ATOM 11056 C CG   . PHE A 1 22  ? -31.376 -13.850 -5.625  1.00 0.00 ? 22  PHE A CG   6  
ATOM 11057 C CD1  . PHE A 1 22  ? -30.498 -12.836 -6.062  1.00 0.00 ? 22  PHE A CD1  6  
ATOM 11058 C CD2  . PHE A 1 22  ? -30.891 -14.843 -4.757  1.00 0.00 ? 22  PHE A CD2  6  
ATOM 11059 C CE1  . PHE A 1 22  ? -29.146 -12.844 -5.672  1.00 0.00 ? 22  PHE A CE1  6  
ATOM 11060 C CE2  . PHE A 1 22  ? -29.541 -14.852 -4.360  1.00 0.00 ? 22  PHE A CE2  6  
ATOM 11061 C CZ   . PHE A 1 22  ? -28.666 -13.855 -4.823  1.00 0.00 ? 22  PHE A CZ   6  
ATOM 11062 H H    . PHE A 1 22  ? -32.304 -16.336 -7.082  1.00 0.00 ? 22  PHE A H    6  
ATOM 11063 H HA   . PHE A 1 22  ? -34.272 -14.139 -7.527  1.00 0.00 ? 22  PHE A HA   6  
ATOM 11064 H HB2  . PHE A 1 22  ? -33.190 -12.798 -5.969  1.00 0.00 ? 22  PHE A HB2  6  
ATOM 11065 H HB3  . PHE A 1 22  ? -33.417 -14.372 -5.255  1.00 0.00 ? 22  PHE A HB3  6  
ATOM 11066 H HD1  . PHE A 1 22  ? -30.859 -12.034 -6.688  1.00 0.00 ? 22  PHE A HD1  6  
ATOM 11067 H HD2  . PHE A 1 22  ? -31.566 -15.603 -4.394  1.00 0.00 ? 22  PHE A HD2  6  
ATOM 11068 H HE1  . PHE A 1 22  ? -28.479 -12.065 -6.016  1.00 0.00 ? 22  PHE A HE1  6  
ATOM 11069 H HE2  . PHE A 1 22  ? -29.173 -15.623 -3.697  1.00 0.00 ? 22  PHE A HE2  6  
ATOM 11070 H HZ   . PHE A 1 22  ? -27.629 -13.858 -4.516  1.00 0.00 ? 22  PHE A HZ   6  
ATOM 11071 N N    . GLU A 1 23  ? -31.993 -14.432 -9.562  1.00 0.00 ? 23  GLU A N    6  
ATOM 11072 C CA   . GLU A 1 23  ? -31.056 -13.946 -10.599 1.00 0.00 ? 23  GLU A CA   6  
ATOM 11073 C C    . GLU A 1 23  ? -31.555 -12.711 -11.387 1.00 0.00 ? 23  GLU A C    6  
ATOM 11074 O O    . GLU A 1 23  ? -30.748 -11.884 -11.822 1.00 0.00 ? 23  GLU A O    6  
ATOM 11075 C CB   . GLU A 1 23  ? -30.710 -15.118 -11.551 1.00 0.00 ? 23  GLU A CB   6  
ATOM 11076 C CG   . GLU A 1 23  ? -29.735 -14.709 -12.667 1.00 0.00 ? 23  GLU A CG   6  
ATOM 11077 C CD   . GLU A 1 23  ? -29.124 -15.928 -13.382 1.00 0.00 ? 23  GLU A CD   6  
ATOM 11078 O OE1  . GLU A 1 23  ? -29.875 -16.719 -14.000 1.00 0.00 ? 23  GLU A OE1  6  
ATOM 11079 O OE2  . GLU A 1 23  ? -27.882 -16.106 -13.330 1.00 0.00 ? 23  GLU A OE2  6  
ATOM 11080 H H    . GLU A 1 23  ? -32.014 -15.434 -9.427  1.00 0.00 ? 23  GLU A H    6  
ATOM 11081 H HA   . GLU A 1 23  ? -30.131 -13.660 -10.089 1.00 0.00 ? 23  GLU A HA   6  
ATOM 11082 H HB2  . GLU A 1 23  ? -30.272 -15.947 -10.990 1.00 0.00 ? 23  GLU A HB2  6  
ATOM 11083 H HB3  . GLU A 1 23  ? -31.628 -15.487 -12.008 1.00 0.00 ? 23  GLU A HB3  6  
ATOM 11084 H HG2  . GLU A 1 23  ? -30.258 -14.090 -13.399 1.00 0.00 ? 23  GLU A HG2  6  
ATOM 11085 H HG3  . GLU A 1 23  ? -28.933 -14.111 -12.227 1.00 0.00 ? 23  GLU A HG3  6  
ATOM 11086 N N    . GLY A 1 24  ? -32.874 -12.545 -11.540 1.00 0.00 ? 24  GLY A N    6  
ATOM 11087 C CA   . GLY A 1 24  ? -33.482 -11.311 -12.058 1.00 0.00 ? 24  GLY A CA   6  
ATOM 11088 C C    . GLY A 1 24  ? -33.400 -11.119 -13.576 1.00 0.00 ? 24  GLY A C    6  
ATOM 11089 O O    . GLY A 1 24  ? -33.307 -9.988  -14.047 1.00 0.00 ? 24  GLY A O    6  
ATOM 11090 H H    . GLY A 1 24  ? -33.479 -13.241 -11.128 1.00 0.00 ? 24  GLY A H    6  
ATOM 11091 H HA2  . GLY A 1 24  ? -34.537 -11.308 -11.784 1.00 0.00 ? 24  GLY A HA2  6  
ATOM 11092 H HA3  . GLY A 1 24  ? -33.013 -10.451 -11.578 1.00 0.00 ? 24  GLY A HA3  6  
ATOM 11093 N N    . GLN A 1 25  ? -33.464 -12.195 -14.368 1.00 0.00 ? 25  GLN A N    6  
ATOM 11094 C CA   . GLN A 1 25  ? -33.493 -12.115 -15.842 1.00 0.00 ? 25  GLN A CA   6  
ATOM 11095 C C    . GLN A 1 25  ? -34.718 -11.358 -16.404 1.00 0.00 ? 25  GLN A C    6  
ATOM 11096 O O    . GLN A 1 25  ? -34.699 -10.890 -17.543 1.00 0.00 ? 25  GLN A O    6  
ATOM 11097 C CB   . GLN A 1 25  ? -33.365 -13.525 -16.444 1.00 0.00 ? 25  GLN A CB   6  
ATOM 11098 C CG   . GLN A 1 25  ? -34.548 -14.465 -16.134 1.00 0.00 ? 25  GLN A CG   6  
ATOM 11099 C CD   . GLN A 1 25  ? -34.410 -15.855 -16.766 1.00 0.00 ? 25  GLN A CD   6  
ATOM 11100 O OE1  . GLN A 1 25  ? -33.478 -16.175 -17.494 1.00 0.00 ? 25  GLN A OE1  6  
ATOM 11101 N NE2  . GLN A 1 25  ? -35.350 -16.745 -16.517 1.00 0.00 ? 25  GLN A NE2  6  
ATOM 11102 H H    . GLN A 1 25  ? -33.516 -13.102 -13.930 1.00 0.00 ? 25  GLN A H    6  
ATOM 11103 H HA   . GLN A 1 25  ? -32.612 -11.553 -16.157 1.00 0.00 ? 25  GLN A HA   6  
ATOM 11104 H HB2  . GLN A 1 25  ? -33.269 -13.428 -17.527 1.00 0.00 ? 25  GLN A HB2  6  
ATOM 11105 H HB3  . GLN A 1 25  ? -32.447 -13.971 -16.064 1.00 0.00 ? 25  GLN A HB3  6  
ATOM 11106 H HG2  . GLN A 1 25  ? -34.640 -14.590 -15.055 1.00 0.00 ? 25  GLN A HG2  6  
ATOM 11107 H HG3  . GLN A 1 25  ? -35.473 -14.020 -16.503 1.00 0.00 ? 25  GLN A HG3  6  
ATOM 11108 H HE21 . GLN A 1 25  ? -36.133 -16.511 -15.924 1.00 0.00 ? 25  GLN A HE21 6  
ATOM 11109 H HE22 . GLN A 1 25  ? -35.264 -17.661 -16.932 1.00 0.00 ? 25  GLN A HE22 6  
ATOM 11110 N N    . SER A 1 26  ? -35.764 -11.190 -15.587 1.00 0.00 ? 26  SER A N    6  
ATOM 11111 C CA   . SER A 1 26  ? -36.973 -10.391 -15.843 1.00 0.00 ? 26  SER A CA   6  
ATOM 11112 C C    . SER A 1 26  ? -36.857 -8.917  -15.399 1.00 0.00 ? 26  SER A C    6  
ATOM 11113 O O    . SER A 1 26  ? -37.876 -8.246  -15.198 1.00 0.00 ? 26  SER A O    6  
ATOM 11114 C CB   . SER A 1 26  ? -38.170 -11.096 -15.189 1.00 0.00 ? 26  SER A CB   6  
ATOM 11115 O OG   . SER A 1 26  ? -37.937 -11.271 -13.797 1.00 0.00 ? 26  SER A OG   6  
ATOM 11116 H H    . SER A 1 26  ? -35.718 -11.629 -14.679 1.00 0.00 ? 26  SER A H    6  
ATOM 11117 H HA   . SER A 1 26  ? -37.156 -10.376 -16.917 1.00 0.00 ? 26  SER A HA   6  
ATOM 11118 H HB2  . SER A 1 26  ? -39.080 -10.516 -15.348 1.00 0.00 ? 26  SER A HB2  6  
ATOM 11119 H HB3  . SER A 1 26  ? -38.301 -12.075 -15.655 1.00 0.00 ? 26  SER A HB3  6  
ATOM 11120 H HG   . SER A 1 26  ? -38.705 -11.739 -13.413 1.00 0.00 ? 26  SER A HG   6  
ATOM 11121 N N    . ARG A 1 27  ? -35.627 -8.401  -15.224 1.00 0.00 ? 27  ARG A N    6  
ATOM 11122 C CA   . ARG A 1 27  ? -35.315 -7.033  -14.750 1.00 0.00 ? 27  ARG A CA   6  
ATOM 11123 C C    . ARG A 1 27  ? -36.025 -5.909  -15.523 1.00 0.00 ? 27  ARG A C    6  
ATOM 11124 O O    . ARG A 1 27  ? -36.279 -5.997  -16.727 1.00 0.00 ? 27  ARG A O    6  
ATOM 11125 C CB   . ARG A 1 27  ? -33.787 -6.802  -14.826 1.00 0.00 ? 27  ARG A CB   6  
ATOM 11126 C CG   . ARG A 1 27  ? -33.047 -6.976  -13.489 1.00 0.00 ? 27  ARG A CG   6  
ATOM 11127 C CD   . ARG A 1 27  ? -32.759 -5.630  -12.815 1.00 0.00 ? 27  ARG A CD   6  
ATOM 11128 N NE   . ARG A 1 27  ? -31.990 -5.826  -11.574 1.00 0.00 ? 27  ARG A NE   6  
ATOM 11129 C CZ   . ARG A 1 27  ? -30.743 -5.493  -11.305 1.00 0.00 ? 27  ARG A CZ   6  
ATOM 11130 N NH1  . ARG A 1 27  ? -30.010 -4.761  -12.093 1.00 0.00 ? 27  ARG A NH1  6  
ATOM 11131 N NH2  . ARG A 1 27  ? -30.229 -5.913  -10.191 1.00 0.00 ? 27  ARG A NH2  6  
ATOM 11132 H H    . ARG A 1 27  ? -34.848 -9.045  -15.338 1.00 0.00 ? 27  ARG A H    6  
ATOM 11133 H HA   . ARG A 1 27  ? -35.640 -6.957  -13.711 1.00 0.00 ? 27  ARG A HA   6  
ATOM 11134 H HB2  . ARG A 1 27  ? -33.363 -7.496  -15.550 1.00 0.00 ? 27  ARG A HB2  6  
ATOM 11135 H HB3  . ARG A 1 27  ? -33.574 -5.804  -15.216 1.00 0.00 ? 27  ARG A HB3  6  
ATOM 11136 H HG2  . ARG A 1 27  ? -33.619 -7.613  -12.812 1.00 0.00 ? 27  ARG A HG2  6  
ATOM 11137 H HG3  . ARG A 1 27  ? -32.090 -7.461  -13.688 1.00 0.00 ? 27  ARG A HG3  6  
ATOM 11138 H HD2  . ARG A 1 27  ? -32.203 -5.007  -13.515 1.00 0.00 ? 27  ARG A HD2  6  
ATOM 11139 H HD3  . ARG A 1 27  ? -33.701 -5.128  -12.584 1.00 0.00 ? 27  ARG A HD3  6  
ATOM 11140 H HE   . ARG A 1 27  ? -32.417 -6.388  -10.842 1.00 0.00 ? 27  ARG A HE   6  
ATOM 11141 H HH11 . ARG A 1 27  ? -30.460 -4.286  -12.864 1.00 0.00 ? 27  ARG A HH11 6  
ATOM 11142 H HH12 . ARG A 1 27  ? -29.060 -4.541  -11.849 1.00 0.00 ? 27  ARG A HH12 6  
ATOM 11143 H HH21 . ARG A 1 27  ? -30.843 -6.459  -9.583  1.00 0.00 ? 27  ARG A HH21 6  
ATOM 11144 H HH22 . ARG A 1 27  ? -29.289 -5.687  -9.920  1.00 0.00 ? 27  ARG A HH22 6  
ATOM 11145 N N    . LYS A 1 28  ? -36.279 -4.819  -14.794 1.00 0.00 ? 28  LYS A N    6  
ATOM 11146 C CA   . LYS A 1 28  ? -36.815 -3.523  -15.249 1.00 0.00 ? 28  LYS A CA   6  
ATOM 11147 C C    . LYS A 1 28  ? -36.110 -2.359  -14.539 1.00 0.00 ? 28  LYS A C    6  
ATOM 11148 O O    . LYS A 1 28  ? -35.662 -2.530  -13.405 1.00 0.00 ? 28  LYS A O    6  
ATOM 11149 C CB   . LYS A 1 28  ? -38.341 -3.476  -15.073 1.00 0.00 ? 28  LYS A CB   6  
ATOM 11150 C CG   . LYS A 1 28  ? -38.928 -3.924  -13.729 1.00 0.00 ? 28  LYS A CG   6  
ATOM 11151 C CD   . LYS A 1 28  ? -39.288 -5.412  -13.598 1.00 0.00 ? 28  LYS A CD   6  
ATOM 11152 C CE   . LYS A 1 28  ? -40.338 -5.879  -14.620 1.00 0.00 ? 28  LYS A CE   6  
ATOM 11153 N NZ   . LYS A 1 28  ? -40.513 -7.354  -14.573 1.00 0.00 ? 28  LYS A NZ   6  
ATOM 11154 H H    . LYS A 1 28  ? -35.966 -4.854  -13.834 1.00 0.00 ? 28  LYS A H    6  
ATOM 11155 H HA   . LYS A 1 28  ? -36.610 -3.403  -16.314 1.00 0.00 ? 28  LYS A HA   6  
ATOM 11156 H HB2  . LYS A 1 28  ? -38.639 -2.440  -15.195 1.00 0.00 ? 28  LYS A HB2  6  
ATOM 11157 H HB3  . LYS A 1 28  ? -38.805 -4.049  -15.872 1.00 0.00 ? 28  LYS A HB3  6  
ATOM 11158 H HG2  . LYS A 1 28  ? -38.237 -3.643  -12.936 1.00 0.00 ? 28  LYS A HG2  6  
ATOM 11159 H HG3  . LYS A 1 28  ? -39.843 -3.363  -13.587 1.00 0.00 ? 28  LYS A HG3  6  
ATOM 11160 H HD2  . LYS A 1 28  ? -38.387 -6.015  -13.688 1.00 0.00 ? 28  LYS A HD2  6  
ATOM 11161 H HD3  . LYS A 1 28  ? -39.705 -5.557  -12.601 1.00 0.00 ? 28  LYS A HD3  6  
ATOM 11162 H HE2  . LYS A 1 28  ? -41.286 -5.374  -14.416 1.00 0.00 ? 28  LYS A HE2  6  
ATOM 11163 H HE3  . LYS A 1 28  ? -40.016 -5.594  -15.625 1.00 0.00 ? 28  LYS A HE3  6  
ATOM 11164 H HZ1  . LYS A 1 28  ? -40.826 -7.667  -13.664 1.00 0.00 ? 28  LYS A HZ1  6  
ATOM 11165 H HZ2  . LYS A 1 28  ? -41.191 -7.664  -15.259 1.00 0.00 ? 28  LYS A HZ2  6  
ATOM 11166 H HZ3  . LYS A 1 28  ? -39.631 -7.819  -14.782 1.00 0.00 ? 28  LYS A HZ3  6  
ATOM 11167 N N    . PHE A 1 29  ? -36.022 -1.185  -15.175 1.00 0.00 ? 29  PHE A N    6  
ATOM 11168 C CA   . PHE A 1 29  ? -35.228 -0.049  -14.673 1.00 0.00 ? 29  PHE A CA   6  
ATOM 11169 C C    . PHE A 1 29  ? -35.453 1.280   -15.414 1.00 0.00 ? 29  PHE A C    6  
ATOM 11170 O O    . PHE A 1 29  ? -35.950 1.334   -16.546 1.00 0.00 ? 29  PHE A O    6  
ATOM 11171 C CB   . PHE A 1 29  ? -33.723 -0.394  -14.741 1.00 0.00 ? 29  PHE A CB   6  
ATOM 11172 C CG   . PHE A 1 29  ? -33.145 -0.658  -16.121 1.00 0.00 ? 29  PHE A CG   6  
ATOM 11173 C CD1  . PHE A 1 29  ? -33.150 -1.966  -16.648 1.00 0.00 ? 29  PHE A CD1  6  
ATOM 11174 C CD2  . PHE A 1 29  ? -32.549 0.385   -16.857 1.00 0.00 ? 29  PHE A CD2  6  
ATOM 11175 C CE1  . PHE A 1 29  ? -32.571 -2.228  -17.901 1.00 0.00 ? 29  PHE A CE1  6  
ATOM 11176 C CE2  . PHE A 1 29  ? -31.966 0.120   -18.111 1.00 0.00 ? 29  PHE A CE2  6  
ATOM 11177 C CZ   . PHE A 1 29  ? -31.974 -1.186  -18.631 1.00 0.00 ? 29  PHE A CZ   6  
ATOM 11178 H H    . PHE A 1 29  ? -36.451 -1.093  -16.083 1.00 0.00 ? 29  PHE A H    6  
ATOM 11179 H HA   . PHE A 1 29  ? -35.495 0.121   -13.628 1.00 0.00 ? 29  PHE A HA   6  
ATOM 11180 H HB2  . PHE A 1 29  ? -33.151 0.409   -14.274 1.00 0.00 ? 29  PHE A HB2  6  
ATOM 11181 H HB3  . PHE A 1 29  ? -33.544 -1.281  -14.140 1.00 0.00 ? 29  PHE A HB3  6  
ATOM 11182 H HD1  . PHE A 1 29  ? -33.584 -2.777  -16.079 1.00 0.00 ? 29  PHE A HD1  6  
ATOM 11183 H HD2  . PHE A 1 29  ? -32.524 1.389   -16.455 1.00 0.00 ? 29  PHE A HD2  6  
ATOM 11184 H HE1  . PHE A 1 29  ? -32.574 -3.234  -18.299 1.00 0.00 ? 29  PHE A HE1  6  
ATOM 11185 H HE2  . PHE A 1 29  ? -31.506 0.918   -18.677 1.00 0.00 ? 29  PHE A HE2  6  
ATOM 11186 H HZ   . PHE A 1 29  ? -31.519 -1.390  -19.592 1.00 0.00 ? 29  PHE A HZ   6  
ATOM 11187 N N    . ILE A 1 30  ? -35.023 2.361   -14.758 1.00 0.00 ? 30  ILE A N    6  
ATOM 11188 C CA   . ILE A 1 30  ? -34.936 3.716   -15.320 1.00 0.00 ? 30  ILE A CA   6  
ATOM 11189 C C    . ILE A 1 30  ? -33.512 4.255   -15.261 1.00 0.00 ? 30  ILE A C    6  
ATOM 11190 O O    . ILE A 1 30  ? -32.647 3.670   -14.621 1.00 0.00 ? 30  ILE A O    6  
ATOM 11191 C CB   . ILE A 1 30  ? -35.915 4.689   -14.623 1.00 0.00 ? 30  ILE A CB   6  
ATOM 11192 C CG1  . ILE A 1 30  ? -36.064 4.523   -13.098 1.00 0.00 ? 30  ILE A CG1  6  
ATOM 11193 C CG2  . ILE A 1 30  ? -37.269 4.542   -15.300 1.00 0.00 ? 30  ILE A CG2  6  
ATOM 11194 C CD1  . ILE A 1 30  ? -34.739 4.659   -12.343 1.00 0.00 ? 30  ILE A CD1  6  
ATOM 11195 H H    . ILE A 1 30  ? -34.606 2.235   -13.837 1.00 0.00 ? 30  ILE A H    6  
ATOM 11196 H HA   . ILE A 1 30  ? -35.184 3.678   -16.379 1.00 0.00 ? 30  ILE A HA   6  
ATOM 11197 H HB   . ILE A 1 30  ? -35.588 5.711   -14.807 1.00 0.00 ? 30  ILE A HB   6  
ATOM 11198 H HG12 . ILE A 1 30  ? -36.743 5.294   -12.731 1.00 0.00 ? 30  ILE A HG12 6  
ATOM 11199 H HG13 . ILE A 1 30  ? -36.504 3.552   -12.867 1.00 0.00 ? 30  ILE A HG13 6  
ATOM 11200 H HG21 . ILE A 1 30  ? -37.154 4.742   -16.364 1.00 0.00 ? 30  ILE A HG21 6  
ATOM 11201 H HG22 . ILE A 1 30  ? -37.637 3.528   -15.156 1.00 0.00 ? 30  ILE A HG22 6  
ATOM 11202 H HG23 . ILE A 1 30  ? -37.978 5.253   -14.877 1.00 0.00 ? 30  ILE A HG23 6  
ATOM 11203 H HD11 . ILE A 1 30  ? -34.248 5.595   -12.609 1.00 0.00 ? 30  ILE A HD11 6  
ATOM 11204 H HD12 . ILE A 1 30  ? -34.951 4.659   -11.280 1.00 0.00 ? 30  ILE A HD12 6  
ATOM 11205 H HD13 . ILE A 1 30  ? -34.081 3.816   -12.565 1.00 0.00 ? 30  ILE A HD13 6  
ATOM 11206 N N    . ILE A 1 31  ? -33.292 5.390   -15.912 1.00 0.00 ? 31  ILE A N    6  
ATOM 11207 C CA   . ILE A 1 31  ? -32.070 6.180   -15.872 1.00 0.00 ? 31  ILE A CA   6  
ATOM 11208 C C    . ILE A 1 31  ? -32.448 7.580   -15.421 1.00 0.00 ? 31  ILE A C    6  
ATOM 11209 O O    . ILE A 1 31  ? -33.192 8.281   -16.113 1.00 0.00 ? 31  ILE A O    6  
ATOM 11210 C CB   . ILE A 1 31  ? -31.380 6.243   -17.249 1.00 0.00 ? 31  ILE A CB   6  
ATOM 11211 C CG1  . ILE A 1 31  ? -31.383 4.906   -18.018 1.00 0.00 ? 31  ILE A CG1  6  
ATOM 11212 C CG2  . ILE A 1 31  ? -29.960 6.794   -17.046 1.00 0.00 ? 31  ILE A CG2  6  
ATOM 11213 C CD1  . ILE A 1 31  ? -30.505 3.852   -17.353 1.00 0.00 ? 31  ILE A CD1  6  
ATOM 11214 H H    . ILE A 1 31  ? -34.053 5.786   -16.455 1.00 0.00 ? 31  ILE A H    6  
ATOM 11215 H HA   . ILE A 1 31  ? -31.386 5.750   -15.142 1.00 0.00 ? 31  ILE A HA   6  
ATOM 11216 H HB   . ILE A 1 31  ? -31.920 6.958   -17.863 1.00 0.00 ? 31  ILE A HB   6  
ATOM 11217 H HG12 . ILE A 1 31  ? -32.410 4.532   -18.099 1.00 0.00 ? 31  ILE A HG12 6  
ATOM 11218 H HG13 . ILE A 1 31  ? -31.005 5.068   -19.028 1.00 0.00 ? 31  ILE A HG13 6  
ATOM 11219 H HG21 . ILE A 1 31  ? -29.409 6.174   -16.335 1.00 0.00 ? 31  ILE A HG21 6  
ATOM 11220 H HG22 . ILE A 1 31  ? -29.434 6.818   -18.001 1.00 0.00 ? 31  ILE A HG22 6  
ATOM 11221 H HG23 . ILE A 1 31  ? -30.008 7.806   -16.649 1.00 0.00 ? 31  ILE A HG23 6  
ATOM 11222 H HD11 . ILE A 1 31  ? -30.700 2.879   -17.796 1.00 0.00 ? 31  ILE A HD11 6  
ATOM 11223 H HD12 . ILE A 1 31  ? -29.456 4.109   -17.499 1.00 0.00 ? 31  ILE A HD12 6  
ATOM 11224 H HD13 . ILE A 1 31  ? -30.722 3.836   -16.289 1.00 0.00 ? 31  ILE A HD13 6  
ATOM 11225 N N    . ALA A 1 32  ? -31.921 7.979   -14.270 1.00 0.00 ? 32  ALA A N    6  
ATOM 11226 C CA   . ALA A 1 32  ? -32.194 9.290   -13.676 1.00 0.00 ? 32  ALA A CA   6  
ATOM 11227 C C    . ALA A 1 32  ? -30.930 10.064  -13.294 1.00 0.00 ? 32  ALA A C    6  
ATOM 11228 O O    . ALA A 1 32  ? -29.912 9.475   -12.921 1.00 0.00 ? 32  ALA A O    6  
ATOM 11229 C CB   . ALA A 1 32  ? -33.166 9.160   -12.495 1.00 0.00 ? 32  ALA A CB   6  
ATOM 11230 H H    . ALA A 1 32  ? -31.341 7.304   -13.770 1.00 0.00 ? 32  ALA A H    6  
ATOM 11231 H HA   . ALA A 1 32  ? -32.685 9.892   -14.433 1.00 0.00 ? 32  ALA A HA   6  
ATOM 11232 H HB1  . ALA A 1 32  ? -32.788 8.446   -11.770 1.00 0.00 ? 32  ALA A HB1  6  
ATOM 11233 H HB2  . ALA A 1 32  ? -33.277 10.126  -11.995 1.00 0.00 ? 32  ALA A HB2  6  
ATOM 11234 H HB3  . ALA A 1 32  ? -34.137 8.819   -12.852 1.00 0.00 ? 32  ALA A HB3  6  
ATOM 11235 N N    . ASN A 1 33  ? -31.012 11.398  -13.345 1.00 0.00 ? 33  ASN A N    6  
ATOM 11236 C CA   . ASN A 1 33  ? -29.918 12.267  -12.899 1.00 0.00 ? 33  ASN A CA   6  
ATOM 11237 C C    . ASN A 1 33  ? -29.852 12.346  -11.358 1.00 0.00 ? 33  ASN A C    6  
ATOM 11238 O O    . ASN A 1 33  ? -30.639 13.038  -10.716 1.00 0.00 ? 33  ASN A O    6  
ATOM 11239 C CB   . ASN A 1 33  ? -29.962 13.649  -13.602 1.00 0.00 ? 33  ASN A CB   6  
ATOM 11240 C CG   . ASN A 1 33  ? -31.319 14.322  -13.745 1.00 0.00 ? 33  ASN A CG   6  
ATOM 11241 O OD1  . ASN A 1 33  ? -32.296 14.021  -13.081 1.00 0.00 ? 33  ASN A OD1  6  
ATOM 11242 N ND2  . ASN A 1 33  ? -31.421 15.282  -14.636 1.00 0.00 ? 33  ASN A ND2  6  
ATOM 11243 H H    . ASN A 1 33  ? -31.907 11.818  -13.599 1.00 0.00 ? 33  ASN A H    6  
ATOM 11244 H HA   . ASN A 1 33  ? -28.980 11.808  -13.217 1.00 0.00 ? 33  ASN A HA   6  
ATOM 11245 H HB2  . ASN A 1 33  ? -29.301 14.338  -13.075 1.00 0.00 ? 33  ASN A HB2  6  
ATOM 11246 H HB3  . ASN A 1 33  ? -29.557 13.545  -14.605 1.00 0.00 ? 33  ASN A HB3  6  
ATOM 11247 H HD21 . ASN A 1 33  ? -30.628 15.552  -15.195 1.00 0.00 ? 33  ASN A HD21 6  
ATOM 11248 H HD22 . ASN A 1 33  ? -32.319 15.722  -14.755 1.00 0.00 ? 33  ASN A HD22 6  
ATOM 11249 N N    . ALA A 1 34  ? -28.850 11.690  -10.754 1.00 0.00 ? 34  ALA A N    6  
ATOM 11250 C CA   . ALA A 1 34  ? -28.605 11.726  -9.302  1.00 0.00 ? 34  ALA A CA   6  
ATOM 11251 C C    . ALA A 1 34  ? -28.012 13.063  -8.811  1.00 0.00 ? 34  ALA A C    6  
ATOM 11252 O O    . ALA A 1 34  ? -27.957 13.328  -7.608  1.00 0.00 ? 34  ALA A O    6  
ATOM 11253 C CB   . ALA A 1 34  ? -27.666 10.570  -8.944  1.00 0.00 ? 34  ALA A CB   6  
ATOM 11254 H H    . ALA A 1 34  ? -28.235 11.127  -11.324 1.00 0.00 ? 34  ALA A H    6  
ATOM 11255 H HA   . ALA A 1 34  ? -29.551 11.576  -8.782  1.00 0.00 ? 34  ALA A HA   6  
ATOM 11256 H HB1  . ALA A 1 34  ? -26.685 10.736  -9.383  1.00 0.00 ? 34  ALA A HB1  6  
ATOM 11257 H HB2  . ALA A 1 34  ? -27.556 10.511  -7.860  1.00 0.00 ? 34  ALA A HB2  6  
ATOM 11258 H HB3  . ALA A 1 34  ? -28.074 9.631   -9.306  1.00 0.00 ? 34  ALA A HB3  6  
ATOM 11259 N N    . ARG A 1 35  ? -27.545 13.897  -9.749  1.00 0.00 ? 35  ARG A N    6  
ATOM 11260 C CA   . ARG A 1 35  ? -26.816 15.155  -9.501  1.00 0.00 ? 35  ARG A CA   6  
ATOM 11261 C C    . ARG A 1 35  ? -27.718 16.398  -9.417  1.00 0.00 ? 35  ARG A C    6  
ATOM 11262 O O    . ARG A 1 35  ? -27.208 17.505  -9.241  1.00 0.00 ? 35  ARG A O    6  
ATOM 11263 C CB   . ARG A 1 35  ? -25.713 15.321  -10.567 1.00 0.00 ? 35  ARG A CB   6  
ATOM 11264 C CG   . ARG A 1 35  ? -24.667 14.190  -10.646 1.00 0.00 ? 35  ARG A CG   6  
ATOM 11265 C CD   . ARG A 1 35  ? -23.715 14.101  -9.442  1.00 0.00 ? 35  ARG A CD   6  
ATOM 11266 N NE   . ARG A 1 35  ? -24.262 13.301  -8.326  1.00 0.00 ? 35  ARG A NE   6  
ATOM 11267 C CZ   . ARG A 1 35  ? -24.468 13.671  -7.076  1.00 0.00 ? 35  ARG A CZ   6  
ATOM 11268 N NH1  . ARG A 1 35  ? -24.303 14.894  -6.660  1.00 0.00 ? 35  ARG A NH1  6  
ATOM 11269 N NH2  . ARG A 1 35  ? -24.844 12.778  -6.212  1.00 0.00 ? 35  ARG A NH2  6  
ATOM 11270 H H    . ARG A 1 35  ? -27.663 13.591  -10.707 1.00 0.00 ? 35  ARG A H    6  
ATOM 11271 H HA   . ARG A 1 35  ? -26.339 15.096  -8.524  1.00 0.00 ? 35  ARG A HA   6  
ATOM 11272 H HB2  . ARG A 1 35  ? -26.192 15.405  -11.544 1.00 0.00 ? 35  ARG A HB2  6  
ATOM 11273 H HB3  . ARG A 1 35  ? -25.179 16.256  -10.389 1.00 0.00 ? 35  ARG A HB3  6  
ATOM 11274 H HG2  . ARG A 1 35  ? -25.159 13.230  -10.801 1.00 0.00 ? 35  ARG A HG2  6  
ATOM 11275 H HG3  . ARG A 1 35  ? -24.055 14.383  -11.528 1.00 0.00 ? 35  ARG A HG3  6  
ATOM 11276 H HD2  . ARG A 1 35  ? -22.799 13.612  -9.780  1.00 0.00 ? 35  ARG A HD2  6  
ATOM 11277 H HD3  . ARG A 1 35  ? -23.441 15.108  -9.122  1.00 0.00 ? 35  ARG A HD3  6  
ATOM 11278 H HE   . ARG A 1 35  ? -24.418 12.316  -8.499  1.00 0.00 ? 35  ARG A HE   6  
ATOM 11279 H HH11 . ARG A 1 35  ? -23.982 15.597  -7.303  1.00 0.00 ? 35  ARG A HH11 6  
ATOM 11280 H HH12 . ARG A 1 35  ? -24.461 15.131  -5.695  1.00 0.00 ? 35  ARG A HH12 6  
ATOM 11281 H HH21 . ARG A 1 35  ? -24.922 11.817  -6.524  1.00 0.00 ? 35  ARG A HH21 6  
ATOM 11282 H HH22 . ARG A 1 35  ? -25.030 13.027  -5.257  1.00 0.00 ? 35  ARG A HH22 6  
ATOM 11283 N N    . VAL A 1 36  ? -29.039 16.234  -9.552  1.00 0.00 ? 36  VAL A N    6  
ATOM 11284 C CA   . VAL A 1 36  ? -30.031 17.320  -9.628  1.00 0.00 ? 36  VAL A CA   6  
ATOM 11285 C C    . VAL A 1 36  ? -31.116 17.148  -8.556  1.00 0.00 ? 36  VAL A C    6  
ATOM 11286 O O    . VAL A 1 36  ? -31.569 16.034  -8.293  1.00 0.00 ? 36  VAL A O    6  
ATOM 11287 C CB   . VAL A 1 36  ? -30.599 17.415  -11.061 1.00 0.00 ? 36  VAL A CB   6  
ATOM 11288 C CG1  . VAL A 1 36  ? -31.842 16.562  -11.312 1.00 0.00 ? 36  VAL A CG1  6  
ATOM 11289 C CG2  . VAL A 1 36  ? -30.919 18.850  -11.459 1.00 0.00 ? 36  VAL A CG2  6  
ATOM 11290 H H    . VAL A 1 36  ? -29.385 15.294  -9.666  1.00 0.00 ? 36  VAL A H    6  
ATOM 11291 H HA   . VAL A 1 36  ? -29.521 18.260  -9.417  1.00 0.00 ? 36  VAL A HA   6  
ATOM 11292 H HB   . VAL A 1 36  ? -29.826 17.074  -11.752 1.00 0.00 ? 36  VAL A HB   6  
ATOM 11293 H HG11 . VAL A 1 36  ? -31.640 15.527  -11.039 1.00 0.00 ? 36  VAL A HG11 6  
ATOM 11294 H HG12 . VAL A 1 36  ? -32.687 16.933  -10.738 1.00 0.00 ? 36  VAL A HG12 6  
ATOM 11295 H HG13 . VAL A 1 36  ? -32.111 16.617  -12.365 1.00 0.00 ? 36  VAL A HG13 6  
ATOM 11296 H HG21 . VAL A 1 36  ? -31.226 18.857  -12.507 1.00 0.00 ? 36  VAL A HG21 6  
ATOM 11297 H HG22 . VAL A 1 36  ? -31.716 19.250  -10.835 1.00 0.00 ? 36  VAL A HG22 6  
ATOM 11298 H HG23 . VAL A 1 36  ? -30.021 19.457  -11.357 1.00 0.00 ? 36  VAL A HG23 6  
ATOM 11299 N N    . GLU A 1 37  ? -31.550 18.245  -7.931  1.00 0.00 ? 37  GLU A N    6  
ATOM 11300 C CA   . GLU A 1 37  ? -32.539 18.231  -6.833  1.00 0.00 ? 37  GLU A CA   6  
ATOM 11301 C C    . GLU A 1 37  ? -33.902 17.620  -7.236  1.00 0.00 ? 37  GLU A C    6  
ATOM 11302 O O    . GLU A 1 37  ? -34.605 17.054  -6.398  1.00 0.00 ? 37  GLU A O    6  
ATOM 11303 C CB   . GLU A 1 37  ? -32.696 19.676  -6.322  1.00 0.00 ? 37  GLU A CB   6  
ATOM 11304 C CG   . GLU A 1 37  ? -33.517 19.789  -5.031  1.00 0.00 ? 37  GLU A CG   6  
ATOM 11305 C CD   . GLU A 1 37  ? -33.508 21.235  -4.498  1.00 0.00 ? 37  GLU A CD   6  
ATOM 11306 O OE1  . GLU A 1 37  ? -34.373 22.047  -4.910  1.00 0.00 ? 37  GLU A OE1  6  
ATOM 11307 O OE2  . GLU A 1 37  ? -32.638 21.573  -3.656  1.00 0.00 ? 37  GLU A OE2  6  
ATOM 11308 H H    . GLU A 1 37  ? -31.133 19.133  -8.175  1.00 0.00 ? 37  GLU A H    6  
ATOM 11309 H HA   . GLU A 1 37  ? -32.141 17.623  -6.019  1.00 0.00 ? 37  GLU A HA   6  
ATOM 11310 H HB2  . GLU A 1 37  ? -31.701 20.081  -6.127  1.00 0.00 ? 37  GLU A HB2  6  
ATOM 11311 H HB3  . GLU A 1 37  ? -33.163 20.283  -7.099  1.00 0.00 ? 37  GLU A HB3  6  
ATOM 11312 H HG2  . GLU A 1 37  ? -34.546 19.478  -5.224  1.00 0.00 ? 37  GLU A HG2  6  
ATOM 11313 H HG3  . GLU A 1 37  ? -33.096 19.113  -4.282  1.00 0.00 ? 37  GLU A HG3  6  
ATOM 11314 N N    . ASN A 1 38  ? -34.256 17.682  -8.526  1.00 0.00 ? 38  ASN A N    6  
ATOM 11315 C CA   . ASN A 1 38  ? -35.485 17.100  -9.085  1.00 0.00 ? 38  ASN A CA   6  
ATOM 11316 C C    . ASN A 1 38  ? -35.381 15.581  -9.389  1.00 0.00 ? 38  ASN A C    6  
ATOM 11317 O O    . ASN A 1 38  ? -36.397 14.974  -9.737  1.00 0.00 ? 38  ASN A O    6  
ATOM 11318 C CB   . ASN A 1 38  ? -35.881 17.922  -10.334 1.00 0.00 ? 38  ASN A CB   6  
ATOM 11319 C CG   . ASN A 1 38  ? -37.388 18.047  -10.538 1.00 0.00 ? 38  ASN A CG   6  
ATOM 11320 O OD1  . ASN A 1 38  ? -37.946 19.135  -10.550 1.00 0.00 ? 38  ASN A OD1  6  
ATOM 11321 N ND2  . ASN A 1 38  ? -38.101 16.958  -10.712 1.00 0.00 ? 38  ASN A ND2  6  
ATOM 11322 H H    . ASN A 1 38  ? -33.641 18.178  -9.153  1.00 0.00 ? 38  ASN A H    6  
ATOM 11323 H HA   . ASN A 1 38  ? -36.275 17.215  -8.341  1.00 0.00 ? 38  ASN A HA   6  
ATOM 11324 H HB2  . ASN A 1 38  ? -35.493 18.938  -10.242 1.00 0.00 ? 38  ASN A HB2  6  
ATOM 11325 H HB3  . ASN A 1 38  ? -35.439 17.477  -11.224 1.00 0.00 ? 38  ASN A HB3  6  
ATOM 11326 H HD21 . ASN A 1 38  ? -37.655 16.053  -10.604 1.00 0.00 ? 38  ASN A HD21 6  
ATOM 11327 H HD22 . ASN A 1 38  ? -39.096 17.053  -10.838 1.00 0.00 ? 38  ASN A HD22 6  
ATOM 11328 N N    . CYS A 1 39  ? -34.182 14.980  -9.297  1.00 0.00 ? 39  CYS A N    6  
ATOM 11329 C CA   . CYS A 1 39  ? -33.889 13.543  -9.457  1.00 0.00 ? 39  CYS A CA   6  
ATOM 11330 C C    . CYS A 1 39  ? -34.724 12.805  -10.531 1.00 0.00 ? 39  CYS A C    6  
ATOM 11331 O O    . CYS A 1 39  ? -35.357 11.789  -10.238 1.00 0.00 ? 39  CYS A O    6  
ATOM 11332 C CB   . CYS A 1 39  ? -33.912 12.846  -8.080  1.00 0.00 ? 39  CYS A CB   6  
ATOM 11333 S SG   . CYS A 1 39  ? -35.524 12.997  -7.249  1.00 0.00 ? 39  CYS A SG   6  
ATOM 11334 H H    . CYS A 1 39  ? -33.406 15.550  -8.979  1.00 0.00 ? 39  CYS A H    6  
ATOM 11335 H HA   . CYS A 1 39  ? -32.863 13.479  -9.814  1.00 0.00 ? 39  CYS A HA   6  
ATOM 11336 H HB2  . CYS A 1 39  ? -33.687 11.788  -8.226  1.00 0.00 ? 39  CYS A HB2  6  
ATOM 11337 H HB3  . CYS A 1 39  ? -33.142 13.275  -7.436  1.00 0.00 ? 39  CYS A HB3  6  
ATOM 11338 H HG   . CYS A 1 39  ? -36.246 12.482  -8.256  1.00 0.00 ? 39  CYS A HG   6  
ATOM 11339 N N    . ALA A 1 40  ? -34.784 13.327  -11.762 1.00 0.00 ? 40  ALA A N    6  
ATOM 11340 C CA   . ALA A 1 40  ? -35.719 12.863  -12.789 1.00 0.00 ? 40  ALA A CA   6  
ATOM 11341 C C    . ALA A 1 40  ? -35.138 11.903  -13.848 1.00 0.00 ? 40  ALA A C    6  
ATOM 11342 O O    . ALA A 1 40  ? -33.928 11.817  -14.074 1.00 0.00 ? 40  ALA A O    6  
ATOM 11343 C CB   . ALA A 1 40  ? -36.460 14.067  -13.391 1.00 0.00 ? 40  ALA A CB   6  
ATOM 11344 H H    . ALA A 1 40  ? -34.139 14.066  -12.007 1.00 0.00 ? 40  ALA A H    6  
ATOM 11345 H HA   . ALA A 1 40  ? -36.481 12.278  -12.281 1.00 0.00 ? 40  ALA A HA   6  
ATOM 11346 H HB1  . ALA A 1 40  ? -36.979 14.620  -12.608 1.00 0.00 ? 40  ALA A HB1  6  
ATOM 11347 H HB2  . ALA A 1 40  ? -35.771 14.723  -13.924 1.00 0.00 ? 40  ALA A HB2  6  
ATOM 11348 H HB3  . ALA A 1 40  ? -37.217 13.715  -14.085 1.00 0.00 ? 40  ALA A HB3  6  
ATOM 11349 N N    . VAL A 1 41  ? -36.057 11.181  -14.500 1.00 0.00 ? 41  VAL A N    6  
ATOM 11350 C CA   . VAL A 1 41  ? -35.864 10.075  -15.439 1.00 0.00 ? 41  VAL A CA   6  
ATOM 11351 C C    . VAL A 1 41  ? -35.506 10.642  -16.811 1.00 0.00 ? 41  VAL A C    6  
ATOM 11352 O O    . VAL A 1 41  ? -36.364 10.937  -17.644 1.00 0.00 ? 41  VAL A O    6  
ATOM 11353 C CB   . VAL A 1 41  ? -37.141 9.202   -15.477 1.00 0.00 ? 41  VAL A CB   6  
ATOM 11354 C CG1  . VAL A 1 41  ? -37.067 8.052   -16.485 1.00 0.00 ? 41  VAL A CG1  6  
ATOM 11355 C CG2  . VAL A 1 41  ? -37.409 8.548   -14.112 1.00 0.00 ? 41  VAL A CG2  6  
ATOM 11356 H H    . VAL A 1 41  ? -37.019 11.341  -14.236 1.00 0.00 ? 41  VAL A H    6  
ATOM 11357 H HA   . VAL A 1 41  ? -35.045 9.452   -15.089 1.00 0.00 ? 41  VAL A HA   6  
ATOM 11358 H HB   . VAL A 1 41  ? -37.997 9.830   -15.731 1.00 0.00 ? 41  VAL A HB   6  
ATOM 11359 H HG11 . VAL A 1 41  ? -36.951 8.431   -17.500 1.00 0.00 ? 41  VAL A HG11 6  
ATOM 11360 H HG12 . VAL A 1 41  ? -36.220 7.414   -16.240 1.00 0.00 ? 41  VAL A HG12 6  
ATOM 11361 H HG13 . VAL A 1 41  ? -37.984 7.464   -16.447 1.00 0.00 ? 41  VAL A HG13 6  
ATOM 11362 H HG21 . VAL A 1 41  ? -36.593 7.878   -13.846 1.00 0.00 ? 41  VAL A HG21 6  
ATOM 11363 H HG22 . VAL A 1 41  ? -37.509 9.305   -13.338 1.00 0.00 ? 41  VAL A HG22 6  
ATOM 11364 H HG23 . VAL A 1 41  ? -38.344 7.990   -14.154 1.00 0.00 ? 41  VAL A HG23 6  
ATOM 11365 N N    . ILE A 1 42  ? -34.207 10.813  -17.034 1.00 0.00 ? 42  ILE A N    6  
ATOM 11366 C CA   . ILE A 1 42  ? -33.617 11.254  -18.302 1.00 0.00 ? 42  ILE A CA   6  
ATOM 11367 C C    . ILE A 1 42  ? -33.729 10.182  -19.399 1.00 0.00 ? 42  ILE A C    6  
ATOM 11368 O O    . ILE A 1 42  ? -33.733 10.518  -20.585 1.00 0.00 ? 42  ILE A O    6  
ATOM 11369 C CB   . ILE A 1 42  ? -32.147 11.679  -18.081 1.00 0.00 ? 42  ILE A CB   6  
ATOM 11370 C CG1  . ILE A 1 42  ? -31.286 10.522  -17.525 1.00 0.00 ? 42  ILE A CG1  6  
ATOM 11371 C CG2  . ILE A 1 42  ? -32.093 12.901  -17.145 1.00 0.00 ? 42  ILE A CG2  6  
ATOM 11372 C CD1  . ILE A 1 42  ? -29.801 10.847  -17.406 1.00 0.00 ? 42  ILE A CD1  6  
ATOM 11373 H H    . ILE A 1 42  ? -33.577 10.550  -16.289 1.00 0.00 ? 42  ILE A H    6  
ATOM 11374 H HA   . ILE A 1 42  ? -34.171 12.126  -18.655 1.00 0.00 ? 42  ILE A HA   6  
ATOM 11375 H HB   . ILE A 1 42  ? -31.739 11.981  -19.047 1.00 0.00 ? 42  ILE A HB   6  
ATOM 11376 H HG12 . ILE A 1 42  ? -31.637 10.247  -16.533 1.00 0.00 ? 42  ILE A HG12 6  
ATOM 11377 H HG13 . ILE A 1 42  ? -31.375 9.655   -18.180 1.00 0.00 ? 42  ILE A HG13 6  
ATOM 11378 H HG21 . ILE A 1 42  ? -31.091 13.329  -17.145 1.00 0.00 ? 42  ILE A HG21 6  
ATOM 11379 H HG22 . ILE A 1 42  ? -32.788 13.668  -17.492 1.00 0.00 ? 42  ILE A HG22 6  
ATOM 11380 H HG23 . ILE A 1 42  ? -32.356 12.613  -16.127 1.00 0.00 ? 42  ILE A HG23 6  
ATOM 11381 H HD11 . ILE A 1 42  ? -29.646 11.590  -16.624 1.00 0.00 ? 42  ILE A HD11 6  
ATOM 11382 H HD12 . ILE A 1 42  ? -29.270 9.937   -17.136 1.00 0.00 ? 42  ILE A HD12 6  
ATOM 11383 H HD13 . ILE A 1 42  ? -29.430 11.212  -18.362 1.00 0.00 ? 42  ILE A HD13 6  
ATOM 11384 N N    . TYR A 1 43  ? -33.846 8.905   -19.013 1.00 0.00 ? 43  TYR A N    6  
ATOM 11385 C CA   . TYR A 1 43  ? -34.115 7.782   -19.932 1.00 0.00 ? 43  TYR A CA   6  
ATOM 11386 C C    . TYR A 1 43  ? -34.778 6.604   -19.213 1.00 0.00 ? 43  TYR A C    6  
ATOM 11387 O O    . TYR A 1 43  ? -34.709 6.505   -17.994 1.00 0.00 ? 43  TYR A O    6  
ATOM 11388 C CB   . TYR A 1 43  ? -32.834 7.335   -20.662 1.00 0.00 ? 43  TYR A CB   6  
ATOM 11389 C CG   . TYR A 1 43  ? -33.100 6.546   -21.932 1.00 0.00 ? 43  TYR A CG   6  
ATOM 11390 C CD1  . TYR A 1 43  ? -33.528 7.218   -23.093 1.00 0.00 ? 43  TYR A CD1  6  
ATOM 11391 C CD2  . TYR A 1 43  ? -32.940 5.146   -21.950 1.00 0.00 ? 43  TYR A CD2  6  
ATOM 11392 C CE1  . TYR A 1 43  ? -33.784 6.495   -24.274 1.00 0.00 ? 43  TYR A CE1  6  
ATOM 11393 C CE2  . TYR A 1 43  ? -33.200 4.419   -23.128 1.00 0.00 ? 43  TYR A CE2  6  
ATOM 11394 C CZ   . TYR A 1 43  ? -33.617 5.093   -24.297 1.00 0.00 ? 43  TYR A CZ   6  
ATOM 11395 O OH   . TYR A 1 43  ? -33.869 4.403   -25.442 1.00 0.00 ? 43  TYR A OH   6  
ATOM 11396 H H    . TYR A 1 43  ? -33.841 8.720   -18.007 1.00 0.00 ? 43  TYR A H    6  
ATOM 11397 H HA   . TYR A 1 43  ? -34.830 8.117   -20.677 1.00 0.00 ? 43  TYR A HA   6  
ATOM 11398 H HB2  . TYR A 1 43  ? -32.231 8.202   -20.921 1.00 0.00 ? 43  TYR A HB2  6  
ATOM 11399 H HB3  . TYR A 1 43  ? -32.227 6.731   -19.998 1.00 0.00 ? 43  TYR A HB3  6  
ATOM 11400 H HD1  . TYR A 1 43  ? -33.652 8.294   -23.081 1.00 0.00 ? 43  TYR A HD1  6  
ATOM 11401 H HD2  . TYR A 1 43  ? -32.617 4.623   -21.058 1.00 0.00 ? 43  TYR A HD2  6  
ATOM 11402 H HE1  . TYR A 1 43  ? -34.101 7.008   -25.171 1.00 0.00 ? 43  TYR A HE1  6  
ATOM 11403 H HE2  . TYR A 1 43  ? -33.078 3.344   -23.140 1.00 0.00 ? 43  TYR A HE2  6  
ATOM 11404 H HH   . TYR A 1 43  ? -33.711 3.448   -25.343 1.00 0.00 ? 43  TYR A HH   6  
ATOM 11405 N N    . CYS A 1 44  ? -35.445 5.707   -19.938 1.00 0.00 ? 44  CYS A N    6  
ATOM 11406 C CA   . CYS A 1 44  ? -36.164 4.585   -19.338 1.00 0.00 ? 44  CYS A CA   6  
ATOM 11407 C C    . CYS A 1 44  ? -36.071 3.284   -20.145 1.00 0.00 ? 44  CYS A C    6  
ATOM 11408 O O    . CYS A 1 44  ? -36.016 3.303   -21.382 1.00 0.00 ? 44  CYS A O    6  
ATOM 11409 C CB   . CYS A 1 44  ? -37.627 4.994   -19.127 1.00 0.00 ? 44  CYS A CB   6  
ATOM 11410 S SG   . CYS A 1 44  ? -38.388 5.422   -20.719 1.00 0.00 ? 44  CYS A SG   6  
ATOM 11411 H H    . CYS A 1 44  ? -35.468 5.797   -20.943 1.00 0.00 ? 44  CYS A H    6  
ATOM 11412 H HA   . CYS A 1 44  ? -35.726 4.384   -18.365 1.00 0.00 ? 44  CYS A HA   6  
ATOM 11413 H HB2  . CYS A 1 44  ? -38.176 4.168   -18.672 1.00 0.00 ? 44  CYS A HB2  6  
ATOM 11414 H HB3  . CYS A 1 44  ? -37.669 5.858   -18.462 1.00 0.00 ? 44  CYS A HB3  6  
ATOM 11415 H HG   . CYS A 1 44  ? -39.632 5.638   -20.267 1.00 0.00 ? 44  CYS A HG   6  
ATOM 11416 N N    . ASN A 1 45  ? -36.109 2.146   -19.444 1.00 0.00 ? 45  ASN A N    6  
ATOM 11417 C CA   . ASN A 1 45  ? -36.285 0.846   -20.087 1.00 0.00 ? 45  ASN A CA   6  
ATOM 11418 C C    . ASN A 1 45  ? -37.765 0.512   -20.284 1.00 0.00 ? 45  ASN A C    6  
ATOM 11419 O O    . ASN A 1 45  ? -38.623 0.874   -19.475 1.00 0.00 ? 45  ASN A O    6  
ATOM 11420 C CB   . ASN A 1 45  ? -35.547 -0.254  -19.314 1.00 0.00 ? 45  ASN A CB   6  
ATOM 11421 C CG   . ASN A 1 45  ? -35.299 -1.481  -20.170 1.00 0.00 ? 45  ASN A CG   6  
ATOM 11422 O OD1  . ASN A 1 45  ? -36.017 -2.465  -20.083 1.00 0.00 ? 45  ASN A OD1  6  
ATOM 11423 N ND2  . ASN A 1 45  ? -34.337 -1.446  -21.063 1.00 0.00 ? 45  ASN A ND2  6  
ATOM 11424 H H    . ASN A 1 45  ? -36.184 2.180   -18.429 1.00 0.00 ? 45  ASN A H    6  
ATOM 11425 H HA   . ASN A 1 45  ? -35.832 0.899   -21.080 1.00 0.00 ? 45  ASN A HA   6  
ATOM 11426 H HB2  . ASN A 1 45  ? -34.581 0.133   -19.018 1.00 0.00 ? 45  ASN A HB2  6  
ATOM 11427 H HB3  . ASN A 1 45  ? -36.103 -0.535  -18.421 1.00 0.00 ? 45  ASN A HB3  6  
ATOM 11428 H HD21 . ASN A 1 45  ? -33.727 -0.646  -21.127 1.00 0.00 ? 45  ASN A HD21 6  
ATOM 11429 H HD22 . ASN A 1 45  ? -34.180 -2.267  -21.626 1.00 0.00 ? 45  ASN A HD22 6  
ATOM 11430 N N    . ASP A 1 46  ? -38.049 -0.252  -21.333 1.00 0.00 ? 46  ASP A N    6  
ATOM 11431 C CA   . ASP A 1 46  ? -39.412 -0.717  -21.616 1.00 0.00 ? 46  ASP A CA   6  
ATOM 11432 C C    . ASP A 1 46  ? -39.899 -1.722  -20.557 1.00 0.00 ? 46  ASP A C    6  
ATOM 11433 O O    . ASP A 1 46  ? -41.090 -1.779  -20.266 1.00 0.00 ? 46  ASP A O    6  
ATOM 11434 C CB   . ASP A 1 46  ? -39.497 -1.286  -23.038 1.00 0.00 ? 46  ASP A CB   6  
ATOM 11435 C CG   . ASP A 1 46  ? -39.226 -0.214  -24.109 1.00 0.00 ? 46  ASP A CG   6  
ATOM 11436 O OD1  . ASP A 1 46  ? -39.798 0.900   -24.019 1.00 0.00 ? 46  ASP A OD1  6  
ATOM 11437 O OD2  . ASP A 1 46  ? -38.431 -0.481  -25.041 1.00 0.00 ? 46  ASP A OD2  6  
ATOM 11438 H H    . ASP A 1 46  ? -37.282 -0.574  -21.908 1.00 0.00 ? 46  ASP A H    6  
ATOM 11439 H HA   . ASP A 1 46  ? -40.084 0.141   -21.564 1.00 0.00 ? 46  ASP A HA   6  
ATOM 11440 H HB2  . ASP A 1 46  ? -38.786 -2.110  -23.136 1.00 0.00 ? 46  ASP A HB2  6  
ATOM 11441 H HB3  . ASP A 1 46  ? -40.499 -1.687  -23.196 1.00 0.00 ? 46  ASP A HB3  6  
ATOM 11442 N N    . GLY A 1 47  ? -38.991 -2.426  -19.874 1.00 0.00 ? 47  GLY A N    6  
ATOM 11443 C CA   . GLY A 1 47  ? -39.329 -3.252  -18.714 1.00 0.00 ? 47  GLY A CA   6  
ATOM 11444 C C    . GLY A 1 47  ? -40.123 -2.488  -17.647 1.00 0.00 ? 47  GLY A C    6  
ATOM 11445 O O    . GLY A 1 47  ? -41.151 -2.978  -17.185 1.00 0.00 ? 47  GLY A O    6  
ATOM 11446 H H    . GLY A 1 47  ? -38.016 -2.362  -20.146 1.00 0.00 ? 47  GLY A H    6  
ATOM 11447 H HA2  . GLY A 1 47  ? -39.920 -4.107  -19.043 1.00 0.00 ? 47  GLY A HA2  6  
ATOM 11448 H HA3  . GLY A 1 47  ? -38.407 -3.621  -18.264 1.00 0.00 ? 47  GLY A HA3  6  
ATOM 11449 N N    . PHE A 1 48  ? -39.667 -1.300  -17.225 1.00 0.00 ? 48  PHE A N    6  
ATOM 11450 C CA   . PHE A 1 48  ? -40.378 -0.510  -16.198 1.00 0.00 ? 48  PHE A CA   6  
ATOM 11451 C C    . PHE A 1 48  ? -41.705 0.064   -16.747 1.00 0.00 ? 48  PHE A C    6  
ATOM 11452 O O    . PHE A 1 48  ? -42.696 0.233   -16.028 1.00 0.00 ? 48  PHE A O    6  
ATOM 11453 C CB   . PHE A 1 48  ? -39.460 0.545   -15.562 1.00 0.00 ? 48  PHE A CB   6  
ATOM 11454 C CG   . PHE A 1 48  ? -39.997 1.962   -15.487 1.00 0.00 ? 48  PHE A CG   6  
ATOM 11455 C CD1  . PHE A 1 48  ? -39.852 2.848   -16.567 1.00 0.00 ? 48  PHE A CD1  6  
ATOM 11456 C CD2  . PHE A 1 48  ? -40.629 2.403   -14.305 1.00 0.00 ? 48  PHE A CD2  6  
ATOM 11457 C CE1  . PHE A 1 48  ? -40.297 4.171   -16.442 1.00 0.00 ? 48  PHE A CE1  6  
ATOM 11458 C CE2  . PHE A 1 48  ? -41.093 3.725   -14.193 1.00 0.00 ? 48  PHE A CE2  6  
ATOM 11459 C CZ   . PHE A 1 48  ? -40.917 4.616   -15.262 1.00 0.00 ? 48  PHE A CZ   6  
ATOM 11460 H H    . PHE A 1 48  ? -38.852 -0.900  -17.671 1.00 0.00 ? 48  PHE A H    6  
ATOM 11461 H HA   . PHE A 1 48  ? -40.635 -1.198  -15.396 1.00 0.00 ? 48  PHE A HA   6  
ATOM 11462 H HB2  . PHE A 1 48  ? -39.209 0.208   -14.560 1.00 0.00 ? 48  PHE A HB2  6  
ATOM 11463 H HB3  . PHE A 1 48  ? -38.522 0.584   -16.117 1.00 0.00 ? 48  PHE A HB3  6  
ATOM 11464 H HD1  . PHE A 1 48  ? -39.377 2.534   -17.482 1.00 0.00 ? 48  PHE A HD1  6  
ATOM 11465 H HD2  . PHE A 1 48  ? -40.761 1.731   -13.472 1.00 0.00 ? 48  PHE A HD2  6  
ATOM 11466 H HE1  . PHE A 1 48  ? -40.139 4.852   -17.255 1.00 0.00 ? 48  PHE A HE1  6  
ATOM 11467 H HE2  . PHE A 1 48  ? -41.573 4.056   -13.283 1.00 0.00 ? 48  PHE A HE2  6  
ATOM 11468 H HZ   . PHE A 1 48  ? -41.257 5.639   -15.176 1.00 0.00 ? 48  PHE A HZ   6  
ATOM 11469 N N    . CYS A 1 49  ? -41.735 0.328   -18.055 1.00 0.00 ? 49  CYS A N    6  
ATOM 11470 C CA   . CYS A 1 49  ? -42.937 0.713   -18.786 1.00 0.00 ? 49  CYS A CA   6  
ATOM 11471 C C    . CYS A 1 49  ? -44.000 -0.394  -18.681 1.00 0.00 ? 49  CYS A C    6  
ATOM 11472 O O    . CYS A 1 49  ? -45.177 -0.103  -18.479 1.00 0.00 ? 49  CYS A O    6  
ATOM 11473 C CB   . CYS A 1 49  ? -42.546 1.057   -20.228 1.00 0.00 ? 49  CYS A CB   6  
ATOM 11474 S SG   . CYS A 1 49  ? -43.934 1.839   -21.074 1.00 0.00 ? 49  CYS A SG   6  
ATOM 11475 H H    . CYS A 1 49  ? -40.923 0.071   -18.598 1.00 0.00 ? 49  CYS A H    6  
ATOM 11476 H HA   . CYS A 1 49  ? -43.351 1.609   -18.320 1.00 0.00 ? 49  CYS A HA   6  
ATOM 11477 H HB2  . CYS A 1 49  ? -41.694 1.739   -20.228 1.00 0.00 ? 49  CYS A HB2  6  
ATOM 11478 H HB3  . CYS A 1 49  ? -42.285 0.155   -20.774 1.00 0.00 ? 49  CYS A HB3  6  
ATOM 11479 H HG   . CYS A 1 49  ? -43.354 1.904   -22.286 1.00 0.00 ? 49  CYS A HG   6  
ATOM 11480 N N    . GLU A 1 50  ? -43.601 -1.670  -18.754 1.00 0.00 ? 50  GLU A N    6  
ATOM 11481 C CA   . GLU A 1 50  ? -44.504 -2.810  -18.545 1.00 0.00 ? 50  GLU A CA   6  
ATOM 11482 C C    . GLU A 1 50  ? -44.788 -3.066  -17.060 1.00 0.00 ? 50  GLU A C    6  
ATOM 11483 O O    . GLU A 1 50  ? -45.890 -3.496  -16.717 1.00 0.00 ? 50  GLU A O    6  
ATOM 11484 C CB   . GLU A 1 50  ? -43.926 -4.081  -19.183 1.00 0.00 ? 50  GLU A CB   6  
ATOM 11485 C CG   . GLU A 1 50  ? -43.721 -3.928  -20.695 1.00 0.00 ? 50  GLU A CG   6  
ATOM 11486 C CD   . GLU A 1 50  ? -43.263 -5.256  -21.330 1.00 0.00 ? 50  GLU A CD   6  
ATOM 11487 O OE1  . GLU A 1 50  ? -42.044 -5.559  -21.321 1.00 0.00 ? 50  GLU A OE1  6  
ATOM 11488 O OE2  . GLU A 1 50  ? -44.122 -6.011  -21.849 1.00 0.00 ? 50  GLU A OE2  6  
ATOM 11489 H H    . GLU A 1 50  ? -42.608 -1.862  -18.883 1.00 0.00 ? 50  GLU A H    6  
ATOM 11490 H HA   . GLU A 1 50  ? -45.462 -2.600  -19.025 1.00 0.00 ? 50  GLU A HA   6  
ATOM 11491 H HB2  . GLU A 1 50  ? -42.981 -4.329  -18.698 1.00 0.00 ? 50  GLU A HB2  6  
ATOM 11492 H HB3  . GLU A 1 50  ? -44.623 -4.903  -19.011 1.00 0.00 ? 50  GLU A HB3  6  
ATOM 11493 H HG2  . GLU A 1 50  ? -44.661 -3.603  -21.147 1.00 0.00 ? 50  GLU A HG2  6  
ATOM 11494 H HG3  . GLU A 1 50  ? -42.985 -3.146  -20.884 1.00 0.00 ? 50  GLU A HG3  6  
ATOM 11495 N N    . LEU A 1 51  ? -43.841 -2.748  -16.168 1.00 0.00 ? 51  LEU A N    6  
ATOM 11496 C CA   . LEU A 1 51  ? -44.013 -2.828  -14.714 1.00 0.00 ? 51  LEU A CA   6  
ATOM 11497 C C    . LEU A 1 51  ? -45.215 -1.985  -14.265 1.00 0.00 ? 51  LEU A C    6  
ATOM 11498 O O    . LEU A 1 51  ? -46.132 -2.511  -13.632 1.00 0.00 ? 51  LEU A O    6  
ATOM 11499 C CB   . LEU A 1 51  ? -42.717 -2.372  -14.019 1.00 0.00 ? 51  LEU A CB   6  
ATOM 11500 C CG   . LEU A 1 51  ? -42.805 -2.319  -12.482 1.00 0.00 ? 51  LEU A CG   6  
ATOM 11501 C CD1  . LEU A 1 51  ? -43.037 -3.689  -11.855 1.00 0.00 ? 51  LEU A CD1  6  
ATOM 11502 C CD2  . LEU A 1 51  ? -41.568 -1.692  -11.860 1.00 0.00 ? 51  LEU A CD2  6  
ATOM 11503 H H    . LEU A 1 51  ? -42.934 -2.474  -16.527 1.00 0.00 ? 51  LEU A H    6  
ATOM 11504 H HA   . LEU A 1 51  ? -44.187 -3.871  -14.452 1.00 0.00 ? 51  LEU A HA   6  
ATOM 11505 H HB2  . LEU A 1 51  ? -41.900 -3.003  -14.370 1.00 0.00 ? 51  LEU A HB2  6  
ATOM 11506 H HB3  . LEU A 1 51  ? -42.502 -1.359  -14.323 1.00 0.00 ? 51  LEU A HB3  6  
ATOM 11507 H HG   . LEU A 1 51  ? -43.648 -1.679  -12.220 1.00 0.00 ? 51  LEU A HG   6  
ATOM 11508 H HD11 . LEU A 1 51  ? -43.091 -3.577  -10.773 1.00 0.00 ? 51  LEU A HD11 6  
ATOM 11509 H HD12 . LEU A 1 51  ? -43.982 -4.106  -12.202 1.00 0.00 ? 51  LEU A HD12 6  
ATOM 11510 H HD13 . LEU A 1 51  ? -42.219 -4.362  -12.113 1.00 0.00 ? 51  LEU A HD13 6  
ATOM 11511 H HD21 . LEU A 1 51  ? -41.349 -0.742  -12.344 1.00 0.00 ? 51  LEU A HD21 6  
ATOM 11512 H HD22 . LEU A 1 51  ? -41.753 -1.516  -10.802 1.00 0.00 ? 51  LEU A HD22 6  
ATOM 11513 H HD23 . LEU A 1 51  ? -40.720 -2.362  -11.945 1.00 0.00 ? 51  LEU A HD23 6  
ATOM 11514 N N    . CYS A 1 52  ? -45.241 -0.702  -14.639 1.00 0.00 ? 52  CYS A N    6  
ATOM 11515 C CA   . CYS A 1 52  ? -46.394 0.170   -14.371 1.00 0.00 ? 52  CYS A CA   6  
ATOM 11516 C C    . CYS A 1 52  ? -47.548 -0.028  -15.377 1.00 0.00 ? 52  CYS A C    6  
ATOM 11517 O O    . CYS A 1 52  ? -48.720 0.150   -15.039 1.00 0.00 ? 52  CYS A O    6  
ATOM 11518 C CB   . CYS A 1 52  ? -45.919 1.630   -14.295 1.00 0.00 ? 52  CYS A CB   6  
ATOM 11519 S SG   . CYS A 1 52  ? -45.236 2.209   -15.881 1.00 0.00 ? 52  CYS A SG   6  
ATOM 11520 H H    . CYS A 1 52  ? -44.439 -0.328  -15.138 1.00 0.00 ? 52  CYS A H    6  
ATOM 11521 H HA   . CYS A 1 52  ? -46.796 -0.091  -13.390 1.00 0.00 ? 52  CYS A HA   6  
ATOM 11522 H HB2  . CYS A 1 52  ? -46.767 2.257   -14.017 1.00 0.00 ? 52  CYS A HB2  6  
ATOM 11523 H HB3  . CYS A 1 52  ? -45.158 1.725   -13.518 1.00 0.00 ? 52  CYS A HB3  6  
ATOM 11524 H HG   . CYS A 1 52  ? -44.097 1.495   -15.851 1.00 0.00 ? 52  CYS A HG   6  
ATOM 11525 N N    . GLY A 1 53  ? -47.229 -0.449  -16.604 1.00 0.00 ? 53  GLY A N    6  
ATOM 11526 C CA   . GLY A 1 53  ? -48.181 -0.703  -17.694 1.00 0.00 ? 53  GLY A CA   6  
ATOM 11527 C C    . GLY A 1 53  ? -48.597 0.524   -18.526 1.00 0.00 ? 53  GLY A C    6  
ATOM 11528 O O    . GLY A 1 53  ? -49.579 0.428   -19.268 1.00 0.00 ? 53  GLY A O    6  
ATOM 11529 H H    . GLY A 1 53  ? -46.240 -0.569  -16.810 1.00 0.00 ? 53  GLY A H    6  
ATOM 11530 H HA2  . GLY A 1 53  ? -47.726 -1.420  -18.378 1.00 0.00 ? 53  GLY A HA2  6  
ATOM 11531 H HA3  . GLY A 1 53  ? -49.082 -1.161  -17.286 1.00 0.00 ? 53  GLY A HA3  6  
ATOM 11532 N N    . TYR A 1 54  ? -47.910 1.667   -18.406 1.00 0.00 ? 54  TYR A N    6  
ATOM 11533 C CA   . TYR A 1 54  ? -48.223 2.918   -19.123 1.00 0.00 ? 54  TYR A CA   6  
ATOM 11534 C C    . TYR A 1 54  ? -47.515 3.018   -20.500 1.00 0.00 ? 54  TYR A C    6  
ATOM 11535 O O    . TYR A 1 54  ? -47.739 2.174   -21.371 1.00 0.00 ? 54  TYR A O    6  
ATOM 11536 C CB   . TYR A 1 54  ? -47.999 4.132   -18.196 1.00 0.00 ? 54  TYR A CB   6  
ATOM 11537 C CG   . TYR A 1 54  ? -48.969 4.249   -17.033 1.0