data_2L1R
# 
_entry.id   2L1R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L1R         
RCSB  RCSB101847   
WWPDB D_1000101847 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2krd PDB . 
unspecified 1lxf PDB . 
unspecified 1ytz PDB . 
unspecified 1dtl PDB . 
unspecified 1wrk PDB . 
unspecified 2kfx PDB . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L1R 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-03 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Robertson, I.M.' 1 
'Sun, Y.'         2 
'Li, M.X.'        3 
'Sykes, B.D.'     4 
# 
_citation.id                        primary 
_citation.title                     
'A structural and functional perspective into the mechanism of Ca(2+)-sensitizers that target the cardiac troponin complex.' 
_citation.journal_abbrev            J.MOL.CELL.CARDIOL. 
_citation.journal_volume            49 
_citation.page_first                1031 
_citation.page_last                 1041 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2828 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20801130 
_citation.pdbx_database_id_DOI      10.1016/j.yjmcc.2010.08.019 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Robertson, I.M.' 1 
primary 'Sun, Y.B.'       2 
primary 'Li, M.X.'        3 
primary 'Sykes, B.D.'     4 
# 
_cell.entry_id           2L1R 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2L1R 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Troponin C'                                    10070.304 1 ? ? 'N-TERMINAL DOMAIN' ? 
2 polymer     syn 'Troponin I'                                    2219.701  1 ? ? 'SWITCH REGION'     ? 
3 non-polymer syn 'CALCIUM ION'                                   40.078    1 ? ? ?                   ? 
4 non-polymer syn 
;[(2',4'-difluorobiphenyl-4-yl)oxy]acetic acid
;
264.224   1 ? ? ?                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 TN-C                 
2 'Cardiac troponin I' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM
MVRCMKDDS
;
;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM
MVRCMKDDS
;
A ? 
2 'polypeptide(L)' no no RRVRISADAMMQALLGARAK                                                                         
RRVRISADAMMQALLGARAK                                                                         B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  ASP n 
1 4  ILE n 
1 5  TYR n 
1 6  LYS n 
1 7  ALA n 
1 8  ALA n 
1 9  VAL n 
1 10 GLU n 
1 11 GLN n 
1 12 LEU n 
1 13 THR n 
1 14 GLU n 
1 15 GLU n 
1 16 GLN n 
1 17 LYS n 
1 18 ASN n 
1 19 GLU n 
1 20 PHE n 
1 21 LYS n 
1 22 ALA n 
1 23 ALA n 
1 24 PHE n 
1 25 ASP n 
1 26 ILE n 
1 27 PHE n 
1 28 VAL n 
1 29 LEU n 
1 30 GLY n 
1 31 ALA n 
1 32 GLU n 
1 33 ASP n 
1 34 GLY n 
1 35 CYS n 
1 36 ILE n 
1 37 SER n 
1 38 THR n 
1 39 LYS n 
1 40 GLU n 
1 41 LEU n 
1 42 GLY n 
1 43 LYS n 
1 44 VAL n 
1 45 MET n 
1 46 ARG n 
1 47 MET n 
1 48 LEU n 
1 49 GLY n 
1 50 GLN n 
1 51 ASN n 
1 52 PRO n 
1 53 THR n 
1 54 PRO n 
1 55 GLU n 
1 56 GLU n 
1 57 LEU n 
1 58 GLN n 
1 59 GLU n 
1 60 MET n 
1 61 ILE n 
1 62 ASP n 
1 63 GLU n 
1 64 VAL n 
1 65 ASP n 
1 66 GLU n 
1 67 ASP n 
1 68 GLY n 
1 69 SER n 
1 70 GLY n 
1 71 THR n 
1 72 VAL n 
1 73 ASP n 
1 74 PHE n 
1 75 ASP n 
1 76 GLU n 
1 77 PHE n 
1 78 LEU n 
1 79 VAL n 
1 80 MET n 
1 81 MET n 
1 82 VAL n 
1 83 ARG n 
1 84 CYS n 
1 85 MET n 
1 86 LYS n 
1 87 ASP n 
1 88 ASP n 
1 89 SER n 
2 1  ARG n 
2 2  ARG n 
2 3  VAL n 
2 4  ARG n 
2 5  ILE n 
2 6  SER n 
2 7  ALA n 
2 8  ASP n 
2 9  ALA n 
2 10 MET n 
2 11 MET n 
2 12 GLN n 
2 13 ALA n 
2 14 LEU n 
2 15 LEU n 
2 16 GLY n 
2 17 ALA n 
2 18 ARG n 
2 19 ALA n 
2 20 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TNNC1, TNNC' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'HOMO SAPIENS' 
_pdbx_entity_src_syn.organism_common_name   HUMAN 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TNNC1_HUMAN P63316 1 
;MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVM
MVRCMKDDS
;
1   ? 
2 UNP TNNI3_HUMAN P19429 2 RRVRISADAMMQALLGARAK                                                                         145 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2L1R A 1 ? 89 ? P63316 1   ? 89  ? 1   89  
2 2 2L1R B 1 ? 20 ? P19429 145 ? 164 ? 144 163 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                                   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE                                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                          ? 'C3 H7 N O3'     105.093 
SXK non-polymer         . 
;[(2',4'-difluorobiphenyl-4-yl)oxy]acetic acid
;
? 'C14 H10 F2 O3'  264.224 
THR 'L-peptide linking' y THREONINE                                       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                                        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                
1 2  1 '2D 1H-13C HSQC'                
1 3  1 '3D CBCA(CO)NH'                 
1 4  1 '3D C(CO)NH'                    
1 5  1 '3D H(CCO)NH'                   
1 6  1 '3D HNCACB'                     
1 7  1 '3D 1H-13C NOESY'               
1 8  1 '3D 1H-15N NOESY'               
1 9  1 '3D 1H-15N TOCSY'               
1 10 1 '2D 13C, 15N Filtered NOESY'    
1 11 1 '2D 13C,15N Filtered TOCSY'     
1 12 1 '2D 1H-19F HOESY'               
1 13 1 '3D 13C filtered, edited NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;0.5-1 mM [U-99% 13C; U-99% 15N] cNTnC, 2-4 mM cTnI(144-163), 2-4 mM 2',4'-difluoro (1,1'-biphenyl)-4-yloxy acetic acid, 2-4 mM Calcium, 100 mM KCl, 10 mM DTT, 10 mM Imidazole, 95% H2O/5% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Varian INOVA 1 'Varian INOVA' 
600 Varian UNITY 2 'Varian Unity' 
# 
_pdbx_nmr_refine.entry_id           2L1R 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L1R 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L1R 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.authors          'Schwieters, Kuszewski, Tjandra and Clore' 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR_NIH 
_pdbx_nmr_software.version          2.24 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L1R 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L1R 
_struct.title                     
'The structure of the calcium-sensitizer, dfbp-o, in complex with the N-domain of troponin C and the switch region of troponin I' 
_struct.pdbx_descriptor           'Troponin C, Troponin I' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L1R 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'troponin C, troponin I, Ca2+-sensitizer, dfbp-o, N-domain, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 3  ? GLN A 11 ? ASP A 3   GLN A 11  1 ? 9  
HELX_P HELX_P2 2 THR A 13 ? VAL A 28 ? THR A 13  VAL A 28  1 ? 16 
HELX_P HELX_P3 3 SER A 37 ? GLY A 49 ? SER A 37  GLY A 49  1 ? 13 
HELX_P HELX_P4 4 THR A 53 ? ASP A 65 ? THR A 53  ASP A 65  1 ? 13 
HELX_P HELX_P5 5 ASP A 73 ? LYS A 86 ? ASP A 73  LYS A 86  1 ? 14 
HELX_P HELX_P6 6 SER B 6  ? LEU B 15 ? SER B 149 LEU B 158 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 65 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 90 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc2  metalc ? ? A ASP 73 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 73 A CA 90 1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc3  metalc ? ? A SER 69 OG  ? ? ? 1_555 C CA . CA ? ? A SER 69 A CA 90 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc4  metalc ? ? A GLU 76 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 76 A CA 90 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc5  metalc ? ? A GLU 76 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 76 A CA 90 1_555 ? ? ? ? ? ? ? 2.828 ? 
metalc6  metalc ? ? A THR 71 O   ? ? ? 1_555 C CA . CA ? ? A THR 71 A CA 90 1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc7  metalc ? ? A ASP 67 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 67 A CA 90 1_555 ? ? ? ? ? ? ? 2.925 ? 
metalc8  metalc ? ? A ASP 65 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 65 A CA 90 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc9  metalc ? ? A ASP 67 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 67 A CA 90 1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc10 metalc ? ? A ASP 73 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 73 A CA 90 1_555 ? ? ? ? ? ? ? 3.112 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 90'  
AC2 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SXK A 91' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 65 ? ASP A 65  . ? 1_555 ? 
2  AC1 6 ASP A 67 ? ASP A 67  . ? 1_555 ? 
3  AC1 6 SER A 69 ? SER A 69  . ? 1_555 ? 
4  AC1 6 THR A 71 ? THR A 71  . ? 1_555 ? 
5  AC1 6 ASP A 73 ? ASP A 73  . ? 1_555 ? 
6  AC1 6 GLU A 76 ? GLU A 76  . ? 1_555 ? 
7  AC2 9 PHE A 27 ? PHE A 27  . ? 1_555 ? 
8  AC2 9 LEU A 41 ? LEU A 41  . ? 1_555 ? 
9  AC2 9 MET A 60 ? MET A 60  . ? 1_555 ? 
10 AC2 9 MET A 80 ? MET A 80  . ? 1_555 ? 
11 AC2 9 ARG A 83 ? ARG A 83  . ? 1_555 ? 
12 AC2 9 CYS A 84 ? CYS A 84  . ? 1_555 ? 
13 AC2 9 ARG B 4  ? ARG B 147 . ? 1_555 ? 
14 AC2 9 ILE B 5  ? ILE B 148 . ? 1_555 ? 
15 AC2 9 MET B 10 ? MET B 153 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2L1R 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
F  
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1  ? 73.172 17.121  12.441  1.00 0.00  ? 1   MET A N    1  
ATOM   2     C  CA   . MET A 1 1  ? 73.688 15.717  12.367  1.00 0.00  ? 1   MET A CA   1  
ATOM   3     C  C    . MET A 1 1  ? 73.026 14.960  11.207  1.00 0.00  ? 1   MET A C    1  
ATOM   4     O  O    . MET A 1 1  ? 72.093 15.442  10.595  1.00 0.00  ? 1   MET A O    1  
ATOM   5     C  CB   . MET A 1 1  ? 73.314 15.072  13.709  1.00 0.00  ? 1   MET A CB   1  
ATOM   6     C  CG   . MET A 1 1  ? 74.565 14.936  14.581  1.00 0.00  ? 1   MET A CG   1  
ATOM   7     S  SD   . MET A 1 1  ? 75.714 13.769  13.811  1.00 0.00  ? 1   MET A SD   1  
ATOM   8     C  CE   . MET A 1 1  ? 76.789 13.530  15.246  1.00 0.00  ? 1   MET A CE   1  
ATOM   9     H  H1   . MET A 1 1  ? 72.216 17.121  12.847  1.00 0.00  ? 1   MET A H1   1  
ATOM   10    H  H2   . MET A 1 1  ? 73.143 17.529  11.483  1.00 0.00  ? 1   MET A H2   1  
ATOM   11    H  H3   . MET A 1 1  ? 73.802 17.691  13.040  1.00 0.00  ? 1   MET A H3   1  
ATOM   12    H  HA   . MET A 1 1  ? 74.760 15.717  12.247  1.00 0.00  ? 1   MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1  ? 72.587 15.689  14.217  1.00 0.00  ? 1   MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1  ? 72.894 14.093  13.533  1.00 0.00  ? 1   MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1  ? 75.043 15.899  14.678  1.00 0.00  ? 1   MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1  ? 74.284 14.574  15.559  1.00 0.00  ? 1   MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1  ? 76.856 14.454  15.805  1.00 0.00  ? 1   MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1  ? 77.774 13.242  14.916  1.00 0.00  ? 1   MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1  ? 76.380 12.751  15.874  1.00 0.00  ? 1   MET A HE3  1  
ATOM   20    N  N    . ASP A 1 2  ? 73.505 13.778  10.908  1.00 0.00  ? 2   ASP A N    1  
ATOM   21    C  CA   . ASP A 1 2  ? 72.910 12.979  9.794   1.00 0.00  ? 2   ASP A CA   1  
ATOM   22    C  C    . ASP A 1 2  ? 72.454 11.604  10.308  1.00 0.00  ? 2   ASP A C    1  
ATOM   23    O  O    . ASP A 1 2  ? 72.471 11.344  11.497  1.00 0.00  ? 2   ASP A O    1  
ATOM   24    C  CB   . ASP A 1 2  ? 74.038 12.834  8.767   1.00 0.00  ? 2   ASP A CB   1  
ATOM   25    C  CG   . ASP A 1 2  ? 73.449 12.885  7.356   1.00 0.00  ? 2   ASP A CG   1  
ATOM   26    O  OD1  . ASP A 1 2  ? 72.989 11.855  6.891   1.00 0.00  ? 2   ASP A OD1  1  
ATOM   27    O  OD2  . ASP A 1 2  ? 73.462 13.953  6.769   1.00 0.00  ? 2   ASP A OD2  1  
ATOM   28    H  H    . ASP A 1 2  ? 74.257 13.412  11.421  1.00 0.00  ? 2   ASP A H    1  
ATOM   29    H  HA   . ASP A 1 2  ? 72.079 13.507  9.354   1.00 0.00  ? 2   ASP A HA   1  
ATOM   30    H  HB2  . ASP A 1 2  ? 74.744 13.642  8.891   1.00 0.00  ? 2   ASP A HB2  1  
ATOM   31    H  HB3  . ASP A 1 2  ? 74.541 11.890  8.911   1.00 0.00  ? 2   ASP A HB3  1  
ATOM   32    N  N    . ASP A 1 3  ? 72.045 10.726  9.418   1.00 0.00  ? 3   ASP A N    1  
ATOM   33    C  CA   . ASP A 1 3  ? 71.581 9.362   9.839   1.00 0.00  ? 3   ASP A CA   1  
ATOM   34    C  C    . ASP A 1 3  ? 70.481 9.473   10.910  1.00 0.00  ? 3   ASP A C    1  
ATOM   35    O  O    . ASP A 1 3  ? 70.500 8.787   11.914  1.00 0.00  ? 3   ASP A O    1  
ATOM   36    C  CB   . ASP A 1 3  ? 72.832 8.672   10.398  1.00 0.00  ? 3   ASP A CB   1  
ATOM   37    C  CG   . ASP A 1 3  ? 72.712 7.157   10.222  1.00 0.00  ? 3   ASP A CG   1  
ATOM   38    O  OD1  . ASP A 1 3  ? 71.993 6.544   10.994  1.00 0.00  ? 3   ASP A OD1  1  
ATOM   39    O  OD2  . ASP A 1 3  ? 73.346 6.633   9.322   1.00 0.00  ? 3   ASP A OD2  1  
ATOM   40    H  H    . ASP A 1 3  ? 72.042 10.965  8.466   1.00 0.00  ? 3   ASP A H    1  
ATOM   41    H  HA   . ASP A 1 3  ? 71.213 8.815   8.985   1.00 0.00  ? 3   ASP A HA   1  
ATOM   42    H  HB2  . ASP A 1 3  ? 73.704 9.027   9.868   1.00 0.00  ? 3   ASP A HB2  1  
ATOM   43    H  HB3  . ASP A 1 3  ? 72.932 8.904   11.447  1.00 0.00  ? 3   ASP A HB3  1  
ATOM   44    N  N    . ILE A 1 4  ? 69.517 10.335  10.699  1.00 0.00  ? 4   ILE A N    1  
ATOM   45    C  CA   . ILE A 1 4  ? 68.418 10.488  11.703  1.00 0.00  ? 4   ILE A CA   1  
ATOM   46    C  C    . ILE A 1 4  ? 67.304 9.470   11.423  1.00 0.00  ? 4   ILE A C    1  
ATOM   47    O  O    . ILE A 1 4  ? 66.786 8.843   12.328  1.00 0.00  ? 4   ILE A O    1  
ATOM   48    C  CB   . ILE A 1 4  ? 67.904 11.925  11.532  1.00 0.00  ? 4   ILE A CB   1  
ATOM   49    C  CG1  . ILE A 1 4  ? 69.013 12.918  11.906  1.00 0.00  ? 4   ILE A CG1  1  
ATOM   50    C  CG2  . ILE A 1 4  ? 66.700 12.153  12.451  1.00 0.00  ? 4   ILE A CG2  1  
ATOM   51    C  CD1  . ILE A 1 4  ? 69.358 13.792  10.698  1.00 0.00  ? 4   ILE A CD1  1  
ATOM   52    H  H    . ILE A 1 4  ? 69.516 10.878  9.883   1.00 0.00  ? 4   ILE A H    1  
ATOM   53    H  HA   . ILE A 1 4  ? 68.803 10.352  12.702  1.00 0.00  ? 4   ILE A HA   1  
ATOM   54    H  HB   . ILE A 1 4  ? 67.607 12.082  10.505  1.00 0.00  ? 4   ILE A HB   1  
ATOM   55    H  HG12 . ILE A 1 4  ? 68.672 13.546  12.717  1.00 0.00  ? 4   ILE A HG12 1  
ATOM   56    H  HG13 . ILE A 1 4  ? 69.893 12.375  12.218  1.00 0.00  ? 4   ILE A HG13 1  
ATOM   57    H  HG21 . ILE A 1 4  ? 66.984 12.811  13.259  1.00 0.00  ? 4   ILE A HG21 1  
ATOM   58    H  HG22 . ILE A 1 4  ? 66.370 11.207  12.857  1.00 0.00  ? 4   ILE A HG22 1  
ATOM   59    H  HG23 . ILE A 1 4  ? 65.896 12.602  11.886  1.00 0.00  ? 4   ILE A HG23 1  
ATOM   60    H  HD11 . ILE A 1 4  ? 68.686 13.564  9.883   1.00 0.00  ? 4   ILE A HD11 1  
ATOM   61    H  HD12 . ILE A 1 4  ? 70.375 13.599  10.392  1.00 0.00  ? 4   ILE A HD12 1  
ATOM   62    H  HD13 . ILE A 1 4  ? 69.256 14.834  10.967  1.00 0.00  ? 4   ILE A HD13 1  
ATOM   63    N  N    . TYR A 1 5  ? 66.933 9.297   10.176  1.00 0.00  ? 5   TYR A N    1  
ATOM   64    C  CA   . TYR A 1 5  ? 65.854 8.315   9.844   1.00 0.00  ? 5   TYR A CA   1  
ATOM   65    C  C    . TYR A 1 5  ? 66.356 6.876   10.035  1.00 0.00  ? 5   TYR A C    1  
ATOM   66    O  O    . TYR A 1 5  ? 65.626 6.022   10.501  1.00 0.00  ? 5   TYR A O    1  
ATOM   67    C  CB   . TYR A 1 5  ? 65.488 8.587   8.379   1.00 0.00  ? 5   TYR A CB   1  
ATOM   68    C  CG   . TYR A 1 5  ? 64.378 9.612   8.328   1.00 0.00  ? 5   TYR A CG   1  
ATOM   69    C  CD1  . TYR A 1 5  ? 63.104 9.287   8.809   1.00 0.00  ? 5   TYR A CD1  1  
ATOM   70    C  CD2  . TYR A 1 5  ? 64.625 10.891  7.813   1.00 0.00  ? 5   TYR A CD2  1  
ATOM   71    C  CE1  . TYR A 1 5  ? 62.079 10.240  8.773   1.00 0.00  ? 5   TYR A CE1  1  
ATOM   72    C  CE2  . TYR A 1 5  ? 63.598 11.843  7.780   1.00 0.00  ? 5   TYR A CE2  1  
ATOM   73    C  CZ   . TYR A 1 5  ? 62.326 11.516  8.260   1.00 0.00  ? 5   TYR A CZ   1  
ATOM   74    O  OH   . TYR A 1 5  ? 61.314 12.453  8.229   1.00 0.00  ? 5   TYR A OH   1  
ATOM   75    H  H    . TYR A 1 5  ? 67.366 9.810   9.462   1.00 0.00  ? 5   TYR A H    1  
ATOM   76    H  HA   . TYR A 1 5  ? 64.993 8.489   10.472  1.00 0.00  ? 5   TYR A HA   1  
ATOM   77    H  HB2  . TYR A 1 5  ? 66.353 8.965   7.853   1.00 0.00  ? 5   TYR A HB2  1  
ATOM   78    H  HB3  . TYR A 1 5  ? 65.154 7.671   7.913   1.00 0.00  ? 5   TYR A HB3  1  
ATOM   79    H  HD1  . TYR A 1 5  ? 62.911 8.301   9.204   1.00 0.00  ? 5   TYR A HD1  1  
ATOM   80    H  HD2  . TYR A 1 5  ? 65.607 11.144  7.441   1.00 0.00  ? 5   TYR A HD2  1  
ATOM   81    H  HE1  . TYR A 1 5  ? 61.097 9.990   9.145   1.00 0.00  ? 5   TYR A HE1  1  
ATOM   82    H  HE2  . TYR A 1 5  ? 63.788 12.830  7.384   1.00 0.00  ? 5   TYR A HE2  1  
ATOM   83    H  HH   . TYR A 1 5  ? 60.765 12.268  7.463   1.00 0.00  ? 5   TYR A HH   1  
ATOM   84    N  N    . LYS A 1 6  ? 67.596 6.600   9.696   1.00 0.00  ? 6   LYS A N    1  
ATOM   85    C  CA   . LYS A 1 6  ? 68.123 5.210   9.883   1.00 0.00  ? 6   LYS A CA   1  
ATOM   86    C  C    . LYS A 1 6  ? 68.297 4.910   11.379  1.00 0.00  ? 6   LYS A C    1  
ATOM   87    O  O    . LYS A 1 6  ? 68.120 3.787   11.811  1.00 0.00  ? 6   LYS A O    1  
ATOM   88    C  CB   . LYS A 1 6  ? 69.468 5.160   9.154   1.00 0.00  ? 6   LYS A CB   1  
ATOM   89    C  CG   . LYS A 1 6  ? 69.699 3.736   8.630   1.00 0.00  ? 6   LYS A CG   1  
ATOM   90    C  CD   . LYS A 1 6  ? 70.785 3.044   9.460   1.00 0.00  ? 6   LYS A CD   1  
ATOM   91    C  CE   . LYS A 1 6  ? 72.144 3.691   9.184   1.00 0.00  ? 6   LYS A CE   1  
ATOM   92    N  NZ   . LYS A 1 6  ? 72.751 3.905   10.530  1.00 0.00  ? 6   LYS A NZ   1  
ATOM   93    H  H    . LYS A 1 6  ? 68.175 7.303   9.332   1.00 0.00  ? 6   LYS A H    1  
ATOM   94    H  HA   . LYS A 1 6  ? 67.444 4.498   9.443   1.00 0.00  ? 6   LYS A HA   1  
ATOM   95    H  HB2  . LYS A 1 6  ? 69.455 5.853   8.324   1.00 0.00  ? 6   LYS A HB2  1  
ATOM   96    H  HB3  . LYS A 1 6  ? 70.260 5.426   9.836   1.00 0.00  ? 6   LYS A HB3  1  
ATOM   97    H  HG2  . LYS A 1 6  ? 68.780 3.173   8.709   1.00 0.00  ? 6   LYS A HG2  1  
ATOM   98    H  HG3  . LYS A 1 6  ? 70.006 3.774   7.598   1.00 0.00  ? 6   LYS A HG3  1  
ATOM   99    H  HD2  . LYS A 1 6  ? 70.546 3.137   10.509  1.00 0.00  ? 6   LYS A HD2  1  
ATOM   100   H  HD3  . LYS A 1 6  ? 70.826 1.998   9.194   1.00 0.00  ? 6   LYS A HD3  1  
ATOM   101   H  HE2  . LYS A 1 6  ? 72.759 3.028   8.591   1.00 0.00  ? 6   LYS A HE2  1  
ATOM   102   H  HE3  . LYS A 1 6  ? 72.015 4.638   8.682   1.00 0.00  ? 6   LYS A HE3  1  
ATOM   103   H  HZ1  . LYS A 1 6  ? 73.555 4.558   10.446  1.00 0.00  ? 6   LYS A HZ1  1  
ATOM   104   H  HZ2  . LYS A 1 6  ? 73.078 2.995   10.916  1.00 0.00  ? 6   LYS A HZ2  1  
ATOM   105   H  HZ3  . LYS A 1 6  ? 72.043 4.320   11.172  1.00 0.00  ? 6   LYS A HZ3  1  
ATOM   106   N  N    . ALA A 1 7  ? 68.617 5.908   12.175  1.00 0.00  ? 7   ALA A N    1  
ATOM   107   C  CA   . ALA A 1 7  ? 68.767 5.678   13.647  1.00 0.00  ? 7   ALA A CA   1  
ATOM   108   C  C    . ALA A 1 7  ? 67.474 5.055   14.197  1.00 0.00  ? 7   ALA A C    1  
ATOM   109   O  O    . ALA A 1 7  ? 67.504 4.136   14.994  1.00 0.00  ? 7   ALA A O    1  
ATOM   110   C  CB   . ALA A 1 7  ? 68.999 7.064   14.251  1.00 0.00  ? 7   ALA A CB   1  
ATOM   111   H  H    . ALA A 1 7  ? 68.738 6.808   11.807  1.00 0.00  ? 7   ALA A H    1  
ATOM   112   H  HA   . ALA A 1 7  ? 69.612 5.037   13.848  1.00 0.00  ? 7   ALA A HA   1  
ATOM   113   H  HB1  . ALA A 1 7  ? 68.203 7.729   13.947  1.00 0.00  ? 7   ALA A HB1  1  
ATOM   114   H  HB2  . ALA A 1 7  ? 69.945 7.454   13.905  1.00 0.00  ? 7   ALA A HB2  1  
ATOM   115   H  HB3  . ALA A 1 7  ? 69.012 6.990   15.329  1.00 0.00  ? 7   ALA A HB3  1  
ATOM   116   N  N    . ALA A 1 8  ? 66.339 5.540   13.744  1.00 0.00  ? 8   ALA A N    1  
ATOM   117   C  CA   . ALA A 1 8  ? 65.034 4.971   14.199  1.00 0.00  ? 8   ALA A CA   1  
ATOM   118   C  C    . ALA A 1 8  ? 64.860 3.563   13.615  1.00 0.00  ? 8   ALA A C    1  
ATOM   119   O  O    . ALA A 1 8  ? 64.350 2.673   14.264  1.00 0.00  ? 8   ALA A O    1  
ATOM   120   C  CB   . ALA A 1 8  ? 63.969 5.921   13.642  1.00 0.00  ? 8   ALA A CB   1  
ATOM   121   H  H    . ALA A 1 8  ? 66.350 6.267   13.087  1.00 0.00  ? 8   ALA A H    1  
ATOM   122   H  HA   . ALA A 1 8  ? 64.984 4.946   15.276  1.00 0.00  ? 8   ALA A HA   1  
ATOM   123   H  HB1  . ALA A 1 8  ? 64.161 6.102   12.594  1.00 0.00  ? 8   ALA A HB1  1  
ATOM   124   H  HB2  . ALA A 1 8  ? 64.002 6.857   14.181  1.00 0.00  ? 8   ALA A HB2  1  
ATOM   125   H  HB3  . ALA A 1 8  ? 62.991 5.474   13.755  1.00 0.00  ? 8   ALA A HB3  1  
ATOM   126   N  N    . VAL A 1 9  ? 65.301 3.360   12.395  1.00 0.00  ? 9   VAL A N    1  
ATOM   127   C  CA   . VAL A 1 9  ? 65.189 2.009   11.753  1.00 0.00  ? 9   VAL A CA   1  
ATOM   128   C  C    . VAL A 1 9  ? 65.970 0.975   12.577  1.00 0.00  ? 9   VAL A C    1  
ATOM   129   O  O    . VAL A 1 9  ? 65.487 -0.111  12.842  1.00 0.00  ? 9   VAL A O    1  
ATOM   130   C  CB   . VAL A 1 9  ? 65.816 2.184   10.361  1.00 0.00  ? 9   VAL A CB   1  
ATOM   131   C  CG1  . VAL A 1 9  ? 65.987 0.823   9.677   1.00 0.00  ? 9   VAL A CG1  1  
ATOM   132   C  CG2  . VAL A 1 9  ? 64.910 3.068   9.501   1.00 0.00  ? 9   VAL A CG2  1  
ATOM   133   H  H    . VAL A 1 9  ? 65.719 4.097   11.903  1.00 0.00  ? 9   VAL A H    1  
ATOM   134   H  HA   . VAL A 1 9  ? 64.155 1.718   11.661  1.00 0.00  ? 9   VAL A HA   1  
ATOM   135   H  HB   . VAL A 1 9  ? 66.783 2.655   10.463  1.00 0.00  ? 9   VAL A HB   1  
ATOM   136   H  HG11 . VAL A 1 9  ? 66.883 0.837   9.071   1.00 0.00  ? 9   VAL A HG11 1  
ATOM   137   H  HG12 . VAL A 1 9  ? 65.132 0.626   9.049   1.00 0.00  ? 9   VAL A HG12 1  
ATOM   138   H  HG13 . VAL A 1 9  ? 66.071 0.049   10.423  1.00 0.00  ? 9   VAL A HG13 1  
ATOM   139   H  HG21 . VAL A 1 9  ? 64.153 2.458   9.030   1.00 0.00  ? 9   VAL A HG21 1  
ATOM   140   H  HG22 . VAL A 1 9  ? 65.502 3.557   8.741   1.00 0.00  ? 9   VAL A HG22 1  
ATOM   141   H  HG23 . VAL A 1 9  ? 64.436 3.813   10.123  1.00 0.00  ? 9   VAL A HG23 1  
ATOM   142   N  N    . GLU A 1 10 ? 67.170 1.312   12.988  1.00 0.00  ? 10  GLU A N    1  
ATOM   143   C  CA   . GLU A 1 10 ? 67.989 0.360   13.804  1.00 0.00  ? 10  GLU A CA   1  
ATOM   144   C  C    . GLU A 1 10 ? 67.327 0.132   15.168  1.00 0.00  ? 10  GLU A C    1  
ATOM   145   O  O    . GLU A 1 10 ? 67.195 -0.989  15.621  1.00 0.00  ? 10  GLU A O    1  
ATOM   146   C  CB   . GLU A 1 10 ? 69.347 1.045   13.975  1.00 0.00  ? 10  GLU A CB   1  
ATOM   147   C  CG   . GLU A 1 10 ? 70.121 0.985   12.655  1.00 0.00  ? 10  GLU A CG   1  
ATOM   148   C  CD   . GLU A 1 10 ? 71.232 2.039   12.655  1.00 0.00  ? 10  GLU A CD   1  
ATOM   149   O  OE1  . GLU A 1 10 ? 70.920 3.207   12.831  1.00 0.00  ? 10  GLU A OE1  1  
ATOM   150   O  OE2  . GLU A 1 10 ? 72.377 1.663   12.470  1.00 0.00  ? 10  GLU A OE2  1  
ATOM   151   H  H    . GLU A 1 10 ? 67.531 2.197   12.764  1.00 0.00  ? 10  GLU A H    1  
ATOM   152   H  HA   . GLU A 1 10 ? 68.110 -0.576  13.282  1.00 0.00  ? 10  GLU A HA   1  
ATOM   153   H  HB2  . GLU A 1 10 ? 69.196 2.078   14.257  1.00 0.00  ? 10  GLU A HB2  1  
ATOM   154   H  HB3  . GLU A 1 10 ? 69.913 0.541   14.745  1.00 0.00  ? 10  GLU A HB3  1  
ATOM   155   H  HG2  . GLU A 1 10 ? 70.557 0.003   12.539  1.00 0.00  ? 10  GLU A HG2  1  
ATOM   156   H  HG3  . GLU A 1 10 ? 69.447 1.179   11.835  1.00 0.00  ? 10  GLU A HG3  1  
ATOM   157   N  N    . GLN A 1 11 ? 66.904 1.189   15.819  1.00 0.00  ? 11  GLN A N    1  
ATOM   158   C  CA   . GLN A 1 11 ? 66.245 1.041   17.145  1.00 0.00  ? 11  GLN A CA   1  
ATOM   159   C  C    . GLN A 1 11 ? 64.769 0.645   16.949  1.00 0.00  ? 11  GLN A C    1  
ATOM   160   O  O    . GLN A 1 11 ? 64.434 -0.526  16.971  1.00 0.00  ? 11  GLN A O    1  
ATOM   161   C  CB   . GLN A 1 11 ? 66.389 2.426   17.795  1.00 0.00  ? 11  GLN A CB   1  
ATOM   162   C  CG   . GLN A 1 11 ? 65.609 2.468   19.109  1.00 0.00  ? 11  GLN A CG   1  
ATOM   163   C  CD   . GLN A 1 11 ? 66.578 2.385   20.290  1.00 0.00  ? 11  GLN A CD   1  
ATOM   164   O  OE1  . GLN A 1 11 ? 66.774 1.329   20.854  1.00 0.00  ? 11  GLN A OE1  1  
ATOM   165   N  NE2  . GLN A 1 11 ? 67.198 3.460   20.690  1.00 0.00  ? 11  GLN A NE2  1  
ATOM   166   H  H    . GLN A 1 11 ? 67.014 2.082   15.432  1.00 0.00  ? 11  GLN A H    1  
ATOM   167   H  HA   . GLN A 1 11 ? 66.757 0.300   17.739  1.00 0.00  ? 11  GLN A HA   1  
ATOM   168   H  HB2  . GLN A 1 11 ? 67.434 2.622   17.990  1.00 0.00  ? 11  GLN A HB2  1  
ATOM   169   H  HB3  . GLN A 1 11 ? 66.003 3.180   17.125  1.00 0.00  ? 11  GLN A HB3  1  
ATOM   170   H  HG2  . GLN A 1 11 ? 65.054 3.391   19.162  1.00 0.00  ? 11  GLN A HG2  1  
ATOM   171   H  HG3  . GLN A 1 11 ? 64.927 1.634   19.147  1.00 0.00  ? 11  GLN A HG3  1  
ATOM   172   H  HE21 . GLN A 1 11 ? 67.043 4.313   20.235  1.00 0.00  ? 11  GLN A HE21 1  
ATOM   173   H  HE22 . GLN A 1 11 ? 67.820 3.413   21.445  1.00 0.00  ? 11  GLN A HE22 1  
ATOM   174   N  N    . LEU A 1 12 ? 63.892 1.607   16.742  1.00 0.00  ? 12  LEU A N    1  
ATOM   175   C  CA   . LEU A 1 12 ? 62.439 1.297   16.531  1.00 0.00  ? 12  LEU A CA   1  
ATOM   176   C  C    . LEU A 1 12 ? 61.889 0.422   17.672  1.00 0.00  ? 12  LEU A C    1  
ATOM   177   O  O    . LEU A 1 12 ? 62.450 0.364   18.752  1.00 0.00  ? 12  LEU A O    1  
ATOM   178   C  CB   . LEU A 1 12 ? 62.385 0.547   15.189  1.00 0.00  ? 12  LEU A CB   1  
ATOM   179   C  CG   . LEU A 1 12 ? 61.607 1.371   14.156  1.00 0.00  ? 12  LEU A CG   1  
ATOM   180   C  CD1  . LEU A 1 12 ? 61.860 0.806   12.757  1.00 0.00  ? 12  LEU A CD1  1  
ATOM   181   C  CD2  . LEU A 1 12 ? 60.109 1.305   14.463  1.00 0.00  ? 12  LEU A CD2  1  
ATOM   182   H  H    . LEU A 1 12 ? 64.192 2.538   16.716  1.00 0.00  ? 12  LEU A H    1  
ATOM   183   H  HA   . LEU A 1 12 ? 61.872 2.211   16.459  1.00 0.00  ? 12  LEU A HA   1  
ATOM   184   H  HB2  . LEU A 1 12 ? 63.392 0.386   14.831  1.00 0.00  ? 12  LEU A HB2  1  
ATOM   185   H  HB3  . LEU A 1 12 ? 61.899 -0.406  15.327  1.00 0.00  ? 12  LEU A HB3  1  
ATOM   186   H  HG   . LEU A 1 12 ? 61.938 2.400   14.192  1.00 0.00  ? 12  LEU A HG   1  
ATOM   187   H  HD11 . LEU A 1 12 ? 62.825 0.323   12.733  1.00 0.00  ? 12  LEU A HD11 1  
ATOM   188   H  HD12 . LEU A 1 12 ? 61.841 1.607   12.034  1.00 0.00  ? 12  LEU A HD12 1  
ATOM   189   H  HD13 . LEU A 1 12 ? 61.092 0.085   12.514  1.00 0.00  ? 12  LEU A HD13 1  
ATOM   190   H  HD21 . LEU A 1 12 ? 59.582 2.005   13.831  1.00 0.00  ? 12  LEU A HD21 1  
ATOM   191   H  HD22 . LEU A 1 12 ? 59.940 1.559   15.498  1.00 0.00  ? 12  LEU A HD22 1  
ATOM   192   H  HD23 . LEU A 1 12 ? 59.747 0.307   14.272  1.00 0.00  ? 12  LEU A HD23 1  
ATOM   193   N  N    . THR A 1 13 ? 60.796 -0.256  17.437  1.00 0.00  ? 13  THR A N    1  
ATOM   194   C  CA   . THR A 1 13 ? 60.199 -1.133  18.491  1.00 0.00  ? 13  THR A CA   1  
ATOM   195   C  C    . THR A 1 13 ? 59.623 -2.394  17.853  1.00 0.00  ? 13  THR A C    1  
ATOM   196   O  O    . THR A 1 13 ? 59.272 -2.404  16.689  1.00 0.00  ? 13  THR A O    1  
ATOM   197   C  CB   . THR A 1 13 ? 59.095 -0.302  19.161  1.00 0.00  ? 13  THR A CB   1  
ATOM   198   O  OG1  . THR A 1 13 ? 58.185 -1.174  19.814  1.00 0.00  ? 13  THR A OG1  1  
ATOM   199   C  CG2  . THR A 1 13 ? 58.344 0.520   18.115  1.00 0.00  ? 13  THR A CG2  1  
ATOM   200   H  H    . THR A 1 13 ? 60.364 -0.191  16.560  1.00 0.00  ? 13  THR A H    1  
ATOM   201   H  HA   . THR A 1 13 ? 60.940 -1.403  19.217  1.00 0.00  ? 13  THR A HA   1  
ATOM   202   H  HB   . THR A 1 13 ? 59.538 0.365   19.886  1.00 0.00  ? 13  THR A HB   1  
ATOM   203   H  HG1  . THR A 1 13 ? 57.773 -0.692  20.533  1.00 0.00  ? 13  THR A HG1  1  
ATOM   204   H  HG21 . THR A 1 13 ? 57.368 0.779   18.493  1.00 0.00  ? 13  THR A HG21 1  
ATOM   205   H  HG22 . THR A 1 13 ? 58.239 -0.061  17.212  1.00 0.00  ? 13  THR A HG22 1  
ATOM   206   H  HG23 . THR A 1 13 ? 58.899 1.420   17.901  1.00 0.00  ? 13  THR A HG23 1  
ATOM   207   N  N    . GLU A 1 14 ? 59.532 -3.458  18.607  1.00 0.00  ? 14  GLU A N    1  
ATOM   208   C  CA   . GLU A 1 14 ? 58.988 -4.730  18.051  1.00 0.00  ? 14  GLU A CA   1  
ATOM   209   C  C    . GLU A 1 14 ? 57.606 -4.509  17.422  1.00 0.00  ? 14  GLU A C    1  
ATOM   210   O  O    . GLU A 1 14 ? 57.296 -5.055  16.380  1.00 0.00  ? 14  GLU A O    1  
ATOM   211   C  CB   . GLU A 1 14 ? 58.891 -5.685  19.235  1.00 0.00  ? 14  GLU A CB   1  
ATOM   212   C  CG   . GLU A 1 14 ? 59.559 -7.006  18.850  1.00 0.00  ? 14  GLU A CG   1  
ATOM   213   C  CD   . GLU A 1 14 ? 58.781 -7.666  17.708  1.00 0.00  ? 14  GLU A CD   1  
ATOM   214   O  OE1  . GLU A 1 14 ? 57.734 -8.231  17.977  1.00 0.00  ? 14  GLU A OE1  1  
ATOM   215   O  OE2  . GLU A 1 14 ? 59.247 -7.595  16.583  1.00 0.00  ? 14  GLU A OE2  1  
ATOM   216   H  H    . GLU A 1 14 ? 59.828 -3.420  19.541  1.00 0.00  ? 14  GLU A H    1  
ATOM   217   H  HA   . GLU A 1 14 ? 59.672 -5.135  17.326  1.00 0.00  ? 14  GLU A HA   1  
ATOM   218   H  HB2  . GLU A 1 14 ? 59.396 -5.257  20.090  1.00 0.00  ? 14  GLU A HB2  1  
ATOM   219   H  HB3  . GLU A 1 14 ? 57.854 -5.863  19.477  1.00 0.00  ? 14  GLU A HB3  1  
ATOM   220   H  HG2  . GLU A 1 14 ? 60.572 -6.816  18.531  1.00 0.00  ? 14  GLU A HG2  1  
ATOM   221   H  HG3  . GLU A 1 14 ? 59.568 -7.659  19.698  1.00 0.00  ? 14  GLU A HG3  1  
ATOM   222   N  N    . GLU A 1 15 ? 56.779 -3.704  18.046  1.00 0.00  ? 15  GLU A N    1  
ATOM   223   C  CA   . GLU A 1 15 ? 55.414 -3.433  17.492  1.00 0.00  ? 15  GLU A CA   1  
ATOM   224   C  C    . GLU A 1 15 ? 55.509 -2.909  16.050  1.00 0.00  ? 15  GLU A C    1  
ATOM   225   O  O    . GLU A 1 15 ? 54.786 -3.346  15.177  1.00 0.00  ? 15  GLU A O    1  
ATOM   226   C  CB   . GLU A 1 15 ? 54.811 -2.366  18.412  1.00 0.00  ? 15  GLU A CB   1  
ATOM   227   C  CG   . GLU A 1 15 ? 54.364 -3.012  19.729  1.00 0.00  ? 15  GLU A CG   1  
ATOM   228   C  CD   . GLU A 1 15 ? 55.432 -2.786  20.804  1.00 0.00  ? 15  GLU A CD   1  
ATOM   229   O  OE1  . GLU A 1 15 ? 55.436 -1.719  21.395  1.00 0.00  ? 15  GLU A OE1  1  
ATOM   230   O  OE2  . GLU A 1 15 ? 56.228 -3.687  21.017  1.00 0.00  ? 15  GLU A OE2  1  
ATOM   231   H  H    . GLU A 1 15 ? 57.059 -3.274  18.883  1.00 0.00  ? 15  GLU A H    1  
ATOM   232   H  HA   . GLU A 1 15 ? 54.813 -4.328  17.526  1.00 0.00  ? 15  GLU A HA   1  
ATOM   233   H  HB2  . GLU A 1 15 ? 55.551 -1.606  18.617  1.00 0.00  ? 15  GLU A HB2  1  
ATOM   234   H  HB3  . GLU A 1 15 ? 53.957 -1.915  17.930  1.00 0.00  ? 15  GLU A HB3  1  
ATOM   235   H  HG2  . GLU A 1 15 ? 53.433 -2.568  20.050  1.00 0.00  ? 15  GLU A HG2  1  
ATOM   236   H  HG3  . GLU A 1 15 ? 54.225 -4.072  19.582  1.00 0.00  ? 15  GLU A HG3  1  
ATOM   237   N  N    . GLN A 1 16 ? 56.399 -1.978  15.797  1.00 0.00  ? 16  GLN A N    1  
ATOM   238   C  CA   . GLN A 1 16 ? 56.543 -1.426  14.411  1.00 0.00  ? 16  GLN A CA   1  
ATOM   239   C  C    . GLN A 1 16 ? 57.490 -2.290  13.572  1.00 0.00  ? 16  GLN A C    1  
ATOM   240   O  O    . GLN A 1 16 ? 57.321 -2.429  12.376  1.00 0.00  ? 16  GLN A O    1  
ATOM   241   C  CB   . GLN A 1 16 ? 57.122 -0.021  14.591  1.00 0.00  ? 16  GLN A CB   1  
ATOM   242   C  CG   . GLN A 1 16 ? 56.012 0.954   15.000  1.00 0.00  ? 16  GLN A CG   1  
ATOM   243   C  CD   . GLN A 1 16 ? 56.576 2.376   15.041  1.00 0.00  ? 16  GLN A CD   1  
ATOM   244   O  OE1  . GLN A 1 16 ? 57.438 2.677   15.841  1.00 0.00  ? 16  GLN A OE1  1  
ATOM   245   N  NE2  . GLN A 1 16 ? 56.128 3.269   14.204  1.00 0.00  ? 16  GLN A NE2  1  
ATOM   246   H  H    . GLN A 1 16 ? 56.973 -1.643  16.519  1.00 0.00  ? 16  GLN A H    1  
ATOM   247   H  HA   . GLN A 1 16 ? 55.589 -1.370  13.936  1.00 0.00  ? 16  GLN A HA   1  
ATOM   248   H  HB2  . GLN A 1 16 ? 57.882 -0.041  15.358  1.00 0.00  ? 16  GLN A HB2  1  
ATOM   249   H  HB3  . GLN A 1 16 ? 57.560 0.308   13.661  1.00 0.00  ? 16  GLN A HB3  1  
ATOM   250   H  HG2  . GLN A 1 16 ? 55.206 0.905   14.282  1.00 0.00  ? 16  GLN A HG2  1  
ATOM   251   H  HG3  . GLN A 1 16 ? 55.641 0.688   15.979  1.00 0.00  ? 16  GLN A HG3  1  
ATOM   252   H  HE21 . GLN A 1 16 ? 55.435 3.030   13.555  1.00 0.00  ? 16  GLN A HE21 1  
ATOM   253   H  HE22 . GLN A 1 16 ? 56.486 4.181   14.224  1.00 0.00  ? 16  GLN A HE22 1  
ATOM   254   N  N    . LYS A 1 17 ? 58.480 -2.866  14.193  1.00 0.00  ? 17  LYS A N    1  
ATOM   255   C  CA   . LYS A 1 17 ? 59.453 -3.728  13.444  1.00 0.00  ? 17  LYS A CA   1  
ATOM   256   C  C    . LYS A 1 17 ? 58.740 -4.968  12.893  1.00 0.00  ? 17  LYS A C    1  
ATOM   257   O  O    . LYS A 1 17 ? 58.800 -5.250  11.710  1.00 0.00  ? 17  LYS A O    1  
ATOM   258   C  CB   . LYS A 1 17 ? 60.524 -4.123  14.468  1.00 0.00  ? 17  LYS A CB   1  
ATOM   259   C  CG   . LYS A 1 17 ? 61.854 -4.384  13.751  1.00 0.00  ? 17  LYS A CG   1  
ATOM   260   C  CD   . LYS A 1 17 ? 62.687 -3.097  13.723  1.00 0.00  ? 17  LYS A CD   1  
ATOM   261   C  CE   . LYS A 1 17 ? 63.603 -3.044  14.950  1.00 0.00  ? 17  LYS A CE   1  
ATOM   262   N  NZ   . LYS A 1 17 ? 64.801 -2.269  14.507  1.00 0.00  ? 17  LYS A NZ   1  
ATOM   263   H  H    . LYS A 1 17 ? 58.580 -2.732  15.155  1.00 0.00  ? 17  LYS A H    1  
ATOM   264   H  HA   . LYS A 1 17 ? 59.903 -3.168  12.639  1.00 0.00  ? 17  LYS A HA   1  
ATOM   265   H  HB2  . LYS A 1 17 ? 60.651 -3.323  15.183  1.00 0.00  ? 17  LYS A HB2  1  
ATOM   266   H  HB3  . LYS A 1 17 ? 60.215 -5.019  14.985  1.00 0.00  ? 17  LYS A HB3  1  
ATOM   267   H  HG2  . LYS A 1 17 ? 62.398 -5.158  14.272  1.00 0.00  ? 17  LYS A HG2  1  
ATOM   268   H  HG3  . LYS A 1 17 ? 61.659 -4.704  12.737  1.00 0.00  ? 17  LYS A HG3  1  
ATOM   269   H  HD2  . LYS A 1 17 ? 63.287 -3.079  12.825  1.00 0.00  ? 17  LYS A HD2  1  
ATOM   270   H  HD3  . LYS A 1 17 ? 62.029 -2.242  13.732  1.00 0.00  ? 17  LYS A HD3  1  
ATOM   271   H  HE2  . LYS A 1 17 ? 63.105 -2.537  15.766  1.00 0.00  ? 17  LYS A HE2  1  
ATOM   272   H  HE3  . LYS A 1 17 ? 63.895 -4.039  15.246  1.00 0.00  ? 17  LYS A HE3  1  
ATOM   273   H  HZ1  . LYS A 1 17 ? 64.525 -1.289  14.293  1.00 0.00  ? 17  LYS A HZ1  1  
ATOM   274   H  HZ2  . LYS A 1 17 ? 65.208 -2.710  13.656  1.00 0.00  ? 17  LYS A HZ2  1  
ATOM   275   H  HZ3  . LYS A 1 17 ? 65.512 -2.264  15.267  1.00 0.00  ? 17  LYS A HZ3  1  
ATOM   276   N  N    . ASN A 1 18 ? 58.049 -5.696  13.738  1.00 0.00  ? 18  ASN A N    1  
ATOM   277   C  CA   . ASN A 1 18 ? 57.309 -6.906  13.259  1.00 0.00  ? 18  ASN A CA   1  
ATOM   278   C  C    . ASN A 1 18 ? 56.237 -6.482  12.246  1.00 0.00  ? 18  ASN A C    1  
ATOM   279   O  O    . ASN A 1 18 ? 55.932 -7.204  11.314  1.00 0.00  ? 18  ASN A O    1  
ATOM   280   C  CB   . ASN A 1 18 ? 56.665 -7.512  14.510  1.00 0.00  ? 18  ASN A CB   1  
ATOM   281   C  CG   . ASN A 1 18 ? 56.773 -9.036  14.455  1.00 0.00  ? 18  ASN A CG   1  
ATOM   282   O  OD1  . ASN A 1 18 ? 55.951 -9.694  13.851  1.00 0.00  ? 18  ASN A OD1  1  
ATOM   283   N  ND2  . ASN A 1 18 ? 57.759 -9.632  15.063  1.00 0.00  ? 18  ASN A ND2  1  
ATOM   284   H  H    . ASN A 1 18 ? 58.005 -5.437  14.684  1.00 0.00  ? 18  ASN A H    1  
ATOM   285   H  HA   . ASN A 1 18 ? 57.991 -7.613  12.811  1.00 0.00  ? 18  ASN A HA   1  
ATOM   286   H  HB2  . ASN A 1 18 ? 57.175 -7.149  15.389  1.00 0.00  ? 18  ASN A HB2  1  
ATOM   287   H  HB3  . ASN A 1 18 ? 55.625 -7.229  14.554  1.00 0.00  ? 18  ASN A HB3  1  
ATOM   288   H  HD21 . ASN A 1 18 ? 58.425 -9.103  15.553  1.00 0.00  ? 18  ASN A HD21 1  
ATOM   289   H  HD22 . ASN A 1 18 ? 57.835 -10.607 15.031  1.00 0.00  ? 18  ASN A HD22 1  
ATOM   290   N  N    . GLU A 1 19 ? 55.679 -5.305  12.415  1.00 0.00  ? 19  GLU A N    1  
ATOM   291   C  CA   . GLU A 1 19 ? 54.643 -4.812  11.456  1.00 0.00  ? 19  GLU A CA   1  
ATOM   292   C  C    . GLU A 1 19 ? 55.252 -4.695  10.052  1.00 0.00  ? 19  GLU A C    1  
ATOM   293   O  O    . GLU A 1 19 ? 54.664 -5.126  9.078   1.00 0.00  ? 19  GLU A O    1  
ATOM   294   C  CB   . GLU A 1 19 ? 54.224 -3.436  11.985  1.00 0.00  ? 19  GLU A CB   1  
ATOM   295   C  CG   . GLU A 1 19 ? 52.836 -3.537  12.625  1.00 0.00  ? 19  GLU A CG   1  
ATOM   296   C  CD   . GLU A 1 19 ? 51.761 -3.390  11.546  1.00 0.00  ? 19  GLU A CD   1  
ATOM   297   O  OE1  . GLU A 1 19 ? 51.428 -4.389  10.928  1.00 0.00  ? 19  GLU A OE1  1  
ATOM   298   O  OE2  . GLU A 1 19 ? 51.290 -2.282  11.356  1.00 0.00  ? 19  GLU A OE2  1  
ATOM   299   H  H    . GLU A 1 19 ? 55.953 -4.739  13.167  1.00 0.00  ? 19  GLU A H    1  
ATOM   300   H  HA   . GLU A 1 19 ? 53.793 -5.478  11.444  1.00 0.00  ? 19  GLU A HA   1  
ATOM   301   H  HB2  . GLU A 1 19 ? 54.938 -3.100  12.723  1.00 0.00  ? 19  GLU A HB2  1  
ATOM   302   H  HB3  . GLU A 1 19 ? 54.191 -2.731  11.168  1.00 0.00  ? 19  GLU A HB3  1  
ATOM   303   H  HG2  . GLU A 1 19 ? 52.731 -4.498  13.108  1.00 0.00  ? 19  GLU A HG2  1  
ATOM   304   H  HG3  . GLU A 1 19 ? 52.718 -2.752  13.356  1.00 0.00  ? 19  GLU A HG3  1  
ATOM   305   N  N    . PHE A 1 20 ? 56.438 -4.136  9.945   1.00 0.00  ? 20  PHE A N    1  
ATOM   306   C  CA   . PHE A 1 20 ? 57.094 -4.017  8.603   1.00 0.00  ? 20  PHE A CA   1  
ATOM   307   C  C    . PHE A 1 20 ? 57.352 -5.420  8.034   1.00 0.00  ? 20  PHE A C    1  
ATOM   308   O  O    . PHE A 1 20 ? 57.224 -5.645  6.847   1.00 0.00  ? 20  PHE A O    1  
ATOM   309   C  CB   . PHE A 1 20 ? 58.414 -3.268  8.846   1.00 0.00  ? 20  PHE A CB   1  
ATOM   310   C  CG   . PHE A 1 20 ? 58.131 -1.802  9.105   1.00 0.00  ? 20  PHE A CG   1  
ATOM   311   C  CD1  . PHE A 1 20 ? 57.193 -1.108  8.322   1.00 0.00  ? 20  PHE A CD1  1  
ATOM   312   C  CD2  . PHE A 1 20 ? 58.809 -1.136  10.134  1.00 0.00  ? 20  PHE A CD2  1  
ATOM   313   C  CE1  . PHE A 1 20 ? 56.939 0.246   8.572   1.00 0.00  ? 20  PHE A CE1  1  
ATOM   314   C  CE2  . PHE A 1 20 ? 58.554 0.218   10.382  1.00 0.00  ? 20  PHE A CE2  1  
ATOM   315   C  CZ   . PHE A 1 20 ? 57.619 0.909   9.602   1.00 0.00  ? 20  PHE A CZ   1  
ATOM   316   H  H    . PHE A 1 20 ? 56.900 -3.811  10.748  1.00 0.00  ? 20  PHE A H    1  
ATOM   317   H  HA   . PHE A 1 20 ? 56.467 -3.453  7.931   1.00 0.00  ? 20  PHE A HA   1  
ATOM   318   H  HB2  . PHE A 1 20 ? 58.920 -3.691  9.702   1.00 0.00  ? 20  PHE A HB2  1  
ATOM   319   H  HB3  . PHE A 1 20 ? 59.048 -3.360  7.975   1.00 0.00  ? 20  PHE A HB3  1  
ATOM   320   H  HD1  . PHE A 1 20 ? 56.666 -1.616  7.523   1.00 0.00  ? 20  PHE A HD1  1  
ATOM   321   H  HD2  . PHE A 1 20 ? 59.530 -1.669  10.737  1.00 0.00  ? 20  PHE A HD2  1  
ATOM   322   H  HE1  . PHE A 1 20 ? 56.217 0.779   7.972   1.00 0.00  ? 20  PHE A HE1  1  
ATOM   323   H  HE2  . PHE A 1 20 ? 59.078 0.731   11.176  1.00 0.00  ? 20  PHE A HE2  1  
ATOM   324   H  HZ   . PHE A 1 20 ? 57.424 1.953   9.794   1.00 0.00  ? 20  PHE A HZ   1  
ATOM   325   N  N    . LYS A 1 21 ? 57.686 -6.367  8.880   1.00 0.00  ? 21  LYS A N    1  
ATOM   326   C  CA   . LYS A 1 21 ? 57.922 -7.766  8.400   1.00 0.00  ? 21  LYS A CA   1  
ATOM   327   C  C    . LYS A 1 21 ? 56.609 -8.344  7.846   1.00 0.00  ? 21  LYS A C    1  
ATOM   328   O  O    . LYS A 1 21 ? 56.583 -8.920  6.776   1.00 0.00  ? 21  LYS A O    1  
ATOM   329   C  CB   . LYS A 1 21 ? 58.402 -8.537  9.644   1.00 0.00  ? 21  LYS A CB   1  
ATOM   330   C  CG   . LYS A 1 21 ? 58.055 -10.028 9.532   1.00 0.00  ? 21  LYS A CG   1  
ATOM   331   C  CD   . LYS A 1 21 ? 58.752 -10.632 8.307   1.00 0.00  ? 21  LYS A CD   1  
ATOM   332   C  CE   . LYS A 1 21 ? 58.191 -12.030 8.031   1.00 0.00  ? 21  LYS A CE   1  
ATOM   333   N  NZ   . LYS A 1 21 ? 56.995 -11.807 7.164   1.00 0.00  ? 21  LYS A NZ   1  
ATOM   334   H  H    . LYS A 1 21 ? 57.763 -6.160  9.836   1.00 0.00  ? 21  LYS A H    1  
ATOM   335   H  HA   . LYS A 1 21 ? 58.687 -7.778  7.640   1.00 0.00  ? 21  LYS A HA   1  
ATOM   336   H  HB2  . LYS A 1 21 ? 59.472 -8.428  9.738   1.00 0.00  ? 21  LYS A HB2  1  
ATOM   337   H  HB3  . LYS A 1 21 ? 57.926 -8.128  10.522  1.00 0.00  ? 21  LYS A HB3  1  
ATOM   338   H  HG2  . LYS A 1 21 ? 58.389 -10.539 10.424  1.00 0.00  ? 21  LYS A HG2  1  
ATOM   339   H  HG3  . LYS A 1 21 ? 56.986 -10.144 9.431   1.00 0.00  ? 21  LYS A HG3  1  
ATOM   340   H  HD2  . LYS A 1 21 ? 58.583 -10.001 7.447   1.00 0.00  ? 21  LYS A HD2  1  
ATOM   341   H  HD3  . LYS A 1 21 ? 59.812 -10.706 8.497   1.00 0.00  ? 21  LYS A HD3  1  
ATOM   342   H  HE2  . LYS A 1 21 ? 58.928 -12.630 7.513   1.00 0.00  ? 21  LYS A HE2  1  
ATOM   343   H  HE3  . LYS A 1 21 ? 57.896 -12.507 8.953   1.00 0.00  ? 21  LYS A HE3  1  
ATOM   344   H  HZ1  . LYS A 1 21 ? 57.277 -11.295 6.303   1.00 0.00  ? 21  LYS A HZ1  1  
ATOM   345   H  HZ2  . LYS A 1 21 ? 56.288 -11.245 7.681   1.00 0.00  ? 21  LYS A HZ2  1  
ATOM   346   H  HZ3  . LYS A 1 21 ? 56.581 -12.723 6.900   1.00 0.00  ? 21  LYS A HZ3  1  
ATOM   347   N  N    . ALA A 1 22 ? 55.522 -8.175  8.563   1.00 0.00  ? 22  ALA A N    1  
ATOM   348   C  CA   . ALA A 1 22 ? 54.202 -8.692  8.079   1.00 0.00  ? 22  ALA A CA   1  
ATOM   349   C  C    . ALA A 1 22 ? 53.758 -7.922  6.822   1.00 0.00  ? 22  ALA A C    1  
ATOM   350   O  O    . ALA A 1 22 ? 53.095 -8.461  5.959   1.00 0.00  ? 22  ALA A O    1  
ATOM   351   C  CB   . ALA A 1 22 ? 53.227 -8.446  9.234   1.00 0.00  ? 22  ALA A CB   1  
ATOM   352   H  H    . ALA A 1 22 ? 55.572 -7.693  9.417   1.00 0.00  ? 22  ALA A H    1  
ATOM   353   H  HA   . ALA A 1 22 ? 54.265 -9.749  7.868   1.00 0.00  ? 22  ALA A HA   1  
ATOM   354   H  HB1  . ALA A 1 22 ? 53.638 -8.855  10.146  1.00 0.00  ? 22  ALA A HB1  1  
ATOM   355   H  HB2  . ALA A 1 22 ? 52.284 -8.925  9.019   1.00 0.00  ? 22  ALA A HB2  1  
ATOM   356   H  HB3  . ALA A 1 22 ? 53.071 -7.384  9.356   1.00 0.00  ? 22  ALA A HB3  1  
ATOM   357   N  N    . ALA A 1 23 ? 54.126 -6.667  6.713   1.00 0.00  ? 23  ALA A N    1  
ATOM   358   C  CA   . ALA A 1 23 ? 53.737 -5.867  5.509   1.00 0.00  ? 23  ALA A CA   1  
ATOM   359   C  C    . ALA A 1 23 ? 54.769 -6.043  4.378   1.00 0.00  ? 23  ALA A C    1  
ATOM   360   O  O    . ALA A 1 23 ? 54.564 -5.582  3.271   1.00 0.00  ? 23  ALA A O    1  
ATOM   361   C  CB   . ALA A 1 23 ? 53.715 -4.411  5.990   1.00 0.00  ? 23  ALA A CB   1  
ATOM   362   H  H    . ALA A 1 23 ? 54.665 -6.253  7.420   1.00 0.00  ? 23  ALA A H    1  
ATOM   363   H  HA   . ALA A 1 23 ? 52.754 -6.155  5.168   1.00 0.00  ? 23  ALA A HA   1  
ATOM   364   H  HB1  . ALA A 1 23 ? 53.760 -3.748  5.138   1.00 0.00  ? 23  ALA A HB1  1  
ATOM   365   H  HB2  . ALA A 1 23 ? 54.565 -4.227  6.633   1.00 0.00  ? 23  ALA A HB2  1  
ATOM   366   H  HB3  . ALA A 1 23 ? 52.803 -4.227  6.540   1.00 0.00  ? 23  ALA A HB3  1  
ATOM   367   N  N    . PHE A 1 24 ? 55.876 -6.694  4.650   1.00 0.00  ? 24  PHE A N    1  
ATOM   368   C  CA   . PHE A 1 24 ? 56.925 -6.884  3.598   1.00 0.00  ? 24  PHE A CA   1  
ATOM   369   C  C    . PHE A 1 24 ? 56.667 -8.149  2.762   1.00 0.00  ? 24  PHE A C    1  
ATOM   370   O  O    . PHE A 1 24 ? 56.698 -8.101  1.547   1.00 0.00  ? 24  PHE A O    1  
ATOM   371   C  CB   . PHE A 1 24 ? 58.240 -7.013  4.380   1.00 0.00  ? 24  PHE A CB   1  
ATOM   372   C  CG   . PHE A 1 24 ? 59.390 -7.245  3.426   1.00 0.00  ? 24  PHE A CG   1  
ATOM   373   C  CD1  . PHE A 1 24 ? 59.920 -6.176  2.694   1.00 0.00  ? 24  PHE A CD1  1  
ATOM   374   C  CD2  . PHE A 1 24 ? 59.927 -8.528  3.278   1.00 0.00  ? 24  PHE A CD2  1  
ATOM   375   C  CE1  . PHE A 1 24 ? 60.988 -6.390  1.814   1.00 0.00  ? 24  PHE A CE1  1  
ATOM   376   C  CE2  . PHE A 1 24 ? 60.995 -8.743  2.399   1.00 0.00  ? 24  PHE A CE2  1  
ATOM   377   C  CZ   . PHE A 1 24 ? 61.526 -7.673  1.667   1.00 0.00  ? 24  PHE A CZ   1  
ATOM   378   H  H    . PHE A 1 24 ? 56.025 -7.048  5.551   1.00 0.00  ? 24  PHE A H    1  
ATOM   379   H  HA   . PHE A 1 24 ? 56.969 -6.019  2.957   1.00 0.00  ? 24  PHE A HA   1  
ATOM   380   H  HB2  . PHE A 1 24 ? 58.416 -6.104  4.936   1.00 0.00  ? 24  PHE A HB2  1  
ATOM   381   H  HB3  . PHE A 1 24 ? 58.169 -7.844  5.065   1.00 0.00  ? 24  PHE A HB3  1  
ATOM   382   H  HD1  . PHE A 1 24 ? 59.504 -5.186  2.807   1.00 0.00  ? 24  PHE A HD1  1  
ATOM   383   H  HD2  . PHE A 1 24 ? 59.518 -9.353  3.842   1.00 0.00  ? 24  PHE A HD2  1  
ATOM   384   H  HE1  . PHE A 1 24 ? 61.398 -5.564  1.251   1.00 0.00  ? 24  PHE A HE1  1  
ATOM   385   H  HE2  . PHE A 1 24 ? 61.409 -9.735  2.285   1.00 0.00  ? 24  PHE A HE2  1  
ATOM   386   H  HZ   . PHE A 1 24 ? 62.350 -7.840  0.988   1.00 0.00  ? 24  PHE A HZ   1  
ATOM   387   N  N    . ASP A 1 25 ? 56.435 -9.280  3.391   1.00 0.00  ? 25  ASP A N    1  
ATOM   388   C  CA   . ASP A 1 25 ? 56.205 -10.542 2.607   1.00 0.00  ? 25  ASP A CA   1  
ATOM   389   C  C    . ASP A 1 25 ? 55.014 -10.399 1.643   1.00 0.00  ? 25  ASP A C    1  
ATOM   390   O  O    . ASP A 1 25 ? 55.062 -10.880 0.528   1.00 0.00  ? 25  ASP A O    1  
ATOM   391   C  CB   . ASP A 1 25 ? 55.968 -11.652 3.645   1.00 0.00  ? 25  ASP A CB   1  
ATOM   392   C  CG   . ASP A 1 25 ? 54.715 -11.366 4.477   1.00 0.00  ? 25  ASP A CG   1  
ATOM   393   O  OD1  . ASP A 1 25 ? 54.834 -10.663 5.464   1.00 0.00  ? 25  ASP A OD1  1  
ATOM   394   O  OD2  . ASP A 1 25 ? 53.664 -11.868 4.120   1.00 0.00  ? 25  ASP A OD2  1  
ATOM   395   H  H    . ASP A 1 25 ? 56.427 -9.303  4.372   1.00 0.00  ? 25  ASP A H    1  
ATOM   396   H  HA   . ASP A 1 25 ? 57.092 -10.775 2.040   1.00 0.00  ? 25  ASP A HA   1  
ATOM   397   H  HB2  . ASP A 1 25 ? 55.846 -12.595 3.135   1.00 0.00  ? 25  ASP A HB2  1  
ATOM   398   H  HB3  . ASP A 1 25 ? 56.823 -11.711 4.301   1.00 0.00  ? 25  ASP A HB3  1  
ATOM   399   N  N    . ILE A 1 26 ? 53.957 -9.730  2.043   1.00 0.00  ? 26  ILE A N    1  
ATOM   400   C  CA   . ILE A 1 26 ? 52.795 -9.558  1.110   1.00 0.00  ? 26  ILE A CA   1  
ATOM   401   C  C    . ILE A 1 26 ? 53.223 -8.689  -0.083  1.00 0.00  ? 26  ILE A C    1  
ATOM   402   O  O    . ILE A 1 26 ? 52.800 -8.910  -1.202  1.00 0.00  ? 26  ILE A O    1  
ATOM   403   C  CB   . ILE A 1 26 ? 51.694 -8.860  1.923   1.00 0.00  ? 26  ILE A CB   1  
ATOM   404   C  CG1  . ILE A 1 26 ? 51.233 -9.769  3.068   1.00 0.00  ? 26  ILE A CG1  1  
ATOM   405   C  CG2  . ILE A 1 26 ? 50.499 -8.562  1.014   1.00 0.00  ? 26  ILE A CG2  1  
ATOM   406   C  CD1  . ILE A 1 26 ? 50.673 -8.911  4.206   1.00 0.00  ? 26  ILE A CD1  1  
ATOM   407   H  H    . ILE A 1 26 ? 53.934 -9.335  2.940   1.00 0.00  ? 26  ILE A H    1  
ATOM   408   H  HA   . ILE A 1 26 ? 52.449 -10.522 0.763   1.00 0.00  ? 26  ILE A HA   1  
ATOM   409   H  HB   . ILE A 1 26 ? 52.079 -7.934  2.327   1.00 0.00  ? 26  ILE A HB   1  
ATOM   410   H  HG12 . ILE A 1 26 ? 50.464 -10.439 2.709   1.00 0.00  ? 26  ILE A HG12 1  
ATOM   411   H  HG13 . ILE A 1 26 ? 52.069 -10.344 3.433   1.00 0.00  ? 26  ILE A HG13 1  
ATOM   412   H  HG21 . ILE A 1 26 ? 50.184 -9.471  0.521   1.00 0.00  ? 26  ILE A HG21 1  
ATOM   413   H  HG22 . ILE A 1 26 ? 50.783 -7.831  0.271   1.00 0.00  ? 26  ILE A HG22 1  
ATOM   414   H  HG23 . ILE A 1 26 ? 49.684 -8.174  1.607   1.00 0.00  ? 26  ILE A HG23 1  
ATOM   415   H  HD11 . ILE A 1 26 ? 49.643 -8.664  3.998   1.00 0.00  ? 26  ILE A HD11 1  
ATOM   416   H  HD12 . ILE A 1 26 ? 51.250 -8.002  4.291   1.00 0.00  ? 26  ILE A HD12 1  
ATOM   417   H  HD13 . ILE A 1 26 ? 50.732 -9.461  5.133   1.00 0.00  ? 26  ILE A HD13 1  
ATOM   418   N  N    . PHE A 1 27 ? 54.076 -7.714  0.146   1.00 0.00  ? 27  PHE A N    1  
ATOM   419   C  CA   . PHE A 1 27 ? 54.551 -6.849  -0.980  1.00 0.00  ? 27  PHE A CA   1  
ATOM   420   C  C    . PHE A 1 27 ? 55.388 -7.693  -1.949  1.00 0.00  ? 27  PHE A C    1  
ATOM   421   O  O    . PHE A 1 27 ? 55.177 -7.670  -3.145  1.00 0.00  ? 27  PHE A O    1  
ATOM   422   C  CB   . PHE A 1 27 ? 55.414 -5.762  -0.328  1.00 0.00  ? 27  PHE A CB   1  
ATOM   423   C  CG   . PHE A 1 27 ? 54.749 -4.416  -0.496  1.00 0.00  ? 27  PHE A CG   1  
ATOM   424   C  CD1  . PHE A 1 27 ? 54.649 -3.838  -1.768  1.00 0.00  ? 27  PHE A CD1  1  
ATOM   425   C  CD2  . PHE A 1 27 ? 54.232 -3.747  0.618   1.00 0.00  ? 27  PHE A CD2  1  
ATOM   426   C  CE1  . PHE A 1 27 ? 54.030 -2.593  -1.923  1.00 0.00  ? 27  PHE A CE1  1  
ATOM   427   C  CE2  . PHE A 1 27 ? 53.613 -2.503  0.463   1.00 0.00  ? 27  PHE A CE2  1  
ATOM   428   C  CZ   . PHE A 1 27 ? 53.512 -1.926  -0.808  1.00 0.00  ? 27  PHE A CZ   1  
ATOM   429   H  H    . PHE A 1 27 ? 54.415 -7.565  1.054   1.00 0.00  ? 27  PHE A H    1  
ATOM   430   H  HA   . PHE A 1 27 ? 53.713 -6.403  -1.496  1.00 0.00  ? 27  PHE A HA   1  
ATOM   431   H  HB2  . PHE A 1 27 ? 55.534 -5.975  0.723   1.00 0.00  ? 27  PHE A HB2  1  
ATOM   432   H  HB3  . PHE A 1 27 ? 56.383 -5.742  -0.802  1.00 0.00  ? 27  PHE A HB3  1  
ATOM   433   H  HD1  . PHE A 1 27 ? 55.049 -4.354  -2.628  1.00 0.00  ? 27  PHE A HD1  1  
ATOM   434   H  HD2  . PHE A 1 27 ? 54.310 -4.190  1.599   1.00 0.00  ? 27  PHE A HD2  1  
ATOM   435   H  HE1  . PHE A 1 27 ? 53.952 -2.147  -2.904  1.00 0.00  ? 27  PHE A HE1  1  
ATOM   436   H  HE2  . PHE A 1 27 ? 53.215 -1.987  1.323   1.00 0.00  ? 27  PHE A HE2  1  
ATOM   437   H  HZ   . PHE A 1 27 ? 53.033 -0.967  -0.929  1.00 0.00  ? 27  PHE A HZ   1  
ATOM   438   N  N    . VAL A 1 28 ? 56.324 -8.451  -1.429  1.00 0.00  ? 28  VAL A N    1  
ATOM   439   C  CA   . VAL A 1 28 ? 57.171 -9.323  -2.302  1.00 0.00  ? 28  VAL A CA   1  
ATOM   440   C  C    . VAL A 1 28 ? 56.849 -10.801 -2.025  1.00 0.00  ? 28  VAL A C    1  
ATOM   441   O  O    . VAL A 1 28 ? 57.376 -11.402 -1.107  1.00 0.00  ? 28  VAL A O    1  
ATOM   442   C  CB   . VAL A 1 28 ? 58.635 -8.993  -1.946  1.00 0.00  ? 28  VAL A CB   1  
ATOM   443   C  CG1  . VAL A 1 28 ? 58.833 -8.964  -0.426  1.00 0.00  ? 28  VAL A CG1  1  
ATOM   444   C  CG2  . VAL A 1 28 ? 59.557 -10.056 -2.545  1.00 0.00  ? 28  VAL A CG2  1  
ATOM   445   H  H    . VAL A 1 28 ? 56.457 -8.457  -0.458  1.00 0.00  ? 28  VAL A H    1  
ATOM   446   H  HA   . VAL A 1 28 ? 56.989 -9.094  -3.340  1.00 0.00  ? 28  VAL A HA   1  
ATOM   447   H  HB   . VAL A 1 28 ? 58.891 -8.029  -2.359  1.00 0.00  ? 28  VAL A HB   1  
ATOM   448   H  HG11 . VAL A 1 28 ? 59.846 -9.256  -0.188  1.00 0.00  ? 28  VAL A HG11 1  
ATOM   449   H  HG12 . VAL A 1 28 ? 58.143 -9.651  0.042   1.00 0.00  ? 28  VAL A HG12 1  
ATOM   450   H  HG13 . VAL A 1 28 ? 58.651 -7.966  -0.057  1.00 0.00  ? 28  VAL A HG13 1  
ATOM   451   H  HG21 . VAL A 1 28 ? 60.429 -9.579  -2.962  1.00 0.00  ? 28  VAL A HG21 1  
ATOM   452   H  HG22 . VAL A 1 28 ? 59.035 -10.591 -3.321  1.00 0.00  ? 28  VAL A HG22 1  
ATOM   453   H  HG23 . VAL A 1 28 ? 59.859 -10.747 -1.773  1.00 0.00  ? 28  VAL A HG23 1  
ATOM   454   N  N    . LEU A 1 29 ? 55.985 -11.385 -2.814  1.00 0.00  ? 29  LEU A N    1  
ATOM   455   C  CA   . LEU A 1 29 ? 55.624 -12.825 -2.598  1.00 0.00  ? 29  LEU A CA   1  
ATOM   456   C  C    . LEU A 1 29 ? 56.468 -13.718 -3.517  1.00 0.00  ? 29  LEU A C    1  
ATOM   457   O  O    . LEU A 1 29 ? 56.917 -14.777 -3.124  1.00 0.00  ? 29  LEU A O    1  
ATOM   458   C  CB   . LEU A 1 29 ? 54.129 -12.953 -2.948  1.00 0.00  ? 29  LEU A CB   1  
ATOM   459   C  CG   . LEU A 1 29 ? 53.352 -11.714 -2.483  1.00 0.00  ? 29  LEU A CG   1  
ATOM   460   C  CD1  . LEU A 1 29 ? 52.615 -11.095 -3.672  1.00 0.00  ? 29  LEU A CD1  1  
ATOM   461   C  CD2  . LEU A 1 29 ? 52.333 -12.124 -1.417  1.00 0.00  ? 29  LEU A CD2  1  
ATOM   462   H  H    . LEU A 1 29 ? 55.573 -10.881 -3.548  1.00 0.00  ? 29  LEU A H    1  
ATOM   463   H  HA   . LEU A 1 29 ? 55.784 -13.098 -1.566  1.00 0.00  ? 29  LEU A HA   1  
ATOM   464   H  HB2  . LEU A 1 29 ? 54.019 -13.064 -4.016  1.00 0.00  ? 29  LEU A HB2  1  
ATOM   465   H  HB3  . LEU A 1 29 ? 53.726 -13.825 -2.455  1.00 0.00  ? 29  LEU A HB3  1  
ATOM   466   H  HG   . LEU A 1 29 ? 54.037 -10.990 -2.069  1.00 0.00  ? 29  LEU A HG   1  
ATOM   467   H  HD11 . LEU A 1 29 ? 51.854 -11.778 -4.020  1.00 0.00  ? 29  LEU A HD11 1  
ATOM   468   H  HD12 . LEU A 1 29 ? 53.317 -10.900 -4.470  1.00 0.00  ? 29  LEU A HD12 1  
ATOM   469   H  HD13 . LEU A 1 29 ? 52.153 -10.168 -3.364  1.00 0.00  ? 29  LEU A HD13 1  
ATOM   470   H  HD21 . LEU A 1 29 ? 51.723 -12.931 -1.794  1.00 0.00  ? 29  LEU A HD21 1  
ATOM   471   H  HD22 . LEU A 1 29 ? 51.704 -11.279 -1.177  1.00 0.00  ? 29  LEU A HD22 1  
ATOM   472   H  HD23 . LEU A 1 29 ? 52.854 -12.450 -0.529  1.00 0.00  ? 29  LEU A HD23 1  
ATOM   473   N  N    . GLY A 1 30 ? 56.688 -13.290 -4.736  1.00 0.00  ? 30  GLY A N    1  
ATOM   474   C  CA   . GLY A 1 30 ? 57.508 -14.099 -5.688  1.00 0.00  ? 30  GLY A CA   1  
ATOM   475   C  C    . GLY A 1 30 ? 58.490 -13.177 -6.412  1.00 0.00  ? 30  GLY A C    1  
ATOM   476   O  O    . GLY A 1 30 ? 58.513 -13.117 -7.625  1.00 0.00  ? 30  GLY A O    1  
ATOM   477   H  H    . GLY A 1 30 ? 56.318 -12.429 -5.026  1.00 0.00  ? 30  GLY A H    1  
ATOM   478   H  HA2  . GLY A 1 30 ? 58.057 -14.856 -5.141  1.00 0.00  ? 30  GLY A HA2  1  
ATOM   479   H  HA3  . GLY A 1 30 ? 56.860 -14.570 -6.414  1.00 0.00  ? 30  GLY A HA3  1  
ATOM   480   N  N    . ALA A 1 31 ? 59.297 -12.454 -5.676  1.00 0.00  ? 31  ALA A N    1  
ATOM   481   C  CA   . ALA A 1 31 ? 60.275 -11.529 -6.319  1.00 0.00  ? 31  ALA A CA   1  
ATOM   482   C  C    . ALA A 1 31 ? 61.709 -11.914 -5.934  1.00 0.00  ? 31  ALA A C    1  
ATOM   483   O  O    . ALA A 1 31 ? 62.155 -11.668 -4.827  1.00 0.00  ? 31  ALA A O    1  
ATOM   484   C  CB   . ALA A 1 31 ? 59.918 -10.141 -5.782  1.00 0.00  ? 31  ALA A CB   1  
ATOM   485   H  H    . ALA A 1 31 ? 59.256 -12.518 -4.699  1.00 0.00  ? 31  ALA A H    1  
ATOM   486   H  HA   . ALA A 1 31 ? 60.159 -11.546 -7.392  1.00 0.00  ? 31  ALA A HA   1  
ATOM   487   H  HB1  . ALA A 1 31 ? 59.963 -9.422  -6.585  1.00 0.00  ? 31  ALA A HB1  1  
ATOM   488   H  HB2  . ALA A 1 31 ? 60.620 -9.861  -5.011  1.00 0.00  ? 31  ALA A HB2  1  
ATOM   489   H  HB3  . ALA A 1 31 ? 58.920 -10.161 -5.371  1.00 0.00  ? 31  ALA A HB3  1  
ATOM   490   N  N    . GLU A 1 32 ? 62.429 -12.515 -6.854  1.00 0.00  ? 32  GLU A N    1  
ATOM   491   C  CA   . GLU A 1 32 ? 63.845 -12.930 -6.591  1.00 0.00  ? 32  GLU A CA   1  
ATOM   492   C  C    . GLU A 1 32 ? 63.948 -13.758 -5.293  1.00 0.00  ? 32  GLU A C    1  
ATOM   493   O  O    . GLU A 1 32 ? 63.416 -14.849 -5.216  1.00 0.00  ? 32  GLU A O    1  
ATOM   494   C  CB   . GLU A 1 32 ? 64.632 -11.612 -6.504  1.00 0.00  ? 32  GLU A CB   1  
ATOM   495   C  CG   . GLU A 1 32 ? 64.633 -10.930 -7.878  1.00 0.00  ? 32  GLU A CG   1  
ATOM   496   C  CD   . GLU A 1 32 ? 63.803 -9.645  -7.823  1.00 0.00  ? 32  GLU A CD   1  
ATOM   497   O  OE1  . GLU A 1 32 ? 62.599 -9.729  -8.008  1.00 0.00  ? 32  GLU A OE1  1  
ATOM   498   O  OE2  . GLU A 1 32 ? 64.385 -8.596  -7.604  1.00 0.00  ? 32  GLU A OE2  1  
ATOM   499   H  H    . GLU A 1 32 ? 62.034 -12.691 -7.734  1.00 0.00  ? 32  GLU A H    1  
ATOM   500   H  HA   . GLU A 1 32 ? 64.213 -13.513 -7.420  1.00 0.00  ? 32  GLU A HA   1  
ATOM   501   H  HB2  . GLU A 1 32 ? 64.170 -10.961 -5.776  1.00 0.00  ? 32  GLU A HB2  1  
ATOM   502   H  HB3  . GLU A 1 32 ? 65.650 -11.819 -6.207  1.00 0.00  ? 32  GLU A HB3  1  
ATOM   503   H  HG2  . GLU A 1 32 ? 65.647 -10.690 -8.160  1.00 0.00  ? 32  GLU A HG2  1  
ATOM   504   H  HG3  . GLU A 1 32 ? 64.205 -11.597 -8.611  1.00 0.00  ? 32  GLU A HG3  1  
ATOM   505   N  N    . ASP A 1 33 ? 64.625 -13.265 -4.280  1.00 0.00  ? 33  ASP A N    1  
ATOM   506   C  CA   . ASP A 1 33 ? 64.754 -14.047 -3.010  1.00 0.00  ? 33  ASP A CA   1  
ATOM   507   C  C    . ASP A 1 33 ? 63.992 -13.360 -1.863  1.00 0.00  ? 33  ASP A C    1  
ATOM   508   O  O    . ASP A 1 33 ? 64.428 -13.366 -0.727  1.00 0.00  ? 33  ASP A O    1  
ATOM   509   C  CB   . ASP A 1 33 ? 66.261 -14.078 -2.723  1.00 0.00  ? 33  ASP A CB   1  
ATOM   510   C  CG   . ASP A 1 33 ? 66.728 -15.526 -2.566  1.00 0.00  ? 33  ASP A CG   1  
ATOM   511   O  OD1  . ASP A 1 33 ? 66.699 -16.019 -1.450  1.00 0.00  ? 33  ASP A OD1  1  
ATOM   512   O  OD2  . ASP A 1 33 ? 67.110 -16.116 -3.562  1.00 0.00  ? 33  ASP A OD2  1  
ATOM   513   H  H    . ASP A 1 33 ? 65.053 -12.389 -4.354  1.00 0.00  ? 33  ASP A H    1  
ATOM   514   H  HA   . ASP A 1 33 ? 64.388 -15.052 -3.150  1.00 0.00  ? 33  ASP A HA   1  
ATOM   515   H  HB2  . ASP A 1 33 ? 66.793 -13.616 -3.542  1.00 0.00  ? 33  ASP A HB2  1  
ATOM   516   H  HB3  . ASP A 1 33 ? 66.465 -13.537 -1.812  1.00 0.00  ? 33  ASP A HB3  1  
ATOM   517   N  N    . GLY A 1 34 ? 62.852 -12.777 -2.148  1.00 0.00  ? 34  GLY A N    1  
ATOM   518   C  CA   . GLY A 1 34 ? 62.062 -12.101 -1.072  1.00 0.00  ? 34  GLY A CA   1  
ATOM   519   C  C    . GLY A 1 34 ? 62.440 -10.620 -0.991  1.00 0.00  ? 34  GLY A C    1  
ATOM   520   O  O    . GLY A 1 34 ? 62.584 -10.070 0.083   1.00 0.00  ? 34  GLY A O    1  
ATOM   521   H  H    . GLY A 1 34 ? 62.512 -12.787 -3.069  1.00 0.00  ? 34  GLY A H    1  
ATOM   522   H  HA2  . GLY A 1 34 ? 61.006 -12.188 -1.294  1.00 0.00  ? 34  GLY A HA2  1  
ATOM   523   H  HA3  . GLY A 1 34 ? 62.273 -12.572 -0.121  1.00 0.00  ? 34  GLY A HA3  1  
ATOM   524   N  N    . CYS A 1 35 ? 62.591 -9.968  -2.115  1.00 0.00  ? 35  CYS A N    1  
ATOM   525   C  CA   . CYS A 1 35 ? 62.946 -8.519  -2.105  1.00 0.00  ? 35  CYS A CA   1  
ATOM   526   C  C    . CYS A 1 35 ? 61.944 -7.738  -2.962  1.00 0.00  ? 35  CYS A C    1  
ATOM   527   O  O    . CYS A 1 35 ? 61.751 -8.037  -4.126  1.00 0.00  ? 35  CYS A O    1  
ATOM   528   C  CB   . CYS A 1 35 ? 64.347 -8.444  -2.714  1.00 0.00  ? 35  CYS A CB   1  
ATOM   529   S  SG   . CYS A 1 35 ? 65.538 -9.227  -1.597  1.00 0.00  ? 35  CYS A SG   1  
ATOM   530   H  H    . CYS A 1 35 ? 62.460 -10.432 -2.969  1.00 0.00  ? 35  CYS A H    1  
ATOM   531   H  HA   . CYS A 1 35 ? 62.960 -8.137  -1.095  1.00 0.00  ? 35  CYS A HA   1  
ATOM   532   H  HB2  . CYS A 1 35 ? 64.354 -8.955  -3.665  1.00 0.00  ? 35  CYS A HB2  1  
ATOM   533   H  HB3  . CYS A 1 35 ? 64.618 -7.409  -2.860  1.00 0.00  ? 35  CYS A HB3  1  
ATOM   534   H  HG   . CYS A 1 35 ? 66.023 -8.531  -1.147  1.00 0.00  ? 35  CYS A HG   1  
ATOM   535   N  N    . ILE A 1 36 ? 61.301 -6.746  -2.397  1.00 0.00  ? 36  ILE A N    1  
ATOM   536   C  CA   . ILE A 1 36 ? 60.304 -5.949  -3.182  1.00 0.00  ? 36  ILE A CA   1  
ATOM   537   C  C    . ILE A 1 36 ? 60.983 -5.306  -4.401  1.00 0.00  ? 36  ILE A C    1  
ATOM   538   O  O    . ILE A 1 36 ? 61.839 -4.452  -4.270  1.00 0.00  ? 36  ILE A O    1  
ATOM   539   C  CB   . ILE A 1 36 ? 59.779 -4.883  -2.209  1.00 0.00  ? 36  ILE A CB   1  
ATOM   540   C  CG1  . ILE A 1 36 ? 58.935 -5.562  -1.125  1.00 0.00  ? 36  ILE A CG1  1  
ATOM   541   C  CG2  . ILE A 1 36 ? 58.909 -3.869  -2.959  1.00 0.00  ? 36  ILE A CG2  1  
ATOM   542   C  CD1  . ILE A 1 36 ? 58.678 -4.580  0.021   1.00 0.00  ? 36  ILE A CD1  1  
ATOM   543   H  H    . ILE A 1 36 ? 61.471 -6.528  -1.457  1.00 0.00  ? 36  ILE A H    1  
ATOM   544   H  HA   . ILE A 1 36 ? 59.491 -6.582  -3.502  1.00 0.00  ? 36  ILE A HA   1  
ATOM   545   H  HB   . ILE A 1 36 ? 60.614 -4.372  -1.749  1.00 0.00  ? 36  ILE A HB   1  
ATOM   546   H  HG12 . ILE A 1 36 ? 57.993 -5.877  -1.550  1.00 0.00  ? 36  ILE A HG12 1  
ATOM   547   H  HG13 . ILE A 1 36 ? 59.463 -6.423  -0.746  1.00 0.00  ? 36  ILE A HG13 1  
ATOM   548   H  HG21 . ILE A 1 36 ? 59.113 -2.877  -2.588  1.00 0.00  ? 36  ILE A HG21 1  
ATOM   549   H  HG22 . ILE A 1 36 ? 57.866 -4.103  -2.801  1.00 0.00  ? 36  ILE A HG22 1  
ATOM   550   H  HG23 . ILE A 1 36 ? 59.131 -3.912  -4.014  1.00 0.00  ? 36  ILE A HG23 1  
ATOM   551   H  HD11 . ILE A 1 36 ? 58.114 -5.074  0.798   1.00 0.00  ? 36  ILE A HD11 1  
ATOM   552   H  HD12 . ILE A 1 36 ? 58.117 -3.734  -0.347  1.00 0.00  ? 36  ILE A HD12 1  
ATOM   553   H  HD13 . ILE A 1 36 ? 59.621 -4.240  0.422   1.00 0.00  ? 36  ILE A HD13 1  
ATOM   554   N  N    . SER A 1 37 ? 60.606 -5.723  -5.583  1.00 0.00  ? 37  SER A N    1  
ATOM   555   C  CA   . SER A 1 37 ? 61.223 -5.153  -6.821  1.00 0.00  ? 37  SER A CA   1  
ATOM   556   C  C    . SER A 1 37 ? 60.225 -4.232  -7.541  1.00 0.00  ? 37  SER A C    1  
ATOM   557   O  O    . SER A 1 37 ? 59.156 -3.944  -7.033  1.00 0.00  ? 37  SER A O    1  
ATOM   558   C  CB   . SER A 1 37 ? 61.567 -6.371  -7.687  1.00 0.00  ? 37  SER A CB   1  
ATOM   559   O  OG   . SER A 1 37 ? 62.835 -6.168  -8.298  1.00 0.00  ? 37  SER A OG   1  
ATOM   560   H  H    . SER A 1 37 ? 59.918 -6.418  -5.658  1.00 0.00  ? 37  SER A H    1  
ATOM   561   H  HA   . SER A 1 37 ? 62.123 -4.612  -6.577  1.00 0.00  ? 37  SER A HA   1  
ATOM   562   H  HB2  . SER A 1 37 ? 61.609 -7.254  -7.070  1.00 0.00  ? 37  SER A HB2  1  
ATOM   563   H  HB3  . SER A 1 37 ? 60.806 -6.500  -8.445  1.00 0.00  ? 37  SER A HB3  1  
ATOM   564   H  HG   . SER A 1 37 ? 63.346 -6.979  -8.200  1.00 0.00  ? 37  SER A HG   1  
ATOM   565   N  N    . THR A 1 38 ? 60.568 -3.767  -8.718  1.00 0.00  ? 38  THR A N    1  
ATOM   566   C  CA   . THR A 1 38 ? 59.644 -2.858  -9.480  1.00 0.00  ? 38  THR A CA   1  
ATOM   567   C  C    . THR A 1 38 ? 58.297 -3.549  -9.750  1.00 0.00  ? 38  THR A C    1  
ATOM   568   O  O    . THR A 1 38 ? 57.249 -2.947  -9.621  1.00 0.00  ? 38  THR A O    1  
ATOM   569   C  CB   . THR A 1 38 ? 60.360 -2.558  -10.806 1.00 0.00  ? 38  THR A CB   1  
ATOM   570   O  OG1  . THR A 1 38 ? 60.850 -3.768  -11.369 1.00 0.00  ? 38  THR A OG1  1  
ATOM   571   C  CG2  . THR A 1 38 ? 61.528 -1.600  -10.560 1.00 0.00  ? 38  THR A CG2  1  
ATOM   572   H  H    . THR A 1 38 ? 61.436 -4.014  -9.104  1.00 0.00  ? 38  THR A H    1  
ATOM   573   H  HA   . THR A 1 38 ? 59.490 -1.941  -8.934  1.00 0.00  ? 38  THR A HA   1  
ATOM   574   H  HB   . THR A 1 38 ? 59.664 -2.098  -11.493 1.00 0.00  ? 38  THR A HB   1  
ATOM   575   H  HG1  . THR A 1 38 ? 61.155 -3.580  -12.259 1.00 0.00  ? 38  THR A HG1  1  
ATOM   576   H  HG21 . THR A 1 38 ? 61.436 -0.745  -11.213 1.00 0.00  ? 38  THR A HG21 1  
ATOM   577   H  HG22 . THR A 1 38 ? 62.459 -2.108  -10.761 1.00 0.00  ? 38  THR A HG22 1  
ATOM   578   H  HG23 . THR A 1 38 ? 61.513 -1.270  -9.532  1.00 0.00  ? 38  THR A HG23 1  
ATOM   579   N  N    . LYS A 1 39 ? 58.323 -4.805  -10.129 1.00 0.00  ? 39  LYS A N    1  
ATOM   580   C  CA   . LYS A 1 39 ? 57.049 -5.542  -10.419 1.00 0.00  ? 39  LYS A CA   1  
ATOM   581   C  C    . LYS A 1 39 ? 56.186 -5.685  -9.154  1.00 0.00  ? 39  LYS A C    1  
ATOM   582   O  O    . LYS A 1 39 ? 54.979 -5.532  -9.204  1.00 0.00  ? 39  LYS A O    1  
ATOM   583   C  CB   . LYS A 1 39 ? 57.493 -6.919  -10.920 1.00 0.00  ? 39  LYS A CB   1  
ATOM   584   C  CG   . LYS A 1 39 ? 56.301 -7.646  -11.554 1.00 0.00  ? 39  LYS A CG   1  
ATOM   585   C  CD   . LYS A 1 39 ? 56.801 -8.613  -12.631 1.00 0.00  ? 39  LYS A CD   1  
ATOM   586   C  CE   . LYS A 1 39 ? 56.819 -7.905  -13.993 1.00 0.00  ? 39  LYS A CE   1  
ATOM   587   N  NZ   . LYS A 1 39 ? 56.039 -8.790  -14.906 1.00 0.00  ? 39  LYS A NZ   1  
ATOM   588   H  H    . LYS A 1 39 ? 59.185 -5.263  -10.231 1.00 0.00  ? 39  LYS A H    1  
ATOM   589   H  HA   . LYS A 1 39 ? 56.494 -5.035  -11.192 1.00 0.00  ? 39  LYS A HA   1  
ATOM   590   H  HB2  . LYS A 1 39 ? 58.276 -6.798  -11.655 1.00 0.00  ? 39  LYS A HB2  1  
ATOM   591   H  HB3  . LYS A 1 39 ? 57.865 -7.500  -10.090 1.00 0.00  ? 39  LYS A HB3  1  
ATOM   592   H  HG2  . LYS A 1 39 ? 55.772 -8.199  -10.791 1.00 0.00  ? 39  LYS A HG2  1  
ATOM   593   H  HG3  . LYS A 1 39 ? 55.635 -6.924  -12.002 1.00 0.00  ? 39  LYS A HG3  1  
ATOM   594   H  HD2  . LYS A 1 39 ? 57.801 -8.943  -12.382 1.00 0.00  ? 39  LYS A HD2  1  
ATOM   595   H  HD3  . LYS A 1 39 ? 56.144 -9.468  -12.679 1.00 0.00  ? 39  LYS A HD3  1  
ATOM   596   H  HE2  . LYS A 1 39 ? 56.349 -6.933  -13.916 1.00 0.00  ? 39  LYS A HE2  1  
ATOM   597   H  HE3  . LYS A 1 39 ? 57.832 -7.805  -14.352 1.00 0.00  ? 39  LYS A HE3  1  
ATOM   598   H  HZ1  . LYS A 1 39 ? 55.837 -8.283  -15.791 1.00 0.00  ? 39  LYS A HZ1  1  
ATOM   599   H  HZ2  . LYS A 1 39 ? 55.142 -9.060  -14.452 1.00 0.00  ? 39  LYS A HZ2  1  
ATOM   600   H  HZ3  . LYS A 1 39 ? 56.592 -9.644  -15.119 1.00 0.00  ? 39  LYS A HZ3  1  
ATOM   601   N  N    . GLU A 1 40 ? 56.789 -5.980  -8.026  1.00 0.00  ? 40  GLU A N    1  
ATOM   602   C  CA   . GLU A 1 40 ? 55.989 -6.133  -6.767  1.00 0.00  ? 40  GLU A CA   1  
ATOM   603   C  C    . GLU A 1 40 ? 55.400 -4.780  -6.355  1.00 0.00  ? 40  GLU A C    1  
ATOM   604   O  O    . GLU A 1 40 ? 54.230 -4.679  -6.036  1.00 0.00  ? 40  GLU A O    1  
ATOM   605   C  CB   . GLU A 1 40 ? 56.971 -6.650  -5.707  1.00 0.00  ? 40  GLU A CB   1  
ATOM   606   C  CG   . GLU A 1 40 ? 57.524 -8.024  -6.121  1.00 0.00  ? 40  GLU A CG   1  
ATOM   607   C  CD   . GLU A 1 40 ? 56.386 -9.045  -6.265  1.00 0.00  ? 40  GLU A CD   1  
ATOM   608   O  OE1  . GLU A 1 40 ? 55.766 -9.069  -7.317  1.00 0.00  ? 40  GLU A OE1  1  
ATOM   609   O  OE2  . GLU A 1 40 ? 56.161 -9.794  -5.328  1.00 0.00  ? 40  GLU A OE2  1  
ATOM   610   H  H    . GLU A 1 40 ? 57.760 -6.102  -8.008  1.00 0.00  ? 40  GLU A H    1  
ATOM   611   H  HA   . GLU A 1 40 ? 55.197 -6.850  -6.914  1.00 0.00  ? 40  GLU A HA   1  
ATOM   612   H  HB2  . GLU A 1 40 ? 57.789 -5.951  -5.604  1.00 0.00  ? 40  GLU A HB2  1  
ATOM   613   H  HB3  . GLU A 1 40 ? 56.459 -6.742  -4.761  1.00 0.00  ? 40  GLU A HB3  1  
ATOM   614   H  HG2  . GLU A 1 40 ? 58.041 -7.933  -7.064  1.00 0.00  ? 40  GLU A HG2  1  
ATOM   615   H  HG3  . GLU A 1 40 ? 58.215 -8.369  -5.367  1.00 0.00  ? 40  GLU A HG3  1  
ATOM   616   N  N    . LEU A 1 41 ? 56.193 -3.736  -6.379  1.00 0.00  ? 41  LEU A N    1  
ATOM   617   C  CA   . LEU A 1 41 ? 55.664 -2.387  -6.008  1.00 0.00  ? 41  LEU A CA   1  
ATOM   618   C  C    . LEU A 1 41 ? 54.580 -1.965  -7.013  1.00 0.00  ? 41  LEU A C    1  
ATOM   619   O  O    . LEU A 1 41 ? 53.561 -1.411  -6.642  1.00 0.00  ? 41  LEU A O    1  
ATOM   620   C  CB   . LEU A 1 41 ? 56.885 -1.453  -6.070  1.00 0.00  ? 41  LEU A CB   1  
ATOM   621   C  CG   . LEU A 1 41 ? 56.446 0.008   -6.258  1.00 0.00  ? 41  LEU A CG   1  
ATOM   622   C  CD1  . LEU A 1 41 ? 55.393 0.388   -5.212  1.00 0.00  ? 41  LEU A CD1  1  
ATOM   623   C  CD2  . LEU A 1 41 ? 57.664 0.921   -6.104  1.00 0.00  ? 41  LEU A CD2  1  
ATOM   624   H  H    . LEU A 1 41 ? 57.130 -3.838  -6.656  1.00 0.00  ? 41  LEU A H    1  
ATOM   625   H  HA   . LEU A 1 41 ? 55.261 -2.404  -5.008  1.00 0.00  ? 41  LEU A HA   1  
ATOM   626   H  HB2  . LEU A 1 41 ? 57.444 -1.539  -5.150  1.00 0.00  ? 41  LEU A HB2  1  
ATOM   627   H  HB3  . LEU A 1 41 ? 57.515 -1.743  -6.899  1.00 0.00  ? 41  LEU A HB3  1  
ATOM   628   H  HG   . LEU A 1 41 ? 56.027 0.131   -7.247  1.00 0.00  ? 41  LEU A HG   1  
ATOM   629   H  HD11 . LEU A 1 41 ? 55.432 -0.308  -4.388  1.00 0.00  ? 41  LEU A HD11 1  
ATOM   630   H  HD12 . LEU A 1 41 ? 54.414 0.356   -5.666  1.00 0.00  ? 41  LEU A HD12 1  
ATOM   631   H  HD13 . LEU A 1 41 ? 55.588 1.387   -4.850  1.00 0.00  ? 41  LEU A HD13 1  
ATOM   632   H  HD21 . LEU A 1 41 ? 58.080 1.132   -7.077  1.00 0.00  ? 41  LEU A HD21 1  
ATOM   633   H  HD22 . LEU A 1 41 ? 58.408 0.431   -5.494  1.00 0.00  ? 41  LEU A HD22 1  
ATOM   634   H  HD23 . LEU A 1 41 ? 57.365 1.846   -5.633  1.00 0.00  ? 41  LEU A HD23 1  
ATOM   635   N  N    . GLY A 1 42 ? 54.790 -2.237  -8.279  1.00 0.00  ? 42  GLY A N    1  
ATOM   636   C  CA   . GLY A 1 42 ? 53.776 -1.865  -9.311  1.00 0.00  ? 42  GLY A CA   1  
ATOM   637   C  C    . GLY A 1 42 ? 52.444 -2.573  -9.023  1.00 0.00  ? 42  GLY A C    1  
ATOM   638   O  O    . GLY A 1 42 ? 51.385 -2.044  -9.305  1.00 0.00  ? 42  GLY A O    1  
ATOM   639   H  H    . GLY A 1 42 ? 55.616 -2.693  -8.550  1.00 0.00  ? 42  GLY A H    1  
ATOM   640   H  HA2  . GLY A 1 42 ? 53.625 -0.792  -9.285  1.00 0.00  ? 42  GLY A HA2  1  
ATOM   641   H  HA3  . GLY A 1 42 ? 54.132 -2.160  -10.289 1.00 0.00  ? 42  GLY A HA3  1  
ATOM   642   N  N    . LYS A 1 43 ? 52.485 -3.757  -8.454  1.00 0.00  ? 43  LYS A N    1  
ATOM   643   C  CA   . LYS A 1 43 ? 51.214 -4.486  -8.134  1.00 0.00  ? 43  LYS A CA   1  
ATOM   644   C  C    . LYS A 1 43 ? 50.352 -3.629  -7.195  1.00 0.00  ? 43  LYS A C    1  
ATOM   645   O  O    . LYS A 1 43 ? 49.174 -3.429  -7.430  1.00 0.00  ? 43  LYS A O    1  
ATOM   646   C  CB   . LYS A 1 43 ? 51.657 -5.780  -7.442  1.00 0.00  ? 43  LYS A CB   1  
ATOM   647   C  CG   . LYS A 1 43 ? 50.720 -6.926  -7.843  1.00 0.00  ? 43  LYS A CG   1  
ATOM   648   C  CD   . LYS A 1 43 ? 51.421 -7.840  -8.857  1.00 0.00  ? 43  LYS A CD   1  
ATOM   649   C  CE   . LYS A 1 43 ? 52.583 -8.579  -8.179  1.00 0.00  ? 43  LYS A CE   1  
ATOM   650   N  NZ   . LYS A 1 43 ? 53.757 -8.363  -9.073  1.00 0.00  ? 43  LYS A NZ   1  
ATOM   651   H  H    . LYS A 1 43 ? 53.349 -4.161  -8.228  1.00 0.00  ? 43  LYS A H    1  
ATOM   652   H  HA   . LYS A 1 43 ? 50.672 -4.715  -9.039  1.00 0.00  ? 43  LYS A HA   1  
ATOM   653   H  HB2  . LYS A 1 43 ? 52.668 -6.018  -7.740  1.00 0.00  ? 43  LYS A HB2  1  
ATOM   654   H  HB3  . LYS A 1 43 ? 51.620 -5.646  -6.371  1.00 0.00  ? 43  LYS A HB3  1  
ATOM   655   H  HG2  . LYS A 1 43 ? 50.455 -7.498  -6.965  1.00 0.00  ? 43  LYS A HG2  1  
ATOM   656   H  HG3  . LYS A 1 43 ? 49.825 -6.519  -8.288  1.00 0.00  ? 43  LYS A HG3  1  
ATOM   657   H  HD2  . LYS A 1 43 ? 50.711 -8.560  -9.238  1.00 0.00  ? 43  LYS A HD2  1  
ATOM   658   H  HD3  . LYS A 1 43 ? 51.802 -7.244  -9.673  1.00 0.00  ? 43  LYS A HD3  1  
ATOM   659   H  HE2  . LYS A 1 43 ? 52.772 -8.163  -7.198  1.00 0.00  ? 43  LYS A HE2  1  
ATOM   660   H  HE3  . LYS A 1 43 ? 52.365 -9.633  -8.105  1.00 0.00  ? 43  LYS A HE3  1  
ATOM   661   H  HZ1  . LYS A 1 43 ? 54.627 -8.659  -8.578  1.00 0.00  ? 43  LYS A HZ1  1  
ATOM   662   H  HZ2  . LYS A 1 43 ? 53.828 -7.353  -9.321  1.00 0.00  ? 43  LYS A HZ2  1  
ATOM   663   H  HZ3  . LYS A 1 43 ? 53.645 -8.927  -9.937  1.00 0.00  ? 43  LYS A HZ3  1  
ATOM   664   N  N    . VAL A 1 44 ? 50.942 -3.101  -6.148  1.00 0.00  ? 44  VAL A N    1  
ATOM   665   C  CA   . VAL A 1 44 ? 50.171 -2.233  -5.201  1.00 0.00  ? 44  VAL A CA   1  
ATOM   666   C  C    . VAL A 1 44 ? 49.855 -0.883  -5.869  1.00 0.00  ? 44  VAL A C    1  
ATOM   667   O  O    . VAL A 1 44 ? 48.847 -0.266  -5.582  1.00 0.00  ? 44  VAL A O    1  
ATOM   668   C  CB   . VAL A 1 44 ? 51.089 -2.041  -3.988  1.00 0.00  ? 44  VAL A CB   1  
ATOM   669   C  CG1  . VAL A 1 44 ? 50.423 -1.106  -2.975  1.00 0.00  ? 44  VAL A CG1  1  
ATOM   670   C  CG2  . VAL A 1 44 ? 51.348 -3.397  -3.325  1.00 0.00  ? 44  VAL A CG2  1  
ATOM   671   H  H    . VAL A 1 44 ? 51.897 -3.265  -5.993  1.00 0.00  ? 44  VAL A H    1  
ATOM   672   H  HA   . VAL A 1 44 ? 49.259 -2.723  -4.899  1.00 0.00  ? 44  VAL A HA   1  
ATOM   673   H  HB   . VAL A 1 44 ? 52.027 -1.612  -4.311  1.00 0.00  ? 44  VAL A HB   1  
ATOM   674   H  HG11 . VAL A 1 44 ? 50.596 -1.476  -1.975  1.00 0.00  ? 44  VAL A HG11 1  
ATOM   675   H  HG12 . VAL A 1 44 ? 49.360 -1.067  -3.164  1.00 0.00  ? 44  VAL A HG12 1  
ATOM   676   H  HG13 . VAL A 1 44 ? 50.842 -0.116  -3.070  1.00 0.00  ? 44  VAL A HG13 1  
ATOM   677   H  HG21 . VAL A 1 44 ? 50.544 -4.077  -3.568  1.00 0.00  ? 44  VAL A HG21 1  
ATOM   678   H  HG22 . VAL A 1 44 ? 51.400 -3.271  -2.254  1.00 0.00  ? 44  VAL A HG22 1  
ATOM   679   H  HG23 . VAL A 1 44 ? 52.283 -3.801  -3.684  1.00 0.00  ? 44  VAL A HG23 1  
ATOM   680   N  N    . MET A 1 45 ? 50.702 -0.430  -6.768  1.00 0.00  ? 45  MET A N    1  
ATOM   681   C  CA   . MET A 1 45 ? 50.439 0.871   -7.468  1.00 0.00  ? 45  MET A CA   1  
ATOM   682   C  C    . MET A 1 45 ? 49.097 0.802   -8.210  1.00 0.00  ? 45  MET A C    1  
ATOM   683   O  O    . MET A 1 45 ? 48.340 1.754   -8.230  1.00 0.00  ? 45  MET A O    1  
ATOM   684   C  CB   . MET A 1 45 ? 51.591 1.037   -8.467  1.00 0.00  ? 45  MET A CB   1  
ATOM   685   C  CG   . MET A 1 45 ? 52.851 1.501   -7.733  1.00 0.00  ? 45  MET A CG   1  
ATOM   686   S  SD   . MET A 1 45 ? 52.904 3.308   -7.716  1.00 0.00  ? 45  MET A SD   1  
ATOM   687   C  CE   . MET A 1 45 ? 54.234 3.477   -6.503  1.00 0.00  ? 45  MET A CE   1  
ATOM   688   H  H    . MET A 1 45 ? 51.502 -0.950  -6.990  1.00 0.00  ? 45  MET A H    1  
ATOM   689   H  HA   . MET A 1 45 ? 50.440 1.688   -6.763  1.00 0.00  ? 45  MET A HA   1  
ATOM   690   H  HB2  . MET A 1 45 ? 51.784 0.093   -8.954  1.00 0.00  ? 45  MET A HB2  1  
ATOM   691   H  HB3  . MET A 1 45 ? 51.319 1.774   -9.208  1.00 0.00  ? 45  MET A HB3  1  
ATOM   692   H  HG2  . MET A 1 45 ? 52.836 1.130   -6.718  1.00 0.00  ? 45  MET A HG2  1  
ATOM   693   H  HG3  . MET A 1 45 ? 53.724 1.121   -8.243  1.00 0.00  ? 45  MET A HG3  1  
ATOM   694   H  HE1  . MET A 1 45 ? 53.825 3.374   -5.508  1.00 0.00  ? 45  MET A HE1  1  
ATOM   695   H  HE2  . MET A 1 45 ? 54.693 4.448   -6.603  1.00 0.00  ? 45  MET A HE2  1  
ATOM   696   H  HE3  . MET A 1 45 ? 54.976 2.709   -6.676  1.00 0.00  ? 45  MET A HE3  1  
ATOM   697   N  N    . ARG A 1 46 ? 48.798 -0.328  -8.808  1.00 0.00  ? 46  ARG A N    1  
ATOM   698   C  CA   . ARG A 1 46 ? 47.503 -0.482  -9.542  1.00 0.00  ? 46  ARG A CA   1  
ATOM   699   C  C    . ARG A 1 46 ? 46.317 -0.377  -8.567  1.00 0.00  ? 46  ARG A C    1  
ATOM   700   O  O    . ARG A 1 46 ? 45.260 0.107   -8.924  1.00 0.00  ? 46  ARG A O    1  
ATOM   701   C  CB   . ARG A 1 46 ? 47.563 -1.878  -10.170 1.00 0.00  ? 46  ARG A CB   1  
ATOM   702   C  CG   . ARG A 1 46 ? 46.491 -2.003  -11.258 1.00 0.00  ? 46  ARG A CG   1  
ATOM   703   C  CD   . ARG A 1 46 ? 45.638 -3.249  -11.005 1.00 0.00  ? 46  ARG A CD   1  
ATOM   704   N  NE   . ARG A 1 46 ? 44.630 -2.829  -9.986  1.00 0.00  ? 46  ARG A NE   1  
ATOM   705   C  CZ   . ARG A 1 46 ? 44.265 -3.655  -9.046  1.00 0.00  ? 46  ARG A CZ   1  
ATOM   706   N  NH1  . ARG A 1 46 ? 45.118 -4.022  -8.136  1.00 0.00  ? 46  ARG A NH1  1  
ATOM   707   N  NH2  . ARG A 1 46 ? 43.046 -4.110  -9.019  1.00 0.00  ? 46  ARG A NH2  1  
ATOM   708   H  H    . ARG A 1 46 ? 49.426 -1.081  -8.767  1.00 0.00  ? 46  ARG A H    1  
ATOM   709   H  HA   . ARG A 1 46 ? 47.419 0.266   -10.316 1.00 0.00  ? 46  ARG A HA   1  
ATOM   710   H  HB2  . ARG A 1 46 ? 48.540 -2.033  -10.608 1.00 0.00  ? 46  ARG A HB2  1  
ATOM   711   H  HB3  . ARG A 1 46 ? 47.390 -2.624  -9.408  1.00 0.00  ? 46  ARG A HB3  1  
ATOM   712   H  HG2  . ARG A 1 46 ? 45.860 -1.126  -11.244 1.00 0.00  ? 46  ARG A HG2  1  
ATOM   713   H  HG3  . ARG A 1 46 ? 46.968 -2.086  -12.223 1.00 0.00  ? 46  ARG A HG3  1  
ATOM   714   H  HD2  . ARG A 1 46 ? 45.148 -3.557  -11.921 1.00 0.00  ? 46  ARG A HD2  1  
ATOM   715   H  HD3  . ARG A 1 46 ? 46.248 -4.051  -10.617 1.00 0.00  ? 46  ARG A HD3  1  
ATOM   716   H  HE   . ARG A 1 46 ? 44.239 -1.930  -10.024 1.00 0.00  ? 46  ARG A HE   1  
ATOM   717   H  HH11 . ARG A 1 46 ? 46.053 -3.671  -8.157  1.00 0.00  ? 46  ARG A HH11 1  
ATOM   718   H  HH12 . ARG A 1 46 ? 44.840 -4.656  -7.415  1.00 0.00  ? 46  ARG A HH12 1  
ATOM   719   H  HH21 . ARG A 1 46 ? 42.391 -3.826  -9.718  1.00 0.00  ? 46  ARG A HH21 1  
ATOM   720   H  HH22 . ARG A 1 46 ? 42.764 -4.743  -8.299  1.00 0.00  ? 46  ARG A HH22 1  
ATOM   721   N  N    . MET A 1 47 ? 46.489 -0.819  -7.338  1.00 0.00  ? 47  MET A N    1  
ATOM   722   C  CA   . MET A 1 47 ? 45.372 -0.734  -6.337  1.00 0.00  ? 47  MET A CA   1  
ATOM   723   C  C    . MET A 1 47 ? 44.977 0.733   -6.110  1.00 0.00  ? 47  MET A C    1  
ATOM   724   O  O    . MET A 1 47 ? 43.813 1.052   -5.956  1.00 0.00  ? 47  MET A O    1  
ATOM   725   C  CB   . MET A 1 47 ? 45.924 -1.342  -5.040  1.00 0.00  ? 47  MET A CB   1  
ATOM   726   C  CG   . MET A 1 47 ? 46.175 -2.843  -5.227  1.00 0.00  ? 47  MET A CG   1  
ATOM   727   S  SD   . MET A 1 47 ? 44.706 -3.770  -4.719  1.00 0.00  ? 47  MET A SD   1  
ATOM   728   C  CE   . MET A 1 47 ? 45.293 -4.239  -3.072  1.00 0.00  ? 47  MET A CE   1  
ATOM   729   H  H    . MET A 1 47 ? 47.353 -1.199  -7.073  1.00 0.00  ? 47  MET A H    1  
ATOM   730   H  HA   . MET A 1 47 ? 44.519 -1.301  -6.677  1.00 0.00  ? 47  MET A HA   1  
ATOM   731   H  HB2  . MET A 1 47 ? 46.851 -0.852  -4.779  1.00 0.00  ? 47  MET A HB2  1  
ATOM   732   H  HB3  . MET A 1 47 ? 45.207 -1.198  -4.245  1.00 0.00  ? 47  MET A HB3  1  
ATOM   733   H  HG2  . MET A 1 47 ? 46.391 -3.048  -6.264  1.00 0.00  ? 47  MET A HG2  1  
ATOM   734   H  HG3  . MET A 1 47 ? 47.016 -3.145  -4.619  1.00 0.00  ? 47  MET A HG3  1  
ATOM   735   H  HE1  . MET A 1 47 ? 45.143 -3.415  -2.388  1.00 0.00  ? 47  MET A HE1  1  
ATOM   736   H  HE2  . MET A 1 47 ? 46.342 -4.480  -3.117  1.00 0.00  ? 47  MET A HE2  1  
ATOM   737   H  HE3  . MET A 1 47 ? 44.743 -5.103  -2.727  1.00 0.00  ? 47  MET A HE3  1  
ATOM   738   N  N    . LEU A 1 48 ? 45.939 1.626   -6.094  1.00 0.00  ? 48  LEU A N    1  
ATOM   739   C  CA   . LEU A 1 48 ? 45.624 3.075   -5.888  1.00 0.00  ? 48  LEU A CA   1  
ATOM   740   C  C    . LEU A 1 48 ? 44.864 3.630   -7.102  1.00 0.00  ? 48  LEU A C    1  
ATOM   741   O  O    . LEU A 1 48 ? 43.956 4.428   -6.965  1.00 0.00  ? 48  LEU A O    1  
ATOM   742   C  CB   . LEU A 1 48 ? 46.983 3.766   -5.747  1.00 0.00  ? 48  LEU A CB   1  
ATOM   743   C  CG   . LEU A 1 48 ? 46.861 4.911   -4.744  1.00 0.00  ? 48  LEU A CG   1  
ATOM   744   C  CD1  . LEU A 1 48 ? 47.465 4.487   -3.404  1.00 0.00  ? 48  LEU A CD1  1  
ATOM   745   C  CD2  . LEU A 1 48 ? 47.607 6.136   -5.273  1.00 0.00  ? 48  LEU A CD2  1  
ATOM   746   H  H    . LEU A 1 48 ? 46.868 1.344   -6.224  1.00 0.00  ? 48  LEU A H    1  
ATOM   747   H  HA   . LEU A 1 48 ? 45.045 3.211   -4.988  1.00 0.00  ? 48  LEU A HA   1  
ATOM   748   H  HB2  . LEU A 1 48 ? 47.718 3.054   -5.399  1.00 0.00  ? 48  LEU A HB2  1  
ATOM   749   H  HB3  . LEU A 1 48 ? 47.288 4.161   -6.704  1.00 0.00  ? 48  LEU A HB3  1  
ATOM   750   H  HG   . LEU A 1 48 ? 45.818 5.153   -4.608  1.00 0.00  ? 48  LEU A HG   1  
ATOM   751   H  HD11 . LEU A 1 48 ? 47.444 5.321   -2.720  1.00 0.00  ? 48  LEU A HD11 1  
ATOM   752   H  HD12 . LEU A 1 48 ? 48.487 4.170   -3.554  1.00 0.00  ? 48  LEU A HD12 1  
ATOM   753   H  HD13 . LEU A 1 48 ? 46.892 3.670   -2.994  1.00 0.00  ? 48  LEU A HD13 1  
ATOM   754   H  HD21 . LEU A 1 48 ? 47.048 6.573   -6.087  1.00 0.00  ? 48  LEU A HD21 1  
ATOM   755   H  HD22 . LEU A 1 48 ? 48.585 5.840   -5.625  1.00 0.00  ? 48  LEU A HD22 1  
ATOM   756   H  HD23 . LEU A 1 48 ? 47.715 6.861   -4.480  1.00 0.00  ? 48  LEU A HD23 1  
ATOM   757   N  N    . GLY A 1 49 ? 45.228 3.201   -8.285  1.00 0.00  ? 49  GLY A N    1  
ATOM   758   C  CA   . GLY A 1 49 ? 44.530 3.686   -9.517  1.00 0.00  ? 49  GLY A CA   1  
ATOM   759   C  C    . GLY A 1 49 ? 45.540 4.151   -10.582 1.00 0.00  ? 49  GLY A C    1  
ATOM   760   O  O    . GLY A 1 49 ? 45.161 4.757   -11.566 1.00 0.00  ? 49  GLY A O    1  
ATOM   761   H  H    . GLY A 1 49 ? 45.956 2.551   -8.361  1.00 0.00  ? 49  GLY A H    1  
ATOM   762   H  HA2  . GLY A 1 49 ? 43.929 2.883   -9.924  1.00 0.00  ? 49  GLY A HA2  1  
ATOM   763   H  HA3  . GLY A 1 49 ? 43.887 4.519   -9.257  1.00 0.00  ? 49  GLY A HA3  1  
ATOM   764   N  N    . GLN A 1 50 ? 46.813 3.876   -10.408 1.00 0.00  ? 50  GLN A N    1  
ATOM   765   C  CA   . GLN A 1 50 ? 47.819 4.312   -11.424 1.00 0.00  ? 50  GLN A CA   1  
ATOM   766   C  C    . GLN A 1 50 ? 48.687 3.127   -11.864 1.00 0.00  ? 50  GLN A C    1  
ATOM   767   O  O    . GLN A 1 50 ? 49.109 2.319   -11.058 1.00 0.00  ? 50  GLN A O    1  
ATOM   768   C  CB   . GLN A 1 50 ? 48.670 5.370   -10.714 1.00 0.00  ? 50  GLN A CB   1  
ATOM   769   C  CG   . GLN A 1 50 ? 47.864 6.667   -10.572 1.00 0.00  ? 50  GLN A CG   1  
ATOM   770   C  CD   . GLN A 1 50 ? 47.608 6.951   -9.091  1.00 0.00  ? 50  GLN A CD   1  
ATOM   771   O  OE1  . GLN A 1 50 ? 46.596 6.554   -8.551  1.00 0.00  ? 50  GLN A OE1  1  
ATOM   772   N  NE2  . GLN A 1 50 ? 48.489 7.624   -8.406  1.00 0.00  ? 50  GLN A NE2  1  
ATOM   773   H  H    . GLN A 1 50 ? 47.109 3.387   -9.615  1.00 0.00  ? 50  GLN A H    1  
ATOM   774   H  HA   . GLN A 1 50 ? 47.327 4.751   -12.277 1.00 0.00  ? 50  GLN A HA   1  
ATOM   775   H  HB2  . GLN A 1 50 ? 48.949 5.009   -9.734  1.00 0.00  ? 50  GLN A HB2  1  
ATOM   776   H  HB3  . GLN A 1 50 ? 49.561 5.564   -11.293 1.00 0.00  ? 50  GLN A HB3  1  
ATOM   777   H  HG2  . GLN A 1 50 ? 48.420 7.486   -11.005 1.00 0.00  ? 50  GLN A HG2  1  
ATOM   778   H  HG3  . GLN A 1 50 ? 46.920 6.563   -11.086 1.00 0.00  ? 50  GLN A HG3  1  
ATOM   779   H  HE21 . GLN A 1 50 ? 49.308 7.944   -8.839  1.00 0.00  ? 50  GLN A HE21 1  
ATOM   780   H  HE22 . GLN A 1 50 ? 48.330 7.812   -7.459  1.00 0.00  ? 50  GLN A HE22 1  
ATOM   781   N  N    . ASN A 1 51 ? 48.957 3.026   -13.140 1.00 0.00  ? 51  ASN A N    1  
ATOM   782   C  CA   . ASN A 1 51 ? 49.802 1.903   -13.649 1.00 0.00  ? 51  ASN A CA   1  
ATOM   783   C  C    . ASN A 1 51 ? 51.029 2.469   -14.386 1.00 0.00  ? 51  ASN A C    1  
ATOM   784   O  O    . ASN A 1 51 ? 51.042 2.546   -15.600 1.00 0.00  ? 51  ASN A O    1  
ATOM   785   C  CB   . ASN A 1 51 ? 48.890 1.126   -14.607 1.00 0.00  ? 51  ASN A CB   1  
ATOM   786   C  CG   . ASN A 1 51 ? 48.327 -0.108  -13.897 1.00 0.00  ? 51  ASN A CG   1  
ATOM   787   O  OD1  . ASN A 1 51 ? 47.151 -0.171  -13.606 1.00 0.00  ? 51  ASN A OD1  1  
ATOM   788   N  ND2  . ASN A 1 51 ? 49.121 -1.100  -13.605 1.00 0.00  ? 51  ASN A ND2  1  
ATOM   789   H  H    . ASN A 1 51 ? 48.607 3.695   -13.765 1.00 0.00  ? 51  ASN A H    1  
ATOM   790   H  HA   . ASN A 1 51 ? 50.112 1.265   -12.836 1.00 0.00  ? 51  ASN A HA   1  
ATOM   791   H  HB2  . ASN A 1 51 ? 48.075 1.760   -14.924 1.00 0.00  ? 51  ASN A HB2  1  
ATOM   792   H  HB3  . ASN A 1 51 ? 49.457 0.813   -15.471 1.00 0.00  ? 51  ASN A HB3  1  
ATOM   793   H  HD21 . ASN A 1 51 ? 50.071 -1.054  -13.839 1.00 0.00  ? 51  ASN A HD21 1  
ATOM   794   H  HD22 . ASN A 1 51 ? 48.767 -1.891  -13.149 1.00 0.00  ? 51  ASN A HD22 1  
ATOM   795   N  N    . PRO A 1 52 ? 52.021 2.862   -13.615 1.00 0.00  ? 52  PRO A N    1  
ATOM   796   C  CA   . PRO A 1 52 ? 53.260 3.443   -14.196 1.00 0.00  ? 52  PRO A CA   1  
ATOM   797   C  C    . PRO A 1 52 ? 54.174 2.344   -14.760 1.00 0.00  ? 52  PRO A C    1  
ATOM   798   O  O    . PRO A 1 52 ? 53.978 1.168   -14.512 1.00 0.00  ? 52  PRO A O    1  
ATOM   799   C  CB   . PRO A 1 52 ? 53.921 4.133   -13.004 1.00 0.00  ? 52  PRO A CB   1  
ATOM   800   C  CG   . PRO A 1 52 ? 53.410 3.415   -11.793 1.00 0.00  ? 52  PRO A CG   1  
ATOM   801   C  CD   . PRO A 1 52 ? 52.078 2.803   -12.148 1.00 0.00  ? 52  PRO A CD   1  
ATOM   802   H  HA   . PRO A 1 52 ? 53.023 4.169   -14.956 1.00 0.00  ? 52  PRO A HA   1  
ATOM   803   H  HB2  . PRO A 1 52 ? 54.997 4.045   -13.070 1.00 0.00  ? 52  PRO A HB2  1  
ATOM   804   H  HB3  . PRO A 1 52 ? 53.632 5.171   -12.965 1.00 0.00  ? 52  PRO A HB3  1  
ATOM   805   H  HG2  . PRO A 1 52 ? 54.108 2.640   -11.504 1.00 0.00  ? 52  PRO A HG2  1  
ATOM   806   H  HG3  . PRO A 1 52 ? 53.281 4.113   -10.980 1.00 0.00  ? 52  PRO A HG3  1  
ATOM   807   H  HD2  . PRO A 1 52 ? 52.034 1.776   -11.807 1.00 0.00  ? 52  PRO A HD2  1  
ATOM   808   H  HD3  . PRO A 1 52 ? 51.272 3.378   -11.721 1.00 0.00  ? 52  PRO A HD3  1  
ATOM   809   N  N    . THR A 1 53 ? 55.179 2.727   -15.508 1.00 0.00  ? 53  THR A N    1  
ATOM   810   C  CA   . THR A 1 53 ? 56.124 1.718   -16.085 1.00 0.00  ? 53  THR A CA   1  
ATOM   811   C  C    . THR A 1 53 ? 57.089 1.227   -14.992 1.00 0.00  ? 53  THR A C    1  
ATOM   812   O  O    . THR A 1 53 ? 57.145 1.802   -13.921 1.00 0.00  ? 53  THR A O    1  
ATOM   813   C  CB   . THR A 1 53 ? 56.888 2.465   -17.189 1.00 0.00  ? 53  THR A CB   1  
ATOM   814   O  OG1  . THR A 1 53 ? 57.477 3.642   -16.651 1.00 0.00  ? 53  THR A OG1  1  
ATOM   815   C  CG2  . THR A 1 53 ? 55.927 2.848   -18.318 1.00 0.00  ? 53  THR A CG2  1  
ATOM   816   H  H    . THR A 1 53 ? 55.321 3.681   -15.683 1.00 0.00  ? 53  THR A H    1  
ATOM   817   H  HA   . THR A 1 53 ? 55.579 0.889   -16.507 1.00 0.00  ? 53  THR A HA   1  
ATOM   818   H  HB   . THR A 1 53 ? 57.661 1.830   -17.583 1.00 0.00  ? 53  THR A HB   1  
ATOM   819   H  HG1  . THR A 1 53 ? 58.241 3.865   -17.193 1.00 0.00  ? 53  THR A HG1  1  
ATOM   820   H  HG21 . THR A 1 53 ? 56.256 2.390   -19.239 1.00 0.00  ? 53  THR A HG21 1  
ATOM   821   H  HG22 . THR A 1 53 ? 55.916 3.922   -18.433 1.00 0.00  ? 53  THR A HG22 1  
ATOM   822   H  HG23 . THR A 1 53 ? 54.932 2.501   -18.079 1.00 0.00  ? 53  THR A HG23 1  
ATOM   823   N  N    . PRO A 1 54 ? 57.824 0.178   -15.291 1.00 0.00  ? 54  PRO A N    1  
ATOM   824   C  CA   . PRO A 1 54 ? 58.791 -0.378  -14.302 1.00 0.00  ? 54  PRO A CA   1  
ATOM   825   C  C    . PRO A 1 54 ? 59.911 0.631   -14.004 1.00 0.00  ? 54  PRO A C    1  
ATOM   826   O  O    . PRO A 1 54 ? 60.499 0.611   -12.939 1.00 0.00  ? 54  PRO A O    1  
ATOM   827   C  CB   . PRO A 1 54 ? 59.328 -1.631  -14.994 1.00 0.00  ? 54  PRO A CB   1  
ATOM   828   C  CG   . PRO A 1 54 ? 59.118 -1.373  -16.450 1.00 0.00  ? 54  PRO A CG   1  
ATOM   829   C  CD   . PRO A 1 54 ? 57.844 -0.579  -16.551 1.00 0.00  ? 54  PRO A CD   1  
ATOM   830   H  HA   . PRO A 1 54 ? 58.282 -0.653  -13.392 1.00 0.00  ? 54  PRO A HA   1  
ATOM   831   H  HB2  . PRO A 1 54 ? 60.381 -1.759  -14.777 1.00 0.00  ? 54  PRO A HB2  1  
ATOM   832   H  HB3  . PRO A 1 54 ? 58.769 -2.501  -14.689 1.00 0.00  ? 54  PRO A HB3  1  
ATOM   833   H  HG2  . PRO A 1 54 ? 59.947 -0.805  -16.849 1.00 0.00  ? 54  PRO A HG2  1  
ATOM   834   H  HG3  . PRO A 1 54 ? 59.012 -2.305  -16.983 1.00 0.00  ? 54  PRO A HG3  1  
ATOM   835   H  HD2  . PRO A 1 54 ? 57.880 0.084   -17.402 1.00 0.00  ? 54  PRO A HD2  1  
ATOM   836   H  HD3  . PRO A 1 54 ? 56.988 -1.233  -16.609 1.00 0.00  ? 54  PRO A HD3  1  
ATOM   837   N  N    . GLU A 1 55 ? 60.195 1.522   -14.927 1.00 0.00  ? 55  GLU A N    1  
ATOM   838   C  CA   . GLU A 1 55 ? 61.263 2.545   -14.687 1.00 0.00  ? 55  GLU A CA   1  
ATOM   839   C  C    . GLU A 1 55 ? 60.850 3.474   -13.539 1.00 0.00  ? 55  GLU A C    1  
ATOM   840   O  O    . GLU A 1 55 ? 61.661 3.848   -12.714 1.00 0.00  ? 55  GLU A O    1  
ATOM   841   C  CB   . GLU A 1 55 ? 61.375 3.342   -15.991 1.00 0.00  ? 55  GLU A CB   1  
ATOM   842   C  CG   . GLU A 1 55 ? 61.778 2.417   -17.146 1.00 0.00  ? 55  GLU A CG   1  
ATOM   843   C  CD   . GLU A 1 55 ? 60.635 2.340   -18.160 1.00 0.00  ? 55  GLU A CD   1  
ATOM   844   O  OE1  . GLU A 1 55 ? 60.519 3.250   -18.964 1.00 0.00  ? 55  GLU A OE1  1  
ATOM   845   O  OE2  . GLU A 1 55 ? 59.893 1.374   -18.111 1.00 0.00  ? 55  GLU A OE2  1  
ATOM   846   H  H    . GLU A 1 55 ? 59.698 1.525   -15.772 1.00 0.00  ? 55  GLU A H    1  
ATOM   847   H  HA   . GLU A 1 55 ? 62.203 2.065   -14.464 1.00 0.00  ? 55  GLU A HA   1  
ATOM   848   H  HB2  . GLU A 1 55 ? 60.421 3.798   -16.213 1.00 0.00  ? 55  GLU A HB2  1  
ATOM   849   H  HB3  . GLU A 1 55 ? 62.121 4.113   -15.874 1.00 0.00  ? 55  GLU A HB3  1  
ATOM   850   H  HG2  . GLU A 1 55 ? 62.662 2.810   -17.629 1.00 0.00  ? 55  GLU A HG2  1  
ATOM   851   H  HG3  . GLU A 1 55 ? 61.986 1.429   -16.764 1.00 0.00  ? 55  GLU A HG3  1  
ATOM   852   N  N    . GLU A 1 56 ? 59.588 3.840   -13.481 1.00 0.00  ? 56  GLU A N    1  
ATOM   853   C  CA   . GLU A 1 56 ? 59.104 4.738   -12.383 1.00 0.00  ? 56  GLU A CA   1  
ATOM   854   C  C    . GLU A 1 56 ? 59.472 4.143   -11.019 1.00 0.00  ? 56  GLU A C    1  
ATOM   855   O  O    . GLU A 1 56 ? 59.981 4.828   -10.152 1.00 0.00  ? 56  GLU A O    1  
ATOM   856   C  CB   . GLU A 1 56 ? 57.579 4.799   -12.556 1.00 0.00  ? 56  GLU A CB   1  
ATOM   857   C  CG   . GLU A 1 56 ? 56.948 5.568   -11.386 1.00 0.00  ? 56  GLU A CG   1  
ATOM   858   C  CD   . GLU A 1 56 ? 56.579 6.985   -11.834 1.00 0.00  ? 56  GLU A CD   1  
ATOM   859   O  OE1  . GLU A 1 56 ? 57.452 7.835   -11.821 1.00 0.00  ? 56  GLU A OE1  1  
ATOM   860   O  OE2  . GLU A 1 56 ? 55.427 7.196   -12.176 1.00 0.00  ? 56  GLU A OE2  1  
ATOM   861   H  H    . GLU A 1 56 ? 58.956 3.515   -14.158 1.00 0.00  ? 56  GLU A H    1  
ATOM   862   H  HA   . GLU A 1 56 ? 59.527 5.725   -12.489 1.00 0.00  ? 56  GLU A HA   1  
ATOM   863   H  HB2  . GLU A 1 56 ? 57.345 5.299   -13.485 1.00 0.00  ? 56  GLU A HB2  1  
ATOM   864   H  HB3  . GLU A 1 56 ? 57.181 3.795   -12.579 1.00 0.00  ? 56  GLU A HB3  1  
ATOM   865   H  HG2  . GLU A 1 56 ? 56.057 5.053   -11.058 1.00 0.00  ? 56  GLU A HG2  1  
ATOM   866   H  HG3  . GLU A 1 56 ? 57.650 5.625   -10.569 1.00 0.00  ? 56  GLU A HG3  1  
ATOM   867   N  N    . LEU A 1 57 ? 59.230 2.870   -10.827 1.00 0.00  ? 57  LEU A N    1  
ATOM   868   C  CA   . LEU A 1 57 ? 59.578 2.237   -9.521  1.00 0.00  ? 57  LEU A CA   1  
ATOM   869   C  C    . LEU A 1 57 ? 61.087 1.960   -9.450  1.00 0.00  ? 57  LEU A C    1  
ATOM   870   O  O    . LEU A 1 57 ? 61.664 1.951   -8.379  1.00 0.00  ? 57  LEU A O    1  
ATOM   871   C  CB   . LEU A 1 57 ? 58.793 0.922   -9.451  1.00 0.00  ? 57  LEU A CB   1  
ATOM   872   C  CG   . LEU A 1 57 ? 57.268 1.160   -9.529  1.00 0.00  ? 57  LEU A CG   1  
ATOM   873   C  CD1  . LEU A 1 57 ? 56.894 2.528   -8.949  1.00 0.00  ? 57  LEU A CD1  1  
ATOM   874   C  CD2  . LEU A 1 57 ? 56.803 1.089   -10.987 1.00 0.00  ? 57  LEU A CD2  1  
ATOM   875   H  H    . LEU A 1 57 ? 58.831 2.334   -11.543 1.00 0.00  ? 57  LEU A H    1  
ATOM   876   H  HA   . LEU A 1 57 ? 59.285 2.881   -8.706  1.00 0.00  ? 57  LEU A HA   1  
ATOM   877   H  HB2  . LEU A 1 57 ? 59.096 0.283   -10.268 1.00 0.00  ? 57  LEU A HB2  1  
ATOM   878   H  HB3  . LEU A 1 57 ? 59.026 0.435   -8.515  1.00 0.00  ? 57  LEU A HB3  1  
ATOM   879   H  HG   . LEU A 1 57 ? 56.764 0.391   -8.961  1.00 0.00  ? 57  LEU A HG   1  
ATOM   880   H  HD11 . LEU A 1 57 ? 57.479 2.717   -8.061  1.00 0.00  ? 57  LEU A HD11 1  
ATOM   881   H  HD12 . LEU A 1 57 ? 55.845 2.536   -8.696  1.00 0.00  ? 57  LEU A HD12 1  
ATOM   882   H  HD13 . LEU A 1 57 ? 57.092 3.296   -9.682  1.00 0.00  ? 57  LEU A HD13 1  
ATOM   883   H  HD21 . LEU A 1 57 ? 57.435 0.406   -11.534 1.00 0.00  ? 57  LEU A HD21 1  
ATOM   884   H  HD22 . LEU A 1 57 ? 56.863 2.072   -11.432 1.00 0.00  ? 57  LEU A HD22 1  
ATOM   885   H  HD23 . LEU A 1 57 ? 55.781 0.742   -11.022 1.00 0.00  ? 57  LEU A HD23 1  
ATOM   886   N  N    . GLN A 1 58 ? 61.739 1.749   -10.576 1.00 0.00  ? 58  GLN A N    1  
ATOM   887   C  CA   . GLN A 1 58 ? 63.214 1.497   -10.546 1.00 0.00  ? 58  GLN A CA   1  
ATOM   888   C  C    . GLN A 1 58 ? 63.918 2.709   -9.915  1.00 0.00  ? 58  GLN A C    1  
ATOM   889   O  O    . GLN A 1 58 ? 64.889 2.569   -9.200  1.00 0.00  ? 58  GLN A O    1  
ATOM   890   C  CB   . GLN A 1 58 ? 63.622 1.261   -12.017 1.00 0.00  ? 58  GLN A CB   1  
ATOM   891   C  CG   . GLN A 1 58 ? 64.405 2.453   -12.586 1.00 0.00  ? 58  GLN A CG   1  
ATOM   892   C  CD   . GLN A 1 58 ? 65.905 2.200   -12.423 1.00 0.00  ? 58  GLN A CD   1  
ATOM   893   O  OE1  . GLN A 1 58 ? 66.445 1.283   -13.006 1.00 0.00  ? 58  GLN A OE1  1  
ATOM   894   N  NE2  . GLN A 1 58 ? 66.604 2.978   -11.649 1.00 0.00  ? 58  GLN A NE2  1  
ATOM   895   H  H    . GLN A 1 58 ? 61.262 1.771   -11.433 1.00 0.00  ? 58  GLN A H    1  
ATOM   896   H  HA   . GLN A 1 58 ? 63.424 0.610   -9.963  1.00 0.00  ? 58  GLN A HA   1  
ATOM   897   H  HB2  . GLN A 1 58 ? 64.241 0.377   -12.073 1.00 0.00  ? 58  GLN A HB2  1  
ATOM   898   H  HB3  . GLN A 1 58 ? 62.734 1.105   -12.611 1.00 0.00  ? 58  GLN A HB3  1  
ATOM   899   H  HG2  . GLN A 1 58 ? 64.170 2.567   -13.634 1.00 0.00  ? 58  GLN A HG2  1  
ATOM   900   H  HG3  . GLN A 1 58 ? 64.134 3.354   -12.062 1.00 0.00  ? 58  GLN A HG3  1  
ATOM   901   H  HE21 . GLN A 1 58 ? 66.171 3.721   -11.179 1.00 0.00  ? 58  GLN A HE21 1  
ATOM   902   H  HE22 . GLN A 1 58 ? 67.564 2.818   -11.532 1.00 0.00  ? 58  GLN A HE22 1  
ATOM   903   N  N    . GLU A 1 59 ? 63.402 3.895   -10.142 1.00 0.00  ? 59  GLU A N    1  
ATOM   904   C  CA   . GLU A 1 59 ? 64.008 5.110   -9.518  1.00 0.00  ? 59  GLU A CA   1  
ATOM   905   C  C    . GLU A 1 59 ? 63.738 5.068   -8.007  1.00 0.00  ? 59  GLU A C    1  
ATOM   906   O  O    . GLU A 1 59 ? 64.576 5.432   -7.203  1.00 0.00  ? 59  GLU A O    1  
ATOM   907   C  CB   . GLU A 1 59 ? 63.294 6.297   -10.174 1.00 0.00  ? 59  GLU A CB   1  
ATOM   908   C  CG   . GLU A 1 59 ? 64.286 7.082   -11.041 1.00 0.00  ? 59  GLU A CG   1  
ATOM   909   C  CD   . GLU A 1 59 ? 64.801 6.192   -12.177 1.00 0.00  ? 59  GLU A CD   1  
ATOM   910   O  OE1  . GLU A 1 59 ? 64.060 5.980   -13.123 1.00 0.00  ? 59  GLU A OE1  1  
ATOM   911   O  OE2  . GLU A 1 59 ? 65.929 5.739   -12.079 1.00 0.00  ? 59  GLU A OE2  1  
ATOM   912   H  H    . GLU A 1 59 ? 62.598 3.980   -10.698 1.00 0.00  ? 59  GLU A H    1  
ATOM   913   H  HA   . GLU A 1 59 ? 65.069 5.151   -9.715  1.00 0.00  ? 59  GLU A HA   1  
ATOM   914   H  HB2  . GLU A 1 59 ? 62.486 5.934   -10.794 1.00 0.00  ? 59  GLU A HB2  1  
ATOM   915   H  HB3  . GLU A 1 59 ? 62.896 6.946   -9.410  1.00 0.00  ? 59  GLU A HB3  1  
ATOM   916   H  HG2  . GLU A 1 59 ? 63.792 7.946   -11.459 1.00 0.00  ? 59  GLU A HG2  1  
ATOM   917   H  HG3  . GLU A 1 59 ? 65.118 7.402   -10.433 1.00 0.00  ? 59  GLU A HG3  1  
ATOM   918   N  N    . MET A 1 60 ? 62.572 4.592   -7.626  1.00 0.00  ? 60  MET A N    1  
ATOM   919   C  CA   . MET A 1 60 ? 62.224 4.480   -6.175  1.00 0.00  ? 60  MET A CA   1  
ATOM   920   C  C    . MET A 1 60 ? 63.181 3.498   -5.484  1.00 0.00  ? 60  MET A C    1  
ATOM   921   O  O    . MET A 1 60 ? 63.682 3.763   -4.409  1.00 0.00  ? 60  MET A O    1  
ATOM   922   C  CB   . MET A 1 60 ? 60.786 3.936   -6.145  1.00 0.00  ? 60  MET A CB   1  
ATOM   923   C  CG   . MET A 1 60 ? 59.811 5.083   -5.875  1.00 0.00  ? 60  MET A CG   1  
ATOM   924   S  SD   . MET A 1 60 ? 58.125 4.547   -6.260  1.00 0.00  ? 60  MET A SD   1  
ATOM   925   C  CE   . MET A 1 60 ? 57.940 5.462   -7.810  1.00 0.00  ? 60  MET A CE   1  
ATOM   926   H  H    . MET A 1 60 ? 61.930 4.289   -8.302  1.00 0.00  ? 60  MET A H    1  
ATOM   927   H  HA   . MET A 1 60 ? 62.265 5.447   -5.697  1.00 0.00  ? 60  MET A HA   1  
ATOM   928   H  HB2  . MET A 1 60 ? 60.549 3.472   -7.097  1.00 0.00  ? 60  MET A HB2  1  
ATOM   929   H  HB3  . MET A 1 60 ? 60.697 3.200   -5.360  1.00 0.00  ? 60  MET A HB3  1  
ATOM   930   H  HG2  . MET A 1 60 ? 59.869 5.367   -4.835  1.00 0.00  ? 60  MET A HG2  1  
ATOM   931   H  HG3  . MET A 1 60 ? 60.069 5.930   -6.494  1.00 0.00  ? 60  MET A HG3  1  
ATOM   932   H  HE1  . MET A 1 60 ? 58.485 6.393   -7.745  1.00 0.00  ? 60  MET A HE1  1  
ATOM   933   H  HE2  . MET A 1 60 ? 56.897 5.670   -7.986  1.00 0.00  ? 60  MET A HE2  1  
ATOM   934   H  HE3  . MET A 1 60 ? 58.328 4.868   -8.625  1.00 0.00  ? 60  MET A HE3  1  
ATOM   935   N  N    . ILE A 1 61 ? 63.438 2.369   -6.104  1.00 0.00  ? 61  ILE A N    1  
ATOM   936   C  CA   . ILE A 1 61 ? 64.365 1.361   -5.496  1.00 0.00  ? 61  ILE A CA   1  
ATOM   937   C  C    . ILE A 1 61 ? 65.803 1.911   -5.449  1.00 0.00  ? 61  ILE A C    1  
ATOM   938   O  O    . ILE A 1 61 ? 66.548 1.622   -4.536  1.00 0.00  ? 61  ILE A O    1  
ATOM   939   C  CB   . ILE A 1 61 ? 64.251 0.116   -6.402  1.00 0.00  ? 61  ILE A CB   1  
ATOM   940   C  CG1  . ILE A 1 61 ? 64.254 -1.148  -5.536  1.00 0.00  ? 61  ILE A CG1  1  
ATOM   941   C  CG2  . ILE A 1 61 ? 65.419 0.045   -7.394  1.00 0.00  ? 61  ILE A CG2  1  
ATOM   942   C  CD1  . ILE A 1 61 ? 63.081 -2.048  -5.939  1.00 0.00  ? 61  ILE A CD1  1  
ATOM   943   H  H    . ILE A 1 61 ? 63.020 2.186   -6.973  1.00 0.00  ? 61  ILE A H    1  
ATOM   944   H  HA   . ILE A 1 61 ? 64.035 1.114   -4.500  1.00 0.00  ? 61  ILE A HA   1  
ATOM   945   H  HB   . ILE A 1 61 ? 63.323 0.165   -6.955  1.00 0.00  ? 61  ILE A HB   1  
ATOM   946   H  HG12 . ILE A 1 61 ? 65.183 -1.680  -5.681  1.00 0.00  ? 61  ILE A HG12 1  
ATOM   947   H  HG13 . ILE A 1 61 ? 64.156 -0.875  -4.497  1.00 0.00  ? 61  ILE A HG13 1  
ATOM   948   H  HG21 . ILE A 1 61 ? 65.577 1.016   -7.838  1.00 0.00  ? 61  ILE A HG21 1  
ATOM   949   H  HG22 . ILE A 1 61 ? 65.189 -0.670  -8.169  1.00 0.00  ? 61  ILE A HG22 1  
ATOM   950   H  HG23 . ILE A 1 61 ? 66.314 -0.263  -6.875  1.00 0.00  ? 61  ILE A HG23 1  
ATOM   951   H  HD11 . ILE A 1 61 ? 62.422 -2.183  -5.093  1.00 0.00  ? 61  ILE A HD11 1  
ATOM   952   H  HD12 . ILE A 1 61 ? 63.458 -3.010  -6.255  1.00 0.00  ? 61  ILE A HD12 1  
ATOM   953   H  HD13 . ILE A 1 61 ? 62.535 -1.590  -6.753  1.00 0.00  ? 61  ILE A HD13 1  
ATOM   954   N  N    . ASP A 1 62 ? 66.190 2.706   -6.418  1.00 0.00  ? 62  ASP A N    1  
ATOM   955   C  CA   . ASP A 1 62 ? 67.574 3.279   -6.422  1.00 0.00  ? 62  ASP A CA   1  
ATOM   956   C  C    . ASP A 1 62 ? 67.722 4.321   -5.303  1.00 0.00  ? 62  ASP A C    1  
ATOM   957   O  O    . ASP A 1 62 ? 68.765 4.444   -4.691  1.00 0.00  ? 62  ASP A O    1  
ATOM   958   C  CB   . ASP A 1 62 ? 67.727 3.942   -7.798  1.00 0.00  ? 62  ASP A CB   1  
ATOM   959   C  CG   . ASP A 1 62 ? 68.290 2.935   -8.808  1.00 0.00  ? 62  ASP A CG   1  
ATOM   960   O  OD1  . ASP A 1 62 ? 67.799 1.818   -8.847  1.00 0.00  ? 62  ASP A OD1  1  
ATOM   961   O  OD2  . ASP A 1 62 ? 69.200 3.303   -9.531  1.00 0.00  ? 62  ASP A OD2  1  
ATOM   962   H  H    . ASP A 1 62 ? 65.568 2.930   -7.143  1.00 0.00  ? 62  ASP A H    1  
ATOM   963   H  HA   . ASP A 1 62 ? 68.307 2.496   -6.306  1.00 0.00  ? 62  ASP A HA   1  
ATOM   964   H  HB2  . ASP A 1 62 ? 66.763 4.290   -8.139  1.00 0.00  ? 62  ASP A HB2  1  
ATOM   965   H  HB3  . ASP A 1 62 ? 68.403 4.780   -7.718  1.00 0.00  ? 62  ASP A HB3  1  
ATOM   966   N  N    . GLU A 1 63 ? 66.681 5.072   -5.035  1.00 0.00  ? 63  GLU A N    1  
ATOM   967   C  CA   . GLU A 1 63 ? 66.748 6.112   -3.960  1.00 0.00  ? 63  GLU A CA   1  
ATOM   968   C  C    . GLU A 1 63 ? 66.922 5.468   -2.574  1.00 0.00  ? 63  GLU A C    1  
ATOM   969   O  O    . GLU A 1 63 ? 67.595 6.009   -1.716  1.00 0.00  ? 63  GLU A O    1  
ATOM   970   C  CB   . GLU A 1 63 ? 65.407 6.846   -4.041  1.00 0.00  ? 63  GLU A CB   1  
ATOM   971   C  CG   . GLU A 1 63 ? 65.489 8.160   -3.256  1.00 0.00  ? 63  GLU A CG   1  
ATOM   972   C  CD   . GLU A 1 63 ? 64.436 8.163   -2.146  1.00 0.00  ? 63  GLU A CD   1  
ATOM   973   O  OE1  . GLU A 1 63 ? 64.731 7.664   -1.073  1.00 0.00  ? 63  GLU A OE1  1  
ATOM   974   O  OE2  . GLU A 1 63 ? 63.352 8.670   -2.387  1.00 0.00  ? 63  GLU A OE2  1  
ATOM   975   H  H    . GLU A 1 63 ? 65.853 4.954   -5.546  1.00 0.00  ? 63  GLU A H    1  
ATOM   976   H  HA   . GLU A 1 63 ? 67.553 6.802   -4.155  1.00 0.00  ? 63  GLU A HA   1  
ATOM   977   H  HB2  . GLU A 1 63 ? 65.174 7.058   -5.076  1.00 0.00  ? 63  GLU A HB2  1  
ATOM   978   H  HB3  . GLU A 1 63 ? 64.631 6.224   -3.619  1.00 0.00  ? 63  GLU A HB3  1  
ATOM   979   H  HG2  . GLU A 1 63 ? 66.472 8.256   -2.818  1.00 0.00  ? 63  GLU A HG2  1  
ATOM   980   H  HG3  . GLU A 1 63 ? 65.308 8.989   -3.923  1.00 0.00  ? 63  GLU A HG3  1  
ATOM   981   N  N    . VAL A 1 64 ? 66.316 4.328   -2.344  1.00 0.00  ? 64  VAL A N    1  
ATOM   982   C  CA   . VAL A 1 64 ? 66.445 3.669   -1.001  1.00 0.00  ? 64  VAL A CA   1  
ATOM   983   C  C    . VAL A 1 64 ? 67.441 2.494   -1.029  1.00 0.00  ? 64  VAL A C    1  
ATOM   984   O  O    . VAL A 1 64 ? 67.872 2.031   0.011   1.00 0.00  ? 64  VAL A O    1  
ATOM   985   C  CB   . VAL A 1 64 ? 65.036 3.168   -0.641  1.00 0.00  ? 64  VAL A CB   1  
ATOM   986   C  CG1  . VAL A 1 64 ? 64.066 4.352   -0.578  1.00 0.00  ? 64  VAL A CG1  1  
ATOM   987   C  CG2  . VAL A 1 64 ? 64.545 2.164   -1.692  1.00 0.00  ? 64  VAL A CG2  1  
ATOM   988   H  H    . VAL A 1 64 ? 65.772 3.912   -3.044  1.00 0.00  ? 64  VAL A H    1  
ATOM   989   H  HA   . VAL A 1 64 ? 66.762 4.394   -0.268  1.00 0.00  ? 64  VAL A HA   1  
ATOM   990   H  HB   . VAL A 1 64 ? 65.069 2.687   0.326   1.00 0.00  ? 64  VAL A HB   1  
ATOM   991   H  HG11 . VAL A 1 64 ? 64.615 5.259   -0.370  1.00 0.00  ? 64  VAL A HG11 1  
ATOM   992   H  HG12 . VAL A 1 64 ? 63.342 4.182   0.206   1.00 0.00  ? 64  VAL A HG12 1  
ATOM   993   H  HG13 . VAL A 1 64 ? 63.554 4.450   -1.524  1.00 0.00  ? 64  VAL A HG13 1  
ATOM   994   H  HG21 . VAL A 1 64 ? 65.333 1.461   -1.917  1.00 0.00  ? 64  VAL A HG21 1  
ATOM   995   H  HG22 . VAL A 1 64 ? 64.265 2.691   -2.591  1.00 0.00  ? 64  VAL A HG22 1  
ATOM   996   H  HG23 . VAL A 1 64 ? 63.688 1.632   -1.307  1.00 0.00  ? 64  VAL A HG23 1  
ATOM   997   N  N    . ASP A 1 65 ? 67.808 2.000   -2.189  1.00 0.00  ? 65  ASP A N    1  
ATOM   998   C  CA   . ASP A 1 65 ? 68.772 0.854   -2.231  1.00 0.00  ? 65  ASP A CA   1  
ATOM   999   C  C    . ASP A 1 65 ? 69.908 1.108   -3.230  1.00 0.00  ? 65  ASP A C    1  
ATOM   1000  O  O    . ASP A 1 65 ? 69.704 1.627   -4.310  1.00 0.00  ? 65  ASP A O    1  
ATOM   1001  C  CB   . ASP A 1 65 ? 67.951 -0.367  -2.664  1.00 0.00  ? 65  ASP A CB   1  
ATOM   1002  C  CG   . ASP A 1 65 ? 68.862 -1.600  -2.723  1.00 0.00  ? 65  ASP A CG   1  
ATOM   1003  O  OD1  . ASP A 1 65 ? 69.658 -1.768  -1.812  1.00 0.00  ? 65  ASP A OD1  1  
ATOM   1004  O  OD2  . ASP A 1 65 ? 68.750 -2.360  -3.673  1.00 0.00  ? 65  ASP A OD2  1  
ATOM   1005  H  H    . ASP A 1 65 ? 67.455 2.376   -3.024  1.00 0.00  ? 65  ASP A H    1  
ATOM   1006  H  HA   . ASP A 1 65 ? 69.181 0.681   -1.249  1.00 0.00  ? 65  ASP A HA   1  
ATOM   1007  H  HB2  . ASP A 1 65 ? 67.159 -0.539  -1.950  1.00 0.00  ? 65  ASP A HB2  1  
ATOM   1008  H  HB3  . ASP A 1 65 ? 67.526 -0.191  -3.640  1.00 0.00  ? 65  ASP A HB3  1  
ATOM   1009  N  N    . GLU A 1 66 ? 71.101 0.716   -2.865  1.00 0.00  ? 66  GLU A N    1  
ATOM   1010  C  CA   . GLU A 1 66 ? 72.280 0.890   -3.762  1.00 0.00  ? 66  GLU A CA   1  
ATOM   1011  C  C    . GLU A 1 66 ? 73.356 -0.148  -3.400  1.00 0.00  ? 66  GLU A C    1  
ATOM   1012  O  O    . GLU A 1 66 ? 74.538 0.142   -3.381  1.00 0.00  ? 66  GLU A O    1  
ATOM   1013  C  CB   . GLU A 1 66 ? 72.775 2.316   -3.492  1.00 0.00  ? 66  GLU A CB   1  
ATOM   1014  C  CG   . GLU A 1 66 ? 73.390 2.897   -4.769  1.00 0.00  ? 66  GLU A CG   1  
ATOM   1015  C  CD   . GLU A 1 66 ? 72.283 3.257   -5.766  1.00 0.00  ? 66  GLU A CD   1  
ATOM   1016  O  OE1  . GLU A 1 66 ? 71.789 4.370   -5.695  1.00 0.00  ? 66  GLU A OE1  1  
ATOM   1017  O  OE2  . GLU A 1 66 ? 71.955 2.415   -6.585  1.00 0.00  ? 66  GLU A OE2  1  
ATOM   1018  H  H    . GLU A 1 66 ? 71.220 0.289   -1.993  1.00 0.00  ? 66  GLU A H    1  
ATOM   1019  H  HA   . GLU A 1 66 ? 71.987 0.786   -4.795  1.00 0.00  ? 66  GLU A HA   1  
ATOM   1020  H  HB2  . GLU A 1 66 ? 71.944 2.933   -3.180  1.00 0.00  ? 66  GLU A HB2  1  
ATOM   1021  H  HB3  . GLU A 1 66 ? 73.521 2.296   -2.713  1.00 0.00  ? 66  GLU A HB3  1  
ATOM   1022  H  HG2  . GLU A 1 66 ? 73.952 3.786   -4.523  1.00 0.00  ? 66  GLU A HG2  1  
ATOM   1023  H  HG3  . GLU A 1 66 ? 74.047 2.167   -5.214  1.00 0.00  ? 66  GLU A HG3  1  
ATOM   1024  N  N    . ASP A 1 67 ? 72.943 -1.359  -3.104  1.00 0.00  ? 67  ASP A N    1  
ATOM   1025  C  CA   . ASP A 1 67 ? 73.918 -2.433  -2.729  1.00 0.00  ? 67  ASP A CA   1  
ATOM   1026  C  C    . ASP A 1 67 ? 74.228 -3.357  -3.922  1.00 0.00  ? 67  ASP A C    1  
ATOM   1027  O  O    . ASP A 1 67 ? 74.935 -4.338  -3.782  1.00 0.00  ? 67  ASP A O    1  
ATOM   1028  C  CB   . ASP A 1 67 ? 73.227 -3.212  -1.588  1.00 0.00  ? 67  ASP A CB   1  
ATOM   1029  C  CG   . ASP A 1 67 ? 72.048 -4.060  -2.109  1.00 0.00  ? 67  ASP A CG   1  
ATOM   1030  O  OD1  . ASP A 1 67 ? 71.384 -3.641  -3.044  1.00 0.00  ? 67  ASP A OD1  1  
ATOM   1031  O  OD2  . ASP A 1 67 ? 71.815 -5.116  -1.548  1.00 0.00  ? 67  ASP A OD2  1  
ATOM   1032  H  H    . ASP A 1 67 ? 71.983 -1.563  -3.124  1.00 0.00  ? 67  ASP A H    1  
ATOM   1033  H  HA   . ASP A 1 67 ? 74.831 -1.991  -2.360  1.00 0.00  ? 67  ASP A HA   1  
ATOM   1034  H  HB2  . ASP A 1 67 ? 73.949 -3.865  -1.122  1.00 0.00  ? 67  ASP A HB2  1  
ATOM   1035  H  HB3  . ASP A 1 67 ? 72.860 -2.511  -0.854  1.00 0.00  ? 67  ASP A HB3  1  
ATOM   1036  N  N    . GLY A 1 68 ? 73.706 -3.059  -5.089  1.00 0.00  ? 68  GLY A N    1  
ATOM   1037  C  CA   . GLY A 1 68 ? 73.972 -3.927  -6.274  1.00 0.00  ? 68  GLY A CA   1  
ATOM   1038  C  C    . GLY A 1 68 ? 72.721 -4.751  -6.597  1.00 0.00  ? 68  GLY A C    1  
ATOM   1039  O  O    . GLY A 1 68 ? 72.450 -5.053  -7.742  1.00 0.00  ? 68  GLY A O    1  
ATOM   1040  H  H    . GLY A 1 68 ? 73.137 -2.269  -5.184  1.00 0.00  ? 68  GLY A H    1  
ATOM   1041  H  HA2  . GLY A 1 68 ? 74.225 -3.308  -7.124  1.00 0.00  ? 68  GLY A HA2  1  
ATOM   1042  H  HA3  . GLY A 1 68 ? 74.792 -4.596  -6.059  1.00 0.00  ? 68  GLY A HA3  1  
ATOM   1043  N  N    . SER A 1 69 ? 71.955 -5.113  -5.595  1.00 0.00  ? 69  SER A N    1  
ATOM   1044  C  CA   . SER A 1 69 ? 70.718 -5.915  -5.846  1.00 0.00  ? 69  SER A CA   1  
ATOM   1045  C  C    . SER A 1 69 ? 69.663 -5.062  -6.574  1.00 0.00  ? 69  SER A C    1  
ATOM   1046  O  O    . SER A 1 69 ? 69.017 -5.528  -7.493  1.00 0.00  ? 69  SER A O    1  
ATOM   1047  C  CB   . SER A 1 69 ? 70.234 -6.362  -4.454  1.00 0.00  ? 69  SER A CB   1  
ATOM   1048  O  OG   . SER A 1 69 ? 69.083 -5.620  -4.062  1.00 0.00  ? 69  SER A OG   1  
ATOM   1049  H  H    . SER A 1 69 ? 72.192 -4.856  -4.679  1.00 0.00  ? 69  SER A H    1  
ATOM   1050  H  HA   . SER A 1 69 ? 70.958 -6.783  -6.440  1.00 0.00  ? 69  SER A HA   1  
ATOM   1051  H  HB2  . SER A 1 69 ? 69.980 -7.409  -4.483  1.00 0.00  ? 69  SER A HB2  1  
ATOM   1052  H  HB3  . SER A 1 69 ? 71.031 -6.214  -3.735  1.00 0.00  ? 69  SER A HB3  1  
ATOM   1053  H  HG   . SER A 1 69 ? 68.313 -6.039  -4.462  1.00 0.00  ? 69  SER A HG   1  
ATOM   1054  N  N    . GLY A 1 70 ? 69.476 -3.823  -6.175  1.00 0.00  ? 70  GLY A N    1  
ATOM   1055  C  CA   . GLY A 1 70 ? 68.456 -2.965  -6.855  1.00 0.00  ? 70  GLY A CA   1  
ATOM   1056  C  C    . GLY A 1 70 ? 67.055 -3.432  -6.453  1.00 0.00  ? 70  GLY A C    1  
ATOM   1057  O  O    . GLY A 1 70 ? 66.107 -3.304  -7.205  1.00 0.00  ? 70  GLY A O    1  
ATOM   1058  H  H    . GLY A 1 70 ? 69.998 -3.460  -5.424  1.00 0.00  ? 70  GLY A H    1  
ATOM   1059  H  HA2  . GLY A 1 70 ? 68.593 -1.933  -6.553  1.00 0.00  ? 70  GLY A HA2  1  
ATOM   1060  H  HA3  . GLY A 1 70 ? 68.567 -3.050  -7.927  1.00 0.00  ? 70  GLY A HA3  1  
ATOM   1061  N  N    . THR A 1 71 ? 66.923 -3.971  -5.269  1.00 0.00  ? 71  THR A N    1  
ATOM   1062  C  CA   . THR A 1 71 ? 65.595 -4.454  -4.791  1.00 0.00  ? 71  THR A CA   1  
ATOM   1063  C  C    . THR A 1 71 ? 65.400 -4.016  -3.340  1.00 0.00  ? 71  THR A C    1  
ATOM   1064  O  O    . THR A 1 71 ? 66.340 -4.003  -2.566  1.00 0.00  ? 71  THR A O    1  
ATOM   1065  C  CB   . THR A 1 71 ? 65.642 -5.989  -4.882  1.00 0.00  ? 71  THR A CB   1  
ATOM   1066  O  OG1  . THR A 1 71 ? 66.621 -6.401  -5.833  1.00 0.00  ? 71  THR A OG1  1  
ATOM   1067  C  CG2  . THR A 1 71 ? 64.272 -6.517  -5.305  1.00 0.00  ? 71  THR A CG2  1  
ATOM   1068  H  H    . THR A 1 71 ? 67.707 -4.056  -4.686  1.00 0.00  ? 71  THR A H    1  
ATOM   1069  H  HA   . THR A 1 71 ? 64.804 -4.068  -5.413  1.00 0.00  ? 71  THR A HA   1  
ATOM   1070  H  HB   . THR A 1 71 ? 65.892 -6.397  -3.915  1.00 0.00  ? 71  THR A HB   1  
ATOM   1071  H  HG1  . THR A 1 71 ? 66.282 -6.212  -6.714  1.00 0.00  ? 71  THR A HG1  1  
ATOM   1072  H  HG21 . THR A 1 71 ? 63.552 -6.313  -4.528  1.00 0.00  ? 71  THR A HG21 1  
ATOM   1073  H  HG22 . THR A 1 71 ? 64.335 -7.584  -5.468  1.00 0.00  ? 71  THR A HG22 1  
ATOM   1074  H  HG23 . THR A 1 71 ? 63.965 -6.029  -6.217  1.00 0.00  ? 71  THR A HG23 1  
ATOM   1075  N  N    . VAL A 1 72 ? 64.197 -3.657  -2.966  1.00 0.00  ? 72  VAL A N    1  
ATOM   1076  C  CA   . VAL A 1 72 ? 63.950 -3.210  -1.559  1.00 0.00  ? 72  VAL A CA   1  
ATOM   1077  C  C    . VAL A 1 72 ? 63.933 -4.419  -0.613  1.00 0.00  ? 72  VAL A C    1  
ATOM   1078  O  O    . VAL A 1 72 ? 63.028 -5.235  -0.642  1.00 0.00  ? 72  VAL A O    1  
ATOM   1079  C  CB   . VAL A 1 72 ? 62.581 -2.508  -1.594  1.00 0.00  ? 72  VAL A CB   1  
ATOM   1080  C  CG1  . VAL A 1 72 ? 61.951 -2.504  -0.198  1.00 0.00  ? 72  VAL A CG1  1  
ATOM   1081  C  CG2  . VAL A 1 72 ? 62.765 -1.063  -2.061  1.00 0.00  ? 72  VAL A CG2  1  
ATOM   1082  H  H    . VAL A 1 72 ? 63.459 -3.675  -3.611  1.00 0.00  ? 72  VAL A H    1  
ATOM   1083  H  HA   . VAL A 1 72 ? 64.711 -2.509  -1.252  1.00 0.00  ? 72  VAL A HA   1  
ATOM   1084  H  HB   . VAL A 1 72 ? 61.929 -3.028  -2.280  1.00 0.00  ? 72  VAL A HB   1  
ATOM   1085  H  HG11 . VAL A 1 72 ? 62.721 -2.364  0.545   1.00 0.00  ? 72  VAL A HG11 1  
ATOM   1086  H  HG12 . VAL A 1 72 ? 61.452 -3.447  -0.026  1.00 0.00  ? 72  VAL A HG12 1  
ATOM   1087  H  HG13 . VAL A 1 72 ? 61.233 -1.700  -0.129  1.00 0.00  ? 72  VAL A HG13 1  
ATOM   1088  H  HG21 . VAL A 1 72 ? 63.633 -0.636  -1.579  1.00 0.00  ? 72  VAL A HG21 1  
ATOM   1089  H  HG22 . VAL A 1 72 ? 61.889 -0.486  -1.802  1.00 0.00  ? 72  VAL A HG22 1  
ATOM   1090  H  HG23 . VAL A 1 72 ? 62.903 -1.045  -3.132  1.00 0.00  ? 72  VAL A HG23 1  
ATOM   1091  N  N    . ASP A 1 73 ? 64.930 -4.531  0.226   1.00 0.00  ? 73  ASP A N    1  
ATOM   1092  C  CA   . ASP A 1 73 ? 64.988 -5.676  1.187   1.00 0.00  ? 73  ASP A CA   1  
ATOM   1093  C  C    . ASP A 1 73 ? 64.128 -5.353  2.420   1.00 0.00  ? 73  ASP A C    1  
ATOM   1094  O  O    . ASP A 1 73 ? 63.456 -4.338  2.465   1.00 0.00  ? 73  ASP A O    1  
ATOM   1095  C  CB   . ASP A 1 73 ? 66.475 -5.811  1.574   1.00 0.00  ? 73  ASP A CB   1  
ATOM   1096  C  CG   . ASP A 1 73 ? 67.359 -6.031  0.330   1.00 0.00  ? 73  ASP A CG   1  
ATOM   1097  O  OD1  . ASP A 1 73 ? 66.831 -6.333  -0.729  1.00 0.00  ? 73  ASP A OD1  1  
ATOM   1098  O  OD2  . ASP A 1 73 ? 68.564 -5.890  0.462   1.00 0.00  ? 73  ASP A OD2  1  
ATOM   1099  H  H    . ASP A 1 73 ? 65.642 -3.858  0.227   1.00 0.00  ? 73  ASP A H    1  
ATOM   1100  H  HA   . ASP A 1 73 ? 64.643 -6.582  0.714   1.00 0.00  ? 73  ASP A HA   1  
ATOM   1101  H  HB2  . ASP A 1 73 ? 66.794 -4.910  2.078   1.00 0.00  ? 73  ASP A HB2  1  
ATOM   1102  H  HB3  . ASP A 1 73 ? 66.592 -6.650  2.242   1.00 0.00  ? 73  ASP A HB3  1  
ATOM   1103  N  N    . PHE A 1 74 ? 64.145 -6.199  3.422   1.00 0.00  ? 74  PHE A N    1  
ATOM   1104  C  CA   . PHE A 1 74 ? 63.328 -5.924  4.649   1.00 0.00  ? 74  PHE A CA   1  
ATOM   1105  C  C    . PHE A 1 74 ? 63.782 -4.606  5.291   1.00 0.00  ? 74  PHE A C    1  
ATOM   1106  O  O    . PHE A 1 74 ? 62.975 -3.758  5.624   1.00 0.00  ? 74  PHE A O    1  
ATOM   1107  C  CB   . PHE A 1 74 ? 63.589 -7.106  5.591   1.00 0.00  ? 74  PHE A CB   1  
ATOM   1108  C  CG   . PHE A 1 74 ? 63.066 -6.778  6.973   1.00 0.00  ? 74  PHE A CG   1  
ATOM   1109  C  CD1  . PHE A 1 74 ? 61.687 -6.782  7.219   1.00 0.00  ? 74  PHE A CD1  1  
ATOM   1110  C  CD2  . PHE A 1 74 ? 63.959 -6.464  8.006   1.00 0.00  ? 74  PHE A CD2  1  
ATOM   1111  C  CE1  . PHE A 1 74 ? 61.201 -6.474  8.496   1.00 0.00  ? 74  PHE A CE1  1  
ATOM   1112  C  CE2  . PHE A 1 74 ? 63.472 -6.157  9.282   1.00 0.00  ? 74  PHE A CE2  1  
ATOM   1113  C  CZ   . PHE A 1 74 ? 62.094 -6.161  9.527   1.00 0.00  ? 74  PHE A CZ   1  
ATOM   1114  H  H    . PHE A 1 74 ? 64.699 -7.005  3.371   1.00 0.00  ? 74  PHE A H    1  
ATOM   1115  H  HA   . PHE A 1 74 ? 62.279 -5.877  4.398   1.00 0.00  ? 74  PHE A HA   1  
ATOM   1116  H  HB2  . PHE A 1 74 ? 63.084 -7.983  5.215   1.00 0.00  ? 74  PHE A HB2  1  
ATOM   1117  H  HB3  . PHE A 1 74 ? 64.651 -7.296  5.645   1.00 0.00  ? 74  PHE A HB3  1  
ATOM   1118  H  HD1  . PHE A 1 74 ? 60.998 -7.023  6.425   1.00 0.00  ? 74  PHE A HD1  1  
ATOM   1119  H  HD2  . PHE A 1 74 ? 65.022 -6.459  7.818   1.00 0.00  ? 74  PHE A HD2  1  
ATOM   1120  H  HE1  . PHE A 1 74 ? 60.138 -6.476  8.684   1.00 0.00  ? 74  PHE A HE1  1  
ATOM   1121  H  HE2  . PHE A 1 74 ? 64.161 -5.915  10.078  1.00 0.00  ? 74  PHE A HE2  1  
ATOM   1122  H  HZ   . PHE A 1 74 ? 61.721 -5.923  10.512  1.00 0.00  ? 74  PHE A HZ   1  
ATOM   1123  N  N    . ASP A 1 75 ? 65.070 -4.432  5.456   1.00 0.00  ? 75  ASP A N    1  
ATOM   1124  C  CA   . ASP A 1 75 ? 65.593 -3.172  6.064   1.00 0.00  ? 75  ASP A CA   1  
ATOM   1125  C  C    . ASP A 1 75 ? 65.226 -1.969  5.185   1.00 0.00  ? 75  ASP A C    1  
ATOM   1126  O  O    . ASP A 1 75 ? 64.658 -1.004  5.655   1.00 0.00  ? 75  ASP A O    1  
ATOM   1127  C  CB   . ASP A 1 75 ? 67.111 -3.365  6.116   1.00 0.00  ? 75  ASP A CB   1  
ATOM   1128  C  CG   . ASP A 1 75 ? 67.761 -2.141  6.762   1.00 0.00  ? 75  ASP A CG   1  
ATOM   1129  O  OD1  . ASP A 1 75 ? 67.813 -2.096  7.980   1.00 0.00  ? 75  ASP A OD1  1  
ATOM   1130  O  OD2  . ASP A 1 75 ? 68.194 -1.268  6.028   1.00 0.00  ? 75  ASP A OD2  1  
ATOM   1131  H  H    . ASP A 1 75 ? 65.696 -5.132  5.171   1.00 0.00  ? 75  ASP A H    1  
ATOM   1132  H  HA   . ASP A 1 75 ? 65.203 -3.045  7.061   1.00 0.00  ? 75  ASP A HA   1  
ATOM   1133  H  HB2  . ASP A 1 75 ? 67.342 -4.246  6.697   1.00 0.00  ? 75  ASP A HB2  1  
ATOM   1134  H  HB3  . ASP A 1 75 ? 67.492 -3.487  5.113   1.00 0.00  ? 75  ASP A HB3  1  
ATOM   1135  N  N    . GLU A 1 76 ? 65.540 -2.028  3.912   1.00 0.00  ? 76  GLU A N    1  
ATOM   1136  C  CA   . GLU A 1 76 ? 65.205 -0.893  2.991   1.00 0.00  ? 76  GLU A CA   1  
ATOM   1137  C  C    . GLU A 1 76 ? 63.695 -0.615  3.007   1.00 0.00  ? 76  GLU A C    1  
ATOM   1138  O  O    . GLU A 1 76 ? 63.269 0.524   2.977   1.00 0.00  ? 76  GLU A O    1  
ATOM   1139  C  CB   . GLU A 1 76 ? 65.656 -1.358  1.605   1.00 0.00  ? 76  GLU A CB   1  
ATOM   1140  C  CG   . GLU A 1 76 ? 67.188 -1.289  1.513   1.00 0.00  ? 76  GLU A CG   1  
ATOM   1141  C  CD   . GLU A 1 76 ? 67.713 -2.381  0.573   1.00 0.00  ? 76  GLU A CD   1  
ATOM   1142  O  OE1  . GLU A 1 76 ? 67.056 -2.661  -0.413  1.00 0.00  ? 76  GLU A OE1  1  
ATOM   1143  O  OE2  . GLU A 1 76 ? 68.772 -2.917  0.849   1.00 0.00  ? 76  GLU A OE2  1  
ATOM   1144  H  H    . GLU A 1 76 ? 65.992 -2.823  3.559   1.00 0.00  ? 76  GLU A H    1  
ATOM   1145  H  HA   . GLU A 1 76 ? 65.751 -0.007  3.276   1.00 0.00  ? 76  GLU A HA   1  
ATOM   1146  H  HB2  . GLU A 1 76 ? 65.328 -2.374  1.444   1.00 0.00  ? 76  GLU A HB2  1  
ATOM   1147  H  HB3  . GLU A 1 76 ? 65.224 -0.716  0.852   1.00 0.00  ? 76  GLU A HB3  1  
ATOM   1148  H  HG2  . GLU A 1 76 ? 67.480 -0.321  1.134   1.00 0.00  ? 76  GLU A HG2  1  
ATOM   1149  H  HG3  . GLU A 1 76 ? 67.613 -1.432  2.496   1.00 0.00  ? 76  GLU A HG3  1  
ATOM   1150  N  N    . PHE A 1 77 ? 62.885 -1.646  3.072   1.00 0.00  ? 77  PHE A N    1  
ATOM   1151  C  CA   . PHE A 1 77 ? 61.404 -1.439  3.113   1.00 0.00  ? 77  PHE A CA   1  
ATOM   1152  C  C    . PHE A 1 77 ? 61.025 -0.681  4.392   1.00 0.00  ? 77  PHE A C    1  
ATOM   1153  O  O    . PHE A 1 77 ? 60.299 0.295   4.352   1.00 0.00  ? 77  PHE A O    1  
ATOM   1154  C  CB   . PHE A 1 77 ? 60.805 -2.849  3.116   1.00 0.00  ? 77  PHE A CB   1  
ATOM   1155  C  CG   . PHE A 1 77 ? 59.298 -2.766  3.164   1.00 0.00  ? 77  PHE A CG   1  
ATOM   1156  C  CD1  . PHE A 1 77 ? 58.591 -2.170  2.111   1.00 0.00  ? 77  PHE A CD1  1  
ATOM   1157  C  CD2  . PHE A 1 77 ? 58.606 -3.290  4.262   1.00 0.00  ? 77  PHE A CD2  1  
ATOM   1158  C  CE1  . PHE A 1 77 ? 57.194 -2.099  2.158   1.00 0.00  ? 77  PHE A CE1  1  
ATOM   1159  C  CE2  . PHE A 1 77 ? 57.209 -3.218  4.308   1.00 0.00  ? 77  PHE A CE2  1  
ATOM   1160  C  CZ   . PHE A 1 77 ? 56.503 -2.623  3.257   1.00 0.00  ? 77  PHE A CZ   1  
ATOM   1161  H  H    . PHE A 1 77 ? 63.253 -2.555  3.108   1.00 0.00  ? 77  PHE A H    1  
ATOM   1162  H  HA   . PHE A 1 77 ? 61.074 -0.898  2.240   1.00 0.00  ? 77  PHE A HA   1  
ATOM   1163  H  HB2  . PHE A 1 77 ? 61.108 -3.370  2.219   1.00 0.00  ? 77  PHE A HB2  1  
ATOM   1164  H  HB3  . PHE A 1 77 ? 61.163 -3.388  3.981   1.00 0.00  ? 77  PHE A HB3  1  
ATOM   1165  H  HD1  . PHE A 1 77 ? 59.124 -1.766  1.264   1.00 0.00  ? 77  PHE A HD1  1  
ATOM   1166  H  HD2  . PHE A 1 77 ? 59.150 -3.749  5.074   1.00 0.00  ? 77  PHE A HD2  1  
ATOM   1167  H  HE1  . PHE A 1 77 ? 56.649 -1.639  1.346   1.00 0.00  ? 77  PHE A HE1  1  
ATOM   1168  H  HE2  . PHE A 1 77 ? 56.675 -3.623  5.156   1.00 0.00  ? 77  PHE A HE2  1  
ATOM   1169  H  HZ   . PHE A 1 77 ? 55.425 -2.569  3.293   1.00 0.00  ? 77  PHE A HZ   1  
ATOM   1170  N  N    . LEU A 1 78 ? 61.530 -1.113  5.524   1.00 0.00  ? 78  LEU A N    1  
ATOM   1171  C  CA   . LEU A 1 78 ? 61.218 -0.409  6.807   1.00 0.00  ? 78  LEU A CA   1  
ATOM   1172  C  C    . LEU A 1 78 ? 61.939 0.958   6.841   1.00 0.00  ? 78  LEU A C    1  
ATOM   1173  O  O    . LEU A 1 78 ? 61.438 1.913   7.406   1.00 0.00  ? 78  LEU A O    1  
ATOM   1174  C  CB   . LEU A 1 78 ? 61.687 -1.375  7.921   1.00 0.00  ? 78  LEU A CB   1  
ATOM   1175  C  CG   . LEU A 1 78 ? 62.903 -0.830  8.676   1.00 0.00  ? 78  LEU A CG   1  
ATOM   1176  C  CD1  . LEU A 1 78 ? 62.425 0.017   9.854   1.00 0.00  ? 78  LEU A CD1  1  
ATOM   1177  C  CD2  . LEU A 1 78 ? 63.732 -2.002  9.207   1.00 0.00  ? 78  LEU A CD2  1  
ATOM   1178  H  H    . LEU A 1 78 ? 62.126 -1.893  5.526   1.00 0.00  ? 78  LEU A H    1  
ATOM   1179  H  HA   . LEU A 1 78 ? 60.151 -0.257  6.887   1.00 0.00  ? 78  LEU A HA   1  
ATOM   1180  H  HB2  . LEU A 1 78 ? 60.879 -1.520  8.625   1.00 0.00  ? 78  LEU A HB2  1  
ATOM   1181  H  HB3  . LEU A 1 78 ? 61.943 -2.328  7.479   1.00 0.00  ? 78  LEU A HB3  1  
ATOM   1182  H  HG   . LEU A 1 78 ? 63.506 -0.228  8.014   1.00 0.00  ? 78  LEU A HG   1  
ATOM   1183  H  HD11 . LEU A 1 78 ? 61.486 0.489   9.603   1.00 0.00  ? 78  LEU A HD11 1  
ATOM   1184  H  HD12 . LEU A 1 78 ? 63.161 0.773   10.076  1.00 0.00  ? 78  LEU A HD12 1  
ATOM   1185  H  HD13 . LEU A 1 78 ? 62.287 -0.617  10.717  1.00 0.00  ? 78  LEU A HD13 1  
ATOM   1186  H  HD21 . LEU A 1 78 ? 64.611 -2.127  8.595   1.00 0.00  ? 78  LEU A HD21 1  
ATOM   1187  H  HD22 . LEU A 1 78 ? 63.140 -2.906  9.176   1.00 0.00  ? 78  LEU A HD22 1  
ATOM   1188  H  HD23 . LEU A 1 78 ? 64.029 -1.803  10.225  1.00 0.00  ? 78  LEU A HD23 1  
ATOM   1189  N  N    . VAL A 1 79 ? 63.090 1.065   6.210   1.00 0.00  ? 79  VAL A N    1  
ATOM   1190  C  CA   . VAL A 1 79 ? 63.818 2.377   6.175   1.00 0.00  ? 79  VAL A CA   1  
ATOM   1191  C  C    . VAL A 1 79 ? 63.020 3.372   5.319   1.00 0.00  ? 79  VAL A C    1  
ATOM   1192  O  O    . VAL A 1 79 ? 62.902 4.536   5.648   1.00 0.00  ? 79  VAL A O    1  
ATOM   1193  C  CB   . VAL A 1 79 ? 65.184 2.073   5.533   1.00 0.00  ? 79  VAL A CB   1  
ATOM   1194  C  CG1  . VAL A 1 79 ? 65.788 3.355   4.951   1.00 0.00  ? 79  VAL A CG1  1  
ATOM   1195  C  CG2  . VAL A 1 79 ? 66.137 1.512   6.592   1.00 0.00  ? 79  VAL A CG2  1  
ATOM   1196  H  H    . VAL A 1 79 ? 63.463 0.288   5.740   1.00 0.00  ? 79  VAL A H    1  
ATOM   1197  H  HA   . VAL A 1 79 ? 63.953 2.761   7.173   1.00 0.00  ? 79  VAL A HA   1  
ATOM   1198  H  HB   . VAL A 1 79 ? 65.056 1.347   4.742   1.00 0.00  ? 79  VAL A HB   1  
ATOM   1199  H  HG11 . VAL A 1 79 ? 65.771 4.133   5.701   1.00 0.00  ? 79  VAL A HG11 1  
ATOM   1200  H  HG12 . VAL A 1 79 ? 65.210 3.669   4.094   1.00 0.00  ? 79  VAL A HG12 1  
ATOM   1201  H  HG13 . VAL A 1 79 ? 66.808 3.169   4.649   1.00 0.00  ? 79  VAL A HG13 1  
ATOM   1202  H  HG21 . VAL A 1 79 ? 65.911 0.470   6.766   1.00 0.00  ? 79  VAL A HG21 1  
ATOM   1203  H  HG22 . VAL A 1 79 ? 66.017 2.065   7.512   1.00 0.00  ? 79  VAL A HG22 1  
ATOM   1204  H  HG23 . VAL A 1 79 ? 67.155 1.605   6.246   1.00 0.00  ? 79  VAL A HG23 1  
ATOM   1205  N  N    . MET A 1 80 ? 62.460 2.907   4.229   1.00 0.00  ? 80  MET A N    1  
ATOM   1206  C  CA   . MET A 1 80 ? 61.647 3.800   3.347   1.00 0.00  ? 80  MET A CA   1  
ATOM   1207  C  C    . MET A 1 80 ? 60.349 4.207   4.066   1.00 0.00  ? 80  MET A C    1  
ATOM   1208  O  O    . MET A 1 80 ? 59.789 5.255   3.806   1.00 0.00  ? 80  MET A O    1  
ATOM   1209  C  CB   . MET A 1 80 ? 61.338 2.948   2.111   1.00 0.00  ? 80  MET A CB   1  
ATOM   1210  C  CG   . MET A 1 80 ? 60.679 3.810   1.032   1.00 0.00  ? 80  MET A CG   1  
ATOM   1211  S  SD   . MET A 1 80 ? 60.970 3.068   -0.596  1.00 0.00  ? 80  MET A SD   1  
ATOM   1212  C  CE   . MET A 1 80 ? 60.220 1.455   -0.260  1.00 0.00  ? 80  MET A CE   1  
ATOM   1213  H  H    . MET A 1 80 ? 62.565 1.960   3.996   1.00 0.00  ? 80  MET A H    1  
ATOM   1214  H  HA   . MET A 1 80 ? 62.215 4.673   3.064   1.00 0.00  ? 80  MET A HA   1  
ATOM   1215  H  HB2  . MET A 1 80 ? 62.256 2.528   1.726   1.00 0.00  ? 80  MET A HB2  1  
ATOM   1216  H  HB3  . MET A 1 80 ? 60.667 2.149   2.388   1.00 0.00  ? 80  MET A HB3  1  
ATOM   1217  H  HG2  . MET A 1 80 ? 59.617 3.868   1.218   1.00 0.00  ? 80  MET A HG2  1  
ATOM   1218  H  HG3  . MET A 1 80 ? 61.103 4.804   1.057   1.00 0.00  ? 80  MET A HG3  1  
ATOM   1219  H  HE1  . MET A 1 80 ? 59.850 1.033   -1.183  1.00 0.00  ? 80  MET A HE1  1  
ATOM   1220  H  HE2  . MET A 1 80 ? 59.403 1.572   0.431   1.00 0.00  ? 80  MET A HE2  1  
ATOM   1221  H  HE3  . MET A 1 80 ? 60.963 0.798   0.172   1.00 0.00  ? 80  MET A HE3  1  
ATOM   1222  N  N    . MET A 1 81 ? 59.871 3.379   4.968   1.00 0.00  ? 81  MET A N    1  
ATOM   1223  C  CA   . MET A 1 81 ? 58.614 3.704   5.711   1.00 0.00  ? 81  MET A CA   1  
ATOM   1224  C  C    . MET A 1 81 ? 58.823 4.911   6.632   1.00 0.00  ? 81  MET A C    1  
ATOM   1225  O  O    . MET A 1 81 ? 58.099 5.885   6.553   1.00 0.00  ? 81  MET A O    1  
ATOM   1226  C  CB   . MET A 1 81 ? 58.310 2.454   6.539   1.00 0.00  ? 81  MET A CB   1  
ATOM   1227  C  CG   . MET A 1 81 ? 57.677 1.394   5.642   1.00 0.00  ? 81  MET A CG   1  
ATOM   1228  S  SD   . MET A 1 81 ? 55.909 1.733   5.476   1.00 0.00  ? 81  MET A SD   1  
ATOM   1229  C  CE   . MET A 1 81 ? 55.651 0.748   3.987   1.00 0.00  ? 81  MET A CE   1  
ATOM   1230  H  H    . MET A 1 81 ? 60.340 2.539   5.155   1.00 0.00  ? 81  MET A H    1  
ATOM   1231  H  HA   . MET A 1 81 ? 57.806 3.892   5.021   1.00 0.00  ? 81  MET A HA   1  
ATOM   1232  H  HB2  . MET A 1 81 ? 59.227 2.069   6.961   1.00 0.00  ? 81  MET A HB2  1  
ATOM   1233  H  HB3  . MET A 1 81 ? 57.625 2.705   7.334   1.00 0.00  ? 81  MET A HB3  1  
ATOM   1234  H  HG2  . MET A 1 81 ? 58.143 1.421   4.668   1.00 0.00  ? 81  MET A HG2  1  
ATOM   1235  H  HG3  . MET A 1 81 ? 57.818 0.419   6.082   1.00 0.00  ? 81  MET A HG3  1  
ATOM   1236  H  HE1  . MET A 1 81 ? 56.520 0.834   3.349   1.00 0.00  ? 81  MET A HE1  1  
ATOM   1237  H  HE2  . MET A 1 81 ? 54.783 1.108   3.459   1.00 0.00  ? 81  MET A HE2  1  
ATOM   1238  H  HE3  . MET A 1 81 ? 55.502 -0.286  4.266   1.00 0.00  ? 81  MET A HE3  1  
ATOM   1239  N  N    . VAL A 1 82 ? 59.804 4.855   7.506   1.00 0.00  ? 82  VAL A N    1  
ATOM   1240  C  CA   . VAL A 1 82 ? 60.051 6.009   8.436   1.00 0.00  ? 82  VAL A CA   1  
ATOM   1241  C  C    . VAL A 1 82 ? 60.348 7.291   7.643   1.00 0.00  ? 82  VAL A C    1  
ATOM   1242  O  O    . VAL A 1 82 ? 60.026 8.377   8.083   1.00 0.00  ? 82  VAL A O    1  
ATOM   1243  C  CB   . VAL A 1 82 ? 61.255 5.620   9.316   1.00 0.00  ? 82  VAL A CB   1  
ATOM   1244  C  CG1  . VAL A 1 82 ? 60.967 4.302   10.039  1.00 0.00  ? 82  VAL A CG1  1  
ATOM   1245  C  CG2  . VAL A 1 82 ? 62.517 5.461   8.461   1.00 0.00  ? 82  VAL A CG2  1  
ATOM   1246  H  H    . VAL A 1 82 ? 60.373 4.057   7.550   1.00 0.00  ? 82  VAL A H    1  
ATOM   1247  H  HA   . VAL A 1 82 ? 59.185 6.163   9.062   1.00 0.00  ? 82  VAL A HA   1  
ATOM   1248  H  HB   . VAL A 1 82 ? 61.417 6.395   10.052  1.00 0.00  ? 82  VAL A HB   1  
ATOM   1249  H  HG11 . VAL A 1 82 ? 61.541 4.261   10.952  1.00 0.00  ? 82  VAL A HG11 1  
ATOM   1250  H  HG12 . VAL A 1 82 ? 61.244 3.474   9.403   1.00 0.00  ? 82  VAL A HG12 1  
ATOM   1251  H  HG13 . VAL A 1 82 ? 59.915 4.241   10.272  1.00 0.00  ? 82  VAL A HG13 1  
ATOM   1252  H  HG21 . VAL A 1 82 ? 62.709 6.379   7.925   1.00 0.00  ? 82  VAL A HG21 1  
ATOM   1253  H  HG22 . VAL A 1 82 ? 62.378 4.655   7.757   1.00 0.00  ? 82  VAL A HG22 1  
ATOM   1254  H  HG23 . VAL A 1 82 ? 63.358 5.237   9.101   1.00 0.00  ? 82  VAL A HG23 1  
ATOM   1255  N  N    . ARG A 1 83 ? 60.942 7.172   6.477   1.00 0.00  ? 83  ARG A N    1  
ATOM   1256  C  CA   . ARG A 1 83 ? 61.248 8.384   5.648   1.00 0.00  ? 83  ARG A CA   1  
ATOM   1257  C  C    . ARG A 1 83 ? 59.982 9.234   5.459   1.00 0.00  ? 83  ARG A C    1  
ATOM   1258  O  O    . ARG A 1 83 ? 59.999 10.435  5.651   1.00 0.00  ? 83  ARG A O    1  
ATOM   1259  C  CB   . ARG A 1 83 ? 61.734 7.835   4.303   1.00 0.00  ? 83  ARG A CB   1  
ATOM   1260  C  CG   . ARG A 1 83 ? 63.264 7.753   4.303   1.00 0.00  ? 83  ARG A CG   1  
ATOM   1261  C  CD   . ARG A 1 83 ? 63.789 7.981   2.883   1.00 0.00  ? 83  ARG A CD   1  
ATOM   1262  N  NE   . ARG A 1 83 ? 63.609 9.441   2.631   1.00 0.00  ? 83  ARG A NE   1  
ATOM   1263  C  CZ   . ARG A 1 83 ? 62.811 9.846   1.684   1.00 0.00  ? 83  ARG A CZ   1  
ATOM   1264  N  NH1  . ARG A 1 83 ? 63.079 9.564   0.443   1.00 0.00  ? 83  ARG A NH1  1  
ATOM   1265  N  NH2  . ARG A 1 83 ? 61.747 10.535  1.983   1.00 0.00  ? 83  ARG A NH2  1  
ATOM   1266  H  H    . ARG A 1 83 ? 61.182 6.282   6.142   1.00 0.00  ? 83  ARG A H    1  
ATOM   1267  H  HA   . ARG A 1 83 ? 62.027 8.969   6.111   1.00 0.00  ? 83  ARG A HA   1  
ATOM   1268  H  HB2  . ARG A 1 83 ? 61.321 6.850   4.148   1.00 0.00  ? 83  ARG A HB2  1  
ATOM   1269  H  HB3  . ARG A 1 83 ? 61.411 8.490   3.508   1.00 0.00  ? 83  ARG A HB3  1  
ATOM   1270  H  HG2  . ARG A 1 83 ? 63.666 8.509   4.962   1.00 0.00  ? 83  ARG A HG2  1  
ATOM   1271  H  HG3  . ARG A 1 83 ? 63.571 6.776   4.646   1.00 0.00  ? 83  ARG A HG3  1  
ATOM   1272  H  HD2  . ARG A 1 83 ? 64.836 7.712   2.823   1.00 0.00  ? 83  ARG A HD2  1  
ATOM   1273  H  HD3  . ARG A 1 83 ? 63.212 7.408   2.172   1.00 0.00  ? 83  ARG A HD3  1  
ATOM   1274  H  HE   . ARG A 1 83 ? 64.089 10.097  3.180   1.00 0.00  ? 83  ARG A HE   1  
ATOM   1275  H  HH11 . ARG A 1 83 ? 63.901 9.039   0.215   1.00 0.00  ? 83  ARG A HH11 1  
ATOM   1276  H  HH12 . ARG A 1 83 ? 62.464 9.865   -0.285  1.00 0.00  ? 83  ARG A HH12 1  
ATOM   1277  H  HH21 . ARG A 1 83 ? 61.545 10.754  2.938   1.00 0.00  ? 83  ARG A HH21 1  
ATOM   1278  H  HH22 . ARG A 1 83 ? 61.132 10.847  1.259   1.00 0.00  ? 83  ARG A HH22 1  
ATOM   1279  N  N    . CYS A 1 84 ? 58.881 8.613   5.104   1.00 0.00  ? 84  CYS A N    1  
ATOM   1280  C  CA   . CYS A 1 84 ? 57.605 9.379   4.925   1.00 0.00  ? 84  CYS A CA   1  
ATOM   1281  C  C    . CYS A 1 84 ? 56.770 9.346   6.221   1.00 0.00  ? 84  CYS A C    1  
ATOM   1282  O  O    . CYS A 1 84 ? 55.736 9.981   6.315   1.00 0.00  ? 84  CYS A O    1  
ATOM   1283  C  CB   . CYS A 1 84 ? 56.866 8.674   3.783   1.00 0.00  ? 84  CYS A CB   1  
ATOM   1284  S  SG   . CYS A 1 84 ? 57.604 9.154   2.200   1.00 0.00  ? 84  CYS A SG   1  
ATOM   1285  H  H    . CYS A 1 84 ? 58.890 7.640   4.970   1.00 0.00  ? 84  CYS A H    1  
ATOM   1286  H  HA   . CYS A 1 84 ? 57.819 10.399  4.647   1.00 0.00  ? 84  CYS A HA   1  
ATOM   1287  H  HB2  . CYS A 1 84 ? 56.943 7.604   3.906   1.00 0.00  ? 84  CYS A HB2  1  
ATOM   1288  H  HB3  . CYS A 1 84 ? 55.825 8.964   3.796   1.00 0.00  ? 84  CYS A HB3  1  
ATOM   1289  H  HG   . CYS A 1 84 ? 57.146 9.936   1.884   1.00 0.00  ? 84  CYS A HG   1  
ATOM   1290  N  N    . MET A 1 85 ? 57.216 8.618   7.221   1.00 0.00  ? 85  MET A N    1  
ATOM   1291  C  CA   . MET A 1 85 ? 56.464 8.547   8.514   1.00 0.00  ? 85  MET A CA   1  
ATOM   1292  C  C    . MET A 1 85 ? 56.788 9.757   9.412   1.00 0.00  ? 85  MET A C    1  
ATOM   1293  O  O    . MET A 1 85 ? 56.123 9.983   10.405  1.00 0.00  ? 85  MET A O    1  
ATOM   1294  C  CB   . MET A 1 85 ? 56.943 7.250   9.176   1.00 0.00  ? 85  MET A CB   1  
ATOM   1295  C  CG   . MET A 1 85 ? 55.838 6.687   10.072  1.00 0.00  ? 85  MET A CG   1  
ATOM   1296  S  SD   . MET A 1 85 ? 56.572 6.018   11.586  1.00 0.00  ? 85  MET A SD   1  
ATOM   1297  C  CE   . MET A 1 85 ? 57.028 4.399   10.918  1.00 0.00  ? 85  MET A CE   1  
ATOM   1298  H  H    . MET A 1 85 ? 58.052 8.120   7.124   1.00 0.00  ? 85  MET A H    1  
ATOM   1299  H  HA   . MET A 1 85 ? 55.403 8.491   8.329   1.00 0.00  ? 85  MET A HA   1  
ATOM   1300  H  HB2  . MET A 1 85 ? 57.190 6.527   8.415   1.00 0.00  ? 85  MET A HB2  1  
ATOM   1301  H  HB3  . MET A 1 85 ? 57.818 7.453   9.776   1.00 0.00  ? 85  MET A HB3  1  
ATOM   1302  H  HG2  . MET A 1 85 ? 55.143 7.472   10.326  1.00 0.00  ? 85  MET A HG2  1  
ATOM   1303  H  HG3  . MET A 1 85 ? 55.316 5.900   9.547   1.00 0.00  ? 85  MET A HG3  1  
ATOM   1304  H  HE1  . MET A 1 85 ? 57.553 3.833   11.675  1.00 0.00  ? 85  MET A HE1  1  
ATOM   1305  H  HE2  . MET A 1 85 ? 57.669 4.530   10.061  1.00 0.00  ? 85  MET A HE2  1  
ATOM   1306  H  HE3  . MET A 1 85 ? 56.134 3.870   10.620  1.00 0.00  ? 85  MET A HE3  1  
ATOM   1307  N  N    . LYS A 1 86 ? 57.807 10.529  9.074   1.00 0.00  ? 86  LYS A N    1  
ATOM   1308  C  CA   . LYS A 1 86 ? 58.191 11.725  9.903   1.00 0.00  ? 86  LYS A CA   1  
ATOM   1309  C  C    . LYS A 1 86 ? 58.643 11.286  11.309  1.00 0.00  ? 86  LYS A C    1  
ATOM   1310  O  O    . LYS A 1 86 ? 58.734 10.107  11.599  1.00 0.00  ? 86  LYS A O    1  
ATOM   1311  C  CB   . LYS A 1 86 ? 56.936 12.613  9.972   1.00 0.00  ? 86  LYS A CB   1  
ATOM   1312  C  CG   . LYS A 1 86 ? 56.917 13.575  8.779   1.00 0.00  ? 86  LYS A CG   1  
ATOM   1313  C  CD   . LYS A 1 86 ? 56.363 12.855  7.543   1.00 0.00  ? 86  LYS A CD   1  
ATOM   1314  C  CE   . LYS A 1 86 ? 54.886 13.217  7.344   1.00 0.00  ? 86  LYS A CE   1  
ATOM   1315  N  NZ   . LYS A 1 86 ? 54.131 11.936  7.506   1.00 0.00  ? 86  LYS A NZ   1  
ATOM   1316  H  H    . LYS A 1 86 ? 58.328 10.318  8.272   1.00 0.00  ? 86  LYS A H    1  
ATOM   1317  H  HA   . LYS A 1 86 ? 58.989 12.266  9.417   1.00 0.00  ? 86  LYS A HA   1  
ATOM   1318  H  HB2  . LYS A 1 86 ? 56.052 11.994  9.947   1.00 0.00  ? 86  LYS A HB2  1  
ATOM   1319  H  HB3  . LYS A 1 86 ? 56.948 13.183  10.889  1.00 0.00  ? 86  LYS A HB3  1  
ATOM   1320  H  HG2  . LYS A 1 86 ? 56.291 14.426  9.014   1.00 0.00  ? 86  LYS A HG2  1  
ATOM   1321  H  HG3  . LYS A 1 86 ? 57.921 13.915  8.576   1.00 0.00  ? 86  LYS A HG3  1  
ATOM   1322  H  HD2  . LYS A 1 86 ? 56.927 13.156  6.671   1.00 0.00  ? 86  LYS A HD2  1  
ATOM   1323  H  HD3  . LYS A 1 86 ? 56.456 11.788  7.677   1.00 0.00  ? 86  LYS A HD3  1  
ATOM   1324  H  HE2  . LYS A 1 86 ? 54.574 13.936  8.090   1.00 0.00  ? 86  LYS A HE2  1  
ATOM   1325  H  HE3  . LYS A 1 86 ? 54.729 13.614  6.353   1.00 0.00  ? 86  LYS A HE3  1  
ATOM   1326  H  HZ1  . LYS A 1 86 ? 53.812 11.844  8.492   1.00 0.00  ? 86  LYS A HZ1  1  
ATOM   1327  H  HZ2  . LYS A 1 86 ? 54.745 11.130  7.262   1.00 0.00  ? 86  LYS A HZ2  1  
ATOM   1328  H  HZ3  . LYS A 1 86 ? 53.304 11.940  6.876   1.00 0.00  ? 86  LYS A HZ3  1  
ATOM   1329  N  N    . ASP A 1 87 ? 58.941 12.221  12.177  1.00 0.00  ? 87  ASP A N    1  
ATOM   1330  C  CA   . ASP A 1 87 ? 59.399 11.846  13.554  1.00 0.00  ? 87  ASP A CA   1  
ATOM   1331  C  C    . ASP A 1 87 ? 58.330 12.185  14.608  1.00 0.00  ? 87  ASP A C    1  
ATOM   1332  O  O    . ASP A 1 87 ? 57.232 12.598  14.286  1.00 0.00  ? 87  ASP A O    1  
ATOM   1333  C  CB   . ASP A 1 87 ? 60.690 12.650  13.782  1.00 0.00  ? 87  ASP A CB   1  
ATOM   1334  C  CG   . ASP A 1 87 ? 60.380 14.144  13.918  1.00 0.00  ? 87  ASP A CG   1  
ATOM   1335  O  OD1  . ASP A 1 87 ? 59.969 14.740  12.936  1.00 0.00  ? 87  ASP A OD1  1  
ATOM   1336  O  OD2  . ASP A 1 87 ? 60.571 14.664  15.002  1.00 0.00  ? 87  ASP A OD2  1  
ATOM   1337  H  H    . ASP A 1 87 ? 58.874 13.166  11.924  1.00 0.00  ? 87  ASP A H    1  
ATOM   1338  H  HA   . ASP A 1 87 ? 59.624 10.791  13.591  1.00 0.00  ? 87  ASP A HA   1  
ATOM   1339  H  HB2  . ASP A 1 87 ? 61.170 12.303  14.684  1.00 0.00  ? 87  ASP A HB2  1  
ATOM   1340  H  HB3  . ASP A 1 87 ? 61.355 12.500  12.944  1.00 0.00  ? 87  ASP A HB3  1  
ATOM   1341  N  N    . ASP A 1 88 ? 58.647 11.991  15.864  1.00 0.00  ? 88  ASP A N    1  
ATOM   1342  C  CA   . ASP A 1 88 ? 57.659 12.276  16.955  1.00 0.00  ? 88  ASP A CA   1  
ATOM   1343  C  C    . ASP A 1 88 ? 57.865 13.681  17.557  1.00 0.00  ? 88  ASP A C    1  
ATOM   1344  O  O    . ASP A 1 88 ? 56.944 14.262  18.100  1.00 0.00  ? 88  ASP A O    1  
ATOM   1345  C  CB   . ASP A 1 88 ? 57.918 11.188  18.010  1.00 0.00  ? 88  ASP A CB   1  
ATOM   1346  C  CG   . ASP A 1 88 ? 59.271 11.425  18.692  1.00 0.00  ? 88  ASP A CG   1  
ATOM   1347  O  OD1  . ASP A 1 88 ? 60.284 11.171  18.061  1.00 0.00  ? 88  ASP A OD1  1  
ATOM   1348  O  OD2  . ASP A 1 88 ? 59.269 11.860  19.831  1.00 0.00  ? 88  ASP A OD2  1  
ATOM   1349  H  H    . ASP A 1 88 ? 59.535 11.644  16.093  1.00 0.00  ? 88  ASP A H    1  
ATOM   1350  H  HA   . ASP A 1 88 ? 56.653 12.179  16.579  1.00 0.00  ? 88  ASP A HA   1  
ATOM   1351  H  HB2  . ASP A 1 88 ? 57.134 11.215  18.751  1.00 0.00  ? 88  ASP A HB2  1  
ATOM   1352  H  HB3  . ASP A 1 88 ? 57.925 10.220  17.532  1.00 0.00  ? 88  ASP A HB3  1  
ATOM   1353  N  N    . SER A 1 89 ? 59.057 14.223  17.473  1.00 0.00  ? 89  SER A N    1  
ATOM   1354  C  CA   . SER A 1 89 ? 59.309 15.586  18.053  1.00 0.00  ? 89  SER A CA   1  
ATOM   1355  C  C    . SER A 1 89 ? 58.670 16.687  17.188  1.00 0.00  ? 89  SER A C    1  
ATOM   1356  O  O    . SER A 1 89 ? 58.443 17.763  17.715  1.00 0.00  ? 89  SER A O    1  
ATOM   1357  C  CB   . SER A 1 89 ? 60.833 15.740  18.076  1.00 0.00  ? 89  SER A CB   1  
ATOM   1358  O  OG   . SER A 1 89 ? 61.363 15.032  19.192  1.00 0.00  ? 89  SER A OG   1  
ATOM   1359  O  OXT  . SER A 1 89 ? 58.418 16.439  16.018  1.00 0.00  ? 89  SER A OXT  1  
ATOM   1360  H  H    . SER A 1 89 ? 59.786 13.736  17.036  1.00 0.00  ? 89  SER A H    1  
ATOM   1361  H  HA   . SER A 1 89 ? 58.924 15.638  19.059  1.00 0.00  ? 89  SER A HA   1  
ATOM   1362  H  HB2  . SER A 1 89 ? 61.254 15.337  17.170  1.00 0.00  ? 89  SER A HB2  1  
ATOM   1363  H  HB3  . SER A 1 89 ? 61.086 16.790  18.151  1.00 0.00  ? 89  SER A HB3  1  
ATOM   1364  H  HG   . SER A 1 89 ? 61.124 14.105  19.101  1.00 0.00  ? 89  SER A HG   1  
ATOM   1365  N  N    . ARG B 2 1  ? 51.911 15.941  -11.577 1.00 0.00  ? 144 ARG B N    1  
ATOM   1366  C  CA   . ARG B 2 1  ? 52.216 14.486  -11.405 1.00 0.00  ? 144 ARG B CA   1  
ATOM   1367  C  C    . ARG B 2 1  ? 51.506 13.942  -10.159 1.00 0.00  ? 144 ARG B C    1  
ATOM   1368  O  O    . ARG B 2 1  ? 51.467 14.586  -9.128  1.00 0.00  ? 144 ARG B O    1  
ATOM   1369  C  CB   . ARG B 2 1  ? 53.741 14.407  -11.245 1.00 0.00  ? 144 ARG B CB   1  
ATOM   1370  C  CG   . ARG B 2 1  ? 54.335 13.545  -12.365 1.00 0.00  ? 144 ARG B CG   1  
ATOM   1371  C  CD   . ARG B 2 1  ? 54.239 12.064  -11.984 1.00 0.00  ? 144 ARG B CD   1  
ATOM   1372  N  NE   . ARG B 2 1  ? 55.165 11.362  -12.922 1.00 0.00  ? 144 ARG B NE   1  
ATOM   1373  C  CZ   . ARG B 2 1  ? 54.688 10.645  -13.901 1.00 0.00  ? 144 ARG B CZ   1  
ATOM   1374  N  NH1  . ARG B 2 1  ? 54.355 11.218  -15.023 1.00 0.00  ? 144 ARG B NH1  1  
ATOM   1375  N  NH2  . ARG B 2 1  ? 54.548 9.358   -13.758 1.00 0.00  ? 144 ARG B NH2  1  
ATOM   1376  H  H1   . ARG B 2 1  ? 52.207 16.250  -12.525 1.00 0.00  ? 144 ARG B H1   1  
ATOM   1377  H  H2   . ARG B 2 1  ? 52.422 16.492  -10.855 1.00 0.00  ? 144 ARG B H2   1  
ATOM   1378  H  H3   . ARG B 2 1  ? 50.889 16.097  -11.469 1.00 0.00  ? 144 ARG B H3   1  
ATOM   1379  H  HA   . ARG B 2 1  ? 51.908 13.934  -12.280 1.00 0.00  ? 144 ARG B HA   1  
ATOM   1380  H  HB2  . ARG B 2 1  ? 54.160 15.402  -11.299 1.00 0.00  ? 144 ARG B HB2  1  
ATOM   1381  H  HB3  . ARG B 2 1  ? 53.982 13.967  -10.289 1.00 0.00  ? 144 ARG B HB3  1  
ATOM   1382  H  HG2  . ARG B 2 1  ? 53.788 13.718  -13.281 1.00 0.00  ? 144 ARG B HG2  1  
ATOM   1383  H  HG3  . ARG B 2 1  ? 55.371 13.810  -12.510 1.00 0.00  ? 144 ARG B HG3  1  
ATOM   1384  H  HD2  . ARG B 2 1  ? 54.556 11.920  -10.959 1.00 0.00  ? 144 ARG B HD2  1  
ATOM   1385  H  HD3  . ARG B 2 1  ? 53.231 11.705  -12.122 1.00 0.00  ? 144 ARG B HD3  1  
ATOM   1386  H  HE   . ARG B 2 1  ? 56.134 11.438  -12.800 1.00 0.00  ? 144 ARG B HE   1  
ATOM   1387  H  HH11 . ARG B 2 1  ? 54.465 12.205  -15.131 1.00 0.00  ? 144 ARG B HH11 1  
ATOM   1388  H  HH12 . ARG B 2 1  ? 53.989 10.671  -15.774 1.00 0.00  ? 144 ARG B HH12 1  
ATOM   1389  H  HH21 . ARG B 2 1  ? 54.805 8.918   -12.895 1.00 0.00  ? 144 ARG B HH21 1  
ATOM   1390  H  HH22 . ARG B 2 1  ? 54.187 8.807   -14.509 1.00 0.00  ? 144 ARG B HH22 1  
ATOM   1391  N  N    . ARG B 2 2  ? 50.939 12.766  -10.250 1.00 0.00  ? 145 ARG B N    1  
ATOM   1392  C  CA   . ARG B 2 2  ? 50.223 12.181  -9.076  1.00 0.00  ? 145 ARG B CA   1  
ATOM   1393  C  C    . ARG B 2 2  ? 50.948 10.916  -8.583  1.00 0.00  ? 145 ARG B C    1  
ATOM   1394  O  O    . ARG B 2 2  ? 50.374 9.845   -8.516  1.00 0.00  ? 145 ARG B O    1  
ATOM   1395  C  CB   . ARG B 2 2  ? 48.825 11.843  -9.607  1.00 0.00  ? 145 ARG B CB   1  
ATOM   1396  C  CG   . ARG B 2 2  ? 47.810 11.901  -8.462  1.00 0.00  ? 145 ARG B CG   1  
ATOM   1397  C  CD   . ARG B 2 2  ? 46.934 13.149  -8.615  1.00 0.00  ? 145 ARG B CD   1  
ATOM   1398  N  NE   . ARG B 2 2  ? 45.692 12.667  -9.287  1.00 0.00  ? 145 ARG B NE   1  
ATOM   1399  C  CZ   . ARG B 2 2  ? 44.538 12.775  -8.691  1.00 0.00  ? 145 ARG B CZ   1  
ATOM   1400  N  NH1  . ARG B 2 2  ? 44.128 11.828  -7.895  1.00 0.00  ? 145 ARG B NH1  1  
ATOM   1401  N  NH2  . ARG B 2 2  ? 43.799 13.829  -8.890  1.00 0.00  ? 145 ARG B NH2  1  
ATOM   1402  H  H    . ARG B 2 2  ? 50.978 12.269  -11.094 1.00 0.00  ? 145 ARG B H    1  
ATOM   1403  H  HA   . ARG B 2 2  ? 50.147 12.906  -8.280  1.00 0.00  ? 145 ARG B HA   1  
ATOM   1404  H  HB2  . ARG B 2 2  ? 48.549 12.556  -10.371 1.00 0.00  ? 145 ARG B HB2  1  
ATOM   1405  H  HB3  . ARG B 2 2  ? 48.832 10.849  -10.029 1.00 0.00  ? 145 ARG B HB3  1  
ATOM   1406  H  HG2  . ARG B 2 2  ? 47.189 11.018  -8.489  1.00 0.00  ? 145 ARG B HG2  1  
ATOM   1407  H  HG3  . ARG B 2 2  ? 48.333 11.945  -7.518  1.00 0.00  ? 145 ARG B HG3  1  
ATOM   1408  H  HD2  . ARG B 2 2  ? 46.705 13.568  -7.644  1.00 0.00  ? 145 ARG B HD2  1  
ATOM   1409  H  HD3  . ARG B 2 2  ? 47.428 13.882  -9.234  1.00 0.00  ? 145 ARG B HD3  1  
ATOM   1410  H  HE   . ARG B 2 2  ? 45.744 12.267  -10.180 1.00 0.00  ? 145 ARG B HE   1  
ATOM   1411  H  HH11 . ARG B 2 2  ? 44.698 11.023  -7.740  1.00 0.00  ? 145 ARG B HH11 1  
ATOM   1412  H  HH12 . ARG B 2 2  ? 43.241 11.906  -7.440  1.00 0.00  ? 145 ARG B HH12 1  
ATOM   1413  H  HH21 . ARG B 2 2  ? 44.118 14.555  -9.498  1.00 0.00  ? 145 ARG B HH21 1  
ATOM   1414  H  HH22 . ARG B 2 2  ? 42.910 13.911  -8.437  1.00 0.00  ? 145 ARG B HH22 1  
ATOM   1415  N  N    . VAL B 2 3  ? 52.207 11.035  -8.237  1.00 0.00  ? 146 VAL B N    1  
ATOM   1416  C  CA   . VAL B 2 3  ? 52.975 9.844   -7.749  1.00 0.00  ? 146 VAL B CA   1  
ATOM   1417  C  C    . VAL B 2 3  ? 53.523 10.110  -6.338  1.00 0.00  ? 146 VAL B C    1  
ATOM   1418  O  O    . VAL B 2 3  ? 54.495 10.821  -6.159  1.00 0.00  ? 146 VAL B O    1  
ATOM   1419  C  CB   . VAL B 2 3  ? 54.114 9.658   -8.762  1.00 0.00  ? 146 VAL B CB   1  
ATOM   1420  C  CG1  . VAL B 2 3  ? 55.063 8.557   -8.281  1.00 0.00  ? 146 VAL B CG1  1  
ATOM   1421  C  CG2  . VAL B 2 3  ? 53.529 9.255   -10.120 1.00 0.00  ? 146 VAL B CG2  1  
ATOM   1422  H  H    . VAL B 2 3  ? 52.649 11.908  -8.298  1.00 0.00  ? 146 VAL B H    1  
ATOM   1423  H  HA   . VAL B 2 3  ? 52.345 8.968   -7.744  1.00 0.00  ? 146 VAL B HA   1  
ATOM   1424  H  HB   . VAL B 2 3  ? 54.662 10.585  -8.863  1.00 0.00  ? 146 VAL B HB   1  
ATOM   1425  H  HG11 . VAL B 2 3  ? 55.969 9.005   -7.899  1.00 0.00  ? 146 VAL B HG11 1  
ATOM   1426  H  HG12 . VAL B 2 3  ? 55.306 7.905   -9.109  1.00 0.00  ? 146 VAL B HG12 1  
ATOM   1427  H  HG13 . VAL B 2 3  ? 54.586 7.984   -7.500  1.00 0.00  ? 146 VAL B HG13 1  
ATOM   1428  H  HG21 . VAL B 2 3  ? 53.587 8.182   -10.234 1.00 0.00  ? 146 VAL B HG21 1  
ATOM   1429  H  HG22 . VAL B 2 3  ? 54.090 9.731   -10.910 1.00 0.00  ? 146 VAL B HG22 1  
ATOM   1430  H  HG23 . VAL B 2 3  ? 52.496 9.566   -10.174 1.00 0.00  ? 146 VAL B HG23 1  
ATOM   1431  N  N    . ARG B 2 4  ? 52.897 9.541   -5.337  1.00 0.00  ? 147 ARG B N    1  
ATOM   1432  C  CA   . ARG B 2 4  ? 53.361 9.748   -3.929  1.00 0.00  ? 147 ARG B CA   1  
ATOM   1433  C  C    . ARG B 2 4  ? 52.719 8.702   -3.007  1.00 0.00  ? 147 ARG B C    1  
ATOM   1434  O  O    . ARG B 2 4  ? 51.539 8.420   -3.104  1.00 0.00  ? 147 ARG B O    1  
ATOM   1435  C  CB   . ARG B 2 4  ? 52.898 11.162  -3.558  1.00 0.00  ? 147 ARG B CB   1  
ATOM   1436  C  CG   . ARG B 2 4  ? 53.267 11.470  -2.099  1.00 0.00  ? 147 ARG B CG   1  
ATOM   1437  C  CD   . ARG B 2 4  ? 54.791 11.430  -1.920  1.00 0.00  ? 147 ARG B CD   1  
ATOM   1438  N  NE   . ARG B 2 4  ? 55.325 12.471  -2.845  1.00 0.00  ? 147 ARG B NE   1  
ATOM   1439  C  CZ   . ARG B 2 4  ? 56.492 12.311  -3.401  1.00 0.00  ? 147 ARG B CZ   1  
ATOM   1440  N  NH1  . ARG B 2 4  ? 57.573 12.492  -2.700  1.00 0.00  ? 147 ARG B NH1  1  
ATOM   1441  N  NH2  . ARG B 2 4  ? 56.572 11.968  -4.654  1.00 0.00  ? 147 ARG B NH2  1  
ATOM   1442  H  H    . ARG B 2 4  ? 52.115 8.976   -5.512  1.00 0.00  ? 147 ARG B H    1  
ATOM   1443  H  HA   . ARG B 2 4  ? 54.436 9.686   -3.875  1.00 0.00  ? 147 ARG B HA   1  
ATOM   1444  H  HB2  . ARG B 2 4  ? 53.378 11.877  -4.210  1.00 0.00  ? 147 ARG B HB2  1  
ATOM   1445  H  HB3  . ARG B 2 4  ? 51.826 11.232  -3.678  1.00 0.00  ? 147 ARG B HB3  1  
ATOM   1446  H  HG2  . ARG B 2 4  ? 52.901 12.453  -1.839  1.00 0.00  ? 147 ARG B HG2  1  
ATOM   1447  H  HG3  . ARG B 2 4  ? 52.812 10.736  -1.451  1.00 0.00  ? 147 ARG B HG3  1  
ATOM   1448  H  HD2  . ARG B 2 4  ? 55.052 11.664  -0.896  1.00 0.00  ? 147 ARG B HD2  1  
ATOM   1449  H  HD3  . ARG B 2 4  ? 55.177 10.459  -2.193  1.00 0.00  ? 147 ARG B HD3  1  
ATOM   1450  H  HE   . ARG B 2 4  ? 54.800 13.276  -3.037  1.00 0.00  ? 147 ARG B HE   1  
ATOM   1451  H  HH11 . ARG B 2 4  ? 57.508 12.752  -1.737  1.00 0.00  ? 147 ARG B HH11 1  
ATOM   1452  H  HH12 . ARG B 2 4  ? 58.471 12.370  -3.121  1.00 0.00  ? 147 ARG B HH12 1  
ATOM   1453  H  HH21 . ARG B 2 4  ? 55.738 11.831  -5.190  1.00 0.00  ? 147 ARG B HH21 1  
ATOM   1454  H  HH22 . ARG B 2 4  ? 57.466 11.837  -5.081  1.00 0.00  ? 147 ARG B HH22 1  
ATOM   1455  N  N    . ILE B 2 5  ? 53.490 8.121   -2.123  1.00 0.00  ? 148 ILE B N    1  
ATOM   1456  C  CA   . ILE B 2 5  ? 52.929 7.082   -1.204  1.00 0.00  ? 148 ILE B CA   1  
ATOM   1457  C  C    . ILE B 2 5  ? 53.349 7.359   0.246   1.00 0.00  ? 148 ILE B C    1  
ATOM   1458  O  O    . ILE B 2 5  ? 54.460 7.774   0.516   1.00 0.00  ? 148 ILE B O    1  
ATOM   1459  C  CB   . ILE B 2 5  ? 53.521 5.755   -1.708  1.00 0.00  ? 148 ILE B CB   1  
ATOM   1460  C  CG1  . ILE B 2 5  ? 52.825 5.354   -3.015  1.00 0.00  ? 148 ILE B CG1  1  
ATOM   1461  C  CG2  . ILE B 2 5  ? 53.311 4.649   -0.666  1.00 0.00  ? 148 ILE B CG2  1  
ATOM   1462  C  CD1  . ILE B 2 5  ? 53.684 5.776   -4.211  1.00 0.00  ? 148 ILE B CD1  1  
ATOM   1463  H  H    . ILE B 2 5  ? 54.439 8.359   -2.070  1.00 0.00  ? 148 ILE B H    1  
ATOM   1464  H  HA   . ILE B 2 5  ? 51.855 7.054   -1.281  1.00 0.00  ? 148 ILE B HA   1  
ATOM   1465  H  HB   . ILE B 2 5  ? 54.580 5.881   -1.886  1.00 0.00  ? 148 ILE B HB   1  
ATOM   1466  H  HG12 . ILE B 2 5  ? 52.684 4.284   -3.035  1.00 0.00  ? 148 ILE B HG12 1  
ATOM   1467  H  HG13 . ILE B 2 5  ? 51.865 5.844   -3.077  1.00 0.00  ? 148 ILE B HG13 1  
ATOM   1468  H  HG21 . ILE B 2 5  ? 52.258 4.415   -0.595  1.00 0.00  ? 148 ILE B HG21 1  
ATOM   1469  H  HG22 . ILE B 2 5  ? 53.670 4.981   0.297   1.00 0.00  ? 148 ILE B HG22 1  
ATOM   1470  H  HG23 . ILE B 2 5  ? 53.855 3.765   -0.966  1.00 0.00  ? 148 ILE B HG23 1  
ATOM   1471  H  HD11 . ILE B 2 5  ? 53.073 5.797   -5.101  1.00 0.00  ? 148 ILE B HD11 1  
ATOM   1472  H  HD12 . ILE B 2 5  ? 54.489 5.069   -4.343  1.00 0.00  ? 148 ILE B HD12 1  
ATOM   1473  H  HD13 . ILE B 2 5  ? 54.094 6.759   -4.032  1.00 0.00  ? 148 ILE B HD13 1  
ATOM   1474  N  N    . SER B 2 6  ? 52.462 7.117   1.179   1.00 0.00  ? 149 SER B N    1  
ATOM   1475  C  CA   . SER B 2 6  ? 52.789 7.344   2.622   1.00 0.00  ? 149 SER B CA   1  
ATOM   1476  C  C    . SER B 2 6  ? 52.832 5.996   3.358   1.00 0.00  ? 149 SER B C    1  
ATOM   1477  O  O    . SER B 2 6  ? 52.256 5.022   2.910   1.00 0.00  ? 149 SER B O    1  
ATOM   1478  C  CB   . SER B 2 6  ? 51.652 8.225   3.152   1.00 0.00  ? 149 SER B CB   1  
ATOM   1479  O  OG   . SER B 2 6  ? 51.525 8.048   4.558   1.00 0.00  ? 149 SER B OG   1  
ATOM   1480  H  H    . SER B 2 6  ? 51.578 6.774   0.930   1.00 0.00  ? 149 SER B H    1  
ATOM   1481  H  HA   . SER B 2 6  ? 53.733 7.857   2.721   1.00 0.00  ? 149 SER B HA   1  
ATOM   1482  H  HB2  . SER B 2 6  ? 51.873 9.260   2.945   1.00 0.00  ? 149 SER B HB2  1  
ATOM   1483  H  HB3  . SER B 2 6  ? 50.728 7.953   2.659   1.00 0.00  ? 149 SER B HB3  1  
ATOM   1484  H  HG   . SER B 2 6  ? 50.638 8.315   4.814   1.00 0.00  ? 149 SER B HG   1  
ATOM   1485  N  N    . ALA B 2 7  ? 53.510 5.930   4.479   1.00 0.00  ? 150 ALA B N    1  
ATOM   1486  C  CA   . ALA B 2 7  ? 53.589 4.639   5.237   1.00 0.00  ? 150 ALA B CA   1  
ATOM   1487  C  C    . ALA B 2 7  ? 52.182 4.140   5.600   1.00 0.00  ? 150 ALA B C    1  
ATOM   1488  O  O    . ALA B 2 7  ? 51.807 3.031   5.268   1.00 0.00  ? 150 ALA B O    1  
ATOM   1489  C  CB   . ALA B 2 7  ? 54.392 4.956   6.503   1.00 0.00  ? 150 ALA B CB   1  
ATOM   1490  H  H    . ALA B 2 7  ? 53.968 6.727   4.819   1.00 0.00  ? 150 ALA B H    1  
ATOM   1491  H  HA   . ALA B 2 7  ? 54.105 3.894   4.652   1.00 0.00  ? 150 ALA B HA   1  
ATOM   1492  H  HB1  . ALA B 2 7  ? 55.122 4.176   6.670   1.00 0.00  ? 150 ALA B HB1  1  
ATOM   1493  H  HB2  . ALA B 2 7  ? 53.725 5.011   7.350   1.00 0.00  ? 150 ALA B HB2  1  
ATOM   1494  H  HB3  . ALA B 2 7  ? 54.899 5.902   6.382   1.00 0.00  ? 150 ALA B HB3  1  
ATOM   1495  N  N    . ASP B 2 8  ? 51.400 4.952   6.270   1.00 0.00  ? 151 ASP B N    1  
ATOM   1496  C  CA   . ASP B 2 8  ? 50.016 4.525   6.648   1.00 0.00  ? 151 ASP B CA   1  
ATOM   1497  C  C    . ASP B 2 8  ? 49.150 4.326   5.393   1.00 0.00  ? 151 ASP B C    1  
ATOM   1498  O  O    . ASP B 2 8  ? 48.390 3.381   5.301   1.00 0.00  ? 151 ASP B O    1  
ATOM   1499  C  CB   . ASP B 2 8  ? 49.471 5.668   7.510   1.00 0.00  ? 151 ASP B CB   1  
ATOM   1500  C  CG   . ASP B 2 8  ? 48.090 5.293   8.054   1.00 0.00  ? 151 ASP B CG   1  
ATOM   1501  O  OD1  . ASP B 2 8  ? 48.037 4.714   9.126   1.00 0.00  ? 151 ASP B OD1  1  
ATOM   1502  O  OD2  . ASP B 2 8  ? 47.111 5.592   7.390   1.00 0.00  ? 151 ASP B OD2  1  
ATOM   1503  H  H    . ASP B 2 8  ? 51.723 5.843   6.521   1.00 0.00  ? 151 ASP B H    1  
ATOM   1504  H  HA   . ASP B 2 8  ? 50.049 3.615   7.227   1.00 0.00  ? 151 ASP B HA   1  
ATOM   1505  H  HB2  . ASP B 2 8  ? 50.145 5.846   8.335   1.00 0.00  ? 151 ASP B HB2  1  
ATOM   1506  H  HB3  . ASP B 2 8  ? 49.390 6.563   6.912   1.00 0.00  ? 151 ASP B HB3  1  
ATOM   1507  N  N    . ALA B 2 9  ? 49.264 5.209   4.428   1.00 0.00  ? 152 ALA B N    1  
ATOM   1508  C  CA   . ALA B 2 9  ? 48.450 5.076   3.176   1.00 0.00  ? 152 ALA B CA   1  
ATOM   1509  C  C    . ALA B 2 9  ? 48.756 3.748   2.470   1.00 0.00  ? 152 ALA B C    1  
ATOM   1510  O  O    . ALA B 2 9  ? 47.860 2.984   2.160   1.00 0.00  ? 152 ALA B O    1  
ATOM   1511  C  CB   . ALA B 2 9  ? 48.868 6.259   2.300   1.00 0.00  ? 152 ALA B CB   1  
ATOM   1512  H  H    . ALA B 2 9  ? 49.886 5.960   4.528   1.00 0.00  ? 152 ALA B H    1  
ATOM   1513  H  HA   . ALA B 2 9  ? 47.399 5.142   3.405   1.00 0.00  ? 152 ALA B HA   1  
ATOM   1514  H  HB1  . ALA B 2 9  ? 48.434 6.150   1.318   1.00 0.00  ? 152 ALA B HB1  1  
ATOM   1515  H  HB2  . ALA B 2 9  ? 49.944 6.283   2.217   1.00 0.00  ? 152 ALA B HB2  1  
ATOM   1516  H  HB3  . ALA B 2 9  ? 48.520 7.178   2.748   1.00 0.00  ? 152 ALA B HB3  1  
ATOM   1517  N  N    . MET B 2 10 ? 50.012 3.463   2.219   1.00 0.00  ? 153 MET B N    1  
ATOM   1518  C  CA   . MET B 2 10 ? 50.368 2.179   1.537   1.00 0.00  ? 153 MET B CA   1  
ATOM   1519  C  C    . MET B 2 10 ? 49.962 0.984   2.412   1.00 0.00  ? 153 MET B C    1  
ATOM   1520  O  O    . MET B 2 10 ? 49.454 -0.003  1.920   1.00 0.00  ? 153 MET B O    1  
ATOM   1521  C  CB   . MET B 2 10 ? 51.887 2.228   1.348   1.00 0.00  ? 153 MET B CB   1  
ATOM   1522  C  CG   . MET B 2 10 ? 52.297 1.271   0.223   1.00 0.00  ? 153 MET B CG   1  
ATOM   1523  S  SD   . MET B 2 10 ? 51.704 1.907   -1.366  1.00 0.00  ? 153 MET B SD   1  
ATOM   1524  C  CE   . MET B 2 10 ? 53.095 1.333   -2.375  1.00 0.00  ? 153 MET B CE   1  
ATOM   1525  H  H    . MET B 2 10 ? 50.719 4.091   2.482   1.00 0.00  ? 153 MET B H    1  
ATOM   1526  H  HA   . MET B 2 10 ? 49.880 2.120   0.576   1.00 0.00  ? 153 MET B HA   1  
ATOM   1527  H  HB2  . MET B 2 10 ? 52.183 3.235   1.091   1.00 0.00  ? 153 MET B HB2  1  
ATOM   1528  H  HB3  . MET B 2 10 ? 52.374 1.933   2.265   1.00 0.00  ? 153 MET B HB3  1  
ATOM   1529  H  HG2  . MET B 2 10 ? 53.373 1.189   0.197   1.00 0.00  ? 153 MET B HG2  1  
ATOM   1530  H  HG3  . MET B 2 10 ? 51.867 0.296   0.404   1.00 0.00  ? 153 MET B HG3  1  
ATOM   1531  H  HE1  . MET B 2 10 ? 52.904 0.322   -2.708  1.00 0.00  ? 153 MET B HE1  1  
ATOM   1532  H  HE2  . MET B 2 10 ? 53.999 1.351   -1.788  1.00 0.00  ? 153 MET B HE2  1  
ATOM   1533  H  HE3  . MET B 2 10 ? 53.212 1.984   -3.231  1.00 0.00  ? 153 MET B HE3  1  
ATOM   1534  N  N    . MET B 2 11 ? 50.169 1.073   3.706   1.00 0.00  ? 154 MET B N    1  
ATOM   1535  C  CA   . MET B 2 11 ? 49.780 -0.056  4.616   1.00 0.00  ? 154 MET B CA   1  
ATOM   1536  C  C    . MET B 2 11 ? 48.260 -0.265  4.578   1.00 0.00  ? 154 MET B C    1  
ATOM   1537  O  O    . MET B 2 11 ? 47.783 -1.383  4.500   1.00 0.00  ? 154 MET B O    1  
ATOM   1538  C  CB   . MET B 2 11 ? 50.222 0.379   6.017   1.00 0.00  ? 154 MET B CB   1  
ATOM   1539  C  CG   . MET B 2 11 ? 51.518 -0.342  6.393   1.00 0.00  ? 154 MET B CG   1  
ATOM   1540  S  SD   . MET B 2 11 ? 51.500 -0.726  8.161   1.00 0.00  ? 154 MET B SD   1  
ATOM   1541  C  CE   . MET B 2 11 ? 50.619 -2.303  8.040   1.00 0.00  ? 154 MET B CE   1  
ATOM   1542  H  H    . MET B 2 11 ? 50.572 1.886   4.081   1.00 0.00  ? 154 MET B H    1  
ATOM   1543  H  HA   . MET B 2 11 ? 50.290 -0.962  4.332   1.00 0.00  ? 154 MET B HA   1  
ATOM   1544  H  HB2  . MET B 2 11 ? 50.386 1.448   6.028   1.00 0.00  ? 154 MET B HB2  1  
ATOM   1545  H  HB3  . MET B 2 11 ? 49.452 0.127   6.731   1.00 0.00  ? 154 MET B HB3  1  
ATOM   1546  H  HG2  . MET B 2 11 ? 51.600 -1.258  5.825   1.00 0.00  ? 154 MET B HG2  1  
ATOM   1547  H  HG3  . MET B 2 11 ? 52.361 0.296   6.171   1.00 0.00  ? 154 MET B HG3  1  
ATOM   1548  H  HE1  . MET B 2 11 ? 49.609 -2.125  7.698   1.00 0.00  ? 154 MET B HE1  1  
ATOM   1549  H  HE2  . MET B 2 11 ? 50.589 -2.776  9.008   1.00 0.00  ? 154 MET B HE2  1  
ATOM   1550  H  HE3  . MET B 2 11 ? 51.134 -2.948  7.342   1.00 0.00  ? 154 MET B HE3  1  
ATOM   1551  N  N    . GLN B 2 12 ? 47.502 0.805   4.623   1.00 0.00  ? 155 GLN B N    1  
ATOM   1552  C  CA   . GLN B 2 12 ? 46.009 0.687   4.579   1.00 0.00  ? 155 GLN B CA   1  
ATOM   1553  C  C    . GLN B 2 12 ? 45.573 0.008   3.273   1.00 0.00  ? 155 GLN B C    1  
ATOM   1554  O  O    . GLN B 2 12 ? 44.680 -0.817  3.262   1.00 0.00  ? 155 GLN B O    1  
ATOM   1555  C  CB   . GLN B 2 12 ? 45.494 2.130   4.639   1.00 0.00  ? 155 GLN B CB   1  
ATOM   1556  C  CG   . GLN B 2 12 ? 44.058 2.146   5.173   1.00 0.00  ? 155 GLN B CG   1  
ATOM   1557  C  CD   . GLN B 2 12 ? 44.059 2.562   6.647   1.00 0.00  ? 155 GLN B CD   1  
ATOM   1558  O  OE1  . GLN B 2 12 ? 43.780 1.762   7.516   1.00 0.00  ? 155 GLN B OE1  1  
ATOM   1559  N  NE2  . GLN B 2 12 ? 44.364 3.788   6.968   1.00 0.00  ? 155 GLN B NE2  1  
ATOM   1560  H  H    . GLN B 2 12 ? 47.919 1.692   4.679   1.00 0.00  ? 155 GLN B H    1  
ATOM   1561  H  HA   . GLN B 2 12 ? 45.651 0.130   5.430   1.00 0.00  ? 155 GLN B HA   1  
ATOM   1562  H  HB2  . GLN B 2 12 ? 46.127 2.710   5.293   1.00 0.00  ? 155 GLN B HB2  1  
ATOM   1563  H  HB3  . GLN B 2 12 ? 45.512 2.559   3.648   1.00 0.00  ? 155 GLN B HB3  1  
ATOM   1564  H  HG2  . GLN B 2 12 ? 43.470 2.850   4.602   1.00 0.00  ? 155 GLN B HG2  1  
ATOM   1565  H  HG3  . GLN B 2 12 ? 43.627 1.160   5.081   1.00 0.00  ? 155 GLN B HG3  1  
ATOM   1566  H  HE21 . GLN B 2 12 ? 44.590 4.437   6.270   1.00 0.00  ? 155 GLN B HE21 1  
ATOM   1567  H  HE22 . GLN B 2 12 ? 44.369 4.061   7.909   1.00 0.00  ? 155 GLN B HE22 1  
ATOM   1568  N  N    . ALA B 2 13 ? 46.209 0.342   2.176   1.00 0.00  ? 156 ALA B N    1  
ATOM   1569  C  CA   . ALA B 2 13 ? 45.847 -0.294  0.872   1.00 0.00  ? 156 ALA B CA   1  
ATOM   1570  C  C    . ALA B 2 13 ? 46.457 -1.703  0.777   1.00 0.00  ? 156 ALA B C    1  
ATOM   1571  O  O    . ALA B 2 13 ? 45.956 -2.553  0.067   1.00 0.00  ? 156 ALA B O    1  
ATOM   1572  C  CB   . ALA B 2 13 ? 46.443 0.624   -0.199  1.00 0.00  ? 156 ALA B CB   1  
ATOM   1573  H  H    . ALA B 2 13 ? 46.933 1.003   2.214   1.00 0.00  ? 156 ALA B H    1  
ATOM   1574  H  HA   . ALA B 2 13 ? 44.774 -0.341  0.761   1.00 0.00  ? 156 ALA B HA   1  
ATOM   1575  H  HB1  . ALA B 2 13 ? 46.008 0.389   -1.159  1.00 0.00  ? 156 ALA B HB1  1  
ATOM   1576  H  HB2  . ALA B 2 13 ? 47.512 0.479   -0.243  1.00 0.00  ? 156 ALA B HB2  1  
ATOM   1577  H  HB3  . ALA B 2 13 ? 46.229 1.653   0.051   1.00 0.00  ? 156 ALA B HB3  1  
ATOM   1578  N  N    . LEU B 2 14 ? 47.533 -1.954  1.489   1.00 0.00  ? 157 LEU B N    1  
ATOM   1579  C  CA   . LEU B 2 14 ? 48.175 -3.306  1.442   1.00 0.00  ? 157 LEU B CA   1  
ATOM   1580  C  C    . LEU B 2 14 ? 47.282 -4.350  2.130   1.00 0.00  ? 157 LEU B C    1  
ATOM   1581  O  O    . LEU B 2 14 ? 46.999 -5.391  1.572   1.00 0.00  ? 157 LEU B O    1  
ATOM   1582  C  CB   . LEU B 2 14 ? 49.509 -3.145  2.190   1.00 0.00  ? 157 LEU B CB   1  
ATOM   1583  C  CG   . LEU B 2 14 ? 50.559 -4.122  1.638   1.00 0.00  ? 157 LEU B CG   1  
ATOM   1584  C  CD1  . LEU B 2 14 ? 50.173 -5.555  1.999   1.00 0.00  ? 157 LEU B CD1  1  
ATOM   1585  C  CD2  . LEU B 2 14 ? 50.647 -3.989  0.115   1.00 0.00  ? 157 LEU B CD2  1  
ATOM   1586  H  H    . LEU B 2 14 ? 47.918 -1.251  2.054   1.00 0.00  ? 157 LEU B H    1  
ATOM   1587  H  HA   . LEU B 2 14 ? 48.360 -3.592  0.419   1.00 0.00  ? 157 LEU B HA   1  
ATOM   1588  H  HB2  . LEU B 2 14 ? 49.868 -2.134  2.068   1.00 0.00  ? 157 LEU B HB2  1  
ATOM   1589  H  HB3  . LEU B 2 14 ? 49.357 -3.343  3.241   1.00 0.00  ? 157 LEU B HB3  1  
ATOM   1590  H  HG   . LEU B 2 14 ? 51.521 -3.892  2.074   1.00 0.00  ? 157 LEU B HG   1  
ATOM   1591  H  HD11 . LEU B 2 14 ? 49.914 -5.607  3.046   1.00 0.00  ? 157 LEU B HD11 1  
ATOM   1592  H  HD12 . LEU B 2 14 ? 51.008 -6.211  1.803   1.00 0.00  ? 157 LEU B HD12 1  
ATOM   1593  H  HD13 . LEU B 2 14 ? 49.327 -5.862  1.402   1.00 0.00  ? 157 LEU B HD13 1  
ATOM   1594  H  HD21 . LEU B 2 14 ? 49.752 -4.394  -0.335  1.00 0.00  ? 157 LEU B HD21 1  
ATOM   1595  H  HD22 . LEU B 2 14 ? 51.507 -4.534  -0.244  1.00 0.00  ? 157 LEU B HD22 1  
ATOM   1596  H  HD23 . LEU B 2 14 ? 50.746 -2.946  -0.151  1.00 0.00  ? 157 LEU B HD23 1  
ATOM   1597  N  N    . LEU B 2 15 ? 46.831 -4.078  3.331   1.00 0.00  ? 158 LEU B N    1  
ATOM   1598  C  CA   . LEU B 2 15 ? 45.952 -5.057  4.044   1.00 0.00  ? 158 LEU B CA   1  
ATOM   1599  C  C    . LEU B 2 15 ? 44.562 -4.446  4.286   1.00 0.00  ? 158 LEU B C    1  
ATOM   1600  O  O    . LEU B 2 15 ? 44.016 -4.522  5.371   1.00 0.00  ? 158 LEU B O    1  
ATOM   1601  C  CB   . LEU B 2 15 ? 46.666 -5.341  5.372   1.00 0.00  ? 158 LEU B CB   1  
ATOM   1602  C  CG   . LEU B 2 15 ? 47.765 -6.386  5.154   1.00 0.00  ? 158 LEU B CG   1  
ATOM   1603  C  CD1  . LEU B 2 15 ? 49.007 -5.999  5.959   1.00 0.00  ? 158 LEU B CD1  1  
ATOM   1604  C  CD2  . LEU B 2 15 ? 47.267 -7.758  5.616   1.00 0.00  ? 158 LEU B CD2  1  
ATOM   1605  H  H    . LEU B 2 15 ? 47.065 -3.228  3.763   1.00 0.00  ? 158 LEU B H    1  
ATOM   1606  H  HA   . LEU B 2 15 ? 45.865 -5.968  3.472   1.00 0.00  ? 158 LEU B HA   1  
ATOM   1607  H  HB2  . LEU B 2 15 ? 47.105 -4.428  5.747   1.00 0.00  ? 158 LEU B HB2  1  
ATOM   1608  H  HB3  . LEU B 2 15 ? 45.953 -5.718  6.091   1.00 0.00  ? 158 LEU B HB3  1  
ATOM   1609  H  HG   . LEU B 2 15 ? 48.019 -6.428  4.105   1.00 0.00  ? 158 LEU B HG   1  
ATOM   1610  H  HD11 . LEU B 2 15 ? 49.370 -5.039  5.622   1.00 0.00  ? 158 LEU B HD11 1  
ATOM   1611  H  HD12 . LEU B 2 15 ? 49.775 -6.745  5.817   1.00 0.00  ? 158 LEU B HD12 1  
ATOM   1612  H  HD13 . LEU B 2 15 ? 48.752 -5.940  7.008   1.00 0.00  ? 158 LEU B HD13 1  
ATOM   1613  H  HD21 . LEU B 2 15 ? 46.381 -7.635  6.224   1.00 0.00  ? 158 LEU B HD21 1  
ATOM   1614  H  HD22 . LEU B 2 15 ? 48.037 -8.245  6.197   1.00 0.00  ? 158 LEU B HD22 1  
ATOM   1615  H  HD23 . LEU B 2 15 ? 47.029 -8.362  4.754   1.00 0.00  ? 158 LEU B HD23 1  
ATOM   1616  N  N    . GLY B 2 16 ? 43.986 -3.841  3.277   1.00 0.00  ? 159 GLY B N    1  
ATOM   1617  C  CA   . GLY B 2 16 ? 42.634 -3.222  3.438   1.00 0.00  ? 159 GLY B CA   1  
ATOM   1618  C  C    . GLY B 2 16 ? 41.942 -3.122  2.078   1.00 0.00  ? 159 GLY B C    1  
ATOM   1619  O  O    . GLY B 2 16 ? 40.860 -3.642  1.887   1.00 0.00  ? 159 GLY B O    1  
ATOM   1620  H  H    . GLY B 2 16 ? 44.445 -3.793  2.411   1.00 0.00  ? 159 GLY B H    1  
ATOM   1621  H  HA2  . GLY B 2 16 ? 42.037 -3.831  4.101   1.00 0.00  ? 159 GLY B HA2  1  
ATOM   1622  H  HA3  . GLY B 2 16 ? 42.740 -2.232  3.856   1.00 0.00  ? 159 GLY B HA3  1  
ATOM   1623  N  N    . ALA B 2 17 ? 42.559 -2.459  1.131   1.00 0.00  ? 160 ALA B N    1  
ATOM   1624  C  CA   . ALA B 2 17 ? 41.938 -2.322  -0.223  1.00 0.00  ? 160 ALA B CA   1  
ATOM   1625  C  C    . ALA B 2 17 ? 41.874 -3.687  -0.923  1.00 0.00  ? 160 ALA B C    1  
ATOM   1626  O  O    . ALA B 2 17 ? 42.838 -4.136  -1.511  1.00 0.00  ? 160 ALA B O    1  
ATOM   1627  C  CB   . ALA B 2 17 ? 42.855 -1.363  -0.988  1.00 0.00  ? 160 ALA B CB   1  
ATOM   1628  H  H    . ALA B 2 17 ? 43.432 -2.050  1.312   1.00 0.00  ? 160 ALA B H    1  
ATOM   1629  H  HA   . ALA B 2 17 ? 40.950 -1.896  -0.140  1.00 0.00  ? 160 ALA B HA   1  
ATOM   1630  H  HB1  . ALA B 2 17 ? 42.437 -1.168  -1.965  1.00 0.00  ? 160 ALA B HB1  1  
ATOM   1631  H  HB2  . ALA B 2 17 ? 43.833 -1.809  -1.098  1.00 0.00  ? 160 ALA B HB2  1  
ATOM   1632  H  HB3  . ALA B 2 17 ? 42.942 -0.435  -0.443  1.00 0.00  ? 160 ALA B HB3  1  
ATOM   1633  N  N    . ARG B 2 18 ? 40.738 -4.346  -0.860  1.00 0.00  ? 161 ARG B N    1  
ATOM   1634  C  CA   . ARG B 2 18 ? 40.588 -5.687  -1.517  1.00 0.00  ? 161 ARG B CA   1  
ATOM   1635  C  C    . ARG B 2 18 ? 41.731 -6.630  -1.104  1.00 0.00  ? 161 ARG B C    1  
ATOM   1636  O  O    . ARG B 2 18 ? 42.325 -7.303  -1.926  1.00 0.00  ? 161 ARG B O    1  
ATOM   1637  C  CB   . ARG B 2 18 ? 40.629 -5.396  -3.023  1.00 0.00  ? 161 ARG B CB   1  
ATOM   1638  C  CG   . ARG B 2 18 ? 39.382 -5.975  -3.693  1.00 0.00  ? 161 ARG B CG   1  
ATOM   1639  C  CD   . ARG B 2 18 ? 38.175 -5.084  -3.385  1.00 0.00  ? 161 ARG B CD   1  
ATOM   1640  N  NE   . ARG B 2 18 ? 37.943 -4.306  -4.635  1.00 0.00  ? 161 ARG B NE   1  
ATOM   1641  C  CZ   . ARG B 2 18 ? 36.991 -4.650  -5.451  1.00 0.00  ? 161 ARG B CZ   1  
ATOM   1642  N  NH1  . ARG B 2 18 ? 35.758 -4.309  -5.196  1.00 0.00  ? 161 ARG B NH1  1  
ATOM   1643  N  NH2  . ARG B 2 18 ? 37.269 -5.347  -6.515  1.00 0.00  ? 161 ARG B NH2  1  
ATOM   1644  H  H    . ARG B 2 18 ? 39.979 -3.956  -0.377  1.00 0.00  ? 161 ARG B H    1  
ATOM   1645  H  HA   . ARG B 2 18 ? 39.636 -6.123  -1.255  1.00 0.00  ? 161 ARG B HA   1  
ATOM   1646  H  HB2  . ARG B 2 18 ? 40.660 -4.328  -3.184  1.00 0.00  ? 161 ARG B HB2  1  
ATOM   1647  H  HB3  . ARG B 2 18 ? 41.509 -5.849  -3.455  1.00 0.00  ? 161 ARG B HB3  1  
ATOM   1648  H  HG2  . ARG B 2 18 ? 39.537 -6.018  -4.761  1.00 0.00  ? 161 ARG B HG2  1  
ATOM   1649  H  HG3  . ARG B 2 18 ? 39.198 -6.971  -3.316  1.00 0.00  ? 161 ARG B HG3  1  
ATOM   1650  H  HD2  . ARG B 2 18 ? 37.311 -5.692  -3.149  1.00 0.00  ? 161 ARG B HD2  1  
ATOM   1651  H  HD3  . ARG B 2 18 ? 38.398 -4.415  -2.569  1.00 0.00  ? 161 ARG B HD3  1  
ATOM   1652  H  HE   . ARG B 2 18 ? 38.509 -3.533  -4.843  1.00 0.00  ? 161 ARG B HE   1  
ATOM   1653  H  HH11 . ARG B 2 18 ? 35.546 -3.785  -4.372  1.00 0.00  ? 161 ARG B HH11 1  
ATOM   1654  H  HH12 . ARG B 2 18 ? 35.026 -4.564  -5.827  1.00 0.00  ? 161 ARG B HH12 1  
ATOM   1655  H  HH21 . ARG B 2 18 ? 38.214 -5.616  -6.700  1.00 0.00  ? 161 ARG B HH21 1  
ATOM   1656  H  HH22 . ARG B 2 18 ? 36.542 -5.613  -7.145  1.00 0.00  ? 161 ARG B HH22 1  
ATOM   1657  N  N    . ALA B 2 19 ? 42.040 -6.682  0.167   1.00 0.00  ? 162 ALA B N    1  
ATOM   1658  C  CA   . ALA B 2 19 ? 43.142 -7.576  0.639   1.00 0.00  ? 162 ALA B CA   1  
ATOM   1659  C  C    . ALA B 2 19 ? 42.718 -8.320  1.913   1.00 0.00  ? 162 ALA B C    1  
ATOM   1660  O  O    . ALA B 2 19 ? 42.848 -9.526  2.006   1.00 0.00  ? 162 ALA B O    1  
ATOM   1661  C  CB   . ALA B 2 19 ? 44.315 -6.633  0.920   1.00 0.00  ? 162 ALA B CB   1  
ATOM   1662  H  H    . ALA B 2 19 ? 41.548 -6.131  0.811   1.00 0.00  ? 162 ALA B H    1  
ATOM   1663  H  HA   . ALA B 2 19 ? 43.413 -8.279  -0.133  1.00 0.00  ? 162 ALA B HA   1  
ATOM   1664  H  HB1  . ALA B 2 19 ? 44.117 -6.067  1.818   1.00 0.00  ? 162 ALA B HB1  1  
ATOM   1665  H  HB2  . ALA B 2 19 ? 44.440 -5.955  0.087   1.00 0.00  ? 162 ALA B HB2  1  
ATOM   1666  H  HB3  . ALA B 2 19 ? 45.219 -7.211  1.050   1.00 0.00  ? 162 ALA B HB3  1  
ATOM   1667  N  N    . LYS B 2 20 ? 42.207 -7.611  2.889   1.00 0.00  ? 163 LYS B N    1  
ATOM   1668  C  CA   . LYS B 2 20 ? 41.766 -8.271  4.157   1.00 0.00  ? 163 LYS B CA   1  
ATOM   1669  C  C    . LYS B 2 20 ? 40.311 -7.900  4.475   1.00 0.00  ? 163 LYS B C    1  
ATOM   1670  O  O    . LYS B 2 20 ? 39.954 -6.747  4.284   1.00 0.00  ? 163 LYS B O    1  
ATOM   1671  C  CB   . LYS B 2 20 ? 42.710 -7.728  5.234   1.00 0.00  ? 163 LYS B CB   1  
ATOM   1672  C  CG   . LYS B 2 20 ? 42.394 -8.392  6.581   1.00 0.00  ? 163 LYS B CG   1  
ATOM   1673  C  CD   . LYS B 2 20 ? 42.014 -7.320  7.610   1.00 0.00  ? 163 LYS B CD   1  
ATOM   1674  C  CE   . LYS B 2 20 ? 40.487 -7.254  7.751   1.00 0.00  ? 163 LYS B CE   1  
ATOM   1675  N  NZ   . LYS B 2 20 ? 40.082 -6.008  7.037   1.00 0.00  ? 163 LYS B NZ   1  
ATOM   1676  O  OXT  . LYS B 2 20 ? 39.582 -8.772  4.917   1.00 0.00  ? 163 LYS B OXT  1  
ATOM   1677  H  H    . LYS B 2 20 ? 42.108 -6.641  2.788   1.00 0.00  ? 163 LYS B H    1  
ATOM   1678  H  HA   . LYS B 2 20 ? 41.872 -9.342  4.081   1.00 0.00  ? 163 LYS B HA   1  
ATOM   1679  H  HB2  . LYS B 2 20 ? 43.732 -7.944  4.956   1.00 0.00  ? 163 LYS B HB2  1  
ATOM   1680  H  HB3  . LYS B 2 20 ? 42.580 -6.660  5.321   1.00 0.00  ? 163 LYS B HB3  1  
ATOM   1681  H  HG2  . LYS B 2 20 ? 41.572 -9.083  6.458   1.00 0.00  ? 163 LYS B HG2  1  
ATOM   1682  H  HG3  . LYS B 2 20 ? 43.264 -8.929  6.928   1.00 0.00  ? 163 LYS B HG3  1  
ATOM   1683  H  HD2  . LYS B 2 20 ? 42.453 -7.573  8.565   1.00 0.00  ? 163 LYS B HD2  1  
ATOM   1684  H  HD3  . LYS B 2 20 ? 42.387 -6.361  7.286   1.00 0.00  ? 163 LYS B HD3  1  
ATOM   1685  H  HE2  . LYS B 2 20 ? 40.030 -8.121  7.290   1.00 0.00  ? 163 LYS B HE2  1  
ATOM   1686  H  HE3  . LYS B 2 20 ? 40.208 -7.191  8.792   1.00 0.00  ? 163 LYS B HE3  1  
ATOM   1687  H  HZ1  . LYS B 2 20 ? 40.453 -5.179  7.542   1.00 0.00  ? 163 LYS B HZ1  1  
ATOM   1688  H  HZ2  . LYS B 2 20 ? 39.043 -5.955  6.996   1.00 0.00  ? 163 LYS B HZ2  1  
ATOM   1689  H  HZ3  . LYS B 2 20 ? 40.464 -6.022  6.068   1.00 0.00  ? 163 LYS B HZ3  1  
HETATM 1690  CA CA   . CA  C 3 .  ? 69.009 -4.293  -1.610  1.00 0.00  ? 90  CA  A CA   1  
HETATM 1691  O  OAA  . SXK D 4 .  ? 59.771 11.305  -1.320  1.00 20.00 ? 91  SXK A OAA  1  
HETATM 1692  O  OAB  . SXK D 4 .  ? 60.015 9.423   -0.167  1.00 20.00 ? 91  SXK A OAB  1  
HETATM 1693  C  CAE  . SXK D 4 .  ? 56.225 1.156   -0.455  1.00 20.00 ? 91  SXK A CAE  1  
HETATM 1694  C  CAF  . SXK D 4 .  ? 57.095 6.568   -2.986  1.00 20.00 ? 91  SXK A CAF  1  
HETATM 1695  C  CAG  . SXK D 4 .  ? 58.165 6.556   -0.764  1.00 20.00 ? 91  SXK A CAG  1  
HETATM 1696  C  CAH  . SXK D 4 .  ? 56.889 5.173   -2.899  1.00 20.00 ? 91  SXK A CAH  1  
HETATM 1697  C  CAI  . SXK D 4 .  ? 57.965 5.163   -0.669  1.00 20.00 ? 91  SXK A CAI  1  
HETATM 1698  C  CAJ  . SXK D 4 .  ? 56.411 2.558   -0.551  1.00 20.00 ? 91  SXK A CAJ  1  
HETATM 1699  C  CAK  . SXK D 4 .  ? 57.452 0.817   -2.546  1.00 20.00 ? 91  SXK A CAK  1  
HETATM 1700  C  CAL  . SXK D 4 .  ? 59.162 9.231   -2.376  1.00 20.00 ? 91  SXK A CAL  1  
HETATM 1701  O  OAM  . SXK D 4 .  ? 57.879 8.607   -2.127  1.00 20.00 ? 91  SXK A OAM  1  
HETATM 1702  C  CAN  . SXK D 4 .  ? 59.692 10.057  -1.192  1.00 20.00 ? 91  SXK A CAN  1  
HETATM 1703  C  CAO  . SXK D 4 .  ? 56.745 0.308   -1.450  1.00 20.00 ? 91  SXK A CAO  1  
HETATM 1704  C  CAP  . SXK D 4 .  ? 57.733 7.257   -1.915  1.00 20.00 ? 91  SXK A CAP  1  
HETATM 1705  C  CAQ  . SXK D 4 .  ? 57.644 2.216   -2.651  1.00 20.00 ? 91  SXK A CAQ  1  
HETATM 1706  C  CAR  . SXK D 4 .  ? 57.327 4.469   -1.738  1.00 20.00 ? 91  SXK A CAR  1  
HETATM 1707  C  CAS  . SXK D 4 .  ? 57.124 3.080   -1.649  1.00 20.00 ? 91  SXK A CAS  1  
HETATM 1708  F  FCC  . SXK D 4 .  ? 56.558 -1.035  -1.341  1.00 20.00 ? 91  SXK A FCC  1  
HETATM 1709  F  FDD  . SXK D 4 .  ? 58.337 2.690   -3.732  1.00 20.00 ? 91  SXK A FDD  1  
HETATM 1710  H  HAE  . SXK D 4 .  ? 55.679 0.733   0.388   1.00 20.00 ? 91  SXK A HAE  1  
HETATM 1711  H  HAF  . SXK D 4 .  ? 56.767 7.119   -3.872  1.00 20.00 ? 91  SXK A HAF  1  
HETATM 1712  H  HAG  . SXK D 4 .  ? 58.657 7.079   0.060   1.00 20.00 ? 91  SXK A HAG  1  
HETATM 1713  H  HAH  . SXK D 4 .  ? 56.401 4.641   -3.715  1.00 20.00 ? 91  SXK A HAH  1  
HETATM 1714  H  HAI  . SXK D 4 .  ? 58.297 4.625   0.222   1.00 20.00 ? 91  SXK A HAI  1  
HETATM 1715  H  HAJ  . SXK D 4 .  ? 56.008 3.214   0.220   1.00 20.00 ? 91  SXK A HAJ  1  
HETATM 1716  H  HAK  . SXK D 4 .  ? 57.852 0.149   -3.314  1.00 20.00 ? 91  SXK A HAK  1  
HETATM 1717  H  HAL  . SXK D 4 .  ? 59.900 8.451   -2.595  1.00 20.00 ? 91  SXK A HAL  1  
HETATM 1718  H  HALA . SXK D 4 .  ? 59.038 9.925   -3.202  1.00 20.00 ? 91  SXK A HALA 1  
ATOM   1719  N  N    . MET A 1 1  ? 78.030 8.691   12.663  1.00 0.00  ? 1   MET A N    2  
ATOM   1720  C  CA   . MET A 1 1  ? 76.634 8.244   12.372  1.00 0.00  ? 1   MET A CA   2  
ATOM   1721  C  C    . MET A 1 1  ? 76.492 7.891   10.884  1.00 0.00  ? 1   MET A C    2  
ATOM   1722  O  O    . MET A 1 1  ? 77.307 8.280   10.069  1.00 0.00  ? 1   MET A O    2  
ATOM   1723  C  CB   . MET A 1 1  ? 75.746 9.442   12.733  1.00 0.00  ? 1   MET A CB   2  
ATOM   1724  C  CG   . MET A 1 1  ? 74.811 9.061   13.885  1.00 0.00  ? 1   MET A CG   2  
ATOM   1725  S  SD   . MET A 1 1  ? 75.772 8.872   15.408  1.00 0.00  ? 1   MET A SD   2  
ATOM   1726  C  CE   . MET A 1 1  ? 75.798 10.617  15.887  1.00 0.00  ? 1   MET A CE   2  
ATOM   1727  H  H1   . MET A 1 1  ? 78.294 9.457   12.012  1.00 0.00  ? 1   MET A H1   2  
ATOM   1728  H  H2   . MET A 1 1  ? 78.683 7.889   12.539  1.00 0.00  ? 1   MET A H2   2  
ATOM   1729  H  H3   . MET A 1 1  ? 78.087 9.037   13.643  1.00 0.00  ? 1   MET A H3   2  
ATOM   1730  H  HA   . MET A 1 1  ? 76.375 7.395   12.985  1.00 0.00  ? 1   MET A HA   2  
ATOM   1731  H  HB2  . MET A 1 1  ? 76.368 10.274  13.034  1.00 0.00  ? 1   MET A HB2  2  
ATOM   1732  H  HB3  . MET A 1 1  ? 75.158 9.728   11.874  1.00 0.00  ? 1   MET A HB3  2  
ATOM   1733  H  HG2  . MET A 1 1  ? 74.072 9.835   14.020  1.00 0.00  ? 1   MET A HG2  2  
ATOM   1734  H  HG3  . MET A 1 1  ? 74.317 8.128   13.654  1.00 0.00  ? 1   MET A HG3  2  
ATOM   1735  H  HE1  . MET A 1 1  ? 74.854 11.076  15.626  1.00 0.00  ? 1   MET A HE1  2  
ATOM   1736  H  HE2  . MET A 1 1  ? 76.597 11.123  15.369  1.00 0.00  ? 1   MET A HE2  2  
ATOM   1737  H  HE3  . MET A 1 1  ? 75.959 10.693  16.954  1.00 0.00  ? 1   MET A HE3  2  
ATOM   1738  N  N    . ASP A 1 2  ? 75.468 7.153   10.527  1.00 0.00  ? 2   ASP A N    2  
ATOM   1739  C  CA   . ASP A 1 2  ? 75.278 6.771   9.093   1.00 0.00  ? 2   ASP A CA   2  
ATOM   1740  C  C    . ASP A 1 2  ? 74.090 7.539   8.485   1.00 0.00  ? 2   ASP A C    2  
ATOM   1741  O  O    . ASP A 1 2  ? 74.274 8.502   7.763   1.00 0.00  ? 2   ASP A O    2  
ATOM   1742  C  CB   . ASP A 1 2  ? 75.012 5.258   9.118   1.00 0.00  ? 2   ASP A CB   2  
ATOM   1743  C  CG   . ASP A 1 2  ? 74.763 4.752   7.695   1.00 0.00  ? 2   ASP A CG   2  
ATOM   1744  O  OD1  . ASP A 1 2  ? 75.723 4.638   6.952   1.00 0.00  ? 2   ASP A OD1  2  
ATOM   1745  O  OD2  . ASP A 1 2  ? 73.617 4.486   7.375   1.00 0.00  ? 2   ASP A OD2  2  
ATOM   1746  H  H    . ASP A 1 2  ? 74.826 6.850   11.202  1.00 0.00  ? 2   ASP A H    2  
ATOM   1747  H  HA   . ASP A 1 2  ? 76.176 6.974   8.531   1.00 0.00  ? 2   ASP A HA   2  
ATOM   1748  H  HB2  . ASP A 1 2  ? 75.871 4.751   9.533   1.00 0.00  ? 2   ASP A HB2  2  
ATOM   1749  H  HB3  . ASP A 1 2  ? 74.146 5.053   9.728   1.00 0.00  ? 2   ASP A HB3  2  
ATOM   1750  N  N    . ASP A 1 3  ? 72.879 7.125   8.770   1.00 0.00  ? 3   ASP A N    2  
ATOM   1751  C  CA   . ASP A 1 3  ? 71.688 7.830   8.209   1.00 0.00  ? 3   ASP A CA   2  
ATOM   1752  C  C    . ASP A 1 3  ? 70.663 8.103   9.321   1.00 0.00  ? 3   ASP A C    2  
ATOM   1753  O  O    . ASP A 1 3  ? 70.465 7.295   10.210  1.00 0.00  ? 3   ASP A O    2  
ATOM   1754  C  CB   . ASP A 1 3  ? 71.130 6.871   7.147   1.00 0.00  ? 3   ASP A CB   2  
ATOM   1755  C  CG   . ASP A 1 3  ? 69.709 7.280   6.743   1.00 0.00  ? 3   ASP A CG   2  
ATOM   1756  O  OD1  . ASP A 1 3  ? 69.489 8.456   6.497   1.00 0.00  ? 3   ASP A OD1  2  
ATOM   1757  O  OD2  . ASP A 1 3  ? 68.865 6.404   6.678   1.00 0.00  ? 3   ASP A OD2  2  
ATOM   1758  H  H    . ASP A 1 3  ? 72.753 6.349   9.354   1.00 0.00  ? 3   ASP A H    2  
ATOM   1759  H  HA   . ASP A 1 3  ? 71.986 8.754   7.744   1.00 0.00  ? 3   ASP A HA   2  
ATOM   1760  H  HB2  . ASP A 1 3  ? 71.769 6.897   6.276   1.00 0.00  ? 3   ASP A HB2  2  
ATOM   1761  H  HB3  . ASP A 1 3  ? 71.113 5.869   7.545   1.00 0.00  ? 3   ASP A HB3  2  
ATOM   1762  N  N    . ILE A 1 4  ? 70.019 9.243   9.275   1.00 0.00  ? 4   ILE A N    2  
ATOM   1763  C  CA   . ILE A 1 4  ? 69.007 9.589   10.328  1.00 0.00  ? 4   ILE A CA   2  
ATOM   1764  C  C    . ILE A 1 4  ? 67.787 8.663   10.230  1.00 0.00  ? 4   ILE A C    2  
ATOM   1765  O  O    . ILE A 1 4  ? 67.237 8.249   11.232  1.00 0.00  ? 4   ILE A O    2  
ATOM   1766  C  CB   . ILE A 1 4  ? 68.618 11.057  10.072  1.00 0.00  ? 4   ILE A CB   2  
ATOM   1767  C  CG1  . ILE A 1 4  ? 67.959 11.205  8.691   1.00 0.00  ? 4   ILE A CG1  2  
ATOM   1768  C  CG2  . ILE A 1 4  ? 69.875 11.931  10.137  1.00 0.00  ? 4   ILE A CG2  2  
ATOM   1769  C  CD1  . ILE A 1 4  ? 67.537 12.664  8.472   1.00 0.00  ? 4   ILE A CD1  2  
ATOM   1770  H  H    . ILE A 1 4  ? 70.203 9.874   8.547   1.00 0.00  ? 4   ILE A H    2  
ATOM   1771  H  HA   . ILE A 1 4  ? 69.454 9.500   11.306  1.00 0.00  ? 4   ILE A HA   2  
ATOM   1772  H  HB   . ILE A 1 4  ? 67.925 11.376  10.838  1.00 0.00  ? 4   ILE A HB   2  
ATOM   1773  H  HG12 . ILE A 1 4  ? 68.660 10.911  7.923   1.00 0.00  ? 4   ILE A HG12 2  
ATOM   1774  H  HG13 . ILE A 1 4  ? 67.085 10.572  8.642   1.00 0.00  ? 4   ILE A HG13 2  
ATOM   1775  H  HG21 . ILE A 1 4  ? 70.626 11.438  10.737  1.00 0.00  ? 4   ILE A HG21 2  
ATOM   1776  H  HG22 . ILE A 1 4  ? 69.629 12.883  10.582  1.00 0.00  ? 4   ILE A HG22 2  
ATOM   1777  H  HG23 . ILE A 1 4  ? 70.257 12.087  9.139   1.00 0.00  ? 4   ILE A HG23 2  
ATOM   1778  H  HD11 . ILE A 1 4  ? 66.554 12.693  8.026   1.00 0.00  ? 4   ILE A HD11 2  
ATOM   1779  H  HD12 . ILE A 1 4  ? 68.244 13.151  7.815   1.00 0.00  ? 4   ILE A HD12 2  
ATOM   1780  H  HD13 . ILE A 1 4  ? 67.516 13.180  9.421   1.00 0.00  ? 4   ILE A HD13 2  
ATOM   1781  N  N    . TYR A 1 5  ? 67.373 8.319   9.034   1.00 0.00  ? 5   TYR A N    2  
ATOM   1782  C  CA   . TYR A 1 5  ? 66.202 7.401   8.882   1.00 0.00  ? 5   TYR A CA   2  
ATOM   1783  C  C    . TYR A 1 5  ? 66.597 5.979   9.314   1.00 0.00  ? 5   TYR A C    2  
ATOM   1784  O  O    . TYR A 1 5  ? 65.756 5.175   9.670   1.00 0.00  ? 5   TYR A O    2  
ATOM   1785  C  CB   . TYR A 1 5  ? 65.839 7.452   7.393   1.00 0.00  ? 5   TYR A CB   2  
ATOM   1786  C  CG   . TYR A 1 5  ? 65.159 8.768   7.088   1.00 0.00  ? 5   TYR A CG   2  
ATOM   1787  C  CD1  . TYR A 1 5  ? 63.850 9.000   7.531   1.00 0.00  ? 5   TYR A CD1  2  
ATOM   1788  C  CD2  . TYR A 1 5  ? 65.838 9.758   6.368   1.00 0.00  ? 5   TYR A CD2  2  
ATOM   1789  C  CE1  . TYR A 1 5  ? 63.222 10.220  7.251   1.00 0.00  ? 5   TYR A CE1  2  
ATOM   1790  C  CE2  . TYR A 1 5  ? 65.210 10.978  6.090   1.00 0.00  ? 5   TYR A CE2  2  
ATOM   1791  C  CZ   . TYR A 1 5  ? 63.903 11.209  6.532   1.00 0.00  ? 5   TYR A CZ   2  
ATOM   1792  O  OH   . TYR A 1 5  ? 63.286 12.412  6.258   1.00 0.00  ? 5   TYR A OH   2  
ATOM   1793  H  H    . TYR A 1 5  ? 67.841 8.652   8.239   1.00 0.00  ? 5   TYR A H    2  
ATOM   1794  H  HA   . TYR A 1 5  ? 65.373 7.753   9.475   1.00 0.00  ? 5   TYR A HA   2  
ATOM   1795  H  HB2  . TYR A 1 5  ? 66.736 7.363   6.799   1.00 0.00  ? 5   TYR A HB2  2  
ATOM   1796  H  HB3  . TYR A 1 5  ? 65.169 6.639   7.158   1.00 0.00  ? 5   TYR A HB3  2  
ATOM   1797  H  HD1  . TYR A 1 5  ? 63.325 8.237   8.086   1.00 0.00  ? 5   TYR A HD1  2  
ATOM   1798  H  HD2  . TYR A 1 5  ? 66.848 9.581   6.026   1.00 0.00  ? 5   TYR A HD2  2  
ATOM   1799  H  HE1  . TYR A 1 5  ? 62.212 10.399  7.591   1.00 0.00  ? 5   TYR A HE1  2  
ATOM   1800  H  HE2  . TYR A 1 5  ? 65.733 11.741  5.535   1.00 0.00  ? 5   TYR A HE2  2  
ATOM   1801  H  HH   . TYR A 1 5  ? 62.700 12.282  5.505   1.00 0.00  ? 5   TYR A HH   2  
ATOM   1802  N  N    . LYS A 1 6  ? 67.877 5.676   9.305   1.00 0.00  ? 6   LYS A N    2  
ATOM   1803  C  CA   . LYS A 1 6  ? 68.344 4.323   9.734   1.00 0.00  ? 6   LYS A CA   2  
ATOM   1804  C  C    . LYS A 1 6  ? 68.137 4.159   11.245  1.00 0.00  ? 6   LYS A C    2  
ATOM   1805  O  O    . LYS A 1 6  ? 67.569 3.184   11.696  1.00 0.00  ? 6   LYS A O    2  
ATOM   1806  C  CB   . LYS A 1 6  ? 69.837 4.287   9.386   1.00 0.00  ? 6   LYS A CB   2  
ATOM   1807  C  CG   . LYS A 1 6  ? 70.196 2.914   8.813   1.00 0.00  ? 6   LYS A CG   2  
ATOM   1808  C  CD   . LYS A 1 6  ? 70.666 3.070   7.366   1.00 0.00  ? 6   LYS A CD   2  
ATOM   1809  C  CE   . LYS A 1 6  ? 69.452 3.104   6.432   1.00 0.00  ? 6   LYS A CE   2  
ATOM   1810  N  NZ   . LYS A 1 6  ? 69.834 4.030   5.329   1.00 0.00  ? 6   LYS A NZ   2  
ATOM   1811  H  H    . LYS A 1 6  ? 68.534 6.348   9.027   1.00 0.00  ? 6   LYS A H    2  
ATOM   1812  H  HA   . LYS A 1 6  ? 67.817 3.552   9.194   1.00 0.00  ? 6   LYS A HA   2  
ATOM   1813  H  HB2  . LYS A 1 6  ? 70.056 5.055   8.655   1.00 0.00  ? 6   LYS A HB2  2  
ATOM   1814  H  HB3  . LYS A 1 6  ? 70.419 4.466   10.278  1.00 0.00  ? 6   LYS A HB3  2  
ATOM   1815  H  HG2  . LYS A 1 6  ? 70.986 2.473   9.404   1.00 0.00  ? 6   LYS A HG2  2  
ATOM   1816  H  HG3  . LYS A 1 6  ? 69.327 2.273   8.840   1.00 0.00  ? 6   LYS A HG3  2  
ATOM   1817  H  HD2  . LYS A 1 6  ? 71.225 3.990   7.267   1.00 0.00  ? 6   LYS A HD2  2  
ATOM   1818  H  HD3  . LYS A 1 6  ? 71.297 2.236   7.101   1.00 0.00  ? 6   LYS A HD3  2  
ATOM   1819  H  HE2  . LYS A 1 6  ? 69.251 2.114   6.044   1.00 0.00  ? 6   LYS A HE2  2  
ATOM   1820  H  HE3  . LYS A 1 6  ? 68.587 3.487   6.953   1.00 0.00  ? 6   LYS A HE3  2  
ATOM   1821  H  HZ1  . LYS A 1 6  ? 69.753 5.013   5.658   1.00 0.00  ? 6   LYS A HZ1  2  
ATOM   1822  H  HZ2  . LYS A 1 6  ? 69.200 3.881   4.518   1.00 0.00  ? 6   LYS A HZ2  2  
ATOM   1823  H  HZ3  . LYS A 1 6  ? 70.817 3.843   5.040   1.00 0.00  ? 6   LYS A HZ3  2  
ATOM   1824  N  N    . ALA A 1 7  ? 68.582 5.121   12.027  1.00 0.00  ? 7   ALA A N    2  
ATOM   1825  C  CA   . ALA A 1 7  ? 68.407 5.042   13.514  1.00 0.00  ? 7   ALA A CA   2  
ATOM   1826  C  C    . ALA A 1 7  ? 66.943 4.731   13.864  1.00 0.00  ? 7   ALA A C    2  
ATOM   1827  O  O    . ALA A 1 7  ? 66.663 3.965   14.767  1.00 0.00  ? 7   ALA A O    2  
ATOM   1828  C  CB   . ALA A 1 7  ? 68.802 6.427   14.033  1.00 0.00  ? 7   ALA A CB   2  
ATOM   1829  H  H    . ALA A 1 7  ? 69.026 5.900   11.631  1.00 0.00  ? 7   ALA A H    2  
ATOM   1830  H  HA   . ALA A 1 7  ? 69.060 4.291   13.932  1.00 0.00  ? 7   ALA A HA   2  
ATOM   1831  H  HB1  . ALA A 1 7  ? 68.109 7.163   13.655  1.00 0.00  ? 7   ALA A HB1  2  
ATOM   1832  H  HB2  . ALA A 1 7  ? 69.800 6.665   13.698  1.00 0.00  ? 7   ALA A HB2  2  
ATOM   1833  H  HB3  . ALA A 1 7  ? 68.774 6.428   15.113  1.00 0.00  ? 7   ALA A HB3  2  
ATOM   1834  N  N    . ALA A 1 8  ? 66.012 5.308   13.138  1.00 0.00  ? 8   ALA A N    2  
ATOM   1835  C  CA   . ALA A 1 8  ? 64.564 5.037   13.403  1.00 0.00  ? 8   ALA A CA   2  
ATOM   1836  C  C    . ALA A 1 8  ? 64.281 3.535   13.253  1.00 0.00  ? 8   ALA A C    2  
ATOM   1837  O  O    . ALA A 1 8  ? 63.583 2.947   14.054  1.00 0.00  ? 8   ALA A O    2  
ATOM   1838  C  CB   . ALA A 1 8  ? 63.808 5.841   12.340  1.00 0.00  ? 8   ALA A CB   2  
ATOM   1839  H  H    . ALA A 1 8  ? 66.268 5.911   12.408  1.00 0.00  ? 8   ALA A H    2  
ATOM   1840  H  HA   . ALA A 1 8  ? 64.289 5.376   14.389  1.00 0.00  ? 8   ALA A HA   2  
ATOM   1841  H  HB1  . ALA A 1 8  ? 64.153 6.864   12.350  1.00 0.00  ? 8   ALA A HB1  2  
ATOM   1842  H  HB2  . ALA A 1 8  ? 62.749 5.815   12.553  1.00 0.00  ? 8   ALA A HB2  2  
ATOM   1843  H  HB3  . ALA A 1 8  ? 63.990 5.410   11.366  1.00 0.00  ? 8   ALA A HB3  2  
ATOM   1844  N  N    . VAL A 1 9  ? 64.840 2.913   12.240  1.00 0.00  ? 9   VAL A N    2  
ATOM   1845  C  CA   . VAL A 1 9  ? 64.630 1.443   12.040  1.00 0.00  ? 9   VAL A CA   2  
ATOM   1846  C  C    . VAL A 1 9  ? 65.302 0.668   13.182  1.00 0.00  ? 9   VAL A C    2  
ATOM   1847  O  O    . VAL A 1 9  ? 64.739 -0.263  13.725  1.00 0.00  ? 9   VAL A O    2  
ATOM   1848  C  CB   . VAL A 1 9  ? 65.288 1.125   10.688  1.00 0.00  ? 9   VAL A CB   2  
ATOM   1849  C  CG1  . VAL A 1 9  ? 65.346 -0.390  10.472  1.00 0.00  ? 9   VAL A CG1  2  
ATOM   1850  C  CG2  . VAL A 1 9  ? 64.469 1.761   9.563   1.00 0.00  ? 9   VAL A CG2  2  
ATOM   1851  H  H    . VAL A 1 9  ? 65.412 3.411   11.619  1.00 0.00  ? 9   VAL A H    2  
ATOM   1852  H  HA   . VAL A 1 9  ? 63.577 1.216   12.001  1.00 0.00  ? 9   VAL A HA   2  
ATOM   1853  H  HB   . VAL A 1 9  ? 66.292 1.526   10.675  1.00 0.00  ? 9   VAL A HB   2  
ATOM   1854  H  HG11 . VAL A 1 9  ? 64.431 -0.842  10.826  1.00 0.00  ? 9   VAL A HG11 2  
ATOM   1855  H  HG12 . VAL A 1 9  ? 66.184 -0.800  11.015  1.00 0.00  ? 9   VAL A HG12 2  
ATOM   1856  H  HG13 . VAL A 1 9  ? 65.465 -0.599  9.418   1.00 0.00  ? 9   VAL A HG13 2  
ATOM   1857  H  HG21 . VAL A 1 9  ? 64.806 2.775   9.402   1.00 0.00  ? 9   VAL A HG21 2  
ATOM   1858  H  HG22 . VAL A 1 9  ? 63.424 1.767   9.836   1.00 0.00  ? 9   VAL A HG22 2  
ATOM   1859  H  HG23 . VAL A 1 9  ? 64.601 1.190   8.657   1.00 0.00  ? 9   VAL A HG23 2  
ATOM   1860  N  N    . GLU A 1 10 ? 66.497 1.063   13.561  1.00 0.00  ? 10  GLU A N    2  
ATOM   1861  C  CA   . GLU A 1 10 ? 67.207 0.371   14.685  1.00 0.00  ? 10  GLU A CA   2  
ATOM   1862  C  C    . GLU A 1 10 ? 66.353 0.426   15.960  1.00 0.00  ? 10  GLU A C    2  
ATOM   1863  O  O    . GLU A 1 10 ? 66.271 -0.533  16.704  1.00 0.00  ? 10  GLU A O    2  
ATOM   1864  C  CB   . GLU A 1 10 ? 68.508 1.158   14.881  1.00 0.00  ? 10  GLU A CB   2  
ATOM   1865  C  CG   . GLU A 1 10 ? 69.621 0.540   14.027  1.00 0.00  ? 10  GLU A CG   2  
ATOM   1866  C  CD   . GLU A 1 10 ? 69.754 1.312   12.710  1.00 0.00  ? 10  GLU A CD   2  
ATOM   1867  O  OE1  . GLU A 1 10 ? 70.370 2.366   12.723  1.00 0.00  ? 10  GLU A OE1  2  
ATOM   1868  O  OE2  . GLU A 1 10 ? 69.240 0.833   11.712  1.00 0.00  ? 10  GLU A OE2  2  
ATOM   1869  H  H    . GLU A 1 10 ? 66.921 1.824   13.113  1.00 0.00  ? 10  GLU A H    2  
ATOM   1870  H  HA   . GLU A 1 10 ? 67.428 -0.651  14.422  1.00 0.00  ? 10  GLU A HA   2  
ATOM   1871  H  HB2  . GLU A 1 10 ? 68.354 2.186   14.584  1.00 0.00  ? 10  GLU A HB2  2  
ATOM   1872  H  HB3  . GLU A 1 10 ? 68.796 1.124   15.921  1.00 0.00  ? 10  GLU A HB3  2  
ATOM   1873  H  HG2  . GLU A 1 10 ? 70.555 0.588   14.566  1.00 0.00  ? 10  GLU A HG2  2  
ATOM   1874  H  HG3  . GLU A 1 10 ? 69.381 -0.490  13.813  1.00 0.00  ? 10  GLU A HG3  2  
ATOM   1875  N  N    . GLN A 1 11 ? 65.711 1.542   16.208  1.00 0.00  ? 11  GLN A N    2  
ATOM   1876  C  CA   . GLN A 1 11 ? 64.850 1.671   17.423  1.00 0.00  ? 11  GLN A CA   2  
ATOM   1877  C  C    . GLN A 1 11 ? 63.367 1.701   17.014  1.00 0.00  ? 11  GLN A C    2  
ATOM   1878  O  O    . GLN A 1 11 ? 62.608 2.545   17.454  1.00 0.00  ? 11  GLN A O    2  
ATOM   1879  C  CB   . GLN A 1 11 ? 65.269 2.999   18.065  1.00 0.00  ? 11  GLN A CB   2  
ATOM   1880  C  CG   . GLN A 1 11 ? 66.552 2.797   18.878  1.00 0.00  ? 11  GLN A CG   2  
ATOM   1881  C  CD   . GLN A 1 11 ? 66.406 3.473   20.244  1.00 0.00  ? 11  GLN A CD   2  
ATOM   1882  O  OE1  . GLN A 1 11 ? 65.739 2.962   21.119  1.00 0.00  ? 11  GLN A OE1  2  
ATOM   1883  N  NE2  . GLN A 1 11 ? 67.005 4.610   20.466  1.00 0.00  ? 11  GLN A NE2  2  
ATOM   1884  H  H    . GLN A 1 11 ? 65.790 2.298   15.586  1.00 0.00  ? 11  GLN A H    2  
ATOM   1885  H  HA   . GLN A 1 11 ? 65.035 0.856   18.105  1.00 0.00  ? 11  GLN A HA   2  
ATOM   1886  H  HB2  . GLN A 1 11 ? 65.446 3.734   17.291  1.00 0.00  ? 11  GLN A HB2  2  
ATOM   1887  H  HB3  . GLN A 1 11 ? 64.483 3.347   18.718  1.00 0.00  ? 11  GLN A HB3  2  
ATOM   1888  H  HG2  . GLN A 1 11 ? 66.729 1.741   19.016  1.00 0.00  ? 11  GLN A HG2  2  
ATOM   1889  H  HG3  . GLN A 1 11 ? 67.384 3.236   18.350  1.00 0.00  ? 11  GLN A HG3  2  
ATOM   1890  H  HE21 . GLN A 1 11 ? 67.545 5.027   19.763  1.00 0.00  ? 11  GLN A HE21 2  
ATOM   1891  H  HE22 . GLN A 1 11 ? 66.913 5.048   21.337  1.00 0.00  ? 11  GLN A HE22 2  
ATOM   1892  N  N    . LEU A 1 12 ? 62.952 0.782   16.174  1.00 0.00  ? 12  LEU A N    2  
ATOM   1893  C  CA   . LEU A 1 12 ? 61.520 0.753   15.730  1.00 0.00  ? 12  LEU A CA   2  
ATOM   1894  C  C    . LEU A 1 12 ? 60.647 0.032   16.766  1.00 0.00  ? 12  LEU A C    2  
ATOM   1895  O  O    . LEU A 1 12 ? 61.131 -0.747  17.566  1.00 0.00  ? 12  LEU A O    2  
ATOM   1896  C  CB   . LEU A 1 12 ? 61.522 -0.020  14.404  1.00 0.00  ? 12  LEU A CB   2  
ATOM   1897  C  CG   . LEU A 1 12 ? 61.237 0.938   13.242  1.00 0.00  ? 12  LEU A CG   2  
ATOM   1898  C  CD1  . LEU A 1 12 ? 61.344 0.178   11.920  1.00 0.00  ? 12  LEU A CD1  2  
ATOM   1899  C  CD2  . LEU A 1 12 ? 59.825 1.512   13.376  1.00 0.00  ? 12  LEU A CD2  2  
ATOM   1900  H  H    . LEU A 1 12 ? 63.582 0.112   15.833  1.00 0.00  ? 12  LEU A H    2  
ATOM   1901  H  HA   . LEU A 1 12 ? 61.158 1.756   15.570  1.00 0.00  ? 12  LEU A HA   2  
ATOM   1902  H  HB2  . LEU A 1 12 ? 62.487 -0.483  14.259  1.00 0.00  ? 12  LEU A HB2  2  
ATOM   1903  H  HB3  . LEU A 1 12 ? 60.759 -0.783  14.431  1.00 0.00  ? 12  LEU A HB3  2  
ATOM   1904  H  HG   . LEU A 1 12 ? 61.958 1.742   13.253  1.00 0.00  ? 12  LEU A HG   2  
ATOM   1905  H  HD11 . LEU A 1 12 ? 62.251 -0.409  11.915  1.00 0.00  ? 12  LEU A HD11 2  
ATOM   1906  H  HD12 . LEU A 1 12 ? 61.367 0.883   11.101  1.00 0.00  ? 12  LEU A HD12 2  
ATOM   1907  H  HD13 . LEU A 1 12 ? 60.491 -0.475  11.809  1.00 0.00  ? 12  LEU A HD13 2  
ATOM   1908  H  HD21 . LEU A 1 12 ? 59.706 1.953   14.355  1.00 0.00  ? 12  LEU A HD21 2  
ATOM   1909  H  HD22 . LEU A 1 12 ? 59.103 0.721   13.247  1.00 0.00  ? 12  LEU A HD22 2  
ATOM   1910  H  HD23 . LEU A 1 12 ? 59.670 2.267   12.620  1.00 0.00  ? 12  LEU A HD23 2  
ATOM   1911  N  N    . THR A 1 13 ? 59.363 0.286   16.750  1.00 0.00  ? 13  THR A N    2  
ATOM   1912  C  CA   . THR A 1 13 ? 58.447 -0.382  17.729  1.00 0.00  ? 13  THR A CA   2  
ATOM   1913  C  C    . THR A 1 13 ? 58.113 -1.796  17.268  1.00 0.00  ? 13  THR A C    2  
ATOM   1914  O  O    . THR A 1 13 ? 58.133 -2.097  16.088  1.00 0.00  ? 13  THR A O    2  
ATOM   1915  C  CB   . THR A 1 13 ? 57.176 0.473   17.772  1.00 0.00  ? 13  THR A CB   2  
ATOM   1916  O  OG1  . THR A 1 13 ? 57.474 1.817   17.413  1.00 0.00  ? 13  THR A OG1  2  
ATOM   1917  C  CG2  . THR A 1 13 ? 56.588 0.443   19.182  1.00 0.00  ? 13  THR A CG2  2  
ATOM   1918  H  H    . THR A 1 13 ? 58.997 0.917   16.092  1.00 0.00  ? 13  THR A H    2  
ATOM   1919  H  HA   . THR A 1 13 ? 58.896 -0.416  18.701  1.00 0.00  ? 13  THR A HA   2  
ATOM   1920  H  HB   . THR A 1 13 ? 56.459 0.069   17.084  1.00 0.00  ? 13  THR A HB   2  
ATOM   1921  H  HG1  . THR A 1 13 ? 56.687 2.198   17.012  1.00 0.00  ? 13  THR A HG1  2  
ATOM   1922  H  HG21 . THR A 1 13 ? 56.121 -0.515  19.357  1.00 0.00  ? 13  THR A HG21 2  
ATOM   1923  H  HG22 . THR A 1 13 ? 55.852 1.227   19.281  1.00 0.00  ? 13  THR A HG22 2  
ATOM   1924  H  HG23 . THR A 1 13 ? 57.376 0.595   19.903  1.00 0.00  ? 13  THR A HG23 2  
ATOM   1925  N  N    . GLU A 1 14 ? 57.801 -2.667  18.195  1.00 0.00  ? 14  GLU A N    2  
ATOM   1926  C  CA   . GLU A 1 14 ? 57.458 -4.070  17.819  1.00 0.00  ? 14  GLU A CA   2  
ATOM   1927  C  C    . GLU A 1 14 ? 56.266 -4.077  16.853  1.00 0.00  ? 14  GLU A C    2  
ATOM   1928  O  O    . GLU A 1 14 ? 56.295 -4.732  15.831  1.00 0.00  ? 14  GLU A O    2  
ATOM   1929  C  CB   . GLU A 1 14 ? 57.103 -4.774  19.134  1.00 0.00  ? 14  GLU A CB   2  
ATOM   1930  C  CG   . GLU A 1 14 ? 56.753 -6.244  18.860  1.00 0.00  ? 14  GLU A CG   2  
ATOM   1931  C  CD   . GLU A 1 14 ? 57.916 -6.934  18.138  1.00 0.00  ? 14  GLU A CD   2  
ATOM   1932  O  OE1  . GLU A 1 14 ? 58.898 -7.241  18.791  1.00 0.00  ? 14  GLU A OE1  2  
ATOM   1933  O  OE2  . GLU A 1 14 ? 57.804 -7.147  16.941  1.00 0.00  ? 14  GLU A OE2  2  
ATOM   1934  H  H    . GLU A 1 14 ? 57.791 -2.396  19.136  1.00 0.00  ? 14  GLU A H    2  
ATOM   1935  H  HA   . GLU A 1 14 ? 58.312 -4.543  17.367  1.00 0.00  ? 14  GLU A HA   2  
ATOM   1936  H  HB2  . GLU A 1 14 ? 57.947 -4.724  19.808  1.00 0.00  ? 14  GLU A HB2  2  
ATOM   1937  H  HB3  . GLU A 1 14 ? 56.254 -4.283  19.586  1.00 0.00  ? 14  GLU A HB3  2  
ATOM   1938  H  HG2  . GLU A 1 14 ? 56.563 -6.748  19.796  1.00 0.00  ? 14  GLU A HG2  2  
ATOM   1939  H  HG3  . GLU A 1 14 ? 55.871 -6.293  18.240  1.00 0.00  ? 14  GLU A HG3  2  
ATOM   1940  N  N    . GLU A 1 15 ? 55.226 -3.336  17.163  1.00 0.00  ? 15  GLU A N    2  
ATOM   1941  C  CA   . GLU A 1 15 ? 54.036 -3.283  16.253  1.00 0.00  ? 15  GLU A CA   2  
ATOM   1942  C  C    . GLU A 1 15 ? 54.466 -2.809  14.857  1.00 0.00  ? 15  GLU A C    2  
ATOM   1943  O  O    . GLU A 1 15 ? 54.084 -3.381  13.855  1.00 0.00  ? 15  GLU A O    2  
ATOM   1944  C  CB   . GLU A 1 15 ? 53.081 -2.270  16.895  1.00 0.00  ? 15  GLU A CB   2  
ATOM   1945  C  CG   . GLU A 1 15 ? 51.688 -2.415  16.273  1.00 0.00  ? 15  GLU A CG   2  
ATOM   1946  C  CD   . GLU A 1 15 ? 50.964 -1.067  16.295  1.00 0.00  ? 15  GLU A CD   2  
ATOM   1947  O  OE1  . GLU A 1 15 ? 50.504 -0.679  17.356  1.00 0.00  ? 15  GLU A OE1  2  
ATOM   1948  O  OE2  . GLU A 1 15 ? 50.880 -0.446  15.248  1.00 0.00  ? 15  GLU A OE2  2  
ATOM   1949  H  H    . GLU A 1 15 ? 55.233 -2.807  17.988  1.00 0.00  ? 15  GLU A H    2  
ATOM   1950  H  HA   . GLU A 1 15 ? 53.563 -4.251  16.193  1.00 0.00  ? 15  GLU A HA   2  
ATOM   1951  H  HB2  . GLU A 1 15 ? 53.022 -2.454  17.958  1.00 0.00  ? 15  GLU A HB2  2  
ATOM   1952  H  HB3  . GLU A 1 15 ? 53.448 -1.269  16.723  1.00 0.00  ? 15  GLU A HB3  2  
ATOM   1953  H  HG2  . GLU A 1 15 ? 51.784 -2.753  15.251  1.00 0.00  ? 15  GLU A HG2  2  
ATOM   1954  H  HG3  . GLU A 1 15 ? 51.115 -3.136  16.836  1.00 0.00  ? 15  GLU A HG3  2  
ATOM   1955  N  N    . GLN A 1 16 ? 55.270 -1.774  14.793  1.00 0.00  ? 16  GLN A N    2  
ATOM   1956  C  CA   . GLN A 1 16 ? 55.746 -1.259  13.471  1.00 0.00  ? 16  GLN A CA   2  
ATOM   1957  C  C    . GLN A 1 16 ? 56.588 -2.320  12.765  1.00 0.00  ? 16  GLN A C    2  
ATOM   1958  O  O    . GLN A 1 16 ? 56.392 -2.621  11.604  1.00 0.00  ? 16  GLN A O    2  
ATOM   1959  C  CB   . GLN A 1 16 ? 56.605 -0.033  13.808  1.00 0.00  ? 16  GLN A CB   2  
ATOM   1960  C  CG   . GLN A 1 16 ? 55.736 1.229   13.842  1.00 0.00  ? 16  GLN A CG   2  
ATOM   1961  C  CD   . GLN A 1 16 ? 54.560 1.033   14.804  1.00 0.00  ? 16  GLN A CD   2  
ATOM   1962  O  OE1  . GLN A 1 16 ? 54.716 1.142   16.003  1.00 0.00  ? 16  GLN A OE1  2  
ATOM   1963  N  NE2  . GLN A 1 16 ? 53.383 0.745   14.326  1.00 0.00  ? 16  GLN A NE2  2  
ATOM   1964  H  H    . GLN A 1 16 ? 55.569 -1.340  15.620  1.00 0.00  ? 16  GLN A H    2  
ATOM   1965  H  HA   . GLN A 1 16 ? 54.920 -0.975  12.860  1.00 0.00  ? 16  GLN A HA   2  
ATOM   1966  H  HB2  . GLN A 1 16 ? 57.070 -0.176  14.773  1.00 0.00  ? 16  GLN A HB2  2  
ATOM   1967  H  HB3  . GLN A 1 16 ? 57.370 0.082   13.056  1.00 0.00  ? 16  GLN A HB3  2  
ATOM   1968  H  HG2  . GLN A 1 16 ? 56.334 2.065   14.175  1.00 0.00  ? 16  GLN A HG2  2  
ATOM   1969  H  HG3  . GLN A 1 16 ? 55.359 1.430   12.853  1.00 0.00  ? 16  GLN A HG3  2  
ATOM   1970  H  HE21 . GLN A 1 16 ? 53.253 0.656   13.360  1.00 0.00  ? 16  GLN A HE21 2  
ATOM   1971  H  HE22 . GLN A 1 16 ? 52.626 0.613   14.935  1.00 0.00  ? 16  GLN A HE22 2  
ATOM   1972  N  N    . LYS A 1 17 ? 57.516 -2.884  13.477  1.00 0.00  ? 17  LYS A N    2  
ATOM   1973  C  CA   . LYS A 1 17 ? 58.398 -3.943  12.894  1.00 0.00  ? 17  LYS A CA   2  
ATOM   1974  C  C    . LYS A 1 17 ? 57.557 -5.144  12.444  1.00 0.00  ? 17  LYS A C    2  
ATOM   1975  O  O    . LYS A 1 17 ? 57.691 -5.621  11.333  1.00 0.00  ? 17  LYS A O    2  
ATOM   1976  C  CB   . LYS A 1 17 ? 59.346 -4.340  14.032  1.00 0.00  ? 17  LYS A CB   2  
ATOM   1977  C  CG   . LYS A 1 17 ? 60.276 -5.465  13.564  1.00 0.00  ? 17  LYS A CG   2  
ATOM   1978  C  CD   . LYS A 1 17 ? 59.883 -6.779  14.247  1.00 0.00  ? 17  LYS A CD   2  
ATOM   1979  C  CE   . LYS A 1 17 ? 60.937 -7.147  15.297  1.00 0.00  ? 17  LYS A CE   2  
ATOM   1980  N  NZ   . LYS A 1 17 ? 60.340 -8.272  16.072  1.00 0.00  ? 17  LYS A NZ   2  
ATOM   1981  H  H    . LYS A 1 17 ? 57.627 -2.610  14.407  1.00 0.00  ? 17  LYS A H    2  
ATOM   1982  H  HA   . LYS A 1 17 ? 58.963 -3.547  12.065  1.00 0.00  ? 17  LYS A HA   2  
ATOM   1983  H  HB2  . LYS A 1 17 ? 59.935 -3.481  14.323  1.00 0.00  ? 17  LYS A HB2  2  
ATOM   1984  H  HB3  . LYS A 1 17 ? 58.767 -4.680  14.878  1.00 0.00  ? 17  LYS A HB3  2  
ATOM   1985  H  HG2  . LYS A 1 17 ? 60.194 -5.577  12.492  1.00 0.00  ? 17  LYS A HG2  2  
ATOM   1986  H  HG3  . LYS A 1 17 ? 61.296 -5.218  13.821  1.00 0.00  ? 17  LYS A HG3  2  
ATOM   1987  H  HD2  . LYS A 1 17 ? 58.921 -6.663  14.726  1.00 0.00  ? 17  LYS A HD2  2  
ATOM   1988  H  HD3  . LYS A 1 17 ? 59.825 -7.564  13.508  1.00 0.00  ? 17  LYS A HD3  2  
ATOM   1989  H  HE2  . LYS A 1 17 ? 61.852 -7.462  14.813  1.00 0.00  ? 17  LYS A HE2  2  
ATOM   1990  H  HE3  . LYS A 1 17 ? 61.126 -6.307  15.949  1.00 0.00  ? 17  LYS A HE3  2  
ATOM   1991  H  HZ1  . LYS A 1 17 ? 60.967 -8.520  16.862  1.00 0.00  ? 17  LYS A HZ1  2  
ATOM   1992  H  HZ2  . LYS A 1 17 ? 60.220 -9.097  15.451  1.00 0.00  ? 17  LYS A HZ2  2  
ATOM   1993  H  HZ3  . LYS A 1 17 ? 59.413 -7.982  16.448  1.00 0.00  ? 17  LYS A HZ3  2  
ATOM   1994  N  N    . ASN A 1 18 ? 56.687 -5.629  13.298  1.00 0.00  ? 18  ASN A N    2  
ATOM   1995  C  CA   . ASN A 1 18 ? 55.826 -6.795  12.924  1.00 0.00  ? 18  ASN A CA   2  
ATOM   1996  C  C    . ASN A 1 18 ? 54.927 -6.428  11.735  1.00 0.00  ? 18  ASN A C    2  
ATOM   1997  O  O    . ASN A 1 18 ? 54.722 -7.222  10.837  1.00 0.00  ? 18  ASN A O    2  
ATOM   1998  C  CB   . ASN A 1 18 ? 54.980 -7.093  14.168  1.00 0.00  ? 18  ASN A CB   2  
ATOM   1999  C  CG   . ASN A 1 18 ? 55.141 -8.563  14.559  1.00 0.00  ? 18  ASN A CG   2  
ATOM   2000  O  OD1  . ASN A 1 18 ? 54.550 -9.431  13.952  1.00 0.00  ? 18  ASN A OD1  2  
ATOM   2001  N  ND2  . ASN A 1 18 ? 55.921 -8.882  15.553  1.00 0.00  ? 18  ASN A ND2  2  
ATOM   2002  H  H    . ASN A 1 18 ? 56.598 -5.220  14.185  1.00 0.00  ? 18  ASN A H    2  
ATOM   2003  H  HA   . ASN A 1 18 ? 56.438 -7.650  12.681  1.00 0.00  ? 18  ASN A HA   2  
ATOM   2004  H  HB2  . ASN A 1 18 ? 55.306 -6.467  14.985  1.00 0.00  ? 18  ASN A HB2  2  
ATOM   2005  H  HB3  . ASN A 1 18 ? 53.941 -6.893  13.955  1.00 0.00  ? 18  ASN A HB3  2  
ATOM   2006  H  HD21 . ASN A 1 18 ? 56.401 -8.183  16.045  1.00 0.00  ? 18  ASN A HD21 2  
ATOM   2007  H  HD22 . ASN A 1 18 ? 56.024 -9.822  15.810  1.00 0.00  ? 18  ASN A HD22 2  
ATOM   2008  N  N    . GLU A 1 19 ? 54.399 -5.226  11.722  1.00 0.00  ? 19  GLU A N    2  
ATOM   2009  C  CA   . GLU A 1 19 ? 53.521 -4.799  10.587  1.00 0.00  ? 19  GLU A CA   2  
ATOM   2010  C  C    . GLU A 1 19 ? 54.328 -4.768  9.282   1.00 0.00  ? 19  GLU A C    2  
ATOM   2011  O  O    . GLU A 1 19 ? 53.915 -5.318  8.279   1.00 0.00  ? 19  GLU A O    2  
ATOM   2012  C  CB   . GLU A 1 19 ? 53.036 -3.392  10.951  1.00 0.00  ? 19  GLU A CB   2  
ATOM   2013  C  CG   . GLU A 1 19 ? 51.664 -3.474  11.633  1.00 0.00  ? 19  GLU A CG   2  
ATOM   2014  C  CD   . GLU A 1 19 ? 50.586 -3.805  10.597  1.00 0.00  ? 19  GLU A CD   2  
ATOM   2015  O  OE1  . GLU A 1 19 ? 50.165 -2.898  9.897   1.00 0.00  ? 19  GLU A OE1  2  
ATOM   2016  O  OE2  . GLU A 1 19 ? 50.198 -4.959  10.523  1.00 0.00  ? 19  GLU A OE2  2  
ATOM   2017  H  H    . GLU A 1 19 ? 54.586 -4.602  12.456  1.00 0.00  ? 19  GLU A H    2  
ATOM   2018  H  HA   . GLU A 1 19 ? 52.680 -5.467  10.492  1.00 0.00  ? 19  GLU A HA   2  
ATOM   2019  H  HB2  . GLU A 1 19 ? 53.745 -2.928  11.622  1.00 0.00  ? 19  GLU A HB2  2  
ATOM   2020  H  HB3  . GLU A 1 19 ? 52.952 -2.799  10.053  1.00 0.00  ? 19  GLU A HB3  2  
ATOM   2021  H  HG2  . GLU A 1 19 ? 51.683 -4.245  12.389  1.00 0.00  ? 19  GLU A HG2  2  
ATOM   2022  H  HG3  . GLU A 1 19 ? 51.435 -2.525  12.094  1.00 0.00  ? 19  GLU A HG3  2  
ATOM   2023  N  N    . PHE A 1 20 ? 55.481 -4.138  9.291   1.00 0.00  ? 20  PHE A N    2  
ATOM   2024  C  CA   . PHE A 1 20 ? 56.320 -4.083  8.050   1.00 0.00  ? 20  PHE A CA   2  
ATOM   2025  C  C    . PHE A 1 20 ? 56.828 -5.486  7.690   1.00 0.00  ? 20  PHE A C    2  
ATOM   2026  O  O    . PHE A 1 20 ? 56.942 -5.828  6.530   1.00 0.00  ? 20  PHE A O    2  
ATOM   2027  C  CB   . PHE A 1 20 ? 57.493 -3.151  8.385   1.00 0.00  ? 20  PHE A CB   2  
ATOM   2028  C  CG   . PHE A 1 20 ? 57.007 -1.721  8.483   1.00 0.00  ? 20  PHE A CG   2  
ATOM   2029  C  CD1  . PHE A 1 20 ? 56.081 -1.222  7.554   1.00 0.00  ? 20  PHE A CD1  2  
ATOM   2030  C  CD2  . PHE A 1 20 ? 57.481 -0.894  9.507   1.00 0.00  ? 20  PHE A CD2  2  
ATOM   2031  C  CE1  . PHE A 1 20 ? 55.633 0.099   7.653   1.00 0.00  ? 20  PHE A CE1  2  
ATOM   2032  C  CE2  . PHE A 1 20 ? 57.033 0.428   9.605   1.00 0.00  ? 20  PHE A CE2  2  
ATOM   2033  C  CZ   . PHE A 1 20 ? 56.109 0.925   8.680   1.00 0.00  ? 20  PHE A CZ   2  
ATOM   2034  H  H    . PHE A 1 20 ? 55.797 -3.709  10.115  1.00 0.00  ? 20  PHE A H    2  
ATOM   2035  H  HA   . PHE A 1 20 ? 55.749 -3.674  7.231   1.00 0.00  ? 20  PHE A HA   2  
ATOM   2036  H  HB2  . PHE A 1 20 ? 57.926 -3.448  9.329   1.00 0.00  ? 20  PHE A HB2  2  
ATOM   2037  H  HB3  . PHE A 1 20 ? 58.241 -3.222  7.610   1.00 0.00  ? 20  PHE A HB3  2  
ATOM   2038  H  HD1  . PHE A 1 20 ? 55.715 -1.856  6.761   1.00 0.00  ? 20  PHE A HD1  2  
ATOM   2039  H  HD2  . PHE A 1 20 ? 58.195 -1.277  10.222  1.00 0.00  ? 20  PHE A HD2  2  
ATOM   2040  H  HE1  . PHE A 1 20 ? 54.921 0.482   6.938   1.00 0.00  ? 20  PHE A HE1  2  
ATOM   2041  H  HE2  . PHE A 1 20 ? 57.400 1.065   10.396  1.00 0.00  ? 20  PHE A HE2  2  
ATOM   2042  H  HZ   . PHE A 1 20 ? 55.763 1.945   8.757   1.00 0.00  ? 20  PHE A HZ   2  
ATOM   2043  N  N    . LYS A 1 21 ? 57.123 -6.301  8.676   1.00 0.00  ? 21  LYS A N    2  
ATOM   2044  C  CA   . LYS A 1 21 ? 57.612 -7.689  8.396   1.00 0.00  ? 21  LYS A CA   2  
ATOM   2045  C  C    . LYS A 1 21 ? 56.570 -8.453  7.567   1.00 0.00  ? 21  LYS A C    2  
ATOM   2046  O  O    . LYS A 1 21 ? 56.872 -8.982  6.515   1.00 0.00  ? 21  LYS A O    2  
ATOM   2047  C  CB   . LYS A 1 21 ? 57.792 -8.330  9.781   1.00 0.00  ? 21  LYS A CB   2  
ATOM   2048  C  CG   . LYS A 1 21 ? 57.868 -9.858  9.654   1.00 0.00  ? 21  LYS A CG   2  
ATOM   2049  C  CD   . LYS A 1 21 ? 59.279 -10.272 9.215   1.00 0.00  ? 21  LYS A CD   2  
ATOM   2050  C  CE   . LYS A 1 21 ? 59.252 -10.774 7.765   1.00 0.00  ? 21  LYS A CE   2  
ATOM   2051  N  NZ   . LYS A 1 21 ? 58.810 -12.198 7.846   1.00 0.00  ? 21  LYS A NZ   2  
ATOM   2052  H  H    . LYS A 1 21 ? 57.016 -6.001  9.604   1.00 0.00  ? 21  LYS A H    2  
ATOM   2053  H  HA   . LYS A 1 21 ? 58.557 -7.659  7.878   1.00 0.00  ? 21  LYS A HA   2  
ATOM   2054  H  HB2  . LYS A 1 21 ? 58.703 -7.962  10.229  1.00 0.00  ? 21  LYS A HB2  2  
ATOM   2055  H  HB3  . LYS A 1 21 ? 56.954 -8.067  10.410  1.00 0.00  ? 21  LYS A HB3  2  
ATOM   2056  H  HG2  . LYS A 1 21 ? 57.644 -10.307 10.612  1.00 0.00  ? 21  LYS A HG2  2  
ATOM   2057  H  HG3  . LYS A 1 21 ? 57.147 -10.196 8.922   1.00 0.00  ? 21  LYS A HG3  2  
ATOM   2058  H  HD2  . LYS A 1 21 ? 59.942 -9.421  9.288   1.00 0.00  ? 21  LYS A HD2  2  
ATOM   2059  H  HD3  . LYS A 1 21 ? 59.638 -11.061 9.860   1.00 0.00  ? 21  LYS A HD3  2  
ATOM   2060  H  HE2  . LYS A 1 21 ? 58.551 -10.194 7.181   1.00 0.00  ? 21  LYS A HE2  2  
ATOM   2061  H  HE3  . LYS A 1 21 ? 60.238 -10.718 7.330   1.00 0.00  ? 21  LYS A HE3  2  
ATOM   2062  H  HZ1  . LYS A 1 21 ? 59.578 -12.780 8.235   1.00 0.00  ? 21  LYS A HZ1  2  
ATOM   2063  H  HZ2  . LYS A 1 21 ? 58.566 -12.538 6.891   1.00 0.00  ? 21  LYS A HZ2  2  
ATOM   2064  H  HZ3  . LYS A 1 21 ? 57.976 -12.272 8.461   1.00 0.00  ? 21  LYS A HZ3  2  
ATOM   2065  N  N    . ALA A 1 22 ? 55.350 -8.510  8.036   1.00 0.00  ? 22  ALA A N    2  
ATOM   2066  C  CA   . ALA A 1 22 ? 54.283 -9.237  7.281   1.00 0.00  ? 22  ALA A CA   2  
ATOM   2067  C  C    . ALA A 1 22 ? 53.985 -8.530  5.949   1.00 0.00  ? 22  ALA A C    2  
ATOM   2068  O  O    . ALA A 1 22 ? 53.828 -9.169  4.926   1.00 0.00  ? 22  ALA A O    2  
ATOM   2069  C  CB   . ALA A 1 22 ? 53.063 -9.210  8.202   1.00 0.00  ? 22  ALA A CB   2  
ATOM   2070  H  H    . ALA A 1 22 ? 55.134 -8.071  8.887   1.00 0.00  ? 22  ALA A H    2  
ATOM   2071  H  HA   . ALA A 1 22 ? 54.583 -10.258 7.102   1.00 0.00  ? 22  ALA A HA   2  
ATOM   2072  H  HB1  . ALA A 1 22 ? 52.267 -9.792  7.764   1.00 0.00  ? 22  ALA A HB1  2  
ATOM   2073  H  HB2  . ALA A 1 22 ? 52.734 -8.190  8.337   1.00 0.00  ? 22  ALA A HB2  2  
ATOM   2074  H  HB3  . ALA A 1 22 ? 53.332 -9.631  9.161   1.00 0.00  ? 22  ALA A HB3  2  
ATOM   2075  N  N    . ALA A 1 23 ? 53.917 -7.218  5.952   1.00 0.00  ? 23  ALA A N    2  
ATOM   2076  C  CA   . ALA A 1 23 ? 53.641 -6.473  4.681   1.00 0.00  ? 23  ALA A CA   2  
ATOM   2077  C  C    . ALA A 1 23 ? 54.762 -6.732  3.663   1.00 0.00  ? 23  ALA A C    2  
ATOM   2078  O  O    . ALA A 1 23 ? 54.511 -6.920  2.487   1.00 0.00  ? 23  ALA A O    2  
ATOM   2079  C  CB   . ALA A 1 23 ? 53.602 -4.994  5.078   1.00 0.00  ? 23  ALA A CB   2  
ATOM   2080  H  H    . ALA A 1 23 ? 54.056 -6.724  6.789   1.00 0.00  ? 23  ALA A H    2  
ATOM   2081  H  HA   . ALA A 1 23 ? 52.688 -6.770  4.272   1.00 0.00  ? 23  ALA A HA   2  
ATOM   2082  H  HB1  . ALA A 1 23 ? 54.527 -4.517  4.787   1.00 0.00  ? 23  ALA A HB1  2  
ATOM   2083  H  HB2  . ALA A 1 23 ? 53.474 -4.910  6.147   1.00 0.00  ? 23  ALA A HB2  2  
ATOM   2084  H  HB3  . ALA A 1 23 ? 52.775 -4.509  4.579   1.00 0.00  ? 23  ALA A HB3  2  
ATOM   2085  N  N    . PHE A 1 24 ? 55.995 -6.755  4.115   1.00 0.00  ? 24  PHE A N    2  
ATOM   2086  C  CA   . PHE A 1 24 ? 57.142 -7.015  3.187   1.00 0.00  ? 24  PHE A CA   2  
ATOM   2087  C  C    . PHE A 1 24 ? 56.994 -8.399  2.541   1.00 0.00  ? 24  PHE A C    2  
ATOM   2088  O  O    . PHE A 1 24 ? 57.168 -8.555  1.347   1.00 0.00  ? 24  PHE A O    2  
ATOM   2089  C  CB   . PHE A 1 24 ? 58.392 -6.964  4.075   1.00 0.00  ? 24  PHE A CB   2  
ATOM   2090  C  CG   . PHE A 1 24 ? 59.629 -7.151  3.228   1.00 0.00  ? 24  PHE A CG   2  
ATOM   2091  C  CD1  . PHE A 1 24 ? 60.251 -6.041  2.645   1.00 0.00  ? 24  PHE A CD1  2  
ATOM   2092  C  CD2  . PHE A 1 24 ? 60.156 -8.433  3.030   1.00 0.00  ? 24  PHE A CD2  2  
ATOM   2093  C  CE1  . PHE A 1 24 ? 61.397 -6.212  1.862   1.00 0.00  ? 24  PHE A CE1  2  
ATOM   2094  C  CE2  . PHE A 1 24 ? 61.303 -8.603  2.245   1.00 0.00  ? 24  PHE A CE2  2  
ATOM   2095  C  CZ   . PHE A 1 24 ? 61.924 -7.493  1.663   1.00 0.00  ? 24  PHE A CZ   2  
ATOM   2096  H  H    . PHE A 1 24 ? 56.165 -6.609  5.070   1.00 0.00  ? 24  PHE A H    2  
ATOM   2097  H  HA   . PHE A 1 24 ? 57.196 -6.249  2.430   1.00 0.00  ? 24  PHE A HA   2  
ATOM   2098  H  HB2  . PHE A 1 24 ? 58.439 -6.007  4.573   1.00 0.00  ? 24  PHE A HB2  2  
ATOM   2099  H  HB3  . PHE A 1 24 ? 58.340 -7.751  4.813   1.00 0.00  ? 24  PHE A HB3  2  
ATOM   2100  H  HD1  . PHE A 1 24 ? 59.845 -5.054  2.798   1.00 0.00  ? 24  PHE A HD1  2  
ATOM   2101  H  HD2  . PHE A 1 24 ? 59.677 -9.290  3.479   1.00 0.00  ? 24  PHE A HD2  2  
ATOM   2102  H  HE1  . PHE A 1 24 ? 61.876 -5.355  1.411   1.00 0.00  ? 24  PHE A HE1  2  
ATOM   2103  H  HE2  . PHE A 1 24 ? 61.710 -9.591  2.091   1.00 0.00  ? 24  PHE A HE2  2  
ATOM   2104  H  HZ   . PHE A 1 24 ? 62.809 -7.624  1.059   1.00 0.00  ? 24  PHE A HZ   2  
ATOM   2105  N  N    . ASP A 1 25 ? 56.667 -9.400  3.325   1.00 0.00  ? 25  ASP A N    2  
ATOM   2106  C  CA   . ASP A 1 25 ? 56.497 -10.780 2.768   1.00 0.00  ? 25  ASP A CA   2  
ATOM   2107  C  C    . ASP A 1 25 ? 55.378 -10.794 1.713   1.00 0.00  ? 25  ASP A C    2  
ATOM   2108  O  O    . ASP A 1 25 ? 55.482 -11.459 0.700   1.00 0.00  ? 25  ASP A O    2  
ATOM   2109  C  CB   . ASP A 1 25 ? 56.120 -11.655 3.972   1.00 0.00  ? 25  ASP A CB   2  
ATOM   2110  C  CG   . ASP A 1 25 ? 57.373 -12.010 4.787   1.00 0.00  ? 25  ASP A CG   2  
ATOM   2111  O  OD1  . ASP A 1 25 ? 58.265 -11.180 4.876   1.00 0.00  ? 25  ASP A OD1  2  
ATOM   2112  O  OD2  . ASP A 1 25 ? 57.413 -13.105 5.321   1.00 0.00  ? 25  ASP A OD2  2  
ATOM   2113  H  H    . ASP A 1 25 ? 56.530 -9.242  4.283   1.00 0.00  ? 25  ASP A H    2  
ATOM   2114  H  HA   . ASP A 1 25 ? 57.423 -11.127 2.337   1.00 0.00  ? 25  ASP A HA   2  
ATOM   2115  H  HB2  . ASP A 1 25 ? 55.424 -11.120 4.601   1.00 0.00  ? 25  ASP A HB2  2  
ATOM   2116  H  HB3  . ASP A 1 25 ? 55.656 -12.565 3.621   1.00 0.00  ? 25  ASP A HB3  2  
ATOM   2117  N  N    . ILE A 1 26 ? 54.318 -10.054 1.937   1.00 0.00  ? 26  ILE A N    2  
ATOM   2118  C  CA   . ILE A 1 26 ? 53.200 -10.013 0.938   1.00 0.00  ? 26  ILE A CA   2  
ATOM   2119  C  C    . ILE A 1 26 ? 53.615 -9.167  -0.279  1.00 0.00  ? 26  ILE A C    2  
ATOM   2120  O  O    . ILE A 1 26 ? 53.129 -9.363  -1.377  1.00 0.00  ? 26  ILE A O    2  
ATOM   2121  C  CB   . ILE A 1 26 ? 52.018 -9.359  1.673   1.00 0.00  ? 26  ILE A CB   2  
ATOM   2122  C  CG1  . ILE A 1 26 ? 51.606 -10.227 2.868   1.00 0.00  ? 26  ILE A CG1  2  
ATOM   2123  C  CG2  . ILE A 1 26 ? 50.825 -9.224  0.722   1.00 0.00  ? 26  ILE A CG2  2  
ATOM   2124  C  CD1  . ILE A 1 26 ? 50.827 -9.378  3.876   1.00 0.00  ? 26  ILE A CD1  2  
ATOM   2125  H  H    . ILE A 1 26 ? 54.261 -9.518  2.756   1.00 0.00  ? 26  ILE A H    2  
ATOM   2126  H  HA   . ILE A 1 26 ? 52.935 -11.011 0.628   1.00 0.00  ? 26  ILE A HA   2  
ATOM   2127  H  HB   . ILE A 1 26 ? 52.311 -8.378  2.023   1.00 0.00  ? 26  ILE A HB   2  
ATOM   2128  H  HG12 . ILE A 1 26 ? 50.983 -11.040 2.523   1.00 0.00  ? 26  ILE A HG12 2  
ATOM   2129  H  HG13 . ILE A 1 26 ? 52.488 -10.629 3.344   1.00 0.00  ? 26  ILE A HG13 2  
ATOM   2130  H  HG21 . ILE A 1 26 ? 50.346 -10.185 0.608   1.00 0.00  ? 26  ILE A HG21 2  
ATOM   2131  H  HG22 . ILE A 1 26 ? 51.166 -8.875  -0.241  1.00 0.00  ? 26  ILE A HG22 2  
ATOM   2132  H  HG23 . ILE A 1 26 ? 50.118 -8.517  1.130   1.00 0.00  ? 26  ILE A HG23 2  
ATOM   2133  H  HD11 . ILE A 1 26 ? 50.225 -8.653  3.349   1.00 0.00  ? 26  ILE A HD11 2  
ATOM   2134  H  HD12 . ILE A 1 26 ? 51.519 -8.866  4.528   1.00 0.00  ? 26  ILE A HD12 2  
ATOM   2135  H  HD13 . ILE A 1 26 ? 50.185 -10.018 4.464   1.00 0.00  ? 26  ILE A HD13 2  
ATOM   2136  N  N    . PHE A 1 27 ? 54.510 -8.227  -0.088  1.00 0.00  ? 27  PHE A N    2  
ATOM   2137  C  CA   . PHE A 1 27 ? 54.960 -7.362  -1.223  1.00 0.00  ? 27  PHE A CA   2  
ATOM   2138  C  C    . PHE A 1 27 ? 55.835 -8.148  -2.208  1.00 0.00  ? 27  PHE A C    2  
ATOM   2139  O  O    . PHE A 1 27 ? 55.755 -7.949  -3.403  1.00 0.00  ? 27  PHE A O    2  
ATOM   2140  C  CB   . PHE A 1 27 ? 55.777 -6.241  -0.576  1.00 0.00  ? 27  PHE A CB   2  
ATOM   2141  C  CG   . PHE A 1 27 ? 55.243 -4.904  -1.025  1.00 0.00  ? 27  PHE A CG   2  
ATOM   2142  C  CD1  . PHE A 1 27 ? 55.431 -4.480  -2.346  1.00 0.00  ? 27  PHE A CD1  2  
ATOM   2143  C  CD2  . PHE A 1 27 ? 54.555 -4.089  -0.119  1.00 0.00  ? 27  PHE A CD2  2  
ATOM   2144  C  CE1  . PHE A 1 27 ? 54.933 -3.239  -2.760  1.00 0.00  ? 27  PHE A CE1  2  
ATOM   2145  C  CE2  . PHE A 1 27 ? 54.058 -2.849  -0.533  1.00 0.00  ? 27  PHE A CE2  2  
ATOM   2146  C  CZ   . PHE A 1 27 ? 54.245 -2.425  -1.854  1.00 0.00  ? 27  PHE A CZ   2  
ATOM   2147  H  H    . PHE A 1 27 ? 54.884 -8.087  0.807   1.00 0.00  ? 27  PHE A H    2  
ATOM   2148  H  HA   . PHE A 1 27 ? 54.107 -6.943  -1.734  1.00 0.00  ? 27  PHE A HA   2  
ATOM   2149  H  HB2  . PHE A 1 27 ? 55.707 -6.315  0.499   1.00 0.00  ? 27  PHE A HB2  2  
ATOM   2150  H  HB3  . PHE A 1 27 ? 56.811 -6.332  -0.875  1.00 0.00  ? 27  PHE A HB3  2  
ATOM   2151  H  HD1  . PHE A 1 27 ? 55.963 -5.111  -3.044  1.00 0.00  ? 27  PHE A HD1  2  
ATOM   2152  H  HD2  . PHE A 1 27 ? 54.411 -4.416  0.899   1.00 0.00  ? 27  PHE A HD2  2  
ATOM   2153  H  HE1  . PHE A 1 27 ? 55.078 -2.912  -3.779  1.00 0.00  ? 27  PHE A HE1  2  
ATOM   2154  H  HE2  . PHE A 1 27 ? 53.527 -2.220  0.167   1.00 0.00  ? 27  PHE A HE2  2  
ATOM   2155  H  HZ   . PHE A 1 27 ? 53.861 -1.467  -2.174  1.00 0.00  ? 27  PHE A HZ   2  
ATOM   2156  N  N    . VAL A 1 28 ? 56.674 -9.029  -1.719  1.00 0.00  ? 28  VAL A N    2  
ATOM   2157  C  CA   . VAL A 1 28 ? 57.561 -9.817  -2.642  1.00 0.00  ? 28  VAL A CA   2  
ATOM   2158  C  C    . VAL A 1 28 ? 56.806 -10.993 -3.293  1.00 0.00  ? 28  VAL A C    2  
ATOM   2159  O  O    . VAL A 1 28 ? 57.410 -11.835 -3.935  1.00 0.00  ? 28  VAL A O    2  
ATOM   2160  C  CB   . VAL A 1 28 ? 58.721 -10.339 -1.779  1.00 0.00  ? 28  VAL A CB   2  
ATOM   2161  C  CG1  . VAL A 1 28 ? 59.547 -9.163  -1.257  1.00 0.00  ? 28  VAL A CG1  2  
ATOM   2162  C  CG2  . VAL A 1 28 ? 58.182 -11.141 -0.589  1.00 0.00  ? 28  VAL A CG2  2  
ATOM   2163  H  H    . VAL A 1 28 ? 56.726 -9.169  -0.750  1.00 0.00  ? 28  VAL A H    2  
ATOM   2164  H  HA   . VAL A 1 28 ? 57.953 -9.170  -3.411  1.00 0.00  ? 28  VAL A HA   2  
ATOM   2165  H  HB   . VAL A 1 28 ? 59.353 -10.974 -2.387  1.00 0.00  ? 28  VAL A HB   2  
ATOM   2166  H  HG11 . VAL A 1 28 ? 59.728 -8.465  -2.060  1.00 0.00  ? 28  VAL A HG11 2  
ATOM   2167  H  HG12 . VAL A 1 28 ? 60.490 -9.527  -0.876  1.00 0.00  ? 28  VAL A HG12 2  
ATOM   2168  H  HG13 . VAL A 1 28 ? 59.006 -8.667  -0.463  1.00 0.00  ? 28  VAL A HG13 2  
ATOM   2169  H  HG21 . VAL A 1 28 ? 57.828 -10.462 0.173   1.00 0.00  ? 28  VAL A HG21 2  
ATOM   2170  H  HG22 . VAL A 1 28 ? 58.972 -11.755 -0.182  1.00 0.00  ? 28  VAL A HG22 2  
ATOM   2171  H  HG23 . VAL A 1 28 ? 57.369 -11.773 -0.916  1.00 0.00  ? 28  VAL A HG23 2  
ATOM   2172  N  N    . LEU A 1 29 ? 55.500 -11.060 -3.147  1.00 0.00  ? 29  LEU A N    2  
ATOM   2173  C  CA   . LEU A 1 29 ? 54.733 -12.180 -3.775  1.00 0.00  ? 29  LEU A CA   2  
ATOM   2174  C  C    . LEU A 1 29 ? 54.710 -12.002 -5.297  1.00 0.00  ? 29  LEU A C    2  
ATOM   2175  O  O    . LEU A 1 29 ? 53.902 -11.271 -5.840  1.00 0.00  ? 29  LEU A O    2  
ATOM   2176  C  CB   . LEU A 1 29 ? 53.321 -12.091 -3.189  1.00 0.00  ? 29  LEU A CB   2  
ATOM   2177  C  CG   . LEU A 1 29 ? 53.160 -13.155 -2.106  1.00 0.00  ? 29  LEU A CG   2  
ATOM   2178  C  CD1  . LEU A 1 29 ? 51.973 -12.800 -1.210  1.00 0.00  ? 29  LEU A CD1  2  
ATOM   2179  C  CD2  . LEU A 1 29 ? 52.915 -14.516 -2.761  1.00 0.00  ? 29  LEU A CD2  2  
ATOM   2180  H  H    . LEU A 1 29 ? 55.027 -10.375 -2.635  1.00 0.00  ? 29  LEU A H    2  
ATOM   2181  H  HA   . LEU A 1 29 ? 55.180 -13.129 -3.518  1.00 0.00  ? 29  LEU A HA   2  
ATOM   2182  H  HB2  . LEU A 1 29 ? 53.169 -11.112 -2.759  1.00 0.00  ? 29  LEU A HB2  2  
ATOM   2183  H  HB3  . LEU A 1 29 ? 52.594 -12.260 -3.968  1.00 0.00  ? 29  LEU A HB3  2  
ATOM   2184  H  HG   . LEU A 1 29 ? 54.063 -13.197 -1.512  1.00 0.00  ? 29  LEU A HG   2  
ATOM   2185  H  HD11 . LEU A 1 29 ? 51.071 -13.232 -1.618  1.00 0.00  ? 29  LEU A HD11 2  
ATOM   2186  H  HD12 . LEU A 1 29 ? 51.868 -11.726 -1.159  1.00 0.00  ? 29  LEU A HD12 2  
ATOM   2187  H  HD13 . LEU A 1 29 ? 52.142 -13.192 -0.218  1.00 0.00  ? 29  LEU A HD13 2  
ATOM   2188  H  HD21 . LEU A 1 29 ? 52.496 -15.195 -2.034  1.00 0.00  ? 29  LEU A HD21 2  
ATOM   2189  H  HD22 . LEU A 1 29 ? 53.851 -14.913 -3.127  1.00 0.00  ? 29  LEU A HD22 2  
ATOM   2190  H  HD23 . LEU A 1 29 ? 52.227 -14.400 -3.585  1.00 0.00  ? 29  LEU A HD23 2  
ATOM   2191  N  N    . GLY A 1 30 ? 55.611 -12.658 -5.976  1.00 0.00  ? 30  GLY A N    2  
ATOM   2192  C  CA   . GLY A 1 30 ? 55.691 -12.537 -7.462  1.00 0.00  ? 30  GLY A CA   2  
ATOM   2193  C  C    . GLY A 1 30 ? 57.162 -12.572 -7.894  1.00 0.00  ? 30  GLY A C    2  
ATOM   2194  O  O    . GLY A 1 30 ? 57.478 -12.944 -9.007  1.00 0.00  ? 30  GLY A O    2  
ATOM   2195  H  H    . GLY A 1 30 ? 56.254 -13.227 -5.501  1.00 0.00  ? 30  GLY A H    2  
ATOM   2196  H  HA2  . GLY A 1 30 ? 55.159 -13.362 -7.920  1.00 0.00  ? 30  GLY A HA2  2  
ATOM   2197  H  HA3  . GLY A 1 30 ? 55.249 -11.600 -7.775  1.00 0.00  ? 30  GLY A HA3  2  
ATOM   2198  N  N    . ALA A 1 31 ? 58.064 -12.191 -7.017  1.00 0.00  ? 31  ALA A N    2  
ATOM   2199  C  CA   . ALA A 1 31 ? 59.516 -12.207 -7.369  1.00 0.00  ? 31  ALA A CA   2  
ATOM   2200  C  C    . ALA A 1 31 ? 60.177 -13.479 -6.812  1.00 0.00  ? 31  ALA A C    2  
ATOM   2201  O  O    . ALA A 1 31 ? 60.332 -14.460 -7.512  1.00 0.00  ? 31  ALA A O    2  
ATOM   2202  C  CB   . ALA A 1 31 ? 60.097 -10.948 -6.712  1.00 0.00  ? 31  ALA A CB   2  
ATOM   2203  H  H    . ALA A 1 31 ? 57.782 -11.899 -6.122  1.00 0.00  ? 31  ALA A H    2  
ATOM   2204  H  HA   . ALA A 1 31 ? 59.644 -12.155 -8.439  1.00 0.00  ? 31  ALA A HA   2  
ATOM   2205  H  HB1  . ALA A 1 31 ? 61.174 -11.026 -6.673  1.00 0.00  ? 31  ALA A HB1  2  
ATOM   2206  H  HB2  . ALA A 1 31 ? 59.707 -10.851 -5.706  1.00 0.00  ? 31  ALA A HB2  2  
ATOM   2207  H  HB3  . ALA A 1 31 ? 59.820 -10.080 -7.291  1.00 0.00  ? 31  ALA A HB3  2  
ATOM   2208  N  N    . GLU A 1 32 ? 60.561 -13.465 -5.560  1.00 0.00  ? 32  GLU A N    2  
ATOM   2209  C  CA   . GLU A 1 32 ? 61.210 -14.668 -4.942  1.00 0.00  ? 32  GLU A CA   2  
ATOM   2210  C  C    . GLU A 1 32 ? 61.061 -14.632 -3.410  1.00 0.00  ? 32  GLU A C    2  
ATOM   2211  O  O    . GLU A 1 32 ? 61.873 -15.183 -2.689  1.00 0.00  ? 32  GLU A O    2  
ATOM   2212  C  CB   . GLU A 1 32 ? 62.699 -14.606 -5.347  1.00 0.00  ? 32  GLU A CB   2  
ATOM   2213  C  CG   . GLU A 1 32 ? 63.174 -13.150 -5.512  1.00 0.00  ? 32  GLU A CG   2  
ATOM   2214  C  CD   . GLU A 1 32 ? 63.075 -12.410 -4.176  1.00 0.00  ? 32  GLU A CD   2  
ATOM   2215  O  OE1  . GLU A 1 32 ? 63.974 -12.563 -3.366  1.00 0.00  ? 32  GLU A OE1  2  
ATOM   2216  O  OE2  . GLU A 1 32 ? 62.101 -11.699 -3.988  1.00 0.00  ? 32  GLU A OE2  2  
ATOM   2217  H  H    . GLU A 1 32 ? 60.425 -12.660 -5.019  1.00 0.00  ? 32  GLU A H    2  
ATOM   2218  H  HA   . GLU A 1 32 ? 60.765 -15.569 -5.333  1.00 0.00  ? 32  GLU A HA   2  
ATOM   2219  H  HB2  . GLU A 1 32 ? 63.292 -15.086 -4.583  1.00 0.00  ? 32  GLU A HB2  2  
ATOM   2220  H  HB3  . GLU A 1 32 ? 62.832 -15.130 -6.281  1.00 0.00  ? 32  GLU A HB3  2  
ATOM   2221  H  HG2  . GLU A 1 32 ? 64.201 -13.147 -5.845  1.00 0.00  ? 32  GLU A HG2  2  
ATOM   2222  H  HG3  . GLU A 1 32 ? 62.560 -12.649 -6.244  1.00 0.00  ? 32  GLU A HG3  2  
ATOM   2223  N  N    . ASP A 1 33 ? 60.022 -13.991 -2.914  1.00 0.00  ? 33  ASP A N    2  
ATOM   2224  C  CA   . ASP A 1 33 ? 59.793 -13.907 -1.434  1.00 0.00  ? 33  ASP A CA   2  
ATOM   2225  C  C    . ASP A 1 33 ? 61.054 -13.400 -0.706  1.00 0.00  ? 33  ASP A C    2  
ATOM   2226  O  O    . ASP A 1 33 ? 61.546 -14.029 0.212   1.00 0.00  ? 33  ASP A O    2  
ATOM   2227  C  CB   . ASP A 1 33 ? 59.441 -15.340 -1.006  1.00 0.00  ? 33  ASP A CB   2  
ATOM   2228  C  CG   . ASP A 1 33 ? 58.031 -15.687 -1.491  1.00 0.00  ? 33  ASP A CG   2  
ATOM   2229  O  OD1  . ASP A 1 33 ? 57.085 -15.316 -0.816  1.00 0.00  ? 33  ASP A OD1  2  
ATOM   2230  O  OD2  . ASP A 1 33 ? 57.923 -16.315 -2.530  1.00 0.00  ? 33  ASP A OD2  2  
ATOM   2231  H  H    . ASP A 1 33 ? 59.383 -13.566 -3.519  1.00 0.00  ? 33  ASP A H    2  
ATOM   2232  H  HA   . ASP A 1 33 ? 58.960 -13.255 -1.228  1.00 0.00  ? 33  ASP A HA   2  
ATOM   2233  H  HB2  . ASP A 1 33 ? 60.150 -16.031 -1.437  1.00 0.00  ? 33  ASP A HB2  2  
ATOM   2234  H  HB3  . ASP A 1 33 ? 59.476 -15.414 0.071   1.00 0.00  ? 33  ASP A HB3  2  
ATOM   2235  N  N    . GLY A 1 34 ? 61.582 -12.265 -1.111  1.00 0.00  ? 34  GLY A N    2  
ATOM   2236  C  CA   . GLY A 1 34 ? 62.811 -11.733 -0.437  1.00 0.00  ? 34  GLY A CA   2  
ATOM   2237  C  C    . GLY A 1 34 ? 63.081 -10.268 -0.822  1.00 0.00  ? 34  GLY A C    2  
ATOM   2238  O  O    . GLY A 1 34 ? 63.512 -9.485  0.002   1.00 0.00  ? 34  GLY A O    2  
ATOM   2239  H  H    . GLY A 1 34 ? 61.174 -11.773 -1.853  1.00 0.00  ? 34  GLY A H    2  
ATOM   2240  H  HA2  . GLY A 1 34 ? 62.682 -11.798 0.636   1.00 0.00  ? 34  GLY A HA2  2  
ATOM   2241  H  HA3  . GLY A 1 34 ? 63.662 -12.334 -0.733  1.00 0.00  ? 34  GLY A HA3  2  
ATOM   2242  N  N    . CYS A 1 35 ? 62.858 -9.892  -2.059  1.00 0.00  ? 35  CYS A N    2  
ATOM   2243  C  CA   . CYS A 1 35 ? 63.134 -8.480  -2.478  1.00 0.00  ? 35  CYS A CA   2  
ATOM   2244  C  C    . CYS A 1 35 ? 61.991 -7.918  -3.339  1.00 0.00  ? 35  CYS A C    2  
ATOM   2245  O  O    . CYS A 1 35 ? 61.256 -8.651  -3.973  1.00 0.00  ? 35  CYS A O    2  
ATOM   2246  C  CB   . CYS A 1 35 ? 64.423 -8.569  -3.301  1.00 0.00  ? 35  CYS A CB   2  
ATOM   2247  S  SG   . CYS A 1 35 ? 65.619 -7.351  -2.699  1.00 0.00  ? 35  CYS A SG   2  
ATOM   2248  H  H    . CYS A 1 35 ? 62.527 -10.539 -2.716  1.00 0.00  ? 35  CYS A H    2  
ATOM   2249  H  HA   . CYS A 1 35 ? 63.295 -7.855  -1.614  1.00 0.00  ? 35  CYS A HA   2  
ATOM   2250  H  HB2  . CYS A 1 35 ? 64.842 -9.560  -3.209  1.00 0.00  ? 35  CYS A HB2  2  
ATOM   2251  H  HB3  . CYS A 1 35 ? 64.200 -8.370  -4.339  1.00 0.00  ? 35  CYS A HB3  2  
ATOM   2252  H  HG   . CYS A 1 35 ? 66.254 -7.808  -2.143  1.00 0.00  ? 35  CYS A HG   2  
ATOM   2253  N  N    . ILE A 1 36 ? 61.852 -6.614  -3.374  1.00 0.00  ? 36  ILE A N    2  
ATOM   2254  C  CA   . ILE A 1 36 ? 60.775 -5.985  -4.201  1.00 0.00  ? 36  ILE A CA   2  
ATOM   2255  C  C    . ILE A 1 36 ? 61.404 -5.177  -5.349  1.00 0.00  ? 36  ILE A C    2  
ATOM   2256  O  O    . ILE A 1 36 ? 62.255 -4.332  -5.135  1.00 0.00  ? 36  ILE A O    2  
ATOM   2257  C  CB   . ILE A 1 36 ? 60.009 -5.069  -3.234  1.00 0.00  ? 36  ILE A CB   2  
ATOM   2258  C  CG1  . ILE A 1 36 ? 59.021 -5.902  -2.413  1.00 0.00  ? 36  ILE A CG1  2  
ATOM   2259  C  CG2  . ILE A 1 36 ? 59.235 -4.006  -4.019  1.00 0.00  ? 36  ILE A CG2  2  
ATOM   2260  C  CD1  . ILE A 1 36 ? 59.430 -5.871  -0.938  1.00 0.00  ? 36  ILE A CD1  2  
ATOM   2261  H  H    . ILE A 1 36 ? 62.466 -6.046  -2.861  1.00 0.00  ? 36  ILE A H    2  
ATOM   2262  H  HA   . ILE A 1 36 ? 60.113 -6.741  -4.594  1.00 0.00  ? 36  ILE A HA   2  
ATOM   2263  H  HB   . ILE A 1 36 ? 60.708 -4.585  -2.570  1.00 0.00  ? 36  ILE A HB   2  
ATOM   2264  H  HG12 . ILE A 1 36 ? 58.028 -5.491  -2.521  1.00 0.00  ? 36  ILE A HG12 2  
ATOM   2265  H  HG13 . ILE A 1 36 ? 59.029 -6.922  -2.765  1.00 0.00  ? 36  ILE A HG13 2  
ATOM   2266  H  HG21 . ILE A 1 36 ? 59.891 -3.180  -4.247  1.00 0.00  ? 36  ILE A HG21 2  
ATOM   2267  H  HG22 . ILE A 1 36 ? 58.405 -3.653  -3.425  1.00 0.00  ? 36  ILE A HG22 2  
ATOM   2268  H  HG23 . ILE A 1 36 ? 58.864 -4.434  -4.937  1.00 0.00  ? 36  ILE A HG23 2  
ATOM   2269  H  HD11 . ILE A 1 36 ? 60.153 -6.650  -0.748  1.00 0.00  ? 36  ILE A HD11 2  
ATOM   2270  H  HD12 . ILE A 1 36 ? 58.558 -6.030  -0.320  1.00 0.00  ? 36  ILE A HD12 2  
ATOM   2271  H  HD13 . ILE A 1 36 ? 59.865 -4.911  -0.705  1.00 0.00  ? 36  ILE A HD13 2  
ATOM   2272  N  N    . SER A 1 37 ? 60.991 -5.439  -6.563  1.00 0.00  ? 37  SER A N    2  
ATOM   2273  C  CA   . SER A 1 37 ? 61.553 -4.700  -7.737  1.00 0.00  ? 37  SER A CA   2  
ATOM   2274  C  C    . SER A 1 37 ? 60.562 -3.633  -8.229  1.00 0.00  ? 37  SER A C    2  
ATOM   2275  O  O    . SER A 1 37 ? 59.583 -3.331  -7.571  1.00 0.00  ? 37  SER A O    2  
ATOM   2276  C  CB   . SER A 1 37 ? 61.765 -5.776  -8.807  1.00 0.00  ? 37  SER A CB   2  
ATOM   2277  O  OG   . SER A 1 37 ? 60.506 -6.142  -9.366  1.00 0.00  ? 37  SER A OG   2  
ATOM   2278  H  H    . SER A 1 37 ? 60.309 -6.126  -6.704  1.00 0.00  ? 37  SER A H    2  
ATOM   2279  H  HA   . SER A 1 37 ? 62.498 -4.246  -7.481  1.00 0.00  ? 37  SER A HA   2  
ATOM   2280  H  HB2  . SER A 1 37 ? 62.401 -5.391  -9.587  1.00 0.00  ? 37  SER A HB2  2  
ATOM   2281  H  HB3  . SER A 1 37 ? 62.236 -6.640  -8.357  1.00 0.00  ? 37  SER A HB3  2  
ATOM   2282  H  HG   . SER A 1 37 ? 60.362 -7.076  -9.193  1.00 0.00  ? 37  SER A HG   2  
ATOM   2283  N  N    . THR A 1 38 ? 60.807 -3.065  -9.387  1.00 0.00  ? 38  THR A N    2  
ATOM   2284  C  CA   . THR A 1 38 ? 59.878 -2.020  -9.933  1.00 0.00  ? 38  THR A CA   2  
ATOM   2285  C  C    . THR A 1 38 ? 58.509 -2.638  -10.247 1.00 0.00  ? 38  THR A C    2  
ATOM   2286  O  O    . THR A 1 38 ? 57.481 -2.091  -9.893  1.00 0.00  ? 38  THR A O    2  
ATOM   2287  C  CB   . THR A 1 38 ? 60.543 -1.505  -11.217 1.00 0.00  ? 38  THR A CB   2  
ATOM   2288  O  OG1  . THR A 1 38 ? 60.892 -2.603  -12.049 1.00 0.00  ? 38  THR A OG1  2  
ATOM   2289  C  CG2  . THR A 1 38 ? 61.802 -0.712  -10.863 1.00 0.00  ? 38  THR A CG2  2  
ATOM   2290  H  H    . THR A 1 38 ? 61.599 -3.329  -9.901  1.00 0.00  ? 38  THR A H    2  
ATOM   2291  H  HA   . THR A 1 38 ? 59.770 -1.211  -9.227  1.00 0.00  ? 38  THR A HA   2  
ATOM   2292  H  HB   . THR A 1 38 ? 59.855 -0.860  -11.742 1.00 0.00  ? 38  THR A HB   2  
ATOM   2293  H  HG1  . THR A 1 38 ? 61.152 -2.256  -12.906 1.00 0.00  ? 38  THR A HG1  2  
ATOM   2294  H  HG21 . THR A 1 38 ? 61.568 0.341   -10.840 1.00 0.00  ? 38  THR A HG21 2  
ATOM   2295  H  HG22 . THR A 1 38 ? 62.563 -0.896  -11.607 1.00 0.00  ? 38  THR A HG22 2  
ATOM   2296  H  HG23 . THR A 1 38 ? 62.164 -1.023  -9.893  1.00 0.00  ? 38  THR A HG23 2  
ATOM   2297  N  N    . LYS A 1 39 ? 58.490 -3.777  -10.899 1.00 0.00  ? 39  LYS A N    2  
ATOM   2298  C  CA   . LYS A 1 39 ? 57.189 -4.444  -11.229 1.00 0.00  ? 39  LYS A CA   2  
ATOM   2299  C  C    . LYS A 1 39 ? 56.485 -4.890  -9.940  1.00 0.00  ? 39  LYS A C    2  
ATOM   2300  O  O    . LYS A 1 39 ? 55.278 -4.796  -9.817  1.00 0.00  ? 39  LYS A O    2  
ATOM   2301  C  CB   . LYS A 1 39 ? 57.565 -5.661  -12.081 1.00 0.00  ? 39  LYS A CB   2  
ATOM   2302  C  CG   . LYS A 1 39 ? 57.679 -5.251  -13.552 1.00 0.00  ? 39  LYS A CG   2  
ATOM   2303  C  CD   . LYS A 1 39 ? 58.579 -6.249  -14.288 1.00 0.00  ? 39  LYS A CD   2  
ATOM   2304  C  CE   . LYS A 1 39 ? 58.736 -5.825  -15.752 1.00 0.00  ? 39  LYS A CE   2  
ATOM   2305  N  NZ   . LYS A 1 39 ? 57.878 -6.771  -16.528 1.00 0.00  ? 39  LYS A NZ   2  
ATOM   2306  H  H    . LYS A 1 39 ? 59.335 -4.198  -11.165 1.00 0.00  ? 39  LYS A H    2  
ATOM   2307  H  HA   . LYS A 1 39 ? 56.554 -3.779  -11.794 1.00 0.00  ? 39  LYS A HA   2  
ATOM   2308  H  HB2  . LYS A 1 39 ? 58.512 -6.056  -11.743 1.00 0.00  ? 39  LYS A HB2  2  
ATOM   2309  H  HB3  . LYS A 1 39 ? 56.803 -6.421  -11.980 1.00 0.00  ? 39  LYS A HB3  2  
ATOM   2310  H  HG2  . LYS A 1 39 ? 56.696 -5.249  -14.003 1.00 0.00  ? 39  LYS A HG2  2  
ATOM   2311  H  HG3  . LYS A 1 39 ? 58.109 -4.262  -13.618 1.00 0.00  ? 39  LYS A HG3  2  
ATOM   2312  H  HD2  . LYS A 1 39 ? 59.551 -6.271  -13.814 1.00 0.00  ? 39  LYS A HD2  2  
ATOM   2313  H  HD3  . LYS A 1 39 ? 58.137 -7.233  -14.244 1.00 0.00  ? 39  LYS A HD3  2  
ATOM   2314  H  HE2  . LYS A 1 39 ? 58.396 -4.806  -15.886 1.00 0.00  ? 39  LYS A HE2  2  
ATOM   2315  H  HE3  . LYS A 1 39 ? 59.766 -5.922  -16.062 1.00 0.00  ? 39  LYS A HE3  2  
ATOM   2316  H  HZ1  . LYS A 1 39 ? 57.676 -6.367  -17.465 1.00 0.00  ? 39  LYS A HZ1  2  
ATOM   2317  H  HZ2  . LYS A 1 39 ? 56.983 -6.930  -16.019 1.00 0.00  ? 39  LYS A HZ2  2  
ATOM   2318  H  HZ3  . LYS A 1 39 ? 58.377 -7.676  -16.646 1.00 0.00  ? 39  LYS A HZ3  2  
ATOM   2319  N  N    . GLU A 1 40 ? 57.237 -5.367  -8.978  1.00 0.00  ? 40  GLU A N    2  
ATOM   2320  C  CA   . GLU A 1 40 ? 56.629 -5.812  -7.686  1.00 0.00  ? 40  GLU A CA   2  
ATOM   2321  C  C    . GLU A 1 40 ? 55.999 -4.615  -6.955  1.00 0.00  ? 40  GLU A C    2  
ATOM   2322  O  O    . GLU A 1 40 ? 55.022 -4.757  -6.242  1.00 0.00  ? 40  GLU A O    2  
ATOM   2323  C  CB   . GLU A 1 40 ? 57.800 -6.388  -6.881  1.00 0.00  ? 40  GLU A CB   2  
ATOM   2324  C  CG   . GLU A 1 40 ? 57.332 -7.596  -6.063  1.00 0.00  ? 40  GLU A CG   2  
ATOM   2325  C  CD   . GLU A 1 40 ? 56.866 -8.715  -7.000  1.00 0.00  ? 40  GLU A CD   2  
ATOM   2326  O  OE1  . GLU A 1 40 ? 57.675 -9.182  -7.785  1.00 0.00  ? 40  GLU A OE1  2  
ATOM   2327  O  OE2  . GLU A 1 40 ? 55.708 -9.084  -6.917  1.00 0.00  ? 40  GLU A OE2  2  
ATOM   2328  H  H    . GLU A 1 40 ? 58.208 -5.424  -9.103  1.00 0.00  ? 40  GLU A H    2  
ATOM   2329  H  HA   . GLU A 1 40 ? 55.889 -6.577  -7.861  1.00 0.00  ? 40  GLU A HA   2  
ATOM   2330  H  HB2  . GLU A 1 40 ? 58.582 -6.698  -7.560  1.00 0.00  ? 40  GLU A HB2  2  
ATOM   2331  H  HB3  . GLU A 1 40 ? 58.185 -5.632  -6.214  1.00 0.00  ? 40  GLU A HB3  2  
ATOM   2332  H  HG2  . GLU A 1 40 ? 58.150 -7.955  -5.455  1.00 0.00  ? 40  GLU A HG2  2  
ATOM   2333  H  HG3  . GLU A 1 40 ? 56.514 -7.302  -5.425  1.00 0.00  ? 40  GLU A HG3  2  
ATOM   2334  N  N    . LEU A 1 41 ? 56.549 -3.439  -7.135  1.00 0.00  ? 41  LEU A N    2  
ATOM   2335  C  CA   . LEU A 1 41 ? 55.987 -2.226  -6.464  1.00 0.00  ? 41  LEU A CA   2  
ATOM   2336  C  C    . LEU A 1 41 ? 54.856 -1.617  -7.307  1.00 0.00  ? 41  LEU A C    2  
ATOM   2337  O  O    . LEU A 1 41 ? 53.814 -1.259  -6.792  1.00 0.00  ? 41  LEU A O    2  
ATOM   2338  C  CB   . LEU A 1 41 ? 57.169 -1.250  -6.360  1.00 0.00  ? 41  LEU A CB   2  
ATOM   2339  C  CG   . LEU A 1 41 ? 56.665 0.182   -6.144  1.00 0.00  ? 41  LEU A CG   2  
ATOM   2340  C  CD1  . LEU A 1 41 ? 55.667 0.225   -4.982  1.00 0.00  ? 41  LEU A CD1  2  
ATOM   2341  C  CD2  . LEU A 1 41 ? 57.854 1.086   -5.827  1.00 0.00  ? 41  LEU A CD2  2  
ATOM   2342  H  H    . LEU A 1 41 ? 57.333 -3.352  -7.717  1.00 0.00  ? 41  LEU A H    2  
ATOM   2343  H  HA   . LEU A 1 41 ? 55.628 -2.473  -5.478  1.00 0.00  ? 41  LEU A HA   2  
ATOM   2344  H  HB2  . LEU A 1 41 ? 57.799 -1.537  -5.532  1.00 0.00  ? 41  LEU A HB2  2  
ATOM   2345  H  HB3  . LEU A 1 41 ? 57.746 -1.287  -7.276  1.00 0.00  ? 41  LEU A HB3  2  
ATOM   2346  H  HG   . LEU A 1 41 ? 56.180 0.530   -7.044  1.00 0.00  ? 41  LEU A HG   2  
ATOM   2347  H  HD11 . LEU A 1 41 ? 54.664 0.118   -5.370  1.00 0.00  ? 41  LEU A HD11 2  
ATOM   2348  H  HD12 . LEU A 1 41 ? 55.754 1.170   -4.466  1.00 0.00  ? 41  LEU A HD12 2  
ATOM   2349  H  HD13 . LEU A 1 41 ? 55.875 -0.582  -4.296  1.00 0.00  ? 41  LEU A HD13 2  
ATOM   2350  H  HD21 . LEU A 1 41 ? 58.369 1.334   -6.742  1.00 0.00  ? 41  LEU A HD21 2  
ATOM   2351  H  HD22 . LEU A 1 41 ? 58.530 0.571   -5.162  1.00 0.00  ? 41  LEU A HD22 2  
ATOM   2352  H  HD23 . LEU A 1 41 ? 57.503 1.991   -5.354  1.00 0.00  ? 41  LEU A HD23 2  
ATOM   2353  N  N    . GLY A 1 42 ? 55.066 -1.480  -8.594  1.00 0.00  ? 42  GLY A N    2  
ATOM   2354  C  CA   . GLY A 1 42 ? 54.021 -0.873  -9.478  1.00 0.00  ? 42  GLY A CA   2  
ATOM   2355  C  C    . GLY A 1 42 ? 52.662 -1.562  -9.283  1.00 0.00  ? 42  GLY A C    2  
ATOM   2356  O  O    . GLY A 1 42 ? 51.631 -0.914  -9.281  1.00 0.00  ? 42  GLY A O    2  
ATOM   2357  H  H    . GLY A 1 42 ? 55.922 -1.764  -8.981  1.00 0.00  ? 42  GLY A H    2  
ATOM   2358  H  HA2  . GLY A 1 42 ? 53.925 0.177   -9.229  1.00 0.00  ? 42  GLY A HA2  2  
ATOM   2359  H  HA3  . GLY A 1 42 ? 54.325 -0.973  -10.513 1.00 0.00  ? 42  GLY A HA3  2  
ATOM   2360  N  N    . LYS A 1 43 ? 52.648 -2.864  -9.118  1.00 0.00  ? 43  LYS A N    2  
ATOM   2361  C  CA   . LYS A 1 43 ? 51.348 -3.587  -8.924  1.00 0.00  ? 43  LYS A CA   2  
ATOM   2362  C  C    . LYS A 1 43 ? 50.603 -3.051  -7.684  1.00 0.00  ? 43  LYS A C    2  
ATOM   2363  O  O    . LYS A 1 43 ? 49.386 -3.032  -7.647  1.00 0.00  ? 43  LYS A O    2  
ATOM   2364  C  CB   . LYS A 1 43 ? 51.731 -5.070  -8.776  1.00 0.00  ? 43  LYS A CB   2  
ATOM   2365  C  CG   . LYS A 1 43 ? 51.932 -5.445  -7.304  1.00 0.00  ? 43  LYS A CG   2  
ATOM   2366  C  CD   . LYS A 1 43 ? 52.435 -6.890  -7.221  1.00 0.00  ? 43  LYS A CD   2  
ATOM   2367  C  CE   . LYS A 1 43 ? 52.608 -7.296  -5.754  1.00 0.00  ? 43  LYS A CE   2  
ATOM   2368  N  NZ   . LYS A 1 43 ? 54.076 -7.235  -5.505  1.00 0.00  ? 43  LYS A NZ   2  
ATOM   2369  H  H    . LYS A 1 43 ? 53.492 -3.366  -9.124  1.00 0.00  ? 43  LYS A H    2  
ATOM   2370  H  HA   . LYS A 1 43 ? 50.729 -3.463  -9.798  1.00 0.00  ? 43  LYS A HA   2  
ATOM   2371  H  HB2  . LYS A 1 43 ? 50.947 -5.682  -9.193  1.00 0.00  ? 43  LYS A HB2  2  
ATOM   2372  H  HB3  . LYS A 1 43 ? 52.648 -5.253  -9.315  1.00 0.00  ? 43  LYS A HB3  2  
ATOM   2373  H  HG2  . LYS A 1 43 ? 52.658 -4.780  -6.858  1.00 0.00  ? 43  LYS A HG2  2  
ATOM   2374  H  HG3  . LYS A 1 43 ? 50.992 -5.361  -6.779  1.00 0.00  ? 43  LYS A HG3  2  
ATOM   2375  H  HD2  . LYS A 1 43 ? 51.718 -7.546  -7.694  1.00 0.00  ? 43  LYS A HD2  2  
ATOM   2376  H  HD3  . LYS A 1 43 ? 53.384 -6.970  -7.730  1.00 0.00  ? 43  LYS A HD3  2  
ATOM   2377  H  HE2  . LYS A 1 43 ? 52.085 -6.603  -5.108  1.00 0.00  ? 43  LYS A HE2  2  
ATOM   2378  H  HE3  . LYS A 1 43 ? 52.248 -8.301  -5.598  1.00 0.00  ? 43  LYS A HE3  2  
ATOM   2379  H  HZ1  . LYS A 1 43 ? 54.419 -6.268  -5.677  1.00 0.00  ? 43  LYS A HZ1  2  
ATOM   2380  H  HZ2  . LYS A 1 43 ? 54.565 -7.896  -6.146  1.00 0.00  ? 43  LYS A HZ2  2  
ATOM   2381  H  HZ3  . LYS A 1 43 ? 54.274 -7.501  -4.520  1.00 0.00  ? 43  LYS A HZ3  2  
ATOM   2382  N  N    . VAL A 1 44 ? 51.321 -2.596  -6.685  1.00 0.00  ? 44  VAL A N    2  
ATOM   2383  C  CA   . VAL A 1 44 ? 50.653 -2.037  -5.465  1.00 0.00  ? 44  VAL A CA   2  
ATOM   2384  C  C    . VAL A 1 44 ? 50.350 -0.546  -5.679  1.00 0.00  ? 44  VAL A C    2  
ATOM   2385  O  O    . VAL A 1 44 ? 49.371 -0.030  -5.178  1.00 0.00  ? 44  VAL A O    2  
ATOM   2386  C  CB   . VAL A 1 44 ? 51.658 -2.222  -4.319  1.00 0.00  ? 44  VAL A CB   2  
ATOM   2387  C  CG1  . VAL A 1 44 ? 51.094 -1.607  -3.034  1.00 0.00  ? 44  VAL A CG1  2  
ATOM   2388  C  CG2  . VAL A 1 44 ? 51.912 -3.714  -4.090  1.00 0.00  ? 44  VAL A CG2  2  
ATOM   2389  H  H    . VAL A 1 44 ? 52.301 -2.605  -6.745  1.00 0.00  ? 44  VAL A H    2  
ATOM   2390  H  HA   . VAL A 1 44 ? 49.745 -2.578  -5.252  1.00 0.00  ? 44  VAL A HA   2  
ATOM   2391  H  HB   . VAL A 1 44 ? 52.587 -1.732  -4.572  1.00 0.00  ? 44  VAL A HB   2  
ATOM   2392  H  HG11 . VAL A 1 44 ? 50.704 -0.622  -3.246  1.00 0.00  ? 44  VAL A HG11 2  
ATOM   2393  H  HG12 . VAL A 1 44 ? 51.878 -1.531  -2.296  1.00 0.00  ? 44  VAL A HG12 2  
ATOM   2394  H  HG13 . VAL A 1 44 ? 50.300 -2.232  -2.653  1.00 0.00  ? 44  VAL A HG13 2  
ATOM   2395  H  HG21 . VAL A 1 44 ? 52.709 -4.047  -4.738  1.00 0.00  ? 44  VAL A HG21 2  
ATOM   2396  H  HG22 . VAL A 1 44 ? 51.014 -4.271  -4.307  1.00 0.00  ? 44  VAL A HG22 2  
ATOM   2397  H  HG23 . VAL A 1 44 ? 52.195 -3.875  -3.059  1.00 0.00  ? 44  VAL A HG23 2  
ATOM   2398  N  N    . MET A 1 45 ? 51.184 0.145   -6.423  1.00 0.00  ? 45  MET A N    2  
ATOM   2399  C  CA   . MET A 1 45 ? 50.948 1.604   -6.678  1.00 0.00  ? 45  MET A CA   2  
ATOM   2400  C  C    . MET A 1 45 ? 49.569 1.816   -7.320  1.00 0.00  ? 45  MET A C    2  
ATOM   2401  O  O    . MET A 1 45 ? 48.781 2.621   -6.858  1.00 0.00  ? 45  MET A O    2  
ATOM   2402  C  CB   . MET A 1 45 ? 52.062 2.028   -7.640  1.00 0.00  ? 45  MET A CB   2  
ATOM   2403  C  CG   . MET A 1 45 ? 53.381 2.167   -6.875  1.00 0.00  ? 45  MET A CG   2  
ATOM   2404  S  SD   . MET A 1 45 ? 54.038 3.836   -7.107  1.00 0.00  ? 45  MET A SD   2  
ATOM   2405  C  CE   . MET A 1 45 ? 55.033 3.900   -5.598  1.00 0.00  ? 45  MET A CE   2  
ATOM   2406  H  H    . MET A 1 45 ? 51.966 -0.297  -6.817  1.00 0.00  ? 45  MET A H    2  
ATOM   2407  H  HA   . MET A 1 45 ? 51.023 2.162   -5.758  1.00 0.00  ? 45  MET A HA   2  
ATOM   2408  H  HB2  . MET A 1 45 ? 52.172 1.282   -8.414  1.00 0.00  ? 45  MET A HB2  2  
ATOM   2409  H  HB3  . MET A 1 45 ? 51.807 2.977   -8.089  1.00 0.00  ? 45  MET A HB3  2  
ATOM   2410  H  HG2  . MET A 1 45 ? 53.208 1.988   -5.823  1.00 0.00  ? 45  MET A HG2  2  
ATOM   2411  H  HG3  . MET A 1 45 ? 54.092 1.446   -7.251  1.00 0.00  ? 45  MET A HG3  2  
ATOM   2412  H  HE1  . MET A 1 45 ? 54.667 3.164   -4.895  1.00 0.00  ? 45  MET A HE1  2  
ATOM   2413  H  HE2  . MET A 1 45 ? 54.961 4.882   -5.158  1.00 0.00  ? 45  MET A HE2  2  
ATOM   2414  H  HE3  . MET A 1 45 ? 56.066 3.691   -5.840  1.00 0.00  ? 45  MET A HE3  2  
ATOM   2415  N  N    . ARG A 1 46 ? 49.268 1.091   -8.371  1.00 0.00  ? 46  ARG A N    2  
ATOM   2416  C  CA   . ARG A 1 46 ? 47.932 1.243   -9.033  1.00 0.00  ? 46  ARG A CA   2  
ATOM   2417  C  C    . ARG A 1 46 ? 46.831 0.695   -8.114  1.00 0.00  ? 46  ARG A C    2  
ATOM   2418  O  O    . ARG A 1 46 ? 45.774 1.283   -7.983  1.00 0.00  ? 46  ARG A O    2  
ATOM   2419  C  CB   . ARG A 1 46 ? 48.023 0.422   -10.327 1.00 0.00  ? 46  ARG A CB   2  
ATOM   2420  C  CG   . ARG A 1 46 ? 47.366 1.197   -11.473 1.00 0.00  ? 46  ARG A CG   2  
ATOM   2421  C  CD   . ARG A 1 46 ? 45.858 0.928   -11.477 1.00 0.00  ? 46  ARG A CD   2  
ATOM   2422  N  NE   . ARG A 1 46 ? 45.223 2.257   -11.235 1.00 0.00  ? 46  ARG A NE   2  
ATOM   2423  C  CZ   . ARG A 1 46 ? 43.981 2.324   -10.851 1.00 0.00  ? 46  ARG A CZ   2  
ATOM   2424  N  NH1  . ARG A 1 46 ? 43.692 2.266   -9.583  1.00 0.00  ? 46  ARG A NH1  2  
ATOM   2425  N  NH2  . ARG A 1 46 ? 43.030 2.456   -11.733 1.00 0.00  ? 46  ARG A NH2  2  
ATOM   2426  H  H    . ARG A 1 46 ? 49.916 0.442   -8.718  1.00 0.00  ? 46  ARG A H    2  
ATOM   2427  H  HA   . ARG A 1 46 ? 47.745 2.280   -9.264  1.00 0.00  ? 46  ARG A HA   2  
ATOM   2428  H  HB2  . ARG A 1 46 ? 49.061 0.239   -10.566 1.00 0.00  ? 46  ARG A HB2  2  
ATOM   2429  H  HB3  . ARG A 1 46 ? 47.513 -0.520  -10.194 1.00 0.00  ? 46  ARG A HB3  2  
ATOM   2430  H  HG2  . ARG A 1 46 ? 47.545 2.254   -11.340 1.00 0.00  ? 46  ARG A HG2  2  
ATOM   2431  H  HG3  . ARG A 1 46 ? 47.789 0.876   -12.413 1.00 0.00  ? 46  ARG A HG3  2  
ATOM   2432  H  HD2  . ARG A 1 46 ? 45.552 0.532   -12.436 1.00 0.00  ? 46  ARG A HD2  2  
ATOM   2433  H  HD3  . ARG A 1 46 ? 45.594 0.243   -10.685 1.00 0.00  ? 46  ARG A HD3  2  
ATOM   2434  H  HE   . ARG A 1 46 ? 45.739 3.080   -11.362 1.00 0.00  ? 46  ARG A HE   2  
ATOM   2435  H  HH11 . ARG A 1 46 ? 44.426 2.172   -8.908  1.00 0.00  ? 46  ARG A HH11 2  
ATOM   2436  H  HH12 . ARG A 1 46 ? 42.742 2.314   -9.283  1.00 0.00  ? 46  ARG A HH12 2  
ATOM   2437  H  HH21 . ARG A 1 46 ? 43.254 2.508   -12.706 1.00 0.00  ? 46  ARG A HH21 2  
ATOM   2438  H  HH22 . ARG A 1 46 ? 42.077 2.504   -11.438 1.00 0.00  ? 46  ARG A HH22 2  
ATOM   2439  N  N    . MET A 1 47 ? 47.082 -0.420  -7.468  1.00 0.00  ? 47  MET A N    2  
ATOM   2440  C  CA   . MET A 1 47 ? 46.064 -1.009  -6.539  1.00 0.00  ? 47  MET A CA   2  
ATOM   2441  C  C    . MET A 1 47 ? 45.779 -0.037  -5.382  1.00 0.00  ? 47  MET A C    2  
ATOM   2442  O  O    . MET A 1 47 ? 44.655 0.093   -4.935  1.00 0.00  ? 47  MET A O    2  
ATOM   2443  C  CB   . MET A 1 47 ? 46.709 -2.301  -6.021  1.00 0.00  ? 47  MET A CB   2  
ATOM   2444  C  CG   . MET A 1 47 ? 45.780 -2.985  -5.014  1.00 0.00  ? 47  MET A CG   2  
ATOM   2445  S  SD   . MET A 1 47 ? 46.625 -3.133  -3.419  1.00 0.00  ? 47  MET A SD   2  
ATOM   2446  C  CE   . MET A 1 47 ? 45.172 -3.567  -2.431  1.00 0.00  ? 47  MET A CE   2  
ATOM   2447  H  H    . MET A 1 47 ? 47.948 -0.866  -7.586  1.00 0.00  ? 47  MET A H    2  
ATOM   2448  H  HA   . MET A 1 47 ? 45.155 -1.238  -7.072  1.00 0.00  ? 47  MET A HA   2  
ATOM   2449  H  HB2  . MET A 1 47 ? 46.891 -2.969  -6.852  1.00 0.00  ? 47  MET A HB2  2  
ATOM   2450  H  HB3  . MET A 1 47 ? 47.647 -2.066  -5.540  1.00 0.00  ? 47  MET A HB3  2  
ATOM   2451  H  HG2  . MET A 1 47 ? 44.882 -2.398  -4.892  1.00 0.00  ? 47  MET A HG2  2  
ATOM   2452  H  HG3  . MET A 1 47 ? 45.519 -3.970  -5.375  1.00 0.00  ? 47  MET A HG3  2  
ATOM   2453  H  HE1  . MET A 1 47 ? 44.805 -2.684  -1.927  1.00 0.00  ? 47  MET A HE1  2  
ATOM   2454  H  HE2  . MET A 1 47 ? 45.442 -4.311  -1.699  1.00 0.00  ? 47  MET A HE2  2  
ATOM   2455  H  HE3  . MET A 1 47 ? 44.403 -3.964  -3.078  1.00 0.00  ? 47  MET A HE3  2  
ATOM   2456  N  N    . LEU A 1 48 ? 46.789 0.648   -4.903  1.00 0.00  ? 48  LEU A N    2  
ATOM   2457  C  CA   . LEU A 1 48 ? 46.590 1.618   -3.786  1.00 0.00  ? 48  LEU A CA   2  
ATOM   2458  C  C    . LEU A 1 48 ? 45.926 2.902   -4.309  1.00 0.00  ? 48  LEU A C    2  
ATOM   2459  O  O    . LEU A 1 48 ? 44.985 3.403   -3.723  1.00 0.00  ? 48  LEU A O    2  
ATOM   2460  C  CB   . LEU A 1 48 ? 48.003 1.905   -3.260  1.00 0.00  ? 48  LEU A CB   2  
ATOM   2461  C  CG   . LEU A 1 48 ? 47.959 3.049   -2.244  1.00 0.00  ? 48  LEU A CG   2  
ATOM   2462  C  CD1  . LEU A 1 48 ? 48.288 2.515   -0.849  1.00 0.00  ? 48  LEU A CD1  2  
ATOM   2463  C  CD2  . LEU A 1 48 ? 48.985 4.114   -2.632  1.00 0.00  ? 48  LEU A CD2  2  
ATOM   2464  H  H    . LEU A 1 48 ? 47.683 0.528   -5.285  1.00 0.00  ? 48  LEU A H    2  
ATOM   2465  H  HA   . LEU A 1 48 ? 45.990 1.176   -3.006  1.00 0.00  ? 48  LEU A HA   2  
ATOM   2466  H  HB2  . LEU A 1 48 ? 48.396 1.017   -2.785  1.00 0.00  ? 48  LEU A HB2  2  
ATOM   2467  H  HB3  . LEU A 1 48 ? 48.644 2.183   -4.085  1.00 0.00  ? 48  LEU A HB3  2  
ATOM   2468  H  HG   . LEU A 1 48 ? 46.971 3.484   -2.239  1.00 0.00  ? 48  LEU A HG   2  
ATOM   2469  H  HD11 . LEU A 1 48 ? 47.403 2.073   -0.415  1.00 0.00  ? 48  LEU A HD11 2  
ATOM   2470  H  HD12 . LEU A 1 48 ? 48.630 3.327   -0.224  1.00 0.00  ? 48  LEU A HD12 2  
ATOM   2471  H  HD13 . LEU A 1 48 ? 49.063 1.767   -0.925  1.00 0.00  ? 48  LEU A HD13 2  
ATOM   2472  H  HD21 . LEU A 1 48 ? 49.957 3.656   -2.734  1.00 0.00  ? 48  LEU A HD21 2  
ATOM   2473  H  HD22 . LEU A 1 48 ? 49.024 4.873   -1.865  1.00 0.00  ? 48  LEU A HD22 2  
ATOM   2474  H  HD23 . LEU A 1 48 ? 48.700 4.565   -3.570  1.00 0.00  ? 48  LEU A HD23 2  
ATOM   2475  N  N    . GLY A 1 49 ? 46.410 3.440   -5.404  1.00 0.00  ? 49  GLY A N    2  
ATOM   2476  C  CA   . GLY A 1 49 ? 45.806 4.690   -5.955  1.00 0.00  ? 49  GLY A CA   2  
ATOM   2477  C  C    . GLY A 1 49 ? 46.210 4.872   -7.421  1.00 0.00  ? 49  GLY A C    2  
ATOM   2478  O  O    . GLY A 1 49 ? 45.466 4.534   -8.323  1.00 0.00  ? 49  GLY A O    2  
ATOM   2479  H  H    . GLY A 1 49 ? 47.172 3.022   -5.860  1.00 0.00  ? 49  GLY A H    2  
ATOM   2480  H  HA2  . GLY A 1 49 ? 44.726 4.626   -5.886  1.00 0.00  ? 49  GLY A HA2  2  
ATOM   2481  H  HA3  . GLY A 1 49 ? 46.156 5.540   -5.382  1.00 0.00  ? 49  GLY A HA3  2  
ATOM   2482  N  N    . GLN A 1 50 ? 47.379 5.414   -7.666  1.00 0.00  ? 50  GLN A N    2  
ATOM   2483  C  CA   . GLN A 1 50 ? 47.828 5.633   -9.077  1.00 0.00  ? 50  GLN A CA   2  
ATOM   2484  C  C    . GLN A 1 50 ? 49.214 5.021   -9.318  1.00 0.00  ? 50  GLN A C    2  
ATOM   2485  O  O    . GLN A 1 50 ? 50.083 5.067   -8.468  1.00 0.00  ? 50  GLN A O    2  
ATOM   2486  C  CB   . GLN A 1 50 ? 47.895 7.154   -9.238  1.00 0.00  ? 50  GLN A CB   2  
ATOM   2487  C  CG   . GLN A 1 50 ? 46.480 7.734   -9.300  1.00 0.00  ? 50  GLN A CG   2  
ATOM   2488  C  CD   . GLN A 1 50 ? 46.554 9.263   -9.325  1.00 0.00  ? 50  GLN A CD   2  
ATOM   2489  O  OE1  . GLN A 1 50 ? 46.926 9.881   -8.349  1.00 0.00  ? 50  GLN A OE1  2  
ATOM   2490  N  NE2  . GLN A 1 50 ? 46.216 9.903   -10.409 1.00 0.00  ? 50  GLN A NE2  2  
ATOM   2491  H  H    . GLN A 1 50 ? 47.957 5.685   -6.922  1.00 0.00  ? 50  GLN A H    2  
ATOM   2492  H  HA   . GLN A 1 50 ? 47.111 5.224   -9.770  1.00 0.00  ? 50  GLN A HA   2  
ATOM   2493  H  HB2  . GLN A 1 50 ? 48.423 7.581   -8.397  1.00 0.00  ? 50  GLN A HB2  2  
ATOM   2494  H  HB3  . GLN A 1 50 ? 48.420 7.395   -10.151 1.00 0.00  ? 50  GLN A HB3  2  
ATOM   2495  H  HG2  . GLN A 1 50 ? 45.984 7.382   -10.193 1.00 0.00  ? 50  GLN A HG2  2  
ATOM   2496  H  HG3  . GLN A 1 50 ? 45.923 7.419   -8.431  1.00 0.00  ? 50  GLN A HG3  2  
ATOM   2497  H  HE21 . GLN A 1 50 ? 45.916 9.408   -11.200 1.00 0.00  ? 50  GLN A HE21 2  
ATOM   2498  H  HE22 . GLN A 1 50 ? 46.262 10.882  -10.433 1.00 0.00  ? 50  GLN A HE22 2  
ATOM   2499  N  N    . ASN A 1 51 ? 49.428 4.469   -10.485 1.00 0.00  ? 51  ASN A N    2  
ATOM   2500  C  CA   . ASN A 1 51 ? 50.758 3.873   -10.810 1.00 0.00  ? 51  ASN A CA   2  
ATOM   2501  C  C    . ASN A 1 51 ? 51.398 4.646   -11.973 1.00 0.00  ? 51  ASN A C    2  
ATOM   2502  O  O    . ASN A 1 51 ? 50.918 4.580   -13.089 1.00 0.00  ? 51  ASN A O    2  
ATOM   2503  C  CB   . ASN A 1 51 ? 50.466 2.428   -11.217 1.00 0.00  ? 51  ASN A CB   2  
ATOM   2504  C  CG   . ASN A 1 51 ? 51.776 1.727   -11.582 1.00 0.00  ? 51  ASN A CG   2  
ATOM   2505  O  OD1  . ASN A 1 51 ? 52.591 1.455   -10.725 1.00 0.00  ? 51  ASN A OD1  2  
ATOM   2506  N  ND2  . ASN A 1 51 ? 52.021 1.426   -12.827 1.00 0.00  ? 51  ASN A ND2  2  
ATOM   2507  H  H    . ASN A 1 51 ? 48.715 4.462   -11.158 1.00 0.00  ? 51  ASN A H    2  
ATOM   2508  H  HA   . ASN A 1 51 ? 51.401 3.890   -9.944  1.00 0.00  ? 51  ASN A HA   2  
ATOM   2509  H  HB2  . ASN A 1 51 ? 49.999 1.910   -10.394 1.00 0.00  ? 51  ASN A HB2  2  
ATOM   2510  H  HB3  . ASN A 1 51 ? 49.806 2.419   -12.071 1.00 0.00  ? 51  ASN A HB3  2  
ATOM   2511  H  HD21 . ASN A 1 51 ? 51.369 1.649   -13.523 1.00 0.00  ? 51  ASN A HD21 2  
ATOM   2512  H  HD22 . ASN A 1 51 ? 52.859 0.979   -13.065 1.00 0.00  ? 51  ASN A HD22 2  
ATOM   2513  N  N    . PRO A 1 52 ? 52.455 5.362   -11.670 1.00 0.00  ? 52  PRO A N    2  
ATOM   2514  C  CA   . PRO A 1 52 ? 53.157 6.163   -12.708 1.00 0.00  ? 52  PRO A CA   2  
ATOM   2515  C  C    . PRO A 1 52 ? 53.919 5.249   -13.691 1.00 0.00  ? 52  PRO A C    2  
ATOM   2516  O  O    . PRO A 1 52 ? 53.364 4.803   -14.677 1.00 0.00  ? 52  PRO A O    2  
ATOM   2517  C  CB   . PRO A 1 52 ? 54.099 7.054   -11.894 1.00 0.00  ? 52  PRO A CB   2  
ATOM   2518  C  CG   . PRO A 1 52 ? 54.321 6.319   -10.609 1.00 0.00  ? 52  PRO A CG   2  
ATOM   2519  C  CD   . PRO A 1 52 ? 53.087 5.495   -10.348 1.00 0.00  ? 52  PRO A CD   2  
ATOM   2520  H  HA   . PRO A 1 52 ? 52.451 6.776   -13.245 1.00 0.00  ? 52  PRO A HA   2  
ATOM   2521  H  HB2  . PRO A 1 52 ? 55.034 7.193   -12.420 1.00 0.00  ? 52  PRO A HB2  2  
ATOM   2522  H  HB3  . PRO A 1 52 ? 53.635 8.007   -11.697 1.00 0.00  ? 52  PRO A HB3  2  
ATOM   2523  H  HG2  . PRO A 1 52 ? 55.186 5.675   -10.696 1.00 0.00  ? 52  PRO A HG2  2  
ATOM   2524  H  HG3  . PRO A 1 52 ? 54.464 7.022   -9.801  1.00 0.00  ? 52  PRO A HG3  2  
ATOM   2525  H  HD2  . PRO A 1 52 ? 53.357 4.524   -9.955  1.00 0.00  ? 52  PRO A HD2  2  
ATOM   2526  H  HD3  . PRO A 1 52 ? 52.423 6.008   -9.670  1.00 0.00  ? 52  PRO A HD3  2  
ATOM   2527  N  N    . THR A 1 53 ? 55.180 4.973   -13.445 1.00 0.00  ? 53  THR A N    2  
ATOM   2528  C  CA   . THR A 1 53 ? 55.955 4.100   -14.379 1.00 0.00  ? 53  THR A CA   2  
ATOM   2529  C  C    . THR A 1 53 ? 56.958 3.231   -13.603 1.00 0.00  ? 53  THR A C    2  
ATOM   2530  O  O    . THR A 1 53 ? 57.304 3.541   -12.478 1.00 0.00  ? 53  THR A O    2  
ATOM   2531  C  CB   . THR A 1 53 ? 56.699 5.065   -15.315 1.00 0.00  ? 53  THR A CB   2  
ATOM   2532  O  OG1  . THR A 1 53 ? 56.892 6.322   -14.678 1.00 0.00  ? 53  THR A OG1  2  
ATOM   2533  C  CG2  . THR A 1 53 ? 55.889 5.266   -16.598 1.00 0.00  ? 53  THR A CG2  2  
ATOM   2534  H  H    . THR A 1 53 ? 55.620 5.343   -12.657 1.00 0.00  ? 53  THR A H    2  
ATOM   2535  H  HA   . THR A 1 53 ? 55.286 3.478   -14.951 1.00 0.00  ? 53  THR A HA   2  
ATOM   2536  H  HB   . THR A 1 53 ? 57.656 4.644   -15.565 1.00 0.00  ? 53  THR A HB   2  
ATOM   2537  H  HG1  . THR A 1 53 ? 57.507 6.198   -13.952 1.00 0.00  ? 53  THR A HG1  2  
ATOM   2538  H  HG21 . THR A 1 53 ? 55.578 4.307   -16.983 1.00 0.00  ? 53  THR A HG21 2  
ATOM   2539  H  HG22 . THR A 1 53 ? 56.498 5.768   -17.333 1.00 0.00  ? 53  THR A HG22 2  
ATOM   2540  H  HG23 . THR A 1 53 ? 55.018 5.867   -16.383 1.00 0.00  ? 53  THR A HG23 2  
ATOM   2541  N  N    . PRO A 1 54 ? 57.395 2.166   -14.241 1.00 0.00  ? 54  PRO A N    2  
ATOM   2542  C  CA   . PRO A 1 54 ? 58.372 1.232   -13.610 1.00 0.00  ? 54  PRO A CA   2  
ATOM   2543  C  C    . PRO A 1 54 ? 59.756 1.886   -13.464 1.00 0.00  ? 54  PRO A C    2  
ATOM   2544  O  O    . PRO A 1 54 ? 60.443 1.680   -12.481 1.00 0.00  ? 54  PRO A O    2  
ATOM   2545  C  CB   . PRO A 1 54 ? 58.424 0.057   -14.588 1.00 0.00  ? 54  PRO A CB   2  
ATOM   2546  C  CG   . PRO A 1 54 ? 58.006 0.632   -15.902 1.00 0.00  ? 54  PRO A CG   2  
ATOM   2547  C  CD   . PRO A 1 54 ? 57.027 1.734   -15.599 1.00 0.00  ? 54  PRO A CD   2  
ATOM   2548  H  HA   . PRO A 1 54 ? 58.010 0.895   -12.652 1.00 0.00  ? 54  PRO A HA   2  
ATOM   2549  H  HB2  . PRO A 1 54 ? 59.430 -0.337  -14.649 1.00 0.00  ? 54  PRO A HB2  2  
ATOM   2550  H  HB3  . PRO A 1 54 ? 57.734 -0.716  -14.287 1.00 0.00  ? 54  PRO A HB3  2  
ATOM   2551  H  HG2  . PRO A 1 54 ? 58.868 1.029   -16.422 1.00 0.00  ? 54  PRO A HG2  2  
ATOM   2552  H  HG3  . PRO A 1 54 ? 57.527 -0.126  -16.504 1.00 0.00  ? 54  PRO A HG3  2  
ATOM   2553  H  HD2  . PRO A 1 54 ? 57.141 2.546   -16.306 1.00 0.00  ? 54  PRO A HD2  2  
ATOM   2554  H  HD3  . PRO A 1 54 ? 56.016 1.359   -15.609 1.00 0.00  ? 54  PRO A HD3  2  
ATOM   2555  N  N    . GLU A 1 55 ? 60.169 2.666   -14.435 1.00 0.00  ? 55  GLU A N    2  
ATOM   2556  C  CA   . GLU A 1 55 ? 61.510 3.331   -14.356 1.00 0.00  ? 55  GLU A CA   2  
ATOM   2557  C  C    . GLU A 1 55 ? 61.579 4.268   -13.140 1.00 0.00  ? 55  GLU A C    2  
ATOM   2558  O  O    . GLU A 1 55 ? 62.594 4.354   -12.475 1.00 0.00  ? 55  GLU A O    2  
ATOM   2559  C  CB   . GLU A 1 55 ? 61.641 4.126   -15.659 1.00 0.00  ? 55  GLU A CB   2  
ATOM   2560  C  CG   . GLU A 1 55 ? 61.996 3.172   -16.805 1.00 0.00  ? 55  GLU A CG   2  
ATOM   2561  C  CD   . GLU A 1 55 ? 62.374 3.977   -18.050 1.00 0.00  ? 55  GLU A CD   2  
ATOM   2562  O  OE1  . GLU A 1 55 ? 63.539 4.310   -18.186 1.00 0.00  ? 55  GLU A OE1  2  
ATOM   2563  O  OE2  . GLU A 1 55 ? 61.491 4.245   -18.849 1.00 0.00  ? 55  GLU A OE2  2  
ATOM   2564  H  H    . GLU A 1 55 ? 59.598 2.814   -15.218 1.00 0.00  ? 55  GLU A H    2  
ATOM   2565  H  HA   . GLU A 1 55 ? 62.291 2.591   -14.299 1.00 0.00  ? 55  GLU A HA   2  
ATOM   2566  H  HB2  . GLU A 1 55 ? 60.706 4.620   -15.877 1.00 0.00  ? 55  GLU A HB2  2  
ATOM   2567  H  HB3  . GLU A 1 55 ? 62.423 4.864   -15.555 1.00 0.00  ? 55  GLU A HB3  2  
ATOM   2568  H  HG2  . GLU A 1 55 ? 62.830 2.552   -16.512 1.00 0.00  ? 55  GLU A HG2  2  
ATOM   2569  H  HG3  . GLU A 1 55 ? 61.145 2.547   -17.030 1.00 0.00  ? 55  GLU A HG3  2  
ATOM   2570  N  N    . GLU A 1 56 ? 60.506 4.962   -12.843 1.00 0.00  ? 56  GLU A N    2  
ATOM   2571  C  CA   . GLU A 1 56 ? 60.507 5.889   -11.666 1.00 0.00  ? 56  GLU A CA   2  
ATOM   2572  C  C    . GLU A 1 56 ? 60.737 5.112   -10.361 1.00 0.00  ? 56  GLU A C    2  
ATOM   2573  O  O    . GLU A 1 56 ? 61.422 5.580   -9.471  1.00 0.00  ? 56  GLU A O    2  
ATOM   2574  C  CB   . GLU A 1 56 ? 59.121 6.540   -11.660 1.00 0.00  ? 56  GLU A CB   2  
ATOM   2575  C  CG   . GLU A 1 56 ? 59.113 7.740   -12.614 1.00 0.00  ? 56  GLU A CG   2  
ATOM   2576  C  CD   . GLU A 1 56 ? 59.928 8.886   -12.010 1.00 0.00  ? 56  GLU A CD   2  
ATOM   2577  O  OE1  . GLU A 1 56 ? 59.382 9.608   -11.192 1.00 0.00  ? 56  GLU A OE1  2  
ATOM   2578  O  OE2  . GLU A 1 56 ? 61.084 9.021   -12.375 1.00 0.00  ? 56  GLU A OE2  2  
ATOM   2579  H  H    . GLU A 1 56 ? 59.699 4.872   -13.392 1.00 0.00  ? 56  GLU A H    2  
ATOM   2580  H  HA   . GLU A 1 56 ? 61.266 6.645   -11.787 1.00 0.00  ? 56  GLU A HA   2  
ATOM   2581  H  HB2  . GLU A 1 56 ? 58.382 5.819   -11.979 1.00 0.00  ? 56  GLU A HB2  2  
ATOM   2582  H  HB3  . GLU A 1 56 ? 58.886 6.877   -10.662 1.00 0.00  ? 56  GLU A HB3  2  
ATOM   2583  H  HG2  . GLU A 1 56 ? 59.545 7.450   -13.561 1.00 0.00  ? 56  GLU A HG2  2  
ATOM   2584  H  HG3  . GLU A 1 56 ? 58.096 8.068   -12.769 1.00 0.00  ? 56  GLU A HG3  2  
ATOM   2585  N  N    . LEU A 1 57 ? 60.176 3.930   -10.239 1.00 0.00  ? 57  LEU A N    2  
ATOM   2586  C  CA   . LEU A 1 57 ? 60.373 3.136   -8.986  1.00 0.00  ? 57  LEU A CA   2  
ATOM   2587  C  C    . LEU A 1 57 ? 61.827 2.665   -8.875  1.00 0.00  ? 57  LEU A C    2  
ATOM   2588  O  O    . LEU A 1 57 ? 62.358 2.551   -7.789  1.00 0.00  ? 57  LEU A O    2  
ATOM   2589  C  CB   . LEU A 1 57 ? 59.428 1.936   -9.092  1.00 0.00  ? 57  LEU A CB   2  
ATOM   2590  C  CG   . LEU A 1 57 ? 57.983 2.414   -9.294  1.00 0.00  ? 57  LEU A CG   2  
ATOM   2591  C  CD1  . LEU A 1 57 ? 57.050 1.204   -9.359  1.00 0.00  ? 57  LEU A CD1  2  
ATOM   2592  C  CD2  . LEU A 1 57 ? 57.564 3.314   -8.127  1.00 0.00  ? 57  LEU A CD2  2  
ATOM   2593  H  H    . LEU A 1 57 ? 59.629 3.567   -10.967 1.00 0.00  ? 57  LEU A H    2  
ATOM   2594  H  HA   . LEU A 1 57 ? 60.112 3.731   -8.126  1.00 0.00  ? 57  LEU A HA   2  
ATOM   2595  H  HB2  . LEU A 1 57 ? 59.724 1.320   -9.929  1.00 0.00  ? 57  LEU A HB2  2  
ATOM   2596  H  HB3  . LEU A 1 57 ? 59.489 1.360   -8.182  1.00 0.00  ? 57  LEU A HB3  2  
ATOM   2597  H  HG   . LEU A 1 57 ? 57.914 2.967   -10.220 1.00 0.00  ? 57  LEU A HG   2  
ATOM   2598  H  HD11 . LEU A 1 57 ? 56.106 1.452   -8.895  1.00 0.00  ? 57  LEU A HD11 2  
ATOM   2599  H  HD12 . LEU A 1 57 ? 57.500 0.372   -8.837  1.00 0.00  ? 57  LEU A HD12 2  
ATOM   2600  H  HD13 . LEU A 1 57 ? 56.883 0.933   -10.391 1.00 0.00  ? 57  LEU A HD13 2  
ATOM   2601  H  HD21 . LEU A 1 57 ? 56.705 2.886   -7.633  1.00 0.00  ? 57  LEU A HD21 2  
ATOM   2602  H  HD22 . LEU A 1 57 ? 57.312 4.294   -8.502  1.00 0.00  ? 57  LEU A HD22 2  
ATOM   2603  H  HD23 . LEU A 1 57 ? 58.380 3.397   -7.423  1.00 0.00  ? 57  LEU A HD23 2  
ATOM   2604  N  N    . GLN A 1 58 ? 62.481 2.406   -9.985  1.00 0.00  ? 58  GLN A N    2  
ATOM   2605  C  CA   . GLN A 1 58 ? 63.911 1.964   -9.926  1.00 0.00  ? 58  GLN A CA   2  
ATOM   2606  C  C    . GLN A 1 58 ? 64.722 2.998   -9.136  1.00 0.00  ? 58  GLN A C    2  
ATOM   2607  O  O    . GLN A 1 58 ? 65.392 2.671   -8.175  1.00 0.00  ? 58  GLN A O    2  
ATOM   2608  C  CB   . GLN A 1 58 ? 64.378 1.897   -11.384 1.00 0.00  ? 58  GLN A CB   2  
ATOM   2609  C  CG   . GLN A 1 58 ? 64.992 0.522   -11.660 1.00 0.00  ? 58  GLN A CG   2  
ATOM   2610  C  CD   . GLN A 1 58 ? 66.463 0.528   -11.240 1.00 0.00  ? 58  GLN A CD   2  
ATOM   2611  O  OE1  . GLN A 1 58 ? 67.338 0.717   -12.058 1.00 0.00  ? 58  GLN A OE1  2  
ATOM   2612  N  NE2  . GLN A 1 58 ? 66.774 0.331   -9.990  1.00 0.00  ? 58  GLN A NE2  2  
ATOM   2613  H  H    . GLN A 1 58 ? 62.037 2.515   -10.852 1.00 0.00  ? 58  GLN A H    2  
ATOM   2614  H  HA   . GLN A 1 58 ? 63.987 0.992   -9.462  1.00 0.00  ? 58  GLN A HA   2  
ATOM   2615  H  HB2  . GLN A 1 58 ? 63.534 2.053   -12.042 1.00 0.00  ? 58  GLN A HB2  2  
ATOM   2616  H  HB3  . GLN A 1 58 ? 65.119 2.661   -11.561 1.00 0.00  ? 58  GLN A HB3  2  
ATOM   2617  H  HG2  . GLN A 1 58 ? 64.458 -0.231  -11.099 1.00 0.00  ? 58  GLN A HG2  2  
ATOM   2618  H  HG3  . GLN A 1 58 ? 64.922 0.302   -12.714 1.00 0.00  ? 58  GLN A HG3  2  
ATOM   2619  H  HE21 . GLN A 1 58 ? 66.070 0.178   -9.327  1.00 0.00  ? 58  GLN A HE21 2  
ATOM   2620  H  HE22 . GLN A 1 58 ? 67.713 0.342   -9.713  1.00 0.00  ? 58  GLN A HE22 2  
ATOM   2621  N  N    . GLU A 1 59 ? 64.627 4.252   -9.515  1.00 0.00  ? 59  GLU A N    2  
ATOM   2622  C  CA   . GLU A 1 59 ? 65.354 5.320   -8.765  1.00 0.00  ? 59  GLU A CA   2  
ATOM   2623  C  C    . GLU A 1 59 ? 64.755 5.436   -7.356  1.00 0.00  ? 59  GLU A C    2  
ATOM   2624  O  O    . GLU A 1 59 ? 65.459 5.660   -6.391  1.00 0.00  ? 59  GLU A O    2  
ATOM   2625  C  CB   . GLU A 1 59 ? 65.126 6.606   -9.567  1.00 0.00  ? 59  GLU A CB   2  
ATOM   2626  C  CG   . GLU A 1 59 ? 65.930 7.755   -8.944  1.00 0.00  ? 59  GLU A CG   2  
ATOM   2627  C  CD   . GLU A 1 59 ? 64.980 8.725   -8.236  1.00 0.00  ? 59  GLU A CD   2  
ATOM   2628  O  OE1  . GLU A 1 59 ? 64.325 9.490   -8.924  1.00 0.00  ? 59  GLU A OE1  2  
ATOM   2629  O  OE2  . GLU A 1 59 ? 64.926 8.686   -7.018  1.00 0.00  ? 59  GLU A OE2  2  
ATOM   2630  H  H    . GLU A 1 59 ? 64.054 4.490   -10.274 1.00 0.00  ? 59  GLU A H    2  
ATOM   2631  H  HA   . GLU A 1 59 ? 66.409 5.095   -8.710  1.00 0.00  ? 59  GLU A HA   2  
ATOM   2632  H  HB2  . GLU A 1 59 ? 65.446 6.454   -10.587 1.00 0.00  ? 59  GLU A HB2  2  
ATOM   2633  H  HB3  . GLU A 1 59 ? 64.075 6.857   -9.554  1.00 0.00  ? 59  GLU A HB3  2  
ATOM   2634  H  HG2  . GLU A 1 59 ? 66.635 7.356   -8.229  1.00 0.00  ? 59  GLU A HG2  2  
ATOM   2635  H  HG3  . GLU A 1 59 ? 66.464 8.282   -9.720  1.00 0.00  ? 59  GLU A HG3  2  
ATOM   2636  N  N    . MET A 1 60 ? 63.455 5.257   -7.235  1.00 0.00  ? 60  MET A N    2  
ATOM   2637  C  CA   . MET A 1 60 ? 62.797 5.325   -5.891  1.00 0.00  ? 60  MET A CA   2  
ATOM   2638  C  C    . MET A 1 60 ? 63.461 4.322   -4.936  1.00 0.00  ? 60  MET A C    2  
ATOM   2639  O  O    . MET A 1 60 ? 63.700 4.621   -3.781  1.00 0.00  ? 60  MET A O    2  
ATOM   2640  C  CB   . MET A 1 60 ? 61.330 4.950   -6.141  1.00 0.00  ? 60  MET A CB   2  
ATOM   2641  C  CG   . MET A 1 60 ? 60.488 5.338   -4.923  1.00 0.00  ? 60  MET A CG   2  
ATOM   2642  S  SD   . MET A 1 60 ? 59.440 6.756   -5.337  1.00 0.00  ? 60  MET A SD   2  
ATOM   2643  C  CE   . MET A 1 60 ? 58.045 5.820   -6.011  1.00 0.00  ? 60  MET A CE   2  
ATOM   2644  H  H    . MET A 1 60 ? 62.916 5.061   -8.030  1.00 0.00  ? 60  MET A H    2  
ATOM   2645  H  HA   . MET A 1 60 ? 62.860 6.326   -5.491  1.00 0.00  ? 60  MET A HA   2  
ATOM   2646  H  HB2  . MET A 1 60 ? 60.967 5.476   -7.012  1.00 0.00  ? 60  MET A HB2  2  
ATOM   2647  H  HB3  . MET A 1 60 ? 61.249 3.883   -6.307  1.00 0.00  ? 60  MET A HB3  2  
ATOM   2648  H  HG2  . MET A 1 60 ? 59.868 4.504   -4.635  1.00 0.00  ? 60  MET A HG2  2  
ATOM   2649  H  HG3  . MET A 1 60 ? 61.140 5.600   -4.102  1.00 0.00  ? 60  MET A HG3  2  
ATOM   2650  H  HE1  . MET A 1 60 ? 58.188 5.680   -7.073  1.00 0.00  ? 60  MET A HE1  2  
ATOM   2651  H  HE2  . MET A 1 60 ? 57.130 6.364   -5.843  1.00 0.00  ? 60  MET A HE2  2  
ATOM   2652  H  HE3  . MET A 1 60 ? 57.986 4.860   -5.520  1.00 0.00  ? 60  MET A HE3  2  
ATOM   2653  N  N    . ILE A 1 61 ? 63.778 3.142   -5.418  1.00 0.00  ? 61  ILE A N    2  
ATOM   2654  C  CA   . ILE A 1 61 ? 64.450 2.125   -4.547  1.00 0.00  ? 61  ILE A CA   2  
ATOM   2655  C  C    . ILE A 1 61 ? 65.893 2.565   -4.275  1.00 0.00  ? 61  ILE A C    2  
ATOM   2656  O  O    . ILE A 1 61 ? 66.335 2.603   -3.142  1.00 0.00  ? 61  ILE A O    2  
ATOM   2657  C  CB   . ILE A 1 61 ? 64.431 0.811   -5.346  1.00 0.00  ? 61  ILE A CB   2  
ATOM   2658  C  CG1  . ILE A 1 61 ? 62.981 0.362   -5.572  1.00 0.00  ? 61  ILE A CG1  2  
ATOM   2659  C  CG2  . ILE A 1 61 ? 65.186 -0.274  -4.567  1.00 0.00  ? 61  ILE A CG2  2  
ATOM   2660  C  CD1  . ILE A 1 61 ? 62.962 -0.937  -6.389  1.00 0.00  ? 61  ILE A CD1  2  
ATOM   2661  H  H    . ILE A 1 61 ? 63.586 2.931   -6.357  1.00 0.00  ? 61  ILE A H    2  
ATOM   2662  H  HA   . ILE A 1 61 ? 63.911 2.004   -3.620  1.00 0.00  ? 61  ILE A HA   2  
ATOM   2663  H  HB   . ILE A 1 61 ? 64.914 0.968   -6.301  1.00 0.00  ? 61  ILE A HB   2  
ATOM   2664  H  HG12 . ILE A 1 61 ? 62.504 0.195   -4.616  1.00 0.00  ? 61  ILE A HG12 2  
ATOM   2665  H  HG13 . ILE A 1 61 ? 62.446 1.131   -6.108  1.00 0.00  ? 61  ILE A HG13 2  
ATOM   2666  H  HG21 . ILE A 1 61 ? 64.496 -0.807  -3.930  1.00 0.00  ? 61  ILE A HG21 2  
ATOM   2667  H  HG22 . ILE A 1 61 ? 65.955 0.181   -3.960  1.00 0.00  ? 61  ILE A HG22 2  
ATOM   2668  H  HG23 . ILE A 1 61 ? 65.639 -0.965  -5.261  1.00 0.00  ? 61  ILE A HG23 2  
ATOM   2669  H  HD11 . ILE A 1 61 ? 63.699 -0.879  -7.178  1.00 0.00  ? 61  ILE A HD11 2  
ATOM   2670  H  HD12 . ILE A 1 61 ? 61.982 -1.078  -6.823  1.00 0.00  ? 61  ILE A HD12 2  
ATOM   2671  H  HD13 . ILE A 1 61 ? 63.192 -1.773  -5.744  1.00 0.00  ? 61  ILE A HD13 2  
ATOM   2672  N  N    . ASP A 1 62 ? 66.623 2.907   -5.313  1.00 0.00  ? 62  ASP A N    2  
ATOM   2673  C  CA   . ASP A 1 62 ? 68.041 3.357   -5.135  1.00 0.00  ? 62  ASP A CA   2  
ATOM   2674  C  C    . ASP A 1 62 ? 68.113 4.592   -4.223  1.00 0.00  ? 62  ASP A C    2  
ATOM   2675  O  O    . ASP A 1 62 ? 69.107 4.814   -3.559  1.00 0.00  ? 62  ASP A O    2  
ATOM   2676  C  CB   . ASP A 1 62 ? 68.537 3.692   -6.545  1.00 0.00  ? 62  ASP A CB   2  
ATOM   2677  C  CG   . ASP A 1 62 ? 69.016 2.412   -7.235  1.00 0.00  ? 62  ASP A CG   2  
ATOM   2678  O  OD1  . ASP A 1 62 ? 70.058 1.907   -6.849  1.00 0.00  ? 62  ASP A OD1  2  
ATOM   2679  O  OD2  . ASP A 1 62 ? 68.331 1.956   -8.133  1.00 0.00  ? 62  ASP A OD2  2  
ATOM   2680  H  H    . ASP A 1 62 ? 66.235 2.871   -6.214  1.00 0.00  ? 62  ASP A H    2  
ATOM   2681  H  HA   . ASP A 1 62 ? 68.636 2.557   -4.723  1.00 0.00  ? 62  ASP A HA   2  
ATOM   2682  H  HB2  . ASP A 1 62 ? 67.732 4.130   -7.117  1.00 0.00  ? 62  ASP A HB2  2  
ATOM   2683  H  HB3  . ASP A 1 62 ? 69.357 4.392   -6.483  1.00 0.00  ? 62  ASP A HB3  2  
ATOM   2684  N  N    . GLU A 1 63 ? 67.064 5.388   -4.174  1.00 0.00  ? 63  GLU A N    2  
ATOM   2685  C  CA   . GLU A 1 63 ? 67.068 6.599   -3.288  1.00 0.00  ? 63  GLU A CA   2  
ATOM   2686  C  C    . GLU A 1 63 ? 67.487 6.205   -1.861  1.00 0.00  ? 63  GLU A C    2  
ATOM   2687  O  O    . GLU A 1 63 ? 68.220 6.917   -1.203  1.00 0.00  ? 63  GLU A O    2  
ATOM   2688  C  CB   . GLU A 1 63 ? 65.623 7.114   -3.303  1.00 0.00  ? 63  GLU A CB   2  
ATOM   2689  C  CG   . GLU A 1 63 ? 65.535 8.423   -2.509  1.00 0.00  ? 63  GLU A CG   2  
ATOM   2690  C  CD   . GLU A 1 63 ? 64.230 8.458   -1.709  1.00 0.00  ? 63  GLU A CD   2  
ATOM   2691  O  OE1  . GLU A 1 63 ? 64.198 7.872   -0.638  1.00 0.00  ? 63  GLU A OE1  2  
ATOM   2692  O  OE2  . GLU A 1 63 ? 63.286 9.075   -2.175  1.00 0.00  ? 63  GLU A OE2  2  
ATOM   2693  H  H    . GLU A 1 63 ? 66.270 5.183   -4.714  1.00 0.00  ? 63  GLU A H    2  
ATOM   2694  H  HA   . GLU A 1 63 ? 67.732 7.351   -3.682  1.00 0.00  ? 63  GLU A HA   2  
ATOM   2695  H  HB2  . GLU A 1 63 ? 65.314 7.290   -4.324  1.00 0.00  ? 63  GLU A HB2  2  
ATOM   2696  H  HB3  . GLU A 1 63 ? 64.974 6.378   -2.853  1.00 0.00  ? 63  GLU A HB3  2  
ATOM   2697  H  HG2  . GLU A 1 63 ? 66.372 8.490   -1.831  1.00 0.00  ? 63  GLU A HG2  2  
ATOM   2698  H  HG3  . GLU A 1 63 ? 65.557 9.260   -3.191  1.00 0.00  ? 63  GLU A HG3  2  
ATOM   2699  N  N    . VAL A 1 64 ? 67.035 5.067   -1.394  1.00 0.00  ? 64  VAL A N    2  
ATOM   2700  C  CA   . VAL A 1 64 ? 67.410 4.605   -0.022  1.00 0.00  ? 64  VAL A CA   2  
ATOM   2701  C  C    . VAL A 1 64 ? 68.016 3.185   -0.079  1.00 0.00  ? 64  VAL A C    2  
ATOM   2702  O  O    . VAL A 1 64 ? 67.970 2.444   0.886   1.00 0.00  ? 64  VAL A O    2  
ATOM   2703  C  CB   . VAL A 1 64 ? 66.093 4.625   0.772   1.00 0.00  ? 64  VAL A CB   2  
ATOM   2704  C  CG1  . VAL A 1 64 ? 65.181 3.478   0.320   1.00 0.00  ? 64  VAL A CG1  2  
ATOM   2705  C  CG2  . VAL A 1 64 ? 66.393 4.476   2.266   1.00 0.00  ? 64  VAL A CG2  2  
ATOM   2706  H  H    . VAL A 1 64 ? 66.453 4.508   -1.952  1.00 0.00  ? 64  VAL A H    2  
ATOM   2707  H  HA   . VAL A 1 64 ? 68.115 5.291   0.422   1.00 0.00  ? 64  VAL A HA   2  
ATOM   2708  H  HB   . VAL A 1 64 ? 65.590 5.567   0.601   1.00 0.00  ? 64  VAL A HB   2  
ATOM   2709  H  HG11 . VAL A 1 64 ? 65.366 3.257   -0.720  1.00 0.00  ? 64  VAL A HG11 2  
ATOM   2710  H  HG12 . VAL A 1 64 ? 64.148 3.767   0.448   1.00 0.00  ? 64  VAL A HG12 2  
ATOM   2711  H  HG13 . VAL A 1 64 ? 65.385 2.600   0.915   1.00 0.00  ? 64  VAL A HG13 2  
ATOM   2712  H  HG21 . VAL A 1 64 ? 67.460 4.524   2.427   1.00 0.00  ? 64  VAL A HG21 2  
ATOM   2713  H  HG22 . VAL A 1 64 ? 66.019 3.524   2.615   1.00 0.00  ? 64  VAL A HG22 2  
ATOM   2714  H  HG23 . VAL A 1 64 ? 65.911 5.274   2.812   1.00 0.00  ? 64  VAL A HG23 2  
ATOM   2715  N  N    . ASP A 1 65 ? 68.591 2.806   -1.200  1.00 0.00  ? 65  ASP A N    2  
ATOM   2716  C  CA   . ASP A 1 65 ? 69.200 1.443   -1.320  1.00 0.00  ? 65  ASP A CA   2  
ATOM   2717  C  C    . ASP A 1 65 ? 70.650 1.459   -0.818  1.00 0.00  ? 65  ASP A C    2  
ATOM   2718  O  O    . ASP A 1 65 ? 71.505 2.117   -1.382  1.00 0.00  ? 65  ASP A O    2  
ATOM   2719  C  CB   . ASP A 1 65 ? 69.152 1.112   -2.819  1.00 0.00  ? 65  ASP A CB   2  
ATOM   2720  C  CG   . ASP A 1 65 ? 69.416 -0.381  -3.040  1.00 0.00  ? 65  ASP A CG   2  
ATOM   2721  O  OD1  . ASP A 1 65 ? 70.489 -0.839  -2.689  1.00 0.00  ? 65  ASP A OD1  2  
ATOM   2722  O  OD2  . ASP A 1 65 ? 68.544 -1.046  -3.566  1.00 0.00  ? 65  ASP A OD2  2  
ATOM   2723  H  H    . ASP A 1 65 ? 68.625 3.421   -1.963  1.00 0.00  ? 65  ASP A H    2  
ATOM   2724  H  HA   . ASP A 1 65 ? 68.619 0.722   -0.767  1.00 0.00  ? 65  ASP A HA   2  
ATOM   2725  H  HB2  . ASP A 1 65 ? 68.179 1.364   -3.211  1.00 0.00  ? 65  ASP A HB2  2  
ATOM   2726  H  HB3  . ASP A 1 65 ? 69.906 1.687   -3.337  1.00 0.00  ? 65  ASP A HB3  2  
ATOM   2727  N  N    . GLU A 1 66 ? 70.930 0.730   0.232   1.00 0.00  ? 66  GLU A N    2  
ATOM   2728  C  CA   . GLU A 1 66 ? 72.325 0.685   0.773   1.00 0.00  ? 66  GLU A CA   2  
ATOM   2729  C  C    . GLU A 1 66 ? 73.195 -0.277  -0.052  1.00 0.00  ? 66  GLU A C    2  
ATOM   2730  O  O    . GLU A 1 66 ? 74.408 -0.191  -0.037  1.00 0.00  ? 66  GLU A O    2  
ATOM   2731  C  CB   . GLU A 1 66 ? 72.181 0.175   2.210   1.00 0.00  ? 66  GLU A CB   2  
ATOM   2732  C  CG   . GLU A 1 66 ? 73.036 1.034   3.148   1.00 0.00  ? 66  GLU A CG   2  
ATOM   2733  C  CD   . GLU A 1 66 ? 72.140 2.019   3.902   1.00 0.00  ? 66  GLU A CD   2  
ATOM   2734  O  OE1  . GLU A 1 66 ? 71.342 1.566   4.704   1.00 0.00  ? 66  GLU A OE1  2  
ATOM   2735  O  OE2  . GLU A 1 66 ? 72.265 3.209   3.664   1.00 0.00  ? 66  GLU A OE2  2  
ATOM   2736  H  H    . GLU A 1 66 ? 70.222 0.203   0.660   1.00 0.00  ? 66  GLU A H    2  
ATOM   2737  H  HA   . GLU A 1 66 ? 72.758 1.672   0.776   1.00 0.00  ? 66  GLU A HA   2  
ATOM   2738  H  HB2  . GLU A 1 66 ? 71.145 0.232   2.511   1.00 0.00  ? 66  GLU A HB2  2  
ATOM   2739  H  HB3  . GLU A 1 66 ? 72.514 -0.852  2.263   1.00 0.00  ? 66  GLU A HB3  2  
ATOM   2740  H  HG2  . GLU A 1 66 ? 73.542 0.395   3.857   1.00 0.00  ? 66  GLU A HG2  2  
ATOM   2741  H  HG3  . GLU A 1 66 ? 73.766 1.582   2.573   1.00 0.00  ? 66  GLU A HG3  2  
ATOM   2742  N  N    . ASP A 1 67 ? 72.588 -1.194  -0.767  1.00 0.00  ? 67  ASP A N    2  
ATOM   2743  C  CA   . ASP A 1 67 ? 73.382 -2.164  -1.586  1.00 0.00  ? 67  ASP A CA   2  
ATOM   2744  C  C    . ASP A 1 67 ? 73.834 -1.548  -2.915  1.00 0.00  ? 67  ASP A C    2  
ATOM   2745  O  O    . ASP A 1 67 ? 74.692 -2.090  -3.586  1.00 0.00  ? 67  ASP A O    2  
ATOM   2746  C  CB   . ASP A 1 67 ? 72.434 -3.339  -1.852  1.00 0.00  ? 67  ASP A CB   2  
ATOM   2747  C  CG   . ASP A 1 67 ? 72.109 -4.062  -0.542  1.00 0.00  ? 67  ASP A CG   2  
ATOM   2748  O  OD1  . ASP A 1 67 ? 73.033 -4.385  0.185   1.00 0.00  ? 67  ASP A OD1  2  
ATOM   2749  O  OD2  . ASP A 1 67 ? 70.937 -4.285  -0.294  1.00 0.00  ? 67  ASP A OD2  2  
ATOM   2750  H  H    . ASP A 1 67 ? 71.609 -1.248  -0.762  1.00 0.00  ? 67  ASP A H    2  
ATOM   2751  H  HA   . ASP A 1 67 ? 74.230 -2.508  -1.036  1.00 0.00  ? 67  ASP A HA   2  
ATOM   2752  H  HB2  . ASP A 1 67 ? 71.524 -2.967  -2.293  1.00 0.00  ? 67  ASP A HB2  2  
ATOM   2753  H  HB3  . ASP A 1 67 ? 72.906 -4.031  -2.532  1.00 0.00  ? 67  ASP A HB3  2  
ATOM   2754  N  N    . GLY A 1 68 ? 73.252 -0.445  -3.324  1.00 0.00  ? 68  GLY A N    2  
ATOM   2755  C  CA   . GLY A 1 68 ? 73.642 0.157   -4.635  1.00 0.00  ? 68  GLY A CA   2  
ATOM   2756  C  C    . GLY A 1 68 ? 73.210 -0.793  -5.762  1.00 0.00  ? 68  GLY A C    2  
ATOM   2757  O  O    . GLY A 1 68 ? 73.667 -0.690  -6.884  1.00 0.00  ? 68  GLY A O    2  
ATOM   2758  H  H    . GLY A 1 68 ? 72.544 -0.032  -2.786  1.00 0.00  ? 68  GLY A H    2  
ATOM   2759  H  HA2  . GLY A 1 68 ? 73.152 1.113   -4.757  1.00 0.00  ? 68  GLY A HA2  2  
ATOM   2760  H  HA3  . GLY A 1 68 ? 74.712 0.290   -4.671  1.00 0.00  ? 68  GLY A HA3  2  
ATOM   2761  N  N    . SER A 1 69 ? 72.328 -1.720  -5.458  1.00 0.00  ? 69  SER A N    2  
ATOM   2762  C  CA   . SER A 1 69 ? 71.847 -2.693  -6.482  1.00 0.00  ? 69  SER A CA   2  
ATOM   2763  C  C    . SER A 1 69 ? 70.552 -2.183  -7.121  1.00 0.00  ? 69  SER A C    2  
ATOM   2764  O  O    . SER A 1 69 ? 70.304 -2.394  -8.293  1.00 0.00  ? 69  SER A O    2  
ATOM   2765  C  CB   . SER A 1 69 ? 71.592 -3.988  -5.702  1.00 0.00  ? 69  SER A CB   2  
ATOM   2766  O  OG   . SER A 1 69 ? 70.575 -3.769  -4.721  1.00 0.00  ? 69  SER A OG   2  
ATOM   2767  H  H    . SER A 1 69 ? 71.978 -1.776  -4.547  1.00 0.00  ? 69  SER A H    2  
ATOM   2768  H  HA   . SER A 1 69 ? 72.602 -2.857  -7.235  1.00 0.00  ? 69  SER A HA   2  
ATOM   2769  H  HB2  . SER A 1 69 ? 71.269 -4.760  -6.380  1.00 0.00  ? 69  SER A HB2  2  
ATOM   2770  H  HB3  . SER A 1 69 ? 72.510 -4.299  -5.219  1.00 0.00  ? 69  SER A HB3  2  
ATOM   2771  H  HG   . SER A 1 69 ? 69.781 -4.233  -5.011  1.00 0.00  ? 69  SER A HG   2  
ATOM   2772  N  N    . GLY A 1 70 ? 69.728 -1.515  -6.354  1.00 0.00  ? 70  GLY A N    2  
ATOM   2773  C  CA   . GLY A 1 70 ? 68.441 -0.984  -6.910  1.00 0.00  ? 70  GLY A CA   2  
ATOM   2774  C  C    . GLY A 1 70 ? 67.300 -1.974  -6.639  1.00 0.00  ? 70  GLY A C    2  
ATOM   2775  O  O    . GLY A 1 70 ? 66.350 -2.058  -7.393  1.00 0.00  ? 70  GLY A O    2  
ATOM   2776  H  H    . GLY A 1 70 ? 69.957 -1.361  -5.405  1.00 0.00  ? 70  GLY A H    2  
ATOM   2777  H  HA2  . GLY A 1 70 ? 68.213 -0.036  -6.438  1.00 0.00  ? 70  GLY A HA2  2  
ATOM   2778  H  HA3  . GLY A 1 70 ? 68.543 -0.841  -7.978  1.00 0.00  ? 70  GLY A HA3  2  
ATOM   2779  N  N    . THR A 1 71 ? 67.385 -2.711  -5.561  1.00 0.00  ? 71  THR A N    2  
ATOM   2780  C  CA   . THR A 1 71 ? 66.310 -3.695  -5.208  1.00 0.00  ? 71  THR A CA   2  
ATOM   2781  C  C    . THR A 1 71 ? 65.882 -3.453  -3.758  1.00 0.00  ? 71  THR A C    2  
ATOM   2782  O  O    . THR A 1 71 ? 66.715 -3.277  -2.893  1.00 0.00  ? 71  THR A O    2  
ATOM   2783  C  CB   . THR A 1 71 ? 66.939 -5.094  -5.357  1.00 0.00  ? 71  THR A CB   2  
ATOM   2784  O  OG1  . THR A 1 71 ? 68.330 -4.989  -5.654  1.00 0.00  ? 71  THR A OG1  2  
ATOM   2785  C  CG2  . THR A 1 71 ? 66.233 -5.855  -6.481  1.00 0.00  ? 71  THR A CG2  2  
ATOM   2786  H  H    . THR A 1 71 ? 68.157 -2.611  -4.968  1.00 0.00  ? 71  THR A H    2  
ATOM   2787  H  HA   . THR A 1 71 ? 65.467 -3.590  -5.873  1.00 0.00  ? 71  THR A HA   2  
ATOM   2788  H  HB   . THR A 1 71 ? 66.814 -5.639  -4.434  1.00 0.00  ? 71  THR A HB   2  
ATOM   2789  H  HG1  . THR A 1 71 ? 68.425 -4.824  -6.598  1.00 0.00  ? 71  THR A HG1  2  
ATOM   2790  H  HG21 . THR A 1 71 ? 65.168 -5.860  -6.299  1.00 0.00  ? 71  THR A HG21 2  
ATOM   2791  H  HG22 . THR A 1 71 ? 66.599 -6.871  -6.510  1.00 0.00  ? 71  THR A HG22 2  
ATOM   2792  H  HG23 . THR A 1 71 ? 66.434 -5.371  -7.426  1.00 0.00  ? 71  THR A HG23 2  
ATOM   2793  N  N    . VAL A 1 72 ? 64.600 -3.422  -3.483  1.00 0.00  ? 72  VAL A N    2  
ATOM   2794  C  CA   . VAL A 1 72 ? 64.144 -3.162  -2.078  1.00 0.00  ? 72  VAL A CA   2  
ATOM   2795  C  C    . VAL A 1 72 ? 64.335 -4.399  -1.190  1.00 0.00  ? 72  VAL A C    2  
ATOM   2796  O  O    . VAL A 1 72 ? 63.679 -5.411  -1.362  1.00 0.00  ? 72  VAL A O    2  
ATOM   2797  C  CB   . VAL A 1 72 ? 62.657 -2.803  -2.179  1.00 0.00  ? 72  VAL A CB   2  
ATOM   2798  C  CG1  . VAL A 1 72 ? 62.050 -2.712  -0.774  1.00 0.00  ? 72  VAL A CG1  2  
ATOM   2799  C  CG2  . VAL A 1 72 ? 62.500 -1.452  -2.875  1.00 0.00  ? 72  VAL A CG2  2  
ATOM   2800  H  H    . VAL A 1 72 ? 63.940 -3.554  -4.198  1.00 0.00  ? 72  VAL A H    2  
ATOM   2801  H  HA   . VAL A 1 72 ? 64.688 -2.327  -1.665  1.00 0.00  ? 72  VAL A HA   2  
ATOM   2802  H  HB   . VAL A 1 72 ? 62.143 -3.564  -2.746  1.00 0.00  ? 72  VAL A HB   2  
ATOM   2803  H  HG11 . VAL A 1 72 ? 61.544 -3.636  -0.540  1.00 0.00  ? 72  VAL A HG11 2  
ATOM   2804  H  HG12 . VAL A 1 72 ? 61.345 -1.896  -0.739  1.00 0.00  ? 72  VAL A HG12 2  
ATOM   2805  H  HG13 . VAL A 1 72 ? 62.836 -2.539  -0.053  1.00 0.00  ? 72  VAL A HG13 2  
ATOM   2806  H  HG21 . VAL A 1 72 ? 63.169 -0.733  -2.422  1.00 0.00  ? 72  VAL A HG21 2  
ATOM   2807  H  HG22 . VAL A 1 72 ? 61.480 -1.110  -2.773  1.00 0.00  ? 72  VAL A HG22 2  
ATOM   2808  H  HG23 . VAL A 1 72 ? 62.741 -1.558  -3.921  1.00 0.00  ? 72  VAL A HG23 2  
ATOM   2809  N  N    . ASP A 1 73 ? 65.214 -4.305  -0.227  1.00 0.00  ? 73  ASP A N    2  
ATOM   2810  C  CA   . ASP A 1 73 ? 65.449 -5.448  0.705   1.00 0.00  ? 73  ASP A CA   2  
ATOM   2811  C  C    . ASP A 1 73 ? 64.630 -5.237  1.990   1.00 0.00  ? 73  ASP A C    2  
ATOM   2812  O  O    . ASP A 1 73 ? 63.860 -4.299  2.091   1.00 0.00  ? 73  ASP A O    2  
ATOM   2813  C  CB   . ASP A 1 73 ? 66.953 -5.412  0.997   1.00 0.00  ? 73  ASP A CB   2  
ATOM   2814  C  CG   . ASP A 1 73 ? 67.715 -6.057  -0.162  1.00 0.00  ? 73  ASP A CG   2  
ATOM   2815  O  OD1  . ASP A 1 73 ? 67.912 -7.259  -0.116  1.00 0.00  ? 73  ASP A OD1  2  
ATOM   2816  O  OD2  . ASP A 1 73 ? 68.088 -5.338  -1.076  1.00 0.00  ? 73  ASP A OD2  2  
ATOM   2817  H  H    . ASP A 1 73 ? 65.712 -3.470  -0.106  1.00 0.00  ? 73  ASP A H    2  
ATOM   2818  H  HA   . ASP A 1 73 ? 65.183 -6.382  0.235   1.00 0.00  ? 73  ASP A HA   2  
ATOM   2819  H  HB2  . ASP A 1 73 ? 67.273 -4.386  1.112   1.00 0.00  ? 73  ASP A HB2  2  
ATOM   2820  H  HB3  . ASP A 1 73 ? 67.158 -5.956  1.906   1.00 0.00  ? 73  ASP A HB3  2  
ATOM   2821  N  N    . PHE A 1 74 ? 64.790 -6.087  2.976   1.00 0.00  ? 74  PHE A N    2  
ATOM   2822  C  CA   . PHE A 1 74 ? 64.013 -5.908  4.244   1.00 0.00  ? 74  PHE A CA   2  
ATOM   2823  C  C    . PHE A 1 74 ? 64.564 -4.710  5.024   1.00 0.00  ? 74  PHE A C    2  
ATOM   2824  O  O    . PHE A 1 74 ? 63.822 -3.921  5.578   1.00 0.00  ? 74  PHE A O    2  
ATOM   2825  C  CB   . PHE A 1 74 ? 64.204 -7.210  5.032   1.00 0.00  ? 74  PHE A CB   2  
ATOM   2826  C  CG   . PHE A 1 74 ? 63.268 -7.222  6.219   1.00 0.00  ? 74  PHE A CG   2  
ATOM   2827  C  CD1  . PHE A 1 74 ? 61.889 -7.070  6.027   1.00 0.00  ? 74  PHE A CD1  2  
ATOM   2828  C  CD2  . PHE A 1 74 ? 63.779 -7.383  7.511   1.00 0.00  ? 74  PHE A CD2  2  
ATOM   2829  C  CE1  . PHE A 1 74 ? 61.023 -7.077  7.125   1.00 0.00  ? 74  PHE A CE1  2  
ATOM   2830  C  CE2  . PHE A 1 74 ? 62.913 -7.390  8.611   1.00 0.00  ? 74  PHE A CE2  2  
ATOM   2831  C  CZ   . PHE A 1 74 ? 61.535 -7.237  8.418   1.00 0.00  ? 74  PHE A CZ   2  
ATOM   2832  H  H    . PHE A 1 74 ? 65.423 -6.831  2.887   1.00 0.00  ? 74  PHE A H    2  
ATOM   2833  H  HA   . PHE A 1 74 ? 62.966 -5.761  4.025   1.00 0.00  ? 74  PHE A HA   2  
ATOM   2834  H  HB2  . PHE A 1 74 ? 63.986 -8.053  4.393   1.00 0.00  ? 74  PHE A HB2  2  
ATOM   2835  H  HB3  . PHE A 1 74 ? 65.225 -7.275  5.379   1.00 0.00  ? 74  PHE A HB3  2  
ATOM   2836  H  HD1  . PHE A 1 74 ? 61.494 -6.946  5.030   1.00 0.00  ? 74  PHE A HD1  2  
ATOM   2837  H  HD2  . PHE A 1 74 ? 64.842 -7.501  7.660   1.00 0.00  ? 74  PHE A HD2  2  
ATOM   2838  H  HE1  . PHE A 1 74 ? 59.961 -6.958  6.975   1.00 0.00  ? 74  PHE A HE1  2  
ATOM   2839  H  HE2  . PHE A 1 74 ? 63.308 -7.514  9.609   1.00 0.00  ? 74  PHE A HE2  2  
ATOM   2840  H  HZ   . PHE A 1 74 ? 60.868 -7.242  9.267   1.00 0.00  ? 74  PHE A HZ   2  
ATOM   2841  N  N    . ASP A 1 75 ? 65.865 -4.567  5.052   1.00 0.00  ? 75  ASP A N    2  
ATOM   2842  C  CA   . ASP A 1 75 ? 66.491 -3.419  5.774   1.00 0.00  ? 75  ASP A CA   2  
ATOM   2843  C  C    . ASP A 1 75 ? 66.157 -2.101  5.055   1.00 0.00  ? 75  ASP A C    2  
ATOM   2844  O  O    . ASP A 1 75 ? 65.937 -1.081  5.682   1.00 0.00  ? 75  ASP A O    2  
ATOM   2845  C  CB   . ASP A 1 75 ? 67.997 -3.724  5.739   1.00 0.00  ? 75  ASP A CB   2  
ATOM   2846  C  CG   . ASP A 1 75 ? 68.580 -3.404  4.359   1.00 0.00  ? 75  ASP A CG   2  
ATOM   2847  O  OD1  . ASP A 1 75 ? 68.353 -4.185  3.449   1.00 0.00  ? 75  ASP A OD1  2  
ATOM   2848  O  OD2  . ASP A 1 75 ? 69.240 -2.387  4.236   1.00 0.00  ? 75  ASP A OD2  2  
ATOM   2849  H  H    . ASP A 1 75 ? 66.434 -5.213  4.584   1.00 0.00  ? 75  ASP A H    2  
ATOM   2850  H  HA   . ASP A 1 75 ? 66.146 -3.386  6.795   1.00 0.00  ? 75  ASP A HA   2  
ATOM   2851  H  HB2  . ASP A 1 75 ? 68.501 -3.131  6.487   1.00 0.00  ? 75  ASP A HB2  2  
ATOM   2852  H  HB3  . ASP A 1 75 ? 68.147 -4.773  5.950   1.00 0.00  ? 75  ASP A HB3  2  
ATOM   2853  N  N    . GLU A 1 76 ? 66.102 -2.125  3.745   1.00 0.00  ? 76  GLU A N    2  
ATOM   2854  C  CA   . GLU A 1 76 ? 65.767 -0.889  2.975   1.00 0.00  ? 76  GLU A CA   2  
ATOM   2855  C  C    . GLU A 1 76 ? 64.273 -0.569  3.128   1.00 0.00  ? 76  GLU A C    2  
ATOM   2856  O  O    . GLU A 1 76 ? 63.891 0.573   3.295   1.00 0.00  ? 76  GLU A O    2  
ATOM   2857  C  CB   . GLU A 1 76 ? 66.098 -1.227  1.518   1.00 0.00  ? 76  GLU A CB   2  
ATOM   2858  C  CG   . GLU A 1 76 ? 67.513 -0.737  1.180   1.00 0.00  ? 76  GLU A CG   2  
ATOM   2859  C  CD   . GLU A 1 76 ? 68.183 -1.685  0.175   1.00 0.00  ? 76  GLU A CD   2  
ATOM   2860  O  OE1  . GLU A 1 76 ? 67.475 -2.391  -0.520  1.00 0.00  ? 76  GLU A OE1  2  
ATOM   2861  O  OE2  . GLU A 1 76 ? 69.400 -1.680  0.107   1.00 0.00  ? 76  GLU A OE2  2  
ATOM   2862  H  H    . GLU A 1 76 ? 66.273 -2.965  3.267   1.00 0.00  ? 76  GLU A H    2  
ATOM   2863  H  HA   . GLU A 1 76 ? 66.369 -0.059  3.310   1.00 0.00  ? 76  GLU A HA   2  
ATOM   2864  H  HB2  . GLU A 1 76 ? 66.043 -2.296  1.376   1.00 0.00  ? 76  GLU A HB2  2  
ATOM   2865  H  HB3  . GLU A 1 76 ? 65.388 -0.741  0.865   1.00 0.00  ? 76  GLU A HB3  2  
ATOM   2866  H  HG2  . GLU A 1 76 ? 67.453 0.251   0.752   1.00 0.00  ? 76  GLU A HG2  2  
ATOM   2867  H  HG3  . GLU A 1 76 ? 68.104 -0.703  2.083   1.00 0.00  ? 76  GLU A HG3  2  
ATOM   2868  N  N    . PHE A 1 77 ? 63.432 -1.577  3.076   1.00 0.00  ? 77  PHE A N    2  
ATOM   2869  C  CA   . PHE A 1 77 ? 61.958 -1.351  3.221   1.00 0.00  ? 77  PHE A CA   2  
ATOM   2870  C  C    . PHE A 1 77 ? 61.645 -0.660  4.555   1.00 0.00  ? 77  PHE A C    2  
ATOM   2871  O  O    . PHE A 1 77 ? 60.940 0.327   4.592   1.00 0.00  ? 77  PHE A O    2  
ATOM   2872  C  CB   . PHE A 1 77 ? 61.334 -2.750  3.181   1.00 0.00  ? 77  PHE A CB   2  
ATOM   2873  C  CG   . PHE A 1 77 ? 59.829 -2.639  3.099   1.00 0.00  ? 77  PHE A CG   2  
ATOM   2874  C  CD1  . PHE A 1 77 ? 59.217 -2.281  1.891   1.00 0.00  ? 77  PHE A CD1  2  
ATOM   2875  C  CD2  . PHE A 1 77 ? 59.044 -2.901  4.230   1.00 0.00  ? 77  PHE A CD2  2  
ATOM   2876  C  CE1  . PHE A 1 77 ? 57.824 -2.182  1.813   1.00 0.00  ? 77  PHE A CE1  2  
ATOM   2877  C  CE2  . PHE A 1 77 ? 57.650 -2.801  4.151   1.00 0.00  ? 77  PHE A CE2  2  
ATOM   2878  C  CZ   . PHE A 1 77 ? 57.040 -2.443  2.944   1.00 0.00  ? 77  PHE A CZ   2  
ATOM   2879  H  H    . PHE A 1 77 ? 63.773 -2.487  2.942   1.00 0.00  ? 77  PHE A H    2  
ATOM   2880  H  HA   . PHE A 1 77 ? 61.587 -0.760  2.399   1.00 0.00  ? 77  PHE A HA   2  
ATOM   2881  H  HB2  . PHE A 1 77 ? 61.701 -3.282  2.315   1.00 0.00  ? 77  PHE A HB2  2  
ATOM   2882  H  HB3  . PHE A 1 77 ? 61.606 -3.291  4.075   1.00 0.00  ? 77  PHE A HB3  2  
ATOM   2883  H  HD1  . PHE A 1 77 ? 59.821 -2.080  1.021   1.00 0.00  ? 77  PHE A HD1  2  
ATOM   2884  H  HD2  . PHE A 1 77 ? 59.515 -3.177  5.162   1.00 0.00  ? 77  PHE A HD2  2  
ATOM   2885  H  HE1  . PHE A 1 77 ? 57.354 -1.906  0.881   1.00 0.00  ? 77  PHE A HE1  2  
ATOM   2886  H  HE2  . PHE A 1 77 ? 57.044 -3.002  5.021   1.00 0.00  ? 77  PHE A HE2  2  
ATOM   2887  H  HZ   . PHE A 1 77 ? 55.965 -2.368  2.886   1.00 0.00  ? 77  PHE A HZ   2  
ATOM   2888  N  N    . LEU A 1 78 ? 62.165 -1.170  5.648   1.00 0.00  ? 78  LEU A N    2  
ATOM   2889  C  CA   . LEU A 1 78 ? 61.895 -0.536  6.981   1.00 0.00  ? 78  LEU A CA   2  
ATOM   2890  C  C    . LEU A 1 78 ? 62.271 0.952   6.951   1.00 0.00  ? 78  LEU A C    2  
ATOM   2891  O  O    . LEU A 1 78 ? 61.517 1.798   7.393   1.00 0.00  ? 78  LEU A O    2  
ATOM   2892  C  CB   . LEU A 1 78 ? 62.776 -1.296  7.978   1.00 0.00  ? 78  LEU A CB   2  
ATOM   2893  C  CG   . LEU A 1 78 ? 62.200 -2.696  8.211   1.00 0.00  ? 78  LEU A CG   2  
ATOM   2894  C  CD1  . LEU A 1 78 ? 63.273 -3.590  8.833   1.00 0.00  ? 78  LEU A CD1  2  
ATOM   2895  C  CD2  . LEU A 1 78 ? 60.998 -2.606  9.156   1.00 0.00  ? 78  LEU A CD2  2  
ATOM   2896  H  H    . LEU A 1 78 ? 62.735 -1.967  5.592   1.00 0.00  ? 78  LEU A H    2  
ATOM   2897  H  HA   . LEU A 1 78 ? 60.855 -0.653  7.246   1.00 0.00  ? 78  LEU A HA   2  
ATOM   2898  H  HB2  . LEU A 1 78 ? 63.778 -1.379  7.582   1.00 0.00  ? 78  LEU A HB2  2  
ATOM   2899  H  HB3  . LEU A 1 78 ? 62.803 -0.760  8.915   1.00 0.00  ? 78  LEU A HB3  2  
ATOM   2900  H  HG   . LEU A 1 78 ? 61.887 -3.119  7.267   1.00 0.00  ? 78  LEU A HG   2  
ATOM   2901  H  HD11 . LEU A 1 78 ? 62.982 -4.624  8.730   1.00 0.00  ? 78  LEU A HD11 2  
ATOM   2902  H  HD12 . LEU A 1 78 ? 63.381 -3.349  9.880   1.00 0.00  ? 78  LEU A HD12 2  
ATOM   2903  H  HD13 . LEU A 1 78 ? 64.213 -3.429  8.327   1.00 0.00  ? 78  LEU A HD13 2  
ATOM   2904  H  HD21 . LEU A 1 78 ? 60.268 -3.353  8.881   1.00 0.00  ? 78  LEU A HD21 2  
ATOM   2905  H  HD22 . LEU A 1 78 ? 60.554 -1.625  9.082   1.00 0.00  ? 78  LEU A HD22 2  
ATOM   2906  H  HD23 . LEU A 1 78 ? 61.324 -2.778  10.171  1.00 0.00  ? 78  LEU A HD23 2  
ATOM   2907  N  N    . VAL A 1 79 ? 63.424 1.274   6.415   1.00 0.00  ? 79  VAL A N    2  
ATOM   2908  C  CA   . VAL A 1 79 ? 63.849 2.710   6.335   1.00 0.00  ? 79  VAL A CA   2  
ATOM   2909  C  C    . VAL A 1 79 ? 62.921 3.474   5.379   1.00 0.00  ? 79  VAL A C    2  
ATOM   2910  O  O    . VAL A 1 79 ? 62.577 4.616   5.615   1.00 0.00  ? 79  VAL A O    2  
ATOM   2911  C  CB   . VAL A 1 79 ? 65.283 2.677   5.787   1.00 0.00  ? 79  VAL A CB   2  
ATOM   2912  C  CG1  . VAL A 1 79 ? 65.773 4.104   5.523   1.00 0.00  ? 79  VAL A CG1  2  
ATOM   2913  C  CG2  . VAL A 1 79 ? 66.209 2.010   6.809   1.00 0.00  ? 79  VAL A CG2  2  
ATOM   2914  H  H    . VAL A 1 79 ? 64.006 0.572   6.055   1.00 0.00  ? 79  VAL A H    2  
ATOM   2915  H  HA   . VAL A 1 79 ? 63.837 3.163   7.314   1.00 0.00  ? 79  VAL A HA   2  
ATOM   2916  H  HB   . VAL A 1 79 ? 65.300 2.115   4.863   1.00 0.00  ? 79  VAL A HB   2  
ATOM   2917  H  HG11 . VAL A 1 79 ? 64.930 4.737   5.281   1.00 0.00  ? 79  VAL A HG11 2  
ATOM   2918  H  HG12 . VAL A 1 79 ? 66.466 4.099   4.695   1.00 0.00  ? 79  VAL A HG12 2  
ATOM   2919  H  HG13 . VAL A 1 79 ? 66.268 4.484   6.405   1.00 0.00  ? 79  VAL A HG13 2  
ATOM   2920  H  HG21 . VAL A 1 79 ? 65.733 1.125   7.203   1.00 0.00  ? 79  VAL A HG21 2  
ATOM   2921  H  HG22 . VAL A 1 79 ? 66.411 2.698   7.615   1.00 0.00  ? 79  VAL A HG22 2  
ATOM   2922  H  HG23 . VAL A 1 79 ? 67.136 1.736   6.329   1.00 0.00  ? 79  VAL A HG23 2  
ATOM   2923  N  N    . MET A 1 80 ? 62.516 2.845   4.304   1.00 0.00  ? 80  MET A N    2  
ATOM   2924  C  CA   . MET A 1 80 ? 61.610 3.518   3.324   1.00 0.00  ? 80  MET A CA   2  
ATOM   2925  C  C    . MET A 1 80 ? 60.238 3.802   3.954   1.00 0.00  ? 80  MET A C    2  
ATOM   2926  O  O    . MET A 1 80 ? 59.665 4.855   3.749   1.00 0.00  ? 80  MET A O    2  
ATOM   2927  C  CB   . MET A 1 80 ? 61.471 2.521   2.170   1.00 0.00  ? 80  MET A CB   2  
ATOM   2928  C  CG   . MET A 1 80 ? 60.866 3.224   0.951   1.00 0.00  ? 80  MET A CG   2  
ATOM   2929  S  SD   . MET A 1 80 ? 61.370 2.357   -0.556  1.00 0.00  ? 80  MET A SD   2  
ATOM   2930  C  CE   . MET A 1 80 ? 60.289 0.918   -0.367  1.00 0.00  ? 80  MET A CE   2  
ATOM   2931  H  H    . MET A 1 80 ? 62.809 1.923   4.141   1.00 0.00  ? 80  MET A H    2  
ATOM   2932  H  HA   . MET A 1 80 ? 62.055 4.432   2.967   1.00 0.00  ? 80  MET A HA   2  
ATOM   2933  H  HB2  . MET A 1 80 ? 62.445 2.129   1.914   1.00 0.00  ? 80  MET A HB2  2  
ATOM   2934  H  HB3  . MET A 1 80 ? 60.825 1.709   2.472   1.00 0.00  ? 80  MET A HB3  2  
ATOM   2935  H  HG2  . MET A 1 80 ? 59.788 3.215   1.029   1.00 0.00  ? 80  MET A HG2  2  
ATOM   2936  H  HG3  . MET A 1 80 ? 61.216 4.245   0.913   1.00 0.00  ? 80  MET A HG3  2  
ATOM   2937  H  HE1  . MET A 1 80 ? 60.739 0.219   0.324   1.00 0.00  ? 80  MET A HE1  2  
ATOM   2938  H  HE2  . MET A 1 80 ? 60.155 0.438   -1.324  1.00 0.00  ? 80  MET A HE2  2  
ATOM   2939  H  HE3  . MET A 1 80 ? 59.327 1.238   0.011   1.00 0.00  ? 80  MET A HE3  2  
ATOM   2940  N  N    . MET A 1 81 ? 59.703 2.871   4.706   1.00 0.00  ? 81  MET A N    2  
ATOM   2941  C  CA   . MET A 1 81 ? 58.361 3.085   5.335   1.00 0.00  ? 81  MET A CA   2  
ATOM   2942  C  C    . MET A 1 81 ? 58.412 4.212   6.379   1.00 0.00  ? 81  MET A C    2  
ATOM   2943  O  O    . MET A 1 81 ? 57.589 5.108   6.366   1.00 0.00  ? 81  MET A O    2  
ATOM   2944  C  CB   . MET A 1 81 ? 58.001 1.749   6.003   1.00 0.00  ? 81  MET A CB   2  
ATOM   2945  C  CG   . MET A 1 81 ? 57.879 0.632   4.953   1.00 0.00  ? 81  MET A CG   2  
ATOM   2946  S  SD   . MET A 1 81 ? 57.291 1.308   3.377   1.00 0.00  ? 81  MET A SD   2  
ATOM   2947  C  CE   . MET A 1 81 ? 55.532 1.355   3.793   1.00 0.00  ? 81  MET A CE   2  
ATOM   2948  H  H    . MET A 1 81 ? 60.178 2.025   4.848   1.00 0.00  ? 81  MET A H    2  
ATOM   2949  H  HA   . MET A 1 81 ? 57.631 3.319   4.577   1.00 0.00  ? 81  MET A HA   2  
ATOM   2950  H  HB2  . MET A 1 81 ? 58.770 1.488   6.716   1.00 0.00  ? 81  MET A HB2  2  
ATOM   2951  H  HB3  . MET A 1 81 ? 57.059 1.854   6.519   1.00 0.00  ? 81  MET A HB3  2  
ATOM   2952  H  HG2  . MET A 1 81 ? 58.843 0.172   4.804   1.00 0.00  ? 81  MET A HG2  2  
ATOM   2953  H  HG3  . MET A 1 81 ? 57.181 -0.114  5.304   1.00 0.00  ? 81  MET A HG3  2  
ATOM   2954  H  HE1  . MET A 1 81 ? 55.420 1.497   4.860   1.00 0.00  ? 81  MET A HE1  2  
ATOM   2955  H  HE2  . MET A 1 81 ? 55.068 0.425   3.507   1.00 0.00  ? 81  MET A HE2  2  
ATOM   2956  H  HE3  . MET A 1 81 ? 55.059 2.169   3.262   1.00 0.00  ? 81  MET A HE3  2  
ATOM   2957  N  N    . VAL A 1 82 ? 59.359 4.173   7.288   1.00 0.00  ? 82  VAL A N    2  
ATOM   2958  C  CA   . VAL A 1 82 ? 59.436 5.249   8.335   1.00 0.00  ? 82  VAL A CA   2  
ATOM   2959  C  C    . VAL A 1 82 ? 59.737 6.618   7.704   1.00 0.00  ? 82  VAL A C    2  
ATOM   2960  O  O    . VAL A 1 82 ? 59.241 7.631   8.159   1.00 0.00  ? 82  VAL A O    2  
ATOM   2961  C  CB   . VAL A 1 82 ? 60.552 4.840   9.311   1.00 0.00  ? 82  VAL A CB   2  
ATOM   2962  C  CG1  . VAL A 1 82 ? 60.191 3.509   9.975   1.00 0.00  ? 82  VAL A CG1  2  
ATOM   2963  C  CG2  . VAL A 1 82 ? 61.891 4.699   8.573   1.00 0.00  ? 82  VAL A CG2  2  
ATOM   2964  H  H    . VAL A 1 82 ? 60.007 3.438   7.286   1.00 0.00  ? 82  VAL A H    2  
ATOM   2965  H  HA   . VAL A 1 82 ? 58.500 5.299   8.868   1.00 0.00  ? 82  VAL A HA   2  
ATOM   2966  H  HB   . VAL A 1 82 ? 60.644 5.599   10.075  1.00 0.00  ? 82  VAL A HB   2  
ATOM   2967  H  HG11 . VAL A 1 82 ? 60.476 2.692   9.327   1.00 0.00  ? 82  VAL A HG11 2  
ATOM   2968  H  HG12 . VAL A 1 82 ? 59.126 3.472   10.153  1.00 0.00  ? 82  VAL A HG12 2  
ATOM   2969  H  HG13 . VAL A 1 82 ? 60.716 3.422   10.915  1.00 0.00  ? 82  VAL A HG13 2  
ATOM   2970  H  HG21 . VAL A 1 82 ? 62.570 4.108   9.170   1.00 0.00  ? 82  VAL A HG21 2  
ATOM   2971  H  HG22 . VAL A 1 82 ? 62.315 5.679   8.409   1.00 0.00  ? 82  VAL A HG22 2  
ATOM   2972  H  HG23 . VAL A 1 82 ? 61.732 4.214   7.623   1.00 0.00  ? 82  VAL A HG23 2  
ATOM   2973  N  N    . ARG A 1 83 ? 60.531 6.662   6.661   1.00 0.00  ? 83  ARG A N    2  
ATOM   2974  C  CA   . ARG A 1 83 ? 60.837 7.980   6.016   1.00 0.00  ? 83  ARG A CA   2  
ATOM   2975  C  C    . ARG A 1 83 ? 59.676 8.421   5.104   1.00 0.00  ? 83  ARG A C    2  
ATOM   2976  O  O    . ARG A 1 83 ? 59.531 9.588   4.797   1.00 0.00  ? 83  ARG A O    2  
ATOM   2977  C  CB   . ARG A 1 83 ? 62.135 7.759   5.219   1.00 0.00  ? 83  ARG A CB   2  
ATOM   2978  C  CG   . ARG A 1 83 ? 61.848 7.054   3.885   1.00 0.00  ? 83  ARG A CG   2  
ATOM   2979  C  CD   . ARG A 1 83 ? 62.660 7.717   2.765   1.00 0.00  ? 83  ARG A CD   2  
ATOM   2980  N  NE   . ARG A 1 83 ? 62.124 9.108   2.663   1.00 0.00  ? 83  ARG A NE   2  
ATOM   2981  C  CZ   . ARG A 1 83 ? 61.347 9.442   1.671   1.00 0.00  ? 83  ARG A CZ   2  
ATOM   2982  N  NH1  . ARG A 1 83 ? 61.791 9.386   0.449   1.00 0.00  ? 83  ARG A NH1  2  
ATOM   2983  N  NH2  . ARG A 1 83 ? 60.129 9.836   1.909   1.00 0.00  ? 83  ARG A NH2  2  
ATOM   2984  H  H    . ARG A 1 83 ? 60.918 5.836   6.301   1.00 0.00  ? 83  ARG A H    2  
ATOM   2985  H  HA   . ARG A 1 83 ? 61.004 8.727   6.777   1.00 0.00  ? 83  ARG A HA   2  
ATOM   2986  H  HB2  . ARG A 1 83 ? 62.598 8.715   5.025   1.00 0.00  ? 83  ARG A HB2  2  
ATOM   2987  H  HB3  . ARG A 1 83 ? 62.811 7.151   5.803   1.00 0.00  ? 83  ARG A HB3  2  
ATOM   2988  H  HG2  . ARG A 1 83 ? 62.130 6.014   3.965   1.00 0.00  ? 83  ARG A HG2  2  
ATOM   2989  H  HG3  . ARG A 1 83 ? 60.798 7.122   3.652   1.00 0.00  ? 83  ARG A HG3  2  
ATOM   2990  H  HD2  . ARG A 1 83 ? 63.710 7.734   3.025   1.00 0.00  ? 83  ARG A HD2  2  
ATOM   2991  H  HD3  . ARG A 1 83 ? 62.511 7.193   1.832   1.00 0.00  ? 83  ARG A HD3  2  
ATOM   2992  H  HE   . ARG A 1 83 ? 62.356 9.774   3.346   1.00 0.00  ? 83  ARG A HE   2  
ATOM   2993  H  HH11 . ARG A 1 83 ? 62.727 9.083   0.270   1.00 0.00  ? 83  ARG A HH11 2  
ATOM   2994  H  HH12 . ARG A 1 83 ? 61.200 9.651   -0.311  1.00 0.00  ? 83  ARG A HH12 2  
ATOM   2995  H  HH21 . ARG A 1 83 ? 59.793 9.881   2.850   1.00 0.00  ? 83  ARG A HH21 2  
ATOM   2996  H  HH22 . ARG A 1 83 ? 59.530 10.096  1.153   1.00 0.00  ? 83  ARG A HH22 2  
ATOM   2997  N  N    . CYS A 1 84 ? 58.846 7.498   4.674   1.00 0.00  ? 84  CYS A N    2  
ATOM   2998  C  CA   . CYS A 1 84 ? 57.694 7.865   3.789   1.00 0.00  ? 84  CYS A CA   2  
ATOM   2999  C  C    . CYS A 1 84 ? 56.545 8.467   4.617   1.00 0.00  ? 84  CYS A C    2  
ATOM   3000  O  O    . CYS A 1 84 ? 55.740 9.222   4.106   1.00 0.00  ? 84  CYS A O    2  
ATOM   3001  C  CB   . CYS A 1 84 ? 57.259 6.547   3.139   1.00 0.00  ? 84  CYS A CB   2  
ATOM   3002  S  SG   . CYS A 1 84 ? 55.818 6.832   2.080   1.00 0.00  ? 84  CYS A SG   2  
ATOM   3003  H  H    . CYS A 1 84 ? 58.978 6.562   4.936   1.00 0.00  ? 84  CYS A H    2  
ATOM   3004  H  HA   . CYS A 1 84 ? 58.012 8.561   3.029   1.00 0.00  ? 84  CYS A HA   2  
ATOM   3005  H  HB2  . CYS A 1 84 ? 58.070 6.156   2.543   1.00 0.00  ? 84  CYS A HB2  2  
ATOM   3006  H  HB3  . CYS A 1 84 ? 57.004 5.834   3.909   1.00 0.00  ? 84  CYS A HB3  2  
ATOM   3007  H  HG   . CYS A 1 84 ? 55.124 6.229   2.355   1.00 0.00  ? 84  CYS A HG   2  
ATOM   3008  N  N    . MET A 1 85 ? 56.464 8.135   5.886   1.00 0.00  ? 85  MET A N    2  
ATOM   3009  C  CA   . MET A 1 85 ? 55.367 8.683   6.752   1.00 0.00  ? 85  MET A CA   2  
ATOM   3010  C  C    . MET A 1 85 ? 55.360 10.221  6.725   1.00 0.00  ? 85  MET A C    2  
ATOM   3011  O  O    . MET A 1 85 ? 54.350 10.836  6.440   1.00 0.00  ? 85  MET A O    2  
ATOM   3012  C  CB   . MET A 1 85 ? 55.676 8.172   8.164   1.00 0.00  ? 85  MET A CB   2  
ATOM   3013  C  CG   . MET A 1 85 ? 54.749 7.002   8.502   1.00 0.00  ? 85  MET A CG   2  
ATOM   3014  S  SD   . MET A 1 85 ? 54.879 6.618   10.267  1.00 0.00  ? 85  MET A SD   2  
ATOM   3015  C  CE   . MET A 1 85 ? 56.557 5.939   10.235  1.00 0.00  ? 85  MET A CE   2  
ATOM   3016  H  H    . MET A 1 85 ? 57.124 7.522   6.271   1.00 0.00  ? 85  MET A H    2  
ATOM   3017  H  HA   . MET A 1 85 ? 54.411 8.302   6.427   1.00 0.00  ? 85  MET A HA   2  
ATOM   3018  H  HB2  . MET A 1 85 ? 56.704 7.842   8.210   1.00 0.00  ? 85  MET A HB2  2  
ATOM   3019  H  HB3  . MET A 1 85 ? 55.522 8.968   8.876   1.00 0.00  ? 85  MET A HB3  2  
ATOM   3020  H  HG2  . MET A 1 85 ? 53.729 7.272   8.268   1.00 0.00  ? 85  MET A HG2  2  
ATOM   3021  H  HG3  . MET A 1 85 ? 55.034 6.136   7.923   1.00 0.00  ? 85  MET A HG3  2  
ATOM   3022  H  HE1  . MET A 1 85 ? 57.191 6.579   9.637   1.00 0.00  ? 85  MET A HE1  2  
ATOM   3023  H  HE2  . MET A 1 85 ? 56.540 4.951   9.805   1.00 0.00  ? 85  MET A HE2  2  
ATOM   3024  H  HE3  . MET A 1 85 ? 56.941 5.885   11.243  1.00 0.00  ? 85  MET A HE3  2  
ATOM   3025  N  N    . LYS A 1 86 ? 56.477 10.846  7.020   1.00 0.00  ? 86  LYS A N    2  
ATOM   3026  C  CA   . LYS A 1 86 ? 56.525 12.342  7.011   1.00 0.00  ? 86  LYS A CA   2  
ATOM   3027  C  C    . LYS A 1 86 ? 57.900 12.839  6.538   1.00 0.00  ? 86  LYS A C    2  
ATOM   3028  O  O    . LYS A 1 86 ? 58.797 13.066  7.329   1.00 0.00  ? 86  LYS A O    2  
ATOM   3029  C  CB   . LYS A 1 86 ? 56.264 12.761  8.464   1.00 0.00  ? 86  LYS A CB   2  
ATOM   3030  C  CG   . LYS A 1 86 ? 55.271 13.929  8.497   1.00 0.00  ? 86  LYS A CG   2  
ATOM   3031  C  CD   . LYS A 1 86 ? 55.957 15.206  8.000   1.00 0.00  ? 86  LYS A CD   2  
ATOM   3032  C  CE   . LYS A 1 86 ? 54.952 16.363  7.993   1.00 0.00  ? 86  LYS A CE   2  
ATOM   3033  N  NZ   . LYS A 1 86 ? 54.590 16.558  6.559   1.00 0.00  ? 86  LYS A NZ   2  
ATOM   3034  H  H    . LYS A 1 86 ? 57.279 10.333  7.248   1.00 0.00  ? 86  LYS A H    2  
ATOM   3035  H  HA   . LYS A 1 86 ? 55.749 12.736  6.373   1.00 0.00  ? 86  LYS A HA   2  
ATOM   3036  H  HB2  . LYS A 1 86 ? 55.853 11.925  9.011   1.00 0.00  ? 86  LYS A HB2  2  
ATOM   3037  H  HB3  . LYS A 1 86 ? 57.192 13.068  8.924   1.00 0.00  ? 86  LYS A HB3  2  
ATOM   3038  H  HG2  . LYS A 1 86 ? 54.428 13.701  7.860   1.00 0.00  ? 86  LYS A HG2  2  
ATOM   3039  H  HG3  . LYS A 1 86 ? 54.927 14.079  9.509   1.00 0.00  ? 86  LYS A HG3  2  
ATOM   3040  H  HD2  . LYS A 1 86 ? 56.782 15.449  8.655   1.00 0.00  ? 86  LYS A HD2  2  
ATOM   3041  H  HD3  . LYS A 1 86 ? 56.329 15.048  6.999   1.00 0.00  ? 86  LYS A HD3  2  
ATOM   3042  H  HE2  . LYS A 1 86 ? 54.077 16.103  8.573   1.00 0.00  ? 86  LYS A HE2  2  
ATOM   3043  H  HE3  . LYS A 1 86 ? 55.409 17.260  8.383   1.00 0.00  ? 86  LYS A HE3  2  
ATOM   3044  H  HZ1  . LYS A 1 86 ? 53.943 17.365  6.471   1.00 0.00  ? 86  LYS A HZ1  2  
ATOM   3045  H  HZ2  . LYS A 1 86 ? 54.126 15.700  6.198   1.00 0.00  ? 86  LYS A HZ2  2  
ATOM   3046  H  HZ3  . LYS A 1 86 ? 55.452 16.747  6.004   1.00 0.00  ? 86  LYS A HZ3  2  
ATOM   3047  N  N    . ASP A 1 87 ? 58.066 13.017  5.251   1.00 0.00  ? 87  ASP A N    2  
ATOM   3048  C  CA   . ASP A 1 87 ? 59.375 13.510  4.722   1.00 0.00  ? 87  ASP A CA   2  
ATOM   3049  C  C    . ASP A 1 87 ? 59.272 15.005  4.390   1.00 0.00  ? 87  ASP A C    2  
ATOM   3050  O  O    . ASP A 1 87 ? 59.995 15.819  4.935   1.00 0.00  ? 87  ASP A O    2  
ATOM   3051  C  CB   . ASP A 1 87 ? 59.636 12.683  3.459   1.00 0.00  ? 87  ASP A CB   2  
ATOM   3052  C  CG   . ASP A 1 87 ? 61.128 12.364  3.355   1.00 0.00  ? 87  ASP A CG   2  
ATOM   3053  O  OD1  . ASP A 1 87 ? 61.601 11.567  4.150   1.00 0.00  ? 87  ASP A OD1  2  
ATOM   3054  O  OD2  . ASP A 1 87 ? 61.773 12.922  2.486   1.00 0.00  ? 87  ASP A OD2  2  
ATOM   3055  H  H    . ASP A 1 87 ? 57.327 12.834  4.634   1.00 0.00  ? 87  ASP A H    2  
ATOM   3056  H  HA   . ASP A 1 87 ? 60.160 13.340  5.443   1.00 0.00  ? 87  ASP A HA   2  
ATOM   3057  H  HB2  . ASP A 1 87 ? 59.073 11.763  3.509   1.00 0.00  ? 87  ASP A HB2  2  
ATOM   3058  H  HB3  . ASP A 1 87 ? 59.329 13.246  2.590   1.00 0.00  ? 87  ASP A HB3  2  
ATOM   3059  N  N    . ASP A 1 88 ? 58.369 15.371  3.513   1.00 0.00  ? 88  ASP A N    2  
ATOM   3060  C  CA   . ASP A 1 88 ? 58.206 16.814  3.155   1.00 0.00  ? 88  ASP A CA   2  
ATOM   3061  C  C    . ASP A 1 88 ? 57.539 17.565  4.314   1.00 0.00  ? 88  ASP A C    2  
ATOM   3062  O  O    . ASP A 1 88 ? 56.476 17.191  4.775   1.00 0.00  ? 88  ASP A O    2  
ATOM   3063  C  CB   . ASP A 1 88 ? 57.301 16.824  1.918   1.00 0.00  ? 88  ASP A CB   2  
ATOM   3064  C  CG   . ASP A 1 88 ? 58.128 16.508  0.672   1.00 0.00  ? 88  ASP A CG   2  
ATOM   3065  O  OD1  . ASP A 1 88 ? 58.684 17.431  0.102   1.00 0.00  ? 88  ASP A OD1  2  
ATOM   3066  O  OD2  . ASP A 1 88 ? 58.185 15.348  0.303   1.00 0.00  ? 88  ASP A OD2  2  
ATOM   3067  H  H    . ASP A 1 88 ? 57.792 14.696  3.096   1.00 0.00  ? 88  ASP A H    2  
ATOM   3068  H  HA   . ASP A 1 88 ? 59.162 17.255  2.918   1.00 0.00  ? 88  ASP A HA   2  
ATOM   3069  H  HB2  . ASP A 1 88 ? 56.525 16.080  2.033   1.00 0.00  ? 88  ASP A HB2  2  
ATOM   3070  H  HB3  . ASP A 1 88 ? 56.850 17.799  1.810   1.00 0.00  ? 88  ASP A HB3  2  
ATOM   3071  N  N    . SER A 1 89 ? 58.156 18.616  4.790   1.00 0.00  ? 89  SER A N    2  
ATOM   3072  C  CA   . SER A 1 89 ? 57.563 19.393  5.924   1.00 0.00  ? 89  SER A CA   2  
ATOM   3073  C  C    . SER A 1 89 ? 57.853 20.889  5.755   1.00 0.00  ? 89  SER A C    2  
ATOM   3074  O  O    . SER A 1 89 ? 56.918 21.667  5.851   1.00 0.00  ? 89  SER A O    2  
ATOM   3075  C  CB   . SER A 1 89 ? 58.250 18.852  7.181   1.00 0.00  ? 89  SER A CB   2  
ATOM   3076  O  OG   . SER A 1 89 ? 57.745 17.555  7.475   1.00 0.00  ? 89  SER A OG   2  
ATOM   3077  O  OXT  . SER A 1 89 ? 59.005 21.231  5.535   1.00 0.00  ? 89  SER A OXT  2  
ATOM   3078  H  H    . SER A 1 89 ? 59.012 18.896  4.404   1.00 0.00  ? 89  SER A H    2  
ATOM   3079  H  HA   . SER A 1 89 ? 56.501 19.221  5.984   1.00 0.00  ? 89  SER A HA   2  
ATOM   3080  H  HB2  . SER A 1 89 ? 59.312 18.790  7.014   1.00 0.00  ? 89  SER A HB2  2  
ATOM   3081  H  HB3  . SER A 1 89 ? 58.058 19.521  8.010   1.00 0.00  ? 89  SER A HB3  2  
ATOM   3082  H  HG   . SER A 1 89 ? 58.350 16.907  7.102   1.00 0.00  ? 89  SER A HG   2  
ATOM   3083  N  N    . ARG B 2 1  ? 50.912 17.471  -7.670  1.00 0.00  ? 144 ARG B N    2  
ATOM   3084  C  CA   . ARG B 2 1  ? 52.339 17.125  -7.953  1.00 0.00  ? 144 ARG B CA   2  
ATOM   3085  C  C    . ARG B 2 1  ? 52.747 15.870  -7.171  1.00 0.00  ? 144 ARG B C    2  
ATOM   3086  O  O    . ARG B 2 1  ? 52.236 15.609  -6.098  1.00 0.00  ? 144 ARG B O    2  
ATOM   3087  C  CB   . ARG B 2 1  ? 53.150 18.339  -7.487  1.00 0.00  ? 144 ARG B CB   2  
ATOM   3088  C  CG   . ARG B 2 1  ? 53.605 19.144  -8.706  1.00 0.00  ? 144 ARG B CG   2  
ATOM   3089  C  CD   . ARG B 2 1  ? 54.283 20.434  -8.243  1.00 0.00  ? 144 ARG B CD   2  
ATOM   3090  N  NE   . ARG B 2 1  ? 54.608 21.167  -9.500  1.00 0.00  ? 144 ARG B NE   2  
ATOM   3091  C  CZ   . ARG B 2 1  ? 55.849 21.335  -9.858  1.00 0.00  ? 144 ARG B CZ   2  
ATOM   3092  N  NH1  . ARG B 2 1  ? 56.511 22.374  -9.438  1.00 0.00  ? 144 ARG B NH1  2  
ATOM   3093  N  NH2  . ARG B 2 1  ? 56.428 20.457  -10.625 1.00 0.00  ? 144 ARG B NH2  2  
ATOM   3094  H  H1   . ARG B 2 1  ? 50.695 18.408  -8.065  1.00 0.00  ? 144 ARG B H1   2  
ATOM   3095  H  H2   . ARG B 2 1  ? 50.755 17.483  -6.640  1.00 0.00  ? 144 ARG B H2   2  
ATOM   3096  H  H3   . ARG B 2 1  ? 50.292 16.763  -8.108  1.00 0.00  ? 144 ARG B H3   2  
ATOM   3097  H  HA   . ARG B 2 1  ? 52.486 16.969  -9.010  1.00 0.00  ? 144 ARG B HA   2  
ATOM   3098  H  HB2  . ARG B 2 1  ? 52.537 18.961  -6.851  1.00 0.00  ? 144 ARG B HB2  2  
ATOM   3099  H  HB3  . ARG B 2 1  ? 54.017 18.005  -6.936  1.00 0.00  ? 144 ARG B HB3  2  
ATOM   3100  H  HG2  . ARG B 2 1  ? 54.303 18.557  -9.285  1.00 0.00  ? 144 ARG B HG2  2  
ATOM   3101  H  HG3  . ARG B 2 1  ? 52.748 19.390  -9.317  1.00 0.00  ? 144 ARG B HG3  2  
ATOM   3102  H  HD2  . ARG B 2 1  ? 53.607 21.014  -7.629  1.00 0.00  ? 144 ARG B HD2  2  
ATOM   3103  H  HD3  . ARG B 2 1  ? 55.189 20.210  -7.700  1.00 0.00  ? 144 ARG B HD3  2  
ATOM   3104  H  HE   . ARG B 2 1  ? 53.886 21.526  -10.058 1.00 0.00  ? 144 ARG B HE   2  
ATOM   3105  H  HH11 . ARG B 2 1  ? 56.065 23.041  -8.842  1.00 0.00  ? 144 ARG B HH11 2  
ATOM   3106  H  HH12 . ARG B 2 1  ? 57.462 22.507  -9.712  1.00 0.00  ? 144 ARG B HH12 2  
ATOM   3107  H  HH21 . ARG B 2 1  ? 55.920 19.654  -10.938 1.00 0.00  ? 144 ARG B HH21 2  
ATOM   3108  H  HH22 . ARG B 2 1  ? 57.378 20.585  -10.904 1.00 0.00  ? 144 ARG B HH22 2  
ATOM   3109  N  N    . ARG B 2 2  ? 53.663 15.095  -7.713  1.00 0.00  ? 145 ARG B N    2  
ATOM   3110  C  CA   . ARG B 2 2  ? 54.126 13.840  -7.028  1.00 0.00  ? 145 ARG B CA   2  
ATOM   3111  C  C    . ARG B 2 2  ? 52.972 12.835  -6.886  1.00 0.00  ? 145 ARG B C    2  
ATOM   3112  O  O    . ARG B 2 2  ? 51.822 13.149  -7.134  1.00 0.00  ? 145 ARG B O    2  
ATOM   3113  C  CB   . ARG B 2 2  ? 54.634 14.286  -5.650  1.00 0.00  ? 145 ARG B CB   2  
ATOM   3114  C  CG   . ARG B 2 2  ? 56.037 13.719  -5.411  1.00 0.00  ? 145 ARG B CG   2  
ATOM   3115  C  CD   . ARG B 2 2  ? 57.023 14.869  -5.188  1.00 0.00  ? 145 ARG B CD   2  
ATOM   3116  N  NE   . ARG B 2 2  ? 58.057 14.319  -4.263  1.00 0.00  ? 145 ARG B NE   2  
ATOM   3117  C  CZ   . ARG B 2 2  ? 58.068 14.670  -3.007  1.00 0.00  ? 145 ARG B CZ   2  
ATOM   3118  N  NH1  . ARG B 2 2  ? 57.297 14.059  -2.155  1.00 0.00  ? 145 ARG B NH1  2  
ATOM   3119  N  NH2  . ARG B 2 2  ? 58.858 15.622  -2.605  1.00 0.00  ? 145 ARG B NH2  2  
ATOM   3120  H  H    . ARG B 2 2  ? 54.049 15.338  -8.580  1.00 0.00  ? 145 ARG B H    2  
ATOM   3121  H  HA   . ARG B 2 2  ? 54.934 13.394  -7.586  1.00 0.00  ? 145 ARG B HA   2  
ATOM   3122  H  HB2  . ARG B 2 2  ? 54.670 15.366  -5.613  1.00 0.00  ? 145 ARG B HB2  2  
ATOM   3123  H  HB3  . ARG B 2 2  ? 53.965 13.923  -4.884  1.00 0.00  ? 145 ARG B HB3  2  
ATOM   3124  H  HG2  . ARG B 2 2  ? 56.022 13.081  -4.538  1.00 0.00  ? 145 ARG B HG2  2  
ATOM   3125  H  HG3  . ARG B 2 2  ? 56.346 13.144  -6.271  1.00 0.00  ? 145 ARG B HG3  2  
ATOM   3126  H  HD2  . ARG B 2 2  ? 57.471 15.163  -6.129  1.00 0.00  ? 145 ARG B HD2  2  
ATOM   3127  H  HD3  . ARG B 2 2  ? 56.525 15.709  -4.730  1.00 0.00  ? 145 ARG B HD3  2  
ATOM   3128  H  HE   . ARG B 2 2  ? 58.734 13.693  -4.600  1.00 0.00  ? 145 ARG B HE   2  
ATOM   3129  H  HH11 . ARG B 2 2  ? 56.698 13.322  -2.463  1.00 0.00  ? 145 ARG B HH11 2  
ATOM   3130  H  HH12 . ARG B 2 2  ? 57.310 14.325  -1.190  1.00 0.00  ? 145 ARG B HH12 2  
ATOM   3131  H  HH21 . ARG B 2 2  ? 59.457 16.082  -3.257  1.00 0.00  ? 145 ARG B HH21 2  
ATOM   3132  H  HH22 . ARG B 2 2  ? 58.865 15.892  -1.642  1.00 0.00  ? 145 ARG B HH22 2  
ATOM   3133  N  N    . VAL B 2 3  ? 53.274 11.624  -6.491  1.00 0.00  ? 146 VAL B N    2  
ATOM   3134  C  CA   . VAL B 2 3  ? 52.198 10.598  -6.331  1.00 0.00  ? 146 VAL B CA   2  
ATOM   3135  C  C    . VAL B 2 3  ? 51.864 10.406  -4.844  1.00 0.00  ? 146 VAL B C    2  
ATOM   3136  O  O    . VAL B 2 3  ? 52.687 10.638  -3.977  1.00 0.00  ? 146 VAL B O    2  
ATOM   3137  C  CB   . VAL B 2 3  ? 52.759 9.313   -6.964  1.00 0.00  ? 146 VAL B CB   2  
ATOM   3138  C  CG1  . VAL B 2 3  ? 53.712 8.601   -5.996  1.00 0.00  ? 146 VAL B CG1  2  
ATOM   3139  C  CG2  . VAL B 2 3  ? 51.601 8.376   -7.315  1.00 0.00  ? 146 VAL B CG2  2  
ATOM   3140  H  H    . VAL B 2 3  ? 54.206 11.391  -6.298  1.00 0.00  ? 146 VAL B H    2  
ATOM   3141  H  HA   . VAL B 2 3  ? 51.314 10.909  -6.867  1.00 0.00  ? 146 VAL B HA   2  
ATOM   3142  H  HB   . VAL B 2 3  ? 53.296 9.568   -7.867  1.00 0.00  ? 146 VAL B HB   2  
ATOM   3143  H  HG11 . VAL B 2 3  ? 53.179 7.816   -5.479  1.00 0.00  ? 146 VAL B HG11 2  
ATOM   3144  H  HG12 . VAL B 2 3  ? 54.094 9.310   -5.277  1.00 0.00  ? 146 VAL B HG12 2  
ATOM   3145  H  HG13 . VAL B 2 3  ? 54.534 8.172   -6.551  1.00 0.00  ? 146 VAL B HG13 2  
ATOM   3146  H  HG21 . VAL B 2 3  ? 50.752 8.959   -7.640  1.00 0.00  ? 146 VAL B HG21 2  
ATOM   3147  H  HG22 . VAL B 2 3  ? 51.329 7.799   -6.444  1.00 0.00  ? 146 VAL B HG22 2  
ATOM   3148  H  HG23 . VAL B 2 3  ? 51.906 7.710   -8.108  1.00 0.00  ? 146 VAL B HG23 2  
ATOM   3149  N  N    . ARG B 2 4  ? 50.657 10.000  -4.546  1.00 0.00  ? 147 ARG B N    2  
ATOM   3150  C  CA   . ARG B 2 4  ? 50.257 9.808   -3.119  1.00 0.00  ? 147 ARG B CA   2  
ATOM   3151  C  C    . ARG B 2 4  ? 50.303 8.324   -2.739  1.00 0.00  ? 147 ARG B C    2  
ATOM   3152  O  O    . ARG B 2 4  ? 49.464 7.542   -3.148  1.00 0.00  ? 147 ARG B O    2  
ATOM   3153  C  CB   . ARG B 2 4  ? 48.824 10.343  -3.030  1.00 0.00  ? 147 ARG B CB   2  
ATOM   3154  C  CG   . ARG B 2 4  ? 48.844 11.875  -3.005  1.00 0.00  ? 147 ARG B CG   2  
ATOM   3155  C  CD   . ARG B 2 4  ? 48.135 12.418  -4.249  1.00 0.00  ? 147 ARG B CD   2  
ATOM   3156  N  NE   . ARG B 2 4  ? 49.217 12.622  -5.258  1.00 0.00  ? 147 ARG B NE   2  
ATOM   3157  C  CZ   . ARG B 2 4  ? 48.916 12.922  -6.488  1.00 0.00  ? 147 ARG B CZ   2  
ATOM   3158  N  NH1  . ARG B 2 4  ? 48.420 12.014  -7.278  1.00 0.00  ? 147 ARG B NH1  2  
ATOM   3159  N  NH2  . ARG B 2 4  ? 49.118 14.129  -6.927  1.00 0.00  ? 147 ARG B NH2  2  
ATOM   3160  H  H    . ARG B 2 4  ? 50.008 9.831   -5.262  1.00 0.00  ? 147 ARG B H    2  
ATOM   3161  H  HA   . ARG B 2 4  ? 50.901 10.380  -2.469  1.00 0.00  ? 147 ARG B HA   2  
ATOM   3162  H  HB2  . ARG B 2 4  ? 48.260 10.002  -3.886  1.00 0.00  ? 147 ARG B HB2  2  
ATOM   3163  H  HB3  . ARG B 2 4  ? 48.360 9.977   -2.126  1.00 0.00  ? 147 ARG B HB3  2  
ATOM   3164  H  HG2  . ARG B 2 4  ? 48.336 12.227  -2.118  1.00 0.00  ? 147 ARG B HG2  2  
ATOM   3165  H  HG3  . ARG B 2 4  ? 49.867 12.223  -2.994  1.00 0.00  ? 147 ARG B HG3  2  
ATOM   3166  H  HD2  . ARG B 2 4  ? 47.409 11.700  -4.610  1.00 0.00  ? 147 ARG B HD2  2  
ATOM   3167  H  HD3  . ARG B 2 4  ? 47.654 13.359  -4.028  1.00 0.00  ? 147 ARG B HD3  2  
ATOM   3168  H  HE   . ARG B 2 4  ? 50.158 12.538  -4.994  1.00 0.00  ? 147 ARG B HE   2  
ATOM   3169  H  HH11 . ARG B 2 4  ? 48.268 11.085  -6.941  1.00 0.00  ? 147 ARG B HH11 2  
ATOM   3170  H  HH12 . ARG B 2 4  ? 48.195 12.243  -8.224  1.00 0.00  ? 147 ARG B HH12 2  
ATOM   3171  H  HH21 . ARG B 2 4  ? 49.505 14.821  -6.319  1.00 0.00  ? 147 ARG B HH21 2  
ATOM   3172  H  HH22 . ARG B 2 4  ? 48.886 14.364  -7.870  1.00 0.00  ? 147 ARG B HH22 2  
ATOM   3173  N  N    . ILE B 2 5  ? 51.273 7.936   -1.952  1.00 0.00  ? 148 ILE B N    2  
ATOM   3174  C  CA   . ILE B 2 5  ? 51.376 6.506   -1.529  1.00 0.00  ? 148 ILE B CA   2  
ATOM   3175  C  C    . ILE B 2 5  ? 50.992 6.374   -0.049  1.00 0.00  ? 148 ILE B C    2  
ATOM   3176  O  O    . ILE B 2 5  ? 50.058 5.675   0.290   1.00 0.00  ? 148 ILE B O    2  
ATOM   3177  C  CB   . ILE B 2 5  ? 52.844 6.122   -1.756  1.00 0.00  ? 148 ILE B CB   2  
ATOM   3178  C  CG1  . ILE B 2 5  ? 53.167 6.181   -3.258  1.00 0.00  ? 148 ILE B CG1  2  
ATOM   3179  C  CG2  . ILE B 2 5  ? 53.096 4.703   -1.233  1.00 0.00  ? 148 ILE B CG2  2  
ATOM   3180  C  CD1  . ILE B 2 5  ? 52.223 5.258   -4.038  1.00 0.00  ? 148 ILE B CD1  2  
ATOM   3181  H  H    . ILE B 2 5  ? 51.932 8.588   -1.633  1.00 0.00  ? 148 ILE B H    2  
ATOM   3182  H  HA   . ILE B 2 5  ? 50.736 5.888   -2.139  1.00 0.00  ? 148 ILE B HA   2  
ATOM   3183  H  HB   . ILE B 2 5  ? 53.480 6.816   -1.224  1.00 0.00  ? 148 ILE B HB   2  
ATOM   3184  H  HG12 . ILE B 2 5  ? 53.048 7.196   -3.609  1.00 0.00  ? 148 ILE B HG12 2  
ATOM   3185  H  HG13 . ILE B 2 5  ? 54.187 5.865   -3.417  1.00 0.00  ? 148 ILE B HG13 2  
ATOM   3186  H  HG21 . ILE B 2 5  ? 52.199 4.112   -1.348  1.00 0.00  ? 148 ILE B HG21 2  
ATOM   3187  H  HG22 . ILE B 2 5  ? 53.366 4.746   -0.187  1.00 0.00  ? 148 ILE B HG22 2  
ATOM   3188  H  HG23 . ILE B 2 5  ? 53.900 4.249   -1.794  1.00 0.00  ? 148 ILE B HG23 2  
ATOM   3189  H  HD11 . ILE B 2 5  ? 51.272 5.750   -4.178  1.00 0.00  ? 148 ILE B HD11 2  
ATOM   3190  H  HD12 . ILE B 2 5  ? 52.076 4.342   -3.485  1.00 0.00  ? 148 ILE B HD12 2  
ATOM   3191  H  HD13 . ILE B 2 5  ? 52.656 5.031   -5.001  1.00 0.00  ? 148 ILE B HD13 2  
ATOM   3192  N  N    . SER B 2 6  ? 51.706 7.056   0.824   1.00 0.00  ? 149 SER B N    2  
ATOM   3193  C  CA   . SER B 2 6  ? 51.406 7.004   2.297   1.00 0.00  ? 149 SER B CA   2  
ATOM   3194  C  C    . SER B 2 6  ? 51.627 5.590   2.858   1.00 0.00  ? 149 SER B C    2  
ATOM   3195  O  O    . SER B 2 6  ? 50.900 4.664   2.551   1.00 0.00  ? 149 SER B O    2  
ATOM   3196  C  CB   . SER B 2 6  ? 49.938 7.426   2.440   1.00 0.00  ? 149 SER B CB   2  
ATOM   3197  O  OG   . SER B 2 6  ? 49.845 8.480   3.390   1.00 0.00  ? 149 SER B OG   2  
ATOM   3198  H  H    . SER B 2 6  ? 52.446 7.614   0.507   1.00 0.00  ? 149 SER B H    2  
ATOM   3199  H  HA   . SER B 2 6  ? 52.034 7.707   2.822   1.00 0.00  ? 149 SER B HA   2  
ATOM   3200  H  HB2  . SER B 2 6  ? 49.564 7.771   1.490   1.00 0.00  ? 149 SER B HB2  2  
ATOM   3201  H  HB3  . SER B 2 6  ? 49.351 6.578   2.768   1.00 0.00  ? 149 SER B HB3  2  
ATOM   3202  H  HG   . SER B 2 6  ? 49.706 8.086   4.260   1.00 0.00  ? 149 SER B HG   2  
ATOM   3203  N  N    . ALA B 2 7  ? 52.628 5.424   3.691   1.00 0.00  ? 150 ALA B N    2  
ATOM   3204  C  CA   . ALA B 2 7  ? 52.904 4.076   4.288   1.00 0.00  ? 150 ALA B CA   2  
ATOM   3205  C  C    . ALA B 2 7  ? 51.664 3.559   5.031   1.00 0.00  ? 150 ALA B C    2  
ATOM   3206  O  O    . ALA B 2 7  ? 51.313 2.399   4.932   1.00 0.00  ? 150 ALA B O    2  
ATOM   3207  C  CB   . ALA B 2 7  ? 54.064 4.296   5.264   1.00 0.00  ? 150 ALA B CB   2  
ATOM   3208  H  H    . ALA B 2 7  ? 53.195 6.188   3.929   1.00 0.00  ? 150 ALA B H    2  
ATOM   3209  H  HA   . ALA B 2 7  ? 53.197 3.379   3.519   1.00 0.00  ? 150 ALA B HA   2  
ATOM   3210  H  HB1  . ALA B 2 7  ? 53.680 4.664   6.204   1.00 0.00  ? 150 ALA B HB1  2  
ATOM   3211  H  HB2  . ALA B 2 7  ? 54.754 5.018   4.849   1.00 0.00  ? 150 ALA B HB2  2  
ATOM   3212  H  HB3  . ALA B 2 7  ? 54.578 3.360   5.427   1.00 0.00  ? 150 ALA B HB3  2  
ATOM   3213  N  N    . ASP B 2 8  ? 50.994 4.418   5.762   1.00 0.00  ? 151 ASP B N    2  
ATOM   3214  C  CA   . ASP B 2 8  ? 49.766 3.993   6.507   1.00 0.00  ? 151 ASP B CA   2  
ATOM   3215  C  C    . ASP B 2 8  ? 48.686 3.501   5.527   1.00 0.00  ? 151 ASP B C    2  
ATOM   3216  O  O    . ASP B 2 8  ? 47.994 2.536   5.794   1.00 0.00  ? 151 ASP B O    2  
ATOM   3217  C  CB   . ASP B 2 8  ? 49.297 5.246   7.268   1.00 0.00  ? 151 ASP B CB   2  
ATOM   3218  C  CG   . ASP B 2 8  ? 48.957 6.372   6.284   1.00 0.00  ? 151 ASP B CG   2  
ATOM   3219  O  OD1  . ASP B 2 8  ? 49.880 6.984   5.772   1.00 0.00  ? 151 ASP B OD1  2  
ATOM   3220  O  OD2  . ASP B 2 8  ? 47.781 6.600   6.059   1.00 0.00  ? 151 ASP B OD2  2  
ATOM   3221  H  H    . ASP B 2 8  ? 51.296 5.350   5.815   1.00 0.00  ? 151 ASP B H    2  
ATOM   3222  H  HA   . ASP B 2 8  ? 50.012 3.212   7.210   1.00 0.00  ? 151 ASP B HA   2  
ATOM   3223  H  HB2  . ASP B 2 8  ? 48.419 5.004   7.849   1.00 0.00  ? 151 ASP B HB2  2  
ATOM   3224  H  HB3  . ASP B 2 8  ? 50.082 5.578   7.930   1.00 0.00  ? 151 ASP B HB3  2  
ATOM   3225  N  N    . ALA B 2 9  ? 48.548 4.147   4.391   1.00 0.00  ? 152 ALA B N    2  
ATOM   3226  C  CA   . ALA B 2 9  ? 47.524 3.707   3.392   1.00 0.00  ? 152 ALA B CA   2  
ATOM   3227  C  C    . ALA B 2 9  ? 47.910 2.334   2.826   1.00 0.00  ? 152 ALA B C    2  
ATOM   3228  O  O    . ALA B 2 9  ? 47.102 1.427   2.777   1.00 0.00  ? 152 ALA B O    2  
ATOM   3229  C  CB   . ALA B 2 9  ? 47.544 4.775   2.293   1.00 0.00  ? 152 ALA B CB   2  
ATOM   3230  H  H    . ALA B 2 9  ? 49.124 4.915   4.193   1.00 0.00  ? 152 ALA B H    2  
ATOM   3231  H  HA   . ALA B 2 9  ? 46.548 3.664   3.849   1.00 0.00  ? 152 ALA B HA   2  
ATOM   3232  H  HB1  . ALA B 2 9  ? 48.567 5.018   2.046   1.00 0.00  ? 152 ALA B HB1  2  
ATOM   3233  H  HB2  . ALA B 2 9  ? 47.037 5.662   2.644   1.00 0.00  ? 152 ALA B HB2  2  
ATOM   3234  H  HB3  . ALA B 2 9  ? 47.042 4.398   1.415   1.00 0.00  ? 152 ALA B HB3  2  
ATOM   3235  N  N    . MET B 2 10 ? 49.146 2.175   2.416   1.00 0.00  ? 153 MET B N    2  
ATOM   3236  C  CA   . MET B 2 10 ? 49.599 0.857   1.868   1.00 0.00  ? 153 MET B CA   2  
ATOM   3237  C  C    . MET B 2 10 ? 49.533 -0.221  2.960   1.00 0.00  ? 153 MET B C    2  
ATOM   3238  O  O    . MET B 2 10 ? 49.191 -1.359  2.696   1.00 0.00  ? 153 MET B O    2  
ATOM   3239  C  CB   . MET B 2 10 ? 51.046 1.086   1.418   1.00 0.00  ? 153 MET B CB   2  
ATOM   3240  C  CG   . MET B 2 10 ? 51.262 0.440   0.048   1.00 0.00  ? 153 MET B CG   2  
ATOM   3241  S  SD   . MET B 2 10 ? 53.014 0.530   -0.391  1.00 0.00  ? 153 MET B SD   2  
ATOM   3242  C  CE   . MET B 2 10 ? 52.803 1.316   -2.007  1.00 0.00  ? 153 MET B CE   2  
ATOM   3243  H  H    . MET B 2 10 ? 49.780 2.922   2.479   1.00 0.00  ? 153 MET B H    2  
ATOM   3244  H  HA   . MET B 2 10 ? 48.991 0.572   1.023   1.00 0.00  ? 153 MET B HA   2  
ATOM   3245  H  HB2  . MET B 2 10 ? 51.238 2.148   1.351   1.00 0.00  ? 153 MET B HB2  2  
ATOM   3246  H  HB3  . MET B 2 10 ? 51.721 0.643   2.134   1.00 0.00  ? 153 MET B HB3  2  
ATOM   3247  H  HG2  . MET B 2 10 ? 50.952 -0.594  0.085   1.00 0.00  ? 153 MET B HG2  2  
ATOM   3248  H  HG3  . MET B 2 10 ? 50.678 0.965   -0.693  1.00 0.00  ? 153 MET B HG3  2  
ATOM   3249  H  HE1  . MET B 2 10 ? 51.912 1.928   -1.994  1.00 0.00  ? 153 MET B HE1  2  
ATOM   3250  H  HE2  . MET B 2 10 ? 52.704 0.558   -2.767  1.00 0.00  ? 153 MET B HE2  2  
ATOM   3251  H  HE3  . MET B 2 10 ? 53.666 1.930   -2.224  1.00 0.00  ? 153 MET B HE3  2  
ATOM   3252  N  N    . MET B 2 11 ? 49.849 0.136   4.185   1.00 0.00  ? 154 MET B N    2  
ATOM   3253  C  CA   . MET B 2 11 ? 49.797 -0.856  5.307   1.00 0.00  ? 154 MET B CA   2  
ATOM   3254  C  C    . MET B 2 11 ? 48.379 -1.429  5.439   1.00 0.00  ? 154 MET B C    2  
ATOM   3255  O  O    . MET B 2 11 ? 48.193 -2.627  5.517   1.00 0.00  ? 154 MET B O    2  
ATOM   3256  C  CB   . MET B 2 11 ? 50.177 -0.062  6.564   1.00 0.00  ? 154 MET B CB   2  
ATOM   3257  C  CG   . MET B 2 11 ? 51.691 -0.131  6.778   1.00 0.00  ? 154 MET B CG   2  
ATOM   3258  S  SD   . MET B 2 11 ? 52.140 0.857   8.226   1.00 0.00  ? 154 MET B SD   2  
ATOM   3259  C  CE   . MET B 2 11 ? 52.283 -0.512  9.401   1.00 0.00  ? 154 MET B CE   2  
ATOM   3260  H  H    . MET B 2 11 ? 50.115 1.062   4.368   1.00 0.00  ? 154 MET B H    2  
ATOM   3261  H  HA   . MET B 2 11 ? 50.510 -1.649  5.142   1.00 0.00  ? 154 MET B HA   2  
ATOM   3262  H  HB2  . MET B 2 11 ? 49.878 0.969   6.443   1.00 0.00  ? 154 MET B HB2  2  
ATOM   3263  H  HB3  . MET B 2 11 ? 49.675 -0.483  7.422   1.00 0.00  ? 154 MET B HB3  2  
ATOM   3264  H  HG2  . MET B 2 11 ? 51.986 -1.158  6.937   1.00 0.00  ? 154 MET B HG2  2  
ATOM   3265  H  HG3  . MET B 2 11 ? 52.197 0.258   5.906   1.00 0.00  ? 154 MET B HG3  2  
ATOM   3266  H  HE1  . MET B 2 11 ? 53.327 -0.687  9.624   1.00 0.00  ? 154 MET B HE1  2  
ATOM   3267  H  HE2  . MET B 2 11 ? 51.857 -1.404  8.970   1.00 0.00  ? 154 MET B HE2  2  
ATOM   3268  H  HE3  . MET B 2 11 ? 51.751 -0.264  10.310  1.00 0.00  ? 154 MET B HE3  2  
ATOM   3269  N  N    . GLN B 2 12 ? 47.381 -0.579  5.452   1.00 0.00  ? 155 GLN B N    2  
ATOM   3270  C  CA   . GLN B 2 12 ? 45.970 -1.069  5.566   1.00 0.00  ? 155 GLN B CA   2  
ATOM   3271  C  C    . GLN B 2 12 ? 45.530 -1.741  4.258   1.00 0.00  ? 155 GLN B C    2  
ATOM   3272  O  O    . GLN B 2 12 ? 44.755 -2.679  4.266   1.00 0.00  ? 155 GLN B O    2  
ATOM   3273  C  CB   . GLN B 2 12 ? 45.129 0.182   5.826   1.00 0.00  ? 155 GLN B CB   2  
ATOM   3274  C  CG   . GLN B 2 12 ? 45.029 0.437   7.331   1.00 0.00  ? 155 GLN B CG   2  
ATOM   3275  C  CD   . GLN B 2 12 ? 43.786 1.281   7.622   1.00 0.00  ? 155 GLN B CD   2  
ATOM   3276  O  OE1  . GLN B 2 12 ? 43.655 2.381   7.125   1.00 0.00  ? 155 GLN B OE1  2  
ATOM   3277  N  NE2  . GLN B 2 12 ? 42.861 0.811   8.409   1.00 0.00  ? 155 GLN B NE2  2  
ATOM   3278  H  H    . GLN B 2 12 ? 47.560 0.382   5.379   1.00 0.00  ? 155 GLN B H    2  
ATOM   3279  H  HA   . GLN B 2 12 ? 45.875 -1.757  6.393   1.00 0.00  ? 155 GLN B HA   2  
ATOM   3280  H  HB2  . GLN B 2 12 ? 45.591 1.033   5.346   1.00 0.00  ? 155 GLN B HB2  2  
ATOM   3281  H  HB3  . GLN B 2 12 ? 44.138 0.038   5.423   1.00 0.00  ? 155 GLN B HB3  2  
ATOM   3282  H  HG2  . GLN B 2 12 ? 44.956 -0.507  7.852   1.00 0.00  ? 155 GLN B HG2  2  
ATOM   3283  H  HG3  . GLN B 2 12 ? 45.909 0.967   7.666   1.00 0.00  ? 155 GLN B HG3  2  
ATOM   3284  H  HE21 . GLN B 2 12 ? 42.963 -0.076  8.812   1.00 0.00  ? 155 GLN B HE21 2  
ATOM   3285  H  HE22 . GLN B 2 12 ? 42.062 1.345   8.596   1.00 0.00  ? 155 GLN B HE22 2  
ATOM   3286  N  N    . ALA B 2 13 ? 46.016 -1.264  3.135   1.00 0.00  ? 156 ALA B N    2  
ATOM   3287  C  CA   . ALA B 2 13 ? 45.628 -1.869  1.823   1.00 0.00  ? 156 ALA B CA   2  
ATOM   3288  C  C    . ALA B 2 13 ? 46.096 -3.330  1.745   1.00 0.00  ? 156 ALA B C    2  
ATOM   3289  O  O    . ALA B 2 13 ? 45.371 -4.197  1.294   1.00 0.00  ? 156 ALA B O    2  
ATOM   3290  C  CB   . ALA B 2 13 ? 46.338 -1.019  0.765   1.00 0.00  ? 156 ALA B CB   2  
ATOM   3291  H  H    . ALA B 2 13 ? 46.636 -0.504  3.157   1.00 0.00  ? 156 ALA B H    2  
ATOM   3292  H  HA   . ALA B 2 13 ? 44.560 -1.810  1.684   1.00 0.00  ? 156 ALA B HA   2  
ATOM   3293  H  HB1  . ALA B 2 13 ? 47.327 -1.417  0.587   1.00 0.00  ? 156 ALA B HB1  2  
ATOM   3294  H  HB2  . ALA B 2 13 ? 46.417 0.000   1.114   1.00 0.00  ? 156 ALA B HB2  2  
ATOM   3295  H  HB3  . ALA B 2 13 ? 45.770 -1.041  -0.154  1.00 0.00  ? 156 ALA B HB3  2  
ATOM   3296  N  N    . LEU B 2 14 ? 47.300 -3.608  2.186   1.00 0.00  ? 157 LEU B N    2  
ATOM   3297  C  CA   . LEU B 2 14 ? 47.812 -5.014  2.141   1.00 0.00  ? 157 LEU B CA   2  
ATOM   3298  C  C    . LEU B 2 14 ? 47.381 -5.778  3.400   1.00 0.00  ? 157 LEU B C    2  
ATOM   3299  O  O    . LEU B 2 14 ? 46.780 -6.832  3.316   1.00 0.00  ? 157 LEU B O    2  
ATOM   3300  C  CB   . LEU B 2 14 ? 49.338 -4.888  2.078   1.00 0.00  ? 157 LEU B CB   2  
ATOM   3301  C  CG   . LEU B 2 14 ? 49.871 -5.719  0.909   1.00 0.00  ? 157 LEU B CG   2  
ATOM   3302  C  CD1  . LEU B 2 14 ? 49.591 -4.992  -0.407  1.00 0.00  ? 157 LEU B CD1  2  
ATOM   3303  C  CD2  . LEU B 2 14 ? 51.380 -5.915  1.067   1.00 0.00  ? 157 LEU B CD2  2  
ATOM   3304  H  H    . LEU B 2 14 ? 47.865 -2.892  2.547   1.00 0.00  ? 157 LEU B H    2  
ATOM   3305  H  HA   . LEU B 2 14 ? 47.448 -5.516  1.259   1.00 0.00  ? 157 LEU B HA   2  
ATOM   3306  H  HB2  . LEU B 2 14 ? 49.610 -3.852  1.939   1.00 0.00  ? 157 LEU B HB2  2  
ATOM   3307  H  HB3  . LEU B 2 14 ? 49.768 -5.252  3.000   1.00 0.00  ? 157 LEU B HB3  2  
ATOM   3308  H  HG   . LEU B 2 14 ? 49.381 -6.682  0.898   1.00 0.00  ? 157 LEU B HG   2  
ATOM   3309  H  HD11 . LEU B 2 14 ? 48.533 -4.784  -0.486  1.00 0.00  ? 157 LEU B HD11 2  
ATOM   3310  H  HD12 . LEU B 2 14 ? 49.898 -5.613  -1.235  1.00 0.00  ? 157 LEU B HD12 2  
ATOM   3311  H  HD13 . LEU B 2 14 ? 50.142 -4.063  -0.429  1.00 0.00  ? 157 LEU B HD13 2  
ATOM   3312  H  HD21 . LEU B 2 14 ? 51.743 -6.557  0.279   1.00 0.00  ? 157 LEU B HD21 2  
ATOM   3313  H  HD22 . LEU B 2 14 ? 51.586 -6.370  2.024   1.00 0.00  ? 157 LEU B HD22 2  
ATOM   3314  H  HD23 . LEU B 2 14 ? 51.876 -4.959  1.009   1.00 0.00  ? 157 LEU B HD23 2  
ATOM   3315  N  N    . LEU B 2 15 ? 47.677 -5.252  4.564   1.00 0.00  ? 158 LEU B N    2  
ATOM   3316  C  CA   . LEU B 2 15 ? 47.279 -5.946  5.827   1.00 0.00  ? 158 LEU B CA   2  
ATOM   3317  C  C    . LEU B 2 15 ? 45.882 -5.477  6.264   1.00 0.00  ? 158 LEU B C    2  
ATOM   3318  O  O    . LEU B 2 15 ? 45.720 -4.821  7.277   1.00 0.00  ? 158 LEU B O    2  
ATOM   3319  C  CB   . LEU B 2 15 ? 48.344 -5.550  6.857   1.00 0.00  ? 158 LEU B CB   2  
ATOM   3320  C  CG   . LEU B 2 15 ? 49.530 -6.515  6.763   1.00 0.00  ? 158 LEU B CG   2  
ATOM   3321  C  CD1  . LEU B 2 15 ? 50.814 -5.793  7.176   1.00 0.00  ? 158 LEU B CD1  2  
ATOM   3322  C  CD2  . LEU B 2 15 ? 49.293 -7.706  7.697   1.00 0.00  ? 158 LEU B CD2  2  
ATOM   3323  H  H    . LEU B 2 15 ? 48.157 -4.398  4.606   1.00 0.00  ? 158 LEU B H    2  
ATOM   3324  H  HA   . LEU B 2 15 ? 47.286 -7.015  5.685   1.00 0.00  ? 158 LEU B HA   2  
ATOM   3325  H  HB2  . LEU B 2 15 ? 48.681 -4.543  6.659   1.00 0.00  ? 158 LEU B HB2  2  
ATOM   3326  H  HB3  . LEU B 2 15 ? 47.922 -5.600  7.850   1.00 0.00  ? 158 LEU B HB3  2  
ATOM   3327  H  HG   . LEU B 2 15 ? 49.627 -6.867  5.746   1.00 0.00  ? 158 LEU B HG   2  
ATOM   3328  H  HD11 . LEU B 2 15 ? 51.632 -6.498  7.197   1.00 0.00  ? 158 LEU B HD11 2  
ATOM   3329  H  HD12 . LEU B 2 15 ? 50.684 -5.361  8.158   1.00 0.00  ? 158 LEU B HD12 2  
ATOM   3330  H  HD13 . LEU B 2 15 ? 51.032 -5.010  6.464   1.00 0.00  ? 158 LEU B HD13 2  
ATOM   3331  H  HD21 . LEU B 2 15 ? 50.091 -7.761  8.421   1.00 0.00  ? 158 LEU B HD21 2  
ATOM   3332  H  HD22 . LEU B 2 15 ? 49.267 -8.618  7.118   1.00 0.00  ? 158 LEU B HD22 2  
ATOM   3333  H  HD23 . LEU B 2 15 ? 48.351 -7.579  8.209   1.00 0.00  ? 158 LEU B HD23 2  
ATOM   3334  N  N    . GLY B 2 16 ? 44.871 -5.813  5.501   1.00 0.00  ? 159 GLY B N    2  
ATOM   3335  C  CA   . GLY B 2 16 ? 43.482 -5.394  5.860   1.00 0.00  ? 159 GLY B CA   2  
ATOM   3336  C  C    . GLY B 2 16 ? 42.466 -6.251  5.104   1.00 0.00  ? 159 GLY B C    2  
ATOM   3337  O  O    . GLY B 2 16 ? 41.693 -6.978  5.698   1.00 0.00  ? 159 GLY B O    2  
ATOM   3338  H  H    . GLY B 2 16 ? 45.028 -6.343  4.690   1.00 0.00  ? 159 GLY B H    2  
ATOM   3339  H  HA2  . GLY B 2 16 ? 43.334 -5.518  6.922   1.00 0.00  ? 159 GLY B HA2  2  
ATOM   3340  H  HA3  . GLY B 2 16 ? 43.339 -4.358  5.594   1.00 0.00  ? 159 GLY B HA3  2  
ATOM   3341  N  N    . ALA B 2 17 ? 42.460 -6.168  3.797   1.00 0.00  ? 160 ALA B N    2  
ATOM   3342  C  CA   . ALA B 2 17 ? 41.489 -6.975  2.995   1.00 0.00  ? 160 ALA B CA   2  
ATOM   3343  C  C    . ALA B 2 17 ? 41.830 -8.470  3.086   1.00 0.00  ? 160 ALA B C    2  
ATOM   3344  O  O    . ALA B 2 17 ? 42.760 -8.939  2.459   1.00 0.00  ? 160 ALA B O    2  
ATOM   3345  C  CB   . ALA B 2 17 ? 41.642 -6.467  1.558   1.00 0.00  ? 160 ALA B CB   2  
ATOM   3346  H  H    . ALA B 2 17 ? 43.092 -5.571  3.343   1.00 0.00  ? 160 ALA B H    2  
ATOM   3347  H  HA   . ALA B 2 17 ? 40.482 -6.800  3.340   1.00 0.00  ? 160 ALA B HA   2  
ATOM   3348  H  HB1  . ALA B 2 17 ? 41.385 -5.418  1.518   1.00 0.00  ? 160 ALA B HB1  2  
ATOM   3349  H  HB2  . ALA B 2 17 ? 40.984 -7.023  0.906   1.00 0.00  ? 160 ALA B HB2  2  
ATOM   3350  H  HB3  . ALA B 2 17 ? 42.664 -6.600  1.236   1.00 0.00  ? 160 ALA B HB3  2  
ATOM   3351  N  N    . ARG B 2 18 ? 41.072 -9.210  3.872   1.00 0.00  ? 161 ARG B N    2  
ATOM   3352  C  CA   . ARG B 2 18 ? 41.302 -10.692 4.046   1.00 0.00  ? 161 ARG B CA   2  
ATOM   3353  C  C    . ARG B 2 18 ? 42.594 -10.979 4.832   1.00 0.00  ? 161 ARG B C    2  
ATOM   3354  O  O    . ARG B 2 18 ? 42.572 -11.683 5.824   1.00 0.00  ? 161 ARG B O    2  
ATOM   3355  C  CB   . ARG B 2 18 ? 41.380 -11.296 2.635   1.00 0.00  ? 161 ARG B CB   2  
ATOM   3356  C  CG   . ARG B 2 18 ? 40.117 -10.945 1.842   1.00 0.00  ? 161 ARG B CG   2  
ATOM   3357  C  CD   . ARG B 2 18 ? 40.500 -10.573 0.407   1.00 0.00  ? 161 ARG B CD   2  
ATOM   3358  N  NE   . ARG B 2 18 ? 39.516 -9.528  0.006   1.00 0.00  ? 161 ARG B NE   2  
ATOM   3359  C  CZ   . ARG B 2 18 ? 38.451 -9.856  -0.667  1.00 0.00  ? 161 ARG B CZ   2  
ATOM   3360  N  NH1  . ARG B 2 18 ? 37.408 -10.327 -0.045  1.00 0.00  ? 161 ARG B NH1  2  
ATOM   3361  N  NH2  . ARG B 2 18 ? 38.433 -9.720  -1.962  1.00 0.00  ? 161 ARG B NH2  2  
ATOM   3362  H  H    . ARG B 2 18 ? 40.336 -8.786  4.359   1.00 0.00  ? 161 ARG B H    2  
ATOM   3363  H  HA   . ARG B 2 18 ? 40.463 -11.125 4.570   1.00 0.00  ? 161 ARG B HA   2  
ATOM   3364  H  HB2  . ARG B 2 18 ? 42.248 -10.909 2.123   1.00 0.00  ? 161 ARG B HB2  2  
ATOM   3365  H  HB3  . ARG B 2 18 ? 41.463 -12.369 2.713   1.00 0.00  ? 161 ARG B HB3  2  
ATOM   3366  H  HG2  . ARG B 2 18 ? 39.453 -11.797 1.828   1.00 0.00  ? 161 ARG B HG2  2  
ATOM   3367  H  HG3  . ARG B 2 18 ? 39.617 -10.108 2.307   1.00 0.00  ? 161 ARG B HG3  2  
ATOM   3368  H  HD2  . ARG B 2 18 ? 41.507 -10.177 0.380   1.00 0.00  ? 161 ARG B HD2  2  
ATOM   3369  H  HD3  . ARG B 2 18 ? 40.415 -11.432 -0.240  1.00 0.00  ? 161 ARG B HD3  2  
ATOM   3370  H  HE   . ARG B 2 18 ? 39.673 -8.591  0.245   1.00 0.00  ? 161 ARG B HE   2  
ATOM   3371  H  HH11 . ARG B 2 18 ? 37.428 -10.439 0.948   1.00 0.00  ? 161 ARG B HH11 2  
ATOM   3372  H  HH12 . ARG B 2 18 ? 36.588 -10.576 -0.559  1.00 0.00  ? 161 ARG B HH12 2  
ATOM   3373  H  HH21 . ARG B 2 18 ? 39.238 -9.366  -2.438  1.00 0.00  ? 161 ARG B HH21 2  
ATOM   3374  H  HH22 . ARG B 2 18 ? 37.616 -9.967  -2.481  1.00 0.00  ? 161 ARG B HH22 2  
ATOM   3375  N  N    . ALA B 2 19 ? 43.714 -10.453 4.402   1.00 0.00  ? 162 ALA B N    2  
ATOM   3376  C  CA   . ALA B 2 19 ? 44.995 -10.709 5.127   1.00 0.00  ? 162 ALA B CA   2  
ATOM   3377  C  C    . ALA B 2 19 ? 45.353 -9.506  6.005   1.00 0.00  ? 162 ALA B C    2  
ATOM   3378  O  O    . ALA B 2 19 ? 45.613 -8.428  5.512   1.00 0.00  ? 162 ALA B O    2  
ATOM   3379  C  CB   . ALA B 2 19 ? 46.040 -10.906 4.024   1.00 0.00  ? 162 ALA B CB   2  
ATOM   3380  H  H    . ALA B 2 19 ? 43.714 -9.889  3.600   1.00 0.00  ? 162 ALA B H    2  
ATOM   3381  H  HA   . ALA B 2 19 ? 44.919 -11.603 5.725   1.00 0.00  ? 162 ALA B HA   2  
ATOM   3382  H  HB1  . ALA B 2 19 ? 46.910 -10.303 4.239   1.00 0.00  ? 162 ALA B HB1  2  
ATOM   3383  H  HB2  . ALA B 2 19 ? 45.621 -10.606 3.074   1.00 0.00  ? 162 ALA B HB2  2  
ATOM   3384  H  HB3  . ALA B 2 19 ? 46.325 -11.947 3.979   1.00 0.00  ? 162 ALA B HB3  2  
ATOM   3385  N  N    . LYS B 2 20 ? 45.366 -9.683  7.301   1.00 0.00  ? 163 LYS B N    2  
ATOM   3386  C  CA   . LYS B 2 20 ? 45.705 -8.546  8.212   1.00 0.00  ? 163 LYS B CA   2  
ATOM   3387  C  C    . LYS B 2 20 ? 46.338 -9.057  9.517   1.00 0.00  ? 163 LYS B C    2  
ATOM   3388  O  O    . LYS B 2 20 ? 47.052 -8.291  10.142  1.00 0.00  ? 163 LYS B O    2  
ATOM   3389  C  CB   . LYS B 2 20 ? 44.369 -7.839  8.485   1.00 0.00  ? 163 LYS B CB   2  
ATOM   3390  C  CG   . LYS B 2 20 ? 43.369 -8.813  9.125   1.00 0.00  ? 163 LYS B CG   2  
ATOM   3391  C  CD   . LYS B 2 20 ? 42.842 -8.229  10.443  1.00 0.00  ? 163 LYS B CD   2  
ATOM   3392  C  CE   . LYS B 2 20 ? 43.986 -8.103  11.458  1.00 0.00  ? 163 LYS B CE   2  
ATOM   3393  N  NZ   . LYS B 2 20 ? 44.229 -9.489  11.955  1.00 0.00  ? 163 LYS B NZ   2  
ATOM   3394  O  OXT  . LYS B 2 20 ? 46.095 -10.201 9.872   1.00 0.00  ? 163 LYS B OXT  2  
ATOM   3395  H  H    . LYS B 2 20 ? 45.151 -10.562 7.677   1.00 0.00  ? 163 LYS B H    2  
ATOM   3396  H  HA   . LYS B 2 20 ? 46.380 -7.865  7.717   1.00 0.00  ? 163 LYS B HA   2  
ATOM   3397  H  HB2  . LYS B 2 20 ? 44.537 -7.005  9.151   1.00 0.00  ? 163 LYS B HB2  2  
ATOM   3398  H  HB3  . LYS B 2 20 ? 43.963 -7.474  7.553   1.00 0.00  ? 163 LYS B HB3  2  
ATOM   3399  H  HG2  . LYS B 2 20 ? 42.541 -8.970  8.447   1.00 0.00  ? 163 LYS B HG2  2  
ATOM   3400  H  HG3  . LYS B 2 20 ? 43.855 -9.757  9.320   1.00 0.00  ? 163 LYS B HG3  2  
ATOM   3401  H  HD2  . LYS B 2 20 ? 42.420 -7.252  10.257  1.00 0.00  ? 163 LYS B HD2  2  
ATOM   3402  H  HD3  . LYS B 2 20 ? 42.079 -8.878  10.844  1.00 0.00  ? 163 LYS B HD3  2  
ATOM   3403  H  HE2  . LYS B 2 20 ? 44.872 -7.714  10.975  1.00 0.00  ? 163 LYS B HE2  2  
ATOM   3404  H  HE3  . LYS B 2 20 ? 43.692 -7.463  12.276  1.00 0.00  ? 163 LYS B HE3  2  
ATOM   3405  H  HZ1  . LYS B 2 20 ? 43.323 -9.947  12.178  1.00 0.00  ? 163 LYS B HZ1  2  
ATOM   3406  H  HZ2  . LYS B 2 20 ? 44.819 -9.449  12.811  1.00 0.00  ? 163 LYS B HZ2  2  
ATOM   3407  H  HZ3  . LYS B 2 20 ? 44.724 -10.038 11.221  1.00 0.00  ? 163 LYS B HZ3  2  
HETATM 3408  CA CA   . CA  C 3 .  ? 69.357 -3.310  -2.198  1.00 0.00  ? 90  CA  A CA   2  
HETATM 3409  O  OAA  . SXK D 4 .  ? 59.557 11.326  -0.774  1.00 20.00 ? 91  SXK A OAA  2  
HETATM 3410  O  OAB  . SXK D 4 .  ? 59.567 12.116  -2.849  1.00 20.00 ? 91  SXK A OAB  2  
HETATM 3411  C  CAE  . SXK D 4 .  ? 56.190 1.749   -0.362  1.00 20.00 ? 91  SXK A CAE  2  
HETATM 3412  C  CAF  . SXK D 4 .  ? 56.872 7.257   -2.600  1.00 20.00 ? 91  SXK A CAF  2  
HETATM 3413  C  CAG  . SXK D 4 .  ? 58.362 7.121   -0.638  1.00 20.00 ? 91  SXK A CAG  2  
HETATM 3414  C  CAH  . SXK D 4 .  ? 56.665 5.861   -2.545  1.00 20.00 ? 91  SXK A CAH  2  
HETATM 3415  C  CAI  . SXK D 4 .  ? 58.160 5.725   -0.577  1.00 20.00 ? 91  SXK A CAI  2  
HETATM 3416  C  CAJ  . SXK D 4 .  ? 56.392 3.151   -0.403  1.00 20.00 ? 91  SXK A CAJ  2  
HETATM 3417  C  CAK  . SXK D 4 .  ? 57.411 1.476   -2.462  1.00 20.00 ? 91  SXK A CAK  2  
HETATM 3418  C  CAL  . SXK D 4 .  ? 58.926 9.849   -2.564  1.00 20.00 ? 91  SXK A CAL  2  
HETATM 3419  O  OAM  . SXK D 4 .  ? 57.846 9.243   -1.812  1.00 20.00 ? 91  SXK A OAM  2  
HETATM 3420  C  CAN  . SXK D 4 .  ? 59.387 11.208  -2.014  1.00 20.00 ? 91  SXK A CAN  2  
HETATM 3421  C  CAO  . SXK D 4 .  ? 56.700 0.934   -1.389  1.00 20.00 ? 91  SXK A CAO  2  
HETATM 3422  C  CAP  . SXK D 4 .  ? 57.721 7.885   -1.643  1.00 20.00 ? 91  SXK A CAP  2  
HETATM 3423  C  CAQ  . SXK D 4 .  ? 57.619 2.874   -2.514  1.00 20.00 ? 91  SXK A CAQ  2  
HETATM 3424  C  CAR  . SXK D 4 .  ? 57.311 5.095   -1.532  1.00 20.00 ? 91  SXK A CAR  2  
HETATM 3425  C  CAS  . SXK D 4 .  ? 57.106 3.706   -1.481  1.00 20.00 ? 91  SXK A CAS  2  
HETATM 3426  F  FCC  . SXK D 4 .  ? 56.497 -0.410  -1.332  1.00 20.00 ? 91  SXK A FCC  2  
HETATM 3427  F  FDD  . SXK D 4 .  ? 58.317 3.379   -3.575  1.00 20.00 ? 91  SXK A FDD  2  
HETATM 3428  H  HAE  . SXK D 4 .  ? 55.639 1.299   0.464   1.00 20.00 ? 91  SXK A HAE  2  
HETATM 3429  H  HAF  . SXK D 4 .  ? 56.384 7.857   -3.374  1.00 20.00 ? 91  SXK A HAF  2  
HETATM 3430  H  HAG  . SXK D 4 .  ? 59.015 7.592   0.097   1.00 20.00 ? 91  SXK A HAG  2  
HETATM 3431  H  HAH  . SXK D 4 .  ? 56.016 5.377   -3.274  1.00 20.00 ? 91  SXK A HAH  2  
HETATM 3432  H  HAI  . SXK D 4 .  ? 58.652 5.138   0.200   1.00 20.00 ? 91  SXK A HAI  2  
HETATM 3433  H  HAJ  . SXK D 4 .  ? 55.997 3.782   0.393   1.00 20.00 ? 91  SXK A HAJ  2  
HETATM 3434  H  HAK  . SXK D 4 .  ? 57.804 0.834   -3.256  1.00 20.00 ? 91  SXK A HAK  2  
HETATM 3435  H  HAL  . SXK D 4 .  ? 59.788 9.174   -2.552  1.00 20.00 ? 91  SXK A HAL  2  
HETATM 3436  H  HALA . SXK D 4 .  ? 58.562 10.035  -3.571  1.00 20.00 ? 91  SXK A HALA 2  
ATOM   3437  N  N    . MET A 1 1  ? 71.878 7.728   1.327   1.00 0.00  ? 1   MET A N    3  
ATOM   3438  C  CA   . MET A 1 1  ? 71.727 9.207   1.483   1.00 0.00  ? 1   MET A CA   3  
ATOM   3439  C  C    . MET A 1 1  ? 70.459 9.529   2.291   1.00 0.00  ? 1   MET A C    3  
ATOM   3440  O  O    . MET A 1 1  ? 69.383 9.680   1.743   1.00 0.00  ? 1   MET A O    3  
ATOM   3441  C  CB   . MET A 1 1  ? 71.620 9.751   0.051   1.00 0.00  ? 1   MET A CB   3  
ATOM   3442  C  CG   . MET A 1 1  ? 72.056 11.220  0.021   1.00 0.00  ? 1   MET A CG   3  
ATOM   3443  S  SD   . MET A 1 1  ? 73.844 11.324  0.287   1.00 0.00  ? 1   MET A SD   3  
ATOM   3444  C  CE   . MET A 1 1  ? 73.983 13.128  0.259   1.00 0.00  ? 1   MET A CE   3  
ATOM   3445  H  H1   . MET A 1 1  ? 71.090 7.355   0.760   1.00 0.00  ? 1   MET A H1   3  
ATOM   3446  H  H2   . MET A 1 1  ? 71.873 7.279   2.266   1.00 0.00  ? 1   MET A H2   3  
ATOM   3447  H  H3   . MET A 1 1  ? 72.777 7.519   0.847   1.00 0.00  ? 1   MET A H3   3  
ATOM   3448  H  HA   . MET A 1 1  ? 72.596 9.622   1.969   1.00 0.00  ? 1   MET A HA   3  
ATOM   3449  H  HB2  . MET A 1 1  ? 72.260 9.173   -0.601  1.00 0.00  ? 1   MET A HB2  3  
ATOM   3450  H  HB3  . MET A 1 1  ? 70.598 9.673   -0.290  1.00 0.00  ? 1   MET A HB3  3  
ATOM   3451  H  HG2  . MET A 1 1  ? 71.810 11.649  -0.940  1.00 0.00  ? 1   MET A HG2  3  
ATOM   3452  H  HG3  . MET A 1 1  ? 71.544 11.765  0.800   1.00 0.00  ? 1   MET A HG3  3  
ATOM   3453  H  HE1  . MET A 1 1  ? 75.006 13.412  0.470   1.00 0.00  ? 1   MET A HE1  3  
ATOM   3454  H  HE2  . MET A 1 1  ? 73.333 13.554  1.006   1.00 0.00  ? 1   MET A HE2  3  
ATOM   3455  H  HE3  . MET A 1 1  ? 73.697 13.496  -0.717  1.00 0.00  ? 1   MET A HE3  3  
ATOM   3456  N  N    . ASP A 1 2  ? 70.585 9.632   3.593   1.00 0.00  ? 2   ASP A N    3  
ATOM   3457  C  CA   . ASP A 1 2  ? 69.397 9.942   4.455   1.00 0.00  ? 2   ASP A CA   3  
ATOM   3458  C  C    . ASP A 1 2  ? 69.849 10.228  5.898   1.00 0.00  ? 2   ASP A C    3  
ATOM   3459  O  O    . ASP A 1 2  ? 69.422 11.193  6.500   1.00 0.00  ? 2   ASP A O    3  
ATOM   3460  C  CB   . ASP A 1 2  ? 68.495 8.696   4.384   1.00 0.00  ? 2   ASP A CB   3  
ATOM   3461  C  CG   . ASP A 1 2  ? 69.197 7.481   4.996   1.00 0.00  ? 2   ASP A CG   3  
ATOM   3462  O  OD1  . ASP A 1 2  ? 70.083 6.941   4.354   1.00 0.00  ? 2   ASP A OD1  3  
ATOM   3463  O  OD2  . ASP A 1 2  ? 68.838 7.116   6.104   1.00 0.00  ? 2   ASP A OD2  3  
ATOM   3464  H  H    . ASP A 1 2  ? 71.465 9.506   4.007   1.00 0.00  ? 2   ASP A H    3  
ATOM   3465  H  HA   . ASP A 1 2  ? 68.869 10.796  4.060   1.00 0.00  ? 2   ASP A HA   3  
ATOM   3466  H  HB2  . ASP A 1 2  ? 67.583 8.888   4.926   1.00 0.00  ? 2   ASP A HB2  3  
ATOM   3467  H  HB3  . ASP A 1 2  ? 68.258 8.486   3.352   1.00 0.00  ? 2   ASP A HB3  3  
ATOM   3468  N  N    . ASP A 1 3  ? 70.724 9.401   6.436   1.00 0.00  ? 3   ASP A N    3  
ATOM   3469  C  CA   . ASP A 1 3  ? 71.253 9.597   7.827   1.00 0.00  ? 3   ASP A CA   3  
ATOM   3470  C  C    . ASP A 1 3  ? 70.125 9.695   8.879   1.00 0.00  ? 3   ASP A C    3  
ATOM   3471  O  O    . ASP A 1 3  ? 69.811 8.725   9.543   1.00 0.00  ? 3   ASP A O    3  
ATOM   3472  C  CB   . ASP A 1 3  ? 72.068 10.896  7.758   1.00 0.00  ? 3   ASP A CB   3  
ATOM   3473  C  CG   . ASP A 1 3  ? 73.331 10.662  6.925   1.00 0.00  ? 3   ASP A CG   3  
ATOM   3474  O  OD1  . ASP A 1 3  ? 74.311 10.204  7.489   1.00 0.00  ? 3   ASP A OD1  3  
ATOM   3475  O  OD2  . ASP A 1 3  ? 73.295 10.942  5.738   1.00 0.00  ? 3   ASP A OD2  3  
ATOM   3476  H  H    . ASP A 1 3  ? 71.055 8.646   5.907   1.00 0.00  ? 3   ASP A H    3  
ATOM   3477  H  HA   . ASP A 1 3  ? 71.911 8.781   8.080   1.00 0.00  ? 3   ASP A HA   3  
ATOM   3478  H  HB2  . ASP A 1 3  ? 71.475 11.672  7.298   1.00 0.00  ? 3   ASP A HB2  3  
ATOM   3479  H  HB3  . ASP A 1 3  ? 72.349 11.198  8.754   1.00 0.00  ? 3   ASP A HB3  3  
ATOM   3480  N  N    . ILE A 1 4  ? 69.536 10.859  9.047   1.00 0.00  ? 4   ILE A N    3  
ATOM   3481  C  CA   . ILE A 1 4  ? 68.445 11.042  10.066  1.00 0.00  ? 4   ILE A CA   3  
ATOM   3482  C  C    . ILE A 1 4  ? 67.339 9.979   9.921   1.00 0.00  ? 4   ILE A C    3  
ATOM   3483  O  O    . ILE A 1 4  ? 66.785 9.522   10.904  1.00 0.00  ? 4   ILE A O    3  
ATOM   3484  C  CB   . ILE A 1 4  ? 67.885 12.450  9.796   1.00 0.00  ? 4   ILE A CB   3  
ATOM   3485  C  CG1  . ILE A 1 4  ? 68.902 13.503  10.254  1.00 0.00  ? 4   ILE A CG1  3  
ATOM   3486  C  CG2  . ILE A 1 4  ? 66.576 12.647  10.569  1.00 0.00  ? 4   ILE A CG2  3  
ATOM   3487  C  CD1  . ILE A 1 4  ? 68.613 14.836  9.556   1.00 0.00  ? 4   ILE A CD1  3  
ATOM   3488  H  H    . ILE A 1 4  ? 69.822 11.624  8.506   1.00 0.00  ? 4   ILE A H    3  
ATOM   3489  H  HA   . ILE A 1 4  ? 68.860 11.005  11.061  1.00 0.00  ? 4   ILE A HA   3  
ATOM   3490  H  HB   . ILE A 1 4  ? 67.698 12.565  8.738   1.00 0.00  ? 4   ILE A HB   3  
ATOM   3491  H  HG12 . ILE A 1 4  ? 68.825 13.633  11.324  1.00 0.00  ? 4   ILE A HG12 3  
ATOM   3492  H  HG13 . ILE A 1 4  ? 69.900 13.176  10.003  1.00 0.00  ? 4   ILE A HG13 3  
ATOM   3493  H  HG21 . ILE A 1 4  ? 66.397 13.703  10.710  1.00 0.00  ? 4   ILE A HG21 3  
ATOM   3494  H  HG22 . ILE A 1 4  ? 66.648 12.164  11.533  1.00 0.00  ? 4   ILE A HG22 3  
ATOM   3495  H  HG23 . ILE A 1 4  ? 65.760 12.216  10.009  1.00 0.00  ? 4   ILE A HG23 3  
ATOM   3496  H  HD11 . ILE A 1 4  ? 67.787 15.329  10.048  1.00 0.00  ? 4   ILE A HD11 3  
ATOM   3497  H  HD12 . ILE A 1 4  ? 68.359 14.655  8.522   1.00 0.00  ? 4   ILE A HD12 3  
ATOM   3498  H  HD13 . ILE A 1 4  ? 69.488 15.466  9.606   1.00 0.00  ? 4   ILE A HD13 3  
ATOM   3499  N  N    . TYR A 1 5  ? 67.006 9.588   8.713   1.00 0.00  ? 5   TYR A N    3  
ATOM   3500  C  CA   . TYR A 1 5  ? 65.925 8.562   8.527   1.00 0.00  ? 5   TYR A CA   3  
ATOM   3501  C  C    . TYR A 1 5  ? 66.290 7.237   9.216   1.00 0.00  ? 5   TYR A C    3  
ATOM   3502  O  O    . TYR A 1 5  ? 65.425 6.540   9.711   1.00 0.00  ? 5   TYR A O    3  
ATOM   3503  C  CB   . TYR A 1 5  ? 65.793 8.380   7.014   1.00 0.00  ? 5   TYR A CB   3  
ATOM   3504  C  CG   . TYR A 1 5  ? 64.966 9.515   6.455   1.00 0.00  ? 5   TYR A CG   3  
ATOM   3505  C  CD1  . TYR A 1 5  ? 63.625 9.661   6.837   1.00 0.00  ? 5   TYR A CD1  3  
ATOM   3506  C  CD2  . TYR A 1 5  ? 65.539 10.423  5.558   1.00 0.00  ? 5   TYR A CD2  3  
ATOM   3507  C  CE1  . TYR A 1 5  ? 62.862 10.716  6.324   1.00 0.00  ? 5   TYR A CE1  3  
ATOM   3508  C  CE2  . TYR A 1 5  ? 64.775 11.477  5.044   1.00 0.00  ? 5   TYR A CE2  3  
ATOM   3509  C  CZ   . TYR A 1 5  ? 63.436 11.623  5.427   1.00 0.00  ? 5   TYR A CZ   3  
ATOM   3510  O  OH   . TYR A 1 5  ? 62.686 12.663  4.922   1.00 0.00  ? 5   TYR A OH   3  
ATOM   3511  H  H    . TYR A 1 5  ? 67.458 9.971   7.933   1.00 0.00  ? 5   TYR A H    3  
ATOM   3512  H  HA   . TYR A 1 5  ? 64.995 8.935   8.927   1.00 0.00  ? 5   TYR A HA   3  
ATOM   3513  H  HB2  . TYR A 1 5  ? 66.773 8.388   6.562   1.00 0.00  ? 5   TYR A HB2  3  
ATOM   3514  H  HB3  . TYR A 1 5  ? 65.304 7.441   6.802   1.00 0.00  ? 5   TYR A HB3  3  
ATOM   3515  H  HD1  . TYR A 1 5  ? 63.181 8.961   7.530   1.00 0.00  ? 5   TYR A HD1  3  
ATOM   3516  H  HD2  . TYR A 1 5  ? 66.572 10.312  5.264   1.00 0.00  ? 5   TYR A HD2  3  
ATOM   3517  H  HE1  . TYR A 1 5  ? 61.829 10.830  6.619   1.00 0.00  ? 5   TYR A HE1  3  
ATOM   3518  H  HE2  . TYR A 1 5  ? 65.218 12.177  4.352   1.00 0.00  ? 5   TYR A HE2  3  
ATOM   3519  H  HH   . TYR A 1 5  ? 62.926 13.461  5.401   1.00 0.00  ? 5   TYR A HH   3  
ATOM   3520  N  N    . LYS A 1 6  ? 67.555 6.890   9.271   1.00 0.00  ? 6   LYS A N    3  
ATOM   3521  C  CA   . LYS A 1 6  ? 67.950 5.619   9.958   1.00 0.00  ? 6   LYS A CA   3  
ATOM   3522  C  C    . LYS A 1 6  ? 67.577 5.696   11.446  1.00 0.00  ? 6   LYS A C    3  
ATOM   3523  O  O    . LYS A 1 6  ? 67.119 4.730   12.027  1.00 0.00  ? 6   LYS A O    3  
ATOM   3524  C  CB   . LYS A 1 6  ? 69.470 5.516   9.784   1.00 0.00  ? 6   LYS A CB   3  
ATOM   3525  C  CG   . LYS A 1 6  ? 69.821 4.178   9.128   1.00 0.00  ? 6   LYS A CG   3  
ATOM   3526  C  CD   . LYS A 1 6  ? 69.426 4.215   7.647   1.00 0.00  ? 6   LYS A CD   3  
ATOM   3527  C  CE   . LYS A 1 6  ? 70.663 4.468   6.778   1.00 0.00  ? 6   LYS A CE   3  
ATOM   3528  N  NZ   . LYS A 1 6  ? 71.118 5.846   7.123   1.00 0.00  ? 6   LYS A NZ   3  
ATOM   3529  H  H    . LYS A 1 6  ? 68.241 7.467   8.874   1.00 0.00  ? 6   LYS A H    3  
ATOM   3530  H  HA   . LYS A 1 6  ? 67.465 4.773   9.494   1.00 0.00  ? 6   LYS A HA   3  
ATOM   3531  H  HB2  . LYS A 1 6  ? 69.817 6.326   9.159   1.00 0.00  ? 6   LYS A HB2  3  
ATOM   3532  H  HB3  . LYS A 1 6  ? 69.949 5.577   10.750  1.00 0.00  ? 6   LYS A HB3  3  
ATOM   3533  H  HG2  . LYS A 1 6  ? 70.883 4.001   9.216   1.00 0.00  ? 6   LYS A HG2  3  
ATOM   3534  H  HG3  . LYS A 1 6  ? 69.282 3.383   9.622   1.00 0.00  ? 6   LYS A HG3  3  
ATOM   3535  H  HD2  . LYS A 1 6  ? 68.982 3.270   7.371   1.00 0.00  ? 6   LYS A HD2  3  
ATOM   3536  H  HD3  . LYS A 1 6  ? 68.710 5.008   7.485   1.00 0.00  ? 6   LYS A HD3  3  
ATOM   3537  H  HE2  . LYS A 1 6  ? 71.435 3.745   7.004   1.00 0.00  ? 6   LYS A HE2  3  
ATOM   3538  H  HE3  . LYS A 1 6  ? 70.397 4.422   5.734   1.00 0.00  ? 6   LYS A HE3  3  
ATOM   3539  H  HZ1  . LYS A 1 6  ? 71.552 5.846   8.067   1.00 0.00  ? 6   LYS A HZ1  3  
ATOM   3540  H  HZ2  . LYS A 1 6  ? 70.300 6.492   7.114   1.00 0.00  ? 6   LYS A HZ2  3  
ATOM   3541  H  HZ3  . LYS A 1 6  ? 71.815 6.165   6.423   1.00 0.00  ? 6   LYS A HZ3  3  
ATOM   3542  N  N    . ALA A 1 7  ? 67.754 6.845   12.057  1.00 0.00  ? 7   ALA A N    3  
ATOM   3543  C  CA   . ALA A 1 7  ? 67.395 7.002   13.502  1.00 0.00  ? 7   ALA A CA   3  
ATOM   3544  C  C    . ALA A 1 7  ? 65.901 6.714   13.713  1.00 0.00  ? 7   ALA A C    3  
ATOM   3545  O  O    . ALA A 1 7  ? 65.513 6.107   14.691  1.00 0.00  ? 7   ALA A O    3  
ATOM   3546  C  CB   . ALA A 1 7  ? 67.713 8.461   13.836  1.00 0.00  ? 7   ALA A CB   3  
ATOM   3547  H  H    . ALA A 1 7  ? 68.113 7.610   11.560  1.00 0.00  ? 7   ALA A H    3  
ATOM   3548  H  HA   . ALA A 1 7  ? 67.994 6.346   14.114  1.00 0.00  ? 7   ALA A HA   3  
ATOM   3549  H  HB1  . ALA A 1 7  ? 67.081 9.111   13.248  1.00 0.00  ? 7   ALA A HB1  3  
ATOM   3550  H  HB2  . ALA A 1 7  ? 68.750 8.664   13.608  1.00 0.00  ? 7   ALA A HB2  3  
ATOM   3551  H  HB3  . ALA A 1 7  ? 67.533 8.637   14.886  1.00 0.00  ? 7   ALA A HB3  3  
ATOM   3552  N  N    . ALA A 1 8  ? 65.064 7.134   12.793  1.00 0.00  ? 8   ALA A N    3  
ATOM   3553  C  CA   . ALA A 1 8  ? 63.596 6.871   12.929  1.00 0.00  ? 8   ALA A CA   3  
ATOM   3554  C  C    . ALA A 1 8  ? 63.327 5.357   12.977  1.00 0.00  ? 8   ALA A C    3  
ATOM   3555  O  O    . ALA A 1 8  ? 62.429 4.902   13.660  1.00 0.00  ? 8   ALA A O    3  
ATOM   3556  C  CB   . ALA A 1 8  ? 62.965 7.492   11.683  1.00 0.00  ? 8   ALA A CB   3  
ATOM   3557  H  H    . ALA A 1 8  ? 65.403 7.614   12.009  1.00 0.00  ? 8   ALA A H    3  
ATOM   3558  H  HA   . ALA A 1 8  ? 63.209 7.351   13.815  1.00 0.00  ? 8   ALA A HA   3  
ATOM   3559  H  HB1  . ALA A 1 8  ? 61.915 7.248   11.653  1.00 0.00  ? 8   ALA A HB1  3  
ATOM   3560  H  HB2  . ALA A 1 8  ? 63.451 7.100   10.802  1.00 0.00  ? 8   ALA A HB2  3  
ATOM   3561  H  HB3  . ALA A 1 8  ? 63.085 8.565   11.714  1.00 0.00  ? 8   ALA A HB3  3  
ATOM   3562  N  N    . VAL A 1 9  ? 64.110 4.576   12.266  1.00 0.00  ? 9   VAL A N    3  
ATOM   3563  C  CA   . VAL A 1 9  ? 63.914 3.089   12.279  1.00 0.00  ? 9   VAL A CA   3  
ATOM   3564  C  C    . VAL A 1 9  ? 64.223 2.537   13.679  1.00 0.00  ? 9   VAL A C    3  
ATOM   3565  O  O    . VAL A 1 9  ? 63.585 1.609   14.138  1.00 0.00  ? 9   VAL A O    3  
ATOM   3566  C  CB   . VAL A 1 9  ? 64.898 2.534   11.240  1.00 0.00  ? 9   VAL A CB   3  
ATOM   3567  C  CG1  . VAL A 1 9  ? 64.854 1.003   11.252  1.00 0.00  ? 9   VAL A CG1  3  
ATOM   3568  C  CG2  . VAL A 1 9  ? 64.508 3.032   9.846   1.00 0.00  ? 9   VAL A CG2  3  
ATOM   3569  H  H    . VAL A 1 9  ? 64.832 4.967   11.731  1.00 0.00  ? 9   VAL A H    3  
ATOM   3570  H  HA   . VAL A 1 9  ? 62.901 2.842   11.996  1.00 0.00  ? 9   VAL A HA   3  
ATOM   3571  H  HB   . VAL A 1 9  ? 65.900 2.868   11.475  1.00 0.00  ? 9   VAL A HB   3  
ATOM   3572  H  HG11 . VAL A 1 9  ? 63.843 0.673   11.440  1.00 0.00  ? 9   VAL A HG11 3  
ATOM   3573  H  HG12 . VAL A 1 9  ? 65.505 0.630   12.028  1.00 0.00  ? 9   VAL A HG12 3  
ATOM   3574  H  HG13 . VAL A 1 9  ? 65.182 0.626   10.295  1.00 0.00  ? 9   VAL A HG13 3  
ATOM   3575  H  HG21 . VAL A 1 9  ? 63.596 2.545   9.533   1.00 0.00  ? 9   VAL A HG21 3  
ATOM   3576  H  HG22 . VAL A 1 9  ? 65.298 2.800   9.149   1.00 0.00  ? 9   VAL A HG22 3  
ATOM   3577  H  HG23 . VAL A 1 9  ? 64.354 4.102   9.874   1.00 0.00  ? 9   VAL A HG23 3  
ATOM   3578  N  N    . GLU A 1 10 ? 65.183 3.113   14.366  1.00 0.00  ? 10  GLU A N    3  
ATOM   3579  C  CA   . GLU A 1 10 ? 65.516 2.636   15.746  1.00 0.00  ? 10  GLU A CA   3  
ATOM   3580  C  C    . GLU A 1 10 ? 64.311 2.844   16.678  1.00 0.00  ? 10  GLU A C    3  
ATOM   3581  O  O    . GLU A 1 10 ? 64.091 2.078   17.595  1.00 0.00  ? 10  GLU A O    3  
ATOM   3582  C  CB   . GLU A 1 10 ? 66.702 3.493   16.198  1.00 0.00  ? 10  GLU A CB   3  
ATOM   3583  C  CG   . GLU A 1 10 ? 67.995 2.922   15.610  1.00 0.00  ? 10  GLU A CG   3  
ATOM   3584  C  CD   . GLU A 1 10 ? 69.136 3.919   15.815  1.00 0.00  ? 10  GLU A CD   3  
ATOM   3585  O  OE1  . GLU A 1 10 ? 69.656 3.977   16.917  1.00 0.00  ? 10  GLU A OE1  3  
ATOM   3586  O  OE2  . GLU A 1 10 ? 69.472 4.606   14.865  1.00 0.00  ? 10  GLU A OE2  3  
ATOM   3587  H  H    . GLU A 1 10 ? 65.675 3.869   13.979  1.00 0.00  ? 10  GLU A H    3  
ATOM   3588  H  HA   . GLU A 1 10 ? 65.800 1.595   15.726  1.00 0.00  ? 10  GLU A HA   3  
ATOM   3589  H  HB2  . GLU A 1 10 ? 66.566 4.508   15.855  1.00 0.00  ? 10  GLU A HB2  3  
ATOM   3590  H  HB3  . GLU A 1 10 ? 66.765 3.482   17.277  1.00 0.00  ? 10  GLU A HB3  3  
ATOM   3591  H  HG2  . GLU A 1 10 ? 68.235 1.991   16.104  1.00 0.00  ? 10  GLU A HG2  3  
ATOM   3592  H  HG3  . GLU A 1 10 ? 67.861 2.745   14.554  1.00 0.00  ? 10  GLU A HG3  3  
ATOM   3593  N  N    . GLN A 1 11 ? 63.523 3.869   16.437  1.00 0.00  ? 11  GLN A N    3  
ATOM   3594  C  CA   . GLN A 1 11 ? 62.320 4.122   17.294  1.00 0.00  ? 11  GLN A CA   3  
ATOM   3595  C  C    . GLN A 1 11 ? 61.283 3.005   17.098  1.00 0.00  ? 11  GLN A C    3  
ATOM   3596  O  O    . GLN A 1 11 ? 60.518 2.699   17.993  1.00 0.00  ? 11  GLN A O    3  
ATOM   3597  C  CB   . GLN A 1 11 ? 61.753 5.464   16.818  1.00 0.00  ? 11  GLN A CB   3  
ATOM   3598  C  CG   . GLN A 1 11 ? 62.322 6.601   17.673  1.00 0.00  ? 11  GLN A CG   3  
ATOM   3599  C  CD   . GLN A 1 11 ? 63.554 7.193   16.987  1.00 0.00  ? 11  GLN A CD   3  
ATOM   3600  O  OE1  . GLN A 1 11 ? 63.438 8.056   16.141  1.00 0.00  ? 11  GLN A OE1  3  
ATOM   3601  N  NE2  . GLN A 1 11 ? 64.739 6.763   17.316  1.00 0.00  ? 11  GLN A NE2  3  
ATOM   3602  H  H    . GLN A 1 11 ? 63.719 4.467   15.685  1.00 0.00  ? 11  GLN A H    3  
ATOM   3603  H  HA   . GLN A 1 11 ? 62.605 4.189   18.332  1.00 0.00  ? 11  GLN A HA   3  
ATOM   3604  H  HB2  . GLN A 1 11 ? 62.021 5.622   15.783  1.00 0.00  ? 11  GLN A HB2  3  
ATOM   3605  H  HB3  . GLN A 1 11 ? 60.677 5.452   16.912  1.00 0.00  ? 11  GLN A HB3  3  
ATOM   3606  H  HG2  . GLN A 1 11 ? 61.574 7.370   17.791  1.00 0.00  ? 11  GLN A HG2  3  
ATOM   3607  H  HG3  . GLN A 1 11 ? 62.602 6.220   18.643  1.00 0.00  ? 11  GLN A HG3  3  
ATOM   3608  H  HE21 . GLN A 1 11 ? 64.837 6.068   17.998  1.00 0.00  ? 11  GLN A HE21 3  
ATOM   3609  H  HE22 . GLN A 1 11 ? 65.532 7.136   16.879  1.00 0.00  ? 11  GLN A HE22 3  
ATOM   3610  N  N    . LEU A 1 12 ? 61.253 2.392   15.938  1.00 0.00  ? 12  LEU A N    3  
ATOM   3611  C  CA   . LEU A 1 12 ? 60.269 1.292   15.695  1.00 0.00  ? 12  LEU A CA   3  
ATOM   3612  C  C    . LEU A 1 12 ? 60.747 0.006   16.382  1.00 0.00  ? 12  LEU A C    3  
ATOM   3613  O  O    . LEU A 1 12 ? 61.583 -0.713  15.866  1.00 0.00  ? 12  LEU A O    3  
ATOM   3614  C  CB   . LEU A 1 12 ? 60.224 1.106   14.172  1.00 0.00  ? 12  LEU A CB   3  
ATOM   3615  C  CG   . LEU A 1 12 ? 59.656 2.361   13.500  1.00 0.00  ? 12  LEU A CG   3  
ATOM   3616  C  CD1  . LEU A 1 12 ? 59.886 2.272   11.991  1.00 0.00  ? 12  LEU A CD1  3  
ATOM   3617  C  CD2  . LEU A 1 12 ? 58.153 2.454   13.779  1.00 0.00  ? 12  LEU A CD2  3  
ATOM   3618  H  H    . LEU A 1 12 ? 61.879 2.652   15.231  1.00 0.00  ? 12  LEU A H    3  
ATOM   3619  H  HA   . LEU A 1 12 ? 59.294 1.572   16.061  1.00 0.00  ? 12  LEU A HA   3  
ATOM   3620  H  HB2  . LEU A 1 12 ? 61.224 0.924   13.806  1.00 0.00  ? 12  LEU A HB2  3  
ATOM   3621  H  HB3  . LEU A 1 12 ? 59.597 0.260   13.935  1.00 0.00  ? 12  LEU A HB3  3  
ATOM   3622  H  HG   . LEU A 1 12 ? 60.153 3.238   13.890  1.00 0.00  ? 12  LEU A HG   3  
ATOM   3623  H  HD11 . LEU A 1 12 ? 59.675 3.229   11.537  1.00 0.00  ? 12  LEU A HD11 3  
ATOM   3624  H  HD12 . LEU A 1 12 ? 59.233 1.521   11.572  1.00 0.00  ? 12  LEU A HD12 3  
ATOM   3625  H  HD13 . LEU A 1 12 ? 60.914 2.002   11.801  1.00 0.00  ? 12  LEU A HD13 3  
ATOM   3626  H  HD21 . LEU A 1 12 ? 57.626 1.749   13.155  1.00 0.00  ? 12  LEU A HD21 3  
ATOM   3627  H  HD22 . LEU A 1 12 ? 57.808 3.454   13.563  1.00 0.00  ? 12  LEU A HD22 3  
ATOM   3628  H  HD23 . LEU A 1 12 ? 57.965 2.226   14.817  1.00 0.00  ? 12  LEU A HD23 3  
ATOM   3629  N  N    . THR A 1 13 ? 60.224 -0.282  17.548  1.00 0.00  ? 13  THR A N    3  
ATOM   3630  C  CA   . THR A 1 13 ? 60.647 -1.516  18.285  1.00 0.00  ? 13  THR A CA   3  
ATOM   3631  C  C    . THR A 1 13 ? 59.988 -2.760  17.688  1.00 0.00  ? 13  THR A C    3  
ATOM   3632  O  O    . THR A 1 13 ? 59.302 -2.690  16.685  1.00 0.00  ? 13  THR A O    3  
ATOM   3633  C  CB   . THR A 1 13 ? 60.194 -1.300  19.736  1.00 0.00  ? 13  THR A CB   3  
ATOM   3634  O  OG1  . THR A 1 13 ? 58.868 -0.789  19.751  1.00 0.00  ? 13  THR A OG1  3  
ATOM   3635  C  CG2  . THR A 1 13 ? 61.127 -0.300  20.417  1.00 0.00  ? 13  THR A CG2  3  
ATOM   3636  H  H    . THR A 1 13 ? 59.557 0.317   17.944  1.00 0.00  ? 13  THR A H    3  
ATOM   3637  H  HA   . THR A 1 13 ? 61.717 -1.626  18.250  1.00 0.00  ? 13  THR A HA   3  
ATOM   3638  H  HB   . THR A 1 13 ? 60.227 -2.238  20.269  1.00 0.00  ? 13  THR A HB   3  
ATOM   3639  H  HG1  . THR A 1 13 ? 58.304 -1.436  20.185  1.00 0.00  ? 13  THR A HG1  3  
ATOM   3640  H  HG21 . THR A 1 13 ? 60.860 0.702   20.118  1.00 0.00  ? 13  THR A HG21 3  
ATOM   3641  H  HG22 . THR A 1 13 ? 62.147 -0.503  20.126  1.00 0.00  ? 13  THR A HG22 3  
ATOM   3642  H  HG23 . THR A 1 13 ? 61.033 -0.392  21.489  1.00 0.00  ? 13  THR A HG23 3  
ATOM   3643  N  N    . GLU A 1 14 ? 60.214 -3.900  18.289  1.00 0.00  ? 14  GLU A N    3  
ATOM   3644  C  CA   . GLU A 1 14 ? 59.629 -5.169  17.756  1.00 0.00  ? 14  GLU A CA   3  
ATOM   3645  C  C    . GLU A 1 14 ? 58.120 -5.026  17.506  1.00 0.00  ? 14  GLU A C    3  
ATOM   3646  O  O    . GLU A 1 14 ? 57.593 -5.569  16.554  1.00 0.00  ? 14  GLU A O    3  
ATOM   3647  C  CB   . GLU A 1 14 ? 59.903 -6.226  18.831  1.00 0.00  ? 14  GLU A CB   3  
ATOM   3648  C  CG   . GLU A 1 14 ? 61.042 -7.143  18.370  1.00 0.00  ? 14  GLU A CG   3  
ATOM   3649  C  CD   . GLU A 1 14 ? 62.349 -6.348  18.287  1.00 0.00  ? 14  GLU A CD   3  
ATOM   3650  O  OE1  . GLU A 1 14 ? 63.034 -6.268  19.293  1.00 0.00  ? 14  GLU A OE1  3  
ATOM   3651  O  OE2  . GLU A 1 14 ? 62.639 -5.832  17.220  1.00 0.00  ? 14  GLU A OE2  3  
ATOM   3652  H  H    . GLU A 1 14 ? 60.785 -3.925  19.086  1.00 0.00  ? 14  GLU A H    3  
ATOM   3653  H  HA   . GLU A 1 14 ? 60.132 -5.439  16.843  1.00 0.00  ? 14  GLU A HA   3  
ATOM   3654  H  HB2  . GLU A 1 14 ? 60.185 -5.739  19.754  1.00 0.00  ? 14  GLU A HB2  3  
ATOM   3655  H  HB3  . GLU A 1 14 ? 59.014 -6.815  18.993  1.00 0.00  ? 14  GLU A HB3  3  
ATOM   3656  H  HG2  . GLU A 1 14 ? 61.158 -7.953  19.075  1.00 0.00  ? 14  GLU A HG2  3  
ATOM   3657  H  HG3  . GLU A 1 14 ? 60.807 -7.546  17.396  1.00 0.00  ? 14  GLU A HG3  3  
ATOM   3658  N  N    . GLU A 1 15 ? 57.428 -4.296  18.345  1.00 0.00  ? 15  GLU A N    3  
ATOM   3659  C  CA   . GLU A 1 15 ? 55.953 -4.109  18.149  1.00 0.00  ? 15  GLU A CA   3  
ATOM   3660  C  C    . GLU A 1 15 ? 55.686 -3.427  16.802  1.00 0.00  ? 15  GLU A C    3  
ATOM   3661  O  O    . GLU A 1 15 ? 54.842 -3.855  16.038  1.00 0.00  ? 15  GLU A O    3  
ATOM   3662  C  CB   . GLU A 1 15 ? 55.500 -3.210  19.306  1.00 0.00  ? 15  GLU A CB   3  
ATOM   3663  C  CG   . GLU A 1 15 ? 55.771 -3.907  20.645  1.00 0.00  ? 15  GLU A CG   3  
ATOM   3664  C  CD   . GLU A 1 15 ? 56.916 -3.196  21.370  1.00 0.00  ? 15  GLU A CD   3  
ATOM   3665  O  OE1  . GLU A 1 15 ? 58.057 -3.408  20.988  1.00 0.00  ? 15  GLU A OE1  3  
ATOM   3666  O  OE2  . GLU A 1 15 ? 56.635 -2.448  22.291  1.00 0.00  ? 15  GLU A OE2  3  
ATOM   3667  H  H    . GLU A 1 15 ? 57.878 -3.863  19.101  1.00 0.00  ? 15  GLU A H    3  
ATOM   3668  H  HA   . GLU A 1 15 ? 55.444 -5.059  18.198  1.00 0.00  ? 15  GLU A HA   3  
ATOM   3669  H  HB2  . GLU A 1 15 ? 56.044 -2.277  19.269  1.00 0.00  ? 15  GLU A HB2  3  
ATOM   3670  H  HB3  . GLU A 1 15 ? 54.442 -3.012  19.214  1.00 0.00  ? 15  GLU A HB3  3  
ATOM   3671  H  HG2  . GLU A 1 15 ? 54.881 -3.872  21.256  1.00 0.00  ? 15  GLU A HG2  3  
ATOM   3672  H  HG3  . GLU A 1 15 ? 56.045 -4.936  20.468  1.00 0.00  ? 15  GLU A HG3  3  
ATOM   3673  N  N    . GLN A 1 16 ? 56.414 -2.378  16.503  1.00 0.00  ? 16  GLN A N    3  
ATOM   3674  C  CA   . GLN A 1 16 ? 56.224 -1.669  15.198  1.00 0.00  ? 16  GLN A CA   3  
ATOM   3675  C  C    . GLN A 1 16 ? 56.860 -2.477  14.067  1.00 0.00  ? 16  GLN A C    3  
ATOM   3676  O  O    . GLN A 1 16 ? 56.353 -2.532  12.962  1.00 0.00  ? 16  GLN A O    3  
ATOM   3677  C  CB   . GLN A 1 16 ? 56.929 -0.318  15.364  1.00 0.00  ? 16  GLN A CB   3  
ATOM   3678  C  CG   . GLN A 1 16 ? 56.036 0.631   16.171  1.00 0.00  ? 16  GLN A CG   3  
ATOM   3679  C  CD   . GLN A 1 16 ? 56.563 0.741   17.605  1.00 0.00  ? 16  GLN A CD   3  
ATOM   3680  O  OE1  . GLN A 1 16 ? 56.270 -0.093  18.435  1.00 0.00  ? 16  GLN A OE1  3  
ATOM   3681  N  NE2  . GLN A 1 16 ? 57.332 1.741   17.935  1.00 0.00  ? 16  GLN A NE2  3  
ATOM   3682  H  H    . GLN A 1 16 ? 57.096 -2.064  17.133  1.00 0.00  ? 16  GLN A H    3  
ATOM   3683  H  HA   . GLN A 1 16 ? 55.184 -1.522  15.004  1.00 0.00  ? 16  GLN A HA   3  
ATOM   3684  H  HB2  . GLN A 1 16 ? 57.867 -0.463  15.882  1.00 0.00  ? 16  GLN A HB2  3  
ATOM   3685  H  HB3  . GLN A 1 16 ? 57.118 0.109   14.390  1.00 0.00  ? 16  GLN A HB3  3  
ATOM   3686  H  HG2  . GLN A 1 16 ? 56.040 1.608   15.709  1.00 0.00  ? 16  GLN A HG2  3  
ATOM   3687  H  HG3  . GLN A 1 16 ? 55.027 0.248   16.190  1.00 0.00  ? 16  GLN A HG3  3  
ATOM   3688  H  HE21 . GLN A 1 16 ? 57.570 2.418   17.268  1.00 0.00  ? 16  GLN A HE21 3  
ATOM   3689  H  HE22 . GLN A 1 16 ? 57.673 1.813   18.850  1.00 0.00  ? 16  GLN A HE22 3  
ATOM   3690  N  N    . LYS A 1 17 ? 57.959 -3.112  14.352  1.00 0.00  ? 17  LYS A N    3  
ATOM   3691  C  CA   . LYS A 1 17 ? 58.654 -3.945  13.323  1.00 0.00  ? 17  LYS A CA   3  
ATOM   3692  C  C    . LYS A 1 17 ? 57.746 -5.103  12.892  1.00 0.00  ? 17  LYS A C    3  
ATOM   3693  O  O    . LYS A 1 17 ? 57.655 -5.426  11.725  1.00 0.00  ? 17  LYS A O    3  
ATOM   3694  C  CB   . LYS A 1 17 ? 59.909 -4.480  14.023  1.00 0.00  ? 17  LYS A CB   3  
ATOM   3695  C  CG   . LYS A 1 17 ? 61.020 -3.427  13.973  1.00 0.00  ? 17  LYS A CG   3  
ATOM   3696  C  CD   . LYS A 1 17 ? 62.006 -3.779  12.857  1.00 0.00  ? 17  LYS A CD   3  
ATOM   3697  C  CE   . LYS A 1 17 ? 63.393 -3.219  13.193  1.00 0.00  ? 17  LYS A CE   3  
ATOM   3698  N  NZ   . LYS A 1 17 ? 64.340 -3.974  12.321  1.00 0.00  ? 17  LYS A NZ   3  
ATOM   3699  H  H    . LYS A 1 17 ? 58.323 -3.048  15.255  1.00 0.00  ? 17  LYS A H    3  
ATOM   3700  H  HA   . LYS A 1 17 ? 58.930 -3.344  12.472  1.00 0.00  ? 17  LYS A HA   3  
ATOM   3701  H  HB2  . LYS A 1 17 ? 59.676 -4.707  15.054  1.00 0.00  ? 17  LYS A HB2  3  
ATOM   3702  H  HB3  . LYS A 1 17 ? 60.243 -5.377  13.525  1.00 0.00  ? 17  LYS A HB3  3  
ATOM   3703  H  HG2  . LYS A 1 17 ? 60.587 -2.455  13.781  1.00 0.00  ? 17  LYS A HG2  3  
ATOM   3704  H  HG3  . LYS A 1 17 ? 61.541 -3.409  14.919  1.00 0.00  ? 17  LYS A HG3  3  
ATOM   3705  H  HD2  . LYS A 1 17 ? 62.066 -4.854  12.757  1.00 0.00  ? 17  LYS A HD2  3  
ATOM   3706  H  HD3  . LYS A 1 17 ? 61.663 -3.351  11.930  1.00 0.00  ? 17  LYS A HD3  3  
ATOM   3707  H  HE2  . LYS A 1 17 ? 63.433 -2.159  12.971  1.00 0.00  ? 17  LYS A HE2  3  
ATOM   3708  H  HE3  . LYS A 1 17 ? 63.627 -3.394  14.232  1.00 0.00  ? 17  LYS A HE3  3  
ATOM   3709  H  HZ1  . LYS A 1 17 ? 63.985 -3.983  11.343  1.00 0.00  ? 17  LYS A HZ1  3  
ATOM   3710  H  HZ2  . LYS A 1 17 ? 64.427 -4.952  12.666  1.00 0.00  ? 17  LYS A HZ2  3  
ATOM   3711  H  HZ3  . LYS A 1 17 ? 65.274 -3.515  12.340  1.00 0.00  ? 17  LYS A HZ3  3  
ATOM   3712  N  N    . ASN A 1 18 ? 57.068 -5.721  13.832  1.00 0.00  ? 18  ASN A N    3  
ATOM   3713  C  CA   . ASN A 1 18 ? 56.153 -6.855  13.492  1.00 0.00  ? 18  ASN A CA   3  
ATOM   3714  C  C    . ASN A 1 18 ? 55.020 -6.372  12.573  1.00 0.00  ? 18  ASN A C    3  
ATOM   3715  O  O    . ASN A 1 18 ? 54.644 -7.050  11.635  1.00 0.00  ? 18  ASN A O    3  
ATOM   3716  C  CB   . ASN A 1 18 ? 55.598 -7.334  14.838  1.00 0.00  ? 18  ASN A CB   3  
ATOM   3717  C  CG   . ASN A 1 18 ? 54.687 -8.542  14.619  1.00 0.00  ? 18  ASN A CG   3  
ATOM   3718  O  OD1  . ASN A 1 18 ? 55.146 -9.664  14.581  1.00 0.00  ? 18  ASN A OD1  3  
ATOM   3719  N  ND2  . ASN A 1 18 ? 53.404 -8.360  14.468  1.00 0.00  ? 18  ASN A ND2  3  
ATOM   3720  H  H    . ASN A 1 18 ? 57.158 -5.433  14.766  1.00 0.00  ? 18  ASN A H    3  
ATOM   3721  H  HA   . ASN A 1 18 ? 56.704 -7.653  13.018  1.00 0.00  ? 18  ASN A HA   3  
ATOM   3722  H  HB2  . ASN A 1 18 ? 56.419 -7.617  15.484  1.00 0.00  ? 18  ASN A HB2  3  
ATOM   3723  H  HB3  . ASN A 1 18 ? 55.035 -6.539  15.301  1.00 0.00  ? 18  ASN A HB3  3  
ATOM   3724  H  HD21 . ASN A 1 18 ? 53.029 -7.456  14.495  1.00 0.00  ? 18  ASN A HD21 3  
ATOM   3725  H  HD22 . ASN A 1 18 ? 52.814 -9.130  14.327  1.00 0.00  ? 18  ASN A HD22 3  
ATOM   3726  N  N    . GLU A 1 19 ? 54.483 -5.202  12.831  1.00 0.00  ? 19  GLU A N    3  
ATOM   3727  C  CA   . GLU A 1 19 ? 53.380 -4.666  11.966  1.00 0.00  ? 19  GLU A CA   3  
ATOM   3728  C  C    . GLU A 1 19 ? 53.876 -4.497  10.520  1.00 0.00  ? 19  GLU A C    3  
ATOM   3729  O  O    . GLU A 1 19 ? 53.189 -4.842  9.577   1.00 0.00  ? 19  GLU A O    3  
ATOM   3730  C  CB   . GLU A 1 19 ? 53.009 -3.310  12.577  1.00 0.00  ? 19  GLU A CB   3  
ATOM   3731  C  CG   . GLU A 1 19 ? 52.075 -3.525  13.775  1.00 0.00  ? 19  GLU A CG   3  
ATOM   3732  C  CD   . GLU A 1 19 ? 50.622 -3.583  13.297  1.00 0.00  ? 19  GLU A CD   3  
ATOM   3733  O  OE1  . GLU A 1 19 ? 50.226 -4.622  12.793  1.00 0.00  ? 19  GLU A OE1  3  
ATOM   3734  O  OE2  . GLU A 1 19 ? 49.929 -2.590  13.444  1.00 0.00  ? 19  GLU A OE2  3  
ATOM   3735  H  H    . GLU A 1 19 ? 54.809 -4.673  13.590  1.00 0.00  ? 19  GLU A H    3  
ATOM   3736  H  HA   . GLU A 1 19 ? 52.528 -5.327  11.993  1.00 0.00  ? 19  GLU A HA   3  
ATOM   3737  H  HB2  . GLU A 1 19 ? 53.906 -2.804  12.903  1.00 0.00  ? 19  GLU A HB2  3  
ATOM   3738  H  HB3  . GLU A 1 19 ? 52.506 -2.707  11.836  1.00 0.00  ? 19  GLU A HB3  3  
ATOM   3739  H  HG2  . GLU A 1 19 ? 52.329 -4.453  14.267  1.00 0.00  ? 19  GLU A HG2  3  
ATOM   3740  H  HG3  . GLU A 1 19 ? 52.189 -2.708  14.471  1.00 0.00  ? 19  GLU A HG3  3  
ATOM   3741  N  N    . PHE A 1 20 ? 55.070 -3.981  10.342  1.00 0.00  ? 20  PHE A N    3  
ATOM   3742  C  CA   . PHE A 1 20 ? 55.619 -3.806  8.958   1.00 0.00  ? 20  PHE A CA   3  
ATOM   3743  C  C    . PHE A 1 20 ? 56.113 -5.155  8.415   1.00 0.00  ? 20  PHE A C    3  
ATOM   3744  O  O    . PHE A 1 20 ? 55.975 -5.448  7.244   1.00 0.00  ? 20  PHE A O    3  
ATOM   3745  C  CB   . PHE A 1 20 ? 56.783 -2.819  9.105   1.00 0.00  ? 20  PHE A CB   3  
ATOM   3746  C  CG   . PHE A 1 20 ? 56.270 -1.401  8.981   1.00 0.00  ? 20  PHE A CG   3  
ATOM   3747  C  CD1  . PHE A 1 20 ? 55.468 -1.032  7.890   1.00 0.00  ? 20  PHE A CD1  3  
ATOM   3748  C  CD2  . PHE A 1 20 ? 56.595 -0.455  9.961   1.00 0.00  ? 20  PHE A CD2  3  
ATOM   3749  C  CE1  . PHE A 1 20 ? 54.994 0.279   7.782   1.00 0.00  ? 20  PHE A CE1  3  
ATOM   3750  C  CE2  . PHE A 1 20 ? 56.120 0.858   9.850   1.00 0.00  ? 20  PHE A CE2  3  
ATOM   3751  C  CZ   . PHE A 1 20 ? 55.320 1.224   8.761   1.00 0.00  ? 20  PHE A CZ   3  
ATOM   3752  H  H    . PHE A 1 20 ? 55.609 -3.720  11.117  1.00 0.00  ? 20  PHE A H    3  
ATOM   3753  H  HA   . PHE A 1 20 ? 54.866 -3.395  8.304   1.00 0.00  ? 20  PHE A HA   3  
ATOM   3754  H  HB2  . PHE A 1 20 ? 57.244 -2.950  10.073  1.00 0.00  ? 20  PHE A HB2  3  
ATOM   3755  H  HB3  . PHE A 1 20 ? 57.515 -3.005  8.332   1.00 0.00  ? 20  PHE A HB3  3  
ATOM   3756  H  HD1  . PHE A 1 20 ? 55.216 -1.759  7.132   1.00 0.00  ? 20  PHE A HD1  3  
ATOM   3757  H  HD2  . PHE A 1 20 ? 57.212 -0.737  10.801  1.00 0.00  ? 20  PHE A HD2  3  
ATOM   3758  H  HE1  . PHE A 1 20 ? 54.377 0.562   6.943   1.00 0.00  ? 20  PHE A HE1  3  
ATOM   3759  H  HE2  . PHE A 1 20 ? 56.370 1.589   10.605  1.00 0.00  ? 20  PHE A HE2  3  
ATOM   3760  H  HZ   . PHE A 1 20 ? 54.953 2.236   8.677   1.00 0.00  ? 20  PHE A HZ   3  
ATOM   3761  N  N    . LYS A 1 21 ? 56.679 -5.977  9.269   1.00 0.00  ? 21  LYS A N    3  
ATOM   3762  C  CA   . LYS A 1 21 ? 57.180 -7.321  8.834   1.00 0.00  ? 21  LYS A CA   3  
ATOM   3763  C  C    . LYS A 1 21 ? 56.036 -8.137  8.215   1.00 0.00  ? 21  LYS A C    3  
ATOM   3764  O  O    . LYS A 1 21 ? 56.174 -8.696  7.143   1.00 0.00  ? 21  LYS A O    3  
ATOM   3765  C  CB   . LYS A 1 21 ? 57.695 -7.976  10.127  1.00 0.00  ? 21  LYS A CB   3  
ATOM   3766  C  CG   . LYS A 1 21 ? 57.703 -9.501  9.991   1.00 0.00  ? 21  LYS A CG   3  
ATOM   3767  C  CD   . LYS A 1 21 ? 58.856 -9.924  9.073   1.00 0.00  ? 21  LYS A CD   3  
ATOM   3768  C  CE   . LYS A 1 21 ? 58.370 -10.987 8.086   1.00 0.00  ? 21  LYS A CE   3  
ATOM   3769  N  NZ   . LYS A 1 21 ? 58.450 -10.334 6.746   1.00 0.00  ? 21  LYS A NZ   3  
ATOM   3770  H  H    . LYS A 1 21 ? 56.769 -5.710  10.208  1.00 0.00  ? 21  LYS A H    3  
ATOM   3771  H  HA   . LYS A 1 21 ? 57.988 -7.213  8.128   1.00 0.00  ? 21  LYS A HA   3  
ATOM   3772  H  HB2  . LYS A 1 21 ? 58.699 -7.631  10.326  1.00 0.00  ? 21  LYS A HB2  3  
ATOM   3773  H  HB3  . LYS A 1 21 ? 57.053 -7.696  10.950  1.00 0.00  ? 21  LYS A HB3  3  
ATOM   3774  H  HG2  . LYS A 1 21 ? 57.838 -9.945  10.967  1.00 0.00  ? 21  LYS A HG2  3  
ATOM   3775  H  HG3  . LYS A 1 21 ? 56.761 -9.832  9.572   1.00 0.00  ? 21  LYS A HG3  3  
ATOM   3776  H  HD2  . LYS A 1 21 ? 59.215 -9.064  8.527   1.00 0.00  ? 21  LYS A HD2  3  
ATOM   3777  H  HD3  . LYS A 1 21 ? 59.658 -10.332 9.669   1.00 0.00  ? 21  LYS A HD3  3  
ATOM   3778  H  HE2  . LYS A 1 21 ? 59.014 -11.855 8.126   1.00 0.00  ? 21  LYS A HE2  3  
ATOM   3779  H  HE3  . LYS A 1 21 ? 57.351 -11.264 8.304   1.00 0.00  ? 21  LYS A HE3  3  
ATOM   3780  H  HZ1  . LYS A 1 21 ? 58.215 -11.030 6.008   1.00 0.00  ? 21  LYS A HZ1  3  
ATOM   3781  H  HZ2  . LYS A 1 21 ? 59.414 -9.975  6.590   1.00 0.00  ? 21  LYS A HZ2  3  
ATOM   3782  H  HZ3  . LYS A 1 21 ? 57.771 -9.547  6.703   1.00 0.00  ? 21  LYS A HZ3  3  
ATOM   3783  N  N    . ALA A 1 22 ? 54.909 -8.200  8.883   1.00 0.00  ? 22  ALA A N    3  
ATOM   3784  C  CA   . ALA A 1 22 ? 53.746 -8.969  8.339   1.00 0.00  ? 22  ALA A CA   3  
ATOM   3785  C  C    . ALA A 1 22 ? 53.322 -8.391  6.981   1.00 0.00  ? 22  ALA A C    3  
ATOM   3786  O  O    . ALA A 1 22 ? 53.084 -9.119  6.037   1.00 0.00  ? 22  ALA A O    3  
ATOM   3787  C  CB   . ALA A 1 22 ? 52.641 -8.794  9.379   1.00 0.00  ? 22  ALA A CB   3  
ATOM   3788  H  H    . ALA A 1 22 ? 54.826 -7.736  9.745   1.00 0.00  ? 22  ALA A H    3  
ATOM   3789  H  HA   . ALA A 1 22 ? 53.998 -10.014 8.240   1.00 0.00  ? 22  ALA A HA   3  
ATOM   3790  H  HB1  . ALA A 1 22 ? 52.904 -9.342  10.272  1.00 0.00  ? 22  ALA A HB1  3  
ATOM   3791  H  HB2  . ALA A 1 22 ? 51.710 -9.170  8.984   1.00 0.00  ? 22  ALA A HB2  3  
ATOM   3792  H  HB3  . ALA A 1 22 ? 52.536 -7.747  9.618   1.00 0.00  ? 22  ALA A HB3  3  
ATOM   3793  N  N    . ALA A 1 23 ? 53.254 -7.086  6.870   1.00 0.00  ? 23  ALA A N    3  
ATOM   3794  C  CA   . ALA A 1 23 ? 52.877 -6.463  5.562   1.00 0.00  ? 23  ALA A CA   3  
ATOM   3795  C  C    . ALA A 1 23 ? 53.986 -6.739  4.534   1.00 0.00  ? 23  ALA A C    3  
ATOM   3796  O  O    . ALA A 1 23 ? 53.727 -6.953  3.363   1.00 0.00  ? 23  ALA A O    3  
ATOM   3797  C  CB   . ALA A 1 23 ? 52.760 -4.963  5.848   1.00 0.00  ? 23  ALA A CB   3  
ATOM   3798  H  H    . ALA A 1 23 ? 53.470 -6.516  7.639   1.00 0.00  ? 23  ALA A H    3  
ATOM   3799  H  HA   . ALA A 1 23 ? 51.933 -6.852  5.215   1.00 0.00  ? 23  ALA A HA   3  
ATOM   3800  H  HB1  . ALA A 1 23 ? 51.923 -4.556  5.302   1.00 0.00  ? 23  ALA A HB1  3  
ATOM   3801  H  HB2  . ALA A 1 23 ? 53.668 -4.467  5.540   1.00 0.00  ? 23  ALA A HB2  3  
ATOM   3802  H  HB3  . ALA A 1 23 ? 52.608 -4.809  6.907   1.00 0.00  ? 23  ALA A HB3  3  
ATOM   3803  N  N    . PHE A 1 24 ? 55.221 -6.751  4.982   1.00 0.00  ? 24  PHE A N    3  
ATOM   3804  C  CA   . PHE A 1 24 ? 56.374 -7.031  4.070   1.00 0.00  ? 24  PHE A CA   3  
ATOM   3805  C  C    . PHE A 1 24 ? 56.256 -8.448  3.486   1.00 0.00  ? 24  PHE A C    3  
ATOM   3806  O  O    . PHE A 1 24 ? 56.623 -8.685  2.353   1.00 0.00  ? 24  PHE A O    3  
ATOM   3807  C  CB   . PHE A 1 24 ? 57.611 -6.914  4.970   1.00 0.00  ? 24  PHE A CB   3  
ATOM   3808  C  CG   . PHE A 1 24 ? 58.875 -6.948  4.141   1.00 0.00  ? 24  PHE A CG   3  
ATOM   3809  C  CD1  . PHE A 1 24 ? 59.214 -5.859  3.331   1.00 0.00  ? 24  PHE A CD1  3  
ATOM   3810  C  CD2  . PHE A 1 24 ? 59.713 -8.067  4.196   1.00 0.00  ? 24  PHE A CD2  3  
ATOM   3811  C  CE1  . PHE A 1 24 ? 60.391 -5.889  2.574   1.00 0.00  ? 24  PHE A CE1  3  
ATOM   3812  C  CE2  . PHE A 1 24 ? 60.891 -8.098  3.441   1.00 0.00  ? 24  PHE A CE2  3  
ATOM   3813  C  CZ   . PHE A 1 24 ? 61.230 -7.010  2.629   1.00 0.00  ? 24  PHE A CZ   3  
ATOM   3814  H  H    . PHE A 1 24 ? 55.388 -6.586  5.934   1.00 0.00  ? 24  PHE A H    3  
ATOM   3815  H  HA   . PHE A 1 24 ? 56.418 -6.297  3.281   1.00 0.00  ? 24  PHE A HA   3  
ATOM   3816  H  HB2  . PHE A 1 24 ? 57.570 -5.982  5.514   1.00 0.00  ? 24  PHE A HB2  3  
ATOM   3817  H  HB3  . PHE A 1 24 ? 57.622 -7.735  5.670   1.00 0.00  ? 24  PHE A HB3  3  
ATOM   3818  H  HD1  . PHE A 1 24 ? 58.566 -4.995  3.289   1.00 0.00  ? 24  PHE A HD1  3  
ATOM   3819  H  HD2  . PHE A 1 24 ? 59.452 -8.908  4.821   1.00 0.00  ? 24  PHE A HD2  3  
ATOM   3820  H  HE1  . PHE A 1 24 ? 60.653 -5.049  1.948   1.00 0.00  ? 24  PHE A HE1  3  
ATOM   3821  H  HE2  . PHE A 1 24 ? 61.539 -8.962  3.485   1.00 0.00  ? 24  PHE A HE2  3  
ATOM   3822  H  HZ   . PHE A 1 24 ? 62.139 -7.034  2.046   1.00 0.00  ? 24  PHE A HZ   3  
ATOM   3823  N  N    . ASP A 1 25 ? 55.739 -9.385  4.252   1.00 0.00  ? 25  ASP A N    3  
ATOM   3824  C  CA   . ASP A 1 25 ? 55.587 -10.788 3.745   1.00 0.00  ? 25  ASP A CA   3  
ATOM   3825  C  C    . ASP A 1 25 ? 54.714 -10.812 2.485   1.00 0.00  ? 25  ASP A C    3  
ATOM   3826  O  O    . ASP A 1 25 ? 55.105 -11.348 1.467   1.00 0.00  ? 25  ASP A O    3  
ATOM   3827  C  CB   . ASP A 1 25 ? 54.901 -11.561 4.879   1.00 0.00  ? 25  ASP A CB   3  
ATOM   3828  C  CG   . ASP A 1 25 ? 55.939 -12.043 5.896   1.00 0.00  ? 25  ASP A CG   3  
ATOM   3829  O  OD1  . ASP A 1 25 ? 57.018 -12.441 5.483   1.00 0.00  ? 25  ASP A OD1  3  
ATOM   3830  O  OD2  . ASP A 1 25 ? 55.635 -12.007 7.075   1.00 0.00  ? 25  ASP A OD2  3  
ATOM   3831  H  H    . ASP A 1 25 ? 55.447 -9.163  5.163   1.00 0.00  ? 25  ASP A H    3  
ATOM   3832  H  HA   . ASP A 1 25 ? 56.553 -11.220 3.539   1.00 0.00  ? 25  ASP A HA   3  
ATOM   3833  H  HB2  . ASP A 1 25 ? 54.191 -10.915 5.374   1.00 0.00  ? 25  ASP A HB2  3  
ATOM   3834  H  HB3  . ASP A 1 25 ? 54.382 -12.414 4.469   1.00 0.00  ? 25  ASP A HB3  3  
ATOM   3835  N  N    . ILE A 1 26 ? 53.541 -10.230 2.543   1.00 0.00  ? 26  ILE A N    3  
ATOM   3836  C  CA   . ILE A 1 26 ? 52.648 -10.212 1.340   1.00 0.00  ? 26  ILE A CA   3  
ATOM   3837  C  C    . ILE A 1 26 ? 53.320 -9.420  0.209   1.00 0.00  ? 26  ILE A C    3  
ATOM   3838  O  O    . ILE A 1 26 ? 53.226 -9.777  -0.949  1.00 0.00  ? 26  ILE A O    3  
ATOM   3839  C  CB   . ILE A 1 26 ? 51.358 -9.518  1.800   1.00 0.00  ? 26  ILE A CB   3  
ATOM   3840  C  CG1  . ILE A 1 26 ? 50.696 -10.343 2.910   1.00 0.00  ? 26  ILE A CG1  3  
ATOM   3841  C  CG2  . ILE A 1 26 ? 50.391 -9.396  0.619   1.00 0.00  ? 26  ILE A CG2  3  
ATOM   3842  C  CD1  . ILE A 1 26 ? 50.532 -9.480  4.165   1.00 0.00  ? 26  ILE A CD1  3  
ATOM   3843  H  H    . ILE A 1 26 ? 53.251 -9.801  3.377   1.00 0.00  ? 26  ILE A H    3  
ATOM   3844  H  HA   . ILE A 1 26 ? 52.433 -11.220 1.017   1.00 0.00  ? 26  ILE A HA   3  
ATOM   3845  H  HB   . ILE A 1 26 ? 51.595 -8.532  2.172   1.00 0.00  ? 26  ILE A HB   3  
ATOM   3846  H  HG12 . ILE A 1 26 ? 49.727 -10.684 2.576   1.00 0.00  ? 26  ILE A HG12 3  
ATOM   3847  H  HG13 . ILE A 1 26 ? 51.315 -11.197 3.141   1.00 0.00  ? 26  ILE A HG13 3  
ATOM   3848  H  HG21 . ILE A 1 26 ? 50.863 -8.840  -0.178  1.00 0.00  ? 26  ILE A HG21 3  
ATOM   3849  H  HG22 . ILE A 1 26 ? 49.498 -8.881  0.939   1.00 0.00  ? 26  ILE A HG22 3  
ATOM   3850  H  HG23 . ILE A 1 26 ? 50.131 -10.383 0.264   1.00 0.00  ? 26  ILE A HG23 3  
ATOM   3851  H  HD11 . ILE A 1 26 ? 49.497 -9.486  4.473   1.00 0.00  ? 26  ILE A HD11 3  
ATOM   3852  H  HD12 . ILE A 1 26 ? 50.836 -8.466  3.950   1.00 0.00  ? 26  ILE A HD12 3  
ATOM   3853  H  HD13 . ILE A 1 26 ? 51.145 -9.878  4.959   1.00 0.00  ? 26  ILE A HD13 3  
ATOM   3854  N  N    . PHE A 1 27 ? 54.004 -8.352  0.546   1.00 0.00  ? 27  PHE A N    3  
ATOM   3855  C  CA   . PHE A 1 27 ? 54.697 -7.528  -0.495  1.00 0.00  ? 27  PHE A CA   3  
ATOM   3856  C  C    . PHE A 1 27 ? 55.763 -8.362  -1.227  1.00 0.00  ? 27  PHE A C    3  
ATOM   3857  O  O    . PHE A 1 27 ? 55.995 -8.182  -2.407  1.00 0.00  ? 27  PHE A O    3  
ATOM   3858  C  CB   . PHE A 1 27 ? 55.354 -6.379  0.284   1.00 0.00  ? 27  PHE A CB   3  
ATOM   3859  C  CG   . PHE A 1 27 ? 55.159 -5.065  -0.444  1.00 0.00  ? 27  PHE A CG   3  
ATOM   3860  C  CD1  . PHE A 1 27 ? 55.149 -5.020  -1.845  1.00 0.00  ? 27  PHE A CD1  3  
ATOM   3861  C  CD2  . PHE A 1 27 ? 54.992 -3.885  0.292   1.00 0.00  ? 27  PHE A CD2  3  
ATOM   3862  C  CE1  . PHE A 1 27 ? 54.973 -3.799  -2.506  1.00 0.00  ? 27  PHE A CE1  3  
ATOM   3863  C  CE2  . PHE A 1 27 ? 54.817 -2.664  -0.370  1.00 0.00  ? 27  PHE A CE2  3  
ATOM   3864  C  CZ   . PHE A 1 27 ? 54.807 -2.621  -1.768  1.00 0.00  ? 27  PHE A CZ   3  
ATOM   3865  H  H    . PHE A 1 27 ? 54.065 -8.094  1.491   1.00 0.00  ? 27  PHE A H    3  
ATOM   3866  H  HA   . PHE A 1 27 ? 53.981 -7.134  -1.198  1.00 0.00  ? 27  PHE A HA   3  
ATOM   3867  H  HB2  . PHE A 1 27 ? 54.909 -6.311  1.265   1.00 0.00  ? 27  PHE A HB2  3  
ATOM   3868  H  HB3  . PHE A 1 27 ? 56.411 -6.576  0.386   1.00 0.00  ? 27  PHE A HB3  3  
ATOM   3869  H  HD1  . PHE A 1 27 ? 55.278 -5.928  -2.415  1.00 0.00  ? 27  PHE A HD1  3  
ATOM   3870  H  HD2  . PHE A 1 27 ? 54.999 -3.916  1.371   1.00 0.00  ? 27  PHE A HD2  3  
ATOM   3871  H  HE1  . PHE A 1 27 ? 54.964 -3.765  -3.586  1.00 0.00  ? 27  PHE A HE1  3  
ATOM   3872  H  HE2  . PHE A 1 27 ? 54.689 -1.755  0.200   1.00 0.00  ? 27  PHE A HE2  3  
ATOM   3873  H  HZ   . PHE A 1 27 ? 54.673 -1.678  -2.278  1.00 0.00  ? 27  PHE A HZ   3  
ATOM   3874  N  N    . VAL A 1 28 ? 56.414 -9.271  -0.537  1.00 0.00  ? 28  VAL A N    3  
ATOM   3875  C  CA   . VAL A 1 28 ? 57.468 -10.114 -1.197  1.00 0.00  ? 28  VAL A CA   3  
ATOM   3876  C  C    . VAL A 1 28 ? 56.940 -11.525 -1.526  1.00 0.00  ? 28  VAL A C    3  
ATOM   3877  O  O    . VAL A 1 28 ? 57.622 -12.307 -2.160  1.00 0.00  ? 28  VAL A O    3  
ATOM   3878  C  CB   . VAL A 1 28 ? 58.632 -10.197 -0.192  1.00 0.00  ? 28  VAL A CB   3  
ATOM   3879  C  CG1  . VAL A 1 28 ? 59.073 -8.789  0.219   1.00 0.00  ? 28  VAL A CG1  3  
ATOM   3880  C  CG2  . VAL A 1 28 ? 58.204 -10.979 1.056   1.00 0.00  ? 28  VAL A CG2  3  
ATOM   3881  H  H    . VAL A 1 28 ? 56.213 -9.397  0.414   1.00 0.00  ? 28  VAL A H    3  
ATOM   3882  H  HA   . VAL A 1 28 ? 57.810 -9.633  -2.099  1.00 0.00  ? 28  VAL A HA   3  
ATOM   3883  H  HB   . VAL A 1 28 ? 59.464 -10.702 -0.659  1.00 0.00  ? 28  VAL A HB   3  
ATOM   3884  H  HG11 . VAL A 1 28 ? 58.204 -8.167  0.368   1.00 0.00  ? 28  VAL A HG11 3  
ATOM   3885  H  HG12 . VAL A 1 28 ? 59.690 -8.364  -0.558  1.00 0.00  ? 28  VAL A HG12 3  
ATOM   3886  H  HG13 . VAL A 1 28 ? 59.639 -8.842  1.138   1.00 0.00  ? 28  VAL A HG13 3  
ATOM   3887  H  HG21 . VAL A 1 28 ? 57.299 -10.552 1.458   1.00 0.00  ? 28  VAL A HG21 3  
ATOM   3888  H  HG22 . VAL A 1 28 ? 58.986 -10.927 1.798   1.00 0.00  ? 28  VAL A HG22 3  
ATOM   3889  H  HG23 . VAL A 1 28 ? 58.028 -12.011 0.791   1.00 0.00  ? 28  VAL A HG23 3  
ATOM   3890  N  N    . LEU A 1 29 ? 55.741 -11.860 -1.097  1.00 0.00  ? 29  LEU A N    3  
ATOM   3891  C  CA   . LEU A 1 29 ? 55.180 -13.223 -1.382  1.00 0.00  ? 29  LEU A CA   3  
ATOM   3892  C  C    . LEU A 1 29 ? 55.246 -13.539 -2.882  1.00 0.00  ? 29  LEU A C    3  
ATOM   3893  O  O    . LEU A 1 29 ? 55.840 -14.519 -3.292  1.00 0.00  ? 29  LEU A O    3  
ATOM   3894  C  CB   . LEU A 1 29 ? 53.722 -13.166 -0.911  1.00 0.00  ? 29  LEU A CB   3  
ATOM   3895  C  CG   . LEU A 1 29 ? 53.389 -14.444 -0.140  1.00 0.00  ? 29  LEU A CG   3  
ATOM   3896  C  CD1  . LEU A 1 29 ? 52.478 -14.108 1.042   1.00 0.00  ? 29  LEU A CD1  3  
ATOM   3897  C  CD2  . LEU A 1 29 ? 52.674 -15.430 -1.069  1.00 0.00  ? 29  LEU A CD2  3  
ATOM   3898  H  H    . LEU A 1 29 ? 55.211 -11.219 -0.582  1.00 0.00  ? 29  LEU A H    3  
ATOM   3899  H  HA   . LEU A 1 29 ? 55.717 -13.970 -0.821  1.00 0.00  ? 29  LEU A HA   3  
ATOM   3900  H  HB2  . LEU A 1 29 ? 53.583 -12.309 -0.267  1.00 0.00  ? 29  LEU A HB2  3  
ATOM   3901  H  HB3  . LEU A 1 29 ? 53.068 -13.083 -1.765  1.00 0.00  ? 29  LEU A HB3  3  
ATOM   3902  H  HG   . LEU A 1 29 ? 54.304 -14.888 0.224   1.00 0.00  ? 29  LEU A HG   3  
ATOM   3903  H  HD11 . LEU A 1 29 ? 51.719 -14.870 1.140   1.00 0.00  ? 29  LEU A HD11 3  
ATOM   3904  H  HD12 . LEU A 1 29 ? 52.007 -13.150 0.875   1.00 0.00  ? 29  LEU A HD12 3  
ATOM   3905  H  HD13 . LEU A 1 29 ? 53.066 -14.067 1.947   1.00 0.00  ? 29  LEU A HD13 3  
ATOM   3906  H  HD21 . LEU A 1 29 ? 53.357 -15.760 -1.838  1.00 0.00  ? 29  LEU A HD21 3  
ATOM   3907  H  HD22 . LEU A 1 29 ? 51.824 -14.945 -1.526  1.00 0.00  ? 29  LEU A HD22 3  
ATOM   3908  H  HD23 . LEU A 1 29 ? 52.337 -16.283 -0.499  1.00 0.00  ? 29  LEU A HD23 3  
ATOM   3909  N  N    . GLY A 1 30 ? 54.652 -12.710 -3.702  1.00 0.00  ? 30  GLY A N    3  
ATOM   3910  C  CA   . GLY A 1 30 ? 54.689 -12.950 -5.176  1.00 0.00  ? 30  GLY A CA   3  
ATOM   3911  C  C    . GLY A 1 30 ? 55.668 -11.965 -5.812  1.00 0.00  ? 30  GLY A C    3  
ATOM   3912  O  O    . GLY A 1 30 ? 55.336 -11.270 -6.753  1.00 0.00  ? 30  GLY A O    3  
ATOM   3913  H  H    . GLY A 1 30 ? 54.189 -11.921 -3.348  1.00 0.00  ? 30  GLY A H    3  
ATOM   3914  H  HA2  . GLY A 1 30 ? 55.012 -13.965 -5.371  1.00 0.00  ? 30  GLY A HA2  3  
ATOM   3915  H  HA3  . GLY A 1 30 ? 53.703 -12.791 -5.593  1.00 0.00  ? 30  GLY A HA3  3  
ATOM   3916  N  N    . ALA A 1 31 ? 56.871 -11.888 -5.298  1.00 0.00  ? 31  ALA A N    3  
ATOM   3917  C  CA   . ALA A 1 31 ? 57.867 -10.930 -5.867  1.00 0.00  ? 31  ALA A CA   3  
ATOM   3918  C  C    . ALA A 1 31 ? 58.830 -11.629 -6.845  1.00 0.00  ? 31  ALA A C    3  
ATOM   3919  O  O    . ALA A 1 31 ? 59.978 -11.252 -6.958  1.00 0.00  ? 31  ALA A O    3  
ATOM   3920  C  CB   . ALA A 1 31 ? 58.617 -10.378 -4.649  1.00 0.00  ? 31  ALA A CB   3  
ATOM   3921  H  H    . ALA A 1 31 ? 57.114 -12.451 -4.530  1.00 0.00  ? 31  ALA A H    3  
ATOM   3922  H  HA   . ALA A 1 31 ? 57.358 -10.126 -6.370  1.00 0.00  ? 31  ALA A HA   3  
ATOM   3923  H  HB1  . ALA A 1 31 ? 59.346 -11.101 -4.313  1.00 0.00  ? 31  ALA A HB1  3  
ATOM   3924  H  HB2  . ALA A 1 31 ? 57.913 -10.181 -3.853  1.00 0.00  ? 31  ALA A HB2  3  
ATOM   3925  H  HB3  . ALA A 1 31 ? 59.118 -9.461  -4.920  1.00 0.00  ? 31  ALA A HB3  3  
ATOM   3926  N  N    . GLU A 1 32 ? 58.357 -12.628 -7.563  1.00 0.00  ? 32  GLU A N    3  
ATOM   3927  C  CA   . GLU A 1 32 ? 59.220 -13.359 -8.556  1.00 0.00  ? 32  GLU A CA   3  
ATOM   3928  C  C    . GLU A 1 32 ? 60.510 -13.881 -7.901  1.00 0.00  ? 32  GLU A C    3  
ATOM   3929  O  O    . GLU A 1 32 ? 60.566 -15.013 -7.457  1.00 0.00  ? 32  GLU A O    3  
ATOM   3930  C  CB   . GLU A 1 32 ? 59.531 -12.335 -9.655  1.00 0.00  ? 32  GLU A CB   3  
ATOM   3931  C  CG   . GLU A 1 32 ? 58.472 -12.431 -10.757 1.00 0.00  ? 32  GLU A CG   3  
ATOM   3932  C  CD   . GLU A 1 32 ? 58.289 -11.062 -11.414 1.00 0.00  ? 32  GLU A CD   3  
ATOM   3933  O  OE1  . GLU A 1 32 ? 59.154 -10.674 -12.183 1.00 0.00  ? 32  GLU A OE1  3  
ATOM   3934  O  OE2  . GLU A 1 32 ? 57.290 -10.421 -11.134 1.00 0.00  ? 32  GLU A OE2  3  
ATOM   3935  H  H    . GLU A 1 32 ? 57.424 -12.896 -7.457  1.00 0.00  ? 32  GLU A H    3  
ATOM   3936  H  HA   . GLU A 1 32 ? 58.669 -14.184 -8.981  1.00 0.00  ? 32  GLU A HA   3  
ATOM   3937  H  HB2  . GLU A 1 32 ? 59.525 -11.339 -9.233  1.00 0.00  ? 32  GLU A HB2  3  
ATOM   3938  H  HB3  . GLU A 1 32 ? 60.504 -12.541 -10.075 1.00 0.00  ? 32  GLU A HB3  3  
ATOM   3939  H  HG2  . GLU A 1 32 ? 58.789 -13.147 -11.501 1.00 0.00  ? 32  GLU A HG2  3  
ATOM   3940  H  HG3  . GLU A 1 32 ? 57.533 -12.749 -10.329 1.00 0.00  ? 32  GLU A HG3  3  
ATOM   3941  N  N    . ASP A 1 33 ? 61.544 -13.073 -7.834  1.00 0.00  ? 33  ASP A N    3  
ATOM   3942  C  CA   . ASP A 1 33 ? 62.820 -13.535 -7.203  1.00 0.00  ? 33  ASP A CA   3  
ATOM   3943  C  C    . ASP A 1 33 ? 62.645 -13.693 -5.683  1.00 0.00  ? 33  ASP A C    3  
ATOM   3944  O  O    . ASP A 1 33 ? 63.247 -14.559 -5.075  1.00 0.00  ? 33  ASP A O    3  
ATOM   3945  C  CB   . ASP A 1 33 ? 63.870 -12.458 -7.538  1.00 0.00  ? 33  ASP A CB   3  
ATOM   3946  C  CG   . ASP A 1 33 ? 63.438 -11.093 -6.992  1.00 0.00  ? 33  ASP A CG   3  
ATOM   3947  O  OD1  . ASP A 1 33 ? 62.718 -10.399 -7.691  1.00 0.00  ? 33  ASP A OD1  3  
ATOM   3948  O  OD2  . ASP A 1 33 ? 63.842 -10.763 -5.888  1.00 0.00  ? 33  ASP A OD2  3  
ATOM   3949  H  H    . ASP A 1 33 ? 61.479 -12.163 -8.194  1.00 0.00  ? 33  ASP A H    3  
ATOM   3950  H  HA   . ASP A 1 33 ? 63.119 -14.476 -7.634  1.00 0.00  ? 33  ASP A HA   3  
ATOM   3951  H  HB2  . ASP A 1 33 ? 64.817 -12.733 -7.098  1.00 0.00  ? 33  ASP A HB2  3  
ATOM   3952  H  HB3  . ASP A 1 33 ? 63.982 -12.391 -8.610  1.00 0.00  ? 33  ASP A HB3  3  
ATOM   3953  N  N    . GLY A 1 34 ? 61.821 -12.879 -5.064  1.00 0.00  ? 34  GLY A N    3  
ATOM   3954  C  CA   . GLY A 1 34 ? 61.612 -13.010 -3.589  1.00 0.00  ? 34  GLY A CA   3  
ATOM   3955  C  C    . GLY A 1 34 ? 61.618 -11.632 -2.921  1.00 0.00  ? 34  GLY A C    3  
ATOM   3956  O  O    . GLY A 1 34 ? 60.798 -11.352 -2.073  1.00 0.00  ? 34  GLY A O    3  
ATOM   3957  H  H    . GLY A 1 34 ? 61.337 -12.191 -5.569  1.00 0.00  ? 34  GLY A H    3  
ATOM   3958  H  HA2  . GLY A 1 34 ? 60.659 -13.491 -3.406  1.00 0.00  ? 34  GLY A HA2  3  
ATOM   3959  H  HA3  . GLY A 1 34 ? 62.406 -13.612 -3.166  1.00 0.00  ? 34  GLY A HA3  3  
ATOM   3960  N  N    . CYS A 1 35 ? 62.536 -10.773 -3.289  1.00 0.00  ? 35  CYS A N    3  
ATOM   3961  C  CA   . CYS A 1 35 ? 62.590 -9.413  -2.661  1.00 0.00  ? 35  CYS A CA   3  
ATOM   3962  C  C    . CYS A 1 35 ? 61.664 -8.437  -3.402  1.00 0.00  ? 35  CYS A C    3  
ATOM   3963  O  O    . CYS A 1 35 ? 61.298 -8.660  -4.539  1.00 0.00  ? 35  CYS A O    3  
ATOM   3964  C  CB   . CYS A 1 35 ? 64.051 -8.978  -2.792  1.00 0.00  ? 35  CYS A CB   3  
ATOM   3965  S  SG   . CYS A 1 35 ? 65.081 -10.004 -1.714  1.00 0.00  ? 35  CYS A SG   3  
ATOM   3966  H  H    . CYS A 1 35 ? 63.192 -11.022 -3.976  1.00 0.00  ? 35  CYS A H    3  
ATOM   3967  H  HA   . CYS A 1 35 ? 62.317 -9.469  -1.619  1.00 0.00  ? 35  CYS A HA   3  
ATOM   3968  H  HB2  . CYS A 1 35 ? 64.372 -9.098  -3.817  1.00 0.00  ? 35  CYS A HB2  3  
ATOM   3969  H  HB3  . CYS A 1 35 ? 64.148 -7.941  -2.503  1.00 0.00  ? 35  CYS A HB3  3  
ATOM   3970  H  HG   . CYS A 1 35 ? 65.581 -10.606 -2.269  1.00 0.00  ? 35  CYS A HG   3  
ATOM   3971  N  N    . ILE A 1 36 ? 61.281 -7.358  -2.761  1.00 0.00  ? 36  ILE A N    3  
ATOM   3972  C  CA   . ILE A 1 36 ? 60.374 -6.367  -3.426  1.00 0.00  ? 36  ILE A CA   3  
ATOM   3973  C  C    . ILE A 1 36 ? 61.115 -5.647  -4.564  1.00 0.00  ? 36  ILE A C    3  
ATOM   3974  O  O    . ILE A 1 36 ? 62.030 -4.875  -4.338  1.00 0.00  ? 36  ILE A O    3  
ATOM   3975  C  CB   . ILE A 1 36 ? 59.966 -5.383  -2.314  1.00 0.00  ? 36  ILE A CB   3  
ATOM   3976  C  CG1  . ILE A 1 36 ? 58.744 -5.933  -1.574  1.00 0.00  ? 36  ILE A CG1  3  
ATOM   3977  C  CG2  . ILE A 1 36 ? 59.613 -4.015  -2.911  1.00 0.00  ? 36  ILE A CG2  3  
ATOM   3978  C  CD1  . ILE A 1 36 ? 58.712 -5.373  -0.149  1.00 0.00  ? 36  ILE A CD1  3  
ATOM   3979  H  H    . ILE A 1 36 ? 61.588 -7.201  -1.843  1.00 0.00  ? 36  ILE A H    3  
ATOM   3980  H  HA   . ILE A 1 36 ? 59.498 -6.866  -3.811  1.00 0.00  ? 36  ILE A HA   3  
ATOM   3981  H  HB   . ILE A 1 36 ? 60.786 -5.269  -1.619  1.00 0.00  ? 36  ILE A HB   3  
ATOM   3982  H  HG12 . ILE A 1 36 ? 57.845 -5.640  -2.097  1.00 0.00  ? 36  ILE A HG12 3  
ATOM   3983  H  HG13 . ILE A 1 36 ? 58.801 -7.009  -1.535  1.00 0.00  ? 36  ILE A HG13 3  
ATOM   3984  H  HG21 . ILE A 1 36 ? 60.458 -3.350  -2.811  1.00 0.00  ? 36  ILE A HG21 3  
ATOM   3985  H  HG22 . ILE A 1 36 ? 58.765 -3.599  -2.386  1.00 0.00  ? 36  ILE A HG22 3  
ATOM   3986  H  HG23 . ILE A 1 36 ? 59.366 -4.127  -3.956  1.00 0.00  ? 36  ILE A HG23 3  
ATOM   3987  H  HD11 . ILE A 1 36 ? 58.797 -6.184  0.559   1.00 0.00  ? 36  ILE A HD11 3  
ATOM   3988  H  HD12 . ILE A 1 36 ? 57.780 -4.851  0.012   1.00 0.00  ? 36  ILE A HD12 3  
ATOM   3989  H  HD13 . ILE A 1 36 ? 59.536 -4.688  -0.011  1.00 0.00  ? 36  ILE A HD13 3  
ATOM   3990  N  N    . SER A 1 37 ? 60.715 -5.895  -5.785  1.00 0.00  ? 37  SER A N    3  
ATOM   3991  C  CA   . SER A 1 37 ? 61.375 -5.229  -6.950  1.00 0.00  ? 37  SER A CA   3  
ATOM   3992  C  C    . SER A 1 37 ? 60.506 -4.058  -7.443  1.00 0.00  ? 37  SER A C    3  
ATOM   3993  O  O    . SER A 1 37 ? 59.504 -3.722  -6.838  1.00 0.00  ? 37  SER A O    3  
ATOM   3994  C  CB   . SER A 1 37 ? 61.495 -6.320  -8.018  1.00 0.00  ? 37  SER A CB   3  
ATOM   3995  O  OG   . SER A 1 37 ? 62.299 -5.844  -9.091  1.00 0.00  ? 37  SER A OG   3  
ATOM   3996  H  H    . SER A 1 37 ? 59.973 -6.518  -5.937  1.00 0.00  ? 37  SER A H    3  
ATOM   3997  H  HA   . SER A 1 37 ? 62.356 -4.876  -6.672  1.00 0.00  ? 37  SER A HA   3  
ATOM   3998  H  HB2  . SER A 1 37 ? 61.959 -7.195  -7.589  1.00 0.00  ? 37  SER A HB2  3  
ATOM   3999  H  HB3  . SER A 1 37 ? 60.508 -6.580  -8.380  1.00 0.00  ? 37  SER A HB3  3  
ATOM   4000  H  HG   . SER A 1 37 ? 63.199 -6.154  -8.951  1.00 0.00  ? 37  SER A HG   3  
ATOM   4001  N  N    . THR A 1 38 ? 60.888 -3.433  -8.529  1.00 0.00  ? 38  THR A N    3  
ATOM   4002  C  CA   . THR A 1 38 ? 60.094 -2.272  -9.061  1.00 0.00  ? 38  THR A CA   3  
ATOM   4003  C  C    . THR A 1 38 ? 58.661 -2.693  -9.418  1.00 0.00  ? 38  THR A C    3  
ATOM   4004  O  O    . THR A 1 38 ? 57.702 -2.085  -8.977  1.00 0.00  ? 38  THR A O    3  
ATOM   4005  C  CB   . THR A 1 38 ? 60.836 -1.807  -10.322 1.00 0.00  ? 38  THR A CB   3  
ATOM   4006  O  OG1  . THR A 1 38 ? 61.225 -2.938  -11.095 1.00 0.00  ? 38  THR A OG1  3  
ATOM   4007  C  CG2  . THR A 1 38 ? 62.075 -1.004  -9.922  1.00 0.00  ? 38  THR A CG2  3  
ATOM   4008  H  H    . THR A 1 38 ? 61.702 -3.720  -8.994  1.00 0.00  ? 38  THR A H    3  
ATOM   4009  H  HA   . THR A 1 38 ? 60.075 -1.473  -8.337  1.00 0.00  ? 38  THR A HA   3  
ATOM   4010  H  HB   . THR A 1 38 ? 60.182 -1.180  -10.909 1.00 0.00  ? 38  THR A HB   3  
ATOM   4011  H  HG1  . THR A 1 38 ? 61.839 -2.641  -11.771 1.00 0.00  ? 38  THR A HG1  3  
ATOM   4012  H  HG21 . THR A 1 38 ? 61.833 -0.359  -9.091  1.00 0.00  ? 38  THR A HG21 3  
ATOM   4013  H  HG22 . THR A 1 38 ? 62.399 -0.404  -10.760 1.00 0.00  ? 38  THR A HG22 3  
ATOM   4014  H  HG23 . THR A 1 38 ? 62.867 -1.680  -9.636  1.00 0.00  ? 38  THR A HG23 3  
ATOM   4015  N  N    . LYS A 1 39 ? 58.510 -3.716  -10.224 1.00 0.00  ? 39  LYS A N    3  
ATOM   4016  C  CA   . LYS A 1 39 ? 57.137 -4.171  -10.629 1.00 0.00  ? 39  LYS A CA   3  
ATOM   4017  C  C    . LYS A 1 39 ? 56.288 -4.566  -9.404  1.00 0.00  ? 39  LYS A C    3  
ATOM   4018  O  O    . LYS A 1 39 ? 55.109 -4.271  -9.351  1.00 0.00  ? 39  LYS A O    3  
ATOM   4019  C  CB   . LYS A 1 39 ? 57.352 -5.371  -11.567 1.00 0.00  ? 39  LYS A CB   3  
ATOM   4020  C  CG   . LYS A 1 39 ? 58.192 -6.450  -10.876 1.00 0.00  ? 39  LYS A CG   3  
ATOM   4021  C  CD   . LYS A 1 39 ? 59.065 -7.157  -11.915 1.00 0.00  ? 39  LYS A CD   3  
ATOM   4022  C  CE   . LYS A 1 39 ? 60.460 -7.402  -11.333 1.00 0.00  ? 39  LYS A CE   3  
ATOM   4023  N  NZ   . LYS A 1 39 ? 60.347 -8.686  -10.585 1.00 0.00  ? 39  LYS A NZ   3  
ATOM   4024  H  H    . LYS A 1 39 ? 59.302 -4.176  -10.575 1.00 0.00  ? 39  LYS A H    3  
ATOM   4025  H  HA   . LYS A 1 39 ? 56.640 -3.381  -11.171 1.00 0.00  ? 39  LYS A HA   3  
ATOM   4026  H  HB2  . LYS A 1 39 ? 56.393 -5.787  -11.838 1.00 0.00  ? 39  LYS A HB2  3  
ATOM   4027  H  HB3  . LYS A 1 39 ? 57.861 -5.040  -12.460 1.00 0.00  ? 39  LYS A HB3  3  
ATOM   4028  H  HG2  . LYS A 1 39 ? 58.821 -5.995  -10.125 1.00 0.00  ? 39  LYS A HG2  3  
ATOM   4029  H  HG3  . LYS A 1 39 ? 57.538 -7.171  -10.411 1.00 0.00  ? 39  LYS A HG3  3  
ATOM   4030  H  HD2  . LYS A 1 39 ? 58.613 -8.103  -12.179 1.00 0.00  ? 39  LYS A HD2  3  
ATOM   4031  H  HD3  . LYS A 1 39 ? 59.149 -6.540  -12.797 1.00 0.00  ? 39  LYS A HD3  3  
ATOM   4032  H  HE2  . LYS A 1 39 ? 61.187 -7.489  -12.130 1.00 0.00  ? 39  LYS A HE2  3  
ATOM   4033  H  HE3  . LYS A 1 39 ? 60.733 -6.604  -10.660 1.00 0.00  ? 39  LYS A HE3  3  
ATOM   4034  H  HZ1  . LYS A 1 39 ? 59.569 -8.622  -9.894  1.00 0.00  ? 39  LYS A HZ1  3  
ATOM   4035  H  HZ2  . LYS A 1 39 ? 61.239 -8.878  -10.085 1.00 0.00  ? 39  LYS A HZ2  3  
ATOM   4036  H  HZ3  . LYS A 1 39 ? 60.149 -9.461  -11.251 1.00 0.00  ? 39  LYS A HZ3  3  
ATOM   4037  N  N    . GLU A 1 40 ? 56.868 -5.219  -8.423  1.00 0.00  ? 40  GLU A N    3  
ATOM   4038  C  CA   . GLU A 1 40 ? 56.074 -5.613  -7.211  1.00 0.00  ? 40  GLU A CA   3  
ATOM   4039  C  C    . GLU A 1 40 ? 55.565 -4.364  -6.477  1.00 0.00  ? 40  GLU A C    3  
ATOM   4040  O  O    . GLU A 1 40 ? 54.408 -4.281  -6.109  1.00 0.00  ? 40  GLU A O    3  
ATOM   4041  C  CB   . GLU A 1 40 ? 57.047 -6.397  -6.329  1.00 0.00  ? 40  GLU A CB   3  
ATOM   4042  C  CG   . GLU A 1 40 ? 57.051 -7.870  -6.754  1.00 0.00  ? 40  GLU A CG   3  
ATOM   4043  C  CD   . GLU A 1 40 ? 58.363 -8.203  -7.466  1.00 0.00  ? 40  GLU A CD   3  
ATOM   4044  O  OE1  . GLU A 1 40 ? 59.396 -8.129  -6.828  1.00 0.00  ? 40  GLU A OE1  3  
ATOM   4045  O  OE2  . GLU A 1 40 ? 58.314 -8.529  -8.638  1.00 0.00  ? 40  GLU A OE2  3  
ATOM   4046  H  H    . GLU A 1 40 ? 57.820 -5.444  -8.480  1.00 0.00  ? 40  GLU A H    3  
ATOM   4047  H  HA   . GLU A 1 40 ? 55.245 -6.243  -7.494  1.00 0.00  ? 40  GLU A HA   3  
ATOM   4048  H  HB2  . GLU A 1 40 ? 58.040 -5.987  -6.436  1.00 0.00  ? 40  GLU A HB2  3  
ATOM   4049  H  HB3  . GLU A 1 40 ? 56.736 -6.324  -5.297  1.00 0.00  ? 40  GLU A HB3  3  
ATOM   4050  H  HG2  . GLU A 1 40 ? 56.950 -8.494  -5.878  1.00 0.00  ? 40  GLU A HG2  3  
ATOM   4051  H  HG3  . GLU A 1 40 ? 56.224 -8.056  -7.424  1.00 0.00  ? 40  GLU A HG3  3  
ATOM   4052  N  N    . LEU A 1 41 ? 56.420 -3.391  -6.276  1.00 0.00  ? 41  LEU A N    3  
ATOM   4053  C  CA   . LEU A 1 41 ? 55.995 -2.132  -5.583  1.00 0.00  ? 41  LEU A CA   3  
ATOM   4054  C  C    . LEU A 1 41 ? 54.845 -1.476  -6.361  1.00 0.00  ? 41  LEU A C    3  
ATOM   4055  O  O    . LEU A 1 41 ? 53.753 -1.307  -5.851  1.00 0.00  ? 41  LEU A O    3  
ATOM   4056  C  CB   . LEU A 1 41 ? 57.242 -1.238  -5.609  1.00 0.00  ? 41  LEU A CB   3  
ATOM   4057  C  CG   . LEU A 1 41 ? 57.186 -0.174  -4.504  1.00 0.00  ? 41  LEU A CG   3  
ATOM   4058  C  CD1  . LEU A 1 41 ? 55.749 0.311   -4.282  1.00 0.00  ? 41  LEU A CD1  3  
ATOM   4059  C  CD2  . LEU A 1 41 ? 57.733 -0.761  -3.199  1.00 0.00  ? 41  LEU A CD2  3  
ATOM   4060  H  H    . LEU A 1 41 ? 57.345 -3.484  -6.592  1.00 0.00  ? 41  LEU A H    3  
ATOM   4061  H  HA   . LEU A 1 41 ? 55.702 -2.335  -4.566  1.00 0.00  ? 41  LEU A HA   3  
ATOM   4062  H  HB2  . LEU A 1 41 ? 58.120 -1.851  -5.465  1.00 0.00  ? 41  LEU A HB2  3  
ATOM   4063  H  HB3  . LEU A 1 41 ? 57.309 -0.747  -6.570  1.00 0.00  ? 41  LEU A HB3  3  
ATOM   4064  H  HG   . LEU A 1 41 ? 57.795 0.663   -4.805  1.00 0.00  ? 41  LEU A HG   3  
ATOM   4065  H  HD11 . LEU A 1 41 ? 55.142 -0.510  -3.933  1.00 0.00  ? 41  LEU A HD11 3  
ATOM   4066  H  HD12 . LEU A 1 41 ? 55.348 0.686   -5.212  1.00 0.00  ? 41  LEU A HD12 3  
ATOM   4067  H  HD13 . LEU A 1 41 ? 55.743 1.100   -3.545  1.00 0.00  ? 41  LEU A HD13 3  
ATOM   4068  H  HD21 . LEU A 1 41 ? 57.644 -1.837  -3.223  1.00 0.00  ? 41  LEU A HD21 3  
ATOM   4069  H  HD22 . LEU A 1 41 ? 57.167 -0.373  -2.365  1.00 0.00  ? 41  LEU A HD22 3  
ATOM   4070  H  HD23 . LEU A 1 41 ? 58.771 -0.487  -3.088  1.00 0.00  ? 41  LEU A HD23 3  
ATOM   4071  N  N    . GLY A 1 42 ? 55.099 -1.110  -7.594  1.00 0.00  ? 42  GLY A N    3  
ATOM   4072  C  CA   . GLY A 1 42 ? 54.051 -0.461  -8.448  1.00 0.00  ? 42  GLY A CA   3  
ATOM   4073  C  C    . GLY A 1 42 ? 52.734 -1.256  -8.406  1.00 0.00  ? 42  GLY A C    3  
ATOM   4074  O  O    . GLY A 1 42 ? 51.666 -0.680  -8.483  1.00 0.00  ? 42  GLY A O    3  
ATOM   4075  H  H    . GLY A 1 42 ? 55.996 -1.258  -7.960  1.00 0.00  ? 42  GLY A H    3  
ATOM   4076  H  HA2  . GLY A 1 42 ? 53.871 0.545   -8.087  1.00 0.00  ? 42  GLY A HA2  3  
ATOM   4077  H  HA3  . GLY A 1 42 ? 54.404 -0.418  -9.470  1.00 0.00  ? 42  GLY A HA3  3  
ATOM   4078  N  N    . LYS A 1 43 ? 52.796 -2.565  -8.287  1.00 0.00  ? 43  LYS A N    3  
ATOM   4079  C  CA   . LYS A 1 43 ? 51.533 -3.380  -8.240  1.00 0.00  ? 43  LYS A CA   3  
ATOM   4080  C  C    . LYS A 1 43 ? 50.632 -2.901  -7.094  1.00 0.00  ? 43  LYS A C    3  
ATOM   4081  O  O    . LYS A 1 43 ? 49.433 -2.771  -7.250  1.00 0.00  ? 43  LYS A O    3  
ATOM   4082  C  CB   . LYS A 1 43 ? 51.983 -4.825  -7.997  1.00 0.00  ? 43  LYS A CB   3  
ATOM   4083  C  CG   . LYS A 1 43 ? 50.835 -5.785  -8.334  1.00 0.00  ? 43  LYS A CG   3  
ATOM   4084  C  CD   . LYS A 1 43 ? 49.884 -5.898  -7.136  1.00 0.00  ? 43  LYS A CD   3  
ATOM   4085  C  CE   . LYS A 1 43 ? 49.452 -7.357  -6.957  1.00 0.00  ? 43  LYS A CE   3  
ATOM   4086  N  NZ   . LYS A 1 43 ? 48.788 -7.409  -5.621  1.00 0.00  ? 43  LYS A NZ   3  
ATOM   4087  H  H    . LYS A 1 43 ? 53.667 -3.011  -8.228  1.00 0.00  ? 43  LYS A H    3  
ATOM   4088  H  HA   . LYS A 1 43 ? 51.009 -3.313  -9.179  1.00 0.00  ? 43  LYS A HA   3  
ATOM   4089  H  HB2  . LYS A 1 43 ? 52.834 -5.046  -8.624  1.00 0.00  ? 43  LYS A HB2  3  
ATOM   4090  H  HB3  . LYS A 1 43 ? 52.259 -4.947  -6.960  1.00 0.00  ? 43  LYS A HB3  3  
ATOM   4091  H  HG2  . LYS A 1 43 ? 50.291 -5.409  -9.190  1.00 0.00  ? 43  LYS A HG2  3  
ATOM   4092  H  HG3  . LYS A 1 43 ? 51.237 -6.760  -8.564  1.00 0.00  ? 43  LYS A HG3  3  
ATOM   4093  H  HD2  . LYS A 1 43 ? 50.387 -5.556  -6.243  1.00 0.00  ? 43  LYS A HD2  3  
ATOM   4094  H  HD3  . LYS A 1 43 ? 49.011 -5.287  -7.313  1.00 0.00  ? 43  LYS A HD3  3  
ATOM   4095  H  HE2  . LYS A 1 43 ? 48.757 -7.640  -7.737  1.00 0.00  ? 43  LYS A HE2  3  
ATOM   4096  H  HE3  . LYS A 1 43 ? 50.313 -8.008  -6.967  1.00 0.00  ? 43  LYS A HE3  3  
ATOM   4097  H  HZ1  . LYS A 1 43 ? 48.754 -8.398  -5.292  1.00 0.00  ? 43  LYS A HZ1  3  
ATOM   4098  H  HZ2  . LYS A 1 43 ? 47.818 -7.041  -5.699  1.00 0.00  ? 43  LYS A HZ2  3  
ATOM   4099  H  HZ3  . LYS A 1 43 ? 49.322 -6.838  -4.937  1.00 0.00  ? 43  LYS A HZ3  3  
ATOM   4100  N  N    . VAL A 1 44 ? 51.202 -2.625  -5.950  1.00 0.00  ? 44  VAL A N    3  
ATOM   4101  C  CA   . VAL A 1 44 ? 50.378 -2.137  -4.803  1.00 0.00  ? 44  VAL A CA   3  
ATOM   4102  C  C    . VAL A 1 44 ? 50.029 -0.658  -5.023  1.00 0.00  ? 44  VAL A C    3  
ATOM   4103  O  O    . VAL A 1 44 ? 48.958 -0.205  -4.662  1.00 0.00  ? 44  VAL A O    3  
ATOM   4104  C  CB   . VAL A 1 44 ? 51.259 -2.324  -3.564  1.00 0.00  ? 44  VAL A CB   3  
ATOM   4105  C  CG1  . VAL A 1 44 ? 50.588 -1.678  -2.349  1.00 0.00  ? 44  VAL A CG1  3  
ATOM   4106  C  CG2  . VAL A 1 44 ? 51.444 -3.821  -3.298  1.00 0.00  ? 44  VAL A CG2  3  
ATOM   4107  H  H    . VAL A 1 44 ? 52.172 -2.726  -5.849  1.00 0.00  ? 44  VAL A H    3  
ATOM   4108  H  HA   . VAL A 1 44 ? 49.478 -2.724  -4.711  1.00 0.00  ? 44  VAL A HA   3  
ATOM   4109  H  HB   . VAL A 1 44 ? 52.223 -1.864  -3.731  1.00 0.00  ? 44  VAL A HB   3  
ATOM   4110  H  HG11 . VAL A 1 44 ? 50.788 -0.617  -2.349  1.00 0.00  ? 44  VAL A HG11 3  
ATOM   4111  H  HG12 . VAL A 1 44 ? 50.980 -2.118  -1.444  1.00 0.00  ? 44  VAL A HG12 3  
ATOM   4112  H  HG13 . VAL A 1 44 ? 49.522 -1.843  -2.397  1.00 0.00  ? 44  VAL A HG13 3  
ATOM   4113  H  HG21 . VAL A 1 44 ? 52.020 -4.261  -4.098  1.00 0.00  ? 44  VAL A HG21 3  
ATOM   4114  H  HG22 . VAL A 1 44 ? 50.477 -4.298  -3.249  1.00 0.00  ? 44  VAL A HG22 3  
ATOM   4115  H  HG23 . VAL A 1 44 ? 51.963 -3.961  -2.362  1.00 0.00  ? 44  VAL A HG23 3  
ATOM   4116  N  N    . MET A 1 45 ? 50.922 0.091   -5.632  1.00 0.00  ? 45  MET A N    3  
ATOM   4117  C  CA   . MET A 1 45 ? 50.647 1.538   -5.901  1.00 0.00  ? 45  MET A CA   3  
ATOM   4118  C  C    . MET A 1 45 ? 49.368 1.678   -6.742  1.00 0.00  ? 45  MET A C    3  
ATOM   4119  O  O    . MET A 1 45 ? 48.439 2.362   -6.352  1.00 0.00  ? 45  MET A O    3  
ATOM   4120  C  CB   . MET A 1 45 ? 51.871 2.045   -6.674  1.00 0.00  ? 45  MET A CB   3  
ATOM   4121  C  CG   . MET A 1 45 ? 53.063 2.184   -5.720  1.00 0.00  ? 45  MET A CG   3  
ATOM   4122  S  SD   . MET A 1 45 ? 53.931 3.737   -6.061  1.00 0.00  ? 45  MET A SD   3  
ATOM   4123  C  CE   . MET A 1 45 ? 54.529 4.049   -4.382  1.00 0.00  ? 45  MET A CE   3  
ATOM   4124  H  H    . MET A 1 45 ? 51.771 -0.305  -5.923  1.00 0.00  ? 45  MET A H    3  
ATOM   4125  H  HA   . MET A 1 45 ? 50.548 2.080   -4.973  1.00 0.00  ? 45  MET A HA   3  
ATOM   4126  H  HB2  . MET A 1 45 ? 52.117 1.345   -7.459  1.00 0.00  ? 45  MET A HB2  3  
ATOM   4127  H  HB3  . MET A 1 45 ? 51.647 3.008   -7.110  1.00 0.00  ? 45  MET A HB3  3  
ATOM   4128  H  HG2  . MET A 1 45 ? 52.711 2.186   -4.700  1.00 0.00  ? 45  MET A HG2  3  
ATOM   4129  H  HG3  . MET A 1 45 ? 53.739 1.354   -5.866  1.00 0.00  ? 45  MET A HG3  3  
ATOM   4130  H  HE1  . MET A 1 45 ? 54.584 5.116   -4.213  1.00 0.00  ? 45  MET A HE1  3  
ATOM   4131  H  HE2  . MET A 1 45 ? 55.509 3.618   -4.261  1.00 0.00  ? 45  MET A HE2  3  
ATOM   4132  H  HE3  . MET A 1 45 ? 53.850 3.603   -3.671  1.00 0.00  ? 45  MET A HE3  3  
ATOM   4133  N  N    . ARG A 1 46 ? 49.306 1.026   -7.883  1.00 0.00  ? 46  ARG A N    3  
ATOM   4134  C  CA   . ARG A 1 46 ? 48.072 1.116   -8.735  1.00 0.00  ? 46  ARG A CA   3  
ATOM   4135  C  C    . ARG A 1 46 ? 46.857 0.563   -7.973  1.00 0.00  ? 46  ARG A C    3  
ATOM   4136  O  O    . ARG A 1 46 ? 45.756 1.061   -8.114  1.00 0.00  ? 46  ARG A O    3  
ATOM   4137  C  CB   . ARG A 1 46 ? 48.363 0.288   -9.995  1.00 0.00  ? 46  ARG A CB   3  
ATOM   4138  C  CG   . ARG A 1 46 ? 48.622 -1.176  -9.629  1.00 0.00  ? 46  ARG A CG   3  
ATOM   4139  C  CD   . ARG A 1 46 ? 49.227 -1.903  -10.833 1.00 0.00  ? 46  ARG A CD   3  
ATOM   4140  N  NE   . ARG A 1 46 ? 50.544 -1.240  -11.058 1.00 0.00  ? 46  ARG A NE   3  
ATOM   4141  C  CZ   . ARG A 1 46 ? 50.980 -1.035  -12.268 1.00 0.00  ? 46  ARG A CZ   3  
ATOM   4142  N  NH1  . ARG A 1 46 ? 50.365 -0.195  -13.051 1.00 0.00  ? 46  ARG A NH1  3  
ATOM   4143  N  NH2  . ARG A 1 46 ? 52.033 -1.672  -12.690 1.00 0.00  ? 46  ARG A NH2  3  
ATOM   4144  H  H    . ARG A 1 46 ? 50.062 0.472   -8.172  1.00 0.00  ? 46  ARG A H    3  
ATOM   4145  H  HA   . ARG A 1 46 ? 47.891 2.144   -9.011  1.00 0.00  ? 46  ARG A HA   3  
ATOM   4146  H  HB2  . ARG A 1 46 ? 47.516 0.344   -10.663 1.00 0.00  ? 46  ARG A HB2  3  
ATOM   4147  H  HB3  . ARG A 1 46 ? 49.234 0.690   -10.491 1.00 0.00  ? 46  ARG A HB3  3  
ATOM   4148  H  HG2  . ARG A 1 46 ? 49.309 -1.221  -8.799  1.00 0.00  ? 46  ARG A HG2  3  
ATOM   4149  H  HG3  . ARG A 1 46 ? 47.692 -1.649  -9.355  1.00 0.00  ? 46  ARG A HG3  3  
ATOM   4150  H  HD2  . ARG A 1 46 ? 49.363 -2.952  -10.605 1.00 0.00  ? 46  ARG A HD2  3  
ATOM   4151  H  HD3  . ARG A 1 46 ? 48.597 -1.784  -11.701 1.00 0.00  ? 46  ARG A HD3  3  
ATOM   4152  H  HE   . ARG A 1 46 ? 51.083 -0.953  -10.291 1.00 0.00  ? 46  ARG A HE   3  
ATOM   4153  H  HH11 . ARG A 1 46 ? 49.555 0.294   -12.724 1.00 0.00  ? 46  ARG A HH11 3  
ATOM   4154  H  HH12 . ARG A 1 46 ? 50.702 -0.036  -13.978 1.00 0.00  ? 46  ARG A HH12 3  
ATOM   4155  H  HH21 . ARG A 1 46 ? 52.503 -2.315  -12.086 1.00 0.00  ? 46  ARG A HH21 3  
ATOM   4156  H  HH22 . ARG A 1 46 ? 52.373 -1.518  -13.616 1.00 0.00  ? 46  ARG A HH22 3  
ATOM   4157  N  N    . MET A 1 47 ? 47.051 -0.445  -7.148  1.00 0.00  ? 47  MET A N    3  
ATOM   4158  C  CA   . MET A 1 47 ? 45.906 -1.001  -6.356  1.00 0.00  ? 47  MET A CA   3  
ATOM   4159  C  C    . MET A 1 47 ? 45.342 0.094   -5.437  1.00 0.00  ? 47  MET A C    3  
ATOM   4160  O  O    . MET A 1 47 ? 44.156 0.149   -5.173  1.00 0.00  ? 47  MET A O    3  
ATOM   4161  C  CB   . MET A 1 47 ? 46.498 -2.150  -5.529  1.00 0.00  ? 47  MET A CB   3  
ATOM   4162  C  CG   . MET A 1 47 ? 45.386 -3.126  -5.135  1.00 0.00  ? 47  MET A CG   3  
ATOM   4163  S  SD   . MET A 1 47 ? 46.125 -4.667  -4.539  1.00 0.00  ? 47  MET A SD   3  
ATOM   4164  C  CE   . MET A 1 47 ? 46.168 -4.234  -2.782  1.00 0.00  ? 47  MET A CE   3  
ATOM   4165  H  H    . MET A 1 47 ? 47.950 -0.819  -7.035  1.00 0.00  ? 47  MET A H    3  
ATOM   4166  H  HA   . MET A 1 47 ? 45.136 -1.375  -7.014  1.00 0.00  ? 47  MET A HA   3  
ATOM   4167  H  HB2  . MET A 1 47 ? 47.241 -2.670  -6.116  1.00 0.00  ? 47  MET A HB2  3  
ATOM   4168  H  HB3  . MET A 1 47 ? 46.957 -1.752  -4.637  1.00 0.00  ? 47  MET A HB3  3  
ATOM   4169  H  HG2  . MET A 1 47 ? 44.782 -2.688  -4.353  1.00 0.00  ? 47  MET A HG2  3  
ATOM   4170  H  HG3  . MET A 1 47 ? 44.766 -3.332  -5.995  1.00 0.00  ? 47  MET A HG3  3  
ATOM   4171  H  HE1  . MET A 1 47 ? 46.682 -3.291  -2.657  1.00 0.00  ? 47  MET A HE1  3  
ATOM   4172  H  HE2  . MET A 1 47 ? 46.691 -5.002  -2.234  1.00 0.00  ? 47  MET A HE2  3  
ATOM   4173  H  HE3  . MET A 1 47 ? 45.157 -4.151  -2.408  1.00 0.00  ? 47  MET A HE3  3  
ATOM   4174  N  N    . LEU A 1 48 ? 46.194 0.975   -4.965  1.00 0.00  ? 48  LEU A N    3  
ATOM   4175  C  CA   . LEU A 1 48 ? 45.735 2.085   -4.080  1.00 0.00  ? 48  LEU A CA   3  
ATOM   4176  C  C    . LEU A 1 48 ? 45.237 3.266   -4.932  1.00 0.00  ? 48  LEU A C    3  
ATOM   4177  O  O    . LEU A 1 48 ? 44.223 3.866   -4.632  1.00 0.00  ? 48  LEU A O    3  
ATOM   4178  C  CB   . LEU A 1 48 ? 46.977 2.482   -3.272  1.00 0.00  ? 48  LEU A CB   3  
ATOM   4179  C  CG   . LEU A 1 48 ? 46.650 3.670   -2.363  1.00 0.00  ? 48  LEU A CG   3  
ATOM   4180  C  CD1  . LEU A 1 48 ? 46.065 3.164   -1.042  1.00 0.00  ? 48  LEU A CD1  3  
ATOM   4181  C  CD2  . LEU A 1 48 ? 47.928 4.464   -2.081  1.00 0.00  ? 48  LEU A CD2  3  
ATOM   4182  H  H    . LEU A 1 48 ? 47.141 0.911   -5.203  1.00 0.00  ? 48  LEU A H    3  
ATOM   4183  H  HA   . LEU A 1 48 ? 44.957 1.744   -3.416  1.00 0.00  ? 48  LEU A HA   3  
ATOM   4184  H  HB2  . LEU A 1 48 ? 47.296 1.644   -2.670  1.00 0.00  ? 48  LEU A HB2  3  
ATOM   4185  H  HB3  . LEU A 1 48 ? 47.771 2.759   -3.950  1.00 0.00  ? 48  LEU A HB3  3  
ATOM   4186  H  HG   . LEU A 1 48 ? 45.930 4.308   -2.854  1.00 0.00  ? 48  LEU A HG   3  
ATOM   4187  H  HD11 . LEU A 1 48 ? 45.561 3.975   -0.538  1.00 0.00  ? 48  LEU A HD11 3  
ATOM   4188  H  HD12 . LEU A 1 48 ? 46.861 2.791   -0.415  1.00 0.00  ? 48  LEU A HD12 3  
ATOM   4189  H  HD13 . LEU A 1 48 ? 45.360 2.371   -1.241  1.00 0.00  ? 48  LEU A HD13 3  
ATOM   4190  H  HD21 . LEU A 1 48 ? 48.597 4.382   -2.924  1.00 0.00  ? 48  LEU A HD21 3  
ATOM   4191  H  HD22 . LEU A 1 48 ? 48.410 4.069   -1.199  1.00 0.00  ? 48  LEU A HD22 3  
ATOM   4192  H  HD23 . LEU A 1 48 ? 47.678 5.502   -1.919  1.00 0.00  ? 48  LEU A HD23 3  
ATOM   4193  N  N    . GLY A 1 49 ? 45.939 3.604   -5.991  1.00 0.00  ? 49  GLY A N    3  
ATOM   4194  C  CA   . GLY A 1 49 ? 45.488 4.745   -6.848  1.00 0.00  ? 49  GLY A CA   3  
ATOM   4195  C  C    . GLY A 1 49 ? 46.570 5.124   -7.869  1.00 0.00  ? 49  GLY A C    3  
ATOM   4196  O  O    . GLY A 1 49 ? 46.377 4.989   -9.062  1.00 0.00  ? 49  GLY A O    3  
ATOM   4197  H  H    . GLY A 1 49 ? 46.756 3.109   -6.221  1.00 0.00  ? 49  GLY A H    3  
ATOM   4198  H  HA2  . GLY A 1 49 ? 44.586 4.457   -7.374  1.00 0.00  ? 49  GLY A HA2  3  
ATOM   4199  H  HA3  . GLY A 1 49 ? 45.280 5.600   -6.218  1.00 0.00  ? 49  GLY A HA3  3  
ATOM   4200  N  N    . GLN A 1 50 ? 47.697 5.616   -7.411  1.00 0.00  ? 50  GLN A N    3  
ATOM   4201  C  CA   . GLN A 1 50 ? 48.790 6.028   -8.358  1.00 0.00  ? 50  GLN A CA   3  
ATOM   4202  C  C    . GLN A 1 50 ? 49.256 4.843   -9.216  1.00 0.00  ? 50  GLN A C    3  
ATOM   4203  O  O    . GLN A 1 50 ? 49.440 3.748   -8.728  1.00 0.00  ? 50  GLN A O    3  
ATOM   4204  C  CB   . GLN A 1 50 ? 49.929 6.524   -7.462  1.00 0.00  ? 50  GLN A CB   3  
ATOM   4205  C  CG   . GLN A 1 50 ? 49.779 8.032   -7.238  1.00 0.00  ? 50  GLN A CG   3  
ATOM   4206  C  CD   . GLN A 1 50 ? 49.918 8.344   -5.748  1.00 0.00  ? 50  GLN A CD   3  
ATOM   4207  O  OE1  . GLN A 1 50 ? 50.958 8.780   -5.303  1.00 0.00  ? 50  GLN A OE1  3  
ATOM   4208  N  NE2  . GLN A 1 50 ? 48.907 8.138   -4.952  1.00 0.00  ? 50  GLN A NE2  3  
ATOM   4209  H  H    . GLN A 1 50 ? 47.821 5.727   -6.444  1.00 0.00  ? 50  GLN A H    3  
ATOM   4210  H  HA   . GLN A 1 50 ? 48.449 6.833   -8.990  1.00 0.00  ? 50  GLN A HA   3  
ATOM   4211  H  HB2  . GLN A 1 50 ? 49.889 6.011   -6.510  1.00 0.00  ? 50  GLN A HB2  3  
ATOM   4212  H  HB3  . GLN A 1 50 ? 50.877 6.326   -7.938  1.00 0.00  ? 50  GLN A HB3  3  
ATOM   4213  H  HG2  . GLN A 1 50 ? 50.546 8.556   -7.789  1.00 0.00  ? 50  GLN A HG2  3  
ATOM   4214  H  HG3  . GLN A 1 50 ? 48.806 8.353   -7.581  1.00 0.00  ? 50  GLN A HG3  3  
ATOM   4215  H  HE21 . GLN A 1 50 ? 48.066 7.784   -5.307  1.00 0.00  ? 50  GLN A HE21 3  
ATOM   4216  H  HE22 . GLN A 1 50 ? 48.990 8.335   -3.997  1.00 0.00  ? 50  GLN A HE22 3  
ATOM   4217  N  N    . ASN A 1 51 ? 49.450 5.060   -10.495 1.00 0.00  ? 51  ASN A N    3  
ATOM   4218  C  CA   . ASN A 1 51 ? 49.904 3.949   -11.391 1.00 0.00  ? 51  ASN A CA   3  
ATOM   4219  C  C    . ASN A 1 51 ? 51.267 4.282   -12.022 1.00 0.00  ? 51  ASN A C    3  
ATOM   4220  O  O    . ASN A 1 51 ? 51.342 4.671   -13.173 1.00 0.00  ? 51  ASN A O    3  
ATOM   4221  C  CB   . ASN A 1 51 ? 48.817 3.841   -12.467 1.00 0.00  ? 51  ASN A CB   3  
ATOM   4222  C  CG   . ASN A 1 51 ? 47.884 2.678   -12.136 1.00 0.00  ? 51  ASN A CG   3  
ATOM   4223  O  OD1  . ASN A 1 51 ? 48.064 1.582   -12.627 1.00 0.00  ? 51  ASN A OD1  3  
ATOM   4224  N  ND2  . ASN A 1 51 ? 46.888 2.867   -11.315 1.00 0.00  ? 51  ASN A ND2  3  
ATOM   4225  H  H    . ASN A 1 51 ? 49.298 5.955   -10.866 1.00 0.00  ? 51  ASN A H    3  
ATOM   4226  H  HA   . ASN A 1 51 ? 49.966 3.024   -10.840 1.00 0.00  ? 51  ASN A HA   3  
ATOM   4227  H  HB2  . ASN A 1 51 ? 48.250 4.760   -12.500 1.00 0.00  ? 51  ASN A HB2  3  
ATOM   4228  H  HB3  . ASN A 1 51 ? 49.277 3.668   -13.428 1.00 0.00  ? 51  ASN A HB3  3  
ATOM   4229  H  HD21 . ASN A 1 51 ? 46.742 3.750   -10.915 1.00 0.00  ? 51  ASN A HD21 3  
ATOM   4230  H  HD22 . ASN A 1 51 ? 46.286 2.126   -11.097 1.00 0.00  ? 51  ASN A HD22 3  
ATOM   4231  N  N    . PRO A 1 52 ? 52.307 4.117   -11.237 1.00 0.00  ? 52  PRO A N    3  
ATOM   4232  C  CA   . PRO A 1 52 ? 53.682 4.397   -11.721 1.00 0.00  ? 52  PRO A CA   3  
ATOM   4233  C  C    . PRO A 1 52 ? 54.233 3.205   -12.520 1.00 0.00  ? 52  PRO A C    3  
ATOM   4234  O  O    . PRO A 1 52 ? 53.723 2.101   -12.440 1.00 0.00  ? 52  PRO A O    3  
ATOM   4235  C  CB   . PRO A 1 52 ? 54.475 4.588   -10.434 1.00 0.00  ? 52  PRO A CB   3  
ATOM   4236  C  CG   . PRO A 1 52 ? 53.731 3.818   -9.385  1.00 0.00  ? 52  PRO A CG   3  
ATOM   4237  C  CD   . PRO A 1 52 ? 52.301 3.664   -9.841  1.00 0.00  ? 52  PRO A CD   3  
ATOM   4238  H  HA   . PRO A 1 52 ? 53.706 5.300   -12.310 1.00 0.00  ? 52  PRO A HA   3  
ATOM   4239  H  HB2  . PRO A 1 52 ? 55.476 4.195   -10.551 1.00 0.00  ? 52  PRO A HB2  3  
ATOM   4240  H  HB3  . PRO A 1 52 ? 54.511 5.632   -10.167 1.00 0.00  ? 52  PRO A HB3  3  
ATOM   4241  H  HG2  . PRO A 1 52 ? 54.183 2.844   -9.260  1.00 0.00  ? 52  PRO A HG2  3  
ATOM   4242  H  HG3  . PRO A 1 52 ? 53.756 4.357   -8.451  1.00 0.00  ? 52  PRO A HG3  3  
ATOM   4243  H  HD2  . PRO A 1 52 ? 51.996 2.628   -9.778  1.00 0.00  ? 52  PRO A HD2  3  
ATOM   4244  H  HD3  . PRO A 1 52 ? 51.649 4.288   -9.252  1.00 0.00  ? 52  PRO A HD3  3  
ATOM   4245  N  N    . THR A 1 53 ? 55.280 3.418   -13.277 1.00 0.00  ? 53  THR A N    3  
ATOM   4246  C  CA   . THR A 1 53 ? 55.879 2.299   -14.069 1.00 0.00  ? 53  THR A CA   3  
ATOM   4247  C  C    . THR A 1 53 ? 57.042 1.673   -13.288 1.00 0.00  ? 53  THR A C    3  
ATOM   4248  O  O    . THR A 1 53 ? 57.573 2.283   -12.378 1.00 0.00  ? 53  THR A O    3  
ATOM   4249  C  CB   . THR A 1 53 ? 56.396 2.944   -15.360 1.00 0.00  ? 53  THR A CB   3  
ATOM   4250  O  OG1  . THR A 1 53 ? 57.226 4.051   -15.038 1.00 0.00  ? 53  THR A OG1  3  
ATOM   4251  C  CG2  . THR A 1 53 ? 55.217 3.417   -16.215 1.00 0.00  ? 53  THR A CG2  3  
ATOM   4252  H  H    . THR A 1 53 ? 55.682 4.311   -13.318 1.00 0.00  ? 53  THR A H    3  
ATOM   4253  H  HA   . THR A 1 53 ? 55.132 1.556   -14.298 1.00 0.00  ? 53  THR A HA   3  
ATOM   4254  H  HB   . THR A 1 53 ? 56.968 2.220   -15.915 1.00 0.00  ? 53  THR A HB   3  
ATOM   4255  H  HG1  . THR A 1 53 ? 57.815 4.209   -15.780 1.00 0.00  ? 53  THR A HG1  3  
ATOM   4256  H  HG21 . THR A 1 53 ? 54.297 3.030   -15.806 1.00 0.00  ? 53  THR A HG21 3  
ATOM   4257  H  HG22 . THR A 1 53 ? 55.340 3.060   -17.227 1.00 0.00  ? 53  THR A HG22 3  
ATOM   4258  H  HG23 . THR A 1 53 ? 55.183 4.497   -16.216 1.00 0.00  ? 53  THR A HG23 3  
ATOM   4259  N  N    . PRO A 1 54 ? 57.415 0.477   -13.678 1.00 0.00  ? 54  PRO A N    3  
ATOM   4260  C  CA   . PRO A 1 54 ? 58.542 -0.228  -13.007 1.00 0.00  ? 54  PRO A CA   3  
ATOM   4261  C  C    . PRO A 1 54 ? 59.860 0.520   -13.255 1.00 0.00  ? 54  PRO A C    3  
ATOM   4262  O  O    . PRO A 1 54 ? 60.731 0.553   -12.406 1.00 0.00  ? 54  PRO A O    3  
ATOM   4263  C  CB   . PRO A 1 54 ? 58.536 -1.612  -13.655 1.00 0.00  ? 54  PRO A CB   3  
ATOM   4264  C  CG   . PRO A 1 54 ? 57.864 -1.411  -14.975 1.00 0.00  ? 54  PRO A CG   3  
ATOM   4265  C  CD   . PRO A 1 54 ? 56.845 -0.322  -14.772 1.00 0.00  ? 54  PRO A CD   3  
ATOM   4266  H  HA   . PRO A 1 54 ? 58.354 -0.316  -11.948 1.00 0.00  ? 54  PRO A HA   3  
ATOM   4267  H  HB2  . PRO A 1 54 ? 59.550 -1.964  -13.794 1.00 0.00  ? 54  PRO A HB2  3  
ATOM   4268  H  HB3  . PRO A 1 54 ? 57.972 -2.307  -13.055 1.00 0.00  ? 54  PRO A HB3  3  
ATOM   4269  H  HG2  . PRO A 1 54 ? 58.590 -1.111  -15.718 1.00 0.00  ? 54  PRO A HG2  3  
ATOM   4270  H  HG3  . PRO A 1 54 ? 57.370 -2.319  -15.282 1.00 0.00  ? 54  PRO A HG3  3  
ATOM   4271  H  HD2  . PRO A 1 54 ? 56.742 0.272   -15.669 1.00 0.00  ? 54  PRO A HD2  3  
ATOM   4272  H  HD3  . PRO A 1 54 ? 55.895 -0.738  -14.474 1.00 0.00  ? 54  PRO A HD3  3  
ATOM   4273  N  N    . GLU A 1 55 ? 59.998 1.144   -14.400 1.00 0.00  ? 55  GLU A N    3  
ATOM   4274  C  CA   . GLU A 1 55 ? 61.243 1.919   -14.694 1.00 0.00  ? 55  GLU A CA   3  
ATOM   4275  C  C    . GLU A 1 55 ? 61.324 3.130   -13.755 1.00 0.00  ? 55  GLU A C    3  
ATOM   4276  O  O    . GLU A 1 55 ? 62.382 3.484   -13.272 1.00 0.00  ? 55  GLU A O    3  
ATOM   4277  C  CB   . GLU A 1 55 ? 61.102 2.374   -16.148 1.00 0.00  ? 55  GLU A CB   3  
ATOM   4278  C  CG   . GLU A 1 55 ? 61.466 1.217   -17.085 1.00 0.00  ? 55  GLU A CG   3  
ATOM   4279  C  CD   . GLU A 1 55 ? 60.292 0.236   -17.195 1.00 0.00  ? 55  GLU A CD   3  
ATOM   4280  O  OE1  . GLU A 1 55 ? 59.177 0.689   -17.406 1.00 0.00  ? 55  GLU A OE1  3  
ATOM   4281  O  OE2  . GLU A 1 55 ? 60.529 -0.952  -17.058 1.00 0.00  ? 55  GLU A OE2  3  
ATOM   4282  H  H    . GLU A 1 55 ? 59.273 1.120   -15.059 1.00 0.00  ? 55  GLU A H    3  
ATOM   4283  H  HA   . GLU A 1 55 ? 62.115 1.293   -14.588 1.00 0.00  ? 55  GLU A HA   3  
ATOM   4284  H  HB2  . GLU A 1 55 ? 60.082 2.682   -16.331 1.00 0.00  ? 55  GLU A HB2  3  
ATOM   4285  H  HB3  . GLU A 1 55 ? 61.766 3.205   -16.332 1.00 0.00  ? 55  GLU A HB3  3  
ATOM   4286  H  HG2  . GLU A 1 55 ? 61.698 1.609   -18.060 1.00 0.00  ? 55  GLU A HG2  3  
ATOM   4287  H  HG3  . GLU A 1 55 ? 62.328 0.696   -16.696 1.00 0.00  ? 55  GLU A HG3  3  
ATOM   4288  N  N    . GLU A 1 56 ? 60.201 3.756   -13.485 1.00 0.00  ? 56  GLU A N    3  
ATOM   4289  C  CA   . GLU A 1 56 ? 60.188 4.936   -12.567 1.00 0.00  ? 56  GLU A CA   3  
ATOM   4290  C  C    . GLU A 1 56 ? 60.363 4.474   -11.111 1.00 0.00  ? 56  GLU A C    3  
ATOM   4291  O  O    . GLU A 1 56 ? 61.077 5.090   -10.342 1.00 0.00  ? 56  GLU A O    3  
ATOM   4292  C  CB   . GLU A 1 56 ? 58.812 5.583   -12.777 1.00 0.00  ? 56  GLU A CB   3  
ATOM   4293  C  CG   . GLU A 1 56 ? 58.605 6.719   -11.767 1.00 0.00  ? 56  GLU A CG   3  
ATOM   4294  C  CD   . GLU A 1 56 ? 57.350 6.443   -10.938 1.00 0.00  ? 56  GLU A CD   3  
ATOM   4295  O  OE1  . GLU A 1 56 ? 57.466 5.768   -9.929  1.00 0.00  ? 56  GLU A OE1  3  
ATOM   4296  O  OE2  . GLU A 1 56 ? 56.294 6.909   -11.329 1.00 0.00  ? 56  GLU A OE2  3  
ATOM   4297  H  H    . GLU A 1 56 ? 59.361 3.439   -13.881 1.00 0.00  ? 56  GLU A H    3  
ATOM   4298  H  HA   . GLU A 1 56 ? 60.967 5.632   -12.837 1.00 0.00  ? 56  GLU A HA   3  
ATOM   4299  H  HB2  . GLU A 1 56 ? 58.754 5.981   -13.780 1.00 0.00  ? 56  GLU A HB2  3  
ATOM   4300  H  HB3  . GLU A 1 56 ? 58.041 4.839   -12.642 1.00 0.00  ? 56  GLU A HB3  3  
ATOM   4301  H  HG2  . GLU A 1 56 ? 59.462 6.781   -11.112 1.00 0.00  ? 56  GLU A HG2  3  
ATOM   4302  H  HG3  . GLU A 1 56 ? 58.487 7.653   -12.294 1.00 0.00  ? 56  GLU A HG3  3  
ATOM   4303  N  N    . LEU A 1 57 ? 59.724 3.389   -10.729 1.00 0.00  ? 57  LEU A N    3  
ATOM   4304  C  CA   . LEU A 1 57 ? 59.864 2.889   -9.322  1.00 0.00  ? 57  LEU A CA   3  
ATOM   4305  C  C    . LEU A 1 57 ? 61.322 2.501   -9.019  1.00 0.00  ? 57  LEU A C    3  
ATOM   4306  O  O    . LEU A 1 57 ? 61.719 2.441   -7.870  1.00 0.00  ? 57  LEU A O    3  
ATOM   4307  C  CB   . LEU A 1 57 ? 58.952 1.663   -9.223  1.00 0.00  ? 57  LEU A CB   3  
ATOM   4308  C  CG   . LEU A 1 57 ? 57.486 2.108   -9.207  1.00 0.00  ? 57  LEU A CG   3  
ATOM   4309  C  CD1  . LEU A 1 57 ? 56.625 1.064   -9.917  1.00 0.00  ? 57  LEU A CD1  3  
ATOM   4310  C  CD2  . LEU A 1 57 ? 57.007 2.251   -7.760  1.00 0.00  ? 57  LEU A CD2  3  
ATOM   4311  H  H    . LEU A 1 57 ? 59.157 2.904   -11.366 1.00 0.00  ? 57  LEU A H    3  
ATOM   4312  H  HA   . LEU A 1 57 ? 59.532 3.644   -8.627  1.00 0.00  ? 57  LEU A HA   3  
ATOM   4313  H  HB2  . LEU A 1 57 ? 59.125 1.014   -10.070 1.00 0.00  ? 57  LEU A HB2  3  
ATOM   4314  H  HB3  . LEU A 1 57 ? 59.173 1.129   -8.309  1.00 0.00  ? 57  LEU A HB3  3  
ATOM   4315  H  HG   . LEU A 1 57 ? 57.391 3.058   -9.715  1.00 0.00  ? 57  LEU A HG   3  
ATOM   4316  H  HD11 . LEU A 1 57 ? 55.869 1.562   -10.506 1.00 0.00  ? 57  LEU A HD11 3  
ATOM   4317  H  HD12 . LEU A 1 57 ? 56.150 0.432   -9.183  1.00 0.00  ? 57  LEU A HD12 3  
ATOM   4318  H  HD13 . LEU A 1 57 ? 57.246 0.462   -10.562 1.00 0.00  ? 57  LEU A HD13 3  
ATOM   4319  H  HD21 . LEU A 1 57 ? 56.685 1.288   -7.390  1.00 0.00  ? 57  LEU A HD21 3  
ATOM   4320  H  HD22 . LEU A 1 57 ? 56.180 2.945   -7.723  1.00 0.00  ? 57  LEU A HD22 3  
ATOM   4321  H  HD23 . LEU A 1 57 ? 57.815 2.620   -7.146  1.00 0.00  ? 57  LEU A HD23 3  
ATOM   4322  N  N    . GLN A 1 58 ? 62.129 2.252   -10.031 1.00 0.00  ? 58  GLN A N    3  
ATOM   4323  C  CA   . GLN A 1 58 ? 63.558 1.891   -9.773  1.00 0.00  ? 58  GLN A CA   3  
ATOM   4324  C  C    . GLN A 1 58 ? 64.239 3.043   -9.014  1.00 0.00  ? 58  GLN A C    3  
ATOM   4325  O  O    . GLN A 1 58 ? 65.032 2.820   -8.121  1.00 0.00  ? 58  GLN A O    3  
ATOM   4326  C  CB   . GLN A 1 58 ? 64.168 1.636   -11.168 1.00 0.00  ? 58  GLN A CB   3  
ATOM   4327  C  CG   . GLN A 1 58 ? 65.259 2.660   -11.516 1.00 0.00  ? 58  GLN A CG   3  
ATOM   4328  C  CD   . GLN A 1 58 ? 66.640 2.042   -11.285 1.00 0.00  ? 58  GLN A CD   3  
ATOM   4329  O  OE1  . GLN A 1 58 ? 67.217 1.467   -12.183 1.00 0.00  ? 58  GLN A OE1  3  
ATOM   4330  N  NE2  . GLN A 1 58 ? 67.197 2.133   -10.110 1.00 0.00  ? 58  GLN A NE2  3  
ATOM   4331  H  H    . GLN A 1 58 ? 61.800 2.314   -10.952 1.00 0.00  ? 58  GLN A H    3  
ATOM   4332  H  HA   . GLN A 1 58 ? 63.607 0.988   -9.183  1.00 0.00  ? 58  GLN A HA   3  
ATOM   4333  H  HB2  . GLN A 1 58 ? 64.599 0.646   -11.186 1.00 0.00  ? 58  GLN A HB2  3  
ATOM   4334  H  HB3  . GLN A 1 58 ? 63.386 1.690   -11.912 1.00 0.00  ? 58  GLN A HB3  3  
ATOM   4335  H  HG2  . GLN A 1 58 ? 65.160 2.939   -12.553 1.00 0.00  ? 58  GLN A HG2  3  
ATOM   4336  H  HG3  . GLN A 1 58 ? 65.152 3.537   -10.902 1.00 0.00  ? 58  GLN A HG3  3  
ATOM   4337  H  HE21 . GLN A 1 58 ? 66.735 2.594   -9.379  1.00 0.00  ? 58  GLN A HE21 3  
ATOM   4338  H  HE22 . GLN A 1 58 ? 68.082 1.740   -9.957  1.00 0.00  ? 58  GLN A HE22 3  
ATOM   4339  N  N    . GLU A 1 59 ? 63.902 4.270   -9.343  1.00 0.00  ? 59  GLU A N    3  
ATOM   4340  C  CA   . GLU A 1 59 ? 64.495 5.436   -8.616  1.00 0.00  ? 59  GLU A CA   3  
ATOM   4341  C  C    . GLU A 1 59 ? 63.864 5.525   -7.222  1.00 0.00  ? 59  GLU A C    3  
ATOM   4342  O  O    . GLU A 1 59 ? 64.518 5.861   -6.253  1.00 0.00  ? 59  GLU A O    3  
ATOM   4343  C  CB   . GLU A 1 59 ? 64.134 6.668   -9.451  1.00 0.00  ? 59  GLU A CB   3  
ATOM   4344  C  CG   . GLU A 1 59 ? 65.191 6.882   -10.539 1.00 0.00  ? 59  GLU A CG   3  
ATOM   4345  C  CD   . GLU A 1 59 ? 64.570 6.638   -11.917 1.00 0.00  ? 59  GLU A CD   3  
ATOM   4346  O  OE1  . GLU A 1 59 ? 64.583 5.502   -12.358 1.00 0.00  ? 59  GLU A OE1  3  
ATOM   4347  O  OE2  . GLU A 1 59 ? 64.095 7.594   -12.508 1.00 0.00  ? 59  GLU A OE2  3  
ATOM   4348  H  H    . GLU A 1 59 ? 63.238 4.423   -10.050 1.00 0.00  ? 59  GLU A H    3  
ATOM   4349  H  HA   . GLU A 1 59 ? 65.567 5.333   -8.542  1.00 0.00  ? 59  GLU A HA   3  
ATOM   4350  H  HB2  . GLU A 1 59 ? 63.166 6.520   -9.912  1.00 0.00  ? 59  GLU A HB2  3  
ATOM   4351  H  HB3  . GLU A 1 59 ? 64.098 7.537   -8.813  1.00 0.00  ? 59  GLU A HB3  3  
ATOM   4352  H  HG2  . GLU A 1 59 ? 65.561 7.895   -10.485 1.00 0.00  ? 59  GLU A HG2  3  
ATOM   4353  H  HG3  . GLU A 1 59 ? 66.008 6.192   -10.389 1.00 0.00  ? 59  GLU A HG3  3  
ATOM   4354  N  N    . MET A 1 60 ? 62.593 5.202   -7.120  1.00 0.00  ? 60  MET A N    3  
ATOM   4355  C  CA   . MET A 1 60 ? 61.900 5.239   -5.794  1.00 0.00  ? 60  MET A CA   3  
ATOM   4356  C  C    . MET A 1 60 ? 62.610 4.295   -4.813  1.00 0.00  ? 60  MET A C    3  
ATOM   4357  O  O    . MET A 1 60 ? 62.831 4.633   -3.667  1.00 0.00  ? 60  MET A O    3  
ATOM   4358  C  CB   . MET A 1 60 ? 60.468 4.758   -6.072  1.00 0.00  ? 60  MET A CB   3  
ATOM   4359  C  CG   . MET A 1 60 ? 59.750 5.767   -6.977  1.00 0.00  ? 60  MET A CG   3  
ATOM   4360  S  SD   . MET A 1 60 ? 58.374 6.523   -6.075  1.00 0.00  ? 60  MET A SD   3  
ATOM   4361  C  CE   . MET A 1 60 ? 57.094 5.345   -6.575  1.00 0.00  ? 60  MET A CE   3  
ATOM   4362  H  H    . MET A 1 60 ? 62.099 4.922   -7.918  1.00 0.00  ? 60  MET A H    3  
ATOM   4363  H  HA   . MET A 1 60 ? 61.883 6.244   -5.403  1.00 0.00  ? 60  MET A HA   3  
ATOM   4364  H  HB2  . MET A 1 60 ? 60.499 3.793   -6.563  1.00 0.00  ? 60  MET A HB2  3  
ATOM   4365  H  HB3  . MET A 1 60 ? 59.932 4.669   -5.140  1.00 0.00  ? 60  MET A HB3  3  
ATOM   4366  H  HG2  . MET A 1 60 ? 60.445 6.536   -7.280  1.00 0.00  ? 60  MET A HG2  3  
ATOM   4367  H  HG3  . MET A 1 60 ? 59.373 5.260   -7.852  1.00 0.00  ? 60  MET A HG3  3  
ATOM   4368  H  HE1  . MET A 1 60 ? 57.377 4.883   -7.510  1.00 0.00  ? 60  MET A HE1  3  
ATOM   4369  H  HE2  . MET A 1 60 ? 56.157 5.861   -6.702  1.00 0.00  ? 60  MET A HE2  3  
ATOM   4370  H  HE3  . MET A 1 60 ? 56.985 4.589   -5.811  1.00 0.00  ? 60  MET A HE3  3  
ATOM   4371  N  N    . ILE A 1 61 ? 62.983 3.121   -5.266  1.00 0.00  ? 61  ILE A N    3  
ATOM   4372  C  CA   . ILE A 1 61 ? 63.696 2.156   -4.370  1.00 0.00  ? 61  ILE A CA   3  
ATOM   4373  C  C    . ILE A 1 61 ? 65.166 2.581   -4.206  1.00 0.00  ? 61  ILE A C    3  
ATOM   4374  O  O    . ILE A 1 61 ? 65.712 2.538   -3.120  1.00 0.00  ? 61  ILE A O    3  
ATOM   4375  C  CB   . ILE A 1 61 ? 63.579 0.792   -5.078  1.00 0.00  ? 61  ILE A CB   3  
ATOM   4376  C  CG1  . ILE A 1 61 ? 62.283 0.106   -4.627  1.00 0.00  ? 61  ILE A CG1  3  
ATOM   4377  C  CG2  . ILE A 1 61 ? 64.783 -0.096  -4.729  1.00 0.00  ? 61  ILE A CG2  3  
ATOM   4378  C  CD1  . ILE A 1 61 ? 62.181 -1.298  -5.247  1.00 0.00  ? 61  ILE A CD1  3  
ATOM   4379  H  H    . ILE A 1 61 ? 62.803 2.878   -6.199  1.00 0.00  ? 61  ILE A H    3  
ATOM   4380  H  HA   . ILE A 1 61 ? 63.211 2.114   -3.408  1.00 0.00  ? 61  ILE A HA   3  
ATOM   4381  H  HB   . ILE A 1 61 ? 63.550 0.946   -6.148  1.00 0.00  ? 61  ILE A HB   3  
ATOM   4382  H  HG12 . ILE A 1 61 ? 62.278 0.027   -3.549  1.00 0.00  ? 61  ILE A HG12 3  
ATOM   4383  H  HG13 . ILE A 1 61 ? 61.438 0.700   -4.945  1.00 0.00  ? 61  ILE A HG13 3  
ATOM   4384  H  HG21 . ILE A 1 61 ? 65.697 0.449   -4.909  1.00 0.00  ? 61  ILE A HG21 3  
ATOM   4385  H  HG22 . ILE A 1 61 ? 64.770 -0.981  -5.347  1.00 0.00  ? 61  ILE A HG22 3  
ATOM   4386  H  HG23 . ILE A 1 61 ? 64.733 -0.381  -3.691  1.00 0.00  ? 61  ILE A HG23 3  
ATOM   4387  H  HD11 . ILE A 1 61 ? 62.659 -1.301  -6.216  1.00 0.00  ? 61  ILE A HD11 3  
ATOM   4388  H  HD12 . ILE A 1 61 ? 61.142 -1.569  -5.360  1.00 0.00  ? 61  ILE A HD12 3  
ATOM   4389  H  HD13 . ILE A 1 61 ? 62.670 -2.016  -4.601  1.00 0.00  ? 61  ILE A HD13 3  
ATOM   4390  N  N    . ASP A 1 62 ? 65.805 2.992   -5.279  1.00 0.00  ? 62  ASP A N    3  
ATOM   4391  C  CA   . ASP A 1 62 ? 67.241 3.424   -5.197  1.00 0.00  ? 62  ASP A CA   3  
ATOM   4392  C  C    . ASP A 1 62 ? 67.407 4.592   -4.212  1.00 0.00  ? 62  ASP A C    3  
ATOM   4393  O  O    . ASP A 1 62 ? 68.431 4.725   -3.570  1.00 0.00  ? 62  ASP A O    3  
ATOM   4394  C  CB   . ASP A 1 62 ? 67.605 3.867   -6.619  1.00 0.00  ? 62  ASP A CB   3  
ATOM   4395  C  CG   . ASP A 1 62 ? 68.515 2.824   -7.272  1.00 0.00  ? 62  ASP A CG   3  
ATOM   4396  O  OD1  . ASP A 1 62 ? 68.132 1.665   -7.306  1.00 0.00  ? 62  ASP A OD1  3  
ATOM   4397  O  OD2  . ASP A 1 62 ? 69.579 3.202   -7.731  1.00 0.00  ? 62  ASP A OD2  3  
ATOM   4398  H  H    . ASP A 1 62 ? 65.339 3.016   -6.141  1.00 0.00  ? 62  ASP A H    3  
ATOM   4399  H  HA   . ASP A 1 62 ? 67.864 2.594   -4.902  1.00 0.00  ? 62  ASP A HA   3  
ATOM   4400  H  HB2  . ASP A 1 62 ? 66.705 3.976   -7.206  1.00 0.00  ? 62  ASP A HB2  3  
ATOM   4401  H  HB3  . ASP A 1 62 ? 68.122 4.815   -6.579  1.00 0.00  ? 62  ASP A HB3  3  
ATOM   4402  N  N    . GLU A 1 63 ? 66.404 5.430   -4.092  1.00 0.00  ? 63  GLU A N    3  
ATOM   4403  C  CA   . GLU A 1 63 ? 66.484 6.595   -3.151  1.00 0.00  ? 63  GLU A CA   3  
ATOM   4404  C  C    . GLU A 1 63 ? 66.857 6.135   -1.730  1.00 0.00  ? 63  GLU A C    3  
ATOM   4405  O  O    . GLU A 1 63 ? 67.553 6.827   -1.012  1.00 0.00  ? 63  GLU A O    3  
ATOM   4406  C  CB   . GLU A 1 63 ? 65.077 7.201   -3.165  1.00 0.00  ? 63  GLU A CB   3  
ATOM   4407  C  CG   . GLU A 1 63 ? 65.099 8.583   -2.502  1.00 0.00  ? 63  GLU A CG   3  
ATOM   4408  C  CD   . GLU A 1 63 ? 63.818 8.781   -1.687  1.00 0.00  ? 63  GLU A CD   3  
ATOM   4409  O  OE1  . GLU A 1 63 ? 63.804 8.375   -0.536  1.00 0.00  ? 63  GLU A OE1  3  
ATOM   4410  O  OE2  . GLU A 1 63 ? 62.874 9.334   -2.227  1.00 0.00  ? 63  GLU A OE2  3  
ATOM   4411  H  H    . GLU A 1 63 ? 65.592 5.292   -4.625  1.00 0.00  ? 63  GLU A H    3  
ATOM   4412  H  HA   . GLU A 1 63 ? 67.198 7.319   -3.509  1.00 0.00  ? 63  GLU A HA   3  
ATOM   4413  H  HB2  . GLU A 1 63 ? 64.738 7.299   -4.187  1.00 0.00  ? 63  GLU A HB2  3  
ATOM   4414  H  HB3  . GLU A 1 63 ? 64.401 6.554   -2.623  1.00 0.00  ? 63  GLU A HB3  3  
ATOM   4415  H  HG2  . GLU A 1 63 ? 65.956 8.655   -1.848  1.00 0.00  ? 63  GLU A HG2  3  
ATOM   4416  H  HG3  . GLU A 1 63 ? 65.160 9.347   -3.262  1.00 0.00  ? 63  GLU A HG3  3  
ATOM   4417  N  N    . VAL A 1 64 ? 66.400 4.977   -1.322  1.00 0.00  ? 64  VAL A N    3  
ATOM   4418  C  CA   . VAL A 1 64 ? 66.730 4.478   0.050   1.00 0.00  ? 64  VAL A CA   3  
ATOM   4419  C  C    . VAL A 1 64 ? 67.523 3.154   -0.014  1.00 0.00  ? 64  VAL A C    3  
ATOM   4420  O  O    . VAL A 1 64 ? 67.627 2.443   0.968   1.00 0.00  ? 64  VAL A O    3  
ATOM   4421  C  CB   . VAL A 1 64 ? 65.364 4.280   0.727   1.00 0.00  ? 64  VAL A CB   3  
ATOM   4422  C  CG1  . VAL A 1 64 ? 64.654 3.060   0.132   1.00 0.00  ? 64  VAL A CG1  3  
ATOM   4423  C  CG2  . VAL A 1 64 ? 65.557 4.069   2.230   1.00 0.00  ? 64  VAL A CG2  3  
ATOM   4424  H  H    . VAL A 1 64 ? 65.839 4.436   -1.917  1.00 0.00  ? 64  VAL A H    3  
ATOM   4425  H  HA   . VAL A 1 64 ? 67.297 5.221   0.588   1.00 0.00  ? 64  VAL A HA   3  
ATOM   4426  H  HB   . VAL A 1 64 ? 64.757 5.160   0.564   1.00 0.00  ? 64  VAL A HB   3  
ATOM   4427  H  HG11 . VAL A 1 64 ? 63.713 2.909   0.638   1.00 0.00  ? 64  VAL A HG11 3  
ATOM   4428  H  HG12 . VAL A 1 64 ? 65.273 2.184   0.257   1.00 0.00  ? 64  VAL A HG12 3  
ATOM   4429  H  HG13 . VAL A 1 64 ? 64.474 3.228   -0.920  1.00 0.00  ? 64  VAL A HG13 3  
ATOM   4430  H  HG21 . VAL A 1 64 ? 64.650 4.341   2.749   1.00 0.00  ? 64  VAL A HG21 3  
ATOM   4431  H  HG22 . VAL A 1 64 ? 66.371 4.687   2.580   1.00 0.00  ? 64  VAL A HG22 3  
ATOM   4432  H  HG23 . VAL A 1 64 ? 65.785 3.030   2.423   1.00 0.00  ? 64  VAL A HG23 3  
ATOM   4433  N  N    . ASP A 1 65 ? 68.090 2.820   -1.153  1.00 0.00  ? 65  ASP A N    3  
ATOM   4434  C  CA   . ASP A 1 65 ? 68.874 1.548   -1.255  1.00 0.00  ? 65  ASP A CA   3  
ATOM   4435  C  C    . ASP A 1 65 ? 70.362 1.819   -0.965  1.00 0.00  ? 65  ASP A C    3  
ATOM   4436  O  O    . ASP A 1 65 ? 70.796 1.726   0.168   1.00 0.00  ? 65  ASP A O    3  
ATOM   4437  C  CB   . ASP A 1 65 ? 68.653 1.049   -2.694  1.00 0.00  ? 65  ASP A CB   3  
ATOM   4438  C  CG   . ASP A 1 65 ? 69.298 -0.331  -2.866  1.00 0.00  ? 65  ASP A CG   3  
ATOM   4439  O  OD1  . ASP A 1 65 ? 68.689 -1.302  -2.452  1.00 0.00  ? 65  ASP A OD1  3  
ATOM   4440  O  OD2  . ASP A 1 65 ? 70.389 -0.395  -3.408  1.00 0.00  ? 65  ASP A OD2  3  
ATOM   4441  H  H    . ASP A 1 65 ? 68.006 3.406   -1.934  1.00 0.00  ? 65  ASP A H    3  
ATOM   4442  H  HA   . ASP A 1 65 ? 68.489 0.822   -0.556  1.00 0.00  ? 65  ASP A HA   3  
ATOM   4443  H  HB2  . ASP A 1 65 ? 67.593 0.974   -2.888  1.00 0.00  ? 65  ASP A HB2  3  
ATOM   4444  H  HB3  . ASP A 1 65 ? 69.096 1.741   -3.392  1.00 0.00  ? 65  ASP A HB3  3  
ATOM   4445  N  N    . GLU A 1 66 ? 71.141 2.163   -1.973  1.00 0.00  ? 66  GLU A N    3  
ATOM   4446  C  CA   . GLU A 1 66 ? 72.602 2.450   -1.762  1.00 0.00  ? 66  GLU A CA   3  
ATOM   4447  C  C    . GLU A 1 66 ? 73.274 1.348   -0.916  1.00 0.00  ? 66  GLU A C    3  
ATOM   4448  O  O    . GLU A 1 66 ? 74.115 1.627   -0.080  1.00 0.00  ? 66  GLU A O    3  
ATOM   4449  C  CB   . GLU A 1 66 ? 72.635 3.801   -1.030  1.00 0.00  ? 66  GLU A CB   3  
ATOM   4450  C  CG   . GLU A 1 66 ? 73.047 4.908   -2.007  1.00 0.00  ? 66  GLU A CG   3  
ATOM   4451  C  CD   . GLU A 1 66 ? 72.801 6.278   -1.368  1.00 0.00  ? 66  GLU A CD   3  
ATOM   4452  O  OE1  . GLU A 1 66 ? 71.698 6.783   -1.498  1.00 0.00  ? 66  GLU A OE1  3  
ATOM   4453  O  OE2  . GLU A 1 66 ? 73.717 6.800   -0.753  1.00 0.00  ? 66  GLU A OE2  3  
ATOM   4454  H  H    . GLU A 1 66 ? 70.765 2.239   -2.872  1.00 0.00  ? 66  GLU A H    3  
ATOM   4455  H  HA   . GLU A 1 66 ? 73.101 2.541   -2.713  1.00 0.00  ? 66  GLU A HA   3  
ATOM   4456  H  HB2  . GLU A 1 66 ? 71.653 4.019   -0.633  1.00 0.00  ? 66  GLU A HB2  3  
ATOM   4457  H  HB3  . GLU A 1 66 ? 73.347 3.755   -0.220  1.00 0.00  ? 66  GLU A HB3  3  
ATOM   4458  H  HG2  . GLU A 1 66 ? 74.096 4.805   -2.245  1.00 0.00  ? 66  GLU A HG2  3  
ATOM   4459  H  HG3  . GLU A 1 66 ? 72.464 4.827   -2.912  1.00 0.00  ? 66  GLU A HG3  3  
ATOM   4460  N  N    . ASP A 1 67 ? 72.912 0.102   -1.124  1.00 0.00  ? 67  ASP A N    3  
ATOM   4461  C  CA   . ASP A 1 67 ? 73.533 -1.004  -0.323  1.00 0.00  ? 67  ASP A CA   3  
ATOM   4462  C  C    . ASP A 1 67 ? 74.369 -1.945  -1.214  1.00 0.00  ? 67  ASP A C    3  
ATOM   4463  O  O    . ASP A 1 67 ? 75.367 -2.487  -0.776  1.00 0.00  ? 67  ASP A O    3  
ATOM   4464  C  CB   . ASP A 1 67 ? 72.349 -1.739  0.334   1.00 0.00  ? 67  ASP A CB   3  
ATOM   4465  C  CG   . ASP A 1 67 ? 71.780 -2.812  -0.598  1.00 0.00  ? 67  ASP A CG   3  
ATOM   4466  O  OD1  . ASP A 1 67 ? 71.341 -2.464  -1.678  1.00 0.00  ? 67  ASP A OD1  3  
ATOM   4467  O  OD2  . ASP A 1 67 ? 71.774 -3.965  -0.207  1.00 0.00  ? 67  ASP A OD2  3  
ATOM   4468  H  H    . ASP A 1 67 ? 72.232 -0.106  -1.800  1.00 0.00  ? 67  ASP A H    3  
ATOM   4469  H  HA   . ASP A 1 67 ? 74.162 -0.585  0.446   1.00 0.00  ? 67  ASP A HA   3  
ATOM   4470  H  HB2  . ASP A 1 67 ? 72.686 -2.207  1.247   1.00 0.00  ? 67  ASP A HB2  3  
ATOM   4471  H  HB3  . ASP A 1 67 ? 71.573 -1.024  0.568   1.00 0.00  ? 67  ASP A HB3  3  
ATOM   4472  N  N    . GLY A 1 68 ? 73.978 -2.145  -2.453  1.00 0.00  ? 68  GLY A N    3  
ATOM   4473  C  CA   . GLY A 1 68 ? 74.764 -3.050  -3.349  1.00 0.00  ? 68  GLY A CA   3  
ATOM   4474  C  C    . GLY A 1 68 ? 73.826 -3.902  -4.216  1.00 0.00  ? 68  GLY A C    3  
ATOM   4475  O  O    . GLY A 1 68 ? 74.169 -4.268  -5.323  1.00 0.00  ? 68  GLY A O    3  
ATOM   4476  H  H    . GLY A 1 68 ? 73.173 -1.701  -2.791  1.00 0.00  ? 68  GLY A H    3  
ATOM   4477  H  HA2  . GLY A 1 68 ? 75.398 -2.457  -3.990  1.00 0.00  ? 68  GLY A HA2  3  
ATOM   4478  H  HA3  . GLY A 1 68 ? 75.379 -3.704  -2.747  1.00 0.00  ? 68  GLY A HA3  3  
ATOM   4479  N  N    . SER A 1 69 ? 72.657 -4.232  -3.724  1.00 0.00  ? 69  SER A N    3  
ATOM   4480  C  CA   . SER A 1 69 ? 71.716 -5.075  -4.531  1.00 0.00  ? 69  SER A CA   3  
ATOM   4481  C  C    . SER A 1 69 ? 70.728 -4.217  -5.338  1.00 0.00  ? 69  SER A C    3  
ATOM   4482  O  O    . SER A 1 69 ? 70.277 -4.632  -6.388  1.00 0.00  ? 69  SER A O    3  
ATOM   4483  C  CB   . SER A 1 69 ? 70.963 -5.949  -3.520  1.00 0.00  ? 69  SER A CB   3  
ATOM   4484  O  OG   . SER A 1 69 ? 70.505 -5.150  -2.434  1.00 0.00  ? 69  SER A OG   3  
ATOM   4485  H  H    . SER A 1 69 ? 72.402 -3.937  -2.825  1.00 0.00  ? 69  SER A H    3  
ATOM   4486  H  HA   . SER A 1 69 ? 72.276 -5.709  -5.200  1.00 0.00  ? 69  SER A HA   3  
ATOM   4487  H  HB2  . SER A 1 69 ? 70.115 -6.405  -4.003  1.00 0.00  ? 69  SER A HB2  3  
ATOM   4488  H  HB3  . SER A 1 69 ? 71.624 -6.726  -3.157  1.00 0.00  ? 69  SER A HB3  3  
ATOM   4489  H  HG   . SER A 1 69 ? 71.049 -5.358  -1.665  1.00 0.00  ? 69  SER A HG   3  
ATOM   4490  N  N    . GLY A 1 70 ? 70.369 -3.041  -4.869  1.00 0.00  ? 70  GLY A N    3  
ATOM   4491  C  CA   . GLY A 1 70 ? 69.396 -2.202  -5.640  1.00 0.00  ? 70  GLY A CA   3  
ATOM   4492  C  C    . GLY A 1 70 ? 67.959 -2.541  -5.213  1.00 0.00  ? 70  GLY A C    3  
ATOM   4493  O  O    . GLY A 1 70 ? 67.136 -1.666  -5.037  1.00 0.00  ? 70  GLY A O    3  
ATOM   4494  H  H    . GLY A 1 70 ? 70.731 -2.712  -4.015  1.00 0.00  ? 70  GLY A H    3  
ATOM   4495  H  HA2  . GLY A 1 70 ? 69.591 -1.154  -5.445  1.00 0.00  ? 70  GLY A HA2  3  
ATOM   4496  H  HA3  . GLY A 1 70 ? 69.506 -2.401  -6.698  1.00 0.00  ? 70  GLY A HA3  3  
ATOM   4497  N  N    . THR A 1 71 ? 67.656 -3.807  -5.048  1.00 0.00  ? 71  THR A N    3  
ATOM   4498  C  CA   . THR A 1 71 ? 66.273 -4.217  -4.631  1.00 0.00  ? 71  THR A CA   3  
ATOM   4499  C  C    . THR A 1 71 ? 66.023 -3.840  -3.162  1.00 0.00  ? 71  THR A C    3  
ATOM   4500  O  O    . THR A 1 71 ? 66.945 -3.746  -2.374  1.00 0.00  ? 71  THR A O    3  
ATOM   4501  C  CB   . THR A 1 71 ? 66.239 -5.740  -4.811  1.00 0.00  ? 71  THR A CB   3  
ATOM   4502  O  OG1  . THR A 1 71 ? 66.679 -6.070  -6.122  1.00 0.00  ? 71  THR A OG1  3  
ATOM   4503  C  CG2  . THR A 1 71 ? 64.814 -6.255  -4.614  1.00 0.00  ? 71  THR A CG2  3  
ATOM   4504  H  H    . THR A 1 71 ? 68.337 -4.493  -5.201  1.00 0.00  ? 71  THR A H    3  
ATOM   4505  H  HA   . THR A 1 71 ? 65.536 -3.755  -5.269  1.00 0.00  ? 71  THR A HA   3  
ATOM   4506  H  HB   . THR A 1 71 ? 66.889 -6.203  -4.084  1.00 0.00  ? 71  THR A HB   3  
ATOM   4507  H  HG1  . THR A 1 71 ? 67.266 -6.828  -6.057  1.00 0.00  ? 71  THR A HG1  3  
ATOM   4508  H  HG21 . THR A 1 71 ? 64.496 -6.058  -3.601  1.00 0.00  ? 71  THR A HG21 3  
ATOM   4509  H  HG22 . THR A 1 71 ? 64.787 -7.318  -4.800  1.00 0.00  ? 71  THR A HG22 3  
ATOM   4510  H  HG23 . THR A 1 71 ? 64.152 -5.753  -5.304  1.00 0.00  ? 71  THR A HG23 3  
ATOM   4511  N  N    . VAL A 1 72 ? 64.783 -3.621  -2.790  1.00 0.00  ? 72  VAL A N    3  
ATOM   4512  C  CA   . VAL A 1 72 ? 64.475 -3.240  -1.371  1.00 0.00  ? 72  VAL A CA   3  
ATOM   4513  C  C    . VAL A 1 72 ? 64.532 -4.468  -0.445  1.00 0.00  ? 72  VAL A C    3  
ATOM   4514  O  O    . VAL A 1 72 ? 64.050 -5.536  -0.779  1.00 0.00  ? 72  VAL A O    3  
ATOM   4515  C  CB   . VAL A 1 72 ? 63.059 -2.637  -1.409  1.00 0.00  ? 72  VAL A CB   3  
ATOM   4516  C  CG1  . VAL A 1 72 ? 62.298 -2.962  -0.116  1.00 0.00  ? 72  VAL A CG1  3  
ATOM   4517  C  CG2  . VAL A 1 72 ? 63.166 -1.118  -1.546  1.00 0.00  ? 72  VAL A CG2  3  
ATOM   4518  H  H    . VAL A 1 72 ? 64.057 -3.701  -3.444  1.00 0.00  ? 72  VAL A H    3  
ATOM   4519  H  HA   . VAL A 1 72 ? 65.174 -2.493  -1.035  1.00 0.00  ? 72  VAL A HA   3  
ATOM   4520  H  HB   . VAL A 1 72 ? 62.519 -3.037  -2.255  1.00 0.00  ? 72  VAL A HB   3  
ATOM   4521  H  HG11 . VAL A 1 72 ? 62.996 -3.041  0.704   1.00 0.00  ? 72  VAL A HG11 3  
ATOM   4522  H  HG12 . VAL A 1 72 ? 61.773 -3.899  -0.232  1.00 0.00  ? 72  VAL A HG12 3  
ATOM   4523  H  HG13 . VAL A 1 72 ? 61.587 -2.176  0.092   1.00 0.00  ? 72  VAL A HG13 3  
ATOM   4524  H  HG21 . VAL A 1 72 ? 63.804 -0.876  -2.381  1.00 0.00  ? 72  VAL A HG21 3  
ATOM   4525  H  HG22 . VAL A 1 72 ? 63.587 -0.705  -0.640  1.00 0.00  ? 72  VAL A HG22 3  
ATOM   4526  H  HG23 . VAL A 1 72 ? 62.184 -0.701  -1.709  1.00 0.00  ? 72  VAL A HG23 3  
ATOM   4527  N  N    . ASP A 1 73 ? 65.109 -4.309  0.724   1.00 0.00  ? 73  ASP A N    3  
ATOM   4528  C  CA   . ASP A 1 73 ? 65.195 -5.448  1.696   1.00 0.00  ? 73  ASP A CA   3  
ATOM   4529  C  C    . ASP A 1 73 ? 64.158 -5.256  2.821   1.00 0.00  ? 73  ASP A C    3  
ATOM   4530  O  O    . ASP A 1 73 ? 63.223 -4.489  2.682   1.00 0.00  ? 73  ASP A O    3  
ATOM   4531  C  CB   . ASP A 1 73 ? 66.625 -5.403  2.269   1.00 0.00  ? 73  ASP A CB   3  
ATOM   4532  C  CG   . ASP A 1 73 ? 67.660 -5.108  1.171   1.00 0.00  ? 73  ASP A CG   3  
ATOM   4533  O  OD1  . ASP A 1 73 ? 67.519 -5.623  0.074   1.00 0.00  ? 73  ASP A OD1  3  
ATOM   4534  O  OD2  . ASP A 1 73 ? 68.588 -4.370  1.453   1.00 0.00  ? 73  ASP A OD2  3  
ATOM   4535  H  H    . ASP A 1 73 ? 65.478 -3.434  0.967   1.00 0.00  ? 73  ASP A H    3  
ATOM   4536  H  HA   . ASP A 1 73 ? 65.030 -6.386  1.189   1.00 0.00  ? 73  ASP A HA   3  
ATOM   4537  H  HB2  . ASP A 1 73 ? 66.680 -4.631  3.021   1.00 0.00  ? 73  ASP A HB2  3  
ATOM   4538  H  HB3  . ASP A 1 73 ? 66.854 -6.355  2.724   1.00 0.00  ? 73  ASP A HB3  3  
ATOM   4539  N  N    . PHE A 1 74 ? 64.315 -5.936  3.937   1.00 0.00  ? 74  PHE A N    3  
ATOM   4540  C  CA   . PHE A 1 74 ? 63.331 -5.771  5.060   1.00 0.00  ? 74  PHE A CA   3  
ATOM   4541  C  C    . PHE A 1 74 ? 63.623 -4.475  5.828   1.00 0.00  ? 74  PHE A C    3  
ATOM   4542  O  O    . PHE A 1 74 ? 62.828 -3.554  5.821   1.00 0.00  ? 74  PHE A O    3  
ATOM   4543  C  CB   . PHE A 1 74 ? 63.519 -6.998  5.964   1.00 0.00  ? 74  PHE A CB   3  
ATOM   4544  C  CG   . PHE A 1 74 ? 62.653 -6.864  7.203   1.00 0.00  ? 74  PHE A CG   3  
ATOM   4545  C  CD1  . PHE A 1 74 ? 61.310 -6.474  7.089   1.00 0.00  ? 74  PHE A CD1  3  
ATOM   4546  C  CD2  . PHE A 1 74 ? 63.198 -7.125  8.468   1.00 0.00  ? 74  PHE A CD2  3  
ATOM   4547  C  CE1  . PHE A 1 74 ? 60.516 -6.348  8.236   1.00 0.00  ? 74  PHE A CE1  3  
ATOM   4548  C  CE2  . PHE A 1 74 ? 62.402 -6.999  9.614   1.00 0.00  ? 74  PHE A CE2  3  
ATOM   4549  C  CZ   . PHE A 1 74 ? 61.062 -6.610  9.498   1.00 0.00  ? 74  PHE A CZ   3  
ATOM   4550  H  H    . PHE A 1 74 ? 65.077 -6.544  4.038   1.00 0.00  ? 74  PHE A H    3  
ATOM   4551  H  HA   . PHE A 1 74 ? 62.324 -5.754  4.672   1.00 0.00  ? 74  PHE A HA   3  
ATOM   4552  H  HB2  . PHE A 1 74 ? 63.235 -7.888  5.423   1.00 0.00  ? 74  PHE A HB2  3  
ATOM   4553  H  HB3  . PHE A 1 74 ? 64.555 -7.072  6.258   1.00 0.00  ? 74  PHE A HB3  3  
ATOM   4554  H  HD1  . PHE A 1 74 ? 60.886 -6.272  6.117   1.00 0.00  ? 74  PHE A HD1  3  
ATOM   4555  H  HD2  . PHE A 1 74 ? 64.231 -7.424  8.560   1.00 0.00  ? 74  PHE A HD2  3  
ATOM   4556  H  HE1  . PHE A 1 74 ? 59.482 -6.048  8.148   1.00 0.00  ? 74  PHE A HE1  3  
ATOM   4557  H  HE2  . PHE A 1 74 ? 62.822 -7.200  10.588  1.00 0.00  ? 74  PHE A HE2  3  
ATOM   4558  H  HZ   . PHE A 1 74 ? 60.448 -6.511  10.382  1.00 0.00  ? 74  PHE A HZ   3  
ATOM   4559  N  N    . ASP A 1 75 ? 64.760 -4.391  6.481   1.00 0.00  ? 75  ASP A N    3  
ATOM   4560  C  CA   . ASP A 1 75 ? 65.102 -3.143  7.235   1.00 0.00  ? 75  ASP A CA   3  
ATOM   4561  C  C    . ASP A 1 75 ? 65.150 -1.948  6.267   1.00 0.00  ? 75  ASP A C    3  
ATOM   4562  O  O    . ASP A 1 75 ? 64.814 -0.835  6.629   1.00 0.00  ? 75  ASP A O    3  
ATOM   4563  C  CB   . ASP A 1 75 ? 66.472 -3.411  7.868   1.00 0.00  ? 75  ASP A CB   3  
ATOM   4564  C  CG   . ASP A 1 75 ? 66.273 -3.959  9.284   1.00 0.00  ? 75  ASP A CG   3  
ATOM   4565  O  OD1  . ASP A 1 75 ? 66.046 -5.151  9.410   1.00 0.00  ? 75  ASP A OD1  3  
ATOM   4566  O  OD2  . ASP A 1 75 ? 66.338 -3.176  10.218  1.00 0.00  ? 75  ASP A OD2  3  
ATOM   4567  H  H    . ASP A 1 75 ? 65.389 -5.143  6.467   1.00 0.00  ? 75  ASP A H    3  
ATOM   4568  H  HA   . ASP A 1 75 ? 64.370 -2.965  8.007   1.00 0.00  ? 75  ASP A HA   3  
ATOM   4569  H  HB2  . ASP A 1 75 ? 67.011 -4.134  7.273   1.00 0.00  ? 75  ASP A HB2  3  
ATOM   4570  H  HB3  . ASP A 1 75 ? 67.034 -2.491  7.917   1.00 0.00  ? 75  ASP A HB3  3  
ATOM   4571  N  N    . GLU A 1 76 ? 65.530 -2.180  5.028   1.00 0.00  ? 76  GLU A N    3  
ATOM   4572  C  CA   . GLU A 1 76 ? 65.557 -1.068  4.024   1.00 0.00  ? 76  GLU A CA   3  
ATOM   4573  C  C    . GLU A 1 76 ? 64.118 -0.590  3.776   1.00 0.00  ? 76  GLU A C    3  
ATOM   4574  O  O    . GLU A 1 76 ? 63.862 0.587   3.610   1.00 0.00  ? 76  GLU A O    3  
ATOM   4575  C  CB   . GLU A 1 76 ? 66.150 -1.687  2.754   1.00 0.00  ? 76  GLU A CB   3  
ATOM   4576  C  CG   . GLU A 1 76 ? 67.170 -0.727  2.131   1.00 0.00  ? 76  GLU A CG   3  
ATOM   4577  C  CD   . GLU A 1 76 ? 67.810 -1.380  0.901   1.00 0.00  ? 76  GLU A CD   3  
ATOM   4578  O  OE1  . GLU A 1 76 ? 67.074 -1.850  0.049   1.00 0.00  ? 76  GLU A OE1  3  
ATOM   4579  O  OE2  . GLU A 1 76 ? 69.027 -1.404  0.831   1.00 0.00  ? 76  GLU A OE2  3  
ATOM   4580  H  H    . GLU A 1 76 ? 65.769 -3.089  4.752   1.00 0.00  ? 76  GLU A H    3  
ATOM   4581  H  HA   . GLU A 1 76 ? 66.175 -0.255  4.370   1.00 0.00  ? 76  GLU A HA   3  
ATOM   4582  H  HB2  . GLU A 1 76 ? 66.639 -2.618  3.002   1.00 0.00  ? 76  GLU A HB2  3  
ATOM   4583  H  HB3  . GLU A 1 76 ? 65.359 -1.875  2.044   1.00 0.00  ? 76  GLU A HB3  3  
ATOM   4584  H  HG2  . GLU A 1 76 ? 66.672 0.185   1.834   1.00 0.00  ? 76  GLU A HG2  3  
ATOM   4585  H  HG3  . GLU A 1 76 ? 67.939 -0.498  2.853   1.00 0.00  ? 76  GLU A HG3  3  
ATOM   4586  N  N    . PHE A 1 77 ? 63.176 -1.503  3.781   1.00 0.00  ? 77  PHE A N    3  
ATOM   4587  C  CA   . PHE A 1 77 ? 61.745 -1.122  3.586   1.00 0.00  ? 77  PHE A CA   3  
ATOM   4588  C  C    . PHE A 1 77 ? 61.258 -0.362  4.830   1.00 0.00  ? 77  PHE A C    3  
ATOM   4589  O  O    . PHE A 1 77 ? 60.512 0.592   4.730   1.00 0.00  ? 77  PHE A O    3  
ATOM   4590  C  CB   . PHE A 1 77 ? 61.002 -2.458  3.418   1.00 0.00  ? 77  PHE A CB   3  
ATOM   4591  C  CG   . PHE A 1 77 ? 59.522 -2.285  3.689   1.00 0.00  ? 77  PHE A CG   3  
ATOM   4592  C  CD1  . PHE A 1 77 ? 58.675 -1.815  2.680   1.00 0.00  ? 77  PHE A CD1  3  
ATOM   4593  C  CD2  . PHE A 1 77 ? 58.997 -2.604  4.950   1.00 0.00  ? 77  PHE A CD2  3  
ATOM   4594  C  CE1  . PHE A 1 77 ? 57.306 -1.662  2.929   1.00 0.00  ? 77  PHE A CE1  3  
ATOM   4595  C  CE2  . PHE A 1 77 ? 57.627 -2.451  5.197   1.00 0.00  ? 77  PHE A CE2  3  
ATOM   4596  C  CZ   . PHE A 1 77 ? 56.782 -1.980  4.187   1.00 0.00  ? 77  PHE A CZ   3  
ATOM   4597  H  H    . PHE A 1 77 ? 63.411 -2.441  3.938   1.00 0.00  ? 77  PHE A H    3  
ATOM   4598  H  HA   . PHE A 1 77 ? 61.631 -0.515  2.701   1.00 0.00  ? 77  PHE A HA   3  
ATOM   4599  H  HB2  . PHE A 1 77 ? 61.140 -2.815  2.409   1.00 0.00  ? 77  PHE A HB2  3  
ATOM   4600  H  HB3  . PHE A 1 77 ? 61.408 -3.181  4.109   1.00 0.00  ? 77  PHE A HB3  3  
ATOM   4601  H  HD1  . PHE A 1 77 ? 59.077 -1.569  1.708   1.00 0.00  ? 77  PHE A HD1  3  
ATOM   4602  H  HD2  . PHE A 1 77 ? 59.649 -2.966  5.731   1.00 0.00  ? 77  PHE A HD2  3  
ATOM   4603  H  HE1  . PHE A 1 77 ? 56.653 -1.297  2.150   1.00 0.00  ? 77  PHE A HE1  3  
ATOM   4604  H  HE2  . PHE A 1 77 ? 57.222 -2.697  6.168   1.00 0.00  ? 77  PHE A HE2  3  
ATOM   4605  H  HZ   . PHE A 1 77 ? 55.725 -1.862  4.377   1.00 0.00  ? 77  PHE A HZ   3  
ATOM   4606  N  N    . LEU A 1 78 ? 61.693 -0.776  5.999   1.00 0.00  ? 78  LEU A N    3  
ATOM   4607  C  CA   . LEU A 1 78 ? 61.278 -0.080  7.259   1.00 0.00  ? 78  LEU A CA   3  
ATOM   4608  C  C    . LEU A 1 78 ? 61.694 1.398   7.213   1.00 0.00  ? 78  LEU A C    3  
ATOM   4609  O  O    . LEU A 1 78 ? 60.918 2.275   7.545   1.00 0.00  ? 78  LEU A O    3  
ATOM   4610  C  CB   . LEU A 1 78 ? 62.010 -0.821  8.383   1.00 0.00  ? 78  LEU A CB   3  
ATOM   4611  C  CG   . LEU A 1 78 ? 61.259 -2.115  8.712   1.00 0.00  ? 78  LEU A CG   3  
ATOM   4612  C  CD1  . LEU A 1 78 ? 62.204 -3.100  9.400   1.00 0.00  ? 78  LEU A CD1  3  
ATOM   4613  C  CD2  . LEU A 1 78 ? 60.087 -1.799  9.643   1.00 0.00  ? 78  LEU A CD2  3  
ATOM   4614  H  H    . LEU A 1 78 ? 62.304 -1.543  6.047   1.00 0.00  ? 78  LEU A H    3  
ATOM   4615  H  HA   . LEU A 1 78 ? 60.211 -0.164  7.398   1.00 0.00  ? 78  LEU A HA   3  
ATOM   4616  H  HB2  . LEU A 1 78 ? 63.015 -1.058  8.063   1.00 0.00  ? 78  LEU A HB2  3  
ATOM   4617  H  HB3  . LEU A 1 78 ? 62.050 -0.196  9.262   1.00 0.00  ? 78  LEU A HB3  3  
ATOM   4618  H  HG   . LEU A 1 78 ? 60.885 -2.555  7.798   1.00 0.00  ? 78  LEU A HG   3  
ATOM   4619  H  HD11 . LEU A 1 78 ? 63.002 -2.557  9.886   1.00 0.00  ? 78  LEU A HD11 3  
ATOM   4620  H  HD12 . LEU A 1 78 ? 62.621 -3.771  8.663   1.00 0.00  ? 78  LEU A HD12 3  
ATOM   4621  H  HD13 . LEU A 1 78 ? 61.657 -3.670  10.136  1.00 0.00  ? 78  LEU A HD13 3  
ATOM   4622  H  HD21 . LEU A 1 78 ? 59.906 -2.643  10.291  1.00 0.00  ? 78  LEU A HD21 3  
ATOM   4623  H  HD22 . LEU A 1 78 ? 59.204 -1.602  9.054   1.00 0.00  ? 78  LEU A HD22 3  
ATOM   4624  H  HD23 . LEU A 1 78 ? 60.324 -0.930  10.239  1.00 0.00  ? 78  LEU A HD23 3  
ATOM   4625  N  N    . VAL A 1 79 ? 62.903 1.682   6.783   1.00 0.00  ? 79  VAL A N    3  
ATOM   4626  C  CA   . VAL A 1 79 ? 63.352 3.110   6.692   1.00 0.00  ? 79  VAL A CA   3  
ATOM   4627  C  C    . VAL A 1 79 ? 62.652 3.815   5.510   1.00 0.00  ? 79  VAL A C    3  
ATOM   4628  O  O    . VAL A 1 79 ? 62.583 5.027   5.458   1.00 0.00  ? 79  VAL A O    3  
ATOM   4629  C  CB   . VAL A 1 79 ? 64.878 3.054   6.496   1.00 0.00  ? 79  VAL A CB   3  
ATOM   4630  C  CG1  . VAL A 1 79 ? 65.225 2.533   5.097   1.00 0.00  ? 79  VAL A CG1  3  
ATOM   4631  C  CG2  . VAL A 1 79 ? 65.464 4.458   6.674   1.00 0.00  ? 79  VAL A CG2  3  
ATOM   4632  H  H    . VAL A 1 79 ? 63.506 0.959   6.506   1.00 0.00  ? 79  VAL A H    3  
ATOM   4633  H  HA   . VAL A 1 79 ? 63.124 3.626   7.613   1.00 0.00  ? 79  VAL A HA   3  
ATOM   4634  H  HB   . VAL A 1 79 ? 65.306 2.394   7.237   1.00 0.00  ? 79  VAL A HB   3  
ATOM   4635  H  HG11 . VAL A 1 79 ? 64.368 2.633   4.450   1.00 0.00  ? 79  VAL A HG11 3  
ATOM   4636  H  HG12 . VAL A 1 79 ? 65.507 1.493   5.161   1.00 0.00  ? 79  VAL A HG12 3  
ATOM   4637  H  HG13 . VAL A 1 79 ? 66.049 3.104   4.693   1.00 0.00  ? 79  VAL A HG13 3  
ATOM   4638  H  HG21 . VAL A 1 79 ? 66.484 4.381   7.020   1.00 0.00  ? 79  VAL A HG21 3  
ATOM   4639  H  HG22 . VAL A 1 79 ? 64.879 5.002   7.400   1.00 0.00  ? 79  VAL A HG22 3  
ATOM   4640  H  HG23 . VAL A 1 79 ? 65.442 4.980   5.728   1.00 0.00  ? 79  VAL A HG23 3  
ATOM   4641  N  N    . MET A 1 80 ? 62.120 3.061   4.573   1.00 0.00  ? 80  MET A N    3  
ATOM   4642  C  CA   . MET A 1 80 ? 61.408 3.681   3.411   1.00 0.00  ? 80  MET A CA   3  
ATOM   4643  C  C    . MET A 1 80 ? 60.016 4.161   3.850   1.00 0.00  ? 80  MET A C    3  
ATOM   4644  O  O    . MET A 1 80 ? 59.557 5.213   3.443   1.00 0.00  ? 80  MET A O    3  
ATOM   4645  C  CB   . MET A 1 80 ? 61.292 2.563   2.369   1.00 0.00  ? 80  MET A CB   3  
ATOM   4646  C  CG   . MET A 1 80 ? 60.909 3.158   1.014   1.00 0.00  ? 80  MET A CG   3  
ATOM   4647  S  SD   . MET A 1 80 ? 61.483 2.064   -0.308  1.00 0.00  ? 80  MET A SD   3  
ATOM   4648  C  CE   . MET A 1 80 ? 60.713 2.959   -1.676  1.00 0.00  ? 80  MET A CE   3  
ATOM   4649  H  H    . MET A 1 80 ? 62.177 2.085   4.641   1.00 0.00  ? 80  MET A H    3  
ATOM   4650  H  HA   . MET A 1 80 ? 61.981 4.503   3.011   1.00 0.00  ? 80  MET A HA   3  
ATOM   4651  H  HB2  . MET A 1 80 ? 62.241 2.052   2.283   1.00 0.00  ? 80  MET A HB2  3  
ATOM   4652  H  HB3  . MET A 1 80 ? 60.532 1.860   2.678   1.00 0.00  ? 80  MET A HB3  3  
ATOM   4653  H  HG2  . MET A 1 80 ? 59.835 3.260   0.956   1.00 0.00  ? 80  MET A HG2  3  
ATOM   4654  H  HG3  . MET A 1 80 ? 61.368 4.129   0.902   1.00 0.00  ? 80  MET A HG3  3  
ATOM   4655  H  HE1  . MET A 1 80 ? 61.460 3.554   -2.183  1.00 0.00  ? 80  MET A HE1  3  
ATOM   4656  H  HE2  . MET A 1 80 ? 59.940 3.607   -1.292  1.00 0.00  ? 80  MET A HE2  3  
ATOM   4657  H  HE3  . MET A 1 80 ? 60.276 2.252   -2.367  1.00 0.00  ? 80  MET A HE3  3  
ATOM   4658  N  N    . MET A 1 81 ? 59.347 3.399   4.687   1.00 0.00  ? 81  MET A N    3  
ATOM   4659  C  CA   . MET A 1 81 ? 57.989 3.803   5.171   1.00 0.00  ? 81  MET A CA   3  
ATOM   4660  C  C    . MET A 1 81 ? 58.070 5.137   5.924   1.00 0.00  ? 81  MET A C    3  
ATOM   4661  O  O    . MET A 1 81 ? 57.272 6.029   5.708   1.00 0.00  ? 81  MET A O    3  
ATOM   4662  C  CB   . MET A 1 81 ? 57.547 2.680   6.120   1.00 0.00  ? 81  MET A CB   3  
ATOM   4663  C  CG   . MET A 1 81 ? 57.478 1.343   5.369   1.00 0.00  ? 81  MET A CG   3  
ATOM   4664  S  SD   . MET A 1 81 ? 56.783 1.591   3.714   1.00 0.00  ? 81  MET A SD   3  
ATOM   4665  C  CE   . MET A 1 81 ? 55.051 1.717   4.213   1.00 0.00  ? 81  MET A CE   3  
ATOM   4666  H  H    . MET A 1 81 ? 59.742 2.559   5.001   1.00 0.00  ? 81  MET A H    3  
ATOM   4667  H  HA   . MET A 1 81 ? 57.300 3.880   4.344   1.00 0.00  ? 81  MET A HA   3  
ATOM   4668  H  HB2  . MET A 1 81 ? 58.259 2.599   6.929   1.00 0.00  ? 81  MET A HB2  3  
ATOM   4669  H  HB3  . MET A 1 81 ? 56.573 2.914   6.523   1.00 0.00  ? 81  MET A HB3  3  
ATOM   4670  H  HG2  . MET A 1 81 ? 58.471 0.931   5.281   1.00 0.00  ? 81  MET A HG2  3  
ATOM   4671  H  HG3  . MET A 1 81 ? 56.854 0.655   5.920   1.00 0.00  ? 81  MET A HG3  3  
ATOM   4672  H  HE1  . MET A 1 81 ? 54.963 2.432   5.017   1.00 0.00  ? 81  MET A HE1  3  
ATOM   4673  H  HE2  . MET A 1 81 ? 54.702 0.754   4.551   1.00 0.00  ? 81  MET A HE2  3  
ATOM   4674  H  HE3  . MET A 1 81 ? 54.457 2.042   3.370   1.00 0.00  ? 81  MET A HE3  3  
ATOM   4675  N  N    . VAL A 1 82 ? 59.036 5.282   6.801   1.00 0.00  ? 82  VAL A N    3  
ATOM   4676  C  CA   . VAL A 1 82 ? 59.172 6.564   7.559   1.00 0.00  ? 82  VAL A CA   3  
ATOM   4677  C  C    . VAL A 1 82 ? 59.634 7.689   6.617   1.00 0.00  ? 82  VAL A C    3  
ATOM   4678  O  O    . VAL A 1 82 ? 59.286 8.840   6.801   1.00 0.00  ? 82  VAL A O    3  
ATOM   4679  C  CB   . VAL A 1 82 ? 60.204 6.283   8.668   1.00 0.00  ? 82  VAL A CB   3  
ATOM   4680  C  CG1  . VAL A 1 82 ? 61.633 6.439   8.135   1.00 0.00  ? 82  VAL A CG1  3  
ATOM   4681  C  CG2  . VAL A 1 82 ? 59.985 7.264   9.822   1.00 0.00  ? 82  VAL A CG2  3  
ATOM   4682  H  H    . VAL A 1 82 ? 59.672 4.551   6.954   1.00 0.00  ? 82  VAL A H    3  
ATOM   4683  H  HA   . VAL A 1 82 ? 58.224 6.828   8.004   1.00 0.00  ? 82  VAL A HA   3  
ATOM   4684  H  HB   . VAL A 1 82 ? 60.069 5.274   9.030   1.00 0.00  ? 82  VAL A HB   3  
ATOM   4685  H  HG11 . VAL A 1 82 ? 62.330 6.021   8.847   1.00 0.00  ? 82  VAL A HG11 3  
ATOM   4686  H  HG12 . VAL A 1 82 ? 61.853 7.486   7.990   1.00 0.00  ? 82  VAL A HG12 3  
ATOM   4687  H  HG13 . VAL A 1 82 ? 61.725 5.918   7.195   1.00 0.00  ? 82  VAL A HG13 3  
ATOM   4688  H  HG21 . VAL A 1 82 ? 60.647 8.110   9.707   1.00 0.00  ? 82  VAL A HG21 3  
ATOM   4689  H  HG22 . VAL A 1 82 ? 60.192 6.769   10.758  1.00 0.00  ? 82  VAL A HG22 3  
ATOM   4690  H  HG23 . VAL A 1 82 ? 58.960 7.607   9.816   1.00 0.00  ? 82  VAL A HG23 3  
ATOM   4691  N  N    . ARG A 1 83 ? 60.396 7.361   5.597   1.00 0.00  ? 83  ARG A N    3  
ATOM   4692  C  CA   . ARG A 1 83 ? 60.854 8.409   4.632   1.00 0.00  ? 83  ARG A CA   3  
ATOM   4693  C  C    . ARG A 1 83 ? 59.642 8.975   3.883   1.00 0.00  ? 83  ARG A C    3  
ATOM   4694  O  O    . ARG A 1 83 ? 59.500 10.173  3.730   1.00 0.00  ? 83  ARG A O    3  
ATOM   4695  C  CB   . ARG A 1 83 ? 61.802 7.686   3.668   1.00 0.00  ? 83  ARG A CB   3  
ATOM   4696  C  CG   . ARG A 1 83 ? 63.237 7.795   4.187   1.00 0.00  ? 83  ARG A CG   3  
ATOM   4697  C  CD   . ARG A 1 83 ? 64.179 7.022   3.261   1.00 0.00  ? 83  ARG A CD   3  
ATOM   4698  N  NE   . ARG A 1 83 ? 65.405 7.870   3.167   1.00 0.00  ? 83  ARG A NE   3  
ATOM   4699  C  CZ   . ARG A 1 83 ? 65.614 8.606   2.111   1.00 0.00  ? 83  ARG A CZ   3  
ATOM   4700  N  NH1  . ARG A 1 83 ? 64.953 9.716   1.949   1.00 0.00  ? 83  ARG A NH1  3  
ATOM   4701  N  NH2  . ARG A 1 83 ? 66.488 8.232   1.221   1.00 0.00  ? 83  ARG A NH2  3  
ATOM   4702  H  H    . ARG A 1 83 ? 60.651 6.425   5.459   1.00 0.00  ? 83  ARG A H    3  
ATOM   4703  H  HA   . ARG A 1 83 ? 61.378 9.196   5.150   1.00 0.00  ? 83  ARG A HA   3  
ATOM   4704  H  HB2  . ARG A 1 83 ? 61.520 6.645   3.599   1.00 0.00  ? 83  ARG A HB2  3  
ATOM   4705  H  HB3  . ARG A 1 83 ? 61.738 8.142   2.691   1.00 0.00  ? 83  ARG A HB3  3  
ATOM   4706  H  HG2  . ARG A 1 83 ? 63.531 8.834   4.216   1.00 0.00  ? 83  ARG A HG2  3  
ATOM   4707  H  HG3  . ARG A 1 83 ? 63.293 7.379   5.182   1.00 0.00  ? 83  ARG A HG3  3  
ATOM   4708  H  HD2  . ARG A 1 83 ? 64.416 6.057   3.689   1.00 0.00  ? 83  ARG A HD2  3  
ATOM   4709  H  HD3  . ARG A 1 83 ? 63.735 6.903   2.285   1.00 0.00  ? 83  ARG A HD3  3  
ATOM   4710  H  HE   . ARG A 1 83 ? 66.054 7.874   3.902   1.00 0.00  ? 83  ARG A HE   3  
ATOM   4711  H  HH11 . ARG A 1 83 ? 64.288 10.006  2.636   1.00 0.00  ? 83  ARG A HH11 3  
ATOM   4712  H  HH12 . ARG A 1 83 ? 65.103 10.273  1.132   1.00 0.00  ? 83  ARG A HH12 3  
ATOM   4713  H  HH21 . ARG A 1 83 ? 66.998 7.382   1.347   1.00 0.00  ? 83  ARG A HH21 3  
ATOM   4714  H  HH22 . ARG A 1 83 ? 66.648 8.794   0.410   1.00 0.00  ? 83  ARG A HH22 3  
ATOM   4715  N  N    . CYS A 1 84 ? 58.756 8.115   3.439   1.00 0.00  ? 84  CYS A N    3  
ATOM   4716  C  CA   . CYS A 1 84 ? 57.532 8.588   2.722   1.00 0.00  ? 84  CYS A CA   3  
ATOM   4717  C  C    . CYS A 1 84 ? 56.562 9.236   3.721   1.00 0.00  ? 84  CYS A C    3  
ATOM   4718  O  O    . CYS A 1 84 ? 55.926 10.230  3.426   1.00 0.00  ? 84  CYS A O    3  
ATOM   4719  C  CB   . CYS A 1 84 ? 56.915 7.328   2.109   1.00 0.00  ? 84  CYS A CB   3  
ATOM   4720  S  SG   . CYS A 1 84 ? 55.605 7.799   0.951   1.00 0.00  ? 84  CYS A SG   3  
ATOM   4721  H  H    . CYS A 1 84 ? 58.890 7.155   3.593   1.00 0.00  ? 84  CYS A H    3  
ATOM   4722  H  HA   . CYS A 1 84 ? 57.796 9.288   1.944   1.00 0.00  ? 84  CYS A HA   3  
ATOM   4723  H  HB2  . CYS A 1 84 ? 57.677 6.773   1.582   1.00 0.00  ? 84  CYS A HB2  3  
ATOM   4724  H  HB3  . CYS A 1 84 ? 56.498 6.713   2.893   1.00 0.00  ? 84  CYS A HB3  3  
ATOM   4725  H  HG   . CYS A 1 84 ? 55.465 7.065   0.346   1.00 0.00  ? 84  CYS A HG   3  
ATOM   4726  N  N    . MET A 1 85 ? 56.457 8.681   4.906   1.00 0.00  ? 85  MET A N    3  
ATOM   4727  C  CA   . MET A 1 85 ? 55.542 9.259   5.942   1.00 0.00  ? 85  MET A CA   3  
ATOM   4728  C  C    . MET A 1 85 ? 56.088 10.603  6.454   1.00 0.00  ? 85  MET A C    3  
ATOM   4729  O  O    . MET A 1 85 ? 55.338 11.440  6.919   1.00 0.00  ? 85  MET A O    3  
ATOM   4730  C  CB   . MET A 1 85 ? 55.523 8.221   7.069   1.00 0.00  ? 85  MET A CB   3  
ATOM   4731  C  CG   . MET A 1 85 ? 54.408 8.555   8.066   1.00 0.00  ? 85  MET A CG   3  
ATOM   4732  S  SD   . MET A 1 85 ? 55.050 8.424   9.755   1.00 0.00  ? 85  MET A SD   3  
ATOM   4733  C  CE   . MET A 1 85 ? 55.425 6.653   9.726   1.00 0.00  ? 85  MET A CE   3  
ATOM   4734  H  H    . MET A 1 85 ? 56.989 7.884   5.117   1.00 0.00  ? 85  MET A H    3  
ATOM   4735  H  HA   . MET A 1 85 ? 54.549 9.384   5.540   1.00 0.00  ? 85  MET A HA   3  
ATOM   4736  H  HB2  . MET A 1 85 ? 55.347 7.241   6.650   1.00 0.00  ? 85  MET A HB2  3  
ATOM   4737  H  HB3  . MET A 1 85 ? 56.473 8.227   7.580   1.00 0.00  ? 85  MET A HB3  3  
ATOM   4738  H  HG2  . MET A 1 85 ? 54.057 9.561   7.892   1.00 0.00  ? 85  MET A HG2  3  
ATOM   4739  H  HG3  . MET A 1 85 ? 53.591 7.861   7.937   1.00 0.00  ? 85  MET A HG3  3  
ATOM   4740  H  HE1  . MET A 1 85 ? 56.495 6.511   9.774   1.00 0.00  ? 85  MET A HE1  3  
ATOM   4741  H  HE2  . MET A 1 85 ? 55.049 6.219   8.814   1.00 0.00  ? 85  MET A HE2  3  
ATOM   4742  H  HE3  . MET A 1 85 ? 54.954 6.172   10.572  1.00 0.00  ? 85  MET A HE3  3  
ATOM   4743  N  N    . LYS A 1 86 ? 57.389 10.805  6.369   1.00 0.00  ? 86  LYS A N    3  
ATOM   4744  C  CA   . LYS A 1 86 ? 58.022 12.081  6.843   1.00 0.00  ? 86  LYS A CA   3  
ATOM   4745  C  C    . LYS A 1 86 ? 57.984 12.172  8.375   1.00 0.00  ? 86  LYS A C    3  
ATOM   4746  O  O    . LYS A 1 86 ? 56.932 12.248  8.982   1.00 0.00  ? 86  LYS A O    3  
ATOM   4747  C  CB   . LYS A 1 86 ? 57.214 13.220  6.205   1.00 0.00  ? 86  LYS A CB   3  
ATOM   4748  C  CG   . LYS A 1 86 ? 58.167 14.322  5.736   1.00 0.00  ? 86  LYS A CG   3  
ATOM   4749  C  CD   . LYS A 1 86 ? 58.530 15.224  6.920   1.00 0.00  ? 86  LYS A CD   3  
ATOM   4750  C  CE   . LYS A 1 86 ? 59.782 16.041  6.582   1.00 0.00  ? 86  LYS A CE   3  
ATOM   4751  N  NZ   . LYS A 1 86 ? 60.535 16.149  7.866   1.00 0.00  ? 86  LYS A NZ   3  
ATOM   4752  H  H    . LYS A 1 86 ? 57.960 10.105  5.990   1.00 0.00  ? 86  LYS A H    3  
ATOM   4753  H  HA   . LYS A 1 86 ? 59.044 12.129  6.500   1.00 0.00  ? 86  LYS A HA   3  
ATOM   4754  H  HB2  . LYS A 1 86 ? 56.659 12.840  5.360   1.00 0.00  ? 86  LYS A HB2  3  
ATOM   4755  H  HB3  . LYS A 1 86 ? 56.527 13.627  6.933   1.00 0.00  ? 86  LYS A HB3  3  
ATOM   4756  H  HG2  . LYS A 1 86 ? 59.065 13.873  5.331   1.00 0.00  ? 86  LYS A HG2  3  
ATOM   4757  H  HG3  . LYS A 1 86 ? 57.685 14.912  4.971   1.00 0.00  ? 86  LYS A HG3  3  
ATOM   4758  H  HD2  . LYS A 1 86 ? 57.708 15.894  7.124   1.00 0.00  ? 86  LYS A HD2  3  
ATOM   4759  H  HD3  . LYS A 1 86 ? 58.724 14.615  7.790   1.00 0.00  ? 86  LYS A HD3  3  
ATOM   4760  H  HE2  . LYS A 1 86 ? 60.375 15.528  5.837   1.00 0.00  ? 86  LYS A HE2  3  
ATOM   4761  H  HE3  . LYS A 1 86 ? 59.506 17.023  6.232   1.00 0.00  ? 86  LYS A HE3  3  
ATOM   4762  H  HZ1  . LYS A 1 86 ? 61.418 16.676  7.708   1.00 0.00  ? 86  LYS A HZ1  3  
ATOM   4763  H  HZ2  . LYS A 1 86 ? 60.762 15.195  8.221   1.00 0.00  ? 86  LYS A HZ2  3  
ATOM   4764  H  HZ3  . LYS A 1 86 ? 59.957 16.652  8.569   1.00 0.00  ? 86  LYS A HZ3  3  
ATOM   4765  N  N    . ASP A 1 87 ? 59.134 12.165  9.001   1.00 0.00  ? 87  ASP A N    3  
ATOM   4766  C  CA   . ASP A 1 87 ? 59.188 12.253  10.492  1.00 0.00  ? 87  ASP A CA   3  
ATOM   4767  C  C    . ASP A 1 87 ? 59.723 13.630  10.926  1.00 0.00  ? 87  ASP A C    3  
ATOM   4768  O  O    . ASP A 1 87 ? 59.754 14.566  10.146  1.00 0.00  ? 87  ASP A O    3  
ATOM   4769  C  CB   . ASP A 1 87 ? 60.139 11.119  10.916  1.00 0.00  ? 87  ASP A CB   3  
ATOM   4770  C  CG   . ASP A 1 87 ? 61.592 11.483  10.583  1.00 0.00  ? 87  ASP A CG   3  
ATOM   4771  O  OD1  . ASP A 1 87 ? 61.923 11.514  9.408   1.00 0.00  ? 87  ASP A OD1  3  
ATOM   4772  O  OD2  . ASP A 1 87 ? 62.348 11.721  11.510  1.00 0.00  ? 87  ASP A OD2  3  
ATOM   4773  H  H    . ASP A 1 87 ? 59.967 12.105  8.487   1.00 0.00  ? 87  ASP A H    3  
ATOM   4774  H  HA   . ASP A 1 87 ? 58.209 12.085  10.914  1.00 0.00  ? 87  ASP A HA   3  
ATOM   4775  H  HB2  . ASP A 1 87 ? 60.047 10.955  11.980  1.00 0.00  ? 87  ASP A HB2  3  
ATOM   4776  H  HB3  . ASP A 1 87 ? 59.871 10.214  10.392  1.00 0.00  ? 87  ASP A HB3  3  
ATOM   4777  N  N    . ASP A 1 88 ? 60.141 13.757  12.162  1.00 0.00  ? 88  ASP A N    3  
ATOM   4778  C  CA   . ASP A 1 88 ? 60.677 15.067  12.655  1.00 0.00  ? 88  ASP A CA   3  
ATOM   4779  C  C    . ASP A 1 88 ? 61.903 15.490  11.830  1.00 0.00  ? 88  ASP A C    3  
ATOM   4780  O  O    . ASP A 1 88 ? 62.042 16.642  11.464  1.00 0.00  ? 88  ASP A O    3  
ATOM   4781  C  CB   . ASP A 1 88 ? 61.070 14.811  14.114  1.00 0.00  ? 88  ASP A CB   3  
ATOM   4782  C  CG   . ASP A 1 88 ? 59.814 14.757  14.987  1.00 0.00  ? 88  ASP A CG   3  
ATOM   4783  O  OD1  . ASP A 1 88 ? 59.220 13.695  15.069  1.00 0.00  ? 88  ASP A OD1  3  
ATOM   4784  O  OD2  . ASP A 1 88 ? 59.470 15.779  15.556  1.00 0.00  ? 88  ASP A OD2  3  
ATOM   4785  H  H    . ASP A 1 88 ? 60.103 12.988  12.769  1.00 0.00  ? 88  ASP A H    3  
ATOM   4786  H  HA   . ASP A 1 88 ? 59.913 15.827  12.607  1.00 0.00  ? 88  ASP A HA   3  
ATOM   4787  H  HB2  . ASP A 1 88 ? 61.597 13.871  14.184  1.00 0.00  ? 88  ASP A HB2  3  
ATOM   4788  H  HB3  . ASP A 1 88 ? 61.711 15.608  14.459  1.00 0.00  ? 88  ASP A HB3  3  
ATOM   4789  N  N    . SER A 1 89 ? 62.783 14.557  11.538  1.00 0.00  ? 89  SER A N    3  
ATOM   4790  C  CA   . SER A 1 89 ? 64.014 14.868  10.735  1.00 0.00  ? 89  SER A CA   3  
ATOM   4791  C  C    . SER A 1 89 ? 64.881 15.923  11.449  1.00 0.00  ? 89  SER A C    3  
ATOM   4792  O  O    . SER A 1 89 ? 64.903 15.919  12.671  1.00 0.00  ? 89  SER A O    3  
ATOM   4793  C  CB   . SER A 1 89 ? 63.507 15.391  9.380   1.00 0.00  ? 89  SER A CB   3  
ATOM   4794  O  OG   . SER A 1 89 ? 62.548 14.485  8.831   1.00 0.00  ? 89  SER A OG   3  
ATOM   4795  O  OXT  . SER A 1 89 ? 65.521 16.707  10.764  1.00 0.00  ? 89  SER A OXT  3  
ATOM   4796  H  H    . SER A 1 89 ? 62.635 13.641  11.849  1.00 0.00  ? 89  SER A H    3  
ATOM   4797  H  HA   . SER A 1 89 ? 64.585 13.968  10.583  1.00 0.00  ? 89  SER A HA   3  
ATOM   4798  H  HB2  . SER A 1 89 ? 63.046 16.353  9.515   1.00 0.00  ? 89  SER A HB2  3  
ATOM   4799  H  HB3  . SER A 1 89 ? 64.347 15.493  8.703   1.00 0.00  ? 89  SER A HB3  3  
ATOM   4800  H  HG   . SER A 1 89 ? 62.747 13.598  9.152   1.00 0.00  ? 89  SER A HG   3  
ATOM   4801  N  N    . ARG B 2 1  ? 58.831 16.003  -7.497  1.00 0.00  ? 144 ARG B N    3  
ATOM   4802  C  CA   . ARG B 2 1  ? 58.554 14.570  -7.159  1.00 0.00  ? 144 ARG B CA   3  
ATOM   4803  C  C    . ARG B 2 1  ? 57.615 13.938  -8.205  1.00 0.00  ? 144 ARG B C    3  
ATOM   4804  O  O    . ARG B 2 1  ? 57.238 14.574  -9.172  1.00 0.00  ? 144 ARG B O    3  
ATOM   4805  C  CB   . ARG B 2 1  ? 57.901 14.601  -5.766  1.00 0.00  ? 144 ARG B CB   3  
ATOM   4806  C  CG   . ARG B 2 1  ? 56.443 15.071  -5.859  1.00 0.00  ? 144 ARG B CG   3  
ATOM   4807  C  CD   . ARG B 2 1  ? 55.517 13.934  -5.417  1.00 0.00  ? 144 ARG B CD   3  
ATOM   4808  N  NE   . ARG B 2 1  ? 55.441 14.051  -3.932  1.00 0.00  ? 144 ARG B NE   3  
ATOM   4809  C  CZ   . ARG B 2 1  ? 56.423 13.617  -3.195  1.00 0.00  ? 144 ARG B CZ   3  
ATOM   4810  N  NH1  . ARG B 2 1  ? 56.587 12.339  -3.025  1.00 0.00  ? 144 ARG B NH1  3  
ATOM   4811  N  NH2  . ARG B 2 1  ? 57.244 14.461  -2.639  1.00 0.00  ? 144 ARG B NH2  3  
ATOM   4812  H  H1   . ARG B 2 1  ? 58.955 16.101  -8.525  1.00 0.00  ? 144 ARG B H1   3  
ATOM   4813  H  H2   . ARG B 2 1  ? 59.701 16.310  -7.014  1.00 0.00  ? 144 ARG B H2   3  
ATOM   4814  H  H3   . ARG B 2 1  ? 58.035 16.598  -7.191  1.00 0.00  ? 144 ARG B H3   3  
ATOM   4815  H  HA   . ARG B 2 1  ? 59.479 14.016  -7.113  1.00 0.00  ? 144 ARG B HA   3  
ATOM   4816  H  HB2  . ARG B 2 1  ? 57.928 13.609  -5.340  1.00 0.00  ? 144 ARG B HB2  3  
ATOM   4817  H  HB3  . ARG B 2 1  ? 58.453 15.276  -5.128  1.00 0.00  ? 144 ARG B HB3  3  
ATOM   4818  H  HG2  . ARG B 2 1  ? 56.297 15.926  -5.213  1.00 0.00  ? 144 ARG B HG2  3  
ATOM   4819  H  HG3  . ARG B 2 1  ? 56.213 15.346  -6.877  1.00 0.00  ? 144 ARG B HG3  3  
ATOM   4820  H  HD2  . ARG B 2 1  ? 54.538 14.052  -5.861  1.00 0.00  ? 144 ARG B HD2  3  
ATOM   4821  H  HD3  . ARG B 2 1  ? 55.943 12.979  -5.689  1.00 0.00  ? 144 ARG B HD3  3  
ATOM   4822  H  HE   . ARG B 2 1  ? 54.652 14.451  -3.510  1.00 0.00  ? 144 ARG B HE   3  
ATOM   4823  H  HH11 . ARG B 2 1  ? 55.960 11.693  -3.460  1.00 0.00  ? 144 ARG B HH11 3  
ATOM   4824  H  HH12 . ARG B 2 1  ? 57.341 12.002  -2.464  1.00 0.00  ? 144 ARG B HH12 3  
ATOM   4825  H  HH21 . ARG B 2 1  ? 57.120 15.443  -2.775  1.00 0.00  ? 144 ARG B HH21 3  
ATOM   4826  H  HH22 . ARG B 2 1  ? 58.005 14.127  -2.084  1.00 0.00  ? 144 ARG B HH22 3  
ATOM   4827  N  N    . ARG B 2 2  ? 57.244 12.693  -8.021  1.00 0.00  ? 145 ARG B N    3  
ATOM   4828  C  CA   . ARG B 2 2  ? 56.333 12.017  -9.002  1.00 0.00  ? 145 ARG B CA   3  
ATOM   4829  C  C    . ARG B 2 2  ? 55.188 11.303  -8.267  1.00 0.00  ? 145 ARG B C    3  
ATOM   4830  O  O    . ARG B 2 2  ? 54.030 11.640  -8.434  1.00 0.00  ? 145 ARG B O    3  
ATOM   4831  C  CB   . ARG B 2 2  ? 57.225 11.007  -9.742  1.00 0.00  ? 145 ARG B CB   3  
ATOM   4832  C  CG   . ARG B 2 2  ? 56.367 10.084  -10.616 1.00 0.00  ? 145 ARG B CG   3  
ATOM   4833  C  CD   . ARG B 2 2  ? 55.591 10.910  -11.645 1.00 0.00  ? 145 ARG B CD   3  
ATOM   4834  N  NE   . ARG B 2 2  ? 55.117 9.916   -12.650 1.00 0.00  ? 145 ARG B NE   3  
ATOM   4835  C  CZ   . ARG B 2 2  ? 53.966 9.325   -12.495 1.00 0.00  ? 145 ARG B CZ   3  
ATOM   4836  N  NH1  . ARG B 2 2  ? 52.868 9.950   -12.811 1.00 0.00  ? 145 ARG B NH1  3  
ATOM   4837  N  NH2  . ARG B 2 2  ? 53.916 8.116   -12.018 1.00 0.00  ? 145 ARG B NH2  3  
ATOM   4838  H  H    . ARG B 2 2  ? 57.563 12.200  -7.235  1.00 0.00  ? 145 ARG B H    3  
ATOM   4839  H  HA   . ARG B 2 2  ? 55.936 12.736  -9.703  1.00 0.00  ? 145 ARG B HA   3  
ATOM   4840  H  HB2  . ARG B 2 2  ? 57.929 11.539  -10.366 1.00 0.00  ? 145 ARG B HB2  3  
ATOM   4841  H  HB3  . ARG B 2 2  ? 57.766 10.411  -9.020  1.00 0.00  ? 145 ARG B HB3  3  
ATOM   4842  H  HG2  . ARG B 2 2  ? 57.006 9.380   -11.130 1.00 0.00  ? 145 ARG B HG2  3  
ATOM   4843  H  HG3  . ARG B 2 2  ? 55.670 9.544   -9.994  1.00 0.00  ? 145 ARG B HG3  3  
ATOM   4844  H  HD2  . ARG B 2 2  ? 54.752 11.405  -11.173 1.00 0.00  ? 145 ARG B HD2  3  
ATOM   4845  H  HD3  . ARG B 2 2  ? 56.239 11.634  -12.115 1.00 0.00  ? 145 ARG B HD3  3  
ATOM   4846  H  HE   . ARG B 2 2  ? 55.671 9.706   -13.430 1.00 0.00  ? 145 ARG B HE   3  
ATOM   4847  H  HH11 . ARG B 2 2  ? 52.910 10.882  -13.171 1.00 0.00  ? 145 ARG B HH11 3  
ATOM   4848  H  HH12 . ARG B 2 2  ? 51.983 9.502   -12.692 1.00 0.00  ? 145 ARG B HH12 3  
ATOM   4849  H  HH21 . ARG B 2 2  ? 54.764 7.643   -11.765 1.00 0.00  ? 145 ARG B HH21 3  
ATOM   4850  H  HH22 . ARG B 2 2  ? 53.036 7.656   -11.906 1.00 0.00  ? 145 ARG B HH22 3  
ATOM   4851  N  N    . VAL B 2 3  ? 55.503 10.320  -7.459  1.00 0.00  ? 146 VAL B N    3  
ATOM   4852  C  CA   . VAL B 2 3  ? 54.436 9.576   -6.713  1.00 0.00  ? 146 VAL B CA   3  
ATOM   4853  C  C    . VAL B 2 3  ? 54.438 9.982   -5.231  1.00 0.00  ? 146 VAL B C    3  
ATOM   4854  O  O    . VAL B 2 3  ? 55.434 10.444  -4.704  1.00 0.00  ? 146 VAL B O    3  
ATOM   4855  C  CB   . VAL B 2 3  ? 54.796 8.093   -6.870  1.00 0.00  ? 146 VAL B CB   3  
ATOM   4856  C  CG1  . VAL B 2 3  ? 53.700 7.226   -6.246  1.00 0.00  ? 146 VAL B CG1  3  
ATOM   4857  C  CG2  . VAL B 2 3  ? 54.920 7.742   -8.356  1.00 0.00  ? 146 VAL B CG2  3  
ATOM   4858  H  H    . VAL B 2 3  ? 56.443 10.066  -7.345  1.00 0.00  ? 146 VAL B H    3  
ATOM   4859  H  HA   . VAL B 2 3  ? 53.468 9.768   -7.152  1.00 0.00  ? 146 VAL B HA   3  
ATOM   4860  H  HB   . VAL B 2 3  ? 55.735 7.897   -6.372  1.00 0.00  ? 146 VAL B HB   3  
ATOM   4861  H  HG11 . VAL B 2 3  ? 53.776 7.268   -5.169  1.00 0.00  ? 146 VAL B HG11 3  
ATOM   4862  H  HG12 . VAL B 2 3  ? 53.821 6.205   -6.575  1.00 0.00  ? 146 VAL B HG12 3  
ATOM   4863  H  HG13 . VAL B 2 3  ? 52.732 7.591   -6.554  1.00 0.00  ? 146 VAL B HG13 3  
ATOM   4864  H  HG21 . VAL B 2 3  ? 55.791 8.227   -8.769  1.00 0.00  ? 146 VAL B HG21 3  
ATOM   4865  H  HG22 . VAL B 2 3  ? 54.037 8.078   -8.881  1.00 0.00  ? 146 VAL B HG22 3  
ATOM   4866  H  HG23 . VAL B 2 3  ? 55.019 6.672   -8.468  1.00 0.00  ? 146 VAL B HG23 3  
ATOM   4867  N  N    . ARG B 2 4  ? 53.327 9.808   -4.557  1.00 0.00  ? 147 ARG B N    3  
ATOM   4868  C  CA   . ARG B 2 4  ? 53.249 10.179  -3.110  1.00 0.00  ? 147 ARG B CA   3  
ATOM   4869  C  C    . ARG B 2 4  ? 53.045 8.927   -2.241  1.00 0.00  ? 147 ARG B C    3  
ATOM   4870  O  O    . ARG B 2 4  ? 53.981 8.432   -1.644  1.00 0.00  ? 147 ARG B O    3  
ATOM   4871  C  CB   . ARG B 2 4  ? 52.044 11.119  -3.005  1.00 0.00  ? 147 ARG B CB   3  
ATOM   4872  C  CG   . ARG B 2 4  ? 52.451 12.522  -3.458  1.00 0.00  ? 147 ARG B CG   3  
ATOM   4873  C  CD   . ARG B 2 4  ? 52.023 13.546  -2.403  1.00 0.00  ? 147 ARG B CD   3  
ATOM   4874  N  NE   . ARG B 2 4  ? 51.401 14.658  -3.176  1.00 0.00  ? 147 ARG B NE   3  
ATOM   4875  C  CZ   . ARG B 2 4  ? 51.984 15.821  -3.230  1.00 0.00  ? 147 ARG B CZ   3  
ATOM   4876  N  NH1  . ARG B 2 4  ? 51.958 16.609  -2.194  1.00 0.00  ? 147 ARG B NH1  3  
ATOM   4877  N  NH2  . ARG B 2 4  ? 52.593 16.192  -4.320  1.00 0.00  ? 147 ARG B NH2  3  
ATOM   4878  H  H    . ARG B 2 4  ? 52.539 9.434   -5.006  1.00 0.00  ? 147 ARG B H    3  
ATOM   4879  H  HA   . ARG B 2 4  ? 54.145 10.697  -2.806  1.00 0.00  ? 147 ARG B HA   3  
ATOM   4880  H  HB2  . ARG B 2 4  ? 51.246 10.754  -3.636  1.00 0.00  ? 147 ARG B HB2  3  
ATOM   4881  H  HB3  . ARG B 2 4  ? 51.704 11.157  -1.980  1.00 0.00  ? 147 ARG B HB3  3  
ATOM   4882  H  HG2  . ARG B 2 4  ? 53.524 12.562  -3.584  1.00 0.00  ? 147 ARG B HG2  3  
ATOM   4883  H  HG3  . ARG B 2 4  ? 51.970 12.749  -4.397  1.00 0.00  ? 147 ARG B HG3  3  
ATOM   4884  H  HD2  . ARG B 2 4  ? 51.303 13.109  -1.725  1.00 0.00  ? 147 ARG B HD2  3  
ATOM   4885  H  HD3  . ARG B 2 4  ? 52.883 13.908  -1.860  1.00 0.00  ? 147 ARG B HD3  3  
ATOM   4886  H  HE   . ARG B 2 4  ? 50.551 14.515  -3.645  1.00 0.00  ? 147 ARG B HE   3  
ATOM   4887  H  HH11 . ARG B 2 4  ? 51.490 16.319  -1.359  1.00 0.00  ? 147 ARG B HH11 3  
ATOM   4888  H  HH12 . ARG B 2 4  ? 52.405 17.502  -2.232  1.00 0.00  ? 147 ARG B HH12 3  
ATOM   4889  H  HH21 . ARG B 2 4  ? 52.612 15.585  -5.114  1.00 0.00  ? 147 ARG B HH21 3  
ATOM   4890  H  HH22 . ARG B 2 4  ? 53.042 17.084  -4.364  1.00 0.00  ? 147 ARG B HH22 3  
ATOM   4891  N  N    . ILE B 2 5  ? 51.828 8.422   -2.166  1.00 0.00  ? 148 ILE B N    3  
ATOM   4892  C  CA   . ILE B 2 5  ? 51.536 7.206   -1.330  1.00 0.00  ? 148 ILE B CA   3  
ATOM   4893  C  C    . ILE B 2 5  ? 51.773 7.508   0.162   1.00 0.00  ? 148 ILE B C    3  
ATOM   4894  O  O    . ILE B 2 5  ? 52.506 8.412   0.518   1.00 0.00  ? 148 ILE B O    3  
ATOM   4895  C  CB   . ILE B 2 5  ? 52.480 6.100   -1.860  1.00 0.00  ? 148 ILE B CB   3  
ATOM   4896  C  CG1  . ILE B 2 5  ? 51.673 5.106   -2.702  1.00 0.00  ? 148 ILE B CG1  3  
ATOM   4897  C  CG2  . ILE B 2 5  ? 53.145 5.346   -0.702  1.00 0.00  ? 148 ILE B CG2  3  
ATOM   4898  C  CD1  . ILE B 2 5  ? 51.279 5.757   -4.029  1.00 0.00  ? 148 ILE B CD1  3  
ATOM   4899  H  H    . ILE B 2 5  ? 51.098 8.851   -2.658  1.00 0.00  ? 148 ILE B H    3  
ATOM   4900  H  HA   . ILE B 2 5  ? 50.511 6.903   -1.478  1.00 0.00  ? 148 ILE B HA   3  
ATOM   4901  H  HB   . ILE B 2 5  ? 53.246 6.549   -2.477  1.00 0.00  ? 148 ILE B HB   3  
ATOM   4902  H  HG12 . ILE B 2 5  ? 52.273 4.229   -2.895  1.00 0.00  ? 148 ILE B HG12 3  
ATOM   4903  H  HG13 . ILE B 2 5  ? 50.781 4.820   -2.165  1.00 0.00  ? 148 ILE B HG13 3  
ATOM   4904  H  HG21 . ILE B 2 5  ? 53.890 4.670   -1.095  1.00 0.00  ? 148 ILE B HG21 3  
ATOM   4905  H  HG22 . ILE B 2 5  ? 52.398 4.783   -0.162  1.00 0.00  ? 148 ILE B HG22 3  
ATOM   4906  H  HG23 . ILE B 2 5  ? 53.617 6.052   -0.035  1.00 0.00  ? 148 ILE B HG23 3  
ATOM   4907  H  HD11 . ILE B 2 5  ? 51.011 4.990   -4.742  1.00 0.00  ? 148 ILE B HD11 3  
ATOM   4908  H  HD12 . ILE B 2 5  ? 52.112 6.328   -4.411  1.00 0.00  ? 148 ILE B HD12 3  
ATOM   4909  H  HD13 . ILE B 2 5  ? 50.436 6.413   -3.872  1.00 0.00  ? 148 ILE B HD13 3  
ATOM   4910  N  N    . SER B 2 6  ? 51.149 6.759   1.036   1.00 0.00  ? 149 SER B N    3  
ATOM   4911  C  CA   . SER B 2 6  ? 51.330 6.999   2.501   1.00 0.00  ? 149 SER B CA   3  
ATOM   4912  C  C    . SER B 2 6  ? 51.723 5.699   3.212   1.00 0.00  ? 149 SER B C    3  
ATOM   4913  O  O    . SER B 2 6  ? 51.275 4.625   2.852   1.00 0.00  ? 149 SER B O    3  
ATOM   4914  C  CB   . SER B 2 6  ? 49.970 7.490   2.996   1.00 0.00  ? 149 SER B CB   3  
ATOM   4915  O  OG   . SER B 2 6  ? 50.166 8.406   4.066   1.00 0.00  ? 149 SER B OG   3  
ATOM   4916  H  H    . SER B 2 6  ? 50.559 6.039   0.729   1.00 0.00  ? 149 SER B H    3  
ATOM   4917  H  HA   . SER B 2 6  ? 52.078 7.759   2.669   1.00 0.00  ? 149 SER B HA   3  
ATOM   4918  H  HB2  . SER B 2 6  ? 49.449 7.985   2.194   1.00 0.00  ? 149 SER B HB2  3  
ATOM   4919  H  HB3  . SER B 2 6  ? 49.384 6.645   3.334   1.00 0.00  ? 149 SER B HB3  3  
ATOM   4920  H  HG   . SER B 2 6  ? 49.714 8.058   4.843   1.00 0.00  ? 149 SER B HG   3  
ATOM   4921  N  N    . ALA B 2 7  ? 52.559 5.792   4.219   1.00 0.00  ? 150 ALA B N    3  
ATOM   4922  C  CA   . ALA B 2 7  ? 52.992 4.565   4.963   1.00 0.00  ? 150 ALA B CA   3  
ATOM   4923  C  C    . ALA B 2 7  ? 51.777 3.820   5.538   1.00 0.00  ? 150 ALA B C    3  
ATOM   4924  O  O    . ALA B 2 7  ? 51.673 2.614   5.422   1.00 0.00  ? 150 ALA B O    3  
ATOM   4925  C  CB   . ALA B 2 7  ? 53.889 5.083   6.089   1.00 0.00  ? 150 ALA B CB   3  
ATOM   4926  H  H    . ALA B 2 7  ? 52.902 6.672   4.484   1.00 0.00  ? 150 ALA B H    3  
ATOM   4927  H  HA   . ALA B 2 7  ? 53.557 3.915   4.315   1.00 0.00  ? 150 ALA B HA   3  
ATOM   4928  H  HB1  . ALA B 2 7  ? 54.243 4.251   6.679   1.00 0.00  ? 150 ALA B HB1  3  
ATOM   4929  H  HB2  . ALA B 2 7  ? 53.325 5.756   6.718   1.00 0.00  ? 150 ALA B HB2  3  
ATOM   4930  H  HB3  . ALA B 2 7  ? 54.732 5.608   5.665   1.00 0.00  ? 150 ALA B HB3  3  
ATOM   4931  N  N    . ASP B 2 8  ? 50.859 4.532   6.148   1.00 0.00  ? 151 ASP B N    3  
ATOM   4932  C  CA   . ASP B 2 8  ? 49.645 3.869   6.726   1.00 0.00  ? 151 ASP B CA   3  
ATOM   4933  C  C    . ASP B 2 8  ? 48.753 3.309   5.603   1.00 0.00  ? 151 ASP B C    3  
ATOM   4934  O  O    . ASP B 2 8  ? 48.177 2.244   5.735   1.00 0.00  ? 151 ASP B O    3  
ATOM   4935  C  CB   . ASP B 2 8  ? 48.917 4.971   7.517   1.00 0.00  ? 151 ASP B CB   3  
ATOM   4936  C  CG   . ASP B 2 8  ? 48.323 6.012   6.563   1.00 0.00  ? 151 ASP B CG   3  
ATOM   4937  O  OD1  . ASP B 2 8  ? 49.088 6.780   6.005   1.00 0.00  ? 151 ASP B OD1  3  
ATOM   4938  O  OD2  . ASP B 2 8  ? 47.114 6.021   6.407   1.00 0.00  ? 151 ASP B OD2  3  
ATOM   4939  H  H    . ASP B 2 8  ? 50.964 5.504   6.223   1.00 0.00  ? 151 ASP B H    3  
ATOM   4940  H  HA   . ASP B 2 8  ? 49.940 3.076   7.395   1.00 0.00  ? 151 ASP B HA   3  
ATOM   4941  H  HB2  . ASP B 2 8  ? 48.123 4.527   8.100   1.00 0.00  ? 151 ASP B HB2  3  
ATOM   4942  H  HB3  . ASP B 2 8  ? 49.618 5.456   8.180   1.00 0.00  ? 151 ASP B HB3  3  
ATOM   4943  N  N    . ALA B 2 9  ? 48.646 4.012   4.497   1.00 0.00  ? 152 ALA B N    3  
ATOM   4944  C  CA   . ALA B 2 9  ? 47.806 3.519   3.359   1.00 0.00  ? 152 ALA B CA   3  
ATOM   4945  C  C    . ALA B 2 9  ? 48.371 2.197   2.829   1.00 0.00  ? 152 ALA B C    3  
ATOM   4946  O  O    . ALA B 2 9  ? 47.651 1.236   2.637   1.00 0.00  ? 152 ALA B O    3  
ATOM   4947  C  CB   . ALA B 2 9  ? 47.898 4.611   2.288   1.00 0.00  ? 152 ALA B CB   3  
ATOM   4948  H  H    . ALA B 2 9  ? 49.129 4.861   4.414   1.00 0.00  ? 152 ALA B H    3  
ATOM   4949  H  HA   . ALA B 2 9  ? 46.781 3.394   3.673   1.00 0.00  ? 152 ALA B HA   3  
ATOM   4950  H  HB1  . ALA B 2 9  ? 47.043 5.265   2.364   1.00 0.00  ? 152 ALA B HB1  3  
ATOM   4951  H  HB2  . ALA B 2 9  ? 47.916 4.154   1.309   1.00 0.00  ? 152 ALA B HB2  3  
ATOM   4952  H  HB3  . ALA B 2 9  ? 48.802 5.182   2.434   1.00 0.00  ? 152 ALA B HB3  3  
ATOM   4953  N  N    . MET B 2 10 ? 49.661 2.146   2.606   1.00 0.00  ? 153 MET B N    3  
ATOM   4954  C  CA   . MET B 2 10 ? 50.296 0.888   2.104   1.00 0.00  ? 153 MET B CA   3  
ATOM   4955  C  C    . MET B 2 10 ? 50.198 -0.211  3.169   1.00 0.00  ? 153 MET B C    3  
ATOM   4956  O  O    . MET B 2 10 ? 49.948 -1.361  2.864   1.00 0.00  ? 153 MET B O    3  
ATOM   4957  C  CB   . MET B 2 10 ? 51.759 1.260   1.852   1.00 0.00  ? 153 MET B CB   3  
ATOM   4958  C  CG   . MET B 2 10 ? 51.943 1.661   0.388   1.00 0.00  ? 153 MET B CG   3  
ATOM   4959  S  SD   . MET B 2 10 ? 53.657 1.360   -0.103  1.00 0.00  ? 153 MET B SD   3  
ATOM   4960  C  CE   . MET B 2 10 ? 53.531 2.022   -1.782  1.00 0.00  ? 153 MET B CE   3  
ATOM   4961  H  H    . MET B 2 10 ? 50.216 2.936   2.781   1.00 0.00  ? 153 MET B H    3  
ATOM   4962  H  HA   . MET B 2 10 ? 49.830 0.569   1.185   1.00 0.00  ? 153 MET B HA   3  
ATOM   4963  H  HB2  . MET B 2 10 ? 52.035 2.088   2.490   1.00 0.00  ? 153 MET B HB2  3  
ATOM   4964  H  HB3  . MET B 2 10 ? 52.390 0.412   2.073   1.00 0.00  ? 153 MET B HB3  3  
ATOM   4965  H  HG2  . MET B 2 10 ? 51.282 1.075   -0.234  1.00 0.00  ? 153 MET B HG2  3  
ATOM   4966  H  HG3  . MET B 2 10 ? 51.714 2.710   0.270   1.00 0.00  ? 153 MET B HG3  3  
ATOM   4967  H  HE1  . MET B 2 10 ? 52.587 2.534   -1.897  1.00 0.00  ? 153 MET B HE1  3  
ATOM   4968  H  HE2  . MET B 2 10 ? 53.589 1.215   -2.493  1.00 0.00  ? 153 MET B HE2  3  
ATOM   4969  H  HE3  . MET B 2 10 ? 54.345 2.713   -1.956  1.00 0.00  ? 153 MET B HE3  3  
ATOM   4970  N  N    . MET B 2 11 ? 50.391 0.143   4.417   1.00 0.00  ? 154 MET B N    3  
ATOM   4971  C  CA   . MET B 2 11 ? 50.309 -0.867  5.517   1.00 0.00  ? 154 MET B CA   3  
ATOM   4972  C  C    . MET B 2 11 ? 48.893 -1.454  5.597   1.00 0.00  ? 154 MET B C    3  
ATOM   4973  O  O    . MET B 2 11 ? 48.715 -2.657  5.585   1.00 0.00  ? 154 MET B O    3  
ATOM   4974  C  CB   . MET B 2 11 ? 50.652 -0.089  6.792   1.00 0.00  ? 154 MET B CB   3  
ATOM   4975  C  CG   . MET B 2 11 ? 51.083 -1.059  7.892   1.00 0.00  ? 154 MET B CG   3  
ATOM   4976  S  SD   . MET B 2 11 ? 49.856 -1.042  9.220   1.00 0.00  ? 154 MET B SD   3  
ATOM   4977  C  CE   . MET B 2 11 ? 50.436 -2.525  10.077  1.00 0.00  ? 154 MET B CE   3  
ATOM   4978  H  H    . MET B 2 11 ? 50.588 1.080   4.631   1.00 0.00  ? 154 MET B H    3  
ATOM   4979  H  HA   . MET B 2 11 ? 51.033 -1.652  5.361   1.00 0.00  ? 154 MET B HA   3  
ATOM   4980  H  HB2  . MET B 2 11 ? 51.459 0.599   6.585   1.00 0.00  ? 154 MET B HB2  3  
ATOM   4981  H  HB3  . MET B 2 11 ? 49.784 0.462   7.120   1.00 0.00  ? 154 MET B HB3  3  
ATOM   4982  H  HG2  . MET B 2 11 ? 51.160 -2.056  7.485   1.00 0.00  ? 154 MET B HG2  3  
ATOM   4983  H  HG3  . MET B 2 11 ? 52.043 -0.754  8.284   1.00 0.00  ? 154 MET B HG3  3  
ATOM   4984  H  HE1  . MET B 2 11 ? 51.478 -2.403  10.337  1.00 0.00  ? 154 MET B HE1  3  
ATOM   4985  H  HE2  . MET B 2 11 ? 50.327 -3.383  9.433   1.00 0.00  ? 154 MET B HE2  3  
ATOM   4986  H  HE3  . MET B 2 11 ? 49.850 -2.673  10.973  1.00 0.00  ? 154 MET B HE3  3  
ATOM   4987  N  N    . GLN B 2 12 ? 47.886 -0.615  5.667   1.00 0.00  ? 155 GLN B N    3  
ATOM   4988  C  CA   . GLN B 2 12 ? 46.481 -1.128  5.733   1.00 0.00  ? 155 GLN B CA   3  
ATOM   4989  C  C    . GLN B 2 12 ? 46.128 -1.876  4.438   1.00 0.00  ? 155 GLN B C    3  
ATOM   4990  O  O    . GLN B 2 12 ? 45.498 -2.918  4.468   1.00 0.00  ? 155 GLN B O    3  
ATOM   4991  C  CB   . GLN B 2 12 ? 45.600 0.117   5.896   1.00 0.00  ? 155 GLN B CB   3  
ATOM   4992  C  CG   . GLN B 2 12 ? 44.706 -0.041  7.130   1.00 0.00  ? 155 GLN B CG   3  
ATOM   4993  C  CD   . GLN B 2 12 ? 43.641 -1.109  6.865   1.00 0.00  ? 155 GLN B CD   3  
ATOM   4994  O  OE1  . GLN B 2 12 ? 43.848 -2.271  7.148   1.00 0.00  ? 155 GLN B OE1  3  
ATOM   4995  N  NE2  . GLN B 2 12 ? 42.503 -0.763  6.330   1.00 0.00  ? 155 GLN B NE2  3  
ATOM   4996  H  H    . GLN B 2 12 ? 48.056 0.353   5.667   1.00 0.00  ? 155 GLN B H    3  
ATOM   4997  H  HA   . GLN B 2 12 ? 46.359 -1.779  6.585   1.00 0.00  ? 155 GLN B HA   3  
ATOM   4998  H  HB2  . GLN B 2 12 ? 46.227 0.990   6.016   1.00 0.00  ? 155 GLN B HB2  3  
ATOM   4999  H  HB3  . GLN B 2 12 ? 44.980 0.239   5.020   1.00 0.00  ? 155 GLN B HB3  3  
ATOM   5000  H  HG2  . GLN B 2 12 ? 45.310 -0.339  7.975   1.00 0.00  ? 155 GLN B HG2  3  
ATOM   5001  H  HG3  . GLN B 2 12 ? 44.223 0.899   7.348   1.00 0.00  ? 155 GLN B HG3  3  
ATOM   5002  H  HE21 . GLN B 2 12 ? 42.332 0.175   6.101   1.00 0.00  ? 155 GLN B HE21 3  
ATOM   5003  H  HE22 . GLN B 2 12 ? 41.819 -1.442  6.156   1.00 0.00  ? 155 GLN B HE22 3  
ATOM   5004  N  N    . ALA B 2 13 ? 46.540 -1.359  3.303   1.00 0.00  ? 156 ALA B N    3  
ATOM   5005  C  CA   . ALA B 2 13 ? 46.238 -2.045  2.005   1.00 0.00  ? 156 ALA B CA   3  
ATOM   5006  C  C    . ALA B 2 13 ? 46.898 -3.434  1.963   1.00 0.00  ? 156 ALA B C    3  
ATOM   5007  O  O    . ALA B 2 13 ? 46.327 -4.379  1.454   1.00 0.00  ? 156 ALA B O    3  
ATOM   5008  C  CB   . ALA B 2 13 ? 46.822 -1.132  0.921   1.00 0.00  ? 156 ALA B CB   3  
ATOM   5009  H  H    . ALA B 2 13 ? 47.052 -0.523  3.305   1.00 0.00  ? 156 ALA B H    3  
ATOM   5010  H  HA   . ALA B 2 13 ? 45.171 -2.136  1.871   1.00 0.00  ? 156 ALA B HA   3  
ATOM   5011  H  HB1  . ALA B 2 13 ? 46.249 -0.217  0.875   1.00 0.00  ? 156 ALA B HB1  3  
ATOM   5012  H  HB2  . ALA B 2 13 ? 46.775 -1.633  -0.035  1.00 0.00  ? 156 ALA B HB2  3  
ATOM   5013  H  HB3  . ALA B 2 13 ? 47.850 -0.902  1.156   1.00 0.00  ? 156 ALA B HB3  3  
ATOM   5014  N  N    . LEU B 2 14 ? 48.091 -3.567  2.498   1.00 0.00  ? 157 LEU B N    3  
ATOM   5015  C  CA   . LEU B 2 14 ? 48.774 -4.902  2.488   1.00 0.00  ? 157 LEU B CA   3  
ATOM   5016  C  C    . LEU B 2 14 ? 48.409 -5.727  3.739   1.00 0.00  ? 157 LEU B C    3  
ATOM   5017  O  O    . LEU B 2 14 ? 48.848 -6.852  3.885   1.00 0.00  ? 157 LEU B O    3  
ATOM   5018  C  CB   . LEU B 2 14 ? 50.274 -4.589  2.480   1.00 0.00  ? 157 LEU B CB   3  
ATOM   5019  C  CG   . LEU B 2 14 ? 50.792 -4.573  1.037   1.00 0.00  ? 157 LEU B CG   3  
ATOM   5020  C  CD1  . LEU B 2 14 ? 51.712 -3.367  0.836   1.00 0.00  ? 157 LEU B CD1  3  
ATOM   5021  C  CD2  . LEU B 2 14 ? 51.578 -5.859  0.758   1.00 0.00  ? 157 LEU B CD2  3  
ATOM   5022  H  H    . LEU B 2 14 ? 48.534 -2.794  2.906   1.00 0.00  ? 157 LEU B H    3  
ATOM   5023  H  HA   . LEU B 2 14 ? 48.512 -5.448  1.596   1.00 0.00  ? 157 LEU B HA   3  
ATOM   5024  H  HB2  . LEU B 2 14 ? 50.444 -3.624  2.935   1.00 0.00  ? 157 LEU B HB2  3  
ATOM   5025  H  HB3  . LEU B 2 14 ? 50.801 -5.347  3.040   1.00 0.00  ? 157 LEU B HB3  3  
ATOM   5026  H  HG   . LEU B 2 14 ? 49.956 -4.504  0.355   1.00 0.00  ? 157 LEU B HG   3  
ATOM   5027  H  HD11 . LEU B 2 14 ? 51.152 -2.456  0.987   1.00 0.00  ? 157 LEU B HD11 3  
ATOM   5028  H  HD12 . LEU B 2 14 ? 52.111 -3.381  -0.167  1.00 0.00  ? 157 LEU B HD12 3  
ATOM   5029  H  HD13 . LEU B 2 14 ? 52.524 -3.411  1.546   1.00 0.00  ? 157 LEU B HD13 3  
ATOM   5030  H  HD21 . LEU B 2 14 ? 51.005 -6.497  0.101   1.00 0.00  ? 157 LEU B HD21 3  
ATOM   5031  H  HD22 . LEU B 2 14 ? 51.767 -6.376  1.686   1.00 0.00  ? 157 LEU B HD22 3  
ATOM   5032  H  HD23 . LEU B 2 14 ? 52.518 -5.611  0.287   1.00 0.00  ? 157 LEU B HD23 3  
ATOM   5033  N  N    . LEU B 2 15 ? 47.616 -5.188  4.640   1.00 0.00  ? 158 LEU B N    3  
ATOM   5034  C  CA   . LEU B 2 15 ? 47.241 -5.963  5.868   1.00 0.00  ? 158 LEU B CA   3  
ATOM   5035  C  C    . LEU B 2 15 ? 46.056 -6.895  5.576   1.00 0.00  ? 158 LEU B C    3  
ATOM   5036  O  O    . LEU B 2 15 ? 46.124 -8.084  5.819   1.00 0.00  ? 158 LEU B O    3  
ATOM   5037  C  CB   . LEU B 2 15 ? 46.860 -4.918  6.925   1.00 0.00  ? 158 LEU B CB   3  
ATOM   5038  C  CG   . LEU B 2 15 ? 47.874 -4.961  8.074   1.00 0.00  ? 158 LEU B CG   3  
ATOM   5039  C  CD1  . LEU B 2 15 ? 47.567 -3.848  9.077   1.00 0.00  ? 158 LEU B CD1  3  
ATOM   5040  C  CD2  . LEU B 2 15 ? 47.791 -6.315  8.784   1.00 0.00  ? 158 LEU B CD2  3  
ATOM   5041  H  H    . LEU B 2 15 ? 47.269 -4.282  4.512   1.00 0.00  ? 158 LEU B H    3  
ATOM   5042  H  HA   . LEU B 2 15 ? 48.086 -6.539  6.214   1.00 0.00  ? 158 LEU B HA   3  
ATOM   5043  H  HB2  . LEU B 2 15 ? 46.861 -3.934  6.479   1.00 0.00  ? 158 LEU B HB2  3  
ATOM   5044  H  HB3  . LEU B 2 15 ? 45.875 -5.137  7.310   1.00 0.00  ? 158 LEU B HB3  3  
ATOM   5045  H  HG   . LEU B 2 15 ? 48.869 -4.821  7.677   1.00 0.00  ? 158 LEU B HG   3  
ATOM   5046  H  HD11 . LEU B 2 15 ? 48.047 -4.071  10.018  1.00 0.00  ? 158 LEU B HD11 3  
ATOM   5047  H  HD12 . LEU B 2 15 ? 46.499 -3.778  9.224   1.00 0.00  ? 158 LEU B HD12 3  
ATOM   5048  H  HD13 . LEU B 2 15 ? 47.940 -2.910  8.697   1.00 0.00  ? 158 LEU B HD13 3  
ATOM   5049  H  HD21 . LEU B 2 15 ? 46.759 -6.629  8.844   1.00 0.00  ? 158 LEU B HD21 3  
ATOM   5050  H  HD22 . LEU B 2 15 ? 48.197 -6.224  9.781   1.00 0.00  ? 158 LEU B HD22 3  
ATOM   5051  H  HD23 . LEU B 2 15 ? 48.359 -7.046  8.230   1.00 0.00  ? 158 LEU B HD23 3  
ATOM   5052  N  N    . GLY B 2 16 ? 44.972 -6.367  5.059   1.00 0.00  ? 159 GLY B N    3  
ATOM   5053  C  CA   . GLY B 2 16 ? 43.788 -7.231  4.752   1.00 0.00  ? 159 GLY B CA   3  
ATOM   5054  C  C    . GLY B 2 16 ? 42.775 -6.454  3.905   1.00 0.00  ? 159 GLY B C    3  
ATOM   5055  O  O    . GLY B 2 16 ? 41.600 -6.418  4.211   1.00 0.00  ? 159 GLY B O    3  
ATOM   5056  H  H    . GLY B 2 16 ? 44.938 -5.405  4.871   1.00 0.00  ? 159 GLY B H    3  
ATOM   5057  H  HA2  . GLY B 2 16 ? 44.115 -8.106  4.208   1.00 0.00  ? 159 GLY B HA2  3  
ATOM   5058  H  HA3  . GLY B 2 16 ? 43.319 -7.538  5.675   1.00 0.00  ? 159 GLY B HA3  3  
ATOM   5059  N  N    . ALA B 2 17 ? 43.222 -5.835  2.839   1.00 0.00  ? 160 ALA B N    3  
ATOM   5060  C  CA   . ALA B 2 17 ? 42.286 -5.061  1.966   1.00 0.00  ? 160 ALA B CA   3  
ATOM   5061  C  C    . ALA B 2 17 ? 42.073 -5.799  0.636   1.00 0.00  ? 160 ALA B C    3  
ATOM   5062  O  O    . ALA B 2 17 ? 40.954 -6.062  0.237   1.00 0.00  ? 160 ALA B O    3  
ATOM   5063  C  CB   . ALA B 2 17 ? 42.976 -3.712  1.741   1.00 0.00  ? 160 ALA B CB   3  
ATOM   5064  H  H    . ALA B 2 17 ? 44.175 -5.883  2.612   1.00 0.00  ? 160 ALA B H    3  
ATOM   5065  H  HA   . ALA B 2 17 ? 41.341 -4.912  2.465   1.00 0.00  ? 160 ALA B HA   3  
ATOM   5066  H  HB1  . ALA B 2 17 ? 44.034 -3.810  1.939   1.00 0.00  ? 160 ALA B HB1  3  
ATOM   5067  H  HB2  . ALA B 2 17 ? 42.553 -2.977  2.410   1.00 0.00  ? 160 ALA B HB2  3  
ATOM   5068  H  HB3  . ALA B 2 17 ? 42.829 -3.396  0.719   1.00 0.00  ? 160 ALA B HB3  3  
ATOM   5069  N  N    . ARG B 2 18 ? 43.139 -6.142  -0.045  1.00 0.00  ? 161 ARG B N    3  
ATOM   5070  C  CA   . ARG B 2 18 ? 43.009 -6.873  -1.344  1.00 0.00  ? 161 ARG B CA   3  
ATOM   5071  C  C    . ARG B 2 18 ? 44.207 -7.816  -1.532  1.00 0.00  ? 161 ARG B C    3  
ATOM   5072  O  O    . ARG B 2 18 ? 45.250 -7.422  -2.021  1.00 0.00  ? 161 ARG B O    3  
ATOM   5073  C  CB   . ARG B 2 18 ? 42.991 -5.783  -2.426  1.00 0.00  ? 161 ARG B CB   3  
ATOM   5074  C  CG   . ARG B 2 18 ? 42.083 -6.216  -3.585  1.00 0.00  ? 161 ARG B CG   3  
ATOM   5075  C  CD   . ARG B 2 18 ? 42.928 -6.485  -4.837  1.00 0.00  ? 161 ARG B CD   3  
ATOM   5076  N  NE   . ARG B 2 18 ? 43.320 -7.924  -4.744  1.00 0.00  ? 161 ARG B NE   3  
ATOM   5077  C  CZ   . ARG B 2 18 ? 42.710 -8.821  -5.468  1.00 0.00  ? 161 ARG B CZ   3  
ATOM   5078  N  NH1  . ARG B 2 18 ? 41.503 -9.200  -5.157  1.00 0.00  ? 161 ARG B NH1  3  
ATOM   5079  N  NH2  . ARG B 2 18 ? 43.316 -9.346  -6.495  1.00 0.00  ? 161 ARG B NH2  3  
ATOM   5080  H  H    . ARG B 2 18 ? 44.029 -5.922  0.302   1.00 0.00  ? 161 ARG B H    3  
ATOM   5081  H  HA   . ARG B 2 18 ? 42.086 -7.432  -1.368  1.00 0.00  ? 161 ARG B HA   3  
ATOM   5082  H  HB2  . ARG B 2 18 ? 42.616 -4.863  -2.002  1.00 0.00  ? 161 ARG B HB2  3  
ATOM   5083  H  HB3  . ARG B 2 18 ? 43.992 -5.626  -2.796  1.00 0.00  ? 161 ARG B HB3  3  
ATOM   5084  H  HG2  . ARG B 2 18 ? 41.550 -7.114  -3.310  1.00 0.00  ? 161 ARG B HG2  3  
ATOM   5085  H  HG3  . ARG B 2 18 ? 41.374 -5.429  -3.797  1.00 0.00  ? 161 ARG B HG3  3  
ATOM   5086  H  HD2  . ARG B 2 18 ? 42.342 -6.309  -5.730  1.00 0.00  ? 161 ARG B HD2  3  
ATOM   5087  H  HD3  . ARG B 2 18 ? 43.808 -5.861  -4.837  1.00 0.00  ? 161 ARG B HD3  3  
ATOM   5088  H  HE   . ARG B 2 18 ? 44.046 -8.197  -4.142  1.00 0.00  ? 161 ARG B HE   3  
ATOM   5089  H  HH11 . ARG B 2 18 ? 41.046 -8.804  -4.363  1.00 0.00  ? 161 ARG B HH11 3  
ATOM   5090  H  HH12 . ARG B 2 18 ? 41.035 -9.886  -5.712  1.00 0.00  ? 161 ARG B HH12 3  
ATOM   5091  H  HH21 . ARG B 2 18 ? 44.248 -9.061  -6.723  1.00 0.00  ? 161 ARG B HH21 3  
ATOM   5092  H  HH22 . ARG B 2 18 ? 42.854 -10.034 -7.051  1.00 0.00  ? 161 ARG B HH22 3  
ATOM   5093  N  N    . ALA B 2 19 ? 44.066 -9.059  -1.141  1.00 0.00  ? 162 ALA B N    3  
ATOM   5094  C  CA   . ALA B 2 19 ? 45.198 -10.029 -1.293  1.00 0.00  ? 162 ALA B CA   3  
ATOM   5095  C  C    . ALA B 2 19 ? 45.363 -10.436 -2.764  1.00 0.00  ? 162 ALA B C    3  
ATOM   5096  O  O    . ALA B 2 19 ? 44.530 -10.130 -3.595  1.00 0.00  ? 162 ALA B O    3  
ATOM   5097  C  CB   . ALA B 2 19 ? 44.808 -11.240 -0.442  1.00 0.00  ? 162 ALA B CB   3  
ATOM   5098  H  H    . ALA B 2 19 ? 43.219 -9.354  -0.744  1.00 0.00  ? 162 ALA B H    3  
ATOM   5099  H  HA   . ALA B 2 19 ? 46.114 -9.597  -0.920  1.00 0.00  ? 162 ALA B HA   3  
ATOM   5100  H  HB1  . ALA B 2 19 ? 44.395 -10.904 0.497   1.00 0.00  ? 162 ALA B HB1  3  
ATOM   5101  H  HB2  . ALA B 2 19 ? 45.684 -11.845 -0.255  1.00 0.00  ? 162 ALA B HB2  3  
ATOM   5102  H  HB3  . ALA B 2 19 ? 44.071 -11.829 -0.969  1.00 0.00  ? 162 ALA B HB3  3  
ATOM   5103  N  N    . LYS B 2 20 ? 46.441 -11.123 -3.076  1.00 0.00  ? 163 LYS B N    3  
ATOM   5104  C  CA   . LYS B 2 20 ? 46.710 -11.571 -4.485  1.00 0.00  ? 163 LYS B CA   3  
ATOM   5105  C  C    . LYS B 2 20 ? 47.055 -10.367 -5.381  1.00 0.00  ? 163 LYS B C    3  
ATOM   5106  O  O    . LYS B 2 20 ? 48.234 -10.152 -5.611  1.00 0.00  ? 163 LYS B O    3  
ATOM   5107  C  CB   . LYS B 2 20 ? 45.430 -12.280 -4.958  1.00 0.00  ? 163 LYS B CB   3  
ATOM   5108  C  CG   . LYS B 2 20 ? 45.797 -13.389 -5.948  1.00 0.00  ? 163 LYS B CG   3  
ATOM   5109  C  CD   . LYS B 2 20 ? 44.529 -13.896 -6.644  1.00 0.00  ? 163 LYS B CD   3  
ATOM   5110  C  CE   . LYS B 2 20 ? 44.402 -15.413 -6.446  1.00 0.00  ? 163 LYS B CE   3  
ATOM   5111  N  NZ   . LYS B 2 20 ? 42.993 -15.630 -6.011  1.00 0.00  ? 163 LYS B NZ   3  
ATOM   5112  O  OXT  . LYS B 2 20 ? 46.145 -9.680  -5.822  1.00 0.00  ? 163 LYS B OXT  3  
ATOM   5113  H  H    . LYS B 2 20 ? 47.085 -11.346 -2.374  1.00 0.00  ? 163 LYS B H    3  
ATOM   5114  H  HA   . LYS B 2 20 ? 47.530 -12.273 -4.491  1.00 0.00  ? 163 LYS B HA   3  
ATOM   5115  H  HB2  . LYS B 2 20 ? 44.922 -12.709 -4.107  1.00 0.00  ? 163 LYS B HB2  3  
ATOM   5116  H  HB3  . LYS B 2 20 ? 44.780 -11.567 -5.443  1.00 0.00  ? 163 LYS B HB3  3  
ATOM   5117  H  HG2  . LYS B 2 20 ? 46.483 -12.999 -6.687  1.00 0.00  ? 163 LYS B HG2  3  
ATOM   5118  H  HG3  . LYS B 2 20 ? 46.265 -14.204 -5.417  1.00 0.00  ? 163 LYS B HG3  3  
ATOM   5119  H  HD2  . LYS B 2 20 ? 43.666 -13.403 -6.220  1.00 0.00  ? 163 LYS B HD2  3  
ATOM   5120  H  HD3  . LYS B 2 20 ? 44.587 -13.677 -7.699  1.00 0.00  ? 163 LYS B HD3  3  
ATOM   5121  H  HE2  . LYS B 2 20 ? 44.595 -15.928 -7.378  1.00 0.00  ? 163 LYS B HE2  3  
ATOM   5122  H  HE3  . LYS B 2 20 ? 45.083 -15.753 -5.680  1.00 0.00  ? 163 LYS B HE3  3  
ATOM   5123  H  HZ1  . LYS B 2 20 ? 42.796 -15.055 -5.167  1.00 0.00  ? 163 LYS B HZ1  3  
ATOM   5124  H  HZ2  . LYS B 2 20 ? 42.852 -16.637 -5.784  1.00 0.00  ? 163 LYS B HZ2  3  
ATOM   5125  H  HZ3  . LYS B 2 20 ? 42.345 -15.353 -6.776  1.00 0.00  ? 163 LYS B HZ3  3  
HETATM 5126  CA CA   . CA  C 3 .  ? 69.025 -3.458  -0.967  1.00 0.00  ? 90  CA  A CA   3  
HETATM 5127  O  OAA  . SXK D 4 .  ? 59.662 12.880  -3.713  1.00 20.00 ? 91  SXK A OAA  3  
HETATM 5128  O  OAB  . SXK D 4 .  ? 59.559 11.901  -5.705  1.00 20.00 ? 91  SXK A OAB  3  
HETATM 5129  C  CAE  . SXK D 4 .  ? 56.731 3.220   0.099   1.00 20.00 ? 91  SXK A CAE  3  
HETATM 5130  C  CAF  . SXK D 4 .  ? 57.398 8.156   -3.247  1.00 20.00 ? 91  SXK A CAF  3  
HETATM 5131  C  CAG  . SXK D 4 .  ? 59.184 8.160   -1.545  1.00 20.00 ? 91  SXK A CAG  3  
HETATM 5132  C  CAH  . SXK D 4 .  ? 57.072 6.823   -2.909  1.00 20.00 ? 91  SXK A CAH  3  
HETATM 5133  C  CAI  . SXK D 4 .  ? 58.867 6.831   -1.203  1.00 20.00 ? 91  SXK A CAI  3  
HETATM 5134  C  CAJ  . SXK D 4 .  ? 57.020 4.559   -0.254  1.00 20.00 ? 91  SXK A CAJ  3  
HETATM 5135  C  CAK  . SXK D 4 .  ? 57.376 2.458   -2.131  1.00 20.00 ? 91  SXK A CAK  3  
HETATM 5136  C  CAL  . SXK D 4 .  ? 59.808 10.481  -3.816  1.00 20.00 ? 91  SXK A CAL  3  
HETATM 5137  O  OAM  . SXK D 4 .  ? 58.681 10.109  -2.983  1.00 20.00 ? 91  SXK A OAM  3  
HETATM 5138  C  CAN  . SXK D 4 .  ? 59.667 11.869  -4.461  1.00 20.00 ? 91  SXK A CAN  3  
HETATM 5139  C  CAO  . SXK D 4 .  ? 56.911 2.191   -0.839  1.00 20.00 ? 91  SXK A CAO  3  
HETATM 5140  C  CAP  . SXK D 4 .  ? 58.456 8.822   -2.560  1.00 20.00 ? 91  SXK A CAP  3  
HETATM 5141  C  CAQ  . SXK D 4 .  ? 57.668 3.791   -2.496  1.00 20.00 ? 91  SXK A CAQ  3  
HETATM 5142  C  CAR  . SXK D 4 .  ? 57.811 6.160   -1.888  1.00 20.00 ? 91  SXK A CAR  3  
HETATM 5143  C  CAS  . SXK D 4 .  ? 57.493 4.837   -1.549  1.00 20.00 ? 91  SXK A CAS  3  
HETATM 5144  F  FCC  . SXK D 4 .  ? 56.627 0.910   -0.479  1.00 20.00 ? 91  SXK A FCC  3  
HETATM 5145  F  FDD  . SXK D 4 .  ? 58.123 4.022   -3.766  1.00 20.00 ? 91  SXK A FDD  3  
HETATM 5146  H  HAE  . SXK D 4 .  ? 56.370 2.983   1.097   1.00 20.00 ? 91  SXK A HAE  3  
HETATM 5147  H  HAF  . SXK D 4 .  ? 56.843 8.677   -4.033  1.00 20.00 ? 91  SXK A HAF  3  
HETATM 5148  H  HAG  . SXK D 4 .  ? 59.998 8.662   -1.017  1.00 20.00 ? 91  SXK A HAG  3  
HETATM 5149  H  HAH  . SXK D 4 .  ? 56.264 6.308   -3.430  1.00 20.00 ? 91  SXK A HAH  3  
HETATM 5150  H  HAI  . SXK D 4 .  ? 59.428 6.323   -0.417  1.00 20.00 ? 91  SXK A HAI  3  
HETATM 5151  H  HAJ  . SXK D 4 .  ? 56.880 5.357   0.476   1.00 20.00 ? 91  SXK A HAJ  3  
HETATM 5152  H  HAK  . SXK D 4 .  ? 57.514 1.650   -2.854  1.00 20.00 ? 91  SXK A HAK  3  
HETATM 5153  H  HAL  . SXK D 4 .  ? 60.719 10.481  -3.207  1.00 20.00 ? 91  SXK A HAL  3  
HETATM 5154  H  HALA . SXK D 4 .  ? 59.863 9.765   -4.634  1.00 20.00 ? 91  SXK A HALA 3  
ATOM   5155  N  N    . MET A 1 1  ? 75.694 5.370   3.493   1.00 0.00  ? 1   MET A N    4  
ATOM   5156  C  CA   . MET A 1 1  ? 75.881 6.180   4.736   1.00 0.00  ? 1   MET A CA   4  
ATOM   5157  C  C    . MET A 1 1  ? 74.547 6.312   5.482   1.00 0.00  ? 1   MET A C    4  
ATOM   5158  O  O    . MET A 1 1  ? 73.561 6.751   4.923   1.00 0.00  ? 1   MET A O    4  
ATOM   5159  C  CB   . MET A 1 1  ? 76.368 7.552   4.254   1.00 0.00  ? 1   MET A CB   4  
ATOM   5160  C  CG   . MET A 1 1  ? 77.883 7.512   4.037   1.00 0.00  ? 1   MET A CG   4  
ATOM   5161  S  SD   . MET A 1 1  ? 78.502 9.192   3.767   1.00 0.00  ? 1   MET A SD   4  
ATOM   5162  C  CE   . MET A 1 1  ? 78.098 9.308   2.006   1.00 0.00  ? 1   MET A CE   4  
ATOM   5163  H  H1   . MET A 1 1  ? 74.900 5.754   2.943   1.00 0.00  ? 1   MET A H1   4  
ATOM   5164  H  H2   . MET A 1 1  ? 75.493 4.381   3.751   1.00 0.00  ? 1   MET A H2   4  
ATOM   5165  H  H3   . MET A 1 1  ? 76.561 5.408   2.919   1.00 0.00  ? 1   MET A H3   4  
ATOM   5166  H  HA   . MET A 1 1  ? 76.625 5.727   5.373   1.00 0.00  ? 1   MET A HA   4  
ATOM   5167  H  HB2  . MET A 1 1  ? 75.876 7.802   3.324   1.00 0.00  ? 1   MET A HB2  4  
ATOM   5168  H  HB3  . MET A 1 1  ? 76.133 8.299   4.997   1.00 0.00  ? 1   MET A HB3  4  
ATOM   5169  H  HG2  . MET A 1 1  ? 78.361 7.088   4.908   1.00 0.00  ? 1   MET A HG2  4  
ATOM   5170  H  HG3  . MET A 1 1  ? 78.108 6.903   3.173   1.00 0.00  ? 1   MET A HG3  4  
ATOM   5171  H  HE1  . MET A 1 1  ? 78.167 8.328   1.556   1.00 0.00  ? 1   MET A HE1  4  
ATOM   5172  H  HE2  . MET A 1 1  ? 78.790 9.975   1.519   1.00 0.00  ? 1   MET A HE2  4  
ATOM   5173  H  HE3  . MET A 1 1  ? 77.093 9.692   1.894   1.00 0.00  ? 1   MET A HE3  4  
ATOM   5174  N  N    . ASP A 1 2  ? 74.510 5.932   6.736   1.00 0.00  ? 2   ASP A N    4  
ATOM   5175  C  CA   . ASP A 1 2  ? 73.237 6.032   7.513   1.00 0.00  ? 2   ASP A CA   4  
ATOM   5176  C  C    . ASP A 1 2  ? 73.496 6.634   8.902   1.00 0.00  ? 2   ASP A C    4  
ATOM   5177  O  O    . ASP A 1 2  ? 74.554 6.465   9.480   1.00 0.00  ? 2   ASP A O    4  
ATOM   5178  C  CB   . ASP A 1 2  ? 72.730 4.590   7.633   1.00 0.00  ? 2   ASP A CB   4  
ATOM   5179  C  CG   . ASP A 1 2  ? 71.214 4.587   7.858   1.00 0.00  ? 2   ASP A CG   4  
ATOM   5180  O  OD1  . ASP A 1 2  ? 70.766 5.251   8.778   1.00 0.00  ? 2   ASP A OD1  4  
ATOM   5181  O  OD2  . ASP A 1 2  ? 70.527 3.910   7.113   1.00 0.00  ? 2   ASP A OD2  4  
ATOM   5182  H  H    . ASP A 1 2  ? 75.316 5.577   7.165   1.00 0.00  ? 2   ASP A H    4  
ATOM   5183  H  HA   . ASP A 1 2  ? 72.515 6.629   6.976   1.00 0.00  ? 2   ASP A HA   4  
ATOM   5184  H  HB2  . ASP A 1 2  ? 72.957 4.054   6.724   1.00 0.00  ? 2   ASP A HB2  4  
ATOM   5185  H  HB3  . ASP A 1 2  ? 73.216 4.106   8.467   1.00 0.00  ? 2   ASP A HB3  4  
ATOM   5186  N  N    . ASP A 1 3  ? 72.525 7.331   9.438   1.00 0.00  ? 3   ASP A N    4  
ATOM   5187  C  CA   . ASP A 1 3  ? 72.683 7.950   10.790  1.00 0.00  ? 3   ASP A CA   4  
ATOM   5188  C  C    . ASP A 1 3  ? 71.302 8.171   11.425  1.00 0.00  ? 3   ASP A C    4  
ATOM   5189  O  O    . ASP A 1 3  ? 70.975 7.586   12.441  1.00 0.00  ? 3   ASP A O    4  
ATOM   5190  C  CB   . ASP A 1 3  ? 73.390 9.289   10.531  1.00 0.00  ? 3   ASP A CB   4  
ATOM   5191  C  CG   . ASP A 1 3  ? 73.530 10.066  11.843  1.00 0.00  ? 3   ASP A CG   4  
ATOM   5192  O  OD1  . ASP A 1 3  ? 74.389 9.710   12.631  1.00 0.00  ? 3   ASP A OD1  4  
ATOM   5193  O  OD2  . ASP A 1 3  ? 72.776 11.005  12.033  1.00 0.00  ? 3   ASP A OD2  4  
ATOM   5194  H  H    . ASP A 1 3  ? 71.683 7.443   8.948   1.00 0.00  ? 3   ASP A H    4  
ATOM   5195  H  HA   . ASP A 1 3  ? 73.294 7.326   11.422  1.00 0.00  ? 3   ASP A HA   4  
ATOM   5196  H  HB2  . ASP A 1 3  ? 74.370 9.102   10.119  1.00 0.00  ? 3   ASP A HB2  4  
ATOM   5197  H  HB3  . ASP A 1 3  ? 72.811 9.872   9.831   1.00 0.00  ? 3   ASP A HB3  4  
ATOM   5198  N  N    . ILE A 1 4  ? 70.491 9.009   10.827  1.00 0.00  ? 4   ILE A N    4  
ATOM   5199  C  CA   . ILE A 1 4  ? 69.127 9.277   11.382  1.00 0.00  ? 4   ILE A CA   4  
ATOM   5200  C  C    . ILE A 1 4  ? 68.170 8.122   11.046  1.00 0.00  ? 4   ILE A C    4  
ATOM   5201  O  O    . ILE A 1 4  ? 67.367 7.720   11.867  1.00 0.00  ? 4   ILE A O    4  
ATOM   5202  C  CB   . ILE A 1 4  ? 68.676 10.579  10.703  1.00 0.00  ? 4   ILE A CB   4  
ATOM   5203  C  CG1  . ILE A 1 4  ? 69.439 11.760  11.312  1.00 0.00  ? 4   ILE A CG1  4  
ATOM   5204  C  CG2  . ILE A 1 4  ? 67.174 10.788  10.911  1.00 0.00  ? 4   ILE A CG2  4  
ATOM   5205  C  CD1  . ILE A 1 4  ? 69.593 12.867  10.266  1.00 0.00  ? 4   ILE A CD1  4  
ATOM   5206  H  H    . ILE A 1 4  ? 70.781 9.463   10.009  1.00 0.00  ? 4   ILE A H    4  
ATOM   5207  H  HA   . ILE A 1 4  ? 69.179 9.420   12.449  1.00 0.00  ? 4   ILE A HA   4  
ATOM   5208  H  HB   . ILE A 1 4  ? 68.886 10.521  9.644   1.00 0.00  ? 4   ILE A HB   4  
ATOM   5209  H  HG12 . ILE A 1 4  ? 68.893 12.142  12.163  1.00 0.00  ? 4   ILE A HG12 4  
ATOM   5210  H  HG13 . ILE A 1 4  ? 70.417 11.432  11.631  1.00 0.00  ? 4   ILE A HG13 4  
ATOM   5211  H  HG21 . ILE A 1 4  ? 66.630 9.961   10.479  1.00 0.00  ? 4   ILE A HG21 4  
ATOM   5212  H  HG22 . ILE A 1 4  ? 66.871 11.707  10.430  1.00 0.00  ? 4   ILE A HG22 4  
ATOM   5213  H  HG23 . ILE A 1 4  ? 66.961 10.847  11.968  1.00 0.00  ? 4   ILE A HG23 4  
ATOM   5214  H  HD11 . ILE A 1 4  ? 68.833 12.754  9.506   1.00 0.00  ? 4   ILE A HD11 4  
ATOM   5215  H  HD12 . ILE A 1 4  ? 70.571 12.799  9.811   1.00 0.00  ? 4   ILE A HD12 4  
ATOM   5216  H  HD13 . ILE A 1 4  ? 69.484 13.829  10.743  1.00 0.00  ? 4   ILE A HD13 4  
ATOM   5217  N  N    . TYR A 1 5  ? 68.249 7.590   9.848   1.00 0.00  ? 5   TYR A N    4  
ATOM   5218  C  CA   . TYR A 1 5  ? 67.340 6.461   9.461   1.00 0.00  ? 5   TYR A CA   4  
ATOM   5219  C  C    . TYR A 1 5  ? 67.539 5.272   10.412  1.00 0.00  ? 5   TYR A C    4  
ATOM   5220  O  O    . TYR A 1 5  ? 66.583 4.669   10.863  1.00 0.00  ? 5   TYR A O    4  
ATOM   5221  C  CB   . TYR A 1 5  ? 67.730 6.092   8.023   1.00 0.00  ? 5   TYR A CB   4  
ATOM   5222  C  CG   . TYR A 1 5  ? 67.341 7.217   7.091   1.00 0.00  ? 5   TYR A CG   4  
ATOM   5223  C  CD1  . TYR A 1 5  ? 65.992 7.454   6.803   1.00 0.00  ? 5   TYR A CD1  4  
ATOM   5224  C  CD2  . TYR A 1 5  ? 68.331 8.026   6.519   1.00 0.00  ? 5   TYR A CD2  4  
ATOM   5225  C  CE1  . TYR A 1 5  ? 65.634 8.498   5.944   1.00 0.00  ? 5   TYR A CE1  4  
ATOM   5226  C  CE2  . TYR A 1 5  ? 67.970 9.071   5.660   1.00 0.00  ? 5   TYR A CE2  4  
ATOM   5227  C  CZ   . TYR A 1 5  ? 66.622 9.307   5.373   1.00 0.00  ? 5   TYR A CZ   4  
ATOM   5228  O  OH   . TYR A 1 5  ? 66.266 10.338  4.526   1.00 0.00  ? 5   TYR A OH   4  
ATOM   5229  H  H    . TYR A 1 5  ? 68.902 7.933   9.205   1.00 0.00  ? 5   TYR A H    4  
ATOM   5230  H  HA   . TYR A 1 5  ? 66.312 6.788   9.489   1.00 0.00  ? 5   TYR A HA   4  
ATOM   5231  H  HB2  . TYR A 1 5  ? 68.796 5.931   7.968   1.00 0.00  ? 5   TYR A HB2  4  
ATOM   5232  H  HB3  . TYR A 1 5  ? 67.215 5.191   7.731   1.00 0.00  ? 5   TYR A HB3  4  
ATOM   5233  H  HD1  . TYR A 1 5  ? 65.228 6.829   7.243   1.00 0.00  ? 5   TYR A HD1  4  
ATOM   5234  H  HD2  . TYR A 1 5  ? 69.372 7.843   6.740   1.00 0.00  ? 5   TYR A HD2  4  
ATOM   5235  H  HE1  . TYR A 1 5  ? 64.594 8.682   5.724   1.00 0.00  ? 5   TYR A HE1  4  
ATOM   5236  H  HE2  . TYR A 1 5  ? 68.733 9.696   5.219   1.00 0.00  ? 5   TYR A HE2  4  
ATOM   5237  H  HH   . TYR A 1 5  ? 65.769 10.983  5.036   1.00 0.00  ? 5   TYR A HH   4  
ATOM   5238  N  N    . LYS A 1 6  ? 68.769 4.948   10.741  1.00 0.00  ? 6   LYS A N    4  
ATOM   5239  C  CA   . LYS A 1 6  ? 69.019 3.817   11.690  1.00 0.00  ? 6   LYS A CA   4  
ATOM   5240  C  C    . LYS A 1 6  ? 68.394 4.158   13.049  1.00 0.00  ? 6   LYS A C    4  
ATOM   5241  O  O    . LYS A 1 6  ? 67.777 3.324   13.684  1.00 0.00  ? 6   LYS A O    4  
ATOM   5242  C  CB   . LYS A 1 6  ? 70.546 3.698   11.800  1.00 0.00  ? 6   LYS A CB   4  
ATOM   5243  C  CG   . LYS A 1 6  ? 70.970 2.248   11.537  1.00 0.00  ? 6   LYS A CG   4  
ATOM   5244  C  CD   . LYS A 1 6  ? 71.321 2.077   10.055  1.00 0.00  ? 6   LYS A CD   4  
ATOM   5245  C  CE   . LYS A 1 6  ? 70.580 0.869   9.477   1.00 0.00  ? 6   LYS A CE   4  
ATOM   5246  N  NZ   . LYS A 1 6  ? 70.468 1.151   8.016   1.00 0.00  ? 6   LYS A NZ   4  
ATOM   5247  H  H    . LYS A 1 6  ? 69.523 5.460   10.379  1.00 0.00  ? 6   LYS A H    4  
ATOM   5248  H  HA   . LYS A 1 6  ? 68.600 2.901   11.304  1.00 0.00  ? 6   LYS A HA   4  
ATOM   5249  H  HB2  . LYS A 1 6  ? 71.012 4.348   11.072  1.00 0.00  ? 6   LYS A HB2  4  
ATOM   5250  H  HB3  . LYS A 1 6  ? 70.861 3.988   12.791  1.00 0.00  ? 6   LYS A HB3  4  
ATOM   5251  H  HG2  . LYS A 1 6  ? 71.836 2.014   12.141  1.00 0.00  ? 6   LYS A HG2  4  
ATOM   5252  H  HG3  . LYS A 1 6  ? 70.160 1.583   11.795  1.00 0.00  ? 6   LYS A HG3  4  
ATOM   5253  H  HD2  . LYS A 1 6  ? 71.033 2.966   9.515   1.00 0.00  ? 6   LYS A HD2  4  
ATOM   5254  H  HD3  . LYS A 1 6  ? 72.386 1.926   9.954   1.00 0.00  ? 6   LYS A HD3  4  
ATOM   5255  H  HE2  . LYS A 1 6  ? 71.150 -0.036  9.646   1.00 0.00  ? 6   LYS A HE2  4  
ATOM   5256  H  HE3  . LYS A 1 6  ? 69.597 0.783   9.913   1.00 0.00  ? 6   LYS A HE3  4  
ATOM   5257  H  HZ1  . LYS A 1 6  ? 71.412 1.130   7.582   1.00 0.00  ? 6   LYS A HZ1  4  
ATOM   5258  H  HZ2  . LYS A 1 6  ? 70.043 2.092   7.873   1.00 0.00  ? 6   LYS A HZ2  4  
ATOM   5259  H  HZ3  . LYS A 1 6  ? 69.867 0.429   7.568   1.00 0.00  ? 6   LYS A HZ3  4  
ATOM   5260  N  N    . ALA A 1 7  ? 68.529 5.390   13.482  1.00 0.00  ? 7   ALA A N    4  
ATOM   5261  C  CA   . ALA A 1 7  ? 67.923 5.805   14.785  1.00 0.00  ? 7   ALA A CA   4  
ATOM   5262  C  C    . ALA A 1 7  ? 66.392 5.691   14.711  1.00 0.00  ? 7   ALA A C    4  
ATOM   5263  O  O    . ALA A 1 7  ? 65.749 5.287   15.661  1.00 0.00  ? 7   ALA A O    4  
ATOM   5264  C  CB   . ALA A 1 7  ? 68.347 7.263   14.981  1.00 0.00  ? 7   ALA A CB   4  
ATOM   5265  H  H    . ALA A 1 7  ? 69.015 6.047   12.940  1.00 0.00  ? 7   ALA A H    4  
ATOM   5266  H  HA   . ALA A 1 7  ? 68.308 5.197   15.589  1.00 0.00  ? 7   ALA A HA   4  
ATOM   5267  H  HB1  . ALA A 1 7  ? 67.701 7.908   14.404  1.00 0.00  ? 7   ALA A HB1  4  
ATOM   5268  H  HB2  . ALA A 1 7  ? 69.369 7.390   14.653  1.00 0.00  ? 7   ALA A HB2  4  
ATOM   5269  H  HB3  . ALA A 1 7  ? 68.272 7.522   16.027  1.00 0.00  ? 7   ALA A HB3  4  
ATOM   5270  N  N    . ALA A 1 8  ? 65.807 6.031   13.581  1.00 0.00  ? 8   ALA A N    4  
ATOM   5271  C  CA   . ALA A 1 8  ? 64.319 5.927   13.434  1.00 0.00  ? 8   ALA A CA   4  
ATOM   5272  C  C    . ALA A 1 8  ? 63.870 4.478   13.676  1.00 0.00  ? 8   ALA A C    4  
ATOM   5273  O  O    . ALA A 1 8  ? 62.820 4.233   14.238  1.00 0.00  ? 8   ALA A O    4  
ATOM   5274  C  CB   . ALA A 1 8  ? 64.022 6.353   11.992  1.00 0.00  ? 8   ALA A CB   4  
ATOM   5275  H  H    . ALA A 1 8  ? 66.350 6.345   12.827  1.00 0.00  ? 8   ALA A H    4  
ATOM   5276  H  HA   . ALA A 1 8  ? 63.825 6.592   14.126  1.00 0.00  ? 8   ALA A HA   4  
ATOM   5277  H  HB1  . ALA A 1 8  ? 64.392 5.603   11.310  1.00 0.00  ? 8   ALA A HB1  4  
ATOM   5278  H  HB2  . ALA A 1 8  ? 64.506 7.297   11.788  1.00 0.00  ? 8   ALA A HB2  4  
ATOM   5279  H  HB3  . ALA A 1 8  ? 62.955 6.461   11.862  1.00 0.00  ? 8   ALA A HB3  4  
ATOM   5280  N  N    . VAL A 1 9  ? 64.672 3.520   13.273  1.00 0.00  ? 9   VAL A N    4  
ATOM   5281  C  CA   . VAL A 1 9  ? 64.310 2.084   13.498  1.00 0.00  ? 9   VAL A CA   4  
ATOM   5282  C  C    . VAL A 1 9  ? 64.189 1.816   15.006  1.00 0.00  ? 9   VAL A C    4  
ATOM   5283  O  O    . VAL A 1 9  ? 63.281 1.142   15.452  1.00 0.00  ? 9   VAL A O    4  
ATOM   5284  C  CB   . VAL A 1 9  ? 65.463 1.277   12.883  1.00 0.00  ? 9   VAL A CB   4  
ATOM   5285  C  CG1  . VAL A 1 9  ? 65.380 -0.185  13.333  1.00 0.00  ? 9   VAL A CG1  4  
ATOM   5286  C  CG2  . VAL A 1 9  ? 65.372 1.339   11.356  1.00 0.00  ? 9   VAL A CG2  4  
ATOM   5287  H  H    . VAL A 1 9  ? 65.520 3.746   12.835  1.00 0.00  ? 9   VAL A H    4  
ATOM   5288  H  HA   . VAL A 1 9  ? 63.385 1.846   12.999  1.00 0.00  ? 9   VAL A HA   4  
ATOM   5289  H  HB   . VAL A 1 9  ? 66.406 1.696   13.204  1.00 0.00  ? 9   VAL A HB   4  
ATOM   5290  H  HG11 . VAL A 1 9  ? 65.836 -0.817  12.585  1.00 0.00  ? 9   VAL A HG11 4  
ATOM   5291  H  HG12 . VAL A 1 9  ? 64.346 -0.466  13.460  1.00 0.00  ? 9   VAL A HG12 4  
ATOM   5292  H  HG13 . VAL A 1 9  ? 65.904 -0.303  14.271  1.00 0.00  ? 9   VAL A HG13 4  
ATOM   5293  H  HG21 . VAL A 1 9  ? 64.899 0.441   10.987  1.00 0.00  ? 9   VAL A HG21 4  
ATOM   5294  H  HG22 . VAL A 1 9  ? 66.365 1.419   10.941  1.00 0.00  ? 9   VAL A HG22 4  
ATOM   5295  H  HG23 . VAL A 1 9  ? 64.790 2.200   11.063  1.00 0.00  ? 9   VAL A HG23 4  
ATOM   5296  N  N    . GLU A 1 10 ? 65.091 2.358   15.790  1.00 0.00  ? 10  GLU A N    4  
ATOM   5297  C  CA   . GLU A 1 10 ? 65.029 2.160   17.274  1.00 0.00  ? 10  GLU A CA   4  
ATOM   5298  C  C    . GLU A 1 10 ? 63.823 2.913   17.861  1.00 0.00  ? 10  GLU A C    4  
ATOM   5299  O  O    . GLU A 1 10 ? 63.290 2.538   18.888  1.00 0.00  ? 10  GLU A O    4  
ATOM   5300  C  CB   . GLU A 1 10 ? 66.337 2.749   17.814  1.00 0.00  ? 10  GLU A CB   4  
ATOM   5301  C  CG   . GLU A 1 10 ? 67.510 1.829   17.459  1.00 0.00  ? 10  GLU A CG   4  
ATOM   5302  C  CD   . GLU A 1 10 ? 68.789 2.659   17.314  1.00 0.00  ? 10  GLU A CD   4  
ATOM   5303  O  OE1  . GLU A 1 10 ? 69.343 3.040   18.331  1.00 0.00  ? 10  GLU A OE1  4  
ATOM   5304  O  OE2  . GLU A 1 10 ? 69.193 2.898   16.188  1.00 0.00  ? 10  GLU A OE2  4  
ATOM   5305  H  H    . GLU A 1 10 ? 65.805 2.908   15.402  1.00 0.00  ? 10  GLU A H    4  
ATOM   5306  H  HA   . GLU A 1 10 ? 64.969 1.109   17.512  1.00 0.00  ? 10  GLU A HA   4  
ATOM   5307  H  HB2  . GLU A 1 10 ? 66.498 3.724   17.376  1.00 0.00  ? 10  GLU A HB2  4  
ATOM   5308  H  HB3  . GLU A 1 10 ? 66.270 2.845   18.887  1.00 0.00  ? 10  GLU A HB3  4  
ATOM   5309  H  HG2  . GLU A 1 10 ? 67.644 1.098   18.243  1.00 0.00  ? 10  GLU A HG2  4  
ATOM   5310  H  HG3  . GLU A 1 10 ? 67.305 1.323   16.527  1.00 0.00  ? 10  GLU A HG3  4  
ATOM   5311  N  N    . GLN A 1 11 ? 63.392 3.972   17.213  1.00 0.00  ? 11  GLN A N    4  
ATOM   5312  C  CA   . GLN A 1 11 ? 62.220 4.755   17.724  1.00 0.00  ? 11  GLN A CA   4  
ATOM   5313  C  C    . GLN A 1 11 ? 60.912 3.988   17.490  1.00 0.00  ? 11  GLN A C    4  
ATOM   5314  O  O    . GLN A 1 11 ? 60.003 4.040   18.296  1.00 0.00  ? 11  GLN A O    4  
ATOM   5315  C  CB   . GLN A 1 11 ? 62.214 6.052   16.908  1.00 0.00  ? 11  GLN A CB   4  
ATOM   5316  C  CG   . GLN A 1 11 ? 63.183 7.060   17.529  1.00 0.00  ? 11  GLN A CG   4  
ATOM   5317  C  CD   . GLN A 1 11 ? 62.619 8.474   17.371  1.00 0.00  ? 11  GLN A CD   4  
ATOM   5318  O  OE1  . GLN A 1 11 ? 62.469 8.963   16.268  1.00 0.00  ? 11  GLN A OE1  4  
ATOM   5319  N  NE2  . GLN A 1 11 ? 62.294 9.158   18.432  1.00 0.00  ? 11  GLN A NE2  4  
ATOM   5320  H  H    . GLN A 1 11 ? 63.840 4.252   16.389  1.00 0.00  ? 11  GLN A H    4  
ATOM   5321  H  HA   . GLN A 1 11 ? 62.343 4.979   18.771  1.00 0.00  ? 11  GLN A HA   4  
ATOM   5322  H  HB2  . GLN A 1 11 ? 62.515 5.839   15.893  1.00 0.00  ? 11  GLN A HB2  4  
ATOM   5323  H  HB3  . GLN A 1 11 ? 61.218 6.469   16.907  1.00 0.00  ? 11  GLN A HB3  4  
ATOM   5324  H  HG2  . GLN A 1 11 ? 63.311 6.838   18.578  1.00 0.00  ? 11  GLN A HG2  4  
ATOM   5325  H  HG3  . GLN A 1 11 ? 64.138 6.997   17.029  1.00 0.00  ? 11  GLN A HG3  4  
ATOM   5326  H  HE21 . GLN A 1 11 ? 62.412 8.767   19.323  1.00 0.00  ? 11  GLN A HE21 4  
ATOM   5327  H  HE22 . GLN A 1 11 ? 61.932 10.062  18.338  1.00 0.00  ? 11  GLN A HE22 4  
ATOM   5328  N  N    . LEU A 1 12 ? 60.811 3.284   16.386  1.00 0.00  ? 12  LEU A N    4  
ATOM   5329  C  CA   . LEU A 1 12 ? 59.562 2.516   16.087  1.00 0.00  ? 12  LEU A CA   4  
ATOM   5330  C  C    . LEU A 1 12 ? 59.270 1.503   17.203  1.00 0.00  ? 12  LEU A C    4  
ATOM   5331  O  O    . LEU A 1 12 ? 60.157 0.823   17.685  1.00 0.00  ? 12  LEU A O    4  
ATOM   5332  C  CB   . LEU A 1 12 ? 59.844 1.791   14.766  1.00 0.00  ? 12  LEU A CB   4  
ATOM   5333  C  CG   . LEU A 1 12 ? 59.791 2.787   13.603  1.00 0.00  ? 12  LEU A CG   4  
ATOM   5334  C  CD1  . LEU A 1 12 ? 60.621 2.254   12.434  1.00 0.00  ? 12  LEU A CD1  4  
ATOM   5335  C  CD2  . LEU A 1 12 ? 58.341 2.968   13.152  1.00 0.00  ? 12  LEU A CD2  4  
ATOM   5336  H  H    . LEU A 1 12 ? 61.557 3.267   15.751  1.00 0.00  ? 12  LEU A H    4  
ATOM   5337  H  HA   . LEU A 1 12 ? 58.728 3.190   15.965  1.00 0.00  ? 12  LEU A HA   4  
ATOM   5338  H  HB2  . LEU A 1 12 ? 60.825 1.339   14.809  1.00 0.00  ? 12  LEU A HB2  4  
ATOM   5339  H  HB3  . LEU A 1 12 ? 59.102 1.022   14.613  1.00 0.00  ? 12  LEU A HB3  4  
ATOM   5340  H  HG   . LEU A 1 12 ? 60.192 3.738   13.924  1.00 0.00  ? 12  LEU A HG   4  
ATOM   5341  H  HD11 . LEU A 1 12 ? 60.361 2.791   11.533  1.00 0.00  ? 12  LEU A HD11 4  
ATOM   5342  H  HD12 . LEU A 1 12 ? 60.417 1.202   12.298  1.00 0.00  ? 12  LEU A HD12 4  
ATOM   5343  H  HD13 . LEU A 1 12 ? 61.671 2.393   12.644  1.00 0.00  ? 12  LEU A HD13 4  
ATOM   5344  H  HD21 . LEU A 1 12 ? 57.963 2.032   12.771  1.00 0.00  ? 12  LEU A HD21 4  
ATOM   5345  H  HD22 . LEU A 1 12 ? 58.297 3.717   12.376  1.00 0.00  ? 12  LEU A HD22 4  
ATOM   5346  H  HD23 . LEU A 1 12 ? 57.740 3.284   13.991  1.00 0.00  ? 12  LEU A HD23 4  
ATOM   5347  N  N    . THR A 1 13 ? 58.032 1.399   17.615  1.00 0.00  ? 13  THR A N    4  
ATOM   5348  C  CA   . THR A 1 13 ? 57.678 0.429   18.701  1.00 0.00  ? 13  THR A CA   4  
ATOM   5349  C  C    . THR A 1 13 ? 57.512 -0.974  18.126  1.00 0.00  ? 13  THR A C    4  
ATOM   5350  O  O    . THR A 1 13 ? 57.519 -1.171  16.923  1.00 0.00  ? 13  THR A O    4  
ATOM   5351  C  CB   . THR A 1 13 ? 56.348 0.927   19.289  1.00 0.00  ? 13  THR A CB   4  
ATOM   5352  O  OG1  . THR A 1 13 ? 55.352 0.934   18.275  1.00 0.00  ? 13  THR A OG1  4  
ATOM   5353  C  CG2  . THR A 1 13 ? 56.517 2.343   19.847  1.00 0.00  ? 13  THR A CG2  4  
ATOM   5354  H  H    . THR A 1 13 ? 57.335 1.957   17.210  1.00 0.00  ? 13  THR A H    4  
ATOM   5355  H  HA   . THR A 1 13 ? 58.438 0.422   19.463  1.00 0.00  ? 13  THR A HA   4  
ATOM   5356  H  HB   . THR A 1 13 ? 56.041 0.268   20.087  1.00 0.00  ? 13  THR A HB   4  
ATOM   5357  H  HG1  . THR A 1 13 ? 54.494 0.843   18.699  1.00 0.00  ? 13  THR A HG1  4  
ATOM   5358  H  HG21 . THR A 1 13 ? 56.237 3.063   19.092  1.00 0.00  ? 13  THR A HG21 4  
ATOM   5359  H  HG22 . THR A 1 13 ? 57.547 2.500   20.130  1.00 0.00  ? 13  THR A HG22 4  
ATOM   5360  H  HG23 . THR A 1 13 ? 55.884 2.466   20.714  1.00 0.00  ? 13  THR A HG23 4  
ATOM   5361  N  N    . GLU A 1 14 ? 57.361 -1.954  18.978  1.00 0.00  ? 14  GLU A N    4  
ATOM   5362  C  CA   . GLU A 1 14 ? 57.190 -3.350  18.484  1.00 0.00  ? 14  GLU A CA   4  
ATOM   5363  C  C    . GLU A 1 14 ? 55.979 -3.429  17.543  1.00 0.00  ? 14  GLU A C    4  
ATOM   5364  O  O    . GLU A 1 14 ? 55.980 -4.170  16.579  1.00 0.00  ? 14  GLU A O    4  
ATOM   5365  C  CB   . GLU A 1 14 ? 56.967 -4.202  19.733  1.00 0.00  ? 14  GLU A CB   4  
ATOM   5366  C  CG   . GLU A 1 14 ? 57.584 -5.585  19.512  1.00 0.00  ? 14  GLU A CG   4  
ATOM   5367  C  CD   . GLU A 1 14 ? 56.508 -6.560  19.028  1.00 0.00  ? 14  GLU A CD   4  
ATOM   5368  O  OE1  . GLU A 1 14 ? 55.698 -6.972  19.842  1.00 0.00  ? 14  GLU A OE1  4  
ATOM   5369  O  OE2  . GLU A 1 14 ? 56.517 -6.881  17.852  1.00 0.00  ? 14  GLU A OE2  4  
ATOM   5370  H  H    . GLU A 1 14 ? 57.357 -1.769  19.941  1.00 0.00  ? 14  GLU A H    4  
ATOM   5371  H  HA   . GLU A 1 14 ? 58.084 -3.669  17.977  1.00 0.00  ? 14  GLU A HA   4  
ATOM   5372  H  HB2  . GLU A 1 14 ? 57.437 -3.728  20.583  1.00 0.00  ? 14  GLU A HB2  4  
ATOM   5373  H  HB3  . GLU A 1 14 ? 55.908 -4.305  19.917  1.00 0.00  ? 14  GLU A HB3  4  
ATOM   5374  H  HG2  . GLU A 1 14 ? 58.365 -5.516  18.770  1.00 0.00  ? 14  GLU A HG2  4  
ATOM   5375  H  HG3  . GLU A 1 14 ? 58.001 -5.942  20.438  1.00 0.00  ? 14  GLU A HG3  4  
ATOM   5376  N  N    . GLU A 1 15 ? 54.957 -2.652  17.813  1.00 0.00  ? 15  GLU A N    4  
ATOM   5377  C  CA   . GLU A 1 15 ? 53.742 -2.653  16.939  1.00 0.00  ? 15  GLU A CA   4  
ATOM   5378  C  C    . GLU A 1 15 ? 54.139 -2.302  15.499  1.00 0.00  ? 15  GLU A C    4  
ATOM   5379  O  O    . GLU A 1 15 ? 53.871 -3.046  14.576  1.00 0.00  ? 15  GLU A O    4  
ATOM   5380  C  CB   . GLU A 1 15 ? 52.825 -1.568  17.521  1.00 0.00  ? 15  GLU A CB   4  
ATOM   5381  C  CG   . GLU A 1 15 ? 52.404 -1.942  18.949  1.00 0.00  ? 15  GLU A CG   4  
ATOM   5382  C  CD   . GLU A 1 15 ? 53.213 -1.119  19.958  1.00 0.00  ? 15  GLU A CD   4  
ATOM   5383  O  OE1  . GLU A 1 15 ? 52.797 -0.013  20.261  1.00 0.00  ? 15  GLU A OE1  4  
ATOM   5384  O  OE2  . GLU A 1 15 ? 54.240 -1.607  20.403  1.00 0.00  ? 15  GLU A OE2  4  
ATOM   5385  H  H    . GLU A 1 15 ? 54.993 -2.057  18.591  1.00 0.00  ? 15  GLU A H    4  
ATOM   5386  H  HA   . GLU A 1 15 ? 53.250 -3.612  16.973  1.00 0.00  ? 15  GLU A HA   4  
ATOM   5387  H  HB2  . GLU A 1 15 ? 53.354 -0.626  17.538  1.00 0.00  ? 15  GLU A HB2  4  
ATOM   5388  H  HB3  . GLU A 1 15 ? 51.945 -1.473  16.902  1.00 0.00  ? 15  GLU A HB3  4  
ATOM   5389  H  HG2  . GLU A 1 15 ? 51.351 -1.735  19.079  1.00 0.00  ? 15  GLU A HG2  4  
ATOM   5390  H  HG3  . GLU A 1 15 ? 52.586 -2.993  19.117  1.00 0.00  ? 15  GLU A HG3  4  
ATOM   5391  N  N    . GLN A 1 16 ? 54.790 -1.177  15.307  1.00 0.00  ? 16  GLN A N    4  
ATOM   5392  C  CA   . GLN A 1 16 ? 55.221 -0.780  13.928  1.00 0.00  ? 16  GLN A CA   4  
ATOM   5393  C  C    . GLN A 1 16 ? 56.265 -1.762  13.399  1.00 0.00  ? 16  GLN A C    4  
ATOM   5394  O  O    . GLN A 1 16 ? 56.268 -2.116  12.236  1.00 0.00  ? 16  GLN A O    4  
ATOM   5395  C  CB   . GLN A 1 16 ? 55.818 0.622   14.071  1.00 0.00  ? 16  GLN A CB   4  
ATOM   5396  C  CG   . GLN A 1 16 ? 54.711 1.668   13.895  1.00 0.00  ? 16  GLN A CG   4  
ATOM   5397  C  CD   . GLN A 1 16 ? 54.913 2.804   14.900  1.00 0.00  ? 16  GLN A CD   4  
ATOM   5398  O  OE1  . GLN A 1 16 ? 54.644 2.648   16.072  1.00 0.00  ? 16  GLN A OE1  4  
ATOM   5399  N  NE2  . GLN A 1 16 ? 55.376 3.951   14.489  1.00 0.00  ? 16  GLN A NE2  4  
ATOM   5400  H  H    . GLN A 1 16 ? 55.004 -0.601  16.071  1.00 0.00  ? 16  GLN A H    4  
ATOM   5401  H  HA   . GLN A 1 16 ? 54.380 -0.756  13.272  1.00 0.00  ? 16  GLN A HA   4  
ATOM   5402  H  HB2  . GLN A 1 16 ? 56.264 0.726   15.050  1.00 0.00  ? 16  GLN A HB2  4  
ATOM   5403  H  HB3  . GLN A 1 16 ? 56.573 0.770   13.313  1.00 0.00  ? 16  GLN A HB3  4  
ATOM   5404  H  HG2  . GLN A 1 16 ? 54.746 2.065   12.890  1.00 0.00  ? 16  GLN A HG2  4  
ATOM   5405  H  HG3  . GLN A 1 16 ? 53.749 1.207   14.066  1.00 0.00  ? 16  GLN A HG3  4  
ATOM   5406  H  HE21 . GLN A 1 16 ? 55.594 4.082   13.543  1.00 0.00  ? 16  GLN A HE21 4  
ATOM   5407  H  HE22 . GLN A 1 16 ? 55.506 4.682   15.127  1.00 0.00  ? 16  GLN A HE22 4  
ATOM   5408  N  N    . LYS A 1 17 ? 57.134 -2.215  14.256  1.00 0.00  ? 17  LYS A N    4  
ATOM   5409  C  CA   . LYS A 1 17 ? 58.180 -3.198  13.833  1.00 0.00  ? 17  LYS A CA   4  
ATOM   5410  C  C    . LYS A 1 17 ? 57.500 -4.454  13.274  1.00 0.00  ? 17  LYS A C    4  
ATOM   5411  O  O    . LYS A 1 17 ? 57.824 -4.918  12.196  1.00 0.00  ? 17  LYS A O    4  
ATOM   5412  C  CB   . LYS A 1 17 ? 58.965 -3.517  15.113  1.00 0.00  ? 17  LYS A CB   4  
ATOM   5413  C  CG   . LYS A 1 17 ? 59.955 -4.661  14.856  1.00 0.00  ? 17  LYS A CG   4  
ATOM   5414  C  CD   . LYS A 1 17 ? 59.707 -5.793  15.862  1.00 0.00  ? 17  LYS A CD   4  
ATOM   5415  C  CE   . LYS A 1 17 ? 58.993 -6.956  15.168  1.00 0.00  ? 17  LYS A CE   4  
ATOM   5416  N  NZ   . LYS A 1 17 ? 58.566 -7.867  16.269  1.00 0.00  ? 17  LYS A NZ   4  
ATOM   5417  H  H    . LYS A 1 17 ? 57.085 -1.915  15.184  1.00 0.00  ? 17  LYS A H    4  
ATOM   5418  H  HA   . LYS A 1 17 ? 58.832 -2.761  13.093  1.00 0.00  ? 17  LYS A HA   4  
ATOM   5419  H  HB2  . LYS A 1 17 ? 59.507 -2.637  15.427  1.00 0.00  ? 17  LYS A HB2  4  
ATOM   5420  H  HB3  . LYS A 1 17 ? 58.276 -3.809  15.892  1.00 0.00  ? 17  LYS A HB3  4  
ATOM   5421  H  HG2  . LYS A 1 17 ? 59.822 -5.035  13.850  1.00 0.00  ? 17  LYS A HG2  4  
ATOM   5422  H  HG3  . LYS A 1 17 ? 60.964 -4.295  14.972  1.00 0.00  ? 17  LYS A HG3  4  
ATOM   5423  H  HD2  . LYS A 1 17 ? 60.653 -6.136  16.256  1.00 0.00  ? 17  LYS A HD2  4  
ATOM   5424  H  HD3  . LYS A 1 17 ? 59.092 -5.428  16.672  1.00 0.00  ? 17  LYS A HD3  4  
ATOM   5425  H  HE2  . LYS A 1 17 ? 58.133 -6.594  14.621  1.00 0.00  ? 17  LYS A HE2  4  
ATOM   5426  H  HE3  . LYS A 1 17 ? 59.670 -7.470  14.504  1.00 0.00  ? 17  LYS A HE3  4  
ATOM   5427  H  HZ1  . LYS A 1 17 ? 58.020 -8.659  15.873  1.00 0.00  ? 17  LYS A HZ1  4  
ATOM   5428  H  HZ2  . LYS A 1 17 ? 57.966 -7.342  16.944  1.00 0.00  ? 17  LYS A HZ2  4  
ATOM   5429  H  HZ3  . LYS A 1 17 ? 59.402 -8.237  16.762  1.00 0.00  ? 17  LYS A HZ3  4  
ATOM   5430  N  N    . ASN A 1 18 ? 56.543 -4.989  13.993  1.00 0.00  ? 18  ASN A N    4  
ATOM   5431  C  CA   . ASN A 1 18 ? 55.818 -6.199  13.500  1.00 0.00  ? 18  ASN A CA   4  
ATOM   5432  C  C    . ASN A 1 18 ? 54.916 -5.809  12.318  1.00 0.00  ? 18  ASN A C    4  
ATOM   5433  O  O    . ASN A 1 18 ? 54.739 -6.571  11.387  1.00 0.00  ? 18  ASN A O    4  
ATOM   5434  C  CB   . ASN A 1 18 ? 54.988 -6.689  14.694  1.00 0.00  ? 18  ASN A CB   4  
ATOM   5435  C  CG   . ASN A 1 18 ? 55.180 -8.198  14.865  1.00 0.00  ? 18  ASN A CG   4  
ATOM   5436  O  OD1  . ASN A 1 18 ? 56.294 -8.685  14.869  1.00 0.00  ? 18  ASN A OD1  4  
ATOM   5437  N  ND2  . ASN A 1 18 ? 54.136 -8.967  15.010  1.00 0.00  ? 18  ASN A ND2  4  
ATOM   5438  H  H    . ASN A 1 18 ? 56.291 -4.582  14.849  1.00 0.00  ? 18  ASN A H    4  
ATOM   5439  H  HA   . ASN A 1 18 ? 56.521 -6.960  13.199  1.00 0.00  ? 18  ASN A HA   4  
ATOM   5440  H  HB2  . ASN A 1 18 ? 55.315 -6.183  15.592  1.00 0.00  ? 18  ASN A HB2  4  
ATOM   5441  H  HB3  . ASN A 1 18 ? 53.944 -6.478  14.522  1.00 0.00  ? 18  ASN A HB3  4  
ATOM   5442  H  HD21 . ASN A 1 18 ? 53.237 -8.580  15.009  1.00 0.00  ? 18  ASN A HD21 4  
ATOM   5443  H  HD22 . ASN A 1 18 ? 54.253 -9.934  15.118  1.00 0.00  ? 18  ASN A HD22 4  
ATOM   5444  N  N    . GLU A 1 19 ? 54.363 -4.616  12.346  1.00 0.00  ? 19  GLU A N    4  
ATOM   5445  C  CA   . GLU A 1 19 ? 53.487 -4.147  11.222  1.00 0.00  ? 19  GLU A CA   4  
ATOM   5446  C  C    . GLU A 1 19 ? 54.255 -4.213  9.892   1.00 0.00  ? 19  GLU A C    4  
ATOM   5447  O  O    . GLU A 1 19 ? 53.762 -4.730  8.907   1.00 0.00  ? 19  GLU A O    4  
ATOM   5448  C  CB   . GLU A 1 19 ? 53.145 -2.693  11.565  1.00 0.00  ? 19  GLU A CB   4  
ATOM   5449  C  CG   . GLU A 1 19 ? 51.775 -2.627  12.244  1.00 0.00  ? 19  GLU A CG   4  
ATOM   5450  C  CD   . GLU A 1 19 ? 51.506 -1.193  12.708  1.00 0.00  ? 19  GLU A CD   4  
ATOM   5451  O  OE1  . GLU A 1 19 ? 51.025 -0.412  11.904  1.00 0.00  ? 19  GLU A OE1  4  
ATOM   5452  O  OE2  . GLU A 1 19 ? 51.787 -0.900  13.859  1.00 0.00  ? 19  GLU A OE2  4  
ATOM   5453  H  H    . GLU A 1 19 ? 54.534 -4.020  13.106  1.00 0.00  ? 19  GLU A H    4  
ATOM   5454  H  HA   . GLU A 1 19 ? 52.586 -4.738  11.170  1.00 0.00  ? 19  GLU A HA   4  
ATOM   5455  H  HB2  . GLU A 1 19 ? 53.896 -2.294  12.231  1.00 0.00  ? 19  GLU A HB2  4  
ATOM   5456  H  HB3  . GLU A 1 19 ? 53.124 -2.106  10.660  1.00 0.00  ? 19  GLU A HB3  4  
ATOM   5457  H  HG2  . GLU A 1 19 ? 51.011 -2.931  11.544  1.00 0.00  ? 19  GLU A HG2  4  
ATOM   5458  H  HG3  . GLU A 1 19 ? 51.764 -3.287  13.099  1.00 0.00  ? 19  GLU A HG3  4  
ATOM   5459  N  N    . PHE A 1 20 ? 55.463 -3.699  9.866   1.00 0.00  ? 20  PHE A N    4  
ATOM   5460  C  CA   . PHE A 1 20 ? 56.275 -3.735  8.608   1.00 0.00  ? 20  PHE A CA   4  
ATOM   5461  C  C    . PHE A 1 20 ? 56.643 -5.182  8.256   1.00 0.00  ? 20  PHE A C    4  
ATOM   5462  O  O    . PHE A 1 20 ? 56.643 -5.557  7.101   1.00 0.00  ? 20  PHE A O    4  
ATOM   5463  C  CB   . PHE A 1 20 ? 57.536 -2.915  8.907   1.00 0.00  ? 20  PHE A CB   4  
ATOM   5464  C  CG   . PHE A 1 20 ? 57.184 -1.448  9.039   1.00 0.00  ? 20  PHE A CG   4  
ATOM   5465  C  CD1  . PHE A 1 20 ? 56.298 -0.847  8.133   1.00 0.00  ? 20  PHE A CD1  4  
ATOM   5466  C  CD2  . PHE A 1 20 ? 57.747 -0.688  10.071  1.00 0.00  ? 20  PHE A CD2  4  
ATOM   5467  C  CE1  . PHE A 1 20 ? 55.977 0.509   8.263   1.00 0.00  ? 20  PHE A CE1  4  
ATOM   5468  C  CE2  . PHE A 1 20 ? 57.426 0.667   10.199  1.00 0.00  ? 20  PHE A CE2  4  
ATOM   5469  C  CZ   . PHE A 1 20 ? 56.542 1.266   9.297   1.00 0.00  ? 20  PHE A CZ   4  
ATOM   5470  H  H    . PHE A 1 20 ? 55.837 -3.294  10.677  1.00 0.00  ? 20  PHE A H    4  
ATOM   5471  H  HA   . PHE A 1 20 ? 55.726 -3.283  7.796   1.00 0.00  ? 20  PHE A HA   4  
ATOM   5472  H  HB2  . PHE A 1 20 ? 57.978 -3.261  9.831   1.00 0.00  ? 20  PHE A HB2  4  
ATOM   5473  H  HB3  . PHE A 1 20 ? 58.244 -3.042  8.101   1.00 0.00  ? 20  PHE A HB3  4  
ATOM   5474  H  HD1  . PHE A 1 20 ? 55.861 -1.431  7.335   1.00 0.00  ? 20  PHE A HD1  4  
ATOM   5475  H  HD2  . PHE A 1 20 ? 58.429 -1.150  10.769  1.00 0.00  ? 20  PHE A HD2  4  
ATOM   5476  H  HE1  . PHE A 1 20 ? 55.294 0.972   7.565   1.00 0.00  ? 20  PHE A HE1  4  
ATOM   5477  H  HE2  . PHE A 1 20 ? 57.861 1.252   10.996  1.00 0.00  ? 20  PHE A HE2  4  
ATOM   5478  H  HZ   . PHE A 1 20 ? 56.294 2.312   9.398   1.00 0.00  ? 20  PHE A HZ   4  
ATOM   5479  N  N    . LYS A 1 21 ? 56.947 -5.997  9.242   1.00 0.00  ? 21  LYS A N    4  
ATOM   5480  C  CA   . LYS A 1 21 ? 57.305 -7.427  8.962   1.00 0.00  ? 21  LYS A CA   4  
ATOM   5481  C  C    . LYS A 1 21 ? 56.165 -8.110  8.189   1.00 0.00  ? 21  LYS A C    4  
ATOM   5482  O  O    . LYS A 1 21 ? 56.381 -8.684  7.140   1.00 0.00  ? 21  LYS A O    4  
ATOM   5483  C  CB   . LYS A 1 21 ? 57.504 -8.071  10.346  1.00 0.00  ? 21  LYS A CB   4  
ATOM   5484  C  CG   . LYS A 1 21 ? 57.333 -9.594  10.260  1.00 0.00  ? 21  LYS A CG   4  
ATOM   5485  C  CD   . LYS A 1 21 ? 58.454 -10.197 9.403   1.00 0.00  ? 21  LYS A CD   4  
ATOM   5486  C  CE   . LYS A 1 21 ? 58.557 -11.702 9.675   1.00 0.00  ? 21  LYS A CE   4  
ATOM   5487  N  NZ   . LYS A 1 21 ? 58.768 -12.328 8.337   1.00 0.00  ? 21  LYS A NZ   4  
ATOM   5488  H  H    . LYS A 1 21 ? 56.933 -5.669  10.167  1.00 0.00  ? 21  LYS A H    4  
ATOM   5489  H  HA   . LYS A 1 21 ? 58.223 -7.478  8.397   1.00 0.00  ? 21  LYS A HA   4  
ATOM   5490  H  HB2  . LYS A 1 21 ? 58.497 -7.844  10.703  1.00 0.00  ? 21  LYS A HB2  4  
ATOM   5491  H  HB3  . LYS A 1 21 ? 56.777 -7.669  11.036  1.00 0.00  ? 21  LYS A HB3  4  
ATOM   5492  H  HG2  . LYS A 1 21 ? 57.375 -10.014 11.255  1.00 0.00  ? 21  LYS A HG2  4  
ATOM   5493  H  HG3  . LYS A 1 21 ? 56.375 -9.825  9.814   1.00 0.00  ? 21  LYS A HG3  4  
ATOM   5494  H  HD2  . LYS A 1 21 ? 58.234 -10.034 8.357   1.00 0.00  ? 21  LYS A HD2  4  
ATOM   5495  H  HD3  . LYS A 1 21 ? 59.392 -9.723  9.653   1.00 0.00  ? 21  LYS A HD3  4  
ATOM   5496  H  HE2  . LYS A 1 21 ? 59.397 -11.907 10.327  1.00 0.00  ? 21  LYS A HE2  4  
ATOM   5497  H  HE3  . LYS A 1 21 ? 57.642 -12.069 10.115  1.00 0.00  ? 21  LYS A HE3  4  
ATOM   5498  H  HZ1  . LYS A 1 21 ? 58.735 -13.363 8.427   1.00 0.00  ? 21  LYS A HZ1  4  
ATOM   5499  H  HZ2  . LYS A 1 21 ? 59.695 -12.042 7.959   1.00 0.00  ? 21  LYS A HZ2  4  
ATOM   5500  H  HZ3  . LYS A 1 21 ? 58.017 -12.018 7.686   1.00 0.00  ? 21  LYS A HZ3  4  
ATOM   5501  N  N    . ALA A 1 22 ? 54.956 -8.040  8.697   1.00 0.00  ? 22  ALA A N    4  
ATOM   5502  C  CA   . ALA A 1 22 ? 53.800 -8.676  7.986   1.00 0.00  ? 22  ALA A CA   4  
ATOM   5503  C  C    . ALA A 1 22 ? 53.636 -8.058  6.591   1.00 0.00  ? 22  ALA A C    4  
ATOM   5504  O  O    . ALA A 1 22 ? 53.476 -8.758  5.609   1.00 0.00  ? 22  ALA A O    4  
ATOM   5505  C  CB   . ALA A 1 22 ? 52.581 -8.373  8.858   1.00 0.00  ? 22  ALA A CB   4  
ATOM   5506  H  H    . ALA A 1 22 ? 54.809 -7.562  9.541   1.00 0.00  ? 22  ALA A H    4  
ATOM   5507  H  HA   . ALA A 1 22 ? 53.946 -9.743  7.912   1.00 0.00  ? 22  ALA A HA   4  
ATOM   5508  H  HB1  . ALA A 1 22 ? 52.662 -8.915  9.788   1.00 0.00  ? 22  ALA A HB1  4  
ATOM   5509  H  HB2  . ALA A 1 22 ? 51.683 -8.679  8.340   1.00 0.00  ? 22  ALA A HB2  4  
ATOM   5510  H  HB3  . ALA A 1 22 ? 52.537 -7.313  9.061   1.00 0.00  ? 22  ALA A HB3  4  
ATOM   5511  N  N    . ALA A 1 23 ? 53.691 -6.749  6.501   1.00 0.00  ? 23  ALA A N    4  
ATOM   5512  C  CA   . ALA A 1 23 ? 53.559 -6.074  5.172   1.00 0.00  ? 23  ALA A CA   4  
ATOM   5513  C  C    . ALA A 1 23 ? 54.705 -6.512  4.248   1.00 0.00  ? 23  ALA A C    4  
ATOM   5514  O  O    . ALA A 1 23 ? 54.515 -6.705  3.062   1.00 0.00  ? 23  ALA A O    4  
ATOM   5515  C  CB   . ALA A 1 23 ? 53.650 -4.575  5.472   1.00 0.00  ? 23  ALA A CB   4  
ATOM   5516  H  H    . ALA A 1 23 ? 53.833 -6.212  7.310   1.00 0.00  ? 23  ALA A H    4  
ATOM   5517  H  HA   . ALA A 1 23 ? 52.605 -6.306  4.725   1.00 0.00  ? 23  ALA A HA   4  
ATOM   5518  H  HB1  . ALA A 1 23 ? 52.777 -4.265  6.027   1.00 0.00  ? 23  ALA A HB1  4  
ATOM   5519  H  HB2  . ALA A 1 23 ? 53.701 -4.025  4.545   1.00 0.00  ? 23  ALA A HB2  4  
ATOM   5520  H  HB3  . ALA A 1 23 ? 54.537 -4.376  6.058   1.00 0.00  ? 23  ALA A HB3  4  
ATOM   5521  N  N    . PHE A 1 24 ? 55.888 -6.682  4.791   1.00 0.00  ? 24  PHE A N    4  
ATOM   5522  C  CA   . PHE A 1 24 ? 57.053 -7.122  3.963   1.00 0.00  ? 24  PHE A CA   4  
ATOM   5523  C  C    . PHE A 1 24 ? 56.786 -8.517  3.382   1.00 0.00  ? 24  PHE A C    4  
ATOM   5524  O  O    . PHE A 1 24 ? 57.013 -8.759  2.212   1.00 0.00  ? 24  PHE A O    4  
ATOM   5525  C  CB   . PHE A 1 24 ? 58.239 -7.161  4.933   1.00 0.00  ? 24  PHE A CB   4  
ATOM   5526  C  CG   . PHE A 1 24 ? 59.536 -7.161  4.157   1.00 0.00  ? 24  PHE A CG   4  
ATOM   5527  C  CD1  . PHE A 1 24 ? 60.146 -5.948  3.823   1.00 0.00  ? 24  PHE A CD1  4  
ATOM   5528  C  CD2  . PHE A 1 24 ? 60.130 -8.372  3.777   1.00 0.00  ? 24  PHE A CD2  4  
ATOM   5529  C  CE1  . PHE A 1 24 ? 61.349 -5.942  3.109   1.00 0.00  ? 24  PHE A CE1  4  
ATOM   5530  C  CE2  . PHE A 1 24 ? 61.335 -8.366  3.063   1.00 0.00  ? 24  PHE A CE2  4  
ATOM   5531  C  CZ   . PHE A 1 24 ? 61.945 -7.151  2.729   1.00 0.00  ? 24  PHE A CZ   4  
ATOM   5532  H  H    . PHE A 1 24 ? 56.008 -6.528  5.753   1.00 0.00  ? 24  PHE A H    4  
ATOM   5533  H  HA   . PHE A 1 24 ? 57.244 -6.413  3.172   1.00 0.00  ? 24  PHE A HA   4  
ATOM   5534  H  HB2  . PHE A 1 24 ? 58.207 -6.292  5.575   1.00 0.00  ? 24  PHE A HB2  4  
ATOM   5535  H  HB3  . PHE A 1 24 ? 58.183 -8.055  5.535   1.00 0.00  ? 24  PHE A HB3  4  
ATOM   5536  H  HD1  . PHE A 1 24 ? 59.687 -5.015  4.114   1.00 0.00  ? 24  PHE A HD1  4  
ATOM   5537  H  HD2  . PHE A 1 24 ? 59.659 -9.309  4.034   1.00 0.00  ? 24  PHE A HD2  4  
ATOM   5538  H  HE1  . PHE A 1 24 ? 61.818 -5.005  2.853   1.00 0.00  ? 24  PHE A HE1  4  
ATOM   5539  H  HE2  . PHE A 1 24 ? 61.795 -9.299  2.770   1.00 0.00  ? 24  PHE A HE2  4  
ATOM   5540  H  HZ   . PHE A 1 24 ? 62.873 -7.146  2.179   1.00 0.00  ? 24  PHE A HZ   4  
ATOM   5541  N  N    . ASP A 1 25 ? 56.296 -9.430  4.191   1.00 0.00  ? 25  ASP A N    4  
ATOM   5542  C  CA   . ASP A 1 25 ? 56.001 -10.809 3.685   1.00 0.00  ? 25  ASP A CA   4  
ATOM   5543  C  C    . ASP A 1 25 ? 55.036 -10.735 2.493   1.00 0.00  ? 25  ASP A C    4  
ATOM   5544  O  O    . ASP A 1 25 ? 55.224 -11.397 1.490   1.00 0.00  ? 25  ASP A O    4  
ATOM   5545  C  CB   . ASP A 1 25 ? 55.350 -11.547 4.862   1.00 0.00  ? 25  ASP A CB   4  
ATOM   5546  C  CG   . ASP A 1 25 ? 56.424 -11.994 5.857   1.00 0.00  ? 25  ASP A CG   4  
ATOM   5547  O  OD1  . ASP A 1 25 ? 57.286 -12.764 5.467   1.00 0.00  ? 25  ASP A OD1  4  
ATOM   5548  O  OD2  . ASP A 1 25 ? 56.367 -11.560 6.995   1.00 0.00  ? 25  ASP A OD2  4  
ATOM   5549  H  H    . ASP A 1 25 ? 56.117 -9.205  5.130   1.00 0.00  ? 25  ASP A H    4  
ATOM   5550  H  HA   . ASP A 1 25 ? 56.915 -11.306 3.398   1.00 0.00  ? 25  ASP A HA   4  
ATOM   5551  H  HB2  . ASP A 1 25 ? 54.652 -10.888 5.359   1.00 0.00  ? 25  ASP A HB2  4  
ATOM   5552  H  HB3  . ASP A 1 25 ? 54.824 -12.414 4.494   1.00 0.00  ? 25  ASP A HB3  4  
ATOM   5553  N  N    . ILE A 1 26 ? 54.015 -9.918  2.594   1.00 0.00  ? 26  ILE A N    4  
ATOM   5554  C  CA   . ILE A 1 26 ? 53.040 -9.776  1.465   1.00 0.00  ? 26  ILE A CA   4  
ATOM   5555  C  C    . ILE A 1 26 ? 53.697 -9.015  0.301   1.00 0.00  ? 26  ILE A C    4  
ATOM   5556  O  O    . ILE A 1 26 ? 53.400 -9.256  -0.855  1.00 0.00  ? 26  ILE A O    4  
ATOM   5557  C  CB   . ILE A 1 26 ? 51.866 -8.973  2.045   1.00 0.00  ? 26  ILE A CB   4  
ATOM   5558  C  CG1  . ILE A 1 26 ? 51.181 -9.785  3.149   1.00 0.00  ? 26  ILE A CG1  4  
ATOM   5559  C  CG2  . ILE A 1 26 ? 50.850 -8.667  0.942   1.00 0.00  ? 26  ILE A CG2  4  
ATOM   5560  C  CD1  . ILE A 1 26 ? 50.470 -8.833  4.114   1.00 0.00  ? 26  ILE A CD1  4  
ATOM   5561  H  H    . ILE A 1 26 ? 53.897 -9.387  3.410   1.00 0.00  ? 26  ILE A H    4  
ATOM   5562  H  HA   . ILE A 1 26 ? 52.699 -10.745 1.137   1.00 0.00  ? 26  ILE A HA   4  
ATOM   5563  H  HB   . ILE A 1 26 ? 52.237 -8.045  2.458   1.00 0.00  ? 26  ILE A HB   4  
ATOM   5564  H  HG12 . ILE A 1 26 ? 50.459 -10.456 2.706   1.00 0.00  ? 26  ILE A HG12 4  
ATOM   5565  H  HG13 . ILE A 1 26 ? 51.920 -10.356 3.689   1.00 0.00  ? 26  ILE A HG13 4  
ATOM   5566  H  HG21 . ILE A 1 26 ? 50.532 -9.590  0.479   1.00 0.00  ? 26  ILE A HG21 4  
ATOM   5567  H  HG22 . ILE A 1 26 ? 51.306 -8.030  0.198   1.00 0.00  ? 26  ILE A HG22 4  
ATOM   5568  H  HG23 . ILE A 1 26 ? 49.994 -8.165  1.370   1.00 0.00  ? 26  ILE A HG23 4  
ATOM   5569  H  HD11 . ILE A 1 26 ? 51.106 -7.982  4.313   1.00 0.00  ? 26  ILE A HD11 4  
ATOM   5570  H  HD12 . ILE A 1 26 ? 50.261 -9.349  5.040   1.00 0.00  ? 26  ILE A HD12 4  
ATOM   5571  H  HD13 . ILE A 1 26 ? 49.544 -8.496  3.672   1.00 0.00  ? 26  ILE A HD13 4  
ATOM   5572  N  N    . PHE A 1 27 ? 54.590 -8.101  0.604   1.00 0.00  ? 27  PHE A N    4  
ATOM   5573  C  CA   . PHE A 1 27 ? 55.280 -7.320  -0.472  1.00 0.00  ? 27  PHE A CA   4  
ATOM   5574  C  C    . PHE A 1 27 ? 56.116 -8.254  -1.360  1.00 0.00  ? 27  PHE A C    4  
ATOM   5575  O  O    . PHE A 1 27 ? 56.108 -8.136  -2.570  1.00 0.00  ? 27  PHE A O    4  
ATOM   5576  C  CB   . PHE A 1 27 ? 56.190 -6.329  0.268   1.00 0.00  ? 27  PHE A CB   4  
ATOM   5577  C  CG   . PHE A 1 27 ? 55.769 -4.910  -0.043  1.00 0.00  ? 27  PHE A CG   4  
ATOM   5578  C  CD1  . PHE A 1 27 ? 56.106 -4.333  -1.273  1.00 0.00  ? 27  PHE A CD1  4  
ATOM   5579  C  CD2  . PHE A 1 27 ? 55.045 -4.170  0.901   1.00 0.00  ? 27  PHE A CD2  4  
ATOM   5580  C  CE1  . PHE A 1 27 ? 55.721 -3.017  -1.560  1.00 0.00  ? 27  PHE A CE1  4  
ATOM   5581  C  CE2  . PHE A 1 27 ? 54.661 -2.855  0.613   1.00 0.00  ? 27  PHE A CE2  4  
ATOM   5582  C  CZ   . PHE A 1 27 ? 54.998 -2.279  -0.616  1.00 0.00  ? 27  PHE A CZ   4  
ATOM   5583  H  H    . PHE A 1 27 ? 54.809 -7.930  1.544   1.00 0.00  ? 27  PHE A H    4  
ATOM   5584  H  HA   . PHE A 1 27 ? 54.558 -6.783  -1.067  1.00 0.00  ? 27  PHE A HA   4  
ATOM   5585  H  HB2  . PHE A 1 27 ? 56.119 -6.499  1.332   1.00 0.00  ? 27  PHE A HB2  4  
ATOM   5586  H  HB3  . PHE A 1 27 ? 57.211 -6.476  -0.049  1.00 0.00  ? 27  PHE A HB3  4  
ATOM   5587  H  HD1  . PHE A 1 27 ? 56.663 -4.902  -2.001  1.00 0.00  ? 27  PHE A HD1  4  
ATOM   5588  H  HD2  . PHE A 1 27 ? 54.783 -4.614  1.851   1.00 0.00  ? 27  PHE A HD2  4  
ATOM   5589  H  HE1  . PHE A 1 27 ? 55.981 -2.572  -2.509  1.00 0.00  ? 27  PHE A HE1  4  
ATOM   5590  H  HE2  . PHE A 1 27 ? 54.103 -2.285  1.340   1.00 0.00  ? 27  PHE A HE2  4  
ATOM   5591  H  HZ   . PHE A 1 27 ? 54.700 -1.264  -0.837  1.00 0.00  ? 27  PHE A HZ   4  
ATOM   5592  N  N    . VAL A 1 28 ? 56.837 -9.179  -0.770  1.00 0.00  ? 28  VAL A N    4  
ATOM   5593  C  CA   . VAL A 1 28 ? 57.671 -10.115 -1.590  1.00 0.00  ? 28  VAL A CA   4  
ATOM   5594  C  C    . VAL A 1 28 ? 57.091 -11.543 -1.557  1.00 0.00  ? 28  VAL A C    4  
ATOM   5595  O  O    . VAL A 1 28 ? 57.724 -12.478 -1.101  1.00 0.00  ? 28  VAL A O    4  
ATOM   5596  C  CB   . VAL A 1 28 ? 59.088 -10.057 -0.980  1.00 0.00  ? 28  VAL A CB   4  
ATOM   5597  C  CG1  . VAL A 1 28 ? 59.040 -10.369 0.519   1.00 0.00  ? 28  VAL A CG1  4  
ATOM   5598  C  CG2  . VAL A 1 28 ? 60.001 -11.074 -1.676  1.00 0.00  ? 28  VAL A CG2  4  
ATOM   5599  H  H    . VAL A 1 28 ? 56.828 -9.258  0.208   1.00 0.00  ? 28  VAL A H    4  
ATOM   5600  H  HA   . VAL A 1 28 ? 57.709 -9.765  -2.611  1.00 0.00  ? 28  VAL A HA   4  
ATOM   5601  H  HB   . VAL A 1 28 ? 59.492 -9.066  -1.127  1.00 0.00  ? 28  VAL A HB   4  
ATOM   5602  H  HG11 . VAL A 1 28 ? 58.189 -10.999 0.730   1.00 0.00  ? 28  VAL A HG11 4  
ATOM   5603  H  HG12 . VAL A 1 28 ? 58.953 -9.448  1.076   1.00 0.00  ? 28  VAL A HG12 4  
ATOM   5604  H  HG13 . VAL A 1 28 ? 59.946 -10.879 0.810   1.00 0.00  ? 28  VAL A HG13 4  
ATOM   5605  H  HG21 . VAL A 1 28 ? 59.409 -11.741 -2.281  1.00 0.00  ? 28  VAL A HG21 4  
ATOM   5606  H  HG22 . VAL A 1 28 ? 60.537 -11.645 -0.930  1.00 0.00  ? 28  VAL A HG22 4  
ATOM   5607  H  HG23 . VAL A 1 28 ? 60.708 -10.551 -2.303  1.00 0.00  ? 28  VAL A HG23 4  
ATOM   5608  N  N    . LEU A 1 29 ? 55.900 -11.725 -2.074  1.00 0.00  ? 29  LEU A N    4  
ATOM   5609  C  CA   . LEU A 1 29 ? 55.304 -13.100 -2.114  1.00 0.00  ? 29  LEU A CA   4  
ATOM   5610  C  C    . LEU A 1 29 ? 55.921 -13.838 -3.305  1.00 0.00  ? 29  LEU A C    4  
ATOM   5611  O  O    . LEU A 1 29 ? 55.330 -13.942 -4.365  1.00 0.00  ? 29  LEU A O    4  
ATOM   5612  C  CB   . LEU A 1 29 ? 53.799 -12.894 -2.314  1.00 0.00  ? 29  LEU A CB   4  
ATOM   5613  C  CG   . LEU A 1 29 ? 53.142 -12.544 -0.976  1.00 0.00  ? 29  LEU A CG   4  
ATOM   5614  C  CD1  . LEU A 1 29 ? 51.733 -12.001 -1.224  1.00 0.00  ? 29  LEU A CD1  4  
ATOM   5615  C  CD2  . LEU A 1 29 ? 53.055 -13.801 -0.108  1.00 0.00  ? 29  LEU A CD2  4  
ATOM   5616  H  H    . LEU A 1 29 ? 55.413 -10.968 -2.462  1.00 0.00  ? 29  LEU A H    4  
ATOM   5617  H  HA   . LEU A 1 29 ? 55.499 -13.629 -1.194  1.00 0.00  ? 29  LEU A HA   4  
ATOM   5618  H  HB2  . LEU A 1 29 ? 53.638 -12.091 -3.017  1.00 0.00  ? 29  LEU A HB2  4  
ATOM   5619  H  HB3  . LEU A 1 29 ? 53.361 -13.803 -2.700  1.00 0.00  ? 29  LEU A HB3  4  
ATOM   5620  H  HG   . LEU A 1 29 ? 53.733 -11.794 -0.470  1.00 0.00  ? 29  LEU A HG   4  
ATOM   5621  H  HD11 . LEU A 1 29 ? 51.231 -11.861 -0.278  1.00 0.00  ? 29  LEU A HD11 4  
ATOM   5622  H  HD12 . LEU A 1 29 ? 51.177 -12.705 -1.826  1.00 0.00  ? 29  LEU A HD12 4  
ATOM   5623  H  HD13 . LEU A 1 29 ? 51.796 -11.055 -1.742  1.00 0.00  ? 29  LEU A HD13 4  
ATOM   5624  H  HD21 . LEU A 1 29 ? 52.030 -13.960 0.194   1.00 0.00  ? 29  LEU A HD21 4  
ATOM   5625  H  HD22 . LEU A 1 29 ? 53.672 -13.674 0.769   1.00 0.00  ? 29  LEU A HD22 4  
ATOM   5626  H  HD23 . LEU A 1 29 ? 53.400 -14.655 -0.672  1.00 0.00  ? 29  LEU A HD23 4  
ATOM   5627  N  N    . GLY A 1 30 ? 57.137 -14.295 -3.151  1.00 0.00  ? 30  GLY A N    4  
ATOM   5628  C  CA   . GLY A 1 30 ? 57.842 -14.967 -4.280  1.00 0.00  ? 30  GLY A CA   4  
ATOM   5629  C  C    . GLY A 1 30 ? 58.742 -13.920 -4.938  1.00 0.00  ? 30  GLY A C    4  
ATOM   5630  O  O    . GLY A 1 30 ? 59.941 -14.096 -5.042  1.00 0.00  ? 30  GLY A O    4  
ATOM   5631  H  H    . GLY A 1 30 ? 57.605 -14.154 -2.301  1.00 0.00  ? 30  GLY A H    4  
ATOM   5632  H  HA2  . GLY A 1 30 ? 58.441 -15.787 -3.902  1.00 0.00  ? 30  GLY A HA2  4  
ATOM   5633  H  HA3  . GLY A 1 30 ? 57.125 -15.330 -5.001  1.00 0.00  ? 30  GLY A HA3  4  
ATOM   5634  N  N    . ALA A 1 31 ? 58.156 -12.813 -5.349  1.00 0.00  ? 31  ALA A N    4  
ATOM   5635  C  CA   . ALA A 1 31 ? 58.934 -11.695 -5.977  1.00 0.00  ? 31  ALA A CA   4  
ATOM   5636  C  C    . ALA A 1 31 ? 59.796 -12.184 -7.151  1.00 0.00  ? 31  ALA A C    4  
ATOM   5637  O  O    . ALA A 1 31 ? 59.653 -13.296 -7.627  1.00 0.00  ? 31  ALA A O    4  
ATOM   5638  C  CB   . ALA A 1 31 ? 59.811 -11.145 -4.845  1.00 0.00  ? 31  ALA A CB   4  
ATOM   5639  H  H    . ALA A 1 31 ? 57.192 -12.706 -5.219  1.00 0.00  ? 31  ALA A H    4  
ATOM   5640  H  HA   . ALA A 1 31 ? 58.261 -10.924 -6.315  1.00 0.00  ? 31  ALA A HA   4  
ATOM   5641  H  HB1  . ALA A 1 31 ? 60.648 -10.607 -5.265  1.00 0.00  ? 31  ALA A HB1  4  
ATOM   5642  H  HB2  . ALA A 1 31 ? 60.176 -11.961 -4.241  1.00 0.00  ? 31  ALA A HB2  4  
ATOM   5643  H  HB3  . ALA A 1 31 ? 59.227 -10.474 -4.229  1.00 0.00  ? 31  ALA A HB3  4  
ATOM   5644  N  N    . GLU A 1 32 ? 60.683 -11.346 -7.624  1.00 0.00  ? 32  GLU A N    4  
ATOM   5645  C  CA   . GLU A 1 32 ? 61.560 -11.734 -8.768  1.00 0.00  ? 32  GLU A CA   4  
ATOM   5646  C  C    . GLU A 1 32 ? 62.979 -12.040 -8.274  1.00 0.00  ? 32  GLU A C    4  
ATOM   5647  O  O    . GLU A 1 32 ? 63.550 -13.062 -8.599  1.00 0.00  ? 32  GLU A O    4  
ATOM   5648  C  CB   . GLU A 1 32 ? 61.568 -10.510 -9.688  1.00 0.00  ? 32  GLU A CB   4  
ATOM   5649  C  CG   . GLU A 1 32 ? 60.264 -10.459 -10.492 1.00 0.00  ? 32  GLU A CG   4  
ATOM   5650  C  CD   . GLU A 1 32 ? 60.577 -10.330 -11.985 1.00 0.00  ? 32  GLU A CD   4  
ATOM   5651  O  OE1  . GLU A 1 32 ? 61.235 -9.370  -12.355 1.00 0.00  ? 32  GLU A OE1  4  
ATOM   5652  O  OE2  . GLU A 1 32 ? 60.144 -11.188 -12.736 1.00 0.00  ? 32  GLU A OE2  4  
ATOM   5653  H  H    . GLU A 1 32 ? 60.768 -10.454 -7.227  1.00 0.00  ? 32  GLU A H    4  
ATOM   5654  H  HA   . GLU A 1 32 ? 61.150 -12.584 -9.291  1.00 0.00  ? 32  GLU A HA   4  
ATOM   5655  H  HB2  . GLU A 1 32 ? 61.657 -9.613  -9.091  1.00 0.00  ? 32  GLU A HB2  4  
ATOM   5656  H  HB3  . GLU A 1 32 ? 62.405 -10.574 -10.366 1.00 0.00  ? 32  GLU A HB3  4  
ATOM   5657  H  HG2  . GLU A 1 32 ? 59.700 -11.365 -10.320 1.00 0.00  ? 32  GLU A HG2  4  
ATOM   5658  H  HG3  . GLU A 1 32 ? 59.680 -9.608  -10.175 1.00 0.00  ? 32  GLU A HG3  4  
ATOM   5659  N  N    . ASP A 1 33 ? 63.552 -11.152 -7.497  1.00 0.00  ? 33  ASP A N    4  
ATOM   5660  C  CA   . ASP A 1 33 ? 64.943 -11.373 -6.985  1.00 0.00  ? 33  ASP A CA   4  
ATOM   5661  C  C    . ASP A 1 33 ? 64.939 -11.785 -5.500  1.00 0.00  ? 33  ASP A C    4  
ATOM   5662  O  O    . ASP A 1 33 ? 65.983 -12.029 -4.924  1.00 0.00  ? 33  ASP A O    4  
ATOM   5663  C  CB   . ASP A 1 33 ? 65.642 -10.016 -7.156  1.00 0.00  ? 33  ASP A CB   4  
ATOM   5664  C  CG   . ASP A 1 33 ? 65.428 -9.491  -8.578  1.00 0.00  ? 33  ASP A CG   4  
ATOM   5665  O  OD1  . ASP A 1 33 ? 66.162 -9.905  -9.459  1.00 0.00  ? 33  ASP A OD1  4  
ATOM   5666  O  OD2  . ASP A 1 33 ? 64.532 -8.681  -8.759  1.00 0.00  ? 33  ASP A OD2  4  
ATOM   5667  H  H    . ASP A 1 33 ? 63.071 -10.332 -7.258  1.00 0.00  ? 33  ASP A H    4  
ATOM   5668  H  HA   . ASP A 1 33 ? 65.448 -12.118 -7.579  1.00 0.00  ? 33  ASP A HA   4  
ATOM   5669  H  HB2  . ASP A 1 33 ? 65.232 -9.311  -6.448  1.00 0.00  ? 33  ASP A HB2  4  
ATOM   5670  H  HB3  . ASP A 1 33 ? 66.700 -10.132 -6.974  1.00 0.00  ? 33  ASP A HB3  4  
ATOM   5671  N  N    . GLY A 1 34 ? 63.787 -11.854 -4.871  1.00 0.00  ? 34  GLY A N    4  
ATOM   5672  C  CA   . GLY A 1 34 ? 63.741 -12.237 -3.425  1.00 0.00  ? 34  GLY A CA   4  
ATOM   5673  C  C    . GLY A 1 34 ? 63.383 -11.009 -2.576  1.00 0.00  ? 34  GLY A C    4  
ATOM   5674  O  O    . GLY A 1 34 ? 62.873 -11.135 -1.481  1.00 0.00  ? 34  GLY A O    4  
ATOM   5675  H  H    . GLY A 1 34 ? 62.955 -11.645 -5.344  1.00 0.00  ? 34  GLY A H    4  
ATOM   5676  H  HA2  . GLY A 1 34 ? 62.991 -13.005 -3.281  1.00 0.00  ? 34  GLY A HA2  4  
ATOM   5677  H  HA3  . GLY A 1 34 ? 64.709 -12.612 -3.118  1.00 0.00  ? 34  GLY A HA3  4  
ATOM   5678  N  N    . CYS A 1 35 ? 63.639 -9.824  -3.081  1.00 0.00  ? 35  CYS A N    4  
ATOM   5679  C  CA   . CYS A 1 35 ? 63.305 -8.581  -2.321  1.00 0.00  ? 35  CYS A CA   4  
ATOM   5680  C  C    . CYS A 1 35 ? 62.141 -7.855  -3.013  1.00 0.00  ? 35  CYS A C    4  
ATOM   5681  O  O    . CYS A 1 35 ? 61.492 -8.405  -3.883  1.00 0.00  ? 35  CYS A O    4  
ATOM   5682  C  CB   . CYS A 1 35 ? 64.583 -7.735  -2.368  1.00 0.00  ? 35  CYS A CB   4  
ATOM   5683  S  SG   . CYS A 1 35 ? 65.507 -7.947  -0.826  1.00 0.00  ? 35  CYS A SG   4  
ATOM   5684  H  H    . CYS A 1 35 ? 64.045 -9.751  -3.969  1.00 0.00  ? 35  CYS A H    4  
ATOM   5685  H  HA   . CYS A 1 35 ? 63.051 -8.817  -1.299  1.00 0.00  ? 35  CYS A HA   4  
ATOM   5686  H  HB2  . CYS A 1 35 ? 65.195 -8.052  -3.199  1.00 0.00  ? 35  CYS A HB2  4  
ATOM   5687  H  HB3  . CYS A 1 35 ? 64.323 -6.694  -2.490  1.00 0.00  ? 35  CYS A HB3  4  
ATOM   5688  H  HG   . CYS A 1 35 ? 64.921 -7.729  -0.098  1.00 0.00  ? 35  CYS A HG   4  
ATOM   5689  N  N    . ILE A 1 36 ? 61.869 -6.628  -2.641  1.00 0.00  ? 36  ILE A N    4  
ATOM   5690  C  CA   . ILE A 1 36 ? 60.747 -5.885  -3.292  1.00 0.00  ? 36  ILE A CA   4  
ATOM   5691  C  C    . ILE A 1 36 ? 61.270 -5.081  -4.492  1.00 0.00  ? 36  ILE A C    4  
ATOM   5692  O  O    . ILE A 1 36 ? 61.808 -3.998  -4.345  1.00 0.00  ? 36  ILE A O    4  
ATOM   5693  C  CB   . ILE A 1 36 ? 60.183 -4.959  -2.205  1.00 0.00  ? 36  ILE A CB   4  
ATOM   5694  C  CG1  . ILE A 1 36 ? 59.490 -5.802  -1.130  1.00 0.00  ? 36  ILE A CG1  4  
ATOM   5695  C  CG2  . ILE A 1 36 ? 59.163 -3.996  -2.821  1.00 0.00  ? 36  ILE A CG2  4  
ATOM   5696  C  CD1  . ILE A 1 36 ? 60.350 -5.828  0.133   1.00 0.00  ? 36  ILE A CD1  4  
ATOM   5697  H  H    . ILE A 1 36 ? 62.403 -6.197  -1.939  1.00 0.00  ? 36  ILE A H    4  
ATOM   5698  H  HA   . ILE A 1 36 ? 59.983 -6.575  -3.615  1.00 0.00  ? 36  ILE A HA   4  
ATOM   5699  H  HB   . ILE A 1 36 ? 60.988 -4.394  -1.759  1.00 0.00  ? 36  ILE A HB   4  
ATOM   5700  H  HG12 . ILE A 1 36 ? 58.526 -5.370  -0.902  1.00 0.00  ? 36  ILE A HG12 4  
ATOM   5701  H  HG13 . ILE A 1 36 ? 59.356 -6.810  -1.493  1.00 0.00  ? 36  ILE A HG13 4  
ATOM   5702  H  HG21 . ILE A 1 36 ? 58.641 -3.473  -2.034  1.00 0.00  ? 36  ILE A HG21 4  
ATOM   5703  H  HG22 . ILE A 1 36 ? 58.453 -4.553  -3.414  1.00 0.00  ? 36  ILE A HG22 4  
ATOM   5704  H  HG23 . ILE A 1 36 ? 59.674 -3.282  -3.449  1.00 0.00  ? 36  ILE A HG23 4  
ATOM   5705  H  HD11 . ILE A 1 36 ? 61.392 -5.876  -0.141  1.00 0.00  ? 36  ILE A HD11 4  
ATOM   5706  H  HD12 . ILE A 1 36 ? 60.094 -6.694  0.726   1.00 0.00  ? 36  ILE A HD12 4  
ATOM   5707  H  HD13 . ILE A 1 36 ? 60.170 -4.932  0.709   1.00 0.00  ? 36  ILE A HD13 4  
ATOM   5708  N  N    . SER A 1 37 ? 61.111 -5.608  -5.680  1.00 0.00  ? 37  SER A N    4  
ATOM   5709  C  CA   . SER A 1 37 ? 61.588 -4.887  -6.903  1.00 0.00  ? 37  SER A CA   4  
ATOM   5710  C  C    . SER A 1 37 ? 60.442 -4.058  -7.510  1.00 0.00  ? 37  SER A C    4  
ATOM   5711  O  O    . SER A 1 37 ? 59.423 -3.842  -6.881  1.00 0.00  ? 37  SER A O    4  
ATOM   5712  C  CB   . SER A 1 37 ? 62.035 -5.992  -7.868  1.00 0.00  ? 37  SER A CB   4  
ATOM   5713  O  OG   . SER A 1 37 ? 60.907 -6.490  -8.583  1.00 0.00  ? 37  SER A OG   4  
ATOM   5714  H  H    . SER A 1 37 ? 60.674 -6.483  -5.769  1.00 0.00  ? 37  SER A H    4  
ATOM   5715  H  HA   . SER A 1 37 ? 62.423 -4.249  -6.661  1.00 0.00  ? 37  SER A HA   4  
ATOM   5716  H  HB2  . SER A 1 37 ? 62.749 -5.592  -8.569  1.00 0.00  ? 37  SER A HB2  4  
ATOM   5717  H  HB3  . SER A 1 37 ? 62.500 -6.793  -7.305  1.00 0.00  ? 37  SER A HB3  4  
ATOM   5718  H  HG   . SER A 1 37 ? 60.723 -7.380  -8.269  1.00 0.00  ? 37  SER A HG   4  
ATOM   5719  N  N    . THR A 1 38 ? 60.601 -3.598  -8.728  1.00 0.00  ? 38  THR A N    4  
ATOM   5720  C  CA   . THR A 1 38 ? 59.520 -2.787  -9.383  1.00 0.00  ? 38  THR A CA   4  
ATOM   5721  C  C    . THR A 1 38 ? 58.216 -3.593  -9.463  1.00 0.00  ? 38  THR A C    4  
ATOM   5722  O  O    . THR A 1 38 ? 57.140 -3.063  -9.258  1.00 0.00  ? 38  THR A O    4  
ATOM   5723  C  CB   . THR A 1 38 ? 60.038 -2.466  -10.792 1.00 0.00  ? 38  THR A CB   4  
ATOM   5724  O  OG1  . THR A 1 38 ? 60.552 -3.648  -11.394 1.00 0.00  ? 38  THR A OG1  4  
ATOM   5725  C  CG2  . THR A 1 38 ? 61.146 -1.415  -10.705 1.00 0.00  ? 38  THR A CG2  4  
ATOM   5726  H  H    . THR A 1 38 ? 61.430 -3.790  -9.217  1.00 0.00  ? 38  THR A H    4  
ATOM   5727  H  HA   . THR A 1 38 ? 59.359 -1.872  -8.836  1.00 0.00  ? 38  THR A HA   4  
ATOM   5728  H  HB   . THR A 1 38 ? 59.228 -2.078  -11.392 1.00 0.00  ? 38  THR A HB   4  
ATOM   5729  H  HG1  . THR A 1 38 ? 60.782 -3.443  -12.303 1.00 0.00  ? 38  THR A HG1  4  
ATOM   5730  H  HG21 . THR A 1 38 ? 60.778 -0.545  -10.183 1.00 0.00  ? 38  THR A HG21 4  
ATOM   5731  H  HG22 . THR A 1 38 ? 61.453 -1.134  -11.702 1.00 0.00  ? 38  THR A HG22 4  
ATOM   5732  H  HG23 . THR A 1 38 ? 61.991 -1.826  -10.171 1.00 0.00  ? 38  THR A HG23 4  
ATOM   5733  N  N    . LYS A 1 39 ? 58.306 -4.871  -9.751  1.00 0.00  ? 39  LYS A N    4  
ATOM   5734  C  CA   . LYS A 1 39 ? 57.072 -5.717  -9.835  1.00 0.00  ? 39  LYS A CA   4  
ATOM   5735  C  C    . LYS A 1 39 ? 56.436 -5.862  -8.443  1.00 0.00  ? 39  LYS A C    4  
ATOM   5736  O  O    . LYS A 1 39 ? 55.240 -5.707  -8.284  1.00 0.00  ? 39  LYS A O    4  
ATOM   5737  C  CB   . LYS A 1 39 ? 57.548 -7.076  -10.363 1.00 0.00  ? 39  LYS A CB   4  
ATOM   5738  C  CG   . LYS A 1 39 ? 57.308 -7.155  -11.875 1.00 0.00  ? 39  LYS A CG   4  
ATOM   5739  C  CD   . LYS A 1 39 ? 58.233 -8.214  -12.481 1.00 0.00  ? 39  LYS A CD   4  
ATOM   5740  C  CE   . LYS A 1 39 ? 58.136 -8.174  -14.010 1.00 0.00  ? 39  LYS A CE   4  
ATOM   5741  N  NZ   . LYS A 1 39 ? 59.244 -9.049  -14.493 1.00 0.00  ? 39  LYS A NZ   4  
ATOM   5742  H  H    . LYS A 1 39 ? 59.186 -5.275  -9.906  1.00 0.00  ? 39  LYS A H    4  
ATOM   5743  H  HA   . LYS A 1 39 ? 56.366 -5.280  -10.525 1.00 0.00  ? 39  LYS A HA   4  
ATOM   5744  H  HB2  . LYS A 1 39 ? 58.603 -7.193  -10.159 1.00 0.00  ? 39  LYS A HB2  4  
ATOM   5745  H  HB3  . LYS A 1 39 ? 56.999 -7.866  -9.872  1.00 0.00  ? 39  LYS A HB3  4  
ATOM   5746  H  HG2  . LYS A 1 39 ? 56.278 -7.424  -12.064 1.00 0.00  ? 39  LYS A HG2  4  
ATOM   5747  H  HG3  . LYS A 1 39 ? 57.518 -6.196  -12.325 1.00 0.00  ? 39  LYS A HG3  4  
ATOM   5748  H  HD2  . LYS A 1 39 ? 59.250 -8.014  -12.178 1.00 0.00  ? 39  LYS A HD2  4  
ATOM   5749  H  HD3  . LYS A 1 39 ? 57.940 -9.192  -12.129 1.00 0.00  ? 39  LYS A HD3  4  
ATOM   5750  H  HE2  . LYS A 1 39 ? 57.179 -8.560  -14.335 1.00 0.00  ? 39  LYS A HE2  4  
ATOM   5751  H  HE3  . LYS A 1 39 ? 58.277 -7.167  -14.370 1.00 0.00  ? 39  LYS A HE3  4  
ATOM   5752  H  HZ1  . LYS A 1 39 ? 59.212 -9.113  -15.529 1.00 0.00  ? 39  LYS A HZ1  4  
ATOM   5753  H  HZ2  . LYS A 1 39 ? 59.141 -10.002 -14.083 1.00 0.00  ? 39  LYS A HZ2  4  
ATOM   5754  H  HZ3  . LYS A 1 39 ? 60.159 -8.647  -14.201 1.00 0.00  ? 39  LYS A HZ3  4  
ATOM   5755  N  N    . GLU A 1 40 ? 57.229 -6.143  -7.435  1.00 0.00  ? 40  GLU A N    4  
ATOM   5756  C  CA   . GLU A 1 40 ? 56.674 -6.285  -6.047  1.00 0.00  ? 40  GLU A CA   4  
ATOM   5757  C  C    . GLU A 1 40 ? 56.115 -4.937  -5.566  1.00 0.00  ? 40  GLU A C    4  
ATOM   5758  O  O    . GLU A 1 40 ? 55.070 -4.873  -4.946  1.00 0.00  ? 40  GLU A O    4  
ATOM   5759  C  CB   . GLU A 1 40 ? 57.861 -6.713  -5.176  1.00 0.00  ? 40  GLU A CB   4  
ATOM   5760  C  CG   . GLU A 1 40 ? 58.120 -8.217  -5.342  1.00 0.00  ? 40  GLU A CG   4  
ATOM   5761  C  CD   . GLU A 1 40 ? 58.994 -8.468  -6.575  1.00 0.00  ? 40  GLU A CD   4  
ATOM   5762  O  OE1  . GLU A 1 40 ? 60.197 -8.300  -6.472  1.00 0.00  ? 40  GLU A OE1  4  
ATOM   5763  O  OE2  . GLU A 1 40 ? 58.446 -8.831  -7.602  1.00 0.00  ? 40  GLU A OE2  4  
ATOM   5764  H  H    . GLU A 1 40 ? 58.191 -6.254  -7.589  1.00 0.00  ? 40  GLU A H    4  
ATOM   5765  H  HA   . GLU A 1 40 ? 55.906 -7.042  -6.023  1.00 0.00  ? 40  GLU A HA   4  
ATOM   5766  H  HB2  . GLU A 1 40 ? 58.741 -6.161  -5.471  1.00 0.00  ? 40  GLU A HB2  4  
ATOM   5767  H  HB3  . GLU A 1 40 ? 57.638 -6.503  -4.140  1.00 0.00  ? 40  GLU A HB3  4  
ATOM   5768  H  HG2  . GLU A 1 40 ? 58.625 -8.591  -4.464  1.00 0.00  ? 40  GLU A HG2  4  
ATOM   5769  H  HG3  . GLU A 1 40 ? 57.179 -8.732  -5.460  1.00 0.00  ? 40  GLU A HG3  4  
ATOM   5770  N  N    . LEU A 1 41 ? 56.804 -3.861  -5.863  1.00 0.00  ? 41  LEU A N    4  
ATOM   5771  C  CA   . LEU A 1 41 ? 56.324 -2.507  -5.446  1.00 0.00  ? 41  LEU A CA   4  
ATOM   5772  C  C    . LEU A 1 41 ? 55.045 -2.154  -6.215  1.00 0.00  ? 41  LEU A C    4  
ATOM   5773  O  O    . LEU A 1 41 ? 54.003 -1.917  -5.632  1.00 0.00  ? 41  LEU A O    4  
ATOM   5774  C  CB   . LEU A 1 41 ? 57.464 -1.558  -5.834  1.00 0.00  ? 41  LEU A CB   4  
ATOM   5775  C  CG   . LEU A 1 41 ? 57.431 -0.274  -4.991  1.00 0.00  ? 41  LEU A CG   4  
ATOM   5776  C  CD1  . LEU A 1 41 ? 56.014 0.016   -4.472  1.00 0.00  ? 41  LEU A CD1  4  
ATOM   5777  C  CD2  . LEU A 1 41 ? 58.387 -0.431  -3.806  1.00 0.00  ? 41  LEU A CD2  4  
ATOM   5778  H  H    . LEU A 1 41 ? 57.639 -3.946  -6.372  1.00 0.00  ? 41  LEU A H    4  
ATOM   5779  H  HA   . LEU A 1 41 ? 56.154 -2.472  -4.382  1.00 0.00  ? 41  LEU A HA   4  
ATOM   5780  H  HB2  . LEU A 1 41 ? 58.408 -2.057  -5.678  1.00 0.00  ? 41  LEU A HB2  4  
ATOM   5781  H  HB3  . LEU A 1 41 ? 57.371 -1.298  -6.879  1.00 0.00  ? 41  LEU A HB3  4  
ATOM   5782  H  HG   . LEU A 1 41 ? 57.754 0.549   -5.607  1.00 0.00  ? 41  LEU A HG   4  
ATOM   5783  H  HD11 . LEU A 1 41 ? 55.319 0.013   -5.298  1.00 0.00  ? 41  LEU A HD11 4  
ATOM   5784  H  HD12 . LEU A 1 41 ? 55.995 0.984   -3.994  1.00 0.00  ? 41  LEU A HD12 4  
ATOM   5785  H  HD13 . LEU A 1 41 ? 55.729 -0.742  -3.758  1.00 0.00  ? 41  LEU A HD13 4  
ATOM   5786  H  HD21 . LEU A 1 41 ? 57.845 -0.288  -2.883  1.00 0.00  ? 41  LEU A HD21 4  
ATOM   5787  H  HD22 . LEU A 1 41 ? 59.174 0.305   -3.879  1.00 0.00  ? 41  LEU A HD22 4  
ATOM   5788  H  HD23 . LEU A 1 41 ? 58.818 -1.421  -3.821  1.00 0.00  ? 41  LEU A HD23 4  
ATOM   5789  N  N    . GLY A 1 42 ? 55.130 -2.123  -7.524  1.00 0.00  ? 42  GLY A N    4  
ATOM   5790  C  CA   . GLY A 1 42 ? 53.940 -1.797  -8.374  1.00 0.00  ? 42  GLY A CA   4  
ATOM   5791  C  C    . GLY A 1 42 ? 52.728 -2.645  -7.953  1.00 0.00  ? 42  GLY A C    4  
ATOM   5792  O  O    . GLY A 1 42 ? 51.601 -2.192  -8.018  1.00 0.00  ? 42  GLY A O    4  
ATOM   5793  H  H    . GLY A 1 42 ? 55.992 -2.316  -7.952  1.00 0.00  ? 42  GLY A H    4  
ATOM   5794  H  HA2  . GLY A 1 42 ? 53.699 -0.747  -8.263  1.00 0.00  ? 42  GLY A HA2  4  
ATOM   5795  H  HA3  . GLY A 1 42 ? 54.174 -2.007  -9.409  1.00 0.00  ? 42  GLY A HA3  4  
ATOM   5796  N  N    . LYS A 1 43 ? 52.950 -3.867  -7.514  1.00 0.00  ? 43  LYS A N    4  
ATOM   5797  C  CA   . LYS A 1 43 ? 51.808 -4.739  -7.077  1.00 0.00  ? 43  LYS A CA   4  
ATOM   5798  C  C    . LYS A 1 43 ? 50.973 -4.032  -5.996  1.00 0.00  ? 43  LYS A C    4  
ATOM   5799  O  O    . LYS A 1 43 ? 49.762 -4.135  -5.971  1.00 0.00  ? 43  LYS A O    4  
ATOM   5800  C  CB   . LYS A 1 43 ? 52.464 -6.001  -6.509  1.00 0.00  ? 43  LYS A CB   4  
ATOM   5801  C  CG   . LYS A 1 43 ? 51.442 -7.142  -6.476  1.00 0.00  ? 43  LYS A CG   4  
ATOM   5802  C  CD   . LYS A 1 43 ? 52.167 -8.479  -6.285  1.00 0.00  ? 43  LYS A CD   4  
ATOM   5803  C  CE   . LYS A 1 43 ? 52.740 -8.565  -4.864  1.00 0.00  ? 43  LYS A CE   4  
ATOM   5804  N  NZ   . LYS A 1 43 ? 52.599 -9.999  -4.476  1.00 0.00  ? 43  LYS A NZ   4  
ATOM   5805  H  H    . LYS A 1 43 ? 53.868 -4.208  -7.467  1.00 0.00  ? 43  LYS A H    4  
ATOM   5806  H  HA   . LYS A 1 43 ? 51.188 -4.994  -7.922  1.00 0.00  ? 43  LYS A HA   4  
ATOM   5807  H  HB2  . LYS A 1 43 ? 53.299 -6.283  -7.133  1.00 0.00  ? 43  LYS A HB2  4  
ATOM   5808  H  HB3  . LYS A 1 43 ? 52.814 -5.805  -5.507  1.00 0.00  ? 43  LYS A HB3  4  
ATOM   5809  H  HG2  . LYS A 1 43 ? 50.752 -6.984  -5.659  1.00 0.00  ? 43  LYS A HG2  4  
ATOM   5810  H  HG3  . LYS A 1 43 ? 50.896 -7.162  -7.408  1.00 0.00  ? 43  LYS A HG3  4  
ATOM   5811  H  HD2  . LYS A 1 43 ? 51.469 -9.290  -6.441  1.00 0.00  ? 43  LYS A HD2  4  
ATOM   5812  H  HD3  . LYS A 1 43 ? 52.973 -8.557  -7.000  1.00 0.00  ? 43  LYS A HD3  4  
ATOM   5813  H  HE2  . LYS A 1 43 ? 53.782 -8.274  -4.864  1.00 0.00  ? 43  LYS A HE2  4  
ATOM   5814  H  HE3  . LYS A 1 43 ? 52.174 -7.940  -4.190  1.00 0.00  ? 43  LYS A HE3  4  
ATOM   5815  H  HZ1  . LYS A 1 43 ? 51.590 -10.243 -4.407  1.00 0.00  ? 43  LYS A HZ1  4  
ATOM   5816  H  HZ2  . LYS A 1 43 ? 53.056 -10.153 -3.553  1.00 0.00  ? 43  LYS A HZ2  4  
ATOM   5817  H  HZ3  . LYS A 1 43 ? 53.051 -10.601 -5.192  1.00 0.00  ? 43  LYS A HZ3  4  
ATOM   5818  N  N    . VAL A 1 44 ? 51.612 -3.306  -5.113  1.00 0.00  ? 44  VAL A N    4  
ATOM   5819  C  CA   . VAL A 1 44 ? 50.863 -2.574  -4.043  1.00 0.00  ? 44  VAL A CA   4  
ATOM   5820  C  C    . VAL A 1 44 ? 50.508 -1.159  -4.530  1.00 0.00  ? 44  VAL A C    4  
ATOM   5821  O  O    . VAL A 1 44 ? 49.509 -0.588  -4.132  1.00 0.00  ? 44  VAL A O    4  
ATOM   5822  C  CB   . VAL A 1 44 ? 51.824 -2.507  -2.846  1.00 0.00  ? 44  VAL A CB   4  
ATOM   5823  C  CG1  . VAL A 1 44 ? 51.113 -1.866  -1.653  1.00 0.00  ? 44  VAL A CG1  4  
ATOM   5824  C  CG2  . VAL A 1 44 ? 52.278 -3.920  -2.460  1.00 0.00  ? 44  VAL A CG2  4  
ATOM   5825  H  H    . VAL A 1 44 ? 52.589 -3.231  -5.160  1.00 0.00  ? 44  VAL A H    4  
ATOM   5826  H  HA   . VAL A 1 44 ? 49.969 -3.113  -3.770  1.00 0.00  ? 44  VAL A HA   4  
ATOM   5827  H  HB   . VAL A 1 44 ? 52.685 -1.910  -3.112  1.00 0.00  ? 44  VAL A HB   4  
ATOM   5828  H  HG11 . VAL A 1 44 ? 50.160 -2.349  -1.498  1.00 0.00  ? 44  VAL A HG11 4  
ATOM   5829  H  HG12 . VAL A 1 44 ? 50.957 -0.816  -1.849  1.00 0.00  ? 44  VAL A HG12 4  
ATOM   5830  H  HG13 . VAL A 1 44 ? 51.722 -1.980  -0.769  1.00 0.00  ? 44  VAL A HG13 4  
ATOM   5831  H  HG21 . VAL A 1 44 ? 52.739 -3.895  -1.483  1.00 0.00  ? 44  VAL A HG21 4  
ATOM   5832  H  HG22 . VAL A 1 44 ? 52.993 -4.281  -3.186  1.00 0.00  ? 44  VAL A HG22 4  
ATOM   5833  H  HG23 . VAL A 1 44 ? 51.424 -4.581  -2.437  1.00 0.00  ? 44  VAL A HG23 4  
ATOM   5834  N  N    . MET A 1 45 ? 51.325 -0.594  -5.390  1.00 0.00  ? 45  MET A N    4  
ATOM   5835  C  CA   . MET A 1 45 ? 51.056 0.784   -5.916  1.00 0.00  ? 45  MET A CA   4  
ATOM   5836  C  C    . MET A 1 45 ? 49.681 0.857   -6.600  1.00 0.00  ? 45  MET A C    4  
ATOM   5837  O  O    . MET A 1 45 ? 48.938 1.798   -6.402  1.00 0.00  ? 45  MET A O    4  
ATOM   5838  C  CB   . MET A 1 45 ? 52.172 1.043   -6.934  1.00 0.00  ? 45  MET A CB   4  
ATOM   5839  C  CG   . MET A 1 45 ? 53.426 1.531   -6.208  1.00 0.00  ? 45  MET A CG   4  
ATOM   5840  S  SD   . MET A 1 45 ? 53.363 3.331   -6.030  1.00 0.00  ? 45  MET A SD   4  
ATOM   5841  C  CE   . MET A 1 45 ? 54.798 3.496   -4.941  1.00 0.00  ? 45  MET A CE   4  
ATOM   5842  H  H    . MET A 1 45 ? 52.123 -1.079  -5.690  1.00 0.00  ? 45  MET A H    4  
ATOM   5843  H  HA   . MET A 1 45 ? 51.116 1.508   -5.118  1.00 0.00  ? 45  MET A HA   4  
ATOM   5844  H  HB2  . MET A 1 45 ? 52.394 0.129   -7.463  1.00 0.00  ? 45  MET A HB2  4  
ATOM   5845  H  HB3  . MET A 1 45 ? 51.851 1.796   -7.638  1.00 0.00  ? 45  MET A HB3  4  
ATOM   5846  H  HG2  . MET A 1 45 ? 53.475 1.075   -5.230  1.00 0.00  ? 45  MET A HG2  4  
ATOM   5847  H  HG3  . MET A 1 45 ? 54.301 1.257   -6.778  1.00 0.00  ? 45  MET A HG3  4  
ATOM   5848  H  HE1  . MET A 1 45 ? 55.067 4.540   -4.859  1.00 0.00  ? 45  MET A HE1  4  
ATOM   5849  H  HE2  . MET A 1 45 ? 55.628 2.944   -5.353  1.00 0.00  ? 45  MET A HE2  4  
ATOM   5850  H  HE3  . MET A 1 45 ? 54.554 3.101   -3.964  1.00 0.00  ? 45  MET A HE3  4  
ATOM   5851  N  N    . ARG A 1 46 ? 49.342 -0.124  -7.406  1.00 0.00  ? 46  ARG A N    4  
ATOM   5852  C  CA   . ARG A 1 46 ? 48.016 -0.106  -8.116  1.00 0.00  ? 46  ARG A CA   4  
ATOM   5853  C  C    . ARG A 1 46 ? 46.833 0.090   -7.143  1.00 0.00  ? 46  ARG A C    4  
ATOM   5854  O  O    . ARG A 1 46 ? 45.743 0.436   -7.560  1.00 0.00  ? 46  ARG A O    4  
ATOM   5855  C  CB   . ARG A 1 46 ? 47.920 -1.460  -8.839  1.00 0.00  ? 46  ARG A CB   4  
ATOM   5856  C  CG   . ARG A 1 46 ? 47.770 -2.608  -7.831  1.00 0.00  ? 46  ARG A CG   4  
ATOM   5857  C  CD   . ARG A 1 46 ? 46.951 -3.741  -8.466  1.00 0.00  ? 46  ARG A CD   4  
ATOM   5858  N  NE   . ARG A 1 46 ? 47.852 -4.933  -8.456  1.00 0.00  ? 46  ARG A NE   4  
ATOM   5859  C  CZ   . ARG A 1 46 ? 47.545 -5.979  -7.739  1.00 0.00  ? 46  ARG A CZ   4  
ATOM   5860  N  NH1  . ARG A 1 46 ? 47.883 -6.027  -6.484  1.00 0.00  ? 46  ARG A NH1  4  
ATOM   5861  N  NH2  . ARG A 1 46 ? 46.912 -6.981  -8.282  1.00 0.00  ? 46  ARG A NH2  4  
ATOM   5862  H  H    . ARG A 1 46 ? 49.963 -0.869  -7.553  1.00 0.00  ? 46  ARG A H    4  
ATOM   5863  H  HA   . ARG A 1 46 ? 48.012 0.686   -8.849  1.00 0.00  ? 46  ARG A HA   4  
ATOM   5864  H  HB2  . ARG A 1 46 ? 47.064 -1.449  -9.498  1.00 0.00  ? 46  ARG A HB2  4  
ATOM   5865  H  HB3  . ARG A 1 46 ? 48.816 -1.615  -9.423  1.00 0.00  ? 46  ARG A HB3  4  
ATOM   5866  H  HG2  . ARG A 1 46 ? 48.749 -2.977  -7.562  1.00 0.00  ? 46  ARG A HG2  4  
ATOM   5867  H  HG3  . ARG A 1 46 ? 47.264 -2.252  -6.948  1.00 0.00  ? 46  ARG A HG3  4  
ATOM   5868  H  HD2  . ARG A 1 46 ? 46.061 -3.932  -7.882  1.00 0.00  ? 46  ARG A HD2  4  
ATOM   5869  H  HD3  . ARG A 1 46 ? 46.685 -3.488  -9.482  1.00 0.00  ? 46  ARG A HD3  4  
ATOM   5870  H  HE   . ARG A 1 46 ? 48.673 -4.931  -8.990  1.00 0.00  ? 46  ARG A HE   4  
ATOM   5871  H  HH11 . ARG A 1 46 ? 48.378 -5.260  -6.071  1.00 0.00  ? 46  ARG A HH11 4  
ATOM   5872  H  HH12 . ARG A 1 46 ? 47.649 -6.826  -5.931  1.00 0.00  ? 46  ARG A HH12 4  
ATOM   5873  H  HH21 . ARG A 1 46 ? 46.663 -6.950  -9.249  1.00 0.00  ? 46  ARG A HH21 4  
ATOM   5874  H  HH22 . ARG A 1 46 ? 46.670 -7.778  -7.730  1.00 0.00  ? 46  ARG A HH22 4  
ATOM   5875  N  N    . MET A 1 47 ? 47.028 -0.119  -5.861  1.00 0.00  ? 47  MET A N    4  
ATOM   5876  C  CA   . MET A 1 47 ? 45.901 0.069   -4.890  1.00 0.00  ? 47  MET A CA   4  
ATOM   5877  C  C    . MET A 1 47 ? 45.745 1.549   -4.504  1.00 0.00  ? 47  MET A C    4  
ATOM   5878  O  O    . MET A 1 47 ? 44.657 1.997   -4.197  1.00 0.00  ? 47  MET A O    4  
ATOM   5879  C  CB   . MET A 1 47 ? 46.277 -0.755  -3.656  1.00 0.00  ? 47  MET A CB   4  
ATOM   5880  C  CG   . MET A 1 47 ? 46.306 -2.241  -4.012  1.00 0.00  ? 47  MET A CG   4  
ATOM   5881  S  SD   . MET A 1 47 ? 46.964 -3.173  -2.610  1.00 0.00  ? 47  MET A SD   4  
ATOM   5882  C  CE   . MET A 1 47 ? 47.556 -4.602  -3.544  1.00 0.00  ? 47  MET A CE   4  
ATOM   5883  H  H    . MET A 1 47 ? 47.909 -0.396  -5.536  1.00 0.00  ? 47  MET A H    4  
ATOM   5884  H  HA   . MET A 1 47 ? 44.980 -0.303  -5.309  1.00 0.00  ? 47  MET A HA   4  
ATOM   5885  H  HB2  . MET A 1 47 ? 47.251 -0.450  -3.303  1.00 0.00  ? 47  MET A HB2  4  
ATOM   5886  H  HB3  . MET A 1 47 ? 45.546 -0.589  -2.879  1.00 0.00  ? 47  MET A HB3  4  
ATOM   5887  H  HG2  . MET A 1 47 ? 45.303 -2.578  -4.233  1.00 0.00  ? 47  MET A HG2  4  
ATOM   5888  H  HG3  . MET A 1 47 ? 46.937 -2.393  -4.875  1.00 0.00  ? 47  MET A HG3  4  
ATOM   5889  H  HE1  . MET A 1 47 ? 46.972 -4.704  -4.448  1.00 0.00  ? 47  MET A HE1  4  
ATOM   5890  H  HE2  . MET A 1 47 ? 47.449 -5.493  -2.946  1.00 0.00  ? 47  MET A HE2  4  
ATOM   5891  H  HE3  . MET A 1 47 ? 48.597 -4.459  -3.795  1.00 0.00  ? 47  MET A HE3  4  
ATOM   5892  N  N    . LEU A 1 48 ? 46.818 2.307   -4.498  1.00 0.00  ? 48  LEU A N    4  
ATOM   5893  C  CA   . LEU A 1 48 ? 46.714 3.747   -4.111  1.00 0.00  ? 48  LEU A CA   4  
ATOM   5894  C  C    . LEU A 1 48 ? 47.664 4.625   -4.947  1.00 0.00  ? 48  LEU A C    4  
ATOM   5895  O  O    . LEU A 1 48 ? 47.268 5.656   -5.459  1.00 0.00  ? 48  LEU A O    4  
ATOM   5896  C  CB   . LEU A 1 48 ? 47.112 3.769   -2.631  1.00 0.00  ? 48  LEU A CB   4  
ATOM   5897  C  CG   . LEU A 1 48 ? 47.247 5.214   -2.148  1.00 0.00  ? 48  LEU A CG   4  
ATOM   5898  C  CD1  . LEU A 1 48 ? 45.898 5.710   -1.625  1.00 0.00  ? 48  LEU A CD1  4  
ATOM   5899  C  CD2  . LEU A 1 48 ? 48.285 5.279   -1.026  1.00 0.00  ? 48  LEU A CD2  4  
ATOM   5900  H  H    . LEU A 1 48 ? 47.689 1.928   -4.732  1.00 0.00  ? 48  LEU A H    4  
ATOM   5901  H  HA   . LEU A 1 48 ? 45.697 4.090   -4.218  1.00 0.00  ? 48  LEU A HA   4  
ATOM   5902  H  HB2  . LEU A 1 48 ? 46.354 3.264   -2.049  1.00 0.00  ? 48  LEU A HB2  4  
ATOM   5903  H  HB3  . LEU A 1 48 ? 48.056 3.260   -2.506  1.00 0.00  ? 48  LEU A HB3  4  
ATOM   5904  H  HG   . LEU A 1 48 ? 47.565 5.839   -2.970  1.00 0.00  ? 48  LEU A HG   4  
ATOM   5905  H  HD11 . LEU A 1 48 ? 45.103 5.142   -2.087  1.00 0.00  ? 48  LEU A HD11 4  
ATOM   5906  H  HD12 . LEU A 1 48 ? 45.781 6.756   -1.868  1.00 0.00  ? 48  LEU A HD12 4  
ATOM   5907  H  HD13 . LEU A 1 48 ? 45.857 5.582   -0.553  1.00 0.00  ? 48  LEU A HD13 4  
ATOM   5908  H  HD21 . LEU A 1 48 ? 49.137 5.851   -1.360  1.00 0.00  ? 48  LEU A HD21 4  
ATOM   5909  H  HD22 . LEU A 1 48 ? 48.601 4.278   -0.769  1.00 0.00  ? 48  LEU A HD22 4  
ATOM   5910  H  HD23 . LEU A 1 48 ? 47.850 5.752   -0.159  1.00 0.00  ? 48  LEU A HD23 4  
ATOM   5911  N  N    . GLY A 1 49 ? 48.910 4.237   -5.077  1.00 0.00  ? 49  GLY A N    4  
ATOM   5912  C  CA   . GLY A 1 49 ? 49.879 5.058   -5.864  1.00 0.00  ? 49  GLY A CA   4  
ATOM   5913  C  C    . GLY A 1 49 ? 49.963 4.539   -7.298  1.00 0.00  ? 49  GLY A C    4  
ATOM   5914  O  O    . GLY A 1 49 ? 50.597 3.540   -7.567  1.00 0.00  ? 49  GLY A O    4  
ATOM   5915  H  H    . GLY A 1 49 ? 49.210 3.410   -4.655  1.00 0.00  ? 49  GLY A H    4  
ATOM   5916  H  HA2  . GLY A 1 49 ? 49.548 6.089   -5.874  1.00 0.00  ? 49  GLY A HA2  4  
ATOM   5917  H  HA3  . GLY A 1 49 ? 50.858 4.995   -5.407  1.00 0.00  ? 49  GLY A HA3  4  
ATOM   5918  N  N    . GLN A 1 50 ? 49.324 5.216   -8.215  1.00 0.00  ? 50  GLN A N    4  
ATOM   5919  C  CA   . GLN A 1 50 ? 49.345 4.785   -9.654  1.00 0.00  ? 50  GLN A CA   4  
ATOM   5920  C  C    . GLN A 1 50 ? 50.768 4.427   -10.122 1.00 0.00  ? 50  GLN A C    4  
ATOM   5921  O  O    . GLN A 1 50 ? 51.739 5.052   -9.738  1.00 0.00  ? 50  GLN A O    4  
ATOM   5922  C  CB   . GLN A 1 50 ? 48.812 5.990   -10.440 1.00 0.00  ? 50  GLN A CB   4  
ATOM   5923  C  CG   . GLN A 1 50 ? 49.584 7.255   -10.042 1.00 0.00  ? 50  GLN A CG   4  
ATOM   5924  C  CD   . GLN A 1 50 ? 50.567 7.645   -11.151 1.00 0.00  ? 50  GLN A CD   4  
ATOM   5925  O  OE1  . GLN A 1 50 ? 50.165 8.094   -12.205 1.00 0.00  ? 50  GLN A OE1  4  
ATOM   5926  N  NE2  . GLN A 1 50 ? 51.847 7.498   -10.954 1.00 0.00  ? 50  GLN A NE2  4  
ATOM   5927  H  H    . GLN A 1 50 ? 48.821 6.017   -7.956  1.00 0.00  ? 50  GLN A H    4  
ATOM   5928  H  HA   . GLN A 1 50 ? 48.688 3.944   -9.797  1.00 0.00  ? 50  GLN A HA   4  
ATOM   5929  H  HB2  . GLN A 1 50 ? 48.932 5.810   -11.498 1.00 0.00  ? 50  GLN A HB2  4  
ATOM   5930  H  HB3  . GLN A 1 50 ? 47.764 6.127   -10.216 1.00 0.00  ? 50  GLN A HB3  4  
ATOM   5931  H  HG2  . GLN A 1 50 ? 48.888 8.063   -9.880  1.00 0.00  ? 50  GLN A HG2  4  
ATOM   5932  H  HG3  . GLN A 1 50 ? 50.131 7.064   -9.131  1.00 0.00  ? 50  GLN A HG3  4  
ATOM   5933  H  HE21 . GLN A 1 50 ? 52.175 7.139   -10.102 1.00 0.00  ? 50  GLN A HE21 4  
ATOM   5934  H  HE22 . GLN A 1 50 ? 52.482 7.743   -11.658 1.00 0.00  ? 50  GLN A HE22 4  
ATOM   5935  N  N    . ASN A 1 51 ? 50.885 3.427   -10.961 1.00 0.00  ? 51  ASN A N    4  
ATOM   5936  C  CA   . ASN A 1 51 ? 52.228 3.012   -11.482 1.00 0.00  ? 51  ASN A CA   4  
ATOM   5937  C  C    . ASN A 1 51 ? 52.172 2.882   -13.015 1.00 0.00  ? 51  ASN A C    4  
ATOM   5938  O  O    . ASN A 1 51 ? 51.820 1.842   -13.539 1.00 0.00  ? 51  ASN A O    4  
ATOM   5939  C  CB   . ASN A 1 51 ? 52.539 1.656   -10.820 1.00 0.00  ? 51  ASN A CB   4  
ATOM   5940  C  CG   . ASN A 1 51 ? 51.288 0.768   -10.781 1.00 0.00  ? 51  ASN A CG   4  
ATOM   5941  O  OD1  . ASN A 1 51 ? 50.472 0.888   -9.891  1.00 0.00  ? 51  ASN A OD1  4  
ATOM   5942  N  ND2  . ASN A 1 51 ? 51.104 -0.126  -11.711 1.00 0.00  ? 51  ASN A ND2  4  
ATOM   5943  H  H    . ASN A 1 51 ? 50.082 2.948   -11.257 1.00 0.00  ? 51  ASN A H    4  
ATOM   5944  H  HA   . ASN A 1 51 ? 52.977 3.736   -11.199 1.00 0.00  ? 51  ASN A HA   4  
ATOM   5945  H  HB2  . ASN A 1 51 ? 53.313 1.154   -11.383 1.00 0.00  ? 51  ASN A HB2  4  
ATOM   5946  H  HB3  . ASN A 1 51 ? 52.887 1.825   -9.811  1.00 0.00  ? 51  ASN A HB3  4  
ATOM   5947  H  HD21 . ASN A 1 51 ? 51.761 -0.229  -12.431 1.00 0.00  ? 51  ASN A HD21 4  
ATOM   5948  H  HD22 . ASN A 1 51 ? 50.308 -0.696  -11.691 1.00 0.00  ? 51  ASN A HD22 4  
ATOM   5949  N  N    . PRO A 1 52 ? 52.515 3.958   -13.686 1.00 0.00  ? 52  PRO A N    4  
ATOM   5950  C  CA   . PRO A 1 52 ? 52.492 3.973   -15.177 1.00 0.00  ? 52  PRO A CA   4  
ATOM   5951  C  C    . PRO A 1 52 ? 53.608 3.094   -15.764 1.00 0.00  ? 52  PRO A C    4  
ATOM   5952  O  O    . PRO A 1 52 ? 53.413 2.419   -16.757 1.00 0.00  ? 52  PRO A O    4  
ATOM   5953  C  CB   . PRO A 1 52 ? 52.717 5.444   -15.522 1.00 0.00  ? 52  PRO A CB   4  
ATOM   5954  C  CG   . PRO A 1 52 ? 53.430 6.013   -14.337 1.00 0.00  ? 52  PRO A CG   4  
ATOM   5955  C  CD   . PRO A 1 52 ? 52.951 5.248   -13.133 1.00 0.00  ? 52  PRO A CD   4  
ATOM   5956  H  HA   . PRO A 1 52 ? 51.530 3.655   -15.543 1.00 0.00  ? 52  PRO A HA   4  
ATOM   5957  H  HB2  . PRO A 1 52 ? 53.326 5.532   -16.411 1.00 0.00  ? 52  PRO A HB2  4  
ATOM   5958  H  HB3  . PRO A 1 52 ? 51.772 5.946   -15.661 1.00 0.00  ? 52  PRO A HB3  4  
ATOM   5959  H  HG2  . PRO A 1 52 ? 54.499 5.891   -14.455 1.00 0.00  ? 52  PRO A HG2  4  
ATOM   5960  H  HG3  . PRO A 1 52 ? 53.187 7.059   -14.225 1.00 0.00  ? 52  PRO A HG3  4  
ATOM   5961  H  HD2  . PRO A 1 52 ? 53.760 5.110   -12.425 1.00 0.00  ? 52  PRO A HD2  4  
ATOM   5962  H  HD3  . PRO A 1 52 ? 52.119 5.754   -12.668 1.00 0.00  ? 52  PRO A HD3  4  
ATOM   5963  N  N    . THR A 1 53 ? 54.772 3.099   -15.165 1.00 0.00  ? 53  THR A N    4  
ATOM   5964  C  CA   . THR A 1 53 ? 55.897 2.264   -15.695 1.00 0.00  ? 53  THR A CA   4  
ATOM   5965  C  C    . THR A 1 53 ? 56.755 1.729   -14.543 1.00 0.00  ? 53  THR A C    4  
ATOM   5966  O  O    . THR A 1 53 ? 56.821 2.330   -13.487 1.00 0.00  ? 53  THR A O    4  
ATOM   5967  C  CB   . THR A 1 53 ? 56.723 3.193   -16.607 1.00 0.00  ? 53  THR A CB   4  
ATOM   5968  O  OG1  . THR A 1 53 ? 58.036 2.670   -16.757 1.00 0.00  ? 53  THR A OG1  4  
ATOM   5969  C  CG2  . THR A 1 53 ? 56.811 4.600   -16.005 1.00 0.00  ? 53  THR A CG2  4  
ATOM   5970  H  H    . THR A 1 53 ? 54.909 3.652   -14.367 1.00 0.00  ? 53  THR A H    4  
ATOM   5971  H  HA   . THR A 1 53 ? 55.505 1.443   -16.274 1.00 0.00  ? 53  THR A HA   4  
ATOM   5972  H  HB   . THR A 1 53 ? 56.252 3.248   -17.574 1.00 0.00  ? 53  THR A HB   4  
ATOM   5973  H  HG1  . THR A 1 53 ? 58.414 3.036   -17.562 1.00 0.00  ? 53  THR A HG1  4  
ATOM   5974  H  HG21 . THR A 1 53 ? 57.620 5.142   -16.473 1.00 0.00  ? 53  THR A HG21 4  
ATOM   5975  H  HG22 . THR A 1 53 ? 56.995 4.526   -14.943 1.00 0.00  ? 53  THR A HG22 4  
ATOM   5976  H  HG23 . THR A 1 53 ? 55.882 5.122   -16.175 1.00 0.00  ? 53  THR A HG23 4  
ATOM   5977  N  N    . PRO A 1 54 ? 57.392 0.609   -14.794 1.00 0.00  ? 54  PRO A N    4  
ATOM   5978  C  CA   . PRO A 1 54 ? 58.268 -0.023  -13.771 1.00 0.00  ? 54  PRO A CA   4  
ATOM   5979  C  C    . PRO A 1 54 ? 59.518 0.836   -13.530 1.00 0.00  ? 54  PRO A C    4  
ATOM   5980  O  O    . PRO A 1 54 ? 60.035 0.896   -12.429 1.00 0.00  ? 54  PRO A O    4  
ATOM   5981  C  CB   . PRO A 1 54 ? 58.632 -1.370  -14.397 1.00 0.00  ? 54  PRO A CB   4  
ATOM   5982  C  CG   . PRO A 1 54 ? 58.476 -1.162  -15.869 1.00 0.00  ? 54  PRO A CG   4  
ATOM   5983  C  CD   . PRO A 1 54 ? 57.363 -0.163  -16.044 1.00 0.00  ? 54  PRO A CD   4  
ATOM   5984  H  HA   . PRO A 1 54 ? 57.729 -0.177  -12.850 1.00 0.00  ? 54  PRO A HA   4  
ATOM   5985  H  HB2  . PRO A 1 54 ? 59.654 -1.631  -14.156 1.00 0.00  ? 54  PRO A HB2  4  
ATOM   5986  H  HB3  . PRO A 1 54 ? 57.955 -2.139  -14.058 1.00 0.00  ? 54  PRO A HB3  4  
ATOM   5987  H  HG2  . PRO A 1 54 ? 59.395 -0.775  -16.288 1.00 0.00  ? 54  PRO A HG2  4  
ATOM   5988  H  HG3  . PRO A 1 54 ? 58.211 -2.091  -16.350 1.00 0.00  ? 54  PRO A HG3  4  
ATOM   5989  H  HD2  . PRO A 1 54 ? 57.554 0.479   -16.896 1.00 0.00  ? 54  PRO A HD2  4  
ATOM   5990  H  HD3  . PRO A 1 54 ? 56.414 -0.664  -16.150 1.00 0.00  ? 54  PRO A HD3  4  
ATOM   5991  N  N    . GLU A 1 55 ? 59.996 1.509   -14.552 1.00 0.00  ? 55  GLU A N    4  
ATOM   5992  C  CA   . GLU A 1 55 ? 61.205 2.378   -14.392 1.00 0.00  ? 55  GLU A CA   4  
ATOM   5993  C  C    . GLU A 1 55 ? 60.930 3.489   -13.370 1.00 0.00  ? 55  GLU A C    4  
ATOM   5994  O  O    . GLU A 1 55 ? 61.810 3.890   -12.632 1.00 0.00  ? 55  GLU A O    4  
ATOM   5995  C  CB   . GLU A 1 55 ? 61.461 2.975   -15.781 1.00 0.00  ? 55  GLU A CB   4  
ATOM   5996  C  CG   . GLU A 1 55 ? 61.968 1.886   -16.739 1.00 0.00  ? 55  GLU A CG   4  
ATOM   5997  C  CD   . GLU A 1 55 ? 63.179 1.170   -16.130 1.00 0.00  ? 55  GLU A CD   4  
ATOM   5998  O  OE1  . GLU A 1 55 ? 64.256 1.742   -16.154 1.00 0.00  ? 55  GLU A OE1  4  
ATOM   5999  O  OE2  . GLU A 1 55 ? 63.005 0.062   -15.650 1.00 0.00  ? 55  GLU A OE2  4  
ATOM   6000  H  H    . GLU A 1 55 ? 59.554 1.448   -15.424 1.00 0.00  ? 55  GLU A H    4  
ATOM   6001  H  HA   . GLU A 1 55 ? 62.053 1.787   -14.084 1.00 0.00  ? 55  GLU A HA   4  
ATOM   6002  H  HB2  . GLU A 1 55 ? 60.541 3.390   -16.166 1.00 0.00  ? 55  GLU A HB2  4  
ATOM   6003  H  HB3  . GLU A 1 55 ? 62.202 3.757   -15.704 1.00 0.00  ? 55  GLU A HB3  4  
ATOM   6004  H  HG2  . GLU A 1 55 ? 61.181 1.169   -16.918 1.00 0.00  ? 55  GLU A HG2  4  
ATOM   6005  H  HG3  . GLU A 1 55 ? 62.258 2.340   -17.675 1.00 0.00  ? 55  GLU A HG3  4  
ATOM   6006  N  N    . GLU A 1 56 ? 59.708 3.975   -13.311 1.00 0.00  ? 56  GLU A N    4  
ATOM   6007  C  CA   . GLU A 1 56 ? 59.365 5.047   -12.323 1.00 0.00  ? 56  GLU A CA   4  
ATOM   6008  C  C    . GLU A 1 56 ? 59.690 4.562   -10.904 1.00 0.00  ? 56  GLU A C    4  
ATOM   6009  O  O    . GLU A 1 56 ? 60.275 5.279   -10.114 1.00 0.00  ? 56  GLU A O    4  
ATOM   6010  C  CB   . GLU A 1 56 ? 57.858 5.277   -12.491 1.00 0.00  ? 56  GLU A CB   4  
ATOM   6011  C  CG   . GLU A 1 56 ? 57.385 6.377   -11.531 1.00 0.00  ? 56  GLU A CG   4  
ATOM   6012  C  CD   . GLU A 1 56 ? 55.874 6.255   -11.310 1.00 0.00  ? 56  GLU A CD   4  
ATOM   6013  O  OE1  . GLU A 1 56 ? 55.457 5.274   -10.716 1.00 0.00  ? 56  GLU A OE1  4  
ATOM   6014  O  OE2  . GLU A 1 56 ? 55.160 7.147   -11.737 1.00 0.00  ? 56  GLU A OE2  4  
ATOM   6015  H  H    . GLU A 1 56 ? 59.014 3.623   -13.909 1.00 0.00  ? 56  GLU A H    4  
ATOM   6016  H  HA   . GLU A 1 56 ? 59.906 5.953   -12.546 1.00 0.00  ? 56  GLU A HA   4  
ATOM   6017  H  HB2  . GLU A 1 56 ? 57.654 5.577   -13.508 1.00 0.00  ? 56  GLU A HB2  4  
ATOM   6018  H  HB3  . GLU A 1 56 ? 57.329 4.361   -12.273 1.00 0.00  ? 56  GLU A HB3  4  
ATOM   6019  H  HG2  . GLU A 1 56 ? 57.896 6.277   -10.585 1.00 0.00  ? 56  GLU A HG2  4  
ATOM   6020  H  HG3  . GLU A 1 56 ? 57.605 7.344   -11.957 1.00 0.00  ? 56  GLU A HG3  4  
ATOM   6021  N  N    . LEU A 1 57 ? 59.334 3.339   -10.587 1.00 0.00  ? 57  LEU A N    4  
ATOM   6022  C  CA   . LEU A 1 57 ? 59.641 2.795   -9.229  1.00 0.00  ? 57  LEU A CA   4  
ATOM   6023  C  C    . LEU A 1 57 ? 61.121 2.404   -9.150  1.00 0.00  ? 57  LEU A C    4  
ATOM   6024  O  O    . LEU A 1 57 ? 61.734 2.492   -8.103  1.00 0.00  ? 57  LEU A O    4  
ATOM   6025  C  CB   . LEU A 1 57 ? 58.755 1.557   -9.054  1.00 0.00  ? 57  LEU A CB   4  
ATOM   6026  C  CG   . LEU A 1 57 ? 57.260 1.931   -9.048  1.00 0.00  ? 57  LEU A CG   4  
ATOM   6027  C  CD1  . LEU A 1 57 ? 57.058 3.357   -8.528  1.00 0.00  ? 57  LEU A CD1  4  
ATOM   6028  C  CD2  . LEU A 1 57 ? 56.698 1.825   -10.468 1.00 0.00  ? 57  LEU A CD2  4  
ATOM   6029  H  H    . LEU A 1 57 ? 58.879 2.776   -11.247 1.00 0.00  ? 57  LEU A H    4  
ATOM   6030  H  HA   . LEU A 1 57 ? 59.408 3.527   -8.471  1.00 0.00  ? 57  LEU A HA   4  
ATOM   6031  H  HB2  . LEU A 1 57 ? 58.945 0.868   -9.863  1.00 0.00  ? 57  LEU A HB2  4  
ATOM   6032  H  HB3  . LEU A 1 57 ? 59.005 1.083   -8.117  1.00 0.00  ? 57  LEU A HB3  4  
ATOM   6033  H  HG   . LEU A 1 57 ? 56.729 1.245   -8.406  1.00 0.00  ? 57  LEU A HG   4  
ATOM   6034  H  HD11 . LEU A 1 57 ? 56.004 3.542   -8.386  1.00 0.00  ? 57  LEU A HD11 4  
ATOM   6035  H  HD12 . LEU A 1 57 ? 57.452 4.062   -9.247  1.00 0.00  ? 57  LEU A HD12 4  
ATOM   6036  H  HD13 . LEU A 1 57 ? 57.575 3.475   -7.588  1.00 0.00  ? 57  LEU A HD13 4  
ATOM   6037  H  HD21 . LEU A 1 57 ? 55.633 1.655   -10.421 1.00 0.00  ? 57  LEU A HD21 4  
ATOM   6038  H  HD22 . LEU A 1 57 ? 57.171 1.002   -10.983 1.00 0.00  ? 57  LEU A HD22 4  
ATOM   6039  H  HD23 . LEU A 1 57 ? 56.891 2.745   -11.001 1.00 0.00  ? 57  LEU A HD23 4  
ATOM   6040  N  N    . GLN A 1 58 ? 61.705 1.983   -10.252 1.00 0.00  ? 58  GLN A N    4  
ATOM   6041  C  CA   . GLN A 1 58 ? 63.153 1.608   -10.237 1.00 0.00  ? 58  GLN A CA   4  
ATOM   6042  C  C    . GLN A 1 58 ? 63.967 2.782   -9.683  1.00 0.00  ? 58  GLN A C    4  
ATOM   6043  O  O    . GLN A 1 58 ? 64.757 2.626   -8.772  1.00 0.00  ? 58  GLN A O    4  
ATOM   6044  C  CB   . GLN A 1 58 ? 63.515 1.331   -11.702 1.00 0.00  ? 58  GLN A CB   4  
ATOM   6045  C  CG   . GLN A 1 58 ? 64.267 0.002   -11.799 1.00 0.00  ? 58  GLN A CG   4  
ATOM   6046  C  CD   . GLN A 1 58 ? 65.695 0.185   -11.282 1.00 0.00  ? 58  GLN A CD   4  
ATOM   6047  O  OE1  . GLN A 1 58 ? 66.581 0.548   -12.027 1.00 0.00  ? 58  GLN A OE1  4  
ATOM   6048  N  NE2  . GLN A 1 58 ? 65.958 -0.052  -10.027 1.00 0.00  ? 58  GLN A NE2  4  
ATOM   6049  H  H    . GLN A 1 58 ? 61.195 1.925   -11.087 1.00 0.00  ? 58  GLN A H    4  
ATOM   6050  H  HA   . GLN A 1 58 ? 63.308 0.724   -9.639  1.00 0.00  ? 58  GLN A HA   4  
ATOM   6051  H  HB2  . GLN A 1 58 ? 62.611 1.277   -12.292 1.00 0.00  ? 58  GLN A HB2  4  
ATOM   6052  H  HB3  . GLN A 1 58 ? 64.142 2.126   -12.077 1.00 0.00  ? 58  GLN A HB3  4  
ATOM   6053  H  HG2  . GLN A 1 58 ? 63.758 -0.741  -11.202 1.00 0.00  ? 58  GLN A HG2  4  
ATOM   6054  H  HG3  . GLN A 1 58 ? 64.297 -0.320  -12.828 1.00 0.00  ? 58  GLN A HG3  4  
ATOM   6055  H  HE21 . GLN A 1 58 ? 65.245 -0.345  -9.423  1.00 0.00  ? 58  GLN A HE21 4  
ATOM   6056  H  HE22 . GLN A 1 58 ? 66.869 0.073   -9.686  1.00 0.00  ? 58  GLN A HE22 4  
ATOM   6057  N  N    . GLU A 1 59 ? 63.745 3.964   -10.209 1.00 0.00  ? 59  GLU A N    4  
ATOM   6058  C  CA   . GLU A 1 59 ? 64.468 5.170   -9.697  1.00 0.00  ? 59  GLU A CA   4  
ATOM   6059  C  C    . GLU A 1 59 ? 64.038 5.447   -8.249  1.00 0.00  ? 59  GLU A C    4  
ATOM   6060  O  O    . GLU A 1 59 ? 64.826 5.883   -7.432  1.00 0.00  ? 59  GLU A O    4  
ATOM   6061  C  CB   . GLU A 1 59 ? 64.033 6.318   -10.613 1.00 0.00  ? 59  GLU A CB   4  
ATOM   6062  C  CG   . GLU A 1 59 ? 65.154 6.644   -11.603 1.00 0.00  ? 59  GLU A CG   4  
ATOM   6063  C  CD   . GLU A 1 59 ? 64.670 7.710   -12.588 1.00 0.00  ? 59  GLU A CD   4  
ATOM   6064  O  OE1  . GLU A 1 59 ? 64.092 7.338   -13.596 1.00 0.00  ? 59  GLU A OE1  4  
ATOM   6065  O  OE2  . GLU A 1 59 ? 64.885 8.880   -12.317 1.00 0.00  ? 59  GLU A OE2  4  
ATOM   6066  H  H    . GLU A 1 59 ? 63.081 4.060   -10.925 1.00 0.00  ? 59  GLU A H    4  
ATOM   6067  H  HA   . GLU A 1 59 ? 65.537 5.028   -9.756  1.00 0.00  ? 59  GLU A HA   4  
ATOM   6068  H  HB2  . GLU A 1 59 ? 63.145 6.030   -11.158 1.00 0.00  ? 59  GLU A HB2  4  
ATOM   6069  H  HB3  . GLU A 1 59 ? 63.819 7.192   -10.016 1.00 0.00  ? 59  GLU A HB3  4  
ATOM   6070  H  HG2  . GLU A 1 59 ? 66.014 7.016   -11.065 1.00 0.00  ? 59  GLU A HG2  4  
ATOM   6071  H  HG3  . GLU A 1 59 ? 65.427 5.752   -12.147 1.00 0.00  ? 59  GLU A HG3  4  
ATOM   6072  N  N    . MET A 1 60 ? 62.788 5.184   -7.931  1.00 0.00  ? 60  MET A N    4  
ATOM   6073  C  CA   . MET A 1 60 ? 62.288 5.413   -6.538  1.00 0.00  ? 60  MET A CA   4  
ATOM   6074  C  C    . MET A 1 60 ? 63.090 4.560   -5.543  1.00 0.00  ? 60  MET A C    4  
ATOM   6075  O  O    . MET A 1 60 ? 63.538 5.048   -4.522  1.00 0.00  ? 60  MET A O    4  
ATOM   6076  C  CB   . MET A 1 60 ? 60.812 4.982   -6.559  1.00 0.00  ? 60  MET A CB   4  
ATOM   6077  C  CG   . MET A 1 60 ? 59.967 6.073   -7.223  1.00 0.00  ? 60  MET A CG   4  
ATOM   6078  S  SD   . MET A 1 60 ? 59.150 7.066   -5.950  1.00 0.00  ? 60  MET A SD   4  
ATOM   6079  C  CE   . MET A 1 60 ? 57.478 6.420   -6.200  1.00 0.00  ? 60  MET A CE   4  
ATOM   6080  H  H    . MET A 1 60 ? 62.180 4.827   -8.612  1.00 0.00  ? 60  MET A H    4  
ATOM   6081  H  HA   . MET A 1 60 ? 62.363 6.458   -6.279  1.00 0.00  ? 60  MET A HA   4  
ATOM   6082  H  HB2  . MET A 1 60 ? 60.708 4.059   -7.114  1.00 0.00  ? 60  MET A HB2  4  
ATOM   6083  H  HB3  . MET A 1 60 ? 60.467 4.831   -5.546  1.00 0.00  ? 60  MET A HB3  4  
ATOM   6084  H  HG2  . MET A 1 60 ? 60.603 6.709   -7.821  1.00 0.00  ? 60  MET A HG2  4  
ATOM   6085  H  HG3  . MET A 1 60 ? 59.221 5.615   -7.856  1.00 0.00  ? 60  MET A HG3  4  
ATOM   6086  H  HE1  . MET A 1 60 ? 56.782 6.979   -5.591  1.00 0.00  ? 60  MET A HE1  4  
ATOM   6087  H  HE2  . MET A 1 60 ? 57.446 5.381   -5.915  1.00 0.00  ? 60  MET A HE2  4  
ATOM   6088  H  HE3  . MET A 1 60 ? 57.209 6.514   -7.243  1.00 0.00  ? 60  MET A HE3  4  
ATOM   6089  N  N    . ILE A 1 61 ? 63.285 3.296   -5.838  1.00 0.00  ? 61  ILE A N    4  
ATOM   6090  C  CA   . ILE A 1 61 ? 64.071 2.422   -4.909  1.00 0.00  ? 61  ILE A CA   4  
ATOM   6091  C  C    . ILE A 1 61 ? 65.562 2.780   -4.985  1.00 0.00  ? 61  ILE A C    4  
ATOM   6092  O  O    . ILE A 1 61 ? 66.233 2.859   -3.974  1.00 0.00  ? 61  ILE A O    4  
ATOM   6093  C  CB   . ILE A 1 61 ? 63.820 0.983   -5.379  1.00 0.00  ? 61  ILE A CB   4  
ATOM   6094  C  CG1  . ILE A 1 61 ? 62.367 0.601   -5.060  1.00 0.00  ? 61  ILE A CG1  4  
ATOM   6095  C  CG2  . ILE A 1 61 ? 64.780 0.037   -4.645  1.00 0.00  ? 61  ILE A CG2  4  
ATOM   6096  C  CD1  . ILE A 1 61 ? 62.067 -0.822  -5.560  1.00 0.00  ? 61  ILE A CD1  4  
ATOM   6097  H  H    . ILE A 1 61 ? 62.922 2.926   -6.670  1.00 0.00  ? 61  ILE A H    4  
ATOM   6098  H  HA   . ILE A 1 61 ? 63.713 2.543   -3.898  1.00 0.00  ? 61  ILE A HA   4  
ATOM   6099  H  HB   . ILE A 1 61 ? 63.990 0.915   -6.445  1.00 0.00  ? 61  ILE A HB   4  
ATOM   6100  H  HG12 . ILE A 1 61 ? 62.212 0.649   -3.991  1.00 0.00  ? 61  ILE A HG12 4  
ATOM   6101  H  HG13 . ILE A 1 61 ? 61.701 1.299   -5.547  1.00 0.00  ? 61  ILE A HG13 4  
ATOM   6102  H  HG21 . ILE A 1 61 ? 64.467 -0.985  -4.791  1.00 0.00  ? 61  ILE A HG21 4  
ATOM   6103  H  HG22 . ILE A 1 61 ? 64.775 0.266   -3.590  1.00 0.00  ? 61  ILE A HG22 4  
ATOM   6104  H  HG23 . ILE A 1 61 ? 65.779 0.165   -5.036  1.00 0.00  ? 61  ILE A HG23 4  
ATOM   6105  H  HD11 . ILE A 1 61 ? 62.289 -1.536  -4.778  1.00 0.00  ? 61  ILE A HD11 4  
ATOM   6106  H  HD12 . ILE A 1 61 ? 62.675 -1.037  -6.426  1.00 0.00  ? 61  ILE A HD12 4  
ATOM   6107  H  HD13 . ILE A 1 61 ? 61.022 -0.897  -5.827  1.00 0.00  ? 61  ILE A HD13 4  
ATOM   6108  N  N    . ASP A 1 62 ? 66.083 3.011   -6.171  1.00 0.00  ? 62  ASP A N    4  
ATOM   6109  C  CA   . ASP A 1 62 ? 67.531 3.383   -6.300  1.00 0.00  ? 62  ASP A CA   4  
ATOM   6110  C  C    . ASP A 1 62 ? 67.830 4.646   -5.478  1.00 0.00  ? 62  ASP A C    4  
ATOM   6111  O  O    . ASP A 1 62 ? 68.914 4.813   -4.955  1.00 0.00  ? 62  ASP A O    4  
ATOM   6112  C  CB   . ASP A 1 62 ? 67.756 3.642   -7.793  1.00 0.00  ? 62  ASP A CB   4  
ATOM   6113  C  CG   . ASP A 1 62 ? 68.433 2.426   -8.428  1.00 0.00  ? 62  ASP A CG   4  
ATOM   6114  O  OD1  . ASP A 1 62 ? 67.845 1.358   -8.391  1.00 0.00  ? 62  ASP A OD1  4  
ATOM   6115  O  OD2  . ASP A 1 62 ? 69.529 2.582   -8.938  1.00 0.00  ? 62  ASP A OD2  4  
ATOM   6116  H  H    . ASP A 1 62 ? 65.521 2.951   -6.972  1.00 0.00  ? 62  ASP A H    4  
ATOM   6117  H  HA   . ASP A 1 62 ? 68.157 2.567   -5.970  1.00 0.00  ? 62  ASP A HA   4  
ATOM   6118  H  HB2  . ASP A 1 62 ? 66.808 3.821   -8.276  1.00 0.00  ? 62  ASP A HB2  4  
ATOM   6119  H  HB3  . ASP A 1 62 ? 68.391 4.506   -7.914  1.00 0.00  ? 62  ASP A HB3  4  
ATOM   6120  N  N    . GLU A 1 63 ? 66.868 5.528   -5.344  1.00 0.00  ? 63  GLU A N    4  
ATOM   6121  C  CA   . GLU A 1 63 ? 67.089 6.764   -4.531  1.00 0.00  ? 63  GLU A CA   4  
ATOM   6122  C  C    . GLU A 1 63 ? 67.281 6.379   -3.055  1.00 0.00  ? 63  GLU A C    4  
ATOM   6123  O  O    . GLU A 1 63 ? 68.024 7.012   -2.329  1.00 0.00  ? 63  GLU A O    4  
ATOM   6124  C  CB   . GLU A 1 63 ? 65.816 7.595   -4.716  1.00 0.00  ? 63  GLU A CB   4  
ATOM   6125  C  CG   . GLU A 1 63 ? 65.995 8.972   -4.065  1.00 0.00  ? 63  GLU A CG   4  
ATOM   6126  C  CD   . GLU A 1 63 ? 64.763 9.302   -3.221  1.00 0.00  ? 63  GLU A CD   4  
ATOM   6127  O  OE1  . GLU A 1 63 ? 64.761 8.954   -2.053  1.00 0.00  ? 63  GLU A OE1  4  
ATOM   6128  O  OE2  . GLU A 1 63 ? 63.842 9.895   -3.756  1.00 0.00  ? 63  GLU A OE2  4  
ATOM   6129  H  H    . GLU A 1 63 ? 65.996 5.369   -5.763  1.00 0.00  ? 63  GLU A H    4  
ATOM   6130  H  HA   . GLU A 1 63 ? 67.947 7.308   -4.895  1.00 0.00  ? 63  GLU A HA   4  
ATOM   6131  H  HB2  . GLU A 1 63 ? 65.620 7.720   -5.772  1.00 0.00  ? 63  GLU A HB2  4  
ATOM   6132  H  HB3  . GLU A 1 63 ? 64.984 7.086   -4.254  1.00 0.00  ? 63  GLU A HB3  4  
ATOM   6133  H  HG2  . GLU A 1 63 ? 66.871 8.962   -3.433  1.00 0.00  ? 63  GLU A HG2  4  
ATOM   6134  H  HG3  . GLU A 1 63 ? 66.113 9.721   -4.832  1.00 0.00  ? 63  GLU A HG3  4  
ATOM   6135  N  N    . VAL A 1 64 ? 66.618 5.334   -2.617  1.00 0.00  ? 64  VAL A N    4  
ATOM   6136  C  CA   . VAL A 1 64 ? 66.756 4.882   -1.199  1.00 0.00  ? 64  VAL A CA   4  
ATOM   6137  C  C    . VAL A 1 64 ? 67.991 3.979   -1.040  1.00 0.00  ? 64  VAL A C    4  
ATOM   6138  O  O    . VAL A 1 64 ? 68.669 4.029   -0.031  1.00 0.00  ? 64  VAL A O    4  
ATOM   6139  C  CB   . VAL A 1 64 ? 65.471 4.094   -0.900  1.00 0.00  ? 64  VAL A CB   4  
ATOM   6140  C  CG1  . VAL A 1 64 ? 65.618 3.346   0.430   1.00 0.00  ? 64  VAL A CG1  4  
ATOM   6141  C  CG2  . VAL A 1 64 ? 64.285 5.058   -0.805  1.00 0.00  ? 64  VAL A CG2  4  
ATOM   6142  H  H    . VAL A 1 64 ? 66.032 4.840   -3.227  1.00 0.00  ? 64  VAL A H    4  
ATOM   6143  H  HA   . VAL A 1 64 ? 66.826 5.732   -0.538  1.00 0.00  ? 64  VAL A HA   4  
ATOM   6144  H  HB   . VAL A 1 64 ? 65.295 3.382   -1.694  1.00 0.00  ? 64  VAL A HB   4  
ATOM   6145  H  HG11 . VAL A 1 64 ? 66.271 3.903   1.087   1.00 0.00  ? 64  VAL A HG11 4  
ATOM   6146  H  HG12 . VAL A 1 64 ? 66.039 2.368   0.248   1.00 0.00  ? 64  VAL A HG12 4  
ATOM   6147  H  HG13 . VAL A 1 64 ? 64.647 3.240   0.893   1.00 0.00  ? 64  VAL A HG13 4  
ATOM   6148  H  HG21 . VAL A 1 64 ? 64.185 5.405   0.213   1.00 0.00  ? 64  VAL A HG21 4  
ATOM   6149  H  HG22 . VAL A 1 64 ? 63.381 4.544   -1.098  1.00 0.00  ? 64  VAL A HG22 4  
ATOM   6150  H  HG23 . VAL A 1 64 ? 64.449 5.901   -1.460  1.00 0.00  ? 64  VAL A HG23 4  
ATOM   6151  N  N    . ASP A 1 65 ? 68.286 3.148   -2.019  1.00 0.00  ? 65  ASP A N    4  
ATOM   6152  C  CA   . ASP A 1 65 ? 69.472 2.245   -1.893  1.00 0.00  ? 65  ASP A CA   4  
ATOM   6153  C  C    . ASP A 1 65 ? 70.401 2.346   -3.110  1.00 0.00  ? 65  ASP A C    4  
ATOM   6154  O  O    . ASP A 1 65 ? 69.971 2.515   -4.235  1.00 0.00  ? 65  ASP A O    4  
ATOM   6155  C  CB   . ASP A 1 65 ? 68.889 0.825   -1.742  1.00 0.00  ? 65  ASP A CB   4  
ATOM   6156  C  CG   . ASP A 1 65 ? 68.777 0.100   -3.097  1.00 0.00  ? 65  ASP A CG   4  
ATOM   6157  O  OD1  . ASP A 1 65 ? 69.801 -0.273  -3.653  1.00 0.00  ? 65  ASP A OD1  4  
ATOM   6158  O  OD2  . ASP A 1 65 ? 67.663 -0.128  -3.525  1.00 0.00  ? 65  ASP A OD2  4  
ATOM   6159  H  H    . ASP A 1 65 ? 67.726 3.113   -2.825  1.00 0.00  ? 65  ASP A H    4  
ATOM   6160  H  HA   . ASP A 1 65 ? 70.024 2.495   -1.000  1.00 0.00  ? 65  ASP A HA   4  
ATOM   6161  H  HB2  . ASP A 1 65 ? 69.527 0.251   -1.089  1.00 0.00  ? 65  ASP A HB2  4  
ATOM   6162  H  HB3  . ASP A 1 65 ? 67.906 0.895   -1.298  1.00 0.00  ? 65  ASP A HB3  4  
ATOM   6163  N  N    . GLU A 1 66 ? 71.677 2.203   -2.874  1.00 0.00  ? 66  GLU A N    4  
ATOM   6164  C  CA   . GLU A 1 66 ? 72.676 2.244   -3.980  1.00 0.00  ? 66  GLU A CA   4  
ATOM   6165  C  C    . GLU A 1 66 ? 73.735 1.166   -3.713  1.00 0.00  ? 66  GLU A C    4  
ATOM   6166  O  O    . GLU A 1 66 ? 74.926 1.403   -3.799  1.00 0.00  ? 66  GLU A O    4  
ATOM   6167  C  CB   . GLU A 1 66 ? 73.283 3.651   -3.929  1.00 0.00  ? 66  GLU A CB   4  
ATOM   6168  C  CG   . GLU A 1 66 ? 73.147 4.316   -5.303  1.00 0.00  ? 66  GLU A CG   4  
ATOM   6169  C  CD   . GLU A 1 66 ? 74.154 3.701   -6.279  1.00 0.00  ? 66  GLU A CD   4  
ATOM   6170  O  OE1  . GLU A 1 66 ? 73.844 2.667   -6.849  1.00 0.00  ? 66  GLU A OE1  4  
ATOM   6171  O  OE2  . GLU A 1 66 ? 75.217 4.277   -6.443  1.00 0.00  ? 66  GLU A OE2  4  
ATOM   6172  H  H    . GLU A 1 66 ? 71.981 2.044   -1.956  1.00 0.00  ? 66  GLU A H    4  
ATOM   6173  H  HA   . GLU A 1 66 ? 72.196 2.076   -4.932  1.00 0.00  ? 66  GLU A HA   4  
ATOM   6174  H  HB2  . GLU A 1 66 ? 72.762 4.242   -3.190  1.00 0.00  ? 66  GLU A HB2  4  
ATOM   6175  H  HB3  . GLU A 1 66 ? 74.328 3.584   -3.666  1.00 0.00  ? 66  GLU A HB3  4  
ATOM   6176  H  HG2  . GLU A 1 66 ? 72.145 4.164   -5.678  1.00 0.00  ? 66  GLU A HG2  4  
ATOM   6177  H  HG3  . GLU A 1 66 ? 73.340 5.374   -5.211  1.00 0.00  ? 66  GLU A HG3  4  
ATOM   6178  N  N    . ASP A 1 67 ? 73.292 -0.017  -3.369  1.00 0.00  ? 67  ASP A N    4  
ATOM   6179  C  CA   . ASP A 1 67 ? 74.242 -1.133  -3.061  1.00 0.00  ? 67  ASP A CA   4  
ATOM   6180  C  C    . ASP A 1 67 ? 74.298 -2.148  -4.216  1.00 0.00  ? 67  ASP A C    4  
ATOM   6181  O  O    . ASP A 1 67 ? 74.301 -3.346  -4.002  1.00 0.00  ? 67  ASP A O    4  
ATOM   6182  C  CB   . ASP A 1 67 ? 73.711 -1.784  -1.766  1.00 0.00  ? 67  ASP A CB   4  
ATOM   6183  C  CG   . ASP A 1 67 ? 72.182 -1.943  -1.809  1.00 0.00  ? 67  ASP A CG   4  
ATOM   6184  O  OD1  . ASP A 1 67 ? 71.719 -2.957  -2.300  1.00 0.00  ? 67  ASP A OD1  4  
ATOM   6185  O  OD2  . ASP A 1 67 ? 71.498 -1.047  -1.345  1.00 0.00  ? 67  ASP A OD2  4  
ATOM   6186  H  H    . ASP A 1 67 ? 72.327 -0.166  -3.298  1.00 0.00  ? 67  ASP A H    4  
ATOM   6187  H  HA   . ASP A 1 67 ? 75.227 -0.734  -2.883  1.00 0.00  ? 67  ASP A HA   4  
ATOM   6188  H  HB2  . ASP A 1 67 ? 74.163 -2.757  -1.646  1.00 0.00  ? 67  ASP A HB2  4  
ATOM   6189  H  HB3  . ASP A 1 67 ? 73.977 -1.164  -0.923  1.00 0.00  ? 67  ASP A HB3  4  
ATOM   6190  N  N    . GLY A 1 68 ? 74.361 -1.674  -5.439  1.00 0.00  ? 68  GLY A N    4  
ATOM   6191  C  CA   . GLY A 1 68 ? 74.435 -2.600  -6.616  1.00 0.00  ? 68  GLY A CA   4  
ATOM   6192  C  C    . GLY A 1 68 ? 73.240 -3.560  -6.617  1.00 0.00  ? 68  GLY A C    4  
ATOM   6193  O  O    . GLY A 1 68 ? 73.389 -4.743  -6.858  1.00 0.00  ? 68  GLY A O    4  
ATOM   6194  H  H    . GLY A 1 68 ? 74.372 -0.705  -5.584  1.00 0.00  ? 68  GLY A H    4  
ATOM   6195  H  HA2  . GLY A 1 68 ? 74.429 -2.021  -7.527  1.00 0.00  ? 68  GLY A HA2  4  
ATOM   6196  H  HA3  . GLY A 1 68 ? 75.348 -3.172  -6.562  1.00 0.00  ? 68  GLY A HA3  4  
ATOM   6197  N  N    . SER A 1 69 ? 72.059 -3.063  -6.352  1.00 0.00  ? 69  SER A N    4  
ATOM   6198  C  CA   . SER A 1 69 ? 70.855 -3.950  -6.339  1.00 0.00  ? 69  SER A CA   4  
ATOM   6199  C  C    . SER A 1 69 ? 69.620 -3.182  -6.834  1.00 0.00  ? 69  SER A C    4  
ATOM   6200  O  O    . SER A 1 69 ? 68.925 -3.631  -7.726  1.00 0.00  ? 69  SER A O    4  
ATOM   6201  C  CB   . SER A 1 69 ? 70.706 -4.395  -4.873  1.00 0.00  ? 69  SER A CB   4  
ATOM   6202  O  OG   . SER A 1 69 ? 69.424 -4.030  -4.364  1.00 0.00  ? 69  SER A OG   4  
ATOM   6203  H  H    . SER A 1 69 ? 71.964 -2.106  -6.162  1.00 0.00  ? 69  SER A H    4  
ATOM   6204  H  HA   . SER A 1 69 ? 71.025 -4.813  -6.965  1.00 0.00  ? 69  SER A HA   4  
ATOM   6205  H  HB2  . SER A 1 69 ? 70.813 -5.465  -4.813  1.00 0.00  ? 69  SER A HB2  4  
ATOM   6206  H  HB3  . SER A 1 69 ? 71.485 -3.932  -4.281  1.00 0.00  ? 69  SER A HB3  4  
ATOM   6207  H  HG   . SER A 1 69 ? 68.801 -4.721  -4.615  1.00 0.00  ? 69  SER A HG   4  
ATOM   6208  N  N    . GLY A 1 70 ? 69.339 -2.032  -6.266  1.00 0.00  ? 70  GLY A N    4  
ATOM   6209  C  CA   . GLY A 1 70 ? 68.144 -1.248  -6.710  1.00 0.00  ? 70  GLY A CA   4  
ATOM   6210  C  C    . GLY A 1 70 ? 66.855 -1.974  -6.291  1.00 0.00  ? 70  GLY A C    4  
ATOM   6211  O  O    . GLY A 1 70 ? 65.809 -1.786  -6.883  1.00 0.00  ? 70  GLY A O    4  
ATOM   6212  H  H    . GLY A 1 70 ? 69.910 -1.685  -5.544  1.00 0.00  ? 70  GLY A H    4  
ATOM   6213  H  HA2  . GLY A 1 70 ? 68.169 -0.267  -6.252  1.00 0.00  ? 70  GLY A HA2  4  
ATOM   6214  H  HA3  . GLY A 1 70 ? 68.160 -1.146  -7.787  1.00 0.00  ? 70  GLY A HA3  4  
ATOM   6215  N  N    . THR A 1 71 ? 66.927 -2.802  -5.275  1.00 0.00  ? 71  THR A N    4  
ATOM   6216  C  CA   . THR A 1 71 ? 65.715 -3.545  -4.800  1.00 0.00  ? 71  THR A CA   4  
ATOM   6217  C  C    . THR A 1 71 ? 65.494 -3.246  -3.314  1.00 0.00  ? 71  THR A C    4  
ATOM   6218  O  O    . THR A 1 71 ? 66.438 -3.183  -2.546  1.00 0.00  ? 71  THR A O    4  
ATOM   6219  C  CB   . THR A 1 71 ? 66.028 -5.039  -5.008  1.00 0.00  ? 71  THR A CB   4  
ATOM   6220  O  OG1  . THR A 1 71 ? 66.928 -5.210  -6.099  1.00 0.00  ? 71  THR A OG1  4  
ATOM   6221  C  CG2  . THR A 1 71 ? 64.732 -5.799  -5.298  1.00 0.00  ? 71  THR A CG2  4  
ATOM   6222  H  H    . THR A 1 71 ? 67.780 -2.931  -4.816  1.00 0.00  ? 71  THR A H    4  
ATOM   6223  H  HA   . THR A 1 71 ? 64.847 -3.263  -5.376  1.00 0.00  ? 71  THR A HA   4  
ATOM   6224  H  HB   . THR A 1 71 ? 66.475 -5.438  -4.110  1.00 0.00  ? 71  THR A HB   4  
ATOM   6225  H  HG1  . THR A 1 71 ? 66.545 -4.791  -6.876  1.00 0.00  ? 71  THR A HG1  4  
ATOM   6226  H  HG21 . THR A 1 71 ? 64.951 -6.850  -5.414  1.00 0.00  ? 71  THR A HG21 4  
ATOM   6227  H  HG22 . THR A 1 71 ? 64.288 -5.422  -6.206  1.00 0.00  ? 71  THR A HG22 4  
ATOM   6228  H  HG23 . THR A 1 71 ? 64.044 -5.664  -4.477  1.00 0.00  ? 71  THR A HG23 4  
ATOM   6229  N  N    . VAL A 1 72 ? 64.266 -3.043  -2.905  1.00 0.00  ? 72  VAL A N    4  
ATOM   6230  C  CA   . VAL A 1 72 ? 63.994 -2.724  -1.466  1.00 0.00  ? 72  VAL A CA   4  
ATOM   6231  C  C    . VAL A 1 72 ? 64.094 -3.977  -0.582  1.00 0.00  ? 72  VAL A C    4  
ATOM   6232  O  O    . VAL A 1 72 ? 63.440 -4.976  -0.824  1.00 0.00  ? 72  VAL A O    4  
ATOM   6233  C  CB   . VAL A 1 72 ? 62.563 -2.163  -1.440  1.00 0.00  ? 72  VAL A CB   4  
ATOM   6234  C  CG1  . VAL A 1 72 ? 62.026 -2.157  -0.005  1.00 0.00  ? 72  VAL A CG1  4  
ATOM   6235  C  CG2  . VAL A 1 72 ? 62.564 -0.730  -1.975  1.00 0.00  ? 72  VAL A CG2  4  
ATOM   6236  H  H    . VAL A 1 72 ? 63.524 -3.088  -3.546  1.00 0.00  ? 72  VAL A H    4  
ATOM   6237  H  HA   . VAL A 1 72 ? 64.682 -1.970  -1.121  1.00 0.00  ? 72  VAL A HA   4  
ATOM   6238  H  HB   . VAL A 1 72 ? 61.925 -2.778  -2.059  1.00 0.00  ? 72  VAL A HB   4  
ATOM   6239  H  HG11 . VAL A 1 72 ? 61.253 -1.408  0.088   1.00 0.00  ? 72  VAL A HG11 4  
ATOM   6240  H  HG12 . VAL A 1 72 ? 62.831 -1.931  0.680   1.00 0.00  ? 72  VAL A HG12 4  
ATOM   6241  H  HG13 . VAL A 1 72 ? 61.617 -3.129  0.228   1.00 0.00  ? 72  VAL A HG13 4  
ATOM   6242  H  HG21 . VAL A 1 72 ? 62.115 -0.071  -1.245  1.00 0.00  ? 72  VAL A HG21 4  
ATOM   6243  H  HG22 . VAL A 1 72 ? 61.995 -0.690  -2.892  1.00 0.00  ? 72  VAL A HG22 4  
ATOM   6244  H  HG23 . VAL A 1 72 ? 63.580 -0.416  -2.167  1.00 0.00  ? 72  VAL A HG23 4  
ATOM   6245  N  N    . ASP A 1 73 ? 64.889 -3.915  0.458   1.00 0.00  ? 73  ASP A N    4  
ATOM   6246  C  CA   . ASP A 1 73 ? 65.017 -5.077  1.391   1.00 0.00  ? 73  ASP A CA   4  
ATOM   6247  C  C    . ASP A 1 73 ? 64.368 -4.712  2.741   1.00 0.00  ? 73  ASP A C    4  
ATOM   6248  O  O    . ASP A 1 73 ? 63.675 -3.717  2.844   1.00 0.00  ? 73  ASP A O    4  
ATOM   6249  C  CB   . ASP A 1 73 ? 66.532 -5.332  1.518   1.00 0.00  ? 73  ASP A CB   4  
ATOM   6250  C  CG   . ASP A 1 73 ? 67.118 -4.571  2.712   1.00 0.00  ? 73  ASP A CG   4  
ATOM   6251  O  OD1  . ASP A 1 73 ? 67.117 -3.355  2.674   1.00 0.00  ? 73  ASP A OD1  4  
ATOM   6252  O  OD2  . ASP A 1 73 ? 67.554 -5.222  3.645   1.00 0.00  ? 73  ASP A OD2  4  
ATOM   6253  H  H    . ASP A 1 73 ? 65.388 -3.090  0.641   1.00 0.00  ? 73  ASP A H    4  
ATOM   6254  H  HA   . ASP A 1 73 ? 64.532 -5.944  0.970   1.00 0.00  ? 73  ASP A HA   4  
ATOM   6255  H  HB2  . ASP A 1 73 ? 66.702 -6.389  1.654   1.00 0.00  ? 73  ASP A HB2  4  
ATOM   6256  H  HB3  . ASP A 1 73 ? 67.025 -5.007  0.613   1.00 0.00  ? 73  ASP A HB3  4  
ATOM   6257  N  N    . PHE A 1 74 ? 64.578 -5.495  3.773   1.00 0.00  ? 74  PHE A N    4  
ATOM   6258  C  CA   . PHE A 1 74 ? 63.955 -5.165  5.098   1.00 0.00  ? 74  PHE A CA   4  
ATOM   6259  C  C    . PHE A 1 74 ? 64.551 -3.871  5.676   1.00 0.00  ? 74  PHE A C    4  
ATOM   6260  O  O    . PHE A 1 74 ? 63.831 -3.008  6.141   1.00 0.00  ? 74  PHE A O    4  
ATOM   6261  C  CB   . PHE A 1 74 ? 64.260 -6.359  6.009   1.00 0.00  ? 74  PHE A CB   4  
ATOM   6262  C  CG   . PHE A 1 74 ? 63.367 -6.295  7.229   1.00 0.00  ? 74  PHE A CG   4  
ATOM   6263  C  CD1  . PHE A 1 74 ? 61.979 -6.418  7.088   1.00 0.00  ? 74  PHE A CD1  4  
ATOM   6264  C  CD2  . PHE A 1 74 ? 63.927 -6.107  8.499   1.00 0.00  ? 74  PHE A CD2  4  
ATOM   6265  C  CE1  . PHE A 1 74 ? 61.152 -6.352  8.216   1.00 0.00  ? 74  PHE A CE1  4  
ATOM   6266  C  CE2  . PHE A 1 74 ? 63.099 -6.042  9.626   1.00 0.00  ? 74  PHE A CE2  4  
ATOM   6267  C  CZ   . PHE A 1 74 ? 61.712 -6.164  9.484   1.00 0.00  ? 74  PHE A CZ   4  
ATOM   6268  H  H    . PHE A 1 74 ? 65.141 -6.293  3.677   1.00 0.00  ? 74  PHE A H    4  
ATOM   6269  H  HA   . PHE A 1 74 ? 62.887 -5.058  4.986   1.00 0.00  ? 74  PHE A HA   4  
ATOM   6270  H  HB2  . PHE A 1 74 ? 64.073 -7.280  5.474   1.00 0.00  ? 74  PHE A HB2  4  
ATOM   6271  H  HB3  . PHE A 1 74 ? 65.294 -6.325  6.318   1.00 0.00  ? 74  PHE A HB3  4  
ATOM   6272  H  HD1  . PHE A 1 74 ? 61.545 -6.563  6.110   1.00 0.00  ? 74  PHE A HD1  4  
ATOM   6273  H  HD2  . PHE A 1 74 ? 64.997 -6.012  8.608   1.00 0.00  ? 74  PHE A HD2  4  
ATOM   6274  H  HE1  . PHE A 1 74 ? 60.081 -6.447  8.106   1.00 0.00  ? 74  PHE A HE1  4  
ATOM   6275  H  HE2  . PHE A 1 74 ? 63.530 -5.897  10.606  1.00 0.00  ? 74  PHE A HE2  4  
ATOM   6276  H  HZ   . PHE A 1 74 ? 61.074 -6.112  10.354  1.00 0.00  ? 74  PHE A HZ   4  
ATOM   6277  N  N    . ASP A 1 75 ? 65.854 -3.730  5.645   1.00 0.00  ? 75  ASP A N    4  
ATOM   6278  C  CA   . ASP A 1 75 ? 66.498 -2.490  6.190   1.00 0.00  ? 75  ASP A CA   4  
ATOM   6279  C  C    . ASP A 1 75 ? 66.004 -1.248  5.429   1.00 0.00  ? 75  ASP A C    4  
ATOM   6280  O  O    . ASP A 1 75 ? 65.518 -0.302  6.023   1.00 0.00  ? 75  ASP A O    4  
ATOM   6281  C  CB   . ASP A 1 75 ? 67.999 -2.701  5.973   1.00 0.00  ? 75  ASP A CB   4  
ATOM   6282  C  CG   . ASP A 1 75 ? 68.780 -1.532  6.576   1.00 0.00  ? 75  ASP A CG   4  
ATOM   6283  O  OD1  . ASP A 1 75 ? 69.020 -1.557  7.771   1.00 0.00  ? 75  ASP A OD1  4  
ATOM   6284  O  OD2  . ASP A 1 75 ? 69.127 -0.630  5.833   1.00 0.00  ? 75  ASP A OD2  4  
ATOM   6285  H  H    . ASP A 1 75 ? 66.413 -4.440  5.261   1.00 0.00  ? 75  ASP A H    4  
ATOM   6286  H  HA   . ASP A 1 75 ? 66.290 -2.390  7.243   1.00 0.00  ? 75  ASP A HA   4  
ATOM   6287  H  HB2  . ASP A 1 75 ? 68.303 -3.621  6.449   1.00 0.00  ? 75  ASP A HB2  4  
ATOM   6288  H  HB3  . ASP A 1 75 ? 68.204 -2.760  4.914   1.00 0.00  ? 75  ASP A HB3  4  
ATOM   6289  N  N    . GLU A 1 76 ? 66.118 -1.251  4.124   1.00 0.00  ? 76  GLU A N    4  
ATOM   6290  C  CA   . GLU A 1 76 ? 65.649 -0.079  3.316   1.00 0.00  ? 76  GLU A CA   4  
ATOM   6291  C  C    . GLU A 1 76 ? 64.151 0.156   3.542   1.00 0.00  ? 76  GLU A C    4  
ATOM   6292  O  O    . GLU A 1 76 ? 63.706 1.279   3.661   1.00 0.00  ? 76  GLU A O    4  
ATOM   6293  C  CB   . GLU A 1 76 ? 65.910 -0.462  1.858   1.00 0.00  ? 76  GLU A CB   4  
ATOM   6294  C  CG   . GLU A 1 76 ? 67.411 -0.367  1.559   1.00 0.00  ? 76  GLU A CG   4  
ATOM   6295  C  CD   . GLU A 1 76 ? 67.767 -1.279  0.380   1.00 0.00  ? 76  GLU A CD   4  
ATOM   6296  O  OE1  . GLU A 1 76 ? 67.011 -1.310  -0.579  1.00 0.00  ? 76  GLU A OE1  4  
ATOM   6297  O  OE2  . GLU A 1 76 ? 68.797 -1.927  0.449   1.00 0.00  ? 76  GLU A OE2  4  
ATOM   6298  H  H    . GLU A 1 76 ? 66.509 -2.031  3.671   1.00 0.00  ? 76  GLU A H    4  
ATOM   6299  H  HA   . GLU A 1 76 ? 66.212 0.805   3.573   1.00 0.00  ? 76  GLU A HA   4  
ATOM   6300  H  HB2  . GLU A 1 76 ? 65.571 -1.473  1.687   1.00 0.00  ? 76  GLU A HB2  4  
ATOM   6301  H  HB3  . GLU A 1 76 ? 65.373 0.212   1.208   1.00 0.00  ? 76  GLU A HB3  4  
ATOM   6302  H  HG2  . GLU A 1 76 ? 67.664 0.654   1.313   1.00 0.00  ? 76  GLU A HG2  4  
ATOM   6303  H  HG3  . GLU A 1 76 ? 67.970 -0.677  2.429   1.00 0.00  ? 76  GLU A HG3  4  
ATOM   6304  N  N    . PHE A 1 77 ? 63.375 -0.898  3.608   1.00 0.00  ? 77  PHE A N    4  
ATOM   6305  C  CA   . PHE A 1 77 ? 61.904 -0.744  3.833   1.00 0.00  ? 77  PHE A CA   4  
ATOM   6306  C  C    . PHE A 1 77 ? 61.640 -0.050  5.177   1.00 0.00  ? 77  PHE A C    4  
ATOM   6307  O  O    . PHE A 1 77 ? 60.779 0.801   5.282   1.00 0.00  ? 77  PHE A O    4  
ATOM   6308  C  CB   . PHE A 1 77 ? 61.355 -2.175  3.846   1.00 0.00  ? 77  PHE A CB   4  
ATOM   6309  C  CG   . PHE A 1 77 ? 59.848 -2.154  3.741   1.00 0.00  ? 77  PHE A CG   4  
ATOM   6310  C  CD1  . PHE A 1 77 ? 59.234 -2.175  2.483   1.00 0.00  ? 77  PHE A CD1  4  
ATOM   6311  C  CD2  . PHE A 1 77 ? 59.066 -2.124  4.901   1.00 0.00  ? 77  PHE A CD2  4  
ATOM   6312  C  CE1  . PHE A 1 77 ? 57.838 -2.165  2.386   1.00 0.00  ? 77  PHE A CE1  4  
ATOM   6313  C  CE2  . PHE A 1 77 ? 57.670 -2.113  4.804   1.00 0.00  ? 77  PHE A CE2  4  
ATOM   6314  C  CZ   . PHE A 1 77 ? 57.056 -2.135  3.546   1.00 0.00  ? 77  PHE A CZ   4  
ATOM   6315  H  H    . PHE A 1 77 ? 63.762 -1.795  3.514   1.00 0.00  ? 77  PHE A H    4  
ATOM   6316  H  HA   . PHE A 1 77 ? 61.456 -0.184  3.027   1.00 0.00  ? 77  PHE A HA   4  
ATOM   6317  H  HB2  . PHE A 1 77 ? 61.763 -2.722  3.009   1.00 0.00  ? 77  PHE A HB2  4  
ATOM   6318  H  HB3  . PHE A 1 77 ? 61.644 -2.661  4.766   1.00 0.00  ? 77  PHE A HB3  4  
ATOM   6319  H  HD1  . PHE A 1 77 ? 59.838 -2.197  1.588   1.00 0.00  ? 77  PHE A HD1  4  
ATOM   6320  H  HD2  . PHE A 1 77 ? 59.540 -2.107  5.872   1.00 0.00  ? 77  PHE A HD2  4  
ATOM   6321  H  HE1  . PHE A 1 77 ? 57.364 -2.181  1.415   1.00 0.00  ? 77  PHE A HE1  4  
ATOM   6322  H  HE2  . PHE A 1 77 ? 57.066 -2.090  5.699   1.00 0.00  ? 77  PHE A HE2  4  
ATOM   6323  H  HZ   . PHE A 1 77 ? 55.978 -2.128  3.472   1.00 0.00  ? 77  PHE A HZ   4  
ATOM   6324  N  N    . LEU A 1 78 ? 62.375 -0.407  6.203   1.00 0.00  ? 78  LEU A N    4  
ATOM   6325  C  CA   . LEU A 1 78 ? 62.164 0.230   7.541   1.00 0.00  ? 78  LEU A CA   4  
ATOM   6326  C  C    . LEU A 1 78 ? 62.399 1.747   7.465   1.00 0.00  ? 78  LEU A C    4  
ATOM   6327  O  O    . LEU A 1 78 ? 61.578 2.524   7.914   1.00 0.00  ? 78  LEU A O    4  
ATOM   6328  C  CB   . LEU A 1 78 ? 63.183 -0.431  8.476   1.00 0.00  ? 78  LEU A CB   4  
ATOM   6329  C  CG   . LEU A 1 78 ? 62.679 -1.816  8.894   1.00 0.00  ? 78  LEU A CG   4  
ATOM   6330  C  CD1  . LEU A 1 78 ? 63.770 -2.538  9.685   1.00 0.00  ? 78  LEU A CD1  4  
ATOM   6331  C  CD2  . LEU A 1 78 ? 61.433 -1.667  9.773   1.00 0.00  ? 78  LEU A CD2  4  
ATOM   6332  H  H    . LEU A 1 78 ? 63.064 -1.098  6.094   1.00 0.00  ? 78  LEU A H    4  
ATOM   6333  H  HA   . LEU A 1 78 ? 61.165 0.030   7.892   1.00 0.00  ? 78  LEU A HA   4  
ATOM   6334  H  HB2  . LEU A 1 78 ? 64.129 -0.532  7.964   1.00 0.00  ? 78  LEU A HB2  4  
ATOM   6335  H  HB3  . LEU A 1 78 ? 63.315 0.181   9.355   1.00 0.00  ? 78  LEU A HB3  4  
ATOM   6336  H  HG   . LEU A 1 78 ? 62.435 -2.392  8.013   1.00 0.00  ? 78  LEU A HG   4  
ATOM   6337  H  HD11 . LEU A 1 78 ? 64.641 -2.668  9.060   1.00 0.00  ? 78  LEU A HD11 4  
ATOM   6338  H  HD12 . LEU A 1 78 ? 63.406 -3.504  10.000  1.00 0.00  ? 78  LEU A HD12 4  
ATOM   6339  H  HD13 . LEU A 1 78 ? 64.035 -1.952  10.552  1.00 0.00  ? 78  LEU A HD13 4  
ATOM   6340  H  HD21 . LEU A 1 78 ? 61.169 -2.628  10.192  1.00 0.00  ? 78  LEU A HD21 4  
ATOM   6341  H  HD22 . LEU A 1 78 ? 60.612 -1.298  9.175   1.00 0.00  ? 78  LEU A HD22 4  
ATOM   6342  H  HD23 . LEU A 1 78 ? 61.637 -0.970  10.572  1.00 0.00  ? 78  LEU A HD23 4  
ATOM   6343  N  N    . VAL A 1 79 ? 63.501 2.178   6.896   1.00 0.00  ? 79  VAL A N    4  
ATOM   6344  C  CA   . VAL A 1 79 ? 63.755 3.654   6.799   1.00 0.00  ? 79  VAL A CA   4  
ATOM   6345  C  C    . VAL A 1 79 ? 62.840 4.270   5.729   1.00 0.00  ? 79  VAL A C    4  
ATOM   6346  O  O    . VAL A 1 79 ? 62.414 5.401   5.851   1.00 0.00  ? 79  VAL A O    4  
ATOM   6347  C  CB   . VAL A 1 79 ? 65.242 3.828   6.427   1.00 0.00  ? 79  VAL A CB   4  
ATOM   6348  C  CG1  . VAL A 1 79 ? 66.116 2.920   7.300   1.00 0.00  ? 79  VAL A CG1  4  
ATOM   6349  C  CG2  . VAL A 1 79 ? 65.468 3.485   4.951   1.00 0.00  ? 79  VAL A CG2  4  
ATOM   6350  H  H    . VAL A 1 79 ? 64.149 1.540   6.531   1.00 0.00  ? 79  VAL A H    4  
ATOM   6351  H  HA   . VAL A 1 79 ? 63.563 4.120   7.754   1.00 0.00  ? 79  VAL A HA   4  
ATOM   6352  H  HB   . VAL A 1 79 ? 65.526 4.856   6.599   1.00 0.00  ? 79  VAL A HB   4  
ATOM   6353  H  HG11 . VAL A 1 79 ? 67.146 3.236   7.227   1.00 0.00  ? 79  VAL A HG11 4  
ATOM   6354  H  HG12 . VAL A 1 79 ? 66.028 1.899   6.959   1.00 0.00  ? 79  VAL A HG12 4  
ATOM   6355  H  HG13 . VAL A 1 79 ? 65.790 2.987   8.327   1.00 0.00  ? 79  VAL A HG13 4  
ATOM   6356  H  HG21 . VAL A 1 79 ? 65.219 2.449   4.780   1.00 0.00  ? 79  VAL A HG21 4  
ATOM   6357  H  HG22 . VAL A 1 79 ? 66.504 3.652   4.698   1.00 0.00  ? 79  VAL A HG22 4  
ATOM   6358  H  HG23 . VAL A 1 79 ? 64.842 4.115   4.334   1.00 0.00  ? 79  VAL A HG23 4  
ATOM   6359  N  N    . MET A 1 80 ? 62.524 3.527   4.689   1.00 0.00  ? 80  MET A N    4  
ATOM   6360  C  CA   . MET A 1 80 ? 61.622 4.061   3.619   1.00 0.00  ? 80  MET A CA   4  
ATOM   6361  C  C    . MET A 1 80 ? 60.272 4.450   4.231   1.00 0.00  ? 80  MET A C    4  
ATOM   6362  O  O    . MET A 1 80 ? 59.781 5.544   4.023   1.00 0.00  ? 80  MET A O    4  
ATOM   6363  C  CB   . MET A 1 80 ? 61.455 2.911   2.621   1.00 0.00  ? 80  MET A CB   4  
ATOM   6364  C  CG   . MET A 1 80 ? 60.697 3.405   1.387   1.00 0.00  ? 80  MET A CG   4  
ATOM   6365  S  SD   . MET A 1 80 ? 61.240 2.471   -0.063  1.00 0.00  ? 80  MET A SD   4  
ATOM   6366  C  CE   . MET A 1 80 ? 60.493 3.543   -1.312  1.00 0.00  ? 80  MET A CE   4  
ATOM   6367  H  H    . MET A 1 80 ? 62.873 2.613   4.620   1.00 0.00  ? 80  MET A H    4  
ATOM   6368  H  HA   . MET A 1 80 ? 62.076 4.911   3.134   1.00 0.00  ? 80  MET A HA   4  
ATOM   6369  H  HB2  . MET A 1 80 ? 62.428 2.549   2.323   1.00 0.00  ? 80  MET A HB2  4  
ATOM   6370  H  HB3  . MET A 1 80 ? 60.900 2.110   3.084   1.00 0.00  ? 80  MET A HB3  4  
ATOM   6371  H  HG2  . MET A 1 80 ? 59.637 3.260   1.534   1.00 0.00  ? 80  MET A HG2  4  
ATOM   6372  H  HG3  . MET A 1 80 ? 60.899 4.455   1.236   1.00 0.00  ? 80  MET A HG3  4  
ATOM   6373  H  HE1  . MET A 1 80 ? 59.453 3.710   -1.065  1.00 0.00  ? 80  MET A HE1  4  
ATOM   6374  H  HE2  . MET A 1 80 ? 60.559 3.073   -2.280  1.00 0.00  ? 80  MET A HE2  4  
ATOM   6375  H  HE3  . MET A 1 80 ? 61.018 4.488   -1.337  1.00 0.00  ? 80  MET A HE3  4  
ATOM   6376  N  N    . MET A 1 81 ? 59.682 3.568   5.001   1.00 0.00  ? 81  MET A N    4  
ATOM   6377  C  CA   . MET A 1 81 ? 58.377 3.888   5.651   1.00 0.00  ? 81  MET A CA   4  
ATOM   6378  C  C    . MET A 1 81 ? 58.559 5.073   6.611   1.00 0.00  ? 81  MET A C    4  
ATOM   6379  O  O    . MET A 1 81 ? 57.678 5.894   6.767   1.00 0.00  ? 81  MET A O    4  
ATOM   6380  C  CB   . MET A 1 81 ? 57.984 2.620   6.419   1.00 0.00  ? 81  MET A CB   4  
ATOM   6381  C  CG   . MET A 1 81 ? 57.739 1.462   5.439   1.00 0.00  ? 81  MET A CG   4  
ATOM   6382  S  SD   . MET A 1 81 ? 56.714 2.024   4.055   1.00 0.00  ? 81  MET A SD   4  
ATOM   6383  C  CE   . MET A 1 81 ? 55.211 2.347   5.005   1.00 0.00  ? 81  MET A CE   4  
ATOM   6384  H  H    . MET A 1 81 ? 60.106 2.699   5.164   1.00 0.00  ? 81  MET A H    4  
ATOM   6385  H  HA   . MET A 1 81 ? 57.631 4.119   4.907   1.00 0.00  ? 81  MET A HA   4  
ATOM   6386  H  HB2  . MET A 1 81 ? 58.782 2.351   7.097   1.00 0.00  ? 81  MET A HB2  4  
ATOM   6387  H  HB3  . MET A 1 81 ? 57.083 2.807   6.983   1.00 0.00  ? 81  MET A HB3  4  
ATOM   6388  H  HG2  . MET A 1 81 ? 58.684 1.106   5.059   1.00 0.00  ? 81  MET A HG2  4  
ATOM   6389  H  HG3  . MET A 1 81 ? 57.236 0.657   5.953   1.00 0.00  ? 81  MET A HG3  4  
ATOM   6390  H  HE1  . MET A 1 81 ? 54.834 1.416   5.407   1.00 0.00  ? 81  MET A HE1  4  
ATOM   6391  H  HE2  . MET A 1 81 ? 54.466 2.788   4.362   1.00 0.00  ? 81  MET A HE2  4  
ATOM   6392  H  HE3  . MET A 1 81 ? 55.440 3.029   5.813   1.00 0.00  ? 81  MET A HE3  4  
ATOM   6393  N  N    . VAL A 1 82 ? 59.709 5.170   7.238   1.00 0.00  ? 82  VAL A N    4  
ATOM   6394  C  CA   . VAL A 1 82 ? 59.974 6.306   8.176   1.00 0.00  ? 82  VAL A CA   4  
ATOM   6395  C  C    . VAL A 1 82 ? 60.024 7.633   7.395   1.00 0.00  ? 82  VAL A C    4  
ATOM   6396  O  O    . VAL A 1 82 ? 59.568 8.654   7.872   1.00 0.00  ? 82  VAL A O    4  
ATOM   6397  C  CB   . VAL A 1 82 ? 61.333 5.977   8.818   1.00 0.00  ? 82  VAL A CB   4  
ATOM   6398  C  CG1  . VAL A 1 82 ? 62.014 7.254   9.319   1.00 0.00  ? 82  VAL A CG1  4  
ATOM   6399  C  CG2  . VAL A 1 82 ? 61.115 5.028   10.000  1.00 0.00  ? 82  VAL A CG2  4  
ATOM   6400  H  H    . VAL A 1 82 ? 60.406 4.498   7.081   1.00 0.00  ? 82  VAL A H    4  
ATOM   6401  H  HA   . VAL A 1 82 ? 59.209 6.349   8.935   1.00 0.00  ? 82  VAL A HA   4  
ATOM   6402  H  HB   . VAL A 1 82 ? 61.968 5.499   8.089   1.00 0.00  ? 82  VAL A HB   4  
ATOM   6403  H  HG11 . VAL A 1 82 ? 62.993 7.011   9.704   1.00 0.00  ? 82  VAL A HG11 4  
ATOM   6404  H  HG12 . VAL A 1 82 ? 61.419 7.698   10.103  1.00 0.00  ? 82  VAL A HG12 4  
ATOM   6405  H  HG13 . VAL A 1 82 ? 62.114 7.955   8.502   1.00 0.00  ? 82  VAL A HG13 4  
ATOM   6406  H  HG21 . VAL A 1 82 ? 60.571 4.156   9.667   1.00 0.00  ? 82  VAL A HG21 4  
ATOM   6407  H  HG22 . VAL A 1 82 ? 60.549 5.534   10.768  1.00 0.00  ? 82  VAL A HG22 4  
ATOM   6408  H  HG23 . VAL A 1 82 ? 62.071 4.724   10.398  1.00 0.00  ? 82  VAL A HG23 4  
ATOM   6409  N  N    . ARG A 1 83 ? 60.564 7.618   6.198   1.00 0.00  ? 83  ARG A N    4  
ATOM   6410  C  CA   . ARG A 1 83 ? 60.637 8.872   5.375   1.00 0.00  ? 83  ARG A CA   4  
ATOM   6411  C  C    . ARG A 1 83 ? 59.227 9.439   5.139   1.00 0.00  ? 83  ARG A C    4  
ATOM   6412  O  O    . ARG A 1 83 ? 59.018 10.637  5.177   1.00 0.00  ? 83  ARG A O    4  
ATOM   6413  C  CB   . ARG A 1 83 ? 61.276 8.452   4.044   1.00 0.00  ? 83  ARG A CB   4  
ATOM   6414  C  CG   . ARG A 1 83 ? 62.672 7.869   4.296   1.00 0.00  ? 83  ARG A CG   4  
ATOM   6415  C  CD   . ARG A 1 83 ? 63.663 8.424   3.269   1.00 0.00  ? 83  ARG A CD   4  
ATOM   6416  N  NE   . ARG A 1 83 ? 63.531 7.530   2.082   1.00 0.00  ? 83  ARG A NE   4  
ATOM   6417  C  CZ   . ARG A 1 83 ? 63.895 7.948   0.904   1.00 0.00  ? 83  ARG A CZ   4  
ATOM   6418  N  NH1  . ARG A 1 83 ? 63.041 8.568   0.143   1.00 0.00  ? 83  ARG A NH1  4  
ATOM   6419  N  NH2  . ARG A 1 83 ? 65.114 7.749   0.487   1.00 0.00  ? 83  ARG A NH2  4  
ATOM   6420  H  H    . ARG A 1 83 ? 60.917 6.778   5.835   1.00 0.00  ? 83  ARG A H    4  
ATOM   6421  H  HA   . ARG A 1 83 ? 61.257 9.607   5.866   1.00 0.00  ? 83  ARG A HA   4  
ATOM   6422  H  HB2  . ARG A 1 83 ? 60.656 7.706   3.569   1.00 0.00  ? 83  ARG A HB2  4  
ATOM   6423  H  HB3  . ARG A 1 83 ? 61.360 9.313   3.398   1.00 0.00  ? 83  ARG A HB3  4  
ATOM   6424  H  HG2  . ARG A 1 83 ? 62.998 8.136   5.291   1.00 0.00  ? 83  ARG A HG2  4  
ATOM   6425  H  HG3  . ARG A 1 83 ? 62.635 6.793   4.209   1.00 0.00  ? 83  ARG A HG3  4  
ATOM   6426  H  HD2  . ARG A 1 83 ? 63.404 9.443   3.010   1.00 0.00  ? 83  ARG A HD2  4  
ATOM   6427  H  HD3  . ARG A 1 83 ? 64.670 8.377   3.656   1.00 0.00  ? 83  ARG A HD3  4  
ATOM   6428  H  HE   . ARG A 1 83 ? 63.168 6.625   2.188   1.00 0.00  ? 83  ARG A HE   4  
ATOM   6429  H  HH11 . ARG A 1 83 ? 62.108 8.724   0.464   1.00 0.00  ? 83  ARG A HH11 4  
ATOM   6430  H  HH12 . ARG A 1 83 ? 63.318 8.886   -0.766  1.00 0.00  ? 83  ARG A HH12 4  
ATOM   6431  H  HH21 . ARG A 1 83 ? 65.771 7.277   1.072   1.00 0.00  ? 83  ARG A HH21 4  
ATOM   6432  H  HH22 . ARG A 1 83 ? 65.390 8.068   -0.421  1.00 0.00  ? 83  ARG A HH22 4  
ATOM   6433  N  N    . CYS A 1 84 ? 58.260 8.584   4.901   1.00 0.00  ? 84  CYS A N    4  
ATOM   6434  C  CA   . CYS A 1 84 ? 56.859 9.063   4.668   1.00 0.00  ? 84  CYS A CA   4  
ATOM   6435  C  C    . CYS A 1 84 ? 56.055 9.089   5.983   1.00 0.00  ? 84  CYS A C    4  
ATOM   6436  O  O    . CYS A 1 84 ? 55.008 9.705   6.059   1.00 0.00  ? 84  CYS A O    4  
ATOM   6437  C  CB   . CYS A 1 84 ? 56.250 8.053   3.691   1.00 0.00  ? 84  CYS A CB   4  
ATOM   6438  S  SG   . CYS A 1 84 ? 56.815 8.421   2.011   1.00 0.00  ? 84  CYS A SG   4  
ATOM   6439  H  H    . CYS A 1 84 ? 58.455 7.623   4.878   1.00 0.00  ? 84  CYS A H    4  
ATOM   6440  H  HA   . CYS A 1 84 ? 56.869 10.043  4.217   1.00 0.00  ? 84  CYS A HA   4  
ATOM   6441  H  HB2  . CYS A 1 84 ? 56.560 7.055   3.965   1.00 0.00  ? 84  CYS A HB2  4  
ATOM   6442  H  HB3  . CYS A 1 84 ? 55.172 8.119   3.731   1.00 0.00  ? 84  CYS A HB3  4  
ATOM   6443  H  HG   . CYS A 1 84 ? 57.677 8.018   1.892   1.00 0.00  ? 84  CYS A HG   4  
ATOM   6444  N  N    . MET A 1 85 ? 56.531 8.426   7.013   1.00 0.00  ? 85  MET A N    4  
ATOM   6445  C  CA   . MET A 1 85 ? 55.790 8.414   8.315   1.00 0.00  ? 85  MET A CA   4  
ATOM   6446  C  C    . MET A 1 85 ? 56.337 9.502   9.253   1.00 0.00  ? 85  MET A C    4  
ATOM   6447  O  O    . MET A 1 85 ? 55.632 10.424  9.614   1.00 0.00  ? 85  MET A O    4  
ATOM   6448  C  CB   . MET A 1 85 ? 56.029 7.015   8.895   1.00 0.00  ? 85  MET A CB   4  
ATOM   6449  C  CG   . MET A 1 85 ? 55.261 6.857   10.210  1.00 0.00  ? 85  MET A CG   4  
ATOM   6450  S  SD   . MET A 1 85 ? 55.965 5.484   11.155  1.00 0.00  ? 85  MET A SD   4  
ATOM   6451  C  CE   . MET A 1 85 ? 57.270 6.428   11.979  1.00 0.00  ? 85  MET A CE   4  
ATOM   6452  H  H    . MET A 1 85 ? 57.373 7.933   6.930   1.00 0.00  ? 85  MET A H    4  
ATOM   6453  H  HA   . MET A 1 85 ? 54.735 8.565   8.146   1.00 0.00  ? 85  MET A HA   4  
ATOM   6454  H  HB2  . MET A 1 85 ? 55.687 6.272   8.189   1.00 0.00  ? 85  MET A HB2  4  
ATOM   6455  H  HB3  . MET A 1 85 ? 57.085 6.877   9.077   1.00 0.00  ? 85  MET A HB3  4  
ATOM   6456  H  HG2  . MET A 1 85 ? 55.339 7.768   10.787  1.00 0.00  ? 85  MET A HG2  4  
ATOM   6457  H  HG3  . MET A 1 85 ? 54.222 6.653   9.998   1.00 0.00  ? 85  MET A HG3  4  
ATOM   6458  H  HE1  . MET A 1 85 ? 58.019 6.715   11.254  1.00 0.00  ? 85  MET A HE1  4  
ATOM   6459  H  HE2  . MET A 1 85 ? 57.728 5.821   12.743  1.00 0.00  ? 85  MET A HE2  4  
ATOM   6460  H  HE3  . MET A 1 85 ? 56.842 7.312   12.432  1.00 0.00  ? 85  MET A HE3  4  
ATOM   6461  N  N    . LYS A 1 86 ? 57.585 9.406   9.650   1.00 0.00  ? 86  LYS A N    4  
ATOM   6462  C  CA   . LYS A 1 86 ? 58.162 10.441  10.563  1.00 0.00  ? 86  LYS A CA   4  
ATOM   6463  C  C    . LYS A 1 86 ? 59.695 10.445  10.481  1.00 0.00  ? 86  LYS A C    4  
ATOM   6464  O  O    . LYS A 1 86 ? 60.365 9.670   11.139  1.00 0.00  ? 86  LYS A O    4  
ATOM   6465  C  CB   . LYS A 1 86 ? 57.699 10.043  11.968  1.00 0.00  ? 86  LYS A CB   4  
ATOM   6466  C  CG   . LYS A 1 86 ? 57.979 11.191  12.947  1.00 0.00  ? 86  LYS A CG   4  
ATOM   6467  C  CD   . LYS A 1 86 ? 59.117 10.796  13.896  1.00 0.00  ? 86  LYS A CD   4  
ATOM   6468  C  CE   . LYS A 1 86 ? 60.256 11.816  13.791  1.00 0.00  ? 86  LYS A CE   4  
ATOM   6469  N  NZ   . LYS A 1 86 ? 61.464 11.105  14.304  1.00 0.00  ? 86  LYS A NZ   4  
ATOM   6470  H  H    . LYS A 1 86 ? 58.140 8.655   9.347   1.00 0.00  ? 86  LYS A H    4  
ATOM   6471  H  HA   . LYS A 1 86 ? 57.775 11.416  10.314  1.00 0.00  ? 86  LYS A HA   4  
ATOM   6472  H  HB2  . LYS A 1 86 ? 56.639 9.834   11.950  1.00 0.00  ? 86  LYS A HB2  4  
ATOM   6473  H  HB3  . LYS A 1 86 ? 58.235 9.162   12.286  1.00 0.00  ? 86  LYS A HB3  4  
ATOM   6474  H  HG2  . LYS A 1 86 ? 58.260 12.076  12.393  1.00 0.00  ? 86  LYS A HG2  4  
ATOM   6475  H  HG3  . LYS A 1 86 ? 57.088 11.396  13.522  1.00 0.00  ? 86  LYS A HG3  4  
ATOM   6476  H  HD2  . LYS A 1 86 ? 58.746 10.774  14.911  1.00 0.00  ? 86  LYS A HD2  4  
ATOM   6477  H  HD3  . LYS A 1 86 ? 59.488 9.818   13.628  1.00 0.00  ? 86  LYS A HD3  4  
ATOM   6478  H  HE2  . LYS A 1 86 ? 60.400 12.110  12.760  1.00 0.00  ? 86  LYS A HE2  4  
ATOM   6479  H  HE3  . LYS A 1 86 ? 60.046 12.680  14.404  1.00 0.00  ? 86  LYS A HE3  4  
ATOM   6480  H  HZ1  . LYS A 1 86 ? 61.879 10.528  13.544  1.00 0.00  ? 86  LYS A HZ1  4  
ATOM   6481  H  HZ2  . LYS A 1 86 ? 61.200 10.490  15.102  1.00 0.00  ? 86  LYS A HZ2  4  
ATOM   6482  H  HZ3  . LYS A 1 86 ? 62.168 11.802  14.624  1.00 0.00  ? 86  LYS A HZ3  4  
ATOM   6483  N  N    . ASP A 1 87 ? 60.250 11.325  9.689   1.00 0.00  ? 87  ASP A N    4  
ATOM   6484  C  CA   . ASP A 1 87 ? 61.738 11.401  9.570   1.00 0.00  ? 87  ASP A CA   4  
ATOM   6485  C  C    . ASP A 1 87 ? 62.271 12.552  10.436  1.00 0.00  ? 87  ASP A C    4  
ATOM   6486  O  O    . ASP A 1 87 ? 61.513 13.249  11.087  1.00 0.00  ? 87  ASP A O    4  
ATOM   6487  C  CB   . ASP A 1 87 ? 62.011 11.659  8.085   1.00 0.00  ? 87  ASP A CB   4  
ATOM   6488  C  CG   . ASP A 1 87 ? 63.262 10.890  7.657   1.00 0.00  ? 87  ASP A CG   4  
ATOM   6489  O  OD1  . ASP A 1 87 ? 64.340 11.450  7.758   1.00 0.00  ? 87  ASP A OD1  4  
ATOM   6490  O  OD2  . ASP A 1 87 ? 63.120 9.755   7.239   1.00 0.00  ? 87  ASP A OD2  4  
ATOM   6491  H  H    . ASP A 1 87 ? 59.688 11.945  9.179   1.00 0.00  ? 87  ASP A H    4  
ATOM   6492  H  HA   . ASP A 1 87 ? 62.188 10.467  9.872   1.00 0.00  ? 87  ASP A HA   4  
ATOM   6493  H  HB2  . ASP A 1 87 ? 61.166 11.327  7.500   1.00 0.00  ? 87  ASP A HB2  4  
ATOM   6494  H  HB3  . ASP A 1 87 ? 62.168 12.715  7.924   1.00 0.00  ? 87  ASP A HB3  4  
ATOM   6495  N  N    . ASP A 1 88 ? 63.563 12.757  10.453  1.00 0.00  ? 88  ASP A N    4  
ATOM   6496  C  CA   . ASP A 1 88 ? 64.136 13.860  11.285  1.00 0.00  ? 88  ASP A CA   4  
ATOM   6497  C  C    . ASP A 1 88 ? 64.918 14.845  10.407  1.00 0.00  ? 88  ASP A C    4  
ATOM   6498  O  O    . ASP A 1 88 ? 65.869 14.475  9.744   1.00 0.00  ? 88  ASP A O    4  
ATOM   6499  C  CB   . ASP A 1 88 ? 65.067 13.163  12.282  1.00 0.00  ? 88  ASP A CB   4  
ATOM   6500  C  CG   . ASP A 1 88 ? 64.246 12.276  13.219  1.00 0.00  ? 88  ASP A CG   4  
ATOM   6501  O  OD1  . ASP A 1 88 ? 63.777 12.784  14.224  1.00 0.00  ? 88  ASP A OD1  4  
ATOM   6502  O  OD2  . ASP A 1 88 ? 64.094 11.105  12.913  1.00 0.00  ? 88  ASP A OD2  4  
ATOM   6503  H  H    . ASP A 1 88 ? 64.158 12.183  9.925   1.00 0.00  ? 88  ASP A H    4  
ATOM   6504  H  HA   . ASP A 1 88 ? 63.352 14.375  11.817  1.00 0.00  ? 88  ASP A HA   4  
ATOM   6505  H  HB2  . ASP A 1 88 ? 65.779 12.556  11.744  1.00 0.00  ? 88  ASP A HB2  4  
ATOM   6506  H  HB3  . ASP A 1 88 ? 65.593 13.905  12.862  1.00 0.00  ? 88  ASP A HB3  4  
ATOM   6507  N  N    . SER A 1 89 ? 64.519 16.098  10.411  1.00 0.00  ? 89  SER A N    4  
ATOM   6508  C  CA   . SER A 1 89 ? 65.220 17.141  9.588   1.00 0.00  ? 89  SER A CA   4  
ATOM   6509  C  C    . SER A 1 89 ? 65.265 16.731  8.102   1.00 0.00  ? 89  SER A C    4  
ATOM   6510  O  O    . SER A 1 89 ? 66.285 16.955  7.467   1.00 0.00  ? 89  SER A O    4  
ATOM   6511  C  CB   . SER A 1 89 ? 66.632 17.243  10.181  1.00 0.00  ? 89  SER A CB   4  
ATOM   6512  O  OG   . SER A 1 89 ? 66.541 17.529  11.574  1.00 0.00  ? 89  SER A OG   4  
ATOM   6513  O  OXT  . SER A 1 89 ? 64.269 16.212  7.621   1.00 0.00  ? 89  SER A OXT  4  
ATOM   6514  H  H    . SER A 1 89 ? 63.752 16.357  10.961  1.00 0.00  ? 89  SER A H    4  
ATOM   6515  H  HA   . SER A 1 89 ? 64.716 18.089  9.690   1.00 0.00  ? 89  SER A HA   4  
ATOM   6516  H  HB2  . SER A 1 89 ? 67.152 16.310  10.042  1.00 0.00  ? 89  SER A HB2  4  
ATOM   6517  H  HB3  . SER A 1 89 ? 67.175 18.032  9.676   1.00 0.00  ? 89  SER A HB3  4  
ATOM   6518  H  HG   . SER A 1 89 ? 66.598 16.699  12.053  1.00 0.00  ? 89  SER A HG   4  
ATOM   6519  N  N    . ARG B 2 1  ? 45.453 7.469   -6.251  1.00 0.00  ? 144 ARG B N    4  
ATOM   6520  C  CA   . ARG B 2 1  ? 45.176 8.279   -7.479  1.00 0.00  ? 144 ARG B CA   4  
ATOM   6521  C  C    . ARG B 2 1  ? 46.487 8.723   -8.145  1.00 0.00  ? 144 ARG B C    4  
ATOM   6522  O  O    . ARG B 2 1  ? 46.712 8.463   -9.311  1.00 0.00  ? 144 ARG B O    4  
ATOM   6523  C  CB   . ARG B 2 1  ? 44.381 9.495   -6.991  1.00 0.00  ? 144 ARG B CB   4  
ATOM   6524  C  CG   . ARG B 2 1  ? 42.881 9.200   -7.093  1.00 0.00  ? 144 ARG B CG   4  
ATOM   6525  C  CD   . ARG B 2 1  ? 42.407 9.437   -8.530  1.00 0.00  ? 144 ARG B CD   4  
ATOM   6526  N  NE   . ARG B 2 1  ? 41.290 10.419  -8.412  1.00 0.00  ? 144 ARG B NE   4  
ATOM   6527  C  CZ   . ARG B 2 1  ? 41.179 11.387  -9.276  1.00 0.00  ? 144 ARG B CZ   4  
ATOM   6528  N  NH1  . ARG B 2 1  ? 41.790 12.519  -9.072  1.00 0.00  ? 144 ARG B NH1  4  
ATOM   6529  N  NH2  . ARG B 2 1  ? 40.453 11.220  -10.343 1.00 0.00  ? 144 ARG B NH2  4  
ATOM   6530  H  H1   . ARG B 2 1  ? 45.867 8.076   -5.516  1.00 0.00  ? 144 ARG B H1   4  
ATOM   6531  H  H2   . ARG B 2 1  ? 46.119 6.702   -6.483  1.00 0.00  ? 144 ARG B H2   4  
ATOM   6532  H  H3   . ARG B 2 1  ? 44.565 7.061   -5.898  1.00 0.00  ? 144 ARG B H3   4  
ATOM   6533  H  HA   . ARG B 2 1  ? 44.582 7.708   -8.175  1.00 0.00  ? 144 ARG B HA   4  
ATOM   6534  H  HB2  . ARG B 2 1  ? 44.638 9.707   -5.963  1.00 0.00  ? 144 ARG B HB2  4  
ATOM   6535  H  HB3  . ARG B 2 1  ? 44.619 10.351  -7.605  1.00 0.00  ? 144 ARG B HB3  4  
ATOM   6536  H  HG2  . ARG B 2 1  ? 42.697 8.171   -6.819  1.00 0.00  ? 144 ARG B HG2  4  
ATOM   6537  H  HG3  . ARG B 2 1  ? 42.340 9.852   -6.425  1.00 0.00  ? 144 ARG B HG3  4  
ATOM   6538  H  HD2  . ARG B 2 1  ? 43.210 9.846   -9.129  1.00 0.00  ? 144 ARG B HD2  4  
ATOM   6539  H  HD3  . ARG B 2 1  ? 42.045 8.517   -8.964  1.00 0.00  ? 144 ARG B HD3  4  
ATOM   6540  H  HE   . ARG B 2 1  ? 40.635 10.333  -7.688  1.00 0.00  ? 144 ARG B HE   4  
ATOM   6541  H  HH11 . ARG B 2 1  ? 42.345 12.646  -8.250  1.00 0.00  ? 144 ARG B HH11 4  
ATOM   6542  H  HH12 . ARG B 2 1  ? 41.705 13.260  -9.737  1.00 0.00  ? 144 ARG B HH12 4  
ATOM   6543  H  HH21 . ARG B 2 1  ? 39.982 10.351  -10.495 1.00 0.00  ? 144 ARG B HH21 4  
ATOM   6544  H  HH22 . ARG B 2 1  ? 40.368 11.957  -11.011 1.00 0.00  ? 144 ARG B HH22 4  
ATOM   6545  N  N    . ARG B 2 2  ? 47.346 9.395   -7.417  1.00 0.00  ? 145 ARG B N    4  
ATOM   6546  C  CA   . ARG B 2 2  ? 48.639 9.859   -8.011  1.00 0.00  ? 145 ARG B CA   4  
ATOM   6547  C  C    . ARG B 2 2  ? 49.822 9.157   -7.319  1.00 0.00  ? 145 ARG B C    4  
ATOM   6548  O  O    . ARG B 2 2  ? 49.701 8.034   -6.871  1.00 0.00  ? 145 ARG B O    4  
ATOM   6549  C  CB   . ARG B 2 2  ? 48.656 11.373  -7.769  1.00 0.00  ? 145 ARG B CB   4  
ATOM   6550  C  CG   . ARG B 2 2  ? 47.683 12.057  -8.737  1.00 0.00  ? 145 ARG B CG   4  
ATOM   6551  C  CD   . ARG B 2 2  ? 48.308 12.124  -10.136 1.00 0.00  ? 145 ARG B CD   4  
ATOM   6552  N  NE   . ARG B 2 2  ? 47.622 11.053  -10.919 1.00 0.00  ? 145 ARG B NE   4  
ATOM   6553  C  CZ   . ARG B 2 2  ? 47.637 11.086  -12.220 1.00 0.00  ? 145 ARG B CZ   4  
ATOM   6554  N  NH1  . ARG B 2 2  ? 46.742 11.785  -12.859 1.00 0.00  ? 145 ARG B NH1  4  
ATOM   6555  N  NH2  . ARG B 2 2  ? 48.540 10.416  -12.878 1.00 0.00  ? 145 ARG B NH2  4  
ATOM   6556  H  H    . ARG B 2 2  ? 47.141 9.598   -6.481  1.00 0.00  ? 145 ARG B H    4  
ATOM   6557  H  HA   . ARG B 2 2  ? 48.657 9.657   -9.070  1.00 0.00  ? 145 ARG B HA   4  
ATOM   6558  H  HB2  . ARG B 2 2  ? 48.357 11.579  -6.751  1.00 0.00  ? 145 ARG B HB2  4  
ATOM   6559  H  HB3  . ARG B 2 2  ? 49.650 11.756  -7.937  1.00 0.00  ? 145 ARG B HB3  4  
ATOM   6560  H  HG2  . ARG B 2 2  ? 46.761 11.494  -8.778  1.00 0.00  ? 145 ARG B HG2  4  
ATOM   6561  H  HG3  . ARG B 2 2  ? 47.476 13.058  -8.390  1.00 0.00  ? 145 ARG B HG3  4  
ATOM   6562  H  HD2  . ARG B 2 2  ? 48.127 13.094  -10.579 1.00 0.00  ? 145 ARG B HD2  4  
ATOM   6563  H  HD3  . ARG B 2 2  ? 49.368 11.924  -10.085 1.00 0.00  ? 145 ARG B HD3  4  
ATOM   6564  H  HE   . ARG B 2 2  ? 47.160 10.323  -10.455 1.00 0.00  ? 145 ARG B HE   4  
ATOM   6565  H  HH11 . ARG B 2 2  ? 46.050 12.294  -12.349 1.00 0.00  ? 145 ARG B HH11 4  
ATOM   6566  H  HH12 . ARG B 2 2  ? 46.747 11.811  -13.858 1.00 0.00  ? 145 ARG B HH12 4  
ATOM   6567  H  HH21 . ARG B 2 2  ? 49.221 9.876   -12.382 1.00 0.00  ? 145 ARG B HH21 4  
ATOM   6568  H  HH22 . ARG B 2 2  ? 48.554 10.440  -13.876 1.00 0.00  ? 145 ARG B HH22 4  
ATOM   6569  N  N    . VAL B 2 3  ? 50.967 9.796   -7.241  1.00 0.00  ? 146 VAL B N    4  
ATOM   6570  C  CA   . VAL B 2 3  ? 52.152 9.145   -6.590  1.00 0.00  ? 146 VAL B CA   4  
ATOM   6571  C  C    . VAL B 2 3  ? 52.265 9.527   -5.097  1.00 0.00  ? 146 VAL B C    4  
ATOM   6572  O  O    . VAL B 2 3  ? 53.349 9.584   -4.545  1.00 0.00  ? 146 VAL B O    4  
ATOM   6573  C  CB   . VAL B 2 3  ? 53.363 9.652   -7.390  1.00 0.00  ? 146 VAL B CB   4  
ATOM   6574  C  CG1  . VAL B 2 3  ? 53.699 11.094  -6.992  1.00 0.00  ? 146 VAL B CG1  4  
ATOM   6575  C  CG2  . VAL B 2 3  ? 54.573 8.756   -7.112  1.00 0.00  ? 146 VAL B CG2  4  
ATOM   6576  H  H    . VAL B 2 3  ? 51.053 10.695  -7.618  1.00 0.00  ? 146 VAL B H    4  
ATOM   6577  H  HA   . VAL B 2 3  ? 52.082 8.073   -6.688  1.00 0.00  ? 146 VAL B HA   4  
ATOM   6578  H  HB   . VAL B 2 3  ? 53.132 9.621   -8.445  1.00 0.00  ? 146 VAL B HB   4  
ATOM   6579  H  HG11 . VAL B 2 3  ? 54.442 11.087  -6.208  1.00 0.00  ? 146 VAL B HG11 4  
ATOM   6580  H  HG12 . VAL B 2 3  ? 52.807 11.590  -6.640  1.00 0.00  ? 146 VAL B HG12 4  
ATOM   6581  H  HG13 . VAL B 2 3  ? 54.089 11.622  -7.850  1.00 0.00  ? 146 VAL B HG13 4  
ATOM   6582  H  HG21 . VAL B 2 3  ? 54.275 7.719   -7.169  1.00 0.00  ? 146 VAL B HG21 4  
ATOM   6583  H  HG22 . VAL B 2 3  ? 54.957 8.966   -6.125  1.00 0.00  ? 146 VAL B HG22 4  
ATOM   6584  H  HG23 . VAL B 2 3  ? 55.340 8.950   -7.846  1.00 0.00  ? 146 VAL B HG23 4  
ATOM   6585  N  N    . ARG B 2 4  ? 51.160 9.769   -4.433  1.00 0.00  ? 147 ARG B N    4  
ATOM   6586  C  CA   . ARG B 2 4  ? 51.226 10.126  -2.981  1.00 0.00  ? 147 ARG B CA   4  
ATOM   6587  C  C    . ARG B 2 4  ? 50.980 8.875   -2.125  1.00 0.00  ? 147 ARG B C    4  
ATOM   6588  O  O    . ARG B 2 4  ? 49.867 8.593   -1.720  1.00 0.00  ? 147 ARG B O    4  
ATOM   6589  C  CB   . ARG B 2 4  ? 50.121 11.171  -2.767  1.00 0.00  ? 147 ARG B CB   4  
ATOM   6590  C  CG   . ARG B 2 4  ? 50.540 12.141  -1.656  1.00 0.00  ? 147 ARG B CG   4  
ATOM   6591  C  CD   . ARG B 2 4  ? 50.546 13.573  -2.196  1.00 0.00  ? 147 ARG B CD   4  
ATOM   6592  N  NE   . ARG B 2 4  ? 51.838 14.155  -1.730  1.00 0.00  ? 147 ARG B NE   4  
ATOM   6593  C  CZ   . ARG B 2 4  ? 52.715 14.573  -2.596  1.00 0.00  ? 147 ARG B CZ   4  
ATOM   6594  N  NH1  . ARG B 2 4  ? 53.533 13.726  -3.156  1.00 0.00  ? 147 ARG B NH1  4  
ATOM   6595  N  NH2  . ARG B 2 4  ? 52.777 15.840  -2.893  1.00 0.00  ? 147 ARG B NH2  4  
ATOM   6596  H  H    . ARG B 2 4  ? 50.292 9.703   -4.881  1.00 0.00  ? 147 ARG B H    4  
ATOM   6597  H  HA   . ARG B 2 4  ? 52.187 10.555  -2.744  1.00 0.00  ? 147 ARG B HA   4  
ATOM   6598  H  HB2  . ARG B 2 4  ? 49.961 11.719  -3.684  1.00 0.00  ? 147 ARG B HB2  4  
ATOM   6599  H  HB3  . ARG B 2 4  ? 49.204 10.675  -2.481  1.00 0.00  ? 147 ARG B HB3  4  
ATOM   6600  H  HG2  . ARG B 2 4  ? 49.840 12.070  -0.835  1.00 0.00  ? 147 ARG B HG2  4  
ATOM   6601  H  HG3  . ARG B 2 4  ? 51.529 11.884  -1.307  1.00 0.00  ? 147 ARG B HG3  4  
ATOM   6602  H  HD2  . ARG B 2 4  ? 50.500 13.568  -3.277  1.00 0.00  ? 147 ARG B HD2  4  
ATOM   6603  H  HD3  . ARG B 2 4  ? 49.720 14.134  -1.787  1.00 0.00  ? 147 ARG B HD3  4  
ATOM   6604  H  HE   . ARG B 2 4  ? 52.026 14.226  -0.770  1.00 0.00  ? 147 ARG B HE   4  
ATOM   6605  H  HH11 . ARG B 2 4  ? 53.487 12.755  -2.918  1.00 0.00  ? 147 ARG B HH11 4  
ATOM   6606  H  HH12 . ARG B 2 4  ? 54.202 14.043  -3.827  1.00 0.00  ? 147 ARG B HH12 4  
ATOM   6607  H  HH21 . ARG B 2 4  ? 52.153 16.486  -2.453  1.00 0.00  ? 147 ARG B HH21 4  
ATOM   6608  H  HH22 . ARG B 2 4  ? 53.444 16.166  -3.561  1.00 0.00  ? 147 ARG B HH22 4  
ATOM   6609  N  N    . ILE B 2 5  ? 52.015 8.119   -1.854  1.00 0.00  ? 148 ILE B N    4  
ATOM   6610  C  CA   . ILE B 2 5  ? 51.849 6.880   -1.031  1.00 0.00  ? 148 ILE B CA   4  
ATOM   6611  C  C    . ILE B 2 5  ? 52.102 7.189   0.451   1.00 0.00  ? 148 ILE B C    4  
ATOM   6612  O  O    . ILE B 2 5  ? 53.178 7.613   0.832   1.00 0.00  ? 148 ILE B O    4  
ATOM   6613  C  CB   . ILE B 2 5  ? 52.894 5.890   -1.568  1.00 0.00  ? 148 ILE B CB   4  
ATOM   6614  C  CG1  . ILE B 2 5  ? 52.413 5.305   -2.902  1.00 0.00  ? 148 ILE B CG1  4  
ATOM   6615  C  CG2  . ILE B 2 5  ? 53.093 4.748   -0.563  1.00 0.00  ? 148 ILE B CG2  4  
ATOM   6616  C  CD1  . ILE B 2 5  ? 52.764 6.259   -4.048  1.00 0.00  ? 148 ILE B CD1  4  
ATOM   6617  H  H    . ILE B 2 5  ? 52.902 8.364   -2.195  1.00 0.00  ? 148 ILE B H    4  
ATOM   6618  H  HA   . ILE B 2 5  ? 50.858 6.473   -1.163  1.00 0.00  ? 148 ILE B HA   4  
ATOM   6619  H  HB   . ILE B 2 5  ? 53.833 6.404   -1.715  1.00 0.00  ? 148 ILE B HB   4  
ATOM   6620  H  HG12 . ILE B 2 5  ? 52.895 4.353   -3.070  1.00 0.00  ? 148 ILE B HG12 4  
ATOM   6621  H  HG13 . ILE B 2 5  ? 51.343 5.165   -2.868  1.00 0.00  ? 148 ILE B HG13 4  
ATOM   6622  H  HG21 . ILE B 2 5  ? 52.131 4.384   -0.235  1.00 0.00  ? 148 ILE B HG21 4  
ATOM   6623  H  HG22 . ILE B 2 5  ? 53.652 5.107   0.289   1.00 0.00  ? 148 ILE B HG22 4  
ATOM   6624  H  HG23 . ILE B 2 5  ? 53.639 3.945   -1.036  1.00 0.00  ? 148 ILE B HG23 4  
ATOM   6625  H  HD11 . ILE B 2 5  ? 51.879 6.798   -4.351  1.00 0.00  ? 148 ILE B HD11 4  
ATOM   6626  H  HD12 . ILE B 2 5  ? 53.145 5.692   -4.885  1.00 0.00  ? 148 ILE B HD12 4  
ATOM   6627  H  HD13 . ILE B 2 5  ? 53.516 6.959   -3.717  1.00 0.00  ? 148 ILE B HD13 4  
ATOM   6628  N  N    . SER B 2 6  ? 51.117 6.970   1.287   1.00 0.00  ? 149 SER B N    4  
ATOM   6629  C  CA   . SER B 2 6  ? 51.292 7.238   2.749   1.00 0.00  ? 149 SER B CA   4  
ATOM   6630  C  C    . SER B 2 6  ? 51.568 5.927   3.496   1.00 0.00  ? 149 SER B C    4  
ATOM   6631  O  O    . SER B 2 6  ? 51.112 4.871   3.100   1.00 0.00  ? 149 SER B O    4  
ATOM   6632  C  CB   . SER B 2 6  ? 49.964 7.846   3.203   1.00 0.00  ? 149 SER B CB   4  
ATOM   6633  O  OG   . SER B 2 6  ? 49.914 7.860   4.626   1.00 0.00  ? 149 SER B OG   4  
ATOM   6634  H  H    . SER B 2 6  ? 50.264 6.622   0.953   1.00 0.00  ? 149 SER B H    4  
ATOM   6635  H  HA   . SER B 2 6  ? 52.094 7.941   2.911   1.00 0.00  ? 149 SER B HA   4  
ATOM   6636  H  HB2  . SER B 2 6  ? 49.884 8.854   2.835   1.00 0.00  ? 149 SER B HB2  4  
ATOM   6637  H  HB3  . SER B 2 6  ? 49.148 7.256   2.809   1.00 0.00  ? 149 SER B HB3  4  
ATOM   6638  H  HG   . SER B 2 6  ? 49.848 8.775   4.913   1.00 0.00  ? 149 SER B HG   4  
ATOM   6639  N  N    . ALA B 2 7  ? 52.309 5.990   4.576   1.00 0.00  ? 150 ALA B N    4  
ATOM   6640  C  CA   . ALA B 2 7  ? 52.618 4.748   5.357   1.00 0.00  ? 150 ALA B CA   4  
ATOM   6641  C  C    . ALA B 2 7  ? 51.324 4.075   5.843   1.00 0.00  ? 150 ALA B C    4  
ATOM   6642  O  O    . ALA B 2 7  ? 51.202 2.865   5.816   1.00 0.00  ? 150 ALA B O    4  
ATOM   6643  C  CB   . ALA B 2 7  ? 53.462 5.222   6.545   1.00 0.00  ? 150 ALA B CB   4  
ATOM   6644  H  H    . ALA B 2 7  ? 52.661 6.855   4.874   1.00 0.00  ? 150 ALA B H    4  
ATOM   6645  H  HA   . ALA B 2 7  ? 53.188 4.062   4.753   1.00 0.00  ? 150 ALA B HA   4  
ATOM   6646  H  HB1  . ALA B 2 7  ? 54.499 5.283   6.248   1.00 0.00  ? 150 ALA B HB1  4  
ATOM   6647  H  HB2  . ALA B 2 7  ? 53.363 4.522   7.361   1.00 0.00  ? 150 ALA B HB2  4  
ATOM   6648  H  HB3  . ALA B 2 7  ? 53.123 6.197   6.864   1.00 0.00  ? 150 ALA B HB3  4  
ATOM   6649  N  N    . ASP B 2 8  ? 50.358 4.848   6.278   1.00 0.00  ? 151 ASP B N    4  
ATOM   6650  C  CA   . ASP B 2 8  ? 49.071 4.253   6.757   1.00 0.00  ? 151 ASP B CA   4  
ATOM   6651  C  C    . ASP B 2 8  ? 48.219 3.797   5.563   1.00 0.00  ? 151 ASP B C    4  
ATOM   6652  O  O    . ASP B 2 8  ? 47.729 2.683   5.531   1.00 0.00  ? 151 ASP B O    4  
ATOM   6653  C  CB   . ASP B 2 8  ? 48.372 5.382   7.524   1.00 0.00  ? 151 ASP B CB   4  
ATOM   6654  C  CG   . ASP B 2 8  ? 47.175 4.820   8.293   1.00 0.00  ? 151 ASP B CG   4  
ATOM   6655  O  OD1  . ASP B 2 8  ? 47.371 4.374   9.411   1.00 0.00  ? 151 ASP B OD1  4  
ATOM   6656  O  OD2  . ASP B 2 8  ? 46.083 4.847   7.751   1.00 0.00  ? 151 ASP B OD2  4  
ATOM   6657  H  H    . ASP B 2 8  ? 50.477 5.821   6.283   1.00 0.00  ? 151 ASP B H    4  
ATOM   6658  H  HA   . ASP B 2 8  ? 49.264 3.422   7.419   1.00 0.00  ? 151 ASP B HA   4  
ATOM   6659  H  HB2  . ASP B 2 8  ? 49.068 5.826   8.220   1.00 0.00  ? 151 ASP B HB2  4  
ATOM   6660  H  HB3  . ASP B 2 8  ? 48.030 6.133   6.829   1.00 0.00  ? 151 ASP B HB3  4  
ATOM   6661  N  N    . ALA B 2 9  ? 48.043 4.652   4.583   1.00 0.00  ? 152 ALA B N    4  
ATOM   6662  C  CA   . ALA B 2 9  ? 47.226 4.278   3.384   1.00 0.00  ? 152 ALA B CA   4  
ATOM   6663  C  C    . ALA B 2 9  ? 47.816 3.038   2.694   1.00 0.00  ? 152 ALA B C    4  
ATOM   6664  O  O    . ALA B 2 9  ? 47.098 2.122   2.340   1.00 0.00  ? 152 ALA B O    4  
ATOM   6665  C  CB   . ALA B 2 9  ? 47.289 5.497   2.459   1.00 0.00  ? 152 ALA B CB   4  
ATOM   6666  H  H    . ALA B 2 9  ? 48.452 5.541   4.637   1.00 0.00  ? 152 ALA B H    4  
ATOM   6667  H  HA   . ALA B 2 9  ? 46.204 4.091   3.673   1.00 0.00  ? 152 ALA B HA   4  
ATOM   6668  H  HB1  . ALA B 2 9  ? 46.670 5.323   1.591   1.00 0.00  ? 152 ALA B HB1  4  
ATOM   6669  H  HB2  . ALA B 2 9  ? 48.310 5.660   2.146   1.00 0.00  ? 152 ALA B HB2  4  
ATOM   6670  H  HB3  . ALA B 2 9  ? 46.930 6.368   2.988   1.00 0.00  ? 152 ALA B HB3  4  
ATOM   6671  N  N    . MET B 2 10 ? 49.116 2.995   2.513   1.00 0.00  ? 153 MET B N    4  
ATOM   6672  C  CA   . MET B 2 10 ? 49.742 1.801   1.859   1.00 0.00  ? 153 MET B CA   4  
ATOM   6673  C  C    . MET B 2 10 ? 49.571 0.567   2.757   1.00 0.00  ? 153 MET B C    4  
ATOM   6674  O  O    . MET B 2 10 ? 49.324 -0.524  2.279   1.00 0.00  ? 153 MET B O    4  
ATOM   6675  C  CB   . MET B 2 10 ? 51.224 2.155   1.686   1.00 0.00  ? 153 MET B CB   4  
ATOM   6676  C  CG   . MET B 2 10 ? 51.807 1.360   0.514   1.00 0.00  ? 153 MET B CG   4  
ATOM   6677  S  SD   . MET B 2 10 ? 51.207 2.053   -1.047  1.00 0.00  ? 153 MET B SD   4  
ATOM   6678  C  CE   . MET B 2 10 ? 52.746 1.871   -1.983  1.00 0.00  ? 153 MET B CE   4  
ATOM   6679  H  H    . MET B 2 10 ? 49.679 3.740   2.817   1.00 0.00  ? 153 MET B H    4  
ATOM   6680  H  HA   . MET B 2 10 ? 49.290 1.625   0.895   1.00 0.00  ? 153 MET B HA   4  
ATOM   6681  H  HB2  . MET B 2 10 ? 51.320 3.213   1.487   1.00 0.00  ? 153 MET B HB2  4  
ATOM   6682  H  HB3  . MET B 2 10 ? 51.763 1.909   2.589   1.00 0.00  ? 153 MET B HB3  4  
ATOM   6683  H  HG2  . MET B 2 10 ? 52.885 1.417   0.541   1.00 0.00  ? 153 MET B HG2  4  
ATOM   6684  H  HG3  . MET B 2 10 ? 51.500 0.327   0.590   1.00 0.00  ? 153 MET B HG3  4  
ATOM   6685  H  HE1  . MET B 2 10 ? 53.585 2.128   -1.349  1.00 0.00  ? 153 MET B HE1  4  
ATOM   6686  H  HE2  . MET B 2 10 ? 52.731 2.529   -2.838  1.00 0.00  ? 153 MET B HE2  4  
ATOM   6687  H  HE3  . MET B 2 10 ? 52.843 0.847   -2.319  1.00 0.00  ? 153 MET B HE3  4  
ATOM   6688  N  N    . MET B 2 11 ? 49.680 0.738   4.055   1.00 0.00  ? 154 MET B N    4  
ATOM   6689  C  CA   . MET B 2 11 ? 49.499 -0.419  4.988   1.00 0.00  ? 154 MET B CA   4  
ATOM   6690  C  C    . MET B 2 11 ? 48.075 -0.976  4.849   1.00 0.00  ? 154 MET B C    4  
ATOM   6691  O  O    . MET B 2 11 ? 47.869 -2.175  4.808   1.00 0.00  ? 154 MET B O    4  
ATOM   6692  C  CB   . MET B 2 11 ? 49.720 0.155   6.393   1.00 0.00  ? 154 MET B CB   4  
ATOM   6693  C  CG   . MET B 2 11 ? 51.177 -0.058  6.809   1.00 0.00  ? 154 MET B CG   4  
ATOM   6694  S  SD   . MET B 2 11 ? 51.443 -1.806  7.193   1.00 0.00  ? 154 MET B SD   4  
ATOM   6695  C  CE   . MET B 2 11 ? 50.979 -1.725  8.940   1.00 0.00  ? 154 MET B CE   4  
ATOM   6696  H  H    . MET B 2 11 ? 49.864 1.632   4.416   1.00 0.00  ? 154 MET B H    4  
ATOM   6697  H  HA   . MET B 2 11 ? 50.226 -1.189  4.782   1.00 0.00  ? 154 MET B HA   4  
ATOM   6698  H  HB2  . MET B 2 11 ? 49.498 1.212   6.390   1.00 0.00  ? 154 MET B HB2  4  
ATOM   6699  H  HB3  . MET B 2 11 ? 49.071 -0.346  7.095   1.00 0.00  ? 154 MET B HB3  4  
ATOM   6700  H  HG2  . MET B 2 11 ? 51.830 0.238   6.002   1.00 0.00  ? 154 MET B HG2  4  
ATOM   6701  H  HG3  . MET B 2 11 ? 51.392 0.539   7.683   1.00 0.00  ? 154 MET B HG3  4  
ATOM   6702  H  HE1  . MET B 2 11 ? 50.312 -2.543  9.173   1.00 0.00  ? 154 MET B HE1  4  
ATOM   6703  H  HE2  . MET B 2 11 ? 50.482 -0.791  9.140   1.00 0.00  ? 154 MET B HE2  4  
ATOM   6704  H  HE3  . MET B 2 11 ? 51.867 -1.793  9.550   1.00 0.00  ? 154 MET B HE3  4  
ATOM   6705  N  N    . GLN B 2 12 ? 47.095 -0.107  4.756   1.00 0.00  ? 155 GLN B N    4  
ATOM   6706  C  CA   . GLN B 2 12 ? 45.680 -0.569  4.595   1.00 0.00  ? 155 GLN B CA   4  
ATOM   6707  C  C    . GLN B 2 12 ? 45.501 -1.246  3.229   1.00 0.00  ? 155 GLN B C    4  
ATOM   6708  O  O    . GLN B 2 12 ? 44.764 -2.206  3.094   1.00 0.00  ? 155 GLN B O    4  
ATOM   6709  C  CB   . GLN B 2 12 ? 44.834 0.706   4.679   1.00 0.00  ? 155 GLN B CB   4  
ATOM   6710  C  CG   . GLN B 2 12 ? 43.388 0.339   5.023   1.00 0.00  ? 155 GLN B CG   4  
ATOM   6711  C  CD   . GLN B 2 12 ? 42.448 1.453   4.556   1.00 0.00  ? 155 GLN B CD   4  
ATOM   6712  O  OE1  . GLN B 2 12 ? 42.274 1.660   3.373   1.00 0.00  ? 155 GLN B OE1  4  
ATOM   6713  N  NE2  . GLN B 2 12 ? 41.828 2.183   5.440   1.00 0.00  ? 155 GLN B NE2  4  
ATOM   6714  H  H    . GLN B 2 12 ? 47.294 0.854   4.777   1.00 0.00  ? 155 GLN B H    4  
ATOM   6715  H  HA   . GLN B 2 12 ? 45.410 -1.246  5.390   1.00 0.00  ? 155 GLN B HA   4  
ATOM   6716  H  HB2  . GLN B 2 12 ? 45.235 1.355   5.445   1.00 0.00  ? 155 GLN B HB2  4  
ATOM   6717  H  HB3  . GLN B 2 12 ? 44.857 1.217   3.727   1.00 0.00  ? 155 GLN B HB3  4  
ATOM   6718  H  HG2  . GLN B 2 12 ? 43.124 -0.584  4.529   1.00 0.00  ? 155 GLN B HG2  4  
ATOM   6719  H  HG3  . GLN B 2 12 ? 43.293 0.215   6.091   1.00 0.00  ? 155 GLN B HG3  4  
ATOM   6720  H  HE21 . GLN B 2 12 ? 41.964 2.018   6.396   1.00 0.00  ? 155 GLN B HE21 4  
ATOM   6721  H  HE22 . GLN B 2 12 ? 41.226 2.898   5.148   1.00 0.00  ? 155 GLN B HE22 4  
ATOM   6722  N  N    . ALA B 2 13 ? 46.177 -0.754  2.219   1.00 0.00  ? 156 ALA B N    4  
ATOM   6723  C  CA   . ALA B 2 13 ? 46.063 -1.366  0.859   1.00 0.00  ? 156 ALA B CA   4  
ATOM   6724  C  C    . ALA B 2 13 ? 46.687 -2.768  0.857   1.00 0.00  ? 156 ALA B C    4  
ATOM   6725  O  O    . ALA B 2 13 ? 46.140 -3.698  0.292   1.00 0.00  ? 156 ALA B O    4  
ATOM   6726  C  CB   . ALA B 2 13 ? 46.842 -0.423  -0.062  1.00 0.00  ? 156 ALA B CB   4  
ATOM   6727  H  H    . ALA B 2 13 ? 46.767 0.016   2.358   1.00 0.00  ? 156 ALA B H    4  
ATOM   6728  H  HA   . ALA B 2 13 ? 45.031 -1.413  0.552   1.00 0.00  ? 156 ALA B HA   4  
ATOM   6729  H  HB1  . ALA B 2 13 ? 46.304 0.508   -0.164  1.00 0.00  ? 156 ALA B HB1  4  
ATOM   6730  H  HB2  . ALA B 2 13 ? 46.957 -0.881  -1.033  1.00 0.00  ? 156 ALA B HB2  4  
ATOM   6731  H  HB3  . ALA B 2 13 ? 47.817 -0.230  0.363   1.00 0.00  ? 156 ALA B HB3  4  
ATOM   6732  N  N    . LEU B 2 14 ? 47.824 -2.922  1.491   1.00 0.00  ? 157 LEU B N    4  
ATOM   6733  C  CA   . LEU B 2 14 ? 48.497 -4.260  1.543   1.00 0.00  ? 157 LEU B CA   4  
ATOM   6734  C  C    . LEU B 2 14 ? 47.571 -5.319  2.158   1.00 0.00  ? 157 LEU B C    4  
ATOM   6735  O  O    . LEU B 2 14 ? 47.612 -6.475  1.786   1.00 0.00  ? 157 LEU B O    4  
ATOM   6736  C  CB   . LEU B 2 14 ? 49.728 -4.051  2.431   1.00 0.00  ? 157 LEU B CB   4  
ATOM   6737  C  CG   . LEU B 2 14 ? 50.942 -3.735  1.557   1.00 0.00  ? 157 LEU B CG   4  
ATOM   6738  C  CD1  . LEU B 2 14 ? 51.933 -2.880  2.348   1.00 0.00  ? 157 LEU B CD1  4  
ATOM   6739  C  CD2  . LEU B 2 14 ? 51.621 -5.040  1.134   1.00 0.00  ? 157 LEU B CD2  4  
ATOM   6740  H  H    . LEU B 2 14 ? 48.237 -2.154  1.940   1.00 0.00  ? 157 LEU B H    4  
ATOM   6741  H  HA   . LEU B 2 14 ? 48.806 -4.562  0.555   1.00 0.00  ? 157 LEU B HA   4  
ATOM   6742  H  HB2  . LEU B 2 14 ? 49.546 -3.229  3.109   1.00 0.00  ? 157 LEU B HB2  4  
ATOM   6743  H  HB3  . LEU B 2 14 ? 49.920 -4.949  2.999   1.00 0.00  ? 157 LEU B HB3  4  
ATOM   6744  H  HG   . LEU B 2 14 ? 50.622 -3.193  0.678   1.00 0.00  ? 157 LEU B HG   4  
ATOM   6745  H  HD11 . LEU B 2 14 ? 52.283 -2.069  1.726   1.00 0.00  ? 157 LEU B HD11 4  
ATOM   6746  H  HD12 . LEU B 2 14 ? 52.772 -3.488  2.652   1.00 0.00  ? 157 LEU B HD12 4  
ATOM   6747  H  HD13 . LEU B 2 14 ? 51.444 -2.477  3.223   1.00 0.00  ? 157 LEU B HD13 4  
ATOM   6748  H  HD21 . LEU B 2 14 ? 50.889 -5.698  0.689   1.00 0.00  ? 157 LEU B HD21 4  
ATOM   6749  H  HD22 . LEU B 2 14 ? 52.056 -5.518  1.999   1.00 0.00  ? 157 LEU B HD22 4  
ATOM   6750  H  HD23 . LEU B 2 14 ? 52.397 -4.825  0.414   1.00 0.00  ? 157 LEU B HD23 4  
ATOM   6751  N  N    . LEU B 2 15 ? 46.745 -4.934  3.102   1.00 0.00  ? 158 LEU B N    4  
ATOM   6752  C  CA   . LEU B 2 15 ? 45.824 -5.920  3.747   1.00 0.00  ? 158 LEU B CA   4  
ATOM   6753  C  C    . LEU B 2 15 ? 44.370 -5.419  3.703   1.00 0.00  ? 158 LEU B C    4  
ATOM   6754  O  O    . LEU B 2 15 ? 43.729 -5.261  4.726   1.00 0.00  ? 158 LEU B O    4  
ATOM   6755  C  CB   . LEU B 2 15 ? 46.324 -6.020  5.193   1.00 0.00  ? 158 LEU B CB   4  
ATOM   6756  C  CG   . LEU B 2 15 ? 47.532 -6.958  5.256   1.00 0.00  ? 158 LEU B CG   4  
ATOM   6757  C  CD1  . LEU B 2 15 ? 48.666 -6.288  6.033   1.00 0.00  ? 158 LEU B CD1  4  
ATOM   6758  C  CD2  . LEU B 2 15 ? 47.130 -8.254  5.961   1.00 0.00  ? 158 LEU B CD2  4  
ATOM   6759  H  H    . LEU B 2 15 ? 46.736 -3.998  3.392   1.00 0.00  ? 158 LEU B H    4  
ATOM   6760  H  HA   . LEU B 2 15 ? 45.903 -6.881  3.265   1.00 0.00  ? 158 LEU B HA   4  
ATOM   6761  H  HB2  . LEU B 2 15 ? 46.612 -5.038  5.541   1.00 0.00  ? 158 LEU B HB2  4  
ATOM   6762  H  HB3  . LEU B 2 15 ? 45.536 -6.407  5.820   1.00 0.00  ? 158 LEU B HB3  4  
ATOM   6763  H  HG   . LEU B 2 15 ? 47.867 -7.181  4.253   1.00 0.00  ? 158 LEU B HG   4  
ATOM   6764  H  HD11 . LEU B 2 15 ? 49.613 -6.675  5.691   1.00 0.00  ? 158 LEU B HD11 4  
ATOM   6765  H  HD12 . LEU B 2 15 ? 48.553 -6.495  7.086   1.00 0.00  ? 158 LEU B HD12 4  
ATOM   6766  H  HD13 . LEU B 2 15 ? 48.634 -5.221  5.871   1.00 0.00  ? 158 LEU B HD13 4  
ATOM   6767  H  HD21 . LEU B 2 15 ? 46.636 -8.020  6.892   1.00 0.00  ? 158 LEU B HD21 4  
ATOM   6768  H  HD22 . LEU B 2 15 ? 48.012 -8.846  6.159   1.00 0.00  ? 158 LEU B HD22 4  
ATOM   6769  H  HD23 . LEU B 2 15 ? 46.457 -8.813  5.328   1.00 0.00  ? 158 LEU B HD23 4  
ATOM   6770  N  N    . GLY B 2 16 ? 43.841 -5.175  2.528   1.00 0.00  ? 159 GLY B N    4  
ATOM   6771  C  CA   . GLY B 2 16 ? 42.426 -4.693  2.434   1.00 0.00  ? 159 GLY B CA   4  
ATOM   6772  C  C    . GLY B 2 16 ? 42.073 -4.324  0.989   1.00 0.00  ? 159 GLY B C    4  
ATOM   6773  O  O    . GLY B 2 16 ? 41.085 -4.789  0.453   1.00 0.00  ? 159 GLY B O    4  
ATOM   6774  H  H    . GLY B 2 16 ? 44.369 -5.313  1.713   1.00 0.00  ? 159 GLY B H    4  
ATOM   6775  H  HA2  . GLY B 2 16 ? 41.761 -5.474  2.775   1.00 0.00  ? 159 GLY B HA2  4  
ATOM   6776  H  HA3  . GLY B 2 16 ? 42.303 -3.823  3.062   1.00 0.00  ? 159 GLY B HA3  4  
ATOM   6777  N  N    . ALA B 2 17 ? 42.862 -3.486  0.359   1.00 0.00  ? 160 ALA B N    4  
ATOM   6778  C  CA   . ALA B 2 17 ? 42.559 -3.077  -1.054  1.00 0.00  ? 160 ALA B CA   4  
ATOM   6779  C  C    . ALA B 2 17 ? 42.531 -4.299  -1.983  1.00 0.00  ? 160 ALA B C    4  
ATOM   6780  O  O    . ALA B 2 17 ? 41.565 -4.529  -2.685  1.00 0.00  ? 160 ALA B O    4  
ATOM   6781  C  CB   . ALA B 2 17 ? 43.691 -2.125  -1.449  1.00 0.00  ? 160 ALA B CB   4  
ATOM   6782  H  H    . ALA B 2 17 ? 43.648 -3.119  0.817   1.00 0.00  ? 160 ALA B H    4  
ATOM   6783  H  HA   . ALA B 2 17 ? 41.614 -2.557  -1.097  1.00 0.00  ? 160 ALA B HA   4  
ATOM   6784  H  HB1  . ALA B 2 17 ? 43.756 -1.323  -0.729  1.00 0.00  ? 160 ALA B HB1  4  
ATOM   6785  H  HB2  . ALA B 2 17 ? 43.490 -1.713  -2.427  1.00 0.00  ? 160 ALA B HB2  4  
ATOM   6786  H  HB3  . ALA B 2 17 ? 44.626 -2.665  -1.472  1.00 0.00  ? 160 ALA B HB3  4  
ATOM   6787  N  N    . ARG B 2 18 ? 43.582 -5.080  -1.993  1.00 0.00  ? 161 ARG B N    4  
ATOM   6788  C  CA   . ARG B 2 18 ? 43.619 -6.285  -2.877  1.00 0.00  ? 161 ARG B CA   4  
ATOM   6789  C  C    . ARG B 2 18 ? 44.171 -7.494  -2.102  1.00 0.00  ? 161 ARG B C    4  
ATOM   6790  O  O    . ARG B 2 18 ? 44.929 -8.289  -2.627  1.00 0.00  ? 161 ARG B O    4  
ATOM   6791  C  CB   . ARG B 2 18 ? 44.554 -5.890  -4.025  1.00 0.00  ? 161 ARG B CB   4  
ATOM   6792  C  CG   . ARG B 2 18 ? 43.765 -5.822  -5.335  1.00 0.00  ? 161 ARG B CG   4  
ATOM   6793  C  CD   . ARG B 2 18 ? 44.267 -4.643  -6.175  1.00 0.00  ? 161 ARG B CD   4  
ATOM   6794  N  NE   . ARG B 2 18 ? 43.243 -3.572  -5.989  1.00 0.00  ? 161 ARG B NE   4  
ATOM   6795  C  CZ   . ARG B 2 18 ? 42.913 -2.798  -6.986  1.00 0.00  ? 161 ARG B CZ   4  
ATOM   6796  N  NH1  . ARG B 2 18 ? 43.645 -1.761  -7.276  1.00 0.00  ? 161 ARG B NH1  4  
ATOM   6797  N  NH2  . ARG B 2 18 ? 41.849 -3.064  -7.688  1.00 0.00  ? 161 ARG B NH2  4  
ATOM   6798  H  H    . ARG B 2 18 ? 44.351 -4.872  -1.421  1.00 0.00  ? 161 ARG B H    4  
ATOM   6799  H  HA   . ARG B 2 18 ? 42.635 -6.503  -3.260  1.00 0.00  ? 161 ARG B HA   4  
ATOM   6800  H  HB2  . ARG B 2 18 ? 44.987 -4.921  -3.816  1.00 0.00  ? 161 ARG B HB2  4  
ATOM   6801  H  HB3  . ARG B 2 18 ? 45.341 -6.622  -4.119  1.00 0.00  ? 161 ARG B HB3  4  
ATOM   6802  H  HG2  . ARG B 2 18 ? 43.903 -6.741  -5.886  1.00 0.00  ? 161 ARG B HG2  4  
ATOM   6803  H  HG3  . ARG B 2 18 ? 42.715 -5.687  -5.119  1.00 0.00  ? 161 ARG B HG3  4  
ATOM   6804  H  HD2  . ARG B 2 18 ? 45.232 -4.312  -5.815  1.00 0.00  ? 161 ARG B HD2  4  
ATOM   6805  H  HD3  . ARG B 2 18 ? 44.328 -4.923  -7.215  1.00 0.00  ? 161 ARG B HD3  4  
ATOM   6806  H  HE   . ARG B 2 18 ? 42.816 -3.449  -5.115  1.00 0.00  ? 161 ARG B HE   4  
ATOM   6807  H  HH11 . ARG B 2 18 ? 44.459 -1.557  -6.735  1.00 0.00  ? 161 ARG B HH11 4  
ATOM   6808  H  HH12 . ARG B 2 18 ? 43.393 -1.166  -8.039  1.00 0.00  ? 161 ARG B HH12 4  
ATOM   6809  H  HH21 . ARG B 2 18 ? 41.288 -3.860  -7.462  1.00 0.00  ? 161 ARG B HH21 4  
ATOM   6810  H  HH22 . ARG B 2 18 ? 41.591 -2.472  -8.452  1.00 0.00  ? 161 ARG B HH22 4  
ATOM   6811  N  N    . ALA B 2 19 ? 43.795 -7.633  -0.853  1.00 0.00  ? 162 ALA B N    4  
ATOM   6812  C  CA   . ALA B 2 19 ? 44.292 -8.782  -0.034  1.00 0.00  ? 162 ALA B CA   4  
ATOM   6813  C  C    . ALA B 2 19 ? 43.318 -9.075  1.117   1.00 0.00  ? 162 ALA B C    4  
ATOM   6814  O  O    . ALA B 2 19 ? 43.364 -8.444  2.158   1.00 0.00  ? 162 ALA B O    4  
ATOM   6815  C  CB   . ALA B 2 19 ? 45.649 -8.320  0.508   1.00 0.00  ? 162 ALA B CB   4  
ATOM   6816  H  H    . ALA B 2 19 ? 43.184 -6.980  -0.452  1.00 0.00  ? 162 ALA B H    4  
ATOM   6817  H  HA   . ALA B 2 19 ? 44.421 -9.658  -0.650  1.00 0.00  ? 162 ALA B HA   4  
ATOM   6818  H  HB1  . ALA B 2 19 ? 46.406 -8.460  -0.250  1.00 0.00  ? 162 ALA B HB1  4  
ATOM   6819  H  HB2  . ALA B 2 19 ? 45.904 -8.899  1.384   1.00 0.00  ? 162 ALA B HB2  4  
ATOM   6820  H  HB3  . ALA B 2 19 ? 45.594 -7.274  0.771   1.00 0.00  ? 162 ALA B HB3  4  
ATOM   6821  N  N    . LYS B 2 20 ? 42.439 -10.028 0.935   1.00 0.00  ? 163 LYS B N    4  
ATOM   6822  C  CA   . LYS B 2 20 ? 41.459 -10.370 2.014   1.00 0.00  ? 163 LYS B CA   4  
ATOM   6823  C  C    . LYS B 2 20 ? 40.878 -11.778 1.798   1.00 0.00  ? 163 LYS B C    4  
ATOM   6824  O  O    . LYS B 2 20 ? 40.459 -12.377 2.774   1.00 0.00  ? 163 LYS B O    4  
ATOM   6825  C  CB   . LYS B 2 20 ? 40.363 -9.295  1.922   1.00 0.00  ? 163 LYS B CB   4  
ATOM   6826  C  CG   . LYS B 2 20 ? 39.615 -9.403  0.585   1.00 0.00  ? 163 LYS B CG   4  
ATOM   6827  C  CD   . LYS B 2 20 ? 38.111 -9.540  0.845   1.00 0.00  ? 163 LYS B CD   4  
ATOM   6828  C  CE   . LYS B 2 20 ? 37.799 -10.940 1.395   1.00 0.00  ? 163 LYS B CE   4  
ATOM   6829  N  NZ   . LYS B 2 20 ? 37.969 -11.870 0.236   1.00 0.00  ? 163 LYS B NZ   4  
ATOM   6830  O  OXT  . LYS B 2 20 ? 40.855 -12.232 0.662   1.00 0.00  ? 163 LYS B OXT  4  
ATOM   6831  H  H    . LYS B 2 20 ? 42.421 -10.522 0.089   1.00 0.00  ? 163 LYS B H    4  
ATOM   6832  H  HA   . LYS B 2 20 ? 41.938 -10.315 2.978   1.00 0.00  ? 163 LYS B HA   4  
ATOM   6833  H  HB2  . LYS B 2 20 ? 39.665 -9.426  2.736   1.00 0.00  ? 163 LYS B HB2  4  
ATOM   6834  H  HB3  . LYS B 2 20 ? 40.817 -8.317  1.997   1.00 0.00  ? 163 LYS B HB3  4  
ATOM   6835  H  HG2  . LYS B 2 20 ? 39.799 -8.513  0.000   1.00 0.00  ? 163 LYS B HG2  4  
ATOM   6836  H  HG3  . LYS B 2 20 ? 39.965 -10.266 0.042   1.00 0.00  ? 163 LYS B HG3  4  
ATOM   6837  H  HD2  . LYS B 2 20 ? 37.803 -8.794  1.564   1.00 0.00  ? 163 LYS B HD2  4  
ATOM   6838  H  HD3  . LYS B 2 20 ? 37.573 -9.391  -0.079  1.00 0.00  ? 163 LYS B HD3  4  
ATOM   6839  H  HE2  . LYS B 2 20 ? 38.491 -11.192 2.187   1.00 0.00  ? 163 LYS B HE2  4  
ATOM   6840  H  HE3  . LYS B 2 20 ? 36.783 -10.982 1.758   1.00 0.00  ? 163 LYS B HE3  4  
ATOM   6841  H  HZ1  . LYS B 2 20 ? 37.356 -12.700 0.363   1.00 0.00  ? 163 LYS B HZ1  4  
ATOM   6842  H  HZ2  . LYS B 2 20 ? 38.963 -12.179 0.185   1.00 0.00  ? 163 LYS B HZ2  4  
ATOM   6843  H  HZ3  . LYS B 2 20 ? 37.712 -11.385 -0.646  1.00 0.00  ? 163 LYS B HZ3  4  
HETATM 6844  CA CA   . CA  C 3 .  ? 69.007 -2.311  -2.173  1.00 0.00  ? 90  CA  A CA   4  
HETATM 6845  O  OAA  . SXK D 4 .  ? 56.772 12.277  -4.531  1.00 20.00 ? 91  SXK A OAA  4  
HETATM 6846  O  OAB  . SXK D 4 .  ? 58.929 12.784  -4.694  1.00 20.00 ? 91  SXK A OAB  4  
HETATM 6847  C  CAE  . SXK D 4 .  ? 56.250 2.964   -0.164  1.00 20.00 ? 91  SXK A CAE  4  
HETATM 6848  C  CAF  . SXK D 4 .  ? 56.283 8.152   -3.122  1.00 20.00 ? 91  SXK A CAF  4  
HETATM 6849  C  CAG  . SXK D 4 .  ? 58.034 8.333   -1.393  1.00 20.00 ? 91  SXK A CAG  4  
HETATM 6850  C  CAH  . SXK D 4 .  ? 56.175 6.765   -2.872  1.00 20.00 ? 91  SXK A CAH  4  
HETATM 6851  C  CAI  . SXK D 4 .  ? 57.932 6.952   -1.138  1.00 20.00 ? 91  SXK A CAI  4  
HETATM 6852  C  CAJ  . SXK D 4 .  ? 56.342 4.354   -0.415  1.00 20.00 ? 91  SXK A CAJ  4  
HETATM 6853  C  CAK  . SXK D 4 .  ? 57.266 2.472   -2.335  1.00 20.00 ? 91  SXK A CAK  4  
HETATM 6854  C  CAL  . SXK D 4 .  ? 58.368 10.900  -3.359  1.00 20.00 ? 91  SXK A CAL  4  
HETATM 6855  O  OAM  . SXK D 4 .  ? 57.235 10.265  -2.716  1.00 20.00 ? 91  SXK A OAM  4  
HETATM 6856  C  CAN  . SXK D 4 .  ? 57.988 12.083  -4.269  1.00 20.00 ? 91  SXK A CAN  4  
HETATM 6857  C  CAO  . SXK D 4 .  ? 56.711 2.044   -1.124  1.00 20.00 ? 91  SXK A CAO  4  
HETATM 6858  C  CAP  . SXK D 4 .  ? 57.216 8.934   -2.377  1.00 20.00 ? 91  SXK A CAP  4  
HETATM 6859  C  CAQ  . SXK D 4 .  ? 57.362 3.857   -2.596  1.00 20.00 ? 91  SXK A CAQ  4  
HETATM 6860  C  CAR  . SXK D 4 .  ? 57.003 6.167   -1.879  1.00 20.00 ? 91  SXK A CAR  4  
HETATM 6861  C  CAS  . SXK D 4 .  ? 56.899 4.793   -1.630  1.00 20.00 ? 91  SXK A CAS  4  
HETATM 6862  F  FCC  . SXK D 4 .  ? 56.615 0.712   -0.865  1.00 20.00 ? 91  SXK A FCC  4  
HETATM 6863  F  FDD  . SXK D 4 .  ? 57.909 4.250   -3.787  1.00 20.00 ? 91  SXK A FDD  4  
HETATM 6864  H  HAE  . SXK D 4 .  ? 55.824 2.603   0.770   1.00 20.00 ? 91  SXK A HAE  4  
HETATM 6865  H  HAF  . SXK D 4 .  ? 55.657 8.626   -3.883  1.00 20.00 ? 91  SXK A HAF  4  
HETATM 6866  H  HAG  . SXK D 4 .  ? 58.751 8.924   -0.820  1.00 20.00 ? 91  SXK A HAG  4  
HETATM 6867  H  HAH  . SXK D 4 .  ? 55.462 6.159   -3.436  1.00 20.00 ? 91  SXK A HAH  4  
HETATM 6868  H  HAI  . SXK D 4 .  ? 58.561 6.492   -0.376  1.00 20.00 ? 91  SXK A HAI  4  
HETATM 6869  H  HAJ  . SXK D 4 .  ? 55.985 5.068   0.328   1.00 20.00 ? 91  SXK A HAJ  4  
HETATM 6870  H  HAK  . SXK D 4 .  ? 57.622 1.751   -3.074  1.00 20.00 ? 91  SXK A HAK  4  
HETATM 6871  H  HAL  . SXK D 4 .  ? 59.050 11.274  -2.590  1.00 20.00 ? 91  SXK A HAL  4  
HETATM 6872  H  HALA . SXK D 4 .  ? 58.842 10.156  -4.001  1.00 20.00 ? 91  SXK A HALA 4  
ATOM   6873  N  N    . MET A 1 1  ? 71.277 14.032  9.401   1.00 0.00  ? 1   MET A N    5  
ATOM   6874  C  CA   . MET A 1 1  ? 71.065 13.452  8.039   1.00 0.00  ? 1   MET A CA   5  
ATOM   6875  C  C    . MET A 1 1  ? 71.543 11.994  7.998   1.00 0.00  ? 1   MET A C    5  
ATOM   6876  O  O    . MET A 1 1  ? 72.440 11.617  8.725   1.00 0.00  ? 1   MET A O    5  
ATOM   6877  C  CB   . MET A 1 1  ? 71.911 14.320  7.098   1.00 0.00  ? 1   MET A CB   5  
ATOM   6878  C  CG   . MET A 1 1  ? 71.153 14.558  5.789   1.00 0.00  ? 1   MET A CG   5  
ATOM   6879  S  SD   . MET A 1 1  ? 69.707 15.601  6.107   1.00 0.00  ? 1   MET A SD   5  
ATOM   6880  C  CE   . MET A 1 1  ? 69.668 16.432  4.500   1.00 0.00  ? 1   MET A CE   5  
ATOM   6881  H  H1   . MET A 1 1  ? 72.297 14.114  9.590   1.00 0.00  ? 1   MET A H1   5  
ATOM   6882  H  H2   . MET A 1 1  ? 70.843 13.408  10.114  1.00 0.00  ? 1   MET A H2   5  
ATOM   6883  H  H3   . MET A 1 1  ? 70.840 14.974  9.451   1.00 0.00  ? 1   MET A H3   5  
ATOM   6884  H  HA   . MET A 1 1  ? 70.024 13.515  7.761   1.00 0.00  ? 1   MET A HA   5  
ATOM   6885  H  HB2  . MET A 1 1  ? 72.118 15.269  7.572   1.00 0.00  ? 1   MET A HB2  5  
ATOM   6886  H  HB3  . MET A 1 1  ? 72.842 13.816  6.884   1.00 0.00  ? 1   MET A HB3  5  
ATOM   6887  H  HG2  . MET A 1 1  ? 71.804 15.052  5.082   1.00 0.00  ? 1   MET A HG2  5  
ATOM   6888  H  HG3  . MET A 1 1  ? 70.831 13.611  5.380   1.00 0.00  ? 1   MET A HG3  5  
ATOM   6889  H  HE1  . MET A 1 1  ? 70.131 17.405  4.588   1.00 0.00  ? 1   MET A HE1  5  
ATOM   6890  H  HE2  . MET A 1 1  ? 68.647 16.550  4.179   1.00 0.00  ? 1   MET A HE2  5  
ATOM   6891  H  HE3  . MET A 1 1  ? 70.204 15.837  3.774   1.00 0.00  ? 1   MET A HE3  5  
ATOM   6892  N  N    . ASP A 1 2  ? 70.945 11.183  7.149   1.00 0.00  ? 2   ASP A N    5  
ATOM   6893  C  CA   . ASP A 1 2  ? 71.343 9.737   7.025   1.00 0.00  ? 2   ASP A CA   5  
ATOM   6894  C  C    . ASP A 1 2  ? 71.187 8.987   8.365   1.00 0.00  ? 2   ASP A C    5  
ATOM   6895  O  O    . ASP A 1 2  ? 70.199 8.311   8.587   1.00 0.00  ? 2   ASP A O    5  
ATOM   6896  C  CB   . ASP A 1 2  ? 72.810 9.757   6.558   1.00 0.00  ? 2   ASP A CB   5  
ATOM   6897  C  CG   . ASP A 1 2  ? 73.358 8.328   6.491   1.00 0.00  ? 2   ASP A CG   5  
ATOM   6898  O  OD1  . ASP A 1 2  ? 72.759 7.511   5.812   1.00 0.00  ? 2   ASP A OD1  5  
ATOM   6899  O  OD2  . ASP A 1 2  ? 74.370 8.075   7.123   1.00 0.00  ? 2   ASP A OD2  5  
ATOM   6900  H  H    . ASP A 1 2  ? 70.228 11.531  6.578   1.00 0.00  ? 2   ASP A H    5  
ATOM   6901  H  HA   . ASP A 1 2  ? 70.737 9.258   6.272   1.00 0.00  ? 2   ASP A HA   5  
ATOM   6902  H  HB2  . ASP A 1 2  ? 72.868 10.208  5.579   1.00 0.00  ? 2   ASP A HB2  5  
ATOM   6903  H  HB3  . ASP A 1 2  ? 73.401 10.332  7.253   1.00 0.00  ? 2   ASP A HB3  5  
ATOM   6904  N  N    . ASP A 1 3  ? 72.154 9.093   9.249   1.00 0.00  ? 3   ASP A N    5  
ATOM   6905  C  CA   . ASP A 1 3  ? 72.071 8.381   10.566  1.00 0.00  ? 3   ASP A CA   5  
ATOM   6906  C  C    . ASP A 1 3  ? 70.802 8.779   11.334  1.00 0.00  ? 3   ASP A C    5  
ATOM   6907  O  O    . ASP A 1 3  ? 70.239 7.980   12.058  1.00 0.00  ? 3   ASP A O    5  
ATOM   6908  C  CB   . ASP A 1 3  ? 73.323 8.817   11.336  1.00 0.00  ? 3   ASP A CB   5  
ATOM   6909  C  CG   . ASP A 1 3  ? 74.519 7.981   10.881  1.00 0.00  ? 3   ASP A CG   5  
ATOM   6910  O  OD1  . ASP A 1 3  ? 74.519 6.788   11.142  1.00 0.00  ? 3   ASP A OD1  5  
ATOM   6911  O  OD2  . ASP A 1 3  ? 75.412 8.544   10.273  1.00 0.00  ? 3   ASP A OD2  5  
ATOM   6912  H  H    . ASP A 1 3  ? 72.943 9.638   9.042   1.00 0.00  ? 3   ASP A H    5  
ATOM   6913  H  HA   . ASP A 1 3  ? 72.093 7.314   10.413  1.00 0.00  ? 3   ASP A HA   5  
ATOM   6914  H  HB2  . ASP A 1 3  ? 73.519 9.862   11.146  1.00 0.00  ? 3   ASP A HB2  5  
ATOM   6915  H  HB3  . ASP A 1 3  ? 73.166 8.668   12.394  1.00 0.00  ? 3   ASP A HB3  5  
ATOM   6916  N  N    . ILE A 1 4  ? 70.347 10.003  11.184  1.00 0.00  ? 4   ILE A N    5  
ATOM   6917  C  CA   . ILE A 1 4  ? 69.113 10.441  11.914  1.00 0.00  ? 4   ILE A CA   5  
ATOM   6918  C  C    . ILE A 1 4  ? 67.932 9.507   11.587  1.00 0.00  ? 4   ILE A C    5  
ATOM   6919  O  O    . ILE A 1 4  ? 67.183 9.120   12.463  1.00 0.00  ? 4   ILE A O    5  
ATOM   6920  C  CB   . ILE A 1 4  ? 68.845 11.884  11.452  1.00 0.00  ? 4   ILE A CB   5  
ATOM   6921  C  CG1  . ILE A 1 4  ? 67.772 12.508  12.349  1.00 0.00  ? 4   ILE A CG1  5  
ATOM   6922  C  CG2  . ILE A 1 4  ? 68.369 11.911  9.996   1.00 0.00  ? 4   ILE A CG2  5  
ATOM   6923  C  CD1  . ILE A 1 4  ? 68.402 12.932  13.678  1.00 0.00  ? 4   ILE A CD1  5  
ATOM   6924  H  H    . ILE A 1 4  ? 70.819 10.630  10.596  1.00 0.00  ? 4   ILE A H    5  
ATOM   6925  H  HA   . ILE A 1 4  ? 69.297 10.432  12.976  1.00 0.00  ? 4   ILE A HA   5  
ATOM   6926  H  HB   . ILE A 1 4  ? 69.757 12.457  11.538  1.00 0.00  ? 4   ILE A HB   5  
ATOM   6927  H  HG12 . ILE A 1 4  ? 67.348 13.371  11.857  1.00 0.00  ? 4   ILE A HG12 5  
ATOM   6928  H  HG13 . ILE A 1 4  ? 66.993 11.783  12.537  1.00 0.00  ? 4   ILE A HG13 5  
ATOM   6929  H  HG21 . ILE A 1 4  ? 67.368 11.509  9.938   1.00 0.00  ? 4   ILE A HG21 5  
ATOM   6930  H  HG22 . ILE A 1 4  ? 69.033 11.314  9.388   1.00 0.00  ? 4   ILE A HG22 5  
ATOM   6931  H  HG23 . ILE A 1 4  ? 68.369 12.929  9.636   1.00 0.00  ? 4   ILE A HG23 5  
ATOM   6932  H  HD11 . ILE A 1 4  ? 67.669 13.457  14.273  1.00 0.00  ? 4   ILE A HD11 5  
ATOM   6933  H  HD12 . ILE A 1 4  ? 69.243 13.583  13.486  1.00 0.00  ? 4   ILE A HD12 5  
ATOM   6934  H  HD13 . ILE A 1 4  ? 68.739 12.056  14.213  1.00 0.00  ? 4   ILE A HD13 5  
ATOM   6935  N  N    . TYR A 1 5  ? 67.782 9.122   10.342  1.00 0.00  ? 5   TYR A N    5  
ATOM   6936  C  CA   . TYR A 1 5  ? 66.672 8.190   9.970   1.00 0.00  ? 5   TYR A CA   5  
ATOM   6937  C  C    . TYR A 1 5  ? 67.113 6.744   10.237  1.00 0.00  ? 5   TYR A C    5  
ATOM   6938  O  O    . TYR A 1 5  ? 66.312 5.897   10.582  1.00 0.00  ? 5   TYR A O    5  
ATOM   6939  C  CB   . TYR A 1 5  ? 66.430 8.411   8.471   1.00 0.00  ? 5   TYR A CB   5  
ATOM   6940  C  CG   . TYR A 1 5  ? 65.874 9.797   8.238   1.00 0.00  ? 5   TYR A CG   5  
ATOM   6941  C  CD1  . TYR A 1 5  ? 64.694 10.201  8.874   1.00 0.00  ? 5   TYR A CD1  5  
ATOM   6942  C  CD2  . TYR A 1 5  ? 66.548 10.682  7.388   1.00 0.00  ? 5   TYR A CD2  5  
ATOM   6943  C  CE1  . TYR A 1 5  ? 64.189 11.490  8.659   1.00 0.00  ? 5   TYR A CE1  5  
ATOM   6944  C  CE2  . TYR A 1 5  ? 66.043 11.968  7.172   1.00 0.00  ? 5   TYR A CE2  5  
ATOM   6945  C  CZ   . TYR A 1 5  ? 64.864 12.373  7.808   1.00 0.00  ? 5   TYR A CZ   5  
ATOM   6946  O  OH   . TYR A 1 5  ? 64.369 13.645  7.597   1.00 0.00  ? 5   TYR A OH   5  
ATOM   6947  H  H    . TYR A 1 5  ? 68.411 9.428   9.656   1.00 0.00  ? 5   TYR A H    5  
ATOM   6948  H  HA   . TYR A 1 5  ? 65.779 8.422   10.530  1.00 0.00  ? 5   TYR A HA   5  
ATOM   6949  H  HB2  . TYR A 1 5  ? 67.364 8.306   7.939   1.00 0.00  ? 5   TYR A HB2  5  
ATOM   6950  H  HB3  . TYR A 1 5  ? 65.726 7.677   8.109   1.00 0.00  ? 5   TYR A HB3  5  
ATOM   6951  H  HD1  . TYR A 1 5  ? 64.172 9.519   9.528   1.00 0.00  ? 5   TYR A HD1  5  
ATOM   6952  H  HD2  . TYR A 1 5  ? 67.456 10.369  6.895   1.00 0.00  ? 5   TYR A HD2  5  
ATOM   6953  H  HE1  . TYR A 1 5  ? 63.279 11.802  9.150   1.00 0.00  ? 5   TYR A HE1  5  
ATOM   6954  H  HE2  . TYR A 1 5  ? 66.564 12.649  6.516   1.00 0.00  ? 5   TYR A HE2  5  
ATOM   6955  H  HH   . TYR A 1 5  ? 64.866 14.251  8.152   1.00 0.00  ? 5   TYR A HH   5  
ATOM   6956  N  N    . LYS A 1 6  ? 68.389 6.467   10.084  1.00 0.00  ? 6   LYS A N    5  
ATOM   6957  C  CA   . LYS A 1 6  ? 68.914 5.085   10.332  1.00 0.00  ? 6   LYS A CA   5  
ATOM   6958  C  C    . LYS A 1 6  ? 68.639 4.661   11.780  1.00 0.00  ? 6   LYS A C    5  
ATOM   6959  O  O    . LYS A 1 6  ? 68.188 3.561   12.035  1.00 0.00  ? 6   LYS A O    5  
ATOM   6960  C  CB   . LYS A 1 6  ? 70.422 5.191   10.092  1.00 0.00  ? 6   LYS A CB   5  
ATOM   6961  C  CG   . LYS A 1 6  ? 70.874 4.079   9.145   1.00 0.00  ? 6   LYS A CG   5  
ATOM   6962  C  CD   . LYS A 1 6  ? 72.398 4.137   8.987   1.00 0.00  ? 6   LYS A CD   5  
ATOM   6963  C  CE   . LYS A 1 6  ? 72.786 5.356   8.141   1.00 0.00  ? 6   LYS A CE   5  
ATOM   6964  N  NZ   . LYS A 1 6  ? 74.182 5.682   8.549   1.00 0.00  ? 6   LYS A NZ   5  
ATOM   6965  H  H    . LYS A 1 6  ? 69.008 7.177   9.811   1.00 0.00  ? 6   LYS A H    5  
ATOM   6966  H  HA   . LYS A 1 6  ? 68.476 4.383   9.640   1.00 0.00  ? 6   LYS A HA   5  
ATOM   6967  H  HB2  . LYS A 1 6  ? 70.650 6.151   9.654   1.00 0.00  ? 6   LYS A HB2  5  
ATOM   6968  H  HB3  . LYS A 1 6  ? 70.943 5.092   11.033  1.00 0.00  ? 6   LYS A HB3  5  
ATOM   6969  H  HG2  . LYS A 1 6  ? 70.590 3.119   9.557   1.00 0.00  ? 6   LYS A HG2  5  
ATOM   6970  H  HG3  . LYS A 1 6  ? 70.405 4.210   8.181   1.00 0.00  ? 6   LYS A HG3  5  
ATOM   6971  H  HD2  . LYS A 1 6  ? 72.855 4.214   9.963   1.00 0.00  ? 6   LYS A HD2  5  
ATOM   6972  H  HD3  . LYS A 1 6  ? 72.742 3.238   8.499   1.00 0.00  ? 6   LYS A HD3  5  
ATOM   6973  H  HE2  . LYS A 1 6  ? 72.746 5.110   7.088   1.00 0.00  ? 6   LYS A HE2  5  
ATOM   6974  H  HE3  . LYS A 1 6  ? 72.134 6.189   8.357   1.00 0.00  ? 6   LYS A HE3  5  
ATOM   6975  H  HZ1  . LYS A 1 6  ? 74.809 4.886   8.320   1.00 0.00  ? 6   LYS A HZ1  5  
ATOM   6976  H  HZ2  . LYS A 1 6  ? 74.213 5.866   9.574   1.00 0.00  ? 6   LYS A HZ2  5  
ATOM   6977  H  HZ3  . LYS A 1 6  ? 74.503 6.532   8.037   1.00 0.00  ? 6   LYS A HZ3  5  
ATOM   6978  N  N    . ALA A 1 7  ? 68.907 5.532   12.725  1.00 0.00  ? 7   ALA A N    5  
ATOM   6979  C  CA   . ALA A 1 7  ? 68.660 5.197   14.164  1.00 0.00  ? 7   ALA A CA   5  
ATOM   6980  C  C    . ALA A 1 7  ? 67.205 4.746   14.359  1.00 0.00  ? 7   ALA A C    5  
ATOM   6981  O  O    . ALA A 1 7  ? 66.935 3.785   15.051  1.00 0.00  ? 7   ALA A O    5  
ATOM   6982  C  CB   . ALA A 1 7  ? 68.929 6.496   14.931  1.00 0.00  ? 7   ALA A CB   5  
ATOM   6983  H  H    . ALA A 1 7  ? 69.268 6.413   12.484  1.00 0.00  ? 7   ALA A H    5  
ATOM   6984  H  HA   . ALA A 1 7  ? 69.340 4.427   14.492  1.00 0.00  ? 7   ALA A HA   5  
ATOM   6985  H  HB1  . ALA A 1 7  ? 68.847 7.337   14.257  1.00 0.00  ? 7   ALA A HB1  5  
ATOM   6986  H  HB2  . ALA A 1 7  ? 69.924 6.467   15.351  1.00 0.00  ? 7   ALA A HB2  5  
ATOM   6987  H  HB3  . ALA A 1 7  ? 68.205 6.601   15.727  1.00 0.00  ? 7   ALA A HB3  5  
ATOM   6988  N  N    . ALA A 1 8  ? 66.272 5.429   13.738  1.00 0.00  ? 8   ALA A N    5  
ATOM   6989  C  CA   . ALA A 1 8  ? 64.833 5.039   13.870  1.00 0.00  ? 8   ALA A CA   5  
ATOM   6990  C  C    . ALA A 1 8  ? 64.588 3.671   13.216  1.00 0.00  ? 8   ALA A C    5  
ATOM   6991  O  O    . ALA A 1 8  ? 63.852 2.854   13.734  1.00 0.00  ? 8   ALA A O    5  
ATOM   6992  C  CB   . ALA A 1 8  ? 64.056 6.134   13.133  1.00 0.00  ? 8   ALA A CB   5  
ATOM   6993  H  H    . ALA A 1 8  ? 66.521 6.194   13.177  1.00 0.00  ? 8   ALA A H    5  
ATOM   6994  H  HA   . ALA A 1 8  ? 64.542 5.017   14.910  1.00 0.00  ? 8   ALA A HA   5  
ATOM   6995  H  HB1  . ALA A 1 8  ? 63.137 5.722   12.741  1.00 0.00  ? 8   ALA A HB1  5  
ATOM   6996  H  HB2  . ALA A 1 8  ? 64.655 6.514   12.319  1.00 0.00  ? 8   ALA A HB2  5  
ATOM   6997  H  HB3  . ALA A 1 8  ? 63.828 6.937   13.818  1.00 0.00  ? 8   ALA A HB3  5  
ATOM   6998  N  N    . VAL A 1 9  ? 65.205 3.418   12.085  1.00 0.00  ? 9   VAL A N    5  
ATOM   6999  C  CA   . VAL A 1 9  ? 65.017 2.100   11.389  1.00 0.00  ? 9   VAL A CA   5  
ATOM   7000  C  C    . VAL A 1 9  ? 65.489 0.948   12.286  1.00 0.00  ? 9   VAL A C    5  
ATOM   7001  O  O    . VAL A 1 9  ? 64.859 -0.089  12.360  1.00 0.00  ? 9   VAL A O    5  
ATOM   7002  C  CB   . VAL A 1 9  ? 65.888 2.176   10.126  1.00 0.00  ? 9   VAL A CB   5  
ATOM   7003  C  CG1  . VAL A 1 9  ? 65.799 0.854   9.358   1.00 0.00  ? 9   VAL A CG1  5  
ATOM   7004  C  CG2  . VAL A 1 9  ? 65.400 3.313   9.225   1.00 0.00  ? 9   VAL A CG2  5  
ATOM   7005  H  H    . VAL A 1 9  ? 65.795 4.096   11.693  1.00 0.00  ? 9   VAL A H    5  
ATOM   7006  H  HA   . VAL A 1 9  ? 63.984 1.963   11.114  1.00 0.00  ? 9   VAL A HA   5  
ATOM   7007  H  HB   . VAL A 1 9  ? 66.916 2.355   10.409  1.00 0.00  ? 9   VAL A HB   5  
ATOM   7008  H  HG11 . VAL A 1 9  ? 66.023 1.027   8.316   1.00 0.00  ? 9   VAL A HG11 5  
ATOM   7009  H  HG12 . VAL A 1 9  ? 64.803 0.450   9.449   1.00 0.00  ? 9   VAL A HG12 5  
ATOM   7010  H  HG13 . VAL A 1 9  ? 66.511 0.153   9.766   1.00 0.00  ? 9   VAL A HG13 5  
ATOM   7011  H  HG21 . VAL A 1 9  ? 66.235 3.715   8.670   1.00 0.00  ? 9   VAL A HG21 5  
ATOM   7012  H  HG22 . VAL A 1 9  ? 64.965 4.092   9.831   1.00 0.00  ? 9   VAL A HG22 5  
ATOM   7013  H  HG23 . VAL A 1 9  ? 64.659 2.936   8.538   1.00 0.00  ? 9   VAL A HG23 5  
ATOM   7014  N  N    . GLU A 1 10 ? 66.598 1.124   12.959  1.00 0.00  ? 10  GLU A N    5  
ATOM   7015  C  CA   . GLU A 1 10 ? 67.126 0.044   13.848  1.00 0.00  ? 10  GLU A CA   5  
ATOM   7016  C  C    . GLU A 1 10 ? 66.386 0.027   15.193  1.00 0.00  ? 10  GLU A C    5  
ATOM   7017  O  O    . GLU A 1 10 ? 66.024 -1.023  15.693  1.00 0.00  ? 10  GLU A O    5  
ATOM   7018  C  CB   . GLU A 1 10 ? 68.602 0.391   14.048  1.00 0.00  ? 10  GLU A CB   5  
ATOM   7019  C  CG   . GLU A 1 10 ? 69.390 0.006   12.794  1.00 0.00  ? 10  GLU A CG   5  
ATOM   7020  C  CD   . GLU A 1 10 ? 70.706 0.786   12.756  1.00 0.00  ? 10  GLU A CD   5  
ATOM   7021  O  OE1  . GLU A 1 10 ? 71.635 0.375   13.431  1.00 0.00  ? 10  GLU A OE1  5  
ATOM   7022  O  OE2  . GLU A 1 10 ? 70.763 1.780   12.050  1.00 0.00  ? 10  GLU A OE2  5  
ATOM   7023  H  H    . GLU A 1 10 ? 67.090 1.969   12.874  1.00 0.00  ? 10  GLU A H    5  
ATOM   7024  H  HA   . GLU A 1 10 ? 67.040 -0.916  13.363  1.00 0.00  ? 10  GLU A HA   5  
ATOM   7025  H  HB2  . GLU A 1 10 ? 68.700 1.453   14.225  1.00 0.00  ? 10  GLU A HB2  5  
ATOM   7026  H  HB3  . GLU A 1 10 ? 68.990 -0.152  14.897  1.00 0.00  ? 10  GLU A HB3  5  
ATOM   7027  H  HG2  . GLU A 1 10 ? 69.599 -1.053  12.811  1.00 0.00  ? 10  GLU A HG2  5  
ATOM   7028  H  HG3  . GLU A 1 10 ? 68.808 0.243   11.916  1.00 0.00  ? 10  GLU A HG3  5  
ATOM   7029  N  N    . GLN A 1 11 ? 66.163 1.176   15.785  1.00 0.00  ? 11  GLN A N    5  
ATOM   7030  C  CA   . GLN A 1 11 ? 65.454 1.217   17.105  1.00 0.00  ? 11  GLN A CA   5  
ATOM   7031  C  C    . GLN A 1 11 ? 63.929 1.329   16.923  1.00 0.00  ? 11  GLN A C    5  
ATOM   7032  O  O    . GLN A 1 11 ? 63.259 2.018   17.669  1.00 0.00  ? 11  GLN A O    5  
ATOM   7033  C  CB   . GLN A 1 11 ? 66.007 2.459   17.816  1.00 0.00  ? 11  GLN A CB   5  
ATOM   7034  C  CG   . GLN A 1 11 ? 67.024 2.035   18.883  1.00 0.00  ? 11  GLN A CG   5  
ATOM   7035  C  CD   . GLN A 1 11 ? 68.443 2.354   18.403  1.00 0.00  ? 11  GLN A CD   5  
ATOM   7036  O  OE1  . GLN A 1 11 ? 68.992 1.649   17.580  1.00 0.00  ? 11  GLN A OE1  5  
ATOM   7037  N  NE2  . GLN A 1 11 ? 69.066 3.392   18.887  1.00 0.00  ? 11  GLN A NE2  5  
ATOM   7038  H  H    . GLN A 1 11 ? 66.467 2.009   15.365  1.00 0.00  ? 11  GLN A H    5  
ATOM   7039  H  HA   . GLN A 1 11 ? 65.692 0.335   17.678  1.00 0.00  ? 11  GLN A HA   5  
ATOM   7040  H  HB2  . GLN A 1 11 ? 66.487 3.105   17.096  1.00 0.00  ? 11  GLN A HB2  5  
ATOM   7041  H  HB3  . GLN A 1 11 ? 65.197 2.992   18.291  1.00 0.00  ? 11  GLN A HB3  5  
ATOM   7042  H  HG2  . GLN A 1 11 ? 66.827 2.571   19.799  1.00 0.00  ? 11  GLN A HG2  5  
ATOM   7043  H  HG3  . GLN A 1 11 ? 66.939 0.974   19.062  1.00 0.00  ? 11  GLN A HG3  5  
ATOM   7044  H  HE21 . GLN A 1 11 ? 68.627 3.962   19.551  1.00 0.00  ? 11  GLN A HE21 5  
ATOM   7045  H  HE22 . GLN A 1 11 ? 69.974 3.602   18.586  1.00 0.00  ? 11  GLN A HE22 5  
ATOM   7046  N  N    . LEU A 1 12 ? 63.369 0.644   15.952  1.00 0.00  ? 12  LEU A N    5  
ATOM   7047  C  CA   . LEU A 1 12 ? 61.887 0.709   15.751  1.00 0.00  ? 12  LEU A CA   5  
ATOM   7048  C  C    . LEU A 1 12 ? 61.184 -0.192  16.775  1.00 0.00  ? 12  LEU A C    5  
ATOM   7049  O  O    . LEU A 1 12 ? 61.635 -1.288  17.058  1.00 0.00  ? 12  LEU A O    5  
ATOM   7050  C  CB   . LEU A 1 12 ? 61.644 0.198   14.325  1.00 0.00  ? 12  LEU A CB   5  
ATOM   7051  C  CG   . LEU A 1 12 ? 61.141 1.345   13.448  1.00 0.00  ? 12  LEU A CG   5  
ATOM   7052  C  CD1  . LEU A 1 12 ? 61.336 0.983   11.976  1.00 0.00  ? 12  LEU A CD1  5  
ATOM   7053  C  CD2  . LEU A 1 12 ? 59.653 1.585   13.720  1.00 0.00  ? 12  LEU A CD2  5  
ATOM   7054  H  H    . LEU A 1 12 ? 63.918 0.084   15.367  1.00 0.00  ? 12  LEU A H    5  
ATOM   7055  H  HA   . LEU A 1 12 ? 61.539 1.727   15.843  1.00 0.00  ? 12  LEU A HA   5  
ATOM   7056  H  HB2  . LEU A 1 12 ? 62.567 -0.189  13.917  1.00 0.00  ? 12  LEU A HB2  5  
ATOM   7057  H  HB3  . LEU A 1 12 ? 60.903 -0.587  14.345  1.00 0.00  ? 12  LEU A HB3  5  
ATOM   7058  H  HG   . LEU A 1 12 ? 61.700 2.242   13.676  1.00 0.00  ? 12  LEU A HG   5  
ATOM   7059  H  HD11 . LEU A 1 12 ? 61.099 -0.060  11.828  1.00 0.00  ? 12  LEU A HD11 5  
ATOM   7060  H  HD12 . LEU A 1 12 ? 62.362 1.162   11.696  1.00 0.00  ? 12  LEU A HD12 5  
ATOM   7061  H  HD13 . LEU A 1 12 ? 60.685 1.591   11.365  1.00 0.00  ? 12  LEU A HD13 5  
ATOM   7062  H  HD21 . LEU A 1 12 ? 59.062 0.939   13.087  1.00 0.00  ? 12  LEU A HD21 5  
ATOM   7063  H  HD22 . LEU A 1 12 ? 59.411 2.616   13.510  1.00 0.00  ? 12  LEU A HD22 5  
ATOM   7064  H  HD23 . LEU A 1 12 ? 59.437 1.369   14.757  1.00 0.00  ? 12  LEU A HD23 5  
ATOM   7065  N  N    . THR A 1 13 ? 60.090 0.260   17.339  1.00 0.00  ? 13  THR A N    5  
ATOM   7066  C  CA   . THR A 1 13 ? 59.365 -0.573  18.355  1.00 0.00  ? 13  THR A CA   5  
ATOM   7067  C  C    . THR A 1 13 ? 58.705 -1.791  17.709  1.00 0.00  ? 13  THR A C    5  
ATOM   7068  O  O    . THR A 1 13 ? 58.549 -1.869  16.504  1.00 0.00  ? 13  THR A O    5  
ATOM   7069  C  CB   . THR A 1 13 ? 58.316 0.346   18.981  1.00 0.00  ? 13  THR A CB   5  
ATOM   7070  O  OG1  . THR A 1 13 ? 57.704 -0.331  20.070  1.00 0.00  ? 13  THR A OG1  5  
ATOM   7071  C  CG2  . THR A 1 13 ? 57.258 0.716   17.942  1.00 0.00  ? 13  THR A CG2  5  
ATOM   7072  H  H    . THR A 1 13 ? 59.749 1.148   17.099  1.00 0.00  ? 13  THR A H    5  
ATOM   7073  H  HA   . THR A 1 13 ? 60.044 -0.902  19.115  1.00 0.00  ? 13  THR A HA   5  
ATOM   7074  H  HB   . THR A 1 13 ? 58.793 1.243   19.340  1.00 0.00  ? 13  THR A HB   5  
ATOM   7075  H  HG1  . THR A 1 13 ? 56.869 0.100   20.262  1.00 0.00  ? 13  THR A HG1  5  
ATOM   7076  H  HG21 . THR A 1 13 ? 57.645 0.519   16.954  1.00 0.00  ? 13  THR A HG21 5  
ATOM   7077  H  HG22 . THR A 1 13 ? 57.016 1.764   18.032  1.00 0.00  ? 13  THR A HG22 5  
ATOM   7078  H  HG23 . THR A 1 13 ? 56.371 0.125   18.107  1.00 0.00  ? 13  THR A HG23 5  
ATOM   7079  N  N    . GLU A 1 14 ? 58.325 -2.746  18.517  1.00 0.00  ? 14  GLU A N    5  
ATOM   7080  C  CA   . GLU A 1 14 ? 57.681 -3.985  17.983  1.00 0.00  ? 14  GLU A CA   5  
ATOM   7081  C  C    . GLU A 1 14 ? 56.358 -3.654  17.277  1.00 0.00  ? 14  GLU A C    5  
ATOM   7082  O  O    . GLU A 1 14 ? 56.006 -4.268  16.289  1.00 0.00  ? 14  GLU A O    5  
ATOM   7083  C  CB   . GLU A 1 14 ? 57.426 -4.864  19.212  1.00 0.00  ? 14  GLU A CB   5  
ATOM   7084  C  CG   . GLU A 1 14 ? 57.395 -6.337  18.796  1.00 0.00  ? 14  GLU A CG   5  
ATOM   7085  C  CD   . GLU A 1 14 ? 57.200 -7.215  20.033  1.00 0.00  ? 14  GLU A CD   5  
ATOM   7086  O  OE1  . GLU A 1 14 ? 56.060 -7.431  20.409  1.00 0.00  ? 14  GLU A OE1  5  
ATOM   7087  O  OE2  . GLU A 1 14 ? 58.196 -7.657  20.585  1.00 0.00  ? 14  GLU A OE2  5  
ATOM   7088  H  H    . GLU A 1 14 ? 58.471 -2.648  19.482  1.00 0.00  ? 14  GLU A H    5  
ATOM   7089  H  HA   . GLU A 1 14 ? 58.354 -4.483  17.308  1.00 0.00  ? 14  GLU A HA   5  
ATOM   7090  H  HB2  . GLU A 1 14 ? 58.215 -4.711  19.935  1.00 0.00  ? 14  GLU A HB2  5  
ATOM   7091  H  HB3  . GLU A 1 14 ? 56.477 -4.598  19.654  1.00 0.00  ? 14  GLU A HB3  5  
ATOM   7092  H  HG2  . GLU A 1 14 ? 56.578 -6.499  18.108  1.00 0.00  ? 14  GLU A HG2  5  
ATOM   7093  H  HG3  . GLU A 1 14 ? 58.327 -6.597  18.316  1.00 0.00  ? 14  GLU A HG3  5  
ATOM   7094  N  N    . GLU A 1 15 ? 55.625 -2.691  17.780  1.00 0.00  ? 15  GLU A N    5  
ATOM   7095  C  CA   . GLU A 1 15 ? 54.319 -2.314  17.147  1.00 0.00  ? 15  GLU A CA   5  
ATOM   7096  C  C    . GLU A 1 15 ? 54.518 -1.933  15.674  1.00 0.00  ? 15  GLU A C    5  
ATOM   7097  O  O    . GLU A 1 15 ? 53.734 -2.302  14.821  1.00 0.00  ? 15  GLU A O    5  
ATOM   7098  C  CB   . GLU A 1 15 ? 53.816 -1.108  17.948  1.00 0.00  ? 15  GLU A CB   5  
ATOM   7099  C  CG   . GLU A 1 15 ? 53.357 -1.566  19.338  1.00 0.00  ? 15  GLU A CG   5  
ATOM   7100  C  CD   . GLU A 1 15 ? 54.438 -1.238  20.370  1.00 0.00  ? 15  GLU A CD   5  
ATOM   7101  O  OE1  . GLU A 1 15 ? 54.462 -0.113  20.838  1.00 0.00  ? 15  GLU A OE1  5  
ATOM   7102  O  OE2  . GLU A 1 15 ? 55.229 -2.119  20.667  1.00 0.00  ? 15  GLU A OE2  5  
ATOM   7103  H  H    . GLU A 1 15 ? 55.934 -2.215  18.580  1.00 0.00  ? 15  GLU A H    5  
ATOM   7104  H  HA   . GLU A 1 15 ? 53.614 -3.127  17.231  1.00 0.00  ? 15  GLU A HA   5  
ATOM   7105  H  HB2  . GLU A 1 15 ? 54.614 -0.387  18.051  1.00 0.00  ? 15  GLU A HB2  5  
ATOM   7106  H  HB3  . GLU A 1 15 ? 52.986 -0.652  17.429  1.00 0.00  ? 15  GLU A HB3  5  
ATOM   7107  H  HG2  . GLU A 1 15 ? 52.442 -1.055  19.601  1.00 0.00  ? 15  GLU A HG2  5  
ATOM   7108  H  HG3  . GLU A 1 15 ? 53.184 -2.632  19.327  1.00 0.00  ? 15  GLU A HG3  5  
ATOM   7109  N  N    . GLN A 1 16 ? 55.560 -1.197  15.370  1.00 0.00  ? 16  GLN A N    5  
ATOM   7110  C  CA   . GLN A 1 16 ? 55.807 -0.792  13.950  1.00 0.00  ? 16  GLN A CA   5  
ATOM   7111  C  C    . GLN A 1 16 ? 56.597 -1.871  13.207  1.00 0.00  ? 16  GLN A C    5  
ATOM   7112  O  O    . GLN A 1 16 ? 56.279 -2.229  12.090  1.00 0.00  ? 16  GLN A O    5  
ATOM   7113  C  CB   . GLN A 1 16 ? 56.612 0.508   14.033  1.00 0.00  ? 16  GLN A CB   5  
ATOM   7114  C  CG   . GLN A 1 16 ? 55.720 1.633   14.568  1.00 0.00  ? 16  GLN A CG   5  
ATOM   7115  C  CD   . GLN A 1 16 ? 56.552 2.903   14.766  1.00 0.00  ? 16  GLN A CD   5  
ATOM   7116  O  OE1  . GLN A 1 16 ? 57.403 2.956   15.630  1.00 0.00  ? 16  GLN A OE1  5  
ATOM   7117  N  NE2  . GLN A 1 16 ? 56.340 3.935   13.998  1.00 0.00  ? 16  GLN A NE2  5  
ATOM   7118  H  H    . GLN A 1 16 ? 56.178 -0.911  16.075  1.00 0.00  ? 16  GLN A H    5  
ATOM   7119  H  HA   . GLN A 1 16 ? 54.881 -0.616  13.454  1.00 0.00  ? 16  GLN A HA   5  
ATOM   7120  H  HB2  . GLN A 1 16 ? 57.455 0.369   14.695  1.00 0.00  ? 16  GLN A HB2  5  
ATOM   7121  H  HB3  . GLN A 1 16 ? 56.967 0.772   13.048  1.00 0.00  ? 16  GLN A HB3  5  
ATOM   7122  H  HG2  . GLN A 1 16 ? 54.926 1.829   13.861  1.00 0.00  ? 16  GLN A HG2  5  
ATOM   7123  H  HG3  . GLN A 1 16 ? 55.293 1.335   15.514  1.00 0.00  ? 16  GLN A HG3  5  
ATOM   7124  H  HE21 . GLN A 1 16 ? 55.654 3.897   13.301  1.00 0.00  ? 16  GLN A HE21 5  
ATOM   7125  H  HE22 . GLN A 1 16 ? 56.868 4.751   14.122  1.00 0.00  ? 16  GLN A HE22 5  
ATOM   7126  N  N    . LYS A 1 17 ? 57.619 -2.385  13.827  1.00 0.00  ? 17  LYS A N    5  
ATOM   7127  C  CA   . LYS A 1 17 ? 58.454 -3.447  13.176  1.00 0.00  ? 17  LYS A CA   5  
ATOM   7128  C  C    . LYS A 1 17 ? 57.599 -4.676  12.840  1.00 0.00  ? 17  LYS A C    5  
ATOM   7129  O  O    . LYS A 1 17 ? 57.657 -5.197  11.743  1.00 0.00  ? 17  LYS A O    5  
ATOM   7130  C  CB   . LYS A 1 17 ? 59.531 -3.805  14.205  1.00 0.00  ? 17  LYS A CB   5  
ATOM   7131  C  CG   . LYS A 1 17 ? 60.845 -4.112  13.480  1.00 0.00  ? 17  LYS A CG   5  
ATOM   7132  C  CD   . LYS A 1 17 ? 61.958 -3.219  14.035  1.00 0.00  ? 17  LYS A CD   5  
ATOM   7133  C  CE   . LYS A 1 17 ? 62.694 -3.951  15.161  1.00 0.00  ? 17  LYS A CE   5  
ATOM   7134  N  NZ   . LYS A 1 17 ? 63.534 -2.905  15.814  1.00 0.00  ? 17  LYS A NZ   5  
ATOM   7135  H  H    . LYS A 1 17 ? 57.834 -2.069  14.725  1.00 0.00  ? 17  LYS A H    5  
ATOM   7136  H  HA   . LYS A 1 17 ? 58.918 -3.061  12.281  1.00 0.00  ? 17  LYS A HA   5  
ATOM   7137  H  HB2  . LYS A 1 17 ? 59.675 -2.973  14.879  1.00 0.00  ? 17  LYS A HB2  5  
ATOM   7138  H  HB3  . LYS A 1 17 ? 59.220 -4.674  14.767  1.00 0.00  ? 17  LYS A HB3  5  
ATOM   7139  H  HG2  . LYS A 1 17 ? 61.104 -5.151  13.629  1.00 0.00  ? 17  LYS A HG2  5  
ATOM   7140  H  HG3  . LYS A 1 17 ? 60.726 -3.920  12.424  1.00 0.00  ? 17  LYS A HG3  5  
ATOM   7141  H  HD2  . LYS A 1 17 ? 62.654 -2.979  13.244  1.00 0.00  ? 17  LYS A HD2  5  
ATOM   7142  H  HD3  . LYS A 1 17 ? 61.526 -2.309  14.423  1.00 0.00  ? 17  LYS A HD3  5  
ATOM   7143  H  HE2  . LYS A 1 17 ? 61.984 -4.362  15.866  1.00 0.00  ? 17  LYS A HE2  5  
ATOM   7144  H  HE3  . LYS A 1 17 ? 63.321 -4.731  14.757  1.00 0.00  ? 17  LYS A HE3  5  
ATOM   7145  H  HZ1  . LYS A 1 17 ? 64.116 -3.341  16.556  1.00 0.00  ? 17  LYS A HZ1  5  
ATOM   7146  H  HZ2  . LYS A 1 17 ? 62.917 -2.180  16.239  1.00 0.00  ? 17  LYS A HZ2  5  
ATOM   7147  H  HZ3  . LYS A 1 17 ? 64.154 -2.462  15.107  1.00 0.00  ? 17  LYS A HZ3  5  
ATOM   7148  N  N    . ASN A 1 18 ? 56.802 -5.134  13.773  1.00 0.00  ? 18  ASN A N    5  
ATOM   7149  C  CA   . ASN A 1 18 ? 55.936 -6.323  13.506  1.00 0.00  ? 18  ASN A CA   5  
ATOM   7150  C  C    . ASN A 1 18 ? 54.855 -5.978  12.469  1.00 0.00  ? 18  ASN A C    5  
ATOM   7151  O  O    . ASN A 1 18 ? 54.415 -6.828  11.719  1.00 0.00  ? 18  ASN A O    5  
ATOM   7152  C  CB   . ASN A 1 18 ? 55.303 -6.671  14.857  1.00 0.00  ? 18  ASN A CB   5  
ATOM   7153  C  CG   . ASN A 1 18 ? 54.897 -8.145  14.866  1.00 0.00  ? 18  ASN A CG   5  
ATOM   7154  O  OD1  . ASN A 1 18 ? 55.683 -9.005  14.524  1.00 0.00  ? 18  ASN A OD1  5  
ATOM   7155  N  ND2  . ASN A 1 18 ? 53.697 -8.479  15.245  1.00 0.00  ? 18  ASN A ND2  5  
ATOM   7156  H  H    . ASN A 1 18 ? 56.770 -4.692  14.649  1.00 0.00  ? 18  ASN A H    5  
ATOM   7157  H  HA   . ASN A 1 18 ? 56.535 -7.151  13.160  1.00 0.00  ? 18  ASN A HA   5  
ATOM   7158  H  HB2  . ASN A 1 18 ? 56.018 -6.491  15.647  1.00 0.00  ? 18  ASN A HB2  5  
ATOM   7159  H  HB3  . ASN A 1 18 ? 54.429 -6.057  15.015  1.00 0.00  ? 18  ASN A HB3  5  
ATOM   7160  H  HD21 . ASN A 1 18 ? 53.060 -7.788  15.523  1.00 0.00  ? 18  ASN A HD21 5  
ATOM   7161  H  HD22 . ASN A 1 18 ? 53.432 -9.421  15.251  1.00 0.00  ? 18  ASN A HD22 5  
ATOM   7162  N  N    . GLU A 1 19 ? 54.432 -4.737  12.414  1.00 0.00  ? 19  GLU A N    5  
ATOM   7163  C  CA   . GLU A 1 19 ? 53.393 -4.335  11.421  1.00 0.00  ? 19  GLU A CA   5  
ATOM   7164  C  C    . GLU A 1 19 ? 54.010 -4.278  10.012  1.00 0.00  ? 19  GLU A C    5  
ATOM   7165  O  O    . GLU A 1 19 ? 53.424 -4.742  9.051   1.00 0.00  ? 19  GLU A O    5  
ATOM   7166  C  CB   . GLU A 1 19 ? 52.928 -2.947  11.887  1.00 0.00  ? 19  GLU A CB   5  
ATOM   7167  C  CG   . GLU A 1 19 ? 52.291 -2.188  10.720  1.00 0.00  ? 19  GLU A CG   5  
ATOM   7168  C  CD   . GLU A 1 19 ? 51.885 -0.783  11.174  1.00 0.00  ? 19  GLU A CD   5  
ATOM   7169  O  OE1  . GLU A 1 19 ? 50.806 -0.649  11.727  1.00 0.00  ? 19  GLU A OE1  5  
ATOM   7170  O  OE2  . GLU A 1 19 ? 52.659 0.134   10.956  1.00 0.00  ? 19  GLU A OE2  5  
ATOM   7171  H  H    . GLU A 1 19 ? 54.805 -4.066  13.021  1.00 0.00  ? 19  GLU A H    5  
ATOM   7172  H  HA   . GLU A 1 19 ? 52.567 -5.027  11.441  1.00 0.00  ? 19  GLU A HA   5  
ATOM   7173  H  HB2  . GLU A 1 19 ? 52.203 -3.060  12.680  1.00 0.00  ? 19  GLU A HB2  5  
ATOM   7174  H  HB3  . GLU A 1 19 ? 53.775 -2.388  12.255  1.00 0.00  ? 19  GLU A HB3  5  
ATOM   7175  H  HG2  . GLU A 1 19 ? 53.007 -2.113  9.917   1.00 0.00  ? 19  GLU A HG2  5  
ATOM   7176  H  HG3  . GLU A 1 19 ? 51.416 -2.720  10.376  1.00 0.00  ? 19  GLU A HG3  5  
ATOM   7177  N  N    . PHE A 1 20 ? 55.189 -3.718  9.887   1.00 0.00  ? 20  PHE A N    5  
ATOM   7178  C  CA   . PHE A 1 20 ? 55.846 -3.633  8.544   1.00 0.00  ? 20  PHE A CA   5  
ATOM   7179  C  C    . PHE A 1 20 ? 56.368 -5.006  8.106   1.00 0.00  ? 20  PHE A C    5  
ATOM   7180  O  O    . PHE A 1 20 ? 56.325 -5.341  6.939   1.00 0.00  ? 20  PHE A O    5  
ATOM   7181  C  CB   . PHE A 1 20 ? 57.004 -2.644  8.717   1.00 0.00  ? 20  PHE A CB   5  
ATOM   7182  C  CG   . PHE A 1 20 ? 56.455 -1.244  8.884   1.00 0.00  ? 20  PHE A CG   5  
ATOM   7183  C  CD1  . PHE A 1 20 ? 55.409 -0.795  8.066   1.00 0.00  ? 20  PHE A CD1  5  
ATOM   7184  C  CD2  . PHE A 1 20 ? 56.988 -0.398  9.864   1.00 0.00  ? 20  PHE A CD2  5  
ATOM   7185  C  CE1  . PHE A 1 20 ? 54.897 0.496   8.232   1.00 0.00  ? 20  PHE A CE1  5  
ATOM   7186  C  CE2  . PHE A 1 20 ? 56.477 0.893   10.026  1.00 0.00  ? 20  PHE A CE2  5  
ATOM   7187  C  CZ   . PHE A 1 20 ? 55.431 1.341   9.211   1.00 0.00  ? 20  PHE A CZ   5  
ATOM   7188  H  H    . PHE A 1 20 ? 55.642 -3.353  10.676  1.00 0.00  ? 20  PHE A H    5  
ATOM   7189  H  HA   . PHE A 1 20 ? 55.150 -3.253  7.813   1.00 0.00  ? 20  PHE A HA   5  
ATOM   7190  H  HB2  . PHE A 1 20 ? 57.576 -2.912  9.594   1.00 0.00  ? 20  PHE A HB2  5  
ATOM   7191  H  HB3  . PHE A 1 20 ? 57.642 -2.681  7.846   1.00 0.00  ? 20  PHE A HB3  5  
ATOM   7192  H  HD1  . PHE A 1 20 ? 54.998 -1.444  7.308   1.00 0.00  ? 20  PHE A HD1  5  
ATOM   7193  H  HD2  . PHE A 1 20 ? 57.795 -0.743  10.493  1.00 0.00  ? 20  PHE A HD2  5  
ATOM   7194  H  HE1  . PHE A 1 20 ? 54.090 0.842   7.602   1.00 0.00  ? 20  PHE A HE1  5  
ATOM   7195  H  HE2  . PHE A 1 20 ? 56.888 1.545   10.783  1.00 0.00  ? 20  PHE A HE2  5  
ATOM   7196  H  HZ   . PHE A 1 20 ? 55.035 2.337   9.338   1.00 0.00  ? 20  PHE A HZ   5  
ATOM   7197  N  N    . LYS A 1 21 ? 56.853 -5.809  9.026   1.00 0.00  ? 21  LYS A N    5  
ATOM   7198  C  CA   . LYS A 1 21 ? 57.362 -7.161  8.636   1.00 0.00  ? 21  LYS A CA   5  
ATOM   7199  C  C    . LYS A 1 21 ? 56.211 -8.024  8.083   1.00 0.00  ? 21  LYS A C    5  
ATOM   7200  O  O    . LYS A 1 21 ? 56.415 -8.852  7.217   1.00 0.00  ? 21  LYS A O    5  
ATOM   7201  C  CB   . LYS A 1 21 ? 57.973 -7.763  9.916   1.00 0.00  ? 21  LYS A CB   5  
ATOM   7202  C  CG   . LYS A 1 21 ? 56.885 -8.377  10.805  1.00 0.00  ? 21  LYS A CG   5  
ATOM   7203  C  CD   . LYS A 1 21 ? 56.852 -9.892  10.598  1.00 0.00  ? 21  LYS A CD   5  
ATOM   7204  C  CE   . LYS A 1 21 ? 55.687 -10.496 11.390  1.00 0.00  ? 21  LYS A CE   5  
ATOM   7205  N  NZ   . LYS A 1 21 ? 56.275 -10.915 12.697  1.00 0.00  ? 21  LYS A NZ   5  
ATOM   7206  H  H    . LYS A 1 21 ? 56.876 -5.525  9.965   1.00 0.00  ? 21  LYS A H    5  
ATOM   7207  H  HA   . LYS A 1 21 ? 58.131 -7.057  7.885   1.00 0.00  ? 21  LYS A HA   5  
ATOM   7208  H  HB2  . LYS A 1 21 ? 58.684 -8.529  9.643   1.00 0.00  ? 21  LYS A HB2  5  
ATOM   7209  H  HB3  . LYS A 1 21 ? 58.484 -6.986  10.465  1.00 0.00  ? 21  LYS A HB3  5  
ATOM   7210  H  HG2  . LYS A 1 21 ? 57.102 -8.160  11.840  1.00 0.00  ? 21  LYS A HG2  5  
ATOM   7211  H  HG3  . LYS A 1 21 ? 55.926 -7.959  10.546  1.00 0.00  ? 21  LYS A HG3  5  
ATOM   7212  H  HD2  . LYS A 1 21 ? 56.724 -10.108 9.547   1.00 0.00  ? 21  LYS A HD2  5  
ATOM   7213  H  HD3  . LYS A 1 21 ? 57.781 -10.321 10.941  1.00 0.00  ? 21  LYS A HD3  5  
ATOM   7214  H  HE2  . LYS A 1 21 ? 54.915 -9.752  11.544  1.00 0.00  ? 21  LYS A HE2  5  
ATOM   7215  H  HE3  . LYS A 1 21 ? 55.285 -11.353 10.873  1.00 0.00  ? 21  LYS A HE3  5  
ATOM   7216  H  HZ1  . LYS A 1 21 ? 55.678 -11.650 13.125  1.00 0.00  ? 21  LYS A HZ1  5  
ATOM   7217  H  HZ2  . LYS A 1 21 ? 56.321 -10.092 13.335  1.00 0.00  ? 21  LYS A HZ2  5  
ATOM   7218  H  HZ3  . LYS A 1 21 ? 57.232 -11.292 12.548  1.00 0.00  ? 21  LYS A HZ3  5  
ATOM   7219  N  N    . ALA A 1 22 ? 55.002 -7.813  8.559   1.00 0.00  ? 22  ALA A N    5  
ATOM   7220  C  CA   . ALA A 1 22 ? 53.833 -8.598  8.043   1.00 0.00  ? 22  ALA A CA   5  
ATOM   7221  C  C    . ALA A 1 22 ? 53.407 -8.048  6.674   1.00 0.00  ? 22  ALA A C    5  
ATOM   7222  O  O    . ALA A 1 22 ? 52.944 -8.774  5.817   1.00 0.00  ? 22  ALA A O    5  
ATOM   7223  C  CB   . ALA A 1 22 ? 52.723 -8.397  9.079   1.00 0.00  ? 22  ALA A CB   5  
ATOM   7224  H  H    . ALA A 1 22 ? 54.860 -7.123  9.242   1.00 0.00  ? 22  ALA A H    5  
ATOM   7225  H  HA   . ALA A 1 22 ? 54.085 -9.645  7.966   1.00 0.00  ? 22  ALA A HA   5  
ATOM   7226  H  HB1  . ALA A 1 22 ? 53.136 -8.497  10.072  1.00 0.00  ? 22  ALA A HB1  5  
ATOM   7227  H  HB2  . ALA A 1 22 ? 51.955 -9.141  8.933   1.00 0.00  ? 22  ALA A HB2  5  
ATOM   7228  H  HB3  . ALA A 1 22 ? 52.297 -7.412  8.965   1.00 0.00  ? 22  ALA A HB3  5  
ATOM   7229  N  N    . ALA A 1 23 ? 53.580 -6.766  6.463   1.00 0.00  ? 23  ALA A N    5  
ATOM   7230  C  CA   . ALA A 1 23 ? 53.213 -6.156  5.149   1.00 0.00  ? 23  ALA A CA   5  
ATOM   7231  C  C    . ALA A 1 23 ? 54.378 -6.294  4.151   1.00 0.00  ? 23  ALA A C    5  
ATOM   7232  O  O    . ALA A 1 23 ? 54.234 -6.004  2.980   1.00 0.00  ? 23  ALA A O    5  
ATOM   7233  C  CB   . ALA A 1 23 ? 52.952 -4.681  5.463   1.00 0.00  ? 23  ALA A CB   5  
ATOM   7234  H  H    . ALA A 1 23 ? 53.966 -6.204  7.167   1.00 0.00  ? 23  ALA A H    5  
ATOM   7235  H  HA   . ALA A 1 23 ? 52.319 -6.613  4.754   1.00 0.00  ? 23  ALA A HA   5  
ATOM   7236  H  HB1  . ALA A 1 23 ? 52.169 -4.603  6.203   1.00 0.00  ? 23  ALA A HB1  5  
ATOM   7237  H  HB2  . ALA A 1 23 ? 52.649 -4.169  4.562   1.00 0.00  ? 23  ALA A HB2  5  
ATOM   7238  H  HB3  . ALA A 1 23 ? 53.856 -4.230  5.847   1.00 0.00  ? 23  ALA A HB3  5  
ATOM   7239  N  N    . PHE A 1 24 ? 55.531 -6.733  4.607   1.00 0.00  ? 24  PHE A N    5  
ATOM   7240  C  CA   . PHE A 1 24 ? 56.699 -6.884  3.687   1.00 0.00  ? 24  PHE A CA   5  
ATOM   7241  C  C    . PHE A 1 24 ? 56.689 -8.275  3.033   1.00 0.00  ? 24  PHE A C    5  
ATOM   7242  O  O    . PHE A 1 24 ? 56.767 -8.392  1.824   1.00 0.00  ? 24  PHE A O    5  
ATOM   7243  C  CB   . PHE A 1 24 ? 57.933 -6.698  4.581   1.00 0.00  ? 24  PHE A CB   5  
ATOM   7244  C  CG   . PHE A 1 24 ? 59.183 -7.056  3.808   1.00 0.00  ? 24  PHE A CG   5  
ATOM   7245  C  CD1  . PHE A 1 24 ? 59.713 -6.156  2.877   1.00 0.00  ? 24  PHE A CD1  5  
ATOM   7246  C  CD2  . PHE A 1 24 ? 59.806 -8.291  4.021   1.00 0.00  ? 24  PHE A CD2  5  
ATOM   7247  C  CE1  . PHE A 1 24 ? 60.867 -6.489  2.158   1.00 0.00  ? 24  PHE A CE1  5  
ATOM   7248  C  CE2  . PHE A 1 24 ? 60.960 -8.626  3.301   1.00 0.00  ? 24  PHE A CE2  5  
ATOM   7249  C  CZ   . PHE A 1 24 ? 61.491 -7.725  2.370   1.00 0.00  ? 24  PHE A CZ   5  
ATOM   7250  H  H    . PHE A 1 24 ? 55.629 -6.959  5.555   1.00 0.00  ? 24  PHE A H    5  
ATOM   7251  H  HA   . PHE A 1 24 ? 56.678 -6.117  2.929   1.00 0.00  ? 24  PHE A HA   5  
ATOM   7252  H  HB2  . PHE A 1 24 ? 57.992 -5.666  4.901   1.00 0.00  ? 24  PHE A HB2  5  
ATOM   7253  H  HB3  . PHE A 1 24 ? 57.850 -7.338  5.447   1.00 0.00  ? 24  PHE A HB3  5  
ATOM   7254  H  HD1  . PHE A 1 24 ? 59.233 -5.203  2.713   1.00 0.00  ? 24  PHE A HD1  5  
ATOM   7255  H  HD2  . PHE A 1 24 ? 59.397 -8.986  4.739   1.00 0.00  ? 24  PHE A HD2  5  
ATOM   7256  H  HE1  . PHE A 1 24 ? 61.276 -5.794  1.440   1.00 0.00  ? 24  PHE A HE1  5  
ATOM   7257  H  HE2  . PHE A 1 24 ? 61.442 -9.578  3.465   1.00 0.00  ? 24  PHE A HE2  5  
ATOM   7258  H  HZ   . PHE A 1 24 ? 62.381 -7.985  1.815   1.00 0.00  ? 24  PHE A HZ   5  
ATOM   7259  N  N    . ASP A 1 25 ? 56.590 -9.328  3.816   1.00 0.00  ? 25  ASP A N    5  
ATOM   7260  C  CA   . ASP A 1 25 ? 56.573 -10.705 3.220   1.00 0.00  ? 25  ASP A CA   5  
ATOM   7261  C  C    . ASP A 1 25 ? 55.369 -10.864 2.274   1.00 0.00  ? 25  ASP A C    5  
ATOM   7262  O  O    . ASP A 1 25 ? 55.467 -11.502 1.244   1.00 0.00  ? 25  ASP A O    5  
ATOM   7263  C  CB   . ASP A 1 25 ? 56.499 -11.680 4.410   1.00 0.00  ? 25  ASP A CB   5  
ATOM   7264  C  CG   . ASP A 1 25 ? 55.090 -11.702 5.008   1.00 0.00  ? 25  ASP A CG   5  
ATOM   7265  O  OD1  . ASP A 1 25 ? 54.791 -10.824 5.795   1.00 0.00  ? 25  ASP A OD1  5  
ATOM   7266  O  OD2  . ASP A 1 25 ? 54.339 -12.601 4.670   1.00 0.00  ? 25  ASP A OD2  5  
ATOM   7267  H  H    . ASP A 1 25 ? 56.525 -9.212  4.788   1.00 0.00  ? 25  ASP A H    5  
ATOM   7268  H  HA   . ASP A 1 25 ? 57.488 -10.874 2.673   1.00 0.00  ? 25  ASP A HA   5  
ATOM   7269  H  HB2  . ASP A 1 25 ? 56.755 -12.674 4.072   1.00 0.00  ? 25  ASP A HB2  5  
ATOM   7270  H  HB3  . ASP A 1 25 ? 57.202 -11.372 5.170   1.00 0.00  ? 25  ASP A HB3  5  
ATOM   7271  N  N    . ILE A 1 26 ? 54.243 -10.270 2.599   1.00 0.00  ? 26  ILE A N    5  
ATOM   7272  C  CA   . ILE A 1 26 ? 53.053 -10.373 1.692   1.00 0.00  ? 26  ILE A CA   5  
ATOM   7273  C  C    . ILE A 1 26 ? 53.315 -9.561  0.415   1.00 0.00  ? 26  ILE A C    5  
ATOM   7274  O  O    . ILE A 1 26 ? 52.897 -9.934  -0.665  1.00 0.00  ? 26  ILE A O    5  
ATOM   7275  C  CB   . ILE A 1 26 ? 51.876 -9.789  2.488   1.00 0.00  ? 26  ILE A CB   5  
ATOM   7276  C  CG1  . ILE A 1 26 ? 51.554 -10.716 3.667   1.00 0.00  ? 26  ILE A CG1  5  
ATOM   7277  C  CG2  . ILE A 1 26 ? 50.640 -9.670  1.583   1.00 0.00  ? 26  ILE A CG2  5  
ATOM   7278  C  CD1  . ILE A 1 26 ? 50.464 -10.087 4.543   1.00 0.00  ? 26  ILE A CD1  5  
ATOM   7279  H  H    . ILE A 1 26 ? 54.186 -9.744  3.426   1.00 0.00  ? 26  ILE A H    5  
ATOM   7280  H  HA   . ILE A 1 26 ? 52.859 -11.405 1.445   1.00 0.00  ? 26  ILE A HA   5  
ATOM   7281  H  HB   . ILE A 1 26 ? 52.144 -8.810  2.859   1.00 0.00  ? 26  ILE A HB   5  
ATOM   7282  H  HG12 . ILE A 1 26 ? 51.209 -11.668 3.290   1.00 0.00  ? 26  ILE A HG12 5  
ATOM   7283  H  HG13 . ILE A 1 26 ? 52.445 -10.868 4.259   1.00 0.00  ? 26  ILE A HG13 5  
ATOM   7284  H  HG21 . ILE A 1 26 ? 50.026 -8.847  1.918   1.00 0.00  ? 26  ILE A HG21 5  
ATOM   7285  H  HG22 . ILE A 1 26 ? 50.069 -10.586 1.629   1.00 0.00  ? 26  ILE A HG22 5  
ATOM   7286  H  HG23 . ILE A 1 26 ? 50.953 -9.493  0.565   1.00 0.00  ? 26  ILE A HG23 5  
ATOM   7287  H  HD11 . ILE A 1 26 ? 49.620 -10.759 4.608   1.00 0.00  ? 26  ILE A HD11 5  
ATOM   7288  H  HD12 . ILE A 1 26 ? 50.145 -9.151  4.109   1.00 0.00  ? 26  ILE A HD12 5  
ATOM   7289  H  HD13 . ILE A 1 26 ? 50.857 -9.908  5.534   1.00 0.00  ? 26  ILE A HD13 5  
ATOM   7290  N  N    . PHE A 1 27 ? 54.019 -8.459  0.534   1.00 0.00  ? 27  PHE A N    5  
ATOM   7291  C  CA   . PHE A 1 27 ? 54.331 -7.622  -0.667  1.00 0.00  ? 27  PHE A CA   5  
ATOM   7292  C  C    . PHE A 1 27 ? 55.175 -8.423  -1.668  1.00 0.00  ? 27  PHE A C    5  
ATOM   7293  O  O    . PHE A 1 27 ? 54.932 -8.393  -2.859  1.00 0.00  ? 27  PHE A O    5  
ATOM   7294  C  CB   . PHE A 1 27 ? 55.137 -6.433  -0.129  1.00 0.00  ? 27  PHE A CB   5  
ATOM   7295  C  CG   . PHE A 1 27 ? 54.639 -5.149  -0.748  1.00 0.00  ? 27  PHE A CG   5  
ATOM   7296  C  CD1  . PHE A 1 27 ? 54.716 -4.962  -2.134  1.00 0.00  ? 27  PHE A CD1  5  
ATOM   7297  C  CD2  . PHE A 1 27 ? 54.103 -4.143  0.064   1.00 0.00  ? 27  PHE A CD2  5  
ATOM   7298  C  CE1  . PHE A 1 27 ? 54.256 -3.771  -2.706  1.00 0.00  ? 27  PHE A CE1  5  
ATOM   7299  C  CE2  . PHE A 1 27 ? 53.643 -2.950  -0.509  1.00 0.00  ? 27  PHE A CE2  5  
ATOM   7300  C  CZ   . PHE A 1 27 ? 53.720 -2.765  -1.894  1.00 0.00  ? 27  PHE A CZ   5  
ATOM   7301  H  H    . PHE A 1 27 ? 54.352 -8.188  1.415   1.00 0.00  ? 27  PHE A H    5  
ATOM   7302  H  HA   . PHE A 1 27 ? 53.423 -7.274  -1.133  1.00 0.00  ? 27  PHE A HA   5  
ATOM   7303  H  HB2  . PHE A 1 27 ? 55.027 -6.380  0.944   1.00 0.00  ? 27  PHE A HB2  5  
ATOM   7304  H  HB3  . PHE A 1 27 ? 56.181 -6.566  -0.375  1.00 0.00  ? 27  PHE A HB3  5  
ATOM   7305  H  HD1  . PHE A 1 27 ? 55.130 -5.738  -2.761  1.00 0.00  ? 27  PHE A HD1  5  
ATOM   7306  H  HD2  . PHE A 1 27 ? 54.044 -4.287  1.133   1.00 0.00  ? 27  PHE A HD2  5  
ATOM   7307  H  HE1  . PHE A 1 27 ? 54.316 -3.628  -3.774  1.00 0.00  ? 27  PHE A HE1  5  
ATOM   7308  H  HE2  . PHE A 1 27 ? 53.230 -2.175  0.118   1.00 0.00  ? 27  PHE A HE2  5  
ATOM   7309  H  HZ   . PHE A 1 27 ? 53.364 -1.846  -2.337  1.00 0.00  ? 27  PHE A HZ   5  
ATOM   7310  N  N    . VAL A 1 28 ? 56.165 -9.138  -1.188  1.00 0.00  ? 28  VAL A N    5  
ATOM   7311  C  CA   . VAL A 1 28 ? 57.036 -9.940  -2.109  1.00 0.00  ? 28  VAL A CA   5  
ATOM   7312  C  C    . VAL A 1 28 ? 56.417 -11.320 -2.411  1.00 0.00  ? 28  VAL A C    5  
ATOM   7313  O  O    . VAL A 1 28 ? 57.104 -12.325 -2.422  1.00 0.00  ? 28  VAL A O    5  
ATOM   7314  C  CB   . VAL A 1 28 ? 58.386 -10.087 -1.377  1.00 0.00  ? 28  VAL A CB   5  
ATOM   7315  C  CG1  . VAL A 1 28 ? 58.980 -8.702  -1.100  1.00 0.00  ? 28  VAL A CG1  5  
ATOM   7316  C  CG2  . VAL A 1 28 ? 58.190 -10.823 -0.046  1.00 0.00  ? 28  VAL A CG2  5  
ATOM   7317  H  H    . VAL A 1 28 ? 56.338 -9.143  -0.223  1.00 0.00  ? 28  VAL A H    5  
ATOM   7318  H  HA   . VAL A 1 28 ? 57.187 -9.401  -3.030  1.00 0.00  ? 28  VAL A HA   5  
ATOM   7319  H  HB   . VAL A 1 28 ? 59.068 -10.647 -2.000  1.00 0.00  ? 28  VAL A HB   5  
ATOM   7320  H  HG11 . VAL A 1 28 ? 60.057 -8.772  -1.078  1.00 0.00  ? 28  VAL A HG11 5  
ATOM   7321  H  HG12 . VAL A 1 28 ? 58.623 -8.342  -0.146  1.00 0.00  ? 28  VAL A HG12 5  
ATOM   7322  H  HG13 . VAL A 1 28 ? 58.679 -8.018  -1.879  1.00 0.00  ? 28  VAL A HG13 5  
ATOM   7323  H  HG21 . VAL A 1 28 ? 57.250 -11.354 -0.061  1.00 0.00  ? 28  VAL A HG21 5  
ATOM   7324  H  HG22 . VAL A 1 28 ? 58.188 -10.110 0.764   1.00 0.00  ? 28  VAL A HG22 5  
ATOM   7325  H  HG23 . VAL A 1 28 ? 58.997 -11.526 0.098   1.00 0.00  ? 28  VAL A HG23 5  
ATOM   7326  N  N    . LEU A 1 29 ? 55.130 -11.376 -2.675  1.00 0.00  ? 29  LEU A N    5  
ATOM   7327  C  CA   . LEU A 1 29 ? 54.480 -12.689 -2.994  1.00 0.00  ? 29  LEU A CA   5  
ATOM   7328  C  C    . LEU A 1 29 ? 55.080 -13.264 -4.286  1.00 0.00  ? 29  LEU A C    5  
ATOM   7329  O  O    . LEU A 1 29 ? 55.584 -14.370 -4.307  1.00 0.00  ? 29  LEU A O    5  
ATOM   7330  C  CB   . LEU A 1 29 ? 52.988 -12.376 -3.176  1.00 0.00  ? 29  LEU A CB   5  
ATOM   7331  C  CG   . LEU A 1 29 ? 52.161 -13.271 -2.248  1.00 0.00  ? 29  LEU A CG   5  
ATOM   7332  C  CD1  . LEU A 1 29 ? 51.202 -12.414 -1.420  1.00 0.00  ? 29  LEU A CD1  5  
ATOM   7333  C  CD2  . LEU A 1 29 ? 51.354 -14.264 -3.085  1.00 0.00  ? 29  LEU A CD2  5  
ATOM   7334  H  H    . LEU A 1 29 ? 54.596 -10.556 -2.676  1.00 0.00  ? 29  LEU A H    5  
ATOM   7335  H  HA   . LEU A 1 29 ? 54.616 -13.383 -2.179  1.00 0.00  ? 29  LEU A HA   5  
ATOM   7336  H  HB2  . LEU A 1 29 ? 52.804 -11.338 -2.936  1.00 0.00  ? 29  LEU A HB2  5  
ATOM   7337  H  HB3  . LEU A 1 29 ? 52.702 -12.563 -4.201  1.00 0.00  ? 29  LEU A HB3  5  
ATOM   7338  H  HG   . LEU A 1 29 ? 52.823 -13.810 -1.586  1.00 0.00  ? 29  LEU A HG   5  
ATOM   7339  H  HD11 . LEU A 1 29 ? 50.703 -11.706 -2.064  1.00 0.00  ? 29  LEU A HD11 5  
ATOM   7340  H  HD12 . LEU A 1 29 ? 51.758 -11.882 -0.662  1.00 0.00  ? 29  LEU A HD12 5  
ATOM   7341  H  HD13 . LEU A 1 29 ? 50.469 -13.050 -0.947  1.00 0.00  ? 29  LEU A HD13 5  
ATOM   7342  H  HD21 . LEU A 1 29 ? 52.029 -14.893 -3.648  1.00 0.00  ? 29  LEU A HD21 5  
ATOM   7343  H  HD22 . LEU A 1 29 ? 50.713 -13.723 -3.765  1.00 0.00  ? 29  LEU A HD22 5  
ATOM   7344  H  HD23 . LEU A 1 29 ? 50.751 -14.877 -2.432  1.00 0.00  ? 29  LEU A HD23 5  
ATOM   7345  N  N    . GLY A 1 30 ? 55.049 -12.506 -5.355  1.00 0.00  ? 30  GLY A N    5  
ATOM   7346  C  CA   . GLY A 1 30 ? 55.638 -12.985 -6.645  1.00 0.00  ? 30  GLY A CA   5  
ATOM   7347  C  C    . GLY A 1 30 ? 56.991 -12.298 -6.849  1.00 0.00  ? 30  GLY A C    5  
ATOM   7348  O  O    . GLY A 1 30 ? 57.241 -11.689 -7.871  1.00 0.00  ? 30  GLY A O    5  
ATOM   7349  H  H    . GLY A 1 30 ? 54.653 -11.611 -5.306  1.00 0.00  ? 30  GLY A H    5  
ATOM   7350  H  HA2  . GLY A 1 30 ? 55.777 -14.059 -6.606  1.00 0.00  ? 30  GLY A HA2  5  
ATOM   7351  H  HA3  . GLY A 1 30 ? 54.980 -12.729 -7.464  1.00 0.00  ? 30  GLY A HA3  5  
ATOM   7352  N  N    . ALA A 1 31 ? 57.858 -12.382 -5.869  1.00 0.00  ? 31  ALA A N    5  
ATOM   7353  C  CA   . ALA A 1 31 ? 59.198 -11.726 -5.978  1.00 0.00  ? 31  ALA A CA   5  
ATOM   7354  C  C    . ALA A 1 31 ? 60.296 -12.755 -6.290  1.00 0.00  ? 31  ALA A C    5  
ATOM   7355  O  O    . ALA A 1 31 ? 61.334 -12.404 -6.814  1.00 0.00  ? 31  ALA A O    5  
ATOM   7356  C  CB   . ALA A 1 31 ? 59.435 -11.097 -4.603  1.00 0.00  ? 31  ALA A CB   5  
ATOM   7357  H  H    . ALA A 1 31 ? 57.622 -12.871 -5.053  1.00 0.00  ? 31  ALA A H    5  
ATOM   7358  H  HA   . ALA A 1 31 ? 59.180 -10.957 -6.733  1.00 0.00  ? 31  ALA A HA   5  
ATOM   7359  H  HB1  . ALA A 1 31 ? 60.302 -10.454 -4.646  1.00 0.00  ? 31  ALA A HB1  5  
ATOM   7360  H  HB2  . ALA A 1 31 ? 59.601 -11.876 -3.874  1.00 0.00  ? 31  ALA A HB2  5  
ATOM   7361  H  HB3  . ALA A 1 31 ? 58.570 -10.516 -4.318  1.00 0.00  ? 31  ALA A HB3  5  
ATOM   7362  N  N    . GLU A 1 32 ? 60.073 -14.014 -5.960  1.00 0.00  ? 32  GLU A N    5  
ATOM   7363  C  CA   . GLU A 1 32 ? 61.090 -15.093 -6.218  1.00 0.00  ? 32  GLU A CA   5  
ATOM   7364  C  C    . GLU A 1 32 ? 62.352 -14.872 -5.367  1.00 0.00  ? 32  GLU A C    5  
ATOM   7365  O  O    . GLU A 1 32 ? 62.631 -15.635 -4.462  1.00 0.00  ? 32  GLU A O    5  
ATOM   7366  C  CB   . GLU A 1 32 ? 61.412 -15.032 -7.720  1.00 0.00  ? 32  GLU A CB   5  
ATOM   7367  C  CG   . GLU A 1 32 ? 60.427 -15.916 -8.493  1.00 0.00  ? 32  GLU A CG   5  
ATOM   7368  C  CD   . GLU A 1 32 ? 59.067 -15.216 -8.589  1.00 0.00  ? 32  GLU A CD   5  
ATOM   7369  O  OE1  . GLU A 1 32 ? 58.892 -14.426 -9.501  1.00 0.00  ? 32  GLU A OE1  5  
ATOM   7370  O  OE2  . GLU A 1 32 ? 58.225 -15.484 -7.747  1.00 0.00  ? 32  GLU A OE2  5  
ATOM   7371  H  H    . GLU A 1 32 ? 59.226 -14.254 -5.533  1.00 0.00  ? 32  GLU A H    5  
ATOM   7372  H  HA   . GLU A 1 32 ? 60.663 -16.056 -5.983  1.00 0.00  ? 32  GLU A HA   5  
ATOM   7373  H  HB2  . GLU A 1 32 ? 61.330 -14.015 -8.071  1.00 0.00  ? 32  GLU A HB2  5  
ATOM   7374  H  HB3  . GLU A 1 32 ? 62.417 -15.389 -7.888  1.00 0.00  ? 32  GLU A HB3  5  
ATOM   7375  H  HG2  . GLU A 1 32 ? 60.810 -16.095 -9.488  1.00 0.00  ? 32  GLU A HG2  5  
ATOM   7376  H  HG3  . GLU A 1 32 ? 60.309 -16.858 -7.979  1.00 0.00  ? 32  GLU A HG3  5  
ATOM   7377  N  N    . ASP A 1 33 ? 63.110 -13.839 -5.644  1.00 0.00  ? 33  ASP A N    5  
ATOM   7378  C  CA   . ASP A 1 33 ? 64.348 -13.569 -4.846  1.00 0.00  ? 33  ASP A CA   5  
ATOM   7379  C  C    . ASP A 1 33 ? 63.994 -13.302 -3.375  1.00 0.00  ? 33  ASP A C    5  
ATOM   7380  O  O    . ASP A 1 33 ? 64.694 -13.729 -2.476  1.00 0.00  ? 33  ASP A O    5  
ATOM   7381  C  CB   . ASP A 1 33 ? 64.969 -12.324 -5.489  1.00 0.00  ? 33  ASP A CB   5  
ATOM   7382  C  CG   . ASP A 1 33 ? 65.759 -12.730 -6.734  1.00 0.00  ? 33  ASP A CG   5  
ATOM   7383  O  OD1  . ASP A 1 33 ? 65.140 -12.922 -7.768  1.00 0.00  ? 33  ASP A OD1  5  
ATOM   7384  O  OD2  . ASP A 1 33 ? 66.968 -12.846 -6.631  1.00 0.00  ? 33  ASP A OD2  5  
ATOM   7385  H  H    . ASP A 1 33 ? 62.862 -13.236 -6.378  1.00 0.00  ? 33  ASP A H    5  
ATOM   7386  H  HA   . ASP A 1 33 ? 65.030 -14.400 -4.922  1.00 0.00  ? 33  ASP A HA   5  
ATOM   7387  H  HB2  . ASP A 1 33 ? 64.185 -11.634 -5.768  1.00 0.00  ? 33  ASP A HB2  5  
ATOM   7388  H  HB3  . ASP A 1 33 ? 65.633 -11.848 -4.784  1.00 0.00  ? 33  ASP A HB3  5  
ATOM   7389  N  N    . GLY A 1 34 ? 62.912 -12.601 -3.125  1.00 0.00  ? 34  GLY A N    5  
ATOM   7390  C  CA   . GLY A 1 34 ? 62.509 -12.308 -1.714  1.00 0.00  ? 34  GLY A CA   5  
ATOM   7391  C  C    . GLY A 1 34 ? 62.502 -10.792 -1.463  1.00 0.00  ? 34  GLY A C    5  
ATOM   7392  O  O    . GLY A 1 34 ? 61.815 -10.311 -0.582  1.00 0.00  ? 34  GLY A O    5  
ATOM   7393  H  H    . GLY A 1 34 ? 62.365 -12.269 -3.867  1.00 0.00  ? 34  GLY A H    5  
ATOM   7394  H  HA2  . GLY A 1 34 ? 61.516 -12.703 -1.538  1.00 0.00  ? 34  GLY A HA2  5  
ATOM   7395  H  HA3  . GLY A 1 34 ? 63.209 -12.776 -1.035  1.00 0.00  ? 34  GLY A HA3  5  
ATOM   7396  N  N    . CYS A 1 35 ? 63.262 -10.038 -2.222  1.00 0.00  ? 35  CYS A N    5  
ATOM   7397  C  CA   . CYS A 1 35 ? 63.300 -8.553  -2.021  1.00 0.00  ? 35  CYS A CA   5  
ATOM   7398  C  C    . CYS A 1 35 ? 62.208 -7.867  -2.860  1.00 0.00  ? 35  CYS A C    5  
ATOM   7399  O  O    . CYS A 1 35 ? 61.800 -8.370  -3.890  1.00 0.00  ? 35  CYS A O    5  
ATOM   7400  C  CB   . CYS A 1 35 ? 64.696 -8.130  -2.493  1.00 0.00  ? 35  CYS A CB   5  
ATOM   7401  S  SG   . CYS A 1 35 ? 65.950 -8.843  -1.398  1.00 0.00  ? 35  CYS A SG   5  
ATOM   7402  H  H    . CYS A 1 35 ? 63.810 -10.448 -2.923  1.00 0.00  ? 35  CYS A H    5  
ATOM   7403  H  HA   . CYS A 1 35 ? 63.177 -8.312  -0.977  1.00 0.00  ? 35  CYS A HA   5  
ATOM   7404  H  HB2  . CYS A 1 35 ? 64.857 -8.483  -3.501  1.00 0.00  ? 35  CYS A HB2  5  
ATOM   7405  H  HB3  . CYS A 1 35 ? 64.772 -7.053  -2.472  1.00 0.00  ? 35  CYS A HB3  5  
ATOM   7406  H  HG   . CYS A 1 35 ? 66.671 -9.166  -1.942  1.00 0.00  ? 35  CYS A HG   5  
ATOM   7407  N  N    . ILE A 1 36 ? 61.733 -6.721  -2.424  1.00 0.00  ? 36  ILE A N    5  
ATOM   7408  C  CA   . ILE A 1 36 ? 60.663 -6.000  -3.193  1.00 0.00  ? 36  ILE A CA   5  
ATOM   7409  C  C    . ILE A 1 36 ? 61.211 -5.504  -4.539  1.00 0.00  ? 36  ILE A C    5  
ATOM   7410  O  O    . ILE A 1 36 ? 62.235 -4.848  -4.603  1.00 0.00  ? 36  ILE A O    5  
ATOM   7411  C  CB   . ILE A 1 36 ? 60.240 -4.815  -2.306  1.00 0.00  ? 36  ILE A CB   5  
ATOM   7412  C  CG1  . ILE A 1 36 ? 59.432 -5.337  -1.110  1.00 0.00  ? 36  ILE A CG1  5  
ATOM   7413  C  CG2  . ILE A 1 36 ? 59.369 -3.844  -3.115  1.00 0.00  ? 36  ILE A CG2  5  
ATOM   7414  C  CD1  . ILE A 1 36 ? 59.303 -4.236  -0.048  1.00 0.00  ? 36  ILE A CD1  5  
ATOM   7415  H  H    . ILE A 1 36 ? 62.078 -6.336  -1.589  1.00 0.00  ? 36  ILE A H    5  
ATOM   7416  H  HA   . ILE A 1 36 ? 59.820 -6.652  -3.354  1.00 0.00  ? 36  ILE A HA   5  
ATOM   7417  H  HB   . ILE A 1 36 ? 61.121 -4.299  -1.951  1.00 0.00  ? 36  ILE A HB   5  
ATOM   7418  H  HG12 . ILE A 1 36 ? 58.447 -5.630  -1.448  1.00 0.00  ? 36  ILE A HG12 5  
ATOM   7419  H  HG13 . ILE A 1 36 ? 59.934 -6.192  -0.683  1.00 0.00  ? 36  ILE A HG13 5  
ATOM   7420  H  HG21 . ILE A 1 36 ? 59.404 -2.864  -2.661  1.00 0.00  ? 36  ILE A HG21 5  
ATOM   7421  H  HG22 . ILE A 1 36 ? 58.348 -4.199  -3.125  1.00 0.00  ? 36  ILE A HG22 5  
ATOM   7422  H  HG23 . ILE A 1 36 ? 59.737 -3.782  -4.128  1.00 0.00  ? 36  ILE A HG23 5  
ATOM   7423  H  HD11 . ILE A 1 36 ? 58.459 -4.450  0.592   1.00 0.00  ? 36  ILE A HD11 5  
ATOM   7424  H  HD12 . ILE A 1 36 ? 59.152 -3.283  -0.532  1.00 0.00  ? 36  ILE A HD12 5  
ATOM   7425  H  HD13 . ILE A 1 36 ? 60.204 -4.197  0.546   1.00 0.00  ? 36  ILE A HD13 5  
ATOM   7426  N  N    . SER A 1 37 ? 60.524 -5.813  -5.611  1.00 0.00  ? 37  SER A N    5  
ATOM   7427  C  CA   . SER A 1 37 ? 60.981 -5.368  -6.966  1.00 0.00  ? 37  SER A CA   5  
ATOM   7428  C  C    . SER A 1 37 ? 60.132 -4.186  -7.460  1.00 0.00  ? 37  SER A C    5  
ATOM   7429  O  O    . SER A 1 37 ? 59.132 -3.834  -6.859  1.00 0.00  ? 37  SER A O    5  
ATOM   7430  C  CB   . SER A 1 37 ? 60.780 -6.586  -7.867  1.00 0.00  ? 37  SER A CB   5  
ATOM   7431  O  OG   . SER A 1 37 ? 61.458 -6.374  -9.098  1.00 0.00  ? 37  SER A OG   5  
ATOM   7432  H  H    . SER A 1 37 ? 59.701 -6.340  -5.524  1.00 0.00  ? 37  SER A H    5  
ATOM   7433  H  HA   . SER A 1 37 ? 62.024 -5.097  -6.943  1.00 0.00  ? 37  SER A HA   5  
ATOM   7434  H  HB2  . SER A 1 37 ? 61.182 -7.463  -7.385  1.00 0.00  ? 37  SER A HB2  5  
ATOM   7435  H  HB3  . SER A 1 37 ? 59.722 -6.730  -8.045  1.00 0.00  ? 37  SER A HB3  5  
ATOM   7436  H  HG   . SER A 1 37 ? 61.853 -7.208  -9.368  1.00 0.00  ? 37  SER A HG   5  
ATOM   7437  N  N    . THR A 1 38 ? 60.522 -3.572  -8.552  1.00 0.00  ? 38  THR A N    5  
ATOM   7438  C  CA   . THR A 1 38 ? 59.738 -2.409  -9.089  1.00 0.00  ? 38  THR A CA   5  
ATOM   7439  C  C    . THR A 1 38 ? 58.371 -2.878  -9.605  1.00 0.00  ? 38  THR A C    5  
ATOM   7440  O  O    . THR A 1 38 ? 57.351 -2.310  -9.265  1.00 0.00  ? 38  THR A O    5  
ATOM   7441  C  CB   . THR A 1 38 ? 60.582 -1.827  -10.230 1.00 0.00  ? 38  THR A CB   5  
ATOM   7442  O  OG1  . THR A 1 38 ? 60.832 -2.833  -11.204 1.00 0.00  ? 38  THR A OG1  5  
ATOM   7443  C  CG2  . THR A 1 38 ? 61.912 -1.313  -9.675  1.00 0.00  ? 38  THR A CG2  5  
ATOM   7444  H  H    . THR A 1 38 ? 61.329 -3.877  -9.020  1.00 0.00  ? 38  THR A H    5  
ATOM   7445  H  HA   . THR A 1 38 ? 59.606 -1.665  -8.319  1.00 0.00  ? 38  THR A HA   5  
ATOM   7446  H  HB   . THR A 1 38 ? 60.048 -1.008  -10.687 1.00 0.00  ? 38  THR A HB   5  
ATOM   7447  H  HG1  . THR A 1 38 ? 61.072 -2.398  -12.026 1.00 0.00  ? 38  THR A HG1  5  
ATOM   7448  H  HG21 . THR A 1 38 ? 61.754 -0.879  -8.699  1.00 0.00  ? 38  THR A HG21 5  
ATOM   7449  H  HG22 . THR A 1 38 ? 62.312 -0.564  -10.340 1.00 0.00  ? 38  THR A HG22 5  
ATOM   7450  H  HG23 . THR A 1 38 ? 62.610 -2.133  -9.596  1.00 0.00  ? 38  THR A HG23 5  
ATOM   7451  N  N    . LYS A 1 39 ? 58.338 -3.919  -10.407 1.00 0.00  ? 39  LYS A N    5  
ATOM   7452  C  CA   . LYS A 1 39 ? 57.026 -4.433  -10.922 1.00 0.00  ? 39  LYS A CA   5  
ATOM   7453  C  C    . LYS A 1 39 ? 56.156 -4.877  -9.740  1.00 0.00  ? 39  LYS A C    5  
ATOM   7454  O  O    . LYS A 1 39 ? 54.957 -4.666  -9.724  1.00 0.00  ? 39  LYS A O    5  
ATOM   7455  C  CB   . LYS A 1 39 ? 57.375 -5.630  -11.819 1.00 0.00  ? 39  LYS A CB   5  
ATOM   7456  C  CG   . LYS A 1 39 ? 56.538 -5.574  -13.103 1.00 0.00  ? 39  LYS A CG   5  
ATOM   7457  C  CD   . LYS A 1 39 ? 55.076 -5.911  -12.786 1.00 0.00  ? 39  LYS A CD   5  
ATOM   7458  C  CE   . LYS A 1 39 ? 54.183 -4.717  -13.143 1.00 0.00  ? 39  LYS A CE   5  
ATOM   7459  N  NZ   . LYS A 1 39 ? 53.252 -4.564  -11.987 1.00 0.00  ? 39  LYS A NZ   5  
ATOM   7460  H  H    . LYS A 1 39 ? 59.173 -4.368  -10.657 1.00 0.00  ? 39  LYS A H    5  
ATOM   7461  H  HA   . LYS A 1 39 ? 56.521 -3.672  -11.497 1.00 0.00  ? 39  LYS A HA   5  
ATOM   7462  H  HB2  . LYS A 1 39 ? 58.424 -5.596  -12.072 1.00 0.00  ? 39  LYS A HB2  5  
ATOM   7463  H  HB3  . LYS A 1 39 ? 57.161 -6.549  -11.293 1.00 0.00  ? 39  LYS A HB3  5  
ATOM   7464  H  HG2  . LYS A 1 39 ? 56.598 -4.581  -13.526 1.00 0.00  ? 39  LYS A HG2  5  
ATOM   7465  H  HG3  . LYS A 1 39 ? 56.924 -6.290  -13.814 1.00 0.00  ? 39  LYS A HG3  5  
ATOM   7466  H  HD2  . LYS A 1 39 ? 54.773 -6.774  -13.363 1.00 0.00  ? 39  LYS A HD2  5  
ATOM   7467  H  HD3  . LYS A 1 39 ? 54.976 -6.131  -11.734 1.00 0.00  ? 39  LYS A HD3  5  
ATOM   7468  H  HE2  . LYS A 1 39 ? 54.782 -3.825  -13.268 1.00 0.00  ? 39  LYS A HE2  5  
ATOM   7469  H  HE3  . LYS A 1 39 ? 53.623 -4.924  -14.043 1.00 0.00  ? 39  LYS A HE3  5  
ATOM   7470  H  HZ1  . LYS A 1 39 ? 52.715 -3.679  -12.088 1.00 0.00  ? 39  LYS A HZ1  5  
ATOM   7471  H  HZ2  . LYS A 1 39 ? 53.799 -4.538  -11.099 1.00 0.00  ? 39  LYS A HZ2  5  
ATOM   7472  H  HZ3  . LYS A 1 39 ? 52.591 -5.366  -11.963 1.00 0.00  ? 39  LYS A HZ3  5  
ATOM   7473  N  N    . GLU A 1 40 ? 56.769 -5.470  -8.744  1.00 0.00  ? 40  GLU A N    5  
ATOM   7474  C  CA   . GLU A 1 40 ? 56.016 -5.919  -7.533  1.00 0.00  ? 40  GLU A CA   5  
ATOM   7475  C  C    . GLU A 1 40 ? 55.429 -4.697  -6.813  1.00 0.00  ? 40  GLU A C    5  
ATOM   7476  O  O    . GLU A 1 40 ? 54.266 -4.673  -6.453  1.00 0.00  ? 40  GLU A O    5  
ATOM   7477  C  CB   . GLU A 1 40 ? 57.074 -6.608  -6.668  1.00 0.00  ? 40  GLU A CB   5  
ATOM   7478  C  CG   . GLU A 1 40 ? 56.425 -7.218  -5.425  1.00 0.00  ? 40  GLU A CG   5  
ATOM   7479  C  CD   . GLU A 1 40 ? 57.467 -7.306  -4.311  1.00 0.00  ? 40  GLU A CD   5  
ATOM   7480  O  OE1  . GLU A 1 40 ? 58.410 -8.065  -4.468  1.00 0.00  ? 40  GLU A OE1  5  
ATOM   7481  O  OE2  . GLU A 1 40 ? 57.311 -6.608  -3.324  1.00 0.00  ? 40  GLU A OE2  5  
ATOM   7482  H  H    . GLU A 1 40 ? 57.738 -5.607  -8.787  1.00 0.00  ? 40  GLU A H    5  
ATOM   7483  H  HA   . GLU A 1 40 ? 55.238 -6.616  -7.801  1.00 0.00  ? 40  GLU A HA   5  
ATOM   7484  H  HB2  . GLU A 1 40 ? 57.553 -7.388  -7.242  1.00 0.00  ? 40  GLU A HB2  5  
ATOM   7485  H  HB3  . GLU A 1 40 ? 57.814 -5.882  -6.363  1.00 0.00  ? 40  GLU A HB3  5  
ATOM   7486  H  HG2  . GLU A 1 40 ? 55.602 -6.595  -5.103  1.00 0.00  ? 40  GLU A HG2  5  
ATOM   7487  H  HG3  . GLU A 1 40 ? 56.062 -8.207  -5.655  1.00 0.00  ? 40  GLU A HG3  5  
ATOM   7488  N  N    . LEU A 1 41 ? 56.227 -3.675  -6.627  1.00 0.00  ? 41  LEU A N    5  
ATOM   7489  C  CA   . LEU A 1 41 ? 55.733 -2.433  -5.959  1.00 0.00  ? 41  LEU A CA   5  
ATOM   7490  C  C    . LEU A 1 41 ? 54.669 -1.770  -6.845  1.00 0.00  ? 41  LEU A C    5  
ATOM   7491  O  O    . LEU A 1 41 ? 53.545 -1.561  -6.432  1.00 0.00  ? 41  LEU A O    5  
ATOM   7492  C  CB   . LEU A 1 41 ? 56.977 -1.540  -5.845  1.00 0.00  ? 41  LEU A CB   5  
ATOM   7493  C  CG   . LEU A 1 41 ? 56.796 -0.460  -4.767  1.00 0.00  ? 41  LEU A CG   5  
ATOM   7494  C  CD1  . LEU A 1 41 ? 55.332 -0.021  -4.659  1.00 0.00  ? 41  LEU A CD1  5  
ATOM   7495  C  CD2  . LEU A 1 41 ? 57.260 -1.011  -3.417  1.00 0.00  ? 41  LEU A CD2  5  
ATOM   7496  H  H    . LEU A 1 41 ? 57.154 -3.720  -6.945  1.00 0.00  ? 41  LEU A H    5  
ATOM   7497  H  HA   . LEU A 1 41 ? 55.337 -2.655  -4.981  1.00 0.00  ? 41  LEU A HA   5  
ATOM   7498  H  HB2  . LEU A 1 41 ? 57.829 -2.152  -5.588  1.00 0.00  ? 41  LEU A HB2  5  
ATOM   7499  H  HB3  . LEU A 1 41 ? 57.160 -1.062  -6.796  1.00 0.00  ? 41  LEU A HB3  5  
ATOM   7500  H  HG   . LEU A 1 41 ? 57.397 0.392   -5.034  1.00 0.00  ? 41  LEU A HG   5  
ATOM   7501  H  HD11 . LEU A 1 41 ? 55.007 0.387   -5.605  1.00 0.00  ? 41  LEU A HD11 5  
ATOM   7502  H  HD12 . LEU A 1 41 ? 55.240 0.733   -3.891  1.00 0.00  ? 41  LEU A HD12 5  
ATOM   7503  H  HD13 . LEU A 1 41 ? 54.718 -0.871  -4.402  1.00 0.00  ? 41  LEU A HD13 5  
ATOM   7504  H  HD21 . LEU A 1 41 ? 56.647 -0.599  -2.628  1.00 0.00  ? 41  LEU A HD21 5  
ATOM   7505  H  HD22 . LEU A 1 41 ? 58.291 -0.736  -3.251  1.00 0.00  ? 41  LEU A HD22 5  
ATOM   7506  H  HD23 . LEU A 1 41 ? 57.170 -2.087  -3.417  1.00 0.00  ? 41  LEU A HD23 5  
ATOM   7507  N  N    . GLY A 1 42 ? 55.036 -1.441  -8.061  1.00 0.00  ? 42  GLY A N    5  
ATOM   7508  C  CA   . GLY A 1 42 ? 54.081 -0.787  -9.018  1.00 0.00  ? 42  GLY A CA   5  
ATOM   7509  C  C    . GLY A 1 42 ? 52.727 -1.519  -9.043  1.00 0.00  ? 42  GLY A C    5  
ATOM   7510  O  O    . GLY A 1 42 ? 51.695 -0.901  -9.224  1.00 0.00  ? 42  GLY A O    5  
ATOM   7511  H  H    . GLY A 1 42 ? 55.958 -1.621  -8.345  1.00 0.00  ? 42  GLY A H    5  
ATOM   7512  H  HA2  . GLY A 1 42 ? 53.923 0.240   -8.712  1.00 0.00  ? 42  GLY A HA2  5  
ATOM   7513  H  HA3  . GLY A 1 42 ? 54.509 -0.803  -10.013 1.00 0.00  ? 42  GLY A HA3  5  
ATOM   7514  N  N    . LYS A 1 43 ? 52.715 -2.821  -8.861  1.00 0.00  ? 43  LYS A N    5  
ATOM   7515  C  CA   . LYS A 1 43 ? 51.413 -3.569  -8.869  1.00 0.00  ? 43  LYS A CA   5  
ATOM   7516  C  C    . LYS A 1 43 ? 50.481 -3.026  -7.773  1.00 0.00  ? 43  LYS A C    5  
ATOM   7517  O  O    . LYS A 1 43 ? 49.281 -2.938  -7.957  1.00 0.00  ? 43  LYS A O    5  
ATOM   7518  C  CB   . LYS A 1 43 ? 51.777 -5.032  -8.586  1.00 0.00  ? 43  LYS A CB   5  
ATOM   7519  C  CG   . LYS A 1 43 ? 50.760 -5.956  -9.267  1.00 0.00  ? 43  LYS A CG   5  
ATOM   7520  C  CD   . LYS A 1 43 ? 49.654 -6.323  -8.273  1.00 0.00  ? 43  LYS A CD   5  
ATOM   7521  C  CE   . LYS A 1 43 ? 48.319 -6.464  -9.015  1.00 0.00  ? 43  LYS A CE   5  
ATOM   7522  N  NZ   . LYS A 1 43 ? 47.754 -5.082  -9.087  1.00 0.00  ? 43  LYS A NZ   5  
ATOM   7523  H  H    . LYS A 1 43 ? 53.556 -3.303  -8.715  1.00 0.00  ? 43  LYS A H    5  
ATOM   7524  H  HA   . LYS A 1 43 ? 50.941 -3.487  -9.836  1.00 0.00  ? 43  LYS A HA   5  
ATOM   7525  H  HB2  . LYS A 1 43 ? 52.766 -5.240  -8.968  1.00 0.00  ? 43  LYS A HB2  5  
ATOM   7526  H  HB3  . LYS A 1 43 ? 51.760 -5.207  -7.520  1.00 0.00  ? 43  LYS A HB3  5  
ATOM   7527  H  HG2  . LYS A 1 43 ? 50.328 -5.450  -10.119 1.00 0.00  ? 43  LYS A HG2  5  
ATOM   7528  H  HG3  . LYS A 1 43 ? 51.256 -6.856  -9.597  1.00 0.00  ? 43  LYS A HG3  5  
ATOM   7529  H  HD2  . LYS A 1 43 ? 49.900 -7.260  -7.794  1.00 0.00  ? 43  LYS A HD2  5  
ATOM   7530  H  HD3  . LYS A 1 43 ? 49.569 -5.549  -7.525  1.00 0.00  ? 43  LYS A HD3  5  
ATOM   7531  H  HE2  . LYS A 1 43 ? 48.486 -6.855  -10.010 1.00 0.00  ? 43  LYS A HE2  5  
ATOM   7532  H  HE3  . LYS A 1 43 ? 47.651 -7.109  -8.465  1.00 0.00  ? 43  LYS A HE3  5  
ATOM   7533  H  HZ1  . LYS A 1 43 ? 46.718 -5.126  -9.013  1.00 0.00  ? 43  LYS A HZ1  5  
ATOM   7534  H  HZ2  . LYS A 1 43 ? 48.019 -4.648  -9.995  1.00 0.00  ? 43  LYS A HZ2  5  
ATOM   7535  H  HZ3  . LYS A 1 43 ? 48.129 -4.503  -8.306  1.00 0.00  ? 43  LYS A HZ3  5  
ATOM   7536  N  N    . VAL A 1 44 ? 51.030 -2.654  -6.641  1.00 0.00  ? 44  VAL A N    5  
ATOM   7537  C  CA   . VAL A 1 44 ? 50.188 -2.101  -5.532  1.00 0.00  ? 44  VAL A CA   5  
ATOM   7538  C  C    . VAL A 1 44 ? 49.973 -0.590  -5.740  1.00 0.00  ? 44  VAL A C    5  
ATOM   7539  O  O    . VAL A 1 44 ? 49.026 -0.019  -5.232  1.00 0.00  ? 44  VAL A O    5  
ATOM   7540  C  CB   . VAL A 1 44 ? 50.981 -2.374  -4.244  1.00 0.00  ? 44  VAL A CB   5  
ATOM   7541  C  CG1  . VAL A 1 44 ? 50.245 -1.777  -3.043  1.00 0.00  ? 44  VAL A CG1  5  
ATOM   7542  C  CG2  . VAL A 1 44 ? 51.119 -3.885  -4.037  1.00 0.00  ? 44  VAL A CG2  5  
ATOM   7543  H  H    . VAL A 1 44 ? 52.000 -2.728  -6.523  1.00 0.00  ? 44  VAL A H    5  
ATOM   7544  H  HA   . VAL A 1 44 ? 49.238 -2.611  -5.494  1.00 0.00  ? 44  VAL A HA   5  
ATOM   7545  H  HB   . VAL A 1 44 ? 51.963 -1.929  -4.322  1.00 0.00  ? 44  VAL A HB   5  
ATOM   7546  H  HG11 . VAL A 1 44 ? 50.803 -1.983  -2.141  1.00 0.00  ? 44  VAL A HG11 5  
ATOM   7547  H  HG12 . VAL A 1 44 ? 49.262 -2.220  -2.966  1.00 0.00  ? 44  VAL A HG12 5  
ATOM   7548  H  HG13 . VAL A 1 44 ? 50.150 -0.709  -3.171  1.00 0.00  ? 44  VAL A HG13 5  
ATOM   7549  H  HG21 . VAL A 1 44 ? 51.831 -4.283  -4.745  1.00 0.00  ? 44  VAL A HG21 5  
ATOM   7550  H  HG22 . VAL A 1 44 ? 50.160 -4.359  -4.187  1.00 0.00  ? 44  VAL A HG22 5  
ATOM   7551  H  HG23 . VAL A 1 44 ? 51.463 -4.080  -3.032  1.00 0.00  ? 44  VAL A HG23 5  
ATOM   7552  N  N    . MET A 1 45 ? 50.837 0.057   -6.492  1.00 0.00  ? 45  MET A N    5  
ATOM   7553  C  CA   . MET A 1 45 ? 50.675 1.526   -6.745  1.00 0.00  ? 45  MET A CA   5  
ATOM   7554  C  C    . MET A 1 45 ? 49.296 1.813   -7.358  1.00 0.00  ? 45  MET A C    5  
ATOM   7555  O  O    . MET A 1 45 ? 48.673 2.808   -7.047  1.00 0.00  ? 45  MET A O    5  
ATOM   7556  C  CB   . MET A 1 45 ? 51.792 1.896   -7.728  1.00 0.00  ? 45  MET A CB   5  
ATOM   7557  C  CG   . MET A 1 45 ? 53.087 2.165   -6.957  1.00 0.00  ? 45  MET A CG   5  
ATOM   7558  S  SD   . MET A 1 45 ? 53.083 3.865   -6.334  1.00 0.00  ? 45  MET A SD   5  
ATOM   7559  C  CE   . MET A 1 45 ? 54.462 3.687   -5.175  1.00 0.00  ? 45  MET A CE   5  
ATOM   7560  H  H    . MET A 1 45 ? 51.587 -0.426  -6.895  1.00 0.00  ? 45  MET A H    5  
ATOM   7561  H  HA   . MET A 1 45 ? 50.796 2.080   -5.828  1.00 0.00  ? 45  MET A HA   5  
ATOM   7562  H  HB2  . MET A 1 45 ? 51.947 1.082   -8.420  1.00 0.00  ? 45  MET A HB2  5  
ATOM   7563  H  HB3  . MET A 1 45 ? 51.510 2.784   -8.276  1.00 0.00  ? 45  MET A HB3  5  
ATOM   7564  H  HG2  . MET A 1 45 ? 53.159 1.480   -6.126  1.00 0.00  ? 45  MET A HG2  5  
ATOM   7565  H  HG3  . MET A 1 45 ? 53.932 2.025   -7.614  1.00 0.00  ? 45  MET A HG3  5  
ATOM   7566  H  HE1  . MET A 1 45 ? 54.465 2.686   -4.767  1.00 0.00  ? 45  MET A HE1  5  
ATOM   7567  H  HE2  . MET A 1 45 ? 54.353 4.398   -4.373  1.00 0.00  ? 45  MET A HE2  5  
ATOM   7568  H  HE3  . MET A 1 45 ? 55.392 3.873   -5.692  1.00 0.00  ? 45  MET A HE3  5  
ATOM   7569  N  N    . ARG A 1 46 ? 48.809 0.941   -8.213  1.00 0.00  ? 46  ARG A N    5  
ATOM   7570  C  CA   . ARG A 1 46 ? 47.460 1.156   -8.832  1.00 0.00  ? 46  ARG A CA   5  
ATOM   7571  C  C    . ARG A 1 46 ? 46.369 1.167   -7.745  1.00 0.00  ? 46  ARG A C    5  
ATOM   7572  O  O    . ARG A 1 46 ? 45.389 1.877   -7.853  1.00 0.00  ? 46  ARG A O    5  
ATOM   7573  C  CB   . ARG A 1 46 ? 47.257 -0.027  -9.787  1.00 0.00  ? 46  ARG A CB   5  
ATOM   7574  C  CG   . ARG A 1 46 ? 47.913 0.280   -11.139 1.00 0.00  ? 46  ARG A CG   5  
ATOM   7575  C  CD   . ARG A 1 46 ? 46.865 0.212   -12.257 1.00 0.00  ? 46  ARG A CD   5  
ATOM   7576  N  NE   . ARG A 1 46 ? 46.782 1.603   -12.796 1.00 0.00  ? 46  ARG A NE   5  
ATOM   7577  C  CZ   . ARG A 1 46 ? 46.937 1.827   -14.073 1.00 0.00  ? 46  ARG A CZ   5  
ATOM   7578  N  NH1  . ARG A 1 46 ? 48.035 1.462   -14.673 1.00 0.00  ? 46  ARG A NH1  5  
ATOM   7579  N  NH2  . ARG A 1 46 ? 45.993 2.422   -14.743 1.00 0.00  ? 46  ARG A NH2  5  
ATOM   7580  H  H    . ARG A 1 46 ? 49.328 0.139   -8.441  1.00 0.00  ? 46  ARG A H    5  
ATOM   7581  H  HA   . ARG A 1 46 ? 47.445 2.081   -9.384  1.00 0.00  ? 46  ARG A HA   5  
ATOM   7582  H  HB2  . ARG A 1 46 ? 47.705 -0.913  -9.360  1.00 0.00  ? 46  ARG A HB2  5  
ATOM   7583  H  HB3  . ARG A 1 46 ? 46.200 -0.193  -9.931  1.00 0.00  ? 46  ARG A HB3  5  
ATOM   7584  H  HG2  . ARG A 1 46 ? 48.346 1.269   -11.111 1.00 0.00  ? 46  ARG A HG2  5  
ATOM   7585  H  HG3  . ARG A 1 46 ? 48.689 -0.446  -11.333 1.00 0.00  ? 46  ARG A HG3  5  
ATOM   7586  H  HD2  . ARG A 1 46 ? 47.184 -0.476  -13.029 1.00 0.00  ? 46  ARG A HD2  5  
ATOM   7587  H  HD3  . ARG A 1 46 ? 45.907 -0.088  -11.860 1.00 0.00  ? 46  ARG A HD3  5  
ATOM   7588  H  HE   . ARG A 1 46 ? 46.600 2.351   -12.190 1.00 0.00  ? 46  ARG A HE   5  
ATOM   7589  H  HH11 . ARG A 1 46 ? 48.762 1.009   -14.157 1.00 0.00  ? 46  ARG A HH11 5  
ATOM   7590  H  HH12 . ARG A 1 46 ? 48.152 1.633   -15.651 1.00 0.00  ? 46  ARG A HH12 5  
ATOM   7591  H  HH21 . ARG A 1 46 ? 45.153 2.706   -14.279 1.00 0.00  ? 46  ARG A HH21 5  
ATOM   7592  H  HH22 . ARG A 1 46 ? 46.107 2.602   -15.719 1.00 0.00  ? 46  ARG A HH22 5  
ATOM   7593  N  N    . MET A 1 47 ? 46.541 0.393   -6.695  1.00 0.00  ? 47  MET A N    5  
ATOM   7594  C  CA   . MET A 1 47 ? 45.521 0.370   -5.594  1.00 0.00  ? 47  MET A CA   5  
ATOM   7595  C  C    . MET A 1 47 ? 45.430 1.752   -4.928  1.00 0.00  ? 47  MET A C    5  
ATOM   7596  O  O    . MET A 1 47 ? 44.377 2.164   -4.480  1.00 0.00  ? 47  MET A O    5  
ATOM   7597  C  CB   . MET A 1 47 ? 46.021 -0.679  -4.589  1.00 0.00  ? 47  MET A CB   5  
ATOM   7598  C  CG   . MET A 1 47 ? 45.221 -1.976  -4.752  1.00 0.00  ? 47  MET A CG   5  
ATOM   7599  S  SD   . MET A 1 47 ? 46.295 -3.272  -5.422  1.00 0.00  ? 47  MET A SD   5  
ATOM   7600  C  CE   . MET A 1 47 ? 46.794 -3.997  -3.840  1.00 0.00  ? 47  MET A CE   5  
ATOM   7601  H  H    . MET A 1 47 ? 47.343 -0.165  -6.627  1.00 0.00  ? 47  MET A H    5  
ATOM   7602  H  HA   . MET A 1 47 ? 44.557 0.079   -5.982  1.00 0.00  ? 47  MET A HA   5  
ATOM   7603  H  HB2  . MET A 1 47 ? 47.067 -0.877  -4.764  1.00 0.00  ? 47  MET A HB2  5  
ATOM   7604  H  HB3  . MET A 1 47 ? 45.891 -0.304  -3.585  1.00 0.00  ? 47  MET A HB3  5  
ATOM   7605  H  HG2  . MET A 1 47 ? 44.842 -2.287  -3.789  1.00 0.00  ? 47  MET A HG2  5  
ATOM   7606  H  HG3  . MET A 1 47 ? 44.395 -1.808  -5.426  1.00 0.00  ? 47  MET A HG3  5  
ATOM   7607  H  HE1  . MET A 1 47 ? 47.307 -3.250  -3.250  1.00 0.00  ? 47  MET A HE1  5  
ATOM   7608  H  HE2  . MET A 1 47 ? 47.454 -4.831  -4.015  1.00 0.00  ? 47  MET A HE2  5  
ATOM   7609  H  HE3  . MET A 1 47 ? 45.916 -4.340  -3.309  1.00 0.00  ? 47  MET A HE3  5  
ATOM   7610  N  N    . LEU A 1 48 ? 46.525 2.472   -4.872  1.00 0.00  ? 48  LEU A N    5  
ATOM   7611  C  CA   . LEU A 1 48 ? 46.507 3.833   -4.251  1.00 0.00  ? 48  LEU A CA   5  
ATOM   7612  C  C    . LEU A 1 48 ? 46.263 4.891   -5.335  1.00 0.00  ? 48  LEU A C    5  
ATOM   7613  O  O    . LEU A 1 48 ? 45.484 5.809   -5.157  1.00 0.00  ? 48  LEU A O    5  
ATOM   7614  C  CB   . LEU A 1 48 ? 47.899 4.006   -3.633  1.00 0.00  ? 48  LEU A CB   5  
ATOM   7615  C  CG   . LEU A 1 48 ? 47.999 3.184   -2.347  1.00 0.00  ? 48  LEU A CG   5  
ATOM   7616  C  CD1  . LEU A 1 48 ? 49.440 2.704   -2.159  1.00 0.00  ? 48  LEU A CD1  5  
ATOM   7617  C  CD2  . LEU A 1 48 ? 47.590 4.051   -1.156  1.00 0.00  ? 48  LEU A CD2  5  
ATOM   7618  H  H    . LEU A 1 48 ? 47.360 2.122   -5.250  1.00 0.00  ? 48  LEU A H    5  
ATOM   7619  H  HA   . LEU A 1 48 ? 45.750 3.890   -3.485  1.00 0.00  ? 48  LEU A HA   5  
ATOM   7620  H  HB2  . LEU A 1 48 ? 48.647 3.668   -4.336  1.00 0.00  ? 48  LEU A HB2  5  
ATOM   7621  H  HB3  . LEU A 1 48 ? 48.065 5.049   -3.407  1.00 0.00  ? 48  LEU A HB3  5  
ATOM   7622  H  HG   . LEU A 1 48 ? 47.341 2.329   -2.415  1.00 0.00  ? 48  LEU A HG   5  
ATOM   7623  H  HD11 . LEU A 1 48 ? 50.123 3.492   -2.437  1.00 0.00  ? 48  LEU A HD11 5  
ATOM   7624  H  HD12 . LEU A 1 48 ? 49.615 1.840   -2.783  1.00 0.00  ? 48  LEU A HD12 5  
ATOM   7625  H  HD13 . LEU A 1 48 ? 49.599 2.438   -1.124  1.00 0.00  ? 48  LEU A HD13 5  
ATOM   7626  H  HD21 . LEU A 1 48 ? 46.645 4.529   -1.366  1.00 0.00  ? 48  LEU A HD21 5  
ATOM   7627  H  HD22 . LEU A 1 48 ? 48.344 4.805   -0.984  1.00 0.00  ? 48  LEU A HD22 5  
ATOM   7628  H  HD23 . LEU A 1 48 ? 47.493 3.431   -0.277  1.00 0.00  ? 48  LEU A HD23 5  
ATOM   7629  N  N    . GLY A 1 49 ? 46.923 4.757   -6.459  1.00 0.00  ? 49  GLY A N    5  
ATOM   7630  C  CA   . GLY A 1 49 ? 46.742 5.733   -7.574  1.00 0.00  ? 49  GLY A CA   5  
ATOM   7631  C  C    . GLY A 1 49 ? 46.815 4.987   -8.909  1.00 0.00  ? 49  GLY A C    5  
ATOM   7632  O  O    . GLY A 1 49 ? 45.868 4.346   -9.322  1.00 0.00  ? 49  GLY A O    5  
ATOM   7633  H  H    . GLY A 1 49 ? 47.540 4.003   -6.572  1.00 0.00  ? 49  GLY A H    5  
ATOM   7634  H  HA2  . GLY A 1 49 ? 45.776 6.214   -7.481  1.00 0.00  ? 49  GLY A HA2  5  
ATOM   7635  H  HA3  . GLY A 1 49 ? 47.527 6.476   -7.536  1.00 0.00  ? 49  GLY A HA3  5  
ATOM   7636  N  N    . GLN A 1 50 ? 47.935 5.063   -9.585  1.00 0.00  ? 50  GLN A N    5  
ATOM   7637  C  CA   . GLN A 1 50 ? 48.079 4.356   -10.896 1.00 0.00  ? 50  GLN A CA   5  
ATOM   7638  C  C    . GLN A 1 50 ? 49.527 3.887   -11.099 1.00 0.00  ? 50  GLN A C    5  
ATOM   7639  O  O    . GLN A 1 50 ? 50.418 4.249   -10.355 1.00 0.00  ? 50  GLN A O    5  
ATOM   7640  C  CB   . GLN A 1 50 ? 47.695 5.396   -11.953 1.00 0.00  ? 50  GLN A CB   5  
ATOM   7641  C  CG   . GLN A 1 50 ? 46.169 5.520   -12.015 1.00 0.00  ? 50  GLN A CG   5  
ATOM   7642  C  CD   . GLN A 1 50 ? 45.737 5.981   -13.410 1.00 0.00  ? 50  GLN A CD   5  
ATOM   7643  O  OE1  . GLN A 1 50 ? 45.167 5.218   -14.163 1.00 0.00  ? 50  GLN A OE1  5  
ATOM   7644  N  NE2  . GLN A 1 50 ? 45.983 7.205   -13.790 1.00 0.00  ? 50  GLN A NE2  5  
ATOM   7645  H  H    . GLN A 1 50 ? 48.683 5.583   -9.228  1.00 0.00  ? 50  GLN A H    5  
ATOM   7646  H  HA   . GLN A 1 50 ? 47.406 3.517   -10.945 1.00 0.00  ? 50  GLN A HA   5  
ATOM   7647  H  HB2  . GLN A 1 50 ? 48.125 6.352   -11.688 1.00 0.00  ? 50  GLN A HB2  5  
ATOM   7648  H  HB3  . GLN A 1 50 ? 48.071 5.088   -12.918 1.00 0.00  ? 50  GLN A HB3  5  
ATOM   7649  H  HG2  . GLN A 1 50 ? 45.722 4.560   -11.802 1.00 0.00  ? 50  GLN A HG2  5  
ATOM   7650  H  HG3  . GLN A 1 50 ? 45.839 6.240   -11.283 1.00 0.00  ? 50  GLN A HG3  5  
ATOM   7651  H  HE21 . GLN A 1 50 ? 46.440 7.824   -13.185 1.00 0.00  ? 50  GLN A HE21 5  
ATOM   7652  H  HE22 . GLN A 1 50 ? 45.707 7.504   -14.680 1.00 0.00  ? 50  GLN A HE22 5  
ATOM   7653  N  N    . ASN A 1 51 ? 49.761 3.084   -12.106 1.00 0.00  ? 51  ASN A N    5  
ATOM   7654  C  CA   . ASN A 1 51 ? 51.144 2.583   -12.375 1.00 0.00  ? 51  ASN A CA   5  
ATOM   7655  C  C    . ASN A 1 51 ? 51.421 2.600   -13.886 1.00 0.00  ? 51  ASN A C    5  
ATOM   7656  O  O    . ASN A 1 51 ? 50.921 1.761   -14.612 1.00 0.00  ? 51  ASN A O    5  
ATOM   7657  C  CB   . ASN A 1 51 ? 51.157 1.149   -11.835 1.00 0.00  ? 51  ASN A CB   5  
ATOM   7658  C  CG   . ASN A 1 51 ? 52.557 0.553   -11.992 1.00 0.00  ? 51  ASN A CG   5  
ATOM   7659  O  OD1  . ASN A 1 51 ? 53.500 1.020   -11.387 1.00 0.00  ? 51  ASN A OD1  5  
ATOM   7660  N  ND2  . ASN A 1 51 ? 52.737 -0.466  -12.785 1.00 0.00  ? 51  ASN A ND2  5  
ATOM   7661  H  H    . ASN A 1 51 ? 49.025 2.811   -12.690 1.00 0.00  ? 51  ASN A H    5  
ATOM   7662  H  HA   . ASN A 1 51 ? 51.871 3.181   -11.850 1.00 0.00  ? 51  ASN A HA   5  
ATOM   7663  H  HB2  . ASN A 1 51 ? 50.884 1.156   -10.789 1.00 0.00  ? 51  ASN A HB2  5  
ATOM   7664  H  HB3  . ASN A 1 51 ? 50.449 0.551   -12.387 1.00 0.00  ? 51  ASN A HB3  5  
ATOM   7665  H  HD21 . ASN A 1 51 ? 51.979 -0.847  -13.277 1.00 0.00  ? 51  ASN A HD21 5  
ATOM   7666  H  HD22 . ASN A 1 51 ? 53.631 -0.851  -12.891 1.00 0.00  ? 51  ASN A HD22 5  
ATOM   7667  N  N    . PRO A 1 52 ? 52.204 3.564   -14.315 1.00 0.00  ? 52  PRO A N    5  
ATOM   7668  C  CA   . PRO A 1 52 ? 52.536 3.687   -15.757 1.00 0.00  ? 52  PRO A CA   5  
ATOM   7669  C  C    . PRO A 1 52 ? 53.611 2.666   -16.167 1.00 0.00  ? 52  PRO A C    5  
ATOM   7670  O  O    . PRO A 1 52 ? 53.454 1.950   -17.137 1.00 0.00  ? 52  PRO A O    5  
ATOM   7671  C  CB   . PRO A 1 52 ? 53.058 5.116   -15.881 1.00 0.00  ? 52  PRO A CB   5  
ATOM   7672  C  CG   . PRO A 1 52 ? 53.566 5.478   -14.519 1.00 0.00  ? 52  PRO A CG   5  
ATOM   7673  C  CD   . PRO A 1 52 ? 52.842 4.618   -13.511 1.00 0.00  ? 52  PRO A CD   5  
ATOM   7674  H  HA   . PRO A 1 52 ? 51.652 3.566   -16.361 1.00 0.00  ? 52  PRO A HA   5  
ATOM   7675  H  HB2  . PRO A 1 52 ? 53.858 5.160   -16.607 1.00 0.00  ? 52  PRO A HB2  5  
ATOM   7676  H  HB3  . PRO A 1 52 ? 52.258 5.783   -16.163 1.00 0.00  ? 52  PRO A HB3  5  
ATOM   7677  H  HG2  . PRO A 1 52 ? 54.630 5.295   -14.464 1.00 0.00  ? 52  PRO A HG2  5  
ATOM   7678  H  HG3  . PRO A 1 52 ? 53.363 6.519   -14.318 1.00 0.00  ? 52  PRO A HG3  5  
ATOM   7679  H  HD2  . PRO A 1 52 ? 53.546 4.189   -12.809 1.00 0.00  ? 52  PRO A HD2  5  
ATOM   7680  H  HD3  . PRO A 1 52 ? 52.093 5.195   -12.991 1.00 0.00  ? 52  PRO A HD3  5  
ATOM   7681  N  N    . THR A 1 53 ? 54.704 2.600   -15.445 1.00 0.00  ? 53  THR A N    5  
ATOM   7682  C  CA   . THR A 1 53 ? 55.791 1.634   -15.803 1.00 0.00  ? 53  THR A CA   5  
ATOM   7683  C  C    . THR A 1 53 ? 56.661 1.314   -14.576 1.00 0.00  ? 53  THR A C    5  
ATOM   7684  O  O    . THR A 1 53 ? 56.695 2.076   -13.627 1.00 0.00  ? 53  THR A O    5  
ATOM   7685  C  CB   . THR A 1 53 ? 56.624 2.345   -16.887 1.00 0.00  ? 53  THR A CB   5  
ATOM   7686  O  OG1  . THR A 1 53 ? 57.908 1.747   -16.977 1.00 0.00  ? 53  THR A OG1  5  
ATOM   7687  C  CG2  . THR A 1 53 ? 56.791 3.830   -16.547 1.00 0.00  ? 53  THR A CG2  5  
ATOM   7688  H  H    . THR A 1 53 ? 54.816 3.191   -14.673 1.00 0.00  ? 53  THR A H    5  
ATOM   7689  H  HA   . THR A 1 53 ? 55.366 0.728   -16.205 1.00 0.00  ? 53  THR A HA   5  
ATOM   7690  H  HB   . THR A 1 53 ? 56.121 2.253   -17.836 1.00 0.00  ? 53  THR A HB   5  
ATOM   7691  H  HG1  . THR A 1 53 ? 58.258 1.917   -17.857 1.00 0.00  ? 53  THR A HG1  5  
ATOM   7692  H  HG21 . THR A 1 53 ? 56.979 3.938   -15.489 1.00 0.00  ? 53  THR A HG21 5  
ATOM   7693  H  HG22 . THR A 1 53 ? 55.889 4.363   -16.809 1.00 0.00  ? 53  THR A HG22 5  
ATOM   7694  H  HG23 . THR A 1 53 ? 57.623 4.235   -17.105 1.00 0.00  ? 53  THR A HG23 5  
ATOM   7695  N  N    . PRO A 1 54 ? 57.351 0.195   -14.645 1.00 0.00  ? 54  PRO A N    5  
ATOM   7696  C  CA   . PRO A 1 54 ? 58.247 -0.225  -13.531 1.00 0.00  ? 54  PRO A CA   5  
ATOM   7697  C  C    . PRO A 1 54 ? 59.440 0.737   -13.401 1.00 0.00  ? 54  PRO A C    5  
ATOM   7698  O  O    . PRO A 1 54 ? 60.019 0.872   -12.340 1.00 0.00  ? 54  PRO A O    5  
ATOM   7699  C  CB   . PRO A 1 54 ? 58.701 -1.626  -13.946 1.00 0.00  ? 54  PRO A CB   5  
ATOM   7700  C  CG   . PRO A 1 54 ? 58.555 -1.645  -15.432 1.00 0.00  ? 54  PRO A CG   5  
ATOM   7701  C  CD   . PRO A 1 54 ? 57.369 -0.774  -15.751 1.00 0.00  ? 54  PRO A CD   5  
ATOM   7702  H  HA   . PRO A 1 54 ? 57.700 -0.275  -12.603 1.00 0.00  ? 54  PRO A HA   5  
ATOM   7703  H  HB2  . PRO A 1 54 ? 59.733 -1.786  -13.664 1.00 0.00  ? 54  PRO A HB2  5  
ATOM   7704  H  HB3  . PRO A 1 54 ? 58.066 -2.376  -13.503 1.00 0.00  ? 54  PRO A HB3  5  
ATOM   7705  H  HG2  . PRO A 1 54 ? 59.447 -1.246  -15.897 1.00 0.00  ? 54  PRO A HG2  5  
ATOM   7706  H  HG3  . PRO A 1 54 ? 58.372 -2.650  -15.776 1.00 0.00  ? 54  PRO A HG3  5  
ATOM   7707  H  HD2  . PRO A 1 54 ? 57.509 -0.275  -16.700 1.00 0.00  ? 54  PRO A HD2  5  
ATOM   7708  H  HD3  . PRO A 1 54 ? 56.460 -1.354  -15.753 1.00 0.00  ? 54  PRO A HD3  5  
ATOM   7709  N  N    . GLU A 1 55 ? 59.801 1.417   -14.469 1.00 0.00  ? 55  GLU A N    5  
ATOM   7710  C  CA   . GLU A 1 55 ? 60.944 2.383   -14.399 1.00 0.00  ? 55  GLU A CA   5  
ATOM   7711  C  C    . GLU A 1 55 ? 60.652 3.466   -13.350 1.00 0.00  ? 55  GLU A C    5  
ATOM   7712  O  O    . GLU A 1 55 ? 61.538 3.906   -12.642 1.00 0.00  ? 55  GLU A O    5  
ATOM   7713  C  CB   . GLU A 1 55 ? 61.042 3.000   -15.798 1.00 0.00  ? 55  GLU A CB   5  
ATOM   7714  C  CG   . GLU A 1 55 ? 61.833 2.062   -16.718 1.00 0.00  ? 55  GLU A CG   5  
ATOM   7715  C  CD   . GLU A 1 55 ? 60.879 1.363   -17.691 1.00 0.00  ? 55  GLU A CD   5  
ATOM   7716  O  OE1  . GLU A 1 55 ? 60.479 1.995   -18.655 1.00 0.00  ? 55  GLU A OE1  5  
ATOM   7717  O  OE2  . GLU A 1 55 ? 60.566 0.208   -17.456 1.00 0.00  ? 55  GLU A OE2  5  
ATOM   7718  H  H    . GLU A 1 55 ? 59.314 1.300   -15.312 1.00 0.00  ? 55  GLU A H    5  
ATOM   7719  H  HA   . GLU A 1 55 ? 61.859 1.866   -14.158 1.00 0.00  ? 55  GLU A HA   5  
ATOM   7720  H  HB2  . GLU A 1 55 ? 60.049 3.149   -16.198 1.00 0.00  ? 55  GLU A HB2  5  
ATOM   7721  H  HB3  . GLU A 1 55 ? 61.551 3.950   -15.737 1.00 0.00  ? 55  GLU A HB3  5  
ATOM   7722  H  HG2  . GLU A 1 55 ? 62.559 2.635   -17.276 1.00 0.00  ? 55  GLU A HG2  5  
ATOM   7723  H  HG3  . GLU A 1 55 ? 62.342 1.319   -16.123 1.00 0.00  ? 55  GLU A HG3  5  
ATOM   7724  N  N    . GLU A 1 56 ? 59.411 3.883   -13.236 1.00 0.00  ? 56  GLU A N    5  
ATOM   7725  C  CA   . GLU A 1 56 ? 59.053 4.922   -12.220 1.00 0.00  ? 56  GLU A CA   5  
ATOM   7726  C  C    . GLU A 1 56 ? 59.396 4.414   -10.814 1.00 0.00  ? 56  GLU A C    5  
ATOM   7727  O  O    . GLU A 1 56 ? 59.948 5.136   -10.006 1.00 0.00  ? 56  GLU A O    5  
ATOM   7728  C  CB   . GLU A 1 56 ? 57.542 5.132   -12.364 1.00 0.00  ? 56  GLU A CB   5  
ATOM   7729  C  CG   . GLU A 1 56 ? 57.260 6.013   -13.586 1.00 0.00  ? 56  GLU A CG   5  
ATOM   7730  C  CD   . GLU A 1 56 ? 56.654 7.346   -13.137 1.00 0.00  ? 56  GLU A CD   5  
ATOM   7731  O  OE1  . GLU A 1 56 ? 55.453 7.389   -12.930 1.00 0.00  ? 56  GLU A OE1  5  
ATOM   7732  O  OE2  . GLU A 1 56 ? 57.401 8.303   -13.015 1.00 0.00  ? 56  GLU A OE2  5  
ATOM   7733  H  H    . GLU A 1 56 ? 58.713 3.502   -13.810 1.00 0.00  ? 56  GLU A H    5  
ATOM   7734  H  HA   . GLU A 1 56 ? 59.575 5.844   -12.424 1.00 0.00  ? 56  GLU A HA   5  
ATOM   7735  H  HB2  . GLU A 1 56 ? 57.056 4.174   -12.489 1.00 0.00  ? 56  GLU A HB2  5  
ATOM   7736  H  HB3  . GLU A 1 56 ? 57.161 5.616   -11.477 1.00 0.00  ? 56  GLU A HB3  5  
ATOM   7737  H  HG2  . GLU A 1 56 ? 58.182 6.199   -14.117 1.00 0.00  ? 56  GLU A HG2  5  
ATOM   7738  H  HG3  . GLU A 1 56 ? 56.565 5.509   -14.239 1.00 0.00  ? 56  GLU A HG3  5  
ATOM   7739  N  N    . LEU A 1 57 ? 59.093 3.171   -10.524 1.00 0.00  ? 57  LEU A N    5  
ATOM   7740  C  CA   . LEU A 1 57 ? 59.426 2.619   -9.176  1.00 0.00  ? 57  LEU A CA   5  
ATOM   7741  C  C    . LEU A 1 57 ? 60.937 2.364   -9.078  1.00 0.00  ? 57  LEU A C    5  
ATOM   7742  O  O    . LEU A 1 57 ? 61.507 2.436   -8.010  1.00 0.00  ? 57  LEU A O    5  
ATOM   7743  C  CB   . LEU A 1 57 ? 58.656 1.299   -9.042  1.00 0.00  ? 57  LEU A CB   5  
ATOM   7744  C  CG   . LEU A 1 57 ? 57.144 1.543   -8.887  1.00 0.00  ? 57  LEU A CG   5  
ATOM   7745  C  CD1  . LEU A 1 57 ? 56.886 2.708   -7.928  1.00 0.00  ? 57  LEU A CD1  5  
ATOM   7746  C  CD2  . LEU A 1 57 ? 56.520 1.856   -10.250 1.00 0.00  ? 57  LEU A CD2  5  
ATOM   7747  H  H    . LEU A 1 57 ? 58.665 2.601   -11.195 1.00 0.00  ? 57  LEU A H    5  
ATOM   7748  H  HA   . LEU A 1 57 ? 59.116 3.307   -8.406  1.00 0.00  ? 57  LEU A HA   5  
ATOM   7749  H  HB2  . LEU A 1 57 ? 58.832 0.693   -9.916  1.00 0.00  ? 57  LEU A HB2  5  
ATOM   7750  H  HB3  . LEU A 1 57 ? 59.019 0.779   -8.167  1.00 0.00  ? 57  LEU A HB3  5  
ATOM   7751  H  HG   . LEU A 1 57 ? 56.686 0.651   -8.485  1.00 0.00  ? 57  LEU A HG   5  
ATOM   7752  H  HD11 . LEU A 1 57 ? 57.537 2.619   -7.071  1.00 0.00  ? 57  LEU A HD11 5  
ATOM   7753  H  HD12 . LEU A 1 57 ? 55.856 2.683   -7.603  1.00 0.00  ? 57  LEU A HD12 5  
ATOM   7754  H  HD13 . LEU A 1 57 ? 57.082 3.641   -8.434  1.00 0.00  ? 57  LEU A HD13 5  
ATOM   7755  H  HD21 . LEU A 1 57 ? 56.520 2.924   -10.411 1.00 0.00  ? 57  LEU A HD21 5  
ATOM   7756  H  HD22 . LEU A 1 57 ? 55.504 1.490   -10.271 1.00 0.00  ? 57  LEU A HD22 5  
ATOM   7757  H  HD23 . LEU A 1 57 ? 57.091 1.374   -11.028 1.00 0.00  ? 57  LEU A HD23 5  
ATOM   7758  N  N    . GLN A 1 58 ? 61.593 2.078   -10.187 1.00 0.00  ? 58  GLN A N    5  
ATOM   7759  C  CA   . GLN A 1 58 ? 63.073 1.840   -10.147 1.00 0.00  ? 58  GLN A CA   5  
ATOM   7760  C  C    . GLN A 1 58 ? 63.756 3.046   -9.495  1.00 0.00  ? 58  GLN A C    5  
ATOM   7761  O  O    . GLN A 1 58 ? 64.481 2.909   -8.528  1.00 0.00  ? 58  GLN A O    5  
ATOM   7762  C  CB   . GLN A 1 58 ? 63.509 1.696   -11.611 1.00 0.00  ? 58  GLN A CB   5  
ATOM   7763  C  CG   . GLN A 1 58 ? 64.314 0.404   -11.791 1.00 0.00  ? 58  GLN A CG   5  
ATOM   7764  C  CD   . GLN A 1 58 ? 65.551 0.425   -10.887 1.00 0.00  ? 58  GLN A CD   5  
ATOM   7765  O  OE1  . GLN A 1 58 ? 65.539 -0.136  -9.811  1.00 0.00  ? 58  GLN A OE1  5  
ATOM   7766  N  NE2  . GLN A 1 58 ? 66.625 1.048   -11.283 1.00 0.00  ? 58  GLN A NE2  5  
ATOM   7767  H  H    . GLN A 1 58 ? 61.114 2.031   -11.040 1.00 0.00  ? 58  GLN A H    5  
ATOM   7768  H  HA   . GLN A 1 58 ? 63.297 0.938   -9.599  1.00 0.00  ? 58  GLN A HA   5  
ATOM   7769  H  HB2  . GLN A 1 58 ? 62.636 1.665   -12.245 1.00 0.00  ? 58  GLN A HB2  5  
ATOM   7770  H  HB3  . GLN A 1 58 ? 64.123 2.541   -11.887 1.00 0.00  ? 58  GLN A HB3  5  
ATOM   7771  H  HG2  . GLN A 1 58 ? 63.695 -0.442  -11.532 1.00 0.00  ? 58  GLN A HG2  5  
ATOM   7772  H  HG3  . GLN A 1 58 ? 64.626 0.318   -12.821 1.00 0.00  ? 58  GLN A HG3  5  
ATOM   7773  H  HE21 . GLN A 1 58 ? 66.640 1.498   -12.152 1.00 0.00  ? 58  GLN A HE21 5  
ATOM   7774  H  HE22 . GLN A 1 58 ? 67.418 1.070   -10.705 1.00 0.00  ? 58  GLN A HE22 5  
ATOM   7775  N  N    . GLU A 1 59 ? 63.494 4.231   -9.994  1.00 0.00  ? 59  GLU A N    5  
ATOM   7776  C  CA   . GLU A 1 59 ? 64.091 5.455   -9.377  1.00 0.00  ? 59  GLU A CA   5  
ATOM   7777  C  C    . GLU A 1 59 ? 63.606 5.565   -7.923  1.00 0.00  ? 59  GLU A C    5  
ATOM   7778  O  O    . GLU A 1 59 ? 64.327 6.005   -7.048  1.00 0.00  ? 59  GLU A O    5  
ATOM   7779  C  CB   . GLU A 1 59 ? 63.573 6.628   -10.217 1.00 0.00  ? 59  GLU A CB   5  
ATOM   7780  C  CG   . GLU A 1 59 ? 64.627 7.738   -10.250 1.00 0.00  ? 59  GLU A CG   5  
ATOM   7781  C  CD   . GLU A 1 59 ? 63.946 9.101   -10.119 1.00 0.00  ? 59  GLU A CD   5  
ATOM   7782  O  OE1  . GLU A 1 59 ? 63.763 9.543   -8.997  1.00 0.00  ? 59  GLU A OE1  5  
ATOM   7783  O  OE2  . GLU A 1 59 ? 63.620 9.679   -11.142 1.00 0.00  ? 59  GLU A OE2  5  
ATOM   7784  H  H    . GLU A 1 59 ? 62.880 4.315   -10.755 1.00 0.00  ? 59  GLU A H    5  
ATOM   7785  H  HA   . GLU A 1 59 ? 65.169 5.413   -9.416  1.00 0.00  ? 59  GLU A HA   5  
ATOM   7786  H  HB2  . GLU A 1 59 ? 63.374 6.289   -11.224 1.00 0.00  ? 59  GLU A HB2  5  
ATOM   7787  H  HB3  . GLU A 1 59 ? 62.662 7.011   -9.780  1.00 0.00  ? 59  GLU A HB3  5  
ATOM   7788  H  HG2  . GLU A 1 59 ? 65.318 7.602   -9.430  1.00 0.00  ? 59  GLU A HG2  5  
ATOM   7789  H  HG3  . GLU A 1 59 ? 65.166 7.696   -11.185 1.00 0.00  ? 59  GLU A HG3  5  
ATOM   7790  N  N    . MET A 1 60 ? 62.389 5.137   -7.667  1.00 0.00  ? 60  MET A N    5  
ATOM   7791  C  CA   . MET A 1 60 ? 61.838 5.177   -6.277  1.00 0.00  ? 60  MET A CA   5  
ATOM   7792  C  C    . MET A 1 60 ? 62.642 4.237   -5.364  1.00 0.00  ? 60  MET A C    5  
ATOM   7793  O  O    . MET A 1 60 ? 62.896 4.549   -4.216  1.00 0.00  ? 60  MET A O    5  
ATOM   7794  C  CB   . MET A 1 60 ? 60.383 4.698   -6.403  1.00 0.00  ? 60  MET A CB   5  
ATOM   7795  C  CG   . MET A 1 60 ? 59.442 5.778   -5.859  1.00 0.00  ? 60  MET A CG   5  
ATOM   7796  S  SD   . MET A 1 60 ? 58.537 6.536   -7.231  1.00 0.00  ? 60  MET A SD   5  
ATOM   7797  C  CE   . MET A 1 60 ? 56.905 5.884   -6.807  1.00 0.00  ? 60  MET A CE   5  
ATOM   7798  H  H    . MET A 1 60 ? 61.842 4.773   -8.394  1.00 0.00  ? 60  MET A H    5  
ATOM   7799  H  HA   . MET A 1 60 ? 61.863 6.184   -5.892  1.00 0.00  ? 60  MET A HA   5  
ATOM   7800  H  HB2  . MET A 1 60 ? 60.151 4.506   -7.442  1.00 0.00  ? 60  MET A HB2  5  
ATOM   7801  H  HB3  . MET A 1 60 ? 60.250 3.788   -5.836  1.00 0.00  ? 60  MET A HB3  5  
ATOM   7802  H  HG2  . MET A 1 60 ? 58.741 5.332   -5.170  1.00 0.00  ? 60  MET A HG2  5  
ATOM   7803  H  HG3  . MET A 1 60 ? 60.017 6.535   -5.346  1.00 0.00  ? 60  MET A HG3  5  
ATOM   7804  H  HE1  . MET A 1 60 ? 56.999 4.850   -6.508  1.00 0.00  ? 60  MET A HE1  5  
ATOM   7805  H  HE2  . MET A 1 60 ? 56.256 5.950   -7.665  1.00 0.00  ? 60  MET A HE2  5  
ATOM   7806  H  HE3  . MET A 1 60 ? 56.487 6.463   -5.996  1.00 0.00  ? 60  MET A HE3  5  
ATOM   7807  N  N    . ILE A 1 61 ? 63.054 3.094   -5.869  1.00 0.00  ? 61  ILE A N    5  
ATOM   7808  C  CA   . ILE A 1 61 ? 63.852 2.149   -5.028  1.00 0.00  ? 61  ILE A CA   5  
ATOM   7809  C  C    . ILE A 1 61 ? 65.283 2.683   -4.871  1.00 0.00  ? 61  ILE A C    5  
ATOM   7810  O  O    . ILE A 1 61 ? 65.826 2.682   -3.786  1.00 0.00  ? 61  ILE A O    5  
ATOM   7811  C  CB   . ILE A 1 61 ? 63.807 0.784   -5.753  1.00 0.00  ? 61  ILE A CB   5  
ATOM   7812  C  CG1  . ILE A 1 61 ? 63.502 -0.308  -4.721  1.00 0.00  ? 61  ILE A CG1  5  
ATOM   7813  C  CG2  . ILE A 1 61 ? 65.148 0.473   -6.434  1.00 0.00  ? 61  ILE A CG2  5  
ATOM   7814  C  CD1  . ILE A 1 61 ? 63.082 -1.604  -5.428  1.00 0.00  ? 61  ILE A CD1  5  
ATOM   7815  H  H    . ILE A 1 61 ? 62.847 2.865   -6.800  1.00 0.00  ? 61  ILE A H    5  
ATOM   7816  H  HA   . ILE A 1 61 ? 63.394 2.056   -4.054  1.00 0.00  ? 61  ILE A HA   5  
ATOM   7817  H  HB   . ILE A 1 61 ? 63.025 0.799   -6.496  1.00 0.00  ? 61  ILE A HB   5  
ATOM   7818  H  HG12 . ILE A 1 61 ? 64.385 -0.494  -4.124  1.00 0.00  ? 61  ILE A HG12 5  
ATOM   7819  H  HG13 . ILE A 1 61 ? 62.700 0.025   -4.080  1.00 0.00  ? 61  ILE A HG13 5  
ATOM   7820  H  HG21 . ILE A 1 61 ? 65.335 1.198   -7.213  1.00 0.00  ? 61  ILE A HG21 5  
ATOM   7821  H  HG22 . ILE A 1 61 ? 65.113 -0.516  -6.866  1.00 0.00  ? 61  ILE A HG22 5  
ATOM   7822  H  HG23 . ILE A 1 61 ? 65.942 0.516   -5.703  1.00 0.00  ? 61  ILE A HG23 5  
ATOM   7823  H  HD11 . ILE A 1 61 ? 62.143 -1.948  -5.022  1.00 0.00  ? 61  ILE A HD11 5  
ATOM   7824  H  HD12 . ILE A 1 61 ? 63.838 -2.360  -5.272  1.00 0.00  ? 61  ILE A HD12 5  
ATOM   7825  H  HD13 . ILE A 1 61 ? 62.970 -1.421  -6.486  1.00 0.00  ? 61  ILE A HD13 5  
ATOM   7826  N  N    . ASP A 1 62 ? 65.887 3.163   -5.936  1.00 0.00  ? 62  ASP A N    5  
ATOM   7827  C  CA   . ASP A 1 62 ? 67.276 3.720   -5.831  1.00 0.00  ? 62  ASP A CA   5  
ATOM   7828  C  C    . ASP A 1 62 ? 67.317 4.825   -4.765  1.00 0.00  ? 62  ASP A C    5  
ATOM   7829  O  O    . ASP A 1 62 ? 68.313 5.014   -4.093  1.00 0.00  ? 62  ASP A O    5  
ATOM   7830  C  CB   . ASP A 1 62 ? 67.588 4.293   -7.220  1.00 0.00  ? 62  ASP A CB   5  
ATOM   7831  C  CG   . ASP A 1 62 ? 68.143 3.187   -8.120  1.00 0.00  ? 62  ASP A CG   5  
ATOM   7832  O  OD1  . ASP A 1 62 ? 69.317 2.884   -7.996  1.00 0.00  ? 62  ASP A OD1  5  
ATOM   7833  O  OD2  . ASP A 1 62 ? 67.384 2.663   -8.916  1.00 0.00  ? 62  ASP A OD2  5  
ATOM   7834  H  H    . ASP A 1 62 ? 65.421 3.172   -6.800  1.00 0.00  ? 62  ASP A H    5  
ATOM   7835  H  HA   . ASP A 1 62 ? 67.979 2.937   -5.589  1.00 0.00  ? 62  ASP A HA   5  
ATOM   7836  H  HB2  . ASP A 1 62 ? 66.684 4.692   -7.657  1.00 0.00  ? 62  ASP A HB2  5  
ATOM   7837  H  HB3  . ASP A 1 62 ? 68.321 5.080   -7.129  1.00 0.00  ? 62  ASP A HB3  5  
ATOM   7838  N  N    . GLU A 1 63 ? 66.228 5.540   -4.602  1.00 0.00  ? 63  GLU A N    5  
ATOM   7839  C  CA   . GLU A 1 63 ? 66.167 6.628   -3.575  1.00 0.00  ? 63  GLU A CA   5  
ATOM   7840  C  C    . GLU A 1 63 ? 66.418 6.061   -2.168  1.00 0.00  ? 63  GLU A C    5  
ATOM   7841  O  O    . GLU A 1 63 ? 67.013 6.709   -1.327  1.00 0.00  ? 63  GLU A O    5  
ATOM   7842  C  CB   . GLU A 1 63 ? 64.740 7.173   -3.682  1.00 0.00  ? 63  GLU A CB   5  
ATOM   7843  C  CG   . GLU A 1 63 ? 64.723 8.672   -3.358  1.00 0.00  ? 63  GLU A CG   5  
ATOM   7844  C  CD   . GLU A 1 63 ? 63.275 9.148   -3.206  1.00 0.00  ? 63  GLU A CD   5  
ATOM   7845  O  OE1  . GLU A 1 63 ? 62.676 8.847   -2.186  1.00 0.00  ? 63  GLU A OE1  5  
ATOM   7846  O  OE2  . GLU A 1 63 ? 62.789 9.803   -4.112  1.00 0.00  ? 63  GLU A OE2  5  
ATOM   7847  H  H    . GLU A 1 63 ? 65.440 5.352   -5.154  1.00 0.00  ? 63  GLU A H    5  
ATOM   7848  H  HA   . GLU A 1 63 ? 66.879 7.405   -3.804  1.00 0.00  ? 63  GLU A HA   5  
ATOM   7849  H  HB2  . GLU A 1 63 ? 64.372 7.020   -4.687  1.00 0.00  ? 63  GLU A HB2  5  
ATOM   7850  H  HB3  . GLU A 1 63 ? 64.102 6.648   -2.985  1.00 0.00  ? 63  GLU A HB3  5  
ATOM   7851  H  HG2  . GLU A 1 63 ? 65.259 8.847   -2.437  1.00 0.00  ? 63  GLU A HG2  5  
ATOM   7852  H  HG3  . GLU A 1 63 ? 65.197 9.219   -4.159  1.00 0.00  ? 63  GLU A HG3  5  
ATOM   7853  N  N    . VAL A 1 64 ? 65.963 4.859   -1.904  1.00 0.00  ? 64  VAL A N    5  
ATOM   7854  C  CA   . VAL A 1 64 ? 66.167 4.248   -0.553  1.00 0.00  ? 64  VAL A CA   5  
ATOM   7855  C  C    . VAL A 1 64 ? 66.885 2.884   -0.669  1.00 0.00  ? 64  VAL A C    5  
ATOM   7856  O  O    . VAL A 1 64 ? 66.781 2.044   0.205   1.00 0.00  ? 64  VAL A O    5  
ATOM   7857  C  CB   . VAL A 1 64 ? 64.746 4.091   0.015   1.00 0.00  ? 64  VAL A CB   5  
ATOM   7858  C  CG1  . VAL A 1 64 ? 64.009 2.963   -0.715  1.00 0.00  ? 64  VAL A CG1  5  
ATOM   7859  C  CG2  . VAL A 1 64 ? 64.820 3.767   1.511   1.00 0.00  ? 64  VAL A CG2  5  
ATOM   7860  H  H    . VAL A 1 64 ? 65.483 4.358   -2.596  1.00 0.00  ? 64  VAL A H    5  
ATOM   7861  H  HA   . VAL A 1 64 ? 66.738 4.914   0.075   1.00 0.00  ? 64  VAL A HA   5  
ATOM   7862  H  HB   . VAL A 1 64 ? 64.204 5.015   -0.124  1.00 0.00  ? 64  VAL A HB   5  
ATOM   7863  H  HG11 . VAL A 1 64 ? 64.615 2.608   -1.537  1.00 0.00  ? 64  VAL A HG11 5  
ATOM   7864  H  HG12 . VAL A 1 64 ? 63.071 3.336   -1.096  1.00 0.00  ? 64  VAL A HG12 5  
ATOM   7865  H  HG13 . VAL A 1 64 ? 63.822 2.151   -0.029  1.00 0.00  ? 64  VAL A HG13 5  
ATOM   7866  H  HG21 . VAL A 1 64 ? 64.519 2.742   1.672   1.00 0.00  ? 64  VAL A HG21 5  
ATOM   7867  H  HG22 . VAL A 1 64 ? 64.159 4.425   2.054   1.00 0.00  ? 64  VAL A HG22 5  
ATOM   7868  H  HG23 . VAL A 1 64 ? 65.832 3.905   1.861   1.00 0.00  ? 64  VAL A HG23 5  
ATOM   7869  N  N    . ASP A 1 65 ? 67.611 2.663   -1.742  1.00 0.00  ? 65  ASP A N    5  
ATOM   7870  C  CA   . ASP A 1 65 ? 68.332 1.363   -1.920  1.00 0.00  ? 65  ASP A CA   5  
ATOM   7871  C  C    . ASP A 1 65 ? 69.798 1.633   -2.320  1.00 0.00  ? 65  ASP A C    5  
ATOM   7872  O  O    . ASP A 1 65 ? 70.673 1.646   -1.477  1.00 0.00  ? 65  ASP A O    5  
ATOM   7873  C  CB   . ASP A 1 65 ? 67.544 0.639   -3.028  1.00 0.00  ? 65  ASP A CB   5  
ATOM   7874  C  CG   . ASP A 1 65 ? 67.853 -0.857  -3.012  1.00 0.00  ? 65  ASP A CG   5  
ATOM   7875  O  OD1  . ASP A 1 65 ? 67.263 -1.553  -2.206  1.00 0.00  ? 65  ASP A OD1  5  
ATOM   7876  O  OD2  . ASP A 1 65 ? 68.663 -1.286  -3.815  1.00 0.00  ? 65  ASP A OD2  5  
ATOM   7877  H  H    . ASP A 1 65 ? 67.683 3.354   -2.433  1.00 0.00  ? 65  ASP A H    5  
ATOM   7878  H  HA   . ASP A 1 65 ? 68.296 0.788   -1.007  1.00 0.00  ? 65  ASP A HA   5  
ATOM   7879  H  HB2  . ASP A 1 65 ? 66.486 0.780   -2.858  1.00 0.00  ? 65  ASP A HB2  5  
ATOM   7880  H  HB3  . ASP A 1 65 ? 67.805 1.048   -3.989  1.00 0.00  ? 65  ASP A HB3  5  
ATOM   7881  N  N    . GLU A 1 66 ? 70.062 1.878   -3.589  1.00 0.00  ? 66  GLU A N    5  
ATOM   7882  C  CA   . GLU A 1 66 ? 71.460 2.179   -4.059  1.00 0.00  ? 66  GLU A CA   5  
ATOM   7883  C  C    . GLU A 1 66 ? 72.515 1.284   -3.375  1.00 0.00  ? 66  GLU A C    5  
ATOM   7884  O  O    . GLU A 1 66 ? 73.527 1.761   -2.896  1.00 0.00  ? 66  GLU A O    5  
ATOM   7885  C  CB   . GLU A 1 66 ? 71.679 3.654   -3.699  1.00 0.00  ? 66  GLU A CB   5  
ATOM   7886  C  CG   . GLU A 1 66 ? 72.163 4.419   -4.936  1.00 0.00  ? 66  GLU A CG   5  
ATOM   7887  C  CD   . GLU A 1 66 ? 73.608 4.025   -5.255  1.00 0.00  ? 66  GLU A CD   5  
ATOM   7888  O  OE1  . GLU A 1 66 ? 74.505 4.671   -4.740  1.00 0.00  ? 66  GLU A OE1  5  
ATOM   7889  O  OE2  . GLU A 1 66 ? 73.791 3.085   -6.012  1.00 0.00  ? 66  GLU A OE2  5  
ATOM   7890  H  H    . GLU A 1 66 ? 69.334 1.886   -4.240  1.00 0.00  ? 66  GLU A H    5  
ATOM   7891  H  HA   . GLU A 1 66 ? 71.520 2.060   -5.129  1.00 0.00  ? 66  GLU A HA   5  
ATOM   7892  H  HB2  . GLU A 1 66 ? 70.749 4.082   -3.352  1.00 0.00  ? 66  GLU A HB2  5  
ATOM   7893  H  HB3  . GLU A 1 66 ? 72.422 3.729   -2.919  1.00 0.00  ? 66  GLU A HB3  5  
ATOM   7894  H  HG2  . GLU A 1 66 ? 71.531 4.178   -5.778  1.00 0.00  ? 66  GLU A HG2  5  
ATOM   7895  H  HG3  . GLU A 1 66 ? 72.117 5.480   -4.744  1.00 0.00  ? 66  GLU A HG3  5  
ATOM   7896  N  N    . ASP A 1 67 ? 72.294 -0.006  -3.336  1.00 0.00  ? 67  ASP A N    5  
ATOM   7897  C  CA   . ASP A 1 67 ? 73.293 -0.922  -2.692  1.00 0.00  ? 67  ASP A CA   5  
ATOM   7898  C  C    . ASP A 1 67 ? 73.874 -1.918  -3.717  1.00 0.00  ? 67  ASP A C    5  
ATOM   7899  O  O    . ASP A 1 67 ? 74.600 -2.828  -3.361  1.00 0.00  ? 67  ASP A O    5  
ATOM   7900  C  CB   . ASP A 1 67 ? 72.509 -1.652  -1.586  1.00 0.00  ? 67  ASP A CB   5  
ATOM   7901  C  CG   . ASP A 1 67 ? 71.654 -2.782  -2.175  1.00 0.00  ? 67  ASP A CG   5  
ATOM   7902  O  OD1  . ASP A 1 67 ? 71.070 -2.583  -3.227  1.00 0.00  ? 67  ASP A OD1  5  
ATOM   7903  O  OD2  . ASP A 1 67 ? 71.584 -3.827  -1.553  1.00 0.00  ? 67  ASP A OD2  5  
ATOM   7904  H  H    . ASP A 1 67 ? 71.477 -0.375  -3.733  1.00 0.00  ? 67  ASP A H    5  
ATOM   7905  H  HA   . ASP A 1 67 ? 74.090 -0.346  -2.249  1.00 0.00  ? 67  ASP A HA   5  
ATOM   7906  H  HB2  . ASP A 1 67 ? 73.205 -2.069  -0.873  1.00 0.00  ? 67  ASP A HB2  5  
ATOM   7907  H  HB3  . ASP A 1 67 ? 71.865 -0.947  -1.082  1.00 0.00  ? 67  ASP A HB3  5  
ATOM   7908  N  N    . GLY A 1 68 ? 73.562 -1.754  -4.984  1.00 0.00  ? 68  GLY A N    5  
ATOM   7909  C  CA   . GLY A 1 68 ? 74.094 -2.692  -6.023  1.00 0.00  ? 68  GLY A CA   5  
ATOM   7910  C  C    . GLY A 1 68 ? 73.064 -3.790  -6.336  1.00 0.00  ? 68  GLY A C    5  
ATOM   7911  O  O    . GLY A 1 68 ? 73.267 -4.594  -7.224  1.00 0.00  ? 68  GLY A O    5  
ATOM   7912  H  H    . GLY A 1 68 ? 72.977 -1.016  -5.252  1.00 0.00  ? 68  GLY A H    5  
ATOM   7913  H  HA2  . GLY A 1 68 ? 74.310 -2.138  -6.925  1.00 0.00  ? 68  GLY A HA2  5  
ATOM   7914  H  HA3  . GLY A 1 68 ? 75.000 -3.152  -5.660  1.00 0.00  ? 68  GLY A HA3  5  
ATOM   7915  N  N    . SER A 1 69 ? 71.965 -3.836  -5.619  1.00 0.00  ? 69  SER A N    5  
ATOM   7916  C  CA   . SER A 1 69 ? 70.935 -4.888  -5.883  1.00 0.00  ? 69  SER A CA   5  
ATOM   7917  C  C    . SER A 1 69 ? 69.712 -4.279  -6.590  1.00 0.00  ? 69  SER A C    5  
ATOM   7918  O  O    . SER A 1 69 ? 69.185 -4.851  -7.526  1.00 0.00  ? 69  SER A O    5  
ATOM   7919  C  CB   . SER A 1 69 ? 70.577 -5.450  -4.495  1.00 0.00  ? 69  SER A CB   5  
ATOM   7920  O  OG   . SER A 1 69 ? 69.240 -5.101  -4.143  1.00 0.00  ? 69  SER A OG   5  
ATOM   7921  H  H    . SER A 1 69 ? 71.817 -3.181  -4.904  1.00 0.00  ? 69  SER A H    5  
ATOM   7922  H  HA   . SER A 1 69 ? 71.358 -5.672  -6.492  1.00 0.00  ? 69  SER A HA   5  
ATOM   7923  H  HB2  . SER A 1 69 ? 70.666 -6.523  -4.510  1.00 0.00  ? 69  SER A HB2  5  
ATOM   7924  H  HB3  . SER A 1 69 ? 71.268 -5.051  -3.762  1.00 0.00  ? 69  SER A HB3  5  
ATOM   7925  H  HG   . SER A 1 69 ? 68.648 -5.736  -4.565  1.00 0.00  ? 69  SER A HG   5  
ATOM   7926  N  N    . GLY A 1 70 ? 69.252 -3.132  -6.146  1.00 0.00  ? 70  GLY A N    5  
ATOM   7927  C  CA   . GLY A 1 70 ? 68.057 -2.497  -6.787  1.00 0.00  ? 70  GLY A CA   5  
ATOM   7928  C  C    . GLY A 1 70 ? 66.781 -3.184  -6.286  1.00 0.00  ? 70  GLY A C    5  
ATOM   7929  O  O    . GLY A 1 70 ? 65.738 -3.104  -6.905  1.00 0.00  ? 70  GLY A O    5  
ATOM   7930  H  H    . GLY A 1 70 ? 69.683 -2.694  -5.382  1.00 0.00  ? 70  GLY A H    5  
ATOM   7931  H  HA2  . GLY A 1 70 ? 68.026 -1.445  -6.528  1.00 0.00  ? 70  GLY A HA2  5  
ATOM   7932  H  HA3  . GLY A 1 70 ? 68.122 -2.606  -7.862  1.00 0.00  ? 70  GLY A HA3  5  
ATOM   7933  N  N    . THR A 1 71 ? 66.865 -3.859  -5.170  1.00 0.00  ? 71  THR A N    5  
ATOM   7934  C  CA   . THR A 1 71 ? 65.677 -4.565  -4.608  1.00 0.00  ? 71  THR A CA   5  
ATOM   7935  C  C    . THR A 1 71 ? 65.564 -4.225  -3.122  1.00 0.00  ? 71  THR A C    5  
ATOM   7936  O  O    . THR A 1 71 ? 66.501 -4.415  -2.368  1.00 0.00  ? 71  THR A O    5  
ATOM   7937  C  CB   . THR A 1 71 ? 65.944 -6.071  -4.801  1.00 0.00  ? 71  THR A CB   5  
ATOM   7938  O  OG1  . THR A 1 71 ? 67.147 -6.279  -5.537  1.00 0.00  ? 71  THR A OG1  5  
ATOM   7939  C  CG2  . THR A 1 71 ? 64.771 -6.704  -5.554  1.00 0.00  ? 71  THR A CG2  5  
ATOM   7940  H  H    . THR A 1 71 ? 67.719 -3.906  -4.695  1.00 0.00  ? 71  THR A H    5  
ATOM   7941  H  HA   . THR A 1 71 ? 64.779 -4.274  -5.132  1.00 0.00  ? 71  THR A HA   5  
ATOM   7942  H  HB   . THR A 1 71 ? 66.036 -6.540  -3.836  1.00 0.00  ? 71  THR A HB   5  
ATOM   7943  H  HG1  . THR A 1 71 ? 66.997 -5.999  -6.445  1.00 0.00  ? 71  THR A HG1  5  
ATOM   7944  H  HG21 . THR A 1 71 ? 63.990 -6.961  -4.854  1.00 0.00  ? 71  THR A HG21 5  
ATOM   7945  H  HG22 . THR A 1 71 ? 65.109 -7.597  -6.059  1.00 0.00  ? 71  THR A HG22 5  
ATOM   7946  H  HG23 . THR A 1 71 ? 64.388 -6.004  -6.280  1.00 0.00  ? 71  THR A HG23 5  
ATOM   7947  N  N    . VAL A 1 72 ? 64.442 -3.706  -2.698  1.00 0.00  ? 72  VAL A N    5  
ATOM   7948  C  CA   . VAL A 1 72 ? 64.294 -3.329  -1.258  1.00 0.00  ? 72  VAL A CA   5  
ATOM   7949  C  C    . VAL A 1 72 ? 64.091 -4.575  -0.380  1.00 0.00  ? 72  VAL A C    5  
ATOM   7950  O  O    . VAL A 1 72 ? 63.186 -5.361  -0.589  1.00 0.00  ? 72  VAL A O    5  
ATOM   7951  C  CB   . VAL A 1 72 ? 63.062 -2.411  -1.208  1.00 0.00  ? 72  VAL A CB   5  
ATOM   7952  C  CG1  . VAL A 1 72 ? 62.478 -2.387  0.209   1.00 0.00  ? 72  VAL A CG1  5  
ATOM   7953  C  CG2  . VAL A 1 72 ? 63.469 -0.988  -1.599  1.00 0.00  ? 72  VAL A CG2  5  
ATOM   7954  H  H    . VAL A 1 72 ? 63.707 -3.544  -3.328  1.00 0.00  ? 72  VAL A H    5  
ATOM   7955  H  HA   . VAL A 1 72 ? 65.164 -2.783  -0.932  1.00 0.00  ? 72  VAL A HA   5  
ATOM   7956  H  HB   . VAL A 1 72 ? 62.316 -2.774  -1.899  1.00 0.00  ? 72  VAL A HB   5  
ATOM   7957  H  HG11 . VAL A 1 72 ? 62.010 -3.337  0.423   1.00 0.00  ? 72  VAL A HG11 5  
ATOM   7958  H  HG12 . VAL A 1 72 ? 61.742 -1.600  0.282   1.00 0.00  ? 72  VAL A HG12 5  
ATOM   7959  H  HG13 . VAL A 1 72 ? 63.269 -2.207  0.922   1.00 0.00  ? 72  VAL A HG13 5  
ATOM   7960  H  HG21 . VAL A 1 72 ? 63.354 -0.334  -0.748  1.00 0.00  ? 72  VAL A HG21 5  
ATOM   7961  H  HG22 . VAL A 1 72 ? 62.839 -0.643  -2.404  1.00 0.00  ? 72  VAL A HG22 5  
ATOM   7962  H  HG23 . VAL A 1 72 ? 64.501 -0.981  -1.921  1.00 0.00  ? 72  VAL A HG23 5  
ATOM   7963  N  N    . ASP A 1 73 ? 64.929 -4.740  0.611   1.00 0.00  ? 73  ASP A N    5  
ATOM   7964  C  CA   . ASP A 1 73 ? 64.808 -5.908  1.536   1.00 0.00  ? 73  ASP A CA   5  
ATOM   7965  C  C    . ASP A 1 73 ? 64.013 -5.490  2.786   1.00 0.00  ? 73  ASP A C    5  
ATOM   7966  O  O    . ASP A 1 73 ? 63.550 -4.369  2.879   1.00 0.00  ? 73  ASP A O    5  
ATOM   7967  C  CB   . ASP A 1 73 ? 66.257 -6.263  1.896   1.00 0.00  ? 73  ASP A CB   5  
ATOM   7968  C  CG   . ASP A 1 73 ? 66.312 -7.636  2.567   1.00 0.00  ? 73  ASP A CG   5  
ATOM   7969  O  OD1  . ASP A 1 73 ? 66.146 -8.622  1.870   1.00 0.00  ? 73  ASP A OD1  5  
ATOM   7970  O  OD2  . ASP A 1 73 ? 66.513 -7.675  3.769   1.00 0.00  ? 73  ASP A OD2  5  
ATOM   7971  H  H    . ASP A 1 73 ? 65.642 -4.082  0.756   1.00 0.00  ? 73  ASP A H    5  
ATOM   7972  H  HA   . ASP A 1 73 ? 64.330 -6.739  1.041   1.00 0.00  ? 73  ASP A HA   5  
ATOM   7973  H  HB2  . ASP A 1 73 ? 66.855 -6.281  0.996   1.00 0.00  ? 73  ASP A HB2  5  
ATOM   7974  H  HB3  . ASP A 1 73 ? 66.652 -5.520  2.572   1.00 0.00  ? 73  ASP A HB3  5  
ATOM   7975  N  N    . PHE A 1 74 ? 63.855 -6.367  3.748   1.00 0.00  ? 74  PHE A N    5  
ATOM   7976  C  CA   . PHE A 1 74 ? 63.095 -5.995  4.984   1.00 0.00  ? 74  PHE A CA   5  
ATOM   7977  C  C    . PHE A 1 74 ? 63.782 -4.811  5.680   1.00 0.00  ? 74  PHE A C    5  
ATOM   7978  O  O    . PHE A 1 74 ? 63.138 -3.864  6.091   1.00 0.00  ? 74  PHE A O    5  
ATOM   7979  C  CB   . PHE A 1 74 ? 63.125 -7.249  5.868   1.00 0.00  ? 74  PHE A CB   5  
ATOM   7980  C  CG   . PHE A 1 74 ? 62.509 -6.948  7.218   1.00 0.00  ? 74  PHE A CG   5  
ATOM   7981  C  CD1  . PHE A 1 74 ? 61.221 -6.401  7.300   1.00 0.00  ? 74  PHE A CD1  5  
ATOM   7982  C  CD2  . PHE A 1 74 ? 63.230 -7.217  8.387   1.00 0.00  ? 74  PHE A CD2  5  
ATOM   7983  C  CE1  . PHE A 1 74 ? 60.657 -6.125  8.551   1.00 0.00  ? 74  PHE A CE1  5  
ATOM   7984  C  CE2  . PHE A 1 74 ? 62.665 -6.941  9.638   1.00 0.00  ? 74  PHE A CE2  5  
ATOM   7985  C  CZ   . PHE A 1 74 ? 61.379 -6.395  9.720   1.00 0.00  ? 74  PHE A CZ   5  
ATOM   7986  H  H    . PHE A 1 74 ? 64.240 -7.263  3.662   1.00 0.00  ? 74  PHE A H    5  
ATOM   7987  H  HA   . PHE A 1 74 ? 62.075 -5.743  4.736   1.00 0.00  ? 74  PHE A HA   5  
ATOM   7988  H  HB2  . PHE A 1 74 ? 62.567 -8.039  5.388   1.00 0.00  ? 74  PHE A HB2  5  
ATOM   7989  H  HB3  . PHE A 1 74 ? 64.148 -7.567  6.006   1.00 0.00  ? 74  PHE A HB3  5  
ATOM   7990  H  HD1  . PHE A 1 74 ? 60.664 -6.193  6.398   1.00 0.00  ? 74  PHE A HD1  5  
ATOM   7991  H  HD2  . PHE A 1 74 ? 64.222 -7.639  8.324   1.00 0.00  ? 74  PHE A HD2  5  
ATOM   7992  H  HE1  . PHE A 1 74 ? 59.666 -5.703  8.615   1.00 0.00  ? 74  PHE A HE1  5  
ATOM   7993  H  HE2  . PHE A 1 74 ? 63.222 -7.150  10.540  1.00 0.00  ? 74  PHE A HE2  5  
ATOM   7994  H  HZ   . PHE A 1 74 ? 60.944 -6.182  10.685  1.00 0.00  ? 74  PHE A HZ   5  
ATOM   7995  N  N    . ASP A 1 75 ? 65.087 -4.856  5.798   1.00 0.00  ? 75  ASP A N    5  
ATOM   7996  C  CA   . ASP A 1 75 ? 65.828 -3.732  6.451   1.00 0.00  ? 75  ASP A CA   5  
ATOM   7997  C  C    . ASP A 1 75 ? 65.644 -2.435  5.648   1.00 0.00  ? 75  ASP A C    5  
ATOM   7998  O  O    . ASP A 1 75 ? 65.326 -1.396  6.198   1.00 0.00  ? 75  ASP A O    5  
ATOM   7999  C  CB   . ASP A 1 75 ? 67.294 -4.174  6.440   1.00 0.00  ? 75  ASP A CB   5  
ATOM   8000  C  CG   . ASP A 1 75 ? 68.164 -3.098  7.094   1.00 0.00  ? 75  ASP A CG   5  
ATOM   8001  O  OD1  . ASP A 1 75 ? 68.135 -2.999  8.310   1.00 0.00  ? 75  ASP A OD1  5  
ATOM   8002  O  OD2  . ASP A 1 75 ? 68.844 -2.392  6.368   1.00 0.00  ? 75  ASP A OD2  5  
ATOM   8003  H  H    . ASP A 1 75 ? 65.581 -5.628  5.448   1.00 0.00  ? 75  ASP A H    5  
ATOM   8004  H  HA   . ASP A 1 75 ? 65.491 -3.597  7.467   1.00 0.00  ? 75  ASP A HA   5  
ATOM   8005  H  HB2  . ASP A 1 75 ? 67.394 -5.099  6.987   1.00 0.00  ? 75  ASP A HB2  5  
ATOM   8006  H  HB3  . ASP A 1 75 ? 67.617 -4.323  5.420   1.00 0.00  ? 75  ASP A HB3  5  
ATOM   8007  N  N    . GLU A 1 76 ? 65.828 -2.494  4.350   1.00 0.00  ? 76  GLU A N    5  
ATOM   8008  C  CA   . GLU A 1 76 ? 65.650 -1.269  3.507   1.00 0.00  ? 76  GLU A CA   5  
ATOM   8009  C  C    . GLU A 1 76 ? 64.175 -0.850  3.511   1.00 0.00  ? 76  GLU A C    5  
ATOM   8010  O  O    . GLU A 1 76 ? 63.857 0.323   3.462   1.00 0.00  ? 76  GLU A O    5  
ATOM   8011  C  CB   . GLU A 1 76 ? 66.107 -1.672  2.100   1.00 0.00  ? 76  GLU A CB   5  
ATOM   8012  C  CG   . GLU A 1 76 ? 67.591 -2.071  2.140   1.00 0.00  ? 76  GLU A CG   5  
ATOM   8013  C  CD   . GLU A 1 76 ? 68.046 -2.559  0.762   1.00 0.00  ? 76  GLU A CD   5  
ATOM   8014  O  OE1  . GLU A 1 76 ? 67.480 -3.523  0.274   1.00 0.00  ? 76  GLU A OE1  5  
ATOM   8015  O  OE2  . GLU A 1 76 ? 68.964 -1.968  0.220   1.00 0.00  ? 76  GLU A OE2  5  
ATOM   8016  H  H    . GLU A 1 76 ? 66.071 -3.346  3.931   1.00 0.00  ? 76  GLU A H    5  
ATOM   8017  H  HA   . GLU A 1 76 ? 66.267 -0.466  3.879   1.00 0.00  ? 76  GLU A HA   5  
ATOM   8018  H  HB2  . GLU A 1 76 ? 65.516 -2.507  1.754   1.00 0.00  ? 76  GLU A HB2  5  
ATOM   8019  H  HB3  . GLU A 1 76 ? 65.979 -0.837  1.427   1.00 0.00  ? 76  GLU A HB3  5  
ATOM   8020  H  HG2  . GLU A 1 76 ? 68.183 -1.215  2.430   1.00 0.00  ? 76  GLU A HG2  5  
ATOM   8021  H  HG3  . GLU A 1 76 ? 67.729 -2.862  2.861   1.00 0.00  ? 76  GLU A HG3  5  
ATOM   8022  N  N    . PHE A 1 77 ? 63.275 -1.802  3.596   1.00 0.00  ? 77  PHE A N    5  
ATOM   8023  C  CA   . PHE A 1 77 ? 61.820 -1.469  3.636   1.00 0.00  ? 77  PHE A CA   5  
ATOM   8024  C  C    . PHE A 1 77 ? 61.528 -0.600  4.869   1.00 0.00  ? 77  PHE A C    5  
ATOM   8025  O  O    . PHE A 1 77 ? 60.760 0.341   4.805   1.00 0.00  ? 77  PHE A O    5  
ATOM   8026  C  CB   . PHE A 1 77 ? 61.105 -2.821  3.733   1.00 0.00  ? 77  PHE A CB   5  
ATOM   8027  C  CG   . PHE A 1 77 ? 59.611 -2.616  3.667   1.00 0.00  ? 77  PHE A CG   5  
ATOM   8028  C  CD1  . PHE A 1 77 ? 59.014 -2.188  2.475   1.00 0.00  ? 77  PHE A CD1  5  
ATOM   8029  C  CD2  . PHE A 1 77 ? 58.823 -2.856  4.798   1.00 0.00  ? 77  PHE A CD2  5  
ATOM   8030  C  CE1  . PHE A 1 77 ? 57.630 -2.000  2.416   1.00 0.00  ? 77  PHE A CE1  5  
ATOM   8031  C  CE2  . PHE A 1 77 ? 57.438 -2.668  4.738   1.00 0.00  ? 77  PHE A CE2  5  
ATOM   8032  C  CZ   . PHE A 1 77 ? 56.841 -2.241  3.547   1.00 0.00  ? 77  PHE A CZ   5  
ATOM   8033  H  H    . PHE A 1 77 ? 63.561 -2.738  3.652   1.00 0.00  ? 77  PHE A H    5  
ATOM   8034  H  HA   . PHE A 1 77 ? 61.526 -0.956  2.734   1.00 0.00  ? 77  PHE A HA   5  
ATOM   8035  H  HB2  . PHE A 1 77 ? 61.417 -3.452  2.912   1.00 0.00  ? 77  PHE A HB2  5  
ATOM   8036  H  HB3  . PHE A 1 77 ? 61.361 -3.297  4.667   1.00 0.00  ? 77  PHE A HB3  5  
ATOM   8037  H  HD1  . PHE A 1 77 ? 59.623 -2.001  1.603   1.00 0.00  ? 77  PHE A HD1  5  
ATOM   8038  H  HD2  . PHE A 1 77 ? 59.285 -3.185  5.716   1.00 0.00  ? 77  PHE A HD2  5  
ATOM   8039  H  HE1  . PHE A 1 77 ? 57.170 -1.670  1.497   1.00 0.00  ? 77  PHE A HE1  5  
ATOM   8040  H  HE2  . PHE A 1 77 ? 56.829 -2.853  5.611   1.00 0.00  ? 77  PHE A HE2  5  
ATOM   8041  H  HZ   . PHE A 1 77 ? 55.773 -2.094  3.501   1.00 0.00  ? 77  PHE A HZ   5  
ATOM   8042  N  N    . LEU A 1 78 ? 62.158 -0.896  5.984   1.00 0.00  ? 78  LEU A N    5  
ATOM   8043  C  CA   . LEU A 1 78 ? 61.940 -0.071  7.215   1.00 0.00  ? 78  LEU A CA   5  
ATOM   8044  C  C    . LEU A 1 78 ? 62.437 1.361   6.966   1.00 0.00  ? 78  LEU A C    5  
ATOM   8045  O  O    . LEU A 1 78 ? 61.820 2.320   7.391   1.00 0.00  ? 78  LEU A O    5  
ATOM   8046  C  CB   . LEU A 1 78 ? 62.759 -0.752  8.320   1.00 0.00  ? 78  LEU A CB   5  
ATOM   8047  C  CG   . LEU A 1 78 ? 62.125 -2.100  8.684   1.00 0.00  ? 78  LEU A CG   5  
ATOM   8048  C  CD1  . LEU A 1 78 ? 63.063 -2.869  9.614   1.00 0.00  ? 78  LEU A CD1  5  
ATOM   8049  C  CD2  . LEU A 1 78 ? 60.790 -1.870  9.396   1.00 0.00  ? 78  LEU A CD2  5  
ATOM   8050  H  H    . LEU A 1 78 ? 62.786 -1.649  6.005   1.00 0.00  ? 78  LEU A H    5  
ATOM   8051  H  HA   . LEU A 1 78 ? 60.895 -0.062  7.481   1.00 0.00  ? 78  LEU A HA   5  
ATOM   8052  H  HB2  . LEU A 1 78 ? 63.768 -0.912  7.971   1.00 0.00  ? 78  LEU A HB2  5  
ATOM   8053  H  HB3  . LEU A 1 78 ? 62.778 -0.119  9.195   1.00 0.00  ? 78  LEU A HB3  5  
ATOM   8054  H  HG   . LEU A 1 78 ? 61.961 -2.676  7.784   1.00 0.00  ? 78  LEU A HG   5  
ATOM   8055  H  HD11 . LEU A 1 78 ? 63.183 -2.321  10.537  1.00 0.00  ? 78  LEU A HD11 5  
ATOM   8056  H  HD12 . LEU A 1 78 ? 64.025 -2.988  9.138   1.00 0.00  ? 78  LEU A HD12 5  
ATOM   8057  H  HD13 . LEU A 1 78 ? 62.642 -3.841  9.825   1.00 0.00  ? 78  LEU A HD13 5  
ATOM   8058  H  HD21 . LEU A 1 78 ? 60.388 -2.818  9.721   1.00 0.00  ? 78  LEU A HD21 5  
ATOM   8059  H  HD22 . LEU A 1 78 ? 60.096 -1.398  8.716   1.00 0.00  ? 78  LEU A HD22 5  
ATOM   8060  H  HD23 . LEU A 1 78 ? 60.945 -1.232  10.254  1.00 0.00  ? 78  LEU A HD23 5  
ATOM   8061  N  N    . VAL A 1 79 ? 63.533 1.513   6.251   1.00 0.00  ? 79  VAL A N    5  
ATOM   8062  C  CA   . VAL A 1 79 ? 64.052 2.885   5.941   1.00 0.00  ? 79  VAL A CA   5  
ATOM   8063  C  C    . VAL A 1 79 ? 63.028 3.625   5.065   1.00 0.00  ? 79  VAL A C    5  
ATOM   8064  O  O    . VAL A 1 79 ? 62.839 4.820   5.184   1.00 0.00  ? 79  VAL A O    5  
ATOM   8065  C  CB   . VAL A 1 79 ? 65.366 2.671   5.173   1.00 0.00  ? 79  VAL A CB   5  
ATOM   8066  C  CG1  . VAL A 1 79 ? 65.914 4.020   4.698   1.00 0.00  ? 79  VAL A CG1  5  
ATOM   8067  C  CG2  . VAL A 1 79 ? 66.400 2.009   6.088   1.00 0.00  ? 79  VAL A CG2  5  
ATOM   8068  H  H    . VAL A 1 79 ? 64.000 0.724   5.901   1.00 0.00  ? 79  VAL A H    5  
ATOM   8069  H  HA   . VAL A 1 79 ? 64.236 3.434   6.850   1.00 0.00  ? 79  VAL A HA   5  
ATOM   8070  H  HB   . VAL A 1 79 ? 65.182 2.037   4.317   1.00 0.00  ? 79  VAL A HB   5  
ATOM   8071  H  HG11 . VAL A 1 79 ? 66.028 4.682   5.544   1.00 0.00  ? 79  VAL A HG11 5  
ATOM   8072  H  HG12 . VAL A 1 79 ? 65.227 4.458   3.988   1.00 0.00  ? 79  VAL A HG12 5  
ATOM   8073  H  HG13 . VAL A 1 79 ? 66.874 3.872   4.224   1.00 0.00  ? 79  VAL A HG13 5  
ATOM   8074  H  HG21 . VAL A 1 79 ? 67.355 1.976   5.584   1.00 0.00  ? 79  VAL A HG21 5  
ATOM   8075  H  HG22 . VAL A 1 79 ? 66.083 1.003   6.323   1.00 0.00  ? 79  VAL A HG22 5  
ATOM   8076  H  HG23 . VAL A 1 79 ? 66.494 2.581   6.999   1.00 0.00  ? 79  VAL A HG23 5  
ATOM   8077  N  N    . MET A 1 80 ? 62.354 2.906   4.198   1.00 0.00  ? 80  MET A N    5  
ATOM   8078  C  CA   . MET A 1 80 ? 61.319 3.539   3.323   1.00 0.00  ? 80  MET A CA   5  
ATOM   8079  C  C    . MET A 1 80 ? 60.130 3.996   4.182   1.00 0.00  ? 80  MET A C    5  
ATOM   8080  O  O    . MET A 1 80 ? 59.565 5.052   3.966   1.00 0.00  ? 80  MET A O    5  
ATOM   8081  C  CB   . MET A 1 80 ? 60.896 2.426   2.356   1.00 0.00  ? 80  MET A CB   5  
ATOM   8082  C  CG   . MET A 1 80 ? 60.242 3.034   1.113   1.00 0.00  ? 80  MET A CG   5  
ATOM   8083  S  SD   . MET A 1 80 ? 60.787 2.127   -0.355  1.00 0.00  ? 80  MET A SD   5  
ATOM   8084  C  CE   . MET A 1 80 ? 60.631 3.493   -1.529  1.00 0.00  ? 80  MET A CE   5  
ATOM   8085  H  H    . MET A 1 80 ? 62.519 1.942   4.133   1.00 0.00  ? 80  MET A H    5  
ATOM   8086  H  HA   . MET A 1 80 ? 61.737 4.370   2.776   1.00 0.00  ? 80  MET A HA   5  
ATOM   8087  H  HB2  . MET A 1 80 ? 61.767 1.858   2.062   1.00 0.00  ? 80  MET A HB2  5  
ATOM   8088  H  HB3  . MET A 1 80 ? 60.191 1.773   2.848   1.00 0.00  ? 80  MET A HB3  5  
ATOM   8089  H  HG2  . MET A 1 80 ? 59.168 2.964   1.200   1.00 0.00  ? 80  MET A HG2  5  
ATOM   8090  H  HG3  . MET A 1 80 ? 60.529 4.071   1.023   1.00 0.00  ? 80  MET A HG3  5  
ATOM   8091  H  HE1  . MET A 1 80 ? 60.796 3.125   -2.533  1.00 0.00  ? 80  MET A HE1  5  
ATOM   8092  H  HE2  . MET A 1 80 ? 61.363 4.251   -1.302  1.00 0.00  ? 80  MET A HE2  5  
ATOM   8093  H  HE3  . MET A 1 80 ? 59.640 3.918   -1.453  1.00 0.00  ? 80  MET A HE3  5  
ATOM   8094  N  N    . MET A 1 81 ? 59.756 3.204   5.160   1.00 0.00  ? 81  MET A N    5  
ATOM   8095  C  CA   . MET A 1 81 ? 58.611 3.574   6.051   1.00 0.00  ? 81  MET A CA   5  
ATOM   8096  C  C    . MET A 1 81 ? 58.953 4.817   6.886   1.00 0.00  ? 81  MET A C    5  
ATOM   8097  O  O    . MET A 1 81 ? 58.191 5.765   6.929   1.00 0.00  ? 81  MET A O    5  
ATOM   8098  C  CB   . MET A 1 81 ? 58.406 2.357   6.960   1.00 0.00  ? 81  MET A CB   5  
ATOM   8099  C  CG   . MET A 1 81 ? 57.260 1.493   6.424   1.00 0.00  ? 81  MET A CG   5  
ATOM   8100  S  SD   . MET A 1 81 ? 57.458 1.240   4.640   1.00 0.00  ? 81  MET A SD   5  
ATOM   8101  C  CE   . MET A 1 81 ? 55.754 1.619   4.161   1.00 0.00  ? 81  MET A CE   5  
ATOM   8102  H  H    . MET A 1 81 ? 60.235 2.361   5.310   1.00 0.00  ? 81  MET A H    5  
ATOM   8103  H  HA   . MET A 1 81 ? 57.722 3.749   5.467   1.00 0.00  ? 81  MET A HA   5  
ATOM   8104  H  HB2  . MET A 1 81 ? 59.314 1.773   6.991   1.00 0.00  ? 81  MET A HB2  5  
ATOM   8105  H  HB3  . MET A 1 81 ? 58.162 2.692   7.957   1.00 0.00  ? 81  MET A HB3  5  
ATOM   8106  H  HG2  . MET A 1 81 ? 57.273 0.537   6.924   1.00 0.00  ? 81  MET A HG2  5  
ATOM   8107  H  HG3  . MET A 1 81 ? 56.319 1.987   6.617   1.00 0.00  ? 81  MET A HG3  5  
ATOM   8108  H  HE1  . MET A 1 81 ? 55.080 1.304   4.947   1.00 0.00  ? 81  MET A HE1  5  
ATOM   8109  H  HE2  . MET A 1 81 ? 55.510 1.095   3.252   1.00 0.00  ? 81  MET A HE2  5  
ATOM   8110  H  HE3  . MET A 1 81 ? 55.655 2.683   3.997   1.00 0.00  ? 81  MET A HE3  5  
ATOM   8111  N  N    . VAL A 1 82 ? 60.091 4.826   7.545   1.00 0.00  ? 82  VAL A N    5  
ATOM   8112  C  CA   . VAL A 1 82 ? 60.468 6.021   8.369   1.00 0.00  ? 82  VAL A CA   5  
ATOM   8113  C  C    . VAL A 1 82 ? 60.609 7.262   7.471   1.00 0.00  ? 82  VAL A C    5  
ATOM   8114  O  O    . VAL A 1 82 ? 60.349 8.374   7.894   1.00 0.00  ? 82  VAL A O    5  
ATOM   8115  C  CB   . VAL A 1 82 ? 61.799 5.663   9.057   1.00 0.00  ? 82  VAL A CB   5  
ATOM   8116  C  CG1  . VAL A 1 82 ? 62.953 5.672   8.049   1.00 0.00  ? 82  VAL A CG1  5  
ATOM   8117  C  CG2  . VAL A 1 82 ? 62.084 6.685   10.160  1.00 0.00  ? 82  VAL A CG2  5  
ATOM   8118  H  H    . VAL A 1 82 ? 60.694 4.054   7.494   1.00 0.00  ? 82  VAL A H    5  
ATOM   8119  H  HA   . VAL A 1 82 ? 59.712 6.201   9.118   1.00 0.00  ? 82  VAL A HA   5  
ATOM   8120  H  HB   . VAL A 1 82 ? 61.720 4.679   9.497   1.00 0.00  ? 82  VAL A HB   5  
ATOM   8121  H  HG11 . VAL A 1 82 ? 62.806 4.883   7.329   1.00 0.00  ? 82  VAL A HG11 5  
ATOM   8122  H  HG12 . VAL A 1 82 ? 63.886 5.513   8.570   1.00 0.00  ? 82  VAL A HG12 5  
ATOM   8123  H  HG13 . VAL A 1 82 ? 62.984 6.624   7.541   1.00 0.00  ? 82  VAL A HG13 5  
ATOM   8124  H  HG21 . VAL A 1 82 ? 61.192 6.838   10.749  1.00 0.00  ? 82  VAL A HG21 5  
ATOM   8125  H  HG22 . VAL A 1 82 ? 62.386 7.621   9.715   1.00 0.00  ? 82  VAL A HG22 5  
ATOM   8126  H  HG23 . VAL A 1 82 ? 62.876 6.317   10.795  1.00 0.00  ? 82  VAL A HG23 5  
ATOM   8127  N  N    . ARG A 1 83 ? 60.992 7.076   6.230   1.00 0.00  ? 83  ARG A N    5  
ATOM   8128  C  CA   . ARG A 1 83 ? 61.120 8.239   5.300   1.00 0.00  ? 83  ARG A CA   5  
ATOM   8129  C  C    . ARG A 1 83 ? 59.726 8.794   4.984   1.00 0.00  ? 83  ARG A C    5  
ATOM   8130  O  O    . ARG A 1 83 ? 59.499 9.989   5.039   1.00 0.00  ? 83  ARG A O    5  
ATOM   8131  C  CB   . ARG A 1 83 ? 61.777 7.675   4.038   1.00 0.00  ? 83  ARG A CB   5  
ATOM   8132  C  CG   . ARG A 1 83 ? 63.292 7.879   4.117   1.00 0.00  ? 83  ARG A CG   5  
ATOM   8133  C  CD   . ARG A 1 83 ? 63.976 7.069   3.014   1.00 0.00  ? 83  ARG A CD   5  
ATOM   8134  N  NE   . ARG A 1 83 ? 64.403 8.082   2.007   1.00 0.00  ? 83  ARG A NE   5  
ATOM   8135  C  CZ   . ARG A 1 83 ? 63.832 8.124   0.838   1.00 0.00  ? 83  ARG A CZ   5  
ATOM   8136  N  NH1  . ARG A 1 83 ? 62.636 8.625   0.710   1.00 0.00  ? 83  ARG A NH1  5  
ATOM   8137  N  NH2  . ARG A 1 83 ? 64.456 7.660   -0.203  1.00 0.00  ? 83  ARG A NH2  5  
ATOM   8138  H  H    . ARG A 1 83 ? 61.179 6.170   5.906   1.00 0.00  ? 83  ARG A H    5  
ATOM   8139  H  HA   . ARG A 1 83 ? 61.743 9.005   5.735   1.00 0.00  ? 83  ARG A HA   5  
ATOM   8140  H  HB2  . ARG A 1 83 ? 61.558 6.620   3.958   1.00 0.00  ? 83  ARG A HB2  5  
ATOM   8141  H  HB3  . ARG A 1 83 ? 61.392 8.189   3.172   1.00 0.00  ? 83  ARG A HB3  5  
ATOM   8142  H  HG2  . ARG A 1 83 ? 63.520 8.927   3.991   1.00 0.00  ? 83  ARG A HG2  5  
ATOM   8143  H  HG3  . ARG A 1 83 ? 63.651 7.546   5.081   1.00 0.00  ? 83  ARG A HG3  5  
ATOM   8144  H  HD2  . ARG A 1 83 ? 64.833 6.544   3.413   1.00 0.00  ? 83  ARG A HD2  5  
ATOM   8145  H  HD3  . ARG A 1 83 ? 63.281 6.374   2.569   1.00 0.00  ? 83  ARG A HD3  5  
ATOM   8146  H  HE   . ARG A 1 83 ? 65.116 8.719   2.225   1.00 0.00  ? 83  ARG A HE   5  
ATOM   8147  H  HH11 . ARG A 1 83 ? 62.155 8.978   1.511   1.00 0.00  ? 83  ARG A HH11 5  
ATOM   8148  H  HH12 . ARG A 1 83 ? 62.203 8.662   -0.192  1.00 0.00  ? 83  ARG A HH12 5  
ATOM   8149  H  HH21 . ARG A 1 83 ? 65.372 7.274   -0.106  1.00 0.00  ? 83  ARG A HH21 5  
ATOM   8150  H  HH22 . ARG A 1 83 ? 64.020 7.693   -1.102  1.00 0.00  ? 83  ARG A HH22 5  
ATOM   8151  N  N    . CYS A 1 84 ? 58.789 7.929   4.669   1.00 0.00  ? 84  CYS A N    5  
ATOM   8152  C  CA   . CYS A 1 84 ? 57.399 8.394   4.364   1.00 0.00  ? 84  CYS A CA   5  
ATOM   8153  C  C    . CYS A 1 84 ? 56.745 8.975   5.629   1.00 0.00  ? 84  CYS A C    5  
ATOM   8154  O  O    . CYS A 1 84 ? 55.957 9.898   5.554   1.00 0.00  ? 84  CYS A O    5  
ATOM   8155  C  CB   . CYS A 1 84 ? 56.651 7.144   3.889   1.00 0.00  ? 84  CYS A CB   5  
ATOM   8156  S  SG   . CYS A 1 84 ? 57.270 6.654   2.259   1.00 0.00  ? 84  CYS A SG   5  
ATOM   8157  H  H    . CYS A 1 84 ? 59.001 6.971   4.645   1.00 0.00  ? 84  CYS A H    5  
ATOM   8158  H  HA   . CYS A 1 84 ? 57.415 9.133   3.579   1.00 0.00  ? 84  CYS A HA   5  
ATOM   8159  H  HB2  . CYS A 1 84 ? 56.810 6.338   4.591   1.00 0.00  ? 84  CYS A HB2  5  
ATOM   8160  H  HB3  . CYS A 1 84 ? 55.595 7.360   3.822   1.00 0.00  ? 84  CYS A HB3  5  
ATOM   8161  H  HG   . CYS A 1 84 ? 56.525 6.624   1.655   1.00 0.00  ? 84  CYS A HG   5  
ATOM   8162  N  N    . MET A 1 85 ? 57.076 8.448   6.787   1.00 0.00  ? 85  MET A N    5  
ATOM   8163  C  CA   . MET A 1 85 ? 56.487 8.981   8.059   1.00 0.00  ? 85  MET A CA   5  
ATOM   8164  C  C    . MET A 1 85 ? 56.994 10.410  8.323   1.00 0.00  ? 85  MET A C    5  
ATOM   8165  O  O    . MET A 1 85 ? 56.298 11.221  8.902   1.00 0.00  ? 85  MET A O    5  
ATOM   8166  C  CB   . MET A 1 85 ? 56.975 8.035   9.163   1.00 0.00  ? 85  MET A CB   5  
ATOM   8167  C  CG   . MET A 1 85 ? 56.061 6.807   9.240   1.00 0.00  ? 85  MET A CG   5  
ATOM   8168  S  SD   . MET A 1 85 ? 56.148 6.090   10.901  1.00 0.00  ? 85  MET A SD   5  
ATOM   8169  C  CE   . MET A 1 85 ? 57.794 5.351   10.751  1.00 0.00  ? 85  MET A CE   5  
ATOM   8170  H  H    . MET A 1 85 ? 57.721 7.709   6.821   1.00 0.00  ? 85  MET A H    5  
ATOM   8171  H  HA   . MET A 1 85 ? 55.410 8.968   8.011   1.00 0.00  ? 85  MET A HA   5  
ATOM   8172  H  HB2  . MET A 1 85 ? 57.985 7.720   8.947   1.00 0.00  ? 85  MET A HB2  5  
ATOM   8173  H  HB3  . MET A 1 85 ? 56.956 8.552   10.111  1.00 0.00  ? 85  MET A HB3  5  
ATOM   8174  H  HG2  . MET A 1 85 ? 55.044 7.102   9.029   1.00 0.00  ? 85  MET A HG2  5  
ATOM   8175  H  HG3  . MET A 1 85 ? 56.380 6.074   8.514   1.00 0.00  ? 85  MET A HG3  5  
ATOM   8176  H  HE1  . MET A 1 85 ? 58.513 6.123   10.515  1.00 0.00  ? 85  MET A HE1  5  
ATOM   8177  H  HE2  . MET A 1 85 ? 57.789 4.614   9.963   1.00 0.00  ? 85  MET A HE2  5  
ATOM   8178  H  HE3  . MET A 1 85 ? 58.061 4.875   11.685  1.00 0.00  ? 85  MET A HE3  5  
ATOM   8179  N  N    . LYS A 1 86 ? 58.204 10.713  7.899   1.00 0.00  ? 86  LYS A N    5  
ATOM   8180  C  CA   . LYS A 1 86 ? 58.783 12.081  8.110   1.00 0.00  ? 86  LYS A CA   5  
ATOM   8181  C  C    . LYS A 1 86 ? 58.841 12.427  9.609   1.00 0.00  ? 86  LYS A C    5  
ATOM   8182  O  O    . LYS A 1 86 ? 58.281 13.412  10.052  1.00 0.00  ? 86  LYS A O    5  
ATOM   8183  C  CB   . LYS A 1 86 ? 57.856 13.038  7.347   1.00 0.00  ? 86  LYS A CB   5  
ATOM   8184  C  CG   . LYS A 1 86 ? 58.577 14.368  7.093   1.00 0.00  ? 86  LYS A CG   5  
ATOM   8185  C  CD   . LYS A 1 86 ? 59.666 14.172  6.033   1.00 0.00  ? 86  LYS A CD   5  
ATOM   8186  C  CE   . LYS A 1 86 ? 60.943 14.914  6.452   1.00 0.00  ? 86  LYS A CE   5  
ATOM   8187  N  NZ   . LYS A 1 86 ? 61.700 13.950  7.304   1.00 0.00  ? 86  LYS A NZ   5  
ATOM   8188  H  H    . LYS A 1 86 ? 58.738 10.033  7.437   1.00 0.00  ? 86  LYS A H    5  
ATOM   8189  H  HA   . LYS A 1 86 ? 59.775 12.125  7.688   1.00 0.00  ? 86  LYS A HA   5  
ATOM   8190  H  HB2  . LYS A 1 86 ? 57.579 12.592  6.402   1.00 0.00  ? 86  LYS A HB2  5  
ATOM   8191  H  HB3  . LYS A 1 86 ? 56.966 13.220  7.931   1.00 0.00  ? 86  LYS A HB3  5  
ATOM   8192  H  HG2  . LYS A 1 86 ? 57.863 15.100  6.743   1.00 0.00  ? 86  LYS A HG2  5  
ATOM   8193  H  HG3  . LYS A 1 86 ? 59.027 14.715  8.011   1.00 0.00  ? 86  LYS A HG3  5  
ATOM   8194  H  HD2  . LYS A 1 86 ? 59.879 13.118  5.926   1.00 0.00  ? 86  LYS A HD2  5  
ATOM   8195  H  HD3  . LYS A 1 86 ? 59.321 14.564  5.088   1.00 0.00  ? 86  LYS A HD3  5  
ATOM   8196  H  HE2  . LYS A 1 86 ? 61.523 15.181  5.578   1.00 0.00  ? 86  LYS A HE2  5  
ATOM   8197  H  HE3  . LYS A 1 86 ? 60.696 15.797  7.023   1.00 0.00  ? 86  LYS A HE3  5  
ATOM   8198  H  HZ1  . LYS A 1 86 ? 62.701 14.234  7.346   1.00 0.00  ? 86  LYS A HZ1  5  
ATOM   8199  H  HZ2  . LYS A 1 86 ? 61.631 12.993  6.901   1.00 0.00  ? 86  LYS A HZ2  5  
ATOM   8200  H  HZ3  . LYS A 1 86 ? 61.306 13.949  8.270   1.00 0.00  ? 86  LYS A HZ3  5  
ATOM   8201  N  N    . ASP A 1 87 ? 59.536 11.621  10.382  1.00 0.00  ? 87  ASP A N    5  
ATOM   8202  C  CA   . ASP A 1 87 ? 59.671 11.878  11.856  1.00 0.00  ? 87  ASP A CA   5  
ATOM   8203  C  C    . ASP A 1 87 ? 58.290 12.026  12.525  1.00 0.00  ? 87  ASP A C    5  
ATOM   8204  O  O    . ASP A 1 87 ? 57.305 11.480  12.063  1.00 0.00  ? 87  ASP A O    5  
ATOM   8205  C  CB   . ASP A 1 87 ? 60.480 13.183  11.967  1.00 0.00  ? 87  ASP A CB   5  
ATOM   8206  C  CG   . ASP A 1 87 ? 61.742 13.095  11.103  1.00 0.00  ? 87  ASP A CG   5  
ATOM   8207  O  OD1  . ASP A 1 87 ? 62.658 12.393  11.497  1.00 0.00  ? 87  ASP A OD1  5  
ATOM   8208  O  OD2  . ASP A 1 87 ? 61.770 13.730  10.061  1.00 0.00  ? 87  ASP A OD2  5  
ATOM   8209  H  H    . ASP A 1 87 ? 59.985 10.844  9.987   1.00 0.00  ? 87  ASP A H    5  
ATOM   8210  H  HA   . ASP A 1 87 ? 60.219 11.073  12.321  1.00 0.00  ? 87  ASP A HA   5  
ATOM   8211  H  HB2  . ASP A 1 87 ? 59.873 14.011  11.632  1.00 0.00  ? 87  ASP A HB2  5  
ATOM   8212  H  HB3  . ASP A 1 87 ? 60.764 13.341  12.996  1.00 0.00  ? 87  ASP A HB3  5  
ATOM   8213  N  N    . ASP A 1 88 ? 58.220 12.753  13.616  1.00 0.00  ? 88  ASP A N    5  
ATOM   8214  C  CA   . ASP A 1 88 ? 56.913 12.937  14.326  1.00 0.00  ? 88  ASP A CA   5  
ATOM   8215  C  C    . ASP A 1 88 ? 56.889 14.271  15.097  1.00 0.00  ? 88  ASP A C    5  
ATOM   8216  O  O    . ASP A 1 88 ? 55.887 14.959  15.118  1.00 0.00  ? 88  ASP A O    5  
ATOM   8217  C  CB   . ASP A 1 88 ? 56.804 11.740  15.286  1.00 0.00  ? 88  ASP A CB   5  
ATOM   8218  C  CG   . ASP A 1 88 ? 57.860 11.841  16.393  1.00 0.00  ? 88  ASP A CG   5  
ATOM   8219  O  OD1  . ASP A 1 88 ? 59.024 11.624  16.099  1.00 0.00  ? 88  ASP A OD1  5  
ATOM   8220  O  OD2  . ASP A 1 88 ? 57.485 12.135  17.515  1.00 0.00  ? 88  ASP A OD2  5  
ATOM   8221  H  H    . ASP A 1 88 ? 59.029 13.173  13.971  1.00 0.00  ? 88  ASP A H    5  
ATOM   8222  H  HA   . ASP A 1 88 ? 56.100 12.908  13.618  1.00 0.00  ? 88  ASP A HA   5  
ATOM   8223  H  HB2  . ASP A 1 88 ? 55.820 11.729  15.732  1.00 0.00  ? 88  ASP A HB2  5  
ATOM   8224  H  HB3  . ASP A 1 88 ? 56.954 10.825  14.734  1.00 0.00  ? 88  ASP A HB3  5  
ATOM   8225  N  N    . SER A 1 89 ? 57.980 14.638  15.727  1.00 0.00  ? 89  SER A N    5  
ATOM   8226  C  CA   . SER A 1 89 ? 58.020 15.923  16.493  1.00 0.00  ? 89  SER A CA   5  
ATOM   8227  C  C    . SER A 1 89 ? 59.238 16.763  16.080  1.00 0.00  ? 89  SER A C    5  
ATOM   8228  O  O    . SER A 1 89 ? 59.228 17.952  16.352  1.00 0.00  ? 89  SER A O    5  
ATOM   8229  C  CB   . SER A 1 89 ? 58.136 15.501  17.958  1.00 0.00  ? 89  SER A CB   5  
ATOM   8230  O  OG   . SER A 1 89 ? 57.656 16.551  18.790  1.00 0.00  ? 89  SER A OG   5  
ATOM   8231  O  OXT  . SER A 1 89 ? 60.160 16.204  15.504  1.00 0.00  ? 89  SER A OXT  5  
ATOM   8232  H  H    . SER A 1 89 ? 58.777 14.069  15.697  1.00 0.00  ? 89  SER A H    5  
ATOM   8233  H  HA   . SER A 1 89 ? 57.110 16.481  16.343  1.00 0.00  ? 89  SER A HA   5  
ATOM   8234  H  HB2  . SER A 1 89 ? 57.546 14.616  18.128  1.00 0.00  ? 89  SER A HB2  5  
ATOM   8235  H  HB3  . SER A 1 89 ? 59.172 15.290  18.190  1.00 0.00  ? 89  SER A HB3  5  
ATOM   8236  H  HG   . SER A 1 89 ? 58.215 17.322  18.649  1.00 0.00  ? 89  SER A HG   5  
ATOM   8237  N  N    . ARG B 2 1  ? 55.105 10.121  -13.670 1.00 0.00  ? 144 ARG B N    5  
ATOM   8238  C  CA   . ARG B 2 1  ? 54.500 11.216  -12.853 1.00 0.00  ? 144 ARG B CA   5  
ATOM   8239  C  C    . ARG B 2 1  ? 54.879 11.044  -11.377 1.00 0.00  ? 144 ARG B C    5  
ATOM   8240  O  O    . ARG B 2 1  ? 55.061 9.942   -10.900 1.00 0.00  ? 144 ARG B O    5  
ATOM   8241  C  CB   . ARG B 2 1  ? 52.986 11.069  -13.044 1.00 0.00  ? 144 ARG B CB   5  
ATOM   8242  C  CG   . ARG B 2 1  ? 52.265 12.289  -12.458 1.00 0.00  ? 144 ARG B CG   5  
ATOM   8243  C  CD   . ARG B 2 1  ? 51.345 12.903  -13.518 1.00 0.00  ? 144 ARG B CD   5  
ATOM   8244  N  NE   . ARG B 2 1  ? 50.398 13.766  -12.752 1.00 0.00  ? 144 ARG B NE   5  
ATOM   8245  C  CZ   . ARG B 2 1  ? 49.187 13.352  -12.503 1.00 0.00  ? 144 ARG B CZ   5  
ATOM   8246  N  NH1  . ARG B 2 1  ? 48.273 13.420  -13.429 1.00 0.00  ? 144 ARG B NH1  5  
ATOM   8247  N  NH2  . ARG B 2 1  ? 48.894 12.873  -11.328 1.00 0.00  ? 144 ARG B NH2  5  
ATOM   8248  H  H1   . ARG B 2 1  ? 56.142 10.173  -13.612 1.00 0.00  ? 144 ARG B H1   5  
ATOM   8249  H  H2   . ARG B 2 1  ? 54.807 10.221  -14.664 1.00 0.00  ? 144 ARG B H2   5  
ATOM   8250  H  H3   . ARG B 2 1  ? 54.792 9.198   -13.304 1.00 0.00  ? 144 ARG B H3   5  
ATOM   8251  H  HA   . ARG B 2 1  ? 54.825 12.180  -13.215 1.00 0.00  ? 144 ARG B HA   5  
ATOM   8252  H  HB2  . ARG B 2 1  ? 52.763 10.991  -14.100 1.00 0.00  ? 144 ARG B HB2  5  
ATOM   8253  H  HB3  . ARG B 2 1  ? 52.645 10.177  -12.540 1.00 0.00  ? 144 ARG B HB3  5  
ATOM   8254  H  HG2  . ARG B 2 1  ? 51.675 11.982  -11.605 1.00 0.00  ? 144 ARG B HG2  5  
ATOM   8255  H  HG3  . ARG B 2 1  ? 52.991 13.025  -12.146 1.00 0.00  ? 144 ARG B HG3  5  
ATOM   8256  H  HD2  . ARG B 2 1  ? 51.921 13.498  -14.215 1.00 0.00  ? 144 ARG B HD2  5  
ATOM   8257  H  HD3  . ARG B 2 1  ? 50.803 12.130  -14.040 1.00 0.00  ? 144 ARG B HD3  5  
ATOM   8258  H  HE   . ARG B 2 1  ? 50.686 14.649  -12.437 1.00 0.00  ? 144 ARG B HE   5  
ATOM   8259  H  HH11 . ARG B 2 1  ? 48.501 13.793  -14.329 1.00 0.00  ? 144 ARG B HH11 5  
ATOM   8260  H  HH12 . ARG B 2 1  ? 47.348 13.093  -13.244 1.00 0.00  ? 144 ARG B HH12 5  
ATOM   8261  H  HH21 . ARG B 2 1  ? 49.598 12.823  -10.620 1.00 0.00  ? 144 ARG B HH21 5  
ATOM   8262  H  HH22 . ARG B 2 1  ? 47.965 12.562  -11.132 1.00 0.00  ? 144 ARG B HH22 5  
ATOM   8263  N  N    . ARG B 2 2  ? 54.999 12.129  -10.655 1.00 0.00  ? 145 ARG B N    5  
ATOM   8264  C  CA   . ARG B 2 2  ? 55.368 12.033  -9.209  1.00 0.00  ? 145 ARG B CA   5  
ATOM   8265  C  C    . ARG B 2 2  ? 54.159 11.586  -8.375  1.00 0.00  ? 145 ARG B C    5  
ATOM   8266  O  O    . ARG B 2 2  ? 53.038 11.991  -8.623  1.00 0.00  ? 145 ARG B O    5  
ATOM   8267  C  CB   . ARG B 2 2  ? 55.806 13.446  -8.815  1.00 0.00  ? 145 ARG B CB   5  
ATOM   8268  C  CG   . ARG B 2 2  ? 56.812 13.366  -7.666  1.00 0.00  ? 145 ARG B CG   5  
ATOM   8269  C  CD   . ARG B 2 2  ? 56.959 14.743  -7.017  1.00 0.00  ? 145 ARG B CD   5  
ATOM   8270  N  NE   . ARG B 2 2  ? 57.901 14.528  -5.883  1.00 0.00  ? 145 ARG B NE   5  
ATOM   8271  C  CZ   . ARG B 2 2  ? 59.106 15.019  -5.930  1.00 0.00  ? 145 ARG B CZ   5  
ATOM   8272  N  NH1  . ARG B 2 2  ? 60.053 14.363  -6.537  1.00 0.00  ? 145 ARG B NH1  5  
ATOM   8273  N  NH2  . ARG B 2 2  ? 59.360 16.166  -5.368  1.00 0.00  ? 145 ARG B NH2  5  
ATOM   8274  H  H    . ARG B 2 2  ? 54.847 13.007  -11.065 1.00 0.00  ? 145 ARG B H    5  
ATOM   8275  H  HA   . ARG B 2 2  ? 56.188 11.345  -9.077  1.00 0.00  ? 145 ARG B HA   5  
ATOM   8276  H  HB2  . ARG B 2 2  ? 56.269 13.931  -9.663  1.00 0.00  ? 145 ARG B HB2  5  
ATOM   8277  H  HB3  . ARG B 2 2  ? 54.946 14.017  -8.498  1.00 0.00  ? 145 ARG B HB3  5  
ATOM   8278  H  HG2  . ARG B 2 2  ? 56.462 12.656  -6.930  1.00 0.00  ? 145 ARG B HG2  5  
ATOM   8279  H  HG3  . ARG B 2 2  ? 57.770 13.046  -8.048  1.00 0.00  ? 145 ARG B HG3  5  
ATOM   8280  H  HD2  . ARG B 2 2  ? 57.371 15.450  -7.726  1.00 0.00  ? 145 ARG B HD2  5  
ATOM   8281  H  HD3  . ARG B 2 2  ? 56.006 15.091  -6.647  1.00 0.00  ? 145 ARG B HD3  5  
ATOM   8282  H  HE   . ARG B 2 2  ? 57.617 14.008  -5.100  1.00 0.00  ? 145 ARG B HE   5  
ATOM   8283  H  HH11 . ARG B 2 2  ? 59.854 13.481  -6.964  1.00 0.00  ? 145 ARG B HH11 5  
ATOM   8284  H  HH12 . ARG B 2 2  ? 60.978 14.738  -6.575  1.00 0.00  ? 145 ARG B HH12 5  
ATOM   8285  H  HH21 . ARG B 2 2  ? 58.630 16.665  -4.904  1.00 0.00  ? 145 ARG B HH21 5  
ATOM   8286  H  HH22 . ARG B 2 2  ? 60.282 16.545  -5.398  1.00 0.00  ? 145 ARG B HH22 5  
ATOM   8287  N  N    . VAL B 2 3  ? 54.386 10.756  -7.387  1.00 0.00  ? 146 VAL B N    5  
ATOM   8288  C  CA   . VAL B 2 3  ? 53.259 10.275  -6.522  1.00 0.00  ? 146 VAL B CA   5  
ATOM   8289  C  C    . VAL B 2 3  ? 53.622 10.442  -5.041  1.00 0.00  ? 146 VAL B C    5  
ATOM   8290  O  O    . VAL B 2 3  ? 54.784 10.466  -4.677  1.00 0.00  ? 146 VAL B O    5  
ATOM   8291  C  CB   . VAL B 2 3  ? 53.067 8.789   -6.869  1.00 0.00  ? 146 VAL B CB   5  
ATOM   8292  C  CG1  . VAL B 2 3  ? 52.497 8.660   -8.284  1.00 0.00  ? 146 VAL B CG1  5  
ATOM   8293  C  CG2  . VAL B 2 3  ? 54.409 8.050   -6.795  1.00 0.00  ? 146 VAL B CG2  5  
ATOM   8294  H  H    . VAL B 2 3  ? 55.301 10.451  -7.209  1.00 0.00  ? 146 VAL B H    5  
ATOM   8295  H  HA   . VAL B 2 3  ? 52.357 10.821  -6.747  1.00 0.00  ? 146 VAL B HA   5  
ATOM   8296  H  HB   . VAL B 2 3  ? 52.375 8.346   -6.166  1.00 0.00  ? 146 VAL B HB   5  
ATOM   8297  H  HG11 . VAL B 2 3  ? 51.744 9.418   -8.439  1.00 0.00  ? 146 VAL B HG11 5  
ATOM   8298  H  HG12 . VAL B 2 3  ? 52.052 7.683   -8.405  1.00 0.00  ? 146 VAL B HG12 5  
ATOM   8299  H  HG13 . VAL B 2 3  ? 53.290 8.787   -9.005  1.00 0.00  ? 146 VAL B HG13 5  
ATOM   8300  H  HG21 . VAL B 2 3  ? 55.100 8.483   -7.502  1.00 0.00  ? 146 VAL B HG21 5  
ATOM   8301  H  HG22 . VAL B 2 3  ? 54.258 7.007   -7.035  1.00 0.00  ? 146 VAL B HG22 5  
ATOM   8302  H  HG23 . VAL B 2 3  ? 54.813 8.135   -5.797  1.00 0.00  ? 146 VAL B HG23 5  
ATOM   8303  N  N    . ARG B 2 4  ? 52.639 10.567  -4.185  1.00 0.00  ? 147 ARG B N    5  
ATOM   8304  C  CA   . ARG B 2 4  ? 52.932 10.741  -2.730  1.00 0.00  ? 147 ARG B CA   5  
ATOM   8305  C  C    . ARG B 2 4  ? 52.378 9.564   -1.915  1.00 0.00  ? 147 ARG B C    5  
ATOM   8306  O  O    . ARG B 2 4  ? 51.247 9.582   -1.465  1.00 0.00  ? 147 ARG B O    5  
ATOM   8307  C  CB   . ARG B 2 4  ? 52.237 12.051  -2.340  1.00 0.00  ? 147 ARG B CB   5  
ATOM   8308  C  CG   . ARG B 2 4  ? 53.158 12.867  -1.432  1.00 0.00  ? 147 ARG B CG   5  
ATOM   8309  C  CD   . ARG B 2 4  ? 53.107 12.301  -0.009  1.00 0.00  ? 147 ARG B CD   5  
ATOM   8310  N  NE   . ARG B 2 4  ? 54.532 12.067  0.367   1.00 0.00  ? 147 ARG B NE   5  
ATOM   8311  C  CZ   . ARG B 2 4  ? 54.954 10.858  0.614   1.00 0.00  ? 147 ARG B CZ   5  
ATOM   8312  N  NH1  . ARG B 2 4  ? 54.606 10.264  1.717   1.00 0.00  ? 147 ARG B NH1  5  
ATOM   8313  N  NH2  . ARG B 2 4  ? 55.723 10.247  -0.245  1.00 0.00  ? 147 ARG B NH2  5  
ATOM   8314  H  H    . ARG B 2 4  ? 51.711 10.549  -4.499  1.00 0.00  ? 147 ARG B H    5  
ATOM   8315  H  HA   . ARG B 2 4  ? 53.995 10.834  -2.574  1.00 0.00  ? 147 ARG B HA   5  
ATOM   8316  H  HB2  . ARG B 2 4  ? 52.014 12.621  -3.231  1.00 0.00  ? 147 ARG B HB2  5  
ATOM   8317  H  HB3  . ARG B 2 4  ? 51.320 11.832  -1.815  1.00 0.00  ? 147 ARG B HB3  5  
ATOM   8318  H  HG2  . ARG B 2 4  ? 54.171 12.814  -1.806  1.00 0.00  ? 147 ARG B HG2  5  
ATOM   8319  H  HG3  . ARG B 2 4  ? 52.831 13.896  -1.420  1.00 0.00  ? 147 ARG B HG3  5  
ATOM   8320  H  HD2  . ARG B 2 4  ? 52.649 13.017  0.661   1.00 0.00  ? 147 ARG B HD2  5  
ATOM   8321  H  HD3  . ARG B 2 4  ? 52.561 11.369  0.005   1.00 0.00  ? 147 ARG B HD3  5  
ATOM   8322  H  HE   . ARG B 2 4  ? 55.151 12.824  0.433   1.00 0.00  ? 147 ARG B HE   5  
ATOM   8323  H  HH11 . ARG B 2 4  ? 54.017 10.734  2.374   1.00 0.00  ? 147 ARG B HH11 5  
ATOM   8324  H  HH12 . ARG B 2 4  ? 54.927 9.337   1.909   1.00 0.00  ? 147 ARG B HH12 5  
ATOM   8325  H  HH21 . ARG B 2 4  ? 55.990 10.704  -1.093  1.00 0.00  ? 147 ARG B HH21 5  
ATOM   8326  H  HH22 . ARG B 2 4  ? 56.047 9.319   -0.056  1.00 0.00  ? 147 ARG B HH22 5  
ATOM   8327  N  N    . ILE B 2 5  ? 53.174 8.543   -1.713  1.00 0.00  ? 148 ILE B N    5  
ATOM   8328  C  CA   . ILE B 2 5  ? 52.703 7.367   -0.916  1.00 0.00  ? 148 ILE B CA   5  
ATOM   8329  C  C    . ILE B 2 5  ? 53.231 7.479   0.521   1.00 0.00  ? 148 ILE B C    5  
ATOM   8330  O  O    . ILE B 2 5  ? 54.425 7.554   0.750   1.00 0.00  ? 148 ILE B O    5  
ATOM   8331  C  CB   . ILE B 2 5  ? 53.278 6.130   -1.627  1.00 0.00  ? 148 ILE B CB   5  
ATOM   8332  C  CG1  . ILE B 2 5  ? 52.414 5.794   -2.848  1.00 0.00  ? 148 ILE B CG1  5  
ATOM   8333  C  CG2  . ILE B 2 5  ? 53.278 4.930   -0.674  1.00 0.00  ? 148 ILE B CG2  5  
ATOM   8334  C  CD1  . ILE B 2 5  ? 52.922 6.562   -4.071  1.00 0.00  ? 148 ILE B CD1  5  
ATOM   8335  H  H    . ILE B 2 5  ? 54.084 8.552   -2.079  1.00 0.00  ? 148 ILE B H    5  
ATOM   8336  H  HA   . ILE B 2 5  ? 51.625 7.324   -0.915  1.00 0.00  ? 148 ILE B HA   5  
ATOM   8337  H  HB   . ILE B 2 5  ? 54.289 6.336   -1.945  1.00 0.00  ? 148 ILE B HB   5  
ATOM   8338  H  HG12 . ILE B 2 5  ? 52.467 4.733   -3.044  1.00 0.00  ? 148 ILE B HG12 5  
ATOM   8339  H  HG13 . ILE B 2 5  ? 51.389 6.072   -2.653  1.00 0.00  ? 148 ILE B HG13 5  
ATOM   8340  H  HG21 . ILE B 2 5  ? 53.146 4.020   -1.241  1.00 0.00  ? 148 ILE B HG21 5  
ATOM   8341  H  HG22 . ILE B 2 5  ? 52.470 5.030   0.036   1.00 0.00  ? 148 ILE B HG22 5  
ATOM   8342  H  HG23 . ILE B 2 5  ? 54.218 4.890   -0.145  1.00 0.00  ? 148 ILE B HG23 5  
ATOM   8343  H  HD11 . ILE B 2 5  ? 52.513 6.120   -4.968  1.00 0.00  ? 148 ILE B HD11 5  
ATOM   8344  H  HD12 . ILE B 2 5  ? 54.001 6.514   -4.106  1.00 0.00  ? 148 ILE B HD12 5  
ATOM   8345  H  HD13 . ILE B 2 5  ? 52.610 7.594   -4.004  1.00 0.00  ? 148 ILE B HD13 5  
ATOM   8346  N  N    . SER B 2 6  ? 52.347 7.498   1.486   1.00 0.00  ? 149 SER B N    5  
ATOM   8347  C  CA   . SER B 2 6  ? 52.786 7.612   2.914   1.00 0.00  ? 149 SER B CA   5  
ATOM   8348  C  C    . SER B 2 6  ? 52.769 6.241   3.599   1.00 0.00  ? 149 SER B C    5  
ATOM   8349  O  O    . SER B 2 6  ? 52.269 5.270   3.058   1.00 0.00  ? 149 SER B O    5  
ATOM   8350  C  CB   . SER B 2 6  ? 51.772 8.549   3.570   1.00 0.00  ? 149 SER B CB   5  
ATOM   8351  O  OG   . SER B 2 6  ? 52.017 9.883   3.142   1.00 0.00  ? 149 SER B OG   5  
ATOM   8352  H  H    . SER B 2 6  ? 51.392 7.442   1.273   1.00 0.00  ? 149 SER B H    5  
ATOM   8353  H  HA   . SER B 2 6  ? 53.772 8.045   2.969   1.00 0.00  ? 149 SER B HA   5  
ATOM   8354  H  HB2  . SER B 2 6  ? 50.774 8.261   3.284   1.00 0.00  ? 149 SER B HB2  5  
ATOM   8355  H  HB3  . SER B 2 6  ? 51.868 8.483   4.647   1.00 0.00  ? 149 SER B HB3  5  
ATOM   8356  H  HG   . SER B 2 6  ? 51.375 10.455  3.572   1.00 0.00  ? 149 SER B HG   5  
ATOM   8357  N  N    . ALA B 2 7  ? 53.311 6.160   4.791   1.00 0.00  ? 150 ALA B N    5  
ATOM   8358  C  CA   . ALA B 2 7  ? 53.334 4.857   5.530   1.00 0.00  ? 150 ALA B CA   5  
ATOM   8359  C  C    . ALA B 2 7  ? 51.905 4.351   5.775   1.00 0.00  ? 150 ALA B C    5  
ATOM   8360  O  O    . ALA B 2 7  ? 51.585 3.218   5.475   1.00 0.00  ? 150 ALA B O    5  
ATOM   8361  C  CB   . ALA B 2 7  ? 54.032 5.164   6.858   1.00 0.00  ? 150 ALA B CB   5  
ATOM   8362  H  H    . ALA B 2 7  ? 53.704 6.959   5.200   1.00 0.00  ? 150 ALA B H    5  
ATOM   8363  H  HA   . ALA B 2 7  ? 53.901 4.123   4.979   1.00 0.00  ? 150 ALA B HA   5  
ATOM   8364  H  HB1  . ALA B 2 7  ? 55.015 5.568   6.663   1.00 0.00  ? 150 ALA B HB1  5  
ATOM   8365  H  HB2  . ALA B 2 7  ? 54.124 4.254   7.434   1.00 0.00  ? 150 ALA B HB2  5  
ATOM   8366  H  HB3  . ALA B 2 7  ? 53.449 5.885   7.413   1.00 0.00  ? 150 ALA B HB3  5  
ATOM   8367  N  N    . ASP B 2 8  ? 51.046 5.186   6.312   1.00 0.00  ? 151 ASP B N    5  
ATOM   8368  C  CA   . ASP B 2 8  ? 49.633 4.757   6.573   1.00 0.00  ? 151 ASP B CA   5  
ATOM   8369  C  C    . ASP B 2 8  ? 48.928 4.379   5.258   1.00 0.00  ? 151 ASP B C    5  
ATOM   8370  O  O    . ASP B 2 8  ? 48.111 3.478   5.224   1.00 0.00  ? 151 ASP B O    5  
ATOM   8371  C  CB   . ASP B 2 8  ? 48.953 5.971   7.232   1.00 0.00  ? 151 ASP B CB   5  
ATOM   8372  C  CG   . ASP B 2 8  ? 48.823 7.121   6.227   1.00 0.00  ? 151 ASP B CG   5  
ATOM   8373  O  OD1  . ASP B 2 8  ? 49.833 7.735   5.921   1.00 0.00  ? 151 ASP B OD1  5  
ATOM   8374  O  OD2  . ASP B 2 8  ? 47.715 7.366   5.780   1.00 0.00  ? 151 ASP B OD2  5  
ATOM   8375  H  H    . ASP B 2 8  ? 51.328 6.097   6.540   1.00 0.00  ? 151 ASP B H    5  
ATOM   8376  H  HA   . ASP B 2 8  ? 49.619 3.920   7.253   1.00 0.00  ? 151 ASP B HA   5  
ATOM   8377  H  HB2  . ASP B 2 8  ? 47.970 5.685   7.576   1.00 0.00  ? 151 ASP B HB2  5  
ATOM   8378  H  HB3  . ASP B 2 8  ? 49.545 6.299   8.074   1.00 0.00  ? 151 ASP B HB3  5  
ATOM   8379  N  N    . ALA B 2 9  ? 49.240 5.059   4.178   1.00 0.00  ? 152 ALA B N    5  
ATOM   8380  C  CA   . ALA B 2 9  ? 48.589 4.739   2.869   1.00 0.00  ? 152 ALA B CA   5  
ATOM   8381  C  C    . ALA B 2 9  ? 49.043 3.360   2.367   1.00 0.00  ? 152 ALA B C    5  
ATOM   8382  O  O    . ALA B 2 9  ? 48.229 2.498   2.090   1.00 0.00  ? 152 ALA B O    5  
ATOM   8383  C  CB   . ALA B 2 9  ? 49.044 5.847   1.913   1.00 0.00  ? 152 ALA B CB   5  
ATOM   8384  H  H    . ALA B 2 9  ? 49.903 5.779   4.230   1.00 0.00  ? 152 ALA B H    5  
ATOM   8385  H  HA   . ALA B 2 9  ? 47.515 4.762   2.972   1.00 0.00  ? 152 ALA B HA   5  
ATOM   8386  H  HB1  . ALA B 2 9  ? 48.456 5.807   1.008   1.00 0.00  ? 152 ALA B HB1  5  
ATOM   8387  H  HB2  . ALA B 2 9  ? 50.087 5.708   1.670   1.00 0.00  ? 152 ALA B HB2  5  
ATOM   8388  H  HB3  . ALA B 2 9  ? 48.910 6.809   2.387   1.00 0.00  ? 152 ALA B HB3  5  
ATOM   8389  N  N    . MET B 2 10 ? 50.332 3.141   2.258   1.00 0.00  ? 153 MET B N    5  
ATOM   8390  C  CA   . MET B 2 10 ? 50.833 1.811   1.782   1.00 0.00  ? 153 MET B CA   5  
ATOM   8391  C  C    . MET B 2 10 ? 50.494 0.714   2.806   1.00 0.00  ? 153 MET B C    5  
ATOM   8392  O  O    . MET B 2 10 ? 50.269 -0.428  2.447   1.00 0.00  ? 153 MET B O    5  
ATOM   8393  C  CB   . MET B 2 10 ? 52.352 1.976   1.643   1.00 0.00  ? 153 MET B CB   5  
ATOM   8394  C  CG   . MET B 2 10 ? 52.896 0.950   0.640   1.00 0.00  ? 153 MET B CG   5  
ATOM   8395  S  SD   . MET B 2 10 ? 52.104 1.191   -0.973  1.00 0.00  ? 153 MET B SD   5  
ATOM   8396  C  CE   . MET B 2 10 ? 53.613 1.404   -1.950  1.00 0.00  ? 153 MET B CE   5  
ATOM   8397  H  H    . MET B 2 10 ? 50.969 3.848   2.496   1.00 0.00  ? 153 MET B H    5  
ATOM   8398  H  HA   . MET B 2 10 ? 50.400 1.570   0.824   1.00 0.00  ? 153 MET B HA   5  
ATOM   8399  H  HB2  . MET B 2 10 ? 52.573 2.975   1.293   1.00 0.00  ? 153 MET B HB2  5  
ATOM   8400  H  HB3  . MET B 2 10 ? 52.819 1.820   2.603   1.00 0.00  ? 153 MET B HB3  5  
ATOM   8401  H  HG2  . MET B 2 10 ? 53.964 1.078   0.538   1.00 0.00  ? 153 MET B HG2  5  
ATOM   8402  H  HG3  . MET B 2 10 ? 52.687 -0.047  0.998   1.00 0.00  ? 153 MET B HG3  5  
ATOM   8403  H  HE1  . MET B 2 10 ? 54.297 0.592   -1.737  1.00 0.00  ? 153 MET B HE1  5  
ATOM   8404  H  HE2  . MET B 2 10 ? 54.080 2.342   -1.694  1.00 0.00  ? 153 MET B HE2  5  
ATOM   8405  H  HE3  . MET B 2 10 ? 53.364 1.405   -3.002  1.00 0.00  ? 153 MET B HE3  5  
ATOM   8406  N  N    . MET B 2 11 ? 50.445 1.054   4.074   1.00 0.00  ? 154 MET B N    5  
ATOM   8407  C  CA   . MET B 2 11 ? 50.109 0.036   5.122   1.00 0.00  ? 154 MET B CA   5  
ATOM   8408  C  C    . MET B 2 11 ? 48.674 -0.481  4.924   1.00 0.00  ? 154 MET B C    5  
ATOM   8409  O  O    . MET B 2 11 ? 48.411 -1.661  5.052   1.00 0.00  ? 154 MET B O    5  
ATOM   8410  C  CB   . MET B 2 11 ? 50.238 0.783   6.455   1.00 0.00  ? 154 MET B CB   5  
ATOM   8411  C  CG   . MET B 2 11 ? 50.160 -0.210  7.618   1.00 0.00  ? 154 MET B CG   5  
ATOM   8412  S  SD   . MET B 2 11 ? 48.534 -0.085  8.403   1.00 0.00  ? 154 MET B SD   5  
ATOM   8413  C  CE   . MET B 2 11 ? 48.176 -1.857  8.464   1.00 0.00  ? 154 MET B CE   5  
ATOM   8414  H  H    . MET B 2 11 ? 50.624 1.982   4.337   1.00 0.00  ? 154 MET B H    5  
ATOM   8415  H  HA   . MET B 2 11 ? 50.810 -0.783  5.090   1.00 0.00  ? 154 MET B HA   5  
ATOM   8416  H  HB2  . MET B 2 11 ? 51.186 1.298   6.487   1.00 0.00  ? 154 MET B HB2  5  
ATOM   8417  H  HB3  . MET B 2 11 ? 49.436 1.501   6.544   1.00 0.00  ? 154 MET B HB3  5  
ATOM   8418  H  HG2  . MET B 2 11 ? 50.306 -1.213  7.247   1.00 0.00  ? 154 MET B HG2  5  
ATOM   8419  H  HG3  . MET B 2 11 ? 50.926 0.023   8.343   1.00 0.00  ? 154 MET B HG3  5  
ATOM   8420  H  HE1  . MET B 2 11 ? 48.855 -2.335  9.157   1.00 0.00  ? 154 MET B HE1  5  
ATOM   8421  H  HE2  . MET B 2 11 ? 48.305 -2.287  7.484   1.00 0.00  ? 154 MET B HE2  5  
ATOM   8422  H  HE3  . MET B 2 11 ? 47.156 -2.008  8.789   1.00 0.00  ? 154 MET B HE3  5  
ATOM   8423  N  N    . GLN B 2 12 ? 47.749 0.394   4.608   1.00 0.00  ? 155 GLN B N    5  
ATOM   8424  C  CA   . GLN B 2 12 ? 46.331 -0.043  4.398   1.00 0.00  ? 155 GLN B CA   5  
ATOM   8425  C  C    . GLN B 2 12 ? 46.159 -0.697  3.016   1.00 0.00  ? 155 GLN B C    5  
ATOM   8426  O  O    . GLN B 2 12 ? 45.342 -1.581  2.844   1.00 0.00  ? 155 GLN B O    5  
ATOM   8427  C  CB   . GLN B 2 12 ? 45.498 1.239   4.484   1.00 0.00  ? 155 GLN B CB   5  
ATOM   8428  C  CG   . GLN B 2 12 ? 45.251 1.600   5.952   1.00 0.00  ? 155 GLN B CG   5  
ATOM   8429  C  CD   . GLN B 2 12 ? 44.582 2.974   6.035   1.00 0.00  ? 155 GLN B CD   5  
ATOM   8430  O  OE1  . GLN B 2 12 ? 43.383 3.069   6.194   1.00 0.00  ? 155 GLN B OE1  5  
ATOM   8431  N  NE2  . GLN B 2 12 ? 45.311 4.050   5.931   1.00 0.00  ? 155 GLN B NE2  5  
ATOM   8432  H  H    . GLN B 2 12 ? 47.988 1.341   4.507   1.00 0.00  ? 155 GLN B H    5  
ATOM   8433  H  HA   . GLN B 2 12 ? 46.030 -0.727  5.176   1.00 0.00  ? 155 GLN B HA   5  
ATOM   8434  H  HB2  . GLN B 2 12 ? 46.028 2.046   3.998   1.00 0.00  ? 155 GLN B HB2  5  
ATOM   8435  H  HB3  . GLN B 2 12 ? 44.549 1.086   3.990   1.00 0.00  ? 155 GLN B HB3  5  
ATOM   8436  H  HG2  . GLN B 2 12 ? 44.606 0.858   6.400   1.00 0.00  ? 155 GLN B HG2  5  
ATOM   8437  H  HG3  . GLN B 2 12 ? 46.192 1.628   6.480   1.00 0.00  ? 155 GLN B HG3  5  
ATOM   8438  H  HE21 . GLN B 2 12 ? 46.279 3.976   5.801   1.00 0.00  ? 155 GLN B HE21 5  
ATOM   8439  H  HE22 . GLN B 2 12 ? 44.890 4.932   5.982   1.00 0.00  ? 155 GLN B HE22 5  
ATOM   8440  N  N    . ALA B 2 13 ? 46.916 -0.264  2.033   1.00 0.00  ? 156 ALA B N    5  
ATOM   8441  C  CA   . ALA B 2 13 ? 46.794 -0.854  0.658   1.00 0.00  ? 156 ALA B CA   5  
ATOM   8442  C  C    . ALA B 2 13 ? 46.971 -2.381  0.697   1.00 0.00  ? 156 ALA B C    5  
ATOM   8443  O  O    . ALA B 2 13 ? 46.207 -3.115  0.097   1.00 0.00  ? 156 ALA B O    5  
ATOM   8444  C  CB   . ALA B 2 13 ? 47.915 -0.202  -0.156  1.00 0.00  ? 156 ALA B CB   5  
ATOM   8445  H  H    . ALA B 2 13 ? 47.561 0.455   2.198   1.00 0.00  ? 156 ALA B H    5  
ATOM   8446  H  HA   . ALA B 2 13 ? 45.837 -0.602  0.228   1.00 0.00  ? 156 ALA B HA   5  
ATOM   8447  H  HB1  . ALA B 2 13 ? 48.871 -0.579  0.179   1.00 0.00  ? 156 ALA B HB1  5  
ATOM   8448  H  HB2  . ALA B 2 13 ? 47.883 0.869   -0.019  1.00 0.00  ? 156 ALA B HB2  5  
ATOM   8449  H  HB3  . ALA B 2 13 ? 47.782 -0.435  -1.202  1.00 0.00  ? 156 ALA B HB3  5  
ATOM   8450  N  N    . LEU B 2 14 ? 47.965 -2.865  1.399   1.00 0.00  ? 157 LEU B N    5  
ATOM   8451  C  CA   . LEU B 2 14 ? 48.180 -4.343  1.477   1.00 0.00  ? 157 LEU B CA   5  
ATOM   8452  C  C    . LEU B 2 14 ? 47.226 -4.964  2.507   1.00 0.00  ? 157 LEU B C    5  
ATOM   8453  O  O    . LEU B 2 14 ? 46.586 -5.965  2.244   1.00 0.00  ? 157 LEU B O    5  
ATOM   8454  C  CB   . LEU B 2 14 ? 49.639 -4.520  1.909   1.00 0.00  ? 157 LEU B CB   5  
ATOM   8455  C  CG   . LEU B 2 14 ? 50.248 -5.705  1.156   1.00 0.00  ? 157 LEU B CG   5  
ATOM   8456  C  CD1  . LEU B 2 14 ? 50.728 -5.246  -0.223  1.00 0.00  ? 157 LEU B CD1  5  
ATOM   8457  C  CD2  . LEU B 2 14 ? 51.434 -6.258  1.947   1.00 0.00  ? 157 LEU B CD2  5  
ATOM   8458  H  H    . LEU B 2 14 ? 48.567 -2.257  1.878   1.00 0.00  ? 157 LEU B H    5  
ATOM   8459  H  HA   . LEU B 2 14 ? 48.028 -4.795  0.509   1.00 0.00  ? 157 LEU B HA   5  
ATOM   8460  H  HB2  . LEU B 2 14 ? 50.194 -3.621  1.679   1.00 0.00  ? 157 LEU B HB2  5  
ATOM   8461  H  HB3  . LEU B 2 14 ? 49.682 -4.708  2.971   1.00 0.00  ? 157 LEU B HB3  5  
ATOM   8462  H  HG   . LEU B 2 14 ? 49.500 -6.477  1.036   1.00 0.00  ? 157 LEU B HG   5  
ATOM   8463  H  HD11 . LEU B 2 14 ? 51.752 -4.909  -0.155  1.00 0.00  ? 157 LEU B HD11 5  
ATOM   8464  H  HD12 . LEU B 2 14 ? 50.105 -4.434  -0.570  1.00 0.00  ? 157 LEU B HD12 5  
ATOM   8465  H  HD13 . LEU B 2 14 ? 50.665 -6.070  -0.918  1.00 0.00  ? 157 LEU B HD13 5  
ATOM   8466  H  HD21 . LEU B 2 14 ? 51.070 -6.826  2.790   1.00 0.00  ? 157 LEU B HD21 5  
ATOM   8467  H  HD22 . LEU B 2 14 ? 52.045 -5.440  2.301   1.00 0.00  ? 157 LEU B HD22 5  
ATOM   8468  H  HD23 . LEU B 2 14 ? 52.025 -6.899  1.309   1.00 0.00  ? 157 LEU B HD23 5  
ATOM   8469  N  N    . LEU B 2 15 ? 47.116 -4.370  3.672   1.00 0.00  ? 158 LEU B N    5  
ATOM   8470  C  CA   . LEU B 2 15 ? 46.188 -4.921  4.707   1.00 0.00  ? 158 LEU B CA   5  
ATOM   8471  C  C    . LEU B 2 15 ? 44.753 -4.487  4.384   1.00 0.00  ? 158 LEU B C    5  
ATOM   8472  O  O    . LEU B 2 15 ? 44.268 -3.477  4.863   1.00 0.00  ? 158 LEU B O    5  
ATOM   8473  C  CB   . LEU B 2 15 ? 46.663 -4.331  6.041   1.00 0.00  ? 158 LEU B CB   5  
ATOM   8474  C  CG   . LEU B 2 15 ? 47.718 -5.254  6.660   1.00 0.00  ? 158 LEU B CG   5  
ATOM   8475  C  CD1  . LEU B 2 15 ? 49.117 -4.728  6.334   1.00 0.00  ? 158 LEU B CD1  5  
ATOM   8476  C  CD2  . LEU B 2 15 ? 47.531 -5.298  8.179   1.00 0.00  ? 158 LEU B CD2  5  
ATOM   8477  H  H    . LEU B 2 15 ? 47.633 -3.558  3.859   1.00 0.00  ? 158 LEU B H    5  
ATOM   8478  H  HA   . LEU B 2 15 ? 46.255 -5.999  4.734   1.00 0.00  ? 158 LEU B HA   5  
ATOM   8479  H  HB2  . LEU B 2 15 ? 47.091 -3.354  5.872   1.00 0.00  ? 158 LEU B HB2  5  
ATOM   8480  H  HB3  . LEU B 2 15 ? 45.823 -4.245  6.714   1.00 0.00  ? 158 LEU B HB3  5  
ATOM   8481  H  HG   . LEU B 2 15 ? 47.606 -6.249  6.255   1.00 0.00  ? 158 LEU B HG   5  
ATOM   8482  H  HD11 . LEU B 2 15 ? 49.253 -3.759  6.789   1.00 0.00  ? 158 LEU B HD11 5  
ATOM   8483  H  HD12 . LEU B 2 15 ? 49.228 -4.642  5.263   1.00 0.00  ? 158 LEU B HD12 5  
ATOM   8484  H  HD13 . LEU B 2 15 ? 49.858 -5.413  6.719   1.00 0.00  ? 158 LEU B HD13 5  
ATOM   8485  H  HD21 . LEU B 2 15 ? 48.376 -5.796  8.631   1.00 0.00  ? 158 LEU B HD21 5  
ATOM   8486  H  HD22 . LEU B 2 15 ? 46.626 -5.839  8.415   1.00 0.00  ? 158 LEU B HD22 5  
ATOM   8487  H  HD23 . LEU B 2 15 ? 47.459 -4.291  8.563   1.00 0.00  ? 158 LEU B HD23 5  
ATOM   8488  N  N    . GLY B 2 16 ? 44.082 -5.242  3.554   1.00 0.00  ? 159 GLY B N    5  
ATOM   8489  C  CA   . GLY B 2 16 ? 42.683 -4.893  3.162   1.00 0.00  ? 159 GLY B CA   5  
ATOM   8490  C  C    . GLY B 2 16 ? 42.450 -5.310  1.707   1.00 0.00  ? 159 GLY B C    5  
ATOM   8491  O  O    . GLY B 2 16 ? 41.411 -5.841  1.366   1.00 0.00  ? 159 GLY B O    5  
ATOM   8492  H  H    . GLY B 2 16 ? 44.506 -6.041  3.176   1.00 0.00  ? 159 GLY B H    5  
ATOM   8493  H  HA2  . GLY B 2 16 ? 41.987 -5.413  3.804   1.00 0.00  ? 159 GLY B HA2  5  
ATOM   8494  H  HA3  . GLY B 2 16 ? 42.535 -3.828  3.255   1.00 0.00  ? 159 GLY B HA3  5  
ATOM   8495  N  N    . ALA B 2 17 ? 43.414 -5.080  0.849   1.00 0.00  ? 160 ALA B N    5  
ATOM   8496  C  CA   . ALA B 2 17 ? 43.256 -5.469  -0.587  1.00 0.00  ? 160 ALA B CA   5  
ATOM   8497  C  C    . ALA B 2 17 ? 44.346 -6.473  -1.006  1.00 0.00  ? 160 ALA B C    5  
ATOM   8498  O  O    . ALA B 2 17 ? 44.702 -6.560  -2.167  1.00 0.00  ? 160 ALA B O    5  
ATOM   8499  C  CB   . ALA B 2 17 ? 43.401 -4.154  -1.359  1.00 0.00  ? 160 ALA B CB   5  
ATOM   8500  H  H    . ALA B 2 17 ? 44.245 -4.654  1.149   1.00 0.00  ? 160 ALA B H    5  
ATOM   8501  H  HA   . ALA B 2 17 ? 42.277 -5.887  -0.758  1.00 0.00  ? 160 ALA B HA   5  
ATOM   8502  H  HB1  . ALA B 2 17 ? 43.757 -4.360  -2.358  1.00 0.00  ? 160 ALA B HB1  5  
ATOM   8503  H  HB2  . ALA B 2 17 ? 44.108 -3.515  -0.850  1.00 0.00  ? 160 ALA B HB2  5  
ATOM   8504  H  HB3  . ALA B 2 17 ? 42.443 -3.660  -1.412  1.00 0.00  ? 160 ALA B HB3  5  
ATOM   8505  N  N    . ARG B 2 18 ? 44.876 -7.237  -0.078  1.00 0.00  ? 161 ARG B N    5  
ATOM   8506  C  CA   . ARG B 2 18 ? 45.935 -8.229  -0.442  1.00 0.00  ? 161 ARG B CA   5  
ATOM   8507  C  C    . ARG B 2 18 ? 45.892 -9.445  0.492   1.00 0.00  ? 161 ARG B C    5  
ATOM   8508  O  O    . ARG B 2 18 ? 45.739 -10.567 0.047   1.00 0.00  ? 161 ARG B O    5  
ATOM   8509  C  CB   . ARG B 2 18 ? 47.261 -7.477  -0.288  1.00 0.00  ? 161 ARG B CB   5  
ATOM   8510  C  CG   . ARG B 2 18 ? 48.321 -8.124  -1.184  1.00 0.00  ? 161 ARG B CG   5  
ATOM   8511  C  CD   . ARG B 2 18 ? 48.489 -7.297  -2.462  1.00 0.00  ? 161 ARG B CD   5  
ATOM   8512  N  NE   . ARG B 2 18 ? 47.305 -7.641  -3.304  1.00 0.00  ? 161 ARG B NE   5  
ATOM   8513  C  CZ   . ARG B 2 18 ? 47.345 -8.667  -4.107  1.00 0.00  ? 161 ARG B CZ   5  
ATOM   8514  N  NH1  . ARG B 2 18 ? 47.945 -8.565  -5.258  1.00 0.00  ? 161 ARG B NH1  5  
ATOM   8515  N  NH2  . ARG B 2 18 ? 46.784 -9.791  -3.759  1.00 0.00  ? 161 ARG B NH2  5  
ATOM   8516  H  H    . ARG B 2 18 ? 44.577 -7.161  0.852   1.00 0.00  ? 161 ARG B H    5  
ATOM   8517  H  HA   . ARG B 2 18 ? 45.812 -8.545  -1.465  1.00 0.00  ? 161 ARG B HA   5  
ATOM   8518  H  HB2  . ARG B 2 18 ? 47.125 -6.444  -0.577  1.00 0.00  ? 161 ARG B HB2  5  
ATOM   8519  H  HB3  . ARG B 2 18 ? 47.586 -7.524  0.741   1.00 0.00  ? 161 ARG B HB3  5  
ATOM   8520  H  HG2  . ARG B 2 18 ? 49.262 -8.166  -0.655  1.00 0.00  ? 161 ARG B HG2  5  
ATOM   8521  H  HG3  . ARG B 2 18 ? 48.011 -9.125  -1.444  1.00 0.00  ? 161 ARG B HG3  5  
ATOM   8522  H  HD2  . ARG B 2 18 ? 48.493 -6.240  -2.225  1.00 0.00  ? 161 ARG B HD2  5  
ATOM   8523  H  HD3  . ARG B 2 18 ? 49.399 -7.573  -2.970  1.00 0.00  ? 161 ARG B HD3  5  
ATOM   8524  H  HE   . ARG B 2 18 ? 46.492 -7.093  -3.253  1.00 0.00  ? 161 ARG B HE   5  
ATOM   8525  H  HH11 . ARG B 2 18 ? 48.374 -7.701  -5.521  1.00 0.00  ? 161 ARG B HH11 5  
ATOM   8526  H  HH12 . ARG B 2 18 ? 47.975 -9.346  -5.880  1.00 0.00  ? 161 ARG B HH12 5  
ATOM   8527  H  HH21 . ARG B 2 18 ? 46.320 -9.866  -2.875  1.00 0.00  ? 161 ARG B HH21 5  
ATOM   8528  H  HH22 . ARG B 2 18 ? 46.817 -10.580 -4.372  1.00 0.00  ? 161 ARG B HH22 5  
ATOM   8529  N  N    . ALA B 2 19 ? 46.032 -9.234  1.779   1.00 0.00  ? 162 ALA B N    5  
ATOM   8530  C  CA   . ALA B 2 19 ? 46.006 -10.383 2.735   1.00 0.00  ? 162 ALA B CA   5  
ATOM   8531  C  C    . ALA B 2 19 ? 44.840 -10.241 3.724   1.00 0.00  ? 162 ALA B C    5  
ATOM   8532  O  O    . ALA B 2 19 ? 43.913 -11.027 3.710   1.00 0.00  ? 162 ALA B O    5  
ATOM   8533  C  CB   . ALA B 2 19 ? 47.350 -10.322 3.463   1.00 0.00  ? 162 ALA B CB   5  
ATOM   8534  H  H    . ALA B 2 19 ? 46.161 -8.321  2.113   1.00 0.00  ? 162 ALA B H    5  
ATOM   8535  H  HA   . ALA B 2 19 ? 45.925 -11.314 2.197   1.00 0.00  ? 162 ALA B HA   5  
ATOM   8536  H  HB1  . ALA B 2 19 ? 47.697 -9.299  3.498   1.00 0.00  ? 162 ALA B HB1  5  
ATOM   8537  H  HB2  . ALA B 2 19 ? 48.072 -10.929 2.937   1.00 0.00  ? 162 ALA B HB2  5  
ATOM   8538  H  HB3  . ALA B 2 19 ? 47.231 -10.696 4.469   1.00 0.00  ? 162 ALA B HB3  5  
ATOM   8539  N  N    . LYS B 2 20 ? 44.882 -9.249  4.582   1.00 0.00  ? 163 LYS B N    5  
ATOM   8540  C  CA   . LYS B 2 20 ? 43.778 -9.059  5.574   1.00 0.00  ? 163 LYS B CA   5  
ATOM   8541  C  C    . LYS B 2 20 ? 43.530 -7.564  5.814   1.00 0.00  ? 163 LYS B C    5  
ATOM   8542  O  O    . LYS B 2 20 ? 42.439 -7.111  5.511   1.00 0.00  ? 163 LYS B O    5  
ATOM   8543  C  CB   . LYS B 2 20 ? 44.271 -9.741  6.857   1.00 0.00  ? 163 LYS B CB   5  
ATOM   8544  C  CG   . LYS B 2 20 ? 43.743 -11.177 6.912   1.00 0.00  ? 163 LYS B CG   5  
ATOM   8545  C  CD   . LYS B 2 20 ? 44.255 -11.864 8.183   1.00 0.00  ? 163 LYS B CD   5  
ATOM   8546  C  CE   . LYS B 2 20 ? 43.092 -12.080 9.157   1.00 0.00  ? 163 LYS B CE   5  
ATOM   8547  N  NZ   . LYS B 2 20 ? 43.710 -12.040 10.516  1.00 0.00  ? 163 LYS B NZ   5  
ATOM   8548  O  OXT  . LYS B 2 20 ? 44.435 -6.898  6.293   1.00 0.00  ? 163 LYS B OXT  5  
ATOM   8549  H  H    . LYS B 2 20 ? 45.641 -8.629  4.576   1.00 0.00  ? 163 LYS B H    5  
ATOM   8550  H  HA   . LYS B 2 20 ? 42.875 -9.538  5.228   1.00 0.00  ? 163 LYS B HA   5  
ATOM   8551  H  HB2  . LYS B 2 20 ? 45.351 -9.754  6.865   1.00 0.00  ? 163 LYS B HB2  5  
ATOM   8552  H  HB3  . LYS B 2 20 ? 43.912 -9.194  7.715   1.00 0.00  ? 163 LYS B HB3  5  
ATOM   8553  H  HG2  . LYS B 2 20 ? 42.662 -11.162 6.916   1.00 0.00  ? 163 LYS B HG2  5  
ATOM   8554  H  HG3  . LYS B 2 20 ? 44.091 -11.721 6.047   1.00 0.00  ? 163 LYS B HG3  5  
ATOM   8555  H  HD2  . LYS B 2 20 ? 44.690 -12.819 7.925   1.00 0.00  ? 163 LYS B HD2  5  
ATOM   8556  H  HD3  . LYS B 2 20 ? 45.004 -11.242 8.651   1.00 0.00  ? 163 LYS B HD3  5  
ATOM   8557  H  HE2  . LYS B 2 20 ? 42.361 -11.290 9.048   1.00 0.00  ? 163 LYS B HE2  5  
ATOM   8558  H  HE3  . LYS B 2 20 ? 42.634 -13.044 8.987   1.00 0.00  ? 163 LYS B HE3  5  
ATOM   8559  H  HZ1  . LYS B 2 20 ? 42.962 -12.057 11.238  1.00 0.00  ? 163 LYS B HZ1  5  
ATOM   8560  H  HZ2  . LYS B 2 20 ? 44.271 -11.169 10.619  1.00 0.00  ? 163 LYS B HZ2  5  
ATOM   8561  H  HZ3  . LYS B 2 20 ? 44.329 -12.867 10.643  1.00 0.00  ? 163 LYS B HZ3  5  
HETATM 8562  CA CA   . CA  C 3 .  ? 68.937 -3.557  -1.988  1.00 0.00  ? 90  CA  A CA   5  
HETATM 8563  O  OAA  . SXK D 4 .  ? 58.947 11.470  -5.883  1.00 20.00 ? 91  SXK A OAA  5  
HETATM 8564  O  OAB  . SXK D 4 .  ? 59.496 12.675  -4.099  1.00 20.00 ? 91  SXK A OAB  5  
HETATM 8565  C  CAE  . SXK D 4 .  ? 56.632 2.897   -0.067  1.00 20.00 ? 91  SXK A CAE  5  
HETATM 8566  C  CAF  . SXK D 4 .  ? 56.927 7.862   -3.430  1.00 20.00 ? 91  SXK A CAF  5  
HETATM 8567  C  CAG  . SXK D 4 .  ? 58.858 7.870   -1.895  1.00 20.00 ? 91  SXK A CAG  5  
HETATM 8568  C  CAH  . SXK D 4 .  ? 56.648 6.522   -3.078  1.00 20.00 ? 91  SXK A CAH  5  
HETATM 8569  C  CAI  . SXK D 4 .  ? 58.587 6.535   -1.539  1.00 20.00 ? 91  SXK A CAI  5  
HETATM 8570  C  CAJ  . SXK D 4 .  ? 56.859 4.241   -0.444  1.00 20.00 ? 91  SXK A CAJ  5  
HETATM 8571  C  CAK  . SXK D 4 .  ? 57.100 2.143   -2.345  1.00 20.00 ? 91  SXK A CAK  5  
HETATM 8572  C  CAL  . SXK D 4 .  ? 59.444 10.315  -3.832  1.00 20.00 ? 91  SXK A CAL  5  
HETATM 8573  O  OAM  . SXK D 4 .  ? 58.206 9.829   -3.258  1.00 20.00 ? 91  SXK A OAM  5  
HETATM 8574  C  CAN  . SXK D 4 .  ? 59.281 11.589  -4.677  1.00 20.00 ? 91  SXK A CAN  5  
HETATM 8575  C  CAO  . SXK D 4 .  ? 56.754 1.869   -1.016  1.00 20.00 ? 91  SXK A CAO  5  
HETATM 8576  C  CAP  . SXK D 4 .  ? 58.036 8.534   -2.835  1.00 20.00 ? 91  SXK A CAP  5  
HETATM 8577  C  CAQ  . SXK D 4 .  ? 57.331 3.483   -2.734  1.00 20.00 ? 91  SXK A CAQ  5  
HETATM 8578  C  CAR  . SXK D 4 .  ? 57.483 5.858   -2.132  1.00 20.00 ? 91  SXK A CAR  5  
HETATM 8579  C  CAS  . SXK D 4 .  ? 57.214 4.528   -1.775  1.00 20.00 ? 91  SXK A CAS  5  
HETATM 8580  F  FCC  . SXK D 4 .  ? 56.530 0.584   -0.631  1.00 20.00 ? 91  SXK A FCC  5  
HETATM 8581  F  FDD  . SXK D 4 .  ? 57.668 3.722   -4.039  1.00 20.00 ? 91  SXK A FDD  5  
HETATM 8582  H  HAE  . SXK D 4 .  ? 56.363 2.654   0.959   1.00 20.00 ? 91  SXK A HAE  5  
HETATM 8583  H  HAF  . SXK D 4 .  ? 56.298 8.385   -4.156  1.00 20.00 ? 91  SXK A HAF  5  
HETATM 8584  H  HAG  . SXK D 4 .  ? 59.709 8.377   -1.436  1.00 20.00 ? 91  SXK A HAG  5  
HETATM 8585  H  HAH  . SXK D 4 .  ? 55.800 6.001   -3.529  1.00 20.00 ? 91  SXK A HAH  5  
HETATM 8586  H  HAI  . SXK D 4 .  ? 59.221 6.027   -0.812  1.00 20.00 ? 91  SXK A HAI  5  
HETATM 8587  H  HAJ  . SXK D 4 .  ? 56.765 5.037   0.295   1.00 20.00 ? 91  SXK A HAJ  5  
HETATM 8588  H  HAK  . SXK D 4 .  ? 57.193 1.335   -3.077  1.00 20.00 ? 91  SXK A HAK  5  
HETATM 8589  H  HAL  . SXK D 4 .  ? 60.148 10.536  -3.024  1.00 20.00 ? 91  SXK A HAL  5  
HETATM 8590  H  HALA . SXK D 4 .  ? 59.819 9.547   -4.505  1.00 20.00 ? 91  SXK A HALA 5  
ATOM   8591  N  N    . MET A 1 1  ? 71.297 7.039   0.995   1.00 0.00  ? 1   MET A N    6  
ATOM   8592  C  CA   . MET A 1 1  ? 71.883 7.989   1.994   1.00 0.00  ? 1   MET A CA   6  
ATOM   8593  C  C    . MET A 1 1  ? 70.772 8.577   2.874   1.00 0.00  ? 1   MET A C    6  
ATOM   8594  O  O    . MET A 1 1  ? 69.736 8.982   2.384   1.00 0.00  ? 1   MET A O    6  
ATOM   8595  C  CB   . MET A 1 1  ? 72.549 9.091   1.161   1.00 0.00  ? 1   MET A CB   6  
ATOM   8596  C  CG   . MET A 1 1  ? 74.012 8.726   0.896   1.00 0.00  ? 1   MET A CG   6  
ATOM   8597  S  SD   . MET A 1 1  ? 75.071 9.579   2.092   1.00 0.00  ? 1   MET A SD   6  
ATOM   8598  C  CE   . MET A 1 1  ? 75.295 11.106  1.146   1.00 0.00  ? 1   MET A CE   6  
ATOM   8599  H  H1   . MET A 1 1  ? 70.754 7.571   0.284   1.00 0.00  ? 1   MET A H1   6  
ATOM   8600  H  H2   . MET A 1 1  ? 70.668 6.367   1.482   1.00 0.00  ? 1   MET A H2   6  
ATOM   8601  H  H3   . MET A 1 1  ? 72.064 6.517   0.522   1.00 0.00  ? 1   MET A H3   6  
ATOM   8602  H  HA   . MET A 1 1  ? 72.620 7.490   2.602   1.00 0.00  ? 1   MET A HA   6  
ATOM   8603  H  HB2  . MET A 1 1  ? 72.028 9.197   0.220   1.00 0.00  ? 1   MET A HB2  6  
ATOM   8604  H  HB3  . MET A 1 1  ? 72.507 10.025  1.701   1.00 0.00  ? 1   MET A HB3  6  
ATOM   8605  H  HG2  . MET A 1 1  ? 74.144 7.658   0.996   1.00 0.00  ? 1   MET A HG2  6  
ATOM   8606  H  HG3  . MET A 1 1  ? 74.284 9.029   -0.105  1.00 0.00  ? 1   MET A HG3  6  
ATOM   8607  H  HE1  . MET A 1 1  ? 75.440 11.933  1.827   1.00 0.00  ? 1   MET A HE1  6  
ATOM   8608  H  HE2  . MET A 1 1  ? 74.421 11.291  0.543   1.00 0.00  ? 1   MET A HE2  6  
ATOM   8609  H  HE3  . MET A 1 1  ? 76.158 11.006  0.503   1.00 0.00  ? 1   MET A HE3  6  
ATOM   8610  N  N    . ASP A 1 2  ? 70.978 8.616   4.168   1.00 0.00  ? 2   ASP A N    6  
ATOM   8611  C  CA   . ASP A 1 2  ? 69.929 9.170   5.081   1.00 0.00  ? 2   ASP A CA   6  
ATOM   8612  C  C    . ASP A 1 2  ? 70.537 9.568   6.434   1.00 0.00  ? 2   ASP A C    6  
ATOM   8613  O  O    . ASP A 1 2  ? 71.580 9.077   6.828   1.00 0.00  ? 2   ASP A O    6  
ATOM   8614  C  CB   . ASP A 1 2  ? 68.924 8.024   5.256   1.00 0.00  ? 2   ASP A CB   6  
ATOM   8615  C  CG   . ASP A 1 2  ? 67.571 8.553   5.759   1.00 0.00  ? 2   ASP A CG   6  
ATOM   8616  O  OD1  . ASP A 1 2  ? 67.437 9.755   5.944   1.00 0.00  ? 2   ASP A OD1  6  
ATOM   8617  O  OD2  . ASP A 1 2  ? 66.685 7.740   5.947   1.00 0.00  ? 2   ASP A OD2  6  
ATOM   8618  H  H    . ASP A 1 2  ? 71.819 8.278   4.540   1.00 0.00  ? 2   ASP A H    6  
ATOM   8619  H  HA   . ASP A 1 2  ? 69.442 10.017  4.624   1.00 0.00  ? 2   ASP A HA   6  
ATOM   8620  H  HB2  . ASP A 1 2  ? 68.780 7.530   4.308   1.00 0.00  ? 2   ASP A HB2  6  
ATOM   8621  H  HB3  . ASP A 1 2  ? 69.315 7.315   5.970   1.00 0.00  ? 2   ASP A HB3  6  
ATOM   8622  N  N    . ASP A 1 3  ? 69.885 10.455  7.147   1.00 0.00  ? 3   ASP A N    6  
ATOM   8623  C  CA   . ASP A 1 3  ? 70.407 10.896  8.476   1.00 0.00  ? 3   ASP A CA   6  
ATOM   8624  C  C    . ASP A 1 3  ? 69.251 11.093  9.470   1.00 0.00  ? 3   ASP A C    6  
ATOM   8625  O  O    . ASP A 1 3  ? 69.122 10.358  10.431  1.00 0.00  ? 3   ASP A O    6  
ATOM   8626  C  CB   . ASP A 1 3  ? 71.124 12.222  8.191   1.00 0.00  ? 3   ASP A CB   6  
ATOM   8627  C  CG   . ASP A 1 3  ? 71.637 12.829  9.499   1.00 0.00  ? 3   ASP A CG   6  
ATOM   8628  O  OD1  . ASP A 1 3  ? 72.680 12.398  9.961   1.00 0.00  ? 3   ASP A OD1  6  
ATOM   8629  O  OD2  . ASP A 1 3  ? 70.977 13.716  10.014  1.00 0.00  ? 3   ASP A OD2  6  
ATOM   8630  H  H    . ASP A 1 3  ? 69.046 10.831  6.804   1.00 0.00  ? 3   ASP A H    6  
ATOM   8631  H  HA   . ASP A 1 3  ? 71.111 10.175  8.861   1.00 0.00  ? 3   ASP A HA   6  
ATOM   8632  H  HB2  . ASP A 1 3  ? 71.957 12.043  7.527   1.00 0.00  ? 3   ASP A HB2  6  
ATOM   8633  H  HB3  . ASP A 1 3  ? 70.435 12.910  7.724   1.00 0.00  ? 3   ASP A HB3  6  
ATOM   8634  N  N    . ILE A 1 4  ? 68.415 12.081  9.249   1.00 0.00  ? 4   ILE A N    6  
ATOM   8635  C  CA   . ILE A 1 4  ? 67.273 12.331  10.188  1.00 0.00  ? 4   ILE A CA   6  
ATOM   8636  C  C    . ILE A 1 4  ? 66.274 11.160  10.170  1.00 0.00  ? 4   ILE A C    6  
ATOM   8637  O  O    . ILE A 1 4  ? 65.792 10.741  11.206  1.00 0.00  ? 4   ILE A O    6  
ATOM   8638  C  CB   . ILE A 1 4  ? 66.617 13.638  9.705   1.00 0.00  ? 4   ILE A CB   6  
ATOM   8639  C  CG1  . ILE A 1 4  ? 65.540 14.068  10.707  1.00 0.00  ? 4   ILE A CG1  6  
ATOM   8640  C  CG2  . ILE A 1 4  ? 65.975 13.443  8.325   1.00 0.00  ? 4   ILE A CG2  6  
ATOM   8641  C  CD1  . ILE A 1 4  ? 66.101 15.149  11.631  1.00 0.00  ? 4   ILE A CD1  6  
ATOM   8642  H  H    . ILE A 1 4  ? 68.544 12.662  8.471   1.00 0.00  ? 4   ILE A H    6  
ATOM   8643  H  HA   . ILE A 1 4  ? 67.651 12.470  11.189  1.00 0.00  ? 4   ILE A HA   6  
ATOM   8644  H  HB   . ILE A 1 4  ? 67.371 14.409  9.639   1.00 0.00  ? 4   ILE A HB   6  
ATOM   8645  H  HG12 . ILE A 1 4  ? 64.687 14.459  10.172  1.00 0.00  ? 4   ILE A HG12 6  
ATOM   8646  H  HG13 . ILE A 1 4  ? 65.235 13.217  11.298  1.00 0.00  ? 4   ILE A HG13 6  
ATOM   8647  H  HG21 . ILE A 1 4  ? 66.716 13.072  7.632   1.00 0.00  ? 4   ILE A HG21 6  
ATOM   8648  H  HG22 . ILE A 1 4  ? 65.592 14.388  7.969   1.00 0.00  ? 4   ILE A HG22 6  
ATOM   8649  H  HG23 . ILE A 1 4  ? 65.165 12.733  8.401   1.00 0.00  ? 4   ILE A HG23 6  
ATOM   8650  H  HD11 . ILE A 1 4  ? 65.286 15.711  12.063  1.00 0.00  ? 4   ILE A HD11 6  
ATOM   8651  H  HD12 . ILE A 1 4  ? 66.736 15.814  11.065  1.00 0.00  ? 4   ILE A HD12 6  
ATOM   8652  H  HD13 . ILE A 1 4  ? 66.676 14.686  12.420  1.00 0.00  ? 4   ILE A HD13 6  
ATOM   8653  N  N    . TYR A 1 5  ? 65.965 10.622  9.014   1.00 0.00  ? 5   TYR A N    6  
ATOM   8654  C  CA   . TYR A 1 5  ? 65.004 9.476   8.957   1.00 0.00  ? 5   TYR A CA   6  
ATOM   8655  C  C    . TYR A 1 5  ? 65.719 8.180   9.350   1.00 0.00  ? 5   TYR A C    6  
ATOM   8656  O  O    . TYR A 1 5  ? 65.140 7.307   9.969   1.00 0.00  ? 5   TYR A O    6  
ATOM   8657  C  CB   . TYR A 1 5  ? 64.517 9.415   7.507   1.00 0.00  ? 5   TYR A CB   6  
ATOM   8658  C  CG   . TYR A 1 5  ? 63.597 10.581  7.235   1.00 0.00  ? 5   TYR A CG   6  
ATOM   8659  C  CD1  . TYR A 1 5  ? 62.509 10.828  8.081   1.00 0.00  ? 5   TYR A CD1  6  
ATOM   8660  C  CD2  . TYR A 1 5  ? 63.835 11.417  6.139   1.00 0.00  ? 5   TYR A CD2  6  
ATOM   8661  C  CE1  . TYR A 1 5  ? 61.662 11.910  7.832   1.00 0.00  ? 5   TYR A CE1  6  
ATOM   8662  C  CE2  . TYR A 1 5  ? 62.987 12.502  5.892   1.00 0.00  ? 5   TYR A CE2  6  
ATOM   8663  C  CZ   . TYR A 1 5  ? 61.901 12.747  6.738   1.00 0.00  ? 5   TYR A CZ   6  
ATOM   8664  O  OH   . TYR A 1 5  ? 61.070 13.819  6.500   1.00 0.00  ? 5   TYR A OH   6  
ATOM   8665  H  H    . TYR A 1 5  ? 66.369 10.965  8.189   1.00 0.00  ? 5   TYR A H    6  
ATOM   8666  H  HA   . TYR A 1 5  ? 64.170 9.656   9.619   1.00 0.00  ? 5   TYR A HA   6  
ATOM   8667  H  HB2  . TYR A 1 5  ? 65.365 9.464   6.841   1.00 0.00  ? 5   TYR A HB2  6  
ATOM   8668  H  HB3  . TYR A 1 5  ? 63.985 8.491   7.343   1.00 0.00  ? 5   TYR A HB3  6  
ATOM   8669  H  HD1  . TYR A 1 5  ? 62.324 10.182  8.927   1.00 0.00  ? 5   TYR A HD1  6  
ATOM   8670  H  HD2  . TYR A 1 5  ? 64.674 11.226  5.485   1.00 0.00  ? 5   TYR A HD2  6  
ATOM   8671  H  HE1  . TYR A 1 5  ? 60.824 12.101  8.486   1.00 0.00  ? 5   TYR A HE1  6  
ATOM   8672  H  HE2  . TYR A 1 5  ? 63.169 13.148  5.046   1.00 0.00  ? 5   TYR A HE2  6  
ATOM   8673  H  HH   . TYR A 1 5  ? 61.242 14.479  7.178   1.00 0.00  ? 5   TYR A HH   6  
ATOM   8674  N  N    . LYS A 1 6  ? 66.980 8.059   9.009   1.00 0.00  ? 6   LYS A N    6  
ATOM   8675  C  CA   . LYS A 1 6  ? 67.745 6.830   9.376   1.00 0.00  ? 6   LYS A CA   6  
ATOM   8676  C  C    . LYS A 1 6  ? 67.790 6.678   10.904  1.00 0.00  ? 6   LYS A C    6  
ATOM   8677  O  O    . LYS A 1 6  ? 67.592 5.598   11.429  1.00 0.00  ? 6   LYS A O    6  
ATOM   8678  C  CB   . LYS A 1 6  ? 69.152 7.045   8.813   1.00 0.00  ? 6   LYS A CB   6  
ATOM   8679  C  CG   . LYS A 1 6  ? 69.857 5.693   8.680   1.00 0.00  ? 6   LYS A CG   6  
ATOM   8680  C  CD   . LYS A 1 6  ? 71.340 5.913   8.368   1.00 0.00  ? 6   LYS A CD   6  
ATOM   8681  C  CE   . LYS A 1 6  ? 72.072 6.382   9.632   1.00 0.00  ? 6   LYS A CE   6  
ATOM   8682  N  NZ   . LYS A 1 6  ? 72.524 5.132   10.312  1.00 0.00  ? 6   LYS A NZ   6  
ATOM   8683  H  H    . LYS A 1 6  ? 67.424 8.783   8.519   1.00 0.00  ? 6   LYS A H    6  
ATOM   8684  H  HA   . LYS A 1 6  ? 67.295 5.960   8.926   1.00 0.00  ? 6   LYS A HA   6  
ATOM   8685  H  HB2  . LYS A 1 6  ? 69.084 7.514   7.842   1.00 0.00  ? 6   LYS A HB2  6  
ATOM   8686  H  HB3  . LYS A 1 6  ? 69.715 7.679   9.481   1.00 0.00  ? 6   LYS A HB3  6  
ATOM   8687  H  HG2  . LYS A 1 6  ? 69.760 5.146   9.607   1.00 0.00  ? 6   LYS A HG2  6  
ATOM   8688  H  HG3  . LYS A 1 6  ? 69.402 5.128   7.880   1.00 0.00  ? 6   LYS A HG3  6  
ATOM   8689  H  HD2  . LYS A 1 6  ? 71.775 4.986   8.020   1.00 0.00  ? 6   LYS A HD2  6  
ATOM   8690  H  HD3  . LYS A 1 6  ? 71.439 6.665   7.598   1.00 0.00  ? 6   LYS A HD3  6  
ATOM   8691  H  HE2  . LYS A 1 6  ? 72.920 6.998   9.365   1.00 0.00  ? 6   LYS A HE2  6  
ATOM   8692  H  HE3  . LYS A 1 6  ? 71.398 6.929   10.275  1.00 0.00  ? 6   LYS A HE3  6  
ATOM   8693  H  HZ1  . LYS A 1 6  ? 72.963 4.493   9.619   1.00 0.00  ? 6   LYS A HZ1  6  
ATOM   8694  H  HZ2  . LYS A 1 6  ? 71.704 4.661   10.752  1.00 0.00  ? 6   LYS A HZ2  6  
ATOM   8695  H  HZ3  . LYS A 1 6  ? 73.219 5.370   11.048  1.00 0.00  ? 6   LYS A HZ3  6  
ATOM   8696  N  N    . ALA A 1 7  ? 68.035 7.756   11.620  1.00 0.00  ? 7   ALA A N    6  
ATOM   8697  C  CA   . ALA A 1 7  ? 68.078 7.681   13.118  1.00 0.00  ? 7   ALA A CA   6  
ATOM   8698  C  C    . ALA A 1 7  ? 66.768 7.085   13.654  1.00 0.00  ? 7   ALA A C    6  
ATOM   8699  O  O    . ALA A 1 7  ? 66.773 6.297   14.582  1.00 0.00  ? 7   ALA A O    6  
ATOM   8700  C  CB   . ALA A 1 7  ? 68.250 9.129   13.593  1.00 0.00  ? 7   ALA A CB   6  
ATOM   8701  H  H    . ALA A 1 7  ? 68.181 8.616   11.171  1.00 0.00  ? 7   ALA A H    6  
ATOM   8702  H  HA   . ALA A 1 7  ? 68.919 7.084   13.439  1.00 0.00  ? 7   ALA A HA   6  
ATOM   8703  H  HB1  . ALA A 1 7  ? 69.289 9.413   13.514  1.00 0.00  ? 7   ALA A HB1  6  
ATOM   8704  H  HB2  . ALA A 1 7  ? 67.933 9.210   14.622  1.00 0.00  ? 7   ALA A HB2  6  
ATOM   8705  H  HB3  . ALA A 1 7  ? 67.650 9.784   12.979  1.00 0.00  ? 7   ALA A HB3  6  
ATOM   8706  N  N    . ALA A 1 8  ? 65.650 7.440   13.061  1.00 0.00  ? 8   ALA A N    6  
ATOM   8707  C  CA   . ALA A 1 8  ? 64.340 6.877   13.518  1.00 0.00  ? 8   ALA A CA   6  
ATOM   8708  C  C    . ALA A 1 8  ? 64.349 5.350   13.352  1.00 0.00  ? 8   ALA A C    6  
ATOM   8709  O  O    . ALA A 1 8  ? 63.859 4.626   14.197  1.00 0.00  ? 8   ALA A O    6  
ATOM   8710  C  CB   . ALA A 1 8  ? 63.284 7.515   12.611  1.00 0.00  ? 8   ALA A CB   6  
ATOM   8711  H  H    . ALA A 1 8  ? 65.676 8.066   12.306  1.00 0.00  ? 8   ALA A H    6  
ATOM   8712  H  HA   . ALA A 1 8  ? 64.154 7.143   14.547  1.00 0.00  ? 8   ALA A HA   6  
ATOM   8713  H  HB1  . ALA A 1 8  ? 63.418 7.162   11.598  1.00 0.00  ? 8   ALA A HB1  6  
ATOM   8714  H  HB2  . ALA A 1 8  ? 63.390 8.589   12.635  1.00 0.00  ? 8   ALA A HB2  6  
ATOM   8715  H  HB3  . ALA A 1 8  ? 62.298 7.242   12.959  1.00 0.00  ? 8   ALA A HB3  6  
ATOM   8716  N  N    . VAL A 1 9  ? 64.926 4.860   12.278  1.00 0.00  ? 9   VAL A N    6  
ATOM   8717  C  CA   . VAL A 1 9  ? 64.996 3.378   12.064  1.00 0.00  ? 9   VAL A CA   6  
ATOM   8718  C  C    . VAL A 1 9  ? 65.860 2.746   13.167  1.00 0.00  ? 9   VAL A C    6  
ATOM   8719  O  O    . VAL A 1 9  ? 65.546 1.691   13.680  1.00 0.00  ? 9   VAL A O    6  
ATOM   8720  C  CB   . VAL A 1 9  ? 65.640 3.187   10.683  1.00 0.00  ? 9   VAL A CB   6  
ATOM   8721  C  CG1  . VAL A 1 9  ? 65.716 1.694   10.353  1.00 0.00  ? 9   VAL A CG1  6  
ATOM   8722  C  CG2  . VAL A 1 9  ? 64.794 3.891   9.617   1.00 0.00  ? 9   VAL A CG2  6  
ATOM   8723  H  H    . VAL A 1 9  ? 65.329 5.467   11.621  1.00 0.00  ? 9   VAL A H    6  
ATOM   8724  H  HA   . VAL A 1 9  ? 64.006 2.951   12.074  1.00 0.00  ? 9   VAL A HA   6  
ATOM   8725  H  HB   . VAL A 1 9  ? 66.637 3.605   10.690  1.00 0.00  ? 9   VAL A HB   6  
ATOM   8726  H  HG11 . VAL A 1 9  ? 66.298 1.187   11.108  1.00 0.00  ? 9   VAL A HG11 6  
ATOM   8727  H  HG12 . VAL A 1 9  ? 66.184 1.562   9.388   1.00 0.00  ? 9   VAL A HG12 6  
ATOM   8728  H  HG13 . VAL A 1 9  ? 64.719 1.281   10.329  1.00 0.00  ? 9   VAL A HG13 6  
ATOM   8729  H  HG21 . VAL A 1 9  ? 65.394 4.636   9.115   1.00 0.00  ? 9   VAL A HG21 6  
ATOM   8730  H  HG22 . VAL A 1 9  ? 63.946 4.369   10.086  1.00 0.00  ? 9   VAL A HG22 6  
ATOM   8731  H  HG23 . VAL A 1 9  ? 64.445 3.165   8.898   1.00 0.00  ? 9   VAL A HG23 6  
ATOM   8732  N  N    . GLU A 1 10 ? 66.933 3.402   13.549  1.00 0.00  ? 10  GLU A N    6  
ATOM   8733  C  CA   . GLU A 1 10 ? 67.806 2.859   14.641  1.00 0.00  ? 10  GLU A CA   6  
ATOM   8734  C  C    . GLU A 1 10 ? 67.026 2.833   15.966  1.00 0.00  ? 10  GLU A C    6  
ATOM   8735  O  O    . GLU A 1 10 ? 67.270 2.003   16.821  1.00 0.00  ? 10  GLU A O    6  
ATOM   8736  C  CB   . GLU A 1 10 ? 68.991 3.827   14.733  1.00 0.00  ? 10  GLU A CB   6  
ATOM   8737  C  CG   . GLU A 1 10 ? 70.100 3.375   13.776  1.00 0.00  ? 10  GLU A CG   6  
ATOM   8738  C  CD   . GLU A 1 10 ? 70.809 4.600   13.194  1.00 0.00  ? 10  GLU A CD   6  
ATOM   8739  O  OE1  . GLU A 1 10 ? 70.366 5.083   12.165  1.00 0.00  ? 10  GLU A OE1  6  
ATOM   8740  O  OE2  . GLU A 1 10 ? 71.785 5.031   13.782  1.00 0.00  ? 10  GLU A OE2  6  
ATOM   8741  H  H    . GLU A 1 10 ? 67.154 4.260   13.129  1.00 0.00  ? 10  GLU A H    6  
ATOM   8742  H  HA   . GLU A 1 10 ? 68.153 1.870   14.390  1.00 0.00  ? 10  GLU A HA   6  
ATOM   8743  H  HB2  . GLU A 1 10 ? 68.666 4.822   14.463  1.00 0.00  ? 10  GLU A HB2  6  
ATOM   8744  H  HB3  . GLU A 1 10 ? 69.373 3.836   15.743  1.00 0.00  ? 10  GLU A HB3  6  
ATOM   8745  H  HG2  . GLU A 1 10 ? 70.815 2.769   14.314  1.00 0.00  ? 10  GLU A HG2  6  
ATOM   8746  H  HG3  . GLU A 1 10 ? 69.670 2.797   12.972  1.00 0.00  ? 10  GLU A HG3  6  
ATOM   8747  N  N    . GLN A 1 11 ? 66.083 3.732   16.133  1.00 0.00  ? 11  GLN A N    6  
ATOM   8748  C  CA   . GLN A 1 11 ? 65.271 3.762   17.392  1.00 0.00  ? 11  GLN A CA   6  
ATOM   8749  C  C    . GLN A 1 11 ? 64.122 2.742   17.322  1.00 0.00  ? 11  GLN A C    6  
ATOM   8750  O  O    . GLN A 1 11 ? 63.568 2.360   18.335  1.00 0.00  ? 11  GLN A O    6  
ATOM   8751  C  CB   . GLN A 1 11 ? 64.714 5.186   17.475  1.00 0.00  ? 11  GLN A CB   6  
ATOM   8752  C  CG   . GLN A 1 11 ? 65.568 6.018   18.438  1.00 0.00  ? 11  GLN A CG   6  
ATOM   8753  C  CD   . GLN A 1 11 ? 64.717 6.460   19.630  1.00 0.00  ? 11  GLN A CD   6  
ATOM   8754  O  OE1  . GLN A 1 11 ? 64.804 5.889   20.697  1.00 0.00  ? 11  GLN A OE1  6  
ATOM   8755  N  NE2  . GLN A 1 11 ? 63.891 7.460   19.496  1.00 0.00  ? 11  GLN A NE2  6  
ATOM   8756  H  H    . GLN A 1 11 ? 65.903 4.385   15.425  1.00 0.00  ? 11  GLN A H    6  
ATOM   8757  H  HA   . GLN A 1 11 ? 65.897 3.562   18.247  1.00 0.00  ? 11  GLN A HA   6  
ATOM   8758  H  HB2  . GLN A 1 11 ? 64.731 5.640   16.494  1.00 0.00  ? 11  GLN A HB2  6  
ATOM   8759  H  HB3  . GLN A 1 11 ? 63.697 5.153   17.838  1.00 0.00  ? 11  GLN A HB3  6  
ATOM   8760  H  HG2  . GLN A 1 11 ? 66.398 5.422   18.790  1.00 0.00  ? 11  GLN A HG2  6  
ATOM   8761  H  HG3  . GLN A 1 11 ? 65.944 6.890   17.924  1.00 0.00  ? 11  GLN A HG3  6  
ATOM   8762  H  HE21 . GLN A 1 11 ? 63.818 7.926   18.637  1.00 0.00  ? 11  GLN A HE21 6  
ATOM   8763  H  HE22 . GLN A 1 11 ? 63.341 7.744   20.254  1.00 0.00  ? 11  GLN A HE22 6  
ATOM   8764  N  N    . LEU A 1 12 ? 63.761 2.298   16.138  1.00 0.00  ? 12  LEU A N    6  
ATOM   8765  C  CA   . LEU A 1 12 ? 62.651 1.302   16.011  1.00 0.00  ? 12  LEU A CA   6  
ATOM   8766  C  C    . LEU A 1 12 ? 63.033 -0.003  16.716  1.00 0.00  ? 12  LEU A C    6  
ATOM   8767  O  O    . LEU A 1 12 ? 63.969 -0.677  16.325  1.00 0.00  ? 12  LEU A O    6  
ATOM   8768  C  CB   . LEU A 1 12 ? 62.490 1.059   14.506  1.00 0.00  ? 12  LEU A CB   6  
ATOM   8769  C  CG   . LEU A 1 12 ? 61.604 2.145   13.894  1.00 0.00  ? 12  LEU A CG   6  
ATOM   8770  C  CD1  . LEU A 1 12 ? 61.727 2.107   12.370  1.00 0.00  ? 12  LEU A CD1  6  
ATOM   8771  C  CD2  . LEU A 1 12 ? 60.147 1.893   14.288  1.00 0.00  ? 12  LEU A CD2  6  
ATOM   8772  H  H    . LEU A 1 12 ? 64.220 2.620   15.335  1.00 0.00  ? 12  LEU A H    6  
ATOM   8773  H  HA   . LEU A 1 12 ? 61.736 1.700   16.421  1.00 0.00  ? 12  LEU A HA   6  
ATOM   8774  H  HB2  . LEU A 1 12 ? 63.462 1.079   14.034  1.00 0.00  ? 12  LEU A HB2  6  
ATOM   8775  H  HB3  . LEU A 1 12 ? 62.035 0.093   14.345  1.00 0.00  ? 12  LEU A HB3  6  
ATOM   8776  H  HG   . LEU A 1 12 ? 61.916 3.113   14.258  1.00 0.00  ? 12  LEU A HG   6  
ATOM   8777  H  HD11 . LEU A 1 12 ? 60.767 1.866   11.938  1.00 0.00  ? 12  LEU A HD11 6  
ATOM   8778  H  HD12 . LEU A 1 12 ? 62.448 1.355   12.084  1.00 0.00  ? 12  LEU A HD12 6  
ATOM   8779  H  HD13 . LEU A 1 12 ? 62.051 3.071   12.010  1.00 0.00  ? 12  LEU A HD13 6  
ATOM   8780  H  HD21 . LEU A 1 12 ? 60.080 1.760   15.358  1.00 0.00  ? 12  LEU A HD21 6  
ATOM   8781  H  HD22 . LEU A 1 12 ? 59.788 1.004   13.790  1.00 0.00  ? 12  LEU A HD22 6  
ATOM   8782  H  HD23 . LEU A 1 12 ? 59.544 2.739   13.992  1.00 0.00  ? 12  LEU A HD23 6  
ATOM   8783  N  N    . THR A 1 13 ? 62.316 -0.369  17.747  1.00 0.00  ? 13  THR A N    6  
ATOM   8784  C  CA   . THR A 1 13 ? 62.643 -1.639  18.469  1.00 0.00  ? 13  THR A CA   6  
ATOM   8785  C  C    . THR A 1 13 ? 62.193 -2.839  17.639  1.00 0.00  ? 13  THR A C    6  
ATOM   8786  O  O    . THR A 1 13 ? 61.467 -2.700  16.671  1.00 0.00  ? 13  THR A O    6  
ATOM   8787  C  CB   . THR A 1 13 ? 61.879 -1.583  19.801  1.00 0.00  ? 13  THR A CB   6  
ATOM   8788  O  OG1  . THR A 1 13 ? 60.482 -1.564  19.546  1.00 0.00  ? 13  THR A OG1  6  
ATOM   8789  C  CG2  . THR A 1 13 ? 62.277 -0.325  20.579  1.00 0.00  ? 13  THR A CG2  6  
ATOM   8790  H  H    . THR A 1 13 ? 61.564 0.186   18.043  1.00 0.00  ? 13  THR A H    6  
ATOM   8791  H  HA   . THR A 1 13 ? 63.702 -1.703  18.654  1.00 0.00  ? 13  THR A HA   6  
ATOM   8792  H  HB   . THR A 1 13 ? 62.124 -2.455  20.389  1.00 0.00  ? 13  THR A HB   6  
ATOM   8793  H  HG1  . THR A 1 13 ? 60.037 -1.954  20.302  1.00 0.00  ? 13  THR A HG1  6  
ATOM   8794  H  HG21 . THR A 1 13 ? 63.024 -0.580  21.317  1.00 0.00  ? 13  THR A HG21 6  
ATOM   8795  H  HG22 . THR A 1 13 ? 61.408 0.083   21.074  1.00 0.00  ? 13  THR A HG22 6  
ATOM   8796  H  HG23 . THR A 1 13 ? 62.679 0.410   19.897  1.00 0.00  ? 13  THR A HG23 6  
ATOM   8797  N  N    . GLU A 1 14 ? 62.626 -4.015  18.006  1.00 0.00  ? 14  GLU A N    6  
ATOM   8798  C  CA   . GLU A 1 14 ? 62.235 -5.229  17.231  1.00 0.00  ? 14  GLU A CA   6  
ATOM   8799  C  C    . GLU A 1 14 ? 60.706 -5.377  17.191  1.00 0.00  ? 14  GLU A C    6  
ATOM   8800  O  O    . GLU A 1 14 ? 60.148 -5.809  16.201  1.00 0.00  ? 14  GLU A O    6  
ATOM   8801  C  CB   . GLU A 1 14 ? 62.890 -6.405  17.963  1.00 0.00  ? 14  GLU A CB   6  
ATOM   8802  C  CG   . GLU A 1 14 ? 62.875 -7.653  17.068  1.00 0.00  ? 14  GLU A CG   6  
ATOM   8803  C  CD   . GLU A 1 14 ? 63.418 -7.317  15.673  1.00 0.00  ? 14  GLU A CD   6  
ATOM   8804  O  OE1  . GLU A 1 14 ? 64.609 -7.074  15.562  1.00 0.00  ? 14  GLU A OE1  6  
ATOM   8805  O  OE2  . GLU A 1 14 ? 62.632 -7.306  14.740  1.00 0.00  ? 14  GLU A OE2  6  
ATOM   8806  H  H    . GLU A 1 14 ? 63.215 -4.098  18.785  1.00 0.00  ? 14  GLU A H    6  
ATOM   8807  H  HA   . GLU A 1 14 ? 62.627 -5.157  16.231  1.00 0.00  ? 14  GLU A HA   6  
ATOM   8808  H  HB2  . GLU A 1 14 ? 63.913 -6.151  18.205  1.00 0.00  ? 14  GLU A HB2  6  
ATOM   8809  H  HB3  . GLU A 1 14 ? 62.347 -6.611  18.872  1.00 0.00  ? 14  GLU A HB3  6  
ATOM   8810  H  HG2  . GLU A 1 14 ? 63.490 -8.420  17.515  1.00 0.00  ? 14  GLU A HG2  6  
ATOM   8811  H  HG3  . GLU A 1 14 ? 61.862 -8.016  16.977  1.00 0.00  ? 14  GLU A HG3  6  
ATOM   8812  N  N    . GLU A 1 15 ? 60.025 -5.001  18.250  1.00 0.00  ? 15  GLU A N    6  
ATOM   8813  C  CA   . GLU A 1 15 ? 58.530 -5.101  18.259  1.00 0.00  ? 15  GLU A CA   6  
ATOM   8814  C  C    . GLU A 1 15 ? 57.954 -4.254  17.114  1.00 0.00  ? 15  GLU A C    6  
ATOM   8815  O  O    . GLU A 1 15 ? 57.107 -4.706  16.365  1.00 0.00  ? 15  GLU A O    6  
ATOM   8816  C  CB   . GLU A 1 15 ? 58.091 -4.550  19.621  1.00 0.00  ? 15  GLU A CB   6  
ATOM   8817  C  CG   . GLU A 1 15 ? 56.734 -5.152  20.006  1.00 0.00  ? 15  GLU A CG   6  
ATOM   8818  C  CD   . GLU A 1 15 ? 56.370 -4.733  21.433  1.00 0.00  ? 15  GLU A CD   6  
ATOM   8819  O  OE1  . GLU A 1 15 ? 56.762 -5.432  22.352  1.00 0.00  ? 15  GLU A OE1  6  
ATOM   8820  O  OE2  . GLU A 1 15 ? 55.704 -3.721  21.581  1.00 0.00  ? 15  GLU A OE2  6  
ATOM   8821  H  H    . GLU A 1 15 ? 60.495 -4.641  19.031  1.00 0.00  ? 15  GLU A H    6  
ATOM   8822  H  HA   . GLU A 1 15 ? 58.220 -6.129  18.158  1.00 0.00  ? 15  GLU A HA   6  
ATOM   8823  H  HB2  . GLU A 1 15 ? 58.826 -4.811  20.369  1.00 0.00  ? 15  GLU A HB2  6  
ATOM   8824  H  HB3  . GLU A 1 15 ? 58.002 -3.475  19.563  1.00 0.00  ? 15  GLU A HB3  6  
ATOM   8825  H  HG2  . GLU A 1 15 ? 55.976 -4.797  19.323  1.00 0.00  ? 15  GLU A HG2  6  
ATOM   8826  H  HG3  . GLU A 1 15 ? 56.790 -6.228  19.954  1.00 0.00  ? 15  GLU A HG3  6  
ATOM   8827  N  N    . GLN A 1 16 ? 58.430 -3.037  16.960  1.00 0.00  ? 16  GLN A N    6  
ATOM   8828  C  CA   . GLN A 1 16 ? 57.933 -2.165  15.848  1.00 0.00  ? 16  GLN A CA   6  
ATOM   8829  C  C    . GLN A 1 16 ? 58.325 -2.769  14.499  1.00 0.00  ? 16  GLN A C    6  
ATOM   8830  O  O    . GLN A 1 16 ? 57.568 -2.735  13.545  1.00 0.00  ? 16  GLN A O    6  
ATOM   8831  C  CB   . GLN A 1 16 ? 58.613 -0.808  16.052  1.00 0.00  ? 16  GLN A CB   6  
ATOM   8832  C  CG   . GLN A 1 16 ? 57.815 0.024   17.062  1.00 0.00  ? 16  GLN A CG   6  
ATOM   8833  C  CD   . GLN A 1 16 ? 58.770 0.685   18.058  1.00 0.00  ? 16  GLN A CD   6  
ATOM   8834  O  OE1  . GLN A 1 16 ? 59.685 1.384   17.670  1.00 0.00  ? 16  GLN A OE1  6  
ATOM   8835  N  NE2  . GLN A 1 16 ? 58.596 0.496   19.335  1.00 0.00  ? 16  GLN A NE2  6  
ATOM   8836  H  H    . GLN A 1 16 ? 59.127 -2.706  17.567  1.00 0.00  ? 16  GLN A H    6  
ATOM   8837  H  HA   . GLN A 1 16 ? 56.873 -2.060  15.907  1.00 0.00  ? 16  GLN A HA   6  
ATOM   8838  H  HB2  . GLN A 1 16 ? 59.617 -0.962  16.423  1.00 0.00  ? 16  GLN A HB2  6  
ATOM   8839  H  HB3  . GLN A 1 16 ? 58.655 -0.282  15.110  1.00 0.00  ? 16  GLN A HB3  6  
ATOM   8840  H  HG2  . GLN A 1 16 ? 57.259 0.787   16.539  1.00 0.00  ? 16  GLN A HG2  6  
ATOM   8841  H  HG3  . GLN A 1 16 ? 57.130 -0.617  17.597  1.00 0.00  ? 16  GLN A HG3  6  
ATOM   8842  H  HE21 . GLN A 1 16 ? 57.858 -0.066  19.652  1.00 0.00  ? 16  GLN A HE21 6  
ATOM   8843  H  HE22 . GLN A 1 16 ? 59.205 0.914   19.977  1.00 0.00  ? 16  GLN A HE22 6  
ATOM   8844  N  N    . LYS A 1 17 ? 59.495 -3.339  14.428  1.00 0.00  ? 17  LYS A N    6  
ATOM   8845  C  CA   . LYS A 1 17 ? 59.953 -3.981  13.156  1.00 0.00  ? 17  LYS A CA   6  
ATOM   8846  C  C    . LYS A 1 17 ? 58.983 -5.110  12.784  1.00 0.00  ? 17  LYS A C    6  
ATOM   8847  O  O    . LYS A 1 17 ? 58.633 -5.282  11.632  1.00 0.00  ? 17  LYS A O    6  
ATOM   8848  C  CB   . LYS A 1 17 ? 61.347 -4.546  13.457  1.00 0.00  ? 17  LYS A CB   6  
ATOM   8849  C  CG   . LYS A 1 17 ? 62.349 -3.400  13.639  1.00 0.00  ? 17  LYS A CG   6  
ATOM   8850  C  CD   . LYS A 1 17 ? 63.606 -3.677  12.810  1.00 0.00  ? 17  LYS A CD   6  
ATOM   8851  C  CE   . LYS A 1 17 ? 64.394 -4.834  13.434  1.00 0.00  ? 17  LYS A CE   6  
ATOM   8852  N  NZ   . LYS A 1 17 ? 65.558 -5.046  12.527  1.00 0.00  ? 17  LYS A NZ   6  
ATOM   8853  H  H    . LYS A 1 17 ? 60.064 -3.358  15.220  1.00 0.00  ? 17  LYS A H    6  
ATOM   8854  H  HA   . LYS A 1 17 ? 60.008 -3.252  12.361  1.00 0.00  ? 17  LYS A HA   6  
ATOM   8855  H  HB2  . LYS A 1 17 ? 61.307 -5.137  14.360  1.00 0.00  ? 17  LYS A HB2  6  
ATOM   8856  H  HB3  . LYS A 1 17 ? 61.665 -5.171  12.636  1.00 0.00  ? 17  LYS A HB3  6  
ATOM   8857  H  HG2  . LYS A 1 17 ? 61.899 -2.473  13.312  1.00 0.00  ? 17  LYS A HG2  6  
ATOM   8858  H  HG3  . LYS A 1 17 ? 62.619 -3.320  14.681  1.00 0.00  ? 17  LYS A HG3  6  
ATOM   8859  H  HD2  . LYS A 1 17 ? 63.320 -3.938  11.803  1.00 0.00  ? 17  LYS A HD2  6  
ATOM   8860  H  HD3  . LYS A 1 17 ? 64.225 -2.793  12.791  1.00 0.00  ? 17  LYS A HD3  6  
ATOM   8861  H  HE2  . LYS A 1 17 ? 64.731 -4.567  14.427  1.00 0.00  ? 17  LYS A HE2  6  
ATOM   8862  H  HE3  . LYS A 1 17 ? 63.788 -5.726  13.469  1.00 0.00  ? 17  LYS A HE3  6  
ATOM   8863  H  HZ1  . LYS A 1 17 ? 65.220 -5.266  11.568  1.00 0.00  ? 17  LYS A HZ1  6  
ATOM   8864  H  HZ2  . LYS A 1 17 ? 66.132 -5.838  12.882  1.00 0.00  ? 17  LYS A HZ2  6  
ATOM   8865  H  HZ3  . LYS A 1 17 ? 66.139 -4.183  12.495  1.00 0.00  ? 17  LYS A HZ3  6  
ATOM   8866  N  N    . ASN A 1 18 ? 58.533 -5.868  13.762  1.00 0.00  ? 18  ASN A N    6  
ATOM   8867  C  CA   . ASN A 1 18 ? 57.568 -6.977  13.481  1.00 0.00  ? 18  ASN A CA   6  
ATOM   8868  C  C    . ASN A 1 18 ? 56.242 -6.398  12.966  1.00 0.00  ? 18  ASN A C    6  
ATOM   8869  O  O    . ASN A 1 18 ? 55.637 -6.939  12.061  1.00 0.00  ? 18  ASN A O    6  
ATOM   8870  C  CB   . ASN A 1 18 ? 57.365 -7.691  14.821  1.00 0.00  ? 18  ASN A CB   6  
ATOM   8871  C  CG   . ASN A 1 18 ? 56.636 -9.016  14.587  1.00 0.00  ? 18  ASN A CG   6  
ATOM   8872  O  OD1  . ASN A 1 18 ? 57.254 -10.021 14.305  1.00 0.00  ? 18  ASN A OD1  6  
ATOM   8873  N  ND2  . ASN A 1 18 ? 55.338 -9.061  14.693  1.00 0.00  ? 18  ASN A ND2  6  
ATOM   8874  H  H    . ASN A 1 18 ? 58.824 -5.695  14.683  1.00 0.00  ? 18  ASN A H    6  
ATOM   8875  H  HA   . ASN A 1 18 ? 57.984 -7.661  12.757  1.00 0.00  ? 18  ASN A HA   6  
ATOM   8876  H  HB2  . ASN A 1 18 ? 58.326 -7.884  15.274  1.00 0.00  ? 18  ASN A HB2  6  
ATOM   8877  H  HB3  . ASN A 1 18 ? 56.775 -7.068  15.477  1.00 0.00  ? 18  ASN A HB3  6  
ATOM   8878  H  HD21 . ASN A 1 18 ? 54.836 -8.251  14.922  1.00 0.00  ? 18  ASN A HD21 6  
ATOM   8879  H  HD22 . ASN A 1 18 ? 54.865 -9.904  14.539  1.00 0.00  ? 18  ASN A HD22 6  
ATOM   8880  N  N    . GLU A 1 19 ? 55.799 -5.293  13.523  1.00 0.00  ? 19  GLU A N    6  
ATOM   8881  C  CA   . GLU A 1 19 ? 54.524 -4.666  13.046  1.00 0.00  ? 19  GLU A CA   6  
ATOM   8882  C  C    . GLU A 1 19 ? 54.641 -4.361  11.547  1.00 0.00  ? 19  GLU A C    6  
ATOM   8883  O  O    . GLU A 1 19 ? 53.730 -4.609  10.780  1.00 0.00  ? 19  GLU A O    6  
ATOM   8884  C  CB   . GLU A 1 19 ? 54.383 -3.371  13.853  1.00 0.00  ? 19  GLU A CB   6  
ATOM   8885  C  CG   . GLU A 1 19 ? 53.804 -3.684  15.236  1.00 0.00  ? 19  GLU A CG   6  
ATOM   8886  C  CD   . GLU A 1 19 ? 54.128 -2.541  16.203  1.00 0.00  ? 19  GLU A CD   6  
ATOM   8887  O  OE1  . GLU A 1 19 ? 53.595 -1.459  16.013  1.00 0.00  ? 19  GLU A OE1  6  
ATOM   8888  O  OE2  . GLU A 1 19 ? 54.903 -2.766  17.118  1.00 0.00  ? 19  GLU A OE2  6  
ATOM   8889  H  H    . GLU A 1 19 ? 56.311 -4.869  14.243  1.00 0.00  ? 19  GLU A H    6  
ATOM   8890  H  HA   . GLU A 1 19 ? 53.685 -5.319  13.234  1.00 0.00  ? 19  GLU A HA   6  
ATOM   8891  H  HB2  . GLU A 1 19 ? 55.353 -2.910  13.965  1.00 0.00  ? 19  GLU A HB2  6  
ATOM   8892  H  HB3  . GLU A 1 19 ? 53.721 -2.694  13.333  1.00 0.00  ? 19  GLU A HB3  6  
ATOM   8893  H  HG2  . GLU A 1 19 ? 52.732 -3.798  15.160  1.00 0.00  ? 19  GLU A HG2  6  
ATOM   8894  H  HG3  . GLU A 1 19 ? 54.237 -4.600  15.609  1.00 0.00  ? 19  GLU A HG3  6  
ATOM   8895  N  N    . PHE A 1 20 ? 55.774 -3.849  11.126  1.00 0.00  ? 20  PHE A N    6  
ATOM   8896  C  CA   . PHE A 1 20 ? 55.976 -3.555  9.675   1.00 0.00  ? 20  PHE A CA   6  
ATOM   8897  C  C    . PHE A 1 20 ? 56.224 -4.867  8.916   1.00 0.00  ? 20  PHE A C    6  
ATOM   8898  O  O    . PHE A 1 20 ? 55.874 -4.996  7.759   1.00 0.00  ? 20  PHE A O    6  
ATOM   8899  C  CB   . PHE A 1 20 ? 57.206 -2.643  9.607   1.00 0.00  ? 20  PHE A CB   6  
ATOM   8900  C  CG   . PHE A 1 20 ? 56.760 -1.200  9.569   1.00 0.00  ? 20  PHE A CG   6  
ATOM   8901  C  CD1  . PHE A 1 20 ? 55.957 -0.743  8.518   1.00 0.00  ? 20  PHE A CD1  6  
ATOM   8902  C  CD2  . PHE A 1 20 ? 57.146 -0.320  10.587  1.00 0.00  ? 20  PHE A CD2  6  
ATOM   8903  C  CE1  . PHE A 1 20 ? 55.540 0.592   8.483   1.00 0.00  ? 20  PHE A CE1  6  
ATOM   8904  C  CE2  . PHE A 1 20 ? 56.730 1.016   10.553  1.00 0.00  ? 20  PHE A CE2  6  
ATOM   8905  C  CZ   . PHE A 1 20 ? 55.926 1.472   9.500   1.00 0.00  ? 20  PHE A CZ   6  
ATOM   8906  H  H    . PHE A 1 20 ? 56.498 -3.679  11.765  1.00 0.00  ? 20  PHE A H    6  
ATOM   8907  H  HA   . PHE A 1 20 ? 55.114 -3.048  9.271   1.00 0.00  ? 20  PHE A HA   6  
ATOM   8908  H  HB2  . PHE A 1 20 ? 57.826 -2.807  10.477  1.00 0.00  ? 20  PHE A HB2  6  
ATOM   8909  H  HB3  . PHE A 1 20 ? 57.773 -2.866  8.715   1.00 0.00  ? 20  PHE A HB3  6  
ATOM   8910  H  HD1  . PHE A 1 20 ? 55.658 -1.423  7.732   1.00 0.00  ? 20  PHE A HD1  6  
ATOM   8911  H  HD2  . PHE A 1 20 ? 57.766 -0.673  11.400  1.00 0.00  ? 20  PHE A HD2  6  
ATOM   8912  H  HE1  . PHE A 1 20 ? 54.921 0.944   7.672   1.00 0.00  ? 20  PHE A HE1  6  
ATOM   8913  H  HE2  . PHE A 1 20 ? 57.027 1.695   11.339  1.00 0.00  ? 20  PHE A HE2  6  
ATOM   8914  H  HZ   . PHE A 1 20 ? 55.604 2.502   9.472   1.00 0.00  ? 20  PHE A HZ   6  
ATOM   8915  N  N    . LYS A 1 21 ? 56.811 -5.846  9.572   1.00 0.00  ? 21  LYS A N    6  
ATOM   8916  C  CA   . LYS A 1 21 ? 57.067 -7.163  8.905   1.00 0.00  ? 21  LYS A CA   6  
ATOM   8917  C  C    . LYS A 1 21 ? 55.739 -7.751  8.394   1.00 0.00  ? 21  LYS A C    6  
ATOM   8918  O  O    . LYS A 1 21 ? 55.701 -8.407  7.373   1.00 0.00  ? 21  LYS A O    6  
ATOM   8919  C  CB   . LYS A 1 21 ? 57.727 -8.045  9.991   1.00 0.00  ? 21  LYS A CB   6  
ATOM   8920  C  CG   . LYS A 1 21 ? 56.841 -9.245  10.364  1.00 0.00  ? 21  LYS A CG   6  
ATOM   8921  C  CD   . LYS A 1 21 ? 57.025 -10.364 9.333   1.00 0.00  ? 21  LYS A CD   6  
ATOM   8922  C  CE   . LYS A 1 21 ? 58.031 -11.391 9.862   1.00 0.00  ? 21  LYS A CE   6  
ATOM   8923  N  NZ   . LYS A 1 21 ? 58.494 -12.141 8.660   1.00 0.00  ? 21  LYS A NZ   6  
ATOM   8924  H  H    . LYS A 1 21 ? 57.073 -5.717  10.508  1.00 0.00  ? 21  LYS A H    6  
ATOM   8925  H  HA   . LYS A 1 21 ? 57.750 -7.031  8.080   1.00 0.00  ? 21  LYS A HA   6  
ATOM   8926  H  HB2  . LYS A 1 21 ? 58.673 -8.409  9.621   1.00 0.00  ? 21  LYS A HB2  6  
ATOM   8927  H  HB3  . LYS A 1 21 ? 57.901 -7.448  10.874  1.00 0.00  ? 21  LYS A HB3  6  
ATOM   8928  H  HG2  . LYS A 1 21 ? 57.125 -9.606  11.342  1.00 0.00  ? 21  LYS A HG2  6  
ATOM   8929  H  HG3  . LYS A 1 21 ? 55.806 -8.941  10.383  1.00 0.00  ? 21  LYS A HG3  6  
ATOM   8930  H  HD2  . LYS A 1 21 ? 56.076 -10.849 9.154   1.00 0.00  ? 21  LYS A HD2  6  
ATOM   8931  H  HD3  . LYS A 1 21 ? 57.395 -9.944  8.409   1.00 0.00  ? 21  LYS A HD3  6  
ATOM   8932  H  HE2  . LYS A 1 21 ? 58.863 -10.888 10.337  1.00 0.00  ? 21  LYS A HE2  6  
ATOM   8933  H  HE3  . LYS A 1 21 ? 57.551 -12.065 10.558  1.00 0.00  ? 21  LYS A HE3  6  
ATOM   8934  H  HZ1  . LYS A 1 21 ? 58.712 -11.472 7.892   1.00 0.00  ? 21  LYS A HZ1  6  
ATOM   8935  H  HZ2  . LYS A 1 21 ? 57.743 -12.792 8.344   1.00 0.00  ? 21  LYS A HZ2  6  
ATOM   8936  H  HZ3  . LYS A 1 21 ? 59.348 -12.683 8.894   1.00 0.00  ? 21  LYS A HZ3  6  
ATOM   8937  N  N    . ALA A 1 22 ? 54.649 -7.496  9.086   1.00 0.00  ? 22  ALA A N    6  
ATOM   8938  C  CA   . ALA A 1 22 ? 53.324 -8.017  8.625   1.00 0.00  ? 22  ALA A CA   6  
ATOM   8939  C  C    . ALA A 1 22 ? 53.033 -7.492  7.212   1.00 0.00  ? 22  ALA A C    6  
ATOM   8940  O  O    . ALA A 1 22 ? 52.770 -8.253  6.300   1.00 0.00  ? 22  ALA A O    6  
ATOM   8941  C  CB   . ALA A 1 22 ? 52.308 -7.466  9.632   1.00 0.00  ? 22  ALA A CB   6  
ATOM   8942  H  H    . ALA A 1 22 ? 54.703 -6.950  9.899   1.00 0.00  ? 22  ALA A H    6  
ATOM   8943  H  HA   . ALA A 1 22 ? 53.314 -9.095  8.638   1.00 0.00  ? 22  ALA A HA   6  
ATOM   8944  H  HB1  . ALA A 1 22 ? 52.573 -7.792  10.627  1.00 0.00  ? 22  ALA A HB1  6  
ATOM   8945  H  HB2  . ALA A 1 22 ? 51.323 -7.830  9.384   1.00 0.00  ? 22  ALA A HB2  6  
ATOM   8946  H  HB3  . ALA A 1 22 ? 52.313 -6.387  9.594   1.00 0.00  ? 22  ALA A HB3  6  
ATOM   8947  N  N    . ALA A 1 23 ? 53.111 -6.196  7.025   1.00 0.00  ? 23  ALA A N    6  
ATOM   8948  C  CA   . ALA A 1 23 ? 52.872 -5.608  5.670   1.00 0.00  ? 23  ALA A CA   6  
ATOM   8949  C  C    . ALA A 1 23 ? 54.019 -6.003  4.729   1.00 0.00  ? 23  ALA A C    6  
ATOM   8950  O  O    . ALA A 1 23 ? 53.816 -6.248  3.556   1.00 0.00  ? 23  ALA A O    6  
ATOM   8951  C  CB   . ALA A 1 23 ? 52.855 -4.093  5.896   1.00 0.00  ? 23  ALA A CB   6  
ATOM   8952  H  H    . ALA A 1 23 ? 53.348 -5.612  7.776   1.00 0.00  ? 23  ALA A H    6  
ATOM   8953  H  HA   . ALA A 1 23 ? 51.924 -5.937  5.273   1.00 0.00  ? 23  ALA A HA   6  
ATOM   8954  H  HB1  . ALA A 1 23 ? 51.878 -3.792  6.246   1.00 0.00  ? 23  ALA A HB1  6  
ATOM   8955  H  HB2  . ALA A 1 23 ? 53.076 -3.586  4.968   1.00 0.00  ? 23  ALA A HB2  6  
ATOM   8956  H  HB3  . ALA A 1 23 ? 53.598 -3.830  6.634   1.00 0.00  ? 23  ALA A HB3  6  
ATOM   8957  N  N    . PHE A 1 24 ? 55.221 -6.075  5.251   1.00 0.00  ? 24  PHE A N    6  
ATOM   8958  C  CA   . PHE A 1 24 ? 56.402 -6.464  4.417   1.00 0.00  ? 24  PHE A CA   6  
ATOM   8959  C  C    . PHE A 1 24 ? 56.219 -7.886  3.858   1.00 0.00  ? 24  PHE A C    6  
ATOM   8960  O  O    . PHE A 1 24 ? 56.357 -8.113  2.671   1.00 0.00  ? 24  PHE A O    6  
ATOM   8961  C  CB   . PHE A 1 24 ? 57.588 -6.408  5.387   1.00 0.00  ? 24  PHE A CB   6  
ATOM   8962  C  CG   . PHE A 1 24 ? 58.868 -6.737  4.659   1.00 0.00  ? 24  PHE A CG   6  
ATOM   8963  C  CD1  . PHE A 1 24 ? 59.592 -5.724  4.020   1.00 0.00  ? 24  PHE A CD1  6  
ATOM   8964  C  CD2  . PHE A 1 24 ? 59.331 -8.057  4.627   1.00 0.00  ? 24  PHE A CD2  6  
ATOM   8965  C  CE1  . PHE A 1 24 ? 60.780 -6.033  3.348   1.00 0.00  ? 24  PHE A CE1  6  
ATOM   8966  C  CE2  . PHE A 1 24 ? 60.519 -8.366  3.956   1.00 0.00  ? 24  PHE A CE2  6  
ATOM   8967  C  CZ   . PHE A 1 24 ? 61.244 -7.354  3.316   1.00 0.00  ? 24  PHE A CZ   6  
ATOM   8968  H  H    . PHE A 1 24 ? 55.347 -5.877  6.202   1.00 0.00  ? 24  PHE A H    6  
ATOM   8969  H  HA   . PHE A 1 24 ? 56.547 -5.757  3.615   1.00 0.00  ? 24  PHE A HA   6  
ATOM   8970  H  HB2  . PHE A 1 24 ? 57.660 -5.416  5.809   1.00 0.00  ? 24  PHE A HB2  6  
ATOM   8971  H  HB3  . PHE A 1 24 ? 57.435 -7.124  6.181   1.00 0.00  ? 24  PHE A HB3  6  
ATOM   8972  H  HD1  . PHE A 1 24 ? 59.233 -4.706  4.046   1.00 0.00  ? 24  PHE A HD1  6  
ATOM   8973  H  HD2  . PHE A 1 24 ? 58.770 -8.838  5.120   1.00 0.00  ? 24  PHE A HD2  6  
ATOM   8974  H  HE1  . PHE A 1 24 ? 61.340 -5.251  2.854   1.00 0.00  ? 24  PHE A HE1  6  
ATOM   8975  H  HE2  . PHE A 1 24 ? 60.875 -9.387  3.932   1.00 0.00  ? 24  PHE A HE2  6  
ATOM   8976  H  HZ   . PHE A 1 24 ? 62.162 -7.592  2.797   1.00 0.00  ? 24  PHE A HZ   6  
ATOM   8977  N  N    . ASP A 1 25 ? 55.905 -8.836  4.707   1.00 0.00  ? 25  ASP A N    6  
ATOM   8978  C  CA   . ASP A 1 25 ? 55.706 -10.245 4.238   1.00 0.00  ? 25  ASP A CA   6  
ATOM   8979  C  C    . ASP A 1 25 ? 54.530 -10.316 3.253   1.00 0.00  ? 25  ASP A C    6  
ATOM   8980  O  O    . ASP A 1 25 ? 54.624 -10.938 2.212   1.00 0.00  ? 25  ASP A O    6  
ATOM   8981  C  CB   . ASP A 1 25 ? 55.407 -11.051 5.510   1.00 0.00  ? 25  ASP A CB   6  
ATOM   8982  C  CG   . ASP A 1 25 ? 56.711 -11.596 6.100   1.00 0.00  ? 25  ASP A CG   6  
ATOM   8983  O  OD1  . ASP A 1 25 ? 57.645 -10.823 6.251   1.00 0.00  ? 25  ASP A OD1  6  
ATOM   8984  O  OD2  . ASP A 1 25 ? 56.754 -12.778 6.399   1.00 0.00  ? 25  ASP A OD2  6  
ATOM   8985  H  H    . ASP A 1 25 ? 55.798 -8.621  5.659   1.00 0.00  ? 25  ASP A H    6  
ATOM   8986  H  HA   . ASP A 1 25 ? 56.605 -10.615 3.771   1.00 0.00  ? 25  ASP A HA   6  
ATOM   8987  H  HB2  . ASP A 1 25 ? 54.925 -10.413 6.236   1.00 0.00  ? 25  ASP A HB2  6  
ATOM   8988  H  HB3  . ASP A 1 25 ? 54.753 -11.875 5.267   1.00 0.00  ? 25  ASP A HB3  6  
ATOM   8989  N  N    . ILE A 1 26 ? 53.432 -9.670  3.563   1.00 0.00  ? 26  ILE A N    6  
ATOM   8990  C  CA   . ILE A 1 26 ? 52.261 -9.686  2.629   1.00 0.00  ? 26  ILE A CA   6  
ATOM   8991  C  C    . ILE A 1 26 ? 52.627 -8.952  1.326   1.00 0.00  ? 26  ILE A C    6  
ATOM   8992  O  O    . ILE A 1 26 ? 52.125 -9.272  0.264   1.00 0.00  ? 26  ILE A O    6  
ATOM   8993  C  CB   . ILE A 1 26 ? 51.132 -8.971  3.385   1.00 0.00  ? 26  ILE A CB   6  
ATOM   8994  C  CG1  . ILE A 1 26 ? 50.525 -9.940  4.408   1.00 0.00  ? 26  ILE A CG1  6  
ATOM   8995  C  CG2  . ILE A 1 26 ? 50.042 -8.525  2.404   1.00 0.00  ? 26  ILE A CG2  6  
ATOM   8996  C  CD1  . ILE A 1 26 ? 49.815 -9.152  5.512   1.00 0.00  ? 26  ILE A CD1  6  
ATOM   8997  H  H    . ILE A 1 26 ? 53.382 -9.164  4.402   1.00 0.00  ? 26  ILE A H    6  
ATOM   8998  H  HA   . ILE A 1 26 ? 51.972 -10.704 2.412   1.00 0.00  ? 26  ILE A HA   6  
ATOM   8999  H  HB   . ILE A 1 26 ? 51.531 -8.107  3.897   1.00 0.00  ? 26  ILE A HB   6  
ATOM   9000  H  HG12 . ILE A 1 26 ? 49.815 -10.586 3.912   1.00 0.00  ? 26  ILE A HG12 6  
ATOM   9001  H  HG13 . ILE A 1 26 ? 51.311 -10.539 4.845   1.00 0.00  ? 26  ILE A HG13 6  
ATOM   9002  H  HG21 . ILE A 1 26 ? 50.230 -7.509  2.096   1.00 0.00  ? 26  ILE A HG21 6  
ATOM   9003  H  HG22 . ILE A 1 26 ? 49.077 -8.581  2.887   1.00 0.00  ? 26  ILE A HG22 6  
ATOM   9004  H  HG23 . ILE A 1 26 ? 50.048 -9.170  1.538   1.00 0.00  ? 26  ILE A HG23 6  
ATOM   9005  H  HD11 . ILE A 1 26 ? 50.546 -8.781  6.215   1.00 0.00  ? 26  ILE A HD11 6  
ATOM   9006  H  HD12 . ILE A 1 26 ? 49.119 -9.799  6.026   1.00 0.00  ? 26  ILE A HD12 6  
ATOM   9007  H  HD13 . ILE A 1 26 ? 49.280 -8.322  5.077   1.00 0.00  ? 26  ILE A HD13 6  
ATOM   9008  N  N    . PHE A 1 27 ? 53.512 -7.984  1.400   1.00 0.00  ? 27  PHE A N    6  
ATOM   9009  C  CA   . PHE A 1 27 ? 53.933 -7.240  0.170   1.00 0.00  ? 27  PHE A CA   6  
ATOM   9010  C  C    . PHE A 1 27 ? 54.603 -8.198  -0.823  1.00 0.00  ? 27  PHE A C    6  
ATOM   9011  O  O    . PHE A 1 27 ? 54.357 -8.143  -2.011  1.00 0.00  ? 27  PHE A O    6  
ATOM   9012  C  CB   . PHE A 1 27 ? 54.946 -6.193  0.650   1.00 0.00  ? 27  PHE A CB   6  
ATOM   9013  C  CG   . PHE A 1 27 ? 54.416 -4.803  0.386   1.00 0.00  ? 27  PHE A CG   6  
ATOM   9014  C  CD1  . PHE A 1 27 ? 53.983 -4.449  -0.898  1.00 0.00  ? 27  PHE A CD1  6  
ATOM   9015  C  CD2  . PHE A 1 27 ? 54.363 -3.869  1.426   1.00 0.00  ? 27  PHE A CD2  6  
ATOM   9016  C  CE1  . PHE A 1 27 ? 53.497 -3.160  -1.140  1.00 0.00  ? 27  PHE A CE1  6  
ATOM   9017  C  CE2  . PHE A 1 27 ? 53.876 -2.580  1.183   1.00 0.00  ? 27  PHE A CE2  6  
ATOM   9018  C  CZ   . PHE A 1 27 ? 53.443 -2.226  -0.100  1.00 0.00  ? 27  PHE A CZ   6  
ATOM   9019  H  H    . PHE A 1 27 ? 53.909 -7.755  2.267   1.00 0.00  ? 27  PHE A H    6  
ATOM   9020  H  HA   . PHE A 1 27 ? 53.085 -6.754  -0.288  1.00 0.00  ? 27  PHE A HA   6  
ATOM   9021  H  HB2  . PHE A 1 27 ? 55.119 -6.316  1.708   1.00 0.00  ? 27  PHE A HB2  6  
ATOM   9022  H  HB3  . PHE A 1 27 ? 55.877 -6.326  0.117   1.00 0.00  ? 27  PHE A HB3  6  
ATOM   9023  H  HD1  . PHE A 1 27 ? 54.026 -5.170  -1.701  1.00 0.00  ? 27  PHE A HD1  6  
ATOM   9024  H  HD2  . PHE A 1 27 ? 54.697 -4.142  2.414   1.00 0.00  ? 27  PHE A HD2  6  
ATOM   9025  H  HE1  . PHE A 1 27 ? 53.164 -2.886  -2.131  1.00 0.00  ? 27  PHE A HE1  6  
ATOM   9026  H  HE2  . PHE A 1 27 ? 53.835 -1.858  1.984   1.00 0.00  ? 27  PHE A HE2  6  
ATOM   9027  H  HZ   . PHE A 1 27 ? 53.069 -1.232  -0.287  1.00 0.00  ? 27  PHE A HZ   6  
ATOM   9028  N  N    . VAL A 1 28 ? 55.449 -9.079  -0.342  1.00 0.00  ? 28  VAL A N    6  
ATOM   9029  C  CA   . VAL A 1 28 ? 56.139 -10.041 -1.263  1.00 0.00  ? 28  VAL A CA   6  
ATOM   9030  C  C    . VAL A 1 28 ? 55.298 -11.318 -1.465  1.00 0.00  ? 28  VAL A C    6  
ATOM   9031  O  O    . VAL A 1 28 ? 55.829 -12.406 -1.582  1.00 0.00  ? 28  VAL A O    6  
ATOM   9032  C  CB   . VAL A 1 28 ? 57.488 -10.371 -0.595  1.00 0.00  ? 28  VAL A CB   6  
ATOM   9033  C  CG1  . VAL A 1 28 ? 58.335 -9.100  -0.484  1.00 0.00  ? 28  VAL A CG1  6  
ATOM   9034  C  CG2  . VAL A 1 28 ? 57.263 -10.951 0.807   1.00 0.00  ? 28  VAL A CG2  6  
ATOM   9035  H  H    . VAL A 1 28 ? 55.632 -9.105  0.621   1.00 0.00  ? 28  VAL A H    6  
ATOM   9036  H  HA   . VAL A 1 28 ? 56.316 -9.569  -2.216  1.00 0.00  ? 28  VAL A HA   6  
ATOM   9037  H  HB   . VAL A 1 28 ? 58.015 -11.095 -1.202  1.00 0.00  ? 28  VAL A HB   6  
ATOM   9038  H  HG11 . VAL A 1 28 ? 59.290 -9.343  -0.042  1.00 0.00  ? 28  VAL A HG11 6  
ATOM   9039  H  HG12 . VAL A 1 28 ? 57.824 -8.380  0.137   1.00 0.00  ? 28  VAL A HG12 6  
ATOM   9040  H  HG13 . VAL A 1 28 ? 58.490 -8.682  -1.468  1.00 0.00  ? 28  VAL A HG13 6  
ATOM   9041  H  HG21 . VAL A 1 28 ? 58.136 -11.511 1.109   1.00 0.00  ? 28  VAL A HG21 6  
ATOM   9042  H  HG22 . VAL A 1 28 ? 56.404 -11.605 0.795   1.00 0.00  ? 28  VAL A HG22 6  
ATOM   9043  H  HG23 . VAL A 1 28 ? 57.092 -10.147 1.507   1.00 0.00  ? 28  VAL A HG23 6  
ATOM   9044  N  N    . LEU A 1 29 ? 53.991 -11.193 -1.530  1.00 0.00  ? 29  LEU A N    6  
ATOM   9045  C  CA   . LEU A 1 29 ? 53.131 -12.400 -1.749  1.00 0.00  ? 29  LEU A CA   6  
ATOM   9046  C  C    . LEU A 1 29 ? 53.244 -12.853 -3.208  1.00 0.00  ? 29  LEU A C    6  
ATOM   9047  O  O    . LEU A 1 29 ? 53.403 -14.025 -3.493  1.00 0.00  ? 29  LEU A O    6  
ATOM   9048  C  CB   . LEU A 1 29 ? 51.700 -11.952 -1.429  1.00 0.00  ? 29  LEU A CB   6  
ATOM   9049  C  CG   . LEU A 1 29 ? 51.308 -12.457 -0.038  1.00 0.00  ? 29  LEU A CG   6  
ATOM   9050  C  CD1  . LEU A 1 29 ? 50.102 -11.669 0.477   1.00 0.00  ? 29  LEU A CD1  6  
ATOM   9051  C  CD2  . LEU A 1 29 ? 50.947 -13.943 -0.115  1.00 0.00  ? 29  LEU A CD2  6  
ATOM   9052  H  H    . LEU A 1 29 ? 53.579 -10.308 -1.452  1.00 0.00  ? 29  LEU A H    6  
ATOM   9053  H  HA   . LEU A 1 29 ? 53.427 -13.197 -1.085  1.00 0.00  ? 29  LEU A HA   6  
ATOM   9054  H  HB2  . LEU A 1 29 ? 51.645 -10.873 -1.449  1.00 0.00  ? 29  LEU A HB2  6  
ATOM   9055  H  HB3  . LEU A 1 29 ? 51.021 -12.360 -2.162  1.00 0.00  ? 29  LEU A HB3  6  
ATOM   9056  H  HG   . LEU A 1 29 ? 52.140 -12.323 0.636   1.00 0.00  ? 29  LEU A HG   6  
ATOM   9057  H  HD11 . LEU A 1 29 ? 49.571 -11.233 -0.357  1.00 0.00  ? 29  LEU A HD11 6  
ATOM   9058  H  HD12 . LEU A 1 29 ? 50.442 -10.886 1.136   1.00 0.00  ? 29  LEU A HD12 6  
ATOM   9059  H  HD13 . LEU A 1 29 ? 49.442 -12.332 1.017   1.00 0.00  ? 29  LEU A HD13 6  
ATOM   9060  H  HD21 . LEU A 1 29 ? 50.215 -14.097 -0.895  1.00 0.00  ? 29  LEU A HD21 6  
ATOM   9061  H  HD22 . LEU A 1 29 ? 50.536 -14.261 0.832   1.00 0.00  ? 29  LEU A HD22 6  
ATOM   9062  H  HD23 . LEU A 1 29 ? 51.834 -14.518 -0.334  1.00 0.00  ? 29  LEU A HD23 6  
ATOM   9063  N  N    . GLY A 1 30 ? 53.181 -11.925 -4.132  1.00 0.00  ? 30  GLY A N    6  
ATOM   9064  C  CA   . GLY A 1 30 ? 53.304 -12.284 -5.577  1.00 0.00  ? 30  GLY A CA   6  
ATOM   9065  C  C    . GLY A 1 30 ? 54.636 -11.755 -6.121  1.00 0.00  ? 30  GLY A C    6  
ATOM   9066  O  O    . GLY A 1 30 ? 54.748 -11.424 -7.286  1.00 0.00  ? 30  GLY A O    6  
ATOM   9067  H  H    . GLY A 1 30 ? 53.066 -10.987 -3.872  1.00 0.00  ? 30  GLY A H    6  
ATOM   9068  H  HA2  . GLY A 1 30 ? 53.271 -13.361 -5.686  1.00 0.00  ? 30  GLY A HA2  6  
ATOM   9069  H  HA3  . GLY A 1 30 ? 52.489 -11.836 -6.131  1.00 0.00  ? 30  GLY A HA3  6  
ATOM   9070  N  N    . ALA A 1 31 ? 55.647 -11.671 -5.286  1.00 0.00  ? 31  ALA A N    6  
ATOM   9071  C  CA   . ALA A 1 31 ? 56.974 -11.160 -5.754  1.00 0.00  ? 31  ALA A CA   6  
ATOM   9072  C  C    . ALA A 1 31 ? 57.876 -12.322 -6.191  1.00 0.00  ? 31  ALA A C    6  
ATOM   9073  O  O    . ALA A 1 31 ? 58.472 -12.997 -5.372  1.00 0.00  ? 31  ALA A O    6  
ATOM   9074  C  CB   . ALA A 1 31 ? 57.578 -10.436 -4.545  1.00 0.00  ? 31  ALA A CB   6  
ATOM   9075  H  H    . ALA A 1 31 ? 55.532 -11.945 -4.350  1.00 0.00  ? 31  ALA A H    6  
ATOM   9076  H  HA   . ALA A 1 31 ? 56.842 -10.465 -6.568  1.00 0.00  ? 31  ALA A HA   6  
ATOM   9077  H  HB1  . ALA A 1 31 ? 58.102 -11.147 -3.923  1.00 0.00  ? 31  ALA A HB1  6  
ATOM   9078  H  HB2  . ALA A 1 31 ? 56.789 -9.971  -3.974  1.00 0.00  ? 31  ALA A HB2  6  
ATOM   9079  H  HB3  . ALA A 1 31 ? 58.270 -9.679  -4.887  1.00 0.00  ? 31  ALA A HB3  6  
ATOM   9080  N  N    . GLU A 1 32 ? 57.986 -12.553 -7.477  1.00 0.00  ? 32  GLU A N    6  
ATOM   9081  C  CA   . GLU A 1 32 ? 58.860 -13.668 -7.974  1.00 0.00  ? 32  GLU A CA   6  
ATOM   9082  C  C    . GLU A 1 32 ? 60.321 -13.448 -7.541  1.00 0.00  ? 32  GLU A C    6  
ATOM   9083  O  O    . GLU A 1 32 ? 61.084 -14.388 -7.419  1.00 0.00  ? 32  GLU A O    6  
ATOM   9084  C  CB   . GLU A 1 32 ? 58.734 -13.638 -9.505  1.00 0.00  ? 32  GLU A CB   6  
ATOM   9085  C  CG   . GLU A 1 32 ? 59.184 -12.274 -10.050 1.00 0.00  ? 32  GLU A CG   6  
ATOM   9086  C  CD   . GLU A 1 32 ? 60.388 -12.455 -10.978 1.00 0.00  ? 32  GLU A CD   6  
ATOM   9087  O  OE1  . GLU A 1 32 ? 61.415 -12.914 -10.508 1.00 0.00  ? 32  GLU A OE1  6  
ATOM   9088  O  OE2  . GLU A 1 32 ? 60.263 -12.122 -12.145 1.00 0.00  ? 32  GLU A OE2  6  
ATOM   9089  H  H    . GLU A 1 32 ? 57.499 -11.991 -8.115  1.00 0.00  ? 32  GLU A H    6  
ATOM   9090  H  HA   . GLU A 1 32 ? 58.501 -14.614 -7.598  1.00 0.00  ? 32  GLU A HA   6  
ATOM   9091  H  HB2  . GLU A 1 32 ? 59.353 -14.416 -9.927  1.00 0.00  ? 32  GLU A HB2  6  
ATOM   9092  H  HB3  . GLU A 1 32 ? 57.704 -13.811 -9.782  1.00 0.00  ? 32  GLU A HB3  6  
ATOM   9093  H  HG2  . GLU A 1 32 ? 58.372 -11.822 -10.601 1.00 0.00  ? 32  GLU A HG2  6  
ATOM   9094  H  HG3  . GLU A 1 32 ? 59.462 -11.630 -9.230  1.00 0.00  ? 32  GLU A HG3  6  
ATOM   9095  N  N    . ASP A 1 33 ? 60.709 -12.216 -7.300  1.00 0.00  ? 33  ASP A N    6  
ATOM   9096  C  CA   . ASP A 1 33 ? 62.114 -11.929 -6.864  1.00 0.00  ? 33  ASP A CA   6  
ATOM   9097  C  C    . ASP A 1 33 ? 62.352 -12.453 -5.437  1.00 0.00  ? 33  ASP A C    6  
ATOM   9098  O  O    . ASP A 1 33 ? 63.462 -12.795 -5.073  1.00 0.00  ? 33  ASP A O    6  
ATOM   9099  C  CB   . ASP A 1 33 ? 62.239 -10.398 -6.894  1.00 0.00  ? 33  ASP A CB   6  
ATOM   9100  C  CG   . ASP A 1 33 ? 61.897 -9.866  -8.288  1.00 0.00  ? 33  ASP A CG   6  
ATOM   9101  O  OD1  . ASP A 1 33 ? 62.776 -9.860  -9.133  1.00 0.00  ? 33  ASP A OD1  6  
ATOM   9102  O  OD2  . ASP A 1 33 ? 60.760 -9.467  -8.485  1.00 0.00  ? 33  ASP A OD2  6  
ATOM   9103  H  H    . ASP A 1 33 ? 60.073 -11.478 -7.400  1.00 0.00  ? 33  ASP A H    6  
ATOM   9104  H  HA   . ASP A 1 33 ? 62.820 -12.370 -7.552  1.00 0.00  ? 33  ASP A HA   6  
ATOM   9105  H  HB2  . ASP A 1 33 ? 61.560 -9.970  -6.171  1.00 0.00  ? 33  ASP A HB2  6  
ATOM   9106  H  HB3  . ASP A 1 33 ? 63.251 -10.117 -6.644  1.00 0.00  ? 33  ASP A HB3  6  
ATOM   9107  N  N    . GLY A 1 34 ? 61.320 -12.507 -4.624  1.00 0.00  ? 34  GLY A N    6  
ATOM   9108  C  CA   . GLY A 1 34 ? 61.483 -12.996 -3.219  1.00 0.00  ? 34  GLY A CA   6  
ATOM   9109  C  C    . GLY A 1 34 ? 61.315 -11.823 -2.246  1.00 0.00  ? 34  GLY A C    6  
ATOM   9110  O  O    . GLY A 1 34 ? 60.770 -11.973 -1.170  1.00 0.00  ? 34  GLY A O    6  
ATOM   9111  H  H    . GLY A 1 34 ? 60.437 -12.218 -4.938  1.00 0.00  ? 34  GLY A H    6  
ATOM   9112  H  HA2  . GLY A 1 34 ? 60.732 -13.748 -3.011  1.00 0.00  ? 34  GLY A HA2  6  
ATOM   9113  H  HA3  . GLY A 1 34 ? 62.469 -13.424 -3.095  1.00 0.00  ? 34  GLY A HA3  6  
ATOM   9114  N  N    . CYS A 1 35 ? 61.772 -10.654 -2.625  1.00 0.00  ? 35  CYS A N    6  
ATOM   9115  C  CA   . CYS A 1 35 ? 61.641 -9.453  -1.738  1.00 0.00  ? 35  CYS A CA   6  
ATOM   9116  C  C    . CYS A 1 35 ? 60.877 -8.341  -2.476  1.00 0.00  ? 35  CYS A C    6  
ATOM   9117  O  O    . CYS A 1 35 ? 60.358 -8.552  -3.558  1.00 0.00  ? 35  CYS A O    6  
ATOM   9118  C  CB   . CYS A 1 35 ? 63.081 -9.021  -1.438  1.00 0.00  ? 35  CYS A CB   6  
ATOM   9119  S  SG   . CYS A 1 35 ? 63.904 -8.523  -2.973  1.00 0.00  ? 35  CYS A SG   6  
ATOM   9120  H  H    . CYS A 1 35 ? 62.199 -10.562 -3.501  1.00 0.00  ? 35  CYS A H    6  
ATOM   9121  H  HA   . CYS A 1 35 ? 61.135 -9.715  -0.822  1.00 0.00  ? 35  CYS A HA   6  
ATOM   9122  H  HB2  . CYS A 1 35 ? 63.071 -8.188  -0.750  1.00 0.00  ? 35  CYS A HB2  6  
ATOM   9123  H  HB3  . CYS A 1 35 ? 63.619 -9.846  -0.994  1.00 0.00  ? 35  CYS A HB3  6  
ATOM   9124  H  HG   . CYS A 1 35 ? 64.352 -9.292  -3.332  1.00 0.00  ? 35  CYS A HG   6  
ATOM   9125  N  N    . ILE A 1 36 ? 60.801 -7.159  -1.910  1.00 0.00  ? 36  ILE A N    6  
ATOM   9126  C  CA   . ILE A 1 36 ? 60.067 -6.055  -2.606  1.00 0.00  ? 36  ILE A CA   6  
ATOM   9127  C  C    . ILE A 1 36 ? 60.965 -5.411  -3.673  1.00 0.00  ? 36  ILE A C    6  
ATOM   9128  O  O    . ILE A 1 36 ? 61.864 -4.645  -3.372  1.00 0.00  ? 36  ILE A O    6  
ATOM   9129  C  CB   . ILE A 1 36 ? 59.685 -5.042  -1.516  1.00 0.00  ? 36  ILE A CB   6  
ATOM   9130  C  CG1  . ILE A 1 36 ? 58.507 -5.591  -0.705  1.00 0.00  ? 36  ILE A CG1  6  
ATOM   9131  C  CG2  . ILE A 1 36 ? 59.261 -3.719  -2.169  1.00 0.00  ? 36  ILE A CG2  6  
ATOM   9132  C  CD1  . ILE A 1 36 ? 58.765 -5.390  0.790   1.00 0.00  ? 36  ILE A CD1  6  
ATOM   9133  H  H    . ILE A 1 36 ? 61.224 -6.999  -1.040  1.00 0.00  ? 36  ILE A H    6  
ATOM   9134  H  HA   . ILE A 1 36 ? 59.172 -6.445  -3.065  1.00 0.00  ? 36  ILE A HA   6  
ATOM   9135  H  HB   . ILE A 1 36 ? 60.531 -4.871  -0.865  1.00 0.00  ? 36  ILE A HB   6  
ATOM   9136  H  HG12 . ILE A 1 36 ? 57.605 -5.067  -0.987  1.00 0.00  ? 36  ILE A HG12 6  
ATOM   9137  H  HG13 . ILE A 1 36 ? 58.388 -6.644  -0.910  1.00 0.00  ? 36  ILE A HG13 6  
ATOM   9138  H  HG21 . ILE A 1 36 ? 58.653 -3.154  -1.477  1.00 0.00  ? 36  ILE A HG21 6  
ATOM   9139  H  HG22 . ILE A 1 36 ? 58.687 -3.926  -3.063  1.00 0.00  ? 36  ILE A HG22 6  
ATOM   9140  H  HG23 . ILE A 1 36 ? 60.138 -3.146  -2.429  1.00 0.00  ? 36  ILE A HG23 6  
ATOM   9141  H  HD11 . ILE A 1 36 ? 58.983 -6.343  1.248   1.00 0.00  ? 36  ILE A HD11 6  
ATOM   9142  H  HD12 . ILE A 1 36 ? 57.888 -4.961  1.251   1.00 0.00  ? 36  ILE A HD12 6  
ATOM   9143  H  HD13 . ILE A 1 36 ? 59.605 -4.724  0.925   1.00 0.00  ? 36  ILE A HD13 6  
ATOM   9144  N  N    . SER A 1 37 ? 60.718 -5.723  -4.918  1.00 0.00  ? 37  SER A N    6  
ATOM   9145  C  CA   . SER A 1 37 ? 61.534 -5.143  -6.027  1.00 0.00  ? 37  SER A CA   6  
ATOM   9146  C  C    . SER A 1 37 ? 60.705 -4.110  -6.805  1.00 0.00  ? 37  SER A C    6  
ATOM   9147  O  O    . SER A 1 37 ? 59.620 -3.740  -6.397  1.00 0.00  ? 37  SER A O    6  
ATOM   9148  C  CB   . SER A 1 37 ? 61.884 -6.335  -6.918  1.00 0.00  ? 37  SER A CB   6  
ATOM   9149  O  OG   . SER A 1 37 ? 63.146 -6.107  -7.530  1.00 0.00  ? 37  SER A OG   6  
ATOM   9150  H  H    . SER A 1 37 ? 59.987 -6.342  -5.127  1.00 0.00  ? 37  SER A H    6  
ATOM   9151  H  HA   . SER A 1 37 ? 62.436 -4.692  -5.641  1.00 0.00  ? 37  SER A HA   6  
ATOM   9152  H  HB2  . SER A 1 37 ? 61.935 -7.232  -6.321  1.00 0.00  ? 37  SER A HB2  6  
ATOM   9153  H  HB3  . SER A 1 37 ? 61.120 -6.454  -7.675  1.00 0.00  ? 37  SER A HB3  6  
ATOM   9154  H  HG   . SER A 1 37 ? 63.072 -6.335  -8.459  1.00 0.00  ? 37  SER A HG   6  
ATOM   9155  N  N    . THR A 1 38 ? 61.205 -3.645  -7.924  1.00 0.00  ? 38  THR A N    6  
ATOM   9156  C  CA   . THR A 1 38 ? 60.441 -2.637  -8.735  1.00 0.00  ? 38  THR A CA   6  
ATOM   9157  C  C    . THR A 1 38 ? 59.122 -3.242  -9.244  1.00 0.00  ? 38  THR A C    6  
ATOM   9158  O  O    . THR A 1 38 ? 58.106 -2.573  -9.299  1.00 0.00  ? 38  THR A O    6  
ATOM   9159  C  CB   . THR A 1 38 ? 61.353 -2.280  -9.918  1.00 0.00  ? 38  THR A CB   6  
ATOM   9160  O  OG1  . THR A 1 38 ? 61.821 -3.472  -10.539 1.00 0.00  ? 38  THR A OG1  6  
ATOM   9161  C  CG2  . THR A 1 38 ? 62.546 -1.460  -9.424  1.00 0.00  ? 38  THR A CG2  6  
ATOM   9162  H  H    . THR A 1 38 ? 62.080 -3.960  -8.235  1.00 0.00  ? 38  THR A H    6  
ATOM   9163  H  HA   . THR A 1 38 ? 60.243 -1.756  -8.147  1.00 0.00  ? 38  THR A HA   6  
ATOM   9164  H  HB   . THR A 1 38 ? 60.797 -1.697  -10.637 1.00 0.00  ? 38  THR A HB   6  
ATOM   9165  H  HG1  . THR A 1 38 ? 61.968 -3.284  -11.470 1.00 0.00  ? 38  THR A HG1  6  
ATOM   9166  H  HG21 . THR A 1 38 ? 62.849 -1.812  -8.449  1.00 0.00  ? 38  THR A HG21 6  
ATOM   9167  H  HG22 . THR A 1 38 ? 62.266 -0.420  -9.360  1.00 0.00  ? 38  THR A HG22 6  
ATOM   9168  H  HG23 . THR A 1 38 ? 63.369 -1.569  -10.116 1.00 0.00  ? 38  THR A HG23 6  
ATOM   9169  N  N    . LYS A 1 39 ? 59.137 -4.499  -9.617  1.00 0.00  ? 39  LYS A N    6  
ATOM   9170  C  CA   . LYS A 1 39 ? 57.893 -5.161  -10.130 1.00 0.00  ? 39  LYS A CA   6  
ATOM   9171  C  C    . LYS A 1 39 ? 56.806 -5.218  -9.044  1.00 0.00  ? 39  LYS A C    6  
ATOM   9172  O  O    . LYS A 1 39 ? 55.659 -4.898  -9.291  1.00 0.00  ? 39  LYS A O    6  
ATOM   9173  C  CB   . LYS A 1 39 ? 58.328 -6.580  -10.512 1.00 0.00  ? 39  LYS A CB   6  
ATOM   9174  C  CG   . LYS A 1 39 ? 58.836 -6.599  -11.956 1.00 0.00  ? 39  LYS A CG   6  
ATOM   9175  C  CD   . LYS A 1 39 ? 59.334 -8.006  -12.307 1.00 0.00  ? 39  LYS A CD   6  
ATOM   9176  C  CE   . LYS A 1 39 ? 60.828 -8.122  -11.983 1.00 0.00  ? 39  LYS A CE   6  
ATOM   9177  N  NZ   . LYS A 1 39 ? 60.989 -9.471  -11.369 1.00 0.00  ? 39  LYS A NZ   6  
ATOM   9178  H  H    . LYS A 1 39 ? 59.972 -5.010  -9.564  1.00 0.00  ? 39  LYS A H    6  
ATOM   9179  H  HA   . LYS A 1 39 ? 57.525 -4.644  -11.002 1.00 0.00  ? 39  LYS A HA   6  
ATOM   9180  H  HB2  . LYS A 1 39 ? 59.116 -6.905  -9.847  1.00 0.00  ? 39  LYS A HB2  6  
ATOM   9181  H  HB3  . LYS A 1 39 ? 57.485 -7.249  -10.422 1.00 0.00  ? 39  LYS A HB3  6  
ATOM   9182  H  HG2  . LYS A 1 39 ? 58.032 -6.323  -12.623 1.00 0.00  ? 39  LYS A HG2  6  
ATOM   9183  H  HG3  . LYS A 1 39 ? 59.648 -5.895  -12.061 1.00 0.00  ? 39  LYS A HG3  6  
ATOM   9184  H  HD2  . LYS A 1 39 ? 58.782 -8.737  -11.732 1.00 0.00  ? 39  LYS A HD2  6  
ATOM   9185  H  HD3  . LYS A 1 39 ? 59.182 -8.190  -13.360 1.00 0.00  ? 39  LYS A HD3  6  
ATOM   9186  H  HE2  . LYS A 1 39 ? 61.415 -8.045  -12.889 1.00 0.00  ? 39  LYS A HE2  6  
ATOM   9187  H  HE3  . LYS A 1 39 ? 61.121 -7.358  -11.279 1.00 0.00  ? 39  LYS A HE3  6  
ATOM   9188  H  HZ1  . LYS A 1 39 ? 60.717 -10.204 -12.056 1.00 0.00  ? 39  LYS A HZ1  6  
ATOM   9189  H  HZ2  . LYS A 1 39 ? 60.383 -9.545  -10.525 1.00 0.00  ? 39  LYS A HZ2  6  
ATOM   9190  H  HZ3  . LYS A 1 39 ? 61.982 -9.613  -11.090 1.00 0.00  ? 39  LYS A HZ3  6  
ATOM   9191  N  N    . GLU A 1 40 ? 57.157 -5.639  -7.850  1.00 0.00  ? 40  GLU A N    6  
ATOM   9192  C  CA   . GLU A 1 40 ? 56.143 -5.740  -6.747  1.00 0.00  ? 40  GLU A CA   6  
ATOM   9193  C  C    . GLU A 1 40 ? 55.513 -4.370  -6.431  1.00 0.00  ? 40  GLU A C    6  
ATOM   9194  O  O    . GLU A 1 40 ? 54.350 -4.286  -6.079  1.00 0.00  ? 40  GLU A O    6  
ATOM   9195  C  CB   . GLU A 1 40 ? 56.916 -6.304  -5.535  1.00 0.00  ? 40  GLU A CB   6  
ATOM   9196  C  CG   . GLU A 1 40 ? 57.459 -5.176  -4.647  1.00 0.00  ? 40  GLU A CG   6  
ATOM   9197  C  CD   . GLU A 1 40 ? 56.468 -4.881  -3.516  1.00 0.00  ? 40  GLU A CD   6  
ATOM   9198  O  OE1  . GLU A 1 40 ? 56.176 -5.792  -2.758  1.00 0.00  ? 40  GLU A OE1  6  
ATOM   9199  O  OE2  . GLU A 1 40 ? 56.026 -3.748  -3.422  1.00 0.00  ? 40  GLU A OE2  6  
ATOM   9200  H  H    . GLU A 1 40 ? 58.087 -5.901  -7.683  1.00 0.00  ? 40  GLU A H    6  
ATOM   9201  H  HA   . GLU A 1 40 ? 55.369 -6.437  -7.030  1.00 0.00  ? 40  GLU A HA   6  
ATOM   9202  H  HB2  . GLU A 1 40 ? 56.256 -6.924  -4.948  1.00 0.00  ? 40  GLU A HB2  6  
ATOM   9203  H  HB3  . GLU A 1 40 ? 57.743 -6.903  -5.887  1.00 0.00  ? 40  GLU A HB3  6  
ATOM   9204  H  HG2  . GLU A 1 40 ? 58.401 -5.481  -4.224  1.00 0.00  ? 40  GLU A HG2  6  
ATOM   9205  H  HG3  . GLU A 1 40 ? 57.607 -4.287  -5.235  1.00 0.00  ? 40  GLU A HG3  6  
ATOM   9206  N  N    . LEU A 1 41 ? 56.267 -3.303  -6.555  1.00 0.00  ? 41  LEU A N    6  
ATOM   9207  C  CA   . LEU A 1 41 ? 55.711 -1.948  -6.257  1.00 0.00  ? 41  LEU A CA   6  
ATOM   9208  C  C    . LEU A 1 41 ? 54.681 -1.554  -7.320  1.00 0.00  ? 41  LEU A C    6  
ATOM   9209  O  O    . LEU A 1 41 ? 53.505 -1.425  -7.036  1.00 0.00  ? 41  LEU A O    6  
ATOM   9210  C  CB   . LEU A 1 41 ? 56.924 -1.007  -6.296  1.00 0.00  ? 41  LEU A CB   6  
ATOM   9211  C  CG   . LEU A 1 41 ? 56.538 0.391   -5.791  1.00 0.00  ? 41  LEU A CG   6  
ATOM   9212  C  CD1  . LEU A 1 41 ? 55.623 1.087   -6.799  1.00 0.00  ? 41  LEU A CD1  6  
ATOM   9213  C  CD2  . LEU A 1 41 ? 55.813 0.280   -4.446  1.00 0.00  ? 41  LEU A CD2  6  
ATOM   9214  H  H    . LEU A 1 41 ? 57.200 -3.396  -6.841  1.00 0.00  ? 41  LEU A H    6  
ATOM   9215  H  HA   . LEU A 1 41 ? 55.266 -1.934  -5.274  1.00 0.00  ? 41  LEU A HA   6  
ATOM   9216  H  HB2  . LEU A 1 41 ? 57.705 -1.409  -5.666  1.00 0.00  ? 41  LEU A HB2  6  
ATOM   9217  H  HB3  . LEU A 1 41 ? 57.288 -0.933  -7.309  1.00 0.00  ? 41  LEU A HB3  6  
ATOM   9218  H  HG   . LEU A 1 41 ? 57.433 0.974   -5.672  1.00 0.00  ? 41  LEU A HG   6  
ATOM   9219  H  HD11 . LEU A 1 41 ? 55.621 2.152   -6.609  1.00 0.00  ? 41  LEU A HD11 6  
ATOM   9220  H  HD12 . LEU A 1 41 ? 54.619 0.704   -6.698  1.00 0.00  ? 41  LEU A HD12 6  
ATOM   9221  H  HD13 . LEU A 1 41 ? 55.979 0.901   -7.799  1.00 0.00  ? 41  LEU A HD13 6  
ATOM   9222  H  HD21 . LEU A 1 41 ? 55.817 1.243   -3.954  1.00 0.00  ? 41  LEU A HD21 6  
ATOM   9223  H  HD22 . LEU A 1 41 ? 56.316 -0.445  -3.823  1.00 0.00  ? 41  LEU A HD22 6  
ATOM   9224  H  HD23 . LEU A 1 41 ? 54.792 -0.034  -4.610  1.00 0.00  ? 41  LEU A HD23 6  
ATOM   9225  N  N    . GLY A 1 42 ? 55.127 -1.354  -8.539  1.00 0.00  ? 42  GLY A N    6  
ATOM   9226  C  CA   . GLY A 1 42 ? 54.201 -0.959  -9.651  1.00 0.00  ? 42  GLY A CA   6  
ATOM   9227  C  C    . GLY A 1 42 ? 52.925 -1.813  -9.621  1.00 0.00  ? 42  GLY A C    6  
ATOM   9228  O  O    . GLY A 1 42 ? 51.835 -1.306  -9.798  1.00 0.00  ? 42  GLY A O    6  
ATOM   9229  H  H    . GLY A 1 42 ? 56.086 -1.455  -8.720  1.00 0.00  ? 42  GLY A H    6  
ATOM   9230  H  HA2  . GLY A 1 42 ? 53.933 0.084   -9.538  1.00 0.00  ? 42  GLY A HA2  6  
ATOM   9231  H  HA3  . GLY A 1 42 ? 54.701 -1.103  -10.600 1.00 0.00  ? 42  GLY A HA3  6  
ATOM   9232  N  N    . LYS A 1 43 ? 53.054 -3.101  -9.394  1.00 0.00  ? 43  LYS A N    6  
ATOM   9233  C  CA   . LYS A 1 43 ? 51.844 -3.987  -9.344  1.00 0.00  ? 43  LYS A CA   6  
ATOM   9234  C  C    . LYS A 1 43 ? 50.855 -3.482  -8.280  1.00 0.00  ? 43  LYS A C    6  
ATOM   9235  O  O    . LYS A 1 43 ? 49.681 -3.312  -8.547  1.00 0.00  ? 43  LYS A O    6  
ATOM   9236  C  CB   . LYS A 1 43 ? 52.378 -5.376  -8.977  1.00 0.00  ? 43  LYS A CB   6  
ATOM   9237  C  CG   . LYS A 1 43 ? 52.478 -6.232  -10.242 1.00 0.00  ? 43  LYS A CG   6  
ATOM   9238  C  CD   . LYS A 1 43 ? 52.746 -7.690  -9.856  1.00 0.00  ? 43  LYS A CD   6  
ATOM   9239  C  CE   . LYS A 1 43 ? 52.024 -8.624  -10.834 1.00 0.00  ? 43  LYS A CE   6  
ATOM   9240  N  NZ   . LYS A 1 43 ? 50.649 -8.783  -10.278 1.00 0.00  ? 43  LYS A NZ   6  
ATOM   9241  H  H    . LYS A 1 43 ? 53.946 -3.484  -9.252  1.00 0.00  ? 43  LYS A H    6  
ATOM   9242  H  HA   . LYS A 1 43 ? 51.365 -4.022  -10.311 1.00 0.00  ? 43  LYS A HA   6  
ATOM   9243  H  HB2  . LYS A 1 43 ? 53.357 -5.279  -8.527  1.00 0.00  ? 43  LYS A HB2  6  
ATOM   9244  H  HB3  . LYS A 1 43 ? 51.705 -5.849  -8.277  1.00 0.00  ? 43  LYS A HB3  6  
ATOM   9245  H  HG2  . LYS A 1 43 ? 51.551 -6.167  -10.795 1.00 0.00  ? 43  LYS A HG2  6  
ATOM   9246  H  HG3  . LYS A 1 43 ? 53.289 -5.870  -10.857 1.00 0.00  ? 43  LYS A HG3  6  
ATOM   9247  H  HD2  . LYS A 1 43 ? 53.810 -7.882  -9.895  1.00 0.00  ? 43  LYS A HD2  6  
ATOM   9248  H  HD3  . LYS A 1 43 ? 52.385 -7.870  -8.855  1.00 0.00  ? 43  LYS A HD3  6  
ATOM   9249  H  HE2  . LYS A 1 43 ? 51.987 -8.178  -11.819 1.00 0.00  ? 43  LYS A HE2  6  
ATOM   9250  H  HE3  . LYS A 1 43 ? 52.521 -9.583  -10.873 1.00 0.00  ? 43  LYS A HE3  6  
ATOM   9251  H  HZ1  . LYS A 1 43 ? 50.120 -9.472  -10.850 1.00 0.00  ? 43  LYS A HZ1  6  
ATOM   9252  H  HZ2  . LYS A 1 43 ? 50.158 -7.864  -10.300 1.00 0.00  ? 43  LYS A HZ2  6  
ATOM   9253  H  HZ3  . LYS A 1 43 ? 50.705 -9.123  -9.297  1.00 0.00  ? 43  LYS A HZ3  6  
ATOM   9254  N  N    . VAL A 1 44 ? 51.326 -3.228  -7.082  1.00 0.00  ? 44  VAL A N    6  
ATOM   9255  C  CA   . VAL A 1 44 ? 50.419 -2.716  -6.002  1.00 0.00  ? 44  VAL A CA   6  
ATOM   9256  C  C    . VAL A 1 44 ? 49.937 -1.296  -6.343  1.00 0.00  ? 44  VAL A C    6  
ATOM   9257  O  O    . VAL A 1 44 ? 48.809 -0.930  -6.066  1.00 0.00  ? 44  VAL A O    6  
ATOM   9258  C  CB   . VAL A 1 44 ? 51.283 -2.706  -4.731  1.00 0.00  ? 44  VAL A CB   6  
ATOM   9259  C  CG1  . VAL A 1 44 ? 50.630 -1.823  -3.661  1.00 0.00  ? 44  VAL A CG1  6  
ATOM   9260  C  CG2  . VAL A 1 44 ? 51.416 -4.134  -4.193  1.00 0.00  ? 44  VAL A CG2  6  
ATOM   9261  H  H    . VAL A 1 44 ? 52.280 -3.363  -6.896  1.00 0.00  ? 44  VAL A H    6  
ATOM   9262  H  HA   . VAL A 1 44 ? 49.577 -3.378  -5.871  1.00 0.00  ? 44  VAL A HA   6  
ATOM   9263  H  HB   . VAL A 1 44 ? 52.263 -2.317  -4.968  1.00 0.00  ? 44  VAL A HB   6  
ATOM   9264  H  HG11 . VAL A 1 44 ? 50.902 -0.792  -3.832  1.00 0.00  ? 44  VAL A HG11 6  
ATOM   9265  H  HG12 . VAL A 1 44 ? 50.973 -2.128  -2.682  1.00 0.00  ? 44  VAL A HG12 6  
ATOM   9266  H  HG13 . VAL A 1 44 ? 49.555 -1.926  -3.714  1.00 0.00  ? 44  VAL A HG13 6  
ATOM   9267  H  HG21 . VAL A 1 44 ? 52.307 -4.589  -4.600  1.00 0.00  ? 44  VAL A HG21 6  
ATOM   9268  H  HG22 . VAL A 1 44 ? 50.552 -4.711  -4.485  1.00 0.00  ? 44  VAL A HG22 6  
ATOM   9269  H  HG23 . VAL A 1 44 ? 51.485 -4.108  -3.115  1.00 0.00  ? 44  VAL A HG23 6  
ATOM   9270  N  N    . MET A 1 45 ? 50.788 -0.498  -6.941  1.00 0.00  ? 45  MET A N    6  
ATOM   9271  C  CA   . MET A 1 45 ? 50.399 0.903   -7.306  1.00 0.00  ? 45  MET A CA   6  
ATOM   9272  C  C    . MET A 1 45 ? 49.251 0.913   -8.329  1.00 0.00  ? 45  MET A C    6  
ATOM   9273  O  O    . MET A 1 45 ? 48.427 1.804   -8.329  1.00 0.00  ? 45  MET A O    6  
ATOM   9274  C  CB   . MET A 1 45 ? 51.664 1.512   -7.909  1.00 0.00  ? 45  MET A CB   6  
ATOM   9275  C  CG   . MET A 1 45 ? 52.399 2.290   -6.824  1.00 0.00  ? 45  MET A CG   6  
ATOM   9276  S  SD   . MET A 1 45 ? 53.312 3.657   -7.569  1.00 0.00  ? 45  MET A SD   6  
ATOM   9277  C  CE   . MET A 1 45 ? 53.320 4.700   -6.098  1.00 0.00  ? 45  MET A CE   6  
ATOM   9278  H  H    . MET A 1 45 ? 51.691 -0.821  -7.150  1.00 0.00  ? 45  MET A H    6  
ATOM   9279  H  HA   . MET A 1 45 ? 50.119 1.459   -6.423  1.00 0.00  ? 45  MET A HA   6  
ATOM   9280  H  HB2  . MET A 1 45 ? 52.301 0.727   -8.287  1.00 0.00  ? 45  MET A HB2  6  
ATOM   9281  H  HB3  . MET A 1 45 ? 51.399 2.181   -8.713  1.00 0.00  ? 45  MET A HB3  6  
ATOM   9282  H  HG2  . MET A 1 45 ? 51.682 2.683   -6.117  1.00 0.00  ? 45  MET A HG2  6  
ATOM   9283  H  HG3  . MET A 1 45 ? 53.085 1.636   -6.311  1.00 0.00  ? 45  MET A HG3  6  
ATOM   9284  H  HE1  . MET A 1 45 ? 52.900 4.143   -5.272  1.00 0.00  ? 45  MET A HE1  6  
ATOM   9285  H  HE2  . MET A 1 45 ? 52.725 5.581   -6.274  1.00 0.00  ? 45  MET A HE2  6  
ATOM   9286  H  HE3  . MET A 1 45 ? 54.335 4.989   -5.867  1.00 0.00  ? 45  MET A HE3  6  
ATOM   9287  N  N    . ARG A 1 46 ? 49.192 -0.068  -9.199  1.00 0.00  ? 46  ARG A N    6  
ATOM   9288  C  CA   . ARG A 1 46 ? 48.097 -0.112  -10.227 1.00 0.00  ? 46  ARG A CA   6  
ATOM   9289  C  C    . ARG A 1 46 ? 46.718 0.130   -9.588  1.00 0.00  ? 46  ARG A C    6  
ATOM   9290  O  O    . ARG A 1 46 ? 45.898 0.846   -10.130 1.00 0.00  ? 46  ARG A O    6  
ATOM   9291  C  CB   . ARG A 1 46 ? 48.174 -1.517  -10.835 1.00 0.00  ? 46  ARG A CB   6  
ATOM   9292  C  CG   . ARG A 1 46 ? 48.461 -1.407  -12.335 1.00 0.00  ? 46  ARG A CG   6  
ATOM   9293  C  CD   . ARG A 1 46 ? 49.900 -0.925  -12.548 1.00 0.00  ? 46  ARG A CD   6  
ATOM   9294  N  NE   . ARG A 1 46 ? 50.179 -1.153  -13.997 1.00 0.00  ? 46  ARG A NE   6  
ATOM   9295  C  CZ   . ARG A 1 46 ? 49.570 -0.436  -14.902 1.00 0.00  ? 46  ARG A CZ   6  
ATOM   9296  N  NH1  . ARG A 1 46 ? 49.907 0.808   -15.080 1.00 0.00  ? 46  ARG A NH1  6  
ATOM   9297  N  NH2  . ARG A 1 46 ? 48.627 -0.966  -15.627 1.00 0.00  ? 46  ARG A NH2  6  
ATOM   9298  H  H    . ARG A 1 46 ? 49.872 -0.775  -9.181  1.00 0.00  ? 46  ARG A H    6  
ATOM   9299  H  HA   . ARG A 1 46 ? 48.281 0.624   -10.993 1.00 0.00  ? 46  ARG A HA   6  
ATOM   9300  H  HB2  . ARG A 1 46 ? 48.966 -2.075  -10.357 1.00 0.00  ? 46  ARG A HB2  6  
ATOM   9301  H  HB3  . ARG A 1 46 ? 47.233 -2.026  -10.687 1.00 0.00  ? 46  ARG A HB3  6  
ATOM   9302  H  HG2  . ARG A 1 46 ? 48.331 -2.375  -12.797 1.00 0.00  ? 46  ARG A HG2  6  
ATOM   9303  H  HG3  . ARG A 1 46 ? 47.777 -0.700  -12.781 1.00 0.00  ? 46  ARG A HG3  6  
ATOM   9304  H  HD2  . ARG A 1 46 ? 49.982 0.127   -12.308 1.00 0.00  ? 46  ARG A HD2  6  
ATOM   9305  H  HD3  . ARG A 1 46 ? 50.585 -1.503  -11.944 1.00 0.00  ? 46  ARG A HD3  6  
ATOM   9306  H  HE   . ARG A 1 46 ? 50.823 -1.839  -14.270 1.00 0.00  ? 46  ARG A HE   6  
ATOM   9307  H  HH11 . ARG A 1 46 ? 50.632 1.215   -14.524 1.00 0.00  ? 46  ARG A HH11 6  
ATOM   9308  H  HH12 . ARG A 1 46 ? 49.440 1.360   -15.770 1.00 0.00  ? 46  ARG A HH12 6  
ATOM   9309  H  HH21 . ARG A 1 46 ? 48.368 -1.922  -15.490 1.00 0.00  ? 46  ARG A HH21 6  
ATOM   9310  H  HH22 . ARG A 1 46 ? 48.161 -0.418  -16.320 1.00 0.00  ? 46  ARG A HH22 6  
ATOM   9311  N  N    . MET A 1 47 ? 46.460 -0.449  -8.439  1.00 0.00  ? 47  MET A N    6  
ATOM   9312  C  CA   . MET A 1 47 ? 45.136 -0.234  -7.768  1.00 0.00  ? 47  MET A CA   6  
ATOM   9313  C  C    . MET A 1 47 ? 45.206 0.978   -6.817  1.00 0.00  ? 47  MET A C    6  
ATOM   9314  O  O    . MET A 1 47 ? 44.214 1.638   -6.572  1.00 0.00  ? 47  MET A O    6  
ATOM   9315  C  CB   . MET A 1 47 ? 44.848 -1.536  -7.004  1.00 0.00  ? 47  MET A CB   6  
ATOM   9316  C  CG   . MET A 1 47 ? 45.647 -1.584  -5.696  1.00 0.00  ? 47  MET A CG   6  
ATOM   9317  S  SD   . MET A 1 47 ? 45.302 -3.138  -4.836  1.00 0.00  ? 47  MET A SD   6  
ATOM   9318  C  CE   . MET A 1 47 ? 46.703 -3.077  -3.693  1.00 0.00  ? 47  MET A CE   6  
ATOM   9319  H  H    . MET A 1 47 ? 47.137 -1.015  -8.013  1.00 0.00  ? 47  MET A H    6  
ATOM   9320  H  HA   . MET A 1 47 ? 44.369 -0.072  -8.511  1.00 0.00  ? 47  MET A HA   6  
ATOM   9321  H  HB2  . MET A 1 47 ? 43.792 -1.590  -6.779  1.00 0.00  ? 47  MET A HB2  6  
ATOM   9322  H  HB3  . MET A 1 47 ? 45.124 -2.379  -7.620  1.00 0.00  ? 47  MET A HB3  6  
ATOM   9323  H  HG2  . MET A 1 47 ? 46.701 -1.521  -5.916  1.00 0.00  ? 47  MET A HG2  6  
ATOM   9324  H  HG3  . MET A 1 47 ? 45.360 -0.754  -5.066  1.00 0.00  ? 47  MET A HG3  6  
ATOM   9325  H  HE1  . MET A 1 47 ? 46.394 -3.450  -2.727  1.00 0.00  ? 47  MET A HE1  6  
ATOM   9326  H  HE2  . MET A 1 47 ? 47.042 -2.058  -3.591  1.00 0.00  ? 47  MET A HE2  6  
ATOM   9327  H  HE3  . MET A 1 47 ? 47.509 -3.685  -4.080  1.00 0.00  ? 47  MET A HE3  6  
ATOM   9328  N  N    . LEU A 1 48 ? 46.372 1.276   -6.292  1.00 0.00  ? 48  LEU A N    6  
ATOM   9329  C  CA   . LEU A 1 48 ? 46.521 2.442   -5.373  1.00 0.00  ? 48  LEU A CA   6  
ATOM   9330  C  C    . LEU A 1 48 ? 47.686 3.321   -5.855  1.00 0.00  ? 48  LEU A C    6  
ATOM   9331  O  O    . LEU A 1 48 ? 48.820 3.148   -5.445  1.00 0.00  ? 48  LEU A O    6  
ATOM   9332  C  CB   . LEU A 1 48 ? 46.825 1.821   -4.003  1.00 0.00  ? 48  LEU A CB   6  
ATOM   9333  C  CG   . LEU A 1 48 ? 46.971 2.930   -2.962  1.00 0.00  ? 48  LEU A CG   6  
ATOM   9334  C  CD1  . LEU A 1 48 ? 45.586 3.400   -2.515  1.00 0.00  ? 48  LEU A CD1  6  
ATOM   9335  C  CD2  . LEU A 1 48 ? 47.742 2.399   -1.751  1.00 0.00  ? 48  LEU A CD2  6  
ATOM   9336  H  H    . LEU A 1 48 ? 47.157 0.737   -6.508  1.00 0.00  ? 48  LEU A H    6  
ATOM   9337  H  HA   . LEU A 1 48 ? 45.606 3.011   -5.329  1.00 0.00  ? 48  LEU A HA   6  
ATOM   9338  H  HB2  . LEU A 1 48 ? 46.017 1.161   -3.718  1.00 0.00  ? 48  LEU A HB2  6  
ATOM   9339  H  HB3  . LEU A 1 48 ? 47.745 1.258   -4.059  1.00 0.00  ? 48  LEU A HB3  6  
ATOM   9340  H  HG   . LEU A 1 48 ? 47.510 3.756   -3.401  1.00 0.00  ? 48  LEU A HG   6  
ATOM   9341  H  HD11 . LEU A 1 48 ? 45.681 4.316   -1.951  1.00 0.00  ? 48  LEU A HD11 6  
ATOM   9342  H  HD12 . LEU A 1 48 ? 45.131 2.641   -1.896  1.00 0.00  ? 48  LEU A HD12 6  
ATOM   9343  H  HD13 . LEU A 1 48 ? 44.967 3.574   -3.383  1.00 0.00  ? 48  LEU A HD13 6  
ATOM   9344  H  HD21 . LEU A 1 48 ? 48.016 3.224   -1.109  1.00 0.00  ? 48  LEU A HD21 6  
ATOM   9345  H  HD22 . LEU A 1 48 ? 48.634 1.893   -2.085  1.00 0.00  ? 48  LEU A HD22 6  
ATOM   9346  H  HD23 . LEU A 1 48 ? 47.119 1.708   -1.203  1.00 0.00  ? 48  LEU A HD23 6  
ATOM   9347  N  N    . GLY A 1 49 ? 47.418 4.248   -6.743  1.00 0.00  ? 49  GLY A N    6  
ATOM   9348  C  CA   . GLY A 1 49 ? 48.509 5.123   -7.278  1.00 0.00  ? 49  GLY A CA   6  
ATOM   9349  C  C    . GLY A 1 49 ? 49.044 4.498   -8.569  1.00 0.00  ? 49  GLY A C    6  
ATOM   9350  O  O    . GLY A 1 49 ? 50.140 3.977   -8.602  1.00 0.00  ? 49  GLY A O    6  
ATOM   9351  H  H    . GLY A 1 49 ? 46.501 4.356   -7.073  1.00 0.00  ? 49  GLY A H    6  
ATOM   9352  H  HA2  . GLY A 1 49 ? 48.115 6.110   -7.486  1.00 0.00  ? 49  GLY A HA2  6  
ATOM   9353  H  HA3  . GLY A 1 49 ? 49.309 5.192   -6.555  1.00 0.00  ? 49  GLY A HA3  6  
ATOM   9354  N  N    . GLN A 1 50 ? 48.252 4.528   -9.617  1.00 0.00  ? 50  GLN A N    6  
ATOM   9355  C  CA   . GLN A 1 50 ? 48.653 3.917   -10.932 1.00 0.00  ? 50  GLN A CA   6  
ATOM   9356  C  C    . GLN A 1 50 ? 50.145 4.099   -11.244 1.00 0.00  ? 50  GLN A C    6  
ATOM   9357  O  O    . GLN A 1 50 ? 50.707 5.165   -11.071 1.00 0.00  ? 50  GLN A O    6  
ATOM   9358  C  CB   . GLN A 1 50 ? 47.807 4.638   -11.979 1.00 0.00  ? 50  GLN A CB   6  
ATOM   9359  C  CG   . GLN A 1 50 ? 46.583 3.777   -12.309 1.00 0.00  ? 50  GLN A CG   6  
ATOM   9360  C  CD   . GLN A 1 50 ? 46.936 2.776   -13.413 1.00 0.00  ? 50  GLN A CD   6  
ATOM   9361  O  OE1  . GLN A 1 50 ? 47.976 2.149   -13.374 1.00 0.00  ? 50  GLN A OE1  6  
ATOM   9362  N  NE2  . GLN A 1 50 ? 46.108 2.594   -14.402 1.00 0.00  ? 50  GLN A NE2  6  
ATOM   9363  H  H    . GLN A 1 50 ? 47.367 4.940   -9.533  1.00 0.00  ? 50  GLN A H    6  
ATOM   9364  H  HA   . GLN A 1 50 ? 48.404 2.868   -10.938 1.00 0.00  ? 50  GLN A HA   6  
ATOM   9365  H  HB2  . GLN A 1 50 ? 47.487 5.594   -11.590 1.00 0.00  ? 50  GLN A HB2  6  
ATOM   9366  H  HB3  . GLN A 1 50 ? 48.393 4.790   -12.875 1.00 0.00  ? 50  GLN A HB3  6  
ATOM   9367  H  HG2  . GLN A 1 50 ? 46.272 3.241   -11.423 1.00 0.00  ? 50  GLN A HG2  6  
ATOM   9368  H  HG3  . GLN A 1 50 ? 45.779 4.410   -12.643 1.00 0.00  ? 50  GLN A HG3  6  
ATOM   9369  H  HE21 . GLN A 1 50 ? 45.267 3.096   -14.436 1.00 0.00  ? 50  GLN A HE21 6  
ATOM   9370  H  HE22 . GLN A 1 50 ? 46.327 1.958   -15.112 1.00 0.00  ? 50  GLN A HE22 6  
ATOM   9371  N  N    . ASN A 1 51 ? 50.776 3.054   -11.722 1.00 0.00  ? 51  ASN A N    6  
ATOM   9372  C  CA   . ASN A 1 51 ? 52.226 3.133   -12.071 1.00 0.00  ? 51  ASN A CA   6  
ATOM   9373  C  C    . ASN A 1 51 ? 52.394 3.301   -13.589 1.00 0.00  ? 51  ASN A C    6  
ATOM   9374  O  O    . ASN A 1 51 ? 52.024 2.426   -14.351 1.00 0.00  ? 51  ASN A O    6  
ATOM   9375  C  CB   . ASN A 1 51 ? 52.824 1.801   -11.615 1.00 0.00  ? 51  ASN A CB   6  
ATOM   9376  C  CG   . ASN A 1 51 ? 54.306 1.770   -11.984 1.00 0.00  ? 51  ASN A CG   6  
ATOM   9377  O  OD1  . ASN A 1 51 ? 55.086 2.533   -11.454 1.00 0.00  ? 51  ASN A OD1  6  
ATOM   9378  N  ND2  . ASN A 1 51 ? 54.728 0.929   -12.886 1.00 0.00  ? 51  ASN A ND2  6  
ATOM   9379  H  H    . ASN A 1 51 ? 50.289 2.216   -11.861 1.00 0.00  ? 51  ASN A H    6  
ATOM   9380  H  HA   . ASN A 1 51 ? 52.696 3.948   -11.544 1.00 0.00  ? 51  ASN A HA   6  
ATOM   9381  H  HB2  . ASN A 1 51 ? 52.716 1.703   -10.544 1.00 0.00  ? 51  ASN A HB2  6  
ATOM   9382  H  HB3  . ASN A 1 51 ? 52.315 0.986   -12.106 1.00 0.00  ? 51  ASN A HB3  6  
ATOM   9383  H  HD21 . ASN A 1 51 ? 54.097 0.320   -13.324 1.00 0.00  ? 51  ASN A HD21 6  
ATOM   9384  H  HD22 . ASN A 1 51 ? 55.677 0.909   -13.129 1.00 0.00  ? 51  ASN A HD22 6  
ATOM   9385  N  N    . PRO A 1 52 ? 52.946 4.425   -13.978 1.00 0.00  ? 52  PRO A N    6  
ATOM   9386  C  CA   . PRO A 1 52 ? 53.161 4.711   -15.422 1.00 0.00  ? 52  PRO A CA   6  
ATOM   9387  C  C    . PRO A 1 52 ? 54.316 3.871   -16.004 1.00 0.00  ? 52  PRO A C    6  
ATOM   9388  O  O    . PRO A 1 52 ? 54.108 3.051   -16.878 1.00 0.00  ? 52  PRO A O    6  
ATOM   9389  C  CB   . PRO A 1 52 ? 53.488 6.204   -15.444 1.00 0.00  ? 52  PRO A CB   6  
ATOM   9390  C  CG   . PRO A 1 52 ? 54.021 6.515   -14.079 1.00 0.00  ? 52  PRO A CG   6  
ATOM   9391  C  CD   . PRO A 1 52 ? 53.409 5.525   -13.120 1.00 0.00  ? 52  PRO A CD   6  
ATOM   9392  H  HA   . PRO A 1 52 ? 52.254 4.531   -15.978 1.00 0.00  ? 52  PRO A HA   6  
ATOM   9393  H  HB2  . PRO A 1 52 ? 54.236 6.412   -16.198 1.00 0.00  ? 52  PRO A HB2  6  
ATOM   9394  H  HB3  . PRO A 1 52 ? 52.596 6.781   -15.631 1.00 0.00  ? 52  PRO A HB3  6  
ATOM   9395  H  HG2  . PRO A 1 52 ? 55.098 6.421   -14.073 1.00 0.00  ? 52  PRO A HG2  6  
ATOM   9396  H  HG3  . PRO A 1 52 ? 53.738 7.517   -13.793 1.00 0.00  ? 52  PRO A HG3  6  
ATOM   9397  H  HD2  . PRO A 1 52 ? 54.151 5.172   -12.414 1.00 0.00  ? 52  PRO A HD2  6  
ATOM   9398  H  HD3  . PRO A 1 52 ? 52.569 5.968   -12.601 1.00 0.00  ? 52  PRO A HD3  6  
ATOM   9399  N  N    . THR A 1 53 ? 55.526 4.075   -15.540 1.00 0.00  ? 53  THR A N    6  
ATOM   9400  C  CA   . THR A 1 53 ? 56.684 3.296   -16.085 1.00 0.00  ? 53  THR A CA   6  
ATOM   9401  C  C    . THR A 1 53 ? 57.341 2.448   -14.986 1.00 0.00  ? 53  THR A C    6  
ATOM   9402  O  O    . THR A 1 53 ? 57.289 2.793   -13.821 1.00 0.00  ? 53  THR A O    6  
ATOM   9403  C  CB   . THR A 1 53 ? 57.673 4.347   -16.611 1.00 0.00  ? 53  THR A CB   6  
ATOM   9404  O  OG1  . THR A 1 53 ? 57.615 5.517   -15.803 1.00 0.00  ? 53  THR A OG1  6  
ATOM   9405  C  CG2  . THR A 1 53 ? 57.320 4.706   -18.055 1.00 0.00  ? 53  THR A CG2  6  
ATOM   9406  H  H    . THR A 1 53 ? 55.679 4.745   -14.844 1.00 0.00  ? 53  THR A H    6  
ATOM   9407  H  HA   . THR A 1 53 ? 56.360 2.664   -16.897 1.00 0.00  ? 53  THR A HA   6  
ATOM   9408  H  HB   . THR A 1 53 ? 58.671 3.942   -16.581 1.00 0.00  ? 53  THR A HB   6  
ATOM   9409  H  HG1  . THR A 1 53 ? 58.513 5.826   -15.659 1.00 0.00  ? 53  THR A HG1  6  
ATOM   9410  H  HG21 . THR A 1 53 ? 56.697 5.587   -18.066 1.00 0.00  ? 53  THR A HG21 6  
ATOM   9411  H  HG22 . THR A 1 53 ? 56.789 3.884   -18.511 1.00 0.00  ? 53  THR A HG22 6  
ATOM   9412  H  HG23 . THR A 1 53 ? 58.226 4.899   -18.609 1.00 0.00  ? 53  THR A HG23 6  
ATOM   9413  N  N    . PRO A 1 54 ? 57.948 1.357   -15.403 1.00 0.00  ? 54  PRO A N    6  
ATOM   9414  C  CA   . PRO A 1 54 ? 58.630 0.438   -14.446 1.00 0.00  ? 54  PRO A CA   6  
ATOM   9415  C  C    . PRO A 1 54 ? 59.924 1.064   -13.897 1.00 0.00  ? 54  PRO A C    6  
ATOM   9416  O  O    . PRO A 1 54 ? 60.261 0.889   -12.741 1.00 0.00  ? 54  PRO A O    6  
ATOM   9417  C  CB   . PRO A 1 54 ? 58.938 -0.795  -15.294 1.00 0.00  ? 54  PRO A CB   6  
ATOM   9418  C  CG   . PRO A 1 54 ? 58.993 -0.295  -16.702 1.00 0.00  ? 54  PRO A CG   6  
ATOM   9419  C  CD   . PRO A 1 54 ? 58.053 0.878   -16.790 1.00 0.00  ? 54  PRO A CD   6  
ATOM   9420  H  HA   . PRO A 1 54 ? 57.967 0.172   -13.639 1.00 0.00  ? 54  PRO A HA   6  
ATOM   9421  H  HB2  . PRO A 1 54 ? 59.891 -1.219  -15.006 1.00 0.00  ? 54  PRO A HB2  6  
ATOM   9422  H  HB3  . PRO A 1 54 ? 58.153 -1.528  -15.194 1.00 0.00  ? 54  PRO A HB3  6  
ATOM   9423  H  HG2  . PRO A 1 54 ? 60.001 0.016   -16.944 1.00 0.00  ? 54  PRO A HG2  6  
ATOM   9424  H  HG3  . PRO A 1 54 ? 58.673 -1.070  -17.383 1.00 0.00  ? 54  PRO A HG3  6  
ATOM   9425  H  HD2  . PRO A 1 54 ? 58.469 1.646   -17.431 1.00 0.00  ? 54  PRO A HD2  6  
ATOM   9426  H  HD3  . PRO A 1 54 ? 57.086 0.565   -17.150 1.00 0.00  ? 54  PRO A HD3  6  
ATOM   9427  N  N    . GLU A 1 55 ? 60.648 1.786   -14.717 1.00 0.00  ? 55  GLU A N    6  
ATOM   9428  C  CA   . GLU A 1 55 ? 61.922 2.423   -14.248 1.00 0.00  ? 55  GLU A CA   6  
ATOM   9429  C  C    . GLU A 1 55 ? 61.642 3.443   -13.134 1.00 0.00  ? 55  GLU A C    6  
ATOM   9430  O  O    . GLU A 1 55 ? 62.449 3.635   -12.245 1.00 0.00  ? 55  GLU A O    6  
ATOM   9431  C  CB   . GLU A 1 55 ? 62.495 3.119   -15.484 1.00 0.00  ? 55  GLU A CB   6  
ATOM   9432  C  CG   . GLU A 1 55 ? 63.409 2.148   -16.238 1.00 0.00  ? 55  GLU A CG   6  
ATOM   9433  C  CD   . GLU A 1 55 ? 62.566 1.197   -17.094 1.00 0.00  ? 55  GLU A CD   6  
ATOM   9434  O  OE1  . GLU A 1 55 ? 62.053 1.640   -18.108 1.00 0.00  ? 55  GLU A OE1  6  
ATOM   9435  O  OE2  . GLU A 1 55 ? 62.448 0.043   -16.718 1.00 0.00  ? 55  GLU A OE2  6  
ATOM   9436  H  H    . GLU A 1 55 ? 60.357 1.908   -15.643 1.00 0.00  ? 55  GLU A H    6  
ATOM   9437  H  HA   . GLU A 1 55 ? 62.612 1.671   -13.901 1.00 0.00  ? 55  GLU A HA   6  
ATOM   9438  H  HB2  . GLU A 1 55 ? 61.687 3.429   -16.131 1.00 0.00  ? 55  GLU A HB2  6  
ATOM   9439  H  HB3  . GLU A 1 55 ? 63.066 3.984   -15.180 1.00 0.00  ? 55  GLU A HB3  6  
ATOM   9440  H  HG2  . GLU A 1 55 ? 64.077 2.707   -16.873 1.00 0.00  ? 55  GLU A HG2  6  
ATOM   9441  H  HG3  . GLU A 1 55 ? 63.986 1.574   -15.530 1.00 0.00  ? 55  GLU A HG3  6  
ATOM   9442  N  N    . GLU A 1 56 ? 60.501 4.094   -13.181 1.00 0.00  ? 56  GLU A N    6  
ATOM   9443  C  CA   . GLU A 1 56 ? 60.149 5.107   -12.133 1.00 0.00  ? 56  GLU A CA   6  
ATOM   9444  C  C    . GLU A 1 56 ? 60.303 4.519   -10.720 1.00 0.00  ? 56  GLU A C    6  
ATOM   9445  O  O    . GLU A 1 56 ? 60.781 5.184   -9.818  1.00 0.00  ? 56  GLU A O    6  
ATOM   9446  C  CB   . GLU A 1 56 ? 58.686 5.466   -12.412 1.00 0.00  ? 56  GLU A CB   6  
ATOM   9447  C  CG   . GLU A 1 56 ? 58.246 6.603   -11.484 1.00 0.00  ? 56  GLU A CG   6  
ATOM   9448  C  CD   . GLU A 1 56 ? 57.439 7.636   -12.273 1.00 0.00  ? 56  GLU A CD   6  
ATOM   9449  O  OE1  . GLU A 1 56 ? 58.037 8.361   -13.050 1.00 0.00  ? 56  GLU A OE1  6  
ATOM   9450  O  OE2  . GLU A 1 56 ? 56.239 7.696   -12.071 1.00 0.00  ? 56  GLU A OE2  6  
ATOM   9451  H  H    . GLU A 1 56 ? 59.872 3.916   -13.910 1.00 0.00  ? 56  GLU A H    6  
ATOM   9452  H  HA   . GLU A 1 56 ? 60.767 5.985   -12.240 1.00 0.00  ? 56  GLU A HA   6  
ATOM   9453  H  HB2  . GLU A 1 56 ? 58.584 5.780   -13.442 1.00 0.00  ? 56  GLU A HB2  6  
ATOM   9454  H  HB3  . GLU A 1 56 ? 58.064 4.600   -12.238 1.00 0.00  ? 56  GLU A HB3  6  
ATOM   9455  H  HG2  . GLU A 1 56 ? 57.634 6.201   -10.690 1.00 0.00  ? 56  GLU A HG2  6  
ATOM   9456  H  HG3  . GLU A 1 56 ? 59.117 7.080   -11.059 1.00 0.00  ? 56  GLU A HG3  6  
ATOM   9457  N  N    . LEU A 1 57 ? 59.910 3.283   -10.516 1.00 0.00  ? 57  LEU A N    6  
ATOM   9458  C  CA   . LEU A 1 57 ? 60.049 2.674   -9.153  1.00 0.00  ? 57  LEU A CA   6  
ATOM   9459  C  C    . LEU A 1 57 ? 61.519 2.350   -8.867  1.00 0.00  ? 57  LEU A C    6  
ATOM   9460  O  O    . LEU A 1 57 ? 61.959 2.411   -7.735  1.00 0.00  ? 57  LEU A O    6  
ATOM   9461  C  CB   . LEU A 1 57 ? 59.220 1.383   -9.147  1.00 0.00  ? 57  LEU A CB   6  
ATOM   9462  C  CG   . LEU A 1 57 ? 57.751 1.641   -9.535  1.00 0.00  ? 57  LEU A CG   6  
ATOM   9463  C  CD1  . LEU A 1 57 ? 57.335 3.082   -9.210  1.00 0.00  ? 57  LEU A CD1  6  
ATOM   9464  C  CD2  . LEU A 1 57 ? 57.567 1.381   -11.030 1.00 0.00  ? 57  LEU A CD2  6  
ATOM   9465  H  H    . LEU A 1 57 ? 59.533 2.761   -11.254 1.00 0.00  ? 57  LEU A H    6  
ATOM   9466  H  HA   . LEU A 1 57 ? 59.670 3.353   -8.405  1.00 0.00  ? 57  LEU A HA   6  
ATOM   9467  H  HB2  . LEU A 1 57 ? 59.652 0.680   -9.843  1.00 0.00  ? 57  LEU A HB2  6  
ATOM   9468  H  HB3  . LEU A 1 57 ? 59.252 0.962   -8.153  1.00 0.00  ? 57  LEU A HB3  6  
ATOM   9469  H  HG   . LEU A 1 57 ? 57.121 0.963   -8.981  1.00 0.00  ? 57  LEU A HG   6  
ATOM   9470  H  HD11 . LEU A 1 57 ? 56.258 3.140   -9.140  1.00 0.00  ? 57  LEU A HD11 6  
ATOM   9471  H  HD12 . LEU A 1 57 ? 57.677 3.743   -9.993  1.00 0.00  ? 57  LEU A HD12 6  
ATOM   9472  H  HD13 . LEU A 1 57 ? 57.773 3.382   -8.270  1.00 0.00  ? 57  LEU A HD13 6  
ATOM   9473  H  HD21 . LEU A 1 57 ? 57.433 2.320   -11.546 1.00 0.00  ? 57  LEU A HD21 6  
ATOM   9474  H  HD22 . LEU A 1 57 ? 56.697 0.761   -11.181 1.00 0.00  ? 57  LEU A HD22 6  
ATOM   9475  H  HD23 . LEU A 1 57 ? 58.438 0.877   -11.418 1.00 0.00  ? 57  LEU A HD23 6  
ATOM   9476  N  N    . GLN A 1 58 ? 62.289 2.018   -9.880  1.00 0.00  ? 58  GLN A N    6  
ATOM   9477  C  CA   . GLN A 1 58 ? 63.735 1.718   -9.642  1.00 0.00  ? 58  GLN A CA   6  
ATOM   9478  C  C    . GLN A 1 58 ? 64.386 2.947   -8.993  1.00 0.00  ? 58  GLN A C    6  
ATOM   9479  O  O    . GLN A 1 58 ? 65.110 2.830   -8.027  1.00 0.00  ? 58  GLN A O    6  
ATOM   9480  C  CB   . GLN A 1 58 ? 64.329 1.384   -11.029 1.00 0.00  ? 58  GLN A CB   6  
ATOM   9481  C  CG   . GLN A 1 58 ? 65.398 2.407   -11.443 1.00 0.00  ? 58  GLN A CG   6  
ATOM   9482  C  CD   . GLN A 1 58 ? 66.491 1.707   -12.251 1.00 0.00  ? 58  GLN A CD   6  
ATOM   9483  O  OE1  . GLN A 1 58 ? 66.267 1.297   -13.371 1.00 0.00  ? 58  GLN A OE1  6  
ATOM   9484  N  NE2  . GLN A 1 58 ? 67.674 1.550   -11.726 1.00 0.00  ? 58  GLN A NE2  6  
ATOM   9485  H  H    . GLN A 1 58 ? 61.921 1.982   -10.787 1.00 0.00  ? 58  GLN A H    6  
ATOM   9486  H  HA   . GLN A 1 58 ? 63.829 0.863   -8.983  1.00 0.00  ? 58  GLN A HA   6  
ATOM   9487  H  HB2  . GLN A 1 58 ? 64.779 0.403   -10.991 1.00 0.00  ? 58  GLN A HB2  6  
ATOM   9488  H  HB3  . GLN A 1 58 ? 63.538 1.380   -11.765 1.00 0.00  ? 58  GLN A HB3  6  
ATOM   9489  H  HG2  . GLN A 1 58 ? 64.941 3.176   -12.048 1.00 0.00  ? 58  GLN A HG2  6  
ATOM   9490  H  HG3  . GLN A 1 58 ? 65.837 2.853   -10.566 1.00 0.00  ? 58  GLN A HG3  6  
ATOM   9491  H  HE21 . GLN A 1 58 ? 67.859 1.880   -10.820 1.00 0.00  ? 58  GLN A HE21 6  
ATOM   9492  H  HE22 . GLN A 1 58 ? 68.378 1.100   -12.236 1.00 0.00  ? 58  GLN A HE22 6  
ATOM   9493  N  N    . GLU A 1 59 ? 64.096 4.130   -9.490  1.00 0.00  ? 59  GLU A N    6  
ATOM   9494  C  CA   . GLU A 1 59 ? 64.668 5.361   -8.860  1.00 0.00  ? 59  GLU A CA   6  
ATOM   9495  C  C    . GLU A 1 59 ? 64.176 5.444   -7.406  1.00 0.00  ? 59  GLU A C    6  
ATOM   9496  O  O    . GLU A 1 59 ? 64.900 5.846   -6.516  1.00 0.00  ? 59  GLU A O    6  
ATOM   9497  C  CB   . GLU A 1 59 ? 64.130 6.536   -9.685  1.00 0.00  ? 59  GLU A CB   6  
ATOM   9498  C  CG   . GLU A 1 59 ? 65.053 6.794   -10.885 1.00 0.00  ? 59  GLU A CG   6  
ATOM   9499  C  CD   . GLU A 1 59 ? 64.453 6.171   -12.151 1.00 0.00  ? 59  GLU A CD   6  
ATOM   9500  O  OE1  . GLU A 1 59 ? 63.344 6.541   -12.505 1.00 0.00  ? 59  GLU A OE1  6  
ATOM   9501  O  OE2  . GLU A 1 59 ? 65.115 5.338   -12.746 1.00 0.00  ? 59  GLU A OE2  6  
ATOM   9502  H  H    . GLU A 1 59 ? 63.482 4.208   -10.252 1.00 0.00  ? 59  GLU A H    6  
ATOM   9503  H  HA   . GLU A 1 59 ? 65.747 5.338   -8.895  1.00 0.00  ? 59  GLU A HA   6  
ATOM   9504  H  HB2  . GLU A 1 59 ? 63.135 6.302   -10.037 1.00 0.00  ? 59  GLU A HB2  6  
ATOM   9505  H  HB3  . GLU A 1 59 ? 64.093 7.420   -9.067  1.00 0.00  ? 59  GLU A HB3  6  
ATOM   9506  H  HG2  . GLU A 1 59 ? 65.163 7.859   -11.029 1.00 0.00  ? 59  GLU A HG2  6  
ATOM   9507  H  HG3  . GLU A 1 59 ? 66.021 6.355   -10.697 1.00 0.00  ? 59  GLU A HG3  6  
ATOM   9508  N  N    . MET A 1 60 ? 62.948 5.032   -7.167  1.00 0.00  ? 60  MET A N    6  
ATOM   9509  C  CA   . MET A 1 60 ? 62.392 5.046   -5.777  1.00 0.00  ? 60  MET A CA   6  
ATOM   9510  C  C    . MET A 1 60 ? 63.210 4.103   -4.877  1.00 0.00  ? 60  MET A C    6  
ATOM   9511  O  O    . MET A 1 60 ? 63.438 4.383   -3.715  1.00 0.00  ? 60  MET A O    6  
ATOM   9512  C  CB   . MET A 1 60 ? 60.945 4.535   -5.911  1.00 0.00  ? 60  MET A CB   6  
ATOM   9513  C  CG   . MET A 1 60 ? 59.968 5.712   -5.820  1.00 0.00  ? 60  MET A CG   6  
ATOM   9514  S  SD   . MET A 1 60 ? 58.582 5.445   -6.956  1.00 0.00  ? 60  MET A SD   6  
ATOM   9515  C  CE   . MET A 1 60 ? 57.592 4.379   -5.877  1.00 0.00  ? 60  MET A CE   6  
ATOM   9516  H  H    . MET A 1 60 ? 62.397 4.696   -7.905  1.00 0.00  ? 60  MET A H    6  
ATOM   9517  H  HA   . MET A 1 60 ? 62.398 6.047   -5.377  1.00 0.00  ? 60  MET A HA   6  
ATOM   9518  H  HB2  . MET A 1 60 ? 60.820 4.034   -6.864  1.00 0.00  ? 60  MET A HB2  6  
ATOM   9519  H  HB3  . MET A 1 60 ? 60.736 3.838   -5.114  1.00 0.00  ? 60  MET A HB3  6  
ATOM   9520  H  HG2  . MET A 1 60 ? 59.595 5.792   -4.810  1.00 0.00  ? 60  MET A HG2  6  
ATOM   9521  H  HG3  . MET A 1 60 ? 60.479 6.626   -6.087  1.00 0.00  ? 60  MET A HG3  6  
ATOM   9522  H  HE1  . MET A 1 60 ? 57.898 4.523   -4.851  1.00 0.00  ? 60  MET A HE1  6  
ATOM   9523  H  HE2  . MET A 1 60 ? 57.742 3.347   -6.152  1.00 0.00  ? 60  MET A HE2  6  
ATOM   9524  H  HE3  . MET A 1 60 ? 56.545 4.628   -5.985  1.00 0.00  ? 60  MET A HE3  6  
ATOM   9525  N  N    . ILE A 1 61 ? 63.652 2.987   -5.412  1.00 0.00  ? 61  ILE A N    6  
ATOM   9526  C  CA   . ILE A 1 61 ? 64.454 2.016   -4.601  1.00 0.00  ? 61  ILE A CA   6  
ATOM   9527  C  C    . ILE A 1 61 ? 65.940 2.416   -4.571  1.00 0.00  ? 61  ILE A C    6  
ATOM   9528  O  O    . ILE A 1 61 ? 66.629 2.164   -3.605  1.00 0.00  ? 61  ILE A O    6  
ATOM   9529  C  CB   . ILE A 1 61 ? 64.249 0.656   -5.299  1.00 0.00  ? 61  ILE A CB   6  
ATOM   9530  C  CG1  . ILE A 1 61 ? 64.099 -0.442  -4.246  1.00 0.00  ? 61  ILE A CG1  6  
ATOM   9531  C  CG2  . ILE A 1 61 ? 65.440 0.312   -6.205  1.00 0.00  ? 61  ILE A CG2  6  
ATOM   9532  C  CD1  . ILE A 1 61 ? 63.212 -1.557  -4.806  1.00 0.00  ? 61  ILE A CD1  6  
ATOM   9533  H  H    . ILE A 1 61 ? 63.453 2.787   -6.351  1.00 0.00  ? 61  ILE A H    6  
ATOM   9534  H  HA   . ILE A 1 61 ? 64.067 1.968   -3.596  1.00 0.00  ? 61  ILE A HA   6  
ATOM   9535  H  HB   . ILE A 1 61 ? 63.350 0.698   -5.897  1.00 0.00  ? 61  ILE A HB   6  
ATOM   9536  H  HG12 . ILE A 1 61 ? 65.073 -0.842  -4.001  1.00 0.00  ? 61  ILE A HG12 6  
ATOM   9537  H  HG13 . ILE A 1 61 ? 63.643 -0.031  -3.358  1.00 0.00  ? 61  ILE A HG13 6  
ATOM   9538  H  HG21 . ILE A 1 61 ? 65.309 -0.682  -6.606  1.00 0.00  ? 61  ILE A HG21 6  
ATOM   9539  H  HG22 . ILE A 1 61 ? 66.353 0.348   -5.631  1.00 0.00  ? 61  ILE A HG22 6  
ATOM   9540  H  HG23 . ILE A 1 61 ? 65.495 1.021   -7.015  1.00 0.00  ? 61  ILE A HG23 6  
ATOM   9541  H  HD11 . ILE A 1 61 ? 62.174 -1.281  -4.695  1.00 0.00  ? 61  ILE A HD11 6  
ATOM   9542  H  HD12 . ILE A 1 61 ? 63.402 -2.473  -4.266  1.00 0.00  ? 61  ILE A HD12 6  
ATOM   9543  H  HD13 . ILE A 1 61 ? 63.437 -1.702  -5.854  1.00 0.00  ? 61  ILE A HD13 6  
ATOM   9544  N  N    . ASP A 1 62 ? 66.437 3.024   -5.623  1.00 0.00  ? 62  ASP A N    6  
ATOM   9545  C  CA   . ASP A 1 62 ? 67.882 3.426   -5.659  1.00 0.00  ? 62  ASP A CA   6  
ATOM   9546  C  C    . ASP A 1 62 ? 68.228 4.363   -4.492  1.00 0.00  ? 62  ASP A C    6  
ATOM   9547  O  O    . ASP A 1 62 ? 69.216 4.173   -3.809  1.00 0.00  ? 62  ASP A O    6  
ATOM   9548  C  CB   . ASP A 1 62 ? 68.061 4.151   -6.997  1.00 0.00  ? 62  ASP A CB   6  
ATOM   9549  C  CG   . ASP A 1 62 ? 68.484 3.154   -8.080  1.00 0.00  ? 62  ASP A CG   6  
ATOM   9550  O  OD1  . ASP A 1 62 ? 69.527 2.541   -7.920  1.00 0.00  ? 62  ASP A OD1  6  
ATOM   9551  O  OD2  . ASP A 1 62 ? 67.762 3.025   -9.054  1.00 0.00  ? 62  ASP A OD2  6  
ATOM   9552  H  H    . ASP A 1 62 ? 65.862 3.207   -6.397  1.00 0.00  ? 62  ASP A H    6  
ATOM   9553  H  HA   . ASP A 1 62 ? 68.512 2.551   -5.632  1.00 0.00  ? 62  ASP A HA   6  
ATOM   9554  H  HB2  . ASP A 1 62 ? 67.129 4.615   -7.280  1.00 0.00  ? 62  ASP A HB2  6  
ATOM   9555  H  HB3  . ASP A 1 62 ? 68.823 4.908   -6.893  1.00 0.00  ? 62  ASP A HB3  6  
ATOM   9556  N  N    . GLU A 1 63 ? 67.425 5.373   -4.261  1.00 0.00  ? 63  GLU A N    6  
ATOM   9557  C  CA   . GLU A 1 63 ? 67.710 6.325   -3.138  1.00 0.00  ? 63  GLU A CA   6  
ATOM   9558  C  C    . GLU A 1 63 ? 67.647 5.604   -1.782  1.00 0.00  ? 63  GLU A C    6  
ATOM   9559  O  O    . GLU A 1 63 ? 68.404 5.903   -0.876  1.00 0.00  ? 63  GLU A O    6  
ATOM   9560  C  CB   . GLU A 1 63 ? 66.611 7.390   -3.230  1.00 0.00  ? 63  GLU A CB   6  
ATOM   9561  C  CG   . GLU A 1 63 ? 67.137 8.726   -2.693  1.00 0.00  ? 63  GLU A CG   6  
ATOM   9562  C  CD   . GLU A 1 63 ? 66.698 8.909   -1.238  1.00 0.00  ? 63  GLU A CD   6  
ATOM   9563  O  OE1  . GLU A 1 63 ? 65.565 9.306   -1.026  1.00 0.00  ? 63  GLU A OE1  6  
ATOM   9564  O  OE2  . GLU A 1 63 ? 67.506 8.653   -0.359  1.00 0.00  ? 63  GLU A OE2  6  
ATOM   9565  H  H    . GLU A 1 63 ? 66.636 5.507   -4.828  1.00 0.00  ? 63  GLU A H    6  
ATOM   9566  H  HA   . GLU A 1 63 ? 68.677 6.784   -3.273  1.00 0.00  ? 63  GLU A HA   6  
ATOM   9567  H  HB2  . GLU A 1 63 ? 66.312 7.509   -4.262  1.00 0.00  ? 63  GLU A HB2  6  
ATOM   9568  H  HB3  . GLU A 1 63 ? 65.759 7.079   -2.643  1.00 0.00  ? 63  GLU A HB3  6  
ATOM   9569  H  HG2  . GLU A 1 63 ? 68.216 8.736   -2.747  1.00 0.00  ? 63  GLU A HG2  6  
ATOM   9570  H  HG3  . GLU A 1 63 ? 66.740 9.534   -3.288  1.00 0.00  ? 63  GLU A HG3  6  
ATOM   9571  N  N    . VAL A 1 64 ? 66.748 4.661   -1.636  1.00 0.00  ? 64  VAL A N    6  
ATOM   9572  C  CA   . VAL A 1 64 ? 66.626 3.927   -0.336  1.00 0.00  ? 64  VAL A CA   6  
ATOM   9573  C  C    . VAL A 1 64 ? 67.627 2.759   -0.252  1.00 0.00  ? 64  VAL A C    6  
ATOM   9574  O  O    . VAL A 1 64 ? 68.070 2.404   0.824   1.00 0.00  ? 64  VAL A O    6  
ATOM   9575  C  CB   . VAL A 1 64 ? 65.182 3.405   -0.308  1.00 0.00  ? 64  VAL A CB   6  
ATOM   9576  C  CG1  . VAL A 1 64 ? 64.953 2.576   0.958   1.00 0.00  ? 64  VAL A CG1  6  
ATOM   9577  C  CG2  . VAL A 1 64 ? 64.206 4.586   -0.314  1.00 0.00  ? 64  VAL A CG2  6  
ATOM   9578  H  H    . VAL A 1 64 ? 66.147 4.442   -2.379  1.00 0.00  ? 64  VAL A H    6  
ATOM   9579  H  HA   . VAL A 1 64 ? 66.780 4.605   0.489   1.00 0.00  ? 64  VAL A HA   6  
ATOM   9580  H  HB   . VAL A 1 64 ? 65.007 2.787   -1.178  1.00 0.00  ? 64  VAL A HB   6  
ATOM   9581  H  HG11 . VAL A 1 64 ? 65.226 3.159   1.824   1.00 0.00  ? 64  VAL A HG11 6  
ATOM   9582  H  HG12 . VAL A 1 64 ? 65.558 1.682   0.920   1.00 0.00  ? 64  VAL A HG12 6  
ATOM   9583  H  HG13 . VAL A 1 64 ? 63.910 2.302   1.024   1.00 0.00  ? 64  VAL A HG13 6  
ATOM   9584  H  HG21 . VAL A 1 64 ? 63.300 4.301   -0.831  1.00 0.00  ? 64  VAL A HG21 6  
ATOM   9585  H  HG22 . VAL A 1 64 ? 64.657 5.427   -0.818  1.00 0.00  ? 64  VAL A HG22 6  
ATOM   9586  H  HG23 . VAL A 1 64 ? 63.969 4.862   0.703   1.00 0.00  ? 64  VAL A HG23 6  
ATOM   9587  N  N    . ASP A 1 65 ? 67.980 2.153   -1.362  1.00 0.00  ? 65  ASP A N    6  
ATOM   9588  C  CA   . ASP A 1 65 ? 68.940 1.006   -1.308  1.00 0.00  ? 65  ASP A CA   6  
ATOM   9589  C  C    . ASP A 1 65 ? 70.038 1.132   -2.374  1.00 0.00  ? 65  ASP A C    6  
ATOM   9590  O  O    . ASP A 1 65 ? 69.783 1.464   -3.516  1.00 0.00  ? 65  ASP A O    6  
ATOM   9591  C  CB   . ASP A 1 65 ? 68.091 -0.243  -1.573  1.00 0.00  ? 65  ASP A CB   6  
ATOM   9592  C  CG   . ASP A 1 65 ? 69.000 -1.475  -1.664  1.00 0.00  ? 65  ASP A CG   6  
ATOM   9593  O  OD1  . ASP A 1 65 ? 69.837 -1.637  -0.792  1.00 0.00  ? 65  ASP A OD1  6  
ATOM   9594  O  OD2  . ASP A 1 65 ? 68.841 -2.239  -2.601  1.00 0.00  ? 65  ASP A OD2  6  
ATOM   9595  H  H    . ASP A 1 65 ? 67.610 2.443   -2.225  1.00 0.00  ? 65  ASP A H    6  
ATOM   9596  H  HA   . ASP A 1 65 ? 69.383 0.937   -0.327  1.00 0.00  ? 65  ASP A HA   6  
ATOM   9597  H  HB2  . ASP A 1 65 ? 67.386 -0.375  -0.767  1.00 0.00  ? 65  ASP A HB2  6  
ATOM   9598  H  HB3  . ASP A 1 65 ? 67.557 -0.125  -2.504  1.00 0.00  ? 65  ASP A HB3  6  
ATOM   9599  N  N    . GLU A 1 66 ? 71.256 0.835   -1.997  1.00 0.00  ? 66  GLU A N    6  
ATOM   9600  C  CA   . GLU A 1 66 ? 72.397 0.895   -2.961  1.00 0.00  ? 66  GLU A CA   6  
ATOM   9601  C  C    . GLU A 1 66 ? 73.437 -0.174  -2.583  1.00 0.00  ? 66  GLU A C    6  
ATOM   9602  O  O    . GLU A 1 66 ? 74.626 0.081   -2.540  1.00 0.00  ? 66  GLU A O    6  
ATOM   9603  C  CB   . GLU A 1 66 ? 72.974 2.308   -2.816  1.00 0.00  ? 66  GLU A CB   6  
ATOM   9604  C  CG   . GLU A 1 66 ? 73.086 2.960   -4.200  1.00 0.00  ? 66  GLU A CG   6  
ATOM   9605  C  CD   . GLU A 1 66 ? 74.230 2.315   -4.986  1.00 0.00  ? 66  GLU A CD   6  
ATOM   9606  O  OE1  . GLU A 1 66 ? 75.347 2.793   -4.870  1.00 0.00  ? 66  GLU A OE1  6  
ATOM   9607  O  OE2  . GLU A 1 66 ? 73.969 1.356   -5.696  1.00 0.00  ? 66  GLU A OE2  6  
ATOM   9608  H  H    . GLU A 1 66 ? 71.418 0.549   -1.074  1.00 0.00  ? 66  GLU A H    6  
ATOM   9609  H  HA   . GLU A 1 66 ? 72.047 0.738   -3.969  1.00 0.00  ? 66  GLU A HA   6  
ATOM   9610  H  HB2  . GLU A 1 66 ? 72.321 2.901   -2.192  1.00 0.00  ? 66  GLU A HB2  6  
ATOM   9611  H  HB3  . GLU A 1 66 ? 73.953 2.256   -2.365  1.00 0.00  ? 66  GLU A HB3  6  
ATOM   9612  H  HG2  . GLU A 1 66 ? 72.159 2.822   -4.737  1.00 0.00  ? 66  GLU A HG2  6  
ATOM   9613  H  HG3  . GLU A 1 66 ? 73.281 4.015   -4.085  1.00 0.00  ? 66  GLU A HG3  6  
ATOM   9614  N  N    . ASP A 1 67 ? 72.983 -1.371  -2.297  1.00 0.00  ? 67  ASP A N    6  
ATOM   9615  C  CA   . ASP A 1 67 ? 73.921 -2.472  -1.904  1.00 0.00  ? 67  ASP A CA   6  
ATOM   9616  C  C    . ASP A 1 67 ? 74.159 -3.457  -3.068  1.00 0.00  ? 67  ASP A C    6  
ATOM   9617  O  O    . ASP A 1 67 ? 74.702 -4.529  -2.874  1.00 0.00  ? 67  ASP A O    6  
ATOM   9618  C  CB   . ASP A 1 67 ? 73.228 -3.170  -0.717  1.00 0.00  ? 67  ASP A CB   6  
ATOM   9619  C  CG   . ASP A 1 67 ? 72.016 -3.993  -1.186  1.00 0.00  ? 67  ASP A CG   6  
ATOM   9620  O  OD1  . ASP A 1 67 ? 71.402 -3.624  -2.173  1.00 0.00  ? 67  ASP A OD1  6  
ATOM   9621  O  OD2  . ASP A 1 67 ? 71.711 -4.979  -0.539  1.00 0.00  ? 67  ASP A OD2  6  
ATOM   9622  H  H    . ASP A 1 67 ? 72.018 -1.547  -2.332  1.00 0.00  ? 67  ASP A H    6  
ATOM   9623  H  HA   . ASP A 1 67 ? 74.861 -2.057  -1.578  1.00 0.00  ? 67  ASP A HA   6  
ATOM   9624  H  HB2  . ASP A 1 67 ? 73.934 -3.826  -0.230  1.00 0.00  ? 67  ASP A HB2  6  
ATOM   9625  H  HB3  . ASP A 1 67 ? 72.895 -2.422  -0.012  1.00 0.00  ? 67  ASP A HB3  6  
ATOM   9626  N  N    . GLY A 1 68 ? 73.770 -3.103  -4.273  1.00 0.00  ? 68  GLY A N    6  
ATOM   9627  C  CA   . GLY A 1 68 ? 73.993 -4.022  -5.432  1.00 0.00  ? 68  GLY A CA   6  
ATOM   9628  C  C    . GLY A 1 68 ? 72.667 -4.637  -5.892  1.00 0.00  ? 68  GLY A C    6  
ATOM   9629  O  O    . GLY A 1 68 ? 72.338 -4.600  -7.061  1.00 0.00  ? 68  GLY A O    6  
ATOM   9630  H  H    . GLY A 1 68 ? 73.342 -2.234  -4.416  1.00 0.00  ? 68  GLY A H    6  
ATOM   9631  H  HA2  . GLY A 1 68 ? 74.430 -3.466  -6.248  1.00 0.00  ? 68  GLY A HA2  6  
ATOM   9632  H  HA3  . GLY A 1 68 ? 74.667 -4.813  -5.139  1.00 0.00  ? 68  GLY A HA3  6  
ATOM   9633  N  N    . SER A 1 69 ? 71.908 -5.213  -4.989  1.00 0.00  ? 69  SER A N    6  
ATOM   9634  C  CA   . SER A 1 69 ? 70.606 -5.841  -5.394  1.00 0.00  ? 69  SER A CA   6  
ATOM   9635  C  C    . SER A 1 69 ? 69.631 -4.782  -5.931  1.00 0.00  ? 69  SER A C    6  
ATOM   9636  O  O    . SER A 1 69 ? 69.131 -4.904  -7.033  1.00 0.00  ? 69  SER A O    6  
ATOM   9637  C  CB   . SER A 1 69 ? 70.046 -6.517  -4.133  1.00 0.00  ? 69  SER A CB   6  
ATOM   9638  O  OG   . SER A 1 69 ? 69.828 -5.549  -3.111  1.00 0.00  ? 69  SER A OG   6  
ATOM   9639  H  H    . SER A 1 69 ? 72.197 -5.239  -4.052  1.00 0.00  ? 69  SER A H    6  
ATOM   9640  H  HA   . SER A 1 69 ? 70.784 -6.588  -6.152  1.00 0.00  ? 69  SER A HA   6  
ATOM   9641  H  HB2  . SER A 1 69 ? 69.109 -6.994  -4.369  1.00 0.00  ? 69  SER A HB2  6  
ATOM   9642  H  HB3  . SER A 1 69 ? 70.748 -7.267  -3.789  1.00 0.00  ? 69  SER A HB3  6  
ATOM   9643  H  HG   . SER A 1 69 ? 70.684 -5.300  -2.752  1.00 0.00  ? 69  SER A HG   6  
ATOM   9644  N  N    . GLY A 1 70 ? 69.342 -3.756  -5.165  1.00 0.00  ? 70  GLY A N    6  
ATOM   9645  C  CA   . GLY A 1 70 ? 68.386 -2.709  -5.639  1.00 0.00  ? 70  GLY A CA   6  
ATOM   9646  C  C    . GLY A 1 70 ? 66.977 -3.119  -5.217  1.00 0.00  ? 70  GLY A C    6  
ATOM   9647  O  O    . GLY A 1 70 ? 66.011 -2.890  -5.918  1.00 0.00  ? 70  GLY A O    6  
ATOM   9648  H  H    . GLY A 1 70 ? 69.738 -3.683  -4.269  1.00 0.00  ? 70  GLY A H    6  
ATOM   9649  H  HA2  . GLY A 1 70 ? 68.638 -1.756  -5.192  1.00 0.00  ? 70  GLY A HA2  6  
ATOM   9650  H  HA3  . GLY A 1 70 ? 68.430 -2.633  -6.717  1.00 0.00  ? 70  GLY A HA3  6  
ATOM   9651  N  N    . THR A 1 71 ? 66.871 -3.740  -4.073  1.00 0.00  ? 71  THR A N    6  
ATOM   9652  C  CA   . THR A 1 71 ? 65.550 -4.202  -3.565  1.00 0.00  ? 71  THR A CA   6  
ATOM   9653  C  C    . THR A 1 71 ? 65.372 -3.757  -2.113  1.00 0.00  ? 71  THR A C    6  
ATOM   9654  O  O    . THR A 1 71 ? 66.317 -3.749  -1.345  1.00 0.00  ? 71  THR A O    6  
ATOM   9655  C  CB   . THR A 1 71 ? 65.614 -5.729  -3.652  1.00 0.00  ? 71  THR A CB   6  
ATOM   9656  O  OG1  . THR A 1 71 ? 66.906 -6.180  -3.257  1.00 0.00  ? 71  THR A OG1  6  
ATOM   9657  C  CG2  . THR A 1 71 ? 65.332 -6.177  -5.087  1.00 0.00  ? 71  THR A CG2  6  
ATOM   9658  H  H    . THR A 1 71 ? 67.676 -3.913  -3.542  1.00 0.00  ? 71  THR A H    6  
ATOM   9659  H  HA   . THR A 1 71 ? 64.749 -3.827  -4.182  1.00 0.00  ? 71  THR A HA   6  
ATOM   9660  H  HB   . THR A 1 71 ? 64.877 -6.151  -2.996  1.00 0.00  ? 71  THR A HB   6  
ATOM   9661  H  HG1  . THR A 1 71 ? 66.894 -7.140  -3.232  1.00 0.00  ? 71  THR A HG1  6  
ATOM   9662  H  HG21 . THR A 1 71 ? 64.336 -6.590  -5.146  1.00 0.00  ? 71  THR A HG21 6  
ATOM   9663  H  HG22 . THR A 1 71 ? 66.051 -6.927  -5.379  1.00 0.00  ? 71  THR A HG22 6  
ATOM   9664  H  HG23 . THR A 1 71 ? 65.409 -5.327  -5.752  1.00 0.00  ? 71  THR A HG23 6  
ATOM   9665  N  N    . VAL A 1 72 ? 64.176 -3.387  -1.731  1.00 0.00  ? 72  VAL A N    6  
ATOM   9666  C  CA   . VAL A 1 72 ? 63.945 -2.936  -0.323  1.00 0.00  ? 72  VAL A CA   6  
ATOM   9667  C  C    . VAL A 1 72 ? 63.921 -4.139  0.633   1.00 0.00  ? 72  VAL A C    6  
ATOM   9668  O  O    . VAL A 1 72 ? 62.977 -4.909  0.657   1.00 0.00  ? 72  VAL A O    6  
ATOM   9669  C  CB   . VAL A 1 72 ? 62.583 -2.227  -0.336  1.00 0.00  ? 72  VAL A CB   6  
ATOM   9670  C  CG1  . VAL A 1 72 ? 62.234 -1.768  1.080   1.00 0.00  ? 72  VAL A CG1  6  
ATOM   9671  C  CG2  . VAL A 1 72 ? 62.641 -1.006  -1.258  1.00 0.00  ? 72  VAL A CG2  6  
ATOM   9672  H  H    . VAL A 1 72 ? 63.431 -3.402  -2.370  1.00 0.00  ? 72  VAL A H    6  
ATOM   9673  H  HA   . VAL A 1 72 ? 64.714 -2.240  -0.027  1.00 0.00  ? 72  VAL A HA   6  
ATOM   9674  H  HB   . VAL A 1 72 ? 61.824 -2.912  -0.689  1.00 0.00  ? 72  VAL A HB   6  
ATOM   9675  H  HG11 . VAL A 1 72 ? 63.130 -1.434  1.583   1.00 0.00  ? 72  VAL A HG11 6  
ATOM   9676  H  HG12 . VAL A 1 72 ? 61.798 -2.591  1.628   1.00 0.00  ? 72  VAL A HG12 6  
ATOM   9677  H  HG13 . VAL A 1 72 ? 61.526 -0.955  1.030   1.00 0.00  ? 72  VAL A HG13 6  
ATOM   9678  H  HG21 . VAL A 1 72 ? 61.868 -0.305  -0.977  1.00 0.00  ? 72  VAL A HG21 6  
ATOM   9679  H  HG22 . VAL A 1 72 ? 62.488 -1.318  -2.281  1.00 0.00  ? 72  VAL A HG22 6  
ATOM   9680  H  HG23 . VAL A 1 72 ? 63.607 -0.530  -1.167  1.00 0.00  ? 72  VAL A HG23 6  
ATOM   9681  N  N    . ASP A 1 73 ? 64.953 -4.299  1.424   1.00 0.00  ? 73  ASP A N    6  
ATOM   9682  C  CA   . ASP A 1 73 ? 65.000 -5.442  2.390   1.00 0.00  ? 73  ASP A CA   6  
ATOM   9683  C  C    . ASP A 1 73 ? 64.069 -5.169  3.583   1.00 0.00  ? 73  ASP A C    6  
ATOM   9684  O  O    . ASP A 1 73 ? 63.362 -4.180  3.610   1.00 0.00  ? 73  ASP A O    6  
ATOM   9685  C  CB   . ASP A 1 73 ? 66.462 -5.516  2.846   1.00 0.00  ? 73  ASP A CB   6  
ATOM   9686  C  CG   . ASP A 1 73 ? 67.276 -6.322  1.833   1.00 0.00  ? 73  ASP A CG   6  
ATOM   9687  O  OD1  . ASP A 1 73 ? 67.581 -5.782  0.781   1.00 0.00  ? 73  ASP A OD1  6  
ATOM   9688  O  OD2  . ASP A 1 73 ? 67.585 -7.463  2.127   1.00 0.00  ? 73  ASP A OD2  6  
ATOM   9689  H  H    . ASP A 1 73 ? 65.698 -3.662  1.384   1.00 0.00  ? 73  ASP A H    6  
ATOM   9690  H  HA   . ASP A 1 73 ? 64.722 -6.361  1.898   1.00 0.00  ? 73  ASP A HA   6  
ATOM   9691  H  HB2  . ASP A 1 73 ? 66.869 -4.517  2.921   1.00 0.00  ? 73  ASP A HB2  6  
ATOM   9692  H  HB3  . ASP A 1 73 ? 66.515 -5.997  3.810   1.00 0.00  ? 73  ASP A HB3  6  
ATOM   9693  N  N    . PHE A 1 74 ? 64.065 -6.035  4.570   1.00 0.00  ? 74  PHE A N    6  
ATOM   9694  C  CA   . PHE A 1 74 ? 63.178 -5.819  5.759   1.00 0.00  ? 74  PHE A CA   6  
ATOM   9695  C  C    . PHE A 1 74 ? 63.621 -4.561  6.515   1.00 0.00  ? 74  PHE A C    6  
ATOM   9696  O  O    . PHE A 1 74 ? 62.859 -3.626  6.681   1.00 0.00  ? 74  PHE A O    6  
ATOM   9697  C  CB   . PHE A 1 74 ? 63.345 -7.077  6.625   1.00 0.00  ? 74  PHE A CB   6  
ATOM   9698  C  CG   . PHE A 1 74 ? 62.668 -6.877  7.961   1.00 0.00  ? 74  PHE A CG   6  
ATOM   9699  C  CD1  . PHE A 1 74 ? 61.287 -6.654  8.022   1.00 0.00  ? 74  PHE A CD1  6  
ATOM   9700  C  CD2  . PHE A 1 74 ? 63.424 -6.914  9.139   1.00 0.00  ? 74  PHE A CD2  6  
ATOM   9701  C  CE1  . PHE A 1 74 ? 60.664 -6.469  9.260   1.00 0.00  ? 74  PHE A CE1  6  
ATOM   9702  C  CE2  . PHE A 1 74 ? 62.800 -6.729  10.376  1.00 0.00  ? 74  PHE A CE2  6  
ATOM   9703  C  CZ   . PHE A 1 74 ? 61.420 -6.506  10.437  1.00 0.00  ? 74  PHE A CZ   6  
ATOM   9704  H  H    . PHE A 1 74 ? 64.648 -6.822  4.531   1.00 0.00  ? 74  PHE A H    6  
ATOM   9705  H  HA   . PHE A 1 74 ? 62.150 -5.721  5.446   1.00 0.00  ? 74  PHE A HA   6  
ATOM   9706  H  HB2  . PHE A 1 74 ? 62.895 -7.920  6.121   1.00 0.00  ? 74  PHE A HB2  6  
ATOM   9707  H  HB3  . PHE A 1 74 ? 64.395 -7.270  6.781   1.00 0.00  ? 74  PHE A HB3  6  
ATOM   9708  H  HD1  . PHE A 1 74 ? 60.705 -6.626  7.113   1.00 0.00  ? 74  PHE A HD1  6  
ATOM   9709  H  HD2  . PHE A 1 74 ? 64.489 -7.086  9.091   1.00 0.00  ? 74  PHE A HD2  6  
ATOM   9710  H  HE1  . PHE A 1 74 ? 59.601 -6.297  9.309   1.00 0.00  ? 74  PHE A HE1  6  
ATOM   9711  H  HE2  . PHE A 1 74 ? 63.383 -6.758  11.284  1.00 0.00  ? 74  PHE A HE2  6  
ATOM   9712  H  HZ   . PHE A 1 74 ? 60.937 -6.364  11.391  1.00 0.00  ? 74  PHE A HZ   6  
ATOM   9713  N  N    . ASP A 1 75 ? 64.852 -4.527  6.955   1.00 0.00  ? 75  ASP A N    6  
ATOM   9714  C  CA   . ASP A 1 75 ? 65.363 -3.327  7.685   1.00 0.00  ? 75  ASP A CA   6  
ATOM   9715  C  C    . ASP A 1 75 ? 65.407 -2.119  6.737   1.00 0.00  ? 75  ASP A C    6  
ATOM   9716  O  O    . ASP A 1 75 ? 65.152 -0.998  7.137   1.00 0.00  ? 75  ASP A O    6  
ATOM   9717  C  CB   . ASP A 1 75 ? 66.767 -3.722  8.146   1.00 0.00  ? 75  ASP A CB   6  
ATOM   9718  C  CG   . ASP A 1 75 ? 66.696 -4.262  9.577   1.00 0.00  ? 75  ASP A CG   6  
ATOM   9719  O  OD1  . ASP A 1 75 ? 66.314 -5.409  9.738   1.00 0.00  ? 75  ASP A OD1  6  
ATOM   9720  O  OD2  . ASP A 1 75 ? 67.019 -3.517  10.487  1.00 0.00  ? 75  ASP A OD2  6  
ATOM   9721  H  H    . ASP A 1 75 ? 65.447 -5.289  6.795   1.00 0.00  ? 75  ASP A H    6  
ATOM   9722  H  HA   . ASP A 1 75 ? 64.740 -3.112  8.539   1.00 0.00  ? 75  ASP A HA   6  
ATOM   9723  H  HB2  . ASP A 1 75 ? 67.158 -4.488  7.491   1.00 0.00  ? 75  ASP A HB2  6  
ATOM   9724  H  HB3  . ASP A 1 75 ? 67.415 -2.859  8.120   1.00 0.00  ? 75  ASP A HB3  6  
ATOM   9725  N  N    . GLU A 1 76 ? 65.705 -2.346  5.479   1.00 0.00  ? 76  GLU A N    6  
ATOM   9726  C  CA   . GLU A 1 76 ? 65.738 -1.220  4.493   1.00 0.00  ? 76  GLU A CA   6  
ATOM   9727  C  C    . GLU A 1 76 ? 64.332 -0.615  4.358   1.00 0.00  ? 76  GLU A C    6  
ATOM   9728  O  O    . GLU A 1 76 ? 64.169 0.588   4.280   1.00 0.00  ? 76  GLU A O    6  
ATOM   9729  C  CB   . GLU A 1 76 ? 66.175 -1.858  3.172   1.00 0.00  ? 76  GLU A CB   6  
ATOM   9730  C  CG   . GLU A 1 76 ? 67.702 -1.793  3.036   1.00 0.00  ? 76  GLU A CG   6  
ATOM   9731  C  CD   . GLU A 1 76 ? 68.153 -2.608  1.817   1.00 0.00  ? 76  GLU A CD   6  
ATOM   9732  O  OE1  . GLU A 1 76 ? 67.461 -2.577  0.814   1.00 0.00  ? 76  GLU A OE1  6  
ATOM   9733  O  OE2  . GLU A 1 76 ? 69.185 -3.253  1.903   1.00 0.00  ? 76  GLU A OE2  6  
ATOM   9734  H  H    . GLU A 1 76 ? 65.889 -3.261  5.179   1.00 0.00  ? 76  GLU A H    6  
ATOM   9735  H  HA   . GLU A 1 76 ? 66.448 -0.468  4.797   1.00 0.00  ? 76  GLU A HA   6  
ATOM   9736  H  HB2  . GLU A 1 76 ? 65.857 -2.889  3.150   1.00 0.00  ? 76  GLU A HB2  6  
ATOM   9737  H  HB3  . GLU A 1 76 ? 65.721 -1.326  2.348   1.00 0.00  ? 76  GLU A HB3  6  
ATOM   9738  H  HG2  . GLU A 1 76 ? 68.007 -0.764  2.911   1.00 0.00  ? 76  GLU A HG2  6  
ATOM   9739  H  HG3  . GLU A 1 76 ? 68.159 -2.198  3.926   1.00 0.00  ? 76  GLU A HG3  6  
ATOM   9740  N  N    . PHE A 1 77 ? 63.317 -1.451  4.339   1.00 0.00  ? 77  PHE A N    6  
ATOM   9741  C  CA   . PHE A 1 77 ? 61.910 -0.949  4.222   1.00 0.00  ? 77  PHE A CA   6  
ATOM   9742  C  C    . PHE A 1 77 ? 61.593 0.038   5.358   1.00 0.00  ? 77  PHE A C    6  
ATOM   9743  O  O    . PHE A 1 77 ? 60.947 1.046   5.143   1.00 0.00  ? 77  PHE A O    6  
ATOM   9744  C  CB   . PHE A 1 77 ? 61.033 -2.203  4.334   1.00 0.00  ? 77  PHE A CB   6  
ATOM   9745  C  CG   . PHE A 1 77 ? 59.588 -1.853  4.059   1.00 0.00  ? 77  PHE A CG   6  
ATOM   9746  C  CD1  . PHE A 1 77 ? 59.196 -1.441  2.780   1.00 0.00  ? 77  PHE A CD1  6  
ATOM   9747  C  CD2  . PHE A 1 77 ? 58.640 -1.945  5.085   1.00 0.00  ? 77  PHE A CD2  6  
ATOM   9748  C  CE1  . PHE A 1 77 ? 57.857 -1.120  2.527   1.00 0.00  ? 77  PHE A CE1  6  
ATOM   9749  C  CE2  . PHE A 1 77 ? 57.300 -1.624  4.833   1.00 0.00  ? 77  PHE A CE2  6  
ATOM   9750  C  CZ   . PHE A 1 77 ? 56.909 -1.212  3.553   1.00 0.00  ? 77  PHE A CZ   6  
ATOM   9751  H  H    . PHE A 1 77 ? 63.482 -2.416  4.408   1.00 0.00  ? 77  PHE A H    6  
ATOM   9752  H  HA   . PHE A 1 77 ? 61.759 -0.479  3.263   1.00 0.00  ? 77  PHE A HA   6  
ATOM   9753  H  HB2  . PHE A 1 77 ? 61.365 -2.939  3.616   1.00 0.00  ? 77  PHE A HB2  6  
ATOM   9754  H  HB3  . PHE A 1 77 ? 61.118 -2.611  5.330   1.00 0.00  ? 77  PHE A HB3  6  
ATOM   9755  H  HD1  . PHE A 1 77 ? 59.926 -1.370  1.988   1.00 0.00  ? 77  PHE A HD1  6  
ATOM   9756  H  HD2  . PHE A 1 77 ? 58.941 -2.263  6.072   1.00 0.00  ? 77  PHE A HD2  6  
ATOM   9757  H  HE1  . PHE A 1 77 ? 57.555 -0.803  1.540   1.00 0.00  ? 77  PHE A HE1  6  
ATOM   9758  H  HE2  . PHE A 1 77 ? 56.570 -1.695  5.625   1.00 0.00  ? 77  PHE A HE2  6  
ATOM   9759  H  HZ   . PHE A 1 77 ? 55.876 -0.963  3.357   1.00 0.00  ? 77  PHE A HZ   6  
ATOM   9760  N  N    . LEU A 1 78 ? 62.046 -0.244  6.561   1.00 0.00  ? 78  LEU A N    6  
ATOM   9761  C  CA   . LEU A 1 78 ? 61.775 0.680   7.714   1.00 0.00  ? 78  LEU A CA   6  
ATOM   9762  C  C    . LEU A 1 78 ? 62.264 2.102   7.395   1.00 0.00  ? 78  LEU A C    6  
ATOM   9763  O  O    . LEU A 1 78 ? 61.603 3.073   7.708   1.00 0.00  ? 78  LEU A O    6  
ATOM   9764  C  CB   . LEU A 1 78 ? 62.557 0.102   8.901   1.00 0.00  ? 78  LEU A CB   6  
ATOM   9765  C  CG   . LEU A 1 78 ? 61.864 -1.161  9.416   1.00 0.00  ? 78  LEU A CG   6  
ATOM   9766  C  CD1  . LEU A 1 78 ? 62.868 -2.010  10.195  1.00 0.00  ? 78  LEU A CD1  6  
ATOM   9767  C  CD2  . LEU A 1 78 ? 60.709 -0.773  10.340  1.00 0.00  ? 78  LEU A CD2  6  
ATOM   9768  H  H    . LEU A 1 78 ? 62.567 -1.063  6.704   1.00 0.00  ? 78  LEU A H    6  
ATOM   9769  H  HA   . LEU A 1 78 ? 60.721 0.691   7.943   1.00 0.00  ? 78  LEU A HA   6  
ATOM   9770  H  HB2  . LEU A 1 78 ? 63.561 -0.140  8.587   1.00 0.00  ? 78  LEU A HB2  6  
ATOM   9771  H  HB3  . LEU A 1 78 ? 62.596 0.836   9.693   1.00 0.00  ? 78  LEU A HB3  6  
ATOM   9772  H  HG   . LEU A 1 78 ? 61.484 -1.730  8.581   1.00 0.00  ? 78  LEU A HG   6  
ATOM   9773  H  HD11 . LEU A 1 78 ? 62.978 -1.613  11.193  1.00 0.00  ? 78  LEU A HD11 6  
ATOM   9774  H  HD12 . LEU A 1 78 ? 63.823 -1.990  9.693   1.00 0.00  ? 78  LEU A HD12 6  
ATOM   9775  H  HD13 . LEU A 1 78 ? 62.511 -3.027  10.250  1.00 0.00  ? 78  LEU A HD13 6  
ATOM   9776  H  HD21 . LEU A 1 78 ? 61.104 -0.360  11.256  1.00 0.00  ? 78  LEU A HD21 6  
ATOM   9777  H  HD22 . LEU A 1 78 ? 60.119 -1.650  10.565  1.00 0.00  ? 78  LEU A HD22 6  
ATOM   9778  H  HD23 . LEU A 1 78 ? 60.089 -0.037  9.851   1.00 0.00  ? 78  LEU A HD23 6  
ATOM   9779  N  N    . VAL A 1 79 ? 63.410 2.226   6.767   1.00 0.00  ? 79  VAL A N    6  
ATOM   9780  C  CA   . VAL A 1 79 ? 63.942 3.585   6.414   1.00 0.00  ? 79  VAL A CA   6  
ATOM   9781  C  C    . VAL A 1 79 ? 62.981 4.291   5.443   1.00 0.00  ? 79  VAL A C    6  
ATOM   9782  O  O    . VAL A 1 79 ? 62.807 5.493   5.494   1.00 0.00  ? 79  VAL A O    6  
ATOM   9783  C  CB   . VAL A 1 79 ? 65.301 3.327   5.746   1.00 0.00  ? 79  VAL A CB   6  
ATOM   9784  C  CG1  . VAL A 1 79 ? 65.856 4.632   5.170   1.00 0.00  ? 79  VAL A CG1  6  
ATOM   9785  C  CG2  . VAL A 1 79 ? 66.289 2.775   6.781   1.00 0.00  ? 79  VAL A CG2  6  
ATOM   9786  H  H    . VAL A 1 79 ? 63.919 1.424   6.521   1.00 0.00  ? 79  VAL A H    6  
ATOM   9787  H  HA   . VAL A 1 79 ? 64.073 4.179   7.304   1.00 0.00  ? 79  VAL A HA   6  
ATOM   9788  H  HB   . VAL A 1 79 ? 65.176 2.609   4.949   1.00 0.00  ? 79  VAL A HB   6  
ATOM   9789  H  HG11 . VAL A 1 79 ? 66.729 4.418   4.571   1.00 0.00  ? 79  VAL A HG11 6  
ATOM   9790  H  HG12 . VAL A 1 79 ? 66.128 5.295   5.976   1.00 0.00  ? 79  VAL A HG12 6  
ATOM   9791  H  HG13 . VAL A 1 79 ? 65.106 5.104   4.554   1.00 0.00  ? 79  VAL A HG13 6  
ATOM   9792  H  HG21 . VAL A 1 79 ? 67.168 2.401   6.275   1.00 0.00  ? 79  VAL A HG21 6  
ATOM   9793  H  HG22 . VAL A 1 79 ? 65.823 1.972   7.333   1.00 0.00  ? 79  VAL A HG22 6  
ATOM   9794  H  HG23 . VAL A 1 79 ? 66.575 3.563   7.463   1.00 0.00  ? 79  VAL A HG23 6  
ATOM   9795  N  N    . MET A 1 80 ? 62.354 3.549   4.566   1.00 0.00  ? 80  MET A N    6  
ATOM   9796  C  CA   . MET A 1 80 ? 61.398 4.167   3.599   1.00 0.00  ? 80  MET A CA   6  
ATOM   9797  C  C    . MET A 1 80 ? 60.097 4.564   4.315   1.00 0.00  ? 80  MET A C    6  
ATOM   9798  O  O    . MET A 1 80 ? 59.484 5.561   3.987   1.00 0.00  ? 80  MET A O    6  
ATOM   9799  C  CB   . MET A 1 80 ? 61.131 3.073   2.561   1.00 0.00  ? 80  MET A CB   6  
ATOM   9800  C  CG   . MET A 1 80 ? 60.490 3.688   1.314   1.00 0.00  ? 80  MET A CG   6  
ATOM   9801  S  SD   . MET A 1 80 ? 60.922 2.696   -0.137  1.00 0.00  ? 80  MET A SD   6  
ATOM   9802  C  CE   . MET A 1 80 ? 59.978 1.217   0.304   1.00 0.00  ? 80  MET A CE   6  
ATOM   9803  H  H    . MET A 1 80 ? 62.509 2.581   4.548   1.00 0.00  ? 80  MET A H    6  
ATOM   9804  H  HA   . MET A 1 80 ? 61.845 5.026   3.125   1.00 0.00  ? 80  MET A HA   6  
ATOM   9805  H  HB2  . MET A 1 80 ? 62.064 2.600   2.290   1.00 0.00  ? 80  MET A HB2  6  
ATOM   9806  H  HB3  . MET A 1 80 ? 60.462 2.337   2.980   1.00 0.00  ? 80  MET A HB3  6  
ATOM   9807  H  HG2  . MET A 1 80 ? 59.416 3.705   1.430   1.00 0.00  ? 80  MET A HG2  6  
ATOM   9808  H  HG3  . MET A 1 80 ? 60.853 4.696   1.181   1.00 0.00  ? 80  MET A HG3  6  
ATOM   9809  H  HE1  . MET A 1 80 ? 59.731 0.667   -0.592  1.00 0.00  ? 80  MET A HE1  6  
ATOM   9810  H  HE2  . MET A 1 80 ? 59.069 1.505   0.808   1.00 0.00  ? 80  MET A HE2  6  
ATOM   9811  H  HE3  . MET A 1 80 ? 60.569 0.597   0.961   1.00 0.00  ? 80  MET A HE3  6  
ATOM   9812  N  N    . MET A 1 81 ? 59.673 3.788   5.286   1.00 0.00  ? 81  MET A N    6  
ATOM   9813  C  CA   . MET A 1 81 ? 58.408 4.117   6.019   1.00 0.00  ? 81  MET A CA   6  
ATOM   9814  C  C    . MET A 1 81 ? 58.571 5.414   6.831   1.00 0.00  ? 81  MET A C    6  
ATOM   9815  O  O    . MET A 1 81 ? 57.721 6.284   6.791   1.00 0.00  ? 81  MET A O    6  
ATOM   9816  C  CB   . MET A 1 81 ? 58.147 2.925   6.952   1.00 0.00  ? 81  MET A CB   6  
ATOM   9817  C  CG   . MET A 1 81 ? 57.992 1.626   6.142   1.00 0.00  ? 81  MET A CG   6  
ATOM   9818  S  SD   . MET A 1 81 ? 57.345 1.983   4.487   1.00 0.00  ? 81  MET A SD   6  
ATOM   9819  C  CE   . MET A 1 81 ? 55.590 1.991   4.920   1.00 0.00  ? 81  MET A CE   6  
ATOM   9820  H  H    . MET A 1 81 ? 60.183 2.986   5.529   1.00 0.00  ? 81  MET A H    6  
ATOM   9821  H  HA   . MET A 1 81 ? 57.591 4.219   5.323   1.00 0.00  ? 81  MET A HA   6  
ATOM   9822  H  HB2  . MET A 1 81 ? 58.975 2.821   7.638   1.00 0.00  ? 81  MET A HB2  6  
ATOM   9823  H  HB3  . MET A 1 81 ? 57.241 3.105   7.511   1.00 0.00  ? 81  MET A HB3  6  
ATOM   9824  H  HG2  . MET A 1 81 ? 58.952 1.142   6.052   1.00 0.00  ? 81  MET A HG2  6  
ATOM   9825  H  HG3  . MET A 1 81 ? 57.309 0.965   6.656   1.00 0.00  ? 81  MET A HG3  6  
ATOM   9826  H  HE1  . MET A 1 81 ? 55.024 2.424   4.108   1.00 0.00  ? 81  MET A HE1  6  
ATOM   9827  H  HE2  . MET A 1 81 ? 55.441 2.577   5.812   1.00 0.00  ? 81  MET A HE2  6  
ATOM   9828  H  HE3  . MET A 1 81 ? 55.260 0.977   5.097   1.00 0.00  ? 81  MET A HE3  6  
ATOM   9829  N  N    . VAL A 1 82 ? 59.652 5.554   7.564   1.00 0.00  ? 82  VAL A N    6  
ATOM   9830  C  CA   . VAL A 1 82 ? 59.855 6.806   8.372   1.00 0.00  ? 82  VAL A CA   6  
ATOM   9831  C  C    . VAL A 1 82 ? 59.956 8.031   7.448   1.00 0.00  ? 82  VAL A C    6  
ATOM   9832  O  O    . VAL A 1 82 ? 59.529 9.114   7.801   1.00 0.00  ? 82  VAL A O    6  
ATOM   9833  C  CB   . VAL A 1 82 ? 61.160 6.610   9.162   1.00 0.00  ? 82  VAL A CB   6  
ATOM   9834  C  CG1  . VAL A 1 82 ? 61.033 5.390   10.076  1.00 0.00  ? 82  VAL A CG1  6  
ATOM   9835  C  CG2  . VAL A 1 82 ? 62.338 6.404   8.204   1.00 0.00  ? 82  VAL A CG2  6  
ATOM   9836  H  H    . VAL A 1 82 ? 60.326 4.841   7.583   1.00 0.00  ? 82  VAL A H    6  
ATOM   9837  H  HA   . VAL A 1 82 ? 59.033 6.935   9.060   1.00 0.00  ? 82  VAL A HA   6  
ATOM   9838  H  HB   . VAL A 1 82 ? 61.342 7.486   9.768   1.00 0.00  ? 82  VAL A HB   6  
ATOM   9839  H  HG11 . VAL A 1 82 ? 61.433 4.520   9.575   1.00 0.00  ? 82  VAL A HG11 6  
ATOM   9840  H  HG12 . VAL A 1 82 ? 59.991 5.222   10.311  1.00 0.00  ? 82  VAL A HG12 6  
ATOM   9841  H  HG13 . VAL A 1 82 ? 61.584 5.566   10.987  1.00 0.00  ? 82  VAL A HG13 6  
ATOM   9842  H  HG21 . VAL A 1 82 ? 62.202 5.483   7.657   1.00 0.00  ? 82  VAL A HG21 6  
ATOM   9843  H  HG22 . VAL A 1 82 ? 63.255 6.353   8.770   1.00 0.00  ? 82  VAL A HG22 6  
ATOM   9844  H  HG23 . VAL A 1 82 ? 62.389 7.231   7.511   1.00 0.00  ? 82  VAL A HG23 6  
ATOM   9845  N  N    . ARG A 1 83 ? 60.500 7.863   6.264   1.00 0.00  ? 83  ARG A N    6  
ATOM   9846  C  CA   . ARG A 1 83 ? 60.607 9.016   5.315   1.00 0.00  ? 83  ARG A CA   6  
ATOM   9847  C  C    . ARG A 1 83 ? 59.206 9.451   4.864   1.00 0.00  ? 83  ARG A C    6  
ATOM   9848  O  O    . ARG A 1 83 ? 58.946 10.622  4.664   1.00 0.00  ? 83  ARG A O    6  
ATOM   9849  C  CB   . ARG A 1 83 ? 61.422 8.487   4.131   1.00 0.00  ? 83  ARG A CB   6  
ATOM   9850  C  CG   . ARG A 1 83 ? 62.911 8.550   4.474   1.00 0.00  ? 83  ARG A CG   6  
ATOM   9851  C  CD   . ARG A 1 83 ? 63.741 8.304   3.213   1.00 0.00  ? 83  ARG A CD   6  
ATOM   9852  N  NE   . ARG A 1 83 ? 65.133 8.695   3.587   1.00 0.00  ? 83  ARG A NE   6  
ATOM   9853  C  CZ   . ARG A 1 83 ? 66.039 8.850   2.665   1.00 0.00  ? 83  ARG A CZ   6  
ATOM   9854  N  NH1  . ARG A 1 83 ? 65.979 9.870   1.859   1.00 0.00  ? 83  ARG A NH1  6  
ATOM   9855  N  NH2  . ARG A 1 83 ? 67.007 7.988   2.550   1.00 0.00  ? 83  ARG A NH2  6  
ATOM   9856  H  H    . ARG A 1 83 ? 60.825 6.978   5.997   1.00 0.00  ? 83  ARG A H    6  
ATOM   9857  H  HA   . ARG A 1 83 ? 61.124 9.841   5.781   1.00 0.00  ? 83  ARG A HA   6  
ATOM   9858  H  HB2  . ARG A 1 83 ? 61.140 7.463   3.927   1.00 0.00  ? 83  ARG A HB2  6  
ATOM   9859  H  HB3  . ARG A 1 83 ? 61.228 9.094   3.260   1.00 0.00  ? 83  ARG A HB3  6  
ATOM   9860  H  HG2  . ARG A 1 83 ? 63.144 9.525   4.874   1.00 0.00  ? 83  ARG A HG2  6  
ATOM   9861  H  HG3  . ARG A 1 83 ? 63.145 7.795   5.210   1.00 0.00  ? 83  ARG A HG3  6  
ATOM   9862  H  HD2  . ARG A 1 83 ? 63.700 7.259   2.935   1.00 0.00  ? 83  ARG A HD2  6  
ATOM   9863  H  HD3  . ARG A 1 83 ? 63.388 8.924   2.403   1.00 0.00  ? 83  ARG A HD3  6  
ATOM   9864  H  HE   . ARG A 1 83 ? 65.368 8.832   4.530   1.00 0.00  ? 83  ARG A HE   6  
ATOM   9865  H  HH11 . ARG A 1 83 ? 65.238 10.534  1.948   1.00 0.00  ? 83  ARG A HH11 6  
ATOM   9866  H  HH12 . ARG A 1 83 ? 66.671 9.986   1.146   1.00 0.00  ? 83  ARG A HH12 6  
ATOM   9867  H  HH21 . ARG A 1 83 ? 67.056 7.206   3.170   1.00 0.00  ? 83  ARG A HH21 6  
ATOM   9868  H  HH22 . ARG A 1 83 ? 67.701 8.107   1.839   1.00 0.00  ? 83  ARG A HH22 6  
ATOM   9869  N  N    . CYS A 1 84 ? 58.299 8.514   4.724   1.00 0.00  ? 84  CYS A N    6  
ATOM   9870  C  CA   . CYS A 1 84 ? 56.904 8.863   4.311   1.00 0.00  ? 84  CYS A CA   6  
ATOM   9871  C  C    . CYS A 1 84 ? 56.131 9.439   5.507   1.00 0.00  ? 84  CYS A C    6  
ATOM   9872  O  O    . CYS A 1 84 ? 55.230 10.242  5.346   1.00 0.00  ? 84  CYS A O    6  
ATOM   9873  C  CB   . CYS A 1 84 ? 56.281 7.540   3.857   1.00 0.00  ? 84  CYS A CB   6  
ATOM   9874  S  SG   . CYS A 1 84 ? 57.026 7.028   2.289   1.00 0.00  ? 84  CYS A SG   6  
ATOM   9875  H  H    . CYS A 1 84 ? 58.533 7.580   4.906   1.00 0.00  ? 84  CYS A H    6  
ATOM   9876  H  HA   . CYS A 1 84 ? 56.916 9.566   3.493   1.00 0.00  ? 84  CYS A HA   6  
ATOM   9877  H  HB2  . CYS A 1 84 ? 56.461 6.782   4.605   1.00 0.00  ? 84  CYS A HB2  6  
ATOM   9878  H  HB3  . CYS A 1 84 ? 55.218 7.669   3.725   1.00 0.00  ? 84  CYS A HB3  6  
ATOM   9879  H  HG   . CYS A 1 84 ? 57.966 7.215   2.332   1.00 0.00  ? 84  CYS A HG   6  
ATOM   9880  N  N    . MET A 1 85 ? 56.483 9.031   6.705   1.00 0.00  ? 85  MET A N    6  
ATOM   9881  C  CA   . MET A 1 85 ? 55.781 9.548   7.922   1.00 0.00  ? 85  MET A CA   6  
ATOM   9882  C  C    . MET A 1 85 ? 56.252 10.974  8.259   1.00 0.00  ? 85  MET A C    6  
ATOM   9883  O  O    . MET A 1 85 ? 55.491 11.773  8.767   1.00 0.00  ? 85  MET A O    6  
ATOM   9884  C  CB   . MET A 1 85 ? 56.163 8.575   9.043   1.00 0.00  ? 85  MET A CB   6  
ATOM   9885  C  CG   . MET A 1 85 ? 55.322 7.300   8.929   1.00 0.00  ? 85  MET A CG   6  
ATOM   9886  S  SD   . MET A 1 85 ? 55.341 6.422   10.513  1.00 0.00  ? 85  MET A SD   6  
ATOM   9887  C  CE   . MET A 1 85 ? 56.876 5.502   10.243  1.00 0.00  ? 85  MET A CE   6  
ATOM   9888  H  H    . MET A 1 85 ? 57.212 8.383   6.803   1.00 0.00  ? 85  MET A H    6  
ATOM   9889  H  HA   . MET A 1 85 ? 54.712 9.533   7.772   1.00 0.00  ? 85  MET A HA   6  
ATOM   9890  H  HB2  . MET A 1 85 ? 57.211 8.324   8.960   1.00 0.00  ? 85  MET A HB2  6  
ATOM   9891  H  HB3  . MET A 1 85 ? 55.980 9.040   10.000  1.00 0.00  ? 85  MET A HB3  6  
ATOM   9892  H  HG2  . MET A 1 85 ? 54.305 7.560   8.674   1.00 0.00  ? 85  MET A HG2  6  
ATOM   9893  H  HG3  . MET A 1 85 ? 55.733 6.664   8.160   1.00 0.00  ? 85  MET A HG3  6  
ATOM   9894  H  HE1  . MET A 1 85 ? 56.710 4.454   10.453  1.00 0.00  ? 85  MET A HE1  6  
ATOM   9895  H  HE2  . MET A 1 85 ? 57.644 5.881   10.899  1.00 0.00  ? 85  MET A HE2  6  
ATOM   9896  H  HE3  . MET A 1 85 ? 57.191 5.623   9.216   1.00 0.00  ? 85  MET A HE3  6  
ATOM   9897  N  N    . LYS A 1 86 ? 57.501 11.291  7.980   1.00 0.00  ? 86  LYS A N    6  
ATOM   9898  C  CA   . LYS A 1 86 ? 58.041 12.662  8.278   1.00 0.00  ? 86  LYS A CA   6  
ATOM   9899  C  C    . LYS A 1 86 ? 57.945 12.971  9.783   1.00 0.00  ? 86  LYS A C    6  
ATOM   9900  O  O    . LYS A 1 86 ? 57.096 13.722  10.226  1.00 0.00  ? 86  LYS A O    6  
ATOM   9901  C  CB   . LYS A 1 86 ? 57.176 13.632  7.458   1.00 0.00  ? 86  LYS A CB   6  
ATOM   9902  C  CG   . LYS A 1 86 ? 58.074 14.612  6.698   1.00 0.00  ? 86  LYS A CG   6  
ATOM   9903  C  CD   . LYS A 1 86 ? 58.699 15.607  7.680   1.00 0.00  ? 86  LYS A CD   6  
ATOM   9904  C  CE   . LYS A 1 86 ? 59.466 16.685  6.905   1.00 0.00  ? 86  LYS A CE   6  
ATOM   9905  N  NZ   . LYS A 1 86 ? 59.869 17.691  7.931   1.00 0.00  ? 86  LYS A NZ   6  
ATOM   9906  H  H    . LYS A 1 86 ? 58.089 10.622  7.571   1.00 0.00  ? 86  LYS A H    6  
ATOM   9907  H  HA   . LYS A 1 86 ? 59.068 12.731  7.955   1.00 0.00  ? 86  LYS A HA   6  
ATOM   9908  H  HB2  . LYS A 1 86 ? 56.578 13.072  6.754   1.00 0.00  ? 86  LYS A HB2  6  
ATOM   9909  H  HB3  . LYS A 1 86 ? 56.525 14.183  8.121   1.00 0.00  ? 86  LYS A HB3  6  
ATOM   9910  H  HG2  . LYS A 1 86 ? 58.856 14.065  6.191   1.00 0.00  ? 86  LYS A HG2  6  
ATOM   9911  H  HG3  . LYS A 1 86 ? 57.484 15.151  5.972   1.00 0.00  ? 86  LYS A HG3  6  
ATOM   9912  H  HD2  . LYS A 1 86 ? 57.919 16.072  8.266   1.00 0.00  ? 86  LYS A HD2  6  
ATOM   9913  H  HD3  . LYS A 1 86 ? 59.380 15.086  8.337   1.00 0.00  ? 86  LYS A HD3  6  
ATOM   9914  H  HE2  . LYS A 1 86 ? 60.340 16.255  6.433   1.00 0.00  ? 86  LYS A HE2  6  
ATOM   9915  H  HE3  . LYS A 1 86 ? 58.827 17.145  6.168   1.00 0.00  ? 86  LYS A HE3  6  
ATOM   9916  H  HZ1  . LYS A 1 86 ? 60.847 17.505  8.237   1.00 0.00  ? 86  LYS A HZ1  6  
ATOM   9917  H  HZ2  . LYS A 1 86 ? 59.233 17.629  8.755   1.00 0.00  ? 86  LYS A HZ2  6  
ATOM   9918  H  HZ3  . LYS A 1 86 ? 59.814 18.647  7.525   1.00 0.00  ? 86  LYS A HZ3  6  
ATOM   9919  N  N    . ASP A 1 87 ? 58.819 12.393  10.569  1.00 0.00  ? 87  ASP A N    6  
ATOM   9920  C  CA   . ASP A 1 87 ? 58.794 12.642  12.048  1.00 0.00  ? 87  ASP A CA   6  
ATOM   9921  C  C    . ASP A 1 87 ? 59.398 14.019  12.390  1.00 0.00  ? 87  ASP A C    6  
ATOM   9922  O  O    . ASP A 1 87 ? 59.065 14.611  13.400  1.00 0.00  ? 87  ASP A O    6  
ATOM   9923  C  CB   . ASP A 1 87 ? 59.633 11.509  12.662  1.00 0.00  ? 87  ASP A CB   6  
ATOM   9924  C  CG   . ASP A 1 87 ? 61.073 11.572  12.141  1.00 0.00  ? 87  ASP A CG   6  
ATOM   9925  O  OD1  . ASP A 1 87 ? 61.317 11.044  11.070  1.00 0.00  ? 87  ASP A OD1  6  
ATOM   9926  O  OD2  . ASP A 1 87 ? 61.904 12.147  12.824  1.00 0.00  ? 87  ASP A OD2  6  
ATOM   9927  H  H    . ASP A 1 87 ? 59.494 11.793  10.186  1.00 0.00  ? 87  ASP A H    6  
ATOM   9928  H  HA   . ASP A 1 87 ? 57.782 12.583  12.415  1.00 0.00  ? 87  ASP A HA   6  
ATOM   9929  H  HB2  . ASP A 1 87 ? 59.638 11.611  13.738  1.00 0.00  ? 87  ASP A HB2  6  
ATOM   9930  H  HB3  . ASP A 1 87 ? 59.199 10.558  12.395  1.00 0.00  ? 87  ASP A HB3  6  
ATOM   9931  N  N    . ASP A 1 88 ? 60.280 14.532  11.564  1.00 0.00  ? 88  ASP A N    6  
ATOM   9932  C  CA   . ASP A 1 88 ? 60.896 15.865  11.854  1.00 0.00  ? 88  ASP A CA   6  
ATOM   9933  C  C    . ASP A 1 88 ? 60.009 17.003  11.318  1.00 0.00  ? 88  ASP A C    6  
ATOM   9934  O  O    . ASP A 1 88 ? 59.130 16.789  10.503  1.00 0.00  ? 88  ASP A O    6  
ATOM   9935  C  CB   . ASP A 1 88 ? 62.262 15.848  11.147  1.00 0.00  ? 88  ASP A CB   6  
ATOM   9936  C  CG   . ASP A 1 88 ? 62.076 15.824  9.628   1.00 0.00  ? 88  ASP A CG   6  
ATOM   9937  O  OD1  . ASP A 1 88 ? 61.681 14.792  9.114   1.00 0.00  ? 88  ASP A OD1  6  
ATOM   9938  O  OD2  . ASP A 1 88 ? 62.331 16.839  9.003   1.00 0.00  ? 88  ASP A OD2  6  
ATOM   9939  H  H    . ASP A 1 88 ? 60.538 14.040  10.756  1.00 0.00  ? 88  ASP A H    6  
ATOM   9940  H  HA   . ASP A 1 88 ? 61.041 15.981  12.916  1.00 0.00  ? 88  ASP A HA   6  
ATOM   9941  H  HB2  . ASP A 1 88 ? 62.819 16.731  11.424  1.00 0.00  ? 88  ASP A HB2  6  
ATOM   9942  H  HB3  . ASP A 1 88 ? 62.811 14.970  11.453  1.00 0.00  ? 88  ASP A HB3  6  
ATOM   9943  N  N    . SER A 1 89 ? 60.237 18.206  11.782  1.00 0.00  ? 89  SER A N    6  
ATOM   9944  C  CA   . SER A 1 89 ? 59.414 19.371  11.320  1.00 0.00  ? 89  SER A CA   6  
ATOM   9945  C  C    . SER A 1 89 ? 59.882 19.861  9.944   1.00 0.00  ? 89  SER A C    6  
ATOM   9946  O  O    . SER A 1 89 ? 59.028 20.148  9.121   1.00 0.00  ? 89  SER A O    6  
ATOM   9947  C  CB   . SER A 1 89 ? 59.632 20.457  12.376  1.00 0.00  ? 89  SER A CB   6  
ATOM   9948  O  OG   . SER A 1 89 ? 59.160 19.989  13.634  1.00 0.00  ? 89  SER A OG   6  
ATOM   9949  O  OXT  . SER A 1 89 ? 61.082 19.938  9.733   1.00 0.00  ? 89  SER A OXT  6  
ATOM   9950  H  H    . SER A 1 89 ? 60.950 18.344  12.440  1.00 0.00  ? 89  SER A H    6  
ATOM   9951  H  HA   . SER A 1 89 ? 58.370 19.101  11.285  1.00 0.00  ? 89  SER A HA   6  
ATOM   9952  H  HB2  . SER A 1 89 ? 60.684 20.682  12.451  1.00 0.00  ? 89  SER A HB2  6  
ATOM   9953  H  HB3  . SER A 1 89 ? 59.095 21.350  12.086  1.00 0.00  ? 89  SER A HB3  6  
ATOM   9954  H  HG   . SER A 1 89 ? 59.259 20.698  14.273  1.00 0.00  ? 89  SER A HG   6  
ATOM   9955  N  N    . ARG B 2 1  ? 58.176 14.104  -1.165  1.00 0.00  ? 144 ARG B N    6  
ATOM   9956  C  CA   . ARG B 2 1  ? 57.588 15.126  -2.090  1.00 0.00  ? 144 ARG B CA   6  
ATOM   9957  C  C    . ARG B 2 1  ? 57.268 14.511  -3.465  1.00 0.00  ? 144 ARG B C    6  
ATOM   9958  O  O    . ARG B 2 1  ? 56.341 14.930  -4.132  1.00 0.00  ? 144 ARG B O    6  
ATOM   9959  C  CB   . ARG B 2 1  ? 58.637 16.250  -2.205  1.00 0.00  ? 144 ARG B CB   6  
ATOM   9960  C  CG   . ARG B 2 1  ? 59.912 15.757  -2.905  1.00 0.00  ? 144 ARG B CG   6  
ATOM   9961  C  CD   . ARG B 2 1  ? 61.133 16.117  -2.050  1.00 0.00  ? 144 ARG B CD   6  
ATOM   9962  N  NE   . ARG B 2 1  ? 62.299 15.501  -2.751  1.00 0.00  ? 144 ARG B NE   6  
ATOM   9963  C  CZ   . ARG B 2 1  ? 62.425 14.204  -2.809  1.00 0.00  ? 144 ARG B CZ   6  
ATOM   9964  N  NH1  . ARG B 2 1  ? 62.758 13.531  -1.743  1.00 0.00  ? 144 ARG B NH1  6  
ATOM   9965  N  NH2  . ARG B 2 1  ? 62.220 13.583  -3.936  1.00 0.00  ? 144 ARG B NH2  6  
ATOM   9966  H  H1   . ARG B 2 1  ? 57.562 13.265  -1.142  1.00 0.00  ? 144 ARG B H1   6  
ATOM   9967  H  H2   . ARG B 2 1  ? 58.249 14.504  -0.207  1.00 0.00  ? 144 ARG B H2   6  
ATOM   9968  H  H3   . ARG B 2 1  ? 59.121 13.828  -1.497  1.00 0.00  ? 144 ARG B H3   6  
ATOM   9969  H  HA   . ARG B 2 1  ? 56.685 15.527  -1.657  1.00 0.00  ? 144 ARG B HA   6  
ATOM   9970  H  HB2  . ARG B 2 1  ? 58.218 17.068  -2.772  1.00 0.00  ? 144 ARG B HB2  6  
ATOM   9971  H  HB3  . ARG B 2 1  ? 58.889 16.600  -1.214  1.00 0.00  ? 144 ARG B HB3  6  
ATOM   9972  H  HG2  . ARG B 2 1  ? 59.868 14.688  -3.039  1.00 0.00  ? 144 ARG B HG2  6  
ATOM   9973  H  HG3  . ARG B 2 1  ? 60.000 16.237  -3.869  1.00 0.00  ? 144 ARG B HG3  6  
ATOM   9974  H  HD2  . ARG B 2 1  ? 61.248 17.192  -1.996  1.00 0.00  ? 144 ARG B HD2  6  
ATOM   9975  H  HD3  . ARG B 2 1  ? 61.034 15.700  -1.059  1.00 0.00  ? 144 ARG B HD3  6  
ATOM   9976  H  HE   . ARG B 2 1  ? 62.976 16.074  -3.169  1.00 0.00  ? 144 ARG B HE   6  
ATOM   9977  H  HH11 . ARG B 2 1  ? 62.917 14.008  -0.881  1.00 0.00  ? 144 ARG B HH11 6  
ATOM   9978  H  HH12 . ARG B 2 1  ? 62.853 12.535  -1.788  1.00 0.00  ? 144 ARG B HH12 6  
ATOM   9979  H  HH21 . ARG B 2 1  ? 61.969 14.101  -4.753  1.00 0.00  ? 144 ARG B HH21 6  
ATOM   9980  H  HH22 . ARG B 2 1  ? 62.309 12.589  -3.984  1.00 0.00  ? 144 ARG B HH22 6  
ATOM   9981  N  N    . ARG B 2 2  ? 58.012 13.517  -3.888  1.00 0.00  ? 145 ARG B N    6  
ATOM   9982  C  CA   . ARG B 2 2  ? 57.732 12.880  -5.210  1.00 0.00  ? 145 ARG B CA   6  
ATOM   9983  C  C    . ARG B 2 2  ? 56.763 11.700  -5.032  1.00 0.00  ? 145 ARG B C    6  
ATOM   9984  O  O    . ARG B 2 2  ? 57.162 10.612  -4.665  1.00 0.00  ? 145 ARG B O    6  
ATOM   9985  C  CB   . ARG B 2 2  ? 59.097 12.403  -5.715  1.00 0.00  ? 145 ARG B CB   6  
ATOM   9986  C  CG   . ARG B 2 2  ? 59.076 12.319  -7.244  1.00 0.00  ? 145 ARG B CG   6  
ATOM   9987  C  CD   . ARG B 2 2  ? 58.797 10.876  -7.675  1.00 0.00  ? 145 ARG B CD   6  
ATOM   9988  N  NE   . ARG B 2 2  ? 57.508 10.938  -8.423  1.00 0.00  ? 145 ARG B NE   6  
ATOM   9989  C  CZ   . ARG B 2 2  ? 57.296 10.143  -9.434  1.00 0.00  ? 145 ARG B CZ   6  
ATOM   9990  N  NH1  . ARG B 2 2  ? 56.897 8.922   -9.227  1.00 0.00  ? 145 ARG B NH1  6  
ATOM   9991  N  NH2  . ARG B 2 2  ? 57.489 10.568  -10.649 1.00 0.00  ? 145 ARG B NH2  6  
ATOM   9992  H  H    . ARG B 2 2  ? 58.747 13.185  -3.335  1.00 0.00  ? 145 ARG B H    6  
ATOM   9993  H  HA   . ARG B 2 2  ? 57.319 13.604  -5.895  1.00 0.00  ? 145 ARG B HA   6  
ATOM   9994  H  HB2  . ARG B 2 2  ? 59.860 13.102  -5.402  1.00 0.00  ? 145 ARG B HB2  6  
ATOM   9995  H  HB3  . ARG B 2 2  ? 59.312 11.428  -5.304  1.00 0.00  ? 145 ARG B HB3  6  
ATOM   9996  H  HG2  . ARG B 2 2  ? 58.302 12.967  -7.629  1.00 0.00  ? 145 ARG B HG2  6  
ATOM   9997  H  HG3  . ARG B 2 2  ? 60.032 12.630  -7.634  1.00 0.00  ? 145 ARG B HG3  6  
ATOM   9998  H  HD2  . ARG B 2 2  ? 59.593 10.518  -8.315  1.00 0.00  ? 145 ARG B HD2  6  
ATOM   9999  H  HD3  . ARG B 2 2  ? 58.693 10.239  -6.809  1.00 0.00  ? 145 ARG B HD3  6  
ATOM   10000 H  HE   . ARG B 2 2  ? 56.813 11.577  -8.152  1.00 0.00  ? 145 ARG B HE   6  
ATOM   10001 H  HH11 . ARG B 2 2  ? 56.756 8.593   -8.295  1.00 0.00  ? 145 ARG B HH11 6  
ATOM   10002 H  HH12 . ARG B 2 2  ? 56.726 8.314   -10.002 1.00 0.00  ? 145 ARG B HH12 6  
ATOM   10003 H  HH21 . ARG B 2 2  ? 57.801 11.504  -10.808 1.00 0.00  ? 145 ARG B HH21 6  
ATOM   10004 H  HH22 . ARG B 2 2  ? 57.325 9.959   -11.425 1.00 0.00  ? 145 ARG B HH22 6  
ATOM   10005 N  N    . VAL B 2 3  ? 55.490 11.928  -5.290  1.00 0.00  ? 146 VAL B N    6  
ATOM   10006 C  CA   . VAL B 2 3  ? 54.443 10.854  -5.146  1.00 0.00  ? 146 VAL B CA   6  
ATOM   10007 C  C    . VAL B 2 3  ? 54.291 10.429  -3.671  1.00 0.00  ? 146 VAL B C    6  
ATOM   10008 O  O    . VAL B 2 3  ? 55.248 10.373  -2.923  1.00 0.00  ? 146 VAL B O    6  
ATOM   10009 C  CB   . VAL B 2 3  ? 54.906 9.682   -6.037  1.00 0.00  ? 146 VAL B CB   6  
ATOM   10010 C  CG1  . VAL B 2 3  ? 54.308 8.360   -5.539  1.00 0.00  ? 146 VAL B CG1  6  
ATOM   10011 C  CG2  . VAL B 2 3  ? 54.436 9.929   -7.473  1.00 0.00  ? 146 VAL B CG2  6  
ATOM   10012 H  H    . VAL B 2 3  ? 55.216 12.823  -5.578  1.00 0.00  ? 146 VAL B H    6  
ATOM   10013 H  HA   . VAL B 2 3  ? 53.498 11.226  -5.510  1.00 0.00  ? 146 VAL B HA   6  
ATOM   10014 H  HB   . VAL B 2 3  ? 55.983 9.616   -6.020  1.00 0.00  ? 146 VAL B HB   6  
ATOM   10015 H  HG11 . VAL B 2 3  ? 54.975 7.913   -4.817  1.00 0.00  ? 146 VAL B HG11 6  
ATOM   10016 H  HG12 . VAL B 2 3  ? 54.179 7.686   -6.374  1.00 0.00  ? 146 VAL B HG12 6  
ATOM   10017 H  HG13 . VAL B 2 3  ? 53.350 8.548   -5.079  1.00 0.00  ? 146 VAL B HG13 6  
ATOM   10018 H  HG21 . VAL B 2 3  ? 54.767 9.118   -8.105  1.00 0.00  ? 146 VAL B HG21 6  
ATOM   10019 H  HG22 . VAL B 2 3  ? 54.849 10.859  -7.833  1.00 0.00  ? 146 VAL B HG22 6  
ATOM   10020 H  HG23 . VAL B 2 3  ? 53.357 9.982   -7.494  1.00 0.00  ? 146 VAL B HG23 6  
ATOM   10021 N  N    . ARG B 2 4  ? 53.083 10.138  -3.250  1.00 0.00  ? 147 ARG B N    6  
ATOM   10022 C  CA   . ARG B 2 4  ? 52.855 9.723   -1.831  1.00 0.00  ? 147 ARG B CA   6  
ATOM   10023 C  C    . ARG B 2 4  ? 51.853 8.562   -1.768  1.00 0.00  ? 147 ARG B C    6  
ATOM   10024 O  O    . ARG B 2 4  ? 50.766 8.642   -2.309  1.00 0.00  ? 147 ARG B O    6  
ATOM   10025 C  CB   . ARG B 2 4  ? 52.277 10.968  -1.149  1.00 0.00  ? 147 ARG B CB   6  
ATOM   10026 C  CG   . ARG B 2 4  ? 52.873 11.114  0.253   1.00 0.00  ? 147 ARG B CG   6  
ATOM   10027 C  CD   . ARG B 2 4  ? 52.221 12.306  0.959   1.00 0.00  ? 147 ARG B CD   6  
ATOM   10028 N  NE   . ARG B 2 4  ? 51.463 11.719  2.105   1.00 0.00  ? 147 ARG B NE   6  
ATOM   10029 C  CZ   . ARG B 2 4  ? 52.090 11.321  3.180   1.00 0.00  ? 147 ARG B CZ   6  
ATOM   10030 N  NH1  . ARG B 2 4  ? 52.996 12.082  3.728   1.00 0.00  ? 147 ARG B NH1  6  
ATOM   10031 N  NH2  . ARG B 2 4  ? 51.795 10.169  3.713   1.00 0.00  ? 147 ARG B NH2  6  
ATOM   10032 H  H    . ARG B 2 4  ? 52.324 10.197  -3.869  1.00 0.00  ? 147 ARG B H    6  
ATOM   10033 H  HA   . ARG B 2 4  ? 53.785 9.445   -1.363  1.00 0.00  ? 147 ARG B HA   6  
ATOM   10034 H  HB2  . ARG B 2 4  ? 52.517 11.844  -1.735  1.00 0.00  ? 147 ARG B HB2  6  
ATOM   10035 H  HB3  . ARG B 2 4  ? 51.204 10.871  -1.072  1.00 0.00  ? 147 ARG B HB3  6  
ATOM   10036 H  HG2  . ARG B 2 4  ? 52.690 10.212  0.818   1.00 0.00  ? 147 ARG B HG2  6  
ATOM   10037 H  HG3  . ARG B 2 4  ? 53.937 11.281  0.176   1.00 0.00  ? 147 ARG B HG3  6  
ATOM   10038 H  HD2  . ARG B 2 4  ? 52.980 12.990  1.315   1.00 0.00  ? 147 ARG B HD2  6  
ATOM   10039 H  HD3  . ARG B 2 4  ? 51.543 12.814  0.289   1.00 0.00  ? 147 ARG B HD3  6  
ATOM   10040 H  HE   . ARG B 2 4  ? 50.488 11.630  2.050   1.00 0.00  ? 147 ARG B HE   6  
ATOM   10041 H  HH11 . ARG B 2 4  ? 53.209 12.972  3.328   1.00 0.00  ? 147 ARG B HH11 6  
ATOM   10042 H  HH12 . ARG B 2 4  ? 53.483 11.772  4.543   1.00 0.00  ? 147 ARG B HH12 6  
ATOM   10043 H  HH21 . ARG B 2 4  ? 51.089 9.592   3.301   1.00 0.00  ? 147 ARG B HH21 6  
ATOM   10044 H  HH22 . ARG B 2 4  ? 52.272 9.861   4.535   1.00 0.00  ? 147 ARG B HH22 6  
ATOM   10045 N  N    . ILE B 2 5  ? 52.211 7.485   -1.113  1.00 0.00  ? 148 ILE B N    6  
ATOM   10046 C  CA   . ILE B 2 5  ? 51.276 6.315   -1.017  1.00 0.00  ? 148 ILE B CA   6  
ATOM   10047 C  C    . ILE B 2 5  ? 50.702 6.174   0.407   1.00 0.00  ? 148 ILE B C    6  
ATOM   10048 O  O    . ILE B 2 5  ? 49.612 5.664   0.585   1.00 0.00  ? 148 ILE B O    6  
ATOM   10049 C  CB   . ILE B 2 5  ? 52.121 5.089   -1.409  1.00 0.00  ? 148 ILE B CB   6  
ATOM   10050 C  CG1  . ILE B 2 5  ? 51.192 3.957   -1.858  1.00 0.00  ? 148 ILE B CG1  6  
ATOM   10051 C  CG2  . ILE B 2 5  ? 52.965 4.608   -0.221  1.00 0.00  ? 148 ILE B CG2  6  
ATOM   10052 C  CD1  . ILE B 2 5  ? 51.644 3.429   -3.221  1.00 0.00  ? 148 ILE B CD1  6  
ATOM   10053 H  H    . ILE B 2 5  ? 53.092 7.444   -0.687  1.00 0.00  ? 148 ILE B H    6  
ATOM   10054 H  HA   . ILE B 2 5  ? 50.469 6.434   -1.724  1.00 0.00  ? 148 ILE B HA   6  
ATOM   10055 H  HB   . ILE B 2 5  ? 52.777 5.357   -2.225  1.00 0.00  ? 148 ILE B HB   6  
ATOM   10056 H  HG12 . ILE B 2 5  ? 51.225 3.157   -1.133  1.00 0.00  ? 148 ILE B HG12 6  
ATOM   10057 H  HG13 . ILE B 2 5  ? 50.181 4.329   -1.936  1.00 0.00  ? 148 ILE B HG13 6  
ATOM   10058 H  HG21 . ILE B 2 5  ? 52.314 4.236   0.557   1.00 0.00  ? 148 ILE B HG21 6  
ATOM   10059 H  HG22 . ILE B 2 5  ? 53.552 5.429   0.161   1.00 0.00  ? 148 ILE B HG22 6  
ATOM   10060 H  HG23 . ILE B 2 5  ? 53.623 3.815   -0.547  1.00 0.00  ? 148 ILE B HG23 6  
ATOM   10061 H  HD11 . ILE B 2 5  ? 50.994 3.817   -3.991  1.00 0.00  ? 148 ILE B HD11 6  
ATOM   10062 H  HD12 . ILE B 2 5  ? 51.598 2.350   -3.221  1.00 0.00  ? 148 ILE B HD12 6  
ATOM   10063 H  HD13 . ILE B 2 5  ? 52.659 3.746   -3.412  1.00 0.00  ? 148 ILE B HD13 6  
ATOM   10064 N  N    . SER B 2 6  ? 51.429 6.625   1.414   1.00 0.00  ? 149 SER B N    6  
ATOM   10065 C  CA   . SER B 2 6  ? 50.947 6.532   2.837   1.00 0.00  ? 149 SER B CA   6  
ATOM   10066 C  C    . SER B 2 6  ? 50.813 5.066   3.283   1.00 0.00  ? 149 SER B C    6  
ATOM   10067 O  O    . SER B 2 6  ? 49.940 4.346   2.839   1.00 0.00  ? 149 SER B O    6  
ATOM   10068 C  CB   . SER B 2 6  ? 49.588 7.243   2.867   1.00 0.00  ? 149 SER B CB   6  
ATOM   10069 O  OG   . SER B 2 6  ? 49.615 8.256   3.865   1.00 0.00  ? 149 SER B OG   6  
ATOM   10070 H  H    . SER B 2 6  ? 52.300 7.031   1.233   1.00 0.00  ? 149 SER B H    6  
ATOM   10071 H  HA   . SER B 2 6  ? 51.634 7.047   3.490   1.00 0.00  ? 149 SER B HA   6  
ATOM   10072 H  HB2  . SER B 2 6  ? 49.393 7.695   1.908   1.00 0.00  ? 149 SER B HB2  6  
ATOM   10073 H  HB3  . SER B 2 6  ? 48.809 6.523   3.088   1.00 0.00  ? 149 SER B HB3  6  
ATOM   10074 H  HG   . SER B 2 6  ? 49.134 7.928   4.634   1.00 0.00  ? 149 SER B HG   6  
ATOM   10075 N  N    . ALA B 2 7  ? 51.680 4.626   4.164   1.00 0.00  ? 150 ALA B N    6  
ATOM   10076 C  CA   . ALA B 2 7  ? 51.624 3.209   4.657   1.00 0.00  ? 150 ALA B CA   6  
ATOM   10077 C  C    . ALA B 2 7  ? 50.236 2.885   5.232   1.00 0.00  ? 150 ALA B C    6  
ATOM   10078 O  O    . ALA B 2 7  ? 49.689 1.828   4.983   1.00 0.00  ? 150 ALA B O    6  
ATOM   10079 C  CB   . ALA B 2 7  ? 52.691 3.128   5.753   1.00 0.00  ? 150 ALA B CB   6  
ATOM   10080 H  H    . ALA B 2 7  ? 52.372 5.232   4.506   1.00 0.00  ? 150 ALA B H    6  
ATOM   10081 H  HA   . ALA B 2 7  ? 51.866 2.526   3.859   1.00 0.00  ? 150 ALA B HA   6  
ATOM   10082 H  HB1  . ALA B 2 7  ? 53.597 3.603   5.408   1.00 0.00  ? 150 ALA B HB1  6  
ATOM   10083 H  HB2  . ALA B 2 7  ? 52.892 2.092   5.985   1.00 0.00  ? 150 ALA B HB2  6  
ATOM   10084 H  HB3  . ALA B 2 7  ? 52.335 3.633   6.640   1.00 0.00  ? 150 ALA B HB3  6  
ATOM   10085 N  N    . ASP B 2 8  ? 49.669 3.790   5.994   1.00 0.00  ? 151 ASP B N    6  
ATOM   10086 C  CA   . ASP B 2 8  ? 48.311 3.549   6.588   1.00 0.00  ? 151 ASP B CA   6  
ATOM   10087 C  C    . ASP B 2 8  ? 47.294 3.180   5.492   1.00 0.00  ? 151 ASP B C    6  
ATOM   10088 O  O    . ASP B 2 8  ? 46.456 2.317   5.683   1.00 0.00  ? 151 ASP B O    6  
ATOM   10089 C  CB   . ASP B 2 8  ? 47.925 4.872   7.274   1.00 0.00  ? 151 ASP B CB   6  
ATOM   10090 C  CG   . ASP B 2 8  ? 48.082 6.048   6.301   1.00 0.00  ? 151 ASP B CG   6  
ATOM   10091 O  OD1  . ASP B 2 8  ? 49.189 6.549   6.181   1.00 0.00  ? 151 ASP B OD1  6  
ATOM   10092 O  OD2  . ASP B 2 8  ? 47.096 6.427   5.694   1.00 0.00  ? 151 ASP B OD2  6  
ATOM   10093 H  H    . ASP B 2 8  ? 50.136 4.633   6.175   1.00 0.00  ? 151 ASP B H    6  
ATOM   10094 H  HA   . ASP B 2 8  ? 48.364 2.761   7.322   1.00 0.00  ? 151 ASP B HA   6  
ATOM   10095 H  HB2  . ASP B 2 8  ? 46.897 4.816   7.601   1.00 0.00  ? 151 ASP B HB2  6  
ATOM   10096 H  HB3  . ASP B 2 8  ? 48.564 5.030   8.129   1.00 0.00  ? 151 ASP B HB3  6  
ATOM   10097 N  N    . ALA B 2 9  ? 47.369 3.817   4.349   1.00 0.00  ? 152 ALA B N    6  
ATOM   10098 C  CA   . ALA B 2 9  ? 46.418 3.500   3.239   1.00 0.00  ? 152 ALA B CA   6  
ATOM   10099 C  C    . ALA B 2 9  ? 46.958 2.341   2.389   1.00 0.00  ? 152 ALA B C    6  
ATOM   10100 O  O    . ALA B 2 9  ? 46.217 1.469   1.972   1.00 0.00  ? 152 ALA B O    6  
ATOM   10101 C  CB   . ALA B 2 9  ? 46.334 4.784   2.410   1.00 0.00  ? 152 ALA B CB   6  
ATOM   10102 H  H    . ALA B 2 9  ? 48.058 4.503   4.218   1.00 0.00  ? 152 ALA B H    6  
ATOM   10103 H  HA   . ALA B 2 9  ? 45.445 3.254   3.635   1.00 0.00  ? 152 ALA B HA   6  
ATOM   10104 H  HB1  . ALA B 2 9  ? 47.154 4.814   1.708   1.00 0.00  ? 152 ALA B HB1  6  
ATOM   10105 H  HB2  . ALA B 2 9  ? 46.390 5.641   3.066   1.00 0.00  ? 152 ALA B HB2  6  
ATOM   10106 H  HB3  . ALA B 2 9  ? 45.398 4.804   1.871   1.00 0.00  ? 152 ALA B HB3  6  
ATOM   10107 N  N    . MET B 2 10 ? 48.245 2.327   2.133   1.00 0.00  ? 153 MET B N    6  
ATOM   10108 C  CA   . MET B 2 10 ? 48.851 1.229   1.313   1.00 0.00  ? 153 MET B CA   6  
ATOM   10109 C  C    . MET B 2 10 ? 48.623 -0.135  1.982   1.00 0.00  ? 153 MET B C    6  
ATOM   10110 O  O    . MET B 2 10 ? 48.254 -1.096  1.334   1.00 0.00  ? 153 MET B O    6  
ATOM   10111 C  CB   . MET B 2 10 ? 50.345 1.565   1.257   1.00 0.00  ? 153 MET B CB   6  
ATOM   10112 C  CG   . MET B 2 10 ? 51.030 0.715   0.185   1.00 0.00  ? 153 MET B CG   6  
ATOM   10113 S  SD   . MET B 2 10 ? 52.799 1.102   0.159   1.00 0.00  ? 153 MET B SD   6  
ATOM   10114 C  CE   . MET B 2 10 ? 53.050 0.940   -1.627  1.00 0.00  ? 153 MET B CE   6  
ATOM   10115 H  H    . MET B 2 10 ? 48.817 3.043   2.484   1.00 0.00  ? 153 MET B H    6  
ATOM   10116 H  HA   . MET B 2 10 ? 48.437 1.231   0.318   1.00 0.00  ? 153 MET B HA   6  
ATOM   10117 H  HB2  . MET B 2 10 ? 50.467 2.612   1.019   1.00 0.00  ? 153 MET B HB2  6  
ATOM   10118 H  HB3  . MET B 2 10 ? 50.795 1.361   2.217   1.00 0.00  ? 153 MET B HB3  6  
ATOM   10119 H  HG2  . MET B 2 10 ? 50.893 -0.332  0.411   1.00 0.00  ? 153 MET B HG2  6  
ATOM   10120 H  HG3  . MET B 2 10 ? 50.599 0.935   -0.781  1.00 0.00  ? 153 MET B HG3  6  
ATOM   10121 H  HE1  . MET B 2 10 ? 53.569 1.813   -1.998  1.00 0.00  ? 153 MET B HE1  6  
ATOM   10122 H  HE2  . MET B 2 10 ? 52.096 0.855   -2.121  1.00 0.00  ? 153 MET B HE2  6  
ATOM   10123 H  HE3  . MET B 2 10 ? 53.636 0.054   -1.828  1.00 0.00  ? 153 MET B HE3  6  
ATOM   10124 N  N    . MET B 2 11 ? 48.837 -0.221  3.273   1.00 0.00  ? 154 MET B N    6  
ATOM   10125 C  CA   . MET B 2 11 ? 48.630 -1.518  3.992   1.00 0.00  ? 154 MET B CA   6  
ATOM   10126 C  C    . MET B 2 11 ? 47.161 -1.953  3.900   1.00 0.00  ? 154 MET B C    6  
ATOM   10127 O  O    . MET B 2 11 ? 46.865 -3.105  3.656   1.00 0.00  ? 154 MET B O    6  
ATOM   10128 C  CB   . MET B 2 11 ? 49.019 -1.233  5.446   1.00 0.00  ? 154 MET B CB   6  
ATOM   10129 C  CG   . MET B 2 11 ? 49.292 -2.550  6.174   1.00 0.00  ? 154 MET B CG   6  
ATOM   10130 S  SD   . MET B 2 11 ? 49.851 -2.204  7.860   1.00 0.00  ? 154 MET B SD   6  
ATOM   10131 C  CE   . MET B 2 11 ? 49.679 -3.886  8.501   1.00 0.00  ? 154 MET B CE   6  
ATOM   10132 H  H    . MET B 2 11 ? 49.132 0.571   3.773   1.00 0.00  ? 154 MET B H    6  
ATOM   10133 H  HA   . MET B 2 11 ? 49.273 -2.282  3.582   1.00 0.00  ? 154 MET B HA   6  
ATOM   10134 H  HB2  . MET B 2 11 ? 49.909 -0.619  5.465   1.00 0.00  ? 154 MET B HB2  6  
ATOM   10135 H  HB3  . MET B 2 11 ? 48.212 -0.711  5.939   1.00 0.00  ? 154 MET B HB3  6  
ATOM   10136 H  HG2  . MET B 2 11 ? 48.385 -3.136  6.209   1.00 0.00  ? 154 MET B HG2  6  
ATOM   10137 H  HG3  . MET B 2 11 ? 50.057 -3.101  5.647   1.00 0.00  ? 154 MET B HG3  6  
ATOM   10138 H  HE1  . MET B 2 11 ? 48.657 -4.046  8.821   1.00 0.00  ? 154 MET B HE1  6  
ATOM   10139 H  HE2  . MET B 2 11 ? 50.341 -4.023  9.341   1.00 0.00  ? 154 MET B HE2  6  
ATOM   10140 H  HE3  . MET B 2 11 ? 49.933 -4.594  7.725   1.00 0.00  ? 154 MET B HE3  6  
ATOM   10141 N  N    . GLN B 2 12 ? 46.244 -1.035  4.090   1.00 0.00  ? 155 GLN B N    6  
ATOM   10142 C  CA   . GLN B 2 12 ? 44.789 -1.387  4.010   1.00 0.00  ? 155 GLN B CA   6  
ATOM   10143 C  C    . GLN B 2 12 ? 44.414 -1.812  2.583   1.00 0.00  ? 155 GLN B C    6  
ATOM   10144 O  O    . GLN B 2 12 ? 43.699 -2.775  2.388   1.00 0.00  ? 155 GLN B O    6  
ATOM   10145 C  CB   . GLN B 2 12 ? 44.043 -0.107  4.407   1.00 0.00  ? 155 GLN B CB   6  
ATOM   10146 C  CG   . GLN B 2 12 ? 42.963 -0.439  5.443   1.00 0.00  ? 155 GLN B CG   6  
ATOM   10147 C  CD   . GLN B 2 12 ? 43.619 -0.982  6.715   1.00 0.00  ? 155 GLN B CD   6  
ATOM   10148 O  OE1  . GLN B 2 12 ? 43.526 -2.157  7.004   1.00 0.00  ? 155 GLN B OE1  6  
ATOM   10149 N  NE2  . GLN B 2 12 ? 44.288 -0.175  7.491   1.00 0.00  ? 155 GLN B NE2  6  
ATOM   10150 H  H    . GLN B 2 12 ? 46.513 -0.112  4.281   1.00 0.00  ? 155 GLN B H    6  
ATOM   10151 H  HA   . GLN B 2 12 ? 44.558 -2.178  4.707   1.00 0.00  ? 155 GLN B HA   6  
ATOM   10152 H  HB2  . GLN B 2 12 ? 44.741 0.600   4.830   1.00 0.00  ? 155 GLN B HB2  6  
ATOM   10153 H  HB3  . GLN B 2 12 ? 43.580 0.324   3.532   1.00 0.00  ? 155 GLN B HB3  6  
ATOM   10154 H  HG2  . GLN B 2 12 ? 42.405 0.456   5.679   1.00 0.00  ? 155 GLN B HG2  6  
ATOM   10155 H  HG3  . GLN B 2 12 ? 42.293 -1.185  5.040   1.00 0.00  ? 155 GLN B HG3  6  
ATOM   10156 H  HE21 . GLN B 2 12 ? 44.371 0.773   7.259   1.00 0.00  ? 155 GLN B HE21 6  
ATOM   10157 H  HE22 . GLN B 2 12 ? 44.712 -0.519  8.304   1.00 0.00  ? 155 GLN B HE22 6  
ATOM   10158 N  N    . ALA B 2 13 ? 44.893 -1.105  1.587   1.00 0.00  ? 156 ALA B N    6  
ATOM   10159 C  CA   . ALA B 2 13 ? 44.565 -1.474  0.172   1.00 0.00  ? 156 ALA B CA   6  
ATOM   10160 C  C    . ALA B 2 13 ? 45.129 -2.862  -0.169  1.00 0.00  ? 156 ALA B C    6  
ATOM   10161 O  O    . ALA B 2 13 ? 44.531 -3.617  -0.913  1.00 0.00  ? 156 ALA B O    6  
ATOM   10162 C  CB   . ALA B 2 13 ? 45.229 -0.394  -0.689  1.00 0.00  ? 156 ALA B CB   6  
ATOM   10163 H  H    . ALA B 2 13 ? 45.471 -0.333  1.770   1.00 0.00  ? 156 ALA B H    6  
ATOM   10164 H  HA   . ALA B 2 13 ? 43.497 -1.458  0.019   1.00 0.00  ? 156 ALA B HA   6  
ATOM   10165 H  HB1  . ALA B 2 13 ? 44.934 -0.523  -1.720  1.00 0.00  ? 156 ALA B HB1  6  
ATOM   10166 H  HB2  . ALA B 2 13 ? 46.302 -0.477  -0.608  1.00 0.00  ? 156 ALA B HB2  6  
ATOM   10167 H  HB3  . ALA B 2 13 ? 44.916 0.581   -0.345  1.00 0.00  ? 156 ALA B HB3  6  
ATOM   10168 N  N    . LEU B 2 14 ? 46.272 -3.204  0.373   1.00 0.00  ? 157 LEU B N    6  
ATOM   10169 C  CA   . LEU B 2 14 ? 46.874 -4.542  0.085   1.00 0.00  ? 157 LEU B CA   6  
ATOM   10170 C  C    . LEU B 2 14 ? 46.222 -5.628  0.957   1.00 0.00  ? 157 LEU B C    6  
ATOM   10171 O  O    . LEU B 2 14 ? 45.808 -6.662  0.461   1.00 0.00  ? 157 LEU B O    6  
ATOM   10172 C  CB   . LEU B 2 14 ? 48.359 -4.386  0.425   1.00 0.00  ? 157 LEU B CB   6  
ATOM   10173 C  CG   . LEU B 2 14 ? 49.130 -5.628  -0.024  1.00 0.00  ? 157 LEU B CG   6  
ATOM   10174 C  CD1  . LEU B 2 14 ? 49.210 -5.663  -1.553  1.00 0.00  ? 157 LEU B CD1  6  
ATOM   10175 C  CD2  . LEU B 2 14 ? 50.543 -5.575  0.558   1.00 0.00  ? 157 LEU B CD2  6  
ATOM   10176 H  H    . LEU B 2 14 ? 46.734 -2.579  0.971   1.00 0.00  ? 157 LEU B H    6  
ATOM   10177 H  HA   . LEU B 2 14 ? 46.761 -4.786  -0.959  1.00 0.00  ? 157 LEU B HA   6  
ATOM   10178 H  HB2  . LEU B 2 14 ? 48.752 -3.516  -0.081  1.00 0.00  ? 157 LEU B HB2  6  
ATOM   10179 H  HB3  . LEU B 2 14 ? 48.471 -4.261  1.492   1.00 0.00  ? 157 LEU B HB3  6  
ATOM   10180 H  HG   . LEU B 2 14 ? 48.626 -6.515  0.331   1.00 0.00  ? 157 LEU B HG   6  
ATOM   10181 H  HD11 . LEU B 2 14 ? 48.218 -5.778  -1.962  1.00 0.00  ? 157 LEU B HD11 6  
ATOM   10182 H  HD12 . LEU B 2 14 ? 49.826 -6.495  -1.863  1.00 0.00  ? 157 LEU B HD12 6  
ATOM   10183 H  HD13 . LEU B 2 14 ? 49.643 -4.740  -1.912  1.00 0.00  ? 157 LEU B HD13 6  
ATOM   10184 H  HD21 . LEU B 2 14 ? 51.180 -4.997  -0.095  1.00 0.00  ? 157 LEU B HD21 6  
ATOM   10185 H  HD22 . LEU B 2 14 ? 50.935 -6.575  0.648   1.00 0.00  ? 157 LEU B HD22 6  
ATOM   10186 H  HD23 . LEU B 2 14 ? 50.513 -5.111  1.532   1.00 0.00  ? 157 LEU B HD23 6  
ATOM   10187 N  N    . LEU B 2 15 ? 46.123 -5.403  2.247   1.00 0.00  ? 158 LEU B N    6  
ATOM   10188 C  CA   . LEU B 2 15 ? 45.493 -6.424  3.146   1.00 0.00  ? 158 LEU B CA   6  
ATOM   10189 C  C    . LEU B 2 15 ? 43.979 -6.470  2.910   1.00 0.00  ? 158 LEU B C    6  
ATOM   10190 O  O    . LEU B 2 15 ? 43.250 -5.580  3.307   1.00 0.00  ? 158 LEU B O    6  
ATOM   10191 C  CB   . LEU B 2 15 ? 45.804 -5.961  4.574   1.00 0.00  ? 158 LEU B CB   6  
ATOM   10192 C  CG   . LEU B 2 15 ? 47.004 -6.741  5.119   1.00 0.00  ? 158 LEU B CG   6  
ATOM   10193 C  CD1  . LEU B 2 15 ? 47.934 -5.788  5.873   1.00 0.00  ? 158 LEU B CD1  6  
ATOM   10194 C  CD2  . LEU B 2 15 ? 46.510 -7.830  6.073   1.00 0.00  ? 158 LEU B CD2  6  
ATOM   10195 H  H    . LEU B 2 15 ? 46.461 -4.561  2.624   1.00 0.00  ? 158 LEU B H    6  
ATOM   10196 H  HA   . LEU B 2 15 ? 45.928 -7.396  2.972   1.00 0.00  ? 158 LEU B HA   6  
ATOM   10197 H  HB2  . LEU B 2 15 ? 46.032 -4.906  4.569   1.00 0.00  ? 158 LEU B HB2  6  
ATOM   10198 H  HB3  . LEU B 2 15 ? 44.946 -6.139  5.205   1.00 0.00  ? 158 LEU B HB3  6  
ATOM   10199 H  HG   . LEU B 2 15 ? 47.541 -7.195  4.298   1.00 0.00  ? 158 LEU B HG   6  
ATOM   10200 H  HD11 . LEU B 2 15 ? 48.759 -6.346  6.292   1.00 0.00  ? 158 LEU B HD11 6  
ATOM   10201 H  HD12 . LEU B 2 15 ? 47.385 -5.303  6.668   1.00 0.00  ? 158 LEU B HD12 6  
ATOM   10202 H  HD13 . LEU B 2 15 ? 48.314 -5.042  5.190   1.00 0.00  ? 158 LEU B HD13 6  
ATOM   10203 H  HD21 . LEU B 2 15 ? 47.318 -8.131  6.725   1.00 0.00  ? 158 LEU B HD21 6  
ATOM   10204 H  HD22 . LEU B 2 15 ? 46.172 -8.682  5.503   1.00 0.00  ? 158 LEU B HD22 6  
ATOM   10205 H  HD23 . LEU B 2 15 ? 45.694 -7.447  6.667   1.00 0.00  ? 158 LEU B HD23 6  
ATOM   10206 N  N    . GLY B 2 16 ? 43.504 -7.503  2.259   1.00 0.00  ? 159 GLY B N    6  
ATOM   10207 C  CA   . GLY B 2 16 ? 42.038 -7.616  1.984   1.00 0.00  ? 159 GLY B CA   6  
ATOM   10208 C  C    . GLY B 2 16 ? 41.803 -7.849  0.485   1.00 0.00  ? 159 GLY B C    6  
ATOM   10209 O  O    . GLY B 2 16 ? 40.874 -8.529  0.097   1.00 0.00  ? 159 GLY B O    6  
ATOM   10210 H  H    . GLY B 2 16 ? 44.113 -8.205  1.947   1.00 0.00  ? 159 GLY B H    6  
ATOM   10211 H  HA2  . GLY B 2 16 ? 41.630 -8.445  2.545   1.00 0.00  ? 159 GLY B HA2  6  
ATOM   10212 H  HA3  . GLY B 2 16 ? 41.544 -6.704  2.283   1.00 0.00  ? 159 GLY B HA3  6  
ATOM   10213 N  N    . ALA B 2 17 ? 42.632 -7.284  -0.361  1.00 0.00  ? 160 ALA B N    6  
ATOM   10214 C  CA   . ALA B 2 17 ? 42.450 -7.469  -1.837  1.00 0.00  ? 160 ALA B CA   6  
ATOM   10215 C  C    . ALA B 2 17 ? 43.573 -8.336  -2.432  1.00 0.00  ? 160 ALA B C    6  
ATOM   10216 O  O    . ALA B 2 17 ? 43.354 -9.075  -3.373  1.00 0.00  ? 160 ALA B O    6  
ATOM   10217 C  CB   . ALA B 2 17 ? 42.497 -6.055  -2.419  1.00 0.00  ? 160 ALA B CB   6  
ATOM   10218 H  H    . ALA B 2 17 ? 43.370 -6.732  -0.027  1.00 0.00  ? 160 ALA B H    6  
ATOM   10219 H  HA   . ALA B 2 17 ? 41.488 -7.914  -2.043  1.00 0.00  ? 160 ALA B HA   6  
ATOM   10220 H  HB1  . ALA B 2 17 ? 42.225 -6.086  -3.463  1.00 0.00  ? 160 ALA B HB1  6  
ATOM   10221 H  HB2  . ALA B 2 17 ? 43.497 -5.657  -2.319  1.00 0.00  ? 160 ALA B HB2  6  
ATOM   10222 H  HB3  . ALA B 2 17 ? 41.804 -5.422  -1.884  1.00 0.00  ? 160 ALA B HB3  6  
ATOM   10223 N  N    . ARG B 2 18 ? 44.773 -8.245  -1.905  1.00 0.00  ? 161 ARG B N    6  
ATOM   10224 C  CA   . ARG B 2 18 ? 45.905 -9.062  -2.459  1.00 0.00  ? 161 ARG B CA   6  
ATOM   10225 C  C    . ARG B 2 18 ? 46.434 -10.070 -1.422  1.00 0.00  ? 161 ARG B C    6  
ATOM   10226 O  O    . ARG B 2 18 ? 47.091 -11.033 -1.772  1.00 0.00  ? 161 ARG B O    6  
ATOM   10227 C  CB   . ARG B 2 18 ? 46.993 -8.042  -2.810  1.00 0.00  ? 161 ARG B CB   6  
ATOM   10228 C  CG   . ARG B 2 18 ? 47.149 -7.956  -4.332  1.00 0.00  ? 161 ARG B CG   6  
ATOM   10229 C  CD   . ARG B 2 18 ? 46.639 -6.598  -4.827  1.00 0.00  ? 161 ARG B CD   6  
ATOM   10230 N  NE   . ARG B 2 18 ? 45.154 -6.733  -4.868  1.00 0.00  ? 161 ARG B NE   6  
ATOM   10231 C  CZ   . ARG B 2 18 ? 44.555 -7.069  -5.975  1.00 0.00  ? 161 ARG B CZ   6  
ATOM   10232 N  NH1  . ARG B 2 18 ? 44.535 -6.242  -6.981  1.00 0.00  ? 161 ARG B NH1  6  
ATOM   10233 N  NH2  . ARG B 2 18 ? 43.977 -8.233  -6.076  1.00 0.00  ? 161 ARG B NH2  6  
ATOM   10234 H  H    . ARG B 2 18 ? 44.933 -7.636  -1.155  1.00 0.00  ? 161 ARG B H    6  
ATOM   10235 H  HA   . ARG B 2 18 ? 45.590 -9.579  -3.351  1.00 0.00  ? 161 ARG B HA   6  
ATOM   10236 H  HB2  . ARG B 2 18 ? 46.719 -7.073  -2.419  1.00 0.00  ? 161 ARG B HB2  6  
ATOM   10237 H  HB3  . ARG B 2 18 ? 47.931 -8.353  -2.373  1.00 0.00  ? 161 ARG B HB3  6  
ATOM   10238 H  HG2  . ARG B 2 18 ? 48.192 -8.066  -4.592  1.00 0.00  ? 161 ARG B HG2  6  
ATOM   10239 H  HG3  . ARG B 2 18 ? 46.578 -8.745  -4.798  1.00 0.00  ? 161 ARG B HG3  6  
ATOM   10240 H  HD2  . ARG B 2 18 ? 46.930 -5.817  -4.138  1.00 0.00  ? 161 ARG B HD2  6  
ATOM   10241 H  HD3  . ARG B 2 18 ? 47.021 -6.391  -5.815  1.00 0.00  ? 161 ARG B HD3  6  
ATOM   10242 H  HE   . ARG B 2 18 ? 44.626 -6.567  -4.059  1.00 0.00  ? 161 ARG B HE   6  
ATOM   10243 H  HH11 . ARG B 2 18 ? 44.983 -5.352  -6.905  1.00 0.00  ? 161 ARG B HH11 6  
ATOM   10244 H  HH12 . ARG B 2 18 ? 44.065 -6.493  -7.826  1.00 0.00  ? 161 ARG B HH12 6  
ATOM   10245 H  HH21 . ARG B 2 18 ? 43.993 -8.867  -5.302  1.00 0.00  ? 161 ARG B HH21 6  
ATOM   10246 H  HH22 . ARG B 2 18 ? 43.521 -8.493  -6.926  1.00 0.00  ? 161 ARG B HH22 6  
ATOM   10247 N  N    . ALA B 2 19 ? 46.166 -9.856  -0.155  1.00 0.00  ? 162 ALA B N    6  
ATOM   10248 C  CA   . ALA B 2 19 ? 46.668 -10.801 0.892   1.00 0.00  ? 162 ALA B CA   6  
ATOM   10249 C  C    . ALA B 2 19 ? 45.637 -11.906 1.181   1.00 0.00  ? 162 ALA B C    6  
ATOM   10250 O  O    . ALA B 2 19 ? 45.956 -13.081 1.152   1.00 0.00  ? 162 ALA B O    6  
ATOM   10251 C  CB   . ALA B 2 19 ? 46.896 -9.929  2.130   1.00 0.00  ? 162 ALA B CB   6  
ATOM   10252 H  H    . ALA B 2 19 ? 45.642 -9.072  0.108   1.00 0.00  ? 162 ALA B H    6  
ATOM   10253 H  HA   . ALA B 2 19 ? 47.603 -11.240 0.579   1.00 0.00  ? 162 ALA B HA   6  
ATOM   10254 H  HB1  . ALA B 2 19 ? 47.353 -8.997  1.832   1.00 0.00  ? 162 ALA B HB1  6  
ATOM   10255 H  HB2  . ALA B 2 19 ? 47.548 -10.446 2.818   1.00 0.00  ? 162 ALA B HB2  6  
ATOM   10256 H  HB3  . ALA B 2 19 ? 45.950 -9.729  2.610   1.00 0.00  ? 162 ALA B HB3  6  
ATOM   10257 N  N    . LYS B 2 20 ? 44.408 -11.543 1.460   1.00 0.00  ? 163 LYS B N    6  
ATOM   10258 C  CA   . LYS B 2 20 ? 43.364 -12.577 1.748   1.00 0.00  ? 163 LYS B CA   6  
ATOM   10259 C  C    . LYS B 2 20 ? 41.977 -12.070 1.337   1.00 0.00  ? 163 LYS B C    6  
ATOM   10260 O  O    . LYS B 2 20 ? 41.262 -12.824 0.696   1.00 0.00  ? 163 LYS B O    6  
ATOM   10261 C  CB   . LYS B 2 20 ? 43.426 -12.808 3.263   1.00 0.00  ? 163 LYS B CB   6  
ATOM   10262 C  CG   . LYS B 2 20 ? 42.747 -14.140 3.606   1.00 0.00  ? 163 LYS B CG   6  
ATOM   10263 C  CD   . LYS B 2 20 ? 43.710 -15.299 3.330   1.00 0.00  ? 163 LYS B CD   6  
ATOM   10264 C  CE   . LYS B 2 20 ? 43.444 -15.866 1.931   1.00 0.00  ? 163 LYS B CE   6  
ATOM   10265 N  NZ   . LYS B 2 20 ? 44.795 -16.063 1.330   1.00 0.00  ? 163 LYS B NZ   6  
ATOM   10266 O  OXT  . LYS B 2 20 ? 41.652 -10.942 1.674   1.00 0.00  ? 163 LYS B OXT  6  
ATOM   10267 H  H    . LYS B 2 20 ? 44.169 -10.593 1.479   1.00 0.00  ? 163 LYS B H    6  
ATOM   10268 H  HA   . LYS B 2 20 ? 43.595 -13.494 1.229   1.00 0.00  ? 163 LYS B HA   6  
ATOM   10269 H  HB2  . LYS B 2 20 ? 44.458 -12.833 3.583   1.00 0.00  ? 163 LYS B HB2  6  
ATOM   10270 H  HB3  . LYS B 2 20 ? 42.912 -12.005 3.769   1.00 0.00  ? 163 LYS B HB3  6  
ATOM   10271 H  HG2  . LYS B 2 20 ? 42.469 -14.144 4.650   1.00 0.00  ? 163 LYS B HG2  6  
ATOM   10272 H  HG3  . LYS B 2 20 ? 41.862 -14.259 2.999   1.00 0.00  ? 163 LYS B HG3  6  
ATOM   10273 H  HD2  . LYS B 2 20 ? 44.728 -14.942 3.389   1.00 0.00  ? 163 LYS B HD2  6  
ATOM   10274 H  HD3  . LYS B 2 20 ? 43.558 -16.076 4.066   1.00 0.00  ? 163 LYS B HD3  6  
ATOM   10275 H  HE2  . LYS B 2 20 ? 42.918 -16.810 2.002   1.00 0.00  ? 163 LYS B HE2  6  
ATOM   10276 H  HE3  . LYS B 2 20 ? 42.875 -15.163 1.341   1.00 0.00  ? 163 LYS B HE3  6  
ATOM   10277 H  HZ1  . LYS B 2 20 ? 45.346 -15.182 1.414   1.00 0.00  ? 163 LYS B HZ1  6  
ATOM   10278 H  HZ2  . LYS B 2 20 ? 44.695 -16.312 0.324   1.00 0.00  ? 163 LYS B HZ2  6  
ATOM   10279 H  HZ3  . LYS B 2 20 ? 45.289 -16.829 1.829   1.00 0.00  ? 163 LYS B HZ3  6  
HETATM 10280 CA CA   . CA  C 3 .  ? 69.047 -4.216  -0.742  1.00 0.00  ? 90  CA  A CA   6  
HETATM 10281 O  OAA  . SXK D 4 .  ? 58.974 11.367  -1.211  1.00 20.00 ? 91  SXK A OAA  6  
HETATM 10282 O  OAB  . SXK D 4 .  ? 60.545 11.584  -2.762  1.00 20.00 ? 91  SXK A OAB  6  
HETATM 10283 C  CAE  . SXK D 4 .  ? 56.027 1.788   -0.024  1.00 20.00 ? 91  SXK A CAE  6  
HETATM 10284 C  CAF  . SXK D 4 .  ? 57.035 6.938   -2.848  1.00 20.00 ? 91  SXK A CAF  6  
HETATM 10285 C  CAG  . SXK D 4 .  ? 58.565 6.934   -0.911  1.00 20.00 ? 91  SXK A CAG  6  
HETATM 10286 C  CAH  . SXK D 4 .  ? 56.755 5.569   -2.632  1.00 20.00 ? 91  SXK A CAH  6  
HETATM 10287 C  CAI  . SXK D 4 .  ? 58.290 5.569   -0.691  1.00 20.00 ? 91  SXK A CAI  6  
HETATM 10288 C  CAJ  . SXK D 4 .  ? 56.281 3.161   -0.259  1.00 20.00 ? 91  SXK A CAJ  6  
HETATM 10289 C  CAK  . SXK D 4 .  ? 57.423 1.168   -1.936  1.00 20.00 ? 91  SXK A CAK  6  
HETATM 10290 C  CAL  . SXK D 4 .  ? 59.431 9.489   -2.654  1.00 20.00 ? 91  SXK A CAL  6  
HETATM 10291 O  OAM  . SXK D 4 .  ? 58.137 8.943   -2.297  1.00 20.00 ? 91  SXK A OAM  6  
HETATM 10292 C  CAN  . SXK D 4 .  ? 59.665 10.929  -2.166  1.00 20.00 ? 91  SXK A CAN  6  
HETATM 10293 C  CAO  . SXK D 4 .  ? 56.597 0.813   -0.863  1.00 20.00 ? 91  SXK A CAO  6  
HETATM 10294 C  CAP  . SXK D 4 .  ? 57.942 7.619   -1.983  1.00 20.00 ? 91  SXK A CAP  6  
HETATM 10295 C  CAQ  . SXK D 4 .  ? 57.682 2.538   -2.179  1.00 20.00 ? 91  SXK A CAQ  6  
HETATM 10296 C  CAR  . SXK D 4 .  ? 57.385 4.885   -1.552  1.00 20.00 ? 91  SXK A CAR  6  
HETATM 10297 C  CAS  . SXK D 4 .  ? 57.111 3.527   -1.334  1.00 20.00 ? 91  SXK A CAS  6  
HETATM 10298 F  FCC  . SXK D 4 .  ? 56.342 -0.502  -0.623  1.00 20.00 ? 91  SXK A FCC  6  
HETATM 10299 F  FDD  . SXK D 4 .  ? 58.490 2.862   -3.235  1.00 20.00 ? 91  SXK A FDD  6  
HETATM 10300 H  HAE  . SXK D 4 .  ? 55.388 1.483   0.804   1.00 20.00 ? 91  SXK A HAE  6  
HETATM 10301 H  HAF  . SXK D 4 .  ? 56.560 7.475   -3.674  1.00 20.00 ? 91  SXK A HAF  6  
HETATM 10302 H  HAG  . SXK D 4 .  ? 59.262 7.447   -0.245  1.00 20.00 ? 91  SXK A HAG  6  
HETATM 10303 H  HAH  . SXK D 4 .  ? 56.062 5.041   -3.289  1.00 20.00 ? 91  SXK A HAH  6  
HETATM 10304 H  HAI  . SXK D 4 .  ? 58.769 5.042   0.137   1.00 20.00 ? 91  SXK A HAI  6  
HETATM 10305 H  HAJ  . SXK D 4 .  ? 55.839 3.916   0.391   1.00 20.00 ? 91  SXK A HAJ  6  
HETATM 10306 H  HAK  . SXK D 4 .  ? 57.861 0.403   -2.583  1.00 20.00 ? 91  SXK A HAK  6  
HETATM 10307 H  HAL  . SXK D 4 .  ? 60.213 8.857   -2.219  1.00 20.00 ? 91  SXK A HAL  6  
HETATM 10308 H  HALA . SXK D 4 .  ? 59.486 9.522   -3.740  1.00 20.00 ? 91  SXK A HALA 6  
ATOM   10309 N  N    . MET A 1 1  ? 70.884 7.930   16.726  1.00 0.00  ? 1   MET A N    7  
ATOM   10310 C  CA   . MET A 1 1  ? 72.303 8.401   16.663  1.00 0.00  ? 1   MET A CA   7  
ATOM   10311 C  C    . MET A 1 1  ? 72.955 7.949   15.349  1.00 0.00  ? 1   MET A C    7  
ATOM   10312 O  O    . MET A 1 1  ? 73.263 8.760   14.498  1.00 0.00  ? 1   MET A O    7  
ATOM   10313 C  CB   . MET A 1 1  ? 73.002 7.761   17.870  1.00 0.00  ? 1   MET A CB   7  
ATOM   10314 C  CG   . MET A 1 1  ? 72.635 8.527   19.144  1.00 0.00  ? 1   MET A CG   7  
ATOM   10315 S  SD   . MET A 1 1  ? 71.219 7.730   19.942  1.00 0.00  ? 1   MET A SD   7  
ATOM   10316 C  CE   . MET A 1 1  ? 70.384 9.242   20.485  1.00 0.00  ? 1   MET A CE   7  
ATOM   10317 H  H1   . MET A 1 1  ? 70.448 8.010   15.784  1.00 0.00  ? 1   MET A H1   7  
ATOM   10318 H  H2   . MET A 1 1  ? 70.353 8.517   17.402  1.00 0.00  ? 1   MET A H2   7  
ATOM   10319 H  H3   . MET A 1 1  ? 70.857 6.937   17.033  1.00 0.00  ? 1   MET A H3   7  
ATOM   10320 H  HA   . MET A 1 1  ? 72.343 9.476   16.745  1.00 0.00  ? 1   MET A HA   7  
ATOM   10321 H  HB2  . MET A 1 1  ? 72.688 6.732   17.966  1.00 0.00  ? 1   MET A HB2  7  
ATOM   10322 H  HB3  . MET A 1 1  ? 74.072 7.798   17.727  1.00 0.00  ? 1   MET A HB3  7  
ATOM   10323 H  HG2  . MET A 1 1  ? 73.478 8.524   19.820  1.00 0.00  ? 1   MET A HG2  7  
ATOM   10324 H  HG3  . MET A 1 1  ? 72.381 9.546   18.892  1.00 0.00  ? 1   MET A HG3  7  
ATOM   10325 H  HE1  . MET A 1 1  ? 69.409 8.991   20.881  1.00 0.00  ? 1   MET A HE1  7  
ATOM   10326 H  HE2  . MET A 1 1  ? 70.269 9.912   19.650  1.00 0.00  ? 1   MET A HE2  7  
ATOM   10327 H  HE3  . MET A 1 1  ? 70.976 9.723   21.251  1.00 0.00  ? 1   MET A HE3  7  
ATOM   10328 N  N    . ASP A 1 2  ? 73.159 6.665   15.173  1.00 0.00  ? 2   ASP A N    7  
ATOM   10329 C  CA   . ASP A 1 2  ? 73.784 6.170   13.907  1.00 0.00  ? 2   ASP A CA   7  
ATOM   10330 C  C    . ASP A 1 2  ? 72.760 6.233   12.766  1.00 0.00  ? 2   ASP A C    7  
ATOM   10331 O  O    . ASP A 1 2  ? 71.672 5.696   12.874  1.00 0.00  ? 2   ASP A O    7  
ATOM   10332 C  CB   . ASP A 1 2  ? 74.196 4.723   14.195  1.00 0.00  ? 2   ASP A CB   7  
ATOM   10333 C  CG   . ASP A 1 2  ? 75.421 4.714   15.113  1.00 0.00  ? 2   ASP A CG   7  
ATOM   10334 O  OD1  . ASP A 1 2  ? 75.240 4.855   16.311  1.00 0.00  ? 2   ASP A OD1  7  
ATOM   10335 O  OD2  . ASP A 1 2  ? 76.518 4.566   14.600  1.00 0.00  ? 2   ASP A OD2  7  
ATOM   10336 H  H    . ASP A 1 2  ? 72.898 6.026   15.870  1.00 0.00  ? 2   ASP A H    7  
ATOM   10337 H  HA   . ASP A 1 2  ? 74.654 6.759   13.664  1.00 0.00  ? 2   ASP A HA   7  
ATOM   10338 H  HB2  . ASP A 1 2  ? 73.380 4.203   14.677  1.00 0.00  ? 2   ASP A HB2  7  
ATOM   10339 H  HB3  . ASP A 1 2  ? 74.441 4.226   13.269  1.00 0.00  ? 2   ASP A HB3  7  
ATOM   10340 N  N    . ASP A 1 3  ? 73.103 6.904   11.687  1.00 0.00  ? 3   ASP A N    7  
ATOM   10341 C  CA   . ASP A 1 3  ? 72.165 7.045   10.521  1.00 0.00  ? 3   ASP A CA   7  
ATOM   10342 C  C    . ASP A 1 3  ? 70.972 7.930   10.899  1.00 0.00  ? 3   ASP A C    7  
ATOM   10343 O  O    . ASP A 1 3  ? 70.559 7.991   12.043  1.00 0.00  ? 3   ASP A O    7  
ATOM   10344 C  CB   . ASP A 1 3  ? 71.693 5.631   10.180  1.00 0.00  ? 3   ASP A CB   7  
ATOM   10345 C  CG   . ASP A 1 3  ? 71.225 5.568   8.722   1.00 0.00  ? 3   ASP A CG   7  
ATOM   10346 O  OD1  . ASP A 1 3  ? 70.213 6.178   8.414   1.00 0.00  ? 3   ASP A OD1  7  
ATOM   10347 O  OD2  . ASP A 1 3  ? 71.880 4.899   7.940   1.00 0.00  ? 3   ASP A OD2  7  
ATOM   10348 H  H    . ASP A 1 3  ? 73.983 7.333   11.649  1.00 0.00  ? 3   ASP A H    7  
ATOM   10349 H  HA   . ASP A 1 3  ? 72.682 7.465   9.676   1.00 0.00  ? 3   ASP A HA   7  
ATOM   10350 H  HB2  . ASP A 1 3  ? 72.505 4.937   10.328  1.00 0.00  ? 3   ASP A HB2  7  
ATOM   10351 H  HB3  . ASP A 1 3  ? 70.873 5.370   10.827  1.00 0.00  ? 3   ASP A HB3  7  
ATOM   10352 N  N    . ILE A 1 4  ? 70.413 8.612   9.940   1.00 0.00  ? 4   ILE A N    7  
ATOM   10353 C  CA   . ILE A 1 4  ? 69.242 9.491   10.230  1.00 0.00  ? 4   ILE A CA   7  
ATOM   10354 C  C    . ILE A 1 4  ? 67.948 8.718   9.954   1.00 0.00  ? 4   ILE A C    7  
ATOM   10355 O  O    . ILE A 1 4  ? 67.042 8.702   10.765  1.00 0.00  ? 4   ILE A O    7  
ATOM   10356 C  CB   . ILE A 1 4  ? 69.375 10.693  9.286   1.00 0.00  ? 4   ILE A CB   7  
ATOM   10357 C  CG1  . ILE A 1 4  ? 70.826 11.194  9.275   1.00 0.00  ? 4   ILE A CG1  7  
ATOM   10358 C  CG2  . ILE A 1 4  ? 68.457 11.819  9.769   1.00 0.00  ? 4   ILE A CG2  7  
ATOM   10359 C  CD1  . ILE A 1 4  ? 71.138 11.814  7.912   1.00 0.00  ? 4   ILE A CD1  7  
ATOM   10360 H  H    . ILE A 1 4  ? 70.759 8.541   9.025   1.00 0.00  ? 4   ILE A H    7  
ATOM   10361 H  HA   . ILE A 1 4  ? 69.269 9.822   11.256  1.00 0.00  ? 4   ILE A HA   7  
ATOM   10362 H  HB   . ILE A 1 4  ? 69.086 10.399  8.286   1.00 0.00  ? 4   ILE A HB   7  
ATOM   10363 H  HG12 . ILE A 1 4  ? 70.956 11.937  10.048  1.00 0.00  ? 4   ILE A HG12 7  
ATOM   10364 H  HG13 . ILE A 1 4  ? 71.498 10.366  9.453   1.00 0.00  ? 4   ILE A HG13 7  
ATOM   10365 H  HG21 . ILE A 1 4  ? 68.880 12.773  9.492   1.00 0.00  ? 4   ILE A HG21 7  
ATOM   10366 H  HG22 . ILE A 1 4  ? 68.359 11.768  10.844  1.00 0.00  ? 4   ILE A HG22 7  
ATOM   10367 H  HG23 . ILE A 1 4  ? 67.483 11.710  9.314   1.00 0.00  ? 4   ILE A HG23 7  
ATOM   10368 H  HD11 . ILE A 1 4  ? 70.509 12.680  7.758   1.00 0.00  ? 4   ILE A HD11 7  
ATOM   10369 H  HD12 . ILE A 1 4  ? 70.949 11.088  7.134   1.00 0.00  ? 4   ILE A HD12 7  
ATOM   10370 H  HD13 . ILE A 1 4  ? 72.175 12.112  7.883   1.00 0.00  ? 4   ILE A HD13 7  
ATOM   10371 N  N    . TYR A 1 5  ? 67.869 8.060   8.822   1.00 0.00  ? 5   TYR A N    7  
ATOM   10372 C  CA   . TYR A 1 5  ? 66.647 7.264   8.497   1.00 0.00  ? 5   TYR A CA   7  
ATOM   10373 C  C    . TYR A 1 5  ? 66.563 6.052   9.433   1.00 0.00  ? 5   TYR A C    7  
ATOM   10374 O  O    . TYR A 1 5  ? 65.494 5.673   9.868   1.00 0.00  ? 5   TYR A O    7  
ATOM   10375 C  CB   . TYR A 1 5  ? 66.820 6.827   7.038   1.00 0.00  ? 5   TYR A CB   7  
ATOM   10376 C  CG   . TYR A 1 5  ? 66.606 8.018   6.133   1.00 0.00  ? 5   TYR A CG   7  
ATOM   10377 C  CD1  . TYR A 1 5  ? 65.382 8.700   6.151   1.00 0.00  ? 5   TYR A CD1  7  
ATOM   10378 C  CD2  . TYR A 1 5  ? 67.633 8.448   5.284   1.00 0.00  ? 5   TYR A CD2  7  
ATOM   10379 C  CE1  . TYR A 1 5  ? 65.187 9.809   5.322   1.00 0.00  ? 5   TYR A CE1  7  
ATOM   10380 C  CE2  . TYR A 1 5  ? 67.434 9.557   4.453   1.00 0.00  ? 5   TYR A CE2  7  
ATOM   10381 C  CZ   . TYR A 1 5  ? 66.212 10.236  4.474   1.00 0.00  ? 5   TYR A CZ   7  
ATOM   10382 O  OH   . TYR A 1 5  ? 66.017 11.328  3.657   1.00 0.00  ? 5   TYR A OH   7  
ATOM   10383 H  H    . TYR A 1 5  ? 68.623 8.076   8.195   1.00 0.00  ? 5   TYR A H    7  
ATOM   10384 H  HA   . TYR A 1 5  ? 65.762 7.875   8.598   1.00 0.00  ? 5   TYR A HA   7  
ATOM   10385 H  HB2  . TYR A 1 5  ? 67.818 6.438   6.895   1.00 0.00  ? 5   TYR A HB2  7  
ATOM   10386 H  HB3  . TYR A 1 5  ? 66.098 6.060   6.801   1.00 0.00  ? 5   TYR A HB3  7  
ATOM   10387 H  HD1  . TYR A 1 5  ? 64.589 8.370   6.806   1.00 0.00  ? 5   TYR A HD1  7  
ATOM   10388 H  HD2  . TYR A 1 5  ? 68.577 7.923   5.268   1.00 0.00  ? 5   TYR A HD2  7  
ATOM   10389 H  HE1  . TYR A 1 5  ? 64.244 10.335  5.336   1.00 0.00  ? 5   TYR A HE1  7  
ATOM   10390 H  HE2  . TYR A 1 5  ? 68.225 9.890   3.798   1.00 0.00  ? 5   TYR A HE2  7  
ATOM   10391 H  HH   . TYR A 1 5  ? 65.370 11.087  2.991   1.00 0.00  ? 5   TYR A HH   7  
ATOM   10392 N  N    . LYS A 1 6  ? 67.688 5.462   9.769   1.00 0.00  ? 6   LYS A N    7  
ATOM   10393 C  CA   . LYS A 1 6  ? 67.673 4.296   10.706  1.00 0.00  ? 6   LYS A CA   7  
ATOM   10394 C  C    . LYS A 1 6  ? 67.183 4.765   12.079  1.00 0.00  ? 6   LYS A C    7  
ATOM   10395 O  O    . LYS A 1 6  ? 66.370 4.119   12.708  1.00 0.00  ? 6   LYS A O    7  
ATOM   10396 C  CB   . LYS A 1 6  ? 69.124 3.808   10.782  1.00 0.00  ? 6   LYS A CB   7  
ATOM   10397 C  CG   . LYS A 1 6  ? 69.171 2.299   10.519  1.00 0.00  ? 6   LYS A CG   7  
ATOM   10398 C  CD   . LYS A 1 6  ? 70.201 1.998   9.427   1.00 0.00  ? 6   LYS A CD   7  
ATOM   10399 C  CE   . LYS A 1 6  ? 69.632 2.393   8.058   1.00 0.00  ? 6   LYS A CE   7  
ATOM   10400 N  NZ   . LYS A 1 6  ? 70.570 1.800   7.062   1.00 0.00  ? 6   LYS A NZ   7  
ATOM   10401 H  H    . LYS A 1 6  ? 68.541 5.802   9.423   1.00 0.00  ? 6   LYS A H    7  
ATOM   10402 H  HA   . LYS A 1 6  ? 67.034 3.514   10.327  1.00 0.00  ? 6   LYS A HA   7  
ATOM   10403 H  HB2  . LYS A 1 6  ? 69.717 4.324   10.040  1.00 0.00  ? 6   LYS A HB2  7  
ATOM   10404 H  HB3  . LYS A 1 6  ? 69.522 4.013   11.765  1.00 0.00  ? 6   LYS A HB3  7  
ATOM   10405 H  HG2  . LYS A 1 6  ? 69.449 1.786   11.429  1.00 0.00  ? 6   LYS A HG2  7  
ATOM   10406 H  HG3  . LYS A 1 6  ? 68.197 1.957   10.198  1.00 0.00  ? 6   LYS A HG3  7  
ATOM   10407 H  HD2  . LYS A 1 6  ? 71.104 2.560   9.619   1.00 0.00  ? 6   LYS A HD2  7  
ATOM   10408 H  HD3  . LYS A 1 6  ? 70.428 0.942   9.428   1.00 0.00  ? 6   LYS A HD3  7  
ATOM   10409 H  HE2  . LYS A 1 6  ? 68.638 1.982   7.934   1.00 0.00  ? 6   LYS A HE2  7  
ATOM   10410 H  HE3  . LYS A 1 6  ? 69.612 3.467   7.955   1.00 0.00  ? 6   LYS A HE3  7  
ATOM   10411 H  HZ1  . LYS A 1 6  ? 71.550 2.004   7.339   1.00 0.00  ? 6   LYS A HZ1  7  
ATOM   10412 H  HZ2  . LYS A 1 6  ? 70.382 2.212   6.124   1.00 0.00  ? 6   LYS A HZ2  7  
ATOM   10413 H  HZ3  . LYS A 1 6  ? 70.429 0.770   7.022   1.00 0.00  ? 6   LYS A HZ3  7  
ATOM   10414 N  N    . ALA A 1 7  ? 67.648 5.906   12.530  1.00 0.00  ? 7   ALA A N    7  
ATOM   10415 C  CA   . ALA A 1 7  ? 67.183 6.443   13.847  1.00 0.00  ? 7   ALA A CA   7  
ATOM   10416 C  C    . ALA A 1 7  ? 65.667 6.691   13.789  1.00 0.00  ? 7   ALA A C    7  
ATOM   10417 O  O    . ALA A 1 7  ? 64.957 6.476   14.753  1.00 0.00  ? 7   ALA A O    7  
ATOM   10418 C  CB   . ALA A 1 7  ? 67.945 7.760   14.035  1.00 0.00  ? 7   ALA A CB   7  
ATOM   10419 H  H    . ALA A 1 7  ? 68.285 6.420   11.991  1.00 0.00  ? 7   ALA A H    7  
ATOM   10420 H  HA   . ALA A 1 7  ? 67.424 5.755   14.644  1.00 0.00  ? 7   ALA A HA   7  
ATOM   10421 H  HB1  . ALA A 1 7  ? 69.007 7.564   14.037  1.00 0.00  ? 7   ALA A HB1  7  
ATOM   10422 H  HB2  . ALA A 1 7  ? 67.661 8.212   14.973  1.00 0.00  ? 7   ALA A HB2  7  
ATOM   10423 H  HB3  . ALA A 1 7  ? 67.706 8.433   13.225  1.00 0.00  ? 7   ALA A HB3  7  
ATOM   10424 N  N    . ALA A 1 8  ? 65.168 7.123   12.650  1.00 0.00  ? 8   ALA A N    7  
ATOM   10425 C  CA   . ALA A 1 8  ? 63.697 7.367   12.509  1.00 0.00  ? 8   ALA A CA   7  
ATOM   10426 C  C    . ALA A 1 8  ? 62.926 6.039   12.603  1.00 0.00  ? 8   ALA A C    7  
ATOM   10427 O  O    . ALA A 1 8  ? 61.776 6.015   13.000  1.00 0.00  ? 8   ALA A O    7  
ATOM   10428 C  CB   . ALA A 1 8  ? 63.524 7.996   11.124  1.00 0.00  ? 8   ALA A CB   7  
ATOM   10429 H  H    . ALA A 1 8  ? 65.761 7.273   11.883  1.00 0.00  ? 8   ALA A H    7  
ATOM   10430 H  HA   . ALA A 1 8  ? 63.356 8.052   13.269  1.00 0.00  ? 8   ALA A HA   7  
ATOM   10431 H  HB1  . ALA A 1 8  ? 64.009 7.379   10.383  1.00 0.00  ? 8   ALA A HB1  7  
ATOM   10432 H  HB2  . ALA A 1 8  ? 63.967 8.981   11.119  1.00 0.00  ? 8   ALA A HB2  7  
ATOM   10433 H  HB3  . ALA A 1 8  ? 62.471 8.074   10.894  1.00 0.00  ? 8   ALA A HB3  7  
ATOM   10434 N  N    . VAL A 1 9  ? 63.553 4.935   12.257  1.00 0.00  ? 9   VAL A N    7  
ATOM   10435 C  CA   . VAL A 1 9  ? 62.856 3.612   12.350  1.00 0.00  ? 9   VAL A CA   7  
ATOM   10436 C  C    . VAL A 1 9  ? 62.425 3.363   13.803  1.00 0.00  ? 9   VAL A C    7  
ATOM   10437 O  O    . VAL A 1 9  ? 61.338 2.883   14.059  1.00 0.00  ? 9   VAL A O    7  
ATOM   10438 C  CB   . VAL A 1 9  ? 63.885 2.567   11.888  1.00 0.00  ? 9   VAL A CB   7  
ATOM   10439 C  CG1  . VAL A 1 9  ? 63.353 1.156   12.160  1.00 0.00  ? 9   VAL A CG1  7  
ATOM   10440 C  CG2  . VAL A 1 9  ? 64.131 2.730   10.385  1.00 0.00  ? 9   VAL A CG2  7  
ATOM   10441 H  H    . VAL A 1 9  ? 64.483 4.977   11.950  1.00 0.00  ? 9   VAL A H    7  
ATOM   10442 H  HA   . VAL A 1 9  ? 61.997 3.596   11.697  1.00 0.00  ? 9   VAL A HA   7  
ATOM   10443 H  HB   . VAL A 1 9  ? 64.812 2.711   12.424  1.00 0.00  ? 9   VAL A HB   7  
ATOM   10444 H  HG11 . VAL A 1 9  ? 62.287 1.132   11.984  1.00 0.00  ? 9   VAL A HG11 7  
ATOM   10445 H  HG12 . VAL A 1 9  ? 63.553 0.888   13.187  1.00 0.00  ? 9   VAL A HG12 7  
ATOM   10446 H  HG13 . VAL A 1 9  ? 63.842 0.452   11.503  1.00 0.00  ? 9   VAL A HG13 7  
ATOM   10447 H  HG21 . VAL A 1 9  ? 63.187 2.861   9.877   1.00 0.00  ? 9   VAL A HG21 7  
ATOM   10448 H  HG22 . VAL A 1 9  ? 64.628 1.851   10.002  1.00 0.00  ? 9   VAL A HG22 7  
ATOM   10449 H  HG23 . VAL A 1 9  ? 64.753 3.596   10.216  1.00 0.00  ? 9   VAL A HG23 7  
ATOM   10450 N  N    . GLU A 1 10 ? 63.263 3.708   14.755  1.00 0.00  ? 10  GLU A N    7  
ATOM   10451 C  CA   . GLU A 1 10 ? 62.897 3.518   16.193  1.00 0.00  ? 10  GLU A CA   7  
ATOM   10452 C  C    . GLU A 1 10 ? 61.655 4.357   16.535  1.00 0.00  ? 10  GLU A C    7  
ATOM   10453 O  O    . GLU A 1 10 ? 60.858 3.978   17.372  1.00 0.00  ? 10  GLU A O    7  
ATOM   10454 C  CB   . GLU A 1 10 ? 64.122 3.992   16.983  1.00 0.00  ? 10  GLU A CB   7  
ATOM   10455 C  CG   . GLU A 1 10 ? 65.059 2.804   17.243  1.00 0.00  ? 10  GLU A CG   7  
ATOM   10456 C  CD   . GLU A 1 10 ? 65.439 2.131   15.920  1.00 0.00  ? 10  GLU A CD   7  
ATOM   10457 O  OE1  . GLU A 1 10 ? 66.330 2.634   15.257  1.00 0.00  ? 10  GLU A OE1  7  
ATOM   10458 O  OE2  . GLU A 1 10 ? 64.829 1.125   15.594  1.00 0.00  ? 10  GLU A OE2  7  
ATOM   10459 H  H    . GLU A 1 10 ? 64.129 4.105   14.524  1.00 0.00  ? 10  GLU A H    7  
ATOM   10460 H  HA   . GLU A 1 10 ? 62.710 2.475   16.398  1.00 0.00  ? 10  GLU A HA   7  
ATOM   10461 H  HB2  . GLU A 1 10 ? 64.645 4.748   16.415  1.00 0.00  ? 10  GLU A HB2  7  
ATOM   10462 H  HB3  . GLU A 1 10 ? 63.802 4.408   17.927  1.00 0.00  ? 10  GLU A HB3  7  
ATOM   10463 H  HG2  . GLU A 1 10 ? 65.954 3.152   17.738  1.00 0.00  ? 10  GLU A HG2  7  
ATOM   10464 H  HG3  . GLU A 1 10 ? 64.558 2.088   17.872  1.00 0.00  ? 10  GLU A HG3  7  
ATOM   10465 N  N    . GLN A 1 11 ? 61.471 5.481   15.870  1.00 0.00  ? 11  GLN A N    7  
ATOM   10466 C  CA   . GLN A 1 11 ? 60.261 6.328   16.130  1.00 0.00  ? 11  GLN A CA   7  
ATOM   10467 C  C    . GLN A 1 11 ? 58.995 5.514   15.829  1.00 0.00  ? 11  GLN A C    7  
ATOM   10468 O  O    . GLN A 1 11 ? 57.982 5.655   16.486  1.00 0.00  ? 11  GLN A O    7  
ATOM   10469 C  CB   . GLN A 1 11 ? 60.379 7.516   15.168  1.00 0.00  ? 11  GLN A CB   7  
ATOM   10470 C  CG   . GLN A 1 11 ? 60.070 8.814   15.917  1.00 0.00  ? 11  GLN A CG   7  
ATOM   10471 C  CD   . GLN A 1 11 ? 61.203 9.817   15.690  1.00 0.00  ? 11  GLN A CD   7  
ATOM   10472 O  OE1  . GLN A 1 11 ? 61.211 10.530  14.708  1.00 0.00  ? 11  GLN A OE1  7  
ATOM   10473 N  NE2  . GLN A 1 11 ? 62.167 9.903   16.562  1.00 0.00  ? 11  GLN A NE2  7  
ATOM   10474 H  H    . GLN A 1 11 ? 62.118 5.754   15.188  1.00 0.00  ? 11  GLN A H    7  
ATOM   10475 H  HA   . GLN A 1 11 ? 60.254 6.674   17.152  1.00 0.00  ? 11  GLN A HA   7  
ATOM   10476 H  HB2  . GLN A 1 11 ? 61.383 7.560   14.770  1.00 0.00  ? 11  GLN A HB2  7  
ATOM   10477 H  HB3  . GLN A 1 11 ? 59.676 7.396   14.356  1.00 0.00  ? 11  GLN A HB3  7  
ATOM   10478 H  HG2  . GLN A 1 11 ? 59.141 9.229   15.551  1.00 0.00  ? 11  GLN A HG2  7  
ATOM   10479 H  HG3  . GLN A 1 11 ? 59.981 8.608   16.972  1.00 0.00  ? 11  GLN A HG3  7  
ATOM   10480 H  HE21 . GLN A 1 11 ? 62.164 9.328   17.354  1.00 0.00  ? 11  GLN A HE21 7  
ATOM   10481 H  HE22 . GLN A 1 11 ? 62.897 10.541  16.422  1.00 0.00  ? 11  GLN A HE22 7  
ATOM   10482 N  N    . LEU A 1 12 ? 59.066 4.643   14.850  1.00 0.00  ? 12  LEU A N    7  
ATOM   10483 C  CA   . LEU A 1 12 ? 57.893 3.778   14.503  1.00 0.00  ? 12  LEU A CA   7  
ATOM   10484 C  C    . LEU A 1 12 ? 57.626 2.783   15.646  1.00 0.00  ? 12  LEU A C    7  
ATOM   10485 O  O    . LEU A 1 12 ? 56.533 2.282   15.800  1.00 0.00  ? 12  LEU A O    7  
ATOM   10486 C  CB   . LEU A 1 12 ? 58.319 3.018   13.244  1.00 0.00  ? 12  LEU A CB   7  
ATOM   10487 C  CG   . LEU A 1 12 ? 58.692 3.994   12.129  1.00 0.00  ? 12  LEU A CG   7  
ATOM   10488 C  CD1  . LEU A 1 12 ? 59.557 3.267   11.099  1.00 0.00  ? 12  LEU A CD1  7  
ATOM   10489 C  CD2  . LEU A 1 12 ? 57.417 4.503   11.460  1.00 0.00  ? 12  LEU A CD2  7  
ATOM   10490 H  H    . LEU A 1 12 ? 59.905 4.541   14.354  1.00 0.00  ? 12  LEU A H    7  
ATOM   10491 H  HA   . LEU A 1 12 ? 57.019 4.378   14.303  1.00 0.00  ? 12  LEU A HA   7  
ATOM   10492 H  HB2  . LEU A 1 12 ? 59.172 2.397   13.474  1.00 0.00  ? 12  LEU A HB2  7  
ATOM   10493 H  HB3  . LEU A 1 12 ? 57.507 2.396   12.910  1.00 0.00  ? 12  LEU A HB3  7  
ATOM   10494 H  HG   . LEU A 1 12 ? 59.244 4.826   12.542  1.00 0.00  ? 12  LEU A HG   7  
ATOM   10495 H  HD11 . LEU A 1 12 ? 60.267 2.633   11.611  1.00 0.00  ? 12  LEU A HD11 7  
ATOM   10496 H  HD12 . LEU A 1 12 ? 60.088 3.989   10.498  1.00 0.00  ? 12  LEU A HD12 7  
ATOM   10497 H  HD13 . LEU A 1 12 ? 58.928 2.662   10.463  1.00 0.00  ? 12  LEU A HD13 7  
ATOM   10498 H  HD21 . LEU A 1 12 ? 57.047 3.755   10.775  1.00 0.00  ? 12  LEU A HD21 7  
ATOM   10499 H  HD22 . LEU A 1 12 ? 57.630 5.413   10.921  1.00 0.00  ? 12  LEU A HD22 7  
ATOM   10500 H  HD23 . LEU A 1 12 ? 56.671 4.697   12.216  1.00 0.00  ? 12  LEU A HD23 7  
ATOM   10501 N  N    . THR A 1 13 ? 58.647 2.504   16.427  1.00 0.00  ? 13  THR A N    7  
ATOM   10502 C  CA   . THR A 1 13 ? 58.568 1.544   17.590  1.00 0.00  ? 13  THR A CA   7  
ATOM   10503 C  C    . THR A 1 13 ? 58.517 0.097   17.099  1.00 0.00  ? 13  THR A C    7  
ATOM   10504 O  O    . THR A 1 13 ? 58.304 -0.172  15.930  1.00 0.00  ? 13  THR A O    7  
ATOM   10505 C  CB   . THR A 1 13 ? 57.322 1.896   18.441  1.00 0.00  ? 13  THR A CB   7  
ATOM   10506 O  OG1  . THR A 1 13 ? 56.178 1.197   17.961  1.00 0.00  ? 13  THR A OG1  7  
ATOM   10507 C  CG2  . THR A 1 13 ? 57.058 3.408   18.423  1.00 0.00  ? 13  THR A CG2  7  
ATOM   10508 H  H    . THR A 1 13 ? 59.500 2.929   16.235  1.00 0.00  ? 13  THR A H    7  
ATOM   10509 H  HA   . THR A 1 13 ? 59.451 1.662   18.199  1.00 0.00  ? 13  THR A HA   7  
ATOM   10510 H  HB   . THR A 1 13 ? 57.506 1.593   19.461  1.00 0.00  ? 13  THR A HB   7  
ATOM   10511 H  HG1  . THR A 1 13 ? 55.957 1.543   17.092  1.00 0.00  ? 13  THR A HG1  7  
ATOM   10512 H  HG21 . THR A 1 13 ? 57.995 3.936   18.325  1.00 0.00  ? 13  THR A HG21 7  
ATOM   10513 H  HG22 . THR A 1 13 ? 56.576 3.699   19.345  1.00 0.00  ? 13  THR A HG22 7  
ATOM   10514 H  HG23 . THR A 1 13 ? 56.416 3.654   17.590  1.00 0.00  ? 13  THR A HG23 7  
ATOM   10515 N  N    . GLU A 1 14 ? 58.735 -0.838  17.991  1.00 0.00  ? 14  GLU A N    7  
ATOM   10516 C  CA   . GLU A 1 14 ? 58.727 -2.278  17.593  1.00 0.00  ? 14  GLU A CA   7  
ATOM   10517 C  C    . GLU A 1 14 ? 57.390 -2.656  16.947  1.00 0.00  ? 14  GLU A C    7  
ATOM   10518 O  O    . GLU A 1 14 ? 57.340 -3.508  16.080  1.00 0.00  ? 14  GLU A O    7  
ATOM   10519 C  CB   . GLU A 1 14 ? 58.959 -3.065  18.890  1.00 0.00  ? 14  GLU A CB   7  
ATOM   10520 C  CG   . GLU A 1 14 ? 60.076 -4.104  18.684  1.00 0.00  ? 14  GLU A CG   7  
ATOM   10521 C  CD   . GLU A 1 14 ? 61.246 -3.491  17.899  1.00 0.00  ? 14  GLU A CD   7  
ATOM   10522 O  OE1  . GLU A 1 14 ? 61.778 -2.483  18.340  1.00 0.00  ? 14  GLU A OE1  7  
ATOM   10523 O  OE2  . GLU A 1 14 ? 61.589 -4.042  16.866  1.00 0.00  ? 14  GLU A OE2  7  
ATOM   10524 H  H    . GLU A 1 14 ? 58.919 -0.590  18.921  1.00 0.00  ? 14  GLU A H    7  
ATOM   10525 H  HA   . GLU A 1 14 ? 59.532 -2.466  16.905  1.00 0.00  ? 14  GLU A HA   7  
ATOM   10526 H  HB2  . GLU A 1 14 ? 59.245 -2.384  19.678  1.00 0.00  ? 14  GLU A HB2  7  
ATOM   10527 H  HB3  . GLU A 1 14 ? 58.047 -3.574  19.169  1.00 0.00  ? 14  GLU A HB3  7  
ATOM   10528 H  HG2  . GLU A 1 14 ? 60.433 -4.440  19.646  1.00 0.00  ? 14  GLU A HG2  7  
ATOM   10529 H  HG3  . GLU A 1 14 ? 59.682 -4.946  18.135  1.00 0.00  ? 14  GLU A HG3  7  
ATOM   10530 N  N    . GLU A 1 15 ? 56.313 -2.018  17.343  1.00 0.00  ? 15  GLU A N    7  
ATOM   10531 C  CA   . GLU A 1 15 ? 54.990 -2.333  16.723  1.00 0.00  ? 15  GLU A CA   7  
ATOM   10532 C  C    . GLU A 1 15 ? 55.073 -2.115  15.208  1.00 0.00  ? 15  GLU A C    7  
ATOM   10533 O  O    . GLU A 1 15 ? 54.671 -2.960  14.433  1.00 0.00  ? 15  GLU A O    7  
ATOM   10534 C  CB   . GLU A 1 15 ? 53.991 -1.360  17.361  1.00 0.00  ? 15  GLU A CB   7  
ATOM   10535 C  CG   . GLU A 1 15 ? 53.101 -2.122  18.348  1.00 0.00  ? 15  GLU A CG   7  
ATOM   10536 C  CD   . GLU A 1 15 ? 53.863 -2.358  19.656  1.00 0.00  ? 15  GLU A CD   7  
ATOM   10537 O  OE1  . GLU A 1 15 ? 54.631 -3.304  19.708  1.00 0.00  ? 15  GLU A OE1  7  
ATOM   10538 O  OE2  . GLU A 1 15 ? 53.661 -1.590  20.582  1.00 0.00  ? 15  GLU A OE2  7  
ATOM   10539 H  H    . GLU A 1 15 ? 56.378 -1.325  18.034  1.00 0.00  ? 15  GLU A H    7  
ATOM   10540 H  HA   . GLU A 1 15 ? 54.705 -3.350  16.940  1.00 0.00  ? 15  GLU A HA   7  
ATOM   10541 H  HB2  . GLU A 1 15 ? 54.527 -0.581  17.884  1.00 0.00  ? 15  GLU A HB2  7  
ATOM   10542 H  HB3  . GLU A 1 15 ? 53.375 -0.919  16.591  1.00 0.00  ? 15  GLU A HB3  7  
ATOM   10543 H  HG2  . GLU A 1 15 ? 52.211 -1.545  18.549  1.00 0.00  ? 15  GLU A HG2  7  
ATOM   10544 H  HG3  . GLU A 1 15 ? 52.824 -3.074  17.921  1.00 0.00  ? 15  GLU A HG3  7  
ATOM   10545 N  N    . GLN A 1 16 ? 55.618 -0.997  14.782  1.00 0.00  ? 16  GLN A N    7  
ATOM   10546 C  CA   . GLN A 1 16 ? 55.746 -0.743  13.314  1.00 0.00  ? 16  GLN A CA   7  
ATOM   10547 C  C    . GLN A 1 16 ? 56.840 -1.627  12.723  1.00 0.00  ? 16  GLN A C    7  
ATOM   10548 O  O    . GLN A 1 16 ? 56.713 -2.150  11.633  1.00 0.00  ? 16  GLN A O    7  
ATOM   10549 C  CB   . GLN A 1 16 ? 56.109 0.727   13.169  1.00 0.00  ? 16  GLN A CB   7  
ATOM   10550 C  CG   . GLN A 1 16 ? 54.885 1.564   13.518  1.00 0.00  ? 16  GLN A CG   7  
ATOM   10551 C  CD   . GLN A 1 16 ? 54.879 2.865   12.713  1.00 0.00  ? 16  GLN A CD   7  
ATOM   10552 O  OE1  . GLN A 1 16 ? 54.946 2.843   11.501  1.00 0.00  ? 16  GLN A OE1  7  
ATOM   10553 N  NE2  . GLN A 1 16 ? 54.792 4.006   13.337  1.00 0.00  ? 16  GLN A NE2  7  
ATOM   10554 H  H    . GLN A 1 16 ? 55.953 -0.338  15.426  1.00 0.00  ? 16  GLN A H    7  
ATOM   10555 H  HA   . GLN A 1 16 ? 54.816 -0.927  12.835  1.00 0.00  ? 16  GLN A HA   7  
ATOM   10556 H  HB2  . GLN A 1 16 ? 56.921 0.968   13.839  1.00 0.00  ? 16  GLN A HB2  7  
ATOM   10557 H  HB3  . GLN A 1 16 ? 56.405 0.930   12.150  1.00 0.00  ? 16  GLN A HB3  7  
ATOM   10558 H  HG2  . GLN A 1 16 ? 53.990 1.003   13.295  1.00 0.00  ? 16  GLN A HG2  7  
ATOM   10559 H  HG3  . GLN A 1 16 ? 54.912 1.788   14.564  1.00 0.00  ? 16  GLN A HG3  7  
ATOM   10560 H  HE21 . GLN A 1 16 ? 54.731 4.028   14.314  1.00 0.00  ? 16  GLN A HE21 7  
ATOM   10561 H  HE22 . GLN A 1 16 ? 54.785 4.842   12.826  1.00 0.00  ? 16  GLN A HE22 7  
ATOM   10562 N  N    . LYS A 1 17 ? 57.907 -1.806  13.452  1.00 0.00  ? 17  LYS A N    7  
ATOM   10563 C  CA   . LYS A 1 17 ? 59.028 -2.673  12.967  1.00 0.00  ? 17  LYS A CA   7  
ATOM   10564 C  C    . LYS A 1 17 ? 58.486 -4.073  12.655  1.00 0.00  ? 17  LYS A C    7  
ATOM   10565 O  O    . LYS A 1 17 ? 58.762 -4.636  11.612  1.00 0.00  ? 17  LYS A O    7  
ATOM   10566 C  CB   . LYS A 1 17 ? 60.038 -2.719  14.119  1.00 0.00  ? 17  LYS A CB   7  
ATOM   10567 C  CG   . LYS A 1 17 ? 61.420 -2.306  13.605  1.00 0.00  ? 17  LYS A CG   7  
ATOM   10568 C  CD   . LYS A 1 17 ? 62.087 -1.373  14.622  1.00 0.00  ? 17  LYS A CD   7  
ATOM   10569 C  CE   . LYS A 1 17 ? 63.349 -2.036  15.180  1.00 0.00  ? 17  LYS A CE   7  
ATOM   10570 N  NZ   . LYS A 1 17 ? 63.642 -1.303  16.445  1.00 0.00  ? 17  LYS A NZ   7  
ATOM   10571 H  H    . LYS A 1 17 ? 57.960 -1.376  14.328  1.00 0.00  ? 17  LYS A H    7  
ATOM   10572 H  HA   . LYS A 1 17 ? 59.484 -2.243  12.088  1.00 0.00  ? 17  LYS A HA   7  
ATOM   10573 H  HB2  . LYS A 1 17 ? 59.726 -2.039  14.900  1.00 0.00  ? 17  LYS A HB2  7  
ATOM   10574 H  HB3  . LYS A 1 17 ? 60.090 -3.722  14.516  1.00 0.00  ? 17  LYS A HB3  7  
ATOM   10575 H  HG2  . LYS A 1 17 ? 62.030 -3.188  13.467  1.00 0.00  ? 17  LYS A HG2  7  
ATOM   10576 H  HG3  . LYS A 1 17 ? 61.316 -1.790  12.662  1.00 0.00  ? 17  LYS A HG3  7  
ATOM   10577 H  HD2  . LYS A 1 17 ? 62.352 -0.444  14.138  1.00 0.00  ? 17  LYS A HD2  7  
ATOM   10578 H  HD3  . LYS A 1 17 ? 61.400 -1.173  15.432  1.00 0.00  ? 17  LYS A HD3  7  
ATOM   10579 H  HE2  . LYS A 1 17 ? 63.165 -3.083  15.381  1.00 0.00  ? 17  LYS A HE2  7  
ATOM   10580 H  HE3  . LYS A 1 17 ? 64.170 -1.923  14.488  1.00 0.00  ? 17  LYS A HE3  7  
ATOM   10581 H  HZ1  . LYS A 1 17 ? 64.504 -1.687  16.877  1.00 0.00  ? 17  LYS A HZ1  7  
ATOM   10582 H  HZ2  . LYS A 1 17 ? 62.843 -1.416  17.105  1.00 0.00  ? 17  LYS A HZ2  7  
ATOM   10583 H  HZ3  . LYS A 1 17 ? 63.784 -0.291  16.237  1.00 0.00  ? 17  LYS A HZ3  7  
ATOM   10584 N  N    . ASN A 1 18 ? 57.690 -4.620  13.541  1.00 0.00  ? 18  ASN A N    7  
ATOM   10585 C  CA   . ASN A 1 18 ? 57.091 -5.966  13.291  1.00 0.00  ? 18  ASN A CA   7  
ATOM   10586 C  C    . ASN A 1 18 ? 56.027 -5.850  12.190  1.00 0.00  ? 18  ASN A C    7  
ATOM   10587 O  O    . ASN A 1 18 ? 55.881 -6.730  11.361  1.00 0.00  ? 18  ASN A O    7  
ATOM   10588 C  CB   . ASN A 1 18 ? 56.458 -6.380  14.624  1.00 0.00  ? 18  ASN A CB   7  
ATOM   10589 C  CG   . ASN A 1 18 ? 57.515 -7.052  15.502  1.00 0.00  ? 18  ASN A CG   7  
ATOM   10590 O  OD1  . ASN A 1 18 ? 57.727 -8.244  15.413  1.00 0.00  ? 18  ASN A OD1  7  
ATOM   10591 N  ND2  . ASN A 1 18 ? 58.194 -6.335  16.353  1.00 0.00  ? 18  ASN A ND2  7  
ATOM   10592 H  H    . ASN A 1 18 ? 57.466 -4.131  14.363  1.00 0.00  ? 18  ASN A H    7  
ATOM   10593 H  HA   . ASN A 1 18 ? 57.855 -6.673  13.005  1.00 0.00  ? 18  ASN A HA   7  
ATOM   10594 H  HB2  . ASN A 1 18 ? 56.073 -5.505  15.128  1.00 0.00  ? 18  ASN A HB2  7  
ATOM   10595 H  HB3  . ASN A 1 18 ? 55.652 -7.074  14.440  1.00 0.00  ? 18  ASN A HB3  7  
ATOM   10596 H  HD21 . ASN A 1 18 ? 58.026 -5.372  16.428  1.00 0.00  ? 18  ASN A HD21 7  
ATOM   10597 H  HD22 . ASN A 1 18 ? 58.875 -6.759  16.915  1.00 0.00  ? 18  ASN A HD22 7  
ATOM   10598 N  N    . GLU A 1 19 ? 55.295 -4.756  12.170  1.00 0.00  ? 19  GLU A N    7  
ATOM   10599 C  CA   . GLU A 1 19 ? 54.249 -4.557  11.116  1.00 0.00  ? 19  GLU A CA   7  
ATOM   10600 C  C    . GLU A 1 19 ? 54.904 -4.519  9.729   1.00 0.00  ? 19  GLU A C    7  
ATOM   10601 O  O    . GLU A 1 19 ? 54.512 -5.240  8.832   1.00 0.00  ? 19  GLU A O    7  
ATOM   10602 C  CB   . GLU A 1 19 ? 53.605 -3.203  11.436  1.00 0.00  ? 19  GLU A CB   7  
ATOM   10603 C  CG   . GLU A 1 19 ? 52.388 -3.407  12.345  1.00 0.00  ? 19  GLU A CG   7  
ATOM   10604 C  CD   . GLU A 1 19 ? 51.773 -2.049  12.692  1.00 0.00  ? 19  GLU A CD   7  
ATOM   10605 O  OE1  . GLU A 1 19 ? 52.310 -1.379  13.559  1.00 0.00  ? 19  GLU A OE1  7  
ATOM   10606 O  OE2  . GLU A 1 19 ? 50.774 -1.702  12.084  1.00 0.00  ? 19  GLU A OE2  7  
ATOM   10607 H  H    . GLU A 1 19 ? 55.444 -4.060  12.844  1.00 0.00  ? 19  GLU A H    7  
ATOM   10608 H  HA   . GLU A 1 19 ? 53.509 -5.341  11.164  1.00 0.00  ? 19  GLU A HA   7  
ATOM   10609 H  HB2  . GLU A 1 19 ? 54.325 -2.572  11.936  1.00 0.00  ? 19  GLU A HB2  7  
ATOM   10610 H  HB3  . GLU A 1 19 ? 53.289 -2.730  10.519  1.00 0.00  ? 19  GLU A HB3  7  
ATOM   10611 H  HG2  . GLU A 1 19 ? 51.655 -4.014  11.835  1.00 0.00  ? 19  GLU A HG2  7  
ATOM   10612 H  HG3  . GLU A 1 19 ? 52.695 -3.902  13.254  1.00 0.00  ? 19  GLU A HG3  7  
ATOM   10613 N  N    . PHE A 1 20 ? 55.906 -3.687  9.553   1.00 0.00  ? 20  PHE A N    7  
ATOM   10614 C  CA   . PHE A 1 20 ? 56.599 -3.607  8.228   1.00 0.00  ? 20  PHE A CA   7  
ATOM   10615 C  C    . PHE A 1 20 ? 57.252 -4.955  7.900   1.00 0.00  ? 20  PHE A C    7  
ATOM   10616 O  O    . PHE A 1 20 ? 57.209 -5.407  6.776   1.00 0.00  ? 20  PHE A O    7  
ATOM   10617 C  CB   . PHE A 1 20 ? 57.662 -2.510  8.382   1.00 0.00  ? 20  PHE A CB   7  
ATOM   10618 C  CG   . PHE A 1 20 ? 56.997 -1.150  8.430   1.00 0.00  ? 20  PHE A CG   7  
ATOM   10619 C  CD1  . PHE A 1 20 ? 56.000 -0.815  7.504   1.00 0.00  ? 20  PHE A CD1  7  
ATOM   10620 C  CD2  . PHE A 1 20 ? 57.381 -0.224  9.406   1.00 0.00  ? 20  PHE A CD2  7  
ATOM   10621 C  CE1  . PHE A 1 20 ? 55.388 0.443   7.558   1.00 0.00  ? 20  PHE A CE1  7  
ATOM   10622 C  CE2  . PHE A 1 20 ? 56.770 1.034   9.459   1.00 0.00  ? 20  PHE A CE2  7  
ATOM   10623 C  CZ   . PHE A 1 20 ? 55.774 1.367   8.536   1.00 0.00  ? 20  PHE A CZ   7  
ATOM   10624 H  H    . PHE A 1 20 ? 56.206 -3.120  10.298  1.00 0.00  ? 20  PHE A H    7  
ATOM   10625 H  HA   . PHE A 1 20 ? 55.898 -3.335  7.455   1.00 0.00  ? 20  PHE A HA   7  
ATOM   10626 H  HB2  . PHE A 1 20 ? 58.215 -2.672  9.295   1.00 0.00  ? 20  PHE A HB2  7  
ATOM   10627 H  HB3  . PHE A 1 20 ? 58.339 -2.547  7.541   1.00 0.00  ? 20  PHE A HB3  7  
ATOM   10628 H  HD1  . PHE A 1 20 ? 55.702 -1.528  6.749   1.00 0.00  ? 20  PHE A HD1  7  
ATOM   10629 H  HD2  . PHE A 1 20 ? 58.150 -0.480  10.120  1.00 0.00  ? 20  PHE A HD2  7  
ATOM   10630 H  HE1  . PHE A 1 20 ? 54.620 0.701   6.844   1.00 0.00  ? 20  PHE A HE1  7  
ATOM   10631 H  HE2  . PHE A 1 20 ? 57.067 1.748   10.214  1.00 0.00  ? 20  PHE A HE2  7  
ATOM   10632 H  HZ   . PHE A 1 20 ? 55.301 2.337   8.578   1.00 0.00  ? 20  PHE A HZ   7  
ATOM   10633 N  N    . LYS A 1 21 ? 57.839 -5.606  8.878   1.00 0.00  ? 21  LYS A N    7  
ATOM   10634 C  CA   . LYS A 1 21 ? 58.475 -6.940  8.628   1.00 0.00  ? 21  LYS A CA   7  
ATOM   10635 C  C    . LYS A 1 21 ? 57.418 -7.922  8.097   1.00 0.00  ? 21  LYS A C    7  
ATOM   10636 O  O    . LYS A 1 21 ? 57.644 -8.625  7.132   1.00 0.00  ? 21  LYS A O    7  
ATOM   10637 C  CB   . LYS A 1 21 ? 59.007 -7.389  9.999   1.00 0.00  ? 21  LYS A CB   7  
ATOM   10638 C  CG   . LYS A 1 21 ? 59.222 -8.910  10.021  1.00 0.00  ? 21  LYS A CG   7  
ATOM   10639 C  CD   . LYS A 1 21 ? 60.379 -9.283  9.086   1.00 0.00  ? 21  LYS A CD   7  
ATOM   10640 C  CE   . LYS A 1 21 ? 60.199 -10.724 8.595   1.00 0.00  ? 21  LYS A CE   7  
ATOM   10641 N  NZ   . LYS A 1 21 ? 61.050 -10.829 7.375   1.00 0.00  ? 21  LYS A NZ   7  
ATOM   10642 H  H    . LYS A 1 21 ? 57.848 -5.223  9.782   1.00 0.00  ? 21  LYS A H    7  
ATOM   10643 H  HA   . LYS A 1 21 ? 59.288 -6.846  7.926   1.00 0.00  ? 21  LYS A HA   7  
ATOM   10644 H  HB2  . LYS A 1 21 ? 59.946 -6.893  10.199  1.00 0.00  ? 21  LYS A HB2  7  
ATOM   10645 H  HB3  . LYS A 1 21 ? 58.294 -7.121  10.764  1.00 0.00  ? 21  LYS A HB3  7  
ATOM   10646 H  HG2  . LYS A 1 21 ? 59.460 -9.222  11.029  1.00 0.00  ? 21  LYS A HG2  7  
ATOM   10647 H  HG3  . LYS A 1 21 ? 58.319 -9.406  9.694   1.00 0.00  ? 21  LYS A HG3  7  
ATOM   10648 H  HD2  . LYS A 1 21 ? 60.389 -8.611  8.239   1.00 0.00  ? 21  LYS A HD2  7  
ATOM   10649 H  HD3  . LYS A 1 21 ? 61.313 -9.202  9.621   1.00 0.00  ? 21  LYS A HD3  7  
ATOM   10650 H  HE2  . LYS A 1 21 ? 60.533 -11.422 9.352   1.00 0.00  ? 21  LYS A HE2  7  
ATOM   10651 H  HE3  . LYS A 1 21 ? 59.166 -10.909 8.341   1.00 0.00  ? 21  LYS A HE3  7  
ATOM   10652 H  HZ1  . LYS A 1 21 ? 62.010 -10.491 7.585   1.00 0.00  ? 21  LYS A HZ1  7  
ATOM   10653 H  HZ2  . LYS A 1 21 ? 60.635 -10.250 6.613   1.00 0.00  ? 21  LYS A HZ2  7  
ATOM   10654 H  HZ3  . LYS A 1 21 ? 61.092 -11.820 7.066   1.00 0.00  ? 21  LYS A HZ3  7  
ATOM   10655 N  N    . ALA A 1 22 ? 56.266 -7.960  8.720   1.00 0.00  ? 22  ALA A N    7  
ATOM   10656 C  CA   . ALA A 1 22 ? 55.182 -8.880  8.256   1.00 0.00  ? 22  ALA A CA   7  
ATOM   10657 C  C    . ALA A 1 22 ? 54.643 -8.410  6.898   1.00 0.00  ? 22  ALA A C    7  
ATOM   10658 O  O    . ALA A 1 22 ? 54.493 -9.192  5.977   1.00 0.00  ? 22  ALA A O    7  
ATOM   10659 C  CB   . ALA A 1 22 ? 54.103 -8.793  9.337   1.00 0.00  ? 22  ALA A CB   7  
ATOM   10660 H  H    . ALA A 1 22 ? 56.110 -7.373  9.491   1.00 0.00  ? 22  ALA A H    7  
ATOM   10661 H  HA   . ALA A 1 22 ? 55.552 -9.891  8.184   1.00 0.00  ? 22  ALA A HA   7  
ATOM   10662 H  HB1  . ALA A 1 22 ? 53.438 -9.639  9.251   1.00 0.00  ? 22  ALA A HB1  7  
ATOM   10663 H  HB2  . ALA A 1 22 ? 53.543 -7.879  9.216   1.00 0.00  ? 22  ALA A HB2  7  
ATOM   10664 H  HB3  . ALA A 1 22 ? 54.573 -8.801  10.311  1.00 0.00  ? 22  ALA A HB3  7  
ATOM   10665 N  N    . ALA A 1 23 ? 54.373 -7.131  6.762   1.00 0.00  ? 23  ALA A N    7  
ATOM   10666 C  CA   . ALA A 1 23 ? 53.869 -6.597  5.456   1.00 0.00  ? 23  ALA A CA   7  
ATOM   10667 C  C    . ALA A 1 23 ? 54.932 -6.813  4.368   1.00 0.00  ? 23  ALA A C    7  
ATOM   10668 O  O    . ALA A 1 23 ? 54.614 -7.085  3.226   1.00 0.00  ? 23  ALA A O    7  
ATOM   10669 C  CB   . ALA A 1 23 ? 53.634 -5.104  5.698   1.00 0.00  ? 23  ALA A CB   7  
ATOM   10670 H  H    . ALA A 1 23 ? 54.519 -6.521  7.515   1.00 0.00  ? 23  ALA A H    7  
ATOM   10671 H  HA   . ALA A 1 23 ? 52.944 -7.079  5.182   1.00 0.00  ? 23  ALA A HA   7  
ATOM   10672 H  HB1  . ALA A 1 23 ? 53.113 -4.679  4.852   1.00 0.00  ? 23  ALA A HB1  7  
ATOM   10673 H  HB2  . ALA A 1 23 ? 54.583 -4.605  5.825   1.00 0.00  ? 23  ALA A HB2  7  
ATOM   10674 H  HB3  . ALA A 1 23 ? 53.038 -4.974  6.589   1.00 0.00  ? 23  ALA A HB3  7  
ATOM   10675 N  N    . PHE A 1 24 ? 56.191 -6.715  4.728   1.00 0.00  ? 24  PHE A N    7  
ATOM   10676 C  CA   . PHE A 1 24 ? 57.290 -6.936  3.738   1.00 0.00  ? 24  PHE A CA   7  
ATOM   10677 C  C    . PHE A 1 24 ? 57.187 -8.363  3.182   1.00 0.00  ? 24  PHE A C    7  
ATOM   10678 O  O    . PHE A 1 24 ? 57.214 -8.572  1.983   1.00 0.00  ? 24  PHE A O    7  
ATOM   10679 C  CB   . PHE A 1 24 ? 58.584 -6.743  4.541   1.00 0.00  ? 24  PHE A CB   7  
ATOM   10680 C  CG   . PHE A 1 24 ? 59.786 -6.907  3.639   1.00 0.00  ? 24  PHE A CG   7  
ATOM   10681 C  CD1  . PHE A 1 24 ? 60.314 -5.799  2.969   1.00 0.00  ? 24  PHE A CD1  7  
ATOM   10682 C  CD2  . PHE A 1 24 ? 60.373 -8.168  3.477   1.00 0.00  ? 24  PHE A CD2  7  
ATOM   10683 C  CE1  . PHE A 1 24 ? 61.428 -5.950  2.135   1.00 0.00  ? 24  PHE A CE1  7  
ATOM   10684 C  CE2  . PHE A 1 24 ? 61.487 -8.320  2.643   1.00 0.00  ? 24  PHE A CE2  7  
ATOM   10685 C  CZ   . PHE A 1 24 ? 62.014 -7.210  1.972   1.00 0.00  ? 24  PHE A CZ   7  
ATOM   10686 H  H    . PHE A 1 24 ? 56.414 -6.509  5.661   1.00 0.00  ? 24  PHE A H    7  
ATOM   10687 H  HA   . PHE A 1 24 ? 57.234 -6.213  2.940   1.00 0.00  ? 24  PHE A HA   7  
ATOM   10688 H  HB2  . PHE A 1 24 ? 58.593 -5.753  4.971   1.00 0.00  ? 24  PHE A HB2  7  
ATOM   10689 H  HB3  . PHE A 1 24 ? 58.629 -7.477  5.332   1.00 0.00  ? 24  PHE A HB3  7  
ATOM   10690 H  HD1  . PHE A 1 24 ? 59.862 -4.826  3.095   1.00 0.00  ? 24  PHE A HD1  7  
ATOM   10691 H  HD2  . PHE A 1 24 ? 59.965 -9.024  3.996   1.00 0.00  ? 24  PHE A HD2  7  
ATOM   10692 H  HE1  . PHE A 1 24 ? 61.835 -5.095  1.617   1.00 0.00  ? 24  PHE A HE1  7  
ATOM   10693 H  HE2  . PHE A 1 24 ? 61.938 -9.293  2.517   1.00 0.00  ? 24  PHE A HE2  7  
ATOM   10694 H  HZ   . PHE A 1 24 ? 62.873 -7.326  1.328   1.00 0.00  ? 24  PHE A HZ   7  
ATOM   10695 N  N    . ASP A 1 25 ? 57.042 -9.340  4.046   1.00 0.00  ? 25  ASP A N    7  
ATOM   10696 C  CA   . ASP A 1 25 ? 56.905 -10.753 3.574   1.00 0.00  ? 25  ASP A CA   7  
ATOM   10697 C  C    . ASP A 1 25 ? 55.606 -10.896 2.763   1.00 0.00  ? 25  ASP A C    7  
ATOM   10698 O  O    . ASP A 1 25 ? 55.549 -11.629 1.794   1.00 0.00  ? 25  ASP A O    7  
ATOM   10699 C  CB   . ASP A 1 25 ? 56.862 -11.608 4.849   1.00 0.00  ? 25  ASP A CB   7  
ATOM   10700 C  CG   . ASP A 1 25 ? 58.273 -11.735 5.439   1.00 0.00  ? 25  ASP A CG   7  
ATOM   10701 O  OD1  . ASP A 1 25 ? 58.919 -10.715 5.620   1.00 0.00  ? 25  ASP A OD1  7  
ATOM   10702 O  OD2  . ASP A 1 25 ? 58.683 -12.852 5.704   1.00 0.00  ? 25  ASP A OD2  7  
ATOM   10703 H  H    . ASP A 1 25 ? 57.005 -9.141  5.006   1.00 0.00  ? 25  ASP A H    7  
ATOM   10704 H  HA   . ASP A 1 25 ? 57.755 -11.032 2.970   1.00 0.00  ? 25  ASP A HA   7  
ATOM   10705 H  HB2  . ASP A 1 25 ? 56.211 -11.142 5.573   1.00 0.00  ? 25  ASP A HB2  7  
ATOM   10706 H  HB3  . ASP A 1 25 ? 56.488 -12.591 4.608   1.00 0.00  ? 25  ASP A HB3  7  
ATOM   10707 N  N    . ILE A 1 26 ? 54.572 -10.174 3.136   1.00 0.00  ? 26  ILE A N    7  
ATOM   10708 C  CA   . ILE A 1 26 ? 53.288 -10.238 2.368   1.00 0.00  ? 26  ILE A CA   7  
ATOM   10709 C  C    . ILE A 1 26 ? 53.506 -9.631  0.970   1.00 0.00  ? 26  ILE A C    7  
ATOM   10710 O  O    . ILE A 1 26 ? 52.938 -10.079 -0.008  1.00 0.00  ? 26  ILE A O    7  
ATOM   10711 C  CB   . ILE A 1 26 ? 52.283 -9.400  3.180   1.00 0.00  ? 26  ILE A CB   7  
ATOM   10712 C  CG1  . ILE A 1 26 ? 51.891 -10.153 4.462   1.00 0.00  ? 26  ILE A CG1  7  
ATOM   10713 C  CG2  . ILE A 1 26 ? 51.032 -9.120  2.338   1.00 0.00  ? 26  ILE A CG2  7  
ATOM   10714 C  CD1  . ILE A 1 26 ? 51.005 -11.358 4.124   1.00 0.00  ? 26  ILE A CD1  7  
ATOM   10715 H  H    . ILE A 1 26 ? 54.649 -9.574  3.908   1.00 0.00  ? 26  ILE A H    7  
ATOM   10716 H  HA   . ILE A 1 26 ? 52.946 -11.256 2.287   1.00 0.00  ? 26  ILE A HA   7  
ATOM   10717 H  HB   . ILE A 1 26 ? 52.743 -8.459  3.447   1.00 0.00  ? 26  ILE A HB   7  
ATOM   10718 H  HG12 . ILE A 1 26 ? 52.786 -10.497 4.961   1.00 0.00  ? 26  ILE A HG12 7  
ATOM   10719 H  HG13 . ILE A 1 26 ? 51.351 -9.486  5.119   1.00 0.00  ? 26  ILE A HG13 7  
ATOM   10720 H  HG21 . ILE A 1 26 ? 50.781 -9.998  1.759   1.00 0.00  ? 26  ILE A HG21 7  
ATOM   10721 H  HG22 . ILE A 1 26 ? 51.227 -8.293  1.672   1.00 0.00  ? 26  ILE A HG22 7  
ATOM   10722 H  HG23 . ILE A 1 26 ? 50.207 -8.870  2.990   1.00 0.00  ? 26  ILE A HG23 7  
ATOM   10723 H  HD11 . ILE A 1 26 ? 49.996 -11.023 3.931   1.00 0.00  ? 26  ILE A HD11 7  
ATOM   10724 H  HD12 . ILE A 1 26 ? 51.000 -12.046 4.957   1.00 0.00  ? 26  ILE A HD12 7  
ATOM   10725 H  HD13 . ILE A 1 26 ? 51.392 -11.856 3.250   1.00 0.00  ? 26  ILE A HD13 7  
ATOM   10726 N  N    . PHE A 1 27 ? 54.340 -8.621  0.878   1.00 0.00  ? 27  PHE A N    7  
ATOM   10727 C  CA   . PHE A 1 27 ? 54.625 -7.976  -0.444  1.00 0.00  ? 27  PHE A CA   7  
ATOM   10728 C  C    . PHE A 1 27 ? 55.342 -8.961  -1.383  1.00 0.00  ? 27  PHE A C    7  
ATOM   10729 O  O    . PHE A 1 27 ? 55.142 -8.940  -2.583  1.00 0.00  ? 27  PHE A O    7  
ATOM   10730 C  CB   . PHE A 1 27 ? 55.549 -6.797  -0.112  1.00 0.00  ? 27  PHE A CB   7  
ATOM   10731 C  CG   . PHE A 1 27 ? 55.216 -5.601  -0.979  1.00 0.00  ? 27  PHE A CG   7  
ATOM   10732 C  CD1  . PHE A 1 27 ? 55.108 -5.741  -2.370  1.00 0.00  ? 27  PHE A CD1  7  
ATOM   10733 C  CD2  . PHE A 1 27 ? 55.023 -4.347  -0.387  1.00 0.00  ? 27  PHE A CD2  7  
ATOM   10734 C  CE1  . PHE A 1 27 ? 54.806 -4.628  -3.163  1.00 0.00  ? 27  PHE A CE1  7  
ATOM   10735 C  CE2  . PHE A 1 27 ? 54.722 -3.235  -1.182  1.00 0.00  ? 27  PHE A CE2  7  
ATOM   10736 C  CZ   . PHE A 1 27 ? 54.613 -3.375  -2.570  1.00 0.00  ? 27  PHE A CZ   7  
ATOM   10737 H  H    . PHE A 1 27 ? 54.788 -8.288  1.685   1.00 0.00  ? 27  PHE A H    7  
ATOM   10738 H  HA   . PHE A 1 27 ? 53.714 -7.616  -0.894  1.00 0.00  ? 27  PHE A HA   7  
ATOM   10739 H  HB2  . PHE A 1 27 ? 55.425 -6.528  0.927   1.00 0.00  ? 27  PHE A HB2  7  
ATOM   10740 H  HB3  . PHE A 1 27 ? 56.575 -7.088  -0.283  1.00 0.00  ? 27  PHE A HB3  7  
ATOM   10741 H  HD1  . PHE A 1 27 ? 55.258 -6.706  -2.830  1.00 0.00  ? 27  PHE A HD1  7  
ATOM   10742 H  HD2  . PHE A 1 27 ? 55.106 -4.238  0.683   1.00 0.00  ? 27  PHE A HD2  7  
ATOM   10743 H  HE1  . PHE A 1 27 ? 54.721 -4.735  -4.235  1.00 0.00  ? 27  PHE A HE1  7  
ATOM   10744 H  HE2  . PHE A 1 27 ? 54.573 -2.268  -0.724  1.00 0.00  ? 27  PHE A HE2  7  
ATOM   10745 H  HZ   . PHE A 1 27 ? 54.381 -2.516  -3.183  1.00 0.00  ? 27  PHE A HZ   7  
ATOM   10746 N  N    . VAL A 1 28 ? 56.182 -9.815  -0.847  1.00 0.00  ? 28  VAL A N    7  
ATOM   10747 C  CA   . VAL A 1 28 ? 56.922 -10.792 -1.715  1.00 0.00  ? 28  VAL A CA   7  
ATOM   10748 C  C    . VAL A 1 28 ? 56.188 -12.141 -1.823  1.00 0.00  ? 28  VAL A C    7  
ATOM   10749 O  O    . VAL A 1 28 ? 56.665 -13.048 -2.480  1.00 0.00  ? 28  VAL A O    7  
ATOM   10750 C  CB   . VAL A 1 28 ? 58.299 -10.980 -1.058  1.00 0.00  ? 28  VAL A CB   7  
ATOM   10751 C  CG1  . VAL A 1 28 ? 59.028 -9.637  -0.990  1.00 0.00  ? 28  VAL A CG1  7  
ATOM   10752 C  CG2  . VAL A 1 28 ? 58.140 -11.542 0.358   1.00 0.00  ? 28  VAL A CG2  7  
ATOM   10753 H  H    . VAL A 1 28 ? 56.334 -9.808  0.121   1.00 0.00  ? 28  VAL A H    7  
ATOM   10754 H  HA   . VAL A 1 28 ? 57.054 -10.374 -2.700  1.00 0.00  ? 28  VAL A HA   7  
ATOM   10755 H  HB   . VAL A 1 28 ? 58.882 -11.669 -1.654  1.00 0.00  ? 28  VAL A HB   7  
ATOM   10756 H  HG11 . VAL A 1 28 ? 59.178 -9.258  -1.990  1.00 0.00  ? 28  VAL A HG11 7  
ATOM   10757 H  HG12 . VAL A 1 28 ? 59.985 -9.773  -0.508  1.00 0.00  ? 28  VAL A HG12 7  
ATOM   10758 H  HG13 . VAL A 1 28 ? 58.436 -8.933  -0.422  1.00 0.00  ? 28  VAL A HG13 7  
ATOM   10759 H  HG21 . VAL A 1 28 ? 59.105 -11.848 0.733   1.00 0.00  ? 28  VAL A HG21 7  
ATOM   10760 H  HG22 . VAL A 1 28 ? 57.476 -12.394 0.336   1.00 0.00  ? 28  VAL A HG22 7  
ATOM   10761 H  HG23 . VAL A 1 28 ? 57.728 -10.781 1.004   1.00 0.00  ? 28  VAL A HG23 7  
ATOM   10762 N  N    . LEU A 1 29 ? 55.036 -12.289 -1.207  1.00 0.00  ? 29  LEU A N    7  
ATOM   10763 C  CA   . LEU A 1 29 ? 54.297 -13.591 -1.312  1.00 0.00  ? 29  LEU A CA   7  
ATOM   10764 C  C    . LEU A 1 29 ? 53.900 -13.843 -2.770  1.00 0.00  ? 29  LEU A C    7  
ATOM   10765 O  O    . LEU A 1 29 ? 54.093 -14.921 -3.297  1.00 0.00  ? 29  LEU A O    7  
ATOM   10766 C  CB   . LEU A 1 29 ? 53.055 -13.438 -0.429  1.00 0.00  ? 29  LEU A CB   7  
ATOM   10767 C  CG   . LEU A 1 29 ? 53.290 -14.168 0.892   1.00 0.00  ? 29  LEU A CG   7  
ATOM   10768 C  CD1  . LEU A 1 29 ? 52.316 -13.644 1.949   1.00 0.00  ? 29  LEU A CD1  7  
ATOM   10769 C  CD2  . LEU A 1 29 ? 53.063 -15.668 0.695   1.00 0.00  ? 29  LEU A CD2  7  
ATOM   10770 H  H    . LEU A 1 29 ? 54.656 -11.550 -0.688  1.00 0.00  ? 29  LEU A H    7  
ATOM   10771 H  HA   . LEU A 1 29 ? 54.912 -14.400 -0.947  1.00 0.00  ? 29  LEU A HA   7  
ATOM   10772 H  HB2  . LEU A 1 29 ? 52.872 -12.390 -0.239  1.00 0.00  ? 29  LEU A HB2  7  
ATOM   10773 H  HB3  . LEU A 1 29 ? 52.201 -13.869 -0.930  1.00 0.00  ? 29  LEU A HB3  7  
ATOM   10774 H  HG   . LEU A 1 29 ? 54.305 -13.995 1.218   1.00 0.00  ? 29  LEU A HG   7  
ATOM   10775 H  HD11 . LEU A 1 29 ? 52.845 -13.480 2.876   1.00 0.00  ? 29  LEU A HD11 7  
ATOM   10776 H  HD12 . LEU A 1 29 ? 51.531 -14.369 2.105   1.00 0.00  ? 29  LEU A HD12 7  
ATOM   10777 H  HD13 . LEU A 1 29 ? 51.884 -12.713 1.611   1.00 0.00  ? 29  LEU A HD13 7  
ATOM   10778 H  HD21 . LEU A 1 29 ? 52.013 -15.891 0.806   1.00 0.00  ? 29  LEU A HD21 7  
ATOM   10779 H  HD22 . LEU A 1 29 ? 53.627 -16.218 1.433   1.00 0.00  ? 29  LEU A HD22 7  
ATOM   10780 H  HD23 . LEU A 1 29 ? 53.389 -15.956 -0.294  1.00 0.00  ? 29  LEU A HD23 7  
ATOM   10781 N  N    . GLY A 1 30 ? 53.370 -12.844 -3.429  1.00 0.00  ? 30  GLY A N    7  
ATOM   10782 C  CA   . GLY A 1 30 ? 52.985 -13.002 -4.862  1.00 0.00  ? 30  GLY A CA   7  
ATOM   10783 C  C    . GLY A 1 30 ? 54.037 -12.305 -5.729  1.00 0.00  ? 30  GLY A C    7  
ATOM   10784 O  O    . GLY A 1 30 ? 53.713 -11.594 -6.661  1.00 0.00  ? 30  GLY A O    7  
ATOM   10785 H  H    . GLY A 1 30 ? 53.243 -11.979 -2.984  1.00 0.00  ? 30  GLY A H    7  
ATOM   10786 H  HA2  . GLY A 1 30 ? 52.941 -14.054 -5.115  1.00 0.00  ? 30  GLY A HA2  7  
ATOM   10787 H  HA3  . GLY A 1 30 ? 52.021 -12.542 -5.033  1.00 0.00  ? 30  GLY A HA3  7  
ATOM   10788 N  N    . ALA A 1 31 ? 55.298 -12.492 -5.414  1.00 0.00  ? 31  ALA A N    7  
ATOM   10789 C  CA   . ALA A 1 31 ? 56.380 -11.828 -6.205  1.00 0.00  ? 31  ALA A CA   7  
ATOM   10790 C  C    . ALA A 1 31 ? 57.077 -12.826 -7.138  1.00 0.00  ? 31  ALA A C    7  
ATOM   10791 O  O    . ALA A 1 31 ? 57.489 -13.895 -6.728  1.00 0.00  ? 31  ALA A O    7  
ATOM   10792 C  CB   . ALA A 1 31 ? 57.365 -11.300 -5.158  1.00 0.00  ? 31  ALA A CB   7  
ATOM   10793 H  H    . ALA A 1 31 ? 55.533 -13.061 -4.648  1.00 0.00  ? 31  ALA A H    7  
ATOM   10794 H  HA   . ALA A 1 31 ? 55.976 -11.006 -6.772  1.00 0.00  ? 31  ALA A HA   7  
ATOM   10795 H  HB1  . ALA A 1 31 ? 58.209 -10.841 -5.655  1.00 0.00  ? 31  ALA A HB1  7  
ATOM   10796 H  HB2  . ALA A 1 31 ? 57.713 -12.118 -4.544  1.00 0.00  ? 31  ALA A HB2  7  
ATOM   10797 H  HB3  . ALA A 1 31 ? 56.872 -10.567 -4.537  1.00 0.00  ? 31  ALA A HB3  7  
ATOM   10798 N  N    . GLU A 1 32 ? 57.224 -12.469 -8.389  1.00 0.00  ? 32  GLU A N    7  
ATOM   10799 C  CA   . GLU A 1 32 ? 57.909 -13.374 -9.366  1.00 0.00  ? 32  GLU A CA   7  
ATOM   10800 C  C    . GLU A 1 32 ? 59.431 -13.305 -9.171  1.00 0.00  ? 32  GLU A C    7  
ATOM   10801 O  O    . GLU A 1 32 ? 60.138 -14.268 -9.401  1.00 0.00  ? 32  GLU A O    7  
ATOM   10802 C  CB   . GLU A 1 32 ? 57.526 -12.835 -10.750 1.00 0.00  ? 32  GLU A CB   7  
ATOM   10803 C  CG   . GLU A 1 32 ? 56.031 -13.067 -11.006 1.00 0.00  ? 32  GLU A CG   7  
ATOM   10804 C  CD   . GLU A 1 32 ? 55.235 -11.815 -10.623 1.00 0.00  ? 32  GLU A CD   7  
ATOM   10805 O  OE1  . GLU A 1 32 ? 55.331 -10.830 -11.338 1.00 0.00  ? 32  GLU A OE1  7  
ATOM   10806 O  OE2  . GLU A 1 32 ? 54.546 -11.861 -9.619  1.00 0.00  ? 32  GLU A OE2  7  
ATOM   10807 H  H    . GLU A 1 32 ? 56.892 -11.596 -8.685  1.00 0.00  ? 32  GLU A H    7  
ATOM   10808 H  HA   . GLU A 1 32 ? 57.558 -14.388 -9.254  1.00 0.00  ? 32  GLU A HA   7  
ATOM   10809 H  HB2  . GLU A 1 32 ? 57.739 -11.777 -10.794 1.00 0.00  ? 32  GLU A HB2  7  
ATOM   10810 H  HB3  . GLU A 1 32 ? 58.101 -13.349 -11.506 1.00 0.00  ? 32  GLU A HB3  7  
ATOM   10811 H  HG2  . GLU A 1 32 ? 55.877 -13.282 -12.054 1.00 0.00  ? 32  GLU A HG2  7  
ATOM   10812 H  HG3  . GLU A 1 32 ? 55.689 -13.902 -10.414 1.00 0.00  ? 32  GLU A HG3  7  
ATOM   10813 N  N    . ASP A 1 33 ? 59.935 -12.169 -8.752  1.00 0.00  ? 33  ASP A N    7  
ATOM   10814 C  CA   . ASP A 1 33 ? 61.408 -12.019 -8.538  1.00 0.00  ? 33  ASP A CA   7  
ATOM   10815 C  C    . ASP A 1 33 ? 61.827 -12.659 -7.206  1.00 0.00  ? 33  ASP A C    7  
ATOM   10816 O  O    . ASP A 1 33 ? 62.895 -13.231 -7.095  1.00 0.00  ? 33  ASP A O    7  
ATOM   10817 C  CB   . ASP A 1 33 ? 61.646 -10.503 -8.502  1.00 0.00  ? 33  ASP A CB   7  
ATOM   10818 C  CG   . ASP A 1 33 ? 61.542 -9.923  -9.917  1.00 0.00  ? 33  ASP A CG   7  
ATOM   10819 O  OD1  . ASP A 1 33 ? 60.467 -9.991  -10.492 1.00 0.00  ? 33  ASP A OD1  7  
ATOM   10820 O  OD2  . ASP A 1 33 ? 62.539 -9.414  -10.398 1.00 0.00  ? 33  ASP A OD2  7  
ATOM   10821 H  H    . ASP A 1 33 ? 59.340 -11.408 -8.578  1.00 0.00  ? 33  ASP A H    7  
ATOM   10822 H  HA   . ASP A 1 33 ? 61.955 -12.458 -9.356  1.00 0.00  ? 33  ASP A HA   7  
ATOM   10823 H  HB2  . ASP A 1 33 ? 60.905 -10.037 -7.869  1.00 0.00  ? 33  ASP A HB2  7  
ATOM   10824 H  HB3  . ASP A 1 33 ? 62.631 -10.304 -8.108  1.00 0.00  ? 33  ASP A HB3  7  
ATOM   10825 N  N    . GLY A 1 34 ? 60.998 -12.559 -6.195  1.00 0.00  ? 34  GLY A N    7  
ATOM   10826 C  CA   . GLY A 1 34 ? 61.347 -13.150 -4.865  1.00 0.00  ? 34  GLY A CA   7  
ATOM   10827 C  C    . GLY A 1 34 ? 61.361 -12.044 -3.804  1.00 0.00  ? 34  GLY A C    7  
ATOM   10828 O  O    . GLY A 1 34 ? 60.956 -12.253 -2.677  1.00 0.00  ? 34  GLY A O    7  
ATOM   10829 H  H    . GLY A 1 34 ? 60.146 -12.086 -6.308  1.00 0.00  ? 34  GLY A H    7  
ATOM   10830 H  HA2  . GLY A 1 34 ? 60.608 -13.896 -4.599  1.00 0.00  ? 34  GLY A HA2  7  
ATOM   10831 H  HA3  . GLY A 1 34 ? 62.325 -13.608 -4.916  1.00 0.00  ? 34  GLY A HA3  7  
ATOM   10832 N  N    . CYS A 1 35 ? 61.816 -10.869 -4.163  1.00 0.00  ? 35  CYS A N    7  
ATOM   10833 C  CA   . CYS A 1 35 ? 61.853 -9.735  -3.187  1.00 0.00  ? 35  CYS A CA   7  
ATOM   10834 C  C    . CYS A 1 35 ? 61.000 -8.567  -3.707  1.00 0.00  ? 35  CYS A C    7  
ATOM   10835 O  O    . CYS A 1 35 ? 60.289 -8.700  -4.686  1.00 0.00  ? 35  CYS A O    7  
ATOM   10836 C  CB   . CYS A 1 35 ? 63.329 -9.337  -3.097  1.00 0.00  ? 35  CYS A CB   7  
ATOM   10837 S  SG   . CYS A 1 35 ? 64.097 -10.186 -1.695  1.00 0.00  ? 35  CYS A SG   7  
ATOM   10838 H  H    . CYS A 1 35 ? 62.128 -10.728 -5.081  1.00 0.00  ? 35  CYS A H    7  
ATOM   10839 H  HA   . CYS A 1 35 ? 61.498 -10.057 -2.221  1.00 0.00  ? 35  CYS A HA   7  
ATOM   10840 H  HB2  . CYS A 1 35 ? 63.835 -9.617  -4.010  1.00 0.00  ? 35  CYS A HB2  7  
ATOM   10841 H  HB3  . CYS A 1 35 ? 63.407 -8.268  -2.958  1.00 0.00  ? 35  CYS A HB3  7  
ATOM   10842 H  HG   . CYS A 1 35 ? 63.865 -11.117 -1.749  1.00 0.00  ? 35  CYS A HG   7  
ATOM   10843 N  N    . ILE A 1 36 ? 61.059 -7.428  -3.063  1.00 0.00  ? 36  ILE A N    7  
ATOM   10844 C  CA   . ILE A 1 36 ? 60.242 -6.266  -3.531  1.00 0.00  ? 36  ILE A CA   7  
ATOM   10845 C  C    . ILE A 1 36 ? 61.033 -5.422  -4.539  1.00 0.00  ? 36  ILE A C    7  
ATOM   10846 O  O    . ILE A 1 36 ? 61.880 -4.625  -4.177  1.00 0.00  ? 36  ILE A O    7  
ATOM   10847 C  CB   . ILE A 1 36 ? 59.911 -5.452  -2.272  1.00 0.00  ? 36  ILE A CB   7  
ATOM   10848 C  CG1  . ILE A 1 36 ? 59.006 -6.278  -1.351  1.00 0.00  ? 36  ILE A CG1  7  
ATOM   10849 C  CG2  . ILE A 1 36 ? 59.177 -4.165  -2.669  1.00 0.00  ? 36  ILE A CG2  7  
ATOM   10850 C  CD1  . ILE A 1 36 ? 58.908 -5.600  0.021   1.00 0.00  ? 36  ILE A CD1  7  
ATOM   10851 H  H    . ILE A 1 36 ? 61.635 -7.337  -2.274  1.00 0.00  ? 36  ILE A H    7  
ATOM   10852 H  HA   . ILE A 1 36 ? 59.329 -6.618  -3.985  1.00 0.00  ? 36  ILE A HA   7  
ATOM   10853 H  HB   . ILE A 1 36 ? 60.826 -5.201  -1.753  1.00 0.00  ? 36  ILE A HB   7  
ATOM   10854 H  HG12 . ILE A 1 36 ? 58.020 -6.350  -1.790  1.00 0.00  ? 36  ILE A HG12 7  
ATOM   10855 H  HG13 . ILE A 1 36 ? 59.420 -7.268  -1.233  1.00 0.00  ? 36  ILE A HG13 7  
ATOM   10856 H  HG21 . ILE A 1 36 ? 59.770 -3.616  -3.385  1.00 0.00  ? 36  ILE A HG21 7  
ATOM   10857 H  HG22 . ILE A 1 36 ? 59.020 -3.555  -1.792  1.00 0.00  ? 36  ILE A HG22 7  
ATOM   10858 H  HG23 . ILE A 1 36 ? 58.223 -4.415  -3.109  1.00 0.00  ? 36  ILE A HG23 7  
ATOM   10859 H  HD11 . ILE A 1 36 ? 58.932 -6.351  0.796   1.00 0.00  ? 36  ILE A HD11 7  
ATOM   10860 H  HD12 . ILE A 1 36 ? 57.983 -5.047  0.085   1.00 0.00  ? 36  ILE A HD12 7  
ATOM   10861 H  HD13 . ILE A 1 36 ? 59.740 -4.925  0.149   1.00 0.00  ? 36  ILE A HD13 7  
ATOM   10862 N  N    . SER A 1 37 ? 60.742 -5.585  -5.803  1.00 0.00  ? 37  SER A N    7  
ATOM   10863 C  CA   . SER A 1 37 ? 61.441 -4.789  -6.856  1.00 0.00  ? 37  SER A CA   7  
ATOM   10864 C  C    . SER A 1 37 ? 60.431 -3.849  -7.523  1.00 0.00  ? 37  SER A C    7  
ATOM   10865 O  O    . SER A 1 37 ? 59.269 -3.833  -7.168  1.00 0.00  ? 37  SER A O    7  
ATOM   10866 C  CB   . SER A 1 37 ? 61.973 -5.819  -7.859  1.00 0.00  ? 37  SER A CB   7  
ATOM   10867 O  OG   . SER A 1 37 ? 60.882 -6.420  -8.552  1.00 0.00  ? 37  SER A OG   7  
ATOM   10868 H  H    . SER A 1 37 ? 60.046 -6.225  -6.061  1.00 0.00  ? 37  SER A H    7  
ATOM   10869 H  HA   . SER A 1 37 ? 62.257 -4.226  -6.430  1.00 0.00  ? 37  SER A HA   7  
ATOM   10870 H  HB2  . SER A 1 37 ? 62.617 -5.328  -8.571  1.00 0.00  ? 37  SER A HB2  7  
ATOM   10871 H  HB3  . SER A 1 37 ? 62.538 -6.575  -7.329  1.00 0.00  ? 37  SER A HB3  7  
ATOM   10872 H  HG   . SER A 1 37 ? 61.131 -7.325  -8.770  1.00 0.00  ? 37  SER A HG   7  
ATOM   10873 N  N    . THR A 1 38 ? 60.850 -3.073  -8.486  1.00 0.00  ? 38  THR A N    7  
ATOM   10874 C  CA   . THR A 1 38 ? 59.887 -2.148  -9.169  1.00 0.00  ? 38  THR A CA   7  
ATOM   10875 C  C    . THR A 1 38 ? 58.789 -2.957  -9.872  1.00 0.00  ? 38  THR A C    7  
ATOM   10876 O  O    . THR A 1 38 ? 57.626 -2.602  -9.826  1.00 0.00  ? 38  THR A O    7  
ATOM   10877 C  CB   . THR A 1 38 ? 60.716 -1.362  -10.187 1.00 0.00  ? 38  THR A CB   7  
ATOM   10878 O  OG1  . THR A 1 38 ? 61.600 -2.243  -10.869 1.00 0.00  ? 38  THR A OG1  7  
ATOM   10879 C  CG2  . THR A 1 38 ? 61.523 -0.286  -9.461  1.00 0.00  ? 38  THR A CG2  7  
ATOM   10880 H  H    . THR A 1 38 ? 61.790 -3.101  -8.767  1.00 0.00  ? 38  THR A H    7  
ATOM   10881 H  HA   . THR A 1 38 ? 59.447 -1.471  -8.452  1.00 0.00  ? 38  THR A HA   7  
ATOM   10882 H  HB   . THR A 1 38 ? 60.055 -0.890  -10.898 1.00 0.00  ? 38  THR A HB   7  
ATOM   10883 H  HG1  . THR A 1 38 ? 61.809 -1.854  -11.723 1.00 0.00  ? 38  THR A HG1  7  
ATOM   10884 H  HG21 . THR A 1 38 ? 61.213 0.688   -9.806  1.00 0.00  ? 38  THR A HG21 7  
ATOM   10885 H  HG22 . THR A 1 38 ? 62.573 -0.424  -9.667  1.00 0.00  ? 38  THR A HG22 7  
ATOM   10886 H  HG23 . THR A 1 38 ? 61.352 -0.362  -8.397  1.00 0.00  ? 38  THR A HG23 7  
ATOM   10887 N  N    . LYS A 1 39 ? 59.149 -4.049  -10.510 1.00 0.00  ? 39  LYS A N    7  
ATOM   10888 C  CA   . LYS A 1 39 ? 58.126 -4.898  -11.206 1.00 0.00  ? 39  LYS A CA   7  
ATOM   10889 C  C    . LYS A 1 39 ? 57.101 -5.424  -10.191 1.00 0.00  ? 39  LYS A C    7  
ATOM   10890 O  O    . LYS A 1 39 ? 55.926 -5.546  -10.487 1.00 0.00  ? 39  LYS A O    7  
ATOM   10891 C  CB   . LYS A 1 39 ? 58.922 -6.052  -11.823 1.00 0.00  ? 39  LYS A CB   7  
ATOM   10892 C  CG   . LYS A 1 39 ? 58.091 -6.718  -12.923 1.00 0.00  ? 39  LYS A CG   7  
ATOM   10893 C  CD   . LYS A 1 39 ? 58.567 -8.161  -13.126 1.00 0.00  ? 39  LYS A CD   7  
ATOM   10894 C  CE   . LYS A 1 39 ? 57.540 -9.131  -12.535 1.00 0.00  ? 39  LYS A CE   7  
ATOM   10895 N  NZ   . LYS A 1 39 ? 57.882 -9.224  -11.087 1.00 0.00  ? 39  LYS A NZ   7  
ATOM   10896 H  H    . LYS A 1 39 ? 60.092 -4.316  -10.522 1.00 0.00  ? 39  LYS A H    7  
ATOM   10897 H  HA   . LYS A 1 39 ? 57.632 -4.334  -11.981 1.00 0.00  ? 39  LYS A HA   7  
ATOM   10898 H  HB2  . LYS A 1 39 ? 59.840 -5.669  -12.247 1.00 0.00  ? 39  LYS A HB2  7  
ATOM   10899 H  HB3  . LYS A 1 39 ? 59.155 -6.778  -11.058 1.00 0.00  ? 39  LYS A HB3  7  
ATOM   10900 H  HG2  . LYS A 1 39 ? 57.048 -6.717  -12.636 1.00 0.00  ? 39  LYS A HG2  7  
ATOM   10901 H  HG3  . LYS A 1 39 ? 58.209 -6.169  -13.845 1.00 0.00  ? 39  LYS A HG3  7  
ATOM   10902 H  HD2  . LYS A 1 39 ? 58.678 -8.356  -14.183 1.00 0.00  ? 39  LYS A HD2  7  
ATOM   10903 H  HD3  . LYS A 1 39 ? 59.517 -8.302  -12.633 1.00 0.00  ? 39  LYS A HD3  7  
ATOM   10904 H  HE2  . LYS A 1 39 ? 56.538 -8.741  -12.665 1.00 0.00  ? 39  LYS A HE2  7  
ATOM   10905 H  HE3  . LYS A 1 39 ? 57.628 -10.101 -13.000 1.00 0.00  ? 39  LYS A HE3  7  
ATOM   10906 H  HZ1  . LYS A 1 39 ? 57.897 -8.273  -10.668 1.00 0.00  ? 39  LYS A HZ1  7  
ATOM   10907 H  HZ2  . LYS A 1 39 ? 58.821 -9.668  -10.976 1.00 0.00  ? 39  LYS A HZ2  7  
ATOM   10908 H  HZ3  . LYS A 1 39 ? 57.167 -9.801  -10.598 1.00 0.00  ? 39  LYS A HZ3  7  
ATOM   10909 N  N    . GLU A 1 40 ? 57.539 -5.718  -8.992  1.00 0.00  ? 40  GLU A N    7  
ATOM   10910 C  CA   . GLU A 1 40 ? 56.602 -6.215  -7.941  1.00 0.00  ? 40  GLU A CA   7  
ATOM   10911 C  C    . GLU A 1 40 ? 55.907 -5.024  -7.264  1.00 0.00  ? 40  GLU A C    7  
ATOM   10912 O  O    . GLU A 1 40 ? 54.730 -5.070  -6.959  1.00 0.00  ? 40  GLU A O    7  
ATOM   10913 C  CB   . GLU A 1 40 ? 57.491 -6.964  -6.941  1.00 0.00  ? 40  GLU A CB   7  
ATOM   10914 C  CG   . GLU A 1 40 ? 56.937 -8.372  -6.712  1.00 0.00  ? 40  GLU A CG   7  
ATOM   10915 C  CD   . GLU A 1 40 ? 57.296 -9.264  -7.901  1.00 0.00  ? 40  GLU A CD   7  
ATOM   10916 O  OE1  . GLU A 1 40 ? 58.416 -9.741  -7.947  1.00 0.00  ? 40  GLU A OE1  7  
ATOM   10917 O  OE2  . GLU A 1 40 ? 56.441 -9.459  -8.746  1.00 0.00  ? 40  GLU A OE2  7  
ATOM   10918 H  H    . GLU A 1 40 ? 58.488 -5.597  -8.779  1.00 0.00  ? 40  GLU A H    7  
ATOM   10919 H  HA   . GLU A 1 40 ? 55.874 -6.887  -8.368  1.00 0.00  ? 40  GLU A HA   7  
ATOM   10920 H  HB2  . GLU A 1 40 ? 58.496 -7.034  -7.336  1.00 0.00  ? 40  GLU A HB2  7  
ATOM   10921 H  HB3  . GLU A 1 40 ? 57.511 -6.429  -6.003  1.00 0.00  ? 40  GLU A HB3  7  
ATOM   10922 H  HG2  . GLU A 1 40 ? 57.365 -8.785  -5.810  1.00 0.00  ? 40  GLU A HG2  7  
ATOM   10923 H  HG3  . GLU A 1 40 ? 55.863 -8.325  -6.611  1.00 0.00  ? 40  GLU A HG3  7  
ATOM   10924 N  N    . LEU A 1 41 ? 56.636 -3.957  -7.035  1.00 0.00  ? 41  LEU A N    7  
ATOM   10925 C  CA   . LEU A 1 41 ? 56.046 -2.743  -6.385  1.00 0.00  ? 41  LEU A CA   7  
ATOM   10926 C  C    . LEU A 1 41 ? 54.934 -2.149  -7.260  1.00 0.00  ? 41  LEU A C    7  
ATOM   10927 O  O    . LEU A 1 41 ? 53.854 -1.852  -6.784  1.00 0.00  ? 41  LEU A O    7  
ATOM   10928 C  CB   . LEU A 1 41 ? 57.218 -1.752  -6.262  1.00 0.00  ? 41  LEU A CB   7  
ATOM   10929 C  CG   . LEU A 1 41 ? 56.693 -0.320  -6.089  1.00 0.00  ? 41  LEU A CG   7  
ATOM   10930 C  CD1  . LEU A 1 41 ? 55.762 -0.246  -4.878  1.00 0.00  ? 41  LEU A CD1  7  
ATOM   10931 C  CD2  . LEU A 1 41 ? 57.871 0.630   -5.881  1.00 0.00  ? 41  LEU A CD2  7  
ATOM   10932 H  H    . LEU A 1 41 ? 57.582 -3.953  -7.297  1.00 0.00  ? 41  LEU A H    7  
ATOM   10933 H  HA   . LEU A 1 41 ? 55.667 -2.986  -5.405  1.00 0.00  ? 41  LEU A HA   7  
ATOM   10934 H  HB2  . LEU A 1 41 ? 57.824 -2.018  -5.409  1.00 0.00  ? 41  LEU A HB2  7  
ATOM   10935 H  HB3  . LEU A 1 41 ? 57.821 -1.800  -7.159  1.00 0.00  ? 41  LEU A HB3  7  
ATOM   10936 H  HG   . LEU A 1 41 ? 56.148 -0.028  -6.975  1.00 0.00  ? 41  LEU A HG   7  
ATOM   10937 H  HD11 . LEU A 1 41 ? 54.818 -0.706  -5.128  1.00 0.00  ? 41  LEU A HD11 7  
ATOM   10938 H  HD12 . LEU A 1 41 ? 55.598 0.789   -4.614  1.00 0.00  ? 41  LEU A HD12 7  
ATOM   10939 H  HD13 . LEU A 1 41 ? 56.209 -0.765  -4.045  1.00 0.00  ? 41  LEU A HD13 7  
ATOM   10940 H  HD21 . LEU A 1 41 ? 58.464 0.292   -5.045  1.00 0.00  ? 41  LEU A HD21 7  
ATOM   10941 H  HD22 . LEU A 1 41 ? 57.500 1.624   -5.681  1.00 0.00  ? 41  LEU A HD22 7  
ATOM   10942 H  HD23 . LEU A 1 41 ? 58.480 0.647   -6.772  1.00 0.00  ? 41  LEU A HD23 7  
ATOM   10943 N  N    . GLY A 1 42 ? 55.202 -1.960  -8.529  1.00 0.00  ? 42  GLY A N    7  
ATOM   10944 C  CA   . GLY A 1 42 ? 54.180 -1.366  -9.443  1.00 0.00  ? 42  GLY A CA   7  
ATOM   10945 C  C    . GLY A 1 42 ? 52.867 -2.159  -9.383  1.00 0.00  ? 42  GLY A C    7  
ATOM   10946 O  O    . GLY A 1 42 ? 51.797 -1.584  -9.420  1.00 0.00  ? 42  GLY A O    7  
ATOM   10947 H  H    . GLY A 1 42 ? 56.087 -2.198  -8.880  1.00 0.00  ? 42  GLY A H    7  
ATOM   10948 H  HA2  . GLY A 1 42 ? 53.993 -0.344  -9.134  1.00 0.00  ? 42  GLY A HA2  7  
ATOM   10949 H  HA3  . GLY A 1 42 ? 54.557 -1.374  -10.458 1.00 0.00  ? 42  GLY A HA3  7  
ATOM   10950 N  N    . LYS A 1 43 ? 52.936 -3.468  -9.285  1.00 0.00  ? 43  LYS A N    7  
ATOM   10951 C  CA   . LYS A 1 43 ? 51.677 -4.286  -9.216  1.00 0.00  ? 43  LYS A CA   7  
ATOM   10952 C  C    . LYS A 1 43 ? 50.779 -3.788  -8.070  1.00 0.00  ? 43  LYS A C    7  
ATOM   10953 O  O    . LYS A 1 43 ? 49.577 -3.677  -8.218  1.00 0.00  ? 43  LYS A O    7  
ATOM   10954 C  CB   . LYS A 1 43 ? 52.140 -5.727  -8.956  1.00 0.00  ? 43  LYS A CB   7  
ATOM   10955 C  CG   . LYS A 1 43 ? 51.837 -6.592  -10.185 1.00 0.00  ? 43  LYS A CG   7  
ATOM   10956 C  CD   . LYS A 1 43 ? 51.957 -8.076  -9.819  1.00 0.00  ? 43  LYS A CD   7  
ATOM   10957 C  CE   . LYS A 1 43 ? 53.405 -8.541  -10.009 1.00 0.00  ? 43  LYS A CE   7  
ATOM   10958 N  NZ   . LYS A 1 43 ? 53.753 -9.256  -8.748  1.00 0.00  ? 43  LYS A NZ   7  
ATOM   10959 H  H    . LYS A 1 43 ? 53.811 -3.911  -9.254  1.00 0.00  ? 43  LYS A H    7  
ATOM   10960 H  HA   . LYS A 1 43 ? 51.146 -4.234  -10.155 1.00 0.00  ? 43  LYS A HA   7  
ATOM   10961 H  HB2  . LYS A 1 43 ? 53.202 -5.734  -8.763  1.00 0.00  ? 43  LYS A HB2  7  
ATOM   10962 H  HB3  . LYS A 1 43 ? 51.615 -6.124  -8.100  1.00 0.00  ? 43  LYS A HB3  7  
ATOM   10963 H  HG2  . LYS A 1 43 ? 50.832 -6.387  -10.529 1.00 0.00  ? 43  LYS A HG2  7  
ATOM   10964 H  HG3  . LYS A 1 43 ? 52.540 -6.359  -10.971 1.00 0.00  ? 43  LYS A HG3  7  
ATOM   10965 H  HD2  . LYS A 1 43 ? 51.664 -8.218  -8.789  1.00 0.00  ? 43  LYS A HD2  7  
ATOM   10966 H  HD3  . LYS A 1 43 ? 51.309 -8.657  -10.459 1.00 0.00  ? 43  LYS A HD3  7  
ATOM   10967 H  HE2  . LYS A 1 43 ? 53.475 -9.212  -10.856 1.00 0.00  ? 43  LYS A HE2  7  
ATOM   10968 H  HE3  . LYS A 1 43 ? 54.059 -7.694  -10.147 1.00 0.00  ? 43  LYS A HE3  7  
ATOM   10969 H  HZ1  . LYS A 1 43 ? 53.646 -8.612  -7.940  1.00 0.00  ? 43  LYS A HZ1  7  
ATOM   10970 H  HZ2  . LYS A 1 43 ? 54.743 -9.585  -8.801  1.00 0.00  ? 43  LYS A HZ2  7  
ATOM   10971 H  HZ3  . LYS A 1 43 ? 53.124 -10.076 -8.624  1.00 0.00  ? 43  LYS A HZ3  7  
ATOM   10972 N  N    . VAL A 1 44 ? 51.359 -3.472  -6.937  1.00 0.00  ? 44  VAL A N    7  
ATOM   10973 C  CA   . VAL A 1 44 ? 50.547 -2.963  -5.784  1.00 0.00  ? 44  VAL A CA   7  
ATOM   10974 C  C    . VAL A 1 44 ? 50.299 -1.455  -5.945  1.00 0.00  ? 44  VAL A C    7  
ATOM   10975 O  O    . VAL A 1 44 ? 49.241 -0.955  -5.612  1.00 0.00  ? 44  VAL A O    7  
ATOM   10976 C  CB   . VAL A 1 44 ? 51.396 -3.238  -4.535  1.00 0.00  ? 44  VAL A CB   7  
ATOM   10977 C  CG1  . VAL A 1 44 ? 50.614 -2.843  -3.278  1.00 0.00  ? 44  VAL A CG1  7  
ATOM   10978 C  CG2  . VAL A 1 44 ? 51.743 -4.728  -4.461  1.00 0.00  ? 44  VAL A CG2  7  
ATOM   10979 H  H    . VAL A 1 44 ? 52.332 -3.558  -6.849  1.00 0.00  ? 44  VAL A H    7  
ATOM   10980 H  HA   . VAL A 1 44 ? 49.610 -3.495  -5.718  1.00 0.00  ? 44  VAL A HA   7  
ATOM   10981 H  HB   . VAL A 1 44 ? 52.306 -2.657  -4.588  1.00 0.00  ? 44  VAL A HB   7  
ATOM   10982 H  HG11 . VAL A 1 44 ? 49.944 -3.645  -3.005  1.00 0.00  ? 44  VAL A HG11 7  
ATOM   10983 H  HG12 . VAL A 1 44 ? 50.043 -1.946  -3.474  1.00 0.00  ? 44  VAL A HG12 7  
ATOM   10984 H  HG13 . VAL A 1 44 ? 51.304 -2.661  -2.467  1.00 0.00  ? 44  VAL A HG13 7  
ATOM   10985 H  HG21 . VAL A 1 44 ? 52.225 -4.939  -3.518  1.00 0.00  ? 44  VAL A HG21 7  
ATOM   10986 H  HG22 . VAL A 1 44 ? 52.412 -4.982  -5.271  1.00 0.00  ? 44  VAL A HG22 7  
ATOM   10987 H  HG23 . VAL A 1 44 ? 50.840 -5.313  -4.541  1.00 0.00  ? 44  VAL A HG23 7  
ATOM   10988 N  N    . MET A 1 45 ? 51.270 -0.732  -6.456  1.00 0.00  ? 45  MET A N    7  
ATOM   10989 C  CA   . MET A 1 45 ? 51.101 0.747   -6.648  1.00 0.00  ? 45  MET A CA   7  
ATOM   10990 C  C    . MET A 1 45 ? 49.956 1.033   -7.624  1.00 0.00  ? 45  MET A C    7  
ATOM   10991 O  O    . MET A 1 45 ? 49.165 1.929   -7.410  1.00 0.00  ? 45  MET A O    7  
ATOM   10992 C  CB   . MET A 1 45 ? 52.430 1.234   -7.223  1.00 0.00  ? 45  MET A CB   7  
ATOM   10993 C  CG   . MET A 1 45 ? 53.495 1.200   -6.126  1.00 0.00  ? 45  MET A CG   7  
ATOM   10994 S  SD   . MET A 1 45 ? 53.233 2.578   -4.984  1.00 0.00  ? 45  MET A SD   7  
ATOM   10995 C  CE   . MET A 1 45 ? 54.153 3.817   -5.923  1.00 0.00  ? 45  MET A CE   7  
ATOM   10996 H  H    . MET A 1 45 ? 52.111 -1.163  -6.716  1.00 0.00  ? 45  MET A H    7  
ATOM   10997 H  HA   . MET A 1 45 ? 50.917 1.232   -5.702  1.00 0.00  ? 45  MET A HA   7  
ATOM   10998 H  HB2  . MET A 1 45 ? 52.728 0.592   -8.040  1.00 0.00  ? 45  MET A HB2  7  
ATOM   10999 H  HB3  . MET A 1 45 ? 52.317 2.245   -7.579  1.00 0.00  ? 45  MET A HB3  7  
ATOM   11000 H  HG2  . MET A 1 45 ? 53.423 0.269   -5.586  1.00 0.00  ? 45  MET A HG2  7  
ATOM   11001 H  HG3  . MET A 1 45 ? 54.475 1.284   -6.572  1.00 0.00  ? 45  MET A HG3  7  
ATOM   11002 H  HE1  . MET A 1 45 ? 53.472 4.583   -6.266  1.00 0.00  ? 45  MET A HE1  7  
ATOM   11003 H  HE2  . MET A 1 45 ? 54.622 3.349   -6.772  1.00 0.00  ? 45  MET A HE2  7  
ATOM   11004 H  HE3  . MET A 1 45 ? 54.912 4.258   -5.291  1.00 0.00  ? 45  MET A HE3  7  
ATOM   11005 N  N    . ARG A 1 46 ? 49.852 0.272   -8.686  1.00 0.00  ? 46  ARG A N    7  
ATOM   11006 C  CA   . ARG A 1 46 ? 48.741 0.494   -9.664  1.00 0.00  ? 46  ARG A CA   7  
ATOM   11007 C  C    . ARG A 1 46 ? 47.398 0.144   -9.006  1.00 0.00  ? 46  ARG A C    7  
ATOM   11008 O  O    . ARG A 1 46 ? 46.401 0.805   -9.223  1.00 0.00  ? 46  ARG A O    7  
ATOM   11009 C  CB   . ARG A 1 46 ? 49.042 -0.446  -10.837 1.00 0.00  ? 46  ARG A CB   7  
ATOM   11010 C  CG   . ARG A 1 46 ? 48.140 -0.100  -12.026 1.00 0.00  ? 46  ARG A CG   7  
ATOM   11011 C  CD   . ARG A 1 46 ? 48.414 1.335   -12.483 1.00 0.00  ? 46  ARG A CD   7  
ATOM   11012 N  NE   . ARG A 1 46 ? 47.941 1.383   -13.895 1.00 0.00  ? 46  ARG A NE   7  
ATOM   11013 C  CZ   . ARG A 1 46 ? 47.206 2.377   -14.305 1.00 0.00  ? 46  ARG A CZ   7  
ATOM   11014 N  NH1  . ARG A 1 46 ? 47.675 3.592   -14.263 1.00 0.00  ? 46  ARG A NH1  7  
ATOM   11015 N  NH2  . ARG A 1 46 ? 46.002 2.152   -14.747 1.00 0.00  ? 46  ARG A NH2  7  
ATOM   11016 H  H    . ARG A 1 46 ? 50.496 -0.454  -8.833  1.00 0.00  ? 46  ARG A H    7  
ATOM   11017 H  HA   . ARG A 1 46 ? 48.738 1.518   -10.001 1.00 0.00  ? 46  ARG A HA   7  
ATOM   11018 H  HB2  . ARG A 1 46 ? 50.078 -0.335  -11.128 1.00 0.00  ? 46  ARG A HB2  7  
ATOM   11019 H  HB3  . ARG A 1 46 ? 48.862 -1.467  -10.536 1.00 0.00  ? 46  ARG A HB3  7  
ATOM   11020 H  HG2  . ARG A 1 46 ? 48.342 -0.783  -12.839 1.00 0.00  ? 46  ARG A HG2  7  
ATOM   11021 H  HG3  . ARG A 1 46 ? 47.105 -0.190  -11.731 1.00 0.00  ? 46  ARG A HG3  7  
ATOM   11022 H  HD2  . ARG A 1 46 ? 47.859 2.035   -11.872 1.00 0.00  ? 46  ARG A HD2  7  
ATOM   11023 H  HD3  . ARG A 1 46 ? 49.471 1.551   -12.439 1.00 0.00  ? 46  ARG A HD3  7  
ATOM   11024 H  HE   . ARG A 1 46 ? 48.184 0.665   -14.518 1.00 0.00  ? 46  ARG A HE   7  
ATOM   11025 H  HH11 . ARG A 1 46 ? 48.596 3.760   -13.911 1.00 0.00  ? 46  ARG A HH11 7  
ATOM   11026 H  HH12 . ARG A 1 46 ? 47.119 4.355   -14.589 1.00 0.00  ? 46  ARG A HH12 7  
ATOM   11027 H  HH21 . ARG A 1 46 ? 45.644 1.219   -14.768 1.00 0.00  ? 46  ARG A HH21 7  
ATOM   11028 H  HH22 . ARG A 1 46 ? 45.434 2.911   -15.061 1.00 0.00  ? 46  ARG A HH22 7  
ATOM   11029 N  N    . MET A 1 47 ? 47.379 -0.878  -8.182  1.00 0.00  ? 47  MET A N    7  
ATOM   11030 C  CA   . MET A 1 47 ? 46.114 -1.265  -7.478  1.00 0.00  ? 47  MET A CA   7  
ATOM   11031 C  C    . MET A 1 47 ? 45.816 -0.282  -6.323  1.00 0.00  ? 47  MET A C    7  
ATOM   11032 O  O    . MET A 1 47 ? 44.811 -0.398  -5.647  1.00 0.00  ? 47  MET A O    7  
ATOM   11033 C  CB   . MET A 1 47 ? 46.385 -2.677  -6.940  1.00 0.00  ? 47  MET A CB   7  
ATOM   11034 C  CG   . MET A 1 47 ? 45.085 -3.297  -6.412  1.00 0.00  ? 47  MET A CG   7  
ATOM   11035 S  SD   . MET A 1 47 ? 45.465 -4.815  -5.497  1.00 0.00  ? 47  MET A SD   7  
ATOM   11036 C  CE   . MET A 1 47 ? 46.386 -4.050  -4.138  1.00 0.00  ? 47  MET A CE   7  
ATOM   11037 H  H    . MET A 1 47 ? 48.203 -1.381  -8.010  1.00 0.00  ? 47  MET A H    7  
ATOM   11038 H  HA   . MET A 1 47 ? 45.289 -1.288  -8.173  1.00 0.00  ? 47  MET A HA   7  
ATOM   11039 H  HB2  . MET A 1 47 ? 46.779 -3.292  -7.735  1.00 0.00  ? 47  MET A HB2  7  
ATOM   11040 H  HB3  . MET A 1 47 ? 47.106 -2.622  -6.138  1.00 0.00  ? 47  MET A HB3  7  
ATOM   11041 H  HG2  . MET A 1 47 ? 44.589 -2.598  -5.756  1.00 0.00  ? 47  MET A HG2  7  
ATOM   11042 H  HG3  . MET A 1 47 ? 44.434 -3.532  -7.243  1.00 0.00  ? 47  MET A HG3  7  
ATOM   11043 H  HE1  . MET A 1 47 ? 47.438 -4.029  -4.384  1.00 0.00  ? 47  MET A HE1  7  
ATOM   11044 H  HE2  . MET A 1 47 ? 46.242 -4.623  -3.236  1.00 0.00  ? 47  MET A HE2  7  
ATOM   11045 H  HE3  . MET A 1 47 ? 46.027 -3.042  -3.983  1.00 0.00  ? 47  MET A HE3  7  
ATOM   11046 N  N    . LEU A 1 48 ? 46.679 0.683   -6.094  1.00 0.00  ? 48  LEU A N    7  
ATOM   11047 C  CA   . LEU A 1 48 ? 46.449 1.666   -4.994  1.00 0.00  ? 48  LEU A CA   7  
ATOM   11048 C  C    . LEU A 1 48 ? 46.358 3.085   -5.577  1.00 0.00  ? 48  LEU A C    7  
ATOM   11049 O  O    . LEU A 1 48 ? 45.391 3.791   -5.363  1.00 0.00  ? 48  LEU A O    7  
ATOM   11050 C  CB   . LEU A 1 48 ? 47.675 1.513   -4.088  1.00 0.00  ? 48  LEU A CB   7  
ATOM   11051 C  CG   . LEU A 1 48 ? 47.668 2.593   -3.003  1.00 0.00  ? 48  LEU A CG   7  
ATOM   11052 C  CD1  . LEU A 1 48 ? 46.967 2.060   -1.753  1.00 0.00  ? 48  LEU A CD1  7  
ATOM   11053 C  CD2  . LEU A 1 48 ? 49.111 2.967   -2.658  1.00 0.00  ? 48  LEU A CD2  7  
ATOM   11054 H  H    . LEU A 1 48 ? 47.482 0.766   -6.648  1.00 0.00  ? 48  LEU A H    7  
ATOM   11055 H  HA   . LEU A 1 48 ? 45.551 1.423   -4.449  1.00 0.00  ? 48  LEU A HA   7  
ATOM   11056 H  HB2  . LEU A 1 48 ? 47.655 0.537   -3.623  1.00 0.00  ? 48  LEU A HB2  7  
ATOM   11057 H  HB3  . LEU A 1 48 ? 48.572 1.607   -4.680  1.00 0.00  ? 48  LEU A HB3  7  
ATOM   11058 H  HG   . LEU A 1 48 ? 47.144 3.466   -3.366  1.00 0.00  ? 48  LEU A HG   7  
ATOM   11059 H  HD11 . LEU A 1 48 ? 46.600 2.889   -1.165  1.00 0.00  ? 48  LEU A HD11 7  
ATOM   11060 H  HD12 . LEU A 1 48 ? 47.668 1.485   -1.165  1.00 0.00  ? 48  LEU A HD12 7  
ATOM   11061 H  HD13 . LEU A 1 48 ? 46.140 1.430   -2.044  1.00 0.00  ? 48  LEU A HD13 7  
ATOM   11062 H  HD21 . LEU A 1 48 ? 49.662 2.075   -2.397  1.00 0.00  ? 48  LEU A HD21 7  
ATOM   11063 H  HD22 . LEU A 1 48 ? 49.118 3.651   -1.823  1.00 0.00  ? 48  LEU A HD22 7  
ATOM   11064 H  HD23 . LEU A 1 48 ? 49.575 3.438   -3.512  1.00 0.00  ? 48  LEU A HD23 7  
ATOM   11065 N  N    . GLY A 1 49 ? 47.356 3.499   -6.319  1.00 0.00  ? 49  GLY A N    7  
ATOM   11066 C  CA   . GLY A 1 49 ? 47.336 4.861   -6.932  1.00 0.00  ? 49  GLY A CA   7  
ATOM   11067 C  C    . GLY A 1 49 ? 47.262 4.727   -8.456  1.00 0.00  ? 49  GLY A C    7  
ATOM   11068 O  O    . GLY A 1 49 ? 46.299 4.214   -8.993  1.00 0.00  ? 49  GLY A O    7  
ATOM   11069 H  H    . GLY A 1 49 ? 48.120 2.906   -6.481  1.00 0.00  ? 49  GLY A H    7  
ATOM   11070 H  HA2  . GLY A 1 49 ? 46.469 5.406   -6.575  1.00 0.00  ? 49  GLY A HA2  7  
ATOM   11071 H  HA3  . GLY A 1 49 ? 48.238 5.392   -6.664  1.00 0.00  ? 49  GLY A HA3  7  
ATOM   11072 N  N    . GLN A 1 50 ? 48.271 5.185   -9.157  1.00 0.00  ? 50  GLN A N    7  
ATOM   11073 C  CA   . GLN A 1 50 ? 48.257 5.086   -10.654 1.00 0.00  ? 50  GLN A CA   7  
ATOM   11074 C  C    . GLN A 1 50 ? 49.634 4.690   -11.217 1.00 0.00  ? 50  GLN A C    7  
ATOM   11075 O  O    . GLN A 1 50 ? 49.861 4.803   -12.405 1.00 0.00  ? 50  GLN A O    7  
ATOM   11076 C  CB   . GLN A 1 50 ? 47.881 6.491   -11.135 1.00 0.00  ? 50  GLN A CB   7  
ATOM   11077 C  CG   . GLN A 1 50 ? 46.373 6.706   -10.976 1.00 0.00  ? 50  GLN A CG   7  
ATOM   11078 C  CD   . GLN A 1 50 ? 46.119 7.946   -10.117 1.00 0.00  ? 50  GLN A CD   7  
ATOM   11079 O  OE1  . GLN A 1 50 ? 46.194 7.888   -8.907  1.00 0.00  ? 50  GLN A OE1  7  
ATOM   11080 N  NE2  . GLN A 1 50 ? 45.819 9.075   -10.696 1.00 0.00  ? 50  GLN A NE2  7  
ATOM   11081 H  H    . GLN A 1 50 ? 49.032 5.595   -8.702  1.00 0.00  ? 50  GLN A H    7  
ATOM   11082 H  HA   . GLN A 1 50 ? 47.507 4.381   -10.975 1.00 0.00  ? 50  GLN A HA   7  
ATOM   11083 H  HB2  . GLN A 1 50 ? 48.415 7.225   -10.549 1.00 0.00  ? 50  GLN A HB2  7  
ATOM   11084 H  HB3  . GLN A 1 50 ? 48.151 6.598   -12.175 1.00 0.00  ? 50  GLN A HB3  7  
ATOM   11085 H  HG2  . GLN A 1 50 ? 45.924 6.843   -11.949 1.00 0.00  ? 50  GLN A HG2  7  
ATOM   11086 H  HG3  . GLN A 1 50 ? 45.938 5.845   -10.494 1.00 0.00  ? 50  GLN A HG3  7  
ATOM   11087 H  HE21 . GLN A 1 50 ? 45.758 9.126   -11.672 1.00 0.00  ? 50  GLN A HE21 7  
ATOM   11088 H  HE22 . GLN A 1 50 ? 45.655 9.874   -10.152 1.00 0.00  ? 50  GLN A HE22 7  
ATOM   11089 N  N    . ASN A 1 51 ? 50.549 4.227   -10.393 1.00 0.00  ? 51  ASN A N    7  
ATOM   11090 C  CA   . ASN A 1 51 ? 51.903 3.830   -10.916 1.00 0.00  ? 51  ASN A CA   7  
ATOM   11091 C  C    . ASN A 1 51 ? 51.812 2.452   -11.592 1.00 0.00  ? 51  ASN A C    7  
ATOM   11092 O  O    . ASN A 1 51 ? 51.617 1.451   -10.928 1.00 0.00  ? 51  ASN A O    7  
ATOM   11093 C  CB   . ASN A 1 51 ? 52.824 3.779   -9.691  1.00 0.00  ? 51  ASN A CB   7  
ATOM   11094 C  CG   . ASN A 1 51 ? 52.676 5.065   -8.872  1.00 0.00  ? 51  ASN A CG   7  
ATOM   11095 O  OD1  . ASN A 1 51 ? 51.819 5.156   -8.016  1.00 0.00  ? 51  ASN A OD1  7  
ATOM   11096 N  ND2  . ASN A 1 51 ? 53.473 6.070   -9.098  1.00 0.00  ? 51  ASN A ND2  7  
ATOM   11097 H  H    . ASN A 1 51 ? 50.348 4.135   -9.438  1.00 0.00  ? 51  ASN A H    7  
ATOM   11098 H  HA   . ASN A 1 51 ? 52.263 4.569   -11.615 1.00 0.00  ? 51  ASN A HA   7  
ATOM   11099 H  HB2  . ASN A 1 51 ? 52.558 2.930   -9.081  1.00 0.00  ? 51  ASN A HB2  7  
ATOM   11100 H  HB3  . ASN A 1 51 ? 53.848 3.680   -10.018 1.00 0.00  ? 51  ASN A HB3  7  
ATOM   11101 H  HD21 . ASN A 1 51 ? 54.166 6.002   -9.789  1.00 0.00  ? 51  ASN A HD21 7  
ATOM   11102 H  HD22 . ASN A 1 51 ? 53.380 6.894   -8.579  1.00 0.00  ? 51  ASN A HD22 7  
ATOM   11103 N  N    . PRO A 1 52 ? 51.920 2.454   -12.901 1.00 0.00  ? 52  PRO A N    7  
ATOM   11104 C  CA   . PRO A 1 52 ? 51.808 1.209   -13.693 1.00 0.00  ? 52  PRO A CA   7  
ATOM   11105 C  C    . PRO A 1 52 ? 53.177 0.551   -13.961 1.00 0.00  ? 52  PRO A C    7  
ATOM   11106 O  O    . PRO A 1 52 ? 53.495 -0.478  -13.397 1.00 0.00  ? 52  PRO A O    7  
ATOM   11107 C  CB   . PRO A 1 52 ? 51.179 1.713   -14.993 1.00 0.00  ? 52  PRO A CB   7  
ATOM   11108 C  CG   . PRO A 1 52 ? 51.544 3.174   -15.093 1.00 0.00  ? 52  PRO A CG   7  
ATOM   11109 C  CD   . PRO A 1 52 ? 52.152 3.601   -13.775 1.00 0.00  ? 52  PRO A CD   7  
ATOM   11110 H  HA   . PRO A 1 52 ? 51.140 0.512   -13.214 1.00 0.00  ? 52  PRO A HA   7  
ATOM   11111 H  HB2  . PRO A 1 52 ? 51.579 1.167   -15.837 1.00 0.00  ? 52  PRO A HB2  7  
ATOM   11112 H  HB3  . PRO A 1 52 ? 50.107 1.606   -14.953 1.00 0.00  ? 52  PRO A HB3  7  
ATOM   11113 H  HG2  . PRO A 1 52 ? 52.259 3.318   -15.891 1.00 0.00  ? 52  PRO A HG2  7  
ATOM   11114 H  HG3  . PRO A 1 52 ? 50.658 3.759   -15.287 1.00 0.00  ? 52  PRO A HG3  7  
ATOM   11115 H  HD2  . PRO A 1 52 ? 53.214 3.786   -13.887 1.00 0.00  ? 52  PRO A HD2  7  
ATOM   11116 H  HD3  . PRO A 1 52 ? 51.652 4.474   -13.388 1.00 0.00  ? 52  PRO A HD3  7  
ATOM   11117 N  N    . THR A 1 53 ? 53.968 1.119   -14.841 1.00 0.00  ? 53  THR A N    7  
ATOM   11118 C  CA   . THR A 1 53 ? 55.296 0.511   -15.177 1.00 0.00  ? 53  THR A CA   7  
ATOM   11119 C  C    . THR A 1 53 ? 56.268 0.588   -13.993 1.00 0.00  ? 53  THR A C    7  
ATOM   11120 O  O    . THR A 1 53 ? 56.297 1.568   -13.272 1.00 0.00  ? 53  THR A O    7  
ATOM   11121 C  CB   . THR A 1 53 ? 55.833 1.327   -16.360 1.00 0.00  ? 53  THR A CB   7  
ATOM   11122 O  OG1  . THR A 1 53 ? 55.646 2.715   -16.113 1.00 0.00  ? 53  THR A OG1  7  
ATOM   11123 C  CG2  . THR A 1 53 ? 55.088 0.934   -17.637 1.00 0.00  ? 53  THR A CG2  7  
ATOM   11124 H  H    . THR A 1 53 ? 53.681 1.933   -15.299 1.00 0.00  ? 53  THR A H    7  
ATOM   11125 H  HA   . THR A 1 53 ? 55.163 -0.515  -15.479 1.00 0.00  ? 53  THR A HA   7  
ATOM   11126 H  HB   . THR A 1 53 ? 56.885 1.123   -16.488 1.00 0.00  ? 53  THR A HB   7  
ATOM   11127 H  HG1  . THR A 1 53 ? 56.072 2.930   -15.281 1.00 0.00  ? 53  THR A HG1  7  
ATOM   11128 H  HG21 . THR A 1 53 ? 55.086 1.767   -18.323 1.00 0.00  ? 53  THR A HG21 7  
ATOM   11129 H  HG22 . THR A 1 53 ? 54.071 0.667   -17.393 1.00 0.00  ? 53  THR A HG22 7  
ATOM   11130 H  HG23 . THR A 1 53 ? 55.581 0.091   -18.096 1.00 0.00  ? 53  THR A HG23 7  
ATOM   11131 N  N    . PRO A 1 54 ? 57.047 -0.460  -13.849 1.00 0.00  ? 54  PRO A N    7  
ATOM   11132 C  CA   . PRO A 1 54 ? 58.054 -0.537  -12.752 1.00 0.00  ? 54  PRO A CA   7  
ATOM   11133 C  C    . PRO A 1 54 ? 59.172 0.496   -12.961 1.00 0.00  ? 54  PRO A C    7  
ATOM   11134 O  O    . PRO A 1 54 ? 59.714 1.027   -12.009 1.00 0.00  ? 54  PRO A O    7  
ATOM   11135 C  CB   . PRO A 1 54 ? 58.593 -1.963  -12.868 1.00 0.00  ? 54  PRO A CB   7  
ATOM   11136 C  CG   . PRO A 1 54 ? 58.345 -2.347  -14.289 1.00 0.00  ? 54  PRO A CG   7  
ATOM   11137 C  CD   . PRO A 1 54 ? 57.067 -1.666  -14.689 1.00 0.00  ? 54  PRO A CD   7  
ATOM   11138 H  HA   . PRO A 1 54 ? 57.582 -0.399  -11.792 1.00 0.00  ? 54  PRO A HA   7  
ATOM   11139 H  HB2  . PRO A 1 54 ? 59.650 -1.985  -12.645 1.00 0.00  ? 54  PRO A HB2  7  
ATOM   11140 H  HB3  . PRO A 1 54 ? 58.052 -2.622  -12.209 1.00 0.00  ? 54  PRO A HB3  7  
ATOM   11141 H  HG2  . PRO A 1 54 ? 59.162 -2.008  -14.913 1.00 0.00  ? 54  PRO A HG2  7  
ATOM   11142 H  HG3  . PRO A 1 54 ? 58.230 -3.416  -14.372 1.00 0.00  ? 54  PRO A HG3  7  
ATOM   11143 H  HD2  . PRO A 1 54 ? 57.089 -1.404  -15.738 1.00 0.00  ? 54  PRO A HD2  7  
ATOM   11144 H  HD3  . PRO A 1 54 ? 56.216 -2.290  -14.467 1.00 0.00  ? 54  PRO A HD3  7  
ATOM   11145 N  N    . GLU A 1 55 ? 59.513 0.791   -14.195 1.00 0.00  ? 55  GLU A N    7  
ATOM   11146 C  CA   . GLU A 1 55 ? 60.591 1.801   -14.466 1.00 0.00  ? 55  GLU A CA   7  
ATOM   11147 C  C    . GLU A 1 55 ? 60.222 3.147   -13.826 1.00 0.00  ? 55  GLU A C    7  
ATOM   11148 O  O    . GLU A 1 55 ? 61.080 3.895   -13.396 1.00 0.00  ? 55  GLU A O    7  
ATOM   11149 C  CB   . GLU A 1 55 ? 60.653 1.945   -15.991 1.00 0.00  ? 55  GLU A CB   7  
ATOM   11150 C  CG   . GLU A 1 55 ? 60.953 0.588   -16.641 1.00 0.00  ? 55  GLU A CG   7  
ATOM   11151 C  CD   . GLU A 1 55 ? 59.744 0.139   -17.463 1.00 0.00  ? 55  GLU A CD   7  
ATOM   11152 O  OE1  . GLU A 1 55 ? 58.781 -0.310  -16.865 1.00 0.00  ? 55  GLU A OE1  7  
ATOM   11153 O  OE2  . GLU A 1 55 ? 59.799 0.256   -18.675 1.00 0.00  ? 55  GLU A OE2  7  
ATOM   11154 H  H    . GLU A 1 55 ? 59.056 0.354   -14.945 1.00 0.00  ? 55  GLU A H    7  
ATOM   11155 H  HA   . GLU A 1 55 ? 61.539 1.452   -14.088 1.00 0.00  ? 55  GLU A HA   7  
ATOM   11156 H  HB2  . GLU A 1 55 ? 59.705 2.315   -16.354 1.00 0.00  ? 55  GLU A HB2  7  
ATOM   11157 H  HB3  . GLU A 1 55 ? 61.433 2.645   -16.252 1.00 0.00  ? 55  GLU A HB3  7  
ATOM   11158 H  HG2  . GLU A 1 55 ? 61.813 0.683   -17.288 1.00 0.00  ? 55  GLU A HG2  7  
ATOM   11159 H  HG3  . GLU A 1 55 ? 61.158 -0.144  -15.875 1.00 0.00  ? 55  GLU A HG3  7  
ATOM   11160 N  N    . GLU A 1 56 ? 58.947 3.451   -13.754 1.00 0.00  ? 56  GLU A N    7  
ATOM   11161 C  CA   . GLU A 1 56 ? 58.507 4.739   -13.132 1.00 0.00  ? 56  GLU A CA   7  
ATOM   11162 C  C    . GLU A 1 56 ? 58.907 4.774   -11.651 1.00 0.00  ? 56  GLU A C    7  
ATOM   11163 O  O    . GLU A 1 56 ? 59.313 5.799   -11.134 1.00 0.00  ? 56  GLU A O    7  
ATOM   11164 C  CB   . GLU A 1 56 ? 56.982 4.750   -13.280 1.00 0.00  ? 56  GLU A CB   7  
ATOM   11165 C  CG   . GLU A 1 56 ? 56.455 6.177   -13.088 1.00 0.00  ? 56  GLU A CG   7  
ATOM   11166 C  CD   . GLU A 1 56 ? 55.405 6.194   -11.976 1.00 0.00  ? 56  GLU A CD   7  
ATOM   11167 O  OE1  . GLU A 1 56 ? 54.342 5.629   -12.179 1.00 0.00  ? 56  GLU A OE1  7  
ATOM   11168 O  OE2  . GLU A 1 56 ? 55.680 6.772   -10.938 1.00 0.00  ? 56  GLU A OE2  7  
ATOM   11169 H  H    . GLU A 1 56 ? 58.277 2.826   -14.103 1.00 0.00  ? 56  GLU A H    7  
ATOM   11170 H  HA   . GLU A 1 56 ? 58.936 5.577   -13.658 1.00 0.00  ? 56  GLU A HA   7  
ATOM   11171 H  HB2  . GLU A 1 56 ? 56.714 4.399   -14.266 1.00 0.00  ? 56  GLU A HB2  7  
ATOM   11172 H  HB3  . GLU A 1 56 ? 56.542 4.103   -12.536 1.00 0.00  ? 56  GLU A HB3  7  
ATOM   11173 H  HG2  . GLU A 1 56 ? 57.273 6.829   -12.820 1.00 0.00  ? 56  GLU A HG2  7  
ATOM   11174 H  HG3  . GLU A 1 56 ? 56.006 6.521   -14.008 1.00 0.00  ? 56  GLU A HG3  7  
ATOM   11175 N  N    . LEU A 1 57 ? 58.805 3.659   -10.966 1.00 0.00  ? 57  LEU A N    7  
ATOM   11176 C  CA   . LEU A 1 57 ? 59.187 3.625   -9.521  1.00 0.00  ? 57  LEU A CA   7  
ATOM   11177 C  C    . LEU A 1 57 ? 60.690 3.326   -9.363  1.00 0.00  ? 57  LEU A C    7  
ATOM   11178 O  O    . LEU A 1 57 ? 61.242 3.478   -8.290  1.00 0.00  ? 57  LEU A O    7  
ATOM   11179 C  CB   . LEU A 1 57 ? 58.350 2.496   -8.899  1.00 0.00  ? 57  LEU A CB   7  
ATOM   11180 C  CG   . LEU A 1 57 ? 56.837 2.743   -9.081  1.00 0.00  ? 57  LEU A CG   7  
ATOM   11181 C  CD1  . LEU A 1 57 ? 56.530 4.241   -9.176  1.00 0.00  ? 57  LEU A CD1  7  
ATOM   11182 C  CD2  . LEU A 1 57 ? 56.347 2.043   -10.353 1.00 0.00  ? 57  LEU A CD2  7  
ATOM   11183 H  H    . LEU A 1 57 ? 58.483 2.843   -11.403 1.00 0.00  ? 57  LEU A H    7  
ATOM   11184 H  HA   . LEU A 1 57 ? 58.943 4.564   -9.048  1.00 0.00  ? 57  LEU A HA   7  
ATOM   11185 H  HB2  . LEU A 1 57 ? 58.615 1.560   -9.367  1.00 0.00  ? 57  LEU A HB2  7  
ATOM   11186 H  HB3  . LEU A 1 57 ? 58.573 2.438   -7.843  1.00 0.00  ? 57  LEU A HB3  7  
ATOM   11187 H  HG   . LEU A 1 57 ? 56.315 2.333   -8.232  1.00 0.00  ? 57  LEU A HG   7  
ATOM   11188 H  HD11 . LEU A 1 57 ? 55.480 4.405   -8.986  1.00 0.00  ? 57  LEU A HD11 7  
ATOM   11189 H  HD12 . LEU A 1 57 ? 56.774 4.597   -10.166 1.00 0.00  ? 57  LEU A HD12 7  
ATOM   11190 H  HD13 . LEU A 1 57 ? 57.116 4.777   -8.446  1.00 0.00  ? 57  LEU A HD13 7  
ATOM   11191 H  HD21 . LEU A 1 57 ? 55.941 2.777   -11.036 1.00 0.00  ? 57  LEU A HD21 7  
ATOM   11192 H  HD22 . LEU A 1 57 ? 55.580 1.328   -10.096 1.00 0.00  ? 57  LEU A HD22 7  
ATOM   11193 H  HD23 . LEU A 1 57 ? 57.173 1.530   -10.825 1.00 0.00  ? 57  LEU A HD23 7  
ATOM   11194 N  N    . GLN A 1 58 ? 61.354 2.903   -10.418 1.00 0.00  ? 58  GLN A N    7  
ATOM   11195 C  CA   . GLN A 1 58 ? 62.822 2.600   -10.321 1.00 0.00  ? 58  GLN A CA   7  
ATOM   11196 C  C    . GLN A 1 58 ? 63.593 3.826   -9.808  1.00 0.00  ? 58  GLN A C    7  
ATOM   11197 O  O    . GLN A 1 58 ? 64.516 3.703   -9.029  1.00 0.00  ? 58  GLN A O    7  
ATOM   11198 C  CB   . GLN A 1 58 ? 63.261 2.246   -11.746 1.00 0.00  ? 58  GLN A CB   7  
ATOM   11199 C  CG   . GLN A 1 58 ? 63.563 0.748   -11.830 1.00 0.00  ? 58  GLN A CG   7  
ATOM   11200 C  CD   . GLN A 1 58 ? 64.849 0.525   -12.629 1.00 0.00  ? 58  GLN A CD   7  
ATOM   11201 O  OE1  . GLN A 1 58 ? 64.808 0.042   -13.741 1.00 0.00  ? 58  GLN A OE1  7  
ATOM   11202 N  NE2  . GLN A 1 58 ? 65.996 0.857   -12.105 1.00 0.00  ? 58  GLN A NE2  7  
ATOM   11203 H  H    . GLN A 1 58 ? 60.890 2.784   -11.270 1.00 0.00  ? 58  GLN A H    7  
ATOM   11204 H  HA   . GLN A 1 58 ? 62.985 1.756   -9.665  1.00 0.00  ? 58  GLN A HA   7  
ATOM   11205 H  HB2  . GLN A 1 58 ? 62.472 2.493   -12.441 1.00 0.00  ? 58  GLN A HB2  7  
ATOM   11206 H  HB3  . GLN A 1 58 ? 64.149 2.805   -11.999 1.00 0.00  ? 58  GLN A HB3  7  
ATOM   11207 H  HG2  . GLN A 1 58 ? 63.686 0.352   -10.833 1.00 0.00  ? 58  GLN A HG2  7  
ATOM   11208 H  HG3  . GLN A 1 58 ? 62.745 0.243   -12.320 1.00 0.00  ? 58  GLN A HG3  7  
ATOM   11209 H  HE21 . GLN A 1 58 ? 66.032 1.246   -11.204 1.00 0.00  ? 58  GLN A HE21 7  
ATOM   11210 H  HE22 . GLN A 1 58 ? 66.822 0.718   -12.611 1.00 0.00  ? 58  GLN A HE22 7  
ATOM   11211 N  N    . GLU A 1 59 ? 63.213 5.009   -10.223 1.00 0.00  ? 59  GLU A N    7  
ATOM   11212 C  CA   . GLU A 1 59 ? 63.919 6.234   -9.728  1.00 0.00  ? 59  GLU A CA   7  
ATOM   11213 C  C    . GLU A 1 59 ? 63.814 6.301   -8.195  1.00 0.00  ? 59  GLU A C    7  
ATOM   11214 O  O    . GLU A 1 59 ? 64.711 6.772   -7.522  1.00 0.00  ? 59  GLU A O    7  
ATOM   11215 C  CB   . GLU A 1 59 ? 63.187 7.414   -10.378 1.00 0.00  ? 59  GLU A CB   7  
ATOM   11216 C  CG   . GLU A 1 59 ? 64.184 8.538   -10.681 1.00 0.00  ? 59  GLU A CG   7  
ATOM   11217 C  CD   . GLU A 1 59 ? 64.176 9.558   -9.539  1.00 0.00  ? 59  GLU A CD   7  
ATOM   11218 O  OE1  . GLU A 1 59 ? 63.238 10.335  -9.468  1.00 0.00  ? 59  GLU A OE1  7  
ATOM   11219 O  OE2  . GLU A 1 59 ? 65.109 9.546   -8.753  1.00 0.00  ? 59  GLU A OE2  7  
ATOM   11220 H  H    . GLU A 1 59 ? 62.458 5.092   -10.842 1.00 0.00  ? 59  GLU A H    7  
ATOM   11221 H  HA   . GLU A 1 59 ? 64.954 6.223   -10.034 1.00 0.00  ? 59  GLU A HA   7  
ATOM   11222 H  HB2  . GLU A 1 59 ? 62.723 7.086   -11.297 1.00 0.00  ? 59  GLU A HB2  7  
ATOM   11223 H  HB3  . GLU A 1 59 ? 62.427 7.781   -9.704  1.00 0.00  ? 59  GLU A HB3  7  
ATOM   11224 H  HG2  . GLU A 1 59 ? 65.176 8.123   -10.785 1.00 0.00  ? 59  GLU A HG2  7  
ATOM   11225 H  HG3  . GLU A 1 59 ? 63.903 9.031   -11.600 1.00 0.00  ? 59  GLU A HG3  7  
ATOM   11226 N  N    . MET A 1 60 ? 62.726 5.809   -7.645  1.00 0.00  ? 60  MET A N    7  
ATOM   11227 C  CA   . MET A 1 60 ? 62.556 5.816   -6.160  1.00 0.00  ? 60  MET A CA   7  
ATOM   11228 C  C    . MET A 1 60 ? 63.368 4.674   -5.526  1.00 0.00  ? 60  MET A C    7  
ATOM   11229 O  O    . MET A 1 60 ? 64.083 4.881   -4.565  1.00 0.00  ? 60  MET A O    7  
ATOM   11230 C  CB   . MET A 1 60 ? 61.055 5.607   -5.921  1.00 0.00  ? 60  MET A CB   7  
ATOM   11231 C  CG   . MET A 1 60 ? 60.308 6.920   -6.169  1.00 0.00  ? 60  MET A CG   7  
ATOM   11232 S  SD   . MET A 1 60 ? 58.759 6.915   -5.233  1.00 0.00  ? 60  MET A SD   7  
ATOM   11233 C  CE   . MET A 1 60 ? 57.831 5.816   -6.330  1.00 0.00  ? 60  MET A CE   7  
ATOM   11234 H  H    . MET A 1 60 ? 62.026 5.422   -8.212  1.00 0.00  ? 60  MET A H    7  
ATOM   11235 H  HA   . MET A 1 60 ? 62.864 6.765   -5.751  1.00 0.00  ? 60  MET A HA   7  
ATOM   11236 H  HB2  . MET A 1 60 ? 60.682 4.846   -6.594  1.00 0.00  ? 60  MET A HB2  7  
ATOM   11237 H  HB3  . MET A 1 60 ? 60.894 5.294   -4.900  1.00 0.00  ? 60  MET A HB3  7  
ATOM   11238 H  HG2  . MET A 1 60 ? 60.920 7.750   -5.847  1.00 0.00  ? 60  MET A HG2  7  
ATOM   11239 H  HG3  . MET A 1 60 ? 60.091 7.018   -7.223  1.00 0.00  ? 60  MET A HG3  7  
ATOM   11240 H  HE1  . MET A 1 60 ? 58.292 4.838   -6.336  1.00 0.00  ? 60  MET A HE1  7  
ATOM   11241 H  HE2  . MET A 1 60 ? 57.834 6.219   -7.330  1.00 0.00  ? 60  MET A HE2  7  
ATOM   11242 H  HE3  . MET A 1 60 ? 56.811 5.738   -5.978  1.00 0.00  ? 60  MET A HE3  7  
ATOM   11243 N  N    . ILE A 1 61 ? 63.269 3.473   -6.057  1.00 0.00  ? 61  ILE A N    7  
ATOM   11244 C  CA   . ILE A 1 61 ? 64.046 2.328   -5.475  1.00 0.00  ? 61  ILE A CA   7  
ATOM   11245 C  C    . ILE A 1 61 ? 65.558 2.594   -5.587  1.00 0.00  ? 61  ILE A C    7  
ATOM   11246 O  O    . ILE A 1 61 ? 66.299 2.342   -4.660  1.00 0.00  ? 61  ILE A O    7  
ATOM   11247 C  CB   . ILE A 1 61 ? 63.623 1.075   -6.275  1.00 0.00  ? 61  ILE A CB   7  
ATOM   11248 C  CG1  . ILE A 1 61 ? 64.056 -0.185  -5.519  1.00 0.00  ? 61  ILE A CG1  7  
ATOM   11249 C  CG2  . ILE A 1 61 ? 64.271 1.068   -7.661  1.00 0.00  ? 61  ILE A CG2  7  
ATOM   11250 C  CD1  . ILE A 1 61 ? 63.172 -1.364  -5.946  1.00 0.00  ? 61  ILE A CD1  7  
ATOM   11251 H  H    . ILE A 1 61 ? 62.689 3.327   -6.834  1.00 0.00  ? 61  ILE A H    7  
ATOM   11252 H  HA   . ILE A 1 61 ? 63.778 2.199   -4.437  1.00 0.00  ? 61  ILE A HA   7  
ATOM   11253 H  HB   . ILE A 1 61 ? 62.549 1.072   -6.386  1.00 0.00  ? 61  ILE A HB   7  
ATOM   11254 H  HG12 . ILE A 1 61 ? 65.090 -0.405  -5.750  1.00 0.00  ? 61  ILE A HG12 7  
ATOM   11255 H  HG13 . ILE A 1 61 ? 63.952 -0.024  -4.457  1.00 0.00  ? 61  ILE A HG13 7  
ATOM   11256 H  HG21 . ILE A 1 61 ? 63.932 0.204   -8.212  1.00 0.00  ? 61  ILE A HG21 7  
ATOM   11257 H  HG22 . ILE A 1 61 ? 65.345 1.030   -7.560  1.00 0.00  ? 61  ILE A HG22 7  
ATOM   11258 H  HG23 . ILE A 1 61 ? 63.990 1.961   -8.190  1.00 0.00  ? 61  ILE A HG23 7  
ATOM   11259 H  HD11 . ILE A 1 61 ? 62.272 -1.373  -5.349  1.00 0.00  ? 61  ILE A HD11 7  
ATOM   11260 H  HD12 . ILE A 1 61 ? 63.708 -2.291  -5.803  1.00 0.00  ? 61  ILE A HD12 7  
ATOM   11261 H  HD13 . ILE A 1 61 ? 62.909 -1.258  -6.989  1.00 0.00  ? 61  ILE A HD13 7  
ATOM   11262 N  N    . ASP A 1 62 ? 66.015 3.119   -6.702  1.00 0.00  ? 62  ASP A N    7  
ATOM   11263 C  CA   . ASP A 1 62 ? 67.477 3.413   -6.857  1.00 0.00  ? 62  ASP A CA   7  
ATOM   11264 C  C    . ASP A 1 62 ? 67.907 4.498   -5.860  1.00 0.00  ? 62  ASP A C    7  
ATOM   11265 O  O    . ASP A 1 62 ? 68.995 4.456   -5.316  1.00 0.00  ? 62  ASP A O    7  
ATOM   11266 C  CB   . ASP A 1 62 ? 67.638 3.901   -8.301  1.00 0.00  ? 62  ASP A CB   7  
ATOM   11267 C  CG   . ASP A 1 62 ? 67.837 2.701   -9.230  1.00 0.00  ? 62  ASP A CG   7  
ATOM   11268 O  OD1  . ASP A 1 62 ? 66.873 1.992   -9.470  1.00 0.00  ? 62  ASP A OD1  7  
ATOM   11269 O  OD2  . ASP A 1 62 ? 68.952 2.510   -9.685  1.00 0.00  ? 62  ASP A OD2  7  
ATOM   11270 H  H    . ASP A 1 62 ? 65.396 3.329   -7.433  1.00 0.00  ? 62  ASP A H    7  
ATOM   11271 H  HA   . ASP A 1 62 ? 68.057 2.517   -6.704  1.00 0.00  ? 62  ASP A HA   7  
ATOM   11272 H  HB2  . ASP A 1 62 ? 66.753 4.444   -8.599  1.00 0.00  ? 62  ASP A HB2  7  
ATOM   11273 H  HB3  . ASP A 1