data_2L29
# 
_entry.id   2L29 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L29         
RCSB  RCSB101865   
BMRB  17127        
WWPDB D_1000101865 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
17127 BMRB unspecified .                                                                                                    
2CNJ  PDB  unspecified 'NMR STUDIES ON THE INTERACTION OF INSULIN-GROWTH FACTOR II (IGF-II) WITH IGF2R DOMAIN 11'           
1GP0  PDB  unspecified 'HUMAN IGF2R DOMAIN 11'                                                                              
2L21  PDB  unspecified 'Chicken IGF2R domain 11'                                                                            
2L2A  PDB  unspecified 'Mutated Domain 11 of the Cytoplasmic region of the Cation-independent mannose-6-phosphate receptor' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L29 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-08-13 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Williams, C.'      1  
'Hoppe, H.'         2  
'Rezgui, D.'        3  
'Strickland, M.'    4  
'Frago, S.'         5  
'Ellis, R.Z.'       6  
'Wattana-Amorn, P.' 7  
'Prince, S.N.'      8  
'Zaccheo, O.J.'     9  
'Forbes, B.'        10 
'Jones, E.Y.'       11 
'Crump, M.P.'       12 
'Hassan, A.B.'      13 
# 
_citation.id                        primary 
_citation.title                     'An exon splice enhancer primes IGF2:IGF2R binding site structure and function evolution.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            338 
_citation.page_first                1209 
_citation.page_last                 1213 
_citation.year                      2012 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23197533 
_citation.pdbx_database_id_DOI      10.1126/science.1228633 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Williams, C.'      1  ? 
primary 'Hoppe, H.J.'       2  ? 
primary 'Rezgui, D.'        3  ? 
primary 'Strickland, M.'    4  ? 
primary 'Forbes, B.E.'      5  ? 
primary 'Grutzner, F.'      6  ? 
primary 'Frago, S.'         7  ? 
primary 'Ellis, R.Z.'       8  ? 
primary 'Wattana-Amorn, P.' 9  ? 
primary 'Prince, S.N.'      10 ? 
primary 'Zaccheo, O.J.'     11 ? 
primary 'Nolan, C.M.'       12 ? 
primary 'Mungall, A.J.'     13 ? 
primary 'Jones, E.Y.'       14 ? 
primary 'Crump, M.P.'       15 ? 
primary 'Hassan, A.B.'      16 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Insulin-like growth factor 2 receptor variant' 15434.524 1 ? 'E1544K, K1545S, L1547V' 
'domain 11, residues 1431-1570' ? 
2 polymer man 'Insulin-like growth factor II'                 7484.472  1 ? ?                        'residues 25-91' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'IGF-II, Somatomedin-A, Insulin-like growth factor II Ala-25 Del, Preptin' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSKSGVVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV
LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEPE
;
;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSKSGVVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV
LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEPE
;
A ? 
2 'polypeptide(L)' no no AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE 
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   SER n 
1 4   ASN n 
1 5   GLU n 
1 6   HIS n 
1 7   ASP n 
1 8   ASP n 
1 9   CYS n 
1 10  GLN n 
1 11  VAL n 
1 12  THR n 
1 13  ASN n 
1 14  PRO n 
1 15  SER n 
1 16  THR n 
1 17  GLY n 
1 18  HIS n 
1 19  LEU n 
1 20  PHE n 
1 21  ASP n 
1 22  LEU n 
1 23  SER n 
1 24  SER n 
1 25  LEU n 
1 26  SER n 
1 27  GLY n 
1 28  ARG n 
1 29  ALA n 
1 30  GLY n 
1 31  PHE n 
1 32  THR n 
1 33  ALA n 
1 34  ALA n 
1 35  TYR n 
1 36  SER n 
1 37  LYS n 
1 38  SER n 
1 39  GLY n 
1 40  VAL n 
1 41  VAL n 
1 42  TYR n 
1 43  MET n 
1 44  SER n 
1 45  ILE n 
1 46  CYS n 
1 47  GLY n 
1 48  GLU n 
1 49  ASN n 
1 50  GLU n 
1 51  ASN n 
1 52  CYS n 
1 53  PRO n 
1 54  PRO n 
1 55  GLY n 
1 56  VAL n 
1 57  GLY n 
1 58  ALA n 
1 59  CYS n 
1 60  PHE n 
1 61  GLY n 
1 62  GLN n 
1 63  THR n 
1 64  ARG n 
1 65  ILE n 
1 66  SER n 
1 67  VAL n 
1 68  GLY n 
1 69  LYS n 
1 70  ALA n 
1 71  ASN n 
1 72  LYS n 
1 73  ARG n 
1 74  LEU n 
1 75  ARG n 
1 76  TYR n 
1 77  VAL n 
1 78  ASP n 
1 79  GLN n 
1 80  VAL n 
1 81  LEU n 
1 82  GLN n 
1 83  LEU n 
1 84  VAL n 
1 85  TYR n 
1 86  LYS n 
1 87  ASP n 
1 88  GLY n 
1 89  SER n 
1 90  PRO n 
1 91  CYS n 
1 92  PRO n 
1 93  SER n 
1 94  LYS n 
1 95  SER n 
1 96  GLY n 
1 97  LEU n 
1 98  SER n 
1 99  TYR n 
1 100 LYS n 
1 101 SER n 
1 102 VAL n 
1 103 ILE n 
1 104 SER n 
1 105 PHE n 
1 106 VAL n 
1 107 CYS n 
1 108 ARG n 
1 109 PRO n 
1 110 GLU n 
1 111 ALA n 
1 112 GLY n 
1 113 PRO n 
1 114 THR n 
1 115 ASN n 
1 116 ARG n 
1 117 PRO n 
1 118 MET n 
1 119 LEU n 
1 120 ILE n 
1 121 SER n 
1 122 LEU n 
1 123 ASP n 
1 124 LYS n 
1 125 GLN n 
1 126 THR n 
1 127 CYS n 
1 128 THR n 
1 129 LEU n 
1 130 PHE n 
1 131 PHE n 
1 132 SER n 
1 133 TRP n 
1 134 HIS n 
1 135 THR n 
1 136 PRO n 
1 137 LEU n 
1 138 ALA n 
1 139 CYS n 
1 140 GLU n 
1 141 PRO n 
1 142 GLU n 
2 1   ALA n 
2 2   TYR n 
2 3   ARG n 
2 4   PRO n 
2 5   SER n 
2 6   GLU n 
2 7   THR n 
2 8   LEU n 
2 9   CYS n 
2 10  GLY n 
2 11  GLY n 
2 12  GLU n 
2 13  LEU n 
2 14  VAL n 
2 15  ASP n 
2 16  THR n 
2 17  LEU n 
2 18  GLN n 
2 19  PHE n 
2 20  VAL n 
2 21  CYS n 
2 22  GLY n 
2 23  ASP n 
2 24  ARG n 
2 25  GLY n 
2 26  PHE n 
2 27  TYR n 
2 28  PHE n 
2 29  SER n 
2 30  ARG n 
2 31  PRO n 
2 32  ALA n 
2 33  SER n 
2 34  ARG n 
2 35  VAL n 
2 36  SER n 
2 37  ARG n 
2 38  ARG n 
2 39  SER n 
2 40  ARG n 
2 41  GLY n 
2 42  ILE n 
2 43  VAL n 
2 44  GLU n 
2 45  GLU n 
2 46  CYS n 
2 47  CYS n 
2 48  PHE n 
2 49  ARG n 
2 50  SER n 
2 51  CYS n 
2 52  ASP n 
2 53  LEU n 
2 54  ALA n 
2 55  LEU n 
2 56  LEU n 
2 57  GLU n 
2 58  THR n 
2 59  TYR n 
2 60  CYS n 
2 61  ALA n 
2 62  THR n 
2 63  PRO n 
2 64  ALA n 
2 65  LYS n 
2 66  SER n 
2 67  GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? ?              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'BL21 (DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pET26a     ? ? 
2 1 sample ? ? ? human ? 'IGF2, PP1446' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? JM101 ? 
? ? ? ? ? ? PLASMID ? ? ? PGEM-TEASY ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q59EZ3_HUMAN Q59EZ3 1 
;MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQV
LQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACE
;
1431 ? 
2 UNP IGF2_HUMAN   P01344 2 AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE 25   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2L29 A 1 ? 140 ? Q59EZ3 1431 ? 1570 ? 1508 1647 
2 2 2L29 B 1 ? 67  ? P01344 25   ? 91   ? 1    67   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L29 LYS A 37  ? UNP Q59EZ3 GLU 1467 'engineered mutation' 1544 1 
1 2L29 SER A 38  ? UNP Q59EZ3 LYS 1468 'engineered mutation' 1545 2 
1 2L29 VAL A 40  ? UNP Q59EZ3 LEU 1470 'engineered mutation' 1547 3 
1 2L29 PRO A 141 ? UNP Q59EZ3 ?   ?    'expression tag'      1648 4 
1 2L29 GLU A 142 ? UNP Q59EZ3 ?   ?    'expression tag'      1649 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '3D 1H-13C NOESY'      
1 2  1 '3D 1H-15N NOESY'      
1 3  1 '3D 1H-15N NOESY'      
1 4  2 '3D 1H-13C NOESY'      
1 5  3 '2D 1H-15N HSQC'       
1 6  3 '3D 1H-15N NOESY'      
1 7  1 '2D 1H-15N HSQC'       
1 8  1 '2D 1H-13C HSQC'       
1 9  1 '3D HNCO'              
1 10 1 '3D CBCA(CO)NH'        
1 11 1 '3D C(CO)NH'           
1 12 1 '3D HNCA'              
1 13 1 '3D HNCACB'            
1 14 1 '3D HNCACB'            
1 15 1 '3D HCCH-TOCSY'        
1 16 1 '3D HN(CO)CA'          
1 17 1 '3D H(CCO)NH'          
1 18 1 '3D 1H-15N NOESY'      
1 19 1 '3D 1H-13C NOESY'      
1 20 2 '2D 1H-15N HSQC'       
1 21 2 '2D 1H-13C HSQC'       
1 22 2 '3D CBCA(CO)NH'        
1 23 2 '3D C(CO)NH'           
1 24 2 '3D HNCO'              
1 25 2 '3D HNCA'              
1 26 2 '3D HNCACB'            
1 27 2 '3D HN(CO)CA'          
1 28 2 '3D H(CCO)NH'          
1 29 2 '3D HCCH-TOCSY'        
1 30 2 '3D 1H-15N NOESY'      
1 31 2 '3D 1H-13C NOESY'      
1 32 1 '2D f2 filter noesy'   
1 33 2 '2D f2 filter noesy'   
1 34 1 '2D f2 filter noesy'   
1 35 2 '2D f2 filter noesy'   
1 36 1 '2D CN filtered noesy' 
1 37 2 '2D CN filtered noesy' 
1 38 1 '2D CN filtered noesy' 
1 39 2 '2D CN filtered noesy' 
1 40 1 '2D CN filtered tocsy' 
1 41 2 '2D CN filtered tocsy' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0 
_pdbx_nmr_exptl_sample_conditions.pH                  4.2 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.5-1 mM [U-98% 13C; U-98% 15N] IGF2R, 1.-1.5 mM IGF2, 5 % D2O, 100 uM sodium azide, 5 mM sodium acetate, 0.1 mM EDTA, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.5-1 mM [U-98% 13C; U-98% 15N] IGF2, 1.-1.5 mM IGF2R, 5 % D2O, 100 uM sodium azide, 5 mM sodium acetate, 0.1 mM EDTA, 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
;0.5-1 mM [U-98% 15N; U-95% 2H] IGF2, 1.-1.5 mM IGF2R, 5 % D2O, 100 uM sodium azide, 5 mM sodium acetate, 0.1 mM EDTA, 95% H2O/5% D2O
;
3 '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Varian INOVA     1 'Varian INOVA'     
600 Varian VNMRS     2 'Varian VNMRS'     
900 Varian UNITYPLUS 3 'Varian UnityPlus' 
# 
_pdbx_nmr_refine.entry_id           2L29 
_pdbx_nmr_refine.method             'simulated annealing, simulated annealing' 
_pdbx_nmr_refine.details            
;ARIA2.2 protocol. Cool_1 and cool_2 steps increased to 40K and cool_2, ARIA2.2 water refinement modified with RECOORD water refinement parameters
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L29 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L29 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Varian                                              collection                  VnmrJ    ?    1  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe  ?    2  
'Cornilescu, Delaglio and Bax'                      'geometry optimization'     TALOS    ?    3  
'Vuister, Doreleijers, Sousa da Silva'              refinement                  iCing    r765 4  
CCPN                                                'chemical shift assignment' Analysis 2.13 5  
CCPN                                                'data analysis'             Analysis 2.13 6  
;Linge, O'Donoghue and Nilges
;
refinement                  ARIA     2.2  7  
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA     2.2  8  
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS      1.2  9  
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS      1.2  10 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    
;Solution structure of IGF-II in complex with the mutant form of human domain 11 from the Cation-independent mannose-6-phosphate receptor
;
_exptl.entry_id                   2L29 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L29 
_struct.title                     'Complex structure of E4 mutant human IGF2R domain 11 bound to IGF-II' 
_struct.pdbx_descriptor           'Insulin-like growth factor 2 receptor variant, Insulin-like growth factor II' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L29 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            
'mannose 6 phosphate receptor, Insulin-like growth factor 2, Genomic imprinting, ligand trap, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 136 ? CYS A 139 ? PRO A 1643 CYS A 1646 5 ? 4  
HELX_P HELX_P2 2 GLY B 10  ? GLY B 22  ? GLY B 10   GLY B 22   1 ? 13 
HELX_P HELX_P3 3 GLU B 44  ? ARG B 49  ? GLU B 44   ARG B 49   1 ? 6  
HELX_P HELX_P4 4 ASP B 52  ? CYS B 60  ? ASP B 52   CYS B 60   1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9   SG ? ? ? 1_555 A CYS 46  SG ? ? A CYS 1516 A CYS 1553 1_555 ? ? ? ? ? ? ? 2.009 ? 
disulf2 disulf ? ? A CYS 52  SG ? ? ? 1_555 A CYS 59  SG ? ? A CYS 1559 A CYS 1566 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf3 disulf ? ? A CYS 91  SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 1598 A CYS 1634 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf4 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 139 SG ? ? A CYS 1614 A CYS 1646 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf5 disulf ? ? B CYS 9   SG ? ? ? 1_555 B CYS 47  SG ? ? B CYS 9    B CYS 47   1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf6 disulf ? ? B CYS 21  SG ? ? ? 1_555 B CYS 60  SG ? ? B CYS 21   B CYS 60   1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf7 disulf ? ? B CYS 46  SG ? ? ? 1_555 B CYS 51  SG ? ? B CYS 46   B CYS 51   1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 10  ? THR A 12  ? GLN A 1517 THR A 1519 
A 2 LEU A 19  ? ASP A 21  ? LEU A 1526 ASP A 1528 
B 1 PHE A 31  ? ALA A 34  ? PHE A 1538 ALA A 1541 
B 2 VAL A 40  ? MET A 43  ? VAL A 1547 MET A 1550 
B 3 VAL A 56  ? PHE A 60  ? VAL A 1563 PHE A 1567 
B 4 ILE A 65  ? LYS A 69  ? ILE A 1572 LYS A 1576 
C 1 ARG A 73  ? VAL A 77  ? ARG A 1580 VAL A 1584 
C 2 VAL A 80  ? TYR A 85  ? VAL A 1587 TYR A 1592 
C 3 LYS A 100 ? CYS A 107 ? LYS A 1607 CYS A 1614 
C 4 THR A 128 ? THR A 135 ? THR A 1635 THR A 1642 
C 5 MET A 118 ? ASP A 123 ? MET A 1625 ASP A 1630 
D 1 PRO A 90  ? CYS A 91  ? PRO A 1597 CYS A 1598 
D 2 LEU A 97  ? SER A 98  ? LEU A 1604 SER A 1605 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 11  ? N VAL A 1518 O PHE A 20  ? O PHE A 1527 
B 1 2 N ALA A 33  ? N ALA A 1540 O VAL A 41  ? O VAL A 1548 
B 2 3 N TYR A 42  ? N TYR A 1549 O CYS A 59  ? O CYS A 1566 
B 3 4 N ALA A 58  ? N ALA A 1565 O VAL A 67  ? O VAL A 1574 
C 1 2 N ARG A 75  ? N ARG A 1582 O GLN A 82  ? O GLN A 1589 
C 2 3 N LEU A 81  ? N LEU A 1588 O PHE A 105 ? O PHE A 1612 
C 3 4 N LYS A 100 ? N LYS A 1607 O LEU A 129 ? O LEU A 1636 
C 4 5 O SER A 132 ? O SER A 1639 N MET A 118 ? N MET A 1625 
D 1 2 N CYS A 91  ? N CYS A 1598 O LEU A 97  ? O LEU A 1604 
# 
_atom_sites.entry_id                    2L29 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? -33.410 10.610  -5.818  1.00 8.13  ? 1508 MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? -32.240 11.365  -5.372  1.00 7.50  ? 1508 MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? -31.191 11.305  -6.445  1.00 6.73  ? 1508 MET A C    1  
ATOM 4     O O    . MET A 1 1   ? -31.140 10.344  -7.223  1.00 6.84  ? 1508 MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? -31.673 10.803  -4.069  1.00 7.83  ? 1508 MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? -32.610 10.857  -2.882  1.00 8.25  ? 1508 MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? -31.856 10.193  -1.385  1.00 8.94  ? 1508 MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? -30.473 11.319  -1.175  1.00 9.34  ? 1508 MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? -34.218 10.700  -5.167  1.00 8.35  ? 1508 MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? -33.144 9.602   -5.867  1.00 8.44  ? 1508 MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? -33.676 10.915  -6.778  1.00 8.31  ? 1508 MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? -32.534 12.395  -5.230  1.00 7.66  ? 1508 MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? -31.401 9.770   -4.228  1.00 8.12  ? 1508 MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? -30.780 11.357  -3.818  1.00 7.83  ? 1508 MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? -32.886 11.885  -2.703  1.00 8.43  ? 1508 MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? -33.495 10.279  -3.109  1.00 8.28  ? 1508 MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? -29.909 11.039  -0.298  1.00 9.55  ? 1508 MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? -30.845 12.325  -1.058  1.00 9.74  ? 1508 MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? -29.835 11.272  -2.047  1.00 9.25  ? 1508 MET A HE3  1  
ATOM 20    N N    . LYS A 1 2   ? -30.367 12.326  -6.491  1.00 6.29  ? 1509 LYS A N    1  
ATOM 21    C CA   . LYS A 1 2   ? -29.379 12.477  -7.515  1.00 5.88  ? 1509 LYS A CA   1  
ATOM 22    C C    . LYS A 1 2   ? -28.177 11.563  -7.290  1.00 5.23  ? 1509 LYS A C    1  
ATOM 23    O O    . LYS A 1 2   ? -27.428 11.755  -6.318  1.00 5.51  ? 1509 LYS A O    1  
ATOM 24    C CB   . LYS A 1 2   ? -28.920 13.936  -7.601  1.00 6.62  ? 1509 LYS A CB   1  
ATOM 25    C CG   . LYS A 1 2   ? -27.882 14.185  -8.690  1.00 7.06  ? 1509 LYS A CG   1  
ATOM 26    C CD   . LYS A 1 2   ? -27.548 15.654  -8.840  1.00 7.86  ? 1509 LYS A CD   1  
ATOM 27    C CE   . LYS A 1 2   ? -28.779 16.471  -9.203  1.00 8.52  ? 1509 LYS A CE   1  
ATOM 28    N NZ   . LYS A 1 2   ? -29.406 16.017  -10.464 1.00 9.04  ? 1509 LYS A NZ   1  
ATOM 29    H H    . LYS A 1 2   ? -30.423 13.010  -5.780  1.00 6.49  ? 1509 LYS A H    1  
ATOM 30    H HA   . LYS A 1 2   ? -29.886 12.245  -8.441  1.00 5.90  ? 1509 LYS A HA   1  
ATOM 31    H HB2  . LYS A 1 2   ? -29.779 14.560  -7.800  1.00 7.05  ? 1509 LYS A HB2  1  
ATOM 32    H HB3  . LYS A 1 2   ? -28.489 14.221  -6.651  1.00 6.74  ? 1509 LYS A HB3  1  
ATOM 33    H HG2  . LYS A 1 2   ? -26.979 13.647  -8.443  1.00 6.93  ? 1509 LYS A HG2  1  
ATOM 34    H HG3  . LYS A 1 2   ? -28.274 13.815  -9.627  1.00 7.28  ? 1509 LYS A HG3  1  
ATOM 35    H HD2  . LYS A 1 2   ? -27.149 16.019  -7.905  1.00 8.13  ? 1509 LYS A HD2  1  
ATOM 36    H HD3  . LYS A 1 2   ? -26.807 15.767  -9.618  1.00 8.01  ? 1509 LYS A HD3  1  
ATOM 37    H HE2  . LYS A 1 2   ? -29.500 16.382  -8.404  1.00 8.69  ? 1509 LYS A HE2  1  
ATOM 38    H HE3  . LYS A 1 2   ? -28.487 17.507  -9.305  1.00 8.71  ? 1509 LYS A HE3  1  
ATOM 39    H HZ1  . LYS A 1 2   ? -29.698 15.016  -10.430 1.00 9.17  ? 1509 LYS A HZ1  1  
ATOM 40    H HZ2  . LYS A 1 2   ? -28.747 16.116  -11.267 1.00 9.28  ? 1509 LYS A HZ2  1  
ATOM 41    H HZ3  . LYS A 1 2   ? -30.253 16.593  -10.665 1.00 9.32  ? 1509 LYS A HZ3  1  
ATOM 42    N N    . SER A 1 3   ? -28.025 10.572  -8.172  1.00 4.76  ? 1510 SER A N    1  
ATOM 43    C CA   . SER A 1 3   ? -26.902 9.653   -8.203  1.00 4.45  ? 1510 SER A CA   1  
ATOM 44    C C    . SER A 1 3   ? -26.909 8.632   -7.035  1.00 3.64  ? 1510 SER A C    1  
ATOM 45    O O    . SER A 1 3   ? -27.077 8.986   -5.867  1.00 3.88  ? 1510 SER A O    1  
ATOM 46    C CB   . SER A 1 3   ? -25.575 10.424  -8.265  1.00 5.16  ? 1510 SER A CB   1  
ATOM 47    O OG   . SER A 1 3   ? -25.561 11.297  -9.393  1.00 5.81  ? 1510 SER A OG   1  
ATOM 48    H H    . SER A 1 3   ? -28.718 10.429  -8.856  1.00 4.93  ? 1510 SER A H    1  
ATOM 49    H HA   . SER A 1 3   ? -27.027 9.146   -9.148  1.00 4.75  ? 1510 SER A HA   1  
ATOM 50    H HB2  . SER A 1 3   ? -25.455 11.011  -7.366  1.00 5.40  ? 1510 SER A HB2  1  
ATOM 51    H HB3  . SER A 1 3   ? -24.756 9.725   -8.354  1.00 5.37  ? 1510 SER A HB3  1  
ATOM 52    H HG   . SER A 1 3   ? -24.817 11.017  -9.950  1.00 5.97  ? 1510 SER A HG   1  
ATOM 53    N N    . ASN A 1 4   ? -26.736 7.354   -7.373  1.00 3.10  ? 1511 ASN A N    1  
ATOM 54    C CA   . ASN A 1 4   ? -26.649 6.275   -6.390  1.00 2.64  ? 1511 ASN A CA   1  
ATOM 55    C C    . ASN A 1 4   ? -25.255 6.266   -5.774  1.00 2.46  ? 1511 ASN A C    1  
ATOM 56    O O    . ASN A 1 4   ? -24.994 5.574   -4.779  1.00 2.95  ? 1511 ASN A O    1  
ATOM 57    C CB   . ASN A 1 4   ? -26.951 4.915   -7.061  1.00 2.88  ? 1511 ASN A CB   1  
ATOM 58    C CG   . ASN A 1 4   ? -25.948 4.554   -8.152  1.00 2.85  ? 1511 ASN A CG   1  
ATOM 59    O OD1  . ASN A 1 4   ? -26.091 4.978   -9.296  1.00 3.42  ? 1511 ASN A OD1  1  
ATOM 60    N ND2  . ASN A 1 4   ? -24.968 3.746   -7.837  1.00 2.85  ? 1511 ASN A ND2  1  
ATOM 61    H H    . ASN A 1 4   ? -26.673 7.093   -8.317  1.00 3.39  ? 1511 ASN A H    1  
ATOM 62    H HA   . ASN A 1 4   ? -27.378 6.463   -5.616  1.00 2.86  ? 1511 ASN A HA   1  
ATOM 63    H HB2  . ASN A 1 4   ? -26.927 4.141   -6.308  1.00 3.16  ? 1511 ASN A HB2  1  
ATOM 64    H HB3  . ASN A 1 4   ? -27.937 4.951   -7.499  1.00 3.48  ? 1511 ASN A HB3  1  
ATOM 65    H HD21 . ASN A 1 4   ? -24.914 3.389   -6.925  1.00 2.88  ? 1511 ASN A HD21 1  
ATOM 66    H HD22 . ASN A 1 4   ? -24.315 3.540   -8.544  1.00 3.22  ? 1511 ASN A HD22 1  
ATOM 67    N N    . GLU A 1 5   ? -24.369 7.020   -6.394  1.00 2.44  ? 1512 GLU A N    1  
ATOM 68    C CA   . GLU A 1 5   ? -23.020 7.206   -5.944  1.00 2.69  ? 1512 GLU A CA   1  
ATOM 69    C C    . GLU A 1 5   ? -22.978 8.433   -5.070  1.00 2.20  ? 1512 GLU A C    1  
ATOM 70    O O    . GLU A 1 5   ? -23.741 9.381   -5.275  1.00 2.74  ? 1512 GLU A O    1  
ATOM 71    C CB   . GLU A 1 5   ? -22.104 7.364   -7.138  1.00 3.65  ? 1512 GLU A CB   1  
ATOM 72    C CG   . GLU A 1 5   ? -22.083 6.135   -8.012  1.00 4.47  ? 1512 GLU A CG   1  
ATOM 73    C CD   . GLU A 1 5   ? -21.473 6.374   -9.356  1.00 5.30  ? 1512 GLU A CD   1  
ATOM 74    O OE1  . GLU A 1 5   ? -20.228 6.350   -9.486  1.00 5.95  ? 1512 GLU A OE1  1  
ATOM 75    O OE2  . GLU A 1 5   ? -22.237 6.539   -10.325 1.00 5.61  ? 1512 GLU A OE2  1  
ATOM 76    H H    . GLU A 1 5   ? -24.646 7.499   -7.203  1.00 2.68  ? 1512 GLU A H    1  
ATOM 77    H HA   . GLU A 1 5   ? -22.723 6.340   -5.370  1.00 3.17  ? 1512 GLU A HA   1  
ATOM 78    H HB2  . GLU A 1 5   ? -22.433 8.213   -7.715  1.00 3.77  ? 1512 GLU A HB2  1  
ATOM 79    H HB3  . GLU A 1 5   ? -21.100 7.548   -6.784  1.00 4.13  ? 1512 GLU A HB3  1  
ATOM 80    H HG2  . GLU A 1 5   ? -21.513 5.366   -7.511  1.00 4.63  ? 1512 GLU A HG2  1  
ATOM 81    H HG3  . GLU A 1 5   ? -23.098 5.792   -8.146  1.00 4.71  ? 1512 GLU A HG3  1  
ATOM 82    N N    . HIS A 1 6   ? -22.113 8.411   -4.107  1.00 1.95  ? 1513 HIS A N    1  
ATOM 83    C CA   . HIS A 1 6   ? -22.005 9.419   -3.096  1.00 2.20  ? 1513 HIS A CA   1  
ATOM 84    C C    . HIS A 1 6   ? -20.603 9.339   -2.607  1.00 2.18  ? 1513 HIS A C    1  
ATOM 85    O O    . HIS A 1 6   ? -20.079 8.230   -2.432  1.00 2.90  ? 1513 HIS A O    1  
ATOM 86    C CB   . HIS A 1 6   ? -22.915 9.098   -1.884  1.00 3.02  ? 1513 HIS A CB   1  
ATOM 87    C CG   . HIS A 1 6   ? -24.368 8.895   -2.181  1.00 3.77  ? 1513 HIS A CG   1  
ATOM 88    N ND1  . HIS A 1 6   ? -24.959 7.654   -2.192  1.00 4.48  ? 1513 HIS A ND1  1  
ATOM 89    C CD2  . HIS A 1 6   ? -25.345 9.774   -2.470  1.00 4.42  ? 1513 HIS A CD2  1  
ATOM 90    C CE1  . HIS A 1 6   ? -26.238 7.787   -2.477  1.00 5.33  ? 1513 HIS A CE1  1  
ATOM 91    N NE2  . HIS A 1 6   ? -26.494 9.062   -2.648  1.00 5.30  ? 1513 HIS A NE2  1  
ATOM 92    H H    . HIS A 1 6   ? -21.427 7.718   -4.076  1.00 2.23  ? 1513 HIS A H    1  
ATOM 93    H HA   . HIS A 1 6   ? -22.242 10.393  -3.492  1.00 2.69  ? 1513 HIS A HA   1  
ATOM 94    H HB2  . HIS A 1 6   ? -22.560 8.191   -1.416  1.00 3.35  ? 1513 HIS A HB2  1  
ATOM 95    H HB3  . HIS A 1 6   ? -22.826 9.906   -1.173  1.00 3.43  ? 1513 HIS A HB3  1  
ATOM 96    H HD1  . HIS A 1 6   ? -24.489 6.803   -2.030  1.00 4.64  ? 1513 HIS A HD1  1  
ATOM 97    H HD2  . HIS A 1 6   ? -25.236 10.847  -2.547  1.00 4.57  ? 1513 HIS A HD2  1  
ATOM 98    H HE1  . HIS A 1 6   ? -26.954 6.982   -2.555  1.00 6.14  ? 1513 HIS A HE1  1  
ATOM 99    H HE2  . HIS A 1 6   ? -27.278 9.417   -3.133  1.00 5.92  ? 1513 HIS A HE2  1  
ATOM 100   N N    . ASP A 1 7   ? -20.011 10.449  -2.322  1.00 2.06  ? 1514 ASP A N    1  
ATOM 101   C CA   . ASP A 1 7   ? -18.646 10.490  -1.819  1.00 2.48  ? 1514 ASP A CA   1  
ATOM 102   C C    . ASP A 1 7   ? -18.706 10.371  -0.285  1.00 1.88  ? 1514 ASP A C    1  
ATOM 103   O O    . ASP A 1 7   ? -18.123 11.149  0.452   1.00 2.21  ? 1514 ASP A O    1  
ATOM 104   C CB   . ASP A 1 7   ? -17.979 11.809  -2.268  1.00 3.42  ? 1514 ASP A CB   1  
ATOM 105   C CG   . ASP A 1 7   ? -16.480 11.882  -2.019  1.00 4.29  ? 1514 ASP A CG   1  
ATOM 106   O OD1  . ASP A 1 7   ? -15.700 11.283  -2.811  1.00 5.06  ? 1514 ASP A OD1  1  
ATOM 107   O OD2  . ASP A 1 7   ? -16.051 12.607  -1.087  1.00 4.55  ? 1514 ASP A OD2  1  
ATOM 108   H H    . ASP A 1 7   ? -20.495 11.302  -2.425  1.00 2.23  ? 1514 ASP A H    1  
ATOM 109   H HA   . ASP A 1 7   ? -18.109 9.644   -2.222  1.00 3.01  ? 1514 ASP A HA   1  
ATOM 110   H HB2  . ASP A 1 7   ? -18.139 11.937  -3.328  1.00 3.71  ? 1514 ASP A HB2  1  
ATOM 111   H HB3  . ASP A 1 7   ? -18.451 12.628  -1.747  1.00 3.65  ? 1514 ASP A HB3  1  
ATOM 112   N N    . ASP A 1 8   ? -19.506 9.412   0.173   1.00 1.41  ? 1515 ASP A N    1  
ATOM 113   C CA   . ASP A 1 8   ? -19.711 9.152   1.606   1.00 1.15  ? 1515 ASP A CA   1  
ATOM 114   C C    . ASP A 1 8   ? -19.584 7.665   1.911   1.00 1.08  ? 1515 ASP A C    1  
ATOM 115   O O    . ASP A 1 8   ? -20.141 7.185   2.904   1.00 1.97  ? 1515 ASP A O    1  
ATOM 116   C CB   . ASP A 1 8   ? -21.114 9.606   2.075   1.00 1.48  ? 1515 ASP A CB   1  
ATOM 117   C CG   . ASP A 1 8   ? -21.380 11.087  1.967   1.00 2.07  ? 1515 ASP A CG   1  
ATOM 118   O OD1  . ASP A 1 8   ? -20.873 11.867  2.807   1.00 2.33  ? 1515 ASP A OD1  1  
ATOM 119   O OD2  . ASP A 1 8   ? -22.153 11.500  1.074   1.00 2.90  ? 1515 ASP A OD2  1  
ATOM 120   H H    . ASP A 1 8   ? -19.988 8.898   -0.511  1.00 1.68  ? 1515 ASP A H    1  
ATOM 121   H HA   . ASP A 1 8   ? -18.966 9.701   2.163   1.00 1.40  ? 1515 ASP A HA   1  
ATOM 122   H HB2  . ASP A 1 8   ? -21.859 9.101   1.480   1.00 1.83  ? 1515 ASP A HB2  1  
ATOM 123   H HB3  . ASP A 1 8   ? -21.242 9.308   3.106   1.00 1.85  ? 1515 ASP A HB3  1  
ATOM 124   N N    . CYS A 1 9   ? -18.855 6.934   1.063   1.00 0.81  ? 1516 CYS A N    1  
ATOM 125   C CA   . CYS A 1 9   ? -18.695 5.466   1.190   1.00 0.69  ? 1516 CYS A CA   1  
ATOM 126   C C    . CYS A 1 9   ? -20.018 4.703   1.259   1.00 0.61  ? 1516 CYS A C    1  
ATOM 127   O O    . CYS A 1 9   ? -20.137 3.695   1.975   1.00 0.65  ? 1516 CYS A O    1  
ATOM 128   C CB   . CYS A 1 9   ? -17.827 5.102   2.377   1.00 0.80  ? 1516 CYS A CB   1  
ATOM 129   S SG   . CYS A 1 9   ? -16.134 5.689   2.245   1.00 1.19  ? 1516 CYS A SG   1  
ATOM 130   H H    . CYS A 1 9   ? -18.340 7.382   0.361   1.00 1.41  ? 1516 CYS A H    1  
ATOM 131   H HA   . CYS A 1 9   ? -18.188 5.139   0.294   1.00 0.82  ? 1516 CYS A HA   1  
ATOM 132   H HB2  . CYS A 1 9   ? -18.254 5.531   3.271   1.00 1.27  ? 1516 CYS A HB2  1  
ATOM 133   H HB3  . CYS A 1 9   ? -17.799 4.026   2.476   1.00 1.18  ? 1516 CYS A HB3  1  
ATOM 134   N N    . GLN A 1 10  ? -21.003 5.166   0.535   1.00 0.58  ? 1517 GLN A N    1  
ATOM 135   C CA   . GLN A 1 10  ? -22.254 4.467   0.493   1.00 0.58  ? 1517 GLN A CA   1  
ATOM 136   C C    . GLN A 1 10  ? -22.842 4.561   -0.894  1.00 0.60  ? 1517 GLN A C    1  
ATOM 137   O O    . GLN A 1 10  ? -22.959 5.660   -1.474  1.00 0.73  ? 1517 GLN A O    1  
ATOM 138   C CB   . GLN A 1 10  ? -23.255 4.930   1.589   1.00 0.65  ? 1517 GLN A CB   1  
ATOM 139   C CG   . GLN A 1 10  ? -23.675 6.396   1.552   1.00 0.74  ? 1517 GLN A CG   1  
ATOM 140   C CD   . GLN A 1 10  ? -24.886 6.661   2.424   1.00 0.90  ? 1517 GLN A CD   1  
ATOM 141   O OE1  . GLN A 1 10  ? -25.115 5.988   3.434   1.00 1.44  ? 1517 GLN A OE1  1  
ATOM 142   N NE2  . GLN A 1 10  ? -25.660 7.639   2.060   1.00 1.52  ? 1517 GLN A NE2  1  
ATOM 143   H H    . GLN A 1 10  ? -20.882 5.967   -0.014  1.00 0.61  ? 1517 GLN A H    1  
ATOM 144   H HA   . GLN A 1 10  ? -22.010 3.427   0.656   1.00 0.58  ? 1517 GLN A HA   1  
ATOM 145   H HB2  . GLN A 1 10  ? -24.149 4.334   1.532   1.00 0.72  ? 1517 GLN A HB2  1  
ATOM 146   H HB3  . GLN A 1 10  ? -22.801 4.748   2.553   1.00 0.64  ? 1517 GLN A HB3  1  
ATOM 147   H HG2  . GLN A 1 10  ? -22.872 7.010   1.934   1.00 0.71  ? 1517 GLN A HG2  1  
ATOM 148   H HG3  . GLN A 1 10  ? -23.910 6.679   0.538   1.00 0.82  ? 1517 GLN A HG3  1  
ATOM 149   H HE21 . GLN A 1 10  ? -25.418 8.158   1.258   1.00 2.18  ? 1517 GLN A HE21 1  
ATOM 150   H HE22 . GLN A 1 10  ? -26.463 7.826   2.601   1.00 1.63  ? 1517 GLN A HE22 1  
ATOM 151   N N    . VAL A 1 11  ? -23.211 3.432   -1.420  1.00 0.51  ? 1518 VAL A N    1  
ATOM 152   C CA   . VAL A 1 11  ? -23.704 3.319   -2.766  1.00 0.53  ? 1518 VAL A CA   1  
ATOM 153   C C    . VAL A 1 11  ? -24.866 2.391   -2.842  1.00 0.54  ? 1518 VAL A C    1  
ATOM 154   O O    . VAL A 1 11  ? -24.883 1.338   -2.214  1.00 0.51  ? 1518 VAL A O    1  
ATOM 155   C CB   . VAL A 1 11  ? -22.618 2.851   -3.766  1.00 0.51  ? 1518 VAL A CB   1  
ATOM 156   C CG1  . VAL A 1 11  ? -21.739 3.977   -4.161  1.00 0.94  ? 1518 VAL A CG1  1  
ATOM 157   C CG2  . VAL A 1 11  ? -21.767 1.745   -3.192  1.00 0.84  ? 1518 VAL A CG2  1  
ATOM 158   H H    . VAL A 1 11  ? -23.177 2.609   -0.882  1.00 0.47  ? 1518 VAL A H    1  
ATOM 159   H HA   . VAL A 1 11  ? -24.033 4.301   -3.072  1.00 0.60  ? 1518 VAL A HA   1  
ATOM 160   H HB   . VAL A 1 11  ? -23.099 2.467   -4.649  1.00 0.93  ? 1518 VAL A HB   1  
ATOM 161   H HG11 . VAL A 1 11  ? -20.998 3.575   -4.832  1.00 1.47  ? 1518 VAL A HG11 1  
ATOM 162   H HG12 . VAL A 1 11  ? -21.276 4.385   -3.274  1.00 1.51  ? 1518 VAL A HG12 1  
ATOM 163   H HG13 . VAL A 1 11  ? -22.350 4.699   -4.679  1.00 1.48  ? 1518 VAL A HG13 1  
ATOM 164   H HG21 . VAL A 1 11  ? -22.360 0.874   -2.970  1.00 1.37  ? 1518 VAL A HG21 1  
ATOM 165   H HG22 . VAL A 1 11  ? -21.279 2.097   -2.294  1.00 1.33  ? 1518 VAL A HG22 1  
ATOM 166   H HG23 . VAL A 1 11  ? -21.006 1.495   -3.918  1.00 1.52  ? 1518 VAL A HG23 1  
ATOM 167   N N    . THR A 1 12  ? -25.829 2.777   -3.586  1.00 0.64  ? 1519 THR A N    1  
ATOM 168   C CA   . THR A 1 12  ? -26.987 1.981   -3.759  1.00 0.69  ? 1519 THR A CA   1  
ATOM 169   C C    . THR A 1 12  ? -26.875 1.197   -5.062  1.00 0.78  ? 1519 THR A C    1  
ATOM 170   O O    . THR A 1 12  ? -26.413 1.724   -6.076  1.00 0.89  ? 1519 THR A O    1  
ATOM 171   C CB   . THR A 1 12  ? -28.216 2.876   -3.810  1.00 0.79  ? 1519 THR A CB   1  
ATOM 172   O OG1  . THR A 1 12  ? -28.108 3.864   -2.758  1.00 0.78  ? 1519 THR A OG1  1  
ATOM 173   C CG2  . THR A 1 12  ? -29.476 2.039   -3.620  1.00 0.85  ? 1519 THR A CG2  1  
ATOM 174   H H    . THR A 1 12  ? -25.779 3.648   -4.035  1.00 0.72  ? 1519 THR A H    1  
ATOM 175   H HA   . THR A 1 12  ? -27.081 1.306   -2.922  1.00 0.66  ? 1519 THR A HA   1  
ATOM 176   H HB   . THR A 1 12  ? -28.251 3.371   -4.769  1.00 0.87  ? 1519 THR A HB   1  
ATOM 177   H HG1  . THR A 1 12  ? -28.714 3.710   -2.016  1.00 1.09  ? 1519 THR A HG1  1  
ATOM 178   H HG21 . THR A 1 12  ? -29.451 1.563   -2.651  1.00 1.36  ? 1519 THR A HG21 1  
ATOM 179   H HG22 . THR A 1 12  ? -29.483 1.271   -4.382  1.00 1.35  ? 1519 THR A HG22 1  
ATOM 180   H HG23 . THR A 1 12  ? -30.356 2.657   -3.712  1.00 1.30  ? 1519 THR A HG23 1  
ATOM 181   N N    . ASN A 1 13  ? -27.244 -0.059  -5.009  1.00 0.80  ? 1520 ASN A N    1  
ATOM 182   C CA   . ASN A 1 13  ? -27.280 -0.916  -6.151  1.00 0.95  ? 1520 ASN A CA   1  
ATOM 183   C C    . ASN A 1 13  ? -28.523 -0.592  -6.969  1.00 0.98  ? 1520 ASN A C    1  
ATOM 184   O O    . ASN A 1 13  ? -29.629 -0.745  -6.476  1.00 0.96  ? 1520 ASN A O    1  
ATOM 185   C CB   . ASN A 1 13  ? -27.340 -2.363  -5.670  1.00 1.09  ? 1520 ASN A CB   1  
ATOM 186   C CG   . ASN A 1 13  ? -27.519 -3.336  -6.790  1.00 1.30  ? 1520 ASN A CG   1  
ATOM 187   O OD1  . ASN A 1 13  ? -28.625 -3.676  -7.137  1.00 1.34  ? 1520 ASN A OD1  1  
ATOM 188   N ND2  . ASN A 1 13  ? -26.460 -3.768  -7.342  1.00 1.74  ? 1520 ASN A ND2  1  
ATOM 189   H H    . ASN A 1 13  ? -27.508 -0.453  -4.148  1.00 0.78  ? 1520 ASN A H    1  
ATOM 190   H HA   . ASN A 1 13  ? -26.386 -0.774  -6.740  1.00 1.07  ? 1520 ASN A HA   1  
ATOM 191   H HB2  . ASN A 1 13  ? -26.430 -2.607  -5.146  1.00 1.19  ? 1520 ASN A HB2  1  
ATOM 192   H HB3  . ASN A 1 13  ? -28.174 -2.468  -4.990  1.00 1.10  ? 1520 ASN A HB3  1  
ATOM 193   H HD21 . ASN A 1 13  ? -25.607 -3.437  -6.989  1.00 2.02  ? 1520 ASN A HD21 1  
ATOM 194   H HD22 . ASN A 1 13  ? -26.501 -4.404  -8.096  1.00 1.91  ? 1520 ASN A HD22 1  
ATOM 195   N N    . PRO A 1 14  ? -28.370 -0.140  -8.217  1.00 1.13  ? 1521 PRO A N    1  
ATOM 196   C CA   . PRO A 1 14  ? -29.512 0.242   -9.066  1.00 1.26  ? 1521 PRO A CA   1  
ATOM 197   C C    . PRO A 1 14  ? -30.379 -0.950  -9.515  1.00 1.30  ? 1521 PRO A C    1  
ATOM 198   O O    . PRO A 1 14  ? -31.496 -0.768  -9.986  1.00 1.40  ? 1521 PRO A O    1  
ATOM 199   C CB   . PRO A 1 14  ? -28.853 0.921   -10.273 1.00 1.47  ? 1521 PRO A CB   1  
ATOM 200   C CG   . PRO A 1 14  ? -27.467 0.369   -10.325 1.00 1.58  ? 1521 PRO A CG   1  
ATOM 201   C CD   . PRO A 1 14  ? -27.073 0.053   -8.910  1.00 1.30  ? 1521 PRO A CD   1  
ATOM 202   H HA   . PRO A 1 14  ? -30.144 0.954   -8.557  1.00 1.25  ? 1521 PRO A HA   1  
ATOM 203   H HB2  . PRO A 1 14  ? -29.407 0.682   -11.169 1.00 1.57  ? 1521 PRO A HB2  1  
ATOM 204   H HB3  . PRO A 1 14  ? -28.843 1.990   -10.125 1.00 1.57  ? 1521 PRO A HB3  1  
ATOM 205   H HG2  . PRO A 1 14  ? -27.451 -0.527  -10.927 1.00 1.79  ? 1521 PRO A HG2  1  
ATOM 206   H HG3  . PRO A 1 14  ? -26.799 1.109   -10.741 1.00 1.82  ? 1521 PRO A HG3  1  
ATOM 207   H HD2  . PRO A 1 14  ? -26.480 -0.848  -8.876  1.00 1.38  ? 1521 PRO A HD2  1  
ATOM 208   H HD3  . PRO A 1 14  ? -26.529 0.880   -8.480  1.00 1.27  ? 1521 PRO A HD3  1  
ATOM 209   N N    . SER A 1 15  ? -29.874 -2.148  -9.339  1.00 1.30  ? 1522 SER A N    1  
ATOM 210   C CA   . SER A 1 15  ? -30.576 -3.336  -9.764  1.00 1.40  ? 1522 SER A CA   1  
ATOM 211   C C    . SER A 1 15  ? -31.636 -3.796  -8.737  1.00 1.36  ? 1522 SER A C    1  
ATOM 212   O O    . SER A 1 15  ? -32.701 -4.278  -9.120  1.00 1.46  ? 1522 SER A O    1  
ATOM 213   C CB   . SER A 1 15  ? -29.567 -4.448  -10.009 1.00 1.53  ? 1522 SER A CB   1  
ATOM 214   O OG   . SER A 1 15  ? -28.524 -3.998  -10.863 1.00 1.65  ? 1522 SER A OG   1  
ATOM 215   H H    . SER A 1 15  ? -28.992 -2.255  -8.926  1.00 1.29  ? 1522 SER A H    1  
ATOM 216   H HA   . SER A 1 15  ? -31.067 -3.118  -10.700 1.00 1.48  ? 1522 SER A HA   1  
ATOM 217   H HB2  . SER A 1 15  ? -29.137 -4.743  -9.063  1.00 1.50  ? 1522 SER A HB2  1  
ATOM 218   H HB3  . SER A 1 15  ? -30.056 -5.298  -10.459 1.00 1.62  ? 1522 SER A HB3  1  
ATOM 219   H HG   . SER A 1 15  ? -28.950 -3.602  -11.639 1.00 1.89  ? 1522 SER A HG   1  
ATOM 220   N N    . THR A 1 16  ? -31.350 -3.657  -7.450  1.00 1.29  ? 1523 THR A N    1  
ATOM 221   C CA   . THR A 1 16  ? -32.281 -4.153  -6.450  1.00 1.35  ? 1523 THR A CA   1  
ATOM 222   C C    . THR A 1 16  ? -32.466 -3.159  -5.279  1.00 1.25  ? 1523 THR A C    1  
ATOM 223   O O    . THR A 1 16  ? -33.176 -3.439  -4.301  1.00 1.36  ? 1523 THR A O    1  
ATOM 224   C CB   . THR A 1 16  ? -31.836 -5.576  -5.957  1.00 1.47  ? 1523 THR A CB   1  
ATOM 225   O OG1  . THR A 1 16  ? -32.796 -6.160  -5.062  1.00 1.61  ? 1523 THR A OG1  1  
ATOM 226   C CG2  . THR A 1 16  ? -30.467 -5.532  -5.282  1.00 1.42  ? 1523 THR A CG2  1  
ATOM 227   H H    . THR A 1 16  ? -30.489 -3.262  -7.183  1.00 1.25  ? 1523 THR A H    1  
ATOM 228   H HA   . THR A 1 16  ? -33.240 -4.252  -6.938  1.00 1.46  ? 1523 THR A HA   1  
ATOM 229   H HB   . THR A 1 16  ? -31.766 -6.214  -6.826  1.00 1.57  ? 1523 THR A HB   1  
ATOM 230   H HG1  . THR A 1 16  ? -32.571 -7.101  -5.020  1.00 1.99  ? 1523 THR A HG1  1  
ATOM 231   H HG21 . THR A 1 16  ? -30.507 -4.868  -4.431  1.00 1.81  ? 1523 THR A HG21 1  
ATOM 232   H HG22 . THR A 1 16  ? -29.737 -5.167  -5.991  1.00 1.69  ? 1523 THR A HG22 1  
ATOM 233   H HG23 . THR A 1 16  ? -30.186 -6.523  -4.957  1.00 1.70  ? 1523 THR A HG23 1  
ATOM 234   N N    . GLY A 1 17  ? -31.832 -2.001  -5.377  1.00 1.13  ? 1524 GLY A N    1  
ATOM 235   C CA   . GLY A 1 17  ? -31.987 -0.983  -4.358  1.00 1.08  ? 1524 GLY A CA   1  
ATOM 236   C C    . GLY A 1 17  ? -31.281 -1.336  -3.075  1.00 0.99  ? 1524 GLY A C    1  
ATOM 237   O O    . GLY A 1 17  ? -31.701 -0.928  -1.997  1.00 1.06  ? 1524 GLY A O    1  
ATOM 238   H H    . GLY A 1 17  ? -31.253 -1.805  -6.145  1.00 1.11  ? 1524 GLY A H    1  
ATOM 239   H HA2  . GLY A 1 17  ? -31.586 -0.052  -4.731  1.00 1.06  ? 1524 GLY A HA2  1  
ATOM 240   H HA3  . GLY A 1 17  ? -33.040 -0.852  -4.154  1.00 1.19  ? 1524 GLY A HA3  1  
ATOM 241   N N    . HIS A 1 18  ? -30.216 -2.103  -3.181  1.00 0.91  ? 1525 HIS A N    1  
ATOM 242   C CA   . HIS A 1 18  ? -29.474 -2.485  -1.999  1.00 0.85  ? 1525 HIS A CA   1  
ATOM 243   C C    . HIS A 1 18  ? -28.480 -1.392  -1.673  1.00 0.72  ? 1525 HIS A C    1  
ATOM 244   O O    . HIS A 1 18  ? -27.604 -1.087  -2.481  1.00 0.68  ? 1525 HIS A O    1  
ATOM 245   C CB   . HIS A 1 18  ? -28.741 -3.820  -2.189  1.00 0.90  ? 1525 HIS A CB   1  
ATOM 246   C CG   . HIS A 1 18  ? -28.174 -4.390  -0.910  1.00 0.91  ? 1525 HIS A CG   1  
ATOM 247   N ND1  . HIS A 1 18  ? -26.962 -4.011  -0.369  1.00 1.12  ? 1525 HIS A ND1  1  
ATOM 248   C CD2  . HIS A 1 18  ? -28.671 -5.323  -0.072  1.00 1.26  ? 1525 HIS A CD2  1  
ATOM 249   C CE1  . HIS A 1 18  ? -26.750 -4.694  0.742   1.00 1.05  ? 1525 HIS A CE1  1  
ATOM 250   N NE2  . HIS A 1 18  ? -27.770 -5.494  0.939   1.00 1.12  ? 1525 HIS A NE2  1  
ATOM 251   H H    . HIS A 1 18  ? -29.942 -2.402  -4.072  1.00 0.93  ? 1525 HIS A H    1  
ATOM 252   H HA   . HIS A 1 18  ? -30.176 -2.572  -1.182  1.00 0.91  ? 1525 HIS A HA   1  
ATOM 253   H HB2  . HIS A 1 18  ? -29.430 -4.544  -2.597  1.00 1.03  ? 1525 HIS A HB2  1  
ATOM 254   H HB3  . HIS A 1 18  ? -27.925 -3.678  -2.884  1.00 0.89  ? 1525 HIS A HB3  1  
ATOM 255   H HD1  . HIS A 1 18  ? -26.339 -3.341  -0.720  1.00 1.59  ? 1525 HIS A HD1  1  
ATOM 256   H HD2  . HIS A 1 18  ? -29.613 -5.842  -0.182  1.00 1.82  ? 1525 HIS A HD2  1  
ATOM 257   H HE1  . HIS A 1 18  ? -25.885 -4.604  1.382   1.00 1.33  ? 1525 HIS A HE1  1  
ATOM 258   H HE2  . HIS A 1 18  ? -27.677 -6.362  1.412   1.00 1.40  ? 1525 HIS A HE2  1  
ATOM 259   N N    . LEU A 1 19  ? -28.613 -0.835  -0.521  1.00 0.68  ? 1526 LEU A N    1  
ATOM 260   C CA   . LEU A 1 19  ? -27.776 0.240   -0.070  1.00 0.60  ? 1526 LEU A CA   1  
ATOM 261   C C    . LEU A 1 19  ? -26.524 -0.346  0.595   1.00 0.54  ? 1526 LEU A C    1  
ATOM 262   O O    . LEU A 1 19  ? -26.620 -1.040  1.607   1.00 0.57  ? 1526 LEU A O    1  
ATOM 263   C CB   . LEU A 1 19  ? -28.609 1.145   0.893   1.00 0.66  ? 1526 LEU A CB   1  
ATOM 264   C CG   . LEU A 1 19  ? -27.955 2.380   1.583   1.00 0.64  ? 1526 LEU A CG   1  
ATOM 265   C CD1  . LEU A 1 19  ? -27.191 1.996   2.826   1.00 0.64  ? 1526 LEU A CD1  1  
ATOM 266   C CD2  . LEU A 1 19  ? -27.043 3.151   0.654   1.00 0.64  ? 1526 LEU A CD2  1  
ATOM 267   H H    . LEU A 1 19  ? -29.301 -1.195  0.091   1.00 0.75  ? 1526 LEU A H    1  
ATOM 268   H HA   . LEU A 1 19  ? -27.533 0.814   -0.953  1.00 0.58  ? 1526 LEU A HA   1  
ATOM 269   H HB2  . LEU A 1 19  ? -29.457 1.514   0.335   1.00 0.71  ? 1526 LEU A HB2  1  
ATOM 270   H HB3  . LEU A 1 19  ? -28.998 0.508   1.674   1.00 0.70  ? 1526 LEU A HB3  1  
ATOM 271   H HG   . LEU A 1 19  ? -28.755 3.035   1.879   1.00 0.71  ? 1526 LEU A HG   1  
ATOM 272   H HD11 . LEU A 1 19  ? -26.422 1.293   2.552   1.00 1.13  ? 1526 LEU A HD11 1  
ATOM 273   H HD12 . LEU A 1 19  ? -27.867 1.544   3.538   1.00 1.25  ? 1526 LEU A HD12 1  
ATOM 274   H HD13 . LEU A 1 19  ? -26.740 2.877   3.259   1.00 1.15  ? 1526 LEU A HD13 1  
ATOM 275   H HD21 . LEU A 1 19  ? -26.882 4.131   1.079   1.00 1.12  ? 1526 LEU A HD21 1  
ATOM 276   H HD22 . LEU A 1 19  ? -27.464 3.231   -0.338  1.00 1.30  ? 1526 LEU A HD22 1  
ATOM 277   H HD23 . LEU A 1 19  ? -26.098 2.631   0.648   1.00 1.16  ? 1526 LEU A HD23 1  
ATOM 278   N N    . PHE A 1 20  ? -25.380 -0.156  -0.019  1.00 0.47  ? 1527 PHE A N    1  
ATOM 279   C CA   . PHE A 1 20  ? -24.139 -0.586  0.556   1.00 0.45  ? 1527 PHE A CA   1  
ATOM 280   C C    . PHE A 1 20  ? -23.542 0.530   1.378   1.00 0.44  ? 1527 PHE A C    1  
ATOM 281   O O    . PHE A 1 20  ? -23.183 1.579   0.834   1.00 0.48  ? 1527 PHE A O    1  
ATOM 282   C CB   . PHE A 1 20  ? -23.126 -1.018  -0.517  1.00 0.43  ? 1527 PHE A CB   1  
ATOM 283   C CG   . PHE A 1 20  ? -23.568 -2.143  -1.388  1.00 0.45  ? 1527 PHE A CG   1  
ATOM 284   C CD1  . PHE A 1 20  ? -23.503 -3.441  -0.936  1.00 0.59  ? 1527 PHE A CD1  1  
ATOM 285   C CD2  . PHE A 1 20  ? -24.031 -1.902  -2.667  1.00 0.44  ? 1527 PHE A CD2  1  
ATOM 286   C CE1  . PHE A 1 20  ? -23.897 -4.480  -1.743  1.00 0.65  ? 1527 PHE A CE1  1  
ATOM 287   C CE2  . PHE A 1 20  ? -24.425 -2.930  -3.474  1.00 0.49  ? 1527 PHE A CE2  1  
ATOM 288   C CZ   . PHE A 1 20  ? -24.360 -4.223  -3.013  1.00 0.58  ? 1527 PHE A CZ   1  
ATOM 289   H H    . PHE A 1 20  ? -25.321 0.277   -0.900  1.00 0.47  ? 1527 PHE A H    1  
ATOM 290   H HA   . PHE A 1 20  ? -24.363 -1.419  1.197   1.00 0.49  ? 1527 PHE A HA   1  
ATOM 291   H HB2  . PHE A 1 20  ? -22.936 -0.177  -1.167  1.00 0.42  ? 1527 PHE A HB2  1  
ATOM 292   H HB3  . PHE A 1 20  ? -22.193 -1.306  -0.054  1.00 0.48  ? 1527 PHE A HB3  1  
ATOM 293   H HD1  . PHE A 1 20  ? -23.140 -3.637  0.062   1.00 0.70  ? 1527 PHE A HD1  1  
ATOM 294   H HD2  . PHE A 1 20  ? -24.084 -0.893  -3.044  1.00 0.49  ? 1527 PHE A HD2  1  
ATOM 295   H HE1  . PHE A 1 20  ? -23.843 -5.496  -1.382  1.00 0.80  ? 1527 PHE A HE1  1  
ATOM 296   H HE2  . PHE A 1 20  ? -24.784 -2.710  -4.468  1.00 0.55  ? 1527 PHE A HE2  1  
ATOM 297   H HZ   . PHE A 1 20  ? -24.672 -5.040  -3.649  1.00 0.66  ? 1527 PHE A HZ   1  
ATOM 298   N N    . ASP A 1 21  ? -23.460 0.323   2.663   1.00 0.44  ? 1528 ASP A N    1  
ATOM 299   C CA   . ASP A 1 21  ? -22.827 1.276   3.543   1.00 0.48  ? 1528 ASP A CA   1  
ATOM 300   C C    . ASP A 1 21  ? -21.548 0.694   4.042   1.00 0.41  ? 1528 ASP A C    1  
ATOM 301   O O    . ASP A 1 21  ? -21.550 -0.324  4.745   1.00 0.46  ? 1528 ASP A O    1  
ATOM 302   C CB   . ASP A 1 21  ? -23.700 1.665   4.735   1.00 0.64  ? 1528 ASP A CB   1  
ATOM 303   C CG   . ASP A 1 21  ? -22.912 2.497   5.730   1.00 0.81  ? 1528 ASP A CG   1  
ATOM 304   O OD1  . ASP A 1 21  ? -22.716 3.700   5.490   1.00 1.17  ? 1528 ASP A OD1  1  
ATOM 305   O OD2  . ASP A 1 21  ? -22.431 1.943   6.759   1.00 0.81  ? 1528 ASP A OD2  1  
ATOM 306   H H    . ASP A 1 21  ? -23.803 -0.517  3.044   1.00 0.47  ? 1528 ASP A H    1  
ATOM 307   H HA   . ASP A 1 21  ? -22.602 2.159   2.963   1.00 0.51  ? 1528 ASP A HA   1  
ATOM 308   H HB2  . ASP A 1 21  ? -24.540 2.250   4.387   1.00 0.81  ? 1528 ASP A HB2  1  
ATOM 309   H HB3  . ASP A 1 21  ? -24.037 0.766   5.233   1.00 0.70  ? 1528 ASP A HB3  1  
ATOM 310   N N    . LEU A 1 22  ? -20.465 1.313   3.697   1.00 0.38  ? 1529 LEU A N    1  
ATOM 311   C CA   . LEU A 1 22  ? -19.188 0.818   4.082   1.00 0.36  ? 1529 LEU A CA   1  
ATOM 312   C C    . LEU A 1 22  ? -18.695 1.541   5.319   1.00 0.40  ? 1529 LEU A C    1  
ATOM 313   O O    . LEU A 1 22  ? -17.645 1.222   5.861   1.00 0.41  ? 1529 LEU A O    1  
ATOM 314   C CB   . LEU A 1 22  ? -18.192 0.924   2.926   1.00 0.39  ? 1529 LEU A CB   1  
ATOM 315   C CG   . LEU A 1 22  ? -18.388 -0.030  1.711   1.00 0.40  ? 1529 LEU A CG   1  
ATOM 316   C CD1  . LEU A 1 22  ? -18.320 -1.475  2.102   1.00 0.52  ? 1529 LEU A CD1  1  
ATOM 317   C CD2  . LEU A 1 22  ? -19.652 0.233   0.887   1.00 0.60  ? 1529 LEU A CD2  1  
ATOM 318   H H    . LEU A 1 22  ? -20.492 2.136   3.159   1.00 0.42  ? 1529 LEU A H    1  
ATOM 319   H HA   . LEU A 1 22  ? -19.315 -0.226  4.331   1.00 0.36  ? 1529 LEU A HA   1  
ATOM 320   H HB2  . LEU A 1 22  ? -18.228 1.937   2.554   1.00 0.44  ? 1529 LEU A HB2  1  
ATOM 321   H HB3  . LEU A 1 22  ? -17.204 0.751   3.325   1.00 0.42  ? 1529 LEU A HB3  1  
ATOM 322   H HG   . LEU A 1 22  ? -17.539 0.169   1.076   1.00 0.70  ? 1529 LEU A HG   1  
ATOM 323   H HD11 . LEU A 1 22  ? -18.475 -2.043  1.195   1.00 1.20  ? 1529 LEU A HD11 1  
ATOM 324   H HD12 . LEU A 1 22  ? -19.095 -1.690  2.823   1.00 1.15  ? 1529 LEU A HD12 1  
ATOM 325   H HD13 . LEU A 1 22  ? -17.346 -1.698  2.512   1.00 1.15  ? 1529 LEU A HD13 1  
ATOM 326   H HD21 . LEU A 1 22  ? -19.648 -0.477  0.074   1.00 1.29  ? 1529 LEU A HD21 1  
ATOM 327   H HD22 . LEU A 1 22  ? -19.613 1.225   0.460   1.00 1.20  ? 1529 LEU A HD22 1  
ATOM 328   H HD23 . LEU A 1 22  ? -20.544 0.084   1.476   1.00 1.18  ? 1529 LEU A HD23 1  
ATOM 329   N N    . SER A 1 23  ? -19.517 2.462   5.810   1.00 0.48  ? 1530 SER A N    1  
ATOM 330   C CA   . SER A 1 23  ? -19.192 3.241   7.015   1.00 0.57  ? 1530 SER A CA   1  
ATOM 331   C C    . SER A 1 23  ? -19.251 2.330   8.240   1.00 0.56  ? 1530 SER A C    1  
ATOM 332   O O    . SER A 1 23  ? -18.695 2.622   9.306   1.00 0.60  ? 1530 SER A O    1  
ATOM 333   C CB   . SER A 1 23  ? -20.167 4.395   7.185   1.00 0.71  ? 1530 SER A CB   1  
ATOM 334   O OG   . SER A 1 23  ? -20.440 4.994   5.923   1.00 0.84  ? 1530 SER A OG   1  
ATOM 335   H H    . SER A 1 23  ? -20.362 2.610   5.335   1.00 0.52  ? 1530 SER A H    1  
ATOM 336   H HA   . SER A 1 23  ? -18.188 3.623   6.910   1.00 0.59  ? 1530 SER A HA   1  
ATOM 337   H HB2  . SER A 1 23  ? -21.082 4.087   7.671   1.00 0.72  ? 1530 SER A HB2  1  
ATOM 338   H HB3  . SER A 1 23  ? -19.694 5.142   7.807   1.00 0.82  ? 1530 SER A HB3  1  
ATOM 339   H HG   . SER A 1 23  ? -21.296 4.611   5.659   1.00 0.91  ? 1530 SER A HG   1  
ATOM 340   N N    . SER A 1 24  ? -19.932 1.220   8.072   1.00 0.58  ? 1531 SER A N    1  
ATOM 341   C CA   . SER A 1 24  ? -20.018 0.203   9.071   1.00 0.65  ? 1531 SER A CA   1  
ATOM 342   C C    . SER A 1 24  ? -18.637 -0.491  9.253   1.00 0.61  ? 1531 SER A C    1  
ATOM 343   O O    . SER A 1 24  ? -18.385 -1.136  10.265  1.00 0.71  ? 1531 SER A O    1  
ATOM 344   C CB   . SER A 1 24  ? -21.095 -0.802  8.657   1.00 0.73  ? 1531 SER A CB   1  
ATOM 345   O OG   . SER A 1 24  ? -22.344 -0.143  8.407   1.00 1.59  ? 1531 SER A OG   1  
ATOM 346   H H    . SER A 1 24  ? -20.432 1.104   7.235   1.00 0.60  ? 1531 SER A H    1  
ATOM 347   H HA   . SER A 1 24  ? -20.310 0.666   10.002  1.00 0.73  ? 1531 SER A HA   1  
ATOM 348   H HB2  . SER A 1 24  ? -20.783 -1.308  7.755   1.00 1.24  ? 1531 SER A HB2  1  
ATOM 349   H HB3  . SER A 1 24  ? -21.236 -1.526  9.446   1.00 1.07  ? 1531 SER A HB3  1  
ATOM 350   H HG   . SER A 1 24  ? -22.217 0.645   7.849   1.00 1.98  ? 1531 SER A HG   1  
ATOM 351   N N    . LEU A 1 25  ? -17.755 -0.339  8.268   1.00 0.54  ? 1532 LEU A N    1  
ATOM 352   C CA   . LEU A 1 25  ? -16.418 -0.907  8.331   1.00 0.56  ? 1532 LEU A CA   1  
ATOM 353   C C    . LEU A 1 25  ? -15.385 0.164   8.664   1.00 0.57  ? 1532 LEU A C    1  
ATOM 354   O O    . LEU A 1 25  ? -14.218 -0.148  8.882   1.00 0.61  ? 1532 LEU A O    1  
ATOM 355   C CB   . LEU A 1 25  ? -16.068 -1.561  6.997   1.00 0.56  ? 1532 LEU A CB   1  
ATOM 356   C CG   . LEU A 1 25  ? -16.989 -2.688  6.544   1.00 0.55  ? 1532 LEU A CG   1  
ATOM 357   C CD1  . LEU A 1 25  ? -16.623 -3.143  5.148   1.00 0.57  ? 1532 LEU A CD1  1  
ATOM 358   C CD2  . LEU A 1 25  ? -16.922 -3.856  7.512   1.00 0.65  ? 1532 LEU A CD2  1  
ATOM 359   H H    . LEU A 1 25  ? -17.984 0.158   7.451   1.00 0.54  ? 1532 LEU A H    1  
ATOM 360   H HA   . LEU A 1 25  ? -16.392 -1.656  9.106   1.00 0.61  ? 1532 LEU A HA   1  
ATOM 361   H HB2  . LEU A 1 25  ? -16.075 -0.795  6.235   1.00 0.55  ? 1532 LEU A HB2  1  
ATOM 362   H HB3  . LEU A 1 25  ? -15.065 -1.956  7.071   1.00 0.62  ? 1532 LEU A HB3  1  
ATOM 363   H HG   . LEU A 1 25  ? -18.001 -2.307  6.538   1.00 0.55  ? 1532 LEU A HG   1  
ATOM 364   H HD11 . LEU A 1 25  ? -15.602 -3.497  5.141   1.00 1.19  ? 1532 LEU A HD11 1  
ATOM 365   H HD12 . LEU A 1 25  ? -16.723 -2.308  4.470   1.00 1.08  ? 1532 LEU A HD12 1  
ATOM 366   H HD13 . LEU A 1 25  ? -17.285 -3.939  4.843   1.00 1.24  ? 1532 LEU A HD13 1  
ATOM 367   H HD21 . LEU A 1 25  ? -17.336 -3.565  8.465   1.00 1.34  ? 1532 LEU A HD21 1  
ATOM 368   H HD22 . LEU A 1 25  ? -15.886 -4.129  7.649   1.00 1.14  ? 1532 LEU A HD22 1  
ATOM 369   H HD23 . LEU A 1 25  ? -17.462 -4.703  7.117   1.00 1.16  ? 1532 LEU A HD23 1  
ATOM 370   N N    . SER A 1 26  ? -15.824 1.415   8.701   1.00 0.58  ? 1533 SER A N    1  
ATOM 371   C CA   . SER A 1 26  ? -14.953 2.548   8.997   1.00 0.62  ? 1533 SER A CA   1  
ATOM 372   C C    . SER A 1 26  ? -14.338 2.425   10.386  1.00 0.68  ? 1533 SER A C    1  
ATOM 373   O O    . SER A 1 26  ? -14.820 1.656   11.231  1.00 0.75  ? 1533 SER A O    1  
ATOM 374   C CB   . SER A 1 26  ? -15.736 3.857   8.909   1.00 0.68  ? 1533 SER A CB   1  
ATOM 375   O OG   . SER A 1 26  ? -16.357 4.004   7.645   1.00 1.52  ? 1533 SER A OG   1  
ATOM 376   H H    . SER A 1 26  ? -16.766 1.600   8.518   1.00 0.59  ? 1533 SER A H    1  
ATOM 377   H HA   . SER A 1 26  ? -14.164 2.570   8.261   1.00 0.65  ? 1533 SER A HA   1  
ATOM 378   H HB2  . SER A 1 26  ? -16.486 3.877   9.685   1.00 1.19  ? 1533 SER A HB2  1  
ATOM 379   H HB3  . SER A 1 26  ? -15.054 4.681   9.059   1.00 1.19  ? 1533 SER A HB3  1  
ATOM 380   H HG   . SER A 1 26  ? -16.722 4.898   7.609   1.00 1.93  ? 1533 SER A HG   1  
ATOM 381   N N    . GLY A 1 27  ? -13.298 3.163   10.625  1.00 0.76  ? 1534 GLY A N    1  
ATOM 382   C CA   . GLY A 1 27  ? -12.664 3.129   11.902  1.00 0.89  ? 1534 GLY A CA   1  
ATOM 383   C C    . GLY A 1 27  ? -11.371 3.878   11.881  1.00 0.95  ? 1534 GLY A C    1  
ATOM 384   O O    . GLY A 1 27  ? -10.731 3.977   10.833  1.00 1.10  ? 1534 GLY A O    1  
ATOM 385   H H    . GLY A 1 27  ? -12.935 3.755   9.932   1.00 0.79  ? 1534 GLY A H    1  
ATOM 386   H HA2  . GLY A 1 27  ? -13.320 3.618   12.616  1.00 0.92  ? 1534 GLY A HA2  1  
ATOM 387   H HA3  . GLY A 1 27  ? -12.462 2.091   12.152  1.00 1.07  ? 1534 GLY A HA3  1  
ATOM 388   N N    . ARG A 1 28  ? -10.998 4.406   13.018  1.00 1.07  ? 1535 ARG A N    1  
ATOM 389   C CA   . ARG A 1 28  ? -9.776  5.176   13.168  1.00 1.36  ? 1535 ARG A CA   1  
ATOM 390   C C    . ARG A 1 28  ? -8.582  4.272   13.478  1.00 1.25  ? 1535 ARG A C    1  
ATOM 391   O O    . ARG A 1 28  ? -7.428  4.579   13.113  1.00 1.46  ? 1535 ARG A O    1  
ATOM 392   C CB   . ARG A 1 28  ? -9.973  6.225   14.256  1.00 1.78  ? 1535 ARG A CB   1  
ATOM 393   C CG   . ARG A 1 28  ? -8.755  7.056   14.565  1.00 2.21  ? 1535 ARG A CG   1  
ATOM 394   C CD   . ARG A 1 28  ? -9.110  8.165   15.515  1.00 2.72  ? 1535 ARG A CD   1  
ATOM 395   N NE   . ARG A 1 28  ? -7.956  8.969   15.894  1.00 3.19  ? 1535 ARG A NE   1  
ATOM 396   C CZ   . ARG A 1 28  ? -7.757  10.232  15.511  1.00 3.82  ? 1535 ARG A CZ   1  
ATOM 397   N NH1  . ARG A 1 28  ? -8.440  10.737  14.477  1.00 4.05  ? 1535 ARG A NH1  1  
ATOM 398   N NH2  . ARG A 1 28  ? -6.808  10.952  16.094  1.00 4.62  ? 1535 ARG A NH2  1  
ATOM 399   H H    . ARG A 1 28  ? -11.592 4.286   13.793  1.00 1.11  ? 1535 ARG A H    1  
ATOM 400   H HA   . ARG A 1 28  ? -9.590  5.683   12.232  1.00 1.48  ? 1535 ARG A HA   1  
ATOM 401   H HB2  . ARG A 1 28  ? -10.762 6.895   13.950  1.00 1.87  ? 1535 ARG A HB2  1  
ATOM 402   H HB3  . ARG A 1 28  ? -10.280 5.725   15.164  1.00 1.80  ? 1535 ARG A HB3  1  
ATOM 403   H HG2  . ARG A 1 28  ? -8.003  6.423   15.014  1.00 2.48  ? 1535 ARG A HG2  1  
ATOM 404   H HG3  . ARG A 1 28  ? -8.375  7.482   13.647  1.00 2.35  ? 1535 ARG A HG3  1  
ATOM 405   H HD2  . ARG A 1 28  ? -9.836  8.808   15.039  1.00 3.08  ? 1535 ARG A HD2  1  
ATOM 406   H HD3  . ARG A 1 28  ? -9.545  7.735   16.405  1.00 3.09  ? 1535 ARG A HD3  1  
ATOM 407   H HE   . ARG A 1 28  ? -7.358  8.521   16.547  1.00 3.43  ? 1535 ARG A HE   1  
ATOM 408   H HH11 . ARG A 1 28  ? -9.105  10.190  13.950  1.00 3.88  ? 1535 ARG A HH11 1  
ATOM 409   H HH12 . ARG A 1 28  ? -8.328  11.694  14.178  1.00 4.70  ? 1535 ARG A HH12 1  
ATOM 410   H HH21 . ARG A 1 28  ? -6.222  10.573  16.822  1.00 4.90  ? 1535 ARG A HH21 1  
ATOM 411   H HH22 . ARG A 1 28  ? -6.623  11.917  15.861  1.00 5.21  ? 1535 ARG A HH22 1  
ATOM 412   N N    . ALA A 1 29  ? -8.842  3.171   14.156  1.00 1.08  ? 1536 ALA A N    1  
ATOM 413   C CA   . ALA A 1 29  ? -7.794  2.220   14.449  1.00 1.24  ? 1536 ALA A CA   1  
ATOM 414   C C    . ALA A 1 29  ? -7.528  1.397   13.214  1.00 1.01  ? 1536 ALA A C    1  
ATOM 415   O O    . ALA A 1 29  ? -6.389  1.008   12.924  1.00 1.27  ? 1536 ALA A O    1  
ATOM 416   C CB   . ALA A 1 29  ? -8.161  1.335   15.621  1.00 1.45  ? 1536 ALA A CB   1  
ATOM 417   H H    . ALA A 1 29  ? -9.760  2.989   14.462  1.00 1.01  ? 1536 ALA A H    1  
ATOM 418   H HA   . ALA A 1 29  ? -6.903  2.780   14.690  1.00 1.60  ? 1536 ALA A HA   1  
ATOM 419   H HB1  . ALA A 1 29  ? -9.051  0.773   15.381  1.00 1.84  ? 1536 ALA A HB1  1  
ATOM 420   H HB2  . ALA A 1 29  ? -8.343  1.946   16.493  1.00 1.94  ? 1536 ALA A HB2  1  
ATOM 421   H HB3  . ALA A 1 29  ? -7.350  0.652   15.825  1.00 1.68  ? 1536 ALA A HB3  1  
ATOM 422   N N    . GLY A 1 30  ? -8.596  1.128   12.497  1.00 0.74  ? 1537 GLY A N    1  
ATOM 423   C CA   . GLY A 1 30  ? -8.524  0.481   11.247  1.00 0.84  ? 1537 GLY A CA   1  
ATOM 424   C C    . GLY A 1 30  ? -8.385  -0.990  11.381  1.00 0.72  ? 1537 GLY A C    1  
ATOM 425   O O    . GLY A 1 30  ? -9.011  -1.613  12.251  1.00 0.85  ? 1537 GLY A O    1  
ATOM 426   H H    . GLY A 1 30  ? -9.494  1.318   12.860  1.00 0.70  ? 1537 GLY A H    1  
ATOM 427   H HA2  . GLY A 1 30  ? -9.422  0.700   10.687  1.00 1.02  ? 1537 GLY A HA2  1  
ATOM 428   H HA3  . GLY A 1 30  ? -7.672  0.865   10.705  1.00 1.08  ? 1537 GLY A HA3  1  
ATOM 429   N N    . PHE A 1 31  ? -7.571  -1.540  10.540  1.00 0.52  ? 1538 PHE A N    1  
ATOM 430   C CA   . PHE A 1 31  ? -7.291  -2.941  10.482  1.00 0.49  ? 1538 PHE A CA   1  
ATOM 431   C C    . PHE A 1 31  ? -5.825  -3.070  10.169  1.00 0.46  ? 1538 PHE A C    1  
ATOM 432   O O    . PHE A 1 31  ? -5.274  -2.230  9.443   1.00 0.43  ? 1538 PHE A O    1  
ATOM 433   C CB   . PHE A 1 31  ? -8.136  -3.630  9.379   1.00 0.54  ? 1538 PHE A CB   1  
ATOM 434   C CG   . PHE A 1 31  ? -9.634  -3.580  9.611   1.00 0.65  ? 1538 PHE A CG   1  
ATOM 435   C CD1  . PHE A 1 31  ? -10.402 -2.505  9.162   1.00 0.68  ? 1538 PHE A CD1  1  
ATOM 436   C CD2  . PHE A 1 31  ? -10.270 -4.601  10.294  1.00 0.80  ? 1538 PHE A CD2  1  
ATOM 437   C CE1  . PHE A 1 31  ? -11.754 -2.458  9.394   1.00 0.82  ? 1538 PHE A CE1  1  
ATOM 438   C CE2  . PHE A 1 31  ? -11.629 -4.557  10.522  1.00 0.93  ? 1538 PHE A CE2  1  
ATOM 439   C CZ   . PHE A 1 31  ? -12.370 -3.484  10.073  1.00 0.93  ? 1538 PHE A CZ   1  
ATOM 440   H H    . PHE A 1 31  ? -7.088  -0.967  9.902   1.00 0.45  ? 1538 PHE A H    1  
ATOM 441   H HA   . PHE A 1 31  ? -7.505  -3.385  11.443  1.00 0.52  ? 1538 PHE A HA   1  
ATOM 442   H HB2  . PHE A 1 31  ? -7.929  -3.150  8.434   1.00 0.55  ? 1538 PHE A HB2  1  
ATOM 443   H HB3  . PHE A 1 31  ? -7.840  -4.666  9.314   1.00 0.56  ? 1538 PHE A HB3  1  
ATOM 444   H HD1  . PHE A 1 31  ? -9.946  -1.688  8.624   1.00 0.66  ? 1538 PHE A HD1  1  
ATOM 445   H HD2  . PHE A 1 31  ? -9.692  -5.443  10.648  1.00 0.85  ? 1538 PHE A HD2  1  
ATOM 446   H HE1  . PHE A 1 31  ? -12.328 -1.612  9.044   1.00 0.88  ? 1538 PHE A HE1  1  
ATOM 447   H HE2  . PHE A 1 31  ? -12.112 -5.361  11.056  1.00 1.07  ? 1538 PHE A HE2  1  
ATOM 448   H HZ   . PHE A 1 31  ? -13.434 -3.447  10.257  1.00 1.05  ? 1538 PHE A HZ   1  
ATOM 449   N N    . THR A 1 32  ? -5.185  -4.039  10.741  1.00 0.50  ? 1539 THR A N    1  
ATOM 450   C CA   . THR A 1 32  ? -3.789  -4.247  10.506  1.00 0.50  ? 1539 THR A CA   1  
ATOM 451   C C    . THR A 1 32  ? -3.615  -5.504  9.653   1.00 0.51  ? 1539 THR A C    1  
ATOM 452   O O    . THR A 1 32  ? -4.198  -6.557  9.949   1.00 0.64  ? 1539 THR A O    1  
ATOM 453   C CB   . THR A 1 32  ? -3.046  -4.424  11.841  1.00 0.58  ? 1539 THR A CB   1  
ATOM 454   O OG1  . THR A 1 32  ? -3.682  -3.606  12.844  1.00 1.03  ? 1539 THR A OG1  1  
ATOM 455   C CG2  . THR A 1 32  ? -1.604  -3.957  11.712  1.00 0.78  ? 1539 THR A CG2  1  
ATOM 456   H H    . THR A 1 32  ? -5.670  -4.653  11.340  1.00 0.56  ? 1539 THR A H    1  
ATOM 457   H HA   . THR A 1 32  ? -3.391  -3.392  9.983   1.00 0.46  ? 1539 THR A HA   1  
ATOM 458   H HB   . THR A 1 32  ? -3.053  -5.473  12.098  1.00 0.77  ? 1539 THR A HB   1  
ATOM 459   H HG1  . THR A 1 32  ? -4.405  -3.127  12.410  1.00 1.46  ? 1539 THR A HG1  1  
ATOM 460   H HG21 . THR A 1 32  ? -1.085  -4.557  10.980  1.00 1.42  ? 1539 THR A HG21 1  
ATOM 461   H HG22 . THR A 1 32  ? -1.119  -4.039  12.673  1.00 1.32  ? 1539 THR A HG22 1  
ATOM 462   H HG23 . THR A 1 32  ? -1.583  -2.921  11.411  1.00 1.30  ? 1539 THR A HG23 1  
ATOM 463   N N    . ALA A 1 33  ? -2.855  -5.391  8.605   1.00 0.44  ? 1540 ALA A N    1  
ATOM 464   C CA   . ALA A 1 33  ? -2.604  -6.507  7.721   1.00 0.47  ? 1540 ALA A CA   1  
ATOM 465   C C    . ALA A 1 33  ? -1.114  -6.714  7.602   1.00 0.50  ? 1540 ALA A C    1  
ATOM 466   O O    . ALA A 1 33  ? -0.345  -5.747  7.674   1.00 0.49  ? 1540 ALA A O    1  
ATOM 467   C CB   . ALA A 1 33  ? -3.227  -6.260  6.353   1.00 0.46  ? 1540 ALA A CB   1  
ATOM 468   H H    . ALA A 1 33  ? -2.424  -4.526  8.424   1.00 0.41  ? 1540 ALA A H    1  
ATOM 469   H HA   . ALA A 1 33  ? -3.050  -7.390  8.158   1.00 0.53  ? 1540 ALA A HA   1  
ATOM 470   H HB1  . ALA A 1 33  ? -3.047  -7.114  5.717   1.00 1.12  ? 1540 ALA A HB1  1  
ATOM 471   H HB2  . ALA A 1 33  ? -2.786  -5.379  5.910   1.00 1.02  ? 1540 ALA A HB2  1  
ATOM 472   H HB3  . ALA A 1 33  ? -4.291  -6.113  6.462   1.00 1.19  ? 1540 ALA A HB3  1  
ATOM 473   N N    . ALA A 1 34  ? -0.703  -7.944  7.439   1.00 0.57  ? 1541 ALA A N    1  
ATOM 474   C CA   . ALA A 1 34  ? 0.703   -8.271  7.356   1.00 0.63  ? 1541 ALA A CA   1  
ATOM 475   C C    . ALA A 1 34  ? 1.162   -8.245  5.914   1.00 0.63  ? 1541 ALA A C    1  
ATOM 476   O O    . ALA A 1 34  ? 0.550   -8.867  5.047   1.00 0.70  ? 1541 ALA A O    1  
ATOM 477   C CB   . ALA A 1 34  ? 0.956   -9.638  7.970   1.00 0.74  ? 1541 ALA A CB   1  
ATOM 478   H H    . ALA A 1 34  ? -1.369  -8.660  7.346   1.00 0.61  ? 1541 ALA A H    1  
ATOM 479   H HA   . ALA A 1 34  ? 1.255   -7.535  7.921   1.00 0.64  ? 1541 ALA A HA   1  
ATOM 480   H HB1  . ALA A 1 34  ? 0.618   -9.640  8.996   1.00 1.37  ? 1541 ALA A HB1  1  
ATOM 481   H HB2  . ALA A 1 34  ? 2.014   -9.856  7.942   1.00 1.19  ? 1541 ALA A HB2  1  
ATOM 482   H HB3  . ALA A 1 34  ? 0.419   -10.390 7.412   1.00 1.25  ? 1541 ALA A HB3  1  
ATOM 483   N N    . TYR A 1 35  ? 2.217   -7.524  5.655   1.00 0.66  ? 1542 TYR A N    1  
ATOM 484   C CA   . TYR A 1 35  ? 2.755   -7.419  4.324   1.00 0.71  ? 1542 TYR A CA   1  
ATOM 485   C C    . TYR A 1 35  ? 4.109   -8.094  4.312   1.00 0.84  ? 1542 TYR A C    1  
ATOM 486   O O    . TYR A 1 35  ? 4.201   -9.324  4.191   1.00 0.96  ? 1542 TYR A O    1  
ATOM 487   C CB   . TYR A 1 35  ? 2.836   -5.968  3.805   1.00 0.68  ? 1542 TYR A CB   1  
ATOM 488   C CG   . TYR A 1 35  ? 2.830   -5.849  2.276   1.00 0.63  ? 1542 TYR A CG   1  
ATOM 489   C CD1  . TYR A 1 35  ? 3.859   -6.367  1.472   1.00 0.99  ? 1542 TYR A CD1  1  
ATOM 490   C CD2  . TYR A 1 35  ? 1.784   -5.205  1.640   1.00 0.62  ? 1542 TYR A CD2  1  
ATOM 491   C CE1  . TYR A 1 35  ? 3.824   -6.239  0.097   1.00 0.97  ? 1542 TYR A CE1  1  
ATOM 492   C CE2  . TYR A 1 35  ? 1.751   -5.076  0.264   1.00 0.66  ? 1542 TYR A CE2  1  
ATOM 493   C CZ   . TYR A 1 35  ? 2.768   -5.594  -0.499  1.00 0.63  ? 1542 TYR A CZ   1  
ATOM 494   O OH   . TYR A 1 35  ? 2.729   -5.468  -1.864  1.00 0.71  ? 1542 TYR A OH   1  
ATOM 495   H H    . TYR A 1 35  ? 2.683   -7.070  6.388   1.00 0.71  ? 1542 TYR A H    1  
ATOM 496   H HA   . TYR A 1 35  ? 2.102   -7.999  3.686   1.00 0.75  ? 1542 TYR A HA   1  
ATOM 497   H HB2  . TYR A 1 35  ? 1.994   -5.410  4.184   1.00 0.74  ? 1542 TYR A HB2  1  
ATOM 498   H HB3  . TYR A 1 35  ? 3.750   -5.521  4.168   1.00 0.74  ? 1542 TYR A HB3  1  
ATOM 499   H HD1  . TYR A 1 35  ? 4.694   -6.883  1.920   1.00 1.38  ? 1542 TYR A HD1  1  
ATOM 500   H HD2  . TYR A 1 35  ? 0.990   -4.800  2.250   1.00 0.88  ? 1542 TYR A HD2  1  
ATOM 501   H HE1  . TYR A 1 35  ? 4.622   -6.642  -0.512  1.00 1.33  ? 1542 TYR A HE1  1  
ATOM 502   H HE2  . TYR A 1 35  ? 0.927   -4.575  -0.222  1.00 0.96  ? 1542 TYR A HE2  1  
ATOM 503   H HH   . TYR A 1 35  ? 2.977   -6.322  -2.246  1.00 1.19  ? 1542 TYR A HH   1  
ATOM 504   N N    . SER A 1 36  ? 5.148   -7.302  4.406   1.00 0.90  ? 1543 SER A N    1  
ATOM 505   C CA   . SER A 1 36  ? 6.486   -7.793  4.450   1.00 1.10  ? 1543 SER A CA   1  
ATOM 506   C C    . SER A 1 36  ? 6.697   -8.498  5.791   1.00 1.18  ? 1543 SER A C    1  
ATOM 507   O O    . SER A 1 36  ? 5.924   -8.234  6.729   1.00 1.13  ? 1543 SER A O    1  
ATOM 508   C CB   . SER A 1 36  ? 7.414   -6.603  4.335   1.00 1.19  ? 1543 SER A CB   1  
ATOM 509   O OG   . SER A 1 36  ? 6.949   -5.739  3.312   1.00 1.91  ? 1543 SER A OG   1  
ATOM 510   H H    . SER A 1 36  ? 5.047   -6.330  4.475   1.00 0.88  ? 1543 SER A H    1  
ATOM 511   H HA   . SER A 1 36  ? 6.650   -8.461  3.618   1.00 1.20  ? 1543 SER A HA   1  
ATOM 512   H HB2  . SER A 1 36  ? 7.437   -6.068  5.273   1.00 1.38  ? 1543 SER A HB2  1  
ATOM 513   H HB3  . SER A 1 36  ? 8.407   -6.940  4.078   1.00 1.60  ? 1543 SER A HB3  1  
ATOM 514   H HG   . SER A 1 36  ? 7.451   -5.952  2.512   1.00 1.98  ? 1543 SER A HG   1  
ATOM 515   N N    . LYS A 1 37  ? 7.685   -9.378  5.905   1.00 1.37  ? 1544 LYS A N    1  
ATOM 516   C CA   . LYS A 1 37  ? 7.889   -10.124 7.160   1.00 1.50  ? 1544 LYS A CA   1  
ATOM 517   C C    . LYS A 1 37  ? 7.932   -9.221  8.403   1.00 1.51  ? 1544 LYS A C    1  
ATOM 518   O O    . LYS A 1 37  ? 7.290   -9.515  9.410   1.00 1.71  ? 1544 LYS A O    1  
ATOM 519   C CB   . LYS A 1 37  ? 9.118   -11.045 7.110   1.00 1.70  ? 1544 LYS A CB   1  
ATOM 520   C CG   . LYS A 1 37  ? 8.988   -12.204 6.147   1.00 2.05  ? 1544 LYS A CG   1  
ATOM 521   C CD   . LYS A 1 37  ? 10.166  -13.145 6.281   1.00 2.36  ? 1544 LYS A CD   1  
ATOM 522   C CE   . LYS A 1 37  ? 10.013  -14.355 5.385   1.00 2.99  ? 1544 LYS A CE   1  
ATOM 523   N NZ   . LYS A 1 37  ? 11.130  -15.302 5.551   1.00 3.59  ? 1544 LYS A NZ   1  
ATOM 524   H H    . LYS A 1 37  ? 8.264   -9.548  5.126   1.00 1.46  ? 1544 LYS A H    1  
ATOM 525   H HA   . LYS A 1 37  ? 7.009   -10.743 7.268   1.00 1.56  ? 1544 LYS A HA   1  
ATOM 526   H HB2  . LYS A 1 37  ? 9.993   -10.485 6.813   1.00 1.89  ? 1544 LYS A HB2  1  
ATOM 527   H HB3  . LYS A 1 37  ? 9.285   -11.456 8.095   1.00 2.12  ? 1544 LYS A HB3  1  
ATOM 528   H HG2  . LYS A 1 37  ? 8.078   -12.743 6.366   1.00 2.58  ? 1544 LYS A HG2  1  
ATOM 529   H HG3  . LYS A 1 37  ? 8.951   -11.824 5.136   1.00 2.43  ? 1544 LYS A HG3  1  
ATOM 530   H HD2  . LYS A 1 37  ? 11.070  -12.620 6.009   1.00 2.45  ? 1544 LYS A HD2  1  
ATOM 531   H HD3  . LYS A 1 37  ? 10.233  -13.473 7.308   1.00 2.83  ? 1544 LYS A HD3  1  
ATOM 532   H HE2  . LYS A 1 37  ? 9.089   -14.856 5.633   1.00 3.22  ? 1544 LYS A HE2  1  
ATOM 533   H HE3  . LYS A 1 37  ? 9.978   -14.026 4.356   1.00 3.43  ? 1544 LYS A HE3  1  
ATOM 534   H HZ1  . LYS A 1 37  ? 11.143  -15.680 6.524   1.00 3.96  ? 1544 LYS A HZ1  1  
ATOM 535   H HZ2  . LYS A 1 37  ? 12.049  -14.837 5.390   1.00 3.94  ? 1544 LYS A HZ2  1  
ATOM 536   H HZ3  . LYS A 1 37  ? 11.073  -16.102 4.886   1.00 3.91  ? 1544 LYS A HZ3  1  
ATOM 537   N N    . SER A 1 38  ? 8.615   -8.104  8.304   1.00 1.42  ? 1545 SER A N    1  
ATOM 538   C CA   . SER A 1 38  ? 8.768   -7.214  9.395   1.00 1.49  ? 1545 SER A CA   1  
ATOM 539   C C    . SER A 1 38  ? 7.911   -5.947  9.214   1.00 1.28  ? 1545 SER A C    1  
ATOM 540   O O    . SER A 1 38  ? 8.261   -4.876  9.725   1.00 1.37  ? 1545 SER A O    1  
ATOM 541   C CB   . SER A 1 38  ? 10.231  -6.851  9.459   1.00 1.81  ? 1545 SER A CB   1  
ATOM 542   O OG   . SER A 1 38  ? 11.035  -8.025  9.519   1.00 2.46  ? 1545 SER A OG   1  
ATOM 543   H H    . SER A 1 38  ? 9.074   -7.830  7.488   1.00 1.41  ? 1545 SER A H    1  
ATOM 544   H HA   . SER A 1 38  ? 8.508   -7.716  10.314  1.00 1.69  ? 1545 SER A HA   1  
ATOM 545   H HB2  . SER A 1 38  ? 10.502  -6.273  8.587   1.00 2.07  ? 1545 SER A HB2  1  
ATOM 546   H HB3  . SER A 1 38  ? 10.391  -6.270  10.347  1.00 1.97  ? 1545 SER A HB3  1  
ATOM 547   H HG   . SER A 1 38  ? 10.987  -8.329  10.440  1.00 2.81  ? 1545 SER A HG   1  
ATOM 548   N N    . GLY A 1 39  ? 6.800   -6.060  8.504   1.00 1.20  ? 1546 GLY A N    1  
ATOM 549   C CA   . GLY A 1 39  ? 5.989   -4.889  8.264   1.00 1.26  ? 1546 GLY A CA   1  
ATOM 550   C C    . GLY A 1 39  ? 4.504   -5.165  8.257   1.00 0.99  ? 1546 GLY A C    1  
ATOM 551   O O    . GLY A 1 39  ? 4.058   -6.265  7.881   1.00 1.08  ? 1546 GLY A O    1  
ATOM 552   H H    . GLY A 1 39  ? 6.513   -6.932  8.148   1.00 1.22  ? 1546 GLY A H    1  
ATOM 553   H HA2  . GLY A 1 39  ? 6.197   -4.162  9.034   1.00 1.36  ? 1546 GLY A HA2  1  
ATOM 554   H HA3  . GLY A 1 39  ? 6.269   -4.465  7.310   1.00 1.68  ? 1546 GLY A HA3  1  
ATOM 555   N N    . VAL A 1 40  ? 3.740   -4.177  8.669   1.00 0.79  ? 1547 VAL A N    1  
ATOM 556   C CA   . VAL A 1 40  ? 2.295   -4.248  8.683   1.00 0.57  ? 1547 VAL A CA   1  
ATOM 557   C C    . VAL A 1 40  ? 1.750   -3.013  8.030   1.00 0.49  ? 1547 VAL A C    1  
ATOM 558   O O    . VAL A 1 40  ? 2.411   -1.966  8.033   1.00 0.56  ? 1547 VAL A O    1  
ATOM 559   C CB   . VAL A 1 40  ? 1.690   -4.367  10.118  1.00 0.57  ? 1547 VAL A CB   1  
ATOM 560   C CG1  . VAL A 1 40  ? 2.034   -5.692  10.754  1.00 0.64  ? 1547 VAL A CG1  1  
ATOM 561   C CG2  . VAL A 1 40  ? 2.131   -3.209  11.014  1.00 0.73  ? 1547 VAL A CG2  1  
ATOM 562   H H    . VAL A 1 40  ? 4.136   -3.322  8.948   1.00 0.89  ? 1547 VAL A H    1  
ATOM 563   H HA   . VAL A 1 40  ? 1.994   -5.105  8.100   1.00 0.61  ? 1547 VAL A HA   1  
ATOM 564   H HB   . VAL A 1 40  ? 0.616   -4.325  10.020  1.00 0.54  ? 1547 VAL A HB   1  
ATOM 565   H HG11 . VAL A 1 40  ? 1.567   -5.741  11.727  1.00 1.12  ? 1547 VAL A HG11 1  
ATOM 566   H HG12 . VAL A 1 40  ? 3.106   -5.781  10.859  1.00 1.08  ? 1547 VAL A HG12 1  
ATOM 567   H HG13 . VAL A 1 40  ? 1.657   -6.495  10.138  1.00 1.31  ? 1547 VAL A HG13 1  
ATOM 568   H HG21 . VAL A 1 40  ? 1.795   -2.280  10.575  1.00 1.24  ? 1547 VAL A HG21 1  
ATOM 569   H HG22 . VAL A 1 40  ? 3.208   -3.204  11.099  1.00 1.22  ? 1547 VAL A HG22 1  
ATOM 570   H HG23 . VAL A 1 40  ? 1.687   -3.326  11.991  1.00 1.38  ? 1547 VAL A HG23 1  
ATOM 571   N N    . VAL A 1 41  ? 0.598   -3.120  7.458   1.00 0.42  ? 1548 VAL A N    1  
ATOM 572   C CA   . VAL A 1 41  ? -0.010  -1.994  6.835   1.00 0.37  ? 1548 VAL A CA   1  
ATOM 573   C C    . VAL A 1 41  ? -1.199  -1.536  7.670   1.00 0.32  ? 1548 VAL A C    1  
ATOM 574   O O    . VAL A 1 41  ? -1.974  -2.361  8.186   1.00 0.35  ? 1548 VAL A O    1  
ATOM 575   C CB   . VAL A 1 41  ? -0.420  -2.284  5.350   1.00 0.40  ? 1548 VAL A CB   1  
ATOM 576   C CG1  . VAL A 1 41  ? -1.547  -3.295  5.224   1.00 0.58  ? 1548 VAL A CG1  1  
ATOM 577   C CG2  . VAL A 1 41  ? -0.725  -1.001  4.588   1.00 0.57  ? 1548 VAL A CG2  1  
ATOM 578   H H    . VAL A 1 41  ? 0.128   -3.985  7.465   1.00 0.46  ? 1548 VAL A H    1  
ATOM 579   H HA   . VAL A 1 41  ? 0.727   -1.203  6.843   1.00 0.38  ? 1548 VAL A HA   1  
ATOM 580   H HB   . VAL A 1 41  ? 0.440   -2.744  4.887   1.00 0.69  ? 1548 VAL A HB   1  
ATOM 581   H HG11 . VAL A 1 41  ? -2.414  -2.925  5.751   1.00 1.21  ? 1548 VAL A HG11 1  
ATOM 582   H HG12 . VAL A 1 41  ? -1.237  -4.236  5.653   1.00 1.21  ? 1548 VAL A HG12 1  
ATOM 583   H HG13 . VAL A 1 41  ? -1.792  -3.433  4.181   1.00 1.23  ? 1548 VAL A HG13 1  
ATOM 584   H HG21 . VAL A 1 41  ? -1.039  -1.246  3.585   1.00 1.17  ? 1548 VAL A HG21 1  
ATOM 585   H HG22 . VAL A 1 41  ? 0.185   -0.417  4.545   1.00 1.24  ? 1548 VAL A HG22 1  
ATOM 586   H HG23 . VAL A 1 41  ? -1.493  -0.439  5.098   1.00 1.17  ? 1548 VAL A HG23 1  
ATOM 587   N N    . TYR A 1 42  ? -1.279  -0.253  7.866   1.00 0.31  ? 1549 TYR A N    1  
ATOM 588   C CA   . TYR A 1 42  ? -2.364  0.364   8.557   1.00 0.31  ? 1549 TYR A CA   1  
ATOM 589   C C    . TYR A 1 42  ? -3.357  0.777   7.533   1.00 0.29  ? 1549 TYR A C    1  
ATOM 590   O O    . TYR A 1 42  ? -2.985  1.364   6.507   1.00 0.37  ? 1549 TYR A O    1  
ATOM 591   C CB   . TYR A 1 42  ? -1.921  1.617   9.311   1.00 0.40  ? 1549 TYR A CB   1  
ATOM 592   C CG   . TYR A 1 42  ? -0.825  1.426   10.321  1.00 0.53  ? 1549 TYR A CG   1  
ATOM 593   C CD1  . TYR A 1 42  ? -0.999  0.620   11.438  1.00 0.59  ? 1549 TYR A CD1  1  
ATOM 594   C CD2  . TYR A 1 42  ? 0.374   2.096   10.176  1.00 0.70  ? 1549 TYR A CD2  1  
ATOM 595   C CE1  . TYR A 1 42  ? 0.010   0.493   12.387  1.00 0.76  ? 1549 TYR A CE1  1  
ATOM 596   C CE2  . TYR A 1 42  ? 1.377   1.970   11.101  1.00 0.87  ? 1549 TYR A CE2  1  
ATOM 597   C CZ   . TYR A 1 42  ? 1.200   1.175   12.204  1.00 0.88  ? 1549 TYR A CZ   1  
ATOM 598   O OH   . TYR A 1 42  ? 2.210   1.090   13.145  1.00 1.08  ? 1549 TYR A OH   1  
ATOM 599   H H    . TYR A 1 42  ? -0.576  0.328   7.494   1.00 0.32  ? 1549 TYR A H    1  
ATOM 600   H HA   . TYR A 1 42  ? -2.827  -0.325  9.243   1.00 0.34  ? 1549 TYR A HA   1  
ATOM 601   H HB2  . TYR A 1 42  ? -1.560  2.338   8.593   1.00 0.46  ? 1549 TYR A HB2  1  
ATOM 602   H HB3  . TYR A 1 42  ? -2.777  2.034   9.819   1.00 0.39  ? 1549 TYR A HB3  1  
ATOM 603   H HD1  . TYR A 1 42  ? -1.940  0.100   11.556  1.00 0.57  ? 1549 TYR A HD1  1  
ATOM 604   H HD2  . TYR A 1 42  ? 0.515   2.723   9.308   1.00 0.77  ? 1549 TYR A HD2  1  
ATOM 605   H HE1  . TYR A 1 42  ? -0.130  -0.139  13.251  1.00 0.86  ? 1549 TYR A HE1  1  
ATOM 606   H HE2  . TYR A 1 42  ? 2.310   2.495   10.960  1.00 1.03  ? 1549 TYR A HE2  1  
ATOM 607   H HH   . TYR A 1 42  ? 2.266   0.176   13.473  1.00 1.29  ? 1549 TYR A HH   1  
ATOM 608   N N    . MET A 1 43  ? -4.581  0.490   7.786   1.00 0.26  ? 1550 MET A N    1  
ATOM 609   C CA   . MET A 1 43  ? -5.625  0.847   6.870   1.00 0.25  ? 1550 MET A CA   1  
ATOM 610   C C    . MET A 1 43  ? -6.883  1.133   7.622   1.00 0.29  ? 1550 MET A C    1  
ATOM 611   O O    . MET A 1 43  ? -7.289  0.367   8.489   1.00 0.40  ? 1550 MET A O    1  
ATOM 612   C CB   . MET A 1 43  ? -5.858  -0.221  5.772   1.00 0.32  ? 1550 MET A CB   1  
ATOM 613   C CG   . MET A 1 43  ? -6.391  -1.576  6.239   1.00 0.35  ? 1550 MET A CG   1  
ATOM 614   S SD   . MET A 1 43  ? -6.624  -2.714  4.881   1.00 0.78  ? 1550 MET A SD   1  
ATOM 615   C CE   . MET A 1 43  ? -7.761  -1.799  3.863   1.00 0.62  ? 1550 MET A CE   1  
ATOM 616   H H    . MET A 1 43  ? -4.796  0.048   8.636   1.00 0.32  ? 1550 MET A H    1  
ATOM 617   H HA   . MET A 1 43  ? -5.322  1.768   6.397   1.00 0.24  ? 1550 MET A HA   1  
ATOM 618   H HB2  . MET A 1 43  ? -6.579  0.167   5.068   1.00 0.38  ? 1550 MET A HB2  1  
ATOM 619   H HB3  . MET A 1 43  ? -4.930  -0.390  5.250   1.00 0.35  ? 1550 MET A HB3  1  
ATOM 620   H HG2  . MET A 1 43  ? -5.704  -2.053  6.918   1.00 0.45  ? 1550 MET A HG2  1  
ATOM 621   H HG3  . MET A 1 43  ? -7.344  -1.433  6.726   1.00 0.48  ? 1550 MET A HG3  1  
ATOM 622   H HE1  . MET A 1 43  ? -8.006  -2.389  2.994   1.00 1.20  ? 1550 MET A HE1  1  
ATOM 623   H HE2  . MET A 1 43  ? -7.290  -0.875  3.561   1.00 1.14  ? 1550 MET A HE2  1  
ATOM 624   H HE3  . MET A 1 43  ? -8.656  -1.584  4.427   1.00 1.47  ? 1550 MET A HE3  1  
ATOM 625   N N    . SER A 1 44  ? -7.433  2.247   7.357   1.00 0.28  ? 1551 SER A N    1  
ATOM 626   C CA   . SER A 1 44  ? -8.664  2.663   7.935   1.00 0.31  ? 1551 SER A CA   1  
ATOM 627   C C    . SER A 1 44  ? -9.691  2.871   6.831   1.00 0.30  ? 1551 SER A C    1  
ATOM 628   O O    . SER A 1 44  ? -9.382  3.464   5.786   1.00 0.36  ? 1551 SER A O    1  
ATOM 629   C CB   . SER A 1 44  ? -8.403  3.930   8.717   1.00 0.34  ? 1551 SER A CB   1  
ATOM 630   O OG   . SER A 1 44  ? -7.556  4.783   7.968   1.00 0.97  ? 1551 SER A OG   1  
ATOM 631   H H    . SER A 1 44  ? -6.980  2.874   6.745   1.00 0.30  ? 1551 SER A H    1  
ATOM 632   H HA   . SER A 1 44  ? -9.007  1.894   8.610   1.00 0.34  ? 1551 SER A HA   1  
ATOM 633   H HB2  . SER A 1 44  ? -9.335  4.440   8.912   1.00 0.61  ? 1551 SER A HB2  1  
ATOM 634   H HB3  . SER A 1 44  ? -7.914  3.688   9.649   1.00 0.73  ? 1551 SER A HB3  1  
ATOM 635   H HG   . SER A 1 44  ? -8.104  5.448   7.526   1.00 1.40  ? 1551 SER A HG   1  
ATOM 636   N N    . ILE A 1 45  ? -10.885 2.367   7.034   1.00 0.30  ? 1552 ILE A N    1  
ATOM 637   C CA   . ILE A 1 45  ? -11.924 2.460   6.031   1.00 0.32  ? 1552 ILE A CA   1  
ATOM 638   C C    . ILE A 1 45  ? -12.603 3.823   6.125   1.00 0.36  ? 1552 ILE A C    1  
ATOM 639   O O    . ILE A 1 45  ? -13.118 4.177   7.181   1.00 0.42  ? 1552 ILE A O    1  
ATOM 640   C CB   . ILE A 1 45  ? -12.993 1.337   6.219   1.00 0.37  ? 1552 ILE A CB   1  
ATOM 641   C CG1  . ILE A 1 45  ? -12.348 -0.069  6.230   1.00 0.39  ? 1552 ILE A CG1  1  
ATOM 642   C CG2  . ILE A 1 45  ? -14.083 1.417   5.149   1.00 0.37  ? 1552 ILE A CG2  1  
ATOM 643   C CD1  . ILE A 1 45  ? -11.597 -0.438  4.969   1.00 0.35  ? 1552 ILE A CD1  1  
ATOM 644   H H    . ILE A 1 45  ? -11.098 1.932   7.886   1.00 0.36  ? 1552 ILE A H    1  
ATOM 645   H HA   . ILE A 1 45  ? -11.469 2.352   5.058   1.00 0.30  ? 1552 ILE A HA   1  
ATOM 646   H HB   . ILE A 1 45  ? -13.471 1.504   7.172   1.00 0.42  ? 1552 ILE A HB   1  
ATOM 647   H HG12 . ILE A 1 45  ? -11.646 -0.126  7.050   1.00 0.42  ? 1552 ILE A HG12 1  
ATOM 648   H HG13 . ILE A 1 45  ? -13.124 -0.805  6.385   1.00 0.45  ? 1552 ILE A HG13 1  
ATOM 649   H HG21 . ILE A 1 45  ? -14.808 0.632   5.313   1.00 1.09  ? 1552 ILE A HG21 1  
ATOM 650   H HG22 . ILE A 1 45  ? -13.637 1.297   4.172   1.00 1.11  ? 1552 ILE A HG22 1  
ATOM 651   H HG23 . ILE A 1 45  ? -14.572 2.378   5.205   1.00 1.04  ? 1552 ILE A HG23 1  
ATOM 652   H HD11 . ILE A 1 45  ? -11.247 -1.456  5.049   1.00 0.98  ? 1552 ILE A HD11 1  
ATOM 653   H HD12 . ILE A 1 45  ? -10.748 0.220   4.870   1.00 1.05  ? 1552 ILE A HD12 1  
ATOM 654   H HD13 . ILE A 1 45  ? -12.246 -0.334  4.113   1.00 1.09  ? 1552 ILE A HD13 1  
ATOM 655   N N    . CYS A 1 46  ? -12.476 4.616   5.057   1.00 0.38  ? 1553 CYS A N    1  
ATOM 656   C CA   . CYS A 1 46  ? -13.165 5.912   4.889   1.00 0.48  ? 1553 CYS A CA   1  
ATOM 657   C C    . CYS A 1 46  ? -12.758 6.964   5.924   1.00 0.47  ? 1553 CYS A C    1  
ATOM 658   O O    . CYS A 1 46  ? -13.343 8.054   5.999   1.00 0.69  ? 1553 CYS A O    1  
ATOM 659   C CB   . CYS A 1 46  ? -14.671 5.697   4.876   1.00 0.60  ? 1553 CYS A CB   1  
ATOM 660   S SG   . CYS A 1 46  ? -15.186 4.530   3.584   1.00 1.40  ? 1553 CYS A SG   1  
ATOM 661   H H    . CYS A 1 46  ? -11.881 4.338   4.323   1.00 0.36  ? 1553 CYS A H    1  
ATOM 662   H HA   . CYS A 1 46  ? -12.875 6.288   3.919   1.00 0.53  ? 1553 CYS A HA   1  
ATOM 663   H HB2  . CYS A 1 46  ? -14.983 5.303   5.832   1.00 0.94  ? 1553 CYS A HB2  1  
ATOM 664   H HB3  . CYS A 1 46  ? -15.169 6.637   4.690   1.00 1.11  ? 1553 CYS A HB3  1  
ATOM 665   N N    . GLY A 1 47  ? -11.726 6.677   6.647   1.00 0.34  ? 1554 GLY A N    1  
ATOM 666   C CA   . GLY A 1 47  ? -11.264 7.541   7.675   1.00 0.35  ? 1554 GLY A CA   1  
ATOM 667   C C    . GLY A 1 47  ? -9.789  7.448   7.755   1.00 0.30  ? 1554 GLY A C    1  
ATOM 668   O O    . GLY A 1 47  ? -9.192  6.648   7.025   1.00 0.31  ? 1554 GLY A O    1  
ATOM 669   H H    . GLY A 1 47  ? -11.232 5.851   6.465   1.00 0.35  ? 1554 GLY A H    1  
ATOM 670   H HA2  . GLY A 1 47  ? -11.558 8.556   7.450   1.00 0.40  ? 1554 GLY A HA2  1  
ATOM 671   H HA3  . GLY A 1 47  ? -11.687 7.238   8.621   1.00 0.38  ? 1554 GLY A HA3  1  
ATOM 672   N N    . GLU A 1 48  ? -9.191  8.229   8.598   1.00 0.31  ? 1555 GLU A N    1  
ATOM 673   C CA   . GLU A 1 48  ? -7.762  8.228   8.718   1.00 0.30  ? 1555 GLU A CA   1  
ATOM 674   C C    . GLU A 1 48  ? -7.321  7.396   9.905   1.00 0.32  ? 1555 GLU A C    1  
ATOM 675   O O    . GLU A 1 48  ? -8.001  7.355   10.951  1.00 0.42  ? 1555 GLU A O    1  
ATOM 676   C CB   . GLU A 1 48  ? -7.211  9.645   8.802   1.00 0.36  ? 1555 GLU A CB   1  
ATOM 677   C CG   . GLU A 1 48  ? -7.703  10.448  9.979   1.00 0.47  ? 1555 GLU A CG   1  
ATOM 678   C CD   . GLU A 1 48  ? -7.142  11.825  9.987   1.00 0.93  ? 1555 GLU A CD   1  
ATOM 679   O OE1  . GLU A 1 48  ? -6.020  12.017  10.492  1.00 1.62  ? 1555 GLU A OE1  1  
ATOM 680   O OE2  . GLU A 1 48  ? -7.807  12.756  9.473   1.00 0.89  ? 1555 GLU A OE2  1  
ATOM 681   H H    . GLU A 1 48  ? -9.729  8.811   9.180   1.00 0.39  ? 1555 GLU A H    1  
ATOM 682   H HA   . GLU A 1 48  ? -7.390  7.766   7.815   1.00 0.28  ? 1555 GLU A HA   1  
ATOM 683   H HB2  . GLU A 1 48  ? -6.136  9.574   8.870   1.00 0.37  ? 1555 GLU A HB2  1  
ATOM 684   H HB3  . GLU A 1 48  ? -7.472  10.169  7.893   1.00 0.39  ? 1555 GLU A HB3  1  
ATOM 685   H HG2  . GLU A 1 48  ? -8.779  10.514  9.928   1.00 0.72  ? 1555 GLU A HG2  1  
ATOM 686   H HG3  . GLU A 1 48  ? -7.416  9.947   10.892  1.00 0.77  ? 1555 GLU A HG3  1  
ATOM 687   N N    . ASN A 1 49  ? -6.202  6.754   9.740   1.00 0.31  ? 1556 ASN A N    1  
ATOM 688   C CA   . ASN A 1 49  ? -5.661  5.871   10.715  1.00 0.38  ? 1556 ASN A CA   1  
ATOM 689   C C    . ASN A 1 49  ? -4.737  6.676   11.622  1.00 0.41  ? 1556 ASN A C    1  
ATOM 690   O O    . ASN A 1 49  ? -3.881  7.421   11.133  1.00 0.46  ? 1556 ASN A O    1  
ATOM 691   C CB   . ASN A 1 49  ? -4.873  4.755   10.012  1.00 0.42  ? 1556 ASN A CB   1  
ATOM 692   C CG   . ASN A 1 49  ? -4.416  3.678   10.960  1.00 0.58  ? 1556 ASN A CG   1  
ATOM 693   O OD1  . ASN A 1 49  ? -3.379  3.787   11.593  1.00 0.83  ? 1556 ASN A OD1  1  
ATOM 694   N ND2  . ASN A 1 49  ? -5.151  2.605   11.017  1.00 0.87  ? 1556 ASN A ND2  1  
ATOM 695   H H    . ASN A 1 49  ? -5.689  6.900   8.914   1.00 0.32  ? 1556 ASN A H    1  
ATOM 696   H HA   . ASN A 1 49  ? -6.493  5.435   11.248  1.00 0.45  ? 1556 ASN A HA   1  
ATOM 697   H HB2  . ASN A 1 49  ? -5.533  4.296   9.293   1.00 0.45  ? 1556 ASN A HB2  1  
ATOM 698   H HB3  . ASN A 1 49  ? -4.020  5.157   9.484   1.00 0.40  ? 1556 ASN A HB3  1  
ATOM 699   H HD21 . ASN A 1 49  ? -5.935  2.581   10.426  1.00 1.12  ? 1556 ASN A HD21 1  
ATOM 700   H HD22 . ASN A 1 49  ? -4.930  1.889   11.655  1.00 1.00  ? 1556 ASN A HD22 1  
ATOM 701   N N    . GLU A 1 50  ? -4.884  6.535   12.927  1.00 0.57  ? 1557 GLU A N    1  
ATOM 702   C CA   . GLU A 1 50  ? -4.101  7.357   13.849  1.00 0.67  ? 1557 GLU A CA   1  
ATOM 703   C C    . GLU A 1 50  ? -2.687  6.834   14.088  1.00 0.62  ? 1557 GLU A C    1  
ATOM 704   O O    . GLU A 1 50  ? -1.896  7.481   14.783  1.00 0.74  ? 1557 GLU A O    1  
ATOM 705   C CB   . GLU A 1 50  ? -4.808  7.594   15.190  1.00 0.95  ? 1557 GLU A CB   1  
ATOM 706   C CG   . GLU A 1 50  ? -5.148  6.343   15.990  1.00 1.65  ? 1557 GLU A CG   1  
ATOM 707   C CD   . GLU A 1 50  ? -5.537  6.686   17.393  1.00 2.05  ? 1557 GLU A CD   1  
ATOM 708   O OE1  . GLU A 1 50  ? -6.413  7.545   17.585  1.00 2.49  ? 1557 GLU A OE1  1  
ATOM 709   O OE2  . GLU A 1 50  ? -4.971  6.103   18.339  1.00 2.40  ? 1557 GLU A OE2  1  
ATOM 710   H H    . GLU A 1 50  ? -5.532  5.882   13.266  1.00 0.70  ? 1557 GLU A H    1  
ATOM 711   H HA   . GLU A 1 50  ? -4.000  8.315   13.359  1.00 0.71  ? 1557 GLU A HA   1  
ATOM 712   H HB2  . GLU A 1 50  ? -4.170  8.206   15.811  1.00 1.22  ? 1557 GLU A HB2  1  
ATOM 713   H HB3  . GLU A 1 50  ? -5.725  8.134   15.005  1.00 1.40  ? 1557 GLU A HB3  1  
ATOM 714   H HG2  . GLU A 1 50  ? -5.995  5.834   15.554  1.00 2.11  ? 1557 GLU A HG2  1  
ATOM 715   H HG3  . GLU A 1 50  ? -4.289  5.689   16.022  1.00 2.10  ? 1557 GLU A HG3  1  
ATOM 716   N N    . ASN A 1 51  ? -2.344  5.699   13.506  1.00 0.56  ? 1558 ASN A N    1  
ATOM 717   C CA   . ASN A 1 51  ? -1.011  5.129   13.721  1.00 0.62  ? 1558 ASN A CA   1  
ATOM 718   C C    . ASN A 1 51  ? -0.008  5.738   12.770  1.00 0.54  ? 1558 ASN A C    1  
ATOM 719   O O    . ASN A 1 51  ? 1.191   5.485   12.876  1.00 0.68  ? 1558 ASN A O    1  
ATOM 720   C CB   . ASN A 1 51  ? -0.971  3.611   13.547  1.00 0.79  ? 1558 ASN A CB   1  
ATOM 721   C CG   . ASN A 1 51  ? -1.845  2.811   14.489  1.00 0.87  ? 1558 ASN A CG   1  
ATOM 722   O OD1  . ASN A 1 51  ? -1.435  2.467   15.594  1.00 1.38  ? 1558 ASN A OD1  1  
ATOM 723   N ND2  . ASN A 1 51  ? -3.022  2.471   14.043  1.00 0.85  ? 1558 ASN A ND2  1  
ATOM 724   H H    . ASN A 1 51  ? -2.985  5.249   12.913  1.00 0.56  ? 1558 ASN A H    1  
ATOM 725   H HA   . ASN A 1 51  ? -0.714  5.372   14.730  1.00 0.71  ? 1558 ASN A HA   1  
ATOM 726   H HB2  . ASN A 1 51  ? -1.283  3.373   12.540  1.00 1.20  ? 1558 ASN A HB2  1  
ATOM 727   H HB3  . ASN A 1 51  ? 0.051   3.283   13.668  1.00 1.02  ? 1558 ASN A HB3  1  
ATOM 728   H HD21 . ASN A 1 51  ? -3.272  2.768   13.139  1.00 0.93  ? 1558 ASN A HD21 1  
ATOM 729   H HD22 . ASN A 1 51  ? -3.582  1.880   14.602  1.00 1.10  ? 1558 ASN A HD22 1  
ATOM 730   N N    . CYS A 1 52  ? -0.485  6.535   11.862  1.00 0.44  ? 1559 CYS A N    1  
ATOM 731   C CA   . CYS A 1 52  ? 0.352   7.159   10.878  1.00 0.41  ? 1559 CYS A CA   1  
ATOM 732   C C    . CYS A 1 52  ? -0.085  8.629   10.770  1.00 0.39  ? 1559 CYS A C    1  
ATOM 733   O O    . CYS A 1 52  ? -1.202  8.938   11.193  1.00 0.42  ? 1559 CYS A O    1  
ATOM 734   C CB   . CYS A 1 52  ? 0.193   6.395   9.531   1.00 0.42  ? 1559 CYS A CB   1  
ATOM 735   S SG   . CYS A 1 52  ? 1.381   6.837   8.200   1.00 1.21  ? 1559 CYS A SG   1  
ATOM 736   H H    . CYS A 1 52  ? -1.440  6.758   11.845  1.00 0.46  ? 1559 CYS A H    1  
ATOM 737   H HA   . CYS A 1 52  ? 1.378   7.107   11.212  1.00 0.46  ? 1559 CYS A HA   1  
ATOM 738   H HB2  . CYS A 1 52  ? 0.312   5.339   9.717   1.00 0.83  ? 1559 CYS A HB2  1  
ATOM 739   H HB3  . CYS A 1 52  ? -0.806  6.569   9.156   1.00 0.94  ? 1559 CYS A HB3  1  
ATOM 740   N N    . PRO A 1 53  ? 0.828   9.561   10.349  1.00 0.45  ? 1560 PRO A N    1  
ATOM 741   C CA   . PRO A 1 53  ? 0.543   10.998  10.106  1.00 0.49  ? 1560 PRO A CA   1  
ATOM 742   C C    . PRO A 1 53  ? -0.921  11.332  9.676   1.00 0.41  ? 1560 PRO A C    1  
ATOM 743   O O    . PRO A 1 53  ? -1.508  10.668  8.810   1.00 0.42  ? 1560 PRO A O    1  
ATOM 744   C CB   . PRO A 1 53  ? 1.512   11.291  8.973   1.00 0.57  ? 1560 PRO A CB   1  
ATOM 745   C CG   . PRO A 1 53  ? 2.730   10.495  9.314   1.00 0.71  ? 1560 PRO A CG   1  
ATOM 746   C CD   . PRO A 1 53  ? 2.268   9.307   10.133  1.00 0.58  ? 1560 PRO A CD   1  
ATOM 747   H HA   . PRO A 1 53  ? 0.814   11.603  10.959  1.00 0.57  ? 1560 PRO A HA   1  
ATOM 748   H HB2  . PRO A 1 53  ? 1.079   10.978  8.034   1.00 0.61  ? 1560 PRO A HB2  1  
ATOM 749   H HB3  . PRO A 1 53  ? 1.729   12.347  8.947   1.00 0.69  ? 1560 PRO A HB3  1  
ATOM 750   H HG2  . PRO A 1 53  ? 3.209   10.157  8.406   1.00 0.90  ? 1560 PRO A HG2  1  
ATOM 751   H HG3  . PRO A 1 53  ? 3.412   11.102  9.890   1.00 0.98  ? 1560 PRO A HG3  1  
ATOM 752   H HD2  . PRO A 1 53  ? 2.417   8.388   9.583   1.00 0.61  ? 1560 PRO A HD2  1  
ATOM 753   H HD3  . PRO A 1 53  ? 2.797   9.270   11.074  1.00 0.70  ? 1560 PRO A HD3  1  
ATOM 754   N N    . PRO A 1 54  ? -1.503  12.381  10.309  1.00 0.47  ? 1561 PRO A N    1  
ATOM 755   C CA   . PRO A 1 54  ? -2.889  12.838  10.084  1.00 0.46  ? 1561 PRO A CA   1  
ATOM 756   C C    . PRO A 1 54  ? -3.279  12.966  8.597   1.00 0.41  ? 1561 PRO A C    1  
ATOM 757   O O    . PRO A 1 54  ? -2.596  13.646  7.803   1.00 0.46  ? 1561 PRO A O    1  
ATOM 758   C CB   . PRO A 1 54  ? -2.936  14.221  10.775  1.00 0.56  ? 1561 PRO A CB   1  
ATOM 759   C CG   . PRO A 1 54  ? -1.532  14.523  11.176  1.00 0.80  ? 1561 PRO A CG   1  
ATOM 760   C CD   . PRO A 1 54  ? -0.846  13.209  11.324  1.00 0.63  ? 1561 PRO A CD   1  
ATOM 761   H HA   . PRO A 1 54  ? -3.586  12.176  10.578  1.00 0.48  ? 1561 PRO A HA   1  
ATOM 762   H HB2  . PRO A 1 54  ? -3.305  14.967  10.086  1.00 0.66  ? 1561 PRO A HB2  1  
ATOM 763   H HB3  . PRO A 1 54  ? -3.583  14.176  11.640  1.00 0.66  ? 1561 PRO A HB3  1  
ATOM 764   H HG2  . PRO A 1 54  ? -1.050  15.110  10.408  1.00 1.15  ? 1561 PRO A HG2  1  
ATOM 765   H HG3  . PRO A 1 54  ? -1.526  15.058  12.114  1.00 1.13  ? 1561 PRO A HG3  1  
ATOM 766   H HD2  . PRO A 1 54  ? 0.210   13.307  11.116  1.00 0.78  ? 1561 PRO A HD2  1  
ATOM 767   H HD3  . PRO A 1 54  ? -1.006  12.805  12.312  1.00 0.77  ? 1561 PRO A HD3  1  
ATOM 768   N N    . GLY A 1 55  ? -4.368  12.319  8.237   1.00 0.41  ? 1562 GLY A N    1  
ATOM 769   C CA   . GLY A 1 55  ? -4.856  12.343  6.878   1.00 0.46  ? 1562 GLY A CA   1  
ATOM 770   C C    . GLY A 1 55  ? -4.603  11.050  6.143   1.00 0.38  ? 1562 GLY A C    1  
ATOM 771   O O    . GLY A 1 55  ? -5.149  10.820  5.073   1.00 0.45  ? 1562 GLY A O    1  
ATOM 772   H H    . GLY A 1 55  ? -4.882  11.845  8.929   1.00 0.44  ? 1562 GLY A H    1  
ATOM 773   H HA2  . GLY A 1 55  ? -5.920  12.531  6.896   1.00 0.55  ? 1562 GLY A HA2  1  
ATOM 774   H HA3  . GLY A 1 55  ? -4.372  13.149  6.346   1.00 0.54  ? 1562 GLY A HA3  1  
ATOM 775   N N    . VAL A 1 56  ? -3.796  10.210  6.716   1.00 0.35  ? 1563 VAL A N    1  
ATOM 776   C CA   . VAL A 1 56  ? -3.430  8.963   6.119   1.00 0.37  ? 1563 VAL A CA   1  
ATOM 777   C C    . VAL A 1 56  ? -4.494  7.880   6.303   1.00 0.27  ? 1563 VAL A C    1  
ATOM 778   O O    . VAL A 1 56  ? -4.924  7.591   7.421   1.00 0.28  ? 1563 VAL A O    1  
ATOM 779   C CB   . VAL A 1 56  ? -2.055  8.521   6.656   1.00 0.53  ? 1563 VAL A CB   1  
ATOM 780   C CG1  . VAL A 1 56  ? -1.861  7.049   6.541   1.00 0.68  ? 1563 VAL A CG1  1  
ATOM 781   C CG2  . VAL A 1 56  ? -0.990  9.202   5.856   1.00 0.98  ? 1563 VAL A CG2  1  
ATOM 782   H H    . VAL A 1 56  ? -3.401  10.405  7.592   1.00 0.42  ? 1563 VAL A H    1  
ATOM 783   H HA   . VAL A 1 56  ? -3.320  9.143   5.059   1.00 0.48  ? 1563 VAL A HA   1  
ATOM 784   H HB   . VAL A 1 56  ? -1.937  8.834   7.682   1.00 1.09  ? 1563 VAL A HB   1  
ATOM 785   H HG11 . VAL A 1 56  ? -2.708  6.563   7.000   1.00 1.27  ? 1563 VAL A HG11 1  
ATOM 786   H HG12 . VAL A 1 56  ? -0.959  6.791   7.078   1.00 1.22  ? 1563 VAL A HG12 1  
ATOM 787   H HG13 . VAL A 1 56  ? -1.766  6.774   5.504   1.00 1.34  ? 1563 VAL A HG13 1  
ATOM 788   H HG21 . VAL A 1 56  ? -1.109  8.866   4.834   1.00 1.53  ? 1563 VAL A HG21 1  
ATOM 789   H HG22 . VAL A 1 56  ? -0.016  8.918   6.224   1.00 1.50  ? 1563 VAL A HG22 1  
ATOM 790   H HG23 . VAL A 1 56  ? -1.116  10.274  5.899   1.00 1.48  ? 1563 VAL A HG23 1  
ATOM 791   N N    . GLY A 1 57  ? -4.917  7.310   5.187   1.00 0.25  ? 1564 GLY A N    1  
ATOM 792   C CA   . GLY A 1 57  ? -5.872  6.220   5.202   1.00 0.25  ? 1564 GLY A CA   1  
ATOM 793   C C    . GLY A 1 57  ? -5.176  4.877   5.114   1.00 0.24  ? 1564 GLY A C    1  
ATOM 794   O O    . GLY A 1 57  ? -5.630  3.890   5.694   1.00 0.28  ? 1564 GLY A O    1  
ATOM 795   H H    . GLY A 1 57  ? -4.569  7.647   4.331   1.00 0.28  ? 1564 GLY A H    1  
ATOM 796   H HA2  . GLY A 1 57  ? -6.463  6.265   6.105   1.00 0.27  ? 1564 GLY A HA2  1  
ATOM 797   H HA3  . GLY A 1 57  ? -6.529  6.320   4.352   1.00 0.29  ? 1564 GLY A HA3  1  
ATOM 798   N N    . ALA A 1 58  ? -4.081  4.834   4.370   1.00 0.23  ? 1565 ALA A N    1  
ATOM 799   C CA   . ALA A 1 58  ? -3.294  3.631   4.230   1.00 0.24  ? 1565 ALA A CA   1  
ATOM 800   C C    . ALA A 1 58  ? -1.821  3.968   4.404   1.00 0.23  ? 1565 ALA A C    1  
ATOM 801   O O    . ALA A 1 58  ? -1.329  4.947   3.822   1.00 0.23  ? 1565 ALA A O    1  
ATOM 802   C CB   . ALA A 1 58  ? -3.544  3.007   2.883   1.00 0.28  ? 1565 ALA A CB   1  
ATOM 803   H H    . ALA A 1 58  ? -3.774  5.625   3.878   1.00 0.24  ? 1565 ALA A H    1  
ATOM 804   H HA   . ALA A 1 58  ? -3.587  2.936   5.002   1.00 0.26  ? 1565 ALA A HA   1  
ATOM 805   H HB1  . ALA A 1 58  ? -2.926  2.126   2.798   1.00 1.01  ? 1565 ALA A HB1  1  
ATOM 806   H HB2  . ALA A 1 58  ? -3.288  3.717   2.111   1.00 1.08  ? 1565 ALA A HB2  1  
ATOM 807   H HB3  . ALA A 1 58  ? -4.580  2.731   2.793   1.00 0.96  ? 1565 ALA A HB3  1  
ATOM 808   N N    . CYS A 1 59  ? -1.121  3.179   5.185   1.00 0.26  ? 1566 CYS A N    1  
ATOM 809   C CA   . CYS A 1 59  ? 0.265   3.469   5.523   1.00 0.28  ? 1566 CYS A CA   1  
ATOM 810   C C    . CYS A 1 59  ? 0.976   2.204   5.992   1.00 0.33  ? 1566 CYS A C    1  
ATOM 811   O O    . CYS A 1 59  ? 0.411   1.444   6.750   1.00 0.37  ? 1566 CYS A O    1  
ATOM 812   C CB   . CYS A 1 59  ? 0.239   4.478   6.680   1.00 0.32  ? 1566 CYS A CB   1  
ATOM 813   S SG   . CYS A 1 59  ? 1.842   5.066   7.308   1.00 0.43  ? 1566 CYS A SG   1  
ATOM 814   H H    . CYS A 1 59  ? -1.549  2.377   5.562   1.00 0.29  ? 1566 CYS A H    1  
ATOM 815   H HA   . CYS A 1 59  ? 0.757   3.929   4.680   1.00 0.30  ? 1566 CYS A HA   1  
ATOM 816   H HB2  . CYS A 1 59  ? -0.303  5.354   6.355   1.00 0.36  ? 1566 CYS A HB2  1  
ATOM 817   H HB3  . CYS A 1 59  ? -0.297  4.033   7.505   1.00 0.38  ? 1566 CYS A HB3  1  
ATOM 818   N N    . PHE A 1 60  ? 2.198   1.970   5.544   1.00 0.39  ? 1567 PHE A N    1  
ATOM 819   C CA   . PHE A 1 60  ? 2.969   0.848   6.079   1.00 0.48  ? 1567 PHE A CA   1  
ATOM 820   C C    . PHE A 1 60  ? 3.659   1.314   7.369   1.00 0.61  ? 1567 PHE A C    1  
ATOM 821   O O    . PHE A 1 60  ? 4.210   2.424   7.411   1.00 0.63  ? 1567 PHE A O    1  
ATOM 822   C CB   . PHE A 1 60  ? 4.007   0.317   5.082   1.00 0.59  ? 1567 PHE A CB   1  
ATOM 823   C CG   . PHE A 1 60  ? 3.415   -0.277  3.853   1.00 0.61  ? 1567 PHE A CG   1  
ATOM 824   C CD1  . PHE A 1 60  ? 2.730   -1.472  3.916   1.00 0.73  ? 1567 PHE A CD1  1  
ATOM 825   C CD2  . PHE A 1 60  ? 3.528   0.360   2.646   1.00 0.86  ? 1567 PHE A CD2  1  
ATOM 826   C CE1  . PHE A 1 60  ? 2.166   -2.019  2.789   1.00 0.91  ? 1567 PHE A CE1  1  
ATOM 827   C CE2  . PHE A 1 60  ? 2.964   -0.178  1.508   1.00 1.03  ? 1567 PHE A CE2  1  
ATOM 828   C CZ   . PHE A 1 60  ? 2.282   -1.371  1.583   1.00 0.99  ? 1567 PHE A CZ   1  
ATOM 829   H H    . PHE A 1 60  ? 2.569   2.546   4.846   1.00 0.41  ? 1567 PHE A H    1  
ATOM 830   H HA   . PHE A 1 60  ? 2.218   0.095   6.275   1.00 0.46  ? 1567 PHE A HA   1  
ATOM 831   H HB2  . PHE A 1 60  ? 4.670   1.115   4.780   1.00 0.71  ? 1567 PHE A HB2  1  
ATOM 832   H HB3  . PHE A 1 60  ? 4.580   -0.458  5.565   1.00 0.69  ? 1567 PHE A HB3  1  
ATOM 833   H HD1  . PHE A 1 60  ? 2.638   -1.981  4.865   1.00 0.87  ? 1567 PHE A HD1  1  
ATOM 834   H HD2  . PHE A 1 60  ? 4.073   1.289   2.610   1.00 1.06  ? 1567 PHE A HD2  1  
ATOM 835   H HE1  . PHE A 1 60  ? 1.631   -2.955  2.852   1.00 1.13  ? 1567 PHE A HE1  1  
ATOM 836   H HE2  . PHE A 1 60  ? 3.059   0.334   0.562   1.00 1.30  ? 1567 PHE A HE2  1  
ATOM 837   H HZ   . PHE A 1 60  ? 1.836   -1.800  0.697   1.00 1.18  ? 1567 PHE A HZ   1  
ATOM 838   N N    . GLY A 1 61  ? 3.663   0.479   8.396   1.00 0.76  ? 1568 GLY A N    1  
ATOM 839   C CA   . GLY A 1 61  ? 4.072   0.924   9.698   1.00 1.03  ? 1568 GLY A CA   1  
ATOM 840   C C    . GLY A 1 61  ? 5.530   0.812   10.033  1.00 0.82  ? 1568 GLY A C    1  
ATOM 841   O O    . GLY A 1 61  ? 5.885   0.946   11.216  1.00 1.13  ? 1568 GLY A O    1  
ATOM 842   H H    . GLY A 1 61  ? 3.392   -0.463  8.303   1.00 0.72  ? 1568 GLY A H    1  
ATOM 843   H HA2  . GLY A 1 61  ? 3.796   1.963   9.794   1.00 1.32  ? 1568 GLY A HA2  1  
ATOM 844   H HA3  . GLY A 1 61  ? 3.504   0.367   10.429  1.00 1.43  ? 1568 GLY A HA3  1  
ATOM 845   N N    . GLN A 1 62  ? 6.387   0.545   9.072   1.00 0.83  ? 1569 GLN A N    1  
ATOM 846   C CA   . GLN A 1 62  ? 7.789   0.513   9.396   1.00 1.01  ? 1569 GLN A CA   1  
ATOM 847   C C    . GLN A 1 62  ? 8.318   1.934   9.572   1.00 0.89  ? 1569 GLN A C    1  
ATOM 848   O O    . GLN A 1 62  ? 8.599   2.354   10.692  1.00 1.08  ? 1569 GLN A O    1  
ATOM 849   C CB   . GLN A 1 62  ? 8.636   -0.209  8.376   1.00 1.47  ? 1569 GLN A CB   1  
ATOM 850   C CG   . GLN A 1 62  ? 8.213   -1.613  7.993   1.00 1.83  ? 1569 GLN A CG   1  
ATOM 851   C CD   . GLN A 1 62  ? 7.031   -1.627  7.064   1.00 2.05  ? 1569 GLN A CD   1  
ATOM 852   O OE1  . GLN A 1 62  ? 5.874   -1.763  7.478   1.00 2.58  ? 1569 GLN A OE1  1  
ATOM 853   N NE2  . GLN A 1 62  ? 7.301   -1.330  5.849   1.00 2.40  ? 1569 GLN A NE2  1  
ATOM 854   H H    . GLN A 1 62  ? 6.080   0.308   8.168   1.00 1.05  ? 1569 GLN A H    1  
ATOM 855   H HA   . GLN A 1 62  ? 7.861   -0.006  10.339  1.00 1.24  ? 1569 GLN A HA   1  
ATOM 856   H HB2  . GLN A 1 62  ? 8.649   0.379   7.470   1.00 1.56  ? 1569 GLN A HB2  1  
ATOM 857   H HB3  . GLN A 1 62  ? 9.645   -0.257  8.758   1.00 1.69  ? 1569 GLN A HB3  1  
ATOM 858   H HG2  . GLN A 1 62  ? 9.042   -2.098  7.499   1.00 2.22  ? 1569 GLN A HG2  1  
ATOM 859   H HG3  . GLN A 1 62  ? 7.961   -2.161  8.889   1.00 2.41  ? 1569 GLN A HG3  1  
ATOM 860   H HE21 . GLN A 1 62  ? 8.255   -1.104  5.690   1.00 2.27  ? 1569 GLN A HE21 1  
ATOM 861   H HE22 . GLN A 1 62  ? 6.616   -1.331  5.153   1.00 3.09  ? 1569 GLN A HE22 1  
ATOM 862   N N    . THR A 1 63  ? 8.426   2.689   8.487   1.00 0.86  ? 1570 THR A N    1  
ATOM 863   C CA   . THR A 1 63  ? 8.862   4.076   8.609   1.00 1.01  ? 1570 THR A CA   1  
ATOM 864   C C    . THR A 1 63  ? 7.684   5.086   8.554   1.00 0.80  ? 1570 THR A C    1  
ATOM 865   O O    . THR A 1 63  ? 7.870   6.299   8.761   1.00 0.93  ? 1570 THR A O    1  
ATOM 866   C CB   . THR A 1 63  ? 9.929   4.429   7.542   1.00 1.48  ? 1570 THR A CB   1  
ATOM 867   O OG1  . THR A 1 63  ? 9.428   4.168   6.231   1.00 2.17  ? 1570 THR A OG1  1  
ATOM 868   C CG2  . THR A 1 63  ? 11.233  3.665   7.769   1.00 1.93  ? 1570 THR A CG2  1  
ATOM 869   H H    . THR A 1 63  ? 8.333   2.292   7.588   1.00 0.98  ? 1570 THR A H    1  
ATOM 870   H HA   . THR A 1 63  ? 9.308   4.183   9.586   1.00 1.23  ? 1570 THR A HA   1  
ATOM 871   H HB   . THR A 1 63  ? 10.126  5.484   7.571   1.00 1.87  ? 1570 THR A HB   1  
ATOM 872   H HG1  . THR A 1 63  ? 9.351   3.205   6.080   1.00 2.52  ? 1570 THR A HG1  1  
ATOM 873   H HG21 . THR A 1 63  ? 11.674  3.925   8.721   1.00 2.20  ? 1570 THR A HG21 1  
ATOM 874   H HG22 . THR A 1 63  ? 11.926  3.918   6.981   1.00 2.46  ? 1570 THR A HG22 1  
ATOM 875   H HG23 . THR A 1 63  ? 11.039  2.602   7.736   1.00 2.40  ? 1570 THR A HG23 1  
ATOM 876   N N    . ARG A 1 64  ? 6.484   4.556   8.309   1.00 0.62  ? 1571 ARG A N    1  
ATOM 877   C CA   . ARG A 1 64  ? 5.229   5.326   8.173   1.00 0.57  ? 1571 ARG A CA   1  
ATOM 878   C C    . ARG A 1 64  ? 5.142   6.075   6.848   1.00 0.47  ? 1571 ARG A C    1  
ATOM 879   O O    . ARG A 1 64  ? 5.020   7.313   6.800   1.00 0.57  ? 1571 ARG A O    1  
ATOM 880   C CB   . ARG A 1 64  ? 4.844   6.221   9.398   1.00 0.87  ? 1571 ARG A CB   1  
ATOM 881   C CG   . ARG A 1 64  ? 4.083   5.487   10.523  1.00 1.13  ? 1571 ARG A CG   1  
ATOM 882   C CD   . ARG A 1 64  ? 4.980   4.832   11.585  1.00 1.32  ? 1571 ARG A CD   1  
ATOM 883   N NE   . ARG A 1 64  ? 4.214   3.967   12.514  1.00 1.46  ? 1571 ARG A NE   1  
ATOM 884   C CZ   . ARG A 1 64  ? 4.335   3.970   13.849  1.00 2.01  ? 1571 ARG A CZ   1  
ATOM 885   N NH1  . ARG A 1 64  ? 5.075   4.898   14.458  1.00 2.62  ? 1571 ARG A NH1  1  
ATOM 886   N NH2  . ARG A 1 64  ? 3.686   3.058   14.567  1.00 2.24  ? 1571 ARG A NH2  1  
ATOM 887   H H    . ARG A 1 64  ? 6.478   3.590   8.166   1.00 0.65  ? 1571 ARG A H    1  
ATOM 888   H HA   . ARG A 1 64  ? 4.458   4.574   8.056   1.00 0.60  ? 1571 ARG A HA   1  
ATOM 889   H HB2  . ARG A 1 64  ? 5.749   6.634   9.819   1.00 0.98  ? 1571 ARG A HB2  1  
ATOM 890   H HB3  . ARG A 1 64  ? 4.227   7.035   9.045   1.00 1.02  ? 1571 ARG A HB3  1  
ATOM 891   H HG2  . ARG A 1 64  ? 3.444   6.206   11.016  1.00 1.78  ? 1571 ARG A HG2  1  
ATOM 892   H HG3  . ARG A 1 64  ? 3.467   4.738   10.049  1.00 1.61  ? 1571 ARG A HG3  1  
ATOM 893   H HD2  . ARG A 1 64  ? 5.783   4.248   11.175  1.00 1.83  ? 1571 ARG A HD2  1  
ATOM 894   H HD3  . ARG A 1 64  ? 5.410   5.626   12.178  1.00 1.89  ? 1571 ARG A HD3  1  
ATOM 895   H HE   . ARG A 1 64  ? 3.612   3.309   12.104  1.00 1.50  ? 1571 ARG A HE   1  
ATOM 896   H HH11 . ARG A 1 64  ? 5.565   5.615   13.946  1.00 2.69  ? 1571 ARG A HH11 1  
ATOM 897   H HH12 . ARG A 1 64  ? 5.186   4.944   15.459  1.00 3.19  ? 1571 ARG A HH12 1  
ATOM 898   H HH21 . ARG A 1 64  ? 3.094   2.355   14.150  1.00 2.19  ? 1571 ARG A HH21 1  
ATOM 899   H HH22 . ARG A 1 64  ? 3.791   3.013   15.570  1.00 2.70  ? 1571 ARG A HH22 1  
ATOM 900   N N    . ILE A 1 65  ? 5.209   5.302   5.781   1.00 0.43  ? 1572 ILE A N    1  
ATOM 901   C CA   . ILE A 1 65  ? 5.081   5.776   4.419   1.00 0.43  ? 1572 ILE A CA   1  
ATOM 902   C C    . ILE A 1 65  ? 3.597   5.703   4.038   1.00 0.40  ? 1572 ILE A C    1  
ATOM 903   O O    . ILE A 1 65  ? 2.947   4.663   4.241   1.00 0.44  ? 1572 ILE A O    1  
ATOM 904   C CB   . ILE A 1 65  ? 5.888   4.860   3.458   1.00 0.53  ? 1572 ILE A CB   1  
ATOM 905   C CG1  . ILE A 1 65  ? 7.298   4.601   4.039   1.00 0.65  ? 1572 ILE A CG1  1  
ATOM 906   C CG2  . ILE A 1 65  ? 5.943   5.452   2.031   1.00 0.60  ? 1572 ILE A CG2  1  
ATOM 907   C CD1  . ILE A 1 65  ? 8.164   3.666   3.213   1.00 0.92  ? 1572 ILE A CD1  1  
ATOM 908   H H    . ILE A 1 65  ? 5.362   4.346   5.903   1.00 0.50  ? 1572 ILE A H    1  
ATOM 909   H HA   . ILE A 1 65  ? 5.443   6.791   4.349   1.00 0.47  ? 1572 ILE A HA   1  
ATOM 910   H HB   . ILE A 1 65  ? 5.362   3.919   3.393   1.00 0.56  ? 1572 ILE A HB   1  
ATOM 911   H HG12 . ILE A 1 65  ? 7.847   5.502   4.284   1.00 0.71  ? 1572 ILE A HG12 1  
ATOM 912   H HG13 . ILE A 1 65  ? 7.134   4.096   4.980   1.00 0.73  ? 1572 ILE A HG13 1  
ATOM 913   H HG21 . ILE A 1 65  ? 4.935   5.480   1.642   1.00 1.12  ? 1572 ILE A HG21 1  
ATOM 914   H HG22 . ILE A 1 65  ? 6.546   4.843   1.373   1.00 1.25  ? 1572 ILE A HG22 1  
ATOM 915   H HG23 . ILE A 1 65  ? 6.323   6.464   2.025   1.00 1.19  ? 1572 ILE A HG23 1  
ATOM 916   H HD11 . ILE A 1 65  ? 7.655   2.720   3.112   1.00 1.39  ? 1572 ILE A HD11 1  
ATOM 917   H HD12 . ILE A 1 65  ? 9.089   3.497   3.747   1.00 1.51  ? 1572 ILE A HD12 1  
ATOM 918   H HD13 . ILE A 1 65  ? 8.357   4.085   2.237   1.00 1.36  ? 1572 ILE A HD13 1  
ATOM 919   N N    . SER A 1 66  ? 3.085   6.766   3.493   1.00 0.42  ? 1573 SER A N    1  
ATOM 920   C CA   . SER A 1 66  ? 1.679   6.869   3.163   1.00 0.42  ? 1573 SER A CA   1  
ATOM 921   C C    . SER A 1 66  ? 1.408   6.287   1.786   1.00 0.33  ? 1573 SER A C    1  
ATOM 922   O O    . SER A 1 66  ? 2.087   6.622   0.802   1.00 0.41  ? 1573 SER A O    1  
ATOM 923   C CB   . SER A 1 66  ? 1.234   8.340   3.222   1.00 0.54  ? 1573 SER A CB   1  
ATOM 924   O OG   . SER A 1 66  ? -0.098  8.518   2.767   1.00 0.80  ? 1573 SER A OG   1  
ATOM 925   H H    . SER A 1 66  ? 3.690   7.497   3.247   1.00 0.50  ? 1573 SER A H    1  
ATOM 926   H HA   . SER A 1 66  ? 1.117   6.310   3.897   1.00 0.49  ? 1573 SER A HA   1  
ATOM 927   H HB2  . SER A 1 66  ? 1.258   8.688   4.245   1.00 0.78  ? 1573 SER A HB2  1  
ATOM 928   H HB3  . SER A 1 66  ? 1.891   8.945   2.614   1.00 0.96  ? 1573 SER A HB3  1  
ATOM 929   H HG   . SER A 1 66  ? -0.256  9.471   2.779   1.00 0.71  ? 1573 SER A HG   1  
ATOM 930   N N    . VAL A 1 67  ? 0.432   5.434   1.691   1.00 0.26  ? 1574 VAL A N    1  
ATOM 931   C CA   . VAL A 1 67  ? 0.105   4.856   0.418   1.00 0.27  ? 1574 VAL A CA   1  
ATOM 932   C C    . VAL A 1 67  ? -1.310  5.230   -0.006  1.00 0.27  ? 1574 VAL A C    1  
ATOM 933   O O    . VAL A 1 67  ? -1.898  4.620   -0.909  1.00 0.38  ? 1574 VAL A O    1  
ATOM 934   C CB   . VAL A 1 67  ? 0.354   3.322   0.350   1.00 0.42  ? 1574 VAL A CB   1  
ATOM 935   C CG1  . VAL A 1 67  ? 1.794   3.002   0.659   1.00 0.98  ? 1574 VAL A CG1  1  
ATOM 936   C CG2  . VAL A 1 67  ? -0.537  2.575   1.277   1.00 0.69  ? 1574 VAL A CG2  1  
ATOM 937   H H    . VAL A 1 67  ? -0.092  5.195   2.492   1.00 0.30  ? 1574 VAL A H    1  
ATOM 938   H HA   . VAL A 1 67  ? 0.766   5.340   -0.288  1.00 0.30  ? 1574 VAL A HA   1  
ATOM 939   H HB   . VAL A 1 67  ? 0.154   2.999   -0.661  1.00 0.93  ? 1574 VAL A HB   1  
ATOM 940   H HG11 . VAL A 1 67  ? 2.432   3.496   -0.061  1.00 1.52  ? 1574 VAL A HG11 1  
ATOM 941   H HG12 . VAL A 1 67  ? 1.936   1.933   0.596   1.00 1.51  ? 1574 VAL A HG12 1  
ATOM 942   H HG13 . VAL A 1 67  ? 2.026   3.357   1.653   1.00 1.60  ? 1574 VAL A HG13 1  
ATOM 943   H HG21 . VAL A 1 67  ? -0.306  1.522   1.221   1.00 1.29  ? 1574 VAL A HG21 1  
ATOM 944   H HG22 . VAL A 1 67  ? -1.549  2.752   0.945   1.00 1.32  ? 1574 VAL A HG22 1  
ATOM 945   H HG23 . VAL A 1 67  ? -0.396  2.946   2.280   1.00 1.37  ? 1574 VAL A HG23 1  
ATOM 946   N N    . GLY A 1 68  ? -1.848  6.244   0.653   1.00 0.23  ? 1575 GLY A N    1  
ATOM 947   C CA   . GLY A 1 68  ? -3.140  6.745   0.297   1.00 0.27  ? 1575 GLY A CA   1  
ATOM 948   C C    . GLY A 1 68  ? -3.697  7.656   1.356   1.00 0.24  ? 1575 GLY A C    1  
ATOM 949   O O    . GLY A 1 68  ? -3.694  7.308   2.550   1.00 0.29  ? 1575 GLY A O    1  
ATOM 950   H H    . GLY A 1 68  ? -1.376  6.651   1.415   1.00 0.25  ? 1575 GLY A H    1  
ATOM 951   H HA2  . GLY A 1 68  ? -3.061  7.288   -0.633  1.00 0.33  ? 1575 GLY A HA2  1  
ATOM 952   H HA3  . GLY A 1 68  ? -3.815  5.912   0.163   1.00 0.34  ? 1575 GLY A HA3  1  
ATOM 953   N N    . LYS A 1 69  ? -4.149  8.826   0.948   1.00 0.27  ? 1576 LYS A N    1  
ATOM 954   C CA   . LYS A 1 69  ? -4.777  9.751   1.861   1.00 0.30  ? 1576 LYS A CA   1  
ATOM 955   C C    . LYS A 1 69  ? -6.203  9.275   2.085   1.00 0.28  ? 1576 LYS A C    1  
ATOM 956   O O    . LYS A 1 69  ? -6.813  8.697   1.180   1.00 0.33  ? 1576 LYS A O    1  
ATOM 957   C CB   . LYS A 1 69  ? -4.734  11.198  1.302   1.00 0.42  ? 1576 LYS A CB   1  
ATOM 958   C CG   . LYS A 1 69  ? -5.316  12.250  2.253   1.00 0.57  ? 1576 LYS A CG   1  
ATOM 959   C CD   . LYS A 1 69  ? -5.023  13.684  1.809   1.00 0.88  ? 1576 LYS A CD   1  
ATOM 960   C CE   . LYS A 1 69  ? -5.694  14.063  0.496   1.00 1.39  ? 1576 LYS A CE   1  
ATOM 961   N NZ   . LYS A 1 69  ? -7.175  14.025  0.575   1.00 2.19  ? 1576 LYS A NZ   1  
ATOM 962   H H    . LYS A 1 69  ? -4.088  9.077   -0.002  1.00 0.32  ? 1576 LYS A H    1  
ATOM 963   H HA   . LYS A 1 69  ? -4.243  9.701   2.799   1.00 0.33  ? 1576 LYS A HA   1  
ATOM 964   H HB2  . LYS A 1 69  ? -3.708  11.462  1.095   1.00 0.46  ? 1576 LYS A HB2  1  
ATOM 965   H HB3  . LYS A 1 69  ? -5.294  11.229  0.379   1.00 0.45  ? 1576 LYS A HB3  1  
ATOM 966   H HG2  . LYS A 1 69  ? -6.387  12.120  2.298   1.00 0.66  ? 1576 LYS A HG2  1  
ATOM 967   H HG3  . LYS A 1 69  ? -4.898  12.094  3.236   1.00 0.68  ? 1576 LYS A HG3  1  
ATOM 968   H HD2  . LYS A 1 69  ? -5.376  14.358  2.575   1.00 1.35  ? 1576 LYS A HD2  1  
ATOM 969   H HD3  . LYS A 1 69  ? -3.954  13.795  1.705   1.00 1.58  ? 1576 LYS A HD3  1  
ATOM 970   H HE2  . LYS A 1 69  ? -5.390  15.065  0.230   1.00 1.83  ? 1576 LYS A HE2  1  
ATOM 971   H HE3  . LYS A 1 69  ? -5.365  13.378  -0.272  1.00 2.02  ? 1576 LYS A HE3  1  
ATOM 972   H HZ1  . LYS A 1 69  ? -7.549  13.054  0.604   1.00 2.66  ? 1576 LYS A HZ1  1  
ATOM 973   H HZ2  . LYS A 1 69  ? -7.592  14.508  -0.249  1.00 2.68  ? 1576 LYS A HZ2  1  
ATOM 974   H HZ3  . LYS A 1 69  ? -7.523  14.533  1.418   1.00 2.63  ? 1576 LYS A HZ3  1  
ATOM 975   N N    . ALA A 1 70  ? -6.699  9.470   3.292   1.00 0.27  ? 1577 ALA A N    1  
ATOM 976   C CA   . ALA A 1 70  ? -8.008  9.006   3.717   1.00 0.30  ? 1577 ALA A CA   1  
ATOM 977   C C    . ALA A 1 70  ? -9.145  9.712   2.997   1.00 0.32  ? 1577 ALA A C    1  
ATOM 978   O O    . ALA A 1 70  ? -9.773  10.642  3.530   1.00 0.61  ? 1577 ALA A O    1  
ATOM 979   C CB   . ALA A 1 70  ? -8.152  9.166   5.208   1.00 0.38  ? 1577 ALA A CB   1  
ATOM 980   H H    . ALA A 1 70  ? -6.150  9.963   3.948   1.00 0.28  ? 1577 ALA A H    1  
ATOM 981   H HA   . ALA A 1 70  ? -8.064  7.951   3.495   1.00 0.33  ? 1577 ALA A HA   1  
ATOM 982   H HB1  . ALA A 1 70  ? -7.325  8.679   5.704   1.00 1.08  ? 1577 ALA A HB1  1  
ATOM 983   H HB2  . ALA A 1 70  ? -9.077  8.712   5.530   1.00 1.00  ? 1577 ALA A HB2  1  
ATOM 984   H HB3  . ALA A 1 70  ? -8.153  10.216  5.461   1.00 1.07  ? 1577 ALA A HB3  1  
ATOM 985   N N    . ASN A 1 71  ? -9.404  9.272   1.810   1.00 0.43  ? 1578 ASN A N    1  
ATOM 986   C CA   . ASN A 1 71  ? -10.480 9.784   0.997   1.00 0.54  ? 1578 ASN A CA   1  
ATOM 987   C C    . ASN A 1 71  ? -11.663 8.876   1.183   1.00 0.48  ? 1578 ASN A C    1  
ATOM 988   O O    . ASN A 1 71  ? -11.634 8.013   2.060   1.00 0.51  ? 1578 ASN A O    1  
ATOM 989   C CB   . ASN A 1 71  ? -10.069 9.865   -0.492  1.00 0.73  ? 1578 ASN A CB   1  
ATOM 990   C CG   . ASN A 1 71  ? -8.936  10.875  -0.742  1.00 1.15  ? 1578 ASN A CG   1  
ATOM 991   O OD1  . ASN A 1 71  ? -8.741  11.810  0.052   1.00 1.95  ? 1578 ASN A OD1  1  
ATOM 992   N ND2  . ASN A 1 71  ? -8.229  10.768  -1.863  1.00 1.31  ? 1578 ASN A ND2  1  
ATOM 993   H H    . ASN A 1 71  ? -8.842  8.539   1.472   1.00 0.67  ? 1578 ASN A H    1  
ATOM 994   H HA   . ASN A 1 71  ? -10.734 10.768  1.360   1.00 0.69  ? 1578 ASN A HA   1  
ATOM 995   H HB2  . ASN A 1 71  ? -9.753  8.873   -0.779  1.00 1.16  ? 1578 ASN A HB2  1  
ATOM 996   H HB3  . ASN A 1 71  ? -10.928 10.146  -1.084  1.00 1.31  ? 1578 ASN A HB3  1  
ATOM 997   H HD21 . ASN A 1 71  ? -8.393  10.076  -2.538  1.00 1.28  ? 1578 ASN A HD21 1  
ATOM 998   H HD22 . ASN A 1 71  ? -7.544  11.464  -1.987  1.00 1.88  ? 1578 ASN A HD22 1  
ATOM 999   N N    . LYS A 1 72  ? -12.708 9.062   0.430   1.00 0.56  ? 1579 LYS A N    1  
ATOM 1000  C CA   . LYS A 1 72  ? -13.861 8.212   0.589   1.00 0.61  ? 1579 LYS A CA   1  
ATOM 1001  C C    . LYS A 1 72  ? -14.591 8.063   -0.725  1.00 0.63  ? 1579 LYS A C    1  
ATOM 1002  O O    . LYS A 1 72  ? -15.832 8.136   -0.800  1.00 0.80  ? 1579 LYS A O    1  
ATOM 1003  C CB   . LYS A 1 72  ? -14.755 8.763   1.714   1.00 0.80  ? 1579 LYS A CB   1  
ATOM 1004  C CG   . LYS A 1 72  ? -15.205 10.202  1.528   1.00 1.30  ? 1579 LYS A CG   1  
ATOM 1005  C CD   . LYS A 1 72  ? -15.849 10.733  2.791   1.00 1.42  ? 1579 LYS A CD   1  
ATOM 1006  C CE   . LYS A 1 72  ? -14.824 10.887  3.906   1.00 2.07  ? 1579 LYS A CE   1  
ATOM 1007  N NZ   . LYS A 1 72  ? -15.445 11.329  5.162   1.00 2.68  ? 1579 LYS A NZ   1  
ATOM 1008  H H    . LYS A 1 72  ? -12.758 9.786   -0.242  1.00 0.65  ? 1579 LYS A H    1  
ATOM 1009  H HA   . LYS A 1 72  ? -13.499 7.238   0.883   1.00 0.61  ? 1579 LYS A HA   1  
ATOM 1010  H HB2  . LYS A 1 72  ? -15.638 8.146   1.784   1.00 1.24  ? 1579 LYS A HB2  1  
ATOM 1011  H HB3  . LYS A 1 72  ? -14.212 8.696   2.645   1.00 1.20  ? 1579 LYS A HB3  1  
ATOM 1012  H HG2  . LYS A 1 72  ? -14.345 10.810  1.286   1.00 1.84  ? 1579 LYS A HG2  1  
ATOM 1013  H HG3  . LYS A 1 72  ? -15.921 10.244  0.720   1.00 1.78  ? 1579 LYS A HG3  1  
ATOM 1014  H HD2  . LYS A 1 72  ? -16.289 11.697  2.584   1.00 1.78  ? 1579 LYS A HD2  1  
ATOM 1015  H HD3  . LYS A 1 72  ? -16.616 10.045  3.112   1.00 1.75  ? 1579 LYS A HD3  1  
ATOM 1016  H HE2  . LYS A 1 72  ? -14.340 9.934   4.069   1.00 2.51  ? 1579 LYS A HE2  1  
ATOM 1017  H HE3  . LYS A 1 72  ? -14.087 11.615  3.599   1.00 2.58  ? 1579 LYS A HE3  1  
ATOM 1018  H HZ1  . LYS A 1 72  ? -16.022 12.187  5.009   1.00 3.11  ? 1579 LYS A HZ1  1  
ATOM 1019  H HZ2  . LYS A 1 72  ? -14.733 11.558  5.888   1.00 3.11  ? 1579 LYS A HZ2  1  
ATOM 1020  H HZ3  . LYS A 1 72  ? -16.073 10.583  5.534   1.00 2.98  ? 1579 LYS A HZ3  1  
ATOM 1021  N N    . ARG A 1 73  ? -13.826 7.798   -1.766  1.00 0.58  ? 1580 ARG A N    1  
ATOM 1022  C CA   . ARG A 1 73  ? -14.383 7.732   -3.068  1.00 0.65  ? 1580 ARG A CA   1  
ATOM 1023  C C    . ARG A 1 73  ? -14.703 6.305   -3.393  1.00 0.57  ? 1580 ARG A C    1  
ATOM 1024  O O    . ARG A 1 73  ? -13.889 5.568   -3.982  1.00 0.61  ? 1580 ARG A O    1  
ATOM 1025  C CB   . ARG A 1 73  ? -13.472 8.363   -4.121  1.00 0.82  ? 1580 ARG A CB   1  
ATOM 1026  C CG   . ARG A 1 73  ? -14.172 8.490   -5.445  1.00 0.97  ? 1580 ARG A CG   1  
ATOM 1027  C CD   . ARG A 1 73  ? -13.391 9.294   -6.461  1.00 1.18  ? 1580 ARG A CD   1  
ATOM 1028  N NE   . ARG A 1 73  ? -12.115 8.684   -6.897  1.00 1.84  ? 1580 ARG A NE   1  
ATOM 1029  C CZ   . ARG A 1 73  ? -11.165 9.371   -7.563  1.00 2.52  ? 1580 ARG A CZ   1  
ATOM 1030  N NH1  . ARG A 1 73  ? -11.304 10.691  -7.733  1.00 2.72  ? 1580 ARG A NH1  1  
ATOM 1031  N NH2  . ARG A 1 73  ? -10.094 8.751   -8.057  1.00 3.47  ? 1580 ARG A NH2  1  
ATOM 1032  H H    . ARG A 1 73  ? -12.879 7.576   -1.653  1.00 0.57  ? 1580 ARG A H    1  
ATOM 1033  H HA   . ARG A 1 73  ? -15.315 8.277   -3.040  1.00 0.73  ? 1580 ARG A HA   1  
ATOM 1034  H HB2  . ARG A 1 73  ? -13.172 9.347   -3.791  1.00 0.91  ? 1580 ARG A HB2  1  
ATOM 1035  H HB3  . ARG A 1 73  ? -12.596 7.745   -4.260  1.00 0.81  ? 1580 ARG A HB3  1  
ATOM 1036  H HG2  . ARG A 1 73  ? -14.372 7.502   -5.829  1.00 1.23  ? 1580 ARG A HG2  1  
ATOM 1037  H HG3  . ARG A 1 73  ? -15.098 8.999   -5.219  1.00 1.23  ? 1580 ARG A HG3  1  
ATOM 1038  H HD2  . ARG A 1 73  ? -14.016 9.441   -7.330  1.00 1.51  ? 1580 ARG A HD2  1  
ATOM 1039  H HD3  . ARG A 1 73  ? -13.186 10.260  -6.024  1.00 1.74  ? 1580 ARG A HD3  1  
ATOM 1040  H HE   . ARG A 1 73  ? -12.010 7.721   -6.724  1.00 2.25  ? 1580 ARG A HE   1  
ATOM 1041  H HH11 . ARG A 1 73  ? -12.098 11.206  -7.385  1.00 2.59  ? 1580 ARG A HH11 1  
ATOM 1042  H HH12 . ARG A 1 73  ? -10.618 11.248  -8.220  1.00 3.38  ? 1580 ARG A HH12 1  
ATOM 1043  H HH21 . ARG A 1 73  ? -9.896  7.763   -7.991  1.00 3.87  ? 1580 ARG A HH21 1  
ATOM 1044  H HH22 . ARG A 1 73  ? -9.380  9.242   -8.578  1.00 4.04  ? 1580 ARG A HH22 1  
ATOM 1045  N N    . LEU A 1 74  ? -15.855 5.909   -2.958  1.00 0.55  ? 1581 LEU A N    1  
ATOM 1046  C CA   . LEU A 1 74  ? -16.325 4.572   -3.165  1.00 0.49  ? 1581 LEU A CA   1  
ATOM 1047  C C    . LEU A 1 74  ? -17.124 4.508   -4.444  1.00 0.46  ? 1581 LEU A C    1  
ATOM 1048  O O    . LEU A 1 74  ? -18.012 5.339   -4.670  1.00 0.51  ? 1581 LEU A O    1  
ATOM 1049  C CB   . LEU A 1 74  ? -17.195 4.108   -2.014  1.00 0.52  ? 1581 LEU A CB   1  
ATOM 1050  C CG   . LEU A 1 74  ? -17.282 2.590   -1.870  1.00 0.51  ? 1581 LEU A CG   1  
ATOM 1051  C CD1  . LEU A 1 74  ? -17.328 2.232   -0.457  1.00 0.64  ? 1581 LEU A CD1  1  
ATOM 1052  C CD2  . LEU A 1 74  ? -18.483 2.023   -2.605  1.00 0.61  ? 1581 LEU A CD2  1  
ATOM 1053  H H    . LEU A 1 74  ? -16.374 6.589   -2.480  1.00 0.66  ? 1581 LEU A H    1  
ATOM 1054  H HA   . LEU A 1 74  ? -15.454 3.932   -3.208  1.00 0.49  ? 1581 LEU A HA   1  
ATOM 1055  H HB2  . LEU A 1 74  ? -16.863 4.547   -1.085  1.00 0.57  ? 1581 LEU A HB2  1  
ATOM 1056  H HB3  . LEU A 1 74  ? -18.200 4.446   -2.246  1.00 0.54  ? 1581 LEU A HB3  1  
ATOM 1057  H HG   . LEU A 1 74  ? -16.404 2.063   -2.203  1.00 0.80  ? 1581 LEU A HG   1  
ATOM 1058  H HD11 . LEU A 1 74  ? -16.466 2.678   0.013   1.00 1.25  ? 1581 LEU A HD11 1  
ATOM 1059  H HD12 . LEU A 1 74  ? -17.240 1.156   -0.439  1.00 1.20  ? 1581 LEU A HD12 1  
ATOM 1060  H HD13 . LEU A 1 74  ? -18.249 2.531   0.021   1.00 1.28  ? 1581 LEU A HD13 1  
ATOM 1061  H HD21 . LEU A 1 74  ? -18.453 2.306   -3.647  1.00 1.32  ? 1581 LEU A HD21 1  
ATOM 1062  H HD22 . LEU A 1 74  ? -19.416 2.369   -2.180  1.00 1.16  ? 1581 LEU A HD22 1  
ATOM 1063  H HD23 . LEU A 1 74  ? -18.454 0.947   -2.546  1.00 1.21  ? 1581 LEU A HD23 1  
ATOM 1064  N N    . ARG A 1 75  ? -16.814 3.556   -5.260  1.00 0.43  ? 1582 ARG A N    1  
ATOM 1065  C CA   . ARG A 1 75  ? -17.495 3.347   -6.510  1.00 0.43  ? 1582 ARG A CA   1  
ATOM 1066  C C    . ARG A 1 75  ? -18.012 1.910   -6.597  1.00 0.39  ? 1582 ARG A C    1  
ATOM 1067  O O    . ARG A 1 75  ? -17.347 0.987   -6.138  1.00 0.40  ? 1582 ARG A O    1  
ATOM 1068  C CB   . ARG A 1 75  ? -16.588 3.721   -7.701  1.00 0.51  ? 1582 ARG A CB   1  
ATOM 1069  C CG   . ARG A 1 75  ? -16.322 5.219   -7.780  1.00 0.85  ? 1582 ARG A CG   1  
ATOM 1070  C CD   . ARG A 1 75  ? -15.488 5.612   -8.982  1.00 0.89  ? 1582 ARG A CD   1  
ATOM 1071  N NE   . ARG A 1 75  ? -14.117 5.062   -8.933  1.00 1.42  ? 1582 ARG A NE   1  
ATOM 1072  C CZ   . ARG A 1 75  ? -13.042 5.636   -9.502  1.00 1.83  ? 1582 ARG A CZ   1  
ATOM 1073  N NH1  . ARG A 1 75  ? -13.142 6.826   -10.095 1.00 1.54  ? 1582 ARG A NH1  1  
ATOM 1074  N NH2  . ARG A 1 75  ? -11.875 5.018   -9.448  1.00 2.85  ? 1582 ARG A NH2  1  
ATOM 1075  H H    . ARG A 1 75  ? -16.107 2.933   -4.971  1.00 0.43  ? 1582 ARG A H    1  
ATOM 1076  H HA   . ARG A 1 75  ? -18.326 4.033   -6.482  1.00 0.44  ? 1582 ARG A HA   1  
ATOM 1077  H HB2  . ARG A 1 75  ? -15.638 3.219   -7.581  1.00 0.85  ? 1582 ARG A HB2  1  
ATOM 1078  H HB3  . ARG A 1 75  ? -17.033 3.408   -8.634  1.00 0.77  ? 1582 ARG A HB3  1  
ATOM 1079  H HG2  . ARG A 1 75  ? -17.268 5.736   -7.839  1.00 1.16  ? 1582 ARG A HG2  1  
ATOM 1080  H HG3  . ARG A 1 75  ? -15.810 5.526   -6.878  1.00 1.23  ? 1582 ARG A HG3  1  
ATOM 1081  H HD2  . ARG A 1 75  ? -15.988 5.268   -9.876  1.00 1.48  ? 1582 ARG A HD2  1  
ATOM 1082  H HD3  . ARG A 1 75  ? -15.431 6.691   -9.013  1.00 1.27  ? 1582 ARG A HD3  1  
ATOM 1083  H HE   . ARG A 1 75  ? -14.004 4.198   -8.468  1.00 1.90  ? 1582 ARG A HE   1  
ATOM 1084  H HH11 . ARG A 1 75  ? -14.008 7.341   -10.148 1.00 1.41  ? 1582 ARG A HH11 1  
ATOM 1085  H HH12 . ARG A 1 75  ? -12.360 7.298   -10.529 1.00 1.89  ? 1582 ARG A HH12 1  
ATOM 1086  H HH21 . ARG A 1 75  ? -11.804 4.128   -8.980  1.00 3.40  ? 1582 ARG A HH21 1  
ATOM 1087  H HH22 . ARG A 1 75  ? -11.036 5.370   -9.881  1.00 3.24  ? 1582 ARG A HH22 1  
ATOM 1088  N N    . TYR A 1 76  ? -19.192 1.724   -7.144  1.00 0.41  ? 1583 TYR A N    1  
ATOM 1089  C CA   . TYR A 1 76  ? -19.778 0.415   -7.282  1.00 0.41  ? 1583 TYR A CA   1  
ATOM 1090  C C    . TYR A 1 76  ? -19.654 -0.026  -8.719  1.00 0.47  ? 1583 TYR A C    1  
ATOM 1091  O O    . TYR A 1 76  ? -20.370 0.454   -9.605  1.00 0.57  ? 1583 TYR A O    1  
ATOM 1092  C CB   . TYR A 1 76  ? -21.241 0.411   -6.817  1.00 0.50  ? 1583 TYR A CB   1  
ATOM 1093  C CG   . TYR A 1 76  ? -21.925 -0.935  -6.957  1.00 0.54  ? 1583 TYR A CG   1  
ATOM 1094  C CD1  . TYR A 1 76  ? -21.433 -2.061  -6.306  1.00 0.56  ? 1583 TYR A CD1  1  
ATOM 1095  C CD2  . TYR A 1 76  ? -23.037 -1.087  -7.766  1.00 0.78  ? 1583 TYR A CD2  1  
ATOM 1096  C CE1  . TYR A 1 76  ? -22.033 -3.287  -6.452  1.00 0.65  ? 1583 TYR A CE1  1  
ATOM 1097  C CE2  . TYR A 1 76  ? -23.632 -2.313  -7.920  1.00 0.86  ? 1583 TYR A CE2  1  
ATOM 1098  C CZ   . TYR A 1 76  ? -23.130 -3.409  -7.260  1.00 0.74  ? 1583 TYR A CZ   1  
ATOM 1099  O OH   . TYR A 1 76  ? -23.722 -4.638  -7.445  1.00 0.84  ? 1583 TYR A OH   1  
ATOM 1100  H H    . TYR A 1 76  ? -19.690 2.484   -7.530  1.00 0.47  ? 1583 TYR A H    1  
ATOM 1101  H HA   . TYR A 1 76  ? -19.213 -0.280  -6.680  1.00 0.36  ? 1583 TYR A HA   1  
ATOM 1102  H HB2  . TYR A 1 76  ? -21.261 0.685   -5.775  1.00 0.49  ? 1583 TYR A HB2  1  
ATOM 1103  H HB3  . TYR A 1 76  ? -21.799 1.137   -7.391  1.00 0.58  ? 1583 TYR A HB3  1  
ATOM 1104  H HD1  . TYR A 1 76  ? -20.566 -1.972  -5.672  1.00 0.69  ? 1583 TYR A HD1  1  
ATOM 1105  H HD2  . TYR A 1 76  ? -23.446 -0.230  -8.282  1.00 0.99  ? 1583 TYR A HD2  1  
ATOM 1106  H HE1  . TYR A 1 76  ? -21.637 -4.149  -5.934  1.00 0.79  ? 1583 TYR A HE1  1  
ATOM 1107  H HE2  . TYR A 1 76  ? -24.498 -2.416  -8.557  1.00 1.10  ? 1583 TYR A HE2  1  
ATOM 1108  H HH   . TYR A 1 76  ? -23.828 -5.134  -6.608  1.00 1.26  ? 1583 TYR A HH   1  
ATOM 1109  N N    . VAL A 1 77  ? -18.747 -0.923  -8.953  1.00 0.45  ? 1584 VAL A N    1  
ATOM 1110  C CA   . VAL A 1 77  ? -18.447 -1.361  -10.297 1.00 0.54  ? 1584 VAL A CA   1  
ATOM 1111  C C    . VAL A 1 77  ? -18.599 -2.871  -10.463 1.00 0.59  ? 1584 VAL A C    1  
ATOM 1112  O O    . VAL A 1 77  ? -17.680 -3.634  -10.198 1.00 0.57  ? 1584 VAL A O    1  
ATOM 1113  C CB   . VAL A 1 77  ? -17.037 -0.866  -10.792 1.00 0.58  ? 1584 VAL A CB   1  
ATOM 1114  C CG1  . VAL A 1 77  ? -17.050 0.642   -11.029 1.00 1.05  ? 1584 VAL A CG1  1  
ATOM 1115  C CG2  . VAL A 1 77  ? -15.934 -1.203  -9.785  1.00 1.03  ? 1584 VAL A CG2  1  
ATOM 1116  H H    . VAL A 1 77  ? -18.276 -1.326  -8.181  1.00 0.40  ? 1584 VAL A H    1  
ATOM 1117  H HA   . VAL A 1 77  ? -19.196 -0.902  -10.926 1.00 0.59  ? 1584 VAL A HA   1  
ATOM 1118  H HB   . VAL A 1 77  ? -16.818 -1.365  -11.726 1.00 1.00  ? 1584 VAL A HB   1  
ATOM 1119  H HG11 . VAL A 1 77  ? -17.785 0.891   -11.782 1.00 1.57  ? 1584 VAL A HG11 1  
ATOM 1120  H HG12 . VAL A 1 77  ? -16.074 0.969   -11.354 1.00 1.71  ? 1584 VAL A HG12 1  
ATOM 1121  H HG13 . VAL A 1 77  ? -17.301 1.144   -10.106 1.00 1.47  ? 1584 VAL A HG13 1  
ATOM 1122  H HG21 . VAL A 1 77  ? -14.987 -0.833  -10.151 1.00 1.59  ? 1584 VAL A HG21 1  
ATOM 1123  H HG22 . VAL A 1 77  ? -15.880 -2.275  -9.662  1.00 1.63  ? 1584 VAL A HG22 1  
ATOM 1124  H HG23 . VAL A 1 77  ? -16.164 -0.744  -8.836  1.00 1.49  ? 1584 VAL A HG23 1  
ATOM 1125  N N    . ASP A 1 78  ? -19.794 -3.289  -10.850 1.00 0.69  ? 1585 ASP A N    1  
ATOM 1126  C CA   . ASP A 1 78  ? -20.113 -4.710  -11.153 1.00 0.78  ? 1585 ASP A CA   1  
ATOM 1127  C C    . ASP A 1 78  ? -19.824 -5.616  -9.950  1.00 0.71  ? 1585 ASP A C    1  
ATOM 1128  O O    . ASP A 1 78  ? -18.861 -6.362  -9.929  1.00 0.70  ? 1585 ASP A O    1  
ATOM 1129  C CB   . ASP A 1 78  ? -19.391 -5.207  -12.443 1.00 0.88  ? 1585 ASP A CB   1  
ATOM 1130  C CG   . ASP A 1 78  ? -19.731 -6.641  -12.811 1.00 1.04  ? 1585 ASP A CG   1  
ATOM 1131  O OD1  . ASP A 1 78  ? -20.889 -6.920  -13.169 1.00 1.17  ? 1585 ASP A OD1  1  
ATOM 1132  O OD2  . ASP A 1 78  ? -18.833 -7.511  -12.784 1.00 1.11  ? 1585 ASP A OD2  1  
ATOM 1133  H H    . ASP A 1 78  ? -20.523 -2.625  -10.917 1.00 0.73  ? 1585 ASP A H    1  
ATOM 1134  H HA   . ASP A 1 78  ? -21.182 -4.741  -11.312 1.00 0.88  ? 1585 ASP A HA   1  
ATOM 1135  H HB2  . ASP A 1 78  ? -19.652 -4.594  -13.293 1.00 0.95  ? 1585 ASP A HB2  1  
ATOM 1136  H HB3  . ASP A 1 78  ? -18.325 -5.148  -12.285 1.00 0.83  ? 1585 ASP A HB3  1  
ATOM 1137  N N    . GLN A 1 79  ? -20.619 -5.401  -8.904  1.00 0.72  ? 1586 GLN A N    1  
ATOM 1138  C CA   . GLN A 1 79  ? -20.639 -6.124  -7.592  1.00 0.73  ? 1586 GLN A CA   1  
ATOM 1139  C C    . GLN A 1 79  ? -19.412 -5.798  -6.757  1.00 0.59  ? 1586 GLN A C    1  
ATOM 1140  O O    . GLN A 1 79  ? -19.275 -6.211  -5.618  1.00 0.65  ? 1586 GLN A O    1  
ATOM 1141  C CB   . GLN A 1 79  ? -20.871 -7.668  -7.684  1.00 0.90  ? 1586 GLN A CB   1  
ATOM 1142  C CG   . GLN A 1 79  ? -19.659 -8.515  -8.075  1.00 0.98  ? 1586 GLN A CG   1  
ATOM 1143  C CD   . GLN A 1 79  ? -19.934 -9.996  -7.969  1.00 1.23  ? 1586 GLN A CD   1  
ATOM 1144  O OE1  . GLN A 1 79  ? -20.359 -10.633 -8.920  1.00 1.61  ? 1586 GLN A OE1  1  
ATOM 1145  N NE2  . GLN A 1 79  ? -19.727 -10.541 -6.807  1.00 1.86  ? 1586 GLN A NE2  1  
ATOM 1146  H H    . GLN A 1 79  ? -21.245 -4.658  -8.998  1.00 0.77  ? 1586 GLN A H    1  
ATOM 1147  H HA   . GLN A 1 79  ? -21.467 -5.678  -7.059  1.00 0.80  ? 1586 GLN A HA   1  
ATOM 1148  H HB2  . GLN A 1 79  ? -21.211 -8.018  -6.721  1.00 0.93  ? 1586 GLN A HB2  1  
ATOM 1149  H HB3  . GLN A 1 79  ? -21.654 -7.847  -8.406  1.00 1.05  ? 1586 GLN A HB3  1  
ATOM 1150  H HG2  . GLN A 1 79  ? -19.387 -8.288  -9.094  1.00 1.03  ? 1586 GLN A HG2  1  
ATOM 1151  H HG3  . GLN A 1 79  ? -18.838 -8.266  -7.419  1.00 0.92  ? 1586 GLN A HG3  1  
ATOM 1152  H HE21 . GLN A 1 79  ? -19.404 -9.959  -6.077  1.00 2.43  ? 1586 GLN A HE21 1  
ATOM 1153  H HE22 . GLN A 1 79  ? -19.905 -11.497 -6.683  1.00 2.04  ? 1586 GLN A HE22 1  
ATOM 1154  N N    . VAL A 1 80  ? -18.554 -5.040  -7.325  1.00 0.48  ? 1587 VAL A N    1  
ATOM 1155  C CA   . VAL A 1 80  ? -17.336 -4.674  -6.706  1.00 0.39  ? 1587 VAL A CA   1  
ATOM 1156  C C    . VAL A 1 80  ? -17.449 -3.304  -6.063  1.00 0.32  ? 1587 VAL A C    1  
ATOM 1157  O O    . VAL A 1 80  ? -17.787 -2.312  -6.734  1.00 0.33  ? 1587 VAL A O    1  
ATOM 1158  C CB   . VAL A 1 80  ? -16.165 -4.742  -7.729  1.00 0.41  ? 1587 VAL A CB   1  
ATOM 1159  C CG1  . VAL A 1 80  ? -14.955 -4.005  -7.234  1.00 0.37  ? 1587 VAL A CG1  1  
ATOM 1160  C CG2  . VAL A 1 80  ? -15.797 -6.193  -8.007  1.00 0.49  ? 1587 VAL A CG2  1  
ATOM 1161  H H    . VAL A 1 80  ? -18.761 -4.705  -8.222  1.00 0.53  ? 1587 VAL A H    1  
ATOM 1162  H HA   . VAL A 1 80  ? -17.148 -5.399  -5.931  1.00 0.42  ? 1587 VAL A HA   1  
ATOM 1163  H HB   . VAL A 1 80  ? -16.482 -4.301  -8.663  1.00 0.45  ? 1587 VAL A HB   1  
ATOM 1164  H HG11 . VAL A 1 80  ? -14.184 -4.041  -7.989  1.00 1.01  ? 1587 VAL A HG11 1  
ATOM 1165  H HG12 . VAL A 1 80  ? -14.617 -4.479  -6.328  1.00 1.02  ? 1587 VAL A HG12 1  
ATOM 1166  H HG13 . VAL A 1 80  ? -15.255 -2.983  -7.060  1.00 1.09  ? 1587 VAL A HG13 1  
ATOM 1167  H HG21 . VAL A 1 80  ? -15.493 -6.666  -7.085  1.00 1.13  ? 1587 VAL A HG21 1  
ATOM 1168  H HG22 . VAL A 1 80  ? -14.983 -6.228  -8.714  1.00 1.07  ? 1587 VAL A HG22 1  
ATOM 1169  H HG23 . VAL A 1 80  ? -16.648 -6.718  -8.416  1.00 1.16  ? 1587 VAL A HG23 1  
ATOM 1170  N N    . LEU A 1 81  ? -17.223 -3.265  -4.764  1.00 0.28  ? 1588 LEU A N    1  
ATOM 1171  C CA   . LEU A 1 81  ? -17.209 -2.033  -4.028  1.00 0.25  ? 1588 LEU A CA   1  
ATOM 1172  C C    . LEU A 1 81  ? -15.782 -1.540  -4.016  1.00 0.24  ? 1588 LEU A C    1  
ATOM 1173  O O    . LEU A 1 81  ? -14.922 -2.115  -3.346  1.00 0.28  ? 1588 LEU A O    1  
ATOM 1174  C CB   . LEU A 1 81  ? -17.718 -2.237  -2.576  1.00 0.28  ? 1588 LEU A CB   1  
ATOM 1175  C CG   . LEU A 1 81  ? -19.225 -2.509  -2.343  1.00 0.30  ? 1588 LEU A CG   1  
ATOM 1176  C CD1  . LEU A 1 81  ? -20.039 -1.311  -2.720  1.00 0.29  ? 1588 LEU A CD1  1  
ATOM 1177  C CD2  . LEU A 1 81  ? -19.725 -3.730  -3.091  1.00 0.36  ? 1588 LEU A CD2  1  
ATOM 1178  H H    . LEU A 1 81  ? -17.045 -4.100  -4.268  1.00 0.30  ? 1588 LEU A H    1  
ATOM 1179  H HA   . LEU A 1 81  ? -17.842 -1.322  -4.541  1.00 0.23  ? 1588 LEU A HA   1  
ATOM 1180  H HB2  . LEU A 1 81  ? -17.176 -3.074  -2.160  1.00 0.34  ? 1588 LEU A HB2  1  
ATOM 1181  H HB3  . LEU A 1 81  ? -17.448 -1.360  -2.005  1.00 0.29  ? 1588 LEU A HB3  1  
ATOM 1182  H HG   . LEU A 1 81  ? -19.377 -2.671  -1.285  1.00 0.34  ? 1588 LEU A HG   1  
ATOM 1183  H HD11 . LEU A 1 81  ? -19.771 -0.988  -3.714  1.00 1.02  ? 1588 LEU A HD11 1  
ATOM 1184  H HD12 . LEU A 1 81  ? -19.850 -0.516  -2.016  1.00 1.04  ? 1588 LEU A HD12 1  
ATOM 1185  H HD13 . LEU A 1 81  ? -21.085 -1.573  -2.699  1.00 1.06  ? 1588 LEU A HD13 1  
ATOM 1186  H HD21 . LEU A 1 81  ? -19.106 -4.580  -2.849  1.00 0.97  ? 1588 LEU A HD21 1  
ATOM 1187  H HD22 . LEU A 1 81  ? -19.663 -3.531  -4.151  1.00 1.00  ? 1588 LEU A HD22 1  
ATOM 1188  H HD23 . LEU A 1 81  ? -20.749 -3.923  -2.808  1.00 1.11  ? 1588 LEU A HD23 1  
ATOM 1189  N N    . GLN A 1 82  ? -15.528 -0.520  -4.764  1.00 0.24  ? 1589 GLN A N    1  
ATOM 1190  C CA   . GLN A 1 82  ? -14.200 0.014   -4.901  1.00 0.25  ? 1589 GLN A CA   1  
ATOM 1191  C C    . GLN A 1 82  ? -14.042 1.197   -4.004  1.00 0.24  ? 1589 GLN A C    1  
ATOM 1192  O O    . GLN A 1 82  ? -14.832 2.120   -4.054  1.00 0.36  ? 1589 GLN A O    1  
ATOM 1193  C CB   . GLN A 1 82  ? -13.914 0.458   -6.339  1.00 0.39  ? 1589 GLN A CB   1  
ATOM 1194  C CG   . GLN A 1 82  ? -12.498 0.958   -6.544  1.00 0.48  ? 1589 GLN A CG   1  
ATOM 1195  C CD   . GLN A 1 82  ? -12.315 1.573   -7.895  1.00 0.75  ? 1589 GLN A CD   1  
ATOM 1196  O OE1  . GLN A 1 82  ? -12.505 2.775   -8.069  1.00 1.74  ? 1589 GLN A OE1  1  
ATOM 1197  N NE2  . GLN A 1 82  ? -11.977 0.778   -8.851  1.00 0.66  ? 1589 GLN A NE2  1  
ATOM 1198  H H    . GLN A 1 82  ? -16.281 -0.087  -5.225  1.00 0.27  ? 1589 GLN A H    1  
ATOM 1199  H HA   . GLN A 1 82  ? -13.496 -0.758  -4.628  1.00 0.30  ? 1589 GLN A HA   1  
ATOM 1200  H HB2  . GLN A 1 82  ? -14.080 -0.362  -7.021  1.00 0.50  ? 1589 GLN A HB2  1  
ATOM 1201  H HB3  . GLN A 1 82  ? -14.564 1.279   -6.612  1.00 0.46  ? 1589 GLN A HB3  1  
ATOM 1202  H HG2  . GLN A 1 82  ? -12.285 1.714   -5.802  1.00 0.53  ? 1589 GLN A HG2  1  
ATOM 1203  H HG3  . GLN A 1 82  ? -11.810 0.133   -6.437  1.00 0.66  ? 1589 GLN A HG3  1  
ATOM 1204  H HE21 . GLN A 1 82  ? -11.863 -0.176  -8.642  1.00 1.25  ? 1589 GLN A HE21 1  
ATOM 1205  H HE22 . GLN A 1 82  ? -11.846 1.137   -9.761  1.00 0.79  ? 1589 GLN A HE22 1  
ATOM 1206  N N    . LEU A 1 83  ? -13.048 1.169   -3.206  1.00 0.25  ? 1590 LEU A N    1  
ATOM 1207  C CA   . LEU A 1 83  ? -12.730 2.270   -2.357  1.00 0.30  ? 1590 LEU A CA   1  
ATOM 1208  C C    . LEU A 1 83  ? -11.304 2.663   -2.745  1.00 0.30  ? 1590 LEU A C    1  
ATOM 1209  O O    . LEU A 1 83  ? -10.350 1.986   -2.385  1.00 0.37  ? 1590 LEU A O    1  
ATOM 1210  C CB   . LEU A 1 83  ? -12.809 1.808   -0.888  1.00 0.37  ? 1590 LEU A CB   1  
ATOM 1211  C CG   . LEU A 1 83  ? -13.156 2.855   0.185   1.00 0.41  ? 1590 LEU A CG   1  
ATOM 1212  C CD1  . LEU A 1 83  ? -13.108 2.236   1.564   1.00 0.56  ? 1590 LEU A CD1  1  
ATOM 1213  C CD2  . LEU A 1 83  ? -12.252 4.055   0.115   1.00 0.72  ? 1590 LEU A CD2  1  
ATOM 1214  H H    . LEU A 1 83  ? -12.487 0.360   -3.187  1.00 0.30  ? 1590 LEU A H    1  
ATOM 1215  H HA   . LEU A 1 83  ? -13.417 3.083   -2.545  1.00 0.31  ? 1590 LEU A HA   1  
ATOM 1216  H HB2  . LEU A 1 83  ? -13.533 1.010   -0.827  1.00 0.57  ? 1590 LEU A HB2  1  
ATOM 1217  H HB3  . LEU A 1 83  ? -11.846 1.387   -0.637  1.00 0.64  ? 1590 LEU A HB3  1  
ATOM 1218  H HG   . LEU A 1 83  ? -14.174 3.180   0.023   1.00 0.76  ? 1590 LEU A HG   1  
ATOM 1219  H HD11 . LEU A 1 83  ? -12.117 1.844   1.744   1.00 1.11  ? 1590 LEU A HD11 1  
ATOM 1220  H HD12 . LEU A 1 83  ? -13.835 1.441   1.624   1.00 1.26  ? 1590 LEU A HD12 1  
ATOM 1221  H HD13 . LEU A 1 83  ? -13.335 2.993   2.301   1.00 1.16  ? 1590 LEU A HD13 1  
ATOM 1222  H HD21 . LEU A 1 83  ? -12.452 4.709   0.951   1.00 1.30  ? 1590 LEU A HD21 1  
ATOM 1223  H HD22 . LEU A 1 83  ? -12.482 4.572   -0.804  1.00 1.23  ? 1590 LEU A HD22 1  
ATOM 1224  H HD23 . LEU A 1 83  ? -11.225 3.714   0.132   1.00 1.40  ? 1590 LEU A HD23 1  
ATOM 1225  N N    . VAL A 1 84  ? -11.167 3.686   -3.540  1.00 0.31  ? 1591 VAL A N    1  
ATOM 1226  C CA   . VAL A 1 84  ? -9.856  4.047   -4.047  1.00 0.31  ? 1591 VAL A CA   1  
ATOM 1227  C C    . VAL A 1 84  ? -9.214  5.193   -3.221  1.00 0.31  ? 1591 VAL A C    1  
ATOM 1228  O O    . VAL A 1 84  ? -9.871  6.197   -2.892  1.00 0.38  ? 1591 VAL A O    1  
ATOM 1229  C CB   . VAL A 1 84  ? -9.920  4.380   -5.583  1.00 0.35  ? 1591 VAL A CB   1  
ATOM 1230  C CG1  . VAL A 1 84  ? -10.518 5.744   -5.874  1.00 1.01  ? 1591 VAL A CG1  1  
ATOM 1231  C CG2  . VAL A 1 84  ? -8.578  4.191   -6.279  1.00 0.81  ? 1591 VAL A CG2  1  
ATOM 1232  H H    . VAL A 1 84  ? -11.959 4.210   -3.788  1.00 0.39  ? 1591 VAL A H    1  
ATOM 1233  H HA   . VAL A 1 84  ? -9.219  3.185   -3.919  1.00 0.29  ? 1591 VAL A HA   1  
ATOM 1234  H HB   . VAL A 1 84  ? -10.609 3.659   -6.001  1.00 0.74  ? 1591 VAL A HB   1  
ATOM 1235  H HG11 . VAL A 1 84  ? -11.542 5.807   -5.540  1.00 1.70  ? 1591 VAL A HG11 1  
ATOM 1236  H HG12 . VAL A 1 84  ? -10.468 5.941   -6.935  1.00 1.50  ? 1591 VAL A HG12 1  
ATOM 1237  H HG13 . VAL A 1 84  ? -9.920  6.470   -5.339  1.00 1.49  ? 1591 VAL A HG13 1  
ATOM 1238  H HG21 . VAL A 1 84  ? -7.836  4.868   -5.883  1.00 1.29  ? 1591 VAL A HG21 1  
ATOM 1239  H HG22 . VAL A 1 84  ? -8.713  4.385   -7.334  1.00 1.42  ? 1591 VAL A HG22 1  
ATOM 1240  H HG23 . VAL A 1 84  ? -8.254  3.167   -6.159  1.00 1.49  ? 1591 VAL A HG23 1  
ATOM 1241  N N    . TYR A 1 85  ? -7.958  5.004   -2.843  1.00 0.27  ? 1592 TYR A N    1  
ATOM 1242  C CA   . TYR A 1 85  ? -7.191  6.007   -2.128  1.00 0.27  ? 1592 TYR A CA   1  
ATOM 1243  C C    . TYR A 1 85  ? -6.038  6.415   -3.003  1.00 0.29  ? 1592 TYR A C    1  
ATOM 1244  O O    . TYR A 1 85  ? -5.439  5.582   -3.657  1.00 0.50  ? 1592 TYR A O    1  
ATOM 1245  C CB   . TYR A 1 85  ? -6.631  5.494   -0.783  1.00 0.25  ? 1592 TYR A CB   1  
ATOM 1246  C CG   . TYR A 1 85  ? -7.636  5.208   0.324   1.00 0.23  ? 1592 TYR A CG   1  
ATOM 1247  C CD1  . TYR A 1 85  ? -8.673  6.090   0.622   1.00 0.31  ? 1592 TYR A CD1  1  
ATOM 1248  C CD2  . TYR A 1 85  ? -7.522  4.066   1.102   1.00 0.30  ? 1592 TYR A CD2  1  
ATOM 1249  C CE1  . TYR A 1 85  ? -9.543  5.837   1.645   1.00 0.34  ? 1592 TYR A CE1  1  
ATOM 1250  C CE2  . TYR A 1 85  ? -8.401  3.825   2.139   1.00 0.33  ? 1592 TYR A CE2  1  
ATOM 1251  C CZ   . TYR A 1 85  ? -9.403  4.714   2.397   1.00 0.31  ? 1592 TYR A CZ   1  
ATOM 1252  O OH   . TYR A 1 85  ? -10.261 4.482   3.428   1.00 0.38  ? 1592 TYR A OH   1  
ATOM 1253  H H    . TYR A 1 85  ? -7.491  4.169   -3.077  1.00 0.28  ? 1592 TYR A H    1  
ATOM 1254  H HA   . TYR A 1 85  ? -7.807  6.880   -1.958  1.00 0.29  ? 1592 TYR A HA   1  
ATOM 1255  H HB2  . TYR A 1 85  ? -6.096  4.573   -0.962  1.00 0.25  ? 1592 TYR A HB2  1  
ATOM 1256  H HB3  . TYR A 1 85  ? -5.928  6.223   -0.405  1.00 0.27  ? 1592 TYR A HB3  1  
ATOM 1257  H HD1  . TYR A 1 85  ? -8.831  6.993   0.056   1.00 0.41  ? 1592 TYR A HD1  1  
ATOM 1258  H HD2  . TYR A 1 85  ? -6.729  3.362   0.896   1.00 0.40  ? 1592 TYR A HD2  1  
ATOM 1259  H HE1  . TYR A 1 85  ? -10.340 6.536   1.856   1.00 0.46  ? 1592 TYR A HE1  1  
ATOM 1260  H HE2  . TYR A 1 85  ? -8.317  2.942   2.750   1.00 0.43  ? 1592 TYR A HE2  1  
ATOM 1261  H HH   . TYR A 1 85  ? -9.716  4.255   4.193   1.00 1.08  ? 1592 TYR A HH   1  
ATOM 1262  N N    . LYS A 1 86  ? -5.718  7.663   -2.969  1.00 0.33  ? 1593 LYS A N    1  
ATOM 1263  C CA   . LYS A 1 86  ? -4.721  8.271   -3.786  1.00 0.36  ? 1593 LYS A CA   1  
ATOM 1264  C C    . LYS A 1 86  ? -4.121  9.368   -2.970  1.00 0.37  ? 1593 LYS A C    1  
ATOM 1265  O O    . LYS A 1 86  ? -4.536  9.539   -1.808  1.00 0.40  ? 1593 LYS A O    1  
ATOM 1266  C CB   . LYS A 1 86  ? -5.383  8.825   -5.058  1.00 0.46  ? 1593 LYS A CB   1  
ATOM 1267  C CG   . LYS A 1 86  ? -6.676  9.608   -4.785  1.00 0.57  ? 1593 LYS A CG   1  
ATOM 1268  C CD   . LYS A 1 86  ? -7.406  9.980   -6.064  1.00 0.90  ? 1593 LYS A CD   1  
ATOM 1269  C CE   . LYS A 1 86  ? -6.682  11.049  -6.858  1.00 0.99  ? 1593 LYS A CE   1  
ATOM 1270  N NZ   . LYS A 1 86  ? -6.700  12.359  -6.183  1.00 1.59  ? 1593 LYS A NZ   1  
ATOM 1271  H H    . LYS A 1 86  ? -6.119  8.277   -2.326  1.00 0.51  ? 1593 LYS A H    1  
ATOM 1272  H HA   . LYS A 1 86  ? -3.971  7.538   -4.051  1.00 0.38  ? 1593 LYS A HA   1  
ATOM 1273  H HB2  . LYS A 1 86  ? -4.682  9.487   -5.543  1.00 0.55  ? 1593 LYS A HB2  1  
ATOM 1274  H HB3  . LYS A 1 86  ? -5.606  8.005   -5.722  1.00 0.49  ? 1593 LYS A HB3  1  
ATOM 1275  H HG2  . LYS A 1 86  ? -7.330  8.996   -4.181  1.00 0.91  ? 1593 LYS A HG2  1  
ATOM 1276  H HG3  . LYS A 1 86  ? -6.426  10.509  -4.244  1.00 0.87  ? 1593 LYS A HG3  1  
ATOM 1277  H HD2  . LYS A 1 86  ? -7.497  9.100   -6.682  1.00 1.53  ? 1593 LYS A HD2  1  
ATOM 1278  H HD3  . LYS A 1 86  ? -8.391  10.341  -5.806  1.00 1.50  ? 1593 LYS A HD3  1  
ATOM 1279  H HE2  . LYS A 1 86  ? -5.655  10.736  -6.957  1.00 1.55  ? 1593 LYS A HE2  1  
ATOM 1280  H HE3  . LYS A 1 86  ? -7.135  11.137  -7.835  1.00 1.51  ? 1593 LYS A HE3  1  
ATOM 1281  H HZ1  . LYS A 1 86  ? -7.675  12.630  -5.930  1.00 1.91  ? 1593 LYS A HZ1  1  
ATOM 1282  H HZ2  . LYS A 1 86  ? -6.315  13.092  -6.817  1.00 2.21  ? 1593 LYS A HZ2  1  
ATOM 1283  H HZ3  . LYS A 1 86  ? -6.111  12.375  -5.319  1.00 2.06  ? 1593 LYS A HZ3  1  
ATOM 1284  N N    . ASP A 1 87  ? -3.173  10.095  -3.538  1.00 0.44  ? 1594 ASP A N    1  
ATOM 1285  C CA   . ASP A 1 87  ? -2.509  11.210  -2.855  1.00 0.51  ? 1594 ASP A CA   1  
ATOM 1286  C C    . ASP A 1 87  ? -1.785  10.720  -1.626  1.00 0.42  ? 1594 ASP A C    1  
ATOM 1287  O O    . ASP A 1 87  ? -1.924  11.282  -0.529  1.00 0.53  ? 1594 ASP A O    1  
ATOM 1288  C CB   . ASP A 1 87  ? -3.490  12.347  -2.481  1.00 0.70  ? 1594 ASP A CB   1  
ATOM 1289  C CG   . ASP A 1 87  ? -4.077  13.058  -3.666  1.00 0.93  ? 1594 ASP A CG   1  
ATOM 1290  O OD1  . ASP A 1 87  ? -3.416  13.976  -4.222  1.00 1.11  ? 1594 ASP A OD1  1  
ATOM 1291  O OD2  . ASP A 1 87  ? -5.224  12.745  -4.056  1.00 1.05  ? 1594 ASP A OD2  1  
ATOM 1292  H H    . ASP A 1 87  ? -2.884  9.879   -4.458  1.00 0.50  ? 1594 ASP A H    1  
ATOM 1293  H HA   . ASP A 1 87  ? -1.770  11.599  -3.540  1.00 0.60  ? 1594 ASP A HA   1  
ATOM 1294  H HB2  . ASP A 1 87  ? -4.307  11.917  -1.920  1.00 0.69  ? 1594 ASP A HB2  1  
ATOM 1295  H HB3  . ASP A 1 87  ? -2.977  13.065  -1.859  1.00 0.78  ? 1594 ASP A HB3  1  
ATOM 1296  N N    . GLY A 1 88  ? -1.040  9.650   -1.793  1.00 0.41  ? 1595 GLY A N    1  
ATOM 1297  C CA   . GLY A 1 88  ? -0.276  9.119   -0.704  1.00 0.48  ? 1595 GLY A CA   1  
ATOM 1298  C C    . GLY A 1 88  ? 1.024   9.857   -0.583  1.00 0.53  ? 1595 GLY A C    1  
ATOM 1299  O O    . GLY A 1 88  ? 1.075   11.073  -0.770  1.00 0.78  ? 1595 GLY A O    1  
ATOM 1300  H H    . GLY A 1 88  ? -0.990  9.238   -2.682  1.00 0.49  ? 1595 GLY A H    1  
ATOM 1301  H HA2  . GLY A 1 88  ? -0.838  9.215   0.214   1.00 0.54  ? 1595 GLY A HA2  1  
ATOM 1302  H HA3  . GLY A 1 88  ? -0.064  8.078   -0.895  1.00 0.56  ? 1595 GLY A HA3  1  
ATOM 1303  N N    . SER A 1 89  ? 2.064   9.166   -0.297  1.00 0.44  ? 1596 SER A N    1  
ATOM 1304  C CA   . SER A 1 89  ? 3.342   9.800   -0.249  1.00 0.50  ? 1596 SER A CA   1  
ATOM 1305  C C    . SER A 1 89  ? 4.078   9.442   -1.518  1.00 0.47  ? 1596 SER A C    1  
ATOM 1306  O O    . SER A 1 89  ? 3.704   8.449   -2.184  1.00 0.44  ? 1596 SER A O    1  
ATOM 1307  C CB   . SER A 1 89  ? 4.124   9.407   1.027   1.00 0.68  ? 1596 SER A CB   1  
ATOM 1308  O OG   . SER A 1 89  ? 4.277   8.012   1.159   1.00 1.07  ? 1596 SER A OG   1  
ATOM 1309  H H    . SER A 1 89  ? 1.985   8.196   -0.154  1.00 0.47  ? 1596 SER A H    1  
ATOM 1310  H HA   . SER A 1 89  ? 3.168   10.867  -0.255  1.00 0.57  ? 1596 SER A HA   1  
ATOM 1311  H HB2  . SER A 1 89  ? 5.105   9.854   0.991   1.00 1.17  ? 1596 SER A HB2  1  
ATOM 1312  H HB3  . SER A 1 89  ? 3.597   9.787   1.891   1.00 1.13  ? 1596 SER A HB3  1  
ATOM 1313  H HG   . SER A 1 89  ? 3.560   7.551   0.704   1.00 1.36  ? 1596 SER A HG   1  
ATOM 1314  N N    . PRO A 1 90  ? 5.053   10.267  -1.934  1.00 0.56  ? 1597 PRO A N    1  
ATOM 1315  C CA   . PRO A 1 90  ? 5.845   9.998   -3.117  1.00 0.62  ? 1597 PRO A CA   1  
ATOM 1316  C C    . PRO A 1 90  ? 6.494   8.615   -3.049  1.00 0.59  ? 1597 PRO A C    1  
ATOM 1317  O O    . PRO A 1 90  ? 7.200   8.284   -2.086  1.00 0.70  ? 1597 PRO A O    1  
ATOM 1318  C CB   . PRO A 1 90  ? 6.895   11.108  -3.112  1.00 0.80  ? 1597 PRO A CB   1  
ATOM 1319  C CG   . PRO A 1 90  ? 6.262   12.209  -2.353  1.00 1.01  ? 1597 PRO A CG   1  
ATOM 1320  C CD   . PRO A 1 90  ? 5.449   11.542  -1.293  1.00 0.66  ? 1597 PRO A CD   1  
ATOM 1321  H HA   . PRO A 1 90  ? 5.242   10.061  -4.011  1.00 0.65  ? 1597 PRO A HA   1  
ATOM 1322  H HB2  . PRO A 1 90  ? 7.794   10.756  -2.628  1.00 0.86  ? 1597 PRO A HB2  1  
ATOM 1323  H HB3  . PRO A 1 90  ? 7.118   11.405  -4.127  1.00 0.90  ? 1597 PRO A HB3  1  
ATOM 1324  H HG2  . PRO A 1 90  ? 7.023   12.834  -1.908  1.00 1.35  ? 1597 PRO A HG2  1  
ATOM 1325  H HG3  . PRO A 1 90  ? 5.626   12.791  -3.003  1.00 1.40  ? 1597 PRO A HG3  1  
ATOM 1326  H HD2  . PRO A 1 90  ? 6.047   11.364  -0.412  1.00 0.75  ? 1597 PRO A HD2  1  
ATOM 1327  H HD3  . PRO A 1 90  ? 4.579   12.135  -1.051  1.00 0.79  ? 1597 PRO A HD3  1  
ATOM 1328  N N    . CYS A 1 91  ? 6.227   7.816   -4.043  1.00 0.52  ? 1598 CYS A N    1  
ATOM 1329  C CA   . CYS A 1 91  ? 6.734   6.466   -4.111  1.00 0.53  ? 1598 CYS A CA   1  
ATOM 1330  C C    . CYS A 1 91  ? 8.226   6.520   -4.474  1.00 0.71  ? 1598 CYS A C    1  
ATOM 1331  O O    . CYS A 1 91  ? 8.587   7.066   -5.510  1.00 0.75  ? 1598 CYS A O    1  
ATOM 1332  C CB   . CYS A 1 91  ? 5.925   5.654   -5.158  1.00 0.51  ? 1598 CYS A CB   1  
ATOM 1333  S SG   . CYS A 1 91  ? 6.266   3.862   -5.156  1.00 0.54  ? 1598 CYS A SG   1  
ATOM 1334  H H    . CYS A 1 91  ? 5.672   8.178   -4.769  1.00 0.52  ? 1598 CYS A H    1  
ATOM 1335  H HA   . CYS A 1 91  ? 6.621   6.015   -3.134  1.00 0.54  ? 1598 CYS A HA   1  
ATOM 1336  H HB2  . CYS A 1 91  ? 4.872   5.775   -4.953  1.00 0.52  ? 1598 CYS A HB2  1  
ATOM 1337  H HB3  . CYS A 1 91  ? 6.130   6.028   -6.152  1.00 0.60  ? 1598 CYS A HB3  1  
ATOM 1338  N N    . PRO A 1 92  ? 9.110   5.978   -3.606  1.00 0.90  ? 1599 PRO A N    1  
ATOM 1339  C CA   . PRO A 1 92  ? 10.581  6.035   -3.790  1.00 1.18  ? 1599 PRO A CA   1  
ATOM 1340  C C    . PRO A 1 92  ? 11.053  5.308   -5.048  1.00 1.35  ? 1599 PRO A C    1  
ATOM 1341  O O    . PRO A 1 92  ? 12.168  5.526   -5.521  1.00 1.70  ? 1599 PRO A O    1  
ATOM 1342  C CB   . PRO A 1 92  ? 11.133  5.324   -2.544  1.00 1.28  ? 1599 PRO A CB   1  
ATOM 1343  C CG   . PRO A 1 92  ? 10.010  5.320   -1.566  1.00 1.18  ? 1599 PRO A CG   1  
ATOM 1344  C CD   . PRO A 1 92  ? 8.754   5.262   -2.373  1.00 0.93  ? 1599 PRO A CD   1  
ATOM 1345  H HA   . PRO A 1 92  ? 10.936  7.055   -3.811  1.00 1.31  ? 1599 PRO A HA   1  
ATOM 1346  H HB2  . PRO A 1 92  ? 11.430  4.320   -2.806  1.00 1.41  ? 1599 PRO A HB2  1  
ATOM 1347  H HB3  . PRO A 1 92  ? 11.984  5.869   -2.163  1.00 1.45  ? 1599 PRO A HB3  1  
ATOM 1348  H HG2  . PRO A 1 92  ? 10.084  4.451   -0.927  1.00 1.37  ? 1599 PRO A HG2  1  
ATOM 1349  H HG3  . PRO A 1 92  ? 10.035  6.223   -0.974  1.00 1.36  ? 1599 PRO A HG3  1  
ATOM 1350  H HD2  . PRO A 1 92  ? 8.486   4.238   -2.586  1.00 0.99  ? 1599 PRO A HD2  1  
ATOM 1351  H HD3  . PRO A 1 92  ? 7.952   5.766   -1.856  1.00 0.91  ? 1599 PRO A HD3  1  
ATOM 1352  N N    . SER A 1 93  ? 10.201  4.436   -5.541  1.00 1.31  ? 1600 SER A N    1  
ATOM 1353  C CA   . SER A 1 93  ? 10.418  3.650   -6.737  1.00 1.59  ? 1600 SER A CA   1  
ATOM 1354  C C    . SER A 1 93  ? 10.658  4.541   -7.979  1.00 1.38  ? 1600 SER A C    1  
ATOM 1355  O O    . SER A 1 93  ? 11.486  4.223   -8.847  1.00 1.40  ? 1600 SER A O    1  
ATOM 1356  C CB   . SER A 1 93  ? 9.176   2.805   -6.943  1.00 1.93  ? 1600 SER A CB   1  
ATOM 1357  O OG   . SER A 1 93  ? 8.801   2.190   -5.715  1.00 2.26  ? 1600 SER A OG   1  
ATOM 1358  H H    . SER A 1 93  ? 9.372   4.266   -5.049  1.00 1.26  ? 1600 SER A H    1  
ATOM 1359  H HA   . SER A 1 93  ? 11.256  2.986   -6.584  1.00 1.89  ? 1600 SER A HA   1  
ATOM 1360  H HB2  . SER A 1 93  ? 8.365   3.430   -7.288  1.00 1.88  ? 1600 SER A HB2  1  
ATOM 1361  H HB3  . SER A 1 93  ? 9.378   2.033   -7.670  1.00 2.21  ? 1600 SER A HB3  1  
ATOM 1362  H HG   . SER A 1 93  ? 7.840   2.108   -5.715  1.00 2.80  ? 1600 SER A HG   1  
ATOM 1363  N N    . LYS A 1 94  ? 9.944   5.642   -8.041  1.00 1.28  ? 1601 LYS A N    1  
ATOM 1364  C CA   . LYS A 1 94  ? 10.037  6.570   -9.127  1.00 1.26  ? 1601 LYS A CA   1  
ATOM 1365  C C    . LYS A 1 94  ? 9.751   7.921   -8.497  1.00 1.10  ? 1601 LYS A C    1  
ATOM 1366  O O    . LYS A 1 94  ? 8.628   8.177   -8.083  1.00 0.94  ? 1601 LYS A O    1  
ATOM 1367  C CB   . LYS A 1 94  ? 8.967   6.208   -10.178 1.00 1.44  ? 1601 LYS A CB   1  
ATOM 1368  C CG   . LYS A 1 94  ? 9.172   6.673   -11.651 1.00 1.77  ? 1601 LYS A CG   1  
ATOM 1369  C CD   . LYS A 1 94  ? 9.088   8.182   -11.901 1.00 2.13  ? 1601 LYS A CD   1  
ATOM 1370  C CE   . LYS A 1 94  ? 10.408  8.900   -11.675 1.00 2.60  ? 1601 LYS A CE   1  
ATOM 1371  N NZ   . LYS A 1 94  ? 10.294  10.348  -11.950 1.00 3.01  ? 1601 LYS A NZ   1  
ATOM 1372  H H    . LYS A 1 94  ? 9.334   5.873   -7.308  1.00 1.31  ? 1601 LYS A H    1  
ATOM 1373  H HA   . LYS A 1 94  ? 11.027  6.489   -9.553  1.00 1.40  ? 1601 LYS A HA   1  
ATOM 1374  H HB2  . LYS A 1 94  ? 8.932   5.131   -10.195 1.00 1.70  ? 1601 LYS A HB2  1  
ATOM 1375  H HB3  . LYS A 1 94  ? 8.012   6.574   -9.830  1.00 1.38  ? 1601 LYS A HB3  1  
ATOM 1376  H HG2  . LYS A 1 94  ? 10.150  6.346   -11.973 1.00 2.10  ? 1601 LYS A HG2  1  
ATOM 1377  H HG3  . LYS A 1 94  ? 8.432   6.175   -12.262 1.00 2.13  ? 1601 LYS A HG3  1  
ATOM 1378  H HD2  . LYS A 1 94  ? 8.782   8.350   -12.922 1.00 2.59  ? 1601 LYS A HD2  1  
ATOM 1379  H HD3  . LYS A 1 94  ? 8.344   8.598   -11.237 1.00 2.51  ? 1601 LYS A HD3  1  
ATOM 1380  H HE2  . LYS A 1 94  ? 10.707  8.759   -10.646 1.00 3.03  ? 1601 LYS A HE2  1  
ATOM 1381  H HE3  . LYS A 1 94  ? 11.153  8.472   -12.330 1.00 3.02  ? 1601 LYS A HE3  1  
ATOM 1382  H HZ1  . LYS A 1 94  ? 9.520   10.758  -11.381 1.00 3.45  ? 1601 LYS A HZ1  1  
ATOM 1383  H HZ2  . LYS A 1 94  ? 10.106  10.558  -12.953 1.00 3.26  ? 1601 LYS A HZ2  1  
ATOM 1384  H HZ3  . LYS A 1 94  ? 11.170  10.843  -11.676 1.00 3.29  ? 1601 LYS A HZ3  1  
ATOM 1385  N N    . SER A 1 95  ? 10.762  8.739   -8.375  1.00 1.23  ? 1602 SER A N    1  
ATOM 1386  C CA   . SER A 1 95  ? 10.672  9.999   -7.688  1.00 1.24  ? 1602 SER A CA   1  
ATOM 1387  C C    . SER A 1 95  ? 9.575   10.888  -8.309  1.00 1.14  ? 1602 SER A C    1  
ATOM 1388  O O    . SER A 1 95  ? 9.646   11.242  -9.484  1.00 1.25  ? 1602 SER A O    1  
ATOM 1389  C CB   . SER A 1 95  ? 12.029  10.704  -7.730  1.00 1.53  ? 1602 SER A CB   1  
ATOM 1390  O OG   . SER A 1 95  ? 12.095  11.784  -6.805  1.00 2.07  ? 1602 SER A OG   1  
ATOM 1391  H H    . SER A 1 95  ? 11.623  8.489   -8.772  1.00 1.39  ? 1602 SER A H    1  
ATOM 1392  H HA   . SER A 1 95  ? 10.458  9.730   -6.664  1.00 1.24  ? 1602 SER A HA   1  
ATOM 1393  H HB2  . SER A 1 95  ? 12.806  9.996   -7.486  1.00 1.93  ? 1602 SER A HB2  1  
ATOM 1394  H HB3  . SER A 1 95  ? 12.195  11.090  -8.725  1.00 1.67  ? 1602 SER A HB3  1  
ATOM 1395  H HG   . SER A 1 95  ? 11.976  11.376  -5.933  1.00 2.44  ? 1602 SER A HG   1  
ATOM 1396  N N    . GLY A 1 96  ? 8.565   11.207  -7.531  1.00 1.06  ? 1603 GLY A N    1  
ATOM 1397  C CA   . GLY A 1 96  ? 7.481   12.012  -8.024  1.00 1.08  ? 1603 GLY A CA   1  
ATOM 1398  C C    . GLY A 1 96  ? 6.228   11.209  -8.260  1.00 0.95  ? 1603 GLY A C    1  
ATOM 1399  O O    . GLY A 1 96  ? 5.173   11.763  -8.552  1.00 1.06  ? 1603 GLY A O    1  
ATOM 1400  H H    . GLY A 1 96  ? 8.557   10.871  -6.606  1.00 1.07  ? 1603 GLY A H    1  
ATOM 1401  H HA2  . GLY A 1 96  ? 7.267   12.812  -7.330  1.00 1.20  ? 1603 GLY A HA2  1  
ATOM 1402  H HA3  . GLY A 1 96  ? 7.784   12.430  -8.973  1.00 1.20  ? 1603 GLY A HA3  1  
ATOM 1403  N N    . LEU A 1 97  ? 6.329   9.915   -8.133  1.00 0.81  ? 1604 LEU A N    1  
ATOM 1404  C CA   . LEU A 1 97  ? 5.189   9.041   -8.297  1.00 0.78  ? 1604 LEU A CA   1  
ATOM 1405  C C    . LEU A 1 97  ? 4.459   8.990   -6.947  1.00 0.60  ? 1604 LEU A C    1  
ATOM 1406  O O    . LEU A 1 97  ? 5.036   9.366   -5.935  1.00 0.64  ? 1604 LEU A O    1  
ATOM 1407  C CB   . LEU A 1 97  ? 5.707   7.659   -8.665  1.00 1.01  ? 1604 LEU A CB   1  
ATOM 1408  C CG   . LEU A 1 97  ? 4.790   6.733   -9.433  1.00 1.11  ? 1604 LEU A CG   1  
ATOM 1409  C CD1  . LEU A 1 97  ? 4.597   7.244   -10.851 1.00 1.84  ? 1604 LEU A CD1  1  
ATOM 1410  C CD2  . LEU A 1 97  ? 5.389   5.355   -9.456  1.00 1.51  ? 1604 LEU A CD2  1  
ATOM 1411  H H    . LEU A 1 97  ? 7.206   9.515   -7.939  1.00 0.82  ? 1604 LEU A H    1  
ATOM 1412  H HA   . LEU A 1 97  ? 4.542   9.426   -9.067  1.00 0.90  ? 1604 LEU A HA   1  
ATOM 1413  H HB2  . LEU A 1 97  ? 6.600   7.789   -9.257  1.00 1.67  ? 1604 LEU A HB2  1  
ATOM 1414  H HB3  . LEU A 1 97  ? 5.989   7.164   -7.747  1.00 1.47  ? 1604 LEU A HB3  1  
ATOM 1415  H HG   . LEU A 1 97  ? 3.826   6.679   -8.947  1.00 1.88  ? 1604 LEU A HG   1  
ATOM 1416  H HD11 . LEU A 1 97  ? 5.569   7.337   -11.315 1.00 2.23  ? 1604 LEU A HD11 1  
ATOM 1417  H HD12 . LEU A 1 97  ? 4.106   8.206   -10.863 1.00 2.37  ? 1604 LEU A HD12 1  
ATOM 1418  H HD13 . LEU A 1 97  ? 4.011   6.536   -11.415 1.00 2.38  ? 1604 LEU A HD13 1  
ATOM 1419  H HD21 . LEU A 1 97  ? 5.486   4.995   -8.443  1.00 1.94  ? 1604 LEU A HD21 1  
ATOM 1420  H HD22 . LEU A 1 97  ? 6.373   5.419   -9.899  1.00 2.01  ? 1604 LEU A HD22 1  
ATOM 1421  H HD23 . LEU A 1 97  ? 4.766   4.685   -10.028 1.00 2.05  ? 1604 LEU A HD23 1  
ATOM 1422  N N    . SER A 1 98  ? 3.235   8.549   -6.915  1.00 0.57  ? 1605 SER A N    1  
ATOM 1423  C CA   . SER A 1 98  ? 2.489   8.489   -5.673  1.00 0.45  ? 1605 SER A CA   1  
ATOM 1424  C C    . SER A 1 98  ? 1.940   7.075   -5.508  1.00 0.39  ? 1605 SER A C    1  
ATOM 1425  O O    . SER A 1 98  ? 1.768   6.350   -6.496  1.00 0.46  ? 1605 SER A O    1  
ATOM 1426  C CB   . SER A 1 98  ? 1.336   9.515   -5.731  1.00 0.52  ? 1605 SER A CB   1  
ATOM 1427  O OG   . SER A 1 98  ? 0.673   9.671   -4.480  1.00 1.41  ? 1605 SER A OG   1  
ATOM 1428  H H    . SER A 1 98  ? 2.780   8.248   -7.735  1.00 0.71  ? 1605 SER A H    1  
ATOM 1429  H HA   . SER A 1 98  ? 3.147   8.729   -4.852  1.00 0.43  ? 1605 SER A HA   1  
ATOM 1430  H HB2  . SER A 1 98  ? 1.717   10.484  -6.008  1.00 1.11  ? 1605 SER A HB2  1  
ATOM 1431  H HB3  . SER A 1 98  ? 0.617   9.187   -6.465  1.00 1.16  ? 1605 SER A HB3  1  
ATOM 1432  H HG   . SER A 1 98  ? 1.097   10.428  -4.045  1.00 1.96  ? 1605 SER A HG   1  
ATOM 1433  N N    . TYR A 1 99  ? 1.714   6.673   -4.278  1.00 0.32  ? 1606 TYR A N    1  
ATOM 1434  C CA   . TYR A 1 99  ? 1.135   5.386   -3.984  1.00 0.28  ? 1606 TYR A CA   1  
ATOM 1435  C C    . TYR A 1 99  ? -0.380  5.451   -4.151  1.00 0.27  ? 1606 TYR A C    1  
ATOM 1436  O O    . TYR A 1 99  ? -0.950  6.550   -4.245  1.00 0.32  ? 1606 TYR A O    1  
ATOM 1437  C CB   . TYR A 1 99  ? 1.462   4.982   -2.564  1.00 0.27  ? 1606 TYR A CB   1  
ATOM 1438  C CG   . TYR A 1 99  ? 2.865   4.488   -2.299  1.00 0.32  ? 1606 TYR A CG   1  
ATOM 1439  C CD1  . TYR A 1 99  ? 3.223   3.170   -2.578  1.00 0.41  ? 1606 TYR A CD1  1  
ATOM 1440  C CD2  . TYR A 1 99  ? 3.810   5.312   -1.718  1.00 0.37  ? 1606 TYR A CD2  1  
ATOM 1441  C CE1  . TYR A 1 99  ? 4.487   2.702   -2.288  1.00 0.49  ? 1606 TYR A CE1  1  
ATOM 1442  C CE2  . TYR A 1 99  ? 5.069   4.849   -1.417  1.00 0.46  ? 1606 TYR A CE2  1  
ATOM 1443  C CZ   . TYR A 1 99  ? 5.404   3.545   -1.703  1.00 0.54  ? 1606 TYR A CZ   1  
ATOM 1444  O OH   . TYR A 1 99  ? 6.661   3.081   -1.393  1.00 0.60  ? 1606 TYR A OH   1  
ATOM 1445  H H    . TYR A 1 99  ? 1.909   7.270   -3.525  1.00 0.35  ? 1606 TYR A H    1  
ATOM 1446  H HA   . TYR A 1 99  ? 1.547   4.656   -4.665  1.00 0.31  ? 1606 TYR A HA   1  
ATOM 1447  H HB2  . TYR A 1 99  ? 1.344   5.869   -1.958  1.00 0.30  ? 1606 TYR A HB2  1  
ATOM 1448  H HB3  . TYR A 1 99  ? 0.762   4.250   -2.195  1.00 0.31  ? 1606 TYR A HB3  1  
ATOM 1449  H HD1  . TYR A 1 99  ? 2.507   2.504   -3.036  1.00 0.46  ? 1606 TYR A HD1  1  
ATOM 1450  H HD2  . TYR A 1 99  ? 3.546   6.337   -1.499  1.00 0.40  ? 1606 TYR A HD2  1  
ATOM 1451  H HE1  . TYR A 1 99  ? 4.750   1.679   -2.514  1.00 0.57  ? 1606 TYR A HE1  1  
ATOM 1452  H HE2  . TYR A 1 99  ? 5.791   5.510   -0.963  1.00 0.54  ? 1606 TYR A HE2  1  
ATOM 1453  H HH   . TYR A 1 99  ? 6.842   3.273   -0.470  1.00 1.06  ? 1606 TYR A HH   1  
ATOM 1454  N N    . LYS A 1 100 ? -1.022  4.300   -4.189  1.00 0.26  ? 1607 LYS A N    1  
ATOM 1455  C CA   . LYS A 1 100 ? -2.461  4.219   -4.336  1.00 0.25  ? 1607 LYS A CA   1  
ATOM 1456  C C    . LYS A 1 100 ? -2.947  2.870   -3.884  1.00 0.24  ? 1607 LYS A C    1  
ATOM 1457  O O    . LYS A 1 100 ? -2.389  1.841   -4.266  1.00 0.29  ? 1607 LYS A O    1  
ATOM 1458  C CB   . LYS A 1 100 ? -2.887  4.520   -5.786  1.00 0.29  ? 1607 LYS A CB   1  
ATOM 1459  C CG   . LYS A 1 100 ? -4.346  4.219   -6.126  1.00 0.88  ? 1607 LYS A CG   1  
ATOM 1460  C CD   . LYS A 1 100 ? -4.759  4.774   -7.489  1.00 0.81  ? 1607 LYS A CD   1  
ATOM 1461  C CE   . LYS A 1 100 ? -4.033  4.119   -8.657  1.00 0.74  ? 1607 LYS A CE   1  
ATOM 1462  N NZ   . LYS A 1 100 ? -4.462  4.690   -9.942  1.00 1.45  ? 1607 LYS A NZ   1  
ATOM 1463  H H    . LYS A 1 100 ? -0.542  3.443   -4.107  1.00 0.29  ? 1607 LYS A H    1  
ATOM 1464  H HA   . LYS A 1 100 ? -2.889  4.966   -3.685  1.00 0.27  ? 1607 LYS A HA   1  
ATOM 1465  H HB2  . LYS A 1 100 ? -2.761  5.583   -5.927  1.00 0.76  ? 1607 LYS A HB2  1  
ATOM 1466  H HB3  . LYS A 1 100 ? -2.231  3.969   -6.438  1.00 0.84  ? 1607 LYS A HB3  1  
ATOM 1467  H HG2  . LYS A 1 100 ? -4.488  3.147   -6.139  1.00 1.42  ? 1607 LYS A HG2  1  
ATOM 1468  H HG3  . LYS A 1 100 ? -4.969  4.665   -5.363  1.00 1.38  ? 1607 LYS A HG3  1  
ATOM 1469  H HD2  . LYS A 1 100 ? -5.819  4.613   -7.618  1.00 1.30  ? 1607 LYS A HD2  1  
ATOM 1470  H HD3  . LYS A 1 100 ? -4.558  5.835   -7.501  1.00 1.28  ? 1607 LYS A HD3  1  
ATOM 1471  H HE2  . LYS A 1 100 ? -2.968  4.269   -8.577  1.00 1.30  ? 1607 LYS A HE2  1  
ATOM 1472  H HE3  . LYS A 1 100 ? -4.253  3.061   -8.657  1.00 1.46  ? 1607 LYS A HE3  1  
ATOM 1473  H HZ1  . LYS A 1 100 ? -5.496  4.618   -10.055 1.00 2.00  ? 1607 LYS A HZ1  1  
ATOM 1474  H HZ2  . LYS A 1 100 ? -4.015  4.167   -10.726 1.00 1.99  ? 1607 LYS A HZ2  1  
ATOM 1475  H HZ3  . LYS A 1 100 ? -4.172  5.687   -10.037 1.00 1.94  ? 1607 LYS A HZ3  1  
ATOM 1476  N N    . SER A 1 101 ? -3.957  2.883   -3.076  1.00 0.24  ? 1608 SER A N    1  
ATOM 1477  C CA   . SER A 1 101 ? -4.528  1.687   -2.544  1.00 0.24  ? 1608 SER A CA   1  
ATOM 1478  C C    . SER A 1 101 ? -5.926  1.519   -3.109  1.00 0.24  ? 1608 SER A C    1  
ATOM 1479  O O    . SER A 1 101 ? -6.756  2.436   -3.016  1.00 0.29  ? 1608 SER A O    1  
ATOM 1480  C CB   . SER A 1 101 ? -4.575  1.783   -1.022  1.00 0.29  ? 1608 SER A CB   1  
ATOM 1481  O OG   . SER A 1 101 ? -3.286  2.064   -0.501  1.00 1.15  ? 1608 SER A OG   1  
ATOM 1482  H H    . SER A 1 101 ? -4.374  3.742   -2.850  1.00 0.28  ? 1608 SER A H    1  
ATOM 1483  H HA   . SER A 1 101 ? -3.913  0.846   -2.829  1.00 0.26  ? 1608 SER A HA   1  
ATOM 1484  H HB2  . SER A 1 101 ? -5.250  2.575   -0.732  1.00 0.83  ? 1608 SER A HB2  1  
ATOM 1485  H HB3  . SER A 1 101 ? -4.920  0.845   -0.613  1.00 1.06  ? 1608 SER A HB3  1  
ATOM 1486  H HG   . SER A 1 101 ? -2.914  2.827   -0.959  1.00 1.61  ? 1608 SER A HG   1  
ATOM 1487  N N    . VAL A 1 102 ? -6.168  0.406   -3.740  1.00 0.22  ? 1609 VAL A N    1  
ATOM 1488  C CA   . VAL A 1 102 ? -7.456  0.125   -4.302  1.00 0.22  ? 1609 VAL A CA   1  
ATOM 1489  C C    . VAL A 1 102 ? -8.137  -0.946  -3.463  1.00 0.22  ? 1609 VAL A C    1  
ATOM 1490  O O    . VAL A 1 102 ? -7.709  -2.103  -3.451  1.00 0.24  ? 1609 VAL A O    1  
ATOM 1491  C CB   . VAL A 1 102 ? -7.340  -0.356  -5.778  1.00 0.23  ? 1609 VAL A CB   1  
ATOM 1492  C CG1  . VAL A 1 102 ? -8.714  -0.544  -6.394  1.00 0.25  ? 1609 VAL A CG1  1  
ATOM 1493  C CG2  . VAL A 1 102 ? -6.499  0.609   -6.619  1.00 0.25  ? 1609 VAL A CG2  1  
ATOM 1494  H H    . VAL A 1 102 ? -5.454  -0.265  -3.845  1.00 0.25  ? 1609 VAL A H    1  
ATOM 1495  H HA   . VAL A 1 102 ? -8.056  1.022   -4.265  1.00 0.23  ? 1609 VAL A HA   1  
ATOM 1496  H HB   . VAL A 1 102 ? -6.851  -1.319  -5.771  1.00 0.24  ? 1609 VAL A HB   1  
ATOM 1497  H HG11 . VAL A 1 102 ? -8.610  -0.882  -7.414  1.00 1.09  ? 1609 VAL A HG11 1  
ATOM 1498  H HG12 . VAL A 1 102 ? -9.235  0.401   -6.369  1.00 1.00  ? 1609 VAL A HG12 1  
ATOM 1499  H HG13 . VAL A 1 102 ? -9.262  -1.275  -5.818  1.00 1.06  ? 1609 VAL A HG13 1  
ATOM 1500  H HG21 . VAL A 1 102 ? -6.429  0.230   -7.628  1.00 1.03  ? 1609 VAL A HG21 1  
ATOM 1501  H HG22 . VAL A 1 102 ? -5.506  0.689   -6.201  1.00 1.06  ? 1609 VAL A HG22 1  
ATOM 1502  H HG23 . VAL A 1 102 ? -6.954  1.588   -6.641  1.00 1.06  ? 1609 VAL A HG23 1  
ATOM 1503  N N    . ILE A 1 103 ? -9.166  -0.556  -2.755  1.00 0.22  ? 1610 ILE A N    1  
ATOM 1504  C CA   . ILE A 1 103 ? -9.905  -1.464  -1.915  1.00 0.22  ? 1610 ILE A CA   1  
ATOM 1505  C C    . ILE A 1 103 ? -10.999 -2.048  -2.783  1.00 0.23  ? 1610 ILE A C    1  
ATOM 1506  O O    . ILE A 1 103 ? -11.716 -1.306  -3.461  1.00 0.34  ? 1610 ILE A O    1  
ATOM 1507  C CB   . ILE A 1 103 ? -10.582 -0.752  -0.684  1.00 0.27  ? 1610 ILE A CB   1  
ATOM 1508  C CG1  . ILE A 1 103 ? -9.645  0.223   0.089   1.00 0.33  ? 1610 ILE A CG1  1  
ATOM 1509  C CG2  . ILE A 1 103 ? -11.184 -1.766  0.272   1.00 0.28  ? 1610 ILE A CG2  1  
ATOM 1510  C CD1  . ILE A 1 103 ? -8.344  -0.351  0.542   1.00 0.45  ? 1610 ILE A CD1  1  
ATOM 1511  H H    . ILE A 1 103 ? -9.476  0.371   -2.819  1.00 0.24  ? 1610 ILE A H    1  
ATOM 1512  H HA   . ILE A 1 103 ? -9.276  -2.277  -1.583  1.00 0.22  ? 1610 ILE A HA   1  
ATOM 1513  H HB   . ILE A 1 103 ? -11.409 -0.187  -1.084  1.00 0.34  ? 1610 ILE A HB   1  
ATOM 1514  H HG12 . ILE A 1 103 ? -9.428  1.109   -0.487  1.00 0.69  ? 1610 ILE A HG12 1  
ATOM 1515  H HG13 . ILE A 1 103 ? -10.176 0.550   0.971   1.00 0.67  ? 1610 ILE A HG13 1  
ATOM 1516  H HG21 . ILE A 1 103 ? -11.691 -1.251  1.075   1.00 1.04  ? 1610 ILE A HG21 1  
ATOM 1517  H HG22 . ILE A 1 103 ? -10.398 -2.377  0.688   1.00 1.03  ? 1610 ILE A HG22 1  
ATOM 1518  H HG23 . ILE A 1 103 ? -11.890 -2.385  -0.261  1.00 1.08  ? 1610 ILE A HG23 1  
ATOM 1519  H HD11 . ILE A 1 103 ? -7.841  0.381   1.153   1.00 1.17  ? 1610 ILE A HD11 1  
ATOM 1520  H HD12 . ILE A 1 103 ? -7.747  -0.537  -0.336  1.00 1.20  ? 1610 ILE A HD12 1  
ATOM 1521  H HD13 . ILE A 1 103 ? -8.526  -1.255  1.100   1.00 1.10  ? 1610 ILE A HD13 1  
ATOM 1522  N N    . SER A 1 104 ? -11.093 -3.332  -2.798  1.00 0.23  ? 1611 SER A N    1  
ATOM 1523  C CA   . SER A 1 104 ? -12.044 -4.016  -3.611  1.00 0.24  ? 1611 SER A CA   1  
ATOM 1524  C C    . SER A 1 104 ? -12.863 -4.981  -2.743  1.00 0.22  ? 1611 SER A C    1  
ATOM 1525  O O    . SER A 1 104 ? -12.391 -6.061  -2.356  1.00 0.25  ? 1611 SER A O    1  
ATOM 1526  C CB   . SER A 1 104 ? -11.301 -4.751  -4.752  1.00 0.30  ? 1611 SER A CB   1  
ATOM 1527  O OG   . SER A 1 104 ? -12.178 -5.321  -5.715  1.00 1.26  ? 1611 SER A OG   1  
ATOM 1528  H H    . SER A 1 104 ? -10.480 -3.867  -2.253  1.00 0.30  ? 1611 SER A H    1  
ATOM 1529  H HA   . SER A 1 104 ? -12.682 -3.258  -4.034  1.00 0.27  ? 1611 SER A HA   1  
ATOM 1530  H HB2  . SER A 1 104 ? -10.654 -4.051  -5.259  1.00 1.06  ? 1611 SER A HB2  1  
ATOM 1531  H HB3  . SER A 1 104 ? -10.696 -5.537  -4.322  1.00 1.11  ? 1611 SER A HB3  1  
ATOM 1532  H HG   . SER A 1 104 ? -12.072 -6.286  -5.684  1.00 1.89  ? 1611 SER A HG   1  
ATOM 1533  N N    . PHE A 1 105 ? -14.057 -4.561  -2.407  1.00 0.21  ? 1612 PHE A N    1  
ATOM 1534  C CA   . PHE A 1 105 ? -14.960 -5.343  -1.595  1.00 0.21  ? 1612 PHE A CA   1  
ATOM 1535  C C    . PHE A 1 105 ? -15.775 -6.301  -2.451  1.00 0.23  ? 1612 PHE A C    1  
ATOM 1536  O O    . PHE A 1 105 ? -16.377 -5.891  -3.456  1.00 0.26  ? 1612 PHE A O    1  
ATOM 1537  C CB   . PHE A 1 105 ? -15.900 -4.440  -0.819  1.00 0.23  ? 1612 PHE A CB   1  
ATOM 1538  C CG   . PHE A 1 105 ? -15.265 -3.630  0.276   1.00 0.21  ? 1612 PHE A CG   1  
ATOM 1539  C CD1  . PHE A 1 105 ? -14.726 -4.252  1.384   1.00 0.22  ? 1612 PHE A CD1  1  
ATOM 1540  C CD2  . PHE A 1 105 ? -15.220 -2.245  0.204   1.00 0.23  ? 1612 PHE A CD2  1  
ATOM 1541  C CE1  . PHE A 1 105 ? -14.158 -3.522  2.403   1.00 0.24  ? 1612 PHE A CE1  1  
ATOM 1542  C CE2  . PHE A 1 105 ? -14.655 -1.505  1.227   1.00 0.24  ? 1612 PHE A CE2  1  
ATOM 1543  C CZ   . PHE A 1 105 ? -14.122 -2.148  2.327   1.00 0.24  ? 1612 PHE A CZ   1  
ATOM 1544  H H    . PHE A 1 105 ? -14.353 -3.683  -2.739  1.00 0.23  ? 1612 PHE A H    1  
ATOM 1545  H HA   . PHE A 1 105 ? -14.373 -5.913  -0.891  1.00 0.22  ? 1612 PHE A HA   1  
ATOM 1546  H HB2  . PHE A 1 105 ? -16.329 -3.742  -1.523  1.00 0.26  ? 1612 PHE A HB2  1  
ATOM 1547  H HB3  . PHE A 1 105 ? -16.693 -5.042  -0.414  1.00 0.27  ? 1612 PHE A HB3  1  
ATOM 1548  H HD1  . PHE A 1 105 ? -14.746 -5.328  1.445   1.00 0.25  ? 1612 PHE A HD1  1  
ATOM 1549  H HD2  . PHE A 1 105 ? -15.637 -1.743  -0.656  1.00 0.27  ? 1612 PHE A HD2  1  
ATOM 1550  H HE1  . PHE A 1 105 ? -13.742 -4.027  3.263   1.00 0.28  ? 1612 PHE A HE1  1  
ATOM 1551  H HE2  . PHE A 1 105 ? -14.623 -0.427  1.163   1.00 0.28  ? 1612 PHE A HE2  1  
ATOM 1552  H HZ   . PHE A 1 105 ? -13.680 -1.585  3.134   1.00 0.27  ? 1612 PHE A HZ   1  
ATOM 1553  N N    . VAL A 1 106 ? -15.801 -7.567  -2.047  1.00 0.26  ? 1613 VAL A N    1  
ATOM 1554  C CA   . VAL A 1 106 ? -16.488 -8.615  -2.772  1.00 0.33  ? 1613 VAL A CA   1  
ATOM 1555  C C    . VAL A 1 106 ? -17.461 -9.381  -1.838  1.00 0.35  ? 1613 VAL A C    1  
ATOM 1556  O O    . VAL A 1 106 ? -17.142 -9.657  -0.668  1.00 0.34  ? 1613 VAL A O    1  
ATOM 1557  C CB   . VAL A 1 106 ? -15.456 -9.624  -3.367  1.00 0.40  ? 1613 VAL A CB   1  
ATOM 1558  C CG1  . VAL A 1 106 ? -16.150 -10.701 -4.173  1.00 0.50  ? 1613 VAL A CG1  1  
ATOM 1559  C CG2  . VAL A 1 106 ? -14.413 -8.914  -4.224  1.00 0.43  ? 1613 VAL A CG2  1  
ATOM 1560  H H    . VAL A 1 106 ? -15.329 -7.820  -1.222  1.00 0.27  ? 1613 VAL A H    1  
ATOM 1561  H HA   . VAL A 1 106 ? -17.041 -8.168  -3.586  1.00 0.38  ? 1613 VAL A HA   1  
ATOM 1562  H HB   . VAL A 1 106 ? -14.949 -10.105 -2.543  1.00 0.40  ? 1613 VAL A HB   1  
ATOM 1563  H HG11 . VAL A 1 106 ? -16.693 -10.242 -4.986  1.00 1.11  ? 1613 VAL A HG11 1  
ATOM 1564  H HG12 . VAL A 1 106 ? -16.838 -11.227 -3.528  1.00 1.23  ? 1613 VAL A HG12 1  
ATOM 1565  H HG13 . VAL A 1 106 ? -15.416 -11.388 -4.564  1.00 1.06  ? 1613 VAL A HG13 1  
ATOM 1566  H HG21 . VAL A 1 106 ? -13.716 -9.637  -4.620  1.00 1.08  ? 1613 VAL A HG21 1  
ATOM 1567  H HG22 . VAL A 1 106 ? -13.880 -8.193  -3.620  1.00 1.09  ? 1613 VAL A HG22 1  
ATOM 1568  H HG23 . VAL A 1 106 ? -14.905 -8.405  -5.040  1.00 1.14  ? 1613 VAL A HG23 1  
ATOM 1569  N N    . CYS A 1 107 ? -18.633 -9.694  -2.373  1.00 0.42  ? 1614 CYS A N    1  
ATOM 1570  C CA   . CYS A 1 107 ? -19.685 -10.460 -1.709  1.00 0.47  ? 1614 CYS A CA   1  
ATOM 1571  C C    . CYS A 1 107 ? -19.228 -11.863 -1.325  1.00 0.51  ? 1614 CYS A C    1  
ATOM 1572  O O    . CYS A 1 107 ? -18.958 -12.695 -2.200  1.00 0.58  ? 1614 CYS A O    1  
ATOM 1573  C CB   . CYS A 1 107 ? -20.917 -10.586 -2.645  1.00 0.59  ? 1614 CYS A CB   1  
ATOM 1574  S SG   . CYS A 1 107 ? -22.083 -11.948 -2.202  1.00 0.77  ? 1614 CYS A SG   1  
ATOM 1575  H H    . CYS A 1 107 ? -18.813 -9.381  -3.292  1.00 0.48  ? 1614 CYS A H    1  
ATOM 1576  H HA   . CYS A 1 107 ? -19.996 -9.901  -0.838  1.00 0.45  ? 1614 CYS A HA   1  
ATOM 1577  H HB2  . CYS A 1 107 ? -21.475 -9.662  -2.616  1.00 0.63  ? 1614 CYS A HB2  1  
ATOM 1578  H HB3  . CYS A 1 107 ? -20.574 -10.759 -3.654  1.00 0.60  ? 1614 CYS A HB3  1  
ATOM 1579  N N    . ARG A 1 108 ? -19.099 -12.117 -0.040  1.00 0.51  ? 1615 ARG A N    1  
ATOM 1580  C CA   . ARG A 1 108 ? -18.836 -13.459 0.463   1.00 0.57  ? 1615 ARG A CA   1  
ATOM 1581  C C    . ARG A 1 108 ? -19.876 -13.779 1.554   1.00 0.61  ? 1615 ARG A C    1  
ATOM 1582  O O    . ARG A 1 108 ? -19.627 -13.553 2.738   1.00 0.67  ? 1615 ARG A O    1  
ATOM 1583  C CB   . ARG A 1 108 ? -17.398 -13.549 1.017   1.00 0.69  ? 1615 ARG A CB   1  
ATOM 1584  C CG   . ARG A 1 108 ? -17.024 -14.873 1.696   1.00 1.17  ? 1615 ARG A CG   1  
ATOM 1585  C CD   . ARG A 1 108 ? -17.059 -16.075 0.763   1.00 1.19  ? 1615 ARG A CD   1  
ATOM 1586  N NE   . ARG A 1 108 ? -16.784 -17.322 1.506   1.00 1.74  ? 1615 ARG A NE   1  
ATOM 1587  C CZ   . ARG A 1 108 ? -16.496 -18.514 0.971   1.00 1.99  ? 1615 ARG A CZ   1  
ATOM 1588  N NH1  . ARG A 1 108 ? -16.270 -18.627 -0.324  1.00 2.19  ? 1615 ARG A NH1  1  
ATOM 1589  N NH2  . ARG A 1 108 ? -16.388 -19.591 1.761   1.00 2.53  ? 1615 ARG A NH2  1  
ATOM 1590  H H    . ARG A 1 108 ? -19.155 -11.381 0.613   1.00 0.50  ? 1615 ARG A H    1  
ATOM 1591  H HA   . ARG A 1 108 ? -18.949 -14.130 -0.376  1.00 0.61  ? 1615 ARG A HA   1  
ATOM 1592  H HB2  . ARG A 1 108 ? -16.710 -13.396 0.200   1.00 0.63  ? 1615 ARG A HB2  1  
ATOM 1593  H HB3  . ARG A 1 108 ? -17.262 -12.752 1.733   1.00 0.91  ? 1615 ARG A HB3  1  
ATOM 1594  H HG2  . ARG A 1 108 ? -16.024 -14.785 2.095   1.00 1.65  ? 1615 ARG A HG2  1  
ATOM 1595  H HG3  . ARG A 1 108 ? -17.711 -15.040 2.513   1.00 1.58  ? 1615 ARG A HG3  1  
ATOM 1596  H HD2  . ARG A 1 108 ? -18.038 -16.139 0.310   1.00 1.21  ? 1615 ARG A HD2  1  
ATOM 1597  H HD3  . ARG A 1 108 ? -16.310 -15.951 -0.005  1.00 1.47  ? 1615 ARG A HD3  1  
ATOM 1598  H HE   . ARG A 1 108 ? -16.857 -17.238 2.488   1.00 2.22  ? 1615 ARG A HE   1  
ATOM 1599  H HH11 . ARG A 1 108 ? -16.289 -17.848 -0.963  1.00 2.21  ? 1615 ARG A HH11 1  
ATOM 1600  H HH12 . ARG A 1 108 ? -16.079 -19.523 -0.745  1.00 2.68  ? 1615 ARG A HH12 1  
ATOM 1601  H HH21 . ARG A 1 108 ? -16.523 -19.544 2.756   1.00 2.92  ? 1615 ARG A HH21 1  
ATOM 1602  H HH22 . ARG A 1 108 ? -16.161 -20.499 1.394   1.00 2.77  ? 1615 ARG A HH22 1  
ATOM 1603  N N    . PRO A 1 109 ? -21.063 -14.305 1.177   1.00 0.67  ? 1616 PRO A N    1  
ATOM 1604  C CA   . PRO A 1 109 ? -22.154 -14.538 2.129   1.00 0.83  ? 1616 PRO A CA   1  
ATOM 1605  C C    . PRO A 1 109 ? -21.847 -15.637 3.147   1.00 0.95  ? 1616 PRO A C    1  
ATOM 1606  O O    . PRO A 1 109 ? -22.416 -15.656 4.248   1.00 1.10  ? 1616 PRO A O    1  
ATOM 1607  C CB   . PRO A 1 109 ? -23.344 -14.926 1.247   1.00 0.94  ? 1616 PRO A CB   1  
ATOM 1608  C CG   . PRO A 1 109 ? -22.745 -15.462 -0.002  1.00 0.92  ? 1616 PRO A CG   1  
ATOM 1609  C CD   . PRO A 1 109 ? -21.437 -14.744 -0.194  1.00 0.69  ? 1616 PRO A CD   1  
ATOM 1610  H HA   . PRO A 1 109 ? -22.386 -13.629 2.666   1.00 0.89  ? 1616 PRO A HA   1  
ATOM 1611  H HB2  . PRO A 1 109 ? -23.937 -15.673 1.753   1.00 1.14  ? 1616 PRO A HB2  1  
ATOM 1612  H HB3  . PRO A 1 109 ? -23.948 -14.052 1.049   1.00 1.05  ? 1616 PRO A HB3  1  
ATOM 1613  H HG2  . PRO A 1 109 ? -22.584 -16.526 0.091   1.00 1.22  ? 1616 PRO A HG2  1  
ATOM 1614  H HG3  . PRO A 1 109 ? -23.406 -15.260 -0.833  1.00 1.07  ? 1616 PRO A HG3  1  
ATOM 1615  H HD2  . PRO A 1 109 ? -20.711 -15.437 -0.594  1.00 0.71  ? 1616 PRO A HD2  1  
ATOM 1616  H HD3  . PRO A 1 109 ? -21.582 -13.907 -0.860  1.00 0.71  ? 1616 PRO A HD3  1  
ATOM 1617  N N    . GLU A 1 110 ? -20.941 -16.540 2.800   1.00 0.99  ? 1617 GLU A N    1  
ATOM 1618  C CA   . GLU A 1 110 ? -20.583 -17.622 3.696   1.00 1.19  ? 1617 GLU A CA   1  
ATOM 1619  C C    . GLU A 1 110 ? -19.490 -17.194 4.660   1.00 1.17  ? 1617 GLU A C    1  
ATOM 1620  O O    . GLU A 1 110 ? -19.103 -17.971 5.541   1.00 1.74  ? 1617 GLU A O    1  
ATOM 1621  C CB   . GLU A 1 110 ? -20.088 -18.850 2.931   1.00 1.39  ? 1617 GLU A CB   1  
ATOM 1622  C CG   . GLU A 1 110 ? -20.917 -19.223 1.730   1.00 1.76  ? 1617 GLU A CG   1  
ATOM 1623  C CD   . GLU A 1 110 ? -20.294 -18.758 0.439   1.00 2.32  ? 1617 GLU A CD   1  
ATOM 1624  O OE1  . GLU A 1 110 ? -20.144 -17.543 0.228   1.00 3.05  ? 1617 GLU A OE1  1  
ATOM 1625  O OE2  . GLU A 1 110 ? -19.958 -19.629 -0.400  1.00 2.53  ? 1617 GLU A OE2  1  
ATOM 1626  H H    . GLU A 1 110 ? -20.536 -16.518 1.904   1.00 0.96  ? 1617 GLU A H    1  
ATOM 1627  H HA   . GLU A 1 110 ? -21.463 -17.899 4.258   1.00 1.33  ? 1617 GLU A HA   1  
ATOM 1628  H HB2  . GLU A 1 110 ? -19.079 -18.659 2.596   1.00 1.44  ? 1617 GLU A HB2  1  
ATOM 1629  H HB3  . GLU A 1 110 ? -20.072 -19.692 3.608   1.00 1.72  ? 1617 GLU A HB3  1  
ATOM 1630  H HG2  . GLU A 1 110 ? -21.023 -20.297 1.695   1.00 2.26  ? 1617 GLU A HG2  1  
ATOM 1631  H HG3  . GLU A 1 110 ? -21.892 -18.769 1.827   1.00 2.04  ? 1617 GLU A HG3  1  
ATOM 1632  N N    . ALA A 1 111 ? -18.972 -15.964 4.468   1.00 0.85  ? 1618 ALA A N    1  
ATOM 1633  C CA   . ALA A 1 111 ? -17.863 -15.419 5.268   1.00 0.78  ? 1618 ALA A CA   1  
ATOM 1634  C C    . ALA A 1 111 ? -16.624 -16.347 5.146   1.00 0.93  ? 1618 ALA A C    1  
ATOM 1635  O O    . ALA A 1 111 ? -16.550 -17.142 4.196   1.00 1.55  ? 1618 ALA A O    1  
ATOM 1636  C CB   . ALA A 1 111 ? -18.316 -15.199 6.719   1.00 0.78  ? 1618 ALA A CB   1  
ATOM 1637  H H    . ALA A 1 111 ? -19.361 -15.402 3.765   1.00 1.00  ? 1618 ALA A H    1  
ATOM 1638  H HA   . ALA A 1 111 ? -17.604 -14.469 4.823   1.00 0.78  ? 1618 ALA A HA   1  
ATOM 1639  H HB1  . ALA A 1 111 ? -17.594 -14.611 7.266   1.00 1.23  ? 1618 ALA A HB1  1  
ATOM 1640  H HB2  . ALA A 1 111 ? -18.444 -16.154 7.208   1.00 1.23  ? 1618 ALA A HB2  1  
ATOM 1641  H HB3  . ALA A 1 111 ? -19.263 -14.680 6.716   1.00 1.20  ? 1618 ALA A HB3  1  
ATOM 1642  N N    . GLY A 1 112 ? -15.660 -16.242 6.028   1.00 0.86  ? 1619 GLY A N    1  
ATOM 1643  C CA   . GLY A 1 112 ? -14.536 -17.092 5.958   1.00 0.93  ? 1619 GLY A CA   1  
ATOM 1644  C C    . GLY A 1 112 ? -13.268 -16.353 6.262   1.00 0.76  ? 1619 GLY A C    1  
ATOM 1645  O O    . GLY A 1 112 ? -13.301 -15.256 6.821   1.00 0.73  ? 1619 GLY A O    1  
ATOM 1646  H H    . GLY A 1 112 ? -15.634 -15.603 6.769   1.00 1.16  ? 1619 GLY A H    1  
ATOM 1647  H HA2  . GLY A 1 112 ? -14.659 -17.888 6.678   1.00 1.12  ? 1619 GLY A HA2  1  
ATOM 1648  H HA3  . GLY A 1 112 ? -14.453 -17.523 4.972   1.00 1.04  ? 1619 GLY A HA3  1  
ATOM 1649  N N    . PRO A 1 113 ? -12.133 -16.912 5.881   1.00 0.73  ? 1620 PRO A N    1  
ATOM 1650  C CA   . PRO A 1 113 ? -10.818 -16.318 6.138   1.00 0.65  ? 1620 PRO A CA   1  
ATOM 1651  C C    . PRO A 1 113 ? -10.432 -15.267 5.101   1.00 0.56  ? 1620 PRO A C    1  
ATOM 1652  O O    . PRO A 1 113 ? -9.269  -14.878 4.982   1.00 0.62  ? 1620 PRO A O    1  
ATOM 1653  C CB   . PRO A 1 113 ? -9.881  -17.512 6.049   1.00 0.71  ? 1620 PRO A CB   1  
ATOM 1654  C CG   . PRO A 1 113 ? -10.535 -18.469 5.107   1.00 0.80  ? 1620 PRO A CG   1  
ATOM 1655  C CD   . PRO A 1 113 ? -12.036 -18.214 5.197   1.00 0.88  ? 1620 PRO A CD   1  
ATOM 1656  H HA   . PRO A 1 113 ? -10.764 -15.887 7.126   1.00 0.72  ? 1620 PRO A HA   1  
ATOM 1657  H HB2  . PRO A 1 113 ? -8.940  -17.158 5.658   1.00 0.79  ? 1620 PRO A HB2  1  
ATOM 1658  H HB3  . PRO A 1 113 ? -9.760  -17.939 7.033   1.00 0.90  ? 1620 PRO A HB3  1  
ATOM 1659  H HG2  . PRO A 1 113 ? -10.138 -18.300 4.116   1.00 0.95  ? 1620 PRO A HG2  1  
ATOM 1660  H HG3  . PRO A 1 113 ? -10.295 -19.475 5.422   1.00 0.97  ? 1620 PRO A HG3  1  
ATOM 1661  H HD2  . PRO A 1 113 ? -12.550 -18.191 4.244   1.00 1.02  ? 1620 PRO A HD2  1  
ATOM 1662  H HD3  . PRO A 1 113 ? -12.537 -18.943 5.816   1.00 1.06  ? 1620 PRO A HD3  1  
ATOM 1663  N N    . THR A 1 114 ? -11.398 -14.832 4.362   1.00 0.53  ? 1621 THR A N    1  
ATOM 1664  C CA   . THR A 1 114 ? -11.215 -13.869 3.330   1.00 0.54  ? 1621 THR A CA   1  
ATOM 1665  C C    . THR A 1 114 ? -11.767 -12.517 3.760   1.00 0.43  ? 1621 THR A C    1  
ATOM 1666  O O    . THR A 1 114 ? -11.712 -11.525 3.013   1.00 0.39  ? 1621 THR A O    1  
ATOM 1667  C CB   . THR A 1 114 ? -11.879 -14.372 2.047   1.00 0.73  ? 1621 THR A CB   1  
ATOM 1668  O OG1  . THR A 1 114 ? -13.219 -14.826 2.336   1.00 0.95  ? 1621 THR A OG1  1  
ATOM 1669  C CG2  . THR A 1 114 ? -11.088 -15.527 1.483   1.00 0.97  ? 1621 THR A CG2  1  
ATOM 1670  H H    . THR A 1 114 ? -12.301 -15.180 4.504   1.00 0.57  ? 1621 THR A H    1  
ATOM 1671  H HA   . THR A 1 114 ? -10.155 -13.769 3.151   1.00 0.64  ? 1621 THR A HA   1  
ATOM 1672  H HB   . THR A 1 114 ? -11.908 -13.574 1.320   1.00 0.81  ? 1621 THR A HB   1  
ATOM 1673  H HG1  . THR A 1 114 ? -13.585 -15.159 1.501   1.00 1.52  ? 1621 THR A HG1  1  
ATOM 1674  H HG21 . THR A 1 114 ? -11.054 -16.302 2.234   1.00 1.40  ? 1621 THR A HG21 1  
ATOM 1675  H HG22 . THR A 1 114 ? -10.087 -15.196 1.252   1.00 1.38  ? 1621 THR A HG22 1  
ATOM 1676  H HG23 . THR A 1 114 ? -11.571 -15.902 0.592   1.00 1.58  ? 1621 THR A HG23 1  
ATOM 1677  N N    . ASN A 1 115 ? -12.272 -12.475 4.982   1.00 0.42  ? 1622 ASN A N    1  
ATOM 1678  C CA   . ASN A 1 115 ? -12.781 -11.242 5.574   1.00 0.40  ? 1622 ASN A CA   1  
ATOM 1679  C C    . ASN A 1 115 ? -11.598 -10.533 6.223   1.00 0.39  ? 1622 ASN A C    1  
ATOM 1680  O O    . ASN A 1 115 ? -11.486 -10.435 7.455   1.00 0.48  ? 1622 ASN A O    1  
ATOM 1681  C CB   . ASN A 1 115 ? -13.852 -11.545 6.633   1.00 0.49  ? 1622 ASN A CB   1  
ATOM 1682  C CG   . ASN A 1 115 ? -14.613 -10.304 7.121   1.00 0.51  ? 1622 ASN A CG   1  
ATOM 1683  O OD1  . ASN A 1 115 ? -14.114 -9.166  7.092   1.00 0.59  ? 1622 ASN A OD1  1  
ATOM 1684  N ND2  . ASN A 1 115 ? -15.793 -10.525 7.623   1.00 0.72  ? 1622 ASN A ND2  1  
ATOM 1685  H H    . ASN A 1 115 ? -12.295 -13.305 5.501   1.00 0.46  ? 1622 ASN A H    1  
ATOM 1686  H HA   . ASN A 1 115 ? -13.196 -10.645 4.775   1.00 0.38  ? 1622 ASN A HA   1  
ATOM 1687  H HB2  . ASN A 1 115 ? -14.571 -12.235 6.217   1.00 0.54  ? 1622 ASN A HB2  1  
ATOM 1688  H HB3  . ASN A 1 115 ? -13.378 -12.008 7.486   1.00 0.55  ? 1622 ASN A HB3  1  
ATOM 1689  H HD21 . ASN A 1 115 ? -16.082 -11.467 7.658   1.00 0.88  ? 1622 ASN A HD21 1  
ATOM 1690  H HD22 . ASN A 1 115 ? -16.341 -9.775  7.934   1.00 0.80  ? 1622 ASN A HD22 1  
ATOM 1691  N N    . ARG A 1 116 ? -10.698 -10.119 5.395   1.00 0.35  ? 1623 ARG A N    1  
ATOM 1692  C CA   . ARG A 1 116 ? -9.470  -9.508  5.788   1.00 0.37  ? 1623 ARG A CA   1  
ATOM 1693  C C    . ARG A 1 116 ? -8.843  -8.967  4.539   1.00 0.33  ? 1623 ARG A C    1  
ATOM 1694  O O    . ARG A 1 116 ? -9.007  -9.566  3.479   1.00 0.32  ? 1623 ARG A O    1  
ATOM 1695  C CB   . ARG A 1 116 ? -8.527  -10.519 6.474   1.00 0.43  ? 1623 ARG A CB   1  
ATOM 1696  C CG   . ARG A 1 116 ? -8.090  -11.699 5.609   1.00 0.49  ? 1623 ARG A CG   1  
ATOM 1697  C CD   . ARG A 1 116 ? -7.148  -12.620 6.365   1.00 0.67  ? 1623 ARG A CD   1  
ATOM 1698  N NE   . ARG A 1 116 ? -5.887  -11.963 6.741   1.00 1.57  ? 1623 ARG A NE   1  
ATOM 1699  C CZ   . ARG A 1 116 ? -5.254  -12.120 7.918   1.00 2.13  ? 1623 ARG A CZ   1  
ATOM 1700  N NH1  . ARG A 1 116 ? -5.813  -12.841 8.889   1.00 1.99  ? 1623 ARG A NH1  1  
ATOM 1701  N NH2  . ARG A 1 116 ? -4.076  -11.534 8.122   1.00 3.26  ? 1623 ARG A NH2  1  
ATOM 1702  H H    . ARG A 1 116 ? -10.851 -10.225 4.428   1.00 0.35  ? 1623 ARG A H    1  
ATOM 1703  H HA   . ARG A 1 116 ? -9.691  -8.693  6.461   1.00 0.41  ? 1623 ARG A HA   1  
ATOM 1704  H HB2  . ARG A 1 116 ? -7.657  -9.969  6.791   1.00 0.46  ? 1623 ARG A HB2  1  
ATOM 1705  H HB3  . ARG A 1 116 ? -9.026  -10.901 7.352   1.00 0.48  ? 1623 ARG A HB3  1  
ATOM 1706  H HG2  . ARG A 1 116 ? -8.964  -12.258 5.311   1.00 0.50  ? 1623 ARG A HG2  1  
ATOM 1707  H HG3  . ARG A 1 116 ? -7.586  -11.319 4.731   1.00 0.52  ? 1623 ARG A HG3  1  
ATOM 1708  H HD2  . ARG A 1 116 ? -7.642  -12.957 7.264   1.00 1.26  ? 1623 ARG A HD2  1  
ATOM 1709  H HD3  . ARG A 1 116 ? -6.925  -13.473 5.741   1.00 1.22  ? 1623 ARG A HD3  1  
ATOM 1710  H HE   . ARG A 1 116 ? -5.499  -11.400 6.024   1.00 2.16  ? 1623 ARG A HE   1  
ATOM 1711  H HH11 . ARG A 1 116 ? -6.711  -13.285 8.784   1.00 1.83  ? 1623 ARG A HH11 1  
ATOM 1712  H HH12 . ARG A 1 116 ? -5.356  -12.979 9.778   1.00 2.53  ? 1623 ARG A HH12 1  
ATOM 1713  H HH21 . ARG A 1 116 ? -3.632  -10.966 7.416   1.00 3.82  ? 1623 ARG A HH21 1  
ATOM 1714  H HH22 . ARG A 1 116 ? -3.557  -11.617 8.977   1.00 3.73  ? 1623 ARG A HH22 1  
ATOM 1715  N N    . PRO A 1 117 ? -8.228  -7.786  4.611   1.00 0.36  ? 1624 PRO A N    1  
ATOM 1716  C CA   . PRO A 1 117 ? -7.600  -7.149  3.455   1.00 0.36  ? 1624 PRO A CA   1  
ATOM 1717  C C    . PRO A 1 117 ? -6.560  -8.068  2.798   1.00 0.36  ? 1624 PRO A C    1  
ATOM 1718  O O    . PRO A 1 117 ? -5.472  -8.302  3.339   1.00 0.47  ? 1624 PRO A O    1  
ATOM 1719  C CB   . PRO A 1 117 ? -6.915  -5.916  4.045   1.00 0.47  ? 1624 PRO A CB   1  
ATOM 1720  C CG   . PRO A 1 117 ? -6.857  -6.166  5.514   1.00 0.59  ? 1624 PRO A CG   1  
ATOM 1721  C CD   . PRO A 1 117 ? -8.056  -6.986  5.831   1.00 0.43  ? 1624 PRO A CD   1  
ATOM 1722  H HA   . PRO A 1 117 ? -8.357  -6.851  2.742   1.00 0.36  ? 1624 PRO A HA   1  
ATOM 1723  H HB2  . PRO A 1 117 ? -5.926  -5.817  3.621   1.00 0.51  ? 1624 PRO A HB2  1  
ATOM 1724  H HB3  . PRO A 1 117 ? -7.498  -5.035  3.820   1.00 0.54  ? 1624 PRO A HB3  1  
ATOM 1725  H HG2  . PRO A 1 117 ? -5.955  -6.710  5.758   1.00 0.76  ? 1624 PRO A HG2  1  
ATOM 1726  H HG3  . PRO A 1 117 ? -6.888  -5.228  6.048   1.00 0.77  ? 1624 PRO A HG3  1  
ATOM 1727  H HD2  . PRO A 1 117 ? -7.871  -7.618  6.687   1.00 0.48  ? 1624 PRO A HD2  1  
ATOM 1728  H HD3  . PRO A 1 117 ? -8.916  -6.355  5.999   1.00 0.47  ? 1624 PRO A HD3  1  
ATOM 1729  N N    . MET A 1 118 ? -6.911  -8.594  1.665   1.00 0.35  ? 1625 MET A N    1  
ATOM 1730  C CA   . MET A 1 118 ? -6.087  -9.522  0.946   1.00 0.46  ? 1625 MET A CA   1  
ATOM 1731  C C    . MET A 1 118 ? -5.345  -8.772  -0.143  1.00 0.40  ? 1625 MET A C    1  
ATOM 1732  O O    . MET A 1 118 ? -5.960  -8.317  -1.100  1.00 0.41  ? 1625 MET A O    1  
ATOM 1733  C CB   . MET A 1 118 ? -6.962  -10.626 0.315   1.00 0.68  ? 1625 MET A CB   1  
ATOM 1734  C CG   . MET A 1 118 ? -7.725  -11.485 1.329   1.00 0.87  ? 1625 MET A CG   1  
ATOM 1735  S SD   . MET A 1 118 ? -8.838  -12.685 0.561   1.00 1.37  ? 1625 MET A SD   1  
ATOM 1736  C CE   . MET A 1 118 ? -7.658  -13.756 -0.247  1.00 0.77  ? 1625 MET A CE   1  
ATOM 1737  H H    . MET A 1 118 ? -7.776  -8.316  1.281   1.00 0.36  ? 1625 MET A H    1  
ATOM 1738  H HA   . MET A 1 118 ? -5.411  -9.977  1.657   1.00 0.56  ? 1625 MET A HA   1  
ATOM 1739  H HB2  . MET A 1 118 ? -7.677  -10.165 -0.351  1.00 0.70  ? 1625 MET A HB2  1  
ATOM 1740  H HB3  . MET A 1 118 ? -6.325  -11.277 -0.264  1.00 0.77  ? 1625 MET A HB3  1  
ATOM 1741  H HG2  . MET A 1 118 ? -6.992  -12.044 1.894   1.00 0.96  ? 1625 MET A HG2  1  
ATOM 1742  H HG3  . MET A 1 118 ? -8.287  -10.878 2.022   1.00 0.72  ? 1625 MET A HG3  1  
ATOM 1743  H HE1  . MET A 1 118 ? -8.191  -14.531 -0.779  1.00 1.43  ? 1625 MET A HE1  1  
ATOM 1744  H HE2  . MET A 1 118 ? -7.023  -14.207 0.502   1.00 1.35  ? 1625 MET A HE2  1  
ATOM 1745  H HE3  . MET A 1 118 ? -7.056  -13.185 -0.936  1.00 1.27  ? 1625 MET A HE3  1  
ATOM 1746  N N    . LEU A 1 119 ? -4.052  -8.607  0.009   1.00 0.42  ? 1626 LEU A N    1  
ATOM 1747  C CA   . LEU A 1 119 ? -3.257  -7.895  -0.979  1.00 0.41  ? 1626 LEU A CA   1  
ATOM 1748  C C    . LEU A 1 119 ? -3.160  -8.804  -2.201  1.00 0.42  ? 1626 LEU A C    1  
ATOM 1749  O O    . LEU A 1 119 ? -2.644  -9.924  -2.111  1.00 0.51  ? 1626 LEU A O    1  
ATOM 1750  C CB   . LEU A 1 119 ? -1.848  -7.620  -0.400  1.00 0.50  ? 1626 LEU A CB   1  
ATOM 1751  C CG   . LEU A 1 119 ? -1.115  -6.323  -0.852  1.00 0.59  ? 1626 LEU A CG   1  
ATOM 1752  C CD1  . LEU A 1 119 ? -0.716  -6.306  -2.313  1.00 0.78  ? 1626 LEU A CD1  1  
ATOM 1753  C CD2  . LEU A 1 119 ? -1.947  -5.122  -0.561  1.00 0.89  ? 1626 LEU A CD2  1  
ATOM 1754  H H    . LEU A 1 119 ? -3.600  -8.991  0.794   1.00 0.51  ? 1626 LEU A H    1  
ATOM 1755  H HA   . LEU A 1 119 ? -3.751  -6.965  -1.218  1.00 0.39  ? 1626 LEU A HA   1  
ATOM 1756  H HB2  . LEU A 1 119 ? -1.936  -7.589  0.676   1.00 0.56  ? 1626 LEU A HB2  1  
ATOM 1757  H HB3  . LEU A 1 119 ? -1.223  -8.461  -0.657  1.00 0.59  ? 1626 LEU A HB3  1  
ATOM 1758  H HG   . LEU A 1 119 ? -0.209  -6.227  -0.271  1.00 0.98  ? 1626 LEU A HG   1  
ATOM 1759  H HD11 . LEU A 1 119 ? -0.425  -5.289  -2.553  1.00 1.41  ? 1626 LEU A HD11 1  
ATOM 1760  H HD12 . LEU A 1 119 ? -1.536  -6.605  -2.946  1.00 1.25  ? 1626 LEU A HD12 1  
ATOM 1761  H HD13 . LEU A 1 119 ? 0.131   -6.957  -2.473  1.00 1.34  ? 1626 LEU A HD13 1  
ATOM 1762  H HD21 . LEU A 1 119 ? -2.801  -5.124  -1.221  1.00 1.40  ? 1626 LEU A HD21 1  
ATOM 1763  H HD22 . LEU A 1 119 ? -1.350  -4.237  -0.716  1.00 1.43  ? 1626 LEU A HD22 1  
ATOM 1764  H HD23 . LEU A 1 119 ? -2.284  -5.165  0.464   1.00 1.42  ? 1626 LEU A HD23 1  
ATOM 1765  N N    . ILE A 1 120 ? -3.735  -8.359  -3.310  1.00 0.37  ? 1627 ILE A N    1  
ATOM 1766  C CA   . ILE A 1 120 ? -3.738  -9.127  -4.531  1.00 0.41  ? 1627 ILE A CA   1  
ATOM 1767  C C    . ILE A 1 120 ? -2.351  -9.146  -5.091  1.00 0.42  ? 1627 ILE A C    1  
ATOM 1768  O O    . ILE A 1 120 ? -1.772  -10.215 -5.325  1.00 0.49  ? 1627 ILE A O    1  
ATOM 1769  C CB   . ILE A 1 120 ? -4.680  -8.519  -5.617  1.00 0.41  ? 1627 ILE A CB   1  
ATOM 1770  C CG1  . ILE A 1 120 ? -6.110  -8.345  -5.086  1.00 0.48  ? 1627 ILE A CG1  1  
ATOM 1771  C CG2  . ILE A 1 120 ? -4.693  -9.430  -6.844  1.00 0.46  ? 1627 ILE A CG2  1  
ATOM 1772  C CD1  . ILE A 1 120 ? -6.769  -9.648  -4.706  1.00 0.58  ? 1627 ILE A CD1  1  
ATOM 1773  H H    . ILE A 1 120 ? -4.171  -7.480  -3.303  1.00 0.34  ? 1627 ILE A H    1  
ATOM 1774  H HA   . ILE A 1 120 ? -4.060  -10.135 -4.313  1.00 0.46  ? 1627 ILE A HA   1  
ATOM 1775  H HB   . ILE A 1 120 ? -4.278  -7.561  -5.911  1.00 0.39  ? 1627 ILE A HB   1  
ATOM 1776  H HG12 . ILE A 1 120 ? -6.096  -7.710  -4.213  1.00 0.48  ? 1627 ILE A HG12 1  
ATOM 1777  H HG13 . ILE A 1 120 ? -6.721  -7.877  -5.845  1.00 0.60  ? 1627 ILE A HG13 1  
ATOM 1778  H HG21 . ILE A 1 120 ? -5.342  -9.039  -7.614  1.00 1.14  ? 1627 ILE A HG21 1  
ATOM 1779  H HG22 . ILE A 1 120 ? -5.065  -10.395 -6.532  1.00 1.07  ? 1627 ILE A HG22 1  
ATOM 1780  H HG23 . ILE A 1 120 ? -3.689  -9.546  -7.224  1.00 1.12  ? 1627 ILE A HG23 1  
ATOM 1781  H HD11 . ILE A 1 120 ? -6.795  -10.292 -5.572  1.00 1.08  ? 1627 ILE A HD11 1  
ATOM 1782  H HD12 . ILE A 1 120 ? -7.781  -9.468  -4.377  1.00 1.23  ? 1627 ILE A HD12 1  
ATOM 1783  H HD13 . ILE A 1 120 ? -6.195  -10.125 -3.925  1.00 1.22  ? 1627 ILE A HD13 1  
ATOM 1784  N N    . SER A 1 121 ? -1.812  -7.959  -5.252  1.00 0.37  ? 1628 SER A N    1  
ATOM 1785  C CA   . SER A 1 121 ? -0.534  -7.762  -5.843  1.00 0.40  ? 1628 SER A CA   1  
ATOM 1786  C C    . SER A 1 121 ? -0.257  -6.274  -5.839  1.00 0.35  ? 1628 SER A C    1  
ATOM 1787  O O    . SER A 1 121 ? -1.182  -5.457  -5.633  1.00 0.35  ? 1628 SER A O    1  
ATOM 1788  C CB   . SER A 1 121 ? -0.532  -8.298  -7.296  1.00 0.48  ? 1628 SER A CB   1  
ATOM 1789  O OG   . SER A 1 121 ? 0.770   -8.305  -7.858  1.00 1.39  ? 1628 SER A OG   1  
ATOM 1790  H H    . SER A 1 121 ? -2.279  -7.150  -4.944  1.00 0.34  ? 1628 SER A H    1  
ATOM 1791  H HA   . SER A 1 121 ? 0.214   -8.284  -5.265  1.00 0.46  ? 1628 SER A HA   1  
ATOM 1792  H HB2  . SER A 1 121 ? -0.912  -9.309  -7.302  1.00 1.12  ? 1628 SER A HB2  1  
ATOM 1793  H HB3  . SER A 1 121 ? -1.172  -7.675  -7.902  1.00 0.97  ? 1628 SER A HB3  1  
ATOM 1794  H HG   . SER A 1 121 ? 1.201   -9.121  -7.558  1.00 1.88  ? 1628 SER A HG   1  
ATOM 1795  N N    . LEU A 1 122 ? 0.980   -5.940  -6.006  1.00 0.37  ? 1629 LEU A N    1  
ATOM 1796  C CA   . LEU A 1 122 ? 1.431   -4.592  -6.109  1.00 0.38  ? 1629 LEU A CA   1  
ATOM 1797  C C    . LEU A 1 122 ? 1.931   -4.390  -7.515  1.00 0.46  ? 1629 LEU A C    1  
ATOM 1798  O O    . LEU A 1 122 ? 2.878   -5.070  -7.933  1.00 0.62  ? 1629 LEU A O    1  
ATOM 1799  C CB   . LEU A 1 122 ? 2.581   -4.355  -5.113  1.00 0.49  ? 1629 LEU A CB   1  
ATOM 1800  C CG   . LEU A 1 122 ? 3.364   -3.029  -5.235  1.00 0.71  ? 1629 LEU A CG   1  
ATOM 1801  C CD1  . LEU A 1 122 ? 2.488   -1.814  -4.975  1.00 1.00  ? 1629 LEU A CD1  1  
ATOM 1802  C CD2  . LEU A 1 122 ? 4.565   -3.036  -4.307  1.00 1.25  ? 1629 LEU A CD2  1  
ATOM 1803  H H    . LEU A 1 122 ? 1.652   -6.651  -6.088  1.00 0.43  ? 1629 LEU A H    1  
ATOM 1804  H HA   . LEU A 1 122 ? 0.616   -3.921  -5.883  1.00 0.34  ? 1629 LEU A HA   1  
ATOM 1805  H HB2  . LEU A 1 122 ? 2.171   -4.404  -4.116  1.00 0.51  ? 1629 LEU A HB2  1  
ATOM 1806  H HB3  . LEU A 1 122 ? 3.282   -5.168  -5.227  1.00 0.62  ? 1629 LEU A HB3  1  
ATOM 1807  H HG   . LEU A 1 122 ? 3.732   -2.949  -6.248  1.00 1.39  ? 1629 LEU A HG   1  
ATOM 1808  H HD11 . LEU A 1 122 ? 2.023   -1.890  -4.004  1.00 1.51  ? 1629 LEU A HD11 1  
ATOM 1809  H HD12 . LEU A 1 122 ? 1.723   -1.733  -5.731  1.00 1.59  ? 1629 LEU A HD12 1  
ATOM 1810  H HD13 . LEU A 1 122 ? 3.100   -0.924  -5.003  1.00 1.59  ? 1629 LEU A HD13 1  
ATOM 1811  H HD21 . LEU A 1 122 ? 5.103   -2.105  -4.409  1.00 1.92  ? 1629 LEU A HD21 1  
ATOM 1812  H HD22 . LEU A 1 122 ? 5.216   -3.858  -4.565  1.00 1.71  ? 1629 LEU A HD22 1  
ATOM 1813  H HD23 . LEU A 1 122 ? 4.229   -3.147  -3.286  1.00 1.66  ? 1629 LEU A HD23 1  
ATOM 1814  N N    . ASP A 1 123 ? 1.280   -3.533  -8.265  1.00 0.45  ? 1630 ASP A N    1  
ATOM 1815  C CA   . ASP A 1 123 ? 1.777   -3.200  -9.610  1.00 0.57  ? 1630 ASP A CA   1  
ATOM 1816  C C    . ASP A 1 123 ? 3.063   -2.421  -9.440  1.00 0.55  ? 1630 ASP A C    1  
ATOM 1817  O O    . ASP A 1 123 ? 3.060   -1.258  -8.991  1.00 0.51  ? 1630 ASP A O    1  
ATOM 1818  C CB   . ASP A 1 123 ? 0.764   -2.429  -10.494 1.00 0.66  ? 1630 ASP A CB   1  
ATOM 1819  C CG   . ASP A 1 123 ? 1.290   -2.210  -11.891 1.00 0.81  ? 1630 ASP A CG   1  
ATOM 1820  O OD1  . ASP A 1 123 ? 2.135   -1.328  -12.084 1.00 0.73  ? 1630 ASP A OD1  1  
ATOM 1821  O OD2  . ASP A 1 123 ? 0.803   -2.873  -12.833 1.00 1.09  ? 1630 ASP A OD2  1  
ATOM 1822  H H    . ASP A 1 123 ? 0.470   -3.138  -7.872  1.00 0.42  ? 1630 ASP A H    1  
ATOM 1823  H HA   . ASP A 1 123 ? 2.049   -4.139  -10.074 1.00 0.67  ? 1630 ASP A HA   1  
ATOM 1824  H HB2  . ASP A 1 123 ? -0.165  -2.973  -10.585 1.00 0.71  ? 1630 ASP A HB2  1  
ATOM 1825  H HB3  . ASP A 1 123 ? 0.530   -1.441  -10.130 1.00 0.62  ? 1630 ASP A HB3  1  
ATOM 1826  N N    . LYS A 1 124 ? 4.145   -3.093  -9.760  1.00 0.67  ? 1631 LYS A N    1  
ATOM 1827  C CA   . LYS A 1 124 ? 5.501   -2.660  -9.492  1.00 0.75  ? 1631 LYS A CA   1  
ATOM 1828  C C    . LYS A 1 124 ? 5.857   -1.281  -10.082 1.00 0.67  ? 1631 LYS A C    1  
ATOM 1829  O O    . LYS A 1 124 ? 6.576   -0.502  -9.451  1.00 0.73  ? 1631 LYS A O    1  
ATOM 1830  C CB   . LYS A 1 124 ? 6.477   -3.726  -10.014 1.00 1.06  ? 1631 LYS A CB   1  
ATOM 1831  C CG   . LYS A 1 124 ? 7.907   -3.551  -9.540  1.00 1.71  ? 1631 LYS A CG   1  
ATOM 1832  C CD   . LYS A 1 124 ? 8.043   -3.839  -8.041  1.00 2.34  ? 1631 LYS A CD   1  
ATOM 1833  C CE   . LYS A 1 124 ? 7.890   -5.328  -7.719  1.00 3.07  ? 1631 LYS A CE   1  
ATOM 1834  N NZ   . LYS A 1 124 ? 8.921   -6.136  -8.403  1.00 3.60  ? 1631 LYS A NZ   1  
ATOM 1835  H H    . LYS A 1 124 ? 4.018   -3.965  -10.202 1.00 0.80  ? 1631 LYS A H    1  
ATOM 1836  H HA   . LYS A 1 124 ? 5.625   -2.617  -8.420  1.00 0.77  ? 1631 LYS A HA   1  
ATOM 1837  H HB2  . LYS A 1 124 ? 6.134   -4.698  -9.690  1.00 1.52  ? 1631 LYS A HB2  1  
ATOM 1838  H HB3  . LYS A 1 124 ? 6.472   -3.699  -11.094 1.00 1.47  ? 1631 LYS A HB3  1  
ATOM 1839  H HG2  . LYS A 1 124 ? 8.542   -4.231  -10.088 1.00 2.29  ? 1631 LYS A HG2  1  
ATOM 1840  H HG3  . LYS A 1 124 ? 8.216   -2.534  -9.732  1.00 2.22  ? 1631 LYS A HG3  1  
ATOM 1841  H HD2  . LYS A 1 124 ? 9.017   -3.513  -7.709  1.00 2.74  ? 1631 LYS A HD2  1  
ATOM 1842  H HD3  . LYS A 1 124 ? 7.282   -3.285  -7.513  1.00 2.69  ? 1631 LYS A HD3  1  
ATOM 1843  H HE2  . LYS A 1 124 ? 7.984   -5.467  -6.652  1.00 3.46  ? 1631 LYS A HE2  1  
ATOM 1844  H HE3  . LYS A 1 124 ? 6.912   -5.653  -8.042  1.00 3.45  ? 1631 LYS A HE3  1  
ATOM 1845  H HZ1  . LYS A 1 124 ? 8.722   -6.222  -9.425  1.00 3.98  ? 1631 LYS A HZ1  1  
ATOM 1846  H HZ2  . LYS A 1 124 ? 9.073   -7.088  -8.004  1.00 3.93  ? 1631 LYS A HZ2  1  
ATOM 1847  H HZ3  . LYS A 1 124 ? 9.837   -5.632  -8.335  1.00 3.83  ? 1631 LYS A HZ3  1  
ATOM 1848  N N    . GLN A 1 125 ? 5.369   -0.975  -11.257 1.00 0.66  ? 1632 GLN A N    1  
ATOM 1849  C CA   . GLN A 1 125 ? 5.776   0.264   -11.907 1.00 0.68  ? 1632 GLN A CA   1  
ATOM 1850  C C    . GLN A 1 125 ? 4.889   1.429   -11.535 1.00 0.57  ? 1632 GLN A C    1  
ATOM 1851  O O    . GLN A 1 125 ? 5.334   2.574   -11.518 1.00 0.60  ? 1632 GLN A O    1  
ATOM 1852  C CB   . GLN A 1 125 ? 5.812   0.103   -13.430 1.00 0.85  ? 1632 GLN A CB   1  
ATOM 1853  C CG   . GLN A 1 125 ? 6.653   -1.073  -13.885 1.00 1.42  ? 1632 GLN A CG   1  
ATOM 1854  C CD   . GLN A 1 125 ? 8.113   -0.998  -13.430 1.00 1.66  ? 1632 GLN A CD   1  
ATOM 1855  O OE1  . GLN A 1 125 ? 8.759   -2.027  -13.177 1.00 2.60  ? 1632 GLN A OE1  1  
ATOM 1856  N NE2  . GLN A 1 125 ? 8.664   0.190   -13.390 1.00 1.55  ? 1632 GLN A NE2  1  
ATOM 1857  H H    . GLN A 1 125 ? 4.737   -1.586  -11.703 1.00 0.70  ? 1632 GLN A H    1  
ATOM 1858  H HA   . GLN A 1 125 ? 6.778   0.484   -11.573 1.00 0.74  ? 1632 GLN A HA   1  
ATOM 1859  H HB2  . GLN A 1 125 ? 4.805   -0.037  -13.792 1.00 1.30  ? 1632 GLN A HB2  1  
ATOM 1860  H HB3  . GLN A 1 125 ? 6.222   1.001   -13.869 1.00 1.21  ? 1632 GLN A HB3  1  
ATOM 1861  H HG2  . GLN A 1 125 ? 6.170   -1.936  -13.451 1.00 1.88  ? 1632 GLN A HG2  1  
ATOM 1862  H HG3  . GLN A 1 125 ? 6.605   -1.143  -14.962 1.00 2.07  ? 1632 GLN A HG3  1  
ATOM 1863  H HE21 . GLN A 1 125 ? 8.122   0.964   -13.663 1.00 1.66  ? 1632 GLN A HE21 1  
ATOM 1864  H HE22 . GLN A 1 125 ? 9.587   0.287   -13.079 1.00 1.98  ? 1632 GLN A HE22 1  
ATOM 1865  N N    . THR A 1 126 ? 3.655   1.160   -11.234 1.00 0.52  ? 1633 THR A N    1  
ATOM 1866  C CA   . THR A 1 126 ? 2.728   2.235   -10.986 1.00 0.52  ? 1633 THR A CA   1  
ATOM 1867  C C    . THR A 1 126 ? 2.476   2.499   -9.475  1.00 0.45  ? 1633 THR A C    1  
ATOM 1868  O O    . THR A 1 126 ? 1.722   3.418   -9.116  1.00 0.53  ? 1633 THR A O    1  
ATOM 1869  C CB   . THR A 1 126 ? 1.400   1.966   -11.729 1.00 0.63  ? 1633 THR A CB   1  
ATOM 1870  O OG1  . THR A 1 126 ? 0.813   0.768   -11.220 1.00 0.63  ? 1633 THR A OG1  1  
ATOM 1871  C CG2  . THR A 1 126 ? 1.660   1.771   -13.228 1.00 0.75  ? 1633 THR A CG2  1  
ATOM 1872  H H    . THR A 1 126 ? 3.344   0.227   -11.212 1.00 0.55  ? 1633 THR A H    1  
ATOM 1873  H HA   . THR A 1 126 ? 3.155   3.135   -11.410 1.00 0.57  ? 1633 THR A HA   1  
ATOM 1874  H HB   . THR A 1 126 ? 0.724   2.798   -11.594 1.00 0.69  ? 1633 THR A HB   1  
ATOM 1875  H HG1  . THR A 1 126 ? 1.304   0.026   -11.617 1.00 0.64  ? 1633 THR A HG1  1  
ATOM 1876  H HG21 . THR A 1 126 ? 2.056   2.674   -13.670 1.00 1.35  ? 1633 THR A HG21 1  
ATOM 1877  H HG22 . THR A 1 126 ? 0.740   1.502   -13.724 1.00 1.23  ? 1633 THR A HG22 1  
ATOM 1878  H HG23 . THR A 1 126 ? 2.377   0.970   -13.356 1.00 1.21  ? 1633 THR A HG23 1  
ATOM 1879  N N    . CYS A 1 127 ? 3.105   1.665   -8.593  1.00 0.38  ? 1634 CYS A N    1  
ATOM 1880  C CA   . CYS A 1 127 ? 2.992   1.789   -7.118  1.00 0.35  ? 1634 CYS A CA   1  
ATOM 1881  C C    . CYS A 1 127 ? 1.538   1.689   -6.656  1.00 0.31  ? 1634 CYS A C    1  
ATOM 1882  O O    . CYS A 1 127 ? 1.104   2.368   -5.726  1.00 0.31  ? 1634 CYS A O    1  
ATOM 1883  C CB   . CYS A 1 127 ? 3.664   3.080   -6.593  1.00 0.41  ? 1634 CYS A CB   1  
ATOM 1884  S SG   . CYS A 1 127 ? 5.471   3.167   -6.897  1.00 0.53  ? 1634 CYS A SG   1  
ATOM 1885  H H    . CYS A 1 127 ? 3.651   0.919   -8.926  1.00 0.41  ? 1634 CYS A H    1  
ATOM 1886  H HA   . CYS A 1 127 ? 3.510   0.933   -6.709  1.00 0.37  ? 1634 CYS A HA   1  
ATOM 1887  H HB2  . CYS A 1 127 ? 3.212   3.933   -7.078  1.00 0.42  ? 1634 CYS A HB2  1  
ATOM 1888  H HB3  . CYS A 1 127 ? 3.503   3.152   -5.527  1.00 0.43  ? 1634 CYS A HB3  1  
ATOM 1889  N N    . THR A 1 128 ? 0.810   0.831   -7.313  1.00 0.33  ? 1635 THR A N    1  
ATOM 1890  C CA   . THR A 1 128 ? -0.594  0.622   -7.047  1.00 0.32  ? 1635 THR A CA   1  
ATOM 1891  C C    . THR A 1 128 ? -0.792  -0.700  -6.302  1.00 0.28  ? 1635 THR A C    1  
ATOM 1892  O O    . THR A 1 128 ? -0.361  -1.757  -6.772  1.00 0.32  ? 1635 THR A O    1  
ATOM 1893  C CB   . THR A 1 128 ? -1.376  0.607   -8.377  1.00 0.38  ? 1635 THR A CB   1  
ATOM 1894  O OG1  . THR A 1 128 ? -1.156  1.852   -9.069  1.00 0.46  ? 1635 THR A OG1  1  
ATOM 1895  C CG2  . THR A 1 128 ? -2.878  0.396   -8.160  1.00 0.41  ? 1635 THR A CG2  1  
ATOM 1896  H H    . THR A 1 128 ? 1.263   0.294   -7.992  1.00 0.39  ? 1635 THR A H    1  
ATOM 1897  H HA   . THR A 1 128 ? -0.940  1.448   -6.443  1.00 0.33  ? 1635 THR A HA   1  
ATOM 1898  H HB   . THR A 1 128 ? -0.984  -0.196  -8.985  1.00 0.41  ? 1635 THR A HB   1  
ATOM 1899  H HG1  . THR A 1 128 ? -0.265  2.149   -8.846  1.00 0.89  ? 1635 THR A HG1  1  
ATOM 1900  H HG21 . THR A 1 128 ? -3.035  -0.540  -7.645  1.00 1.04  ? 1635 THR A HG21 1  
ATOM 1901  H HG22 . THR A 1 128 ? -3.368  0.353   -9.122  1.00 1.11  ? 1635 THR A HG22 1  
ATOM 1902  H HG23 . THR A 1 128 ? -3.307  1.202   -7.585  1.00 1.08  ? 1635 THR A HG23 1  
ATOM 1903  N N    . LEU A 1 129 ? -1.425  -0.634  -5.158  1.00 0.25  ? 1636 LEU A N    1  
ATOM 1904  C CA   . LEU A 1 129 ? -1.639  -1.794  -4.327  1.00 0.24  ? 1636 LEU A CA   1  
ATOM 1905  C C    . LEU A 1 129 ? -3.092  -2.204  -4.480  1.00 0.23  ? 1636 LEU A C    1  
ATOM 1906  O O    . LEU A 1 129 ? -3.988  -1.349  -4.426  1.00 0.28  ? 1636 LEU A O    1  
ATOM 1907  C CB   . LEU A 1 129 ? -1.403  -1.494  -2.819  1.00 0.27  ? 1636 LEU A CB   1  
ATOM 1908  C CG   . LEU A 1 129 ? -0.049  -0.894  -2.294  1.00 0.32  ? 1636 LEU A CG   1  
ATOM 1909  C CD1  . LEU A 1 129 ? 0.359   0.404   -2.982  1.00 0.85  ? 1636 LEU A CD1  1  
ATOM 1910  C CD2  . LEU A 1 129 ? -0.196  -0.594  -0.828  1.00 0.86  ? 1636 LEU A CD2  1  
ATOM 1911  H H    . LEU A 1 129 ? -1.808  0.220   -4.849  1.00 0.27  ? 1636 LEU A H    1  
ATOM 1912  H HA   . LEU A 1 129 ? -0.985  -2.592  -4.647  1.00 0.24  ? 1636 LEU A HA   1  
ATOM 1913  H HB2  . LEU A 1 129 ? -2.235  -0.958  -2.405  1.00 0.34  ? 1636 LEU A HB2  1  
ATOM 1914  H HB3  . LEU A 1 129 ? -1.486  -2.473  -2.372  1.00 0.26  ? 1636 LEU A HB3  1  
ATOM 1915  H HG   . LEU A 1 129 ? 0.746   -1.616  -2.391  1.00 0.83  ? 1636 LEU A HG   1  
ATOM 1916  H HD11 . LEU A 1 129 ? 1.285   0.754   -2.548  1.00 1.40  ? 1636 LEU A HD11 1  
ATOM 1917  H HD12 . LEU A 1 129 ? -0.408  1.149   -2.829  1.00 1.36  ? 1636 LEU A HD12 1  
ATOM 1918  H HD13 . LEU A 1 129 ? 0.506   0.226   -4.038  1.00 1.56  ? 1636 LEU A HD13 1  
ATOM 1919  H HD21 . LEU A 1 129 ? 0.752   -0.262  -0.433  1.00 1.36  ? 1636 LEU A HD21 1  
ATOM 1920  H HD22 . LEU A 1 129 ? -0.570  -1.449  -0.288  1.00 1.31  ? 1636 LEU A HD22 1  
ATOM 1921  H HD23 . LEU A 1 129 ? -0.900  0.224   -0.747  1.00 1.40  ? 1636 LEU A HD23 1  
ATOM 1922  N N    . PHE A 1 130 ? -3.336  -3.463  -4.684  1.00 0.22  ? 1637 PHE A N    1  
ATOM 1923  C CA   . PHE A 1 130 ? -4.695  -3.944  -4.811  1.00 0.23  ? 1637 PHE A CA   1  
ATOM 1924  C C    . PHE A 1 130 ? -5.078  -4.742  -3.574  1.00 0.22  ? 1637 PHE A C    1  
ATOM 1925  O O    . PHE A 1 130 ? -4.297  -5.581  -3.101  1.00 0.26  ? 1637 PHE A O    1  
ATOM 1926  C CB   . PHE A 1 130 ? -4.853  -4.803  -6.058  1.00 0.28  ? 1637 PHE A CB   1  
ATOM 1927  C CG   . PHE A 1 130 ? -4.525  -4.104  -7.350  1.00 0.31  ? 1637 PHE A CG   1  
ATOM 1928  C CD1  . PHE A 1 130 ? -5.408  -3.194  -7.904  1.00 0.38  ? 1637 PHE A CD1  1  
ATOM 1929  C CD2  . PHE A 1 130 ? -3.331  -4.361  -8.010  1.00 0.37  ? 1637 PHE A CD2  1  
ATOM 1930  C CE1  . PHE A 1 130 ? -5.109  -2.555  -9.089  1.00 0.45  ? 1637 PHE A CE1  1  
ATOM 1931  C CE2  . PHE A 1 130 ? -3.029  -3.724  -9.195  1.00 0.43  ? 1637 PHE A CE2  1  
ATOM 1932  C CZ   . PHE A 1 130 ? -3.920  -2.820  -9.735  1.00 0.45  ? 1637 PHE A CZ   1  
ATOM 1933  H H    . PHE A 1 130 ? -2.590  -4.097  -4.755  1.00 0.25  ? 1637 PHE A H    1  
ATOM 1934  H HA   . PHE A 1 130 ? -5.344  -3.084  -4.889  1.00 0.23  ? 1637 PHE A HA   1  
ATOM 1935  H HB2  . PHE A 1 130 ? -4.177  -5.637  -5.960  1.00 0.29  ? 1637 PHE A HB2  1  
ATOM 1936  H HB3  . PHE A 1 130 ? -5.874  -5.150  -6.105  1.00 0.31  ? 1637 PHE A HB3  1  
ATOM 1937  H HD1  . PHE A 1 130 ? -6.340  -2.985  -7.400  1.00 0.43  ? 1637 PHE A HD1  1  
ATOM 1938  H HD2  . PHE A 1 130 ? -2.634  -5.070  -7.587  1.00 0.41  ? 1637 PHE A HD2  1  
ATOM 1939  H HE1  . PHE A 1 130 ? -5.804  -1.847  -9.516  1.00 0.54  ? 1637 PHE A HE1  1  
ATOM 1940  H HE2  . PHE A 1 130 ? -2.101  -3.928  -9.707  1.00 0.50  ? 1637 PHE A HE2  1  
ATOM 1941  H HZ   . PHE A 1 130 ? -3.687  -2.320  -10.662 1.00 0.52  ? 1637 PHE A HZ   1  
ATOM 1942  N N    . PHE A 1 131 ? -6.272  -4.523  -3.083  1.00 0.21  ? 1638 PHE A N    1  
ATOM 1943  C CA   . PHE A 1 131 ? -6.745  -5.148  -1.853  1.00 0.22  ? 1638 PHE A CA   1  
ATOM 1944  C C    . PHE A 1 131 ? -8.102  -5.784  -2.087  1.00 0.22  ? 1638 PHE A C    1  
ATOM 1945  O O    . PHE A 1 131 ? -8.990  -5.155  -2.626  1.00 0.26  ? 1638 PHE A O    1  
ATOM 1946  C CB   . PHE A 1 131 ? -6.882  -4.127  -0.682  1.00 0.25  ? 1638 PHE A CB   1  
ATOM 1947  C CG   . PHE A 1 131 ? -5.611  -3.541  -0.050  1.00 0.28  ? 1638 PHE A CG   1  
ATOM 1948  C CD1  . PHE A 1 131 ? -4.931  -2.441  -0.603  1.00 0.29  ? 1638 PHE A CD1  1  
ATOM 1949  C CD2  . PHE A 1 131 ? -5.137  -4.061  1.150   1.00 0.42  ? 1638 PHE A CD2  1  
ATOM 1950  C CE1  . PHE A 1 131 ? -3.831  -1.901  0.025   1.00 0.34  ? 1638 PHE A CE1  1  
ATOM 1951  C CE2  . PHE A 1 131 ? -4.024  -3.518  1.773   1.00 0.50  ? 1638 PHE A CE2  1  
ATOM 1952  C CZ   . PHE A 1 131 ? -3.374  -2.435  1.210   1.00 0.43  ? 1638 PHE A CZ   1  
ATOM 1953  H H    . PHE A 1 131 ? -6.907  -3.955  -3.580  1.00 0.23  ? 1638 PHE A H    1  
ATOM 1954  H HA   . PHE A 1 131 ? -6.068  -5.936  -1.566  1.00 0.24  ? 1638 PHE A HA   1  
ATOM 1955  H HB2  . PHE A 1 131 ? -7.480  -3.290  -1.010  1.00 0.26  ? 1638 PHE A HB2  1  
ATOM 1956  H HB3  . PHE A 1 131 ? -7.420  -4.640  0.102   1.00 0.28  ? 1638 PHE A HB3  1  
ATOM 1957  H HD1  . PHE A 1 131 ? -5.225  -1.967  -1.525  1.00 0.34  ? 1638 PHE A HD1  1  
ATOM 1958  H HD2  . PHE A 1 131 ? -5.636  -4.906  1.600   1.00 0.51  ? 1638 PHE A HD2  1  
ATOM 1959  H HE1  . PHE A 1 131 ? -3.324  -1.060  -0.424  1.00 0.39  ? 1638 PHE A HE1  1  
ATOM 1960  H HE2  . PHE A 1 131 ? -3.667  -3.940  2.702   1.00 0.64  ? 1638 PHE A HE2  1  
ATOM 1961  H HZ   . PHE A 1 131 ? -2.511  -1.999  1.691   1.00 0.50  ? 1638 PHE A HZ   1  
ATOM 1962  N N    . SER A 1 132 ? -8.236  -7.010  -1.688  1.00 0.25  ? 1639 SER A N    1  
ATOM 1963  C CA   . SER A 1 132 ? -9.475  -7.739  -1.776  1.00 0.25  ? 1639 SER A CA   1  
ATOM 1964  C C    . SER A 1 132 ? -10.031 -7.845  -0.369  1.00 0.24  ? 1639 SER A C    1  
ATOM 1965  O O    . SER A 1 132 ? -9.267  -7.774  0.602   1.00 0.33  ? 1639 SER A O    1  
ATOM 1966  C CB   . SER A 1 132 ? -9.209  -9.145  -2.326  1.00 0.29  ? 1639 SER A CB   1  
ATOM 1967  O OG   . SER A 1 132 ? -10.406 -9.815  -2.679  1.00 1.04  ? 1639 SER A OG   1  
ATOM 1968  H H    . SER A 1 132 ? -7.456  -7.460  -1.292  1.00 0.30  ? 1639 SER A H    1  
ATOM 1969  H HA   . SER A 1 132 ? -10.175 -7.226  -2.417  1.00 0.26  ? 1639 SER A HA   1  
ATOM 1970  H HB2  . SER A 1 132 ? -8.596  -9.083  -3.211  1.00 0.71  ? 1639 SER A HB2  1  
ATOM 1971  H HB3  . SER A 1 132 ? -8.697  -9.728  -1.575  1.00 0.78  ? 1639 SER A HB3  1  
ATOM 1972  H HG   . SER A 1 132 ? -10.362 -9.938  -3.641  1.00 1.34  ? 1639 SER A HG   1  
ATOM 1973  N N    . TRP A 1 133 ? -11.318 -7.993  -0.244  1.00 0.23  ? 1640 TRP A N    1  
ATOM 1974  C CA   . TRP A 1 133 ? -11.939 -8.131  1.034   1.00 0.23  ? 1640 TRP A CA   1  
ATOM 1975  C C    . TRP A 1 133 ? -13.239 -8.841  0.791   1.00 0.25  ? 1640 TRP A C    1  
ATOM 1976  O O    . TRP A 1 133 ? -14.112 -8.326  0.081   1.00 0.31  ? 1640 TRP A O    1  
ATOM 1977  C CB   . TRP A 1 133 ? -12.217 -6.763  1.655   1.00 0.27  ? 1640 TRP A CB   1  
ATOM 1978  C CG   . TRP A 1 133 ? -12.317 -6.779  3.159   1.00 0.28  ? 1640 TRP A CG   1  
ATOM 1979  C CD1  . TRP A 1 133 ? -13.074 -7.604  3.951   1.00 0.30  ? 1640 TRP A CD1  1  
ATOM 1980  C CD2  . TRP A 1 133 ? -11.641 -5.893  4.044   1.00 0.39  ? 1640 TRP A CD2  1  
ATOM 1981  N NE1  . TRP A 1 133 ? -12.868 -7.299  5.275   1.00 0.36  ? 1640 TRP A NE1  1  
ATOM 1982  C CE2  . TRP A 1 133 ? -12.003 -6.244  5.356   1.00 0.43  ? 1640 TRP A CE2  1  
ATOM 1983  C CE3  . TRP A 1 133 ? -10.753 -4.836  3.849   1.00 0.51  ? 1640 TRP A CE3  1  
ATOM 1984  C CZ2  . TRP A 1 133 ? -11.508 -5.574  6.466   1.00 0.57  ? 1640 TRP A CZ2  1  
ATOM 1985  C CZ3  . TRP A 1 133 ? -10.267 -4.173  4.945   1.00 0.66  ? 1640 TRP A CZ3  1  
ATOM 1986  C CH2  . TRP A 1 133 ? -10.642 -4.541  6.240   1.00 0.68  ? 1640 TRP A CH2  1  
ATOM 1987  H H    . TRP A 1 133 ? -11.895 -8.036  -1.038  1.00 0.31  ? 1640 TRP A H    1  
ATOM 1988  H HA   . TRP A 1 133 ? -11.280 -8.702  1.672   1.00 0.23  ? 1640 TRP A HA   1  
ATOM 1989  H HB2  . TRP A 1 133 ? -11.412 -6.095  1.389   1.00 0.32  ? 1640 TRP A HB2  1  
ATOM 1990  H HB3  . TRP A 1 133 ? -13.146 -6.380  1.259   1.00 0.29  ? 1640 TRP A HB3  1  
ATOM 1991  H HD1  . TRP A 1 133 ? -13.712 -8.392  3.579   1.00 0.33  ? 1640 TRP A HD1  1  
ATOM 1992  H HE1  . TRP A 1 133 ? -13.278 -7.756  6.045   1.00 0.40  ? 1640 TRP A HE1  1  
ATOM 1993  H HE3  . TRP A 1 133 ? -10.452 -4.536  2.856   1.00 0.52  ? 1640 TRP A HE3  1  
ATOM 1994  H HZ2  . TRP A 1 133 ? -11.787 -5.848  7.472   1.00 0.61  ? 1640 TRP A HZ2  1  
ATOM 1995  H HZ3  . TRP A 1 133 ? -9.577  -3.355  4.799   1.00 0.78  ? 1640 TRP A HZ3  1  
ATOM 1996  H HH2  . TRP A 1 133 ? -10.232 -3.987  7.072   1.00 0.80  ? 1640 TRP A HH2  1  
ATOM 1997  N N    . HIS A 1 134 ? -13.370 -10.016 1.301   1.00 0.28  ? 1641 HIS A N    1  
ATOM 1998  C CA   . HIS A 1 134 ? -14.565 -10.767 1.063   1.00 0.34  ? 1641 HIS A CA   1  
ATOM 1999  C C    . HIS A 1 134 ? -15.442 -10.770 2.310   1.00 0.33  ? 1641 HIS A C    1  
ATOM 2000  O O    . HIS A 1 134 ? -15.094 -11.353 3.325   1.00 0.39  ? 1641 HIS A O    1  
ATOM 2001  C CB   . HIS A 1 134 ? -14.244 -12.184 0.591   1.00 0.48  ? 1641 HIS A CB   1  
ATOM 2002  C CG   . HIS A 1 134 ? -13.457 -12.273 -0.695  1.00 0.51  ? 1641 HIS A CG   1  
ATOM 2003  N ND1  . HIS A 1 134 ? -13.993 -12.727 -1.874  1.00 0.73  ? 1641 HIS A ND1  1  
ATOM 2004  C CD2  . HIS A 1 134 ? -12.159 -11.999 -0.966  1.00 0.64  ? 1641 HIS A CD2  1  
ATOM 2005  C CE1  . HIS A 1 134 ? -13.071 -12.727 -2.807  1.00 0.90  ? 1641 HIS A CE1  1  
ATOM 2006  N NE2  . HIS A 1 134 ? -11.954 -12.292 -2.285  1.00 0.85  ? 1641 HIS A NE2  1  
ATOM 2007  H H    . HIS A 1 134 ? -12.666 -10.400 1.876   1.00 0.30  ? 1641 HIS A H    1  
ATOM 2008  H HA   . HIS A 1 134 ? -15.104 -10.251 0.281   1.00 0.38  ? 1641 HIS A HA   1  
ATOM 2009  H HB2  . HIS A 1 134 ? -13.704 -12.724 1.356   1.00 0.65  ? 1641 HIS A HB2  1  
ATOM 2010  H HB3  . HIS A 1 134 ? -15.192 -12.662 0.412   1.00 0.67  ? 1641 HIS A HB3  1  
ATOM 2011  H HD1  . HIS A 1 134 ? -14.920 -13.046 -2.016  1.00 0.86  ? 1641 HIS A HD1  1  
ATOM 2012  H HD2  . HIS A 1 134 ? -11.425 -11.616 -0.270  1.00 0.74  ? 1641 HIS A HD2  1  
ATOM 2013  H HE1  . HIS A 1 134 ? -13.209 -13.033 -3.834  1.00 1.14  ? 1641 HIS A HE1  1  
ATOM 2014  H HE2  . HIS A 1 134 ? -11.073 -12.345 -2.728  1.00 0.89  ? 1641 HIS A HE2  1  
ATOM 2015  N N    . THR A 1 135 ? -16.570 -10.117 2.212   1.00 0.33  ? 1642 THR A N    1  
ATOM 2016  C CA   . THR A 1 135 ? -17.473 -9.936  3.337   1.00 0.35  ? 1642 THR A CA   1  
ATOM 2017  C C    . THR A 1 135 ? -18.951 -10.023 2.864   1.00 0.38  ? 1642 THR A C    1  
ATOM 2018  O O    . THR A 1 135 ? -19.261 -9.702  1.701   1.00 0.38  ? 1642 THR A O    1  
ATOM 2019  C CB   . THR A 1 135 ? -17.208 -8.545  4.019   1.00 0.37  ? 1642 THR A CB   1  
ATOM 2020  O OG1  . THR A 1 135 ? -18.167 -8.284  5.058   1.00 0.48  ? 1642 THR A OG1  1  
ATOM 2021  C CG2  . THR A 1 135 ? -17.247 -7.408  3.008   1.00 0.32  ? 1642 THR A CG2  1  
ATOM 2022  H H    . THR A 1 135 ? -16.820 -9.755  1.335   1.00 0.36  ? 1642 THR A H    1  
ATOM 2023  H HA   . THR A 1 135 ? -17.228 -10.718 4.038   1.00 0.39  ? 1642 THR A HA   1  
ATOM 2024  H HB   . THR A 1 135 ? -16.221 -8.581  4.458   1.00 0.40  ? 1642 THR A HB   1  
ATOM 2025  H HG1  . THR A 1 135 ? -17.679 -8.092  5.877   1.00 0.61  ? 1642 THR A HG1  1  
ATOM 2026  H HG21 . THR A 1 135 ? -17.039 -6.473  3.507   1.00 1.11  ? 1642 THR A HG21 1  
ATOM 2027  H HG22 . THR A 1 135 ? -18.227 -7.368  2.558   1.00 1.04  ? 1642 THR A HG22 1  
ATOM 2028  H HG23 . THR A 1 135 ? -16.508 -7.594  2.244   1.00 1.03  ? 1642 THR A HG23 1  
ATOM 2029  N N    . PRO A 1 136 ? -19.887 -10.513 3.732   1.00 0.46  ? 1643 PRO A N    1  
ATOM 2030  C CA   . PRO A 1 136 ? -21.313 -10.566 3.404   1.00 0.52  ? 1643 PRO A CA   1  
ATOM 2031  C C    . PRO A 1 136 ? -22.009 -9.204  3.576   1.00 0.50  ? 1643 PRO A C    1  
ATOM 2032  O O    . PRO A 1 136 ? -23.188 -9.062  3.255   1.00 0.57  ? 1643 PRO A O    1  
ATOM 2033  C CB   . PRO A 1 136 ? -21.876 -11.586 4.399   1.00 0.63  ? 1643 PRO A CB   1  
ATOM 2034  C CG   . PRO A 1 136 ? -20.982 -11.494 5.587   1.00 0.66  ? 1643 PRO A CG   1  
ATOM 2035  C CD   . PRO A 1 136 ? -19.618 -11.109 5.078   1.00 0.54  ? 1643 PRO A CD   1  
ATOM 2036  H HA   . PRO A 1 136 ? -21.470 -10.911 2.393   1.00 0.54  ? 1643 PRO A HA   1  
ATOM 2037  H HB2  . PRO A 1 136 ? -22.889 -11.311 4.652   1.00 0.67  ? 1643 PRO A HB2  1  
ATOM 2038  H HB3  . PRO A 1 136 ? -21.869 -12.580 3.976   1.00 0.69  ? 1643 PRO A HB3  1  
ATOM 2039  H HG2  . PRO A 1 136 ? -21.353 -10.738 6.263   1.00 0.72  ? 1643 PRO A HG2  1  
ATOM 2040  H HG3  . PRO A 1 136 ? -20.939 -12.452 6.085   1.00 0.78  ? 1643 PRO A HG3  1  
ATOM 2041  H HD2  . PRO A 1 136 ? -19.174 -10.392 5.755   1.00 0.54  ? 1643 PRO A HD2  1  
ATOM 2042  H HD3  . PRO A 1 136 ? -19.022 -12.006 5.004   1.00 0.56  ? 1643 PRO A HD3  1  
ATOM 2043  N N    . LEU A 1 137 ? -21.285 -8.216  4.088   1.00 0.47  ? 1644 LEU A N    1  
ATOM 2044  C CA   . LEU A 1 137 ? -21.830 -6.859  4.245   1.00 0.48  ? 1644 LEU A CA   1  
ATOM 2045  C C    . LEU A 1 137 ? -21.883 -6.167  2.884   1.00 0.52  ? 1644 LEU A C    1  
ATOM 2046  O O    . LEU A 1 137 ? -22.708 -5.280  2.635   1.00 0.60  ? 1644 LEU A O    1  
ATOM 2047  C CB   . LEU A 1 137 ? -20.984 -6.052  5.286   1.00 0.58  ? 1644 LEU A CB   1  
ATOM 2048  C CG   . LEU A 1 137 ? -21.337 -4.550  5.534   1.00 0.66  ? 1644 LEU A CG   1  
ATOM 2049  C CD1  . LEU A 1 137 ? -20.891 -4.133  6.918   1.00 0.97  ? 1644 LEU A CD1  1  
ATOM 2050  C CD2  . LEU A 1 137 ? -20.635 -3.635  4.527   1.00 0.96  ? 1644 LEU A CD2  1  
ATOM 2051  H H    . LEU A 1 137 ? -20.368 -8.411  4.389   1.00 0.48  ? 1644 LEU A H    1  
ATOM 2052  H HA   . LEU A 1 137 ? -22.842 -6.962  4.610   1.00 0.49  ? 1644 LEU A HA   1  
ATOM 2053  H HB2  . LEU A 1 137 ? -21.058 -6.561  6.236   1.00 0.83  ? 1644 LEU A HB2  1  
ATOM 2054  H HB3  . LEU A 1 137 ? -19.952 -6.102  4.970   1.00 0.85  ? 1644 LEU A HB3  1  
ATOM 2055  H HG   . LEU A 1 137 ? -22.403 -4.401  5.449   1.00 1.11  ? 1644 LEU A HG   1  
ATOM 2056  H HD11 . LEU A 1 137 ? -21.122 -3.086  7.058   1.00 1.36  ? 1644 LEU A HD11 1  
ATOM 2057  H HD12 . LEU A 1 137 ? -19.827 -4.280  7.006   1.00 1.66  ? 1644 LEU A HD12 1  
ATOM 2058  H HD13 . LEU A 1 137 ? -21.409 -4.722  7.660   1.00 1.48  ? 1644 LEU A HD13 1  
ATOM 2059  H HD21 . LEU A 1 137 ? -19.567 -3.790  4.575   1.00 1.41  ? 1644 LEU A HD21 1  
ATOM 2060  H HD22 . LEU A 1 137 ? -20.840 -2.608  4.790   1.00 1.47  ? 1644 LEU A HD22 1  
ATOM 2061  H HD23 . LEU A 1 137 ? -20.991 -3.827  3.527   1.00 1.56  ? 1644 LEU A HD23 1  
ATOM 2062  N N    . ALA A 1 138 ? -21.056 -6.642  1.990   1.00 0.50  ? 1645 ALA A N    1  
ATOM 2063  C CA   . ALA A 1 138 ? -20.892 -6.044  0.686   1.00 0.59  ? 1645 ALA A CA   1  
ATOM 2064  C C    . ALA A 1 138 ? -21.610 -6.840  -0.380  1.00 0.66  ? 1645 ALA A C    1  
ATOM 2065  O O    . ALA A 1 138 ? -21.214 -6.844  -1.541  1.00 0.84  ? 1645 ALA A O    1  
ATOM 2066  C CB   . ALA A 1 138 ? -19.430 -5.981  0.358   1.00 0.72  ? 1645 ALA A CB   1  
ATOM 2067  H H    . ALA A 1 138 ? -20.546 -7.449  2.212   1.00 0.45  ? 1645 ALA A H    1  
ATOM 2068  H HA   . ALA A 1 138 ? -21.272 -5.035  0.707   1.00 0.62  ? 1645 ALA A HA   1  
ATOM 2069  H HB1  . ALA A 1 138 ? -19.285 -5.325  -0.481  1.00 1.29  ? 1645 ALA A HB1  1  
ATOM 2070  H HB2  . ALA A 1 138 ? -19.134 -6.977  0.067   1.00 1.28  ? 1645 ALA A HB2  1  
ATOM 2071  H HB3  . ALA A 1 138 ? -18.868 -5.662  1.219   1.00 1.23  ? 1645 ALA A HB3  1  
ATOM 2072  N N    . CYS A 1 139 ? -22.647 -7.504  -0.007  1.00 0.62  ? 1646 CYS A N    1  
ATOM 2073  C CA   . CYS A 1 139 ? -23.316 -8.360  -0.932  1.00 0.75  ? 1646 CYS A CA   1  
ATOM 2074  C C    . CYS A 1 139 ? -24.752 -7.933  -1.106  1.00 0.85  ? 1646 CYS A C    1  
ATOM 2075  O O    . CYS A 1 139 ? -25.340 -7.322  -0.203  1.00 0.89  ? 1646 CYS A O    1  
ATOM 2076  C CB   . CYS A 1 139 ? -23.247 -9.801  -0.434  1.00 0.87  ? 1646 CYS A CB   1  
ATOM 2077  S SG   . CYS A 1 139 ? -23.801 -11.042 -1.643  1.00 1.19  ? 1646 CYS A SG   1  
ATOM 2078  H H    . CYS A 1 139 ? -23.006 -7.404  0.900   1.00 0.60  ? 1646 CYS A H    1  
ATOM 2079  H HA   . CYS A 1 139 ? -22.802 -8.304  -1.879  1.00 0.92  ? 1646 CYS A HA   1  
ATOM 2080  H HB2  . CYS A 1 139 ? -22.225 -10.035 -0.175  1.00 1.48  ? 1646 CYS A HB2  1  
ATOM 2081  H HB3  . CYS A 1 139 ? -23.865 -9.897  0.447   1.00 1.22  ? 1646 CYS A HB3  1  
ATOM 2082  N N    . GLU A 1 140 ? -25.287 -8.173  -2.272  1.00 1.08  ? 1647 GLU A N    1  
ATOM 2083  C CA   . GLU A 1 140 ? -26.669 -7.970  -2.520  1.00 1.37  ? 1647 GLU A CA   1  
ATOM 2084  C C    . GLU A 1 140 ? -27.291 -9.341  -2.850  1.00 1.48  ? 1647 GLU A C    1  
ATOM 2085  O O    . GLU A 1 140 ? -26.866 -10.018 -3.784  1.00 1.50  ? 1647 GLU A O    1  
ATOM 2086  C CB   . GLU A 1 140 ? -26.940 -6.878  -3.603  1.00 1.75  ? 1647 GLU A CB   1  
ATOM 2087  C CG   . GLU A 1 140 ? -26.384 -7.126  -5.003  1.00 2.13  ? 1647 GLU A CG   1  
ATOM 2088  C CD   . GLU A 1 140 ? -24.863 -7.175  -5.086  1.00 2.58  ? 1647 GLU A CD   1  
ATOM 2089  O OE1  . GLU A 1 140 ? -24.276 -8.266  -4.879  1.00 3.14  ? 1647 GLU A OE1  1  
ATOM 2090  O OE2  . GLU A 1 140 ? -24.242 -6.148  -5.360  1.00 2.88  ? 1647 GLU A OE2  1  
ATOM 2091  H H    . GLU A 1 140 ? -24.745 -8.512  -3.023  1.00 1.15  ? 1647 GLU A H    1  
ATOM 2092  H HA   . GLU A 1 140 ? -27.063 -7.645  -1.568  1.00 1.45  ? 1647 GLU A HA   1  
ATOM 2093  H HB2  . GLU A 1 140 ? -28.010 -6.763  -3.706  1.00 2.23  ? 1647 GLU A HB2  1  
ATOM 2094  H HB3  . GLU A 1 140 ? -26.537 -5.944  -3.241  1.00 2.14  ? 1647 GLU A HB3  1  
ATOM 2095  H HG2  . GLU A 1 140 ? -26.780 -8.073  -5.339  1.00 2.45  ? 1647 GLU A HG2  1  
ATOM 2096  H HG3  . GLU A 1 140 ? -26.747 -6.345  -5.655  1.00 2.59  ? 1647 GLU A HG3  1  
ATOM 2097  N N    . PRO A 1 141 ? -28.260 -9.783  -2.049  1.00 1.76  ? 1648 PRO A N    1  
ATOM 2098  C CA   . PRO A 1 141 ? -28.812 -11.138 -2.143  1.00 2.03  ? 1648 PRO A CA   1  
ATOM 2099  C C    . PRO A 1 141 ? -29.650 -11.409 -3.395  1.00 2.21  ? 1648 PRO A C    1  
ATOM 2100  O O    . PRO A 1 141 ? -30.763 -10.879 -3.556  1.00 2.55  ? 1648 PRO A O    1  
ATOM 2101  C CB   . PRO A 1 141 ? -29.679 -11.249 -0.889  1.00 2.55  ? 1648 PRO A CB   1  
ATOM 2102  C CG   . PRO A 1 141 ? -30.069 -9.852  -0.577  1.00 2.58  ? 1648 PRO A CG   1  
ATOM 2103  C CD   . PRO A 1 141 ? -28.911 -9.001  -0.989  1.00 2.03  ? 1648 PRO A CD   1  
ATOM 2104  H HA   . PRO A 1 141 ? -28.028 -11.879 -2.085  1.00 1.99  ? 1648 PRO A HA   1  
ATOM 2105  H HB2  . PRO A 1 141 ? -30.539 -11.869 -1.091  1.00 2.92  ? 1648 PRO A HB2  1  
ATOM 2106  H HB3  . PRO A 1 141 ? -29.095 -11.679 -0.087  1.00 2.71  ? 1648 PRO A HB3  1  
ATOM 2107  H HG2  . PRO A 1 141 ? -30.951 -9.586  -1.141  1.00 2.88  ? 1648 PRO A HG2  1  
ATOM 2108  H HG3  . PRO A 1 141 ? -30.254 -9.749  0.482   1.00 2.86  ? 1648 PRO A HG3  1  
ATOM 2109  H HD2  . PRO A 1 141 ? -29.261 -8.061  -1.391  1.00 2.12  ? 1648 PRO A HD2  1  
ATOM 2110  H HD3  . PRO A 1 141 ? -28.245 -8.851  -0.152  1.00 1.94  ? 1648 PRO A HD3  1  
ATOM 2111  N N    . GLU A 1 142 ? -29.110 -12.200 -4.284  1.00 2.23  ? 1649 GLU A N    1  
ATOM 2112  C CA   . GLU A 1 142 ? -29.839 -12.659 -5.430  1.00 2.59  ? 1649 GLU A CA   1  
ATOM 2113  C C    . GLU A 1 142 ? -30.188 -14.098 -5.193  1.00 2.73  ? 1649 GLU A C    1  
ATOM 2114  O O    . GLU A 1 142 ? -31.305 -14.378 -4.718  1.00 3.18  ? 1649 GLU A O    1  
ATOM 2115  C CB   . GLU A 1 142 ? -29.029 -12.543 -6.718  1.00 3.20  ? 1649 GLU A CB   1  
ATOM 2116  C CG   . GLU A 1 142 ? -28.631 -11.142 -7.101  1.00 3.71  ? 1649 GLU A CG   1  
ATOM 2117  C CD   . GLU A 1 142 ? -29.801 -10.218 -7.267  1.00 4.21  ? 1649 GLU A CD   1  
ATOM 2118  O OE1  . GLU A 1 142 ? -30.748 -10.546 -8.023  1.00 4.48  ? 1649 GLU A OE1  1  
ATOM 2119  O OE2  . GLU A 1 142 ? -29.796 -9.130  -6.670  1.00 4.72  ? 1649 GLU A OE2  1  
ATOM 2120  O OXT  . GLU A 1 142 ? -29.325 -14.972 -5.418  1.00 3.07  ? 1649 GLU A OXT  1  
ATOM 2121  H H    . GLU A 1 142 ? -28.179 -12.502 -4.165  1.00 2.17  ? 1649 GLU A H    1  
ATOM 2122  H HA   . GLU A 1 142 ? -30.747 -12.080 -5.512  1.00 2.87  ? 1649 GLU A HA   1  
ATOM 2123  H HB2  . GLU A 1 142 ? -28.126 -13.125 -6.607  1.00 3.68  ? 1649 GLU A HB2  1  
ATOM 2124  H HB3  . GLU A 1 142 ? -29.612 -12.962 -7.525  1.00 3.42  ? 1649 GLU A HB3  1  
ATOM 2125  H HG2  . GLU A 1 142 ? -27.988 -10.741 -6.332  1.00 4.08  ? 1649 GLU A HG2  1  
ATOM 2126  H HG3  . GLU A 1 142 ? -28.086 -11.182 -8.033  1.00 3.96  ? 1649 GLU A HG3  1  
ATOM 2127  N N    . ALA B 2 1   ? 1.810   19.108  0.781   1.00 9.97  ? 1    ALA B N    1  
ATOM 2128  C CA   . ALA B 2 1   ? 2.724   18.576  1.779   1.00 9.24  ? 1    ALA B CA   1  
ATOM 2129  C C    . ALA B 2 1   ? 4.145   18.678  1.259   1.00 8.32  ? 1    ALA B C    1  
ATOM 2130  O O    . ALA B 2 1   ? 4.430   18.268  0.129   1.00 8.34  ? 1    ALA B O    1  
ATOM 2131  C CB   . ALA B 2 1   ? 2.372   17.129  2.096   1.00 9.68  ? 1    ALA B CB   1  
ATOM 2132  H H1   . ALA B 2 1   ? 2.027   20.115  0.617   1.00 10.26 ? 1    ALA B H1   1  
ATOM 2133  H H2   . ALA B 2 1   ? 0.819   19.008  1.085   1.00 10.22 ? 1    ALA B H2   1  
ATOM 2134  H H3   . ALA B 2 1   ? 1.954   18.601  -0.120  1.00 10.14 ? 1    ALA B H3   1  
ATOM 2135  H HA   . ALA B 2 1   ? 2.632   19.160  2.684   1.00 9.24  ? 1    ALA B HA   1  
ATOM 2136  H HB1  . ALA B 2 1   ? 2.462   16.533  1.201   1.00 10.04 ? 1    ALA B HB1  1  
ATOM 2137  H HB2  . ALA B 2 1   ? 1.358   17.075  2.465   1.00 9.77  ? 1    ALA B HB2  1  
ATOM 2138  H HB3  . ALA B 2 1   ? 3.050   16.752  2.848   1.00 9.78  ? 1    ALA B HB3  1  
ATOM 2139  N N    . TYR B 2 2   ? 5.035   19.201  2.058   1.00 7.68  ? 2    TYR B N    1  
ATOM 2140  C CA   . TYR B 2 2   ? 6.404   19.355  1.644   1.00 6.91  ? 2    TYR B CA   1  
ATOM 2141  C C    . TYR B 2 2   ? 7.304   18.743  2.692   1.00 6.01  ? 2    TYR B C    1  
ATOM 2142  O O    . TYR B 2 2   ? 7.117   18.957  3.888   1.00 6.08  ? 2    TYR B O    1  
ATOM 2143  C CB   . TYR B 2 2   ? 6.762   20.845  1.403   1.00 7.21  ? 2    TYR B CB   1  
ATOM 2144  C CG   . TYR B 2 2   ? 8.167   21.069  0.829   1.00 6.80  ? 2    TYR B CG   1  
ATOM 2145  C CD1  . TYR B 2 2   ? 9.288   21.130  1.657   1.00 6.75  ? 2    TYR B CD1  1  
ATOM 2146  C CD2  . TYR B 2 2   ? 8.367   21.194  -0.541  1.00 6.74  ? 2    TYR B CD2  1  
ATOM 2147  C CE1  . TYR B 2 2   ? 10.561  21.303  1.133   1.00 6.73  ? 2    TYR B CE1  1  
ATOM 2148  C CE2  . TYR B 2 2   ? 9.639   21.373  -1.066  1.00 6.64  ? 2    TYR B CE2  1  
ATOM 2149  C CZ   . TYR B 2 2   ? 10.727  21.422  -0.225  1.00 6.68  ? 2    TYR B CZ   1  
ATOM 2150  O OH   . TYR B 2 2   ? 11.996  21.585  -0.754  1.00 6.93  ? 2    TYR B OH   1  
ATOM 2151  H H    . TYR B 2 2   ? 4.796   19.446  2.983   1.00 7.83  ? 2    TYR B H    1  
ATOM 2152  H HA   . TYR B 2 2   ? 6.523   18.801  0.725   1.00 6.99  ? 2    TYR B HA   1  
ATOM 2153  H HB2  . TYR B 2 2   ? 6.052   21.257  0.700   1.00 7.94  ? 2    TYR B HB2  1  
ATOM 2154  H HB3  . TYR B 2 2   ? 6.681   21.381  2.338   1.00 7.23  ? 2    TYR B HB3  1  
ATOM 2155  H HD1  . TYR B 2 2   ? 9.141   21.034  2.723   1.00 6.91  ? 2    TYR B HD1  1  
ATOM 2156  H HD2  . TYR B 2 2   ? 7.511   21.161  -1.201  1.00 6.94  ? 2    TYR B HD2  1  
ATOM 2157  H HE1  . TYR B 2 2   ? 11.433  21.350  1.773   1.00 6.93  ? 2    TYR B HE1  1  
ATOM 2158  H HE2  . TYR B 2 2   ? 9.795   21.467  -2.131  1.00 6.72  ? 2    TYR B HE2  1  
ATOM 2159  H HH   . TYR B 2 2   ? 12.616  21.010  -0.273  1.00 6.91  ? 2    TYR B HH   1  
ATOM 2160  N N    . ARG B 2 3   ? 8.265   18.005  2.250   1.00 5.37  ? 3    ARG B N    1  
ATOM 2161  C CA   . ARG B 2 3   ? 9.195   17.338  3.123   1.00 4.66  ? 3    ARG B CA   1  
ATOM 2162  C C    . ARG B 2 3   ? 10.614  17.764  2.734   1.00 4.12  ? 3    ARG B C    1  
ATOM 2163  O O    . ARG B 2 3   ? 10.890  18.019  1.565   1.00 4.20  ? 3    ARG B O    1  
ATOM 2164  C CB   . ARG B 2 3   ? 9.014   15.822  2.982   1.00 4.56  ? 3    ARG B CB   1  
ATOM 2165  C CG   . ARG B 2 3   ? 9.236   15.312  1.573   1.00 4.51  ? 3    ARG B CG   1  
ATOM 2166  C CD   . ARG B 2 3   ? 8.997   13.837  1.465   1.00 4.76  ? 3    ARG B CD   1  
ATOM 2167  N NE   . ARG B 2 3   ? 9.331   13.328  0.136   1.00 5.07  ? 3    ARG B NE   1  
ATOM 2168  C CZ   . ARG B 2 3   ? 9.265   12.035  -0.196  1.00 5.48  ? 3    ARG B CZ   1  
ATOM 2169  N NH1  . ARG B 2 3   ? 8.624   11.180  0.599   1.00 5.57  ? 3    ARG B NH1  1  
ATOM 2170  N NH2  . ARG B 2 3   ? 9.752   11.624  -1.349  1.00 6.11  ? 3    ARG B NH2  1  
ATOM 2171  H H    . ARG B 2 3   ? 8.395   17.909  1.278   1.00 5.53  ? 3    ARG B H    1  
ATOM 2172  H HA   . ARG B 2 3   ? 8.991   17.636  4.140   1.00 4.95  ? 3    ARG B HA   1  
ATOM 2173  H HB2  . ARG B 2 3   ? 9.714   15.328  3.639   1.00 4.24  ? 3    ARG B HB2  1  
ATOM 2174  H HB3  . ARG B 2 3   ? 8.008   15.572  3.286   1.00 5.22  ? 3    ARG B HB3  1  
ATOM 2175  H HG2  . ARG B 2 3   ? 8.560   15.823  0.905   1.00 5.11  ? 3    ARG B HG2  1  
ATOM 2176  H HG3  . ARG B 2 3   ? 10.254  15.528  1.283   1.00 4.04  ? 3    ARG B HG3  1  
ATOM 2177  H HD2  . ARG B 2 3   ? 9.609   13.328  2.193   1.00 4.84  ? 3    ARG B HD2  1  
ATOM 2178  H HD3  . ARG B 2 3   ? 7.954   13.631  1.660   1.00 5.08  ? 3    ARG B HD3  1  
ATOM 2179  H HE   . ARG B 2 3   ? 9.682   14.012  -0.484  1.00 5.24  ? 3    ARG B HE   1  
ATOM 2180  H HH11 . ARG B 2 3   ? 8.168   11.479  1.446   1.00 5.42  ? 3    ARG B HH11 1  
ATOM 2181  H HH12 . ARG B 2 3   ? 8.553   10.187  0.435   1.00 6.03  ? 3    ARG B HH12 1  
ATOM 2182  H HH21 . ARG B 2 3   ? 10.175  12.232  -2.023  1.00 6.35  ? 3    ARG B HH21 1  
ATOM 2183  H HH22 . ARG B 2 3   ? 9.754   10.653  -1.618  1.00 6.56  ? 3    ARG B HH22 1  
ATOM 2184  N N    . PRO B 2 4   ? 11.506  17.911  3.722   1.00 4.08  ? 4    PRO B N    1  
ATOM 2185  C CA   . PRO B 2 4   ? 12.892  18.352  3.497   1.00 4.17  ? 4    PRO B CA   1  
ATOM 2186  C C    . PRO B 2 4   ? 13.771  17.352  2.718   1.00 3.73  ? 4    PRO B C    1  
ATOM 2187  O O    . PRO B 2 4   ? 14.848  17.720  2.237   1.00 4.12  ? 4    PRO B O    1  
ATOM 2188  C CB   . PRO B 2 4   ? 13.434  18.545  4.915   1.00 4.81  ? 4    PRO B CB   1  
ATOM 2189  C CG   . PRO B 2 4   ? 12.571  17.710  5.780   1.00 4.84  ? 4    PRO B CG   1  
ATOM 2190  C CD   . PRO B 2 4   ? 11.224  17.738  5.164   1.00 4.56  ? 4    PRO B CD   1  
ATOM 2191  H HA   . PRO B 2 4   ? 12.913  19.302  2.983   1.00 4.57  ? 4    PRO B HA   1  
ATOM 2192  H HB2  . PRO B 2 4   ? 14.449  18.190  4.959   1.00 4.98  ? 4    PRO B HB2  1  
ATOM 2193  H HB3  . PRO B 2 4   ? 13.384  19.587  5.193   1.00 5.36  ? 4    PRO B HB3  1  
ATOM 2194  H HG2  . PRO B 2 4   ? 12.947  16.698  5.808   1.00 4.72  ? 4    PRO B HG2  1  
ATOM 2195  H HG3  . PRO B 2 4   ? 12.537  18.127  6.775   1.00 5.51  ? 4    PRO B HG3  1  
ATOM 2196  H HD2  . PRO B 2 4   ? 10.692  16.821  5.368   1.00 4.55  ? 4    PRO B HD2  1  
ATOM 2197  H HD3  . PRO B 2 4   ? 10.688  18.591  5.548   1.00 5.09  ? 4    PRO B HD3  1  
ATOM 2198  N N    . SER B 2 5   ? 13.318  16.118  2.585   1.00 3.33  ? 5    SER B N    1  
ATOM 2199  C CA   . SER B 2 5   ? 14.072  15.094  1.893   1.00 3.26  ? 5    SER B CA   1  
ATOM 2200  C C    . SER B 2 5   ? 13.171  14.281  0.961   1.00 2.82  ? 5    SER B C    1  
ATOM 2201  O O    . SER B 2 5   ? 12.224  13.656  1.411   1.00 2.91  ? 5    SER B O    1  
ATOM 2202  C CB   . SER B 2 5   ? 14.724  14.147  2.917   1.00 4.08  ? 5    SER B CB   1  
ATOM 2203  O OG   . SER B 2 5   ? 15.609  14.846  3.791   1.00 4.60  ? 5    SER B OG   1  
ATOM 2204  H H    . SER B 2 5   ? 12.445  15.876  2.954   1.00 3.42  ? 5    SER B H    1  
ATOM 2205  H HA   . SER B 2 5   ? 14.855  15.568  1.321   1.00 3.37  ? 5    SER B HA   1  
ATOM 2206  H HB2  . SER B 2 5   ? 13.953  13.678  3.511   1.00 4.31  ? 5    SER B HB2  1  
ATOM 2207  H HB3  . SER B 2 5   ? 15.282  13.386  2.392   1.00 4.46  ? 5    SER B HB3  1  
ATOM 2208  H HG   . SER B 2 5   ? 16.266  15.272  3.213   1.00 4.91  ? 5    SER B HG   1  
ATOM 2209  N N    . GLU B 2 6   ? 13.452  14.320  -0.336  1.00 2.79  ? 6    GLU B N    1  
ATOM 2210  C CA   . GLU B 2 6   ? 12.748  13.473  -1.293  1.00 2.83  ? 6    GLU B CA   1  
ATOM 2211  C C    . GLU B 2 6   ? 13.309  12.074  -1.244  1.00 2.71  ? 6    GLU B C    1  
ATOM 2212  O O    . GLU B 2 6   ? 12.683  11.122  -1.689  1.00 2.87  ? 6    GLU B O    1  
ATOM 2213  C CB   . GLU B 2 6   ? 12.810  14.014  -2.722  1.00 3.19  ? 6    GLU B CB   1  
ATOM 2214  C CG   . GLU B 2 6   ? 12.092  15.328  -2.910  1.00 3.41  ? 6    GLU B CG   1  
ATOM 2215  C CD   . GLU B 2 6   ? 10.693  15.277  -2.354  1.00 3.74  ? 6    GLU B CD   1  
ATOM 2216  O OE1  . GLU B 2 6   ? 9.813   14.633  -2.957  1.00 3.88  ? 6    GLU B OE1  1  
ATOM 2217  O OE2  . GLU B 2 6   ? 10.467  15.834  -1.281  1.00 4.23  ? 6    GLU B OE2  1  
ATOM 2218  H H    . GLU B 2 6   ? 14.142  14.948  -0.655  1.00 3.08  ? 6    GLU B H    1  
ATOM 2219  H HA   . GLU B 2 6   ? 11.717  13.428  -0.974  1.00 2.97  ? 6    GLU B HA   1  
ATOM 2220  H HB2  . GLU B 2 6   ? 13.846  14.155  -2.996  1.00 3.28  ? 6    GLU B HB2  1  
ATOM 2221  H HB3  . GLU B 2 6   ? 12.369  13.288  -3.389  1.00 3.43  ? 6    GLU B HB3  1  
ATOM 2222  H HG2  . GLU B 2 6   ? 12.645  16.099  -2.395  1.00 3.61  ? 6    GLU B HG2  1  
ATOM 2223  H HG3  . GLU B 2 6   ? 12.040  15.555  -3.964  1.00 3.54  ? 6    GLU B HG3  1  
ATOM 2224  N N    . THR B 2 7   ? 14.507  11.977  -0.754  1.00 2.63  ? 7    THR B N    1  
ATOM 2225  C CA   . THR B 2 7   ? 15.121  10.729  -0.493  1.00 2.57  ? 7    THR B CA   1  
ATOM 2226  C C    . THR B 2 7   ? 15.506  10.694  0.990   1.00 2.39  ? 7    THR B C    1  
ATOM 2227  O O    . THR B 2 7   ? 16.509  11.300  1.403   1.00 2.45  ? 7    THR B O    1  
ATOM 2228  C CB   . THR B 2 7   ? 16.367  10.527  -1.409  1.00 2.76  ? 7    THR B CB   1  
ATOM 2229  O OG1  . THR B 2 7   ? 17.147  11.753  -1.485  1.00 2.82  ? 7    THR B OG1  1  
ATOM 2230  C CG2  . THR B 2 7   ? 15.948  10.099  -2.811  1.00 3.14  ? 7    THR B CG2  1  
ATOM 2231  H H    . THR B 2 7   ? 15.016  12.791  -0.554  1.00 2.71  ? 7    THR B H    1  
ATOM 2232  H HA   . THR B 2 7   ? 14.390  9.966   -0.722  1.00 2.72  ? 7    THR B HA   1  
ATOM 2233  H HB   . THR B 2 7   ? 16.986  9.757   -0.971  1.00 2.75  ? 7    THR B HB   1  
ATOM 2234  H HG1  . THR B 2 7   ? 18.061  11.495  -1.290  1.00 2.92  ? 7    THR B HG1  1  
ATOM 2235  H HG21 . THR B 2 7   ? 15.414  9.161   -2.766  1.00 3.45  ? 7    THR B HG21 1  
ATOM 2236  H HG22 . THR B 2 7   ? 16.818  9.987   -3.439  1.00 3.48  ? 7    THR B HG22 1  
ATOM 2237  H HG23 . THR B 2 7   ? 15.301  10.856  -3.231  1.00 3.24  ? 7    THR B HG23 1  
ATOM 2238  N N    . LEU B 2 8   ? 14.675  10.063  1.802   1.00 2.43  ? 8    LEU B N    1  
ATOM 2239  C CA   . LEU B 2 8   ? 14.926  9.958   3.214   1.00 2.40  ? 8    LEU B CA   1  
ATOM 2240  C C    . LEU B 2 8   ? 16.042  8.939   3.461   1.00 2.21  ? 8    LEU B C    1  
ATOM 2241  O O    . LEU B 2 8   ? 15.782  7.716   3.471   1.00 2.36  ? 8    LEU B O    1  
ATOM 2242  C CB   . LEU B 2 8   ? 13.645  9.516   3.941   1.00 2.82  ? 8    LEU B CB   1  
ATOM 2243  C CG   . LEU B 2 8   ? 13.659  9.569   5.471   1.00 3.42  ? 8    LEU B CG   1  
ATOM 2244  C CD1  . LEU B 2 8   ? 13.769  11.006  5.960   1.00 3.96  ? 8    LEU B CD1  1  
ATOM 2245  C CD2  . LEU B 2 8   ? 12.409  8.913   6.032   1.00 3.94  ? 8    LEU B CD2  1  
ATOM 2246  H H    . LEU B 2 8   ? 13.828  9.686   1.456   1.00 2.65  ? 8    LEU B H    1  
ATOM 2247  H HA   . LEU B 2 8   ? 15.199  10.941  3.567   1.00 2.44  ? 8    LEU B HA   1  
ATOM 2248  H HB2  . LEU B 2 8   ? 12.837  10.144  3.596   1.00 2.74  ? 8    LEU B HB2  1  
ATOM 2249  H HB3  . LEU B 2 8   ? 13.431  8.501   3.642   1.00 3.13  ? 8    LEU B HB3  1  
ATOM 2250  H HG   . LEU B 2 8   ? 14.520  9.027   5.834   1.00 3.68  ? 8    LEU B HG   1  
ATOM 2251  H HD11 . LEU B 2 8   ? 14.676  11.461  5.595   1.00 4.23  ? 8    LEU B HD11 1  
ATOM 2252  H HD12 . LEU B 2 8   ? 13.774  11.016  7.039   1.00 4.35  ? 8    LEU B HD12 1  
ATOM 2253  H HD13 . LEU B 2 8   ? 12.918  11.569  5.604   1.00 4.24  ? 8    LEU B HD13 1  
ATOM 2254  H HD21 . LEU B 2 8   ? 11.535  9.431   5.668   1.00 4.29  ? 8    LEU B HD21 1  
ATOM 2255  H HD22 . LEU B 2 8   ? 12.432  8.959   7.111   1.00 4.13  ? 8    LEU B HD22 1  
ATOM 2256  H HD23 . LEU B 2 8   ? 12.373  7.880   5.716   1.00 4.30  ? 8    LEU B HD23 1  
ATOM 2257  N N    . CYS B 2 9   ? 17.275  9.430   3.577   1.00 2.15  ? 9    CYS B N    1  
ATOM 2258  C CA   . CYS B 2 9   ? 18.427  8.620   3.888   1.00 2.11  ? 9    CYS B CA   1  
ATOM 2259  C C    . CYS B 2 9   ? 18.157  7.846   5.168   1.00 2.19  ? 9    CYS B C    1  
ATOM 2260  O O    . CYS B 2 9   ? 17.876  8.432   6.218   1.00 2.84  ? 9    CYS B O    1  
ATOM 2261  C CB   . CYS B 2 9   ? 19.629  9.537   4.062   1.00 2.28  ? 9    CYS B CB   1  
ATOM 2262  S SG   . CYS B 2 9   ? 19.885  10.658  2.651   1.00 2.37  ? 9    CYS B SG   1  
ATOM 2263  H H    . CYS B 2 9   ? 17.460  10.383  3.430   1.00 2.32  ? 9    CYS B H    1  
ATOM 2264  H HA   . CYS B 2 9   ? 18.613  7.936   3.074   1.00 2.03  ? 9    CYS B HA   1  
ATOM 2265  H HB2  . CYS B 2 9   ? 19.482  10.145  4.942   1.00 2.65  ? 9    CYS B HB2  1  
ATOM 2266  H HB3  . CYS B 2 9   ? 20.525  8.948   4.187   1.00 2.56  ? 9    CYS B HB3  1  
ATOM 2267  N N    . GLY B 2 10  ? 18.187  6.555   5.070   1.00 1.97  ? 10   GLY B N    1  
ATOM 2268  C CA   . GLY B 2 10  ? 17.849  5.737   6.177   1.00 2.09  ? 10   GLY B CA   1  
ATOM 2269  C C    . GLY B 2 10  ? 16.460  5.201   6.005   1.00 1.88  ? 10   GLY B C    1  
ATOM 2270  O O    . GLY B 2 10  ? 16.295  4.121   5.473   1.00 1.88  ? 10   GLY B O    1  
ATOM 2271  H H    . GLY B 2 10  ? 18.444  6.131   4.229   1.00 2.07  ? 10   GLY B H    1  
ATOM 2272  H HA2  . GLY B 2 10  ? 18.550  4.917   6.243   1.00 2.28  ? 10   GLY B HA2  1  
ATOM 2273  H HA3  . GLY B 2 10  ? 17.888  6.323   7.082   1.00 2.27  ? 10   GLY B HA3  1  
ATOM 2274  N N    . GLY B 2 11  ? 15.471  6.015   6.373   1.00 1.84  ? 11   GLY B N    1  
ATOM 2275  C CA   . GLY B 2 11  ? 14.056  5.650   6.336   1.00 1.77  ? 11   GLY B CA   1  
ATOM 2276  C C    . GLY B 2 11  ? 13.590  4.995   5.046   1.00 1.58  ? 11   GLY B C    1  
ATOM 2277  O O    . GLY B 2 11  ? 13.339  3.797   5.033   1.00 1.50  ? 11   GLY B O    1  
ATOM 2278  H H    . GLY B 2 11  ? 15.705  6.907   6.718   1.00 1.94  ? 11   GLY B H    1  
ATOM 2279  H HA2  . GLY B 2 11  ? 13.856  4.968   7.149   1.00 1.85  ? 11   GLY B HA2  1  
ATOM 2280  H HA3  . GLY B 2 11  ? 13.474  6.546   6.498   1.00 1.89  ? 11   GLY B HA3  1  
ATOM 2281  N N    . GLU B 2 12  ? 13.516  5.756   3.953   1.00 1.53  ? 12   GLU B N    1  
ATOM 2282  C CA   . GLU B 2 12  ? 13.017  5.207   2.688   1.00 1.40  ? 12   GLU B CA   1  
ATOM 2283  C C    . GLU B 2 12  ? 13.954  4.148   2.162   1.00 1.33  ? 12   GLU B C    1  
ATOM 2284  O O    . GLU B 2 12  ? 13.519  3.154   1.591   1.00 1.25  ? 12   GLU B O    1  
ATOM 2285  C CB   . GLU B 2 12  ? 12.798  6.280   1.620   1.00 1.44  ? 12   GLU B CB   1  
ATOM 2286  C CG   . GLU B 2 12  ? 11.748  7.320   1.954   1.00 1.56  ? 12   GLU B CG   1  
ATOM 2287  C CD   . GLU B 2 12  ? 11.585  8.345   0.856   1.00 2.03  ? 12   GLU B CD   1  
ATOM 2288  O OE1  . GLU B 2 12  ? 10.837  8.087   -0.127  1.00 2.50  ? 12   GLU B OE1  1  
ATOM 2289  O OE2  . GLU B 2 12  ? 12.198  9.410   0.951   1.00 2.55  ? 12   GLU B OE2  1  
ATOM 2290  H H    . GLU B 2 12  ? 13.825  6.685   3.994   1.00 1.62  ? 12   GLU B H    1  
ATOM 2291  H HA   . GLU B 2 12  ? 12.077  4.729   2.907   1.00 1.40  ? 12   GLU B HA   1  
ATOM 2292  H HB2  . GLU B 2 12  ? 13.728  6.797   1.468   1.00 1.51  ? 12   GLU B HB2  1  
ATOM 2293  H HB3  . GLU B 2 12  ? 12.514  5.796   0.697   1.00 1.39  ? 12   GLU B HB3  1  
ATOM 2294  H HG2  . GLU B 2 12  ? 10.799  6.840   2.118   1.00 1.79  ? 12   GLU B HG2  1  
ATOM 2295  H HG3  . GLU B 2 12  ? 12.053  7.829   2.857   1.00 1.99  ? 12   GLU B HG3  1  
ATOM 2296  N N    . LEU B 2 13  ? 15.232  4.359   2.381   1.00 1.40  ? 13   LEU B N    1  
ATOM 2297  C CA   . LEU B 2 13  ? 16.253  3.428   1.950   1.00 1.41  ? 13   LEU B CA   1  
ATOM 2298  C C    . LEU B 2 13  ? 16.082  2.032   2.536   1.00 1.37  ? 13   LEU B C    1  
ATOM 2299  O O    . LEU B 2 13  ? 15.862  1.067   1.807   1.00 1.27  ? 13   LEU B O    1  
ATOM 2300  C CB   . LEU B 2 13  ? 17.640  3.988   2.243   1.00 1.61  ? 13   LEU B CB   1  
ATOM 2301  C CG   . LEU B 2 13  ? 18.331  4.606   1.042   1.00 1.79  ? 13   LEU B CG   1  
ATOM 2302  C CD1  . LEU B 2 13  ? 19.614  5.313   1.447   1.00 2.35  ? 13   LEU B CD1  1  
ATOM 2303  C CD2  . LEU B 2 13  ? 18.624  3.506   0.047   1.00 2.02  ? 13   LEU B CD2  1  
ATOM 2304  H H    . LEU B 2 13  ? 15.492  5.181   2.853   1.00 1.49  ? 13   LEU B H    1  
ATOM 2305  H HA   . LEU B 2 13  ? 16.156  3.342   0.878   1.00 1.38  ? 13   LEU B HA   1  
ATOM 2306  H HB2  . LEU B 2 13  ? 17.539  4.735   3.018   1.00 1.84  ? 13   LEU B HB2  1  
ATOM 2307  H HB3  . LEU B 2 13  ? 18.259  3.186   2.616   1.00 1.72  ? 13   LEU B HB3  1  
ATOM 2308  H HG   . LEU B 2 13  ? 17.676  5.318   0.564   1.00 2.18  ? 13   LEU B HG   1  
ATOM 2309  H HD11 . LEU B 2 13  ? 19.373  6.155   2.078   1.00 2.68  ? 13   LEU B HD11 1  
ATOM 2310  H HD12 . LEU B 2 13  ? 20.119  5.667   0.560   1.00 2.82  ? 13   LEU B HD12 1  
ATOM 2311  H HD13 . LEU B 2 13  ? 20.253  4.627   1.983   1.00 2.72  ? 13   LEU B HD13 1  
ATOM 2312  H HD21 . LEU B 2 13  ? 19.159  3.890   -0.808  1.00 2.36  ? 13   LEU B HD21 1  
ATOM 2313  H HD22 . LEU B 2 13  ? 17.682  3.076   -0.259  1.00 2.41  ? 13   LEU B HD22 1  
ATOM 2314  H HD23 . LEU B 2 13  ? 19.201  2.743   0.549   1.00 2.37  ? 13   LEU B HD23 1  
ATOM 2315  N N    . VAL B 2 14  ? 16.126  1.927   3.826   1.00 1.48  ? 14   VAL B N    1  
ATOM 2316  C CA   . VAL B 2 14  ? 16.058  0.635   4.443   1.00 1.51  ? 14   VAL B CA   1  
ATOM 2317  C C    . VAL B 2 14  ? 14.638  0.064   4.410   1.00 1.39  ? 14   VAL B C    1  
ATOM 2318  O O    . VAL B 2 14  ? 14.463  -1.157  4.330   1.00 1.39  ? 14   VAL B O    1  
ATOM 2319  C CB   . VAL B 2 14  ? 16.652  0.626   5.883   1.00 1.73  ? 14   VAL B CB   1  
ATOM 2320  C CG1  . VAL B 2 14  ? 15.774  1.401   6.884   1.00 2.11  ? 14   VAL B CG1  1  
ATOM 2321  C CG2  . VAL B 2 14  ? 16.907  -0.799  6.364   1.00 1.63  ? 14   VAL B CG2  1  
ATOM 2322  H H    . VAL B 2 14  ? 16.208  2.738   4.377   1.00 1.57  ? 14   VAL B H    1  
ATOM 2323  H HA   . VAL B 2 14  ? 16.665  -0.014  3.828   1.00 1.51  ? 14   VAL B HA   1  
ATOM 2324  H HB   . VAL B 2 14  ? 17.607  1.127   5.774   1.00 2.16  ? 14   VAL B HB   1  
ATOM 2325  H HG11 . VAL B 2 14  ? 16.217  1.375   7.869   1.00 2.48  ? 14   VAL B HG11 1  
ATOM 2326  H HG12 . VAL B 2 14  ? 14.799  0.940   6.927   1.00 2.44  ? 14   VAL B HG12 1  
ATOM 2327  H HG13 . VAL B 2 14  ? 15.660  2.428   6.567   1.00 2.50  ? 14   VAL B HG13 1  
ATOM 2328  H HG21 . VAL B 2 14  ? 17.607  -1.292  5.706   1.00 1.98  ? 14   VAL B HG21 1  
ATOM 2329  H HG22 . VAL B 2 14  ? 15.975  -1.345  6.363   1.00 2.03  ? 14   VAL B HG22 1  
ATOM 2330  H HG23 . VAL B 2 14  ? 17.301  -0.788  7.370   1.00 1.86  ? 14   VAL B HG23 1  
ATOM 2331  N N    . ASP B 2 15  ? 13.621  0.933   4.442   1.00 1.34  ? 15   ASP B N    1  
ATOM 2332  C CA   . ASP B 2 15  ? 12.249  0.435   4.408   1.00 1.28  ? 15   ASP B CA   1  
ATOM 2333  C C    . ASP B 2 15  ? 11.921  -0.206  3.060   1.00 1.09  ? 15   ASP B C    1  
ATOM 2334  O O    . ASP B 2 15  ? 11.342  -1.265  3.027   1.00 1.03  ? 15   ASP B O    1  
ATOM 2335  C CB   . ASP B 2 15  ? 11.213  1.499   4.780   1.00 1.42  ? 15   ASP B CB   1  
ATOM 2336  C CG   . ASP B 2 15  ? 9.940   0.885   5.369   1.00 1.57  ? 15   ASP B CG   1  
ATOM 2337  O OD1  . ASP B 2 15  ? 9.875   -0.361  5.514   1.00 2.04  ? 15   ASP B OD1  1  
ATOM 2338  O OD2  . ASP B 2 15  ? 9.029   1.650   5.788   1.00 1.59  ? 15   ASP B OD2  1  
ATOM 2339  H H    . ASP B 2 15  ? 13.790  1.900   4.538   1.00 1.39  ? 15   ASP B H    1  
ATOM 2340  H HA   . ASP B 2 15  ? 12.211  -0.358  5.141   1.00 1.40  ? 15   ASP B HA   1  
ATOM 2341  H HB2  . ASP B 2 15  ? 11.640  2.171   5.510   1.00 1.57  ? 15   ASP B HB2  1  
ATOM 2342  H HB3  . ASP B 2 15  ? 10.944  2.058   3.895   1.00 1.40  ? 15   ASP B HB3  1  
ATOM 2343  N N    . THR B 2 16  ? 12.347  0.410   1.939   1.00 1.04  ? 16   THR B N    1  
ATOM 2344  C CA   . THR B 2 16  ? 12.112  -0.183  0.623   1.00 0.95  ? 16   THR B CA   1  
ATOM 2345  C C    . THR B 2 16  ? 12.808  -1.550  0.510   1.00 0.95  ? 16   THR B C    1  
ATOM 2346  O O    . THR B 2 16  ? 12.228  -2.520  -0.024  1.00 0.93  ? 16   THR B O    1  
ATOM 2347  C CB   . THR B 2 16  ? 12.556  0.755   -0.528  1.00 1.03  ? 16   THR B CB   1  
ATOM 2348  O OG1  . THR B 2 16  ? 13.885  1.226   -0.289  1.00 1.84  ? 16   THR B OG1  1  
ATOM 2349  C CG2  . THR B 2 16  ? 11.613  1.943   -0.666  1.00 1.54  ? 16   THR B CG2  1  
ATOM 2350  H H    . THR B 2 16  ? 12.817  1.268   1.970   1.00 1.10  ? 16   THR B H    1  
ATOM 2351  H HA   . THR B 2 16  ? 11.048  -0.355  0.546   1.00 0.92  ? 16   THR B HA   1  
ATOM 2352  H HB   . THR B 2 16  ? 12.548  0.192   -1.450  1.00 1.43  ? 16   THR B HB   1  
ATOM 2353  H HG1  . THR B 2 16  ? 13.858  1.971   0.325   1.00 2.31  ? 16   THR B HG1  1  
ATOM 2354  H HG21 . THR B 2 16  ? 10.611  1.608   -0.885  1.00 2.11  ? 16   THR B HG21 1  
ATOM 2355  H HG22 . THR B 2 16  ? 11.957  2.583   -1.465  1.00 1.98  ? 16   THR B HG22 1  
ATOM 2356  H HG23 . THR B 2 16  ? 11.611  2.502   0.259   1.00 2.03  ? 16   THR B HG23 1  
ATOM 2357  N N    . LEU B 2 17  ? 14.037  -1.628  1.047   1.00 1.04  ? 17   LEU B N    1  
ATOM 2358  C CA   . LEU B 2 17  ? 14.768  -2.887  1.118   1.00 1.11  ? 17   LEU B CA   1  
ATOM 2359  C C    . LEU B 2 17  ? 13.991  -3.934  1.902   1.00 1.11  ? 17   LEU B C    1  
ATOM 2360  O O    . LEU B 2 17  ? 13.735  -5.013  1.419   1.00 1.15  ? 17   LEU B O    1  
ATOM 2361  C CB   . LEU B 2 17  ? 16.180  -2.704  1.711   1.00 1.24  ? 17   LEU B CB   1  
ATOM 2362  C CG   . LEU B 2 17  ? 17.313  -2.416  0.697   1.00 1.34  ? 17   LEU B CG   1  
ATOM 2363  C CD1  . LEU B 2 17  ? 17.486  -3.608  -0.251  1.00 1.74  ? 17   LEU B CD1  1  
ATOM 2364  C CD2  . LEU B 2 17  ? 17.040  -1.152  -0.115  1.00 1.46  ? 17   LEU B CD2  1  
ATOM 2365  H H    . LEU B 2 17  ? 14.451  -0.799  1.374   1.00 1.07  ? 17   LEU B H    1  
ATOM 2366  H HA   . LEU B 2 17  ? 14.881  -3.230  0.103   1.00 1.11  ? 17   LEU B HA   1  
ATOM 2367  H HB2  . LEU B 2 17  ? 16.151  -1.910  2.444   1.00 1.25  ? 17   LEU B HB2  1  
ATOM 2368  H HB3  . LEU B 2 17  ? 16.431  -3.617  2.231   1.00 1.32  ? 17   LEU B HB3  1  
ATOM 2369  H HG   . LEU B 2 17  ? 18.229  -2.286  1.257   1.00 1.73  ? 17   LEU B HG   1  
ATOM 2370  H HD11 . LEU B 2 17  ? 18.271  -3.406  -0.965  1.00 2.14  ? 17   LEU B HD11 1  
ATOM 2371  H HD12 . LEU B 2 17  ? 16.561  -3.767  -0.786  1.00 2.27  ? 17   LEU B HD12 1  
ATOM 2372  H HD13 . LEU B 2 17  ? 17.724  -4.502  0.307   1.00 2.06  ? 17   LEU B HD13 1  
ATOM 2373  H HD21 . LEU B 2 17  ? 16.976  -0.288  0.531   1.00 1.88  ? 17   LEU B HD21 1  
ATOM 2374  H HD22 . LEU B 2 17  ? 16.105  -1.267  -0.643  1.00 1.93  ? 17   LEU B HD22 1  
ATOM 2375  H HD23 . LEU B 2 17  ? 17.832  -1.005  -0.835  1.00 1.76  ? 17   LEU B HD23 1  
ATOM 2376  N N    . GLN B 2 18  ? 13.559  -3.574  3.075   1.00 1.12  ? 18   GLN B N    1  
ATOM 2377  C CA   . GLN B 2 18  ? 12.837  -4.492  3.958   1.00 1.15  ? 18   GLN B CA   1  
ATOM 2378  C C    . GLN B 2 18  ? 11.445  -4.825  3.398   1.00 1.05  ? 18   GLN B C    1  
ATOM 2379  O O    . GLN B 2 18  ? 10.910  -5.909  3.639   1.00 1.10  ? 18   GLN B O    1  
ATOM 2380  C CB   . GLN B 2 18  ? 12.722  -3.864  5.340   1.00 1.24  ? 18   GLN B CB   1  
ATOM 2381  C CG   . GLN B 2 18  ? 12.052  -4.715  6.396   1.00 1.32  ? 18   GLN B CG   1  
ATOM 2382  C CD   . GLN B 2 18  ? 12.034  -4.029  7.714   1.00 1.70  ? 18   GLN B CD   1  
ATOM 2383  O OE1  . GLN B 2 18  ? 12.951  -4.174  8.531   1.00 2.39  ? 18   GLN B OE1  1  
ATOM 2384  N NE2  . GLN B 2 18  ? 11.035  -3.277  7.941   1.00 1.82  ? 18   GLN B NE2  1  
ATOM 2385  H H    . GLN B 2 18  ? 13.728  -2.648  3.358   1.00 1.14  ? 18   GLN B H    1  
ATOM 2386  H HA   . GLN B 2 18  ? 13.399  -5.411  4.035   1.00 1.23  ? 18   GLN B HA   1  
ATOM 2387  H HB2  . GLN B 2 18  ? 13.698  -3.590  5.710   1.00 1.34  ? 18   GLN B HB2  1  
ATOM 2388  H HB3  . GLN B 2 18  ? 12.119  -2.980  5.198   1.00 1.24  ? 18   GLN B HB3  1  
ATOM 2389  H HG2  . GLN B 2 18  ? 11.035  -4.932  6.110   1.00 1.45  ? 18   GLN B HG2  1  
ATOM 2390  H HG3  . GLN B 2 18  ? 12.592  -5.635  6.535   1.00 1.59  ? 18   GLN B HG3  1  
ATOM 2391  H HE21 . GLN B 2 18  ? 10.335  -3.179  7.262   1.00 1.80  ? 18   GLN B HE21 1  
ATOM 2392  H HE22 . GLN B 2 18  ? 11.037  -2.801  8.793   1.00 2.27  ? 18   GLN B HE22 1  
ATOM 2393  N N    . PHE B 2 19  ? 10.886  -3.896  2.660   1.00 0.96  ? 19   PHE B N    1  
ATOM 2394  C CA   . PHE B 2 19  ? 9.567   -4.047  2.066   1.00 0.87  ? 19   PHE B CA   1  
ATOM 2395  C C    . PHE B 2 19  ? 9.502   -5.223  1.093   1.00 0.90  ? 19   PHE B C    1  
ATOM 2396  O O    . PHE B 2 19  ? 8.747   -6.172  1.318   1.00 0.95  ? 19   PHE B O    1  
ATOM 2397  C CB   . PHE B 2 19  ? 9.086   -2.738  1.388   1.00 0.81  ? 19   PHE B CB   1  
ATOM 2398  C CG   . PHE B 2 19  ? 7.697   -2.815  0.846   1.00 0.74  ? 19   PHE B CG   1  
ATOM 2399  C CD1  . PHE B 2 19  ? 6.615   -2.712  1.692   1.00 0.80  ? 19   PHE B CD1  1  
ATOM 2400  C CD2  . PHE B 2 19  ? 7.472   -2.985  -0.513  1.00 0.79  ? 19   PHE B CD2  1  
ATOM 2401  C CE1  . PHE B 2 19  ? 5.336   -2.777  1.204   1.00 0.83  ? 19   PHE B CE1  1  
ATOM 2402  C CE2  . PHE B 2 19  ? 6.190   -3.049  -1.010  1.00 0.81  ? 19   PHE B CE2  1  
ATOM 2403  C CZ   . PHE B 2 19  ? 5.116   -2.944  -0.150  1.00 0.79  ? 19   PHE B CZ   1  
ATOM 2404  H H    . PHE B 2 19  ? 11.375  -3.047  2.561   1.00 0.99  ? 19   PHE B H    1  
ATOM 2405  H HA   . PHE B 2 19  ? 8.891   -4.270  2.879   1.00 0.88  ? 19   PHE B HA   1  
ATOM 2406  H HB2  . PHE B 2 19  ? 9.091   -1.943  2.118   1.00 0.85  ? 19   PHE B HB2  1  
ATOM 2407  H HB3  . PHE B 2 19  ? 9.723   -2.445  0.565   1.00 0.85  ? 19   PHE B HB3  1  
ATOM 2408  H HD1  . PHE B 2 19  ? 6.785   -2.583  2.751   1.00 0.95  ? 19   PHE B HD1  1  
ATOM 2409  H HD2  . PHE B 2 19  ? 8.317   -3.073  -1.181  1.00 0.94  ? 19   PHE B HD2  1  
ATOM 2410  H HE1  . PHE B 2 19  ? 4.501   -2.695  1.885   1.00 1.00  ? 19   PHE B HE1  1  
ATOM 2411  H HE2  . PHE B 2 19  ? 6.030   -3.181  -2.069  1.00 0.96  ? 19   PHE B HE2  1  
ATOM 2412  H HZ   . PHE B 2 19  ? 4.103   -2.989  -0.526  1.00 0.88  ? 19   PHE B HZ   1  
ATOM 2413  N N    . VAL B 2 20  ? 10.290  -5.195  0.039   1.00 0.92  ? 20   VAL B N    1  
ATOM 2414  C CA   . VAL B 2 20  ? 10.188  -6.263  -0.930  1.00 0.98  ? 20   VAL B CA   1  
ATOM 2415  C C    . VAL B 2 20  ? 11.264  -7.335  -0.708  1.00 1.11  ? 20   VAL B C    1  
ATOM 2416  O O    . VAL B 2 20  ? 11.172  -8.453  -1.219  1.00 1.22  ? 20   VAL B O    1  
ATOM 2417  C CB   . VAL B 2 20  ? 10.126  -5.755  -2.421  1.00 0.99  ? 20   VAL B CB   1  
ATOM 2418  C CG1  . VAL B 2 20  ? 11.387  -5.056  -2.864  1.00 1.16  ? 20   VAL B CG1  1  
ATOM 2419  C CG2  . VAL B 2 20  ? 9.768   -6.875  -3.374  1.00 1.37  ? 20   VAL B CG2  1  
ATOM 2420  H H    . VAL B 2 20  ? 10.943  -4.471  -0.081  1.00 0.92  ? 20   VAL B H    1  
ATOM 2421  H HA   . VAL B 2 20  ? 9.249   -6.747  -0.699  1.00 1.00  ? 20   VAL B HA   1  
ATOM 2422  H HB   . VAL B 2 20  ? 9.339   -5.017  -2.473  1.00 1.08  ? 20   VAL B HB   1  
ATOM 2423  H HG11 . VAL B 2 20  ? 11.507  -4.157  -2.283  1.00 1.51  ? 20   VAL B HG11 1  
ATOM 2424  H HG12 . VAL B 2 20  ? 11.291  -4.804  -3.911  1.00 1.70  ? 20   VAL B HG12 1  
ATOM 2425  H HG13 . VAL B 2 20  ? 12.229  -5.717  -2.724  1.00 1.58  ? 20   VAL B HG13 1  
ATOM 2426  H HG21 . VAL B 2 20  ? 8.792   -7.260  -3.120  1.00 1.77  ? 20   VAL B HG21 1  
ATOM 2427  H HG22 . VAL B 2 20  ? 10.507  -7.650  -3.232  1.00 1.83  ? 20   VAL B HG22 1  
ATOM 2428  H HG23 . VAL B 2 20  ? 9.787   -6.517  -4.393  1.00 1.81  ? 20   VAL B HG23 1  
ATOM 2429  N N    . CYS B 2 21  ? 12.249  -7.034  0.094   1.00 1.14  ? 21   CYS B N    1  
ATOM 2430  C CA   . CYS B 2 21  ? 13.290  -8.018  0.369   1.00 1.28  ? 21   CYS B CA   1  
ATOM 2431  C C    . CYS B 2 21  ? 13.179  -8.612  1.758   1.00 1.38  ? 21   CYS B C    1  
ATOM 2432  O O    . CYS B 2 21  ? 14.108  -9.247  2.227   1.00 1.66  ? 21   CYS B O    1  
ATOM 2433  C CB   . CYS B 2 21  ? 14.682  -7.458  0.133   1.00 1.33  ? 21   CYS B CB   1  
ATOM 2434  S SG   . CYS B 2 21  ? 14.980  -6.949  -1.576  1.00 1.38  ? 21   CYS B SG   1  
ATOM 2435  H H    . CYS B 2 21  ? 12.308  -6.139  0.500   1.00 1.09  ? 21   CYS B H    1  
ATOM 2436  H HA   . CYS B 2 21  ? 13.130  -8.823  -0.333  1.00 1.36  ? 21   CYS B HA   1  
ATOM 2437  H HB2  . CYS B 2 21  ? 14.831  -6.600  0.773   1.00 1.32  ? 21   CYS B HB2  1  
ATOM 2438  H HB3  . CYS B 2 21  ? 15.411  -8.214  0.386   1.00 1.44  ? 21   CYS B HB3  1  
ATOM 2439  N N    . GLY B 2 22  ? 12.037  -8.411  2.411   1.00 1.25  ? 22   GLY B N    1  
ATOM 2440  C CA   . GLY B 2 22  ? 11.798  -9.010  3.725   1.00 1.36  ? 22   GLY B CA   1  
ATOM 2441  C C    . GLY B 2 22  ? 12.046  -10.523 3.745   1.00 1.38  ? 22   GLY B C    1  
ATOM 2442  O O    . GLY B 2 22  ? 12.690  -11.037 4.659   1.00 1.53  ? 22   GLY B O    1  
ATOM 2443  H H    . GLY B 2 22  ? 11.364  -7.805  2.034   1.00 1.13  ? 22   GLY B H    1  
ATOM 2444  H HA2  . GLY B 2 22  ? 12.452  -8.542  4.444   1.00 1.50  ? 22   GLY B HA2  1  
ATOM 2445  H HA3  . GLY B 2 22  ? 10.774  -8.822  4.011   1.00 1.44  ? 22   GLY B HA3  1  
ATOM 2446  N N    . ASP B 2 23  ? 11.544  -11.224 2.744   1.00 1.38  ? 23   ASP B N    1  
ATOM 2447  C CA   . ASP B 2 23  ? 11.755  -12.667 2.626   1.00 1.53  ? 23   ASP B CA   1  
ATOM 2448  C C    . ASP B 2 23  ? 13.139  -13.011 2.062   1.00 1.53  ? 23   ASP B C    1  
ATOM 2449  O O    . ASP B 2 23  ? 13.820  -13.911 2.567   1.00 1.72  ? 23   ASP B O    1  
ATOM 2450  C CB   . ASP B 2 23  ? 10.672  -13.289 1.739   1.00 1.68  ? 23   ASP B CB   1  
ATOM 2451  C CG   . ASP B 2 23  ? 10.825  -14.788 1.572   1.00 2.19  ? 23   ASP B CG   1  
ATOM 2452  O OD1  . ASP B 2 23  ? 10.448  -15.530 2.493   1.00 2.72  ? 23   ASP B OD1  1  
ATOM 2453  O OD2  . ASP B 2 23  ? 11.302  -15.246 0.509   1.00 2.67  ? 23   ASP B OD2  1  
ATOM 2454  H H    . ASP B 2 23  ? 10.969  -10.774 2.084   1.00 1.37  ? 23   ASP B H    1  
ATOM 2455  H HA   . ASP B 2 23  ? 11.668  -13.093 3.615   1.00 1.66  ? 23   ASP B HA   1  
ATOM 2456  H HB2  . ASP B 2 23  ? 9.705   -13.097 2.180   1.00 1.99  ? 23   ASP B HB2  1  
ATOM 2457  H HB3  . ASP B 2 23  ? 10.710  -12.829 0.762   1.00 1.99  ? 23   ASP B HB3  1  
ATOM 2458  N N    . ARG B 2 24  ? 13.555  -12.282 1.045   1.00 1.44  ? 24   ARG B N    1  
ATOM 2459  C CA   . ARG B 2 24  ? 14.792  -12.555 0.316   1.00 1.54  ? 24   ARG B CA   1  
ATOM 2460  C C    . ARG B 2 24  ? 16.047  -12.230 1.131   1.00 1.55  ? 24   ARG B C    1  
ATOM 2461  O O    . ARG B 2 24  ? 17.084  -12.906 1.006   1.00 1.73  ? 24   ARG B O    1  
ATOM 2462  C CB   . ARG B 2 24  ? 14.798  -11.745 -0.990  1.00 1.62  ? 24   ARG B CB   1  
ATOM 2463  C CG   . ARG B 2 24  ? 16.052  -11.866 -1.861  1.00 1.85  ? 24   ARG B CG   1  
ATOM 2464  C CD   . ARG B 2 24  ? 16.208  -13.238 -2.500  1.00 2.35  ? 24   ARG B CD   1  
ATOM 2465  N NE   . ARG B 2 24  ? 16.521  -14.311 -1.547  1.00 2.81  ? 24   ARG B NE   1  
ATOM 2466  C CZ   . ARG B 2 24  ? 16.218  -15.600 -1.751  1.00 3.62  ? 24   ARG B CZ   1  
ATOM 2467  N NH1  . ARG B 2 24  ? 15.504  -15.950 -2.801  1.00 4.13  ? 24   ARG B NH1  1  
ATOM 2468  N NH2  . ARG B 2 24  ? 16.606  -16.536 -0.896  1.00 4.33  ? 24   ARG B NH2  1  
ATOM 2469  H H    . ARG B 2 24  ? 13.026  -11.514 0.753   1.00 1.41  ? 24   ARG B H    1  
ATOM 2470  H HA   . ARG B 2 24  ? 14.802  -13.603 0.054   1.00 1.65  ? 24   ARG B HA   1  
ATOM 2471  H HB2  . ARG B 2 24  ? 13.956  -12.061 -1.589  1.00 1.68  ? 24   ARG B HB2  1  
ATOM 2472  H HB3  . ARG B 2 24  ? 14.664  -10.703 -0.739  1.00 1.56  ? 24   ARG B HB3  1  
ATOM 2473  H HG2  . ARG B 2 24  ? 16.000  -11.127 -2.647  1.00 2.16  ? 24   ARG B HG2  1  
ATOM 2474  H HG3  . ARG B 2 24  ? 16.914  -11.665 -1.242  1.00 1.99  ? 24   ARG B HG3  1  
ATOM 2475  H HD2  . ARG B 2 24  ? 15.284  -13.488 -3.002  1.00 2.72  ? 24   ARG B HD2  1  
ATOM 2476  H HD3  . ARG B 2 24  ? 16.998  -13.180 -3.235  1.00 2.77  ? 24   ARG B HD3  1  
ATOM 2477  H HE   . ARG B 2 24  ? 17.007  -14.031 -0.737  1.00 2.89  ? 24   ARG B HE   1  
ATOM 2478  H HH11 . ARG B 2 24  ? 15.157  -15.296 -3.485  1.00 4.04  ? 24   ARG B HH11 1  
ATOM 2479  H HH12 . ARG B 2 24  ? 15.261  -16.918 -2.939  1.00 4.90  ? 24   ARG B HH12 1  
ATOM 2480  H HH21 . ARG B 2 24  ? 17.143  -16.345 -0.064  1.00 4.44  ? 24   ARG B HH21 1  
ATOM 2481  H HH22 . ARG B 2 24  ? 16.349  -17.492 -1.064  1.00 5.02  ? 24   ARG B HH22 1  
ATOM 2482  N N    . GLY B 2 25  ? 15.947  -11.220 1.938   1.00 1.46  ? 25   GLY B N    1  
ATOM 2483  C CA   . GLY B 2 25  ? 17.058  -10.745 2.691   1.00 1.52  ? 25   GLY B CA   1  
ATOM 2484  C C    . GLY B 2 25  ? 17.457  -9.402  2.157   1.00 1.48  ? 25   GLY B C    1  
ATOM 2485  O O    . GLY B 2 25  ? 17.404  -9.184  0.952   1.00 1.53  ? 25   GLY B O    1  
ATOM 2486  H H    . GLY B 2 25  ? 15.101  -10.727 2.022   1.00 1.40  ? 25   GLY B H    1  
ATOM 2487  H HA2  . GLY B 2 25  ? 16.782  -10.665 3.733   1.00 1.55  ? 25   GLY B HA2  1  
ATOM 2488  H HA3  . GLY B 2 25  ? 17.890  -11.425 2.582   1.00 1.63  ? 25   GLY B HA3  1  
ATOM 2489  N N    . PHE B 2 26  ? 17.789  -8.493  3.014   1.00 1.46  ? 26   PHE B N    1  
ATOM 2490  C CA   . PHE B 2 26  ? 18.182  -7.181  2.576   1.00 1.46  ? 26   PHE B CA   1  
ATOM 2491  C C    . PHE B 2 26  ? 19.516  -6.786  3.203   1.00 1.62  ? 26   PHE B C    1  
ATOM 2492  O O    . PHE B 2 26  ? 19.665  -6.816  4.430   1.00 1.65  ? 26   PHE B O    1  
ATOM 2493  C CB   . PHE B 2 26  ? 17.073  -6.127  2.866   1.00 1.37  ? 26   PHE B CB   1  
ATOM 2494  C CG   . PHE B 2 26  ? 16.658  -5.988  4.309   1.00 1.36  ? 26   PHE B CG   1  
ATOM 2495  C CD1  . PHE B 2 26  ? 15.647  -6.769  4.839   1.00 1.32  ? 26   PHE B CD1  1  
ATOM 2496  C CD2  . PHE B 2 26  ? 17.276  -5.063  5.121   1.00 1.49  ? 26   PHE B CD2  1  
ATOM 2497  C CE1  . PHE B 2 26  ? 15.269  -6.630  6.159   1.00 1.36  ? 26   PHE B CE1  1  
ATOM 2498  C CE2  . PHE B 2 26  ? 16.903  -4.913  6.440   1.00 1.55  ? 26   PHE B CE2  1  
ATOM 2499  C CZ   . PHE B 2 26  ? 15.899  -5.699  6.960   1.00 1.45  ? 26   PHE B CZ   1  
ATOM 2500  H H    . PHE B 2 26  ? 17.774  -8.703  3.977   1.00 1.48  ? 26   PHE B H    1  
ATOM 2501  H HA   . PHE B 2 26  ? 18.291  -7.272  1.505   1.00 1.49  ? 26   PHE B HA   1  
ATOM 2502  H HB2  . PHE B 2 26  ? 17.423  -5.148  2.568   1.00 1.42  ? 26   PHE B HB2  1  
ATOM 2503  H HB3  . PHE B 2 26  ? 16.194  -6.374  2.288   1.00 1.31  ? 26   PHE B HB3  1  
ATOM 2504  H HD1  . PHE B 2 26  ? 15.158  -7.498  4.211   1.00 1.33  ? 26   PHE B HD1  1  
ATOM 2505  H HD2  . PHE B 2 26  ? 18.067  -4.468  4.691   1.00 1.61  ? 26   PHE B HD2  1  
ATOM 2506  H HE1  . PHE B 2 26  ? 14.480  -7.248  6.561   1.00 1.38  ? 26   PHE B HE1  1  
ATOM 2507  H HE2  . PHE B 2 26  ? 17.397  -4.183  7.063   1.00 1.71  ? 26   PHE B HE2  1  
ATOM 2508  H HZ   . PHE B 2 26  ? 15.604  -5.586  7.992   1.00 1.52  ? 26   PHE B HZ   1  
ATOM 2509  N N    . TYR B 2 27  ? 20.496  -6.472  2.378   1.00 1.77  ? 27   TYR B N    1  
ATOM 2510  C CA   . TYR B 2 27  ? 21.794  -6.045  2.847   1.00 2.00  ? 27   TYR B CA   1  
ATOM 2511  C C    . TYR B 2 27  ? 22.591  -5.357  1.742   1.00 2.07  ? 27   TYR B C    1  
ATOM 2512  O O    . TYR B 2 27  ? 23.221  -6.010  0.904   1.00 2.53  ? 27   TYR B O    1  
ATOM 2513  C CB   . TYR B 2 27  ? 22.604  -7.188  3.542   1.00 2.27  ? 27   TYR B CB   1  
ATOM 2514  C CG   . TYR B 2 27  ? 22.608  -8.546  2.862   1.00 2.21  ? 27   TYR B CG   1  
ATOM 2515  C CD1  . TYR B 2 27  ? 23.552  -8.875  1.905   1.00 2.56  ? 27   TYR B CD1  1  
ATOM 2516  C CD2  . TYR B 2 27  ? 21.674  -9.508  3.216   1.00 2.35  ? 27   TYR B CD2  1  
ATOM 2517  C CE1  . TYR B 2 27  ? 23.559  -10.125 1.313   1.00 2.98  ? 27   TYR B CE1  1  
ATOM 2518  C CE2  . TYR B 2 27  ? 21.675  -10.752 2.642   1.00 2.56  ? 27   TYR B CE2  1  
ATOM 2519  C CZ   . TYR B 2 27  ? 22.616  -11.061 1.692   1.00 2.85  ? 27   TYR B CZ   1  
ATOM 2520  O OH   . TYR B 2 27  ? 22.613  -12.308 1.125   1.00 3.42  ? 27   TYR B OH   1  
ATOM 2521  H H    . TYR B 2 27  ? 20.364  -6.518  1.404   1.00 1.76  ? 27   TYR B H    1  
ATOM 2522  H HA   . TYR B 2 27  ? 21.545  -5.315  3.604   1.00 2.04  ? 27   TYR B HA   1  
ATOM 2523  H HB2  . TYR B 2 27  ? 23.635  -6.878  3.619   1.00 2.65  ? 27   TYR B HB2  1  
ATOM 2524  H HB3  . TYR B 2 27  ? 22.212  -7.317  4.541   1.00 2.57  ? 27   TYR B HB3  1  
ATOM 2525  H HD1  . TYR B 2 27  ? 24.278  -8.123  1.629   1.00 2.81  ? 27   TYR B HD1  1  
ATOM 2526  H HD2  . TYR B 2 27  ? 20.932  -9.261  3.962   1.00 2.63  ? 27   TYR B HD2  1  
ATOM 2527  H HE1  . TYR B 2 27  ? 24.300  -10.367 0.566   1.00 3.60  ? 27   TYR B HE1  1  
ATOM 2528  H HE2  . TYR B 2 27  ? 20.936  -11.482 2.937   1.00 2.80  ? 27   TYR B HE2  1  
ATOM 2529  H HH   . TYR B 2 27  ? 21.689  -12.530 0.942   1.00 3.67  ? 27   TYR B HH   1  
ATOM 2530  N N    . PHE B 2 28  ? 22.535  -4.035  1.718   1.00 1.95  ? 28   PHE B N    1  
ATOM 2531  C CA   . PHE B 2 28  ? 23.245  -3.257  0.736   1.00 2.01  ? 28   PHE B CA   1  
ATOM 2532  C C    . PHE B 2 28  ? 24.596  -2.821  1.281   1.00 2.20  ? 28   PHE B C    1  
ATOM 2533  O O    . PHE B 2 28  ? 25.438  -2.305  0.558   1.00 2.26  ? 28   PHE B O    1  
ATOM 2534  C CB   . PHE B 2 28  ? 22.403  -2.052  0.272   1.00 1.96  ? 28   PHE B CB   1  
ATOM 2535  C CG   . PHE B 2 28  ? 21.902  -1.138  1.376   1.00 1.99  ? 28   PHE B CG   1  
ATOM 2536  C CD1  . PHE B 2 28  ? 22.680  -0.089  1.841   1.00 2.17  ? 28   PHE B CD1  1  
ATOM 2537  C CD2  . PHE B 2 28  ? 20.646  -1.323  1.927   1.00 1.98  ? 28   PHE B CD2  1  
ATOM 2538  C CE1  . PHE B 2 28  ? 22.215  0.753   2.833   1.00 2.24  ? 28   PHE B CE1  1  
ATOM 2539  C CE2  . PHE B 2 28  ? 20.176  -0.487  2.918   1.00 2.08  ? 28   PHE B CE2  1  
ATOM 2540  C CZ   . PHE B 2 28  ? 20.962  0.553   3.372   1.00 2.17  ? 28   PHE B CZ   1  
ATOM 2541  H H    . PHE B 2 28  ? 22.021  -3.527  2.384   1.00 2.06  ? 28   PHE B H    1  
ATOM 2542  H HA   . PHE B 2 28  ? 23.420  -3.904  -0.112  1.00 2.03  ? 28   PHE B HA   1  
ATOM 2543  H HB2  . PHE B 2 28  ? 23.002  -1.452  -0.395  1.00 2.02  ? 28   PHE B HB2  1  
ATOM 2544  H HB3  . PHE B 2 28  ? 21.545  -2.422  -0.270  1.00 1.90  ? 28   PHE B HB3  1  
ATOM 2545  H HD1  . PHE B 2 28  ? 23.661  0.063   1.417   1.00 2.32  ? 28   PHE B HD1  1  
ATOM 2546  H HD2  . PHE B 2 28  ? 20.028  -2.136  1.576   1.00 1.99  ? 28   PHE B HD2  1  
ATOM 2547  H HE1  . PHE B 2 28  ? 22.832  1.567   3.185   1.00 2.44  ? 28   PHE B HE1  1  
ATOM 2548  H HE2  . PHE B 2 28  ? 19.193  -0.647  3.338   1.00 2.19  ? 28   PHE B HE2  1  
ATOM 2549  H HZ   . PHE B 2 28  ? 20.595  1.208   4.148   1.00 2.28  ? 28   PHE B HZ   1  
ATOM 2550  N N    . SER B 2 29  ? 24.783  -3.022  2.553   1.00 2.41  ? 29   SER B N    1  
ATOM 2551  C CA   . SER B 2 29  ? 26.014  -2.710  3.198   1.00 2.66  ? 29   SER B CA   1  
ATOM 2552  C C    . SER B 2 29  ? 26.692  -4.020  3.556   1.00 2.58  ? 29   SER B C    1  
ATOM 2553  O O    . SER B 2 29  ? 26.206  -4.762  4.415   1.00 2.79  ? 29   SER B O    1  
ATOM 2554  C CB   . SER B 2 29  ? 25.748  -1.859  4.456   1.00 3.13  ? 29   SER B CB   1  
ATOM 2555  O OG   . SER B 2 29  ? 26.950  -1.539  5.147   1.00 3.68  ? 29   SER B OG   1  
ATOM 2556  H H    . SER B 2 29  ? 24.060  -3.412  3.094   1.00 2.48  ? 29   SER B H    1  
ATOM 2557  H HA   . SER B 2 29  ? 26.623  -2.147  2.505   1.00 2.71  ? 29   SER B HA   1  
ATOM 2558  H HB2  . SER B 2 29  ? 25.263  -0.939  4.165   1.00 3.33  ? 29   SER B HB2  1  
ATOM 2559  H HB3  . SER B 2 29  ? 25.098  -2.409  5.122   1.00 3.32  ? 29   SER B HB3  1  
ATOM 2560  H HG   . SER B 2 29  ? 26.946  -2.072  5.959   1.00 3.85  ? 29   SER B HG   1  
ATOM 2561  N N    . ARG B 2 30  ? 27.757  -4.354  2.853   1.00 2.55  ? 30   ARG B N    1  
ATOM 2562  C CA   . ARG B 2 30  ? 28.473  -5.575  3.130   1.00 2.65  ? 30   ARG B CA   1  
ATOM 2563  C C    . ARG B 2 30  ? 29.918  -5.277  3.434   1.00 2.99  ? 30   ARG B C    1  
ATOM 2564  O O    . ARG B 2 30  ? 30.686  -4.900  2.545   1.00 3.28  ? 30   ARG B O    1  
ATOM 2565  C CB   . ARG B 2 30  ? 28.358  -6.561  1.962   1.00 2.70  ? 30   ARG B CB   1  
ATOM 2566  C CG   . ARG B 2 30  ? 26.948  -7.061  1.755   1.00 2.63  ? 30   ARG B CG   1  
ATOM 2567  C CD   . ARG B 2 30  ? 26.849  -8.102  0.661   1.00 2.46  ? 30   ARG B CD   1  
ATOM 2568  N NE   . ARG B 2 30  ? 27.134  -7.571  -0.691  1.00 2.71  ? 30   ARG B NE   1  
ATOM 2569  C CZ   . ARG B 2 30  ? 26.174  -7.331  -1.593  1.00 3.07  ? 30   ARG B CZ   1  
ATOM 2570  N NH1  . ARG B 2 30  ? 24.920  -7.185  -1.192  1.00 3.21  ? 30   ARG B NH1  1  
ATOM 2571  N NH2  . ARG B 2 30  ? 26.475  -7.135  -2.865  1.00 3.81  ? 30   ARG B NH2  1  
ATOM 2572  H H    . ARG B 2 30  ? 28.090  -3.766  2.144   1.00 2.65  ? 30   ARG B H    1  
ATOM 2573  H HA   . ARG B 2 30  ? 28.023  -6.021  4.005   1.00 2.72  ? 30   ARG B HA   1  
ATOM 2574  H HB2  . ARG B 2 30  ? 28.682  -6.072  1.056   1.00 2.85  ? 30   ARG B HB2  1  
ATOM 2575  H HB3  . ARG B 2 30  ? 28.996  -7.411  2.155   1.00 2.90  ? 30   ARG B HB3  1  
ATOM 2576  H HG2  . ARG B 2 30  ? 26.597  -7.499  2.677   1.00 2.87  ? 30   ARG B HG2  1  
ATOM 2577  H HG3  . ARG B 2 30  ? 26.321  -6.220  1.497   1.00 2.91  ? 30   ARG B HG3  1  
ATOM 2578  H HD2  . ARG B 2 30  ? 27.522  -8.914  0.896   1.00 2.70  ? 30   ARG B HD2  1  
ATOM 2579  H HD3  . ARG B 2 30  ? 25.838  -8.488  0.677   1.00 2.74  ? 30   ARG B HD3  1  
ATOM 2580  H HE   . ARG B 2 30  ? 28.083  -7.504  -0.957  1.00 3.07  ? 30   ARG B HE   1  
ATOM 2581  H HH11 . ARG B 2 30  ? 24.632  -7.221  -0.232  1.00 3.17  ? 30   ARG B HH11 1  
ATOM 2582  H HH12 . ARG B 2 30  ? 24.167  -7.091  -1.852  1.00 3.73  ? 30   ARG B HH12 1  
ATOM 2583  H HH21 . ARG B 2 30  ? 27.417  -7.149  -3.237  1.00 4.18  ? 30   ARG B HH21 1  
ATOM 2584  H HH22 . ARG B 2 30  ? 25.751  -6.983  -3.553  1.00 4.27  ? 30   ARG B HH22 1  
ATOM 2585  N N    . PRO B 2 31  ? 30.296  -5.432  4.709   1.00 3.17  ? 31   PRO B N    1  
ATOM 2586  C CA   . PRO B 2 31  ? 31.665  -5.221  5.174   1.00 3.60  ? 31   PRO B CA   1  
ATOM 2587  C C    . PRO B 2 31  ? 32.648  -6.241  4.592   1.00 3.72  ? 31   PRO B C    1  
ATOM 2588  O O    . PRO B 2 31  ? 33.708  -5.867  4.075   1.00 4.02  ? 31   PRO B O    1  
ATOM 2589  C CB   . PRO B 2 31  ? 31.563  -5.377  6.700   1.00 3.86  ? 31   PRO B CB   1  
ATOM 2590  C CG   . PRO B 2 31  ? 30.120  -5.213  7.015   1.00 3.76  ? 31   PRO B CG   1  
ATOM 2591  C CD   . PRO B 2 31  ? 29.384  -5.745  5.830   1.00 3.25  ? 31   PRO B CD   1  
ATOM 2592  H HA   . PRO B 2 31  ? 32.008  -4.225  4.935   1.00 3.85  ? 31   PRO B HA   1  
ATOM 2593  H HB2  . PRO B 2 31  ? 31.925  -6.349  6.999   1.00 3.96  ? 31   PRO B HB2  1  
ATOM 2594  H HB3  . PRO B 2 31  ? 32.154  -4.610  7.177   1.00 4.20  ? 31   PRO B HB3  1  
ATOM 2595  H HG2  . PRO B 2 31  ? 29.870  -5.781  7.900   1.00 4.07  ? 31   PRO B HG2  1  
ATOM 2596  H HG3  . PRO B 2 31  ? 29.892  -4.168  7.160   1.00 3.95  ? 31   PRO B HG3  1  
ATOM 2597  H HD2  . PRO B 2 31  ? 29.197  -6.804  5.931   1.00 3.28  ? 31   PRO B HD2  1  
ATOM 2598  H HD3  . PRO B 2 31  ? 28.447  -5.219  5.713   1.00 3.18  ? 31   PRO B HD3  1  
ATOM 2599  N N    . ALA B 2 32  ? 32.306  -7.527  4.665   1.00 3.72  ? 32   ALA B N    1  
ATOM 2600  C CA   . ALA B 2 32  ? 33.143  -8.560  4.151   1.00 4.11  ? 32   ALA B CA   1  
ATOM 2601  C C    . ALA B 2 32  ? 32.332  -9.816  3.904   1.00 4.50  ? 32   ALA B C    1  
ATOM 2602  O O    . ALA B 2 32  ? 31.109  -9.825  4.118   1.00 4.92  ? 32   ALA B O    1  
ATOM 2603  C CB   . ALA B 2 32  ? 34.292  -8.839  5.096   1.00 4.78  ? 32   ALA B CB   1  
ATOM 2604  H H    . ALA B 2 32  ? 31.468  -7.832  5.073   1.00 3.61  ? 32   ALA B H    1  
ATOM 2605  H HA   . ALA B 2 32  ? 33.550  -8.218  3.210   1.00 4.05  ? 32   ALA B HA   1  
ATOM 2606  H HB1  . ALA B 2 32  ? 34.947  -9.556  4.620   1.00 5.02  ? 32   ALA B HB1  1  
ATOM 2607  H HB2  . ALA B 2 32  ? 33.908  -9.250  6.017   1.00 5.08  ? 32   ALA B HB2  1  
ATOM 2608  H HB3  . ALA B 2 32  ? 34.834  -7.926  5.287   1.00 5.12  ? 32   ALA B HB3  1  
ATOM 2609  N N    . SER B 2 33  ? 33.016  -10.848 3.448   1.00 4.79  ? 33   SER B N    1  
ATOM 2610  C CA   . SER B 2 33  ? 32.505  -12.130 3.114   1.00 5.55  ? 33   SER B CA   1  
ATOM 2611  C C    . SER B 2 33  ? 33.615  -12.832 2.429   1.00 6.06  ? 33   SER B C    1  
ATOM 2612  O O    . SER B 2 33  ? 34.425  -12.202 1.735   1.00 5.86  ? 33   SER B O    1  
ATOM 2613  C CB   . SER B 2 33  ? 31.332  -12.027 2.163   1.00 5.88  ? 33   SER B CB   1  
ATOM 2614  O OG   . SER B 2 33  ? 30.888  -13.291 1.712   1.00 6.72  ? 33   SER B OG   1  
ATOM 2615  H H    . SER B 2 33  ? 33.986  -10.815 3.316   1.00 4.77  ? 33   SER B H    1  
ATOM 2616  H HA   . SER B 2 33  ? 32.215  -12.645 4.017   1.00 5.80  ? 33   SER B HA   1  
ATOM 2617  H HB2  . SER B 2 33  ? 30.546  -11.611 2.763   1.00 5.86  ? 33   SER B HB2  1  
ATOM 2618  H HB3  . SER B 2 33  ? 31.576  -11.391 1.326   1.00 5.82  ? 33   SER B HB3  1  
ATOM 2619  H HG   . SER B 2 33  ? 30.205  -13.609 2.327   1.00 6.93  ? 33   SER B HG   1  
ATOM 2620  N N    . ARG B 2 34  ? 33.622  -14.109 2.557   1.00 6.92  ? 34   ARG B N    1  
ATOM 2621  C CA   . ARG B 2 34  ? 34.672  -14.950 2.003   1.00 7.72  ? 34   ARG B CA   1  
ATOM 2622  C C    . ARG B 2 34  ? 34.384  -15.179 0.511   1.00 8.17  ? 34   ARG B C    1  
ATOM 2623  O O    . ARG B 2 34  ? 35.148  -15.803 -0.214  1.00 8.95  ? 34   ARG B O    1  
ATOM 2624  C CB   . ARG B 2 34  ? 34.740  -16.266 2.792   1.00 8.57  ? 34   ARG B CB   1  
ATOM 2625  C CG   . ARG B 2 34  ? 35.988  -17.115 2.521   1.00 9.48  ? 34   ARG B CG   1  
ATOM 2626  C CD   . ARG B 2 34  ? 35.994  -18.426 3.314   1.00 10.00 ? 34   ARG B CD   1  
ATOM 2627  N NE   . ARG B 2 34  ? 36.002  -18.213 4.764   1.00 10.50 ? 34   ARG B NE   1  
ATOM 2628  C CZ   . ARG B 2 34  ? 36.584  -19.024 5.664   1.00 11.06 ? 34   ARG B CZ   1  
ATOM 2629  N NH1  . ARG B 2 34  ? 37.215  -20.131 5.270   1.00 11.22 ? 34   ARG B NH1  1  
ATOM 2630  N NH2  . ARG B 2 34  ? 36.517  -18.726 6.956   1.00 11.63 ? 34   ARG B NH2  1  
ATOM 2631  H H    . ARG B 2 34  ? 32.848  -14.490 3.039   1.00 7.14  ? 34   ARG B H    1  
ATOM 2632  H HA   . ARG B 2 34  ? 35.608  -14.417 2.092   1.00 7.56  ? 34   ARG B HA   1  
ATOM 2633  H HB2  . ARG B 2 34  ? 34.723  -15.983 3.835   1.00 8.20  ? 34   ARG B HB2  1  
ATOM 2634  H HB3  . ARG B 2 34  ? 33.857  -16.846 2.571   1.00 8.99  ? 34   ARG B HB3  1  
ATOM 2635  H HG2  . ARG B 2 34  ? 36.050  -17.350 1.469   1.00 9.92  ? 34   ARG B HG2  1  
ATOM 2636  H HG3  . ARG B 2 34  ? 36.856  -16.537 2.802   1.00 9.53  ? 34   ARG B HG3  1  
ATOM 2637  H HD2  . ARG B 2 34  ? 35.122  -19.011 3.055   1.00 10.20 ? 34   ARG B HD2  1  
ATOM 2638  H HD3  . ARG B 2 34  ? 36.876  -18.990 3.045   1.00 10.03 ? 34   ARG B HD3  1  
ATOM 2639  H HE   . ARG B 2 34  ? 35.525  -17.407 5.085   1.00 10.53 ? 34   ARG B HE   1  
ATOM 2640  H HH11 . ARG B 2 34  ? 37.287  -20.410 4.303   1.00 10.95 ? 34   ARG B HH11 1  
ATOM 2641  H HH12 . ARG B 2 34  ? 37.650  -20.761 5.927   1.00 11.73 ? 34   ARG B HH12 1  
ATOM 2642  H HH21 . ARG B 2 34  ? 36.033  -17.909 7.289   1.00 11.70 ? 34   ARG B HH21 1  
ATOM 2643  H HH22 . ARG B 2 34  ? 36.954  -19.285 7.676   1.00 12.14 ? 34   ARG B HH22 1  
ATOM 2644  N N    . VAL B 2 35  ? 33.268  -14.619 0.077   1.00 7.81  ? 35   VAL B N    1  
ATOM 2645  C CA   . VAL B 2 35  ? 32.837  -14.648 -1.310  1.00 8.33  ? 35   VAL B CA   1  
ATOM 2646  C C    . VAL B 2 35  ? 33.382  -13.395 -2.027  1.00 7.66  ? 35   VAL B C    1  
ATOM 2647  O O    . VAL B 2 35  ? 33.236  -13.219 -3.241  1.00 8.09  ? 35   VAL B O    1  
ATOM 2648  C CB   . VAL B 2 35  ? 31.269  -14.704 -1.391  1.00 8.82  ? 35   VAL B CB   1  
ATOM 2649  C CG1  . VAL B 2 35  ? 30.772  -14.792 -2.825  1.00 9.61  ? 35   VAL B CG1  1  
ATOM 2650  C CG2  . VAL B 2 35  ? 30.734  -15.879 -0.578  1.00 9.47  ? 35   VAL B CG2  1  
ATOM 2651  H H    . VAL B 2 35  ? 32.705  -14.172 0.749   1.00 7.32  ? 35   VAL B H    1  
ATOM 2652  H HA   . VAL B 2 35  ? 33.253  -15.509 -1.807  1.00 9.01  ? 35   VAL B HA   1  
ATOM 2653  H HB   . VAL B 2 35  ? 30.879  -13.795 -0.959  1.00 8.27  ? 35   VAL B HB   1  
ATOM 2654  H HG11 . VAL B 2 35  ? 31.149  -15.694 -3.285  1.00 9.90  ? 35   VAL B HG11 1  
ATOM 2655  H HG12 . VAL B 2 35  ? 31.153  -13.933 -3.357  1.00 9.79  ? 35   VAL B HG12 1  
ATOM 2656  H HG13 . VAL B 2 35  ? 29.692  -14.786 -2.840  1.00 9.89  ? 35   VAL B HG13 1  
ATOM 2657  H HG21 . VAL B 2 35  ? 29.657  -15.912 -0.650  1.00 9.62  ? 35   VAL B HG21 1  
ATOM 2658  H HG22 . VAL B 2 35  ? 31.021  -15.761 0.456   1.00 9.75  ? 35   VAL B HG22 1  
ATOM 2659  H HG23 . VAL B 2 35  ? 31.148  -16.800 -0.961  1.00 9.67  ? 35   VAL B HG23 1  
ATOM 2660  N N    . SER B 2 36  ? 34.043  -12.533 -1.233  1.00 6.71  ? 36   SER B N    1  
ATOM 2661  C CA   . SER B 2 36  ? 34.627  -11.283 -1.707  1.00 6.10  ? 36   SER B CA   1  
ATOM 2662  C C    . SER B 2 36  ? 33.511  -10.366 -2.244  1.00 5.54  ? 36   SER B C    1  
ATOM 2663  O O    . SER B 2 36  ? 33.714  -9.534  -3.111  1.00 5.31  ? 36   SER B O    1  
ATOM 2664  C CB   . SER B 2 36  ? 35.747  -11.567 -2.761  1.00 6.44  ? 36   SER B CB   1  
ATOM 2665  O OG   . SER B 2 36  ? 36.465  -10.394 -3.138  1.00 6.53  ? 36   SER B OG   1  
ATOM 2666  H H    . SER B 2 36  ? 34.161  -12.776 -0.291  1.00 6.51  ? 36   SER B H    1  
ATOM 2667  H HA   . SER B 2 36  ? 35.058  -10.809 -0.839  1.00 6.14  ? 36   SER B HA   1  
ATOM 2668  H HB2  . SER B 2 36  ? 36.451  -12.274 -2.349  1.00 6.82  ? 36   SER B HB2  1  
ATOM 2669  H HB3  . SER B 2 36  ? 35.294  -11.997 -3.644  1.00 6.60  ? 36   SER B HB3  1  
ATOM 2670  H HG   . SER B 2 36  ? 36.267  -10.246 -4.078  1.00 6.58  ? 36   SER B HG   1  
ATOM 2671  N N    . ARG B 2 37  ? 32.332  -10.501 -1.642  1.00 5.74  ? 37   ARG B N    1  
ATOM 2672  C CA   . ARG B 2 37  ? 31.129  -9.770  -2.091  1.00 5.75  ? 37   ARG B CA   1  
ATOM 2673  C C    . ARG B 2 37  ? 30.969  -8.445  -1.343  1.00 5.29  ? 37   ARG B C    1  
ATOM 2674  O O    . ARG B 2 37  ? 29.898  -7.821  -1.334  1.00 5.64  ? 37   ARG B O    1  
ATOM 2675  C CB   . ARG B 2 37  ? 29.859  -10.633 -2.014  1.00 6.47  ? 37   ARG B CB   1  
ATOM 2676  C CG   . ARG B 2 37  ? 29.365  -10.948 -0.610  1.00 7.24  ? 37   ARG B CG   1  
ATOM 2677  C CD   . ARG B 2 37  ? 28.117  -11.820 -0.650  1.00 8.13  ? 37   ARG B CD   1  
ATOM 2678  N NE   . ARG B 2 37  ? 27.554  -12.053 0.681   1.00 8.59  ? 37   ARG B NE   1  
ATOM 2679  C CZ   . ARG B 2 37  ? 26.545  -12.895 0.936   1.00 9.42  ? 37   ARG B CZ   1  
ATOM 2680  N NH1  . ARG B 2 37  ? 26.106  -13.716 -0.009  1.00 9.86  ? 37   ARG B NH1  1  
ATOM 2681  N NH2  . ARG B 2 37  ? 26.009  -12.947 2.149   1.00 10.00 ? 37   ARG B NH2  1  
ATOM 2682  H H    . ARG B 2 37  ? 32.298  -11.118 -0.879  1.00 6.18  ? 37   ARG B H    1  
ATOM 2683  H HA   . ARG B 2 37  ? 31.317  -9.516  -3.124  1.00 5.92  ? 37   ARG B HA   1  
ATOM 2684  H HB2  . ARG B 2 37  ? 29.073  -10.127 -2.553  1.00 6.44  ? 37   ARG B HB2  1  
ATOM 2685  H HB3  . ARG B 2 37  ? 30.087  -11.564 -2.513  1.00 6.79  ? 37   ARG B HB3  1  
ATOM 2686  H HG2  . ARG B 2 37  ? 30.142  -11.459 -0.061  1.00 7.36  ? 37   ARG B HG2  1  
ATOM 2687  H HG3  . ARG B 2 37  ? 29.130  -10.020 -0.111  1.00 7.28  ? 37   ARG B HG3  1  
ATOM 2688  H HD2  . ARG B 2 37  ? 27.359  -11.334 -1.249  1.00 8.28  ? 37   ARG B HD2  1  
ATOM 2689  H HD3  . ARG B 2 37  ? 28.355  -12.776 -1.093  1.00 8.54  ? 37   ARG B HD3  1  
ATOM 2690  H HE   . ARG B 2 37  ? 27.941  -11.493 1.400   1.00 8.43  ? 37   ARG B HE   1  
ATOM 2691  H HH11 . ARG B 2 37  ? 26.519  -13.757 -0.929  1.00 9.63  ? 37   ARG B HH11 1  
ATOM 2692  H HH12 . ARG B 2 37  ? 25.308  -14.312 0.123   1.00 10.58 ? 37   ARG B HH12 1  
ATOM 2693  H HH21 . ARG B 2 37  ? 26.316  -12.373 2.911   1.00 9.90  ? 37   ARG B HH21 1  
ATOM 2694  H HH22 . ARG B 2 37  ? 25.263  -13.598 2.345   1.00 10.71 ? 37   ARG B HH22 1  
ATOM 2695  N N    . ARG B 2 38  ? 32.016  -8.092  -0.639  1.00 4.85  ? 38   ARG B N    1  
ATOM 2696  C CA   . ARG B 2 38  ? 32.121  -6.877  0.132   1.00 4.66  ? 38   ARG B CA   1  
ATOM 2697  C C    . ARG B 2 38  ? 32.118  -5.624  -0.755  1.00 4.10  ? 38   ARG B C    1  
ATOM 2698  O O    . ARG B 2 38  ? 33.161  -5.072  -1.106  1.00 3.96  ? 38   ARG B O    1  
ATOM 2699  C CB   . ARG B 2 38  ? 33.365  -6.967  1.011   1.00 5.06  ? 38   ARG B CB   1  
ATOM 2700  C CG   . ARG B 2 38  ? 34.589  -7.444  0.276   1.00 5.56  ? 38   ARG B CG   1  
ATOM 2701  C CD   . ARG B 2 38  ? 35.689  -7.793  1.226   1.00 6.01  ? 38   ARG B CD   1  
ATOM 2702  N NE   . ARG B 2 38  ? 36.798  -8.441  0.522   1.00 6.54  ? 38   ARG B NE   1  
ATOM 2703  C CZ   . ARG B 2 38  ? 37.550  -9.438  1.002   1.00 7.27  ? 38   ARG B CZ   1  
ATOM 2704  N NH1  . ARG B 2 38  ? 37.388  -9.861  2.245   1.00 7.58  ? 38   ARG B NH1  1  
ATOM 2705  N NH2  . ARG B 2 38  ? 38.466  -10.009 0.227   1.00 7.94  ? 38   ARG B NH2  1  
ATOM 2706  H H    . ARG B 2 38  ? 32.800  -8.674  -0.674  1.00 4.85  ? 38   ARG B H    1  
ATOM 2707  H HA   . ARG B 2 38  ? 31.259  -6.801  0.775   1.00 5.01  ? 38   ARG B HA   1  
ATOM 2708  H HB2  . ARG B 2 38  ? 33.588  -5.979  1.379   1.00 5.29  ? 38   ARG B HB2  1  
ATOM 2709  H HB3  . ARG B 2 38  ? 33.204  -7.631  1.850   1.00 5.11  ? 38   ARG B HB3  1  
ATOM 2710  H HG2  . ARG B 2 38  ? 34.328  -8.318  -0.304  1.00 5.80  ? 38   ARG B HG2  1  
ATOM 2711  H HG3  . ARG B 2 38  ? 34.925  -6.661  -0.389  1.00 5.77  ? 38   ARG B HG3  1  
ATOM 2712  H HD2  . ARG B 2 38  ? 36.016  -6.889  1.718   1.00 6.10  ? 38   ARG B HD2  1  
ATOM 2713  H HD3  . ARG B 2 38  ? 35.263  -8.472  1.950   1.00 6.21  ? 38   ARG B HD3  1  
ATOM 2714  H HE   . ARG B 2 38  ? 36.948  -8.110  -0.400  1.00 6.55  ? 38   ARG B HE   1  
ATOM 2715  H HH11 . ARG B 2 38  ? 36.725  -9.480  2.890   1.00 7.31  ? 38   ARG B HH11 1  
ATOM 2716  H HH12 . ARG B 2 38  ? 37.948  -10.625 2.594   1.00 8.27  ? 38   ARG B HH12 1  
ATOM 2717  H HH21 . ARG B 2 38  ? 38.648  -9.732  -0.728  1.00 7.97  ? 38   ARG B HH21 1  
ATOM 2718  H HH22 . ARG B 2 38  ? 39.038  -10.782 0.524   1.00 8.60  ? 38   ARG B HH22 1  
ATOM 2719  N N    . SER B 2 39  ? 30.946  -5.249  -1.154  1.00 4.23  ? 39   SER B N    1  
ATOM 2720  C CA   . SER B 2 39  ? 30.705  -4.054  -1.891  1.00 4.13  ? 39   SER B CA   1  
ATOM 2721  C C    . SER B 2 39  ? 29.402  -3.460  -1.391  1.00 3.72  ? 39   SER B C    1  
ATOM 2722  O O    . SER B 2 39  ? 28.346  -4.103  -1.462  1.00 4.10  ? 39   SER B O    1  
ATOM 2723  C CB   . SER B 2 39  ? 30.607  -4.344  -3.397  1.00 5.02  ? 39   SER B CB   1  
ATOM 2724  O OG   . SER B 2 39  ? 31.802  -4.958  -3.908  1.00 5.76  ? 39   SER B OG   1  
ATOM 2725  H H    . SER B 2 39  ? 30.168  -5.819  -0.973  1.00 4.67  ? 39   SER B H    1  
ATOM 2726  H HA   . SER B 2 39  ? 31.515  -3.365  -1.705  1.00 4.08  ? 39   SER B HA   1  
ATOM 2727  H HB2  . SER B 2 39  ? 29.775  -5.009  -3.575  1.00 5.31  ? 39   SER B HB2  1  
ATOM 2728  H HB3  . SER B 2 39  ? 30.442  -3.417  -3.925  1.00 5.15  ? 39   SER B HB3  1  
ATOM 2729  H HG   . SER B 2 39  ? 32.516  -4.301  -3.830  1.00 5.79  ? 39   SER B HG   1  
ATOM 2730  N N    . ARG B 2 40  ? 29.495  -2.304  -0.803  1.00 3.23  ? 40   ARG B N    1  
ATOM 2731  C CA   . ARG B 2 40  ? 28.332  -1.575  -0.352  1.00 2.98  ? 40   ARG B CA   1  
ATOM 2732  C C    . ARG B 2 40  ? 27.734  -0.837  -1.529  1.00 2.50  ? 40   ARG B C    1  
ATOM 2733  O O    . ARG B 2 40  ? 28.461  -0.441  -2.452  1.00 2.57  ? 40   ARG B O    1  
ATOM 2734  C CB   . ARG B 2 40  ? 28.709  -0.609  0.811   1.00 3.36  ? 40   ARG B CB   1  
ATOM 2735  C CG   . ARG B 2 40  ? 29.724  0.506   0.468   1.00 3.83  ? 40   ARG B CG   1  
ATOM 2736  C CD   . ARG B 2 40  ? 29.077  1.743   -0.176  1.00 4.14  ? 40   ARG B CD   1  
ATOM 2737  N NE   . ARG B 2 40  ? 30.055  2.748   -0.576  1.00 4.69  ? 40   ARG B NE   1  
ATOM 2738  C CZ   . ARG B 2 40  ? 30.071  4.013   -0.158  1.00 5.27  ? 40   ARG B CZ   1  
ATOM 2739  N NH1  . ARG B 2 40  ? 29.338  4.381   0.893   1.00 5.33  ? 40   ARG B NH1  1  
ATOM 2740  N NH2  . ARG B 2 40  ? 30.868  4.889   -0.748  1.00 6.03  ? 40   ARG B NH2  1  
ATOM 2741  H H    . ARG B 2 40  ? 30.397  -1.932  -0.668  1.00 3.27  ? 40   ARG B H    1  
ATOM 2742  H HA   . ARG B 2 40  ? 27.610  -2.296  0.003   1.00 3.20  ? 40   ARG B HA   1  
ATOM 2743  H HB2  . ARG B 2 40  ? 27.817  -0.146  1.204   1.00 3.35  ? 40   ARG B HB2  1  
ATOM 2744  H HB3  . ARG B 2 40  ? 29.131  -1.214  1.598   1.00 3.80  ? 40   ARG B HB3  1  
ATOM 2745  H HG2  . ARG B 2 40  ? 30.251  0.807   1.361   1.00 4.27  ? 40   ARG B HG2  1  
ATOM 2746  H HG3  . ARG B 2 40  ? 30.422  0.079   -0.237  1.00 3.96  ? 40   ARG B HG3  1  
ATOM 2747  H HD2  . ARG B 2 40  ? 28.552  1.448   -1.072  1.00 4.23  ? 40   ARG B HD2  1  
ATOM 2748  H HD3  . ARG B 2 40  ? 28.389  2.197   0.523   1.00 4.31  ? 40   ARG B HD3  1  
ATOM 2749  H HE   . ARG B 2 40  ? 30.689  2.430   -1.268  1.00 4.83  ? 40   ARG B HE   1  
ATOM 2750  H HH11 . ARG B 2 40  ? 28.772  3.719   1.397   1.00 5.05  ? 40   ARG B HH11 1  
ATOM 2751  H HH12 . ARG B 2 40  ? 29.310  5.328   1.240   1.00 5.86  ? 40   ARG B HH12 1  
ATOM 2752  H HH21 . ARG B 2 40  ? 31.464  4.626   -1.512  1.00 6.25  ? 40   ARG B HH21 1  
ATOM 2753  H HH22 . ARG B 2 40  ? 30.917  5.853   -0.457  1.00 6.57  ? 40   ARG B HH22 1  
ATOM 2754  N N    . GLY B 2 41  ? 26.455  -0.668  -1.528  1.00 2.37  ? 41   GLY B N    1  
ATOM 2755  C CA   . GLY B 2 41  ? 25.839  0.040   -2.593  1.00 2.23  ? 41   GLY B CA   1  
ATOM 2756  C C    . GLY B 2 41  ? 24.649  0.798   -2.129  1.00 2.11  ? 41   GLY B C    1  
ATOM 2757  O O    . GLY B 2 41  ? 24.224  0.625   -0.989  1.00 2.30  ? 41   GLY B O    1  
ATOM 2758  H H    . GLY B 2 41  ? 25.896  -1.045  -0.811  1.00 2.62  ? 41   GLY B H    1  
ATOM 2759  H HA2  . GLY B 2 41  ? 26.562  0.721   -3.015  1.00 2.38  ? 41   GLY B HA2  1  
ATOM 2760  H HA3  . GLY B 2 41  ? 25.536  -0.669  -3.351  1.00 2.42  ? 41   GLY B HA3  1  
ATOM 2761  N N    . ILE B 2 42  ? 24.169  1.695   -2.994  1.00 2.07  ? 42   ILE B N    1  
ATOM 2762  C CA   . ILE B 2 42  ? 22.931  2.517   -2.879  1.00 1.96  ? 42   ILE B CA   1  
ATOM 2763  C C    . ILE B 2 42  ? 22.863  3.493   -1.691  1.00 1.97  ? 42   ILE B C    1  
ATOM 2764  O O    . ILE B 2 42  ? 22.146  4.476   -1.764  1.00 1.99  ? 42   ILE B O    1  
ATOM 2765  C CB   . ILE B 2 42  ? 21.608  1.702   -2.989  1.00 1.84  ? 42   ILE B CB   1  
ATOM 2766  C CG1  . ILE B 2 42  ? 21.321  0.913   -1.700  1.00 1.79  ? 42   ILE B CG1  1  
ATOM 2767  C CG2  . ILE B 2 42  ? 21.715  0.758   -4.181  1.00 1.88  ? 42   ILE B CG2  1  
ATOM 2768  C CD1  . ILE B 2 42  ? 19.963  0.256   -1.653  1.00 1.67  ? 42   ILE B CD1  1  
ATOM 2769  H H    . ILE B 2 42  ? 24.679  1.860   -3.821  1.00 2.28  ? 42   ILE B H    1  
ATOM 2770  H HA   . ILE B 2 42  ? 22.975  3.156   -3.750  1.00 2.03  ? 42   ILE B HA   1  
ATOM 2771  H HB   . ILE B 2 42  ? 20.801  2.394   -3.183  1.00 1.82  ? 42   ILE B HB   1  
ATOM 2772  H HG12 . ILE B 2 42  ? 22.058  0.125   -1.630  1.00 1.87  ? 42   ILE B HG12 1  
ATOM 2773  H HG13 . ILE B 2 42  ? 21.437  1.564   -0.846  1.00 1.81  ? 42   ILE B HG13 1  
ATOM 2774  H HG21 . ILE B 2 42  ? 21.952  1.338   -5.061  1.00 2.21  ? 42   ILE B HG21 1  
ATOM 2775  H HG22 . ILE B 2 42  ? 20.787  0.236   -4.348  1.00 2.12  ? 42   ILE B HG22 1  
ATOM 2776  H HG23 . ILE B 2 42  ? 22.517  0.060   -3.993  1.00 2.04  ? 42   ILE B HG23 1  
ATOM 2777  H HD11 . ILE B 2 42  ? 19.937  -0.564  -2.351  1.00 1.95  ? 42   ILE B HD11 1  
ATOM 2778  H HD12 . ILE B 2 42  ? 19.205  0.976   -1.923  1.00 1.92  ? 42   ILE B HD12 1  
ATOM 2779  H HD13 . ILE B 2 42  ? 19.770  -0.117  -0.656  1.00 1.92  ? 42   ILE B HD13 1  
ATOM 2780  N N    . VAL B 2 43  ? 23.585  3.215   -0.630  1.00 1.99  ? 43   VAL B N    1  
ATOM 2781  C CA   . VAL B 2 43  ? 23.595  4.031   0.574   1.00 2.04  ? 43   VAL B CA   1  
ATOM 2782  C C    . VAL B 2 43  ? 23.853  5.541   0.329   1.00 2.11  ? 43   VAL B C    1  
ATOM 2783  O O    . VAL B 2 43  ? 23.043  6.386   0.722   1.00 2.13  ? 43   VAL B O    1  
ATOM 2784  C CB   . VAL B 2 43  ? 24.503  3.416   1.707   1.00 2.13  ? 43   VAL B CB   1  
ATOM 2785  C CG1  . VAL B 2 43  ? 25.888  3.056   1.219   1.00 2.24  ? 43   VAL B CG1  1  
ATOM 2786  C CG2  . VAL B 2 43  ? 24.610  4.346   2.892   1.00 2.24  ? 43   VAL B CG2  1  
ATOM 2787  H H    . VAL B 2 43  ? 24.096  2.377   -0.654  1.00 1.99  ? 43   VAL B H    1  
ATOM 2788  H HA   . VAL B 2 43  ? 22.578  3.973   0.925   1.00 2.00  ? 43   VAL B HA   1  
ATOM 2789  H HB   . VAL B 2 43  ? 24.031  2.506   2.046   1.00 2.07  ? 43   VAL B HB   1  
ATOM 2790  H HG11 . VAL B 2 43  ? 26.457  3.949   1.018   1.00 2.47  ? 43   VAL B HG11 1  
ATOM 2791  H HG12 . VAL B 2 43  ? 25.809  2.457   0.326   1.00 2.57  ? 43   VAL B HG12 1  
ATOM 2792  H HG13 . VAL B 2 43  ? 26.387  2.483   1.987   1.00 2.43  ? 43   VAL B HG13 1  
ATOM 2793  H HG21 . VAL B 2 43  ? 23.621  4.571   3.259   1.00 2.51  ? 43   VAL B HG21 1  
ATOM 2794  H HG22 . VAL B 2 43  ? 25.113  5.249   2.572   1.00 2.37  ? 43   VAL B HG22 1  
ATOM 2795  H HG23 . VAL B 2 43  ? 25.192  3.866   3.664   1.00 2.60  ? 43   VAL B HG23 1  
ATOM 2796  N N    . GLU B 2 44  ? 24.891  5.869   -0.390  1.00 2.18  ? 44   GLU B N    1  
ATOM 2797  C CA   . GLU B 2 44  ? 25.242  7.251   -0.591  1.00 2.27  ? 44   GLU B CA   1  
ATOM 2798  C C    . GLU B 2 44  ? 24.582  7.722   -1.869  1.00 2.24  ? 44   GLU B C    1  
ATOM 2799  O O    . GLU B 2 44  ? 24.186  8.894   -1.997  1.00 2.28  ? 44   GLU B O    1  
ATOM 2800  C CB   . GLU B 2 44  ? 26.777  7.373   -0.605  1.00 2.40  ? 44   GLU B CB   1  
ATOM 2801  C CG   . GLU B 2 44  ? 27.353  8.778   -0.596  1.00 2.54  ? 44   GLU B CG   1  
ATOM 2802  C CD   . GLU B 2 44  ? 27.306  9.473   -1.934  1.00 2.88  ? 44   GLU B CD   1  
ATOM 2803  O OE1  . GLU B 2 44  ? 27.883  8.950   -2.906  1.00 3.04  ? 44   GLU B OE1  1  
ATOM 2804  O OE2  . GLU B 2 44  ? 26.704  10.541  -2.040  1.00 3.36  ? 44   GLU B OE2  1  
ATOM 2805  H H    . GLU B 2 44  ? 25.419  5.185   -0.861  1.00 2.18  ? 44   GLU B H    1  
ATOM 2806  H HA   . GLU B 2 44  ? 24.837  7.835   0.221   1.00 2.30  ? 44   GLU B HA   1  
ATOM 2807  H HB2  . GLU B 2 44  ? 27.169  6.862   0.261   1.00 2.43  ? 44   GLU B HB2  1  
ATOM 2808  H HB3  . GLU B 2 44  ? 27.151  6.872   -1.486  1.00 2.40  ? 44   GLU B HB3  1  
ATOM 2809  H HG2  . GLU B 2 44  ? 26.795  9.364   0.118   1.00 2.65  ? 44   GLU B HG2  1  
ATOM 2810  H HG3  . GLU B 2 44  ? 28.371  8.696   -0.258  1.00 2.59  ? 44   GLU B HG3  1  
ATOM 2811  N N    . GLU B 2 45  ? 24.401  6.781   -2.785  1.00 2.18  ? 45   GLU B N    1  
ATOM 2812  C CA   . GLU B 2 45  ? 23.737  7.033   -4.028  1.00 2.16  ? 45   GLU B CA   1  
ATOM 2813  C C    . GLU B 2 45  ? 22.313  7.512   -3.754  1.00 2.11  ? 45   GLU B C    1  
ATOM 2814  O O    . GLU B 2 45  ? 22.023  8.683   -3.895  1.00 2.25  ? 45   GLU B O    1  
ATOM 2815  C CB   . GLU B 2 45  ? 23.730  5.760   -4.882  1.00 2.15  ? 45   GLU B CB   1  
ATOM 2816  C CG   . GLU B 2 45  ? 25.123  5.237   -5.187  1.00 2.38  ? 45   GLU B CG   1  
ATOM 2817  C CD   . GLU B 2 45  ? 25.122  3.931   -5.937  1.00 2.65  ? 45   GLU B CD   1  
ATOM 2818  O OE1  . GLU B 2 45  ? 25.137  3.946   -7.181  1.00 3.03  ? 45   GLU B OE1  1  
ATOM 2819  O OE2  . GLU B 2 45  ? 25.157  2.863   -5.294  1.00 3.08  ? 45   GLU B OE2  1  
ATOM 2820  H H    . GLU B 2 45  ? 24.740  5.876   -2.615  1.00 2.17  ? 45   GLU B H    1  
ATOM 2821  H HA   . GLU B 2 45  ? 24.278  7.807   -4.551  1.00 2.24  ? 45   GLU B HA   1  
ATOM 2822  H HB2  . GLU B 2 45  ? 23.185  4.989   -4.359  1.00 2.30  ? 45   GLU B HB2  1  
ATOM 2823  H HB3  . GLU B 2 45  ? 23.235  5.969   -5.819  1.00 2.35  ? 45   GLU B HB3  1  
ATOM 2824  H HG2  . GLU B 2 45  ? 25.646  5.970   -5.784  1.00 2.66  ? 45   GLU B HG2  1  
ATOM 2825  H HG3  . GLU B 2 45  ? 25.648  5.100   -4.254  1.00 2.86  ? 45   GLU B HG3  1  
ATOM 2826  N N    . CYS B 2 46  ? 21.497  6.648   -3.216  1.00 1.99  ? 46   CYS B N    1  
ATOM 2827  C CA   . CYS B 2 46  ? 20.080  6.936   -2.995  1.00 1.96  ? 46   CYS B CA   1  
ATOM 2828  C C    . CYS B 2 46  ? 19.843  7.838   -1.796  1.00 2.04  ? 46   CYS B C    1  
ATOM 2829  O O    . CYS B 2 46  ? 18.706  8.129   -1.442  1.00 2.10  ? 46   CYS B O    1  
ATOM 2830  C CB   . CYS B 2 46  ? 19.292  5.642   -2.885  1.00 1.87  ? 46   CYS B CB   1  
ATOM 2831  S SG   . CYS B 2 46  ? 19.451  4.607   -4.370  1.00 2.23  ? 46   CYS B SG   1  
ATOM 2832  H H    . CYS B 2 46  ? 21.836  5.770   -2.924  1.00 1.97  ? 46   CYS B H    1  
ATOM 2833  H HA   . CYS B 2 46  ? 19.723  7.472   -3.865  1.00 1.98  ? 46   CYS B HA   1  
ATOM 2834  H HB2  . CYS B 2 46  ? 19.655  5.075   -2.040  1.00 2.07  ? 46   CYS B HB2  1  
ATOM 2835  H HB3  . CYS B 2 46  ? 18.244  5.865   -2.749  1.00 2.01  ? 46   CYS B HB3  1  
ATOM 2836  N N    . CYS B 2 47  ? 20.904  8.250   -1.150  1.00 2.09  ? 47   CYS B N    1  
ATOM 2837  C CA   . CYS B 2 47  ? 20.767  9.249   -0.135  1.00 2.19  ? 47   CYS B CA   1  
ATOM 2838  C C    . CYS B 2 47  ? 20.732  10.630  -0.793  1.00 2.27  ? 47   CYS B C    1  
ATOM 2839  O O    . CYS B 2 47  ? 19.800  11.412  -0.574  1.00 2.37  ? 47   CYS B O    1  
ATOM 2840  C CB   . CYS B 2 47  ? 21.896  9.169   0.893   1.00 2.25  ? 47   CYS B CB   1  
ATOM 2841  S SG   . CYS B 2 47  ? 21.849  10.459  2.192   1.00 2.37  ? 47   CYS B SG   1  
ATOM 2842  H H    . CYS B 2 47  ? 21.774  7.856   -1.364  1.00 2.10  ? 47   CYS B H    1  
ATOM 2843  H HA   . CYS B 2 47  ? 19.820  9.082   0.358   1.00 2.17  ? 47   CYS B HA   1  
ATOM 2844  H HB2  . CYS B 2 47  ? 21.855  8.209   1.388   1.00 2.29  ? 47   CYS B HB2  1  
ATOM 2845  H HB3  . CYS B 2 47  ? 22.841  9.255   0.376   1.00 2.48  ? 47   CYS B HB3  1  
ATOM 2846  N N    . PHE B 2 48  ? 21.696  10.903  -1.660  1.00 2.29  ? 48   PHE B N    1  
ATOM 2847  C CA   . PHE B 2 48  ? 21.830  12.233  -2.227  1.00 2.39  ? 48   PHE B CA   1  
ATOM 2848  C C    . PHE B 2 48  ? 21.310  12.364  -3.663  1.00 2.37  ? 48   PHE B C    1  
ATOM 2849  O O    . PHE B 2 48  ? 21.007  13.474  -4.117  1.00 2.47  ? 48   PHE B O    1  
ATOM 2850  C CB   . PHE B 2 48  ? 23.272  12.718  -2.104  1.00 2.48  ? 48   PHE B CB   1  
ATOM 2851  C CG   . PHE B 2 48  ? 23.711  12.907  -0.679  1.00 2.56  ? 48   PHE B CG   1  
ATOM 2852  C CD1  . PHE B 2 48  ? 23.281  13.998  0.049   1.00 2.71  ? 48   PHE B CD1  1  
ATOM 2853  C CD2  . PHE B 2 48  ? 24.548  11.994  -0.069  1.00 2.54  ? 48   PHE B CD2  1  
ATOM 2854  C CE1  . PHE B 2 48  ? 23.678  14.179  1.358   1.00 2.82  ? 48   PHE B CE1  1  
ATOM 2855  C CE2  . PHE B 2 48  ? 24.950  12.169  1.238   1.00 2.64  ? 48   PHE B CE2  1  
ATOM 2856  C CZ   . PHE B 2 48  ? 24.514  13.262  1.951   1.00 2.78  ? 48   PHE B CZ   1  
ATOM 2857  H H    . PHE B 2 48  ? 22.327  10.203  -1.931  1.00 2.26  ? 48   PHE B H    1  
ATOM 2858  H HA   . PHE B 2 48  ? 21.222  12.880  -1.611  1.00 2.44  ? 48   PHE B HA   1  
ATOM 2859  H HB2  . PHE B 2 48  ? 23.933  11.982  -2.540  1.00 2.44  ? 48   PHE B HB2  1  
ATOM 2860  H HB3  . PHE B 2 48  ? 23.389  13.660  -2.620  1.00 2.57  ? 48   PHE B HB3  1  
ATOM 2861  H HD1  . PHE B 2 48  ? 22.623  14.718  -0.418  1.00 2.77  ? 48   PHE B HD1  1  
ATOM 2862  H HD2  . PHE B 2 48  ? 24.891  11.139  -0.631  1.00 2.47  ? 48   PHE B HD2  1  
ATOM 2863  H HE1  . PHE B 2 48  ? 23.334  15.038  1.914   1.00 2.97  ? 48   PHE B HE1  1  
ATOM 2864  H HE2  . PHE B 2 48  ? 25.603  11.449  1.706   1.00 2.64  ? 48   PHE B HE2  1  
ATOM 2865  H HZ   . PHE B 2 48  ? 24.828  13.401  2.976   1.00 2.88  ? 48   PHE B HZ   1  
ATOM 2866  N N    . ARG B 2 49  ? 21.200  11.273  -4.375  1.00 2.29  ? 49   ARG B N    1  
ATOM 2867  C CA   . ARG B 2 49  ? 20.696  11.322  -5.739  1.00 2.28  ? 49   ARG B CA   1  
ATOM 2868  C C    . ARG B 2 49  ? 19.354  10.607  -5.774  1.00 2.15  ? 49   ARG B C    1  
ATOM 2869  O O    . ARG B 2 49  ? 18.995  9.903   -4.825  1.00 2.17  ? 49   ARG B O    1  
ATOM 2870  C CB   . ARG B 2 49  ? 21.695  10.665  -6.725  1.00 2.32  ? 49   ARG B CB   1  
ATOM 2871  C CG   . ARG B 2 49  ? 21.689  9.146   -6.739  1.00 2.59  ? 49   ARG B CG   1  
ATOM 2872  C CD   . ARG B 2 49  ? 22.831  8.582   -7.549  1.00 2.43  ? 49   ARG B CD   1  
ATOM 2873  N NE   . ARG B 2 49  ? 24.153  8.958   -7.006  1.00 2.85  ? 49   ARG B NE   1  
ATOM 2874  C CZ   . ARG B 2 49  ? 25.322  8.621   -7.570  1.00 3.35  ? 49   ARG B CZ   1  
ATOM 2875  N NH1  . ARG B 2 49  ? 25.349  7.794   -8.607  1.00 3.64  ? 49   ARG B NH1  1  
ATOM 2876  N NH2  . ARG B 2 49  ? 26.457  9.074   -7.069  1.00 4.09  ? 49   ARG B NH2  1  
ATOM 2877  H H    . ARG B 2 49  ? 21.426  10.395  -3.994  1.00 2.26  ? 49   ARG B H    1  
ATOM 2878  H HA   . ARG B 2 49  ? 20.548  12.358  -6.002  1.00 2.37  ? 49   ARG B HA   1  
ATOM 2879  H HB2  . ARG B 2 49  ? 21.483  11.007  -7.726  1.00 2.30  ? 49   ARG B HB2  1  
ATOM 2880  H HB3  . ARG B 2 49  ? 22.689  10.985  -6.448  1.00 2.41  ? 49   ARG B HB3  1  
ATOM 2881  H HG2  . ARG B 2 49  ? 21.776  8.786   -5.724  1.00 3.15  ? 49   ARG B HG2  1  
ATOM 2882  H HG3  . ARG B 2 49  ? 20.755  8.805   -7.160  1.00 2.91  ? 49   ARG B HG3  1  
ATOM 2883  H HD2  . ARG B 2 49  ? 22.750  7.507   -7.560  1.00 2.60  ? 49   ARG B HD2  1  
ATOM 2884  H HD3  . ARG B 2 49  ? 22.750  8.958   -8.559  1.00 2.67  ? 49   ARG B HD3  1  
ATOM 2885  H HE   . ARG B 2 49  ? 24.147  9.517   -6.190  1.00 3.20  ? 49   ARG B HE   1  
ATOM 2886  H HH11 . ARG B 2 49  ? 24.512  7.392   -8.990  1.00 3.51  ? 49   ARG B HH11 1  
ATOM 2887  H HH12 . ARG B 2 49  ? 26.202  7.529   -9.078  1.00 4.32  ? 49   ARG B HH12 1  
ATOM 2888  H HH21 . ARG B 2 49  ? 26.520  9.663   -6.257  1.00 4.36  ? 49   ARG B HH21 1  
ATOM 2889  H HH22 . ARG B 2 49  ? 27.349  8.876   -7.496  1.00 4.65  ? 49   ARG B HH22 1  
ATOM 2890  N N    . SER B 2 50  ? 18.630  10.798  -6.833  1.00 2.09  ? 50   SER B N    1  
ATOM 2891  C CA   . SER B 2 50  ? 17.351  10.194  -7.008  1.00 2.02  ? 50   SER B CA   1  
ATOM 2892  C C    . SER B 2 50  ? 17.557  8.801   -7.617  1.00 1.87  ? 50   SER B C    1  
ATOM 2893  O O    . SER B 2 50  ? 18.408  8.624   -8.508  1.00 1.92  ? 50   SER B O    1  
ATOM 2894  C CB   . SER B 2 50  ? 16.513  11.097  -7.925  1.00 2.16  ? 50   SER B CB   1  
ATOM 2895  O OG   . SER B 2 50  ? 15.178  10.643  -8.065  1.00 2.67  ? 50   SER B OG   1  
ATOM 2896  H H    . SER B 2 50  ? 18.971  11.357  -7.571  1.00 2.12  ? 50   SER B H    1  
ATOM 2897  H HA   . SER B 2 50  ? 16.868  10.108  -6.047  1.00 2.02  ? 50   SER B HA   1  
ATOM 2898  H HB2  . SER B 2 50  ? 16.492  12.095  -7.513  1.00 2.49  ? 50   SER B HB2  1  
ATOM 2899  H HB3  . SER B 2 50  ? 16.974  11.129  -8.902  1.00 2.20  ? 50   SER B HB3  1  
ATOM 2900  H HG   . SER B 2 50  ? 14.948  10.166  -7.246  1.00 2.86  ? 50   SER B HG   1  
ATOM 2901  N N    . CYS B 2 51  ? 16.800  7.834   -7.158  1.00 1.76  ? 51   CYS B N    1  
ATOM 2902  C CA   . CYS B 2 51  ? 16.969  6.474   -7.580  1.00 1.65  ? 51   CYS B CA   1  
ATOM 2903  C C    . CYS B 2 51  ? 15.698  5.899   -8.139  1.00 1.53  ? 51   CYS B C    1  
ATOM 2904  O O    . CYS B 2 51  ? 14.597  6.430   -7.929  1.00 1.59  ? 51   CYS B O    1  
ATOM 2905  C CB   . CYS B 2 51  ? 17.453  5.606   -6.418  1.00 1.66  ? 51   CYS B CB   1  
ATOM 2906  S SG   . CYS B 2 51  ? 19.166  5.933   -5.882  1.00 2.11  ? 51   CYS B SG   1  
ATOM 2907  H H    . CYS B 2 51  ? 16.069  8.015   -6.530  1.00 1.79  ? 51   CYS B H    1  
ATOM 2908  H HA   . CYS B 2 51  ? 17.732  6.454   -8.344  1.00 1.70  ? 51   CYS B HA   1  
ATOM 2909  H HB2  . CYS B 2 51  ? 16.812  5.779   -5.566  1.00 1.78  ? 51   CYS B HB2  1  
ATOM 2910  H HB3  . CYS B 2 51  ? 17.381  4.568   -6.705  1.00 1.92  ? 51   CYS B HB3  1  
ATOM 2911  N N    . ASP B 2 52  ? 15.872  4.861   -8.893  1.00 1.44  ? 52   ASP B N    1  
ATOM 2912  C CA   . ASP B 2 52  ? 14.801  4.089   -9.467  1.00 1.35  ? 52   ASP B CA   1  
ATOM 2913  C C    . ASP B 2 52  ? 14.729  2.785   -8.700  1.00 1.17  ? 52   ASP B C    1  
ATOM 2914  O O    . ASP B 2 52  ? 15.750  2.277   -8.206  1.00 1.27  ? 52   ASP B O    1  
ATOM 2915  C CB   . ASP B 2 52  ? 15.135  3.772   -10.929 1.00 1.55  ? 52   ASP B CB   1  
ATOM 2916  C CG   . ASP B 2 52  ? 13.993  3.124   -11.699 1.00 1.89  ? 52   ASP B CG   1  
ATOM 2917  O OD1  . ASP B 2 52  ? 13.689  1.926   -11.501 1.00 2.67  ? 52   ASP B OD1  1  
ATOM 2918  O OD2  . ASP B 2 52  ? 13.398  3.811   -12.540 1.00 2.16  ? 52   ASP B OD2  1  
ATOM 2919  H H    . ASP B 2 52  ? 16.795  4.587   -9.093  1.00 1.49  ? 52   ASP B H    1  
ATOM 2920  H HA   . ASP B 2 52  ? 13.885  4.656   -9.408  1.00 1.38  ? 52   ASP B HA   1  
ATOM 2921  H HB2  . ASP B 2 52  ? 15.396  4.689   -11.435 1.00 1.93  ? 52   ASP B HB2  1  
ATOM 2922  H HB3  . ASP B 2 52  ? 15.985  3.105   -10.952 1.00 2.04  ? 52   ASP B HB3  1  
ATOM 2923  N N    . LEU B 2 53  ? 13.520  2.259   -8.612  1.00 0.99  ? 53   LEU B N    1  
ATOM 2924  C CA   . LEU B 2 53  ? 13.199  1.002   -7.926  1.00 0.92  ? 53   LEU B CA   1  
ATOM 2925  C C    . LEU B 2 53  ? 14.012  -0.167  -8.465  1.00 1.02  ? 53   LEU B C    1  
ATOM 2926  O O    . LEU B 2 53  ? 14.304  -1.102  -7.723  1.00 1.10  ? 53   LEU B O    1  
ATOM 2927  C CB   . LEU B 2 53  ? 11.687  0.710   -8.058  1.00 1.01  ? 53   LEU B CB   1  
ATOM 2928  C CG   . LEU B 2 53  ? 11.153  -0.640  -7.564  1.00 1.33  ? 53   LEU B CG   1  
ATOM 2929  C CD1  . LEU B 2 53  ? 11.384  -0.829  -6.079  1.00 1.72  ? 53   LEU B CD1  1  
ATOM 2930  C CD2  . LEU B 2 53  ? 9.680   -0.753  -7.883  1.00 1.90  ? 53   LEU B CD2  1  
ATOM 2931  H H    . LEU B 2 53  ? 12.800  2.770   -9.049  1.00 1.00  ? 53   LEU B H    1  
ATOM 2932  H HA   . LEU B 2 53  ? 13.426  1.129   -6.878  1.00 0.96  ? 53   LEU B HA   1  
ATOM 2933  H HB2  . LEU B 2 53  ? 11.148  1.452   -7.485  1.00 1.38  ? 53   LEU B HB2  1  
ATOM 2934  H HB3  . LEU B 2 53  ? 11.415  0.815   -9.099  1.00 1.54  ? 53   LEU B HB3  1  
ATOM 2935  H HG   . LEU B 2 53  ? 11.666  -1.435  -8.086  1.00 1.81  ? 53   LEU B HG   1  
ATOM 2936  H HD11 . LEU B 2 53  ? 10.863  -0.064  -5.525  1.00 2.24  ? 53   LEU B HD11 1  
ATOM 2937  H HD12 . LEU B 2 53  ? 12.443  -0.769  -5.876  1.00 2.15  ? 53   LEU B HD12 1  
ATOM 2938  H HD13 . LEU B 2 53  ? 11.019  -1.801  -5.782  1.00 2.04  ? 53   LEU B HD13 1  
ATOM 2939  H HD21 . LEU B 2 53  ? 9.533   -0.686  -8.950  1.00 2.34  ? 53   LEU B HD21 1  
ATOM 2940  H HD22 . LEU B 2 53  ? 9.144   0.049   -7.397  1.00 2.36  ? 53   LEU B HD22 1  
ATOM 2941  H HD23 . LEU B 2 53  ? 9.306   -1.702  -7.529  1.00 2.26  ? 53   LEU B HD23 1  
ATOM 2942  N N    . ALA B 2 54  ? 14.410  -0.091  -9.733  1.00 1.12  ? 54   ALA B N    1  
ATOM 2943  C CA   . ALA B 2 54  ? 15.161  -1.157  -10.375 1.00 1.30  ? 54   ALA B CA   1  
ATOM 2944  C C    . ALA B 2 54  ? 16.449  -1.436  -9.626  1.00 1.38  ? 54   ALA B C    1  
ATOM 2945  O O    . ALA B 2 54  ? 16.727  -2.580  -9.285  1.00 1.52  ? 54   ALA B O    1  
ATOM 2946  C CB   . ALA B 2 54  ? 15.459  -0.807  -11.820 1.00 1.47  ? 54   ALA B CB   1  
ATOM 2947  H H    . ALA B 2 54  ? 14.196  0.721   -10.253 1.00 1.11  ? 54   ALA B H    1  
ATOM 2948  H HA   . ALA B 2 54  ? 14.549  -2.046  -10.359 1.00 1.33  ? 54   ALA B HA   1  
ATOM 2949  H HB1  . ALA B 2 54  ? 14.532  -0.606  -12.334 1.00 1.92  ? 54   ALA B HB1  1  
ATOM 2950  H HB2  . ALA B 2 54  ? 15.967  -1.636  -12.291 1.00 1.78  ? 54   ALA B HB2  1  
ATOM 2951  H HB3  . ALA B 2 54  ? 16.089  0.070   -11.849 1.00 1.73  ? 54   ALA B HB3  1  
ATOM 2952  N N    . LEU B 2 55  ? 17.177  -0.367  -9.311  1.00 1.36  ? 55   LEU B N    1  
ATOM 2953  C CA   . LEU B 2 55  ? 18.465  -0.433  -8.621  1.00 1.47  ? 55   LEU B CA   1  
ATOM 2954  C C    . LEU B 2 55  ? 18.357  -1.209  -7.331  1.00 1.43  ? 55   LEU B C    1  
ATOM 2955  O O    . LEU B 2 55  ? 19.113  -2.154  -7.105  1.00 1.52  ? 55   LEU B O    1  
ATOM 2956  C CB   . LEU B 2 55  ? 18.966  0.983   -8.313  1.00 1.53  ? 55   LEU B CB   1  
ATOM 2957  C CG   . LEU B 2 55  ? 20.267  1.108   -7.494  1.00 1.68  ? 55   LEU B CG   1  
ATOM 2958  C CD1  . LEU B 2 55  ? 21.476  0.561   -8.242  1.00 1.97  ? 55   LEU B CD1  1  
ATOM 2959  C CD2  . LEU B 2 55  ? 20.494  2.553   -7.082  1.00 1.78  ? 55   LEU B CD2  1  
ATOM 2960  H H    . LEU B 2 55  ? 16.816  0.513   -9.549  1.00 1.32  ? 55   LEU B H    1  
ATOM 2961  H HA   . LEU B 2 55  ? 19.179  -0.912  -9.275  1.00 1.57  ? 55   LEU B HA   1  
ATOM 2962  H HB2  . LEU B 2 55  ? 19.114  1.480   -9.260  1.00 1.68  ? 55   LEU B HB2  1  
ATOM 2963  H HB3  . LEU B 2 55  ? 18.184  1.490   -7.766  1.00 1.51  ? 55   LEU B HB3  1  
ATOM 2964  H HG   . LEU B 2 55  ? 20.153  0.523   -6.593  1.00 1.82  ? 55   LEU B HG   1  
ATOM 2965  H HD11 . LEU B 2 55  ? 21.629  1.115   -9.156  1.00 2.35  ? 55   LEU B HD11 1  
ATOM 2966  H HD12 . LEU B 2 55  ? 21.323  -0.482  -8.472  1.00 2.27  ? 55   LEU B HD12 1  
ATOM 2967  H HD13 . LEU B 2 55  ? 22.354  0.654   -7.618  1.00 2.29  ? 55   LEU B HD13 1  
ATOM 2968  H HD21 . LEU B 2 55  ? 21.399  2.634   -6.496  1.00 2.06  ? 55   LEU B HD21 1  
ATOM 2969  H HD22 . LEU B 2 55  ? 19.657  2.892   -6.487  1.00 2.14  ? 55   LEU B HD22 1  
ATOM 2970  H HD23 . LEU B 2 55  ? 20.577  3.180   -7.958  1.00 2.10  ? 55   LEU B HD23 1  
ATOM 2971  N N    . LEU B 2 56  ? 17.389  -0.844  -6.515  1.00 1.33  ? 56   LEU B N    1  
ATOM 2972  C CA   . LEU B 2 56  ? 17.249  -1.422  -5.224  1.00 1.34  ? 56   LEU B CA   1  
ATOM 2973  C C    . LEU B 2 56  ? 16.703  -2.831  -5.302  1.00 1.32  ? 56   LEU B C    1  
ATOM 2974  O O    . LEU B 2 56  ? 17.129  -3.702  -4.549  1.00 1.41  ? 56   LEU B O    1  
ATOM 2975  C CB   . LEU B 2 56  ? 16.421  -0.493  -4.320  1.00 1.27  ? 56   LEU B CB   1  
ATOM 2976  C CG   . LEU B 2 56  ? 14.926  -0.313  -4.634  1.00 1.16  ? 56   LEU B CG   1  
ATOM 2977  C CD1  . LEU B 2 56  ? 14.071  -1.292  -3.832  1.00 0.91  ? 56   LEU B CD1  1  
ATOM 2978  C CD2  . LEU B 2 56  ? 14.486  1.131   -4.410  1.00 1.53  ? 56   LEU B CD2  1  
ATOM 2979  H H    . LEU B 2 56  ? 16.739  -0.159  -6.770  1.00 1.27  ? 56   LEU B H    1  
ATOM 2980  H HA   . LEU B 2 56  ? 18.241  -1.498  -4.814  1.00 1.46  ? 56   LEU B HA   1  
ATOM 2981  H HB2  . LEU B 2 56  ? 16.503  -0.876  -3.320  1.00 1.31  ? 56   LEU B HB2  1  
ATOM 2982  H HB3  . LEU B 2 56  ? 16.889  0.477   -4.349  1.00 1.34  ? 56   LEU B HB3  1  
ATOM 2983  H HG   . LEU B 2 56  ? 14.778  -0.553  -5.677  1.00 1.23  ? 56   LEU B HG   1  
ATOM 2984  H HD11 . LEU B 2 56  ? 14.219  -1.122  -2.776  1.00 1.35  ? 56   LEU B HD11 1  
ATOM 2985  H HD12 . LEU B 2 56  ? 14.357  -2.304  -4.077  1.00 1.35  ? 56   LEU B HD12 1  
ATOM 2986  H HD13 . LEU B 2 56  ? 13.029  -1.147  -4.077  1.00 1.31  ? 56   LEU B HD13 1  
ATOM 2987  H HD21 . LEU B 2 56  ? 15.056  1.770   -5.069  1.00 1.81  ? 56   LEU B HD21 1  
ATOM 2988  H HD22 . LEU B 2 56  ? 14.663  1.416   -3.383  1.00 2.01  ? 56   LEU B HD22 1  
ATOM 2989  H HD23 . LEU B 2 56  ? 13.434  1.238   -4.639  1.00 1.92  ? 56   LEU B HD23 1  
ATOM 2990  N N    . GLU B 2 57  ? 15.810  -3.057  -6.243  1.00 1.25  ? 57   GLU B N    1  
ATOM 2991  C CA   . GLU B 2 57  ? 15.194  -4.347  -6.412  1.00 1.30  ? 57   GLU B CA   1  
ATOM 2992  C C    . GLU B 2 57  ? 16.205  -5.388  -6.915  1.00 1.44  ? 57   GLU B C    1  
ATOM 2993  O O    . GLU B 2 57  ? 16.302  -6.490  -6.360  1.00 1.53  ? 57   GLU B O    1  
ATOM 2994  C CB   . GLU B 2 57  ? 14.021  -4.253  -7.369  1.00 1.32  ? 57   GLU B CB   1  
ATOM 2995  C CG   . GLU B 2 57  ? 13.224  -5.528  -7.491  1.00 1.50  ? 57   GLU B CG   1  
ATOM 2996  C CD   . GLU B 2 57  ? 12.178  -5.428  -8.545  1.00 1.67  ? 57   GLU B CD   1  
ATOM 2997  O OE1  . GLU B 2 57  ? 11.157  -4.772  -8.326  1.00 1.83  ? 57   GLU B OE1  1  
ATOM 2998  O OE2  . GLU B 2 57  ? 12.353  -6.015  -9.624  1.00 2.27  ? 57   GLU B OE2  1  
ATOM 2999  H H    . GLU B 2 57  ? 15.527  -2.317  -6.826  1.00 1.19  ? 57   GLU B H    1  
ATOM 3000  H HA   . GLU B 2 57  ? 14.826  -4.630  -5.439  1.00 1.30  ? 57   GLU B HA   1  
ATOM 3001  H HB2  . GLU B 2 57  ? 13.357  -3.471  -7.032  1.00 1.32  ? 57   GLU B HB2  1  
ATOM 3002  H HB3  . GLU B 2 57  ? 14.395  -3.993  -8.349  1.00 1.49  ? 57   GLU B HB3  1  
ATOM 3003  H HG2  . GLU B 2 57  ? 13.894  -6.338  -7.741  1.00 1.91  ? 57   GLU B HG2  1  
ATOM 3004  H HG3  . GLU B 2 57  ? 12.748  -5.733  -6.544  1.00 1.97  ? 57   GLU B HG3  1  
ATOM 3005  N N    . THR B 2 58  ? 16.961  -5.051  -7.956  1.00 1.51  ? 58   THR B N    1  
ATOM 3006  C CA   . THR B 2 58  ? 17.936  -5.981  -8.477  1.00 1.69  ? 58   THR B CA   1  
ATOM 3007  C C    . THR B 2 58  ? 19.159  -6.095  -7.559  1.00 1.77  ? 58   THR B C    1  
ATOM 3008  O O    . THR B 2 58  ? 19.958  -7.041  -7.700  1.00 1.92  ? 58   THR B O    1  
ATOM 3009  C CB   . THR B 2 58  ? 18.360  -5.700  -9.960  1.00 1.80  ? 58   THR B CB   1  
ATOM 3010  O OG1  . THR B 2 58  ? 19.293  -6.705  -10.409 1.00 2.33  ? 58   THR B OG1  1  
ATOM 3011  C CG2  . THR B 2 58  ? 19.014  -4.355  -10.099 1.00 1.73  ? 58   THR B CG2  1  
ATOM 3012  H H    . THR B 2 58  ? 16.830  -4.178  -8.396  1.00 1.46  ? 58   THR B H    1  
ATOM 3013  H HA   . THR B 2 58  ? 17.452  -6.946  -8.444  1.00 1.76  ? 58   THR B HA   1  
ATOM 3014  H HB   . THR B 2 58  ? 17.482  -5.739  -10.589 1.00 2.02  ? 58   THR B HB   1  
ATOM 3015  H HG1  . THR B 2 58  ? 19.727  -7.054  -9.618  1.00 2.67  ? 58   THR B HG1  1  
ATOM 3016  H HG21 . THR B 2 58  ? 19.293  -4.196  -11.130 1.00 2.01  ? 58   THR B HG21 1  
ATOM 3017  H HG22 . THR B 2 58  ? 19.892  -4.333  -9.470  1.00 2.05  ? 58   THR B HG22 1  
ATOM 3018  H HG23 . THR B 2 58  ? 18.317  -3.592  -9.785  1.00 2.06  ? 58   THR B HG23 1  
ATOM 3019  N N    . TYR B 2 59  ? 19.320  -5.154  -6.634  1.00 1.73  ? 59   TYR B N    1  
ATOM 3020  C CA   . TYR B 2 59  ? 20.365  -5.249  -5.662  1.00 1.88  ? 59   TYR B CA   1  
ATOM 3021  C C    . TYR B 2 59  ? 19.855  -6.203  -4.599  1.00 1.95  ? 59   TYR B C    1  
ATOM 3022  O O    . TYR B 2 59  ? 20.202  -7.394  -4.615  1.00 2.30  ? 59   TYR B O    1  
ATOM 3023  C CB   . TYR B 2 59  ? 20.649  -3.875  -5.052  1.00 1.88  ? 59   TYR B CB   1  
ATOM 3024  C CG   . TYR B 2 59  ? 22.026  -3.740  -4.471  1.00 2.06  ? 59   TYR B CG   1  
ATOM 3025  C CD1  . TYR B 2 59  ? 22.338  -4.219  -3.207  1.00 2.32  ? 59   TYR B CD1  1  
ATOM 3026  C CD2  . TYR B 2 59  ? 23.025  -3.133  -5.208  1.00 2.08  ? 59   TYR B CD2  1  
ATOM 3027  C CE1  . TYR B 2 59  ? 23.614  -4.090  -2.700  1.00 2.57  ? 59   TYR B CE1  1  
ATOM 3028  C CE2  . TYR B 2 59  ? 24.292  -2.999  -4.717  1.00 2.32  ? 59   TYR B CE2  1  
ATOM 3029  C CZ   . TYR B 2 59  ? 24.590  -3.479  -3.459  1.00 2.56  ? 59   TYR B CZ   1  
ATOM 3030  O OH   . TYR B 2 59  ? 25.868  -3.341  -2.960  1.00 2.86  ? 59   TYR B OH   1  
ATOM 3031  H H    . TYR B 2 59  ? 18.744  -4.363  -6.598  1.00 1.65  ? 59   TYR B H    1  
ATOM 3032  H HA   . TYR B 2 59  ? 21.253  -5.648  -6.129  1.00 1.98  ? 59   TYR B HA   1  
ATOM 3033  H HB2  . TYR B 2 59  ? 20.532  -3.120  -5.815  1.00 1.82  ? 59   TYR B HB2  1  
ATOM 3034  H HB3  . TYR B 2 59  ? 19.933  -3.691  -4.263  1.00 1.93  ? 59   TYR B HB3  1  
ATOM 3035  H HD1  . TYR B 2 59  ? 21.569  -4.697  -2.619  1.00 2.39  ? 59   TYR B HD1  1  
ATOM 3036  H HD2  . TYR B 2 59  ? 22.792  -2.757  -6.193  1.00 2.00  ? 59   TYR B HD2  1  
ATOM 3037  H HE1  . TYR B 2 59  ? 23.835  -4.471  -1.715  1.00 2.84  ? 59   TYR B HE1  1  
ATOM 3038  H HE2  . TYR B 2 59  ? 25.034  -2.516  -5.332  1.00 2.39  ? 59   TYR B HE2  1  
ATOM 3039  H HH   . TYR B 2 59  ? 26.141  -4.153  -2.519  1.00 3.20  ? 59   TYR B HH   1  
ATOM 3040  N N    . CYS B 2 60  ? 18.957  -5.691  -3.759  1.00 1.73  ? 60   CYS B N    1  
ATOM 3041  C CA   . CYS B 2 60  ? 18.267  -6.439  -2.705  1.00 1.77  ? 60   CYS B CA   1  
ATOM 3042  C C    . CYS B 2 60  ? 19.252  -7.084  -1.686  1.00 1.79  ? 60   CYS B C    1  
ATOM 3043  O O    . CYS B 2 60  ? 19.496  -6.547  -0.583  1.00 2.30  ? 60   CYS B O    1  
ATOM 3044  C CB   . CYS B 2 60  ? 17.331  -7.483  -3.355  1.00 1.99  ? 60   CYS B CB   1  
ATOM 3045  S SG   . CYS B 2 60  ? 16.255  -8.372  -2.219  1.00 2.21  ? 60   CYS B SG   1  
ATOM 3046  H H    . CYS B 2 60  ? 18.709  -4.746  -3.865  1.00 1.62  ? 60   CYS B H    1  
ATOM 3047  H HA   . CYS B 2 60  ? 17.658  -5.728  -2.165  1.00 1.97  ? 60   CYS B HA   1  
ATOM 3048  H HB2  . CYS B 2 60  ? 16.683  -7.003  -4.074  1.00 2.21  ? 60   CYS B HB2  1  
ATOM 3049  H HB3  . CYS B 2 60  ? 17.937  -8.214  -3.870  1.00 2.05  ? 60   CYS B HB3  1  
ATOM 3050  N N    . ALA B 2 61  ? 19.845  -8.175  -2.079  1.00 1.81  ? 61   ALA B N    1  
ATOM 3051  C CA   . ALA B 2 61  ? 20.783  -8.888  -1.285  1.00 2.03  ? 61   ALA B CA   1  
ATOM 3052  C C    . ALA B 2 61  ? 21.901  -9.345  -2.202  1.00 2.45  ? 61   ALA B C    1  
ATOM 3053  O O    . ALA B 2 61  ? 22.953  -8.738  -2.243  1.00 3.19  ? 61   ALA B O    1  
ATOM 3054  C CB   . ALA B 2 61  ? 20.109  -10.056 -0.580  1.00 1.94  ? 61   ALA B CB   1  
ATOM 3055  H H    . ALA B 2 61  ? 19.679  -8.492  -2.991  1.00 2.06  ? 61   ALA B H    1  
ATOM 3056  H HA   . ALA B 2 61  ? 21.188  -8.207  -0.550  1.00 2.22  ? 61   ALA B HA   1  
ATOM 3057  H HB1  . ALA B 2 61  ? 19.369  -9.668  0.103   1.00 2.12  ? 61   ALA B HB1  1  
ATOM 3058  H HB2  . ALA B 2 61  ? 20.842  -10.627 -0.029  1.00 2.13  ? 61   ALA B HB2  1  
ATOM 3059  H HB3  . ALA B 2 61  ? 19.620  -10.696 -1.299  1.00 2.27  ? 61   ALA B HB3  1  
ATOM 3060  N N    . THR B 2 62  ? 21.639  -10.360 -2.982  1.00 2.33  ? 62   THR B N    1  
ATOM 3061  C CA   . THR B 2 62  ? 22.571  -10.839 -3.962  1.00 2.79  ? 62   THR B CA   1  
ATOM 3062  C C    . THR B 2 62  ? 21.827  -11.131 -5.276  1.00 3.01  ? 62   THR B C    1  
ATOM 3063  O O    . THR B 2 62  ? 20.789  -11.789 -5.273  1.00 3.05  ? 62   THR B O    1  
ATOM 3064  C CB   . THR B 2 62  ? 23.387  -12.044 -3.435  1.00 3.14  ? 62   THR B CB   1  
ATOM 3065  O OG1  . THR B 2 62  ? 22.603  -12.807 -2.489  1.00 3.39  ? 62   THR B OG1  1  
ATOM 3066  C CG2  . THR B 2 62  ? 24.682  -11.588 -2.769  1.00 3.68  ? 62   THR B CG2  1  
ATOM 3067  H H    . THR B 2 62  ? 20.781  -10.834 -2.919  1.00 2.17  ? 62   THR B H    1  
ATOM 3068  H HA   . THR B 2 62  ? 23.243  -10.016 -4.166  1.00 3.27  ? 62   THR B HA   1  
ATOM 3069  H HB   . THR B 2 62  ? 23.629  -12.655 -4.293  1.00 3.37  ? 62   THR B HB   1  
ATOM 3070  H HG1  . THR B 2 62  ? 21.668  -12.571 -2.587  1.00 3.74  ? 62   THR B HG1  1  
ATOM 3071  H HG21 . THR B 2 62  ? 25.224  -12.450 -2.411  1.00 4.14  ? 62   THR B HG21 1  
ATOM 3072  H HG22 . THR B 2 62  ? 24.447  -10.941 -1.936  1.00 3.96  ? 62   THR B HG22 1  
ATOM 3073  H HG23 . THR B 2 62  ? 25.291  -11.049 -3.479  1.00 3.81  ? 62   THR B HG23 1  
ATOM 3074  N N    . PRO B 2 63  ? 22.353  -10.645 -6.405  1.00 3.66  ? 63   PRO B N    1  
ATOM 3075  C CA   . PRO B 2 63  ? 21.632  -10.607 -7.691  1.00 4.31  ? 63   PRO B CA   1  
ATOM 3076  C C    . PRO B 2 63  ? 21.265  -11.947 -8.320  1.00 4.40  ? 63   PRO B C    1  
ATOM 3077  O O    . PRO B 2 63  ? 20.308  -12.025 -9.100  1.00 5.06  ? 63   PRO B O    1  
ATOM 3078  C CB   . PRO B 2 63  ? 22.556  -9.821  -8.607  1.00 5.08  ? 63   PRO B CB   1  
ATOM 3079  C CG   . PRO B 2 63  ? 23.906  -9.908  -7.996  1.00 4.98  ? 63   PRO B CG   1  
ATOM 3080  C CD   . PRO B 2 63  ? 23.717  -10.111 -6.527  1.00 4.19  ? 63   PRO B CD   1  
ATOM 3081  H HA   . PRO B 2 63  ? 20.720  -10.045 -7.581  1.00 4.51  ? 63   PRO B HA   1  
ATOM 3082  H HB2  . PRO B 2 63  ? 22.540  -10.233 -9.604  1.00 5.47  ? 63   PRO B HB2  1  
ATOM 3083  H HB3  . PRO B 2 63  ? 22.214  -8.803  -8.615  1.00 5.54  ? 63   PRO B HB3  1  
ATOM 3084  H HG2  . PRO B 2 63  ? 24.444  -10.748 -8.411  1.00 5.10  ? 63   PRO B HG2  1  
ATOM 3085  H HG3  . PRO B 2 63  ? 24.449  -8.993  -8.179  1.00 5.59  ? 63   PRO B HG3  1  
ATOM 3086  H HD2  . PRO B 2 63  ? 24.424  -10.859 -6.210  1.00 4.15  ? 63   PRO B HD2  1  
ATOM 3087  H HD3  . PRO B 2 63  ? 23.847  -9.211  -5.947  1.00 4.36  ? 63   PRO B HD3  1  
ATOM 3088  N N    . ALA B 2 64  ? 21.977  -12.974 -8.001  1.00 4.07  ? 64   ALA B N    1  
ATOM 3089  C CA   . ALA B 2 64  ? 21.722  -14.270 -8.609  1.00 4.49  ? 64   ALA B CA   1  
ATOM 3090  C C    . ALA B 2 64  ? 21.472  -15.363 -7.569  1.00 4.55  ? 64   ALA B C    1  
ATOM 3091  O O    . ALA B 2 64  ? 21.665  -16.546 -7.844  1.00 4.94  ? 64   ALA B O    1  
ATOM 3092  C CB   . ALA B 2 64  ? 22.871  -14.648 -9.537  1.00 5.10  ? 64   ALA B CB   1  
ATOM 3093  H H    . ALA B 2 64  ? 22.704  -12.840 -7.351  1.00 3.80  ? 64   ALA B H    1  
ATOM 3094  H HA   . ALA B 2 64  ? 20.832  -14.169 -9.211  1.00 4.81  ? 64   ALA B HA   1  
ATOM 3095  H HB1  . ALA B 2 64  ? 23.026  -13.858 -10.258 1.00 5.36  ? 64   ALA B HB1  1  
ATOM 3096  H HB2  . ALA B 2 64  ? 22.631  -15.565 -10.054 1.00 5.29  ? 64   ALA B HB2  1  
ATOM 3097  H HB3  . ALA B 2 64  ? 23.772  -14.787 -8.958  1.00 5.51  ? 64   ALA B HB3  1  
ATOM 3098  N N    . LYS B 2 65  ? 21.010  -14.979 -6.393  1.00 4.63  ? 65   LYS B N    1  
ATOM 3099  C CA   . LYS B 2 65  ? 20.778  -15.935 -5.328  1.00 5.27  ? 65   LYS B CA   1  
ATOM 3100  C C    . LYS B 2 65  ? 19.359  -16.459 -5.248  1.00 5.65  ? 65   LYS B C    1  
ATOM 3101  O O    . LYS B 2 65  ? 19.027  -17.202 -4.330  1.00 5.93  ? 65   LYS B O    1  
ATOM 3102  C CB   . LYS B 2 65  ? 21.230  -15.410 -3.985  1.00 5.85  ? 65   LYS B CB   1  
ATOM 3103  C CG   . LYS B 2 65  ? 22.689  -15.639 -3.695  1.00 6.65  ? 65   LYS B CG   1  
ATOM 3104  C CD   . LYS B 2 65  ? 23.011  -17.116 -3.715  1.00 7.41  ? 65   LYS B CD   1  
ATOM 3105  C CE   . LYS B 2 65  ? 24.406  -17.392 -3.204  1.00 8.15  ? 65   LYS B CE   1  
ATOM 3106  N NZ   . LYS B 2 65  ? 24.535  -17.058 -1.771  1.00 8.51  ? 65   LYS B NZ   1  
ATOM 3107  H H    . LYS B 2 65  ? 20.812  -14.037 -6.214  1.00 4.56  ? 65   LYS B H    1  
ATOM 3108  H HA   . LYS B 2 65  ? 21.406  -16.782 -5.569  1.00 5.51  ? 65   LYS B HA   1  
ATOM 3109  H HB2  . LYS B 2 65  ? 21.042  -14.346 -3.928  1.00 5.88  ? 65   LYS B HB2  1  
ATOM 3110  H HB3  . LYS B 2 65  ? 20.643  -15.886 -3.220  1.00 6.03  ? 65   LYS B HB3  1  
ATOM 3111  H HG2  . LYS B 2 65  ? 23.275  -15.132 -4.448  1.00 6.88  ? 65   LYS B HG2  1  
ATOM 3112  H HG3  . LYS B 2 65  ? 22.922  -15.237 -2.720  1.00 6.78  ? 65   LYS B HG3  1  
ATOM 3113  H HD2  . LYS B 2 65  ? 22.297  -17.631 -3.090  1.00 7.54  ? 65   LYS B HD2  1  
ATOM 3114  H HD3  . LYS B 2 65  ? 22.924  -17.473 -4.731  1.00 7.58  ? 65   LYS B HD3  1  
ATOM 3115  H HE2  . LYS B 2 65  ? 24.615  -18.444 -3.336  1.00 8.50  ? 65   LYS B HE2  1  
ATOM 3116  H HE3  . LYS B 2 65  ? 25.122  -16.816 -3.771  1.00 8.37  ? 65   LYS B HE3  1  
ATOM 3117  H HZ1  . LYS B 2 65  ? 24.280  -16.065 -1.574  1.00 8.59  ? 65   LYS B HZ1  1  
ATOM 3118  H HZ2  . LYS B 2 65  ? 25.514  -17.210 -1.447  1.00 8.70  ? 65   LYS B HZ2  1  
ATOM 3119  H HZ3  . LYS B 2 65  ? 23.895  -17.664 -1.210  1.00 8.80  ? 65   LYS B HZ3  1  
ATOM 3120  N N    . SER B 2 66  ? 18.532  -16.080 -6.175  1.00 6.08  ? 66   SER B N    1  
ATOM 3121  C CA   . SER B 2 66  ? 17.194  -16.630 -6.236  1.00 6.85  ? 66   SER B CA   1  
ATOM 3122  C C    . SER B 2 66  ? 17.149  -17.685 -7.334  1.00 7.46  ? 66   SER B C    1  
ATOM 3123  O O    . SER B 2 66  ? 16.091  -18.233 -7.674  1.00 8.12  ? 66   SER B O    1  
ATOM 3124  C CB   . SER B 2 66  ? 16.175  -15.522 -6.488  1.00 7.35  ? 66   SER B CB   1  
ATOM 3125  O OG   . SER B 2 66  ? 16.260  -14.529 -5.478  1.00 7.52  ? 66   SER B OG   1  
ATOM 3126  H H    . SER B 2 66  ? 18.807  -15.408 -6.836  1.00 6.13  ? 66   SER B H    1  
ATOM 3127  H HA   . SER B 2 66  ? 16.989  -17.104 -5.286  1.00 6.99  ? 66   SER B HA   1  
ATOM 3128  H HB2  . SER B 2 66  ? 16.373  -15.064 -7.446  1.00 7.38  ? 66   SER B HB2  1  
ATOM 3129  H HB3  . SER B 2 66  ? 15.179  -15.941 -6.484  1.00 7.87  ? 66   SER B HB3  1  
ATOM 3130  H HG   . SER B 2 66  ? 17.180  -14.229 -5.429  1.00 7.68  ? 66   SER B HG   1  
ATOM 3131  N N    . GLU B 2 67  ? 18.323  -17.975 -7.862  1.00 7.51  ? 67   GLU B N    1  
ATOM 3132  C CA   . GLU B 2 67  ? 18.497  -18.904 -8.933  1.00 8.31  ? 67   GLU B CA   1  
ATOM 3133  C C    . GLU B 2 67  ? 19.147  -20.163 -8.399  1.00 8.57  ? 67   GLU B C    1  
ATOM 3134  O O    . GLU B 2 67  ? 18.458  -21.197 -8.299  1.00 8.74  ? 67   GLU B O    1  
ATOM 3135  C CB   . GLU B 2 67  ? 19.348  -18.291 -10.040 1.00 8.74  ? 67   GLU B CB   1  
ATOM 3136  C CG   . GLU B 2 67  ? 18.773  -17.010 -10.635 1.00 9.47  ? 67   GLU B CG   1  
ATOM 3137  C CD   . GLU B 2 67  ? 17.375  -17.199 -11.172 1.00 9.82  ? 67   GLU B CD   1  
ATOM 3138  O OE1  . GLU B 2 67  ? 17.188  -18.003 -12.117 1.00 9.89  ? 67   GLU B OE1  1  
ATOM 3139  O OE2  . GLU B 2 67  ? 16.447  -16.539 -10.675 1.00 10.21 ? 67   GLU B OE2  1  
ATOM 3140  O OXT  . GLU B 2 67  ? 20.320  -20.116 -8.001  1.00 8.84  ? 67   GLU B OXT  1  
ATOM 3141  H H    . GLU B 2 67  ? 19.127  -17.559 -7.488  1.00 7.18  ? 67   GLU B H    1  
ATOM 3142  H HA   . GLU B 2 67  ? 17.523  -19.147 -9.330  1.00 8.70  ? 67   GLU B HA   1  
ATOM 3143  H HB2  . GLU B 2 67  ? 20.328  -18.069 -9.641  1.00 8.63  ? 67   GLU B HB2  1  
ATOM 3144  H HB3  . GLU B 2 67  ? 19.451  -19.015 -10.834 1.00 8.93  ? 67   GLU B HB3  1  
ATOM 3145  H HG2  . GLU B 2 67  ? 18.746  -16.252 -9.867  1.00 9.74  ? 67   GLU B HG2  1  
ATOM 3146  H HG3  . GLU B 2 67  ? 19.414  -16.684 -11.441 1.00 9.75  ? 67   GLU B HG3  1  
ATOM 3147  N N    . MET A 1 1   ? -30.376 10.848  -3.773  1.00 8.13  ? 1508 MET A N    2  
ATOM 3148  C CA   . MET A 1 1   ? -29.122 10.695  -4.503  1.00 7.50  ? 1508 MET A CA   2  
ATOM 3149  C C    . MET A 1 1   ? -29.362 10.915  -5.983  1.00 6.73  ? 1508 MET A C    2  
ATOM 3150  O O    . MET A 1 1   ? -30.353 10.443  -6.537  1.00 6.84  ? 1508 MET A O    2  
ATOM 3151  C CB   . MET A 1 1   ? -28.429 9.328   -4.233  1.00 7.83  ? 1508 MET A CB   2  
ATOM 3152  C CG   . MET A 1 1   ? -29.140 8.071   -4.743  1.00 8.25  ? 1508 MET A CG   2  
ATOM 3153  S SD   . MET A 1 1   ? -30.703 7.707   -3.928  1.00 8.94  ? 1508 MET A SD   2  
ATOM 3154  C CE   . MET A 1 1   ? -31.111 6.156   -4.737  1.00 9.34  ? 1508 MET A CE   2  
ATOM 3155  H H1   . MET A 1 1   ? -31.120 10.212  -4.133  1.00 8.35  ? 1508 MET A H1   2  
ATOM 3156  H H2   . MET A 1 1   ? -30.724 11.823  -3.901  1.00 8.44  ? 1508 MET A H2   2  
ATOM 3157  H H3   . MET A 1 1   ? -30.244 10.673  -2.753  1.00 8.31  ? 1508 MET A H3   2  
ATOM 3158  H HA   . MET A 1 1   ? -28.478 11.495  -4.168  1.00 7.66  ? 1508 MET A HA   2  
ATOM 3159  H HB2  . MET A 1 1   ? -27.453 9.349   -4.693  1.00 8.12  ? 1508 MET A HB2  2  
ATOM 3160  H HB3  . MET A 1 1   ? -28.293 9.229   -3.165  1.00 7.83  ? 1508 MET A HB3  2  
ATOM 3161  H HG2  . MET A 1 1   ? -29.335 8.196   -5.798  1.00 8.43  ? 1508 MET A HG2  2  
ATOM 3162  H HG3  . MET A 1 1   ? -28.474 7.231   -4.611  1.00 8.28  ? 1508 MET A HG3  2  
ATOM 3163  H HE1  . MET A 1 1   ? -32.050 5.787   -4.351  1.00 9.55  ? 1508 MET A HE1  2  
ATOM 3164  H HE2  . MET A 1 1   ? -30.332 5.433   -4.542  1.00 9.74  ? 1508 MET A HE2  2  
ATOM 3165  H HE3  . MET A 1 1   ? -31.196 6.315   -5.801  1.00 9.25  ? 1508 MET A HE3  2  
ATOM 3166  N N    . LYS A 1 2   ? -28.458 11.632  -6.617  1.00 6.29  ? 1509 LYS A N    2  
ATOM 3167  C CA   . LYS A 1 2   ? -28.592 12.021  -8.014  1.00 5.88  ? 1509 LYS A CA   2  
ATOM 3168  C C    . LYS A 1 2   ? -27.826 11.061  -8.905  1.00 5.23  ? 1509 LYS A C    2  
ATOM 3169  O O    . LYS A 1 2   ? -27.967 11.046  -10.134 1.00 5.51  ? 1509 LYS A O    2  
ATOM 3170  C CB   . LYS A 1 2   ? -28.114 13.470  -8.183  1.00 6.62  ? 1509 LYS A CB   2  
ATOM 3171  C CG   . LYS A 1 2   ? -28.277 14.066  -9.570  1.00 7.06  ? 1509 LYS A CG   2  
ATOM 3172  C CD   . LYS A 1 2   ? -27.929 15.564  -9.622  1.00 7.86  ? 1509 LYS A CD   2  
ATOM 3173  C CE   . LYS A 1 2   ? -26.427 15.887  -9.456  1.00 8.52  ? 1509 LYS A CE   2  
ATOM 3174  N NZ   . LYS A 1 2   ? -25.879 15.603  -8.102  1.00 9.04  ? 1509 LYS A NZ   2  
ATOM 3175  H H    . LYS A 1 2   ? -27.636 11.887  -6.138  1.00 6.49  ? 1509 LYS A H    2  
ATOM 3176  H HA   . LYS A 1 2   ? -29.634 11.955  -8.268  1.00 5.90  ? 1509 LYS A HA   2  
ATOM 3177  H HB2  . LYS A 1 2   ? -28.667 14.095  -7.496  1.00 7.05  ? 1509 LYS A HB2  2  
ATOM 3178  H HB3  . LYS A 1 2   ? -27.068 13.516  -7.916  1.00 6.74  ? 1509 LYS A HB3  2  
ATOM 3179  H HG2  . LYS A 1 2   ? -27.625 13.539  -10.251 1.00 6.93  ? 1509 LYS A HG2  2  
ATOM 3180  H HG3  . LYS A 1 2   ? -29.302 13.934  -9.887  1.00 7.28  ? 1509 LYS A HG3  2  
ATOM 3181  H HD2  . LYS A 1 2   ? -28.249 15.957  -10.575 1.00 8.13  ? 1509 LYS A HD2  2  
ATOM 3182  H HD3  . LYS A 1 2   ? -28.481 16.064  -8.839  1.00 8.01  ? 1509 LYS A HD3  2  
ATOM 3183  H HE2  . LYS A 1 2   ? -25.872 15.302  -10.172 1.00 8.69  ? 1509 LYS A HE2  2  
ATOM 3184  H HE3  . LYS A 1 2   ? -26.284 16.934  -9.680  1.00 8.71  ? 1509 LYS A HE3  2  
ATOM 3185  H HZ1  . LYS A 1 2   ? -24.928 16.023  -8.016  1.00 9.17  ? 1509 LYS A HZ1  2  
ATOM 3186  H HZ2  . LYS A 1 2   ? -25.739 14.579  -7.955  1.00 9.28  ? 1509 LYS A HZ2  2  
ATOM 3187  H HZ3  . LYS A 1 2   ? -26.478 15.985  -7.338  1.00 9.32  ? 1509 LYS A HZ3  2  
ATOM 3188  N N    . SER A 1 3   ? -27.056 10.268  -8.284  1.00 4.76  ? 1510 SER A N    2  
ATOM 3189  C CA   . SER A 1 3   ? -26.286 9.266   -8.928  1.00 4.45  ? 1510 SER A CA   2  
ATOM 3190  C C    . SER A 1 3   ? -26.321 8.023   -8.049  1.00 3.64  ? 1510 SER A C    2  
ATOM 3191  O O    . SER A 1 3   ? -27.099 7.985   -7.089  1.00 3.88  ? 1510 SER A O    2  
ATOM 3192  C CB   . SER A 1 3   ? -24.842 9.762   -9.162  1.00 5.16  ? 1510 SER A CB   2  
ATOM 3193  O OG   . SER A 1 3   ? -24.070 8.805   -9.873  1.00 5.81  ? 1510 SER A OG   2  
ATOM 3194  H H    . SER A 1 3   ? -27.016 10.362  -7.308  1.00 4.93  ? 1510 SER A H    2  
ATOM 3195  H HA   . SER A 1 3   ? -26.752 9.042   -9.877  1.00 4.75  ? 1510 SER A HA   2  
ATOM 3196  H HB2  . SER A 1 3   ? -24.867 10.679  -9.731  1.00 5.40  ? 1510 SER A HB2  2  
ATOM 3197  H HB3  . SER A 1 3   ? -24.374 9.948   -8.206  1.00 5.37  ? 1510 SER A HB3  2  
ATOM 3198  H HG   . SER A 1 3   ? -23.530 9.252   -10.541 1.00 5.97  ? 1510 SER A HG   2  
ATOM 3199  N N    . ASN A 1 4   ? -25.527 7.034   -8.342  1.00 3.10  ? 1511 ASN A N    2  
ATOM 3200  C CA   . ASN A 1 4   ? -25.500 5.837   -7.524  1.00 2.64  ? 1511 ASN A CA   2  
ATOM 3201  C C    . ASN A 1 4   ? -24.700 6.090   -6.244  1.00 2.46  ? 1511 ASN A C    2  
ATOM 3202  O O    . ASN A 1 4   ? -24.980 5.513   -5.184  1.00 2.95  ? 1511 ASN A O    2  
ATOM 3203  C CB   . ASN A 1 4   ? -24.943 4.616   -8.301  1.00 2.88  ? 1511 ASN A CB   2  
ATOM 3204  C CG   . ASN A 1 4   ? -23.464 4.698   -8.676  1.00 2.85  ? 1511 ASN A CG   2  
ATOM 3205  O OD1  . ASN A 1 4   ? -22.905 5.778   -8.898  1.00 3.42  ? 1511 ASN A OD1  2  
ATOM 3206  N ND2  . ASN A 1 4   ? -22.832 3.554   -8.776  1.00 2.85  ? 1511 ASN A ND2  2  
ATOM 3207  H H    . ASN A 1 4   ? -24.939 7.129   -9.127  1.00 3.39  ? 1511 ASN A H    2  
ATOM 3208  H HA   . ASN A 1 4   ? -26.522 5.636   -7.237  1.00 2.86  ? 1511 ASN A HA   2  
ATOM 3209  H HB2  . ASN A 1 4   ? -25.072 3.731   -7.695  1.00 3.16  ? 1511 ASN A HB2  2  
ATOM 3210  H HB3  . ASN A 1 4   ? -25.517 4.503   -9.208  1.00 3.48  ? 1511 ASN A HB3  2  
ATOM 3211  H HD21 . ASN A 1 4   ? -23.337 2.730   -8.614  1.00 2.88  ? 1511 ASN A HD21 2  
ATOM 3212  H HD22 . ASN A 1 4   ? -21.873 3.564   -9.003  1.00 3.22  ? 1511 ASN A HD22 2  
ATOM 3213  N N    . GLU A 1 5   ? -23.755 7.000   -6.333  1.00 2.44  ? 1512 GLU A N    2  
ATOM 3214  C CA   . GLU A 1 5   ? -22.886 7.310   -5.216  1.00 2.69  ? 1512 GLU A CA   2  
ATOM 3215  C C    . GLU A 1 5   ? -23.494 8.368   -4.314  1.00 2.20  ? 1512 GLU A C    2  
ATOM 3216  O O    . GLU A 1 5   ? -24.412 9.093   -4.707  1.00 2.74  ? 1512 GLU A O    2  
ATOM 3217  C CB   . GLU A 1 5   ? -21.456 7.711   -5.665  1.00 3.65  ? 1512 GLU A CB   2  
ATOM 3218  C CG   . GLU A 1 5   ? -21.334 8.953   -6.551  1.00 4.47  ? 1512 GLU A CG   2  
ATOM 3219  C CD   . GLU A 1 5   ? -19.896 9.323   -6.793  1.00 5.30  ? 1512 GLU A CD   2  
ATOM 3220  O OE1  . GLU A 1 5   ? -19.216 8.658   -7.623  1.00 5.61  ? 1512 GLU A OE1  2  
ATOM 3221  O OE2  . GLU A 1 5   ? -19.401 10.268  -6.159  1.00 5.95  ? 1512 GLU A OE2  2  
ATOM 3222  H H    . GLU A 1 5   ? -23.687 7.477   -7.186  1.00 2.68  ? 1512 GLU A H    2  
ATOM 3223  H HA   . GLU A 1 5   ? -22.815 6.403   -4.634  1.00 3.17  ? 1512 GLU A HA   2  
ATOM 3224  H HB2  . GLU A 1 5   ? -20.862 7.891   -4.782  1.00 3.77  ? 1512 GLU A HB2  2  
ATOM 3225  H HB3  . GLU A 1 5   ? -21.025 6.875   -6.195  1.00 4.13  ? 1512 GLU A HB3  2  
ATOM 3226  H HG2  . GLU A 1 5   ? -21.768 8.782   -7.524  1.00 4.63  ? 1512 GLU A HG2  2  
ATOM 3227  H HG3  . GLU A 1 5   ? -21.818 9.788   -6.068  1.00 4.71  ? 1512 GLU A HG3  2  
ATOM 3228  N N    . HIS A 1 6   ? -23.013 8.413   -3.096  1.00 1.95  ? 1513 HIS A N    2  
ATOM 3229  C CA   . HIS A 1 6   ? -23.460 9.361   -2.106  1.00 2.20  ? 1513 HIS A CA   2  
ATOM 3230  C C    . HIS A 1 6   ? -22.250 10.182  -1.695  1.00 2.18  ? 1513 HIS A C    2  
ATOM 3231  O O    . HIS A 1 6   ? -21.184 9.981   -2.277  1.00 2.90  ? 1513 HIS A O    2  
ATOM 3232  C CB   . HIS A 1 6   ? -24.101 8.652   -0.882  1.00 3.02  ? 1513 HIS A CB   2  
ATOM 3233  C CG   . HIS A 1 6   ? -25.359 7.853   -1.181  1.00 3.77  ? 1513 HIS A CG   2  
ATOM 3234  N ND1  . HIS A 1 6   ? -26.591 8.119   -0.615  1.00 4.48  ? 1513 HIS A ND1  2  
ATOM 3235  C CD2  . HIS A 1 6   ? -25.557 6.766   -1.974  1.00 4.42  ? 1513 HIS A CD2  2  
ATOM 3236  C CE1  . HIS A 1 6   ? -27.475 7.245   -1.044  1.00 5.33  ? 1513 HIS A CE1  2  
ATOM 3237  N NE2  . HIS A 1 6   ? -26.875 6.416   -1.869  1.00 5.30  ? 1513 HIS A NE2  2  
ATOM 3238  H H    . HIS A 1 6   ? -22.285 7.813   -2.832  1.00 2.23  ? 1513 HIS A H    2  
ATOM 3239  H HA   . HIS A 1 6   ? -24.181 10.013  -2.578  1.00 2.69  ? 1513 HIS A HA   2  
ATOM 3240  H HB2  . HIS A 1 6   ? -23.380 7.970   -0.459  1.00 3.35  ? 1513 HIS A HB2  2  
ATOM 3241  H HB3  . HIS A 1 6   ? -24.349 9.400   -0.143  1.00 3.43  ? 1513 HIS A HB3  2  
ATOM 3242  H HD1  . HIS A 1 6   ? -26.816 8.829   0.036   1.00 4.64  ? 1513 HIS A HD1  2  
ATOM 3243  H HD2  . HIS A 1 6   ? -24.809 6.271   -2.577  1.00 4.57  ? 1513 HIS A HD2  2  
ATOM 3244  H HE1  . HIS A 1 6   ? -28.519 7.216   -0.769  1.00 6.14  ? 1513 HIS A HE1  2  
ATOM 3245  H HE2  . HIS A 1 6   ? -27.238 5.525   -2.104  1.00 5.92  ? 1513 HIS A HE2  2  
ATOM 3246  N N    . ASP A 1 7   ? -22.365 11.066  -0.739  1.00 2.06  ? 1514 ASP A N    2  
ATOM 3247  C CA   . ASP A 1 7   ? -21.223 11.936  -0.395  1.00 2.48  ? 1514 ASP A CA   2  
ATOM 3248  C C    . ASP A 1 7   ? -20.060 11.158  0.266   1.00 1.88  ? 1514 ASP A C    2  
ATOM 3249  O O    . ASP A 1 7   ? -18.877 11.491  0.073   1.00 2.21  ? 1514 ASP A O    2  
ATOM 3250  C CB   . ASP A 1 7   ? -21.660 13.134  0.461   1.00 3.42  ? 1514 ASP A CB   2  
ATOM 3251  C CG   . ASP A 1 7   ? -20.553 14.161  0.649   1.00 4.29  ? 1514 ASP A CG   2  
ATOM 3252  O OD1  . ASP A 1 7   ? -20.189 14.858  -0.317  1.00 5.06  ? 1514 ASP A OD1  2  
ATOM 3253  O OD2  . ASP A 1 7   ? -20.006 14.283  1.775   1.00 4.55  ? 1514 ASP A OD2  2  
ATOM 3254  H H    . ASP A 1 7   ? -23.223 11.155  -0.263  1.00 2.23  ? 1514 ASP A H    2  
ATOM 3255  H HA   . ASP A 1 7   ? -20.847 12.306  -1.338  1.00 3.01  ? 1514 ASP A HA   2  
ATOM 3256  H HB2  . ASP A 1 7   ? -22.498 13.623  -0.014  1.00 3.71  ? 1514 ASP A HB2  2  
ATOM 3257  H HB3  . ASP A 1 7   ? -21.965 12.779  1.435   1.00 3.65  ? 1514 ASP A HB3  2  
ATOM 3258  N N    . ASP A 1 8   ? -20.382 10.134  1.029   1.00 1.41  ? 1515 ASP A N    2  
ATOM 3259  C CA   . ASP A 1 8   ? -19.372 9.301   1.661   1.00 1.15  ? 1515 ASP A CA   2  
ATOM 3260  C C    . ASP A 1 8   ? -19.260 7.949   0.985   1.00 1.08  ? 1515 ASP A C    2  
ATOM 3261  O O    . ASP A 1 8   ? -19.762 7.742   -0.125  1.00 1.97  ? 1515 ASP A O    2  
ATOM 3262  C CB   . ASP A 1 8   ? -19.635 9.111   3.166   1.00 1.48  ? 1515 ASP A CB   2  
ATOM 3263  C CG   . ASP A 1 8   ? -19.237 10.303  3.992   1.00 2.07  ? 1515 ASP A CG   2  
ATOM 3264  O OD1  . ASP A 1 8   ? -18.053 10.431  4.374   1.00 2.33  ? 1515 ASP A OD1  2  
ATOM 3265  O OD2  . ASP A 1 8   ? -20.096 11.160  4.262   1.00 2.90  ? 1515 ASP A OD2  2  
ATOM 3266  H H    . ASP A 1 8   ? -21.324 9.909   1.194   1.00 1.68  ? 1515 ASP A H    2  
ATOM 3267  H HA   . ASP A 1 8   ? -18.428 9.810   1.544   1.00 1.40  ? 1515 ASP A HA   2  
ATOM 3268  H HB2  . ASP A 1 8   ? -20.688 8.932   3.320   1.00 1.83  ? 1515 ASP A HB2  2  
ATOM 3269  H HB3  . ASP A 1 8   ? -19.078 8.252   3.510   1.00 1.85  ? 1515 ASP A HB3  2  
ATOM 3270  N N    . CYS A 1 9   ? -18.624 7.030   1.669   1.00 0.81  ? 1516 CYS A N    2  
ATOM 3271  C CA   . CYS A 1 9   ? -18.365 5.680   1.179   1.00 0.69  ? 1516 CYS A CA   2  
ATOM 3272  C C    . CYS A 1 9   ? -19.617 4.801   1.233   1.00 0.61  ? 1516 CYS A C    2  
ATOM 3273  O O    . CYS A 1 9   ? -19.702 3.827   1.996   1.00 0.65  ? 1516 CYS A O    2  
ATOM 3274  C CB   . CYS A 1 9   ? -17.212 5.054   1.965   1.00 0.80  ? 1516 CYS A CB   2  
ATOM 3275  S SG   . CYS A 1 9   ? -17.367 5.212   3.776   1.00 1.19  ? 1516 CYS A SG   2  
ATOM 3276  H H    . CYS A 1 9   ? -18.337 7.264   2.576   1.00 1.41  ? 1516 CYS A H    2  
ATOM 3277  H HA   . CYS A 1 9   ? -18.064 5.768   0.145   1.00 0.82  ? 1516 CYS A HA   2  
ATOM 3278  H HB2  . CYS A 1 9   ? -17.176 3.998   1.743   1.00 1.27  ? 1516 CYS A HB2  2  
ATOM 3279  H HB3  . CYS A 1 9   ? -16.281 5.517   1.669   1.00 1.18  ? 1516 CYS A HB3  2  
ATOM 3280  N N    . GLN A 1 10  ? -20.580 5.154   0.434   1.00 0.58  ? 1517 GLN A N    2  
ATOM 3281  C CA   . GLN A 1 10  ? -21.807 4.441   0.357   1.00 0.58  ? 1517 GLN A CA   2  
ATOM 3282  C C    . GLN A 1 10  ? -22.445 4.664   -1.012  1.00 0.60  ? 1517 GLN A C    2  
ATOM 3283  O O    . GLN A 1 10  ? -22.532 5.802   -1.487  1.00 0.73  ? 1517 GLN A O    2  
ATOM 3284  C CB   . GLN A 1 10  ? -22.740 4.849   1.519   1.00 0.65  ? 1517 GLN A CB   2  
ATOM 3285  C CG   . GLN A 1 10  ? -23.015 6.338   1.623   1.00 0.74  ? 1517 GLN A CG   2  
ATOM 3286  C CD   . GLN A 1 10  ? -24.012 6.686   2.711   1.00 0.90  ? 1517 GLN A CD   2  
ATOM 3287  O OE1  . GLN A 1 10  ? -24.750 7.667   2.589   1.00 1.44  ? 1517 GLN A OE1  2  
ATOM 3288  N NE2  . GLN A 1 10  ? -24.021 5.936   3.789   1.00 1.52  ? 1517 GLN A NE2  2  
ATOM 3289  H H    . GLN A 1 10  ? -20.464 5.952   -0.132  1.00 0.61  ? 1517 GLN A H    2  
ATOM 3290  H HA   . GLN A 1 10  ? -21.572 3.390   0.447   1.00 0.58  ? 1517 GLN A HA   2  
ATOM 3291  H HB2  . GLN A 1 10  ? -23.683 4.337   1.422   1.00 0.72  ? 1517 GLN A HB2  2  
ATOM 3292  H HB3  . GLN A 1 10  ? -22.285 4.536   2.448   1.00 0.64  ? 1517 GLN A HB3  2  
ATOM 3293  H HG2  . GLN A 1 10  ? -22.086 6.847   1.832   1.00 0.71  ? 1517 GLN A HG2  2  
ATOM 3294  H HG3  . GLN A 1 10  ? -23.403 6.682   0.675   1.00 0.82  ? 1517 GLN A HG3  2  
ATOM 3295  H HE21 . GLN A 1 10  ? -23.384 5.184   3.884   1.00 2.18  ? 1517 GLN A HE21 2  
ATOM 3296  H HE22 . GLN A 1 10  ? -24.710 6.125   4.471   1.00 1.63  ? 1517 GLN A HE22 2  
ATOM 3297  N N    . VAL A 1 11  ? -22.851 3.588   -1.654  1.00 0.51  ? 1518 VAL A N    2  
ATOM 3298  C CA   . VAL A 1 11  ? -23.423 3.627   -2.988  1.00 0.53  ? 1518 VAL A CA   2  
ATOM 3299  C C    . VAL A 1 11  ? -24.665 2.755   -3.079  1.00 0.54  ? 1518 VAL A C    2  
ATOM 3300  O O    . VAL A 1 11  ? -24.748 1.708   -2.433  1.00 0.51  ? 1518 VAL A O    2  
ATOM 3301  C CB   . VAL A 1 11  ? -22.399 3.198   -4.088  1.00 0.51  ? 1518 VAL A CB   2  
ATOM 3302  C CG1  . VAL A 1 11  ? -21.361 4.260   -4.311  1.00 0.94  ? 1518 VAL A CG1  2  
ATOM 3303  C CG2  . VAL A 1 11  ? -21.708 1.896   -3.740  1.00 0.84  ? 1518 VAL A CG2  2  
ATOM 3304  H H    . VAL A 1 11  ? -22.795 2.705   -1.228  1.00 0.47  ? 1518 VAL A H    2  
ATOM 3305  H HA   . VAL A 1 11  ? -23.715 4.650   -3.178  1.00 0.60  ? 1518 VAL A HA   2  
ATOM 3306  H HB   . VAL A 1 11  ? -22.923 3.052   -5.017  1.00 0.93  ? 1518 VAL A HB   2  
ATOM 3307  H HG11 . VAL A 1 11  ? -20.668 3.930   -5.070  1.00 1.47  ? 1518 VAL A HG11 2  
ATOM 3308  H HG12 . VAL A 1 11  ? -20.833 4.445   -3.388  1.00 1.51  ? 1518 VAL A HG12 2  
ATOM 3309  H HG13 . VAL A 1 11  ? -21.865 5.154   -4.643  1.00 1.48  ? 1518 VAL A HG13 2  
ATOM 3310  H HG21 . VAL A 1 11  ? -21.161 1.990   -2.809  1.00 1.37  ? 1518 VAL A HG21 2  
ATOM 3311  H HG22 . VAL A 1 11  ? -20.971 1.712   -4.510  1.00 1.33  ? 1518 VAL A HG22 2  
ATOM 3312  H HG23 . VAL A 1 11  ? -22.411 1.081   -3.689  1.00 1.52  ? 1518 VAL A HG23 2  
ATOM 3313  N N    . THR A 1 12  ? -25.623 3.195   -3.848  1.00 0.64  ? 1519 THR A N    2  
ATOM 3314  C CA   . THR A 1 12  ? -26.839 2.456   -4.051  1.00 0.69  ? 1519 THR A CA   2  
ATOM 3315  C C    . THR A 1 12  ? -26.888 1.945   -5.492  1.00 0.78  ? 1519 THR A C    2  
ATOM 3316  O O    . THR A 1 12  ? -26.590 2.685   -6.425  1.00 0.89  ? 1519 THR A O    2  
ATOM 3317  C CB   . THR A 1 12  ? -28.067 3.359   -3.810  1.00 0.79  ? 1519 THR A CB   2  
ATOM 3318  O OG1  . THR A 1 12  ? -27.940 4.027   -2.532  1.00 0.78  ? 1519 THR A OG1  2  
ATOM 3319  C CG2  . THR A 1 12  ? -29.355 2.529   -3.834  1.00 0.85  ? 1519 THR A CG2  2  
ATOM 3320  H H    . THR A 1 12  ? -25.526 4.052   -4.323  1.00 0.72  ? 1519 THR A H    2  
ATOM 3321  H HA   . THR A 1 12  ? -26.870 1.628   -3.359  1.00 0.66  ? 1519 THR A HA   2  
ATOM 3322  H HB   . THR A 1 12  ? -28.109 4.101   -4.594  1.00 0.87  ? 1519 THR A HB   2  
ATOM 3323  H HG1  . THR A 1 12  ? -28.820 4.081   -2.125  1.00 1.09  ? 1519 THR A HG1  2  
ATOM 3324  H HG21 . THR A 1 12  ? -29.435 2.036   -4.793  1.00 1.36  ? 1519 THR A HG21 2  
ATOM 3325  H HG22 . THR A 1 12  ? -30.213 3.168   -3.686  1.00 1.35  ? 1519 THR A HG22 2  
ATOM 3326  H HG23 . THR A 1 12  ? -29.322 1.780   -3.056  1.00 1.30  ? 1519 THR A HG23 2  
ATOM 3327  N N    . ASN A 1 13  ? -27.228 0.693   -5.670  1.00 0.80  ? 1520 ASN A N    2  
ATOM 3328  C CA   . ASN A 1 13  ? -27.389 0.145   -6.996  1.00 0.95  ? 1520 ASN A CA   2  
ATOM 3329  C C    . ASN A 1 13  ? -28.840 0.218   -7.408  1.00 0.98  ? 1520 ASN A C    2  
ATOM 3330  O O    . ASN A 1 13  ? -29.692 -0.323  -6.721  1.00 0.96  ? 1520 ASN A O    2  
ATOM 3331  C CB   . ASN A 1 13  ? -26.896 -1.291  -7.059  1.00 1.09  ? 1520 ASN A CB   2  
ATOM 3332  C CG   . ASN A 1 13  ? -27.268 -1.968  -8.360  1.00 1.30  ? 1520 ASN A CG   2  
ATOM 3333  O OD1  . ASN A 1 13  ? -28.261 -2.684  -8.426  1.00 1.34  ? 1520 ASN A OD1  2  
ATOM 3334  N ND2  . ASN A 1 13  ? -26.563 -1.662  -9.405  1.00 1.74  ? 1520 ASN A ND2  2  
ATOM 3335  H H    . ASN A 1 13  ? -27.392 0.118   -4.892  1.00 0.78  ? 1520 ASN A H    2  
ATOM 3336  H HA   . ASN A 1 13  ? -26.803 0.750   -7.673  1.00 1.07  ? 1520 ASN A HA   2  
ATOM 3337  H HB2  . ASN A 1 13  ? -25.823 -1.316  -6.952  1.00 1.19  ? 1520 ASN A HB2  2  
ATOM 3338  H HB3  . ASN A 1 13  ? -27.369 -1.836  -6.257  1.00 1.10  ? 1520 ASN A HB3  2  
ATOM 3339  H HD21 . ASN A 1 13  ? -25.838 -0.998  -9.305  1.00 2.02  ? 1520 ASN A HD21 2  
ATOM 3340  H HD22 . ASN A 1 13  ? -26.751 -2.117  -10.260 1.00 1.91  ? 1520 ASN A HD22 2  
ATOM 3341  N N    . PRO A 1 14  ? -29.135 0.864   -8.548  1.00 1.13  ? 1521 PRO A N    2  
ATOM 3342  C CA   . PRO A 1 14  ? -30.516 1.078   -9.024  1.00 1.26  ? 1521 PRO A CA   2  
ATOM 3343  C C    . PRO A 1 14  ? -31.272 -0.208  -9.397  1.00 1.30  ? 1521 PRO A C    2  
ATOM 3344  O O    . PRO A 1 14  ? -32.492 -0.190  -9.526  1.00 1.40  ? 1521 PRO A O    2  
ATOM 3345  C CB   . PRO A 1 14  ? -30.338 1.952   -10.274 1.00 1.47  ? 1521 PRO A CB   2  
ATOM 3346  C CG   . PRO A 1 14  ? -28.940 1.716   -10.715 1.00 1.58  ? 1521 PRO A CG   2  
ATOM 3347  C CD   . PRO A 1 14  ? -28.144 1.471   -9.467  1.00 1.30  ? 1521 PRO A CD   2  
ATOM 3348  H HA   . PRO A 1 14  ? -31.096 1.624   -8.297  1.00 1.25  ? 1521 PRO A HA   2  
ATOM 3349  H HB2  . PRO A 1 14  ? -31.046 1.639   -11.027 1.00 1.57  ? 1521 PRO A HB2  2  
ATOM 3350  H HB3  . PRO A 1 14  ? -30.511 2.990   -10.026 1.00 1.57  ? 1521 PRO A HB3  2  
ATOM 3351  H HG2  . PRO A 1 14  ? -28.907 0.850   -11.361 1.00 1.79  ? 1521 PRO A HG2  2  
ATOM 3352  H HG3  . PRO A 1 14  ? -28.570 2.584   -11.239 1.00 1.82  ? 1521 PRO A HG3  2  
ATOM 3353  H HD2  . PRO A 1 14  ? -27.338 0.781   -9.671  1.00 1.38  ? 1521 PRO A HD2  2  
ATOM 3354  H HD3  . PRO A 1 14  ? -27.752 2.392   -9.063  1.00 1.27  ? 1521 PRO A HD3  2  
ATOM 3355  N N    . SER A 1 15  ? -30.562 -1.301  -9.577  1.00 1.30  ? 1522 SER A N    2  
ATOM 3356  C CA   . SER A 1 15  ? -31.189 -2.538  -9.972  1.00 1.40  ? 1522 SER A CA   2  
ATOM 3357  C C    . SER A 1 15  ? -31.773 -3.293  -8.774  1.00 1.36  ? 1522 SER A C    2  
ATOM 3358  O O    . SER A 1 15  ? -32.935 -3.687  -8.792  1.00 1.46  ? 1522 SER A O    2  
ATOM 3359  C CB   . SER A 1 15  ? -30.195 -3.404  -10.734 1.00 1.53  ? 1522 SER A CB   2  
ATOM 3360  O OG   . SER A 1 15  ? -29.713 -2.721  -11.896 1.00 1.65  ? 1522 SER A OG   2  
ATOM 3361  H H    . SER A 1 15  ? -29.591 -1.288  -9.435  1.00 1.29  ? 1522 SER A H    2  
ATOM 3362  H HA   . SER A 1 15  ? -32.001 -2.288  -10.638 1.00 1.48  ? 1522 SER A HA   2  
ATOM 3363  H HB2  . SER A 1 15  ? -29.356 -3.609  -10.084 1.00 1.50  ? 1522 SER A HB2  2  
ATOM 3364  H HB3  . SER A 1 15  ? -30.655 -4.336  -11.019 1.00 1.62  ? 1522 SER A HB3  2  
ATOM 3365  H HG   . SER A 1 15  ? -30.302 -1.963  -12.056 1.00 1.89  ? 1522 SER A HG   2  
ATOM 3366  N N    . THR A 1 16  ? -30.988 -3.466  -7.733  1.00 1.29  ? 1523 THR A N    2  
ATOM 3367  C CA   . THR A 1 16  ? -31.457 -4.218  -6.581  1.00 1.35  ? 1523 THR A CA   2  
ATOM 3368  C C    . THR A 1 16  ? -31.878 -3.279  -5.431  1.00 1.25  ? 1523 THR A C    2  
ATOM 3369  O O    . THR A 1 16  ? -32.511 -3.697  -4.444  1.00 1.36  ? 1523 THR A O    2  
ATOM 3370  C CB   . THR A 1 16  ? -30.408 -5.322  -6.139  1.00 1.47  ? 1523 THR A CB   2  
ATOM 3371  O OG1  . THR A 1 16  ? -30.792 -5.999  -4.927  1.00 1.61  ? 1523 THR A OG1  2  
ATOM 3372  C CG2  . THR A 1 16  ? -29.010 -4.739  -5.992  1.00 1.42  ? 1523 THR A CG2  2  
ATOM 3373  H H    . THR A 1 16  ? -30.076 -3.094  -7.740  1.00 1.25  ? 1523 THR A H    2  
ATOM 3374  H HA   . THR A 1 16  ? -32.367 -4.709  -6.898  1.00 1.46  ? 1523 THR A HA   2  
ATOM 3375  H HB   . THR A 1 16  ? -30.376 -6.076  -6.914  1.00 1.57  ? 1523 THR A HB   2  
ATOM 3376  H HG1  . THR A 1 16  ? -31.089 -6.888  -5.189  1.00 1.99  ? 1523 THR A HG1  2  
ATOM 3377  H HG21 . THR A 1 16  ? -29.008 -3.999  -5.209  1.00 1.81  ? 1523 THR A HG21 2  
ATOM 3378  H HG22 . THR A 1 16  ? -28.740 -4.268  -6.929  1.00 1.69  ? 1523 THR A HG22 2  
ATOM 3379  H HG23 . THR A 1 16  ? -28.304 -5.524  -5.763  1.00 1.70  ? 1523 THR A HG23 2  
ATOM 3380  N N    . GLY A 1 17  ? -31.570 -1.992  -5.604  1.00 1.13  ? 1524 GLY A N    2  
ATOM 3381  C CA   . GLY A 1 17  ? -31.916 -0.970  -4.632  1.00 1.08  ? 1524 GLY A CA   2  
ATOM 3382  C C    . GLY A 1 17  ? -31.205 -1.173  -3.341  1.00 0.99  ? 1524 GLY A C    2  
ATOM 3383  O O    . GLY A 1 17  ? -31.747 -0.912  -2.267  1.00 1.06  ? 1524 GLY A O    2  
ATOM 3384  H H    . GLY A 1 17  ? -31.097 -1.707  -6.416  1.00 1.11  ? 1524 GLY A H    2  
ATOM 3385  H HA2  . GLY A 1 17  ? -31.632 -0.007  -5.033  1.00 1.06  ? 1524 GLY A HA2  2  
ATOM 3386  H HA3  . GLY A 1 17  ? -32.979 -0.967  -4.455  1.00 1.19  ? 1524 GLY A HA3  2  
ATOM 3387  N N    . HIS A 1 18  ? -29.995 -1.649  -3.431  1.00 0.91  ? 1525 HIS A N    2  
ATOM 3388  C CA   . HIS A 1 18  ? -29.251 -1.927  -2.251  1.00 0.85  ? 1525 HIS A CA   2  
ATOM 3389  C C    . HIS A 1 18  ? -28.297 -0.810  -1.966  1.00 0.72  ? 1525 HIS A C    2  
ATOM 3390  O O    . HIS A 1 18  ? -27.469 -0.450  -2.811  1.00 0.68  ? 1525 HIS A O    2  
ATOM 3391  C CB   . HIS A 1 18  ? -28.499 -3.254  -2.336  1.00 0.90  ? 1525 HIS A CB   2  
ATOM 3392  C CG   . HIS A 1 18  ? -27.972 -3.704  -1.000  1.00 0.91  ? 1525 HIS A CG   2  
ATOM 3393  N ND1  . HIS A 1 18  ? -26.637 -3.820  -0.709  1.00 1.12  ? 1525 HIS A ND1  2  
ATOM 3394  C CD2  . HIS A 1 18  ? -28.628 -4.065  0.126   1.00 1.26  ? 1525 HIS A CD2  2  
ATOM 3395  C CE1  . HIS A 1 18  ? -26.495 -4.232  0.537   1.00 1.05  ? 1525 HIS A CE1  2  
ATOM 3396  N NE2  . HIS A 1 18  ? -27.686 -4.386  1.062   1.00 1.12  ? 1525 HIS A NE2  2  
ATOM 3397  H H    . HIS A 1 18  ? -29.617 -1.784  -4.322  1.00 0.93  ? 1525 HIS A H    2  
ATOM 3398  H HA   . HIS A 1 18  ? -29.958 -1.985  -1.436  1.00 0.91  ? 1525 HIS A HA   2  
ATOM 3399  H HB2  . HIS A 1 18  ? -29.157 -4.017  -2.726  1.00 1.03  ? 1525 HIS A HB2  2  
ATOM 3400  H HB3  . HIS A 1 18  ? -27.654 -3.134  -2.996  1.00 0.89  ? 1525 HIS A HB3  2  
ATOM 3401  H HD1  . HIS A 1 18  ? -25.882 -3.636  -1.309  1.00 1.59  ? 1525 HIS A HD1  2  
ATOM 3402  H HD2  . HIS A 1 18  ? -29.701 -4.097  0.260   1.00 1.82  ? 1525 HIS A HD2  2  
ATOM 3403  H HE1  . HIS A 1 18  ? -25.556 -4.409  1.038   1.00 1.33  ? 1525 HIS A HE1  2  
ATOM 3404  H HE2  . HIS A 1 18  ? -27.842 -4.246  2.032   1.00 1.40  ? 1525 HIS A HE2  2  
ATOM 3405  N N    . LEU A 1 19  ? -28.438 -0.273  -0.805  1.00 0.68  ? 1526 LEU A N    2  
ATOM 3406  C CA   . LEU A 1 19  ? -27.597 0.763   -0.305  1.00 0.60  ? 1526 LEU A CA   2  
ATOM 3407  C C    . LEU A 1 19  ? -26.403 0.107   0.396   1.00 0.54  ? 1526 LEU A C    2  
ATOM 3408  O O    . LEU A 1 19  ? -26.560 -0.526  1.439   1.00 0.57  ? 1526 LEU A O    2  
ATOM 3409  C CB   . LEU A 1 19  ? -28.437 1.654   0.660   1.00 0.66  ? 1526 LEU A CB   2  
ATOM 3410  C CG   . LEU A 1 19  ? -27.770 2.845   1.419   1.00 0.64  ? 1526 LEU A CG   2  
ATOM 3411  C CD1  . LEU A 1 19  ? -27.182 2.408   2.747   1.00 0.64  ? 1526 LEU A CD1  2  
ATOM 3412  C CD2  . LEU A 1 19  ? -26.703 3.569   0.608   1.00 0.64  ? 1526 LEU A CD2  2  
ATOM 3413  H H    . LEU A 1 19  ? -29.171 -0.605  -0.235  1.00 0.75  ? 1526 LEU A H    2  
ATOM 3414  H HA   . LEU A 1 19  ? -27.307 1.359   -1.158  1.00 0.58  ? 1526 LEU A HA   2  
ATOM 3415  H HB2  . LEU A 1 19  ? -29.297 2.029   0.125   1.00 0.71  ? 1526 LEU A HB2  2  
ATOM 3416  H HB3  . LEU A 1 19  ? -28.832 0.993   1.419   1.00 0.70  ? 1526 LEU A HB3  2  
ATOM 3417  H HG   . LEU A 1 19  ? -28.564 3.539   1.619   1.00 0.71  ? 1526 LEU A HG   2  
ATOM 3418  H HD11 . LEU A 1 19  ? -27.968 2.028   3.383   1.00 1.13  ? 1526 LEU A HD11 2  
ATOM 3419  H HD12 . LEU A 1 19  ? -26.703 3.248   3.227   1.00 1.25  ? 1526 LEU A HD12 2  
ATOM 3420  H HD13 . LEU A 1 19  ? -26.459 1.628   2.570   1.00 1.15  ? 1526 LEU A HD13 2  
ATOM 3421  H HD21 . LEU A 1 19  ? -26.429 4.457   1.160   1.00 1.12  ? 1526 LEU A HD21 2  
ATOM 3422  H HD22 . LEU A 1 19  ? -27.041 3.842   -0.381  1.00 1.30  ? 1526 LEU A HD22 2  
ATOM 3423  H HD23 . LEU A 1 19  ? -25.835 2.928   0.566   1.00 1.16  ? 1526 LEU A HD23 2  
ATOM 3424  N N    . PHE A 1 20  ? -25.254 0.167   -0.220  1.00 0.47  ? 1527 PHE A N    2  
ATOM 3425  C CA   . PHE A 1 20  ? -24.048 -0.336  0.385   1.00 0.45  ? 1527 PHE A CA   2  
ATOM 3426  C C    . PHE A 1 20  ? -23.411 0.754   1.181   1.00 0.44  ? 1527 PHE A C    2  
ATOM 3427  O O    . PHE A 1 20  ? -22.955 1.736   0.612   1.00 0.48  ? 1527 PHE A O    2  
ATOM 3428  C CB   . PHE A 1 20  ? -23.029 -0.802  -0.650  1.00 0.43  ? 1527 PHE A CB   2  
ATOM 3429  C CG   . PHE A 1 20  ? -23.388 -2.009  -1.445  1.00 0.45  ? 1527 PHE A CG   2  
ATOM 3430  C CD1  . PHE A 1 20  ? -23.293 -3.262  -0.893  1.00 0.59  ? 1527 PHE A CD1  2  
ATOM 3431  C CD2  . PHE A 1 20  ? -23.853 -1.882  -2.735  1.00 0.44  ? 1527 PHE A CD2  2  
ATOM 3432  C CE1  . PHE A 1 20  ? -23.652 -4.372  -1.616  1.00 0.65  ? 1527 PHE A CE1  2  
ATOM 3433  C CE2  . PHE A 1 20  ? -24.211 -2.991  -3.467  1.00 0.49  ? 1527 PHE A CE2  2  
ATOM 3434  C CZ   . PHE A 1 20  ? -23.996 -4.258  -2.932  1.00 0.58  ? 1527 PHE A CZ   2  
ATOM 3435  H H    . PHE A 1 20  ? -25.182 0.576   -1.112  1.00 0.47  ? 1527 PHE A H    2  
ATOM 3436  H HA   . PHE A 1 20  ? -24.312 -1.157  1.028   1.00 0.49  ? 1527 PHE A HA   2  
ATOM 3437  H HB2  . PHE A 1 20  ? -22.914 0.012   -1.350  1.00 0.42  ? 1527 PHE A HB2  2  
ATOM 3438  H HB3  . PHE A 1 20  ? -22.078 -0.978  -0.168  1.00 0.48  ? 1527 PHE A HB3  2  
ATOM 3439  H HD1  . PHE A 1 20  ? -22.934 -3.361  0.121   1.00 0.70  ? 1527 PHE A HD1  2  
ATOM 3440  H HD2  . PHE A 1 20  ? -23.930 -0.897  -3.171  1.00 0.49  ? 1527 PHE A HD2  2  
ATOM 3441  H HE1  . PHE A 1 20  ? -23.582 -5.349  -1.166  1.00 0.80  ? 1527 PHE A HE1  2  
ATOM 3442  H HE2  . PHE A 1 20  ? -24.571 -2.877  -4.479  1.00 0.55  ? 1527 PHE A HE2  2  
ATOM 3443  H HZ   . PHE A 1 20  ? -24.234 -5.134  -3.516  1.00 0.66  ? 1527 PHE A HZ   2  
ATOM 3444  N N    . ASP A 1 21  ? -23.385 0.603   2.464   1.00 0.44  ? 1528 ASP A N    2  
ATOM 3445  C CA   . ASP A 1 21  ? -22.739 1.567   3.303   1.00 0.48  ? 1528 ASP A CA   2  
ATOM 3446  C C    . ASP A 1 21  ? -21.504 0.947   3.895   1.00 0.41  ? 1528 ASP A C    2  
ATOM 3447  O O    . ASP A 1 21  ? -21.582 -0.005  4.674   1.00 0.46  ? 1528 ASP A O    2  
ATOM 3448  C CB   . ASP A 1 21  ? -23.680 2.074   4.382   1.00 0.64  ? 1528 ASP A CB   2  
ATOM 3449  C CG   . ASP A 1 21  ? -22.992 2.998   5.351   1.00 0.81  ? 1528 ASP A CG   2  
ATOM 3450  O OD1  . ASP A 1 21  ? -22.404 4.006   4.905   1.00 1.17  ? 1528 ASP A OD1  2  
ATOM 3451  O OD2  . ASP A 1 21  ? -23.050 2.750   6.574   1.00 0.81  ? 1528 ASP A OD2  2  
ATOM 3452  H H    . ASP A 1 21  ? -23.791 -0.185  2.888   1.00 0.47  ? 1528 ASP A H    2  
ATOM 3453  H HA   . ASP A 1 21  ? -22.439 2.391   2.673   1.00 0.51  ? 1528 ASP A HA   2  
ATOM 3454  H HB2  . ASP A 1 21  ? -24.485 2.625   3.915   1.00 0.81  ? 1528 ASP A HB2  2  
ATOM 3455  H HB3  . ASP A 1 21  ? -24.067 1.227   4.933   1.00 0.70  ? 1528 ASP A HB3  2  
ATOM 3456  N N    . LEU A 1 22  ? -20.367 1.467   3.524   1.00 0.38  ? 1529 LEU A N    2  
ATOM 3457  C CA   . LEU A 1 22  ? -19.107 0.896   3.930   1.00 0.36  ? 1529 LEU A CA   2  
ATOM 3458  C C    . LEU A 1 22  ? -18.642 1.524   5.223   1.00 0.40  ? 1529 LEU A C    2  
ATOM 3459  O O    . LEU A 1 22  ? -17.658 1.090   5.829   1.00 0.41  ? 1529 LEU A O    2  
ATOM 3460  C CB   . LEU A 1 22  ? -18.047 1.040   2.822   1.00 0.39  ? 1529 LEU A CB   2  
ATOM 3461  C CG   . LEU A 1 22  ? -18.202 0.165   1.545   1.00 0.40  ? 1529 LEU A CG   2  
ATOM 3462  C CD1  . LEU A 1 22  ? -18.193 -1.310  1.865   1.00 0.52  ? 1529 LEU A CD1  2  
ATOM 3463  C CD2  . LEU A 1 22  ? -19.425 0.499   0.701   1.00 0.60  ? 1529 LEU A CD2  2  
ATOM 3464  H H    . LEU A 1 22  ? -20.338 2.283   2.974   1.00 0.42  ? 1529 LEU A H    2  
ATOM 3465  H HA   . LEU A 1 22  ? -19.277 -0.155  4.112   1.00 0.36  ? 1529 LEU A HA   2  
ATOM 3466  H HB2  . LEU A 1 22  ? -18.036 2.074   2.511   1.00 0.44  ? 1529 LEU A HB2  2  
ATOM 3467  H HB3  . LEU A 1 22  ? -17.085 0.817   3.261   1.00 0.42  ? 1529 LEU A HB3  2  
ATOM 3468  H HG   . LEU A 1 22  ? -17.325 0.372   0.953   1.00 0.70  ? 1529 LEU A HG   2  
ATOM 3469  H HD11 . LEU A 1 22  ? -17.248 -1.573  2.318   1.00 1.20  ? 1529 LEU A HD11 2  
ATOM 3470  H HD12 . LEU A 1 22  ? -18.321 -1.852  0.937   1.00 1.15  ? 1529 LEU A HD12 2  
ATOM 3471  H HD13 . LEU A 1 22  ? -19.006 -1.541  2.536   1.00 1.15  ? 1529 LEU A HD13 2  
ATOM 3472  H HD21 . LEU A 1 22  ? -19.411 1.535   0.393   1.00 1.29  ? 1529 LEU A HD21 2  
ATOM 3473  H HD22 . LEU A 1 22  ? -20.339 0.241   1.215   1.00 1.20  ? 1529 LEU A HD22 2  
ATOM 3474  H HD23 . LEU A 1 22  ? -19.360 -0.120  -0.179  1.00 1.18  ? 1529 LEU A HD23 2  
ATOM 3475  N N    . SER A 1 23  ? -19.409 2.506   5.676   1.00 0.48  ? 1530 SER A N    2  
ATOM 3476  C CA   . SER A 1 23  ? -19.135 3.210   6.932   1.00 0.57  ? 1530 SER A CA   2  
ATOM 3477  C C    . SER A 1 23  ? -19.190 2.242   8.118   1.00 0.56  ? 1530 SER A C    2  
ATOM 3478  O O    . SER A 1 23  ? -18.619 2.501   9.163   1.00 0.60  ? 1530 SER A O    2  
ATOM 3479  C CB   . SER A 1 23  ? -20.138 4.355   7.156   1.00 0.71  ? 1530 SER A CB   2  
ATOM 3480  O OG   . SER A 1 23  ? -20.281 5.144   5.974   1.00 0.84  ? 1530 SER A OG   2  
ATOM 3481  H H    . SER A 1 23  ? -20.164 2.763   5.104   1.00 0.52  ? 1530 SER A H    2  
ATOM 3482  H HA   . SER A 1 23  ? -18.139 3.623   6.868   1.00 0.59  ? 1530 SER A HA   2  
ATOM 3483  H HB2  . SER A 1 23  ? -21.099 3.994   7.495   1.00 0.72  ? 1530 SER A HB2  2  
ATOM 3484  H HB3  . SER A 1 23  ? -19.737 4.995   7.929   1.00 0.82  ? 1530 SER A HB3  2  
ATOM 3485  H HG   . SER A 1 23  ? -21.022 4.732   5.491   1.00 0.91  ? 1530 SER A HG   2  
ATOM 3486  N N    . SER A 1 24  ? -19.850 1.108   7.930   1.00 0.58  ? 1531 SER A N    2  
ATOM 3487  C CA   . SER A 1 24  ? -19.965 0.101   8.959   1.00 0.65  ? 1531 SER A CA   2  
ATOM 3488  C C    . SER A 1 24  ? -18.598 -0.529  9.292   1.00 0.61  ? 1531 SER A C    2  
ATOM 3489  O O    . SER A 1 24  ? -18.409 -1.080  10.366  1.00 0.71  ? 1531 SER A O    2  
ATOM 3490  C CB   . SER A 1 24  ? -20.957 -0.965  8.507   1.00 0.73  ? 1531 SER A CB   2  
ATOM 3491  O OG   . SER A 1 24  ? -22.192 -0.363  8.137   1.00 1.59  ? 1531 SER A OG   2  
ATOM 3492  H H    . SER A 1 24  ? -20.290 0.946   7.069   1.00 0.60  ? 1531 SER A H    2  
ATOM 3493  H HA   . SER A 1 24  ? -20.356 0.578   9.846   1.00 0.73  ? 1531 SER A HA   2  
ATOM 3494  H HB2  . SER A 1 24  ? -20.554 -1.495  7.657   1.00 1.24  ? 1531 SER A HB2  2  
ATOM 3495  H HB3  . SER A 1 24  ? -21.134 -1.657  9.316   1.00 1.07  ? 1531 SER A HB3  2  
ATOM 3496  H HG   . SER A 1 24  ? -22.248 0.506   8.569   1.00 1.98  ? 1531 SER A HG   2  
ATOM 3497  N N    . LEU A 1 25  ? -17.643 -0.393  8.386   1.00 0.54  ? 1532 LEU A N    2  
ATOM 3498  C CA   . LEU A 1 25  ? -16.318 -0.973  8.559   1.00 0.56  ? 1532 LEU A CA   2  
ATOM 3499  C C    . LEU A 1 25  ? -15.322 0.055   9.070   1.00 0.57  ? 1532 LEU A C    2  
ATOM 3500  O O    . LEU A 1 25  ? -14.121 -0.184  9.068   1.00 0.61  ? 1532 LEU A O    2  
ATOM 3501  C CB   . LEU A 1 25  ? -15.835 -1.534  7.234   1.00 0.56  ? 1532 LEU A CB   2  
ATOM 3502  C CG   . LEU A 1 25  ? -16.687 -2.633  6.626   1.00 0.55  ? 1532 LEU A CG   2  
ATOM 3503  C CD1  . LEU A 1 25  ? -16.222 -2.917  5.224   1.00 0.57  ? 1532 LEU A CD1  2  
ATOM 3504  C CD2  . LEU A 1 25  ? -16.612 -3.892  7.472   1.00 0.65  ? 1532 LEU A CD2  2  
ATOM 3505  H H    . LEU A 1 25  ? -17.815 0.113   7.559   1.00 0.54  ? 1532 LEU A H    2  
ATOM 3506  H HA   . LEU A 1 25  ? -16.382 -1.780  9.272   1.00 0.61  ? 1532 LEU A HA   2  
ATOM 3507  H HB2  . LEU A 1 25  ? -15.780 -0.720  6.527   1.00 0.55  ? 1532 LEU A HB2  2  
ATOM 3508  H HB3  . LEU A 1 25  ? -14.838 -1.924  7.379   1.00 0.62  ? 1532 LEU A HB3  2  
ATOM 3509  H HG   . LEU A 1 25  ? -17.715 -2.302  6.596   1.00 0.55  ? 1532 LEU A HG   2  
ATOM 3510  H HD11 . LEU A 1 25  ? -16.311 -2.006  4.652   1.00 1.19  ? 1532 LEU A HD11 2  
ATOM 3511  H HD12 . LEU A 1 25  ? -16.835 -3.692  4.787   1.00 1.08  ? 1532 LEU A HD12 2  
ATOM 3512  H HD13 . LEU A 1 25  ? -15.187 -3.225  5.248   1.00 1.24  ? 1532 LEU A HD13 2  
ATOM 3513  H HD21 . LEU A 1 25  ? -15.577 -4.170  7.604   1.00 1.34  ? 1532 LEU A HD21 2  
ATOM 3514  H HD22 . LEU A 1 25  ? -17.125 -4.698  6.967   1.00 1.14  ? 1532 LEU A HD22 2  
ATOM 3515  H HD23 . LEU A 1 25  ? -17.068 -3.724  8.437   1.00 1.16  ? 1532 LEU A HD23 2  
ATOM 3516  N N    . SER A 1 26  ? -15.819 1.190   9.489   1.00 0.58  ? 1533 SER A N    2  
ATOM 3517  C CA   . SER A 1 26  ? -14.958 2.244   10.004  1.00 0.62  ? 1533 SER A CA   2  
ATOM 3518  C C    . SER A 1 26  ? -14.272 1.850   11.302  1.00 0.68  ? 1533 SER A C    2  
ATOM 3519  O O    . SER A 1 26  ? -14.756 0.975   12.056  1.00 0.75  ? 1533 SER A O    2  
ATOM 3520  C CB   . SER A 1 26  ? -15.728 3.547   10.193  1.00 0.68  ? 1533 SER A CB   2  
ATOM 3521  O OG   . SER A 1 26  ? -16.916 3.341   10.953  1.00 1.52  ? 1533 SER A OG   2  
ATOM 3522  H H    . SER A 1 26  ? -16.789 1.303   9.431   1.00 0.59  ? 1533 SER A H    2  
ATOM 3523  H HA   . SER A 1 26  ? -14.190 2.413   9.264   1.00 0.65  ? 1533 SER A HA   2  
ATOM 3524  H HB2  . SER A 1 26  ? -15.093 4.237   10.730  1.00 1.19  ? 1533 SER A HB2  2  
ATOM 3525  H HB3  . SER A 1 26  ? -15.965 3.959   9.227   1.00 1.19  ? 1533 SER A HB3  2  
ATOM 3526  H HG   . SER A 1 26  ? -17.635 3.191   10.321  1.00 1.93  ? 1533 SER A HG   2  
ATOM 3527  N N    . GLY A 1 27  ? -13.169 2.489   11.549  1.00 0.76  ? 1534 GLY A N    2  
ATOM 3528  C CA   . GLY A 1 27  ? -12.408 2.268   12.737  1.00 0.89  ? 1534 GLY A CA   2  
ATOM 3529  C C    . GLY A 1 27  ? -11.256 3.216   12.781  1.00 0.95  ? 1534 GLY A C    2  
ATOM 3530  O O    . GLY A 1 27  ? -10.662 3.518   11.742  1.00 1.10  ? 1534 GLY A O    2  
ATOM 3531  H H    . GLY A 1 27  ? -12.855 3.155   10.900  1.00 0.79  ? 1534 GLY A H    2  
ATOM 3532  H HA2  . GLY A 1 27  ? -13.048 2.490   13.585  1.00 0.92  ? 1534 GLY A HA2  2  
ATOM 3533  H HA3  . GLY A 1 27  ? -12.023 1.255   12.755  1.00 1.07  ? 1534 GLY A HA3  2  
ATOM 3534  N N    . ARG A 1 28  ? -10.947 3.690   13.953  1.00 1.07  ? 1535 ARG A N    2  
ATOM 3535  C CA   . ARG A 1 28  ? -9.884  4.647   14.132  1.00 1.36  ? 1535 ARG A CA   2  
ATOM 3536  C C    . ARG A 1 28  ? -8.550  3.940   14.368  1.00 1.25  ? 1535 ARG A C    2  
ATOM 3537  O O    . ARG A 1 28  ? -7.509  4.374   13.856  1.00 1.46  ? 1535 ARG A O    2  
ATOM 3538  C CB   . ARG A 1 28  ? -10.223 5.631   15.269  1.00 1.78  ? 1535 ARG A CB   2  
ATOM 3539  C CG   . ARG A 1 28  ? -9.109  6.607   15.595  1.00 2.21  ? 1535 ARG A CG   2  
ATOM 3540  C CD   . ARG A 1 28  ? -9.515  7.602   16.669  1.00 2.72  ? 1535 ARG A CD   2  
ATOM 3541  N NE   . ARG A 1 28  ? -10.630 8.485   16.273  1.00 3.19  ? 1535 ARG A NE   2  
ATOM 3542  C CZ   . ARG A 1 28  ? -11.277 9.305   17.107  1.00 3.82  ? 1535 ARG A CZ   2  
ATOM 3543  N NH1  . ARG A 1 28  ? -10.980 9.316   18.405  1.00 4.05  ? 1535 ARG A NH1  2  
ATOM 3544  N NH2  . ARG A 1 28  ? -12.222 10.107  16.641  1.00 4.62  ? 1535 ARG A NH2  2  
ATOM 3545  H H    . ARG A 1 28  ? -11.452 3.370   14.735  1.00 1.11  ? 1535 ARG A H    2  
ATOM 3546  H HA   . ARG A 1 28  ? -9.804  5.202   13.209  1.00 1.48  ? 1535 ARG A HA   2  
ATOM 3547  H HB2  . ARG A 1 28  ? -11.086 6.207   14.974  1.00 1.87  ? 1535 ARG A HB2  2  
ATOM 3548  H HB3  . ARG A 1 28  ? -10.467 5.082   16.166  1.00 1.80  ? 1535 ARG A HB3  2  
ATOM 3549  H HG2  . ARG A 1 28  ? -8.275  6.031   15.969  1.00 2.48  ? 1535 ARG A HG2  2  
ATOM 3550  H HG3  . ARG A 1 28  ? -8.795  7.127   14.702  1.00 2.35  ? 1535 ARG A HG3  2  
ATOM 3551  H HD2  . ARG A 1 28  ? -9.811  7.054   17.550  1.00 3.08  ? 1535 ARG A HD2  2  
ATOM 3552  H HD3  . ARG A 1 28  ? -8.656  8.212   16.908  1.00 3.09  ? 1535 ARG A HD3  2  
ATOM 3553  H HE   . ARG A 1 28  ? -10.880 8.483   15.321  1.00 3.43  ? 1535 ARG A HE   2  
ATOM 3554  H HH11 . ARG A 1 28  ? -10.279 8.716   18.812  1.00 3.88  ? 1535 ARG A HH11 2  
ATOM 3555  H HH12 . ARG A 1 28  ? -11.435 9.957   19.036  1.00 4.70  ? 1535 ARG A HH12 2  
ATOM 3556  H HH21 . ARG A 1 28  ? -12.450 10.108  15.656  1.00 4.90  ? 1535 ARG A HH21 2  
ATOM 3557  H HH22 . ARG A 1 28  ? -12.758 10.735  17.220  1.00 5.21  ? 1535 ARG A HH22 2  
ATOM 3558  N N    . ALA A 1 29  ? -8.579  2.836   15.110  1.00 1.08  ? 1536 ALA A N    2  
ATOM 3559  C CA   . ALA A 1 29  ? -7.365  2.074   15.369  1.00 1.24  ? 1536 ALA A CA   2  
ATOM 3560  C C    . ALA A 1 29  ? -6.935  1.369   14.096  1.00 1.01  ? 1536 ALA A C    2  
ATOM 3561  O O    . ALA A 1 29  ? -5.739  1.189   13.815  1.00 1.27  ? 1536 ALA A O    2  
ATOM 3562  C CB   . ALA A 1 29  ? -7.565  1.086   16.507  1.00 1.45  ? 1536 ALA A CB   2  
ATOM 3563  H H    . ALA A 1 29  ? -9.432  2.518   15.482  1.00 1.01  ? 1536 ALA A H    2  
ATOM 3564  H HA   . ALA A 1 29  ? -6.594  2.780   15.641  1.00 1.60  ? 1536 ALA A HA   2  
ATOM 3565  H HB1  . ALA A 1 29  ? -8.329  0.375   16.233  1.00 1.84  ? 1536 ALA A HB1  2  
ATOM 3566  H HB2  . ALA A 1 29  ? -7.869  1.619   17.396  1.00 1.94  ? 1536 ALA A HB2  2  
ATOM 3567  H HB3  . ALA A 1 29  ? -6.638  0.566   16.698  1.00 1.68  ? 1536 ALA A HB3  2  
ATOM 3568  N N    . GLY A 1 30  ? -7.918  0.973   13.327  1.00 0.74  ? 1537 GLY A N    2  
ATOM 3569  C CA   . GLY A 1 30  ? -7.681  0.445   12.034  1.00 0.84  ? 1537 GLY A CA   2  
ATOM 3570  C C    . GLY A 1 30  ? -7.654  -1.046  12.008  1.00 0.72  ? 1537 GLY A C    2  
ATOM 3571  O O    . GLY A 1 30  ? -7.982  -1.716  12.995  1.00 0.85  ? 1537 GLY A O    2  
ATOM 3572  H H    . GLY A 1 30  ? -8.835  0.998   13.682  1.00 0.70  ? 1537 GLY A H    2  
ATOM 3573  H HA2  . GLY A 1 30  ? -8.459  0.790   11.370  1.00 1.02  ? 1537 GLY A HA2  2  
ATOM 3574  H HA3  . GLY A 1 30  ? -6.731  0.816   11.679  1.00 1.08  ? 1537 GLY A HA3  2  
ATOM 3575  N N    . PHE A 1 31  ? -7.275  -1.562  10.901  1.00 0.52  ? 1538 PHE A N    2  
ATOM 3576  C CA   . PHE A 1 31  ? -7.175  -2.971  10.687  1.00 0.49  ? 1538 PHE A CA   2  
ATOM 3577  C C    . PHE A 1 31  ? -5.778  -3.268  10.223  1.00 0.46  ? 1538 PHE A C    2  
ATOM 3578  O O    . PHE A 1 31  ? -5.170  -2.444  9.521   1.00 0.43  ? 1538 PHE A O    2  
ATOM 3579  C CB   . PHE A 1 31  ? -8.216  -3.465  9.653   1.00 0.54  ? 1538 PHE A CB   2  
ATOM 3580  C CG   . PHE A 1 31  ? -9.660  -3.374  10.112  1.00 0.65  ? 1538 PHE A CG   2  
ATOM 3581  C CD1  . PHE A 1 31  ? -10.234 -4.426  10.808  1.00 0.80  ? 1538 PHE A CD1  2  
ATOM 3582  C CD2  . PHE A 1 31  ? -10.444 -2.249  9.843   1.00 0.68  ? 1538 PHE A CD2  2  
ATOM 3583  C CE1  . PHE A 1 31  ? -11.548 -4.363  11.227  1.00 0.93  ? 1538 PHE A CE1  2  
ATOM 3584  C CE2  . PHE A 1 31  ? -11.758 -2.190  10.261  1.00 0.82  ? 1538 PHE A CE2  2  
ATOM 3585  C CZ   . PHE A 1 31  ? -12.309 -3.247  10.954  1.00 0.93  ? 1538 PHE A CZ   2  
ATOM 3586  H H    . PHE A 1 31  ? -7.012  -0.953  10.176  1.00 0.45  ? 1538 PHE A H    2  
ATOM 3587  H HA   . PHE A 1 31  ? -7.345  -3.466  11.632  1.00 0.52  ? 1538 PHE A HA   2  
ATOM 3588  H HB2  . PHE A 1 31  ? -8.124  -2.897  8.739   1.00 0.55  ? 1538 PHE A HB2  2  
ATOM 3589  H HB3  . PHE A 1 31  ? -8.006  -4.502  9.434   1.00 0.56  ? 1538 PHE A HB3  2  
ATOM 3590  H HD1  . PHE A 1 31  ? -9.644  -5.305  11.026  1.00 0.85  ? 1538 PHE A HD1  2  
ATOM 3591  H HD2  . PHE A 1 31  ? -10.042 -1.405  9.304   1.00 0.66  ? 1538 PHE A HD2  2  
ATOM 3592  H HE1  . PHE A 1 31  ? -11.979 -5.192  11.769  1.00 1.07  ? 1538 PHE A HE1  2  
ATOM 3593  H HE2  . PHE A 1 31  ? -12.354 -1.316  10.048  1.00 0.88  ? 1538 PHE A HE2  2  
ATOM 3594  H HZ   . PHE A 1 31  ? -13.337 -3.201  11.282  1.00 1.05  ? 1538 PHE A HZ   2  
ATOM 3595  N N    . THR A 1 32  ? -5.262  -4.379  10.641  1.00 0.50  ? 1539 THR A N    2  
ATOM 3596  C CA   . THR A 1 32  ? -3.939  -4.788  10.288  1.00 0.50  ? 1539 THR A CA   2  
ATOM 3597  C C    . THR A 1 32  ? -3.989  -5.913  9.271   1.00 0.51  ? 1539 THR A C    2  
ATOM 3598  O O    . THR A 1 32  ? -4.743  -6.883  9.429   1.00 0.64  ? 1539 THR A O    2  
ATOM 3599  C CB   . THR A 1 32  ? -3.115  -5.228  11.533  1.00 0.58  ? 1539 THR A CB   2  
ATOM 3600  O OG1  . THR A 1 32  ? -3.868  -6.146  12.364  1.00 1.03  ? 1539 THR A OG1  2  
ATOM 3601  C CG2  . THR A 1 32  ? -2.652  -4.032  12.360  1.00 0.78  ? 1539 THR A CG2  2  
ATOM 3602  H H    . THR A 1 32  ? -5.814  -4.971  11.203  1.00 0.56  ? 1539 THR A H    2  
ATOM 3603  H HA   . THR A 1 32  ? -3.447  -3.940  9.835   1.00 0.46  ? 1539 THR A HA   2  
ATOM 3604  H HB   . THR A 1 32  ? -2.245  -5.755  11.168  1.00 0.77  ? 1539 THR A HB   2  
ATOM 3605  H HG1  . THR A 1 32  ? -4.817  -5.966  12.276  1.00 1.46  ? 1539 THR A HG1  2  
ATOM 3606  H HG21 . THR A 1 32  ? -3.491  -3.418  12.656  1.00 1.42  ? 1539 THR A HG21 2  
ATOM 3607  H HG22 . THR A 1 32  ? -1.941  -3.449  11.791  1.00 1.32  ? 1539 THR A HG22 2  
ATOM 3608  H HG23 . THR A 1 32  ? -2.153  -4.402  13.244  1.00 1.30  ? 1539 THR A HG23 2  
ATOM 3609  N N    . ALA A 1 33  ? -3.242  -5.768  8.226   1.00 0.44  ? 1540 ALA A N    2  
ATOM 3610  C CA   . ALA A 1 33  ? -3.146  -6.781  7.217   1.00 0.47  ? 1540 ALA A CA   2  
ATOM 3611  C C    . ALA A 1 33  ? -1.710  -7.233  7.148   1.00 0.50  ? 1540 ALA A C    2  
ATOM 3612  O O    . ALA A 1 33  ? -0.787  -6.408  7.295   1.00 0.49  ? 1540 ALA A O    2  
ATOM 3613  C CB   . ALA A 1 33  ? -3.618  -6.240  5.879   1.00 0.46  ? 1540 ALA A CB   2  
ATOM 3614  H H    . ALA A 1 33  ? -2.717  -4.944  8.121   1.00 0.41  ? 1540 ALA A H    2  
ATOM 3615  H HA   . ALA A 1 33  ? -3.771  -7.612  7.508   1.00 0.53  ? 1540 ALA A HA   2  
ATOM 3616  H HB1  . ALA A 1 33  ? -4.646  -5.918  5.967   1.00 1.12  ? 1540 ALA A HB1  2  
ATOM 3617  H HB2  . ALA A 1 33  ? -3.547  -7.014  5.130   1.00 1.02  ? 1540 ALA A HB2  2  
ATOM 3618  H HB3  . ALA A 1 33  ? -3.004  -5.400  5.594   1.00 1.19  ? 1540 ALA A HB3  2  
ATOM 3619  N N    . ALA A 1 34  ? -1.516  -8.522  6.968   1.00 0.57  ? 1541 ALA A N    2  
ATOM 3620  C CA   . ALA A 1 34  ? -0.194  -9.104  6.924   1.00 0.63  ? 1541 ALA A CA   2  
ATOM 3621  C C    . ALA A 1 34  ? 0.424   -8.872  5.566   1.00 0.63  ? 1541 ALA A C    2  
ATOM 3622  O O    . ALA A 1 34  ? -0.264  -8.958  4.535   1.00 0.70  ? 1541 ALA A O    2  
ATOM 3623  C CB   . ALA A 1 34  ? -0.253  -10.593 7.245   1.00 0.74  ? 1541 ALA A CB   2  
ATOM 3624  H H    . ALA A 1 34  ? -2.286  -9.110  6.825   1.00 0.61  ? 1541 ALA A H    2  
ATOM 3625  H HA   . ALA A 1 34  ? 0.413   -8.614  7.672   1.00 0.64  ? 1541 ALA A HA   2  
ATOM 3626  H HB1  . ALA A 1 34  ? -0.860  -11.094 6.504   1.00 1.37  ? 1541 ALA A HB1  2  
ATOM 3627  H HB2  . ALA A 1 34  ? -0.686  -10.734 8.223   1.00 1.19  ? 1541 ALA A HB2  2  
ATOM 3628  H HB3  . ALA A 1 34  ? 0.745   -11.004 7.229   1.00 1.25  ? 1541 ALA A HB3  2  
ATOM 3629  N N    . TYR A 1 35  ? 1.690   -8.562  5.555   1.00 0.66  ? 1542 TYR A N    2  
ATOM 3630  C CA   . TYR A 1 35  ? 2.378   -8.290  4.329   1.00 0.71  ? 1542 TYR A CA   2  
ATOM 3631  C C    . TYR A 1 35  ? 3.851   -8.696  4.483   1.00 0.84  ? 1542 TYR A C    2  
ATOM 3632  O O    . TYR A 1 35  ? 4.183   -9.893  4.473   1.00 0.96  ? 1542 TYR A O    2  
ATOM 3633  C CB   . TYR A 1 35  ? 2.235   -6.792  3.950   1.00 0.68  ? 1542 TYR A CB   2  
ATOM 3634  C CG   . TYR A 1 35  ? 2.482   -6.454  2.485   1.00 0.63  ? 1542 TYR A CG   2  
ATOM 3635  C CD1  . TYR A 1 35  ? 3.355   -7.193  1.696   1.00 0.99  ? 1542 TYR A CD1  2  
ATOM 3636  C CD2  . TYR A 1 35  ? 1.832   -5.381  1.905   1.00 0.62  ? 1542 TYR A CD2  2  
ATOM 3637  C CE1  . TYR A 1 35  ? 3.567   -6.874  0.376   1.00 0.97  ? 1542 TYR A CE1  2  
ATOM 3638  C CE2  . TYR A 1 35  ? 2.039   -5.051  0.579   1.00 0.66  ? 1542 TYR A CE2  2  
ATOM 3639  C CZ   . TYR A 1 35  ? 2.908   -5.807  -0.179  1.00 0.63  ? 1542 TYR A CZ   2  
ATOM 3640  O OH   . TYR A 1 35  ? 3.123   -5.490  -1.502  1.00 0.71  ? 1542 TYR A OH   2  
ATOM 3641  H H    . TYR A 1 35  ? 2.181   -8.531  6.409   1.00 0.71  ? 1542 TYR A H    2  
ATOM 3642  H HA   . TYR A 1 35  ? 1.930   -8.898  3.557   1.00 0.75  ? 1542 TYR A HA   2  
ATOM 3643  H HB2  . TYR A 1 35  ? 1.232   -6.470  4.187   1.00 0.74  ? 1542 TYR A HB2  2  
ATOM 3644  H HB3  . TYR A 1 35  ? 2.931   -6.221  4.546   1.00 0.74  ? 1542 TYR A HB3  2  
ATOM 3645  H HD1  . TYR A 1 35  ? 3.868   -8.033  2.142   1.00 1.38  ? 1542 TYR A HD1  2  
ATOM 3646  H HD2  . TYR A 1 35  ? 1.155   -4.802  2.518   1.00 0.88  ? 1542 TYR A HD2  2  
ATOM 3647  H HE1  . TYR A 1 35  ? 4.248   -7.458  -0.225  1.00 1.33  ? 1542 TYR A HE1  2  
ATOM 3648  H HE2  . TYR A 1 35  ? 1.520   -4.209  0.142   1.00 0.96  ? 1542 TYR A HE2  2  
ATOM 3649  H HH   . TYR A 1 35  ? 3.049   -6.305  -2.023  1.00 1.19  ? 1542 TYR A HH   2  
ATOM 3650  N N    . SER A 1 36  ? 4.701   -7.711  4.673   1.00 0.90  ? 1543 SER A N    2  
ATOM 3651  C CA   . SER A 1 36  ? 6.114   -7.890  4.823   1.00 1.10  ? 1543 SER A CA   2  
ATOM 3652  C C    . SER A 1 36  ? 6.399   -8.616  6.153   1.00 1.18  ? 1543 SER A C    2  
ATOM 3653  O O    . SER A 1 36  ? 5.630   -8.523  7.121   1.00 1.13  ? 1543 SER A O    2  
ATOM 3654  C CB   . SER A 1 36  ? 6.738   -6.504  4.819   1.00 1.19  ? 1543 SER A CB   2  
ATOM 3655  O OG   . SER A 1 36  ? 6.299   -5.784  3.679   1.00 1.91  ? 1543 SER A OG   2  
ATOM 3656  H H    . SER A 1 36  ? 4.376   -6.788  4.727   1.00 0.88  ? 1543 SER A H    2  
ATOM 3657  H HA   . SER A 1 36  ? 6.465   -8.438  3.961   1.00 1.20  ? 1543 SER A HA   2  
ATOM 3658  H HB2  . SER A 1 36  ? 6.438   -5.966  5.706   1.00 1.38  ? 1543 SER A HB2  2  
ATOM 3659  H HB3  . SER A 1 36  ? 7.814   -6.587  4.785   1.00 1.60  ? 1543 SER A HB3  2  
ATOM 3660  H HG   . SER A 1 36  ? 6.834   -6.072  2.927   1.00 1.98  ? 1543 SER A HG   2  
ATOM 3661  N N    . LYS A 1 37  ? 7.520   -9.335  6.184   1.00 1.37  ? 1544 LYS A N    2  
ATOM 3662  C CA   . LYS A 1 37  ? 7.863   -10.223 7.273   1.00 1.50  ? 1544 LYS A CA   2  
ATOM 3663  C C    . LYS A 1 37  ? 8.055   -9.484  8.578   1.00 1.51  ? 1544 LYS A C    2  
ATOM 3664  O O    . LYS A 1 37  ? 7.866   -10.051 9.639   1.00 1.71  ? 1544 LYS A O    2  
ATOM 3665  C CB   . LYS A 1 37  ? 9.096   -11.063 6.903   1.00 1.70  ? 1544 LYS A CB   2  
ATOM 3666  C CG   . LYS A 1 37  ? 9.445   -12.165 7.897   1.00 2.05  ? 1544 LYS A CG   2  
ATOM 3667  C CD   . LYS A 1 37  ? 8.285   -13.156 8.158   1.00 2.36  ? 1544 LYS A CD   2  
ATOM 3668  C CE   . LYS A 1 37  ? 7.874   -14.007 6.935   1.00 2.99  ? 1544 LYS A CE   2  
ATOM 3669  N NZ   . LYS A 1 37  ? 7.127   -13.260 5.884   1.00 3.59  ? 1544 LYS A NZ   2  
ATOM 3670  H H    . LYS A 1 37  ? 8.168   -9.260  5.443   1.00 1.46  ? 1544 LYS A H    2  
ATOM 3671  H HA   . LYS A 1 37  ? 7.030   -10.899 7.400   1.00 1.56  ? 1544 LYS A HA   2  
ATOM 3672  H HB2  . LYS A 1 37  ? 8.920   -11.525 5.944   1.00 1.89  ? 1544 LYS A HB2  2  
ATOM 3673  H HB3  . LYS A 1 37  ? 9.946   -10.402 6.818   1.00 2.12  ? 1544 LYS A HB3  2  
ATOM 3674  H HG2  . LYS A 1 37  ? 10.286  -12.721 7.512   1.00 2.58  ? 1544 LYS A HG2  2  
ATOM 3675  H HG3  . LYS A 1 37  ? 9.726   -11.701 8.832   1.00 2.43  ? 1544 LYS A HG3  2  
ATOM 3676  H HD2  . LYS A 1 37  ? 8.585   -13.830 8.945   1.00 2.45  ? 1544 LYS A HD2  2  
ATOM 3677  H HD3  . LYS A 1 37  ? 7.431   -12.586 8.493   1.00 2.83  ? 1544 LYS A HD3  2  
ATOM 3678  H HE2  . LYS A 1 37  ? 8.769   -14.411 6.486   1.00 3.22  ? 1544 LYS A HE2  2  
ATOM 3679  H HE3  . LYS A 1 37  ? 7.264   -14.827 7.286   1.00 3.43  ? 1544 LYS A HE3  2  
ATOM 3680  H HZ1  . LYS A 1 37  ? 7.692   -12.531 5.397   1.00 3.96  ? 1544 LYS A HZ1  2  
ATOM 3681  H HZ2  . LYS A 1 37  ? 6.288   -12.776 6.271   1.00 3.94  ? 1544 LYS A HZ2  2  
ATOM 3682  H HZ3  . LYS A 1 37  ? 6.765   -13.904 5.148   1.00 3.91  ? 1544 LYS A HZ3  2  
ATOM 3683  N N    . SER A 1 38  ? 8.435   -8.241  8.500   1.00 1.42  ? 1545 SER A N    2  
ATOM 3684  C CA   . SER A 1 38  ? 8.564   -7.442  9.639   1.00 1.49  ? 1545 SER A CA   2  
ATOM 3685  C C    . SER A 1 38  ? 7.683   -6.190  9.493   1.00 1.28  ? 1545 SER A C    2  
ATOM 3686  O O    . SER A 1 38  ? 8.044   -5.110  9.966   1.00 1.37  ? 1545 SER A O    2  
ATOM 3687  C CB   . SER A 1 38  ? 10.005  -7.037  9.742   1.00 1.81  ? 1545 SER A CB   2  
ATOM 3688  O OG   . SER A 1 38  ? 10.876  -8.164  9.728   1.00 2.46  ? 1545 SER A OG   2  
ATOM 3689  H H    . SER A 1 38  ? 8.712   -7.807  7.670   1.00 1.41  ? 1545 SER A H    2  
ATOM 3690  H HA   . SER A 1 38  ? 8.297   -8.005  10.521  1.00 1.69  ? 1545 SER A HA   2  
ATOM 3691  H HB2  . SER A 1 38  ? 10.250  -6.395  8.909   1.00 2.07  ? 1545 SER A HB2  2  
ATOM 3692  H HB3  . SER A 1 38  ? 10.127  -6.496  10.659  1.00 1.97  ? 1545 SER A HB3  2  
ATOM 3693  H HG   . SER A 1 38  ? 10.576  -8.812  10.387  1.00 2.81  ? 1545 SER A HG   2  
ATOM 3694  N N    . GLY A 1 39  ? 6.548   -6.316  8.825   1.00 1.20  ? 1546 GLY A N    2  
ATOM 3695  C CA   . GLY A 1 39  ? 5.732   -5.148  8.631   1.00 1.26  ? 1546 GLY A CA   2  
ATOM 3696  C C    . GLY A 1 39  ? 4.305   -5.422  8.238   1.00 0.99  ? 1546 GLY A C    2  
ATOM 3697  O O    . GLY A 1 39  ? 4.037   -6.188  7.312   1.00 1.08  ? 1546 GLY A O    2  
ATOM 3698  H H    . GLY A 1 39  ? 6.252   -7.182  8.470   1.00 1.22  ? 1546 GLY A H    2  
ATOM 3699  H HA2  . GLY A 1 39  ? 5.720   -4.585  9.552   1.00 1.36  ? 1546 GLY A HA2  2  
ATOM 3700  H HA3  . GLY A 1 39  ? 6.193   -4.537  7.868   1.00 1.68  ? 1546 GLY A HA3  2  
ATOM 3701  N N    . VAL A 1 40  ? 3.397   -4.785  8.936   1.00 0.79  ? 1547 VAL A N    2  
ATOM 3702  C CA   . VAL A 1 40  ? 1.987   -4.887  8.663   1.00 0.57  ? 1547 VAL A CA   2  
ATOM 3703  C C    . VAL A 1 40  ? 1.500   -3.549  8.158   1.00 0.49  ? 1547 VAL A C    2  
ATOM 3704  O O    . VAL A 1 40  ? 2.178   -2.514  8.346   1.00 0.56  ? 1547 VAL A O    2  
ATOM 3705  C CB   . VAL A 1 40  ? 1.168   -5.290  9.926   1.00 0.57  ? 1547 VAL A CB   2  
ATOM 3706  C CG1  . VAL A 1 40  ? 1.549   -6.679  10.389  1.00 0.64  ? 1547 VAL A CG1  2  
ATOM 3707  C CG2  . VAL A 1 40  ? 1.351   -4.282  11.063  1.00 0.73  ? 1547 VAL A CG2  2  
ATOM 3708  H H    . VAL A 1 40  ? 3.662   -4.170  9.655   1.00 0.89  ? 1547 VAL A H    2  
ATOM 3709  H HA   . VAL A 1 40  ? 1.844   -5.632  7.893   1.00 0.61  ? 1547 VAL A HA   2  
ATOM 3710  H HB   . VAL A 1 40  ? 0.124   -5.308  9.651   1.00 0.54  ? 1547 VAL A HB   2  
ATOM 3711  H HG11 . VAL A 1 40  ? 0.964   -6.937  11.259  1.00 1.12  ? 1547 VAL A HG11 2  
ATOM 3712  H HG12 . VAL A 1 40  ? 2.599   -6.698  10.640  1.00 1.08  ? 1547 VAL A HG12 2  
ATOM 3713  H HG13 . VAL A 1 40  ? 1.350   -7.388  9.599   1.00 1.31  ? 1547 VAL A HG13 2  
ATOM 3714  H HG21 . VAL A 1 40  ? 2.395   -4.238  11.339  1.00 1.24  ? 1547 VAL A HG21 2  
ATOM 3715  H HG22 . VAL A 1 40  ? 0.766   -4.589  11.918  1.00 1.22  ? 1547 VAL A HG22 2  
ATOM 3716  H HG23 . VAL A 1 40  ? 1.025   -3.307  10.732  1.00 1.38  ? 1547 VAL A HG23 2  
ATOM 3717  N N    . VAL A 1 41  ? 0.375   -3.550  7.511   1.00 0.42  ? 1548 VAL A N    2  
ATOM 3718  C CA   . VAL A 1 41  ? -0.172  -2.329  7.005   1.00 0.37  ? 1548 VAL A CA   2  
ATOM 3719  C C    . VAL A 1 41  ? -1.376  -1.902  7.842   1.00 0.32  ? 1548 VAL A C    2  
ATOM 3720  O O    . VAL A 1 41  ? -2.211  -2.740  8.227   1.00 0.35  ? 1548 VAL A O    2  
ATOM 3721  C CB   . VAL A 1 41  ? -0.535  -2.438  5.483   1.00 0.40  ? 1548 VAL A CB   2  
ATOM 3722  C CG1  . VAL A 1 41  ? -1.626  -3.450  5.207   1.00 0.58  ? 1548 VAL A CG1  2  
ATOM 3723  C CG2  . VAL A 1 41  ? -0.879  -1.082  4.888   1.00 0.57  ? 1548 VAL A CG2  2  
ATOM 3724  H H    . VAL A 1 41  ? -0.103  -4.397  7.375   1.00 0.46  ? 1548 VAL A H    2  
ATOM 3725  H HA   . VAL A 1 41  ? 0.594   -1.574  7.121   1.00 0.38  ? 1548 VAL A HA   2  
ATOM 3726  H HB   . VAL A 1 41  ? 0.352   -2.799  4.982   1.00 0.69  ? 1548 VAL A HB   2  
ATOM 3727  H HG11 . VAL A 1 41  ? -2.521  -3.169  5.741   1.00 1.21  ? 1548 VAL A HG11 2  
ATOM 3728  H HG12 . VAL A 1 41  ? -1.305  -4.427  5.539   1.00 1.21  ? 1548 VAL A HG12 2  
ATOM 3729  H HG13 . VAL A 1 41  ? -1.834  -3.479  4.147   1.00 1.23  ? 1548 VAL A HG13 2  
ATOM 3730  H HG21 . VAL A 1 41  ? -1.724  -0.655  5.405   1.00 1.17  ? 1548 VAL A HG21 2  
ATOM 3731  H HG22 . VAL A 1 41  ? -1.097  -1.202  3.836   1.00 1.24  ? 1548 VAL A HG22 2  
ATOM 3732  H HG23 . VAL A 1 41  ? -0.013  -0.444  5.008   1.00 1.17  ? 1548 VAL A HG23 2  
ATOM 3733  N N    . TYR A 1 42  ? -1.411  -0.634  8.174   1.00 0.31  ? 1549 TYR A N    2  
ATOM 3734  C CA   . TYR A 1 42  ? -2.506  -0.034  8.879   1.00 0.31  ? 1549 TYR A CA   2  
ATOM 3735  C C    . TYR A 1 42  ? -3.454  0.534   7.888   1.00 0.29  ? 1549 TYR A C    2  
ATOM 3736  O O    . TYR A 1 42  ? -3.044  1.227   6.944   1.00 0.37  ? 1549 TYR A O    2  
ATOM 3737  C CB   . TYR A 1 42  ? -2.059  1.103   9.810   1.00 0.40  ? 1549 TYR A CB   2  
ATOM 3738  C CG   . TYR A 1 42  ? -1.268  0.692   11.022  1.00 0.53  ? 1549 TYR A CG   2  
ATOM 3739  C CD1  . TYR A 1 42  ? -1.865  0.016   12.076  1.00 0.59  ? 1549 TYR A CD1  2  
ATOM 3740  C CD2  . TYR A 1 42  ? 0.093   0.952   11.095  1.00 0.70  ? 1549 TYR A CD2  2  
ATOM 3741  C CE1  . TYR A 1 42  ? -1.123  -0.393  13.168  1.00 0.76  ? 1549 TYR A CE1  2  
ATOM 3742  C CE2  . TYR A 1 42  ? 0.837   0.556   12.182  1.00 0.87  ? 1549 TYR A CE2  2  
ATOM 3743  C CZ   . TYR A 1 42  ? 0.154   -0.017  13.297  1.00 0.88  ? 1549 TYR A CZ   2  
ATOM 3744  O OH   . TYR A 1 42  ? 0.978   -0.536  14.293  1.00 1.08  ? 1549 TYR A OH   2  
ATOM 3745  H H    . TYR A 1 42  ? -0.672  -0.047  7.893   1.00 0.32  ? 1549 TYR A H    2  
ATOM 3746  H HA   . TYR A 1 42  ? -3.022  -0.780  9.458   1.00 0.34  ? 1549 TYR A HA   2  
ATOM 3747  H HB2  . TYR A 1 42  ? -1.445  1.793   9.251   1.00 0.46  ? 1549 TYR A HB2  2  
ATOM 3748  H HB3  . TYR A 1 42  ? -2.941  1.629   10.151  1.00 0.39  ? 1549 TYR A HB3  2  
ATOM 3749  H HD1  . TYR A 1 42  ? -2.923  -0.194  12.034  1.00 0.57  ? 1549 TYR A HD1  2  
ATOM 3750  H HD2  . TYR A 1 42  ? 0.568   1.481   10.282  1.00 0.77  ? 1549 TYR A HD2  2  
ATOM 3751  H HE1  . TYR A 1 42  ? -1.602  -0.918  13.981  1.00 0.86  ? 1549 TYR A HE1  2  
ATOM 3752  H HE2  . TYR A 1 42  ? 1.896   0.769   12.221  1.00 1.03  ? 1549 TYR A HE2  2  
ATOM 3753  H HH   . TYR A 1 42  ? 0.809   -1.494  14.346  1.00 1.29  ? 1549 TYR A HH   2  
ATOM 3754  N N    . MET A 1 43  ? -4.688  0.224   8.059   1.00 0.26  ? 1550 MET A N    2  
ATOM 3755  C CA   . MET A 1 43  ? -5.711  0.779   7.230   1.00 0.25  ? 1550 MET A CA   2  
ATOM 3756  C C    . MET A 1 43  ? -6.913  1.181   8.040   1.00 0.29  ? 1550 MET A C    2  
ATOM 3757  O O    . MET A 1 43  ? -7.326  0.466   8.959   1.00 0.40  ? 1550 MET A O    2  
ATOM 3758  C CB   . MET A 1 43  ? -6.133  -0.151  6.098   1.00 0.32  ? 1550 MET A CB   2  
ATOM 3759  C CG   . MET A 1 43  ? -6.693  -1.506  6.519   1.00 0.35  ? 1550 MET A CG   2  
ATOM 3760  S SD   . MET A 1 43  ? -7.481  -2.363  5.149   1.00 0.78  ? 1550 MET A SD   2  
ATOM 3761  C CE   . MET A 1 43  ? -6.131  -2.407  3.986   1.00 0.62  ? 1550 MET A CE   2  
ATOM 3762  H H    . MET A 1 43  ? -4.908  -0.416  8.770   1.00 0.32  ? 1550 MET A H    2  
ATOM 3763  H HA   . MET A 1 43  ? -5.298  1.676   6.792   1.00 0.24  ? 1550 MET A HA   2  
ATOM 3764  H HB2  . MET A 1 43  ? -6.905  0.361   5.550   1.00 0.38  ? 1550 MET A HB2  2  
ATOM 3765  H HB3  . MET A 1 43  ? -5.281  -0.317  5.454   1.00 0.35  ? 1550 MET A HB3  2  
ATOM 3766  H HG2  . MET A 1 43  ? -5.886  -2.132  6.869   1.00 0.45  ? 1550 MET A HG2  2  
ATOM 3767  H HG3  . MET A 1 43  ? -7.418  -1.369  7.307   1.00 0.48  ? 1550 MET A HG3  2  
ATOM 3768  H HE1  . MET A 1 43  ? -5.836  -1.389  3.778   1.00 1.20  ? 1550 MET A HE1  2  
ATOM 3769  H HE2  . MET A 1 43  ? -6.454  -2.893  3.077   1.00 1.14  ? 1550 MET A HE2  2  
ATOM 3770  H HE3  . MET A 1 43  ? -5.304  -2.941  4.429   1.00 1.47  ? 1550 MET A HE3  2  
ATOM 3771  N N    . SER A 1 44  ? -7.432  2.320   7.727   1.00 0.28  ? 1551 SER A N    2  
ATOM 3772  C CA   . SER A 1 44  ? -8.618  2.832   8.333   1.00 0.31  ? 1551 SER A CA   2  
ATOM 3773  C C    . SER A 1 44  ? -9.697  2.990   7.259   1.00 0.30  ? 1551 SER A C    2  
ATOM 3774  O O    . SER A 1 44  ? -9.544  3.787   6.321   1.00 0.36  ? 1551 SER A O    2  
ATOM 3775  C CB   . SER A 1 44  ? -8.293  4.159   9.011   1.00 0.34  ? 1551 SER A CB   2  
ATOM 3776  O OG   . SER A 1 44  ? -7.539  4.992   8.138   1.00 0.97  ? 1551 SER A OG   2  
ATOM 3777  H H    . SER A 1 44  ? -6.983  2.877   7.051   1.00 0.30  ? 1551 SER A H    2  
ATOM 3778  H HA   . SER A 1 44  ? -8.941  2.121   9.080   1.00 0.34  ? 1551 SER A HA   2  
ATOM 3779  H HB2  . SER A 1 44  ? -9.210  4.666   9.272   1.00 0.61  ? 1551 SER A HB2  2  
ATOM 3780  H HB3  . SER A 1 44  ? -7.713  3.976   9.904   1.00 0.73  ? 1551 SER A HB3  2  
ATOM 3781  H HG   . SER A 1 44  ? -8.150  5.565   7.655   1.00 1.40  ? 1551 SER A HG   2  
ATOM 3782  N N    . ILE A 1 45  ? -10.752 2.210   7.362   1.00 0.30  ? 1552 ILE A N    2  
ATOM 3783  C CA   . ILE A 1 45  ? -11.816 2.238   6.375   1.00 0.32  ? 1552 ILE A CA   2  
ATOM 3784  C C    . ILE A 1 45  ? -12.709 3.454   6.604   1.00 0.36  ? 1552 ILE A C    2  
ATOM 3785  O O    . ILE A 1 45  ? -13.277 3.612   7.694   1.00 0.42  ? 1552 ILE A O    2  
ATOM 3786  C CB   . ILE A 1 45  ? -12.672 0.934   6.421   1.00 0.37  ? 1552 ILE A CB   2  
ATOM 3787  C CG1  . ILE A 1 45  ? -11.788 -0.321  6.227   1.00 0.39  ? 1552 ILE A CG1  2  
ATOM 3788  C CG2  . ILE A 1 45  ? -13.793 0.969   5.383   1.00 0.37  ? 1552 ILE A CG2  2  
ATOM 3789  C CD1  . ILE A 1 45  ? -11.036 -0.364  4.908   1.00 0.35  ? 1552 ILE A CD1  2  
ATOM 3790  H H    . ILE A 1 45  ? -10.842 1.595   8.118   1.00 0.36  ? 1552 ILE A H    2  
ATOM 3791  H HA   . ILE A 1 45  ? -11.364 2.326   5.399   1.00 0.30  ? 1552 ILE A HA   2  
ATOM 3792  H HB   . ILE A 1 45  ? -13.136 0.880   7.395   1.00 0.42  ? 1552 ILE A HB   2  
ATOM 3793  H HG12 . ILE A 1 45  ? -11.056 -0.358  7.019   1.00 0.42  ? 1552 ILE A HG12 2  
ATOM 3794  H HG13 . ILE A 1 45  ? -12.414 -1.200  6.285   1.00 0.45  ? 1552 ILE A HG13 2  
ATOM 3795  H HG21 . ILE A 1 45  ? -14.364 0.054   5.437   1.00 1.09  ? 1552 ILE A HG21 2  
ATOM 3796  H HG22 . ILE A 1 45  ? -13.363 1.075   4.398   1.00 1.11  ? 1552 ILE A HG22 2  
ATOM 3797  H HG23 . ILE A 1 45  ? -14.438 1.811   5.584   1.00 1.04  ? 1552 ILE A HG23 2  
ATOM 3798  H HD11 . ILE A 1 45  ? -10.406 -1.239  4.855   1.00 0.98  ? 1552 ILE A HD11 2  
ATOM 3799  H HD12 . ILE A 1 45  ? -10.418 0.516   4.836   1.00 1.05  ? 1552 ILE A HD12 2  
ATOM 3800  H HD13 . ILE A 1 45  ? -11.741 -0.373  4.091   1.00 1.09  ? 1552 ILE A HD13 2  
ATOM 3801  N N    . CYS A 1 46  ? -12.776 4.325   5.592   1.00 0.38  ? 1553 CYS A N    2  
ATOM 3802  C CA   . CYS A 1 46  ? -13.622 5.526   5.615   1.00 0.48  ? 1553 CYS A CA   2  
ATOM 3803  C C    . CYS A 1 46  ? -13.165 6.493   6.700   1.00 0.47  ? 1553 CYS A C    2  
ATOM 3804  O O    . CYS A 1 46  ? -13.975 7.046   7.451   1.00 0.69  ? 1553 CYS A O    2  
ATOM 3805  C CB   . CYS A 1 46  ? -15.110 5.163   5.805   1.00 0.60  ? 1553 CYS A CB   2  
ATOM 3806  S SG   . CYS A 1 46  ? -15.814 4.115   4.488   1.00 1.40  ? 1553 CYS A SG   2  
ATOM 3807  H H    . CYS A 1 46  ? -12.210 4.171   4.802   1.00 0.36  ? 1553 CYS A H    2  
ATOM 3808  H HA   . CYS A 1 46  ? -13.505 6.015   4.658   1.00 0.53  ? 1553 CYS A HA   2  
ATOM 3809  H HB2  . CYS A 1 46  ? -15.224 4.630   6.738   1.00 0.94  ? 1553 CYS A HB2  2  
ATOM 3810  H HB3  . CYS A 1 46  ? -15.688 6.076   5.848   1.00 1.11  ? 1553 CYS A HB3  2  
ATOM 3811  N N    . GLY A 1 47  ? -11.879 6.691   6.787   1.00 0.34  ? 1554 GLY A N    2  
ATOM 3812  C CA   . GLY A 1 47  ? -11.346 7.566   7.788   1.00 0.35  ? 1554 GLY A CA   2  
ATOM 3813  C C    . GLY A 1 47  ? -9.851  7.547   7.785   1.00 0.30  ? 1554 GLY A C    2  
ATOM 3814  O O    . GLY A 1 47  ? -9.244  6.828   6.978   1.00 0.31  ? 1554 GLY A O    2  
ATOM 3815  H H    . GLY A 1 47  ? -11.270 6.245   6.160   1.00 0.35  ? 1554 GLY A H    2  
ATOM 3816  H HA2  . GLY A 1 47  ? -11.688 8.572   7.596   1.00 0.40  ? 1554 GLY A HA2  2  
ATOM 3817  H HA3  . GLY A 1 47  ? -11.701 7.251   8.757   1.00 0.38  ? 1554 GLY A HA3  2  
ATOM 3818  N N    . GLU A 1 48  ? -9.252  8.307   8.672   1.00 0.31  ? 1555 GLU A N    2  
ATOM 3819  C CA   . GLU A 1 48  ? -7.807  8.389   8.754   1.00 0.30  ? 1555 GLU A CA   2  
ATOM 3820  C C    . GLU A 1 48  ? -7.292  7.603   9.950   1.00 0.32  ? 1555 GLU A C    2  
ATOM 3821  O O    . GLU A 1 48  ? -8.043  7.313   10.879  1.00 0.42  ? 1555 GLU A O    2  
ATOM 3822  C CB   . GLU A 1 48  ? -7.333  9.855   8.807   1.00 0.36  ? 1555 GLU A CB   2  
ATOM 3823  C CG   . GLU A 1 48  ? -7.791  10.641  10.022  1.00 0.47  ? 1555 GLU A CG   2  
ATOM 3824  C CD   . GLU A 1 48  ? -7.371  12.088  9.952   1.00 0.93  ? 1555 GLU A CD   2  
ATOM 3825  O OE1  . GLU A 1 48  ? -8.057  12.903  9.284   1.00 0.89  ? 1555 GLU A OE1  2  
ATOM 3826  O OE2  . GLU A 1 48  ? -6.337  12.435  10.565  1.00 1.62  ? 1555 GLU A OE2  2  
ATOM 3827  H H    . GLU A 1 48  ? -9.804  8.811   9.313   1.00 0.39  ? 1555 GLU A H    2  
ATOM 3828  H HA   . GLU A 1 48  ? -7.411  7.929   7.858   1.00 0.28  ? 1555 GLU A HA   2  
ATOM 3829  H HB2  . GLU A 1 48  ? -6.254  9.884   8.781   1.00 0.37  ? 1555 GLU A HB2  2  
ATOM 3830  H HB3  . GLU A 1 48  ? -7.706  10.357  7.927   1.00 0.39  ? 1555 GLU A HB3  2  
ATOM 3831  H HG2  . GLU A 1 48  ? -8.868  10.592  10.085  1.00 0.72  ? 1555 GLU A HG2  2  
ATOM 3832  H HG3  . GLU A 1 48  ? -7.358  10.197  10.906  1.00 0.77  ? 1555 GLU A HG3  2  
ATOM 3833  N N    . ASN A 1 49  ? -6.044  7.238   9.898   1.00 0.31  ? 1556 ASN A N    2  
ATOM 3834  C CA   . ASN A 1 49  ? -5.399  6.504   10.957  1.00 0.38  ? 1556 ASN A CA   2  
ATOM 3835  C C    . ASN A 1 49  ? -4.234  7.354   11.492  1.00 0.41  ? 1556 ASN A C    2  
ATOM 3836  O O    . ASN A 1 49  ? -3.239  7.563   10.780  1.00 0.46  ? 1556 ASN A O    2  
ATOM 3837  C CB   . ASN A 1 49  ? -4.877  5.175   10.392  1.00 0.42  ? 1556 ASN A CB   2  
ATOM 3838  C CG   . ASN A 1 49  ? -4.285  4.272   11.443  1.00 0.58  ? 1556 ASN A CG   2  
ATOM 3839  O OD1  . ASN A 1 49  ? -3.105  4.345   11.741  1.00 0.83  ? 1556 ASN A OD1  2  
ATOM 3840  N ND2  . ASN A 1 49  ? -5.091  3.407   12.001  1.00 0.87  ? 1556 ASN A ND2  2  
ATOM 3841  H H    . ASN A 1 49  ? -5.532  7.453   9.086   1.00 0.32  ? 1556 ASN A H    2  
ATOM 3842  H HA   . ASN A 1 49  ? -6.139  6.305   11.719  1.00 0.45  ? 1556 ASN A HA   2  
ATOM 3843  H HB2  . ASN A 1 49  ? -5.698  4.648   9.926   1.00 0.45  ? 1556 ASN A HB2  2  
ATOM 3844  H HB3  . ASN A 1 49  ? -4.124  5.380   9.646   1.00 0.40  ? 1556 ASN A HB3  2  
ATOM 3845  H HD21 . ASN A 1 49  ? -6.025  3.411   11.691  1.00 1.12  ? 1556 ASN A HD21 2  
ATOM 3846  H HD22 . ASN A 1 49  ? -4.758  2.791   12.695  1.00 1.00  ? 1556 ASN A HD22 2  
ATOM 3847  N N    . GLU A 1 50  ? -4.348  7.856   12.727  1.00 0.57  ? 1557 GLU A N    2  
ATOM 3848  C CA   . GLU A 1 50  ? -3.368  8.796   13.311  1.00 0.67  ? 1557 GLU A CA   2  
ATOM 3849  C C    . GLU A 1 50  ? -2.007  8.168   13.625  1.00 0.62  ? 1557 GLU A C    2  
ATOM 3850  O O    . GLU A 1 50  ? -1.128  8.837   14.160  1.00 0.74  ? 1557 GLU A O    2  
ATOM 3851  C CB   . GLU A 1 50  ? -3.891  9.477   14.587  1.00 0.95  ? 1557 GLU A CB   2  
ATOM 3852  C CG   . GLU A 1 50  ? -5.260  10.115  14.473  1.00 1.65  ? 1557 GLU A CG   2  
ATOM 3853  C CD   . GLU A 1 50  ? -6.359  9.173   14.869  1.00 2.05  ? 1557 GLU A CD   2  
ATOM 3854  O OE1  . GLU A 1 50  ? -6.704  8.268   14.092  1.00 2.40  ? 1557 GLU A OE1  2  
ATOM 3855  O OE2  . GLU A 1 50  ? -6.846  9.279   16.007  1.00 2.49  ? 1557 GLU A OE2  2  
ATOM 3856  H H    . GLU A 1 50  ? -5.137  7.644   13.278  1.00 0.70  ? 1557 GLU A H    2  
ATOM 3857  H HA   . GLU A 1 50  ? -3.221  9.571   12.571  1.00 0.71  ? 1557 GLU A HA   2  
ATOM 3858  H HB2  . GLU A 1 50  ? -3.940  8.738   15.373  1.00 1.22  ? 1557 GLU A HB2  2  
ATOM 3859  H HB3  . GLU A 1 50  ? -3.183  10.240  14.877  1.00 1.40  ? 1557 GLU A HB3  2  
ATOM 3860  H HG2  . GLU A 1 50  ? -5.291  10.975  15.122  1.00 2.11  ? 1557 GLU A HG2  2  
ATOM 3861  H HG3  . GLU A 1 50  ? -5.402  10.426  13.447  1.00 2.10  ? 1557 GLU A HG3  2  
ATOM 3862  N N    . ASN A 1 51  ? -1.817  6.903   13.302  1.00 0.56  ? 1558 ASN A N    2  
ATOM 3863  C CA   . ASN A 1 51  ? -0.515  6.260   13.560  1.00 0.62  ? 1558 ASN A CA   2  
ATOM 3864  C C    . ASN A 1 51  ? 0.500   6.708   12.525  1.00 0.54  ? 1558 ASN A C    2  
ATOM 3865  O O    . ASN A 1 51  ? 1.713   6.541   12.698  1.00 0.68  ? 1558 ASN A O    2  
ATOM 3866  C CB   . ASN A 1 51  ? -0.573  4.711   13.574  1.00 0.79  ? 1558 ASN A CB   2  
ATOM 3867  C CG   . ASN A 1 51  ? -1.426  4.108   14.684  1.00 0.87  ? 1558 ASN A CG   2  
ATOM 3868  O OD1  . ASN A 1 51  ? -0.962  3.921   15.811  1.00 1.38  ? 1558 ASN A OD1  2  
ATOM 3869  N ND2  . ASN A 1 51  ? -2.635  3.744   14.361  1.00 0.85  ? 1558 ASN A ND2  2  
ATOM 3870  H H    . ASN A 1 51  ? -2.565  6.427   12.883  1.00 0.56  ? 1558 ASN A H    2  
ATOM 3871  H HA   . ASN A 1 51  ? -0.180  6.613   14.523  1.00 0.71  ? 1558 ASN A HA   2  
ATOM 3872  H HB2  . ASN A 1 51  ? -0.975  4.370   12.632  1.00 1.20  ? 1558 ASN A HB2  2  
ATOM 3873  H HB3  . ASN A 1 51  ? 0.435   4.333   13.672  1.00 1.02  ? 1558 ASN A HB3  2  
ATOM 3874  H HD21 . ASN A 1 51  ? -2.913  3.891   13.427  1.00 0.93  ? 1558 ASN A HD21 2  
ATOM 3875  H HD22 . ASN A 1 51  ? -3.206  3.312   15.043  1.00 1.10  ? 1558 ASN A HD22 2  
ATOM 3876  N N    . CYS A 1 52  ? 0.011   7.277   11.461  1.00 0.44  ? 1559 CYS A N    2  
ATOM 3877  C CA   . CYS A 1 52  ? 0.843   7.727   10.375  1.00 0.41  ? 1559 CYS A CA   2  
ATOM 3878  C C    . CYS A 1 52  ? 0.452   9.159   9.962   1.00 0.39  ? 1559 CYS A C    2  
ATOM 3879  O O    . CYS A 1 52  ? -0.515  9.677   10.530  1.00 0.42  ? 1559 CYS A O    2  
ATOM 3880  C CB   . CYS A 1 52  ? 0.704   6.754   9.210   1.00 0.42  ? 1559 CYS A CB   2  
ATOM 3881  S SG   . CYS A 1 52  ? 1.262   5.067   9.567   1.00 1.21  ? 1559 CYS A SG   2  
ATOM 3882  H H    . CYS A 1 52  ? -0.959  7.418   11.401  1.00 0.46  ? 1559 CYS A H    2  
ATOM 3883  H HA   . CYS A 1 52  ? 1.869   7.726   10.715  1.00 0.46  ? 1559 CYS A HA   2  
ATOM 3884  H HB2  . CYS A 1 52  ? -0.335  6.696   8.921   1.00 0.83  ? 1559 CYS A HB2  2  
ATOM 3885  H HB3  . CYS A 1 52  ? 1.281   7.123   8.375   1.00 0.94  ? 1559 CYS A HB3  2  
ATOM 3886  N N    . PRO A 1 53  ? 1.215   9.824   9.000   1.00 0.45  ? 1560 PRO A N    2  
ATOM 3887  C CA   . PRO A 1 53  ? 0.948   11.189  8.480   1.00 0.49  ? 1560 PRO A CA   2  
ATOM 3888  C C    . PRO A 1 53  ? -0.535  11.608  8.500   1.00 0.41  ? 1560 PRO A C    2  
ATOM 3889  O O    . PRO A 1 53  ? -1.400  10.873  8.026   1.00 0.42  ? 1560 PRO A O    2  
ATOM 3890  C CB   . PRO A 1 53  ? 1.443   11.082  7.025   1.00 0.57  ? 1560 PRO A CB   2  
ATOM 3891  C CG   . PRO A 1 53  ? 2.302   9.842   6.961   1.00 0.71  ? 1560 PRO A CG   2  
ATOM 3892  C CD   . PRO A 1 53  ? 2.432   9.321   8.365   1.00 0.58  ? 1560 PRO A CD   2  
ATOM 3893  H HA   . PRO A 1 53  ? 1.541   11.931  8.994   1.00 0.57  ? 1560 PRO A HA   2  
ATOM 3894  H HB2  . PRO A 1 53  ? 0.592   11.003  6.365   1.00 0.61  ? 1560 PRO A HB2  2  
ATOM 3895  H HB3  . PRO A 1 53  ? 2.013   11.965  6.774   1.00 0.69  ? 1560 PRO A HB3  2  
ATOM 3896  H HG2  . PRO A 1 53  ? 1.822   9.103   6.337   1.00 0.90  ? 1560 PRO A HG2  2  
ATOM 3897  H HG3  . PRO A 1 53  ? 3.273   10.093  6.561   1.00 0.98  ? 1560 PRO A HG3  2  
ATOM 3898  H HD2  . PRO A 1 53  ? 2.459   8.242   8.368   1.00 0.61  ? 1560 PRO A HD2  2  
ATOM 3899  H HD3  . PRO A 1 53  ? 3.314   9.726   8.840   1.00 0.70  ? 1560 PRO A HD3  2  
ATOM 3900  N N    . PRO A 1 54  ? -0.820  12.797  9.081   1.00 0.47  ? 1561 PRO A N    2  
ATOM 3901  C CA   . PRO A 1 54  ? -2.183  13.346  9.242   1.00 0.46  ? 1561 PRO A CA   2  
ATOM 3902  C C    . PRO A 1 54  ? -3.071  13.196  8.003   1.00 0.41  ? 1561 PRO A C    2  
ATOM 3903  O O    . PRO A 1 54  ? -2.729  13.680  6.906   1.00 0.46  ? 1561 PRO A O    2  
ATOM 3904  C CB   . PRO A 1 54  ? -1.923  14.822  9.517   1.00 0.56  ? 1561 PRO A CB   2  
ATOM 3905  C CG   . PRO A 1 54  ? -0.622  14.839  10.227  1.00 0.80  ? 1561 PRO A CG   2  
ATOM 3906  C CD   . PRO A 1 54  ? 0.191   13.713  9.648   1.00 0.63  ? 1561 PRO A CD   2  
ATOM 3907  H HA   . PRO A 1 54  ? -2.680  12.912  10.097  1.00 0.48  ? 1561 PRO A HA   2  
ATOM 3908  H HB2  . PRO A 1 54  ? -1.875  15.361  8.582   1.00 0.66  ? 1561 PRO A HB2  2  
ATOM 3909  H HB3  . PRO A 1 54  ? -2.713  15.224  10.134  1.00 0.66  ? 1561 PRO A HB3  2  
ATOM 3910  H HG2  . PRO A 1 54  ? -0.126  15.784  10.060  1.00 1.15  ? 1561 PRO A HG2  2  
ATOM 3911  H HG3  . PRO A 1 54  ? -0.781  14.679  11.284  1.00 1.13  ? 1561 PRO A HG3  2  
ATOM 3912  H HD2  . PRO A 1 54  ? 0.850   14.082  8.875   1.00 0.78  ? 1561 PRO A HD2  2  
ATOM 3913  H HD3  . PRO A 1 54  ? 0.760   13.222  10.423  1.00 0.77  ? 1561 PRO A HD3  2  
ATOM 3914  N N    . GLY A 1 55  ? -4.175  12.491  8.176   1.00 0.41  ? 1562 GLY A N    2  
ATOM 3915  C CA   . GLY A 1 55  ? -5.131  12.322  7.117   1.00 0.46  ? 1562 GLY A CA   2  
ATOM 3916  C C    . GLY A 1 55  ? -4.830  11.143  6.220   1.00 0.38  ? 1562 GLY A C    2  
ATOM 3917  O O    . GLY A 1 55  ? -5.279  11.105  5.086   1.00 0.45  ? 1562 GLY A O    2  
ATOM 3918  H H    . GLY A 1 55  ? -4.346  12.077  9.049   1.00 0.44  ? 1562 GLY A H    2  
ATOM 3919  H HA2  . GLY A 1 55  ? -6.108  12.181  7.554   1.00 0.55  ? 1562 GLY A HA2  2  
ATOM 3920  H HA3  . GLY A 1 55  ? -5.145  13.221  6.518   1.00 0.54  ? 1562 GLY A HA3  2  
ATOM 3921  N N    . VAL A 1 56  ? -4.102  10.168  6.710   1.00 0.35  ? 1563 VAL A N    2  
ATOM 3922  C CA   . VAL A 1 56  ? -3.763  9.025   5.881   1.00 0.37  ? 1563 VAL A CA   2  
ATOM 3923  C C    . VAL A 1 56  ? -4.675  7.847   6.223   1.00 0.27  ? 1563 VAL A C    2  
ATOM 3924  O O    . VAL A 1 56  ? -5.074  7.678   7.374   1.00 0.28  ? 1563 VAL A O    2  
ATOM 3925  C CB   . VAL A 1 56  ? -2.268  8.617   6.033   1.00 0.53  ? 1563 VAL A CB   2  
ATOM 3926  C CG1  . VAL A 1 56  ? -1.994  7.890   7.334   1.00 0.68  ? 1563 VAL A CG1  2  
ATOM 3927  C CG2  . VAL A 1 56  ? -1.801  7.813   4.853   1.00 0.98  ? 1563 VAL A CG2  2  
ATOM 3928  H H    . VAL A 1 56  ? -3.804  10.205  7.645   1.00 0.42  ? 1563 VAL A H    2  
ATOM 3929  H HA   . VAL A 1 56  ? -3.949  9.309   4.855   1.00 0.48  ? 1563 VAL A HA   2  
ATOM 3930  H HB   . VAL A 1 56  ? -1.693  9.531   6.060   1.00 1.09  ? 1563 VAL A HB   2  
ATOM 3931  H HG11 . VAL A 1 56  ? -2.247  8.533   8.163   1.00 1.27  ? 1563 VAL A HG11 2  
ATOM 3932  H HG12 . VAL A 1 56  ? -0.951  7.618   7.381   1.00 1.22  ? 1563 VAL A HG12 2  
ATOM 3933  H HG13 . VAL A 1 56  ? -2.606  7.000   7.368   1.00 1.34  ? 1563 VAL A HG13 2  
ATOM 3934  H HG21 . VAL A 1 56  ? -2.336  6.876   4.821   1.00 1.53  ? 1563 VAL A HG21 2  
ATOM 3935  H HG22 . VAL A 1 56  ? -0.737  7.646   4.916   1.00 1.50  ? 1563 VAL A HG22 2  
ATOM 3936  H HG23 . VAL A 1 56  ? -2.013  8.367   3.951   1.00 1.48  ? 1563 VAL A HG23 2  
ATOM 3937  N N    . GLY A 1 57  ? -5.031  7.078   5.217   1.00 0.25  ? 1564 GLY A N    2  
ATOM 3938  C CA   . GLY A 1 57  ? -5.890  5.930   5.417   1.00 0.25  ? 1564 GLY A CA   2  
ATOM 3939  C C    . GLY A 1 57  ? -5.148  4.600   5.329   1.00 0.24  ? 1564 GLY A C    2  
ATOM 3940  O O    . GLY A 1 57  ? -5.555  3.627   5.951   1.00 0.28  ? 1564 GLY A O    2  
ATOM 3941  H H    . GLY A 1 57  ? -4.711  7.299   4.315   1.00 0.28  ? 1564 GLY A H    2  
ATOM 3942  H HA2  . GLY A 1 57  ? -6.344  6.006   6.393   1.00 0.27  ? 1564 GLY A HA2  2  
ATOM 3943  H HA3  . GLY A 1 57  ? -6.671  5.941   4.671   1.00 0.29  ? 1564 GLY A HA3  2  
ATOM 3944  N N    . ALA A 1 58  ? -4.091  4.545   4.531   1.00 0.23  ? 1565 ALA A N    2  
ATOM 3945  C CA   . ALA A 1 58  ? -3.292  3.344   4.389   1.00 0.24  ? 1565 ALA A CA   2  
ATOM 3946  C C    . ALA A 1 58  ? -1.820  3.672   4.610   1.00 0.23  ? 1565 ALA A C    2  
ATOM 3947  O O    . ALA A 1 58  ? -1.281  4.619   4.003   1.00 0.23  ? 1565 ALA A O    2  
ATOM 3948  C CB   . ALA A 1 58  ? -3.491  2.749   3.011   1.00 0.28  ? 1565 ALA A CB   2  
ATOM 3949  H H    . ALA A 1 58  ? -3.823  5.319   3.993   1.00 0.24  ? 1565 ALA A H    2  
ATOM 3950  H HA   . ALA A 1 58  ? -3.616  2.628   5.129   1.00 0.26  ? 1565 ALA A HA   2  
ATOM 3951  H HB1  . ALA A 1 58  ? -3.198  3.487   2.276   1.00 1.01  ? 1565 ALA A HB1  2  
ATOM 3952  H HB2  . ALA A 1 58  ? -4.525  2.478   2.870   1.00 1.08  ? 1565 ALA A HB2  2  
ATOM 3953  H HB3  . ALA A 1 58  ? -2.867  1.875   2.905   1.00 0.96  ? 1565 ALA A HB3  2  
ATOM 3954  N N    . CYS A 1 59  ? -1.172  2.904   5.454   1.00 0.26  ? 1566 CYS A N    2  
ATOM 3955  C CA   . CYS A 1 59  ? 0.215   3.143   5.812   1.00 0.28  ? 1566 CYS A CA   2  
ATOM 3956  C C    . CYS A 1 59  ? 0.880   1.872   6.337   1.00 0.33  ? 1566 CYS A C    2  
ATOM 3957  O O    . CYS A 1 59  ? 0.252   1.105   7.042   1.00 0.37  ? 1566 CYS A O    2  
ATOM 3958  C CB   . CYS A 1 59  ? 0.236   4.203   6.902   1.00 0.32  ? 1566 CYS A CB   2  
ATOM 3959  S SG   . CYS A 1 59  ? 1.823   4.416   7.748   1.00 0.43  ? 1566 CYS A SG   2  
ATOM 3960  H H    . CYS A 1 59  ? -1.641  2.152   5.884   1.00 0.29  ? 1566 CYS A H    2  
ATOM 3961  H HA   . CYS A 1 59  ? 0.733   3.534   4.950   1.00 0.30  ? 1566 CYS A HA   2  
ATOM 3962  H HB2  . CYS A 1 59  ? -0.016  5.157   6.468   1.00 0.36  ? 1566 CYS A HB2  2  
ATOM 3963  H HB3  . CYS A 1 59  ? -0.506  3.952   7.646   1.00 0.38  ? 1566 CYS A HB3  2  
ATOM 3964  N N    . PHE A 1 60  ? 2.140   1.639   5.982   1.00 0.39  ? 1567 PHE A N    2  
ATOM 3965  C CA   . PHE A 1 60  ? 2.872   0.498   6.530   1.00 0.48  ? 1567 PHE A CA   2  
ATOM 3966  C C    . PHE A 1 60  ? 3.545   0.931   7.848   1.00 0.61  ? 1567 PHE A C    2  
ATOM 3967  O O    . PHE A 1 60  ? 4.139   2.016   7.911   1.00 0.63  ? 1567 PHE A O    2  
ATOM 3968  C CB   . PHE A 1 60  ? 3.909   -0.045  5.539   1.00 0.59  ? 1567 PHE A CB   2  
ATOM 3969  C CG   . PHE A 1 60  ? 3.311   -0.511  4.249   1.00 0.61  ? 1567 PHE A CG   2  
ATOM 3970  C CD1  . PHE A 1 60  ? 2.542   -1.654  4.209   1.00 0.73  ? 1567 PHE A CD1  2  
ATOM 3971  C CD2  . PHE A 1 60  ? 3.506   0.199   3.088   1.00 0.86  ? 1567 PHE A CD2  2  
ATOM 3972  C CE1  . PHE A 1 60  ? 1.974   -2.080  3.030   1.00 0.91  ? 1567 PHE A CE1  2  
ATOM 3973  C CE2  . PHE A 1 60  ? 2.940   -0.218  1.904   1.00 1.03  ? 1567 PHE A CE2  2  
ATOM 3974  C CZ   . PHE A 1 60  ? 2.170   -1.360  1.876   1.00 0.99  ? 1567 PHE A CZ   2  
ATOM 3975  H H    . PHE A 1 60  ? 2.586   2.252   5.363   1.00 0.41  ? 1567 PHE A H    2  
ATOM 3976  H HA   . PHE A 1 60  ? 2.103   -0.241  6.705   1.00 0.46  ? 1567 PHE A HA   2  
ATOM 3977  H HB2  . PHE A 1 60  ? 4.648   0.710   5.316   1.00 0.71  ? 1567 PHE A HB2  2  
ATOM 3978  H HB3  . PHE A 1 60  ? 4.386   -0.900  5.991   1.00 0.69  ? 1567 PHE A HB3  2  
ATOM 3979  H HD1  . PHE A 1 60  ? 2.386   -2.221  5.115   1.00 0.87  ? 1567 PHE A HD1  2  
ATOM 3980  H HD2  . PHE A 1 60  ? 4.109   1.092   3.119   1.00 1.06  ? 1567 PHE A HD2  2  
ATOM 3981  H HE1  . PHE A 1 60  ? 1.370   -2.975  3.014   1.00 1.13  ? 1567 PHE A HE1  2  
ATOM 3982  H HE2  . PHE A 1 60  ? 3.110   0.348   1.000   1.00 1.30  ? 1567 PHE A HE2  2  
ATOM 3983  H HZ   . PHE A 1 60  ? 1.724   -1.691  0.951   1.00 1.18  ? 1567 PHE A HZ   2  
ATOM 3984  N N    . GLY A 1 61  ? 3.512   0.077   8.867   1.00 0.76  ? 1568 GLY A N    2  
ATOM 3985  C CA   . GLY A 1 61  ? 3.892   0.486   10.205  1.00 1.03  ? 1568 GLY A CA   2  
ATOM 3986  C C    . GLY A 1 61  ? 5.376   0.719   10.486  1.00 0.82  ? 1568 GLY A C    2  
ATOM 3987  O O    . GLY A 1 61  ? 5.703   1.228   11.549  1.00 1.13  ? 1568 GLY A O    2  
ATOM 3988  H H    . GLY A 1 61  ? 3.233   -0.861  8.753   1.00 0.72  ? 1568 GLY A H    2  
ATOM 3989  H HA2  . GLY A 1 61  ? 3.376   1.409   10.428  1.00 1.32  ? 1568 GLY A HA2  2  
ATOM 3990  H HA3  . GLY A 1 61  ? 3.525   -0.265  10.889  1.00 1.43  ? 1568 GLY A HA3  2  
ATOM 3991  N N    . GLN A 1 62  ? 6.278   0.378   9.588   1.00 0.83  ? 1569 GLN A N    2  
ATOM 3992  C CA   . GLN A 1 62  ? 7.689   0.543   9.931   1.00 1.01  ? 1569 GLN A CA   2  
ATOM 3993  C C    . GLN A 1 62  ? 8.164   1.989   9.768   1.00 0.89  ? 1569 GLN A C    2  
ATOM 3994  O O    . GLN A 1 62  ? 8.407   2.684   10.753  1.00 1.08  ? 1569 GLN A O    2  
ATOM 3995  C CB   . GLN A 1 62  ? 8.616   -0.355  9.148   1.00 1.47  ? 1569 GLN A CB   2  
ATOM 3996  C CG   . GLN A 1 62  ? 8.258   -1.821  9.079   1.00 1.83  ? 1569 GLN A CG   2  
ATOM 3997  C CD   . GLN A 1 62  ? 7.145   -2.082  8.100   1.00 2.05  ? 1569 GLN A CD   2  
ATOM 3998  O OE1  . GLN A 1 62  ? 5.967   -2.142  8.455   1.00 2.58  ? 1569 GLN A OE1  2  
ATOM 3999  N NE2  . GLN A 1 62  ? 7.494   -2.092  6.871   1.00 2.40  ? 1569 GLN A NE2  2  
ATOM 4000  H H    . GLN A 1 62  ? 5.996   -0.020  8.737   1.00 1.05  ? 1569 GLN A H    2  
ATOM 4001  H HA   . GLN A 1 62  ? 7.764   0.272   10.972  1.00 1.24  ? 1569 GLN A HA   2  
ATOM 4002  H HB2  . GLN A 1 62  ? 8.659   0.009   8.132   1.00 1.56  ? 1569 GLN A HB2  2  
ATOM 4003  H HB3  . GLN A 1 62  ? 9.602   -0.270  9.579   1.00 1.69  ? 1569 GLN A HB3  2  
ATOM 4004  H HG2  . GLN A 1 62  ? 9.132   -2.370  8.763   1.00 2.22  ? 1569 GLN A HG2  2  
ATOM 4005  H HG3  . GLN A 1 62  ? 7.950   -2.156  10.058  1.00 2.41  ? 1569 GLN A HG3  2  
ATOM 4006  H HE21 . GLN A 1 62  ? 8.457   -1.900  6.722   1.00 2.27  ? 1569 GLN A HE21 2  
ATOM 4007  H HE22 . GLN A 1 62  ? 6.857   -2.260  6.149   1.00 3.09  ? 1569 GLN A HE22 2  
ATOM 4008  N N    . THR A 1 63  ? 8.277   2.461   8.546   1.00 0.86  ? 1570 THR A N    2  
ATOM 4009  C CA   . THR A 1 63  ? 8.723   3.834   8.336   1.00 1.01  ? 1570 THR A CA   2  
ATOM 4010  C C    . THR A 1 63  ? 7.564   4.826   8.250   1.00 0.80  ? 1570 THR A C    2  
ATOM 4011  O O    . THR A 1 63  ? 7.771   6.052   8.174   1.00 0.93  ? 1570 THR A O    2  
ATOM 4012  C CB   . THR A 1 63  ? 9.658   3.957   7.125   1.00 1.48  ? 1570 THR A CB   2  
ATOM 4013  O OG1  . THR A 1 63  ? 9.078   3.271   6.014   1.00 2.17  ? 1570 THR A OG1  2  
ATOM 4014  C CG2  . THR A 1 63  ? 11.048  3.397   7.419   1.00 1.93  ? 1570 THR A CG2  2  
ATOM 4015  H H    . THR A 1 63  ? 8.146   1.881   7.761   1.00 0.98  ? 1570 THR A H    2  
ATOM 4016  H HA   . THR A 1 63  ? 9.270   4.112   9.224   1.00 1.23  ? 1570 THR A HA   2  
ATOM 4017  H HB   . THR A 1 63  ? 9.739   5.004   6.875   1.00 1.87  ? 1570 THR A HB   2  
ATOM 4018  H HG1  . THR A 1 63  ? 9.279   2.316   6.047   1.00 2.52  ? 1570 THR A HG1  2  
ATOM 4019  H HG21 . THR A 1 63  ? 10.970  2.364   7.730   1.00 2.20  ? 1570 THR A HG21 2  
ATOM 4020  H HG22 . THR A 1 63  ? 11.567  3.976   8.169   1.00 2.46  ? 1570 THR A HG22 2  
ATOM 4021  H HG23 . THR A 1 63  ? 11.626  3.429   6.506   1.00 2.40  ? 1570 THR A HG23 2  
ATOM 4022  N N    . ARG A 1 64  ? 6.345   4.279   8.301   1.00 0.62  ? 1571 ARG A N    2  
ATOM 4023  C CA   . ARG A 1 64  ? 5.084   5.043   8.299   1.00 0.57  ? 1571 ARG A CA   2  
ATOM 4024  C C    . ARG A 1 64  ? 4.889   5.785   6.964   1.00 0.47  ? 1571 ARG A C    2  
ATOM 4025  O O    . ARG A 1 64  ? 4.542   6.970   6.936   1.00 0.57  ? 1571 ARG A O    2  
ATOM 4026  C CB   . ARG A 1 64  ? 5.021   6.017   9.511   1.00 0.87  ? 1571 ARG A CB   2  
ATOM 4027  C CG   . ARG A 1 64  ? 5.225   5.341   10.876  1.00 1.13  ? 1571 ARG A CG   2  
ATOM 4028  C CD   . ARG A 1 64  ? 4.093   4.390   11.239  1.00 1.32  ? 1571 ARG A CD   2  
ATOM 4029  N NE   . ARG A 1 64  ? 4.452   3.513   12.364  1.00 1.46  ? 1571 ARG A NE   2  
ATOM 4030  C CZ   . ARG A 1 64  ? 3.868   3.501   13.567  1.00 2.01  ? 1571 ARG A CZ   2  
ATOM 4031  N NH1  . ARG A 1 64  ? 2.960   4.413   13.883  1.00 2.62  ? 1571 ARG A NH1  2  
ATOM 4032  N NH2  . ARG A 1 64  ? 4.214   2.583   14.460  1.00 2.24  ? 1571 ARG A NH2  2  
ATOM 4033  H H    . ARG A 1 64  ? 6.312   3.301   8.334   1.00 0.65  ? 1571 ARG A H    2  
ATOM 4034  H HA   . ARG A 1 64  ? 4.273   4.331   8.381   1.00 0.60  ? 1571 ARG A HA   2  
ATOM 4035  H HB2  . ARG A 1 64  ? 5.789   6.767   9.391   1.00 0.98  ? 1571 ARG A HB2  2  
ATOM 4036  H HB3  . ARG A 1 64  ? 4.057   6.505   9.515   1.00 1.02  ? 1571 ARG A HB3  2  
ATOM 4037  H HG2  . ARG A 1 64  ? 6.159   4.800   10.885  1.00 1.78  ? 1571 ARG A HG2  2  
ATOM 4038  H HG3  . ARG A 1 64  ? 5.274   6.118   11.626  1.00 1.61  ? 1571 ARG A HG3  2  
ATOM 4039  H HD2  . ARG A 1 64  ? 3.237   4.983   11.528  1.00 1.83  ? 1571 ARG A HD2  2  
ATOM 4040  H HD3  . ARG A 1 64  ? 3.824   3.784   10.387  1.00 1.89  ? 1571 ARG A HD3  2  
ATOM 4041  H HE   . ARG A 1 64  ? 5.161   2.851   12.170  1.00 1.50  ? 1571 ARG A HE   2  
ATOM 4042  H HH11 . ARG A 1 64  ? 2.671   5.139   13.251  1.00 2.69  ? 1571 ARG A HH11 2  
ATOM 4043  H HH12 . ARG A 1 64  ? 2.520   4.427   14.791  1.00 3.19  ? 1571 ARG A HH12 2  
ATOM 4044  H HH21 . ARG A 1 64  ? 4.908   1.876   14.272  1.00 2.19  ? 1571 ARG A HH21 2  
ATOM 4045  H HH22 . ARG A 1 64  ? 3.799   2.548   15.376  1.00 2.70  ? 1571 ARG A HH22 2  
ATOM 4046  N N    . ILE A 1 65  ? 5.160   5.087   5.867   1.00 0.43  ? 1572 ILE A N    2  
ATOM 4047  C CA   . ILE A 1 65  ? 4.988   5.625   4.522   1.00 0.43  ? 1572 ILE A CA   2  
ATOM 4048  C C    . ILE A 1 65  ? 3.491   5.670   4.176   1.00 0.40  ? 1572 ILE A C    2  
ATOM 4049  O O    . ILE A 1 65  ? 2.749   4.722   4.461   1.00 0.44  ? 1572 ILE A O    2  
ATOM 4050  C CB   . ILE A 1 65  ? 5.734   4.745   3.464   1.00 0.53  ? 1572 ILE A CB   2  
ATOM 4051  C CG1  . ILE A 1 65  ? 7.229   4.580   3.842   1.00 0.65  ? 1572 ILE A CG1  2  
ATOM 4052  C CG2  . ILE A 1 65  ? 5.560   5.297   2.027   1.00 0.60  ? 1572 ILE A CG2  2  
ATOM 4053  C CD1  . ILE A 1 65  ? 8.043   3.780   2.835   1.00 0.92  ? 1572 ILE A CD1  2  
ATOM 4054  H H    . ILE A 1 65  ? 5.497   4.173   5.951   1.00 0.50  ? 1572 ILE A H    2  
ATOM 4055  H HA   . ILE A 1 65  ? 5.391   6.626   4.498   1.00 0.47  ? 1572 ILE A HA   2  
ATOM 4056  H HB   . ILE A 1 65  ? 5.266   3.772   3.481   1.00 0.56  ? 1572 ILE A HB   2  
ATOM 4057  H HG12 . ILE A 1 65  ? 7.732   5.514   4.054   1.00 0.71  ? 1572 ILE A HG12 2  
ATOM 4058  H HG13 . ILE A 1 65  ? 7.247   4.013   4.760   1.00 0.73  ? 1572 ILE A HG13 2  
ATOM 4059  H HG21 . ILE A 1 65  ? 6.117   4.703   1.319   1.00 1.12  ? 1572 ILE A HG21 2  
ATOM 4060  H HG22 . ILE A 1 65  ? 5.863   6.332   1.955   1.00 1.25  ? 1572 ILE A HG22 2  
ATOM 4061  H HG23 . ILE A 1 65  ? 4.513   5.248   1.766   1.00 1.19  ? 1572 ILE A HG23 2  
ATOM 4062  H HD11 . ILE A 1 65  ? 9.058   3.681   3.189   1.00 1.39  ? 1572 ILE A HD11 2  
ATOM 4063  H HD12 . ILE A 1 65  ? 8.043   4.286   1.879   1.00 1.51  ? 1572 ILE A HD12 2  
ATOM 4064  H HD13 . ILE A 1 65  ? 7.606   2.800   2.719   1.00 1.36  ? 1572 ILE A HD13 2  
ATOM 4065  N N    . SER A 1 66  ? 3.072   6.754   3.572   1.00 0.42  ? 1573 SER A N    2  
ATOM 4066  C CA   . SER A 1 66  ? 1.691   6.953   3.194   1.00 0.42  ? 1573 SER A CA   2  
ATOM 4067  C C    . SER A 1 66  ? 1.428   6.266   1.857   1.00 0.33  ? 1573 SER A C    2  
ATOM 4068  O O    . SER A 1 66  ? 2.076   6.570   0.851   1.00 0.41  ? 1573 SER A O    2  
ATOM 4069  C CB   . SER A 1 66  ? 1.383   8.471   3.101   1.00 0.54  ? 1573 SER A CB   2  
ATOM 4070  O OG   . SER A 1 66  ? 0.108   8.719   2.537   1.00 0.80  ? 1573 SER A OG   2  
ATOM 4071  H H    . SER A 1 66  ? 3.738   7.429   3.317   1.00 0.50  ? 1573 SER A H    2  
ATOM 4072  H HA   . SER A 1 66  ? 1.062   6.512   3.953   1.00 0.49  ? 1573 SER A HA   2  
ATOM 4073  H HB2  . SER A 1 66  ? 1.375   8.901   4.092   1.00 0.78  ? 1573 SER A HB2  2  
ATOM 4074  H HB3  . SER A 1 66  ? 2.135   8.958   2.497   1.00 0.96  ? 1573 SER A HB3  2  
ATOM 4075  H HG   . SER A 1 66  ? 0.003   9.680   2.439   1.00 0.71  ? 1573 SER A HG   2  
ATOM 4076  N N    . VAL A 1 67  ? 0.515   5.336   1.824   1.00 0.26  ? 1574 VAL A N    2  
ATOM 4077  C CA   . VAL A 1 67  ? 0.231   4.661   0.570   1.00 0.27  ? 1574 VAL A CA   2  
ATOM 4078  C C    . VAL A 1 67  ? -1.204  4.887   0.133   1.00 0.27  ? 1574 VAL A C    2  
ATOM 4079  O O    . VAL A 1 67  ? -1.703  4.259   -0.809  1.00 0.38  ? 1574 VAL A O    2  
ATOM 4080  C CB   . VAL A 1 67  ? 0.569   3.155   0.598   1.00 0.42  ? 1574 VAL A CB   2  
ATOM 4081  C CG1  . VAL A 1 67  ? 2.039   2.941   0.900   1.00 0.98  ? 1574 VAL A CG1  2  
ATOM 4082  C CG2  . VAL A 1 67  ? -0.284  2.441   1.595   1.00 0.69  ? 1574 VAL A CG2  2  
ATOM 4083  H H    . VAL A 1 67  ? 0.024   5.088   2.642   1.00 0.30  ? 1574 VAL A H    2  
ATOM 4084  H HA   . VAL A 1 67  ? 0.860   5.139   -0.167  1.00 0.30  ? 1574 VAL A HA   2  
ATOM 4085  H HB   . VAL A 1 67  ? 0.369   2.747   -0.383  1.00 0.93  ? 1574 VAL A HB   2  
ATOM 4086  H HG11 . VAL A 1 67  ? 2.247   1.881   0.916   1.00 1.52  ? 1574 VAL A HG11 2  
ATOM 4087  H HG12 . VAL A 1 67  ? 2.265   3.371   1.864   1.00 1.51  ? 1574 VAL A HG12 2  
ATOM 4088  H HG13 . VAL A 1 67  ? 2.637   3.419   0.139   1.00 1.60  ? 1574 VAL A HG13 2  
ATOM 4089  H HG21 . VAL A 1 67  ? -1.308  2.620   1.302   1.00 1.29  ? 1574 VAL A HG21 2  
ATOM 4090  H HG22 . VAL A 1 67  ? -0.097  2.857   2.573   1.00 1.32  ? 1574 VAL A HG22 2  
ATOM 4091  H HG23 . VAL A 1 67  ? -0.080  1.383   1.576   1.00 1.37  ? 1574 VAL A HG23 2  
ATOM 4092  N N    . GLY A 1 68  ? -1.851  5.786   0.815   1.00 0.23  ? 1575 GLY A N    2  
ATOM 4093  C CA   . GLY A 1 68  ? -3.191  6.125   0.495   1.00 0.27  ? 1575 GLY A CA   2  
ATOM 4094  C C    . GLY A 1 68  ? -3.739  7.067   1.513   1.00 0.24  ? 1575 GLY A C    2  
ATOM 4095  O O    . GLY A 1 68  ? -3.878  6.703   2.678   1.00 0.29  ? 1575 GLY A O    2  
ATOM 4096  H H    . GLY A 1 68  ? -1.416  6.228   1.574   1.00 0.25  ? 1575 GLY A H    2  
ATOM 4097  H HA2  . GLY A 1 68  ? -3.208  6.583   -0.484  1.00 0.33  ? 1575 GLY A HA2  2  
ATOM 4098  H HA3  . GLY A 1 68  ? -3.794  5.230   0.481   1.00 0.34  ? 1575 GLY A HA3  2  
ATOM 4099  N N    . LYS A 1 69  ? -4.015  8.275   1.103   1.00 0.27  ? 1576 LYS A N    2  
ATOM 4100  C CA   . LYS A 1 69  ? -4.553  9.282   1.989   1.00 0.30  ? 1576 LYS A CA   2  
ATOM 4101  C C    . LYS A 1 69  ? -6.022  8.933   2.253   1.00 0.28  ? 1576 LYS A C    2  
ATOM 4102  O O    . LYS A 1 69  ? -6.624  8.211   1.462   1.00 0.33  ? 1576 LYS A O    2  
ATOM 4103  C CB   . LYS A 1 69  ? -4.397  10.658  1.316   1.00 0.42  ? 1576 LYS A CB   2  
ATOM 4104  C CG   . LYS A 1 69  ? -4.773  11.844  2.185   1.00 0.57  ? 1576 LYS A CG   2  
ATOM 4105  C CD   . LYS A 1 69  ? -4.461  13.167  1.511   1.00 0.88  ? 1576 LYS A CD   2  
ATOM 4106  C CE   . LYS A 1 69  ? -2.968  13.348  1.265   1.00 1.39  ? 1576 LYS A CE   2  
ATOM 4107  N NZ   . LYS A 1 69  ? -2.178  13.345  2.514   1.00 2.19  ? 1576 LYS A NZ   2  
ATOM 4108  H H    . LYS A 1 69  ? -3.888  8.520   0.162   1.00 0.32  ? 1576 LYS A H    2  
ATOM 4109  H HA   . LYS A 1 69  ? -4.002  9.259   2.918   1.00 0.33  ? 1576 LYS A HA   2  
ATOM 4110  H HB2  . LYS A 1 69  ? -3.366  10.782  1.017   1.00 0.46  ? 1576 LYS A HB2  2  
ATOM 4111  H HB3  . LYS A 1 69  ? -5.017  10.677  0.433   1.00 0.45  ? 1576 LYS A HB3  2  
ATOM 4112  H HG2  . LYS A 1 69  ? -5.831  11.804  2.398   1.00 0.66  ? 1576 LYS A HG2  2  
ATOM 4113  H HG3  . LYS A 1 69  ? -4.217  11.786  3.110   1.00 0.68  ? 1576 LYS A HG3  2  
ATOM 4114  H HD2  . LYS A 1 69  ? -4.976  13.208  0.563   1.00 1.35  ? 1576 LYS A HD2  2  
ATOM 4115  H HD3  . LYS A 1 69  ? -4.813  13.971  2.142   1.00 1.58  ? 1576 LYS A HD3  2  
ATOM 4116  H HE2  . LYS A 1 69  ? -2.623  12.542  0.635   1.00 1.83  ? 1576 LYS A HE2  2  
ATOM 4117  H HE3  . LYS A 1 69  ? -2.817  14.285  0.751   1.00 2.02  ? 1576 LYS A HE3  2  
ATOM 4118  H HZ1  . LYS A 1 69  ? -1.180  13.566  2.309   1.00 2.66  ? 1576 LYS A HZ1  2  
ATOM 4119  H HZ2  . LYS A 1 69  ? -2.194  12.428  3.009   1.00 2.68  ? 1576 LYS A HZ2  2  
ATOM 4120  H HZ3  . LYS A 1 69  ? -2.525  14.064  3.186   1.00 2.63  ? 1576 LYS A HZ3  2  
ATOM 4121  N N    . ALA A 1 70  ? -6.564  9.391   3.382   1.00 0.27  ? 1577 ALA A N    2  
ATOM 4122  C CA   . ALA A 1 70  ? -7.937  9.090   3.796   1.00 0.30  ? 1577 ALA A CA   2  
ATOM 4123  C C    . ALA A 1 70  ? -8.962  9.731   2.870   1.00 0.32  ? 1577 ALA A C    2  
ATOM 4124  O O    . ALA A 1 70  ? -9.582  10.746  3.192   1.00 0.61  ? 1577 ALA A O    2  
ATOM 4125  C CB   . ALA A 1 70  ? -8.166  9.523   5.229   1.00 0.38  ? 1577 ALA A CB   2  
ATOM 4126  H H    . ALA A 1 70  ? -6.029  9.971   3.973   1.00 0.28  ? 1577 ALA A H    2  
ATOM 4127  H HA   . ALA A 1 70  ? -8.060  8.018   3.744   1.00 0.33  ? 1577 ALA A HA   2  
ATOM 4128  H HB1  . ALA A 1 70  ? -9.152  9.212   5.545   1.00 1.08  ? 1577 ALA A HB1  2  
ATOM 4129  H HB2  . ALA A 1 70  ? -8.084  10.597  5.300   1.00 1.00  ? 1577 ALA A HB2  2  
ATOM 4130  H HB3  . ALA A 1 70  ? -7.424  9.062   5.865   1.00 1.07  ? 1577 ALA A HB3  2  
ATOM 4131  N N    . ASN A 1 71  ? -9.123  9.112   1.750   1.00 0.43  ? 1578 ASN A N    2  
ATOM 4132  C CA   . ASN A 1 71  ? -10.002 9.520   0.687   1.00 0.54  ? 1578 ASN A CA   2  
ATOM 4133  C C    . ASN A 1 71  ? -11.357 8.836   0.923   1.00 0.48  ? 1578 ASN A C    2  
ATOM 4134  O O    . ASN A 1 71  ? -11.534 8.167   1.951   1.00 0.51  ? 1578 ASN A O    2  
ATOM 4135  C CB   . ASN A 1 71  ? -9.368  9.005   -0.615  1.00 0.73  ? 1578 ASN A CB   2  
ATOM 4136  C CG   . ASN A 1 71  ? -9.943  9.596   -1.891  1.00 1.15  ? 1578 ASN A CG   2  
ATOM 4137  O OD1  . ASN A 1 71  ? -10.911 9.103   -2.426  1.00 1.95  ? 1578 ASN A OD1  2  
ATOM 4138  N ND2  . ASN A 1 71  ? -9.350  10.635  -2.403  1.00 1.31  ? 1578 ASN A ND2  2  
ATOM 4139  H H    . ASN A 1 71  ? -8.590  8.300   1.610   1.00 0.67  ? 1578 ASN A H    2  
ATOM 4140  H HA   . ASN A 1 71  ? -10.093 10.595  0.651   1.00 0.69  ? 1578 ASN A HA   2  
ATOM 4141  H HB2  . ASN A 1 71  ? -8.297  9.129   -0.572  1.00 1.16  ? 1578 ASN A HB2  2  
ATOM 4142  H HB3  . ASN A 1 71  ? -9.546  7.939   -0.636  1.00 1.31  ? 1578 ASN A HB3  2  
ATOM 4143  H HD21 . ASN A 1 71  ? -8.565  11.081  -2.014  1.00 1.28  ? 1578 ASN A HD21 2  
ATOM 4144  H HD22 . ASN A 1 71  ? -9.745  10.933  -3.251  1.00 1.88  ? 1578 ASN A HD22 2  
ATOM 4145  N N    . LYS A 1 72  ? -12.303 8.994   0.023   1.00 0.56  ? 1579 LYS A N    2  
ATOM 4146  C CA   . LYS A 1 72  ? -13.574 8.311   0.145   1.00 0.61  ? 1579 LYS A CA   2  
ATOM 4147  C C    . LYS A 1 72  ? -14.246 8.229   -1.200  1.00 0.63  ? 1579 LYS A C    2  
ATOM 4148  O O    . LYS A 1 72  ? -15.415 8.593   -1.368  1.00 0.80  ? 1579 LYS A O    2  
ATOM 4149  C CB   . LYS A 1 72  ? -14.487 8.938   1.231   1.00 0.80  ? 1579 LYS A CB   2  
ATOM 4150  C CG   . LYS A 1 72  ? -14.766 10.429  1.094   1.00 1.30  ? 1579 LYS A CG   2  
ATOM 4151  C CD   . LYS A 1 72  ? -15.642 10.899  2.239   1.00 1.42  ? 1579 LYS A CD   2  
ATOM 4152  C CE   . LYS A 1 72  ? -15.925 12.388  2.181   1.00 2.07  ? 1579 LYS A CE   2  
ATOM 4153  N NZ   . LYS A 1 72  ? -16.654 12.782  0.960   1.00 2.68  ? 1579 LYS A NZ   2  
ATOM 4154  H H    . LYS A 1 72  ? -12.159 9.571   -0.767  1.00 0.65  ? 1579 LYS A H    2  
ATOM 4155  H HA   . LYS A 1 72  ? -13.334 7.298   0.433   1.00 0.61  ? 1579 LYS A HA   2  
ATOM 4156  H HB2  . LYS A 1 72  ? -15.438 8.427   1.212   1.00 1.24  ? 1579 LYS A HB2  2  
ATOM 4157  H HB3  . LYS A 1 72  ? -14.031 8.767   2.196   1.00 1.20  ? 1579 LYS A HB3  2  
ATOM 4158  H HG2  . LYS A 1 72  ? -13.831 10.970  1.110   1.00 1.84  ? 1579 LYS A HG2  2  
ATOM 4159  H HG3  . LYS A 1 72  ? -15.278 10.609  0.160   1.00 1.78  ? 1579 LYS A HG3  2  
ATOM 4160  H HD2  . LYS A 1 72  ? -16.582 10.369  2.203   1.00 1.78  ? 1579 LYS A HD2  2  
ATOM 4161  H HD3  . LYS A 1 72  ? -15.141 10.673  3.169   1.00 1.75  ? 1579 LYS A HD3  2  
ATOM 4162  H HE2  . LYS A 1 72  ? -16.518 12.659  3.042   1.00 2.51  ? 1579 LYS A HE2  2  
ATOM 4163  H HE3  . LYS A 1 72  ? -14.984 12.917  2.218   1.00 2.58  ? 1579 LYS A HE3  2  
ATOM 4164  H HZ1  . LYS A 1 72  ? -16.896 13.796  1.031   1.00 3.11  ? 1579 LYS A HZ1  2  
ATOM 4165  H HZ2  . LYS A 1 72  ? -17.539 12.250  0.817   1.00 3.11  ? 1579 LYS A HZ2  2  
ATOM 4166  H HZ3  . LYS A 1 72  ? -16.087 12.671  0.093   1.00 2.98  ? 1579 LYS A HZ3  2  
ATOM 4167  N N    . ARG A 1 73  ? -13.519 7.727   -2.162  1.00 0.58  ? 1580 ARG A N    2  
ATOM 4168  C CA   . ARG A 1 73  ? -14.019 7.669   -3.482  1.00 0.65  ? 1580 ARG A CA   2  
ATOM 4169  C C    . ARG A 1 73  ? -14.573 6.275   -3.721  1.00 0.57  ? 1580 ARG A C    2  
ATOM 4170  O O    . ARG A 1 73  ? -13.859 5.364   -4.159  1.00 0.61  ? 1580 ARG A O    2  
ATOM 4171  C CB   . ARG A 1 73  ? -12.917 8.020   -4.484  1.00 0.82  ? 1580 ARG A CB   2  
ATOM 4172  C CG   . ARG A 1 73  ? -13.434 8.360   -5.841  1.00 0.97  ? 1580 ARG A CG   2  
ATOM 4173  C CD   . ARG A 1 73  ? -13.908 9.819   -5.968  1.00 1.18  ? 1580 ARG A CD   2  
ATOM 4174  N NE   . ARG A 1 73  ? -14.729 10.293  -4.804  1.00 1.84  ? 1580 ARG A NE   2  
ATOM 4175  C CZ   . ARG A 1 73  ? -16.046 10.518  -4.828  1.00 2.52  ? 1580 ARG A CZ   2  
ATOM 4176  N NH1  . ARG A 1 73  ? -16.751 10.273  -5.928  1.00 2.72  ? 1580 ARG A NH1  2  
ATOM 4177  N NH2  . ARG A 1 73  ? -16.650 10.993  -3.751  1.00 3.47  ? 1580 ARG A NH2  2  
ATOM 4178  H H    . ARG A 1 73  ? -12.627 7.349   -1.997  1.00 0.57  ? 1580 ARG A H    2  
ATOM 4179  H HA   . ARG A 1 73  ? -14.822 8.387   -3.567  1.00 0.73  ? 1580 ARG A HA   2  
ATOM 4180  H HB2  . ARG A 1 73  ? -12.362 8.878   -4.133  1.00 0.91  ? 1580 ARG A HB2  2  
ATOM 4181  H HB3  . ARG A 1 73  ? -12.244 7.182   -4.591  1.00 0.81  ? 1580 ARG A HB3  2  
ATOM 4182  H HG2  . ARG A 1 73  ? -12.614 8.197   -6.520  1.00 1.23  ? 1580 ARG A HG2  2  
ATOM 4183  H HG3  . ARG A 1 73  ? -14.255 7.688   -6.024  1.00 1.23  ? 1580 ARG A HG3  2  
ATOM 4184  H HD2  . ARG A 1 73  ? -13.048 10.450  -6.148  1.00 1.51  ? 1580 ARG A HD2  2  
ATOM 4185  H HD3  . ARG A 1 73  ? -14.518 9.861   -6.860  1.00 1.74  ? 1580 ARG A HD3  2  
ATOM 4186  H HE   . ARG A 1 73  ? -14.240 10.475  -3.958  1.00 2.25  ? 1580 ARG A HE   2  
ATOM 4187  H HH11 . ARG A 1 73  ? -16.346 9.920   -6.775  1.00 2.59  ? 1580 ARG A HH11 2  
ATOM 4188  H HH12 . ARG A 1 73  ? -17.756 10.396  -5.974  1.00 3.38  ? 1580 ARG A HH12 2  
ATOM 4189  H HH21 . ARG A 1 73  ? -16.166 11.213  -2.898  1.00 3.87  ? 1580 ARG A HH21 2  
ATOM 4190  H HH22 . ARG A 1 73  ? -17.648 11.152  -3.727  1.00 4.04  ? 1580 ARG A HH22 2  
ATOM 4191  N N    . LEU A 1 74  ? -15.828 6.108   -3.368  1.00 0.55  ? 1581 LEU A N    2  
ATOM 4192  C CA   . LEU A 1 74  ? -16.507 4.811   -3.475  1.00 0.49  ? 1581 LEU A CA   2  
ATOM 4193  C C    . LEU A 1 74  ? -17.080 4.664   -4.879  1.00 0.46  ? 1581 LEU A C    2  
ATOM 4194  O O    . LEU A 1 74  ? -17.816 5.537   -5.361  1.00 0.51  ? 1581 LEU A O    2  
ATOM 4195  C CB   . LEU A 1 74  ? -17.658 4.681   -2.423  1.00 0.52  ? 1581 LEU A CB   2  
ATOM 4196  C CG   . LEU A 1 74  ? -18.142 3.249   -2.005  1.00 0.51  ? 1581 LEU A CG   2  
ATOM 4197  C CD1  . LEU A 1 74  ? -18.549 2.373   -3.151  1.00 0.64  ? 1581 LEU A CD1  2  
ATOM 4198  C CD2  . LEU A 1 74  ? -17.149 2.527   -1.157  1.00 0.61  ? 1581 LEU A CD2  2  
ATOM 4199  H H    . LEU A 1 74  ? -16.279 6.911   -3.032  1.00 0.66  ? 1581 LEU A H    2  
ATOM 4200  H HA   . LEU A 1 74  ? -15.777 4.032   -3.305  1.00 0.49  ? 1581 LEU A HA   2  
ATOM 4201  H HB2  . LEU A 1 74  ? -17.357 5.189   -1.520  1.00 0.57  ? 1581 LEU A HB2  2  
ATOM 4202  H HB3  . LEU A 1 74  ? -18.538 5.178   -2.815  1.00 0.54  ? 1581 LEU A HB3  2  
ATOM 4203  H HG   . LEU A 1 74  ? -19.032 3.383   -1.409  1.00 0.80  ? 1581 LEU A HG   2  
ATOM 4204  H HD11 . LEU A 1 74  ? -19.338 2.854   -3.710  1.00 1.25  ? 1581 LEU A HD11 2  
ATOM 4205  H HD12 . LEU A 1 74  ? -18.937 1.444   -2.760  1.00 1.20  ? 1581 LEU A HD12 2  
ATOM 4206  H HD13 . LEU A 1 74  ? -17.709 2.175   -3.798  1.00 1.28  ? 1581 LEU A HD13 2  
ATOM 4207  H HD21 . LEU A 1 74  ? -16.954 3.079   -0.249  1.00 1.32  ? 1581 LEU A HD21 2  
ATOM 4208  H HD22 . LEU A 1 74  ? -16.244 2.356   -1.719  1.00 1.16  ? 1581 LEU A HD22 2  
ATOM 4209  H HD23 . LEU A 1 74  ? -17.623 1.586   -0.915  1.00 1.21  ? 1581 LEU A HD23 2  
ATOM 4210  N N    . ARG A 1 75  ? -16.738 3.592   -5.525  1.00 0.43  ? 1582 ARG A N    2  
ATOM 4211  C CA   . ARG A 1 75  ? -17.280 3.271   -6.828  1.00 0.43  ? 1582 ARG A CA   2  
ATOM 4212  C C    . ARG A 1 75  ? -17.911 1.879   -6.780  1.00 0.39  ? 1582 ARG A C    2  
ATOM 4213  O O    . ARG A 1 75  ? -17.383 0.988   -6.122  1.00 0.40  ? 1582 ARG A O    2  
ATOM 4214  C CB   . ARG A 1 75  ? -16.196 3.302   -7.929  1.00 0.51  ? 1582 ARG A CB   2  
ATOM 4215  C CG   . ARG A 1 75  ? -15.520 4.645   -8.166  1.00 0.85  ? 1582 ARG A CG   2  
ATOM 4216  C CD   . ARG A 1 75  ? -14.528 4.532   -9.317  1.00 0.89  ? 1582 ARG A CD   2  
ATOM 4217  N NE   . ARG A 1 75  ? -13.776 5.772   -9.575  1.00 1.42  ? 1582 ARG A NE   2  
ATOM 4218  C CZ   . ARG A 1 75  ? -12.696 5.842   -10.368 1.00 1.83  ? 1582 ARG A CZ   2  
ATOM 4219  N NH1  . ARG A 1 75  ? -12.354 4.795   -11.134 1.00 1.54  ? 1582 ARG A NH1  2  
ATOM 4220  N NH2  . ARG A 1 75  ? -11.995 6.967   -10.438 1.00 2.85  ? 1582 ARG A NH2  2  
ATOM 4221  H H    . ARG A 1 75  ? -16.098 2.981   -5.090  1.00 0.43  ? 1582 ARG A H    2  
ATOM 4222  H HA   . ARG A 1 75  ? -18.037 4.012   -7.033  1.00 0.44  ? 1582 ARG A HA   2  
ATOM 4223  H HB2  . ARG A 1 75  ? -15.419 2.606   -7.650  1.00 0.85  ? 1582 ARG A HB2  2  
ATOM 4224  H HB3  . ARG A 1 75  ? -16.621 2.972   -8.865  1.00 0.77  ? 1582 ARG A HB3  2  
ATOM 4225  H HG2  . ARG A 1 75  ? -16.273 5.379   -8.412  1.00 1.16  ? 1582 ARG A HG2  2  
ATOM 4226  H HG3  . ARG A 1 75  ? -14.993 4.943   -7.271  1.00 1.23  ? 1582 ARG A HG3  2  
ATOM 4227  H HD2  . ARG A 1 75  ? -13.819 3.749   -9.092  1.00 1.48  ? 1582 ARG A HD2  2  
ATOM 4228  H HD3  . ARG A 1 75  ? -15.074 4.272   -10.212 1.00 1.27  ? 1582 ARG A HD3  2  
ATOM 4229  H HE   . ARG A 1 75  ? -14.088 6.584   -9.100  1.00 1.90  ? 1582 ARG A HE   2  
ATOM 4230  H HH11 . ARG A 1 75  ? -12.880 3.935   -11.159 1.00 1.41  ? 1582 ARG A HH11 2  
ATOM 4231  H HH12 . ARG A 1 75  ? -11.542 4.795   -11.724 1.00 1.89  ? 1582 ARG A HH12 2  
ATOM 4232  H HH21 . ARG A 1 75  ? -12.232 7.797   -9.916  1.00 3.40  ? 1582 ARG A HH21 2  
ATOM 4233  H HH22 . ARG A 1 75  ? -11.170 7.061   -11.014 1.00 3.24  ? 1582 ARG A HH22 2  
ATOM 4234  N N    . TYR A 1 76  ? -19.031 1.701   -7.439  1.00 0.41  ? 1583 TYR A N    2  
ATOM 4235  C CA   . TYR A 1 76  ? -19.662 0.411   -7.525  1.00 0.41  ? 1583 TYR A CA   2  
ATOM 4236  C C    . TYR A 1 76  ? -19.423 -0.102  -8.912  1.00 0.47  ? 1583 TYR A C    2  
ATOM 4237  O O    . TYR A 1 76  ? -20.113 0.266   -9.854  1.00 0.57  ? 1583 TYR A O    2  
ATOM 4238  C CB   . TYR A 1 76  ? -21.154 0.515   -7.218  1.00 0.50  ? 1583 TYR A CB   2  
ATOM 4239  C CG   . TYR A 1 76  ? -21.927 -0.793  -7.294  1.00 0.54  ? 1583 TYR A CG   2  
ATOM 4240  C CD1  . TYR A 1 76  ? -21.686 -1.814  -6.394  1.00 0.56  ? 1583 TYR A CD1  2  
ATOM 4241  C CD2  . TYR A 1 76  ? -22.865 -1.017  -8.287  1.00 0.78  ? 1583 TYR A CD2  2  
ATOM 4242  C CE1  . TYR A 1 76  ? -22.361 -3.006  -6.478  1.00 0.65  ? 1583 TYR A CE1  2  
ATOM 4243  C CE2  . TYR A 1 76  ? -23.534 -2.213  -8.379  1.00 0.86  ? 1583 TYR A CE2  2  
ATOM 4244  C CZ   . TYR A 1 76  ? -23.388 -3.144  -7.400  1.00 0.74  ? 1583 TYR A CZ   2  
ATOM 4245  O OH   . TYR A 1 76  ? -23.928 -4.413  -7.575  1.00 0.84  ? 1583 TYR A OH   2  
ATOM 4246  H H    . TYR A 1 76  ? -19.461 2.442   -7.929  1.00 0.47  ? 1583 TYR A H    2  
ATOM 4247  H HA   . TYR A 1 76  ? -19.182 -0.248  -6.817  1.00 0.36  ? 1583 TYR A HA   2  
ATOM 4248  H HB2  . TYR A 1 76  ? -21.235 0.876   -6.205  1.00 0.49  ? 1583 TYR A HB2  2  
ATOM 4249  H HB3  . TYR A 1 76  ? -21.611 1.228   -7.890  1.00 0.58  ? 1583 TYR A HB3  2  
ATOM 4250  H HD1  . TYR A 1 76  ? -20.962 -1.678  -5.606  1.00 0.69  ? 1583 TYR A HD1  2  
ATOM 4251  H HD2  . TYR A 1 76  ? -23.081 -0.241  -9.002  1.00 0.99  ? 1583 TYR A HD2  2  
ATOM 4252  H HE1  . TYR A 1 76  ? -22.169 -3.786  -5.755  1.00 0.79  ? 1583 TYR A HE1  2  
ATOM 4253  H HE2  . TYR A 1 76  ? -24.262 -2.365  -9.162  1.00 1.10  ? 1583 TYR A HE2  2  
ATOM 4254  H HH   . TYR A 1 76  ? -24.017 -4.805  -6.692  1.00 1.26  ? 1583 TYR A HH   2  
ATOM 4255  N N    . VAL A 1 77  ? -18.436 -0.915  -9.035  1.00 0.45  ? 1584 VAL A N    2  
ATOM 4256  C CA   . VAL A 1 77  ? -18.003 -1.387  -10.325 1.00 0.54  ? 1584 VAL A CA   2  
ATOM 4257  C C    . VAL A 1 77  ? -18.274 -2.864  -10.519 1.00 0.59  ? 1584 VAL A C    2  
ATOM 4258  O O    . VAL A 1 77  ? -17.457 -3.710  -10.181 1.00 0.57  ? 1584 VAL A O    2  
ATOM 4259  C CB   . VAL A 1 77  ? -16.512 -1.026  -10.607 1.00 0.58  ? 1584 VAL A CB   2  
ATOM 4260  C CG1  . VAL A 1 77  ? -16.389 0.466   -10.815 1.00 1.05  ? 1584 VAL A CG1  2  
ATOM 4261  C CG2  . VAL A 1 77  ? -15.603 -1.440  -9.449  1.00 1.03  ? 1584 VAL A CG2  2  
ATOM 4262  H H    . VAL A 1 77  ? -18.008 -1.234  -8.205  1.00 0.40  ? 1584 VAL A H    2  
ATOM 4263  H HA   . VAL A 1 77  ? -18.609 -0.861  -11.049 1.00 0.59  ? 1584 VAL A HA   2  
ATOM 4264  H HB   . VAL A 1 77  ? -16.196 -1.543  -11.503 1.00 1.00  ? 1584 VAL A HB   2  
ATOM 4265  H HG11 . VAL A 1 77  ? -17.001 0.764   -11.654 1.00 1.57  ? 1584 VAL A HG11 2  
ATOM 4266  H HG12 . VAL A 1 77  ? -15.356 0.714   -11.013 1.00 1.71  ? 1584 VAL A HG12 2  
ATOM 4267  H HG13 . VAL A 1 77  ? -16.728 0.972   -9.923  1.00 1.47  ? 1584 VAL A HG13 2  
ATOM 4268  H HG21 . VAL A 1 77  ? -14.584 -1.159  -9.671  1.00 1.59  ? 1584 VAL A HG21 2  
ATOM 4269  H HG22 . VAL A 1 77  ? -15.661 -2.511  -9.316  1.00 1.63  ? 1584 VAL A HG22 2  
ATOM 4270  H HG23 . VAL A 1 77  ? -15.930 -0.950  -8.544  1.00 1.49  ? 1584 VAL A HG23 2  
ATOM 4271  N N    . ASP A 1 78  ? -19.452 -3.157  -11.040 1.00 0.69  ? 1585 ASP A N    2  
ATOM 4272  C CA   . ASP A 1 78  ? -19.906 -4.538  -11.329 1.00 0.78  ? 1585 ASP A CA   2  
ATOM 4273  C C    . ASP A 1 78  ? -19.854 -5.380  -10.058 1.00 0.71  ? 1585 ASP A C    2  
ATOM 4274  O O    . ASP A 1 78  ? -19.011 -6.250  -9.902  1.00 0.70  ? 1585 ASP A O    2  
ATOM 4275  C CB   . ASP A 1 78  ? -19.105 -5.204  -12.491 1.00 0.88  ? 1585 ASP A CB   2  
ATOM 4276  C CG   . ASP A 1 78  ? -19.661 -6.557  -12.916 1.00 1.04  ? 1585 ASP A CG   2  
ATOM 4277  O OD1  . ASP A 1 78  ? -20.719 -6.613  -13.573 1.00 1.17  ? 1585 ASP A OD1  2  
ATOM 4278  O OD2  . ASP A 1 78  ? -19.059 -7.605  -12.565 1.00 1.11  ? 1585 ASP A OD2  2  
ATOM 4279  H H    . ASP A 1 78  ? -20.077 -2.416  -11.234 1.00 0.73  ? 1585 ASP A H    2  
ATOM 4280  H HA   . ASP A 1 78  ? -20.947 -4.453  -11.605 1.00 0.88  ? 1585 ASP A HA   2  
ATOM 4281  H HB2  . ASP A 1 78  ? -19.087 -4.574  -13.370 1.00 0.95  ? 1585 ASP A HB2  2  
ATOM 4282  H HB3  . ASP A 1 78  ? -18.088 -5.356  -12.158 1.00 0.83  ? 1585 ASP A HB3  2  
ATOM 4283  N N    . GLN A 1 79  ? -20.690 -4.975  -9.103  1.00 0.72  ? 1586 GLN A N    2  
ATOM 4284  C CA   . GLN A 1 79  ? -20.909 -5.614  -7.775  1.00 0.73  ? 1586 GLN A CA   2  
ATOM 4285  C C    . GLN A 1 79  ? -19.670 -5.604  -6.905  1.00 0.59  ? 1586 GLN A C    2  
ATOM 4286  O O    . GLN A 1 79  ? -19.575 -6.310  -5.894  1.00 0.65  ? 1586 GLN A O    2  
ATOM 4287  C CB   . GLN A 1 79  ? -21.611 -7.005  -7.820  1.00 0.90  ? 1586 GLN A CB   2  
ATOM 4288  C CG   . GLN A 1 79  ? -20.850 -8.131  -8.501  1.00 0.98  ? 1586 GLN A CG   2  
ATOM 4289  C CD   . GLN A 1 79  ? -21.597 -9.442  -8.460  1.00 1.23  ? 1586 GLN A CD   2  
ATOM 4290  O OE1  . GLN A 1 79  ? -21.473 -10.268 -9.356  1.00 1.61  ? 1586 GLN A OE1  2  
ATOM 4291  N NE2  . GLN A 1 79  ? -22.361 -9.654  -7.421  1.00 1.86  ? 1586 GLN A NE2  2  
ATOM 4292  H H    . GLN A 1 79  ? -21.175 -4.150  -9.299  1.00 0.77  ? 1586 GLN A H    2  
ATOM 4293  H HA   . GLN A 1 79  ? -21.575 -4.914  -7.287  1.00 0.80  ? 1586 GLN A HA   2  
ATOM 4294  H HB2  . GLN A 1 79  ? -21.806 -7.328  -6.808  1.00 0.93  ? 1586 GLN A HB2  2  
ATOM 4295  H HB3  . GLN A 1 79  ? -22.559 -6.887  -8.326  1.00 1.05  ? 1586 GLN A HB3  2  
ATOM 4296  H HG2  . GLN A 1 79  ? -20.675 -7.855  -9.530  1.00 1.03  ? 1586 GLN A HG2  2  
ATOM 4297  H HG3  . GLN A 1 79  ? -19.900 -8.255  -8.001  1.00 0.92  ? 1586 GLN A HG3  2  
ATOM 4298  H HE21 . GLN A 1 79  ? -22.411 -8.965  -6.725  1.00 2.43  ? 1586 GLN A HE21 2  
ATOM 4299  H HE22 . GLN A 1 79  ? -22.879 -10.486 -7.379  1.00 2.04  ? 1586 GLN A HE22 2  
ATOM 4300  N N    . VAL A 1 80  ? -18.743 -4.795  -7.304  1.00 0.48  ? 1587 VAL A N    2  
ATOM 4301  C CA   . VAL A 1 80  ? -17.536 -4.575  -6.592  1.00 0.39  ? 1587 VAL A CA   2  
ATOM 4302  C C    . VAL A 1 80  ? -17.564 -3.182  -5.982  1.00 0.32  ? 1587 VAL A C    2  
ATOM 4303  O O    . VAL A 1 80  ? -17.880 -2.199  -6.665  1.00 0.33  ? 1587 VAL A O    2  
ATOM 4304  C CB   . VAL A 1 80  ? -16.316 -4.748  -7.528  1.00 0.41  ? 1587 VAL A CB   2  
ATOM 4305  C CG1  . VAL A 1 80  ? -15.068 -4.170  -6.911  1.00 0.37  ? 1587 VAL A CG1  2  
ATOM 4306  C CG2  . VAL A 1 80  ? -16.105 -6.220  -7.855  1.00 0.49  ? 1587 VAL A CG2  2  
ATOM 4307  H H    . VAL A 1 80  ? -18.880 -4.327  -8.154  1.00 0.53  ? 1587 VAL A H    2  
ATOM 4308  H HA   . VAL A 1 80  ? -17.482 -5.308  -5.802  1.00 0.42  ? 1587 VAL A HA   2  
ATOM 4309  H HB   . VAL A 1 80  ? -16.527 -4.230  -8.453  1.00 0.45  ? 1587 VAL A HB   2  
ATOM 4310  H HG11 . VAL A 1 80  ? -15.268 -3.124  -6.728  1.00 1.01  ? 1587 VAL A HG11 2  
ATOM 4311  H HG12 . VAL A 1 80  ? -14.250 -4.259  -7.611  1.00 1.02  ? 1587 VAL A HG12 2  
ATOM 4312  H HG13 . VAL A 1 80  ? -14.841 -4.669  -5.982  1.00 1.09  ? 1587 VAL A HG13 2  
ATOM 4313  H HG21 . VAL A 1 80  ? -15.252 -6.325  -8.509  1.00 1.13  ? 1587 VAL A HG21 2  
ATOM 4314  H HG22 . VAL A 1 80  ? -16.985 -6.610  -8.344  1.00 1.07  ? 1587 VAL A HG22 2  
ATOM 4315  H HG23 . VAL A 1 80  ? -15.926 -6.768  -6.942  1.00 1.16  ? 1587 VAL A HG23 2  
ATOM 4316  N N    . LEU A 1 81  ? -17.281 -3.115  -4.714  1.00 0.28  ? 1588 LEU A N    2  
ATOM 4317  C CA   . LEU A 1 81  ? -17.266 -1.873  -3.978  1.00 0.25  ? 1588 LEU A CA   2  
ATOM 4318  C C    . LEU A 1 81  ? -15.850 -1.384  -3.891  1.00 0.24  ? 1588 LEU A C    2  
ATOM 4319  O O    . LEU A 1 81  ? -15.030 -1.963  -3.193  1.00 0.28  ? 1588 LEU A O    2  
ATOM 4320  C CB   . LEU A 1 81  ? -17.854 -2.052  -2.558  1.00 0.28  ? 1588 LEU A CB   2  
ATOM 4321  C CG   . LEU A 1 81  ? -19.376 -2.286  -2.413  1.00 0.30  ? 1588 LEU A CG   2  
ATOM 4322  C CD1  . LEU A 1 81  ? -20.128 -1.077  -2.855  1.00 0.29  ? 1588 LEU A CD1  2  
ATOM 4323  C CD2  . LEU A 1 81  ? -19.863 -3.490  -3.190  1.00 0.36  ? 1588 LEU A CD2  2  
ATOM 4324  H H    . LEU A 1 81  ? -17.055 -3.944  -4.233  1.00 0.30  ? 1588 LEU A H    2  
ATOM 4325  H HA   . LEU A 1 81  ? -17.851 -1.149  -4.522  1.00 0.23  ? 1588 LEU A HA   2  
ATOM 4326  H HB2  . LEU A 1 81  ? -17.352 -2.889  -2.098  1.00 0.34  ? 1588 LEU A HB2  2  
ATOM 4327  H HB3  . LEU A 1 81  ? -17.599 -1.166  -1.994  1.00 0.29  ? 1588 LEU A HB3  2  
ATOM 4328  H HG   . LEU A 1 81  ? -19.600 -2.440  -1.368  1.00 0.34  ? 1588 LEU A HG   2  
ATOM 4329  H HD11 . LEU A 1 81  ? -21.177 -1.325  -2.884  1.00 1.02  ? 1588 LEU A HD11 2  
ATOM 4330  H HD12 . LEU A 1 81  ? -19.777 -0.744  -3.818  1.00 1.04  ? 1588 LEU A HD12 2  
ATOM 4331  H HD13 . LEU A 1 81  ? -19.976 -0.288  -2.137  1.00 1.06  ? 1588 LEU A HD13 2  
ATOM 4332  H HD21 . LEU A 1 81  ? -19.815 -3.256  -4.244  1.00 0.97  ? 1588 LEU A HD21 2  
ATOM 4333  H HD22 . LEU A 1 81  ? -20.871 -3.749  -2.906  1.00 1.00  ? 1588 LEU A HD22 2  
ATOM 4334  H HD23 . LEU A 1 81  ? -19.182 -4.303  -2.999  1.00 1.11  ? 1588 LEU A HD23 2  
ATOM 4335  N N    . GLN A 1 82  ? -15.562 -0.359  -4.604  1.00 0.24  ? 1589 GLN A N    2  
ATOM 4336  C CA   . GLN A 1 82  ? -14.227 0.165   -4.647  1.00 0.25  ? 1589 GLN A CA   2  
ATOM 4337  C C    . GLN A 1 82  ? -14.084 1.378   -3.767  1.00 0.24  ? 1589 GLN A C    2  
ATOM 4338  O O    . GLN A 1 82  ? -14.767 2.373   -3.966  1.00 0.36  ? 1589 GLN A O    2  
ATOM 4339  C CB   . GLN A 1 82  ? -13.817 0.530   -6.077  1.00 0.39  ? 1589 GLN A CB   2  
ATOM 4340  C CG   . GLN A 1 82  ? -12.394 1.023   -6.174  1.00 0.48  ? 1589 GLN A CG   2  
ATOM 4341  C CD   . GLN A 1 82  ? -12.009 1.392   -7.574  1.00 0.75  ? 1589 GLN A CD   2  
ATOM 4342  O OE1  . GLN A 1 82  ? -12.150 2.541   -7.995  1.00 1.74  ? 1589 GLN A OE1  2  
ATOM 4343  N NE2  . GLN A 1 82  ? -11.550 0.434   -8.317  1.00 0.66  ? 1589 GLN A NE2  2  
ATOM 4344  H H    . GLN A 1 82  ? -16.293 0.065   -5.111  1.00 0.27  ? 1589 GLN A H    2  
ATOM 4345  H HA   . GLN A 1 82  ? -13.557 -0.605  -4.294  1.00 0.30  ? 1589 GLN A HA   2  
ATOM 4346  H HB2  . GLN A 1 82  ? -13.916 -0.331  -6.721  1.00 0.50  ? 1589 GLN A HB2  2  
ATOM 4347  H HB3  . GLN A 1 82  ? -14.444 1.327   -6.454  1.00 0.46  ? 1589 GLN A HB3  2  
ATOM 4348  H HG2  . GLN A 1 82  ? -12.328 1.912   -5.563  1.00 0.53  ? 1589 GLN A HG2  2  
ATOM 4349  H HG3  . GLN A 1 82  ? -11.720 0.267   -5.802  1.00 0.66  ? 1589 GLN A HG3  2  
ATOM 4350  H HE21 . GLN A 1 82  ? -11.477 -0.472  -7.946  1.00 1.25  ? 1589 GLN A HE21 2  
ATOM 4351  H HE22 . GLN A 1 82  ? -11.293 0.665   -9.233  1.00 0.79  ? 1589 GLN A HE22 2  
ATOM 4352  N N    . LEU A 1 83  ? -13.238 1.275   -2.794  1.00 0.25  ? 1590 LEU A N    2  
ATOM 4353  C CA   . LEU A 1 83  ? -12.839 2.402   -2.003  1.00 0.30  ? 1590 LEU A CA   2  
ATOM 4354  C C    . LEU A 1 83  ? -11.406 2.717   -2.389  1.00 0.30  ? 1590 LEU A C    2  
ATOM 4355  O O    . LEU A 1 83  ? -10.467 2.040   -1.949  1.00 0.37  ? 1590 LEU A O    2  
ATOM 4356  C CB   . LEU A 1 83  ? -12.931 2.104   -0.500  1.00 0.37  ? 1590 LEU A CB   2  
ATOM 4357  C CG   . LEU A 1 83  ? -13.959 2.913   0.309   1.00 0.41  ? 1590 LEU A CG   2  
ATOM 4358  C CD1  . LEU A 1 83  ? -13.907 2.526   1.764   1.00 0.56  ? 1590 LEU A CD1  2  
ATOM 4359  C CD2  . LEU A 1 83  ? -13.716 4.398   0.173   1.00 0.72  ? 1590 LEU A CD2  2  
ATOM 4360  H H    . LEU A 1 83  ? -12.852 0.392   -2.590  1.00 0.30  ? 1590 LEU A H    2  
ATOM 4361  H HA   . LEU A 1 83  ? -13.475 3.236   -2.264  1.00 0.31  ? 1590 LEU A HA   2  
ATOM 4362  H HB2  . LEU A 1 83  ? -13.167 1.057   -0.379  1.00 0.57  ? 1590 LEU A HB2  2  
ATOM 4363  H HB3  . LEU A 1 83  ? -11.956 2.288   -0.075  1.00 0.64  ? 1590 LEU A HB3  2  
ATOM 4364  H HG   . LEU A 1 83  ? -14.950 2.696   -0.060  1.00 0.76  ? 1590 LEU A HG   2  
ATOM 4365  H HD11 . LEU A 1 83  ? -14.182 1.489   1.863   1.00 1.11  ? 1590 LEU A HD11 2  
ATOM 4366  H HD12 . LEU A 1 83  ? -14.591 3.148   2.322   1.00 1.26  ? 1590 LEU A HD12 2  
ATOM 4367  H HD13 . LEU A 1 83  ? -12.902 2.678   2.131   1.00 1.16  ? 1590 LEU A HD13 2  
ATOM 4368  H HD21 . LEU A 1 83  ? -12.687 4.595   0.427   1.00 1.30  ? 1590 LEU A HD21 2  
ATOM 4369  H HD22 . LEU A 1 83  ? -14.352 4.924   0.872   1.00 1.23  ? 1590 LEU A HD22 2  
ATOM 4370  H HD23 . LEU A 1 83  ? -13.920 4.713   -0.838  1.00 1.40  ? 1590 LEU A HD23 2  
ATOM 4371  N N    . VAL A 1 84  ? -11.240 3.670   -3.261  1.00 0.31  ? 1591 VAL A N    2  
ATOM 4372  C CA   . VAL A 1 84  ? -9.923  4.017   -3.740  1.00 0.31  ? 1591 VAL A CA   2  
ATOM 4373  C C    . VAL A 1 84  ? -9.349  5.182   -2.912  1.00 0.31  ? 1591 VAL A C    2  
ATOM 4374  O O    . VAL A 1 84  ? -10.053 6.147   -2.601  1.00 0.38  ? 1591 VAL A O    2  
ATOM 4375  C CB   . VAL A 1 84  ? -9.926  4.325   -5.293  1.00 0.35  ? 1591 VAL A CB   2  
ATOM 4376  C CG1  . VAL A 1 84  ? -10.567 5.649   -5.647  1.00 1.01  ? 1591 VAL A CG1  2  
ATOM 4377  C CG2  . VAL A 1 84  ? -8.544  4.206   -5.923  1.00 0.81  ? 1591 VAL A CG2  2  
ATOM 4378  H H    . VAL A 1 84  ? -12.029 4.160   -3.577  1.00 0.39  ? 1591 VAL A H    2  
ATOM 4379  H HA   . VAL A 1 84  ? -9.293  3.159   -3.561  1.00 0.29  ? 1591 VAL A HA   2  
ATOM 4380  H HB   . VAL A 1 84  ? -10.555 3.568   -5.738  1.00 0.74  ? 1591 VAL A HB   2  
ATOM 4381  H HG11 . VAL A 1 84  ? -10.467 5.803   -6.711  1.00 1.70  ? 1591 VAL A HG11 2  
ATOM 4382  H HG12 . VAL A 1 84  ? -10.038 6.424   -5.111  1.00 1.50  ? 1591 VAL A HG12 2  
ATOM 4383  H HG13 . VAL A 1 84  ? -11.611 5.668   -5.374  1.00 1.49  ? 1591 VAL A HG13 2  
ATOM 4384  H HG21 . VAL A 1 84  ? -8.131  3.223   -5.753  1.00 1.29  ? 1591 VAL A HG21 2  
ATOM 4385  H HG22 . VAL A 1 84  ? -7.883  4.973   -5.553  1.00 1.42  ? 1591 VAL A HG22 2  
ATOM 4386  H HG23 . VAL A 1 84  ? -8.653  4.347   -6.989  1.00 1.49  ? 1591 VAL A HG23 2  
ATOM 4387  N N    . TYR A 1 85  ? -8.111  5.045   -2.499  1.00 0.27  ? 1592 TYR A N    2  
ATOM 4388  C CA   . TYR A 1 85  ? -7.413  6.071   -1.729  1.00 0.27  ? 1592 TYR A CA   2  
ATOM 4389  C C    . TYR A 1 85  ? -6.222  6.525   -2.521  1.00 0.29  ? 1592 TYR A C    2  
ATOM 4390  O O    . TYR A 1 85  ? -5.291  5.749   -2.735  1.00 0.50  ? 1592 TYR A O    2  
ATOM 4391  C CB   . TYR A 1 85  ? -6.883  5.534   -0.378  1.00 0.25  ? 1592 TYR A CB   2  
ATOM 4392  C CG   . TYR A 1 85  ? -7.876  5.264   0.742   1.00 0.23  ? 1592 TYR A CG   2  
ATOM 4393  C CD1  . TYR A 1 85  ? -9.171  5.752   0.722   1.00 0.31  ? 1592 TYR A CD1  2  
ATOM 4394  C CD2  . TYR A 1 85  ? -7.473  4.545   1.861   1.00 0.30  ? 1592 TYR A CD2  2  
ATOM 4395  C CE1  . TYR A 1 85  ? -10.034 5.519   1.776   1.00 0.34  ? 1592 TYR A CE1  2  
ATOM 4396  C CE2  . TYR A 1 85  ? -8.331  4.316   2.912   1.00 0.33  ? 1592 TYR A CE2  2  
ATOM 4397  C CZ   . TYR A 1 85  ? -9.607  4.802   2.865   1.00 0.31  ? 1592 TYR A CZ   2  
ATOM 4398  O OH   . TYR A 1 85  ? -10.463 4.571   3.919   1.00 0.38  ? 1592 TYR A OH   2  
ATOM 4399  H H    . TYR A 1 85  ? -7.619  4.222   -2.734  1.00 0.28  ? 1592 TYR A H    2  
ATOM 4400  H HA   . TYR A 1 85  ? -8.065  6.920   -1.560  1.00 0.29  ? 1592 TYR A HA   2  
ATOM 4401  H HB2  . TYR A 1 85  ? -6.376  4.599   -0.563  1.00 0.25  ? 1592 TYR A HB2  2  
ATOM 4402  H HB3  . TYR A 1 85  ? -6.150  6.237   -0.008  1.00 0.27  ? 1592 TYR A HB3  2  
ATOM 4403  H HD1  . TYR A 1 85  ? -9.518  6.314   -0.132  1.00 0.41  ? 1592 TYR A HD1  2  
ATOM 4404  H HD2  . TYR A 1 85  ? -6.468  4.154   1.898   1.00 0.40  ? 1592 TYR A HD2  2  
ATOM 4405  H HE1  . TYR A 1 85  ? -11.036 5.915   1.750   1.00 0.46  ? 1592 TYR A HE1  2  
ATOM 4406  H HE2  . TYR A 1 85  ? -7.997  3.768   3.778   1.00 0.43  ? 1592 TYR A HE2  2  
ATOM 4407  H HH   . TYR A 1 85  ? -9.914  4.481   4.713   1.00 1.08  ? 1592 TYR A HH   2  
ATOM 4408  N N    . LYS A 1 86  ? -6.230  7.746   -2.942  1.00 0.33  ? 1593 LYS A N    2  
ATOM 4409  C CA   . LYS A 1 86  ? -5.134  8.281   -3.705  1.00 0.36  ? 1593 LYS A CA   2  
ATOM 4410  C C    . LYS A 1 86  ? -4.449  9.397   -2.933  1.00 0.37  ? 1593 LYS A C    2  
ATOM 4411  O O    . LYS A 1 86  ? -4.843  9.696   -1.802  1.00 0.40  ? 1593 LYS A O    2  
ATOM 4412  C CB   . LYS A 1 86  ? -5.607  8.751   -5.089  1.00 0.46  ? 1593 LYS A CB   2  
ATOM 4413  C CG   . LYS A 1 86  ? -6.730  9.776   -5.069  1.00 0.57  ? 1593 LYS A CG   2  
ATOM 4414  C CD   . LYS A 1 86  ? -7.172  10.123  -6.478  1.00 0.90  ? 1593 LYS A CD   2  
ATOM 4415  C CE   . LYS A 1 86  ? -8.202  11.244  -6.493  1.00 0.99  ? 1593 LYS A CE   2  
ATOM 4416  N NZ   . LYS A 1 86  ? -7.659  12.493  -5.922  1.00 1.59  ? 1593 LYS A NZ   2  
ATOM 4417  H H    . LYS A 1 86  ? -6.981  8.335   -2.720  1.00 0.51  ? 1593 LYS A H    2  
ATOM 4418  H HA   . LYS A 1 86  ? -4.422  7.479   -3.836  1.00 0.38  ? 1593 LYS A HA   2  
ATOM 4419  H HB2  . LYS A 1 86  ? -4.765  9.197   -5.598  1.00 0.55  ? 1593 LYS A HB2  2  
ATOM 4420  H HB3  . LYS A 1 86  ? -5.931  7.891   -5.652  1.00 0.49  ? 1593 LYS A HB3  2  
ATOM 4421  H HG2  . LYS A 1 86  ? -7.570  9.363   -4.530  1.00 0.91  ? 1593 LYS A HG2  2  
ATOM 4422  H HG3  . LYS A 1 86  ? -6.389  10.672  -4.574  1.00 0.87  ? 1593 LYS A HG3  2  
ATOM 4423  H HD2  . LYS A 1 86  ? -6.309  10.438  -7.047  1.00 1.53  ? 1593 LYS A HD2  2  
ATOM 4424  H HD3  . LYS A 1 86  ? -7.601  9.244   -6.936  1.00 1.50  ? 1593 LYS A HD3  2  
ATOM 4425  H HE2  . LYS A 1 86  ? -8.505  11.427  -7.513  1.00 1.55  ? 1593 LYS A HE2  2  
ATOM 4426  H HE3  . LYS A 1 86  ? -9.061  10.936  -5.914  1.00 1.51  ? 1593 LYS A HE3  2  
ATOM 4427  H HZ1  . LYS A 1 86  ? -6.762  12.738  -6.395  1.00 1.91  ? 1593 LYS A HZ1  2  
ATOM 4428  H HZ2  . LYS A 1 86  ? -7.483  12.394  -4.898  1.00 2.21  ? 1593 LYS A HZ2  2  
ATOM 4429  H HZ3  . LYS A 1 86  ? -8.318  13.293  -6.043  1.00 2.06  ? 1593 LYS A HZ3  2  
ATOM 4430  N N    . ASP A 1 87  ? -3.401  9.961   -3.525  1.00 0.44  ? 1594 ASP A N    2  
ATOM 4431  C CA   . ASP A 1 87  ? -2.614  11.055  -2.937  1.00 0.51  ? 1594 ASP A CA   2  
ATOM 4432  C C    . ASP A 1 87  ? -1.830  10.606  -1.732  1.00 0.42  ? 1594 ASP A C    2  
ATOM 4433  O O    . ASP A 1 87  ? -1.675  11.341  -0.749  1.00 0.53  ? 1594 ASP A O    2  
ATOM 4434  C CB   . ASP A 1 87  ? -3.418  12.349  -2.643  1.00 0.70  ? 1594 ASP A CB   2  
ATOM 4435  C CG   . ASP A 1 87  ? -3.726  13.171  -3.877  1.00 0.93  ? 1594 ASP A CG   2  
ATOM 4436  O OD1  . ASP A 1 87  ? -2.854  13.922  -4.344  1.00 1.11  ? 1594 ASP A OD1  2  
ATOM 4437  O OD2  . ASP A 1 87  ? -4.857  13.079  -4.418  1.00 1.05  ? 1594 ASP A OD2  2  
ATOM 4438  H H    . ASP A 1 87  ? -3.111  9.596   -4.393  1.00 0.50  ? 1594 ASP A H    2  
ATOM 4439  H HA   . ASP A 1 87  ? -1.870  11.283  -3.690  1.00 0.60  ? 1594 ASP A HA   2  
ATOM 4440  H HB2  . ASP A 1 87  ? -4.356  12.074  -2.187  1.00 0.69  ? 1594 ASP A HB2  2  
ATOM 4441  H HB3  . ASP A 1 87  ? -2.855  12.958  -1.951  1.00 0.78  ? 1594 ASP A HB3  2  
ATOM 4442  N N    . GLY A 1 88  ? -1.334  9.377   -1.799  1.00 0.41  ? 1595 GLY A N    2  
ATOM 4443  C CA   . GLY A 1 88  ? -0.443  8.885   -0.776  1.00 0.48  ? 1595 GLY A CA   2  
ATOM 4444  C C    . GLY A 1 88  ? 0.915   9.551   -0.917  1.00 0.53  ? 1595 GLY A C    2  
ATOM 4445  O O    . GLY A 1 88  ? 1.032   10.611  -1.537  1.00 0.78  ? 1595 GLY A O    2  
ATOM 4446  H H    . GLY A 1 88  ? -1.583  8.800   -2.552  1.00 0.49  ? 1595 GLY A H    2  
ATOM 4447  H HA2  . GLY A 1 88  ? -0.859  9.108   0.196   1.00 0.54  ? 1595 GLY A HA2  2  
ATOM 4448  H HA3  . GLY A 1 88  ? -0.323  7.817   -0.883  1.00 0.56  ? 1595 GLY A HA3  2  
ATOM 4449  N N    . SER A 1 89  ? 1.933   8.969   -0.405  1.00 0.44  ? 1596 SER A N    2  
ATOM 4450  C CA   . SER A 1 89  ? 3.212   9.599   -0.536  1.00 0.50  ? 1596 SER A CA   2  
ATOM 4451  C C    . SER A 1 89  ? 3.856   9.160   -1.836  1.00 0.47  ? 1596 SER A C    2  
ATOM 4452  O O    . SER A 1 89  ? 3.519   8.074   -2.358  1.00 0.44  ? 1596 SER A O    2  
ATOM 4453  C CB   . SER A 1 89  ? 4.114   9.379   0.707   1.00 0.68  ? 1596 SER A CB   2  
ATOM 4454  O OG   . SER A 1 89  ? 4.264   8.019   1.048   1.00 1.07  ? 1596 SER A OG   2  
ATOM 4455  H H    . SER A 1 89  ? 1.840   8.084   0.016   1.00 0.47  ? 1596 SER A H    2  
ATOM 4456  H HA   . SER A 1 89  ? 3.004   10.655  -0.640  1.00 0.57  ? 1596 SER A HA   2  
ATOM 4457  H HB2  . SER A 1 89  ? 5.094   9.784   0.505   1.00 1.17  ? 1596 SER A HB2  2  
ATOM 4458  H HB3  . SER A 1 89  ? 3.684   9.906   1.547   1.00 1.13  ? 1596 SER A HB3  2  
ATOM 4459  H HG   . SER A 1 89  ? 3.582   7.483   0.623   1.00 1.36  ? 1596 SER A HG   2  
ATOM 4460  N N    . PRO A 1 90  ? 4.667   10.045  -2.449  1.00 0.56  ? 1597 PRO A N    2  
ATOM 4461  C CA   . PRO A 1 90  ? 5.407   9.745   -3.669  1.00 0.62  ? 1597 PRO A CA   2  
ATOM 4462  C C    . PRO A 1 90  ? 6.136   8.416   -3.572  1.00 0.59  ? 1597 PRO A C    2  
ATOM 4463  O O    . PRO A 1 90  ? 6.813   8.120   -2.575  1.00 0.70  ? 1597 PRO A O    2  
ATOM 4464  C CB   . PRO A 1 90  ? 6.383   10.900  -3.762  1.00 0.80  ? 1597 PRO A CB   2  
ATOM 4465  C CG   . PRO A 1 90  ? 5.637   12.031  -3.173  1.00 1.01  ? 1597 PRO A CG   2  
ATOM 4466  C CD   . PRO A 1 90  ? 4.895   11.441  -2.017  1.00 0.66  ? 1597 PRO A CD   2  
ATOM 4467  H HA   . PRO A 1 90  ? 4.759   9.737   -4.534  1.00 0.65  ? 1597 PRO A HA   2  
ATOM 4468  H HB2  . PRO A 1 90  ? 7.276   10.671  -3.201  1.00 0.86  ? 1597 PRO A HB2  2  
ATOM 4469  H HB3  . PRO A 1 90  ? 6.629   11.091  -4.797  1.00 0.90  ? 1597 PRO A HB3  2  
ATOM 4470  H HG2  . PRO A 1 90  ? 6.326   12.790  -2.834  1.00 1.35  ? 1597 PRO A HG2  2  
ATOM 4471  H HG3  . PRO A 1 90  ? 4.945   12.436  -3.897  1.00 1.40  ? 1597 PRO A HG3  2  
ATOM 4472  H HD2  . PRO A 1 90  ? 5.498   11.479  -1.122  1.00 0.75  ? 1597 PRO A HD2  2  
ATOM 4473  H HD3  . PRO A 1 90  ? 3.957   11.954  -1.866  1.00 0.79  ? 1597 PRO A HD3  2  
ATOM 4474  N N    . CYS A 1 91  ? 5.967   7.628   -4.585  1.00 0.52  ? 1598 CYS A N    2  
ATOM 4475  C CA   . CYS A 1 91  ? 6.501   6.301   -4.643  1.00 0.53  ? 1598 CYS A CA   2  
ATOM 4476  C C    . CYS A 1 91  ? 8.007   6.348   -4.946  1.00 0.71  ? 1598 CYS A C    2  
ATOM 4477  O O    . CYS A 1 91  ? 8.440   7.032   -5.872  1.00 0.75  ? 1598 CYS A O    2  
ATOM 4478  C CB   . CYS A 1 91  ? 5.743   5.527   -5.738  1.00 0.51  ? 1598 CYS A CB   2  
ATOM 4479  S SG   . CYS A 1 91  ? 6.155   3.763   -5.849  1.00 0.54  ? 1598 CYS A SG   2  
ATOM 4480  H H    . CYS A 1 91  ? 5.459   7.961   -5.360  1.00 0.52  ? 1598 CYS A H    2  
ATOM 4481  H HA   . CYS A 1 91  ? 6.332   5.815   -3.692  1.00 0.54  ? 1598 CYS A HA   2  
ATOM 4482  H HB2  . CYS A 1 91  ? 4.685   5.590   -5.535  1.00 0.52  ? 1598 CYS A HB2  2  
ATOM 4483  H HB3  . CYS A 1 91  ? 5.936   5.970   -6.707  1.00 0.60  ? 1598 CYS A HB3  2  
ATOM 4484  N N    . PRO A 1 92  ? 8.832   5.678   -4.109  1.00 0.90  ? 1599 PRO A N    2  
ATOM 4485  C CA   . PRO A 1 92  ? 10.278  5.573   -4.327  1.00 1.18  ? 1599 PRO A CA   2  
ATOM 4486  C C    . PRO A 1 92  ? 10.593  4.692   -5.534  1.00 1.35  ? 1599 PRO A C    2  
ATOM 4487  O O    . PRO A 1 92  ? 11.558  4.925   -6.249  1.00 1.70  ? 1599 PRO A O    2  
ATOM 4488  C CB   . PRO A 1 92  ? 10.801  4.906   -3.041  1.00 1.28  ? 1599 PRO A CB   2  
ATOM 4489  C CG   . PRO A 1 92  ? 9.691   5.029   -2.056  1.00 1.18  ? 1599 PRO A CG   2  
ATOM 4490  C CD   . PRO A 1 92  ? 8.430   5.022   -2.858  1.00 0.93  ? 1599 PRO A CD   2  
ATOM 4491  H HA   . PRO A 1 92  ? 10.735  6.544   -4.455  1.00 1.31  ? 1599 PRO A HA   2  
ATOM 4492  H HB2  . PRO A 1 92  ? 11.034  3.871   -3.240  1.00 1.41  ? 1599 PRO A HB2  2  
ATOM 4493  H HB3  . PRO A 1 92  ? 11.686  5.422   -2.702  1.00 1.45  ? 1599 PRO A HB3  2  
ATOM 4494  H HG2  . PRO A 1 92  ? 9.709   4.193   -1.373  1.00 1.37  ? 1599 PRO A HG2  2  
ATOM 4495  H HG3  . PRO A 1 92  ? 9.785   5.960   -1.515  1.00 1.36  ? 1599 PRO A HG3  2  
ATOM 4496  H HD2  . PRO A 1 92  ? 8.098   4.011   -3.038  1.00 0.99  ? 1599 PRO A HD2  2  
ATOM 4497  H HD3  . PRO A 1 92  ? 7.660   5.590   -2.358  1.00 0.91  ? 1599 PRO A HD3  2  
ATOM 4498  N N    . SER A 1 93  ? 9.762   3.677   -5.735  1.00 1.31  ? 1600 SER A N    2  
ATOM 4499  C CA   . SER A 1 93  ? 9.872   2.761   -6.844  1.00 1.59  ? 1600 SER A CA   2  
ATOM 4500  C C    . SER A 1 93  ? 9.814   3.506   -8.194  1.00 1.38  ? 1600 SER A C    2  
ATOM 4501  O O    . SER A 1 93  ? 10.605  3.227   -9.112  1.00 1.40  ? 1600 SER A O    2  
ATOM 4502  C CB   . SER A 1 93  ? 8.739   1.749   -6.740  1.00 1.93  ? 1600 SER A CB   2  
ATOM 4503  O OG   . SER A 1 93  ? 8.671   1.226   -5.413  1.00 2.26  ? 1600 SER A OG   2  
ATOM 4504  H H    . SER A 1 93  ? 9.055   3.487   -5.085  1.00 1.26  ? 1600 SER A H    2  
ATOM 4505  H HA   . SER A 1 93  ? 10.811  2.233   -6.764  1.00 1.89  ? 1600 SER A HA   2  
ATOM 4506  H HB2  . SER A 1 93  ? 7.803   2.232   -6.983  1.00 1.88  ? 1600 SER A HB2  2  
ATOM 4507  H HB3  . SER A 1 93  ? 8.917   0.935   -7.428  1.00 2.21  ? 1600 SER A HB3  2  
ATOM 4508  H HG   . SER A 1 93  ? 8.687   0.266   -5.465  1.00 2.80  ? 1600 SER A HG   2  
ATOM 4509  N N    . LYS A 1 94  ? 8.912   4.454   -8.311  1.00 1.28  ? 1601 LYS A N    2  
ATOM 4510  C CA   . LYS A 1 94  ? 8.797   5.220   -9.505  1.00 1.26  ? 1601 LYS A CA   2  
ATOM 4511  C C    . LYS A 1 94  ? 8.394   6.640   -9.145  1.00 1.10  ? 1601 LYS A C    2  
ATOM 4512  O O    . LYS A 1 94  ? 7.396   6.856   -8.455  1.00 0.94  ? 1601 LYS A O    2  
ATOM 4513  C CB   . LYS A 1 94  ? 7.825   4.550   -10.498 1.00 1.44  ? 1601 LYS A CB   2  
ATOM 4514  C CG   . LYS A 1 94  ? 7.622   5.289   -11.829 1.00 1.77  ? 1601 LYS A CG   2  
ATOM 4515  C CD   . LYS A 1 94  ? 8.926   5.645   -12.592 1.00 2.13  ? 1601 LYS A CD   2  
ATOM 4516  C CE   . LYS A 1 94  ? 9.810   4.442   -12.976 1.00 2.60  ? 1601 LYS A CE   2  
ATOM 4517  N NZ   . LYS A 1 94  ? 10.627  3.924   -11.848 1.00 3.01  ? 1601 LYS A NZ   2  
ATOM 4518  H H    . LYS A 1 94  ? 8.305   4.679   -7.574  1.00 1.31  ? 1601 LYS A H    2  
ATOM 4519  H HA   . LYS A 1 94  ? 9.791   5.204   -9.929  1.00 1.40  ? 1601 LYS A HA   2  
ATOM 4520  H HB2  . LYS A 1 94  ? 8.197   3.562   -10.725 1.00 1.70  ? 1601 LYS A HB2  2  
ATOM 4521  H HB3  . LYS A 1 94  ? 6.863   4.453   -10.016 1.00 1.38  ? 1601 LYS A HB3  2  
ATOM 4522  H HG2  . LYS A 1 94  ? 7.021   4.667   -12.475 1.00 2.10  ? 1601 LYS A HG2  2  
ATOM 4523  H HG3  . LYS A 1 94  ? 7.079   6.201   -11.623 1.00 2.13  ? 1601 LYS A HG3  2  
ATOM 4524  H HD2  . LYS A 1 94  ? 8.656   6.159   -13.503 1.00 2.59  ? 1601 LYS A HD2  2  
ATOM 4525  H HD3  . LYS A 1 94  ? 9.500   6.319   -11.974 1.00 2.51  ? 1601 LYS A HD3  2  
ATOM 4526  H HE2  . LYS A 1 94  ? 9.171   3.646   -13.329 1.00 3.03  ? 1601 LYS A HE2  2  
ATOM 4527  H HE3  . LYS A 1 94  ? 10.466  4.745   -13.780 1.00 3.02  ? 1601 LYS A HE3  2  
ATOM 4528  H HZ1  . LYS A 1 94  ? 11.169  4.695   -11.403 1.00 3.45  ? 1601 LYS A HZ1  2  
ATOM 4529  H HZ2  . LYS A 1 94  ? 11.337  3.248   -12.212 1.00 3.26  ? 1601 LYS A HZ2  2  
ATOM 4530  H HZ3  . LYS A 1 94  ? 10.076  3.430   -11.118 1.00 3.29  ? 1601 LYS A HZ3  2  
ATOM 4531  N N    . SER A 1 95  ? 9.189   7.586   -9.568  1.00 1.23  ? 1602 SER A N    2  
ATOM 4532  C CA   . SER A 1 95  ? 9.014   8.943   -9.242  1.00 1.24  ? 1602 SER A CA   2  
ATOM 4533  C C    . SER A 1 95  ? 7.913   9.558   -10.112 1.00 1.14  ? 1602 SER A C    2  
ATOM 4534  O O    . SER A 1 95  ? 7.697   9.130   -11.253 1.00 1.25  ? 1602 SER A O    2  
ATOM 4535  C CB   . SER A 1 95  ? 10.348  9.641   -9.483  1.00 1.53  ? 1602 SER A CB   2  
ATOM 4536  O OG   . SER A 1 95  ? 11.408  8.892   -8.865  1.00 2.07  ? 1602 SER A OG   2  
ATOM 4537  H H    . SER A 1 95  ? 9.957   7.416   -10.150 1.00 1.39  ? 1602 SER A H    2  
ATOM 4538  H HA   . SER A 1 95  ? 8.793   8.997   -8.187  1.00 1.24  ? 1602 SER A HA   2  
ATOM 4539  H HB2  . SER A 1 95  ? 10.533  9.710   -10.545 1.00 1.93  ? 1602 SER A HB2  2  
ATOM 4540  H HB3  . SER A 1 95  ? 10.324  10.630  -9.051  1.00 1.67  ? 1602 SER A HB3  2  
ATOM 4541  H HG   . SER A 1 95  ? 11.160  8.790   -7.930  1.00 2.44  ? 1602 SER A HG   2  
ATOM 4542  N N    . GLY A 1 96  ? 7.215   10.515  -9.563  1.00 1.06  ? 1603 GLY A N    2  
ATOM 4543  C CA   . GLY A 1 96  ? 6.195   11.231  -10.297 1.00 1.08  ? 1603 GLY A CA   2  
ATOM 4544  C C    . GLY A 1 96  ? 4.787   10.847  -9.895  1.00 0.95  ? 1603 GLY A C    2  
ATOM 4545  O O    . GLY A 1 96  ? 3.825   11.560  -10.212 1.00 1.06  ? 1603 GLY A O    2  
ATOM 4546  H H    . GLY A 1 96  ? 7.393   10.721  -8.621  1.00 1.07  ? 1603 GLY A H    2  
ATOM 4547  H HA2  . GLY A 1 96  ? 6.324   12.290  -10.130 1.00 1.20  ? 1603 GLY A HA2  2  
ATOM 4548  H HA3  . GLY A 1 96  ? 6.324   11.028  -11.350 1.00 1.20  ? 1603 GLY A HA3  2  
ATOM 4549  N N    . LEU A 1 97  ? 4.644   9.752   -9.188  1.00 0.81  ? 1604 LEU A N    2  
ATOM 4550  C CA   . LEU A 1 97  ? 3.376   9.308   -8.772  1.00 0.78  ? 1604 LEU A CA   2  
ATOM 4551  C C    . LEU A 1 97  ? 3.373   8.853   -7.307  1.00 0.60  ? 1604 LEU A C    2  
ATOM 4552  O O    . LEU A 1 97  ? 4.383   8.364   -6.780  1.00 0.64  ? 1604 LEU A O    2  
ATOM 4553  C CB   . LEU A 1 97  ? 2.799   8.269   -9.765  1.00 1.01  ? 1604 LEU A CB   2  
ATOM 4554  C CG   . LEU A 1 97  ? 3.241   6.758   -9.823  1.00 1.11  ? 1604 LEU A CG   2  
ATOM 4555  C CD1  . LEU A 1 97  ? 4.689   6.531   -10.169 1.00 1.84  ? 1604 LEU A CD1  2  
ATOM 4556  C CD2  . LEU A 1 97  ? 2.850   5.983   -8.583  1.00 1.51  ? 1604 LEU A CD2  2  
ATOM 4557  H H    . LEU A 1 97  ? 5.402   9.208   -8.930  1.00 0.82  ? 1604 LEU A H    2  
ATOM 4558  H HA   . LEU A 1 97  ? 2.745   10.184  -8.812  1.00 0.90  ? 1604 LEU A HA   2  
ATOM 4559  H HB2  . LEU A 1 97  ? 1.735   8.303   -9.655  1.00 1.67  ? 1604 LEU A HB2  2  
ATOM 4560  H HB3  . LEU A 1 97  ? 3.059   8.720   -10.712 1.00 1.47  ? 1604 LEU A HB3  2  
ATOM 4561  H HG   . LEU A 1 97  ? 2.692   6.324   -10.646 1.00 1.88  ? 1604 LEU A HG   2  
ATOM 4562  H HD11 . LEU A 1 97  ? 4.991   7.140   -11.008 1.00 2.23  ? 1604 LEU A HD11 2  
ATOM 4563  H HD12 . LEU A 1 97  ? 4.759   5.497   -10.481 1.00 2.37  ? 1604 LEU A HD12 2  
ATOM 4564  H HD13 . LEU A 1 97  ? 5.340   6.654   -9.319  1.00 2.38  ? 1604 LEU A HD13 2  
ATOM 4565  H HD21 . LEU A 1 97  ? 1.779   6.027   -8.456  1.00 1.94  ? 1604 LEU A HD21 2  
ATOM 4566  H HD22 . LEU A 1 97  ? 3.334   6.404   -7.714  1.00 2.01  ? 1604 LEU A HD22 2  
ATOM 4567  H HD23 . LEU A 1 97  ? 3.150   4.952   -8.700  1.00 2.05  ? 1604 LEU A HD23 2  
ATOM 4568  N N    . SER A 1 98  ? 2.256   9.061   -6.660  1.00 0.57  ? 1605 SER A N    2  
ATOM 4569  C CA   . SER A 1 98  ? 2.045   8.724   -5.274  1.00 0.45  ? 1605 SER A CA   2  
ATOM 4570  C C    . SER A 1 98  ? 1.360   7.362   -5.164  1.00 0.39  ? 1605 SER A C    2  
ATOM 4571  O O    . SER A 1 98  ? 0.654   6.943   -6.098  1.00 0.46  ? 1605 SER A O    2  
ATOM 4572  C CB   . SER A 1 98  ? 1.155   9.821   -4.685  1.00 0.52  ? 1605 SER A CB   2  
ATOM 4573  O OG   . SER A 1 98  ? 0.059   10.097  -5.554  1.00 1.41  ? 1605 SER A OG   2  
ATOM 4574  H H    . SER A 1 98  ? 1.497   9.467   -7.130  1.00 0.71  ? 1605 SER A H    2  
ATOM 4575  H HA   . SER A 1 98  ? 2.988   8.723   -4.749  1.00 0.43  ? 1605 SER A HA   2  
ATOM 4576  H HB2  . SER A 1 98  ? 0.755   9.545   -3.720  1.00 1.11  ? 1605 SER A HB2  2  
ATOM 4577  H HB3  . SER A 1 98  ? 1.732   10.721  -4.566  1.00 1.16  ? 1605 SER A HB3  2  
ATOM 4578  H HG   . SER A 1 98  ? -0.131  11.049  -5.509  1.00 1.96  ? 1605 SER A HG   2  
ATOM 4579  N N    . TYR A 1 99  ? 1.578   6.670   -4.042  1.00 0.32  ? 1606 TYR A N    2  
ATOM 4580  C CA   . TYR A 1 99  ? 0.928   5.400   -3.777  1.00 0.28  ? 1606 TYR A CA   2  
ATOM 4581  C C    . TYR A 1 99  ? -0.592  5.557   -3.744  1.00 0.27  ? 1606 TYR A C    2  
ATOM 4582  O O    . TYR A 1 99  ? -1.110  6.654   -3.443  1.00 0.32  ? 1606 TYR A O    2  
ATOM 4583  C CB   . TYR A 1 99  ? 1.420   4.830   -2.460  1.00 0.27  ? 1606 TYR A CB   2  
ATOM 4584  C CG   . TYR A 1 99  ? 2.783   4.186   -2.505  1.00 0.32  ? 1606 TYR A CG   2  
ATOM 4585  C CD1  . TYR A 1 99  ? 2.945   2.886   -2.937  1.00 0.41  ? 1606 TYR A CD1  2  
ATOM 4586  C CD2  . TYR A 1 99  ? 3.916   4.898   -2.129  1.00 0.37  ? 1606 TYR A CD2  2  
ATOM 4587  C CE1  . TYR A 1 99  ? 4.193   2.307   -2.991  1.00 0.49  ? 1606 TYR A CE1  2  
ATOM 4588  C CE2  . TYR A 1 99  ? 5.166   4.330   -2.179  1.00 0.46  ? 1606 TYR A CE2  2  
ATOM 4589  C CZ   . TYR A 1 99  ? 5.274   2.970   -2.565  1.00 0.54  ? 1606 TYR A CZ   2  
ATOM 4590  O OH   . TYR A 1 99  ? 6.552   2.456   -2.653  1.00 0.60  ? 1606 TYR A OH   2  
ATOM 4591  H H    . TYR A 1 99  ? 2.193   7.007   -3.352  1.00 0.35  ? 1606 TYR A H    2  
ATOM 4592  H HA   . TYR A 1 99  ? 1.201   4.721   -4.572  1.00 0.31  ? 1606 TYR A HA   2  
ATOM 4593  H HB2  . TYR A 1 99  ? 1.488   5.657   -1.767  1.00 0.30  ? 1606 TYR A HB2  2  
ATOM 4594  H HB3  . TYR A 1 99  ? 0.710   4.128   -2.053  1.00 0.31  ? 1606 TYR A HB3  2  
ATOM 4595  H HD1  . TYR A 1 99  ? 2.072   2.321   -3.232  1.00 0.46  ? 1606 TYR A HD1  2  
ATOM 4596  H HD2  . TYR A 1 99  ? 3.814   5.919   -1.789  1.00 0.40  ? 1606 TYR A HD2  2  
ATOM 4597  H HE1  . TYR A 1 99  ? 4.299   1.287   -3.330  1.00 0.57  ? 1606 TYR A HE1  2  
ATOM 4598  H HE2  . TYR A 1 99  ? 6.032   4.902   -1.881  1.00 0.54  ? 1606 TYR A HE2  2  
ATOM 4599  H HH   . TYR A 1 99  ? 7.021   2.659   -1.837  1.00 1.06  ? 1606 TYR A HH   2  
ATOM 4600  N N    . LYS A 1 100 ? -1.294  4.485   -4.038  1.00 0.26  ? 1607 LYS A N    2  
ATOM 4601  C CA   . LYS A 1 100 ? -2.738  4.503   -4.114  1.00 0.25  ? 1607 LYS A CA   2  
ATOM 4602  C C    . LYS A 1 100 ? -3.259  3.130   -3.777  1.00 0.24  ? 1607 LYS A C    2  
ATOM 4603  O O    . LYS A 1 100 ? -2.837  2.138   -4.373  1.00 0.29  ? 1607 LYS A O    2  
ATOM 4604  C CB   . LYS A 1 100 ? -3.192  4.913   -5.525  1.00 0.29  ? 1607 LYS A CB   2  
ATOM 4605  C CG   . LYS A 1 100 ? -4.703  4.903   -5.752  1.00 0.88  ? 1607 LYS A CG   2  
ATOM 4606  C CD   . LYS A 1 100 ? -5.097  5.309   -7.181  1.00 0.81  ? 1607 LYS A CD   2  
ATOM 4607  C CE   . LYS A 1 100 ? -4.599  4.315   -8.231  1.00 0.74  ? 1607 LYS A CE   2  
ATOM 4608  N NZ   . LYS A 1 100 ? -5.135  4.603   -9.572  1.00 1.45  ? 1607 LYS A NZ   2  
ATOM 4609  H H    . LYS A 1 100 ? -0.853  3.615   -4.174  1.00 0.29  ? 1607 LYS A H    2  
ATOM 4610  H HA   . LYS A 1 100 ? -3.112  5.218   -3.397  1.00 0.27  ? 1607 LYS A HA   2  
ATOM 4611  H HB2  . LYS A 1 100 ? -2.852  5.922   -5.700  1.00 0.76  ? 1607 LYS A HB2  2  
ATOM 4612  H HB3  . LYS A 1 100 ? -2.723  4.229   -6.211  1.00 0.84  ? 1607 LYS A HB3  2  
ATOM 4613  H HG2  . LYS A 1 100 ? -5.072  3.903   -5.573  1.00 1.42  ? 1607 LYS A HG2  2  
ATOM 4614  H HG3  . LYS A 1 100 ? -5.155  5.597   -5.056  1.00 1.38  ? 1607 LYS A HG3  2  
ATOM 4615  H HD2  . LYS A 1 100 ? -6.174  5.361   -7.245  1.00 1.30  ? 1607 LYS A HD2  2  
ATOM 4616  H HD3  . LYS A 1 100 ? -4.680  6.283   -7.393  1.00 1.28  ? 1607 LYS A HD3  2  
ATOM 4617  H HE2  . LYS A 1 100 ? -3.525  4.375   -8.321  1.00 1.30  ? 1607 LYS A HE2  2  
ATOM 4618  H HE3  . LYS A 1 100 ? -4.890  3.314   -7.948  1.00 1.46  ? 1607 LYS A HE3  2  
ATOM 4619  H HZ1  . LYS A 1 100 ? -4.820  5.530   -9.934  1.00 2.00  ? 1607 LYS A HZ1  2  
ATOM 4620  H HZ2  . LYS A 1 100 ? -6.178  4.585   -9.569  1.00 1.99  ? 1607 LYS A HZ2  2  
ATOM 4621  H HZ3  . LYS A 1 100 ? -4.810  3.866   -10.235 1.00 1.94  ? 1607 LYS A HZ3  2  
ATOM 4622  N N    . SER A 1 101 ? -4.149  3.070   -2.846  1.00 0.24  ? 1608 SER A N    2  
ATOM 4623  C CA   . SER A 1 101 ? -4.686  1.817   -2.402  1.00 0.24  ? 1608 SER A CA   2  
ATOM 4624  C C    . SER A 1 101 ? -6.105  1.635   -2.931  1.00 0.24  ? 1608 SER A C    2  
ATOM 4625  O O    . SER A 1 101 ? -6.928  2.554   -2.855  1.00 0.29  ? 1608 SER A O    2  
ATOM 4626  C CB   . SER A 1 101 ? -4.661  1.764   -0.878  1.00 0.29  ? 1608 SER A CB   2  
ATOM 4627  O OG   . SER A 1 101 ? -3.339  1.962   -0.389  1.00 1.15  ? 1608 SER A OG   2  
ATOM 4628  H H    . SER A 1 101 ? -4.494  3.906   -2.462  1.00 0.28  ? 1608 SER A H    2  
ATOM 4629  H HA   . SER A 1 101 ? -4.061  1.026   -2.789  1.00 0.26  ? 1608 SER A HA   2  
ATOM 4630  H HB2  . SER A 1 101 ? -5.301  2.539   -0.481  1.00 0.83  ? 1608 SER A HB2  2  
ATOM 4631  H HB3  . SER A 1 101 ? -5.014  0.798   -0.546  1.00 1.06  ? 1608 SER A HB3  2  
ATOM 4632  H HG   . SER A 1 101 ? -2.920  2.697   -0.854  1.00 1.61  ? 1608 SER A HG   2  
ATOM 4633  N N    . VAL A 1 102 ? -6.361  0.494   -3.517  1.00 0.22  ? 1609 VAL A N    2  
ATOM 4634  C CA   . VAL A 1 102 ? -7.645  0.152   -4.015  1.00 0.22  ? 1609 VAL A CA   2  
ATOM 4635  C C    . VAL A 1 102 ? -8.219  -0.924  -3.118  1.00 0.22  ? 1609 VAL A C    2  
ATOM 4636  O O    . VAL A 1 102 ? -7.735  -2.067  -3.108  1.00 0.24  ? 1609 VAL A O    2  
ATOM 4637  C CB   . VAL A 1 102 ? -7.559  -0.390  -5.462  1.00 0.23  ? 1609 VAL A CB   2  
ATOM 4638  C CG1  . VAL A 1 102 ? -8.939  -0.601  -6.027  1.00 0.25  ? 1609 VAL A CG1  2  
ATOM 4639  C CG2  . VAL A 1 102 ? -6.747  0.536   -6.356  1.00 0.25  ? 1609 VAL A CG2  2  
ATOM 4640  H H    . VAL A 1 102 ? -5.667  -0.186  -3.650  1.00 0.25  ? 1609 VAL A H    2  
ATOM 4641  H HA   . VAL A 1 102 ? -8.297  1.012   -3.988  1.00 0.23  ? 1609 VAL A HA   2  
ATOM 4642  H HB   . VAL A 1 102 ? -7.067  -1.351  -5.430  1.00 0.24  ? 1609 VAL A HB   2  
ATOM 4643  H HG11 . VAL A 1 102 ? -9.469  -1.321  -5.423  1.00 1.09  ? 1609 VAL A HG11 2  
ATOM 4644  H HG12 . VAL A 1 102 ? -8.870  -0.938  -7.051  1.00 1.00  ? 1609 VAL A HG12 2  
ATOM 4645  H HG13 . VAL A 1 102 ? -9.442  0.352   -5.981  1.00 1.06  ? 1609 VAL A HG13 2  
ATOM 4646  H HG21 . VAL A 1 102 ? -7.216  1.508   -6.408  1.00 1.03  ? 1609 VAL A HG21 2  
ATOM 4647  H HG22 . VAL A 1 102 ? -6.688  0.114   -7.348  1.00 1.06  ? 1609 VAL A HG22 2  
ATOM 4648  H HG23 . VAL A 1 102 ? -5.751  0.640   -5.953  1.00 1.06  ? 1609 VAL A HG23 2  
ATOM 4649  N N    . ILE A 1 103 ? -9.194  -0.559  -2.343  1.00 0.22  ? 1610 ILE A N    2  
ATOM 4650  C CA   . ILE A 1 103 ? -9.837  -1.474  -1.463  1.00 0.22  ? 1610 ILE A CA   2  
ATOM 4651  C C    . ILE A 1 103 ? -11.099 -1.953  -2.144  1.00 0.23  ? 1610 ILE A C    2  
ATOM 4652  O O    . ILE A 1 103 ? -12.082 -1.223  -2.268  1.00 0.34  ? 1610 ILE A O    2  
ATOM 4653  C CB   . ILE A 1 103 ? -10.150 -0.827  -0.098  1.00 0.27  ? 1610 ILE A CB   2  
ATOM 4654  C CG1  . ILE A 1 103 ? -8.859  -0.251  0.512   1.00 0.33  ? 1610 ILE A CG1  2  
ATOM 4655  C CG2  . ILE A 1 103 ? -10.745 -1.872  0.838   1.00 0.28  ? 1610 ILE A CG2  2  
ATOM 4656  C CD1  . ILE A 1 103 ? -9.073  0.529   1.781   1.00 0.45  ? 1610 ILE A CD1  2  
ATOM 4657  H H    . ILE A 1 103 ? -9.531  0.364   -2.370  1.00 0.24  ? 1610 ILE A H    2  
ATOM 4658  H HA   . ILE A 1 103 ? -9.176  -2.317  -1.323  1.00 0.22  ? 1610 ILE A HA   2  
ATOM 4659  H HB   . ILE A 1 103 ? -10.862 -0.026  -0.236  1.00 0.34  ? 1610 ILE A HB   2  
ATOM 4660  H HG12 . ILE A 1 103 ? -8.195  -1.068  0.750   1.00 0.69  ? 1610 ILE A HG12 2  
ATOM 4661  H HG13 . ILE A 1 103 ? -8.357  0.397   -0.190  1.00 0.67  ? 1610 ILE A HG13 2  
ATOM 4662  H HG21 . ILE A 1 103 ? -10.042 -2.682  0.965   1.00 1.04  ? 1610 ILE A HG21 2  
ATOM 4663  H HG22 . ILE A 1 103 ? -11.661 -2.255  0.413   1.00 1.03  ? 1610 ILE A HG22 2  
ATOM 4664  H HG23 . ILE A 1 103 ? -10.951 -1.418  1.796   1.00 1.08  ? 1610 ILE A HG23 2  
ATOM 4665  H HD11 . ILE A 1 103 ? -8.115  0.901   2.107   1.00 1.17  ? 1610 ILE A HD11 2  
ATOM 4666  H HD12 . ILE A 1 103 ? -9.510  -0.119  2.526   1.00 1.20  ? 1610 ILE A HD12 2  
ATOM 4667  H HD13 . ILE A 1 103 ? -9.736  1.361   1.594   1.00 1.10  ? 1610 ILE A HD13 2  
ATOM 4668  N N    . SER A 1 104 ? -11.019 -3.138  -2.627  1.00 0.23  ? 1611 SER A N    2  
ATOM 4669  C CA   . SER A 1 104 ? -12.036 -3.755  -3.401  1.00 0.24  ? 1611 SER A CA   2  
ATOM 4670  C C    . SER A 1 104 ? -12.861 -4.713  -2.525  1.00 0.22  ? 1611 SER A C    2  
ATOM 4671  O O    . SER A 1 104 ? -12.374 -5.784  -2.090  1.00 0.25  ? 1611 SER A O    2  
ATOM 4672  C CB   . SER A 1 104 ? -11.341 -4.492  -4.559  1.00 0.30  ? 1611 SER A CB   2  
ATOM 4673  O OG   . SER A 1 104 ? -12.245 -5.020  -5.507  1.00 1.26  ? 1611 SER A OG   2  
ATOM 4674  H H    . SER A 1 104 ? -10.207 -3.649  -2.450  1.00 0.30  ? 1611 SER A H    2  
ATOM 4675  H HA   . SER A 1 104 ? -12.673 -2.988  -3.815  1.00 0.27  ? 1611 SER A HA   2  
ATOM 4676  H HB2  . SER A 1 104 ? -10.679 -3.809  -5.068  1.00 1.06  ? 1611 SER A HB2  2  
ATOM 4677  H HB3  . SER A 1 104 ? -10.755 -5.302  -4.149  1.00 1.11  ? 1611 SER A HB3  2  
ATOM 4678  H HG   . SER A 1 104 ? -11.979 -5.942  -5.648  1.00 1.89  ? 1611 SER A HG   2  
ATOM 4679  N N    . PHE A 1 105 ? -14.072 -4.308  -2.235  1.00 0.21  ? 1612 PHE A N    2  
ATOM 4680  C CA   . PHE A 1 105 ? -14.990 -5.095  -1.457  1.00 0.21  ? 1612 PHE A CA   2  
ATOM 4681  C C    . PHE A 1 105 ? -15.811 -5.967  -2.368  1.00 0.23  ? 1612 PHE A C    2  
ATOM 4682  O O    . PHE A 1 105 ? -16.548 -5.469  -3.232  1.00 0.26  ? 1612 PHE A O    2  
ATOM 4683  C CB   . PHE A 1 105 ? -15.901 -4.214  -0.612  1.00 0.23  ? 1612 PHE A CB   2  
ATOM 4684  C CG   . PHE A 1 105 ? -15.180 -3.400  0.418   1.00 0.21  ? 1612 PHE A CG   2  
ATOM 4685  C CD1  . PHE A 1 105 ? -14.547 -4.020  1.468   1.00 0.22  ? 1612 PHE A CD1  2  
ATOM 4686  C CD2  . PHE A 1 105 ? -15.142 -2.017  0.341   1.00 0.23  ? 1612 PHE A CD2  2  
ATOM 4687  C CE1  . PHE A 1 105 ? -13.895 -3.298  2.426   1.00 0.24  ? 1612 PHE A CE1  2  
ATOM 4688  C CE2  . PHE A 1 105 ? -14.490 -1.281  1.309   1.00 0.24  ? 1612 PHE A CE2  2  
ATOM 4689  C CZ   . PHE A 1 105 ? -13.866 -1.931  2.358   1.00 0.24  ? 1612 PHE A CZ   2  
ATOM 4690  H H    . PHE A 1 105 ? -14.368 -3.437  -2.584  1.00 0.23  ? 1612 PHE A H    2  
ATOM 4691  H HA   . PHE A 1 105 ? -14.419 -5.730  -0.801  1.00 0.22  ? 1612 PHE A HA   2  
ATOM 4692  H HB2  . PHE A 1 105 ? -16.438 -3.537  -1.257  1.00 0.26  ? 1612 PHE A HB2  2  
ATOM 4693  H HB3  . PHE A 1 105 ? -16.611 -4.848  -0.102  1.00 0.27  ? 1612 PHE A HB3  2  
ATOM 4694  H HD1  . PHE A 1 105 ? -14.552 -5.096  1.529   1.00 0.25  ? 1612 PHE A HD1  2  
ATOM 4695  H HD2  . PHE A 1 105 ? -15.636 -1.511  -0.475  1.00 0.27  ? 1612 PHE A HD2  2  
ATOM 4696  H HE1  . PHE A 1 105 ? -13.410 -3.809  3.244   1.00 0.28  ? 1612 PHE A HE1  2  
ATOM 4697  H HE2  . PHE A 1 105 ? -14.465 -0.204  1.238   1.00 0.28  ? 1612 PHE A HE2  2  
ATOM 4698  H HZ   . PHE A 1 105 ? -13.347 -1.395  3.136   1.00 0.27  ? 1612 PHE A HZ   2  
ATOM 4699  N N    . VAL A 1 106 ? -15.677 -7.256  -2.191  1.00 0.26  ? 1613 VAL A N    2  
ATOM 4700  C CA   . VAL A 1 106 ? -16.351 -8.222  -3.014  1.00 0.33  ? 1613 VAL A CA   2  
ATOM 4701  C C    . VAL A 1 106 ? -17.198 -9.120  -2.114  1.00 0.35  ? 1613 VAL A C    2  
ATOM 4702  O O    . VAL A 1 106 ? -16.759 -9.503  -1.015  1.00 0.34  ? 1613 VAL A O    2  
ATOM 4703  C CB   . VAL A 1 106 ? -15.321 -9.083  -3.802  1.00 0.40  ? 1613 VAL A CB   2  
ATOM 4704  C CG1  . VAL A 1 106 ? -16.021 -10.035 -4.748  1.00 0.50  ? 1613 VAL A CG1  2  
ATOM 4705  C CG2  . VAL A 1 106 ? -14.336 -8.203  -4.571  1.00 0.43  ? 1613 VAL A CG2  2  
ATOM 4706  H H    . VAL A 1 106 ? -15.113 -7.584  -1.459  1.00 0.27  ? 1613 VAL A H    2  
ATOM 4707  H HA   . VAL A 1 106 ? -16.989 -7.700  -3.713  1.00 0.38  ? 1613 VAL A HA   2  
ATOM 4708  H HB   . VAL A 1 106 ? -14.762 -9.672  -3.089  1.00 0.40  ? 1613 VAL A HB   2  
ATOM 4709  H HG11 . VAL A 1 106 ? -15.285 -10.620 -5.279  1.00 1.11  ? 1613 VAL A HG11 2  
ATOM 4710  H HG12 . VAL A 1 106 ? -16.616 -9.467  -5.446  1.00 1.23  ? 1613 VAL A HG12 2  
ATOM 4711  H HG13 . VAL A 1 106 ? -16.658 -10.689 -4.172  1.00 1.06  ? 1613 VAL A HG13 2  
ATOM 4712  H HG21 . VAL A 1 106 ? -13.631 -8.828  -5.098  1.00 1.08  ? 1613 VAL A HG21 2  
ATOM 4713  H HG22 . VAL A 1 106 ? -13.805 -7.565  -3.879  1.00 1.09  ? 1613 VAL A HG22 2  
ATOM 4714  H HG23 . VAL A 1 106 ? -14.877 -7.594  -5.280  1.00 1.14  ? 1613 VAL A HG23 2  
ATOM 4715  N N    . CYS A 1 107 ? -18.391 -9.432  -2.574  1.00 0.42  ? 1614 CYS A N    2  
ATOM 4716  C CA   . CYS A 1 107 ? -19.359 -10.238 -1.847  1.00 0.47  ? 1614 CYS A CA   2  
ATOM 4717  C C    . CYS A 1 107 ? -18.904 -11.684 -1.673  1.00 0.51  ? 1614 CYS A C    2  
ATOM 4718  O O    . CYS A 1 107 ? -18.673 -12.387 -2.659  1.00 0.58  ? 1614 CYS A O    2  
ATOM 4719  C CB   . CYS A 1 107 ? -20.695 -10.223 -2.596  1.00 0.59  ? 1614 CYS A CB   2  
ATOM 4720  S SG   . CYS A 1 107 ? -21.905 -11.468 -2.022  1.00 0.77  ? 1614 CYS A SG   2  
ATOM 4721  H H    . CYS A 1 107 ? -18.654 -9.124  -3.473  1.00 0.48  ? 1614 CYS A H    2  
ATOM 4722  H HA   . CYS A 1 107 ? -19.520 -9.771  -0.888  1.00 0.45  ? 1614 CYS A HA   2  
ATOM 4723  H HB2  . CYS A 1 107 ? -21.153 -9.253  -2.476  1.00 0.63  ? 1614 CYS A HB2  2  
ATOM 4724  H HB3  . CYS A 1 107 ? -20.510 -10.401 -3.644  1.00 0.60  ? 1614 CYS A HB3  2  
ATOM 4725  N N    . ARG A 1 108 ? -18.720 -12.117 -0.438  1.00 0.51  ? 1615 ARG A N    2  
ATOM 4726  C CA   . ARG A 1 108 ? -18.451 -13.509 -0.173  1.00 0.57  ? 1615 ARG A CA   2  
ATOM 4727  C C    . ARG A 1 108 ? -19.276 -13.926 1.063   1.00 0.61  ? 1615 ARG A C    2  
ATOM 4728  O O    . ARG A 1 108 ? -18.802 -13.788 2.196   1.00 0.67  ? 1615 ARG A O    2  
ATOM 4729  C CB   . ARG A 1 108 ? -16.954 -13.719 0.080   1.00 0.69  ? 1615 ARG A CB   2  
ATOM 4730  C CG   . ARG A 1 108 ? -16.455 -15.169 -0.005  1.00 1.17  ? 1615 ARG A CG   2  
ATOM 4731  C CD   . ARG A 1 108 ? -16.755 -15.766 -1.375  1.00 1.19  ? 1615 ARG A CD   2  
ATOM 4732  N NE   . ARG A 1 108 ? -15.932 -16.952 -1.701  1.00 1.74  ? 1615 ARG A NE   2  
ATOM 4733  C CZ   . ARG A 1 108 ? -16.361 -17.979 -2.443  1.00 1.99  ? 1615 ARG A CZ   2  
ATOM 4734  N NH1  . ARG A 1 108 ? -17.657 -18.242 -2.511  1.00 2.19  ? 1615 ARG A NH1  2  
ATOM 4735  N NH2  . ARG A 1 108 ? -15.489 -18.811 -3.017  1.00 2.53  ? 1615 ARG A NH2  2  
ATOM 4736  H H    . ARG A 1 108 ? -18.757 -11.483 0.314   1.00 0.50  ? 1615 ARG A H    2  
ATOM 4737  H HA   . ARG A 1 108 ? -18.749 -14.032 -1.069  1.00 0.61  ? 1615 ARG A HA   2  
ATOM 4738  H HB2  . ARG A 1 108 ? -16.402 -13.135 -0.642  1.00 0.63  ? 1615 ARG A HB2  2  
ATOM 4739  H HB3  . ARG A 1 108 ? -16.722 -13.341 1.065   1.00 0.91  ? 1615 ARG A HB3  2  
ATOM 4740  H HG2  . ARG A 1 108 ? -15.388 -15.186 0.160   1.00 1.65  ? 1615 ARG A HG2  2  
ATOM 4741  H HG3  . ARG A 1 108 ? -16.950 -15.757 0.752   1.00 1.58  ? 1615 ARG A HG3  2  
ATOM 4742  H HD2  . ARG A 1 108 ? -17.796 -16.056 -1.402  1.00 1.21  ? 1615 ARG A HD2  2  
ATOM 4743  H HD3  . ARG A 1 108 ? -16.583 -15.007 -2.123  1.00 1.47  ? 1615 ARG A HD3  2  
ATOM 4744  H HE   . ARG A 1 108 ? -14.981 -16.873 -1.447  1.00 2.22  ? 1615 ARG A HE   2  
ATOM 4745  H HH11 . ARG A 1 108 ? -18.332 -17.697 -1.992  1.00 2.21  ? 1615 ARG A HH11 2  
ATOM 4746  H HH12 . ARG A 1 108 ? -18.065 -18.970 -3.076  1.00 2.68  ? 1615 ARG A HH12 2  
ATOM 4747  H HH21 . ARG A 1 108 ? -14.489 -18.699 -2.917  1.00 2.92  ? 1615 ARG A HH21 2  
ATOM 4748  H HH22 . ARG A 1 108 ? -15.780 -19.577 -3.590  1.00 2.77  ? 1615 ARG A HH22 2  
ATOM 4749  N N    . PRO A 1 109 ? -20.520 -14.434 0.873   1.00 0.67  ? 1616 PRO A N    2  
ATOM 4750  C CA   . PRO A 1 109 ? -21.436 -14.759 1.997   1.00 0.83  ? 1616 PRO A CA   2  
ATOM 4751  C C    . PRO A 1 109 ? -20.950 -15.934 2.865   1.00 0.95  ? 1616 PRO A C    2  
ATOM 4752  O O    . PRO A 1 109 ? -21.435 -16.152 3.981   1.00 1.10  ? 1616 PRO A O    2  
ATOM 4753  C CB   . PRO A 1 109 ? -22.748 -15.113 1.294   1.00 0.94  ? 1616 PRO A CB   2  
ATOM 4754  C CG   . PRO A 1 109 ? -22.354 -15.554 -0.068  1.00 0.92  ? 1616 PRO A CG   2  
ATOM 4755  C CD   . PRO A 1 109 ? -21.144 -14.748 -0.439  1.00 0.69  ? 1616 PRO A CD   2  
ATOM 4756  H HA   . PRO A 1 109 ? -21.585 -13.897 2.630   1.00 0.89  ? 1616 PRO A HA   2  
ATOM 4757  H HB2  . PRO A 1 109 ? -23.247 -15.903 1.835   1.00 1.14  ? 1616 PRO A HB2  2  
ATOM 4758  H HB3  . PRO A 1 109 ? -23.384 -14.241 1.255   1.00 1.05  ? 1616 PRO A HB3  2  
ATOM 4759  H HG2  . PRO A 1 109 ? -22.120 -16.607 -0.062  1.00 1.22  ? 1616 PRO A HG2  2  
ATOM 4760  H HG3  . PRO A 1 109 ? -23.159 -15.356 -0.761  1.00 1.07  ? 1616 PRO A HG3  2  
ATOM 4761  H HD2  . PRO A 1 109 ? -20.498 -15.356 -1.055  1.00 0.71  ? 1616 PRO A HD2  2  
ATOM 4762  H HD3  . PRO A 1 109 ? -21.454 -13.856 -0.962  1.00 0.71  ? 1616 PRO A HD3  2  
ATOM 4763  N N    . GLU A 1 110 ? -20.001 -16.680 2.329   1.00 0.99  ? 1617 GLU A N    2  
ATOM 4764  C CA   . GLU A 1 110 ? -19.367 -17.812 2.985   1.00 1.19  ? 1617 GLU A CA   2  
ATOM 4765  C C    . GLU A 1 110 ? -18.718 -17.391 4.297   1.00 1.17  ? 1617 GLU A C    2  
ATOM 4766  O O    . GLU A 1 110 ? -18.813 -18.130 5.291   1.00 1.74  ? 1617 GLU A O    2  
ATOM 4767  C CB   . GLU A 1 110 ? -18.310 -18.432 2.052   1.00 1.39  ? 1617 GLU A CB   2  
ATOM 4768  C CG   . GLU A 1 110 ? -18.863 -19.229 0.868   1.00 1.76  ? 1617 GLU A CG   2  
ATOM 4769  C CD   . GLU A 1 110 ? -19.872 -18.476 0.033   1.00 2.32  ? 1617 GLU A CD   2  
ATOM 4770  O OE1  . GLU A 1 110 ? -19.463 -17.579 -0.736  1.00 3.05  ? 1617 GLU A OE1  2  
ATOM 4771  O OE2  . GLU A 1 110 ? -21.076 -18.789 0.099   1.00 2.53  ? 1617 GLU A OE2  2  
ATOM 4772  H H    . GLU A 1 110 ? -19.736 -16.467 1.410   1.00 0.96  ? 1617 GLU A H    2  
ATOM 4773  H HA   . GLU A 1 110 ? -20.124 -18.555 3.185   1.00 1.33  ? 1617 GLU A HA   2  
ATOM 4774  H HB2  . GLU A 1 110 ? -17.698 -17.638 1.650   1.00 1.44  ? 1617 GLU A HB2  2  
ATOM 4775  H HB3  . GLU A 1 110 ? -17.682 -19.088 2.637   1.00 1.72  ? 1617 GLU A HB3  2  
ATOM 4776  H HG2  . GLU A 1 110 ? -18.036 -19.500 0.230   1.00 2.26  ? 1617 GLU A HG2  2  
ATOM 4777  H HG3  . GLU A 1 110 ? -19.325 -20.125 1.255   1.00 2.04  ? 1617 GLU A HG3  2  
ATOM 4778  N N    . ALA A 1 111 ? -18.106 -16.201 4.296   1.00 0.85  ? 1618 ALA A N    2  
ATOM 4779  C CA   . ALA A 1 111 ? -17.453 -15.601 5.472   1.00 0.78  ? 1618 ALA A CA   2  
ATOM 4780  C C    . ALA A 1 111 ? -16.464 -16.548 6.157   1.00 0.93  ? 1618 ALA A C    2  
ATOM 4781  O O    . ALA A 1 111 ? -16.850 -17.379 7.004   1.00 1.55  ? 1618 ALA A O    2  
ATOM 4782  C CB   . ALA A 1 111 ? -18.469 -15.121 6.476   1.00 0.78  ? 1618 ALA A CB   2  
ATOM 4783  H H    . ALA A 1 111 ? -18.104 -15.698 3.454   1.00 1.00  ? 1618 ALA A H    2  
ATOM 4784  H HA   . ALA A 1 111 ? -16.933 -14.731 5.096   1.00 0.78  ? 1618 ALA A HA   2  
ATOM 4785  H HB1  . ALA A 1 111 ? -19.036 -15.964 6.839   1.00 1.23  ? 1618 ALA A HB1  2  
ATOM 4786  H HB2  . ALA A 1 111 ? -19.113 -14.380 6.030   1.00 1.23  ? 1618 ALA A HB2  2  
ATOM 4787  H HB3  . ALA A 1 111 ? -17.908 -14.693 7.293   1.00 1.20  ? 1618 ALA A HB3  2  
ATOM 4788  N N    . GLY A 1 112 ? -15.225 -16.406 5.827   1.00 0.86  ? 1619 GLY A N    2  
ATOM 4789  C CA   . GLY A 1 112 ? -14.202 -17.236 6.378   1.00 0.93  ? 1619 GLY A CA   2  
ATOM 4790  C C    . GLY A 1 112 ? -12.899 -16.505 6.428   1.00 0.76  ? 1619 GLY A C    2  
ATOM 4791  O O    . GLY A 1 112 ? -12.887 -15.293 6.642   1.00 0.73  ? 1619 GLY A O    2  
ATOM 4792  H H    . GLY A 1 112 ? -14.968 -15.690 5.204   1.00 1.16  ? 1619 GLY A H    2  
ATOM 4793  H HA2  . GLY A 1 112 ? -14.463 -17.537 7.382   1.00 1.12  ? 1619 GLY A HA2  2  
ATOM 4794  H HA3  . GLY A 1 112 ? -14.081 -18.111 5.759   1.00 1.04  ? 1619 GLY A HA3  2  
ATOM 4795  N N    . PRO A 1 113 ? -11.781 -17.190 6.191   1.00 0.73  ? 1620 PRO A N    2  
ATOM 4796  C CA   . PRO A 1 113 ? -10.427 -16.575 6.240   1.00 0.65  ? 1620 PRO A CA   2  
ATOM 4797  C C    . PRO A 1 113 ? -10.148 -15.533 5.136   1.00 0.56  ? 1620 PRO A C    2  
ATOM 4798  O O    . PRO A 1 113 ? -9.049  -14.994 5.040   1.00 0.62  ? 1620 PRO A O    2  
ATOM 4799  C CB   . PRO A 1 113 ? -9.489  -17.770 6.078   1.00 0.71  ? 1620 PRO A CB   2  
ATOM 4800  C CG   . PRO A 1 113 ? -10.301 -18.813 5.387   1.00 0.80  ? 1620 PRO A CG   2  
ATOM 4801  C CD   . PRO A 1 113 ? -11.711 -18.653 5.918   1.00 0.88  ? 1620 PRO A CD   2  
ATOM 4802  H HA   . PRO A 1 113 ? -10.249 -16.114 7.200   1.00 0.72  ? 1620 PRO A HA   2  
ATOM 4803  H HB2  . PRO A 1 113 ? -8.624  -17.480 5.499   1.00 0.79  ? 1620 PRO A HB2  2  
ATOM 4804  H HB3  . PRO A 1 113 ? -9.189  -18.093 7.064   1.00 0.90  ? 1620 PRO A HB3  2  
ATOM 4805  H HG2  . PRO A 1 113 ? -10.260 -18.623 4.323   1.00 0.95  ? 1620 PRO A HG2  2  
ATOM 4806  H HG3  . PRO A 1 113 ? -9.900  -19.794 5.598   1.00 0.97  ? 1620 PRO A HG3  2  
ATOM 4807  H HD2  . PRO A 1 113 ? -12.450 -18.979 5.199   1.00 1.02  ? 1620 PRO A HD2  2  
ATOM 4808  H HD3  . PRO A 1 113 ? -11.891 -19.203 6.833   1.00 1.06  ? 1620 PRO A HD3  2  
ATOM 4809  N N    . THR A 1 114 ? -11.129 -15.264 4.325   1.00 0.53  ? 1621 THR A N    2  
ATOM 4810  C CA   . THR A 1 114 ? -11.014 -14.339 3.254   1.00 0.54  ? 1621 THR A CA   2  
ATOM 4811  C C    . THR A 1 114 ? -11.703 -13.019 3.656   1.00 0.43  ? 1621 THR A C    2  
ATOM 4812  O O    . THR A 1 114 ? -11.666 -12.002 2.928   1.00 0.39  ? 1621 THR A O    2  
ATOM 4813  C CB   . THR A 1 114 ? -11.687 -14.966 2.037   1.00 0.73  ? 1621 THR A CB   2  
ATOM 4814  O OG1  . THR A 1 114 ? -11.240 -16.328 1.945   1.00 0.95  ? 1621 THR A OG1  2  
ATOM 4815  C CG2  . THR A 1 114 ? -11.291 -14.246 0.778   1.00 0.97  ? 1621 THR A CG2  2  
ATOM 4816  H H    . THR A 1 114 ? -11.992 -15.709 4.421   1.00 0.57  ? 1621 THR A H    2  
ATOM 4817  H HA   . THR A 1 114 ? -9.970  -14.171 3.034   1.00 0.64  ? 1621 THR A HA   2  
ATOM 4818  H HB   . THR A 1 114 ? -12.760 -14.936 2.159   1.00 0.81  ? 1621 THR A HB   2  
ATOM 4819  H HG1  . THR A 1 114 ? -10.301 -16.340 2.212   1.00 1.52  ? 1621 THR A HG1  2  
ATOM 4820  H HG21 . THR A 1 114 ? -11.782 -14.700 -0.069  1.00 1.40  ? 1621 THR A HG21 2  
ATOM 4821  H HG22 . THR A 1 114 ? -10.219 -14.302 0.668   1.00 1.38  ? 1621 THR A HG22 2  
ATOM 4822  H HG23 . THR A 1 114 ? -11.599 -13.217 0.875   1.00 1.58  ? 1621 THR A HG23 2  
ATOM 4823  N N    . ASN A 1 115 ? -12.301 -13.034 4.836   1.00 0.42  ? 1622 ASN A N    2  
ATOM 4824  C CA   . ASN A 1 115 ? -12.970 -11.874 5.393   1.00 0.40  ? 1622 ASN A CA   2  
ATOM 4825  C C    . ASN A 1 115 ? -11.942 -11.035 6.156   1.00 0.39  ? 1622 ASN A C    2  
ATOM 4826  O O    . ASN A 1 115 ? -11.989 -10.880 7.391   1.00 0.48  ? 1622 ASN A O    2  
ATOM 4827  C CB   . ASN A 1 115 ? -14.158 -12.301 6.293   1.00 0.49  ? 1622 ASN A CB   2  
ATOM 4828  C CG   . ASN A 1 115 ? -14.923 -11.130 6.913   1.00 0.51  ? 1622 ASN A CG   2  
ATOM 4829  O OD1  . ASN A 1 115 ? -14.974 -10.033 6.362   1.00 0.59  ? 1622 ASN A OD1  2  
ATOM 4830  N ND2  . ASN A 1 115 ? -15.545 -11.364 8.041   1.00 0.72  ? 1622 ASN A ND2  2  
ATOM 4831  H H    . ASN A 1 115 ? -12.285 -13.866 5.358   1.00 0.46  ? 1622 ASN A H    2  
ATOM 4832  H HA   . ASN A 1 115 ? -13.335 -11.311 4.546   1.00 0.38  ? 1622 ASN A HA   2  
ATOM 4833  H HB2  . ASN A 1 115 ? -14.850 -12.877 5.697   1.00 0.54  ? 1622 ASN A HB2  2  
ATOM 4834  H HB3  . ASN A 1 115 ? -13.782 -12.925 7.089   1.00 0.55  ? 1622 ASN A HB3  2  
ATOM 4835  H HD21 . ASN A 1 115 ? -15.492 -12.275 8.421   1.00 0.88  ? 1622 ASN A HD21 2  
ATOM 4836  H HD22 . ASN A 1 115 ? -16.039 -10.643 8.481   1.00 0.80  ? 1622 ASN A HD22 2  
ATOM 4837  N N    . ARG A 1 116 ? -10.980 -10.576 5.407   1.00 0.35  ? 1623 ARG A N    2  
ATOM 4838  C CA   . ARG A 1 116 ? -9.889  -9.760  5.862   1.00 0.37  ? 1623 ARG A CA   2  
ATOM 4839  C C    . ARG A 1 116 ? -9.229  -9.178  4.631   1.00 0.33  ? 1623 ARG A C    2  
ATOM 4840  O O    . ARG A 1 116 ? -9.141  -9.859  3.608   1.00 0.32  ? 1623 ARG A O    2  
ATOM 4841  C CB   . ARG A 1 116 ? -8.876  -10.581 6.693   1.00 0.43  ? 1623 ARG A CB   2  
ATOM 4842  C CG   . ARG A 1 116 ? -8.318  -11.818 6.000   1.00 0.49  ? 1623 ARG A CG   2  
ATOM 4843  C CD   . ARG A 1 116 ? -7.317  -12.526 6.887   1.00 0.67  ? 1623 ARG A CD   2  
ATOM 4844  N NE   . ARG A 1 116 ? -6.855  -13.793 6.314   1.00 1.57  ? 1623 ARG A NE   2  
ATOM 4845  C CZ   . ARG A 1 116 ? -5.938  -14.595 6.867   1.00 2.13  ? 1623 ARG A CZ   2  
ATOM 4846  N NH1  . ARG A 1 116 ? -5.276  -14.207 7.958   1.00 1.99  ? 1623 ARG A NH1  2  
ATOM 4847  N NH2  . ARG A 1 116 ? -5.661  -15.766 6.315   1.00 3.26  ? 1623 ARG A NH2  2  
ATOM 4848  H H    . ARG A 1 116 ? -10.982 -10.801 4.450   1.00 0.35  ? 1623 ARG A H    2  
ATOM 4849  H HA   . ARG A 1 116 ? -10.294 -8.956  6.460   1.00 0.41  ? 1623 ARG A HA   2  
ATOM 4850  H HB2  . ARG A 1 116 ? -8.042  -9.944  6.946   1.00 0.46  ? 1623 ARG A HB2  2  
ATOM 4851  H HB3  . ARG A 1 116 ? -9.359  -10.894 7.606   1.00 0.48  ? 1623 ARG A HB3  2  
ATOM 4852  H HG2  . ARG A 1 116 ? -9.132  -12.494 5.780   1.00 0.50  ? 1623 ARG A HG2  2  
ATOM 4853  H HG3  . ARG A 1 116 ? -7.833  -11.521 5.082   1.00 0.52  ? 1623 ARG A HG3  2  
ATOM 4854  H HD2  . ARG A 1 116 ? -6.463  -11.879 7.029   1.00 1.26  ? 1623 ARG A HD2  2  
ATOM 4855  H HD3  . ARG A 1 116 ? -7.779  -12.722 7.843   1.00 1.22  ? 1623 ARG A HD3  2  
ATOM 4856  H HE   . ARG A 1 116 ? -7.311  -14.065 5.482   1.00 2.16  ? 1623 ARG A HE   2  
ATOM 4857  H HH11 . ARG A 1 116 ? -5.441  -13.314 8.394   1.00 1.83  ? 1623 ARG A HH11 2  
ATOM 4858  H HH12 . ARG A 1 116 ? -4.576  -14.785 8.392   1.00 2.53  ? 1623 ARG A HH12 2  
ATOM 4859  H HH21 . ARG A 1 116 ? -6.105  -16.087 5.468   1.00 3.82  ? 1623 ARG A HH21 2  
ATOM 4860  H HH22 . ARG A 1 116 ? -5.013  -16.413 6.743   1.00 3.73  ? 1623 ARG A HH22 2  
ATOM 4861  N N    . PRO A 1 117 ? -8.847  -7.903  4.672   1.00 0.36  ? 1624 PRO A N    2  
ATOM 4862  C CA   . PRO A 1 117 ? -8.201  -7.242  3.539   1.00 0.36  ? 1624 PRO A CA   2  
ATOM 4863  C C    . PRO A 1 117 ? -6.830  -7.864  3.242   1.00 0.36  ? 1624 PRO A C    2  
ATOM 4864  O O    . PRO A 1 117 ? -5.903  -7.760  4.046   1.00 0.47  ? 1624 PRO A O    2  
ATOM 4865  C CB   . PRO A 1 117 ? -8.047  -5.788  4.005   1.00 0.47  ? 1624 PRO A CB   2  
ATOM 4866  C CG   . PRO A 1 117 ? -8.120  -5.844  5.493   1.00 0.59  ? 1624 PRO A CG   2  
ATOM 4867  C CD   . PRO A 1 117 ? -9.018  -6.994  5.823   1.00 0.43  ? 1624 PRO A CD   2  
ATOM 4868  H HA   . PRO A 1 117 ? -8.825  -7.287  2.658   1.00 0.36  ? 1624 PRO A HA   2  
ATOM 4869  H HB2  . PRO A 1 117 ? -7.094  -5.404  3.674   1.00 0.51  ? 1624 PRO A HB2  2  
ATOM 4870  H HB3  . PRO A 1 117 ? -8.847  -5.187  3.595   1.00 0.54  ? 1624 PRO A HB3  2  
ATOM 4871  H HG2  . PRO A 1 117 ? -7.135  -6.008  5.902   1.00 0.76  ? 1624 PRO A HG2  2  
ATOM 4872  H HG3  . PRO A 1 117 ? -8.535  -4.923  5.875   1.00 0.77  ? 1624 PRO A HG3  2  
ATOM 4873  H HD2  . PRO A 1 117 ? -8.699  -7.470  6.738   1.00 0.48  ? 1624 PRO A HD2  2  
ATOM 4874  H HD3  . PRO A 1 117 ? -10.044 -6.665  5.903   1.00 0.47  ? 1624 PRO A HD3  2  
ATOM 4875  N N    . MET A 1 118 ? -6.721  -8.532  2.120   1.00 0.35  ? 1625 MET A N    2  
ATOM 4876  C CA   . MET A 1 118 ? -5.490  -9.196  1.738   1.00 0.46  ? 1625 MET A CA   2  
ATOM 4877  C C    . MET A 1 118 ? -4.907  -8.562  0.483   1.00 0.40  ? 1625 MET A C    2  
ATOM 4878  O O    . MET A 1 118 ? -5.656  -8.129  -0.410  1.00 0.41  ? 1625 MET A O    2  
ATOM 4879  C CB   . MET A 1 118 ? -5.712  -10.712 1.535   1.00 0.68  ? 1625 MET A CB   2  
ATOM 4880  C CG   . MET A 1 118 ? -6.120  -11.443 2.809   1.00 0.87  ? 1625 MET A CG   2  
ATOM 4881  S SD   . MET A 1 118 ? -6.238  -13.246 2.630   1.00 1.37  ? 1625 MET A SD   2  
ATOM 4882  C CE   . MET A 1 118 ? -7.542  -13.415 1.408   1.00 0.77  ? 1625 MET A CE   2  
ATOM 4883  H H    . MET A 1 118 ? -7.500  -8.570  1.518   1.00 0.36  ? 1625 MET A H    2  
ATOM 4884  H HA   . MET A 1 118 ? -4.813  -9.054  2.568   1.00 0.56  ? 1625 MET A HA   2  
ATOM 4885  H HB2  . MET A 1 118 ? -6.486  -10.859 0.798   1.00 0.70  ? 1625 MET A HB2  2  
ATOM 4886  H HB3  . MET A 1 118 ? -4.794  -11.152 1.172   1.00 0.77  ? 1625 MET A HB3  2  
ATOM 4887  H HG2  . MET A 1 118 ? -5.373  -11.230 3.559   1.00 0.96  ? 1625 MET A HG2  2  
ATOM 4888  H HG3  . MET A 1 118 ? -7.074  -11.058 3.140   1.00 0.72  ? 1625 MET A HG3  2  
ATOM 4889  H HE1  . MET A 1 118 ? -8.451  -12.964 1.775   1.00 1.43  ? 1625 MET A HE1  2  
ATOM 4890  H HE2  . MET A 1 118 ? -7.720  -14.467 1.233   1.00 1.35  ? 1625 MET A HE2  2  
ATOM 4891  H HE3  . MET A 1 118 ? -7.246  -12.947 0.482   1.00 1.27  ? 1625 MET A HE3  2  
ATOM 4892  N N    . LEU A 1 119 ? -3.588  -8.493  0.429   1.00 0.42  ? 1626 LEU A N    2  
ATOM 4893  C CA   . LEU A 1 119 ? -2.863  -7.889  -0.675  1.00 0.41  ? 1626 LEU A CA   2  
ATOM 4894  C C    . LEU A 1 119 ? -2.784  -8.913  -1.811  1.00 0.42  ? 1626 LEU A C    2  
ATOM 4895  O O    . LEU A 1 119 ? -2.208  -9.996  -1.642  1.00 0.51  ? 1626 LEU A O    2  
ATOM 4896  C CB   . LEU A 1 119 ? -1.436  -7.527  -0.173  1.00 0.50  ? 1626 LEU A CB   2  
ATOM 4897  C CG   . LEU A 1 119 ? -0.517  -6.603  -1.028  1.00 0.59  ? 1626 LEU A CG   2  
ATOM 4898  C CD1  . LEU A 1 119 ? -0.183  -7.140  -2.391  1.00 0.78  ? 1626 LEU A CD1  2  
ATOM 4899  C CD2  . LEU A 1 119 ? -1.057  -5.209  -1.130  1.00 0.89  ? 1626 LEU A CD2  2  
ATOM 4900  H H    . LEU A 1 119 ? -3.057  -8.883  1.161   1.00 0.51  ? 1626 LEU A H    2  
ATOM 4901  H HA   . LEU A 1 119 ? -3.373  -6.990  -0.986  1.00 0.39  ? 1626 LEU A HA   2  
ATOM 4902  H HB2  . LEU A 1 119 ? -1.534  -7.065  0.798   1.00 0.56  ? 1626 LEU A HB2  2  
ATOM 4903  H HB3  . LEU A 1 119 ? -0.917  -8.464  -0.037  1.00 0.59  ? 1626 LEU A HB3  2  
ATOM 4904  H HG   . LEU A 1 119 ? 0.428   -6.534  -0.508  1.00 0.98  ? 1626 LEU A HG   2  
ATOM 4905  H HD11 . LEU A 1 119 ? -1.097  -7.313  -2.940  1.00 1.41  ? 1626 LEU A HD11 2  
ATOM 4906  H HD12 . LEU A 1 119 ? 0.379   -8.059  -2.309  1.00 1.25  ? 1626 LEU A HD12 2  
ATOM 4907  H HD13 . LEU A 1 119 ? 0.402   -6.395  -2.914  1.00 1.34  ? 1626 LEU A HD13 2  
ATOM 4908  H HD21 . LEU A 1 119 ? -2.042  -5.201  -1.571  1.00 1.40  ? 1626 LEU A HD21 2  
ATOM 4909  H HD22 . LEU A 1 119 ? -0.367  -4.654  -1.745  1.00 1.43  ? 1626 LEU A HD22 2  
ATOM 4910  H HD23 . LEU A 1 119 ? -1.085  -4.789  -0.136  1.00 1.42  ? 1626 LEU A HD23 2  
ATOM 4911  N N    . ILE A 1 120 ? -3.383  -8.576  -2.942  1.00 0.37  ? 1627 ILE A N    2  
ATOM 4912  C CA   . ILE A 1 120 ? -3.375  -9.424  -4.124  1.00 0.41  ? 1627 ILE A CA   2  
ATOM 4913  C C    . ILE A 1 120 ? -2.044  -9.308  -4.825  1.00 0.42  ? 1627 ILE A C    2  
ATOM 4914  O O    . ILE A 1 120 ? -1.330  -10.294 -5.009  1.00 0.49  ? 1627 ILE A O    2  
ATOM 4915  C CB   . ILE A 1 120 ? -4.506  -9.001  -5.115  1.00 0.41  ? 1627 ILE A CB   2  
ATOM 4916  C CG1  . ILE A 1 120 ? -5.861  -9.087  -4.420  1.00 0.48  ? 1627 ILE A CG1  2  
ATOM 4917  C CG2  . ILE A 1 120 ? -4.494  -9.865  -6.381  1.00 0.46  ? 1627 ILE A CG2  2  
ATOM 4918  C CD1  . ILE A 1 120 ? -6.171  -10.475 -3.908  1.00 0.58  ? 1627 ILE A CD1  2  
ATOM 4919  H H    . ILE A 1 120 ? -3.868  -7.721  -2.988  1.00 0.34  ? 1627 ILE A H    2  
ATOM 4920  H HA   . ILE A 1 120 ? -3.540  -10.449 -3.827  1.00 0.46  ? 1627 ILE A HA   2  
ATOM 4921  H HB   . ILE A 1 120 ? -4.333  -7.981  -5.426  1.00 0.39  ? 1627 ILE A HB   2  
ATOM 4922  H HG12 . ILE A 1 120 ? -5.852  -8.424  -3.567  1.00 0.48  ? 1627 ILE A HG12 2  
ATOM 4923  H HG13 . ILE A 1 120 ? -6.659  -8.792  -5.086  1.00 0.60  ? 1627 ILE A HG13 2  
ATOM 4924  H HG21 . ILE A 1 120 ? -4.653  -10.897 -6.107  1.00 1.14  ? 1627 ILE A HG21 2  
ATOM 4925  H HG22 . ILE A 1 120 ? -3.541  -9.762  -6.879  1.00 1.07  ? 1627 ILE A HG22 2  
ATOM 4926  H HG23 . ILE A 1 120 ? -5.282  -9.539  -7.044  1.00 1.12  ? 1627 ILE A HG23 2  
ATOM 4927  H HD11 . ILE A 1 120 ? -7.180  -10.508 -3.532  1.00 1.08  ? 1627 ILE A HD11 2  
ATOM 4928  H HD12 . ILE A 1 120 ? -5.475  -10.708 -3.116  1.00 1.23  ? 1627 ILE A HD12 2  
ATOM 4929  H HD13 . ILE A 1 120 ? -6.054  -11.176 -4.720  1.00 1.22  ? 1627 ILE A HD13 2  
ATOM 4930  N N    . SER A 1 121 ? -1.720  -8.101  -5.194  1.00 0.37  ? 1628 SER A N    2  
ATOM 4931  C CA   . SER A 1 121 ? -0.517  -7.772  -5.908  1.00 0.40  ? 1628 SER A CA   2  
ATOM 4932  C C    . SER A 1 121 ? -0.304  -6.278  -5.802  1.00 0.35  ? 1628 SER A C    2  
ATOM 4933  O O    . SER A 1 121 ? -1.269  -5.512  -5.624  1.00 0.35  ? 1628 SER A O    2  
ATOM 4934  C CB   . SER A 1 121 ? -0.620  -8.184  -7.401  1.00 0.48  ? 1628 SER A CB   2  
ATOM 4935  O OG   . SER A 1 121 ? -0.796  -9.594  -7.552  1.00 1.39  ? 1628 SER A OG   2  
ATOM 4936  H H    . SER A 1 121 ? -2.302  -7.349  -4.952  1.00 0.34  ? 1628 SER A H    2  
ATOM 4937  H HA   . SER A 1 121 ? 0.317   -8.282  -5.450  1.00 0.46  ? 1628 SER A HA   2  
ATOM 4938  H HB2  . SER A 1 121 ? -1.465  -7.686  -7.853  1.00 1.12  ? 1628 SER A HB2  2  
ATOM 4939  H HB3  . SER A 1 121 ? 0.282   -7.891  -7.919  1.00 0.97  ? 1628 SER A HB3  2  
ATOM 4940  H HG   . SER A 1 121 ? -0.864  -9.963  -6.661  1.00 1.88  ? 1628 SER A HG   2  
ATOM 4941  N N    . LEU A 1 122 ? 0.921   -5.885  -5.822  1.00 0.37  ? 1629 LEU A N    2  
ATOM 4942  C CA   . LEU A 1 122 ? 1.290   -4.510  -5.832  1.00 0.38  ? 1629 LEU A CA   2  
ATOM 4943  C C    . LEU A 1 122 ? 1.902   -4.215  -7.171  1.00 0.46  ? 1629 LEU A C    2  
ATOM 4944  O O    . LEU A 1 122 ? 2.973   -4.743  -7.487  1.00 0.62  ? 1629 LEU A O    2  
ATOM 4945  C CB   . LEU A 1 122 ? 2.319   -4.239  -4.724  1.00 0.49  ? 1629 LEU A CB   2  
ATOM 4946  C CG   . LEU A 1 122 ? 3.055   -2.882  -4.775  1.00 0.71  ? 1629 LEU A CG   2  
ATOM 4947  C CD1  . LEU A 1 122 ? 2.108   -1.711  -4.627  1.00 1.00  ? 1629 LEU A CD1  2  
ATOM 4948  C CD2  . LEU A 1 122 ? 4.148   -2.824  -3.729  1.00 1.25  ? 1629 LEU A CD2  2  
ATOM 4949  H H    . LEU A 1 122 ? 1.649   -6.549  -5.833  1.00 0.43  ? 1629 LEU A H    2  
ATOM 4950  H HA   . LEU A 1 122 ? 0.415   -3.899  -5.661  1.00 0.34  ? 1629 LEU A HA   2  
ATOM 4951  H HB2  . LEU A 1 122 ? 1.792   -4.312  -3.784  1.00 0.51  ? 1629 LEU A HB2  2  
ATOM 4952  H HB3  . LEU A 1 122 ? 3.058   -5.026  -4.758  1.00 0.62  ? 1629 LEU A HB3  2  
ATOM 4953  H HG   . LEU A 1 122 ? 3.522   -2.789  -5.744  1.00 1.39  ? 1629 LEU A HG   2  
ATOM 4954  H HD11 . LEU A 1 122 ? 2.674   -0.790  -4.660  1.00 1.51  ? 1629 LEU A HD11 2  
ATOM 4955  H HD12 . LEU A 1 122 ? 1.590   -1.778  -3.682  1.00 1.59  ? 1629 LEU A HD12 2  
ATOM 4956  H HD13 . LEU A 1 122 ? 1.388   -1.716  -5.431  1.00 1.59  ? 1629 LEU A HD13 2  
ATOM 4957  H HD21 . LEU A 1 122 ? 4.860   -3.616  -3.909  1.00 1.92  ? 1629 LEU A HD21 2  
ATOM 4958  H HD22 . LEU A 1 122 ? 3.718   -2.941  -2.746  1.00 1.71  ? 1629 LEU A HD22 2  
ATOM 4959  H HD23 . LEU A 1 122 ? 4.651   -1.870  -3.789  1.00 1.66  ? 1629 LEU A HD23 2  
ATOM 4960  N N    . ASP A 1 123 ? 1.222   -3.449  -7.987  1.00 0.45  ? 1630 ASP A N    2  
ATOM 4961  C CA   . ASP A 1 123 ? 1.833   -3.050  -9.259  1.00 0.57  ? 1630 ASP A CA   2  
ATOM 4962  C C    . ASP A 1 123 ? 2.937   -2.077  -8.941  1.00 0.55  ? 1630 ASP A C    2  
ATOM 4963  O O    . ASP A 1 123 ? 2.689   -1.006  -8.398  1.00 0.51  ? 1630 ASP A O    2  
ATOM 4964  C CB   . ASP A 1 123 ? 0.846   -2.461  -10.310 1.00 0.66  ? 1630 ASP A CB   2  
ATOM 4965  C CG   . ASP A 1 123 ? 1.562   -2.141  -11.597 1.00 0.81  ? 1630 ASP A CG   2  
ATOM 4966  O OD1  . ASP A 1 123 ? 2.075   -1.021  -11.744 1.00 0.73  ? 1630 ASP A OD1  2  
ATOM 4967  O OD2  . ASP A 1 123 ? 1.627   -3.013  -12.482 1.00 1.09  ? 1630 ASP A OD2  2  
ATOM 4968  H H    . ASP A 1 123 ? 0.331   -3.160  -7.689  1.00 0.42  ? 1630 ASP A H    2  
ATOM 4969  H HA   . ASP A 1 123 ? 2.318   -3.935  -9.648  1.00 0.67  ? 1630 ASP A HA   2  
ATOM 4970  H HB2  . ASP A 1 123 ? 0.064   -3.167  -10.549 1.00 0.71  ? 1630 ASP A HB2  2  
ATOM 4971  H HB3  . ASP A 1 123 ? 0.371   -1.541  -10.010 1.00 0.62  ? 1630 ASP A HB3  2  
ATOM 4972  N N    . LYS A 1 124 ? 4.144   -2.455  -9.273  1.00 0.67  ? 1631 LYS A N    2  
ATOM 4973  C CA   . LYS A 1 124 ? 5.331   -1.737  -8.845  1.00 0.75  ? 1631 LYS A CA   2  
ATOM 4974  C C    . LYS A 1 124 ? 5.615   -0.545  -9.724  1.00 0.67  ? 1631 LYS A C    2  
ATOM 4975  O O    . LYS A 1 124 ? 6.448   0.292   -9.396  1.00 0.73  ? 1631 LYS A O    2  
ATOM 4976  C CB   . LYS A 1 124 ? 6.538   -2.671  -8.882  1.00 1.06  ? 1631 LYS A CB   2  
ATOM 4977  C CG   . LYS A 1 124 ? 6.424   -3.920  -8.027  1.00 1.71  ? 1631 LYS A CG   2  
ATOM 4978  C CD   . LYS A 1 124 ? 7.665   -4.775  -8.190  1.00 2.34  ? 1631 LYS A CD   2  
ATOM 4979  C CE   . LYS A 1 124 ? 7.594   -6.055  -7.380  1.00 3.07  ? 1631 LYS A CE   2  
ATOM 4980  N NZ   . LYS A 1 124 ? 8.830   -6.851  -7.525  1.00 3.60  ? 1631 LYS A NZ   2  
ATOM 4981  H H    . LYS A 1 124 ? 4.252   -3.234  -9.863  1.00 0.80  ? 1631 LYS A H    2  
ATOM 4982  H HA   . LYS A 1 124 ? 5.191   -1.413  -7.826  1.00 0.77  ? 1631 LYS A HA   2  
ATOM 4983  H HB2  . LYS A 1 124 ? 6.696   -2.983  -9.903  1.00 1.52  ? 1631 LYS A HB2  2  
ATOM 4984  H HB3  . LYS A 1 124 ? 7.405   -2.116  -8.556  1.00 1.47  ? 1631 LYS A HB3  2  
ATOM 4985  H HG2  . LYS A 1 124 ? 6.324   -3.632  -6.991  1.00 2.29  ? 1631 LYS A HG2  2  
ATOM 4986  H HG3  . LYS A 1 124 ? 5.558   -4.487  -8.337  1.00 2.22  ? 1631 LYS A HG3  2  
ATOM 4987  H HD2  . LYS A 1 124 ? 7.779   -5.033  -9.233  1.00 2.74  ? 1631 LYS A HD2  2  
ATOM 4988  H HD3  . LYS A 1 124 ? 8.523   -4.203  -7.868  1.00 2.69  ? 1631 LYS A HD3  2  
ATOM 4989  H HE2  . LYS A 1 124 ? 7.457   -5.804  -6.339  1.00 3.46  ? 1631 LYS A HE2  2  
ATOM 4990  H HE3  . LYS A 1 124 ? 6.754   -6.640  -7.725  1.00 3.45  ? 1631 LYS A HE3  2  
ATOM 4991  H HZ1  . LYS A 1 124 ? 8.996   -7.116  -8.519  1.00 3.98  ? 1631 LYS A HZ1  2  
ATOM 4992  H HZ2  . LYS A 1 124 ? 8.786   -7.726  -6.957  1.00 3.93  ? 1631 LYS A HZ2  2  
ATOM 4993  H HZ3  . LYS A 1 124 ? 9.644   -6.286  -7.197  1.00 3.83  ? 1631 LYS A HZ3  2  
ATOM 4994  N N    . GLN A 1 125 ? 4.929   -0.462  -10.828 1.00 0.66  ? 1632 GLN A N    2  
ATOM 4995  C CA   . GLN A 1 125 ? 5.199   0.568   -11.764 1.00 0.68  ? 1632 GLN A CA   2  
ATOM 4996  C C    . GLN A 1 125 ? 4.256   1.748   -11.562 1.00 0.57  ? 1632 GLN A C    2  
ATOM 4997  O O    . GLN A 1 125 ? 4.671   2.907   -11.598 1.00 0.60  ? 1632 GLN A O    2  
ATOM 4998  C CB   . GLN A 1 125 ? 5.107   0.008   -13.178 1.00 0.85  ? 1632 GLN A CB   2  
ATOM 4999  C CG   . GLN A 1 125 ? 5.559   0.980   -14.225 1.00 1.42  ? 1632 GLN A CG   2  
ATOM 5000  C CD   . GLN A 1 125 ? 6.998   1.435   -14.013 1.00 1.66  ? 1632 GLN A CD   2  
ATOM 5001  O OE1  . GLN A 1 125 ? 7.348   2.558   -14.328 1.00 2.60  ? 1632 GLN A OE1  2  
ATOM 5002  N NE2  . GLN A 1 125 ? 7.836   0.563   -13.534 1.00 1.55  ? 1632 GLN A NE2  2  
ATOM 5003  H H    . GLN A 1 125 ? 4.208   -1.097  -11.022 1.00 0.70  ? 1632 GLN A H    2  
ATOM 5004  H HA   . GLN A 1 125 ? 6.211   0.904   -11.599 1.00 0.74  ? 1632 GLN A HA   2  
ATOM 5005  H HB2  . GLN A 1 125 ? 5.725   -0.875  -13.244 1.00 1.30  ? 1632 GLN A HB2  2  
ATOM 5006  H HB3  . GLN A 1 125 ? 4.081   -0.264  -13.384 1.00 1.21  ? 1632 GLN A HB3  2  
ATOM 5007  H HG2  . GLN A 1 125 ? 5.480   0.488   -15.181 1.00 1.88  ? 1632 GLN A HG2  2  
ATOM 5008  H HG3  . GLN A 1 125 ? 4.903   1.834   -14.175 1.00 2.07  ? 1632 GLN A HG3  2  
ATOM 5009  H HE21 . GLN A 1 125 ? 7.517   -0.346  -13.343 1.00 1.66  ? 1632 GLN A HE21 2  
ATOM 5010  H HE22 . GLN A 1 125 ? 8.769   0.839   -13.371 1.00 1.98  ? 1632 GLN A HE22 2  
ATOM 5011  N N    . THR A 1 126 ? 3.003   1.456   -11.359 1.00 0.52  ? 1633 THR A N    2  
ATOM 5012  C CA   . THR A 1 126 ? 2.021   2.475   -11.117 1.00 0.52  ? 1633 THR A CA   2  
ATOM 5013  C C    . THR A 1 126 ? 1.779   2.660   -9.601  1.00 0.45  ? 1633 THR A C    2  
ATOM 5014  O O    . THR A 1 126 ? 0.939   3.471   -9.185  1.00 0.53  ? 1633 THR A O    2  
ATOM 5015  C CB   . THR A 1 126 ? 0.684   2.144   -11.853 1.00 0.63  ? 1633 THR A CB   2  
ATOM 5016  O OG1  . THR A 1 126 ? 0.215   0.834   -11.473 1.00 0.63  ? 1633 THR A OG1  2  
ATOM 5017  C CG2  . THR A 1 126 ? 0.865   2.179   -13.373 1.00 0.75  ? 1633 THR A CG2  2  
ATOM 5018  H H    . THR A 1 126 ? 2.703   0.519   -11.404 1.00 0.55  ? 1633 THR A H    2  
ATOM 5019  H HA   . THR A 1 126 ? 2.400   3.412   -11.509 1.00 0.57  ? 1633 THR A HA   2  
ATOM 5020  H HB   . THR A 1 126 ? -0.060  2.877   -11.572 1.00 0.69  ? 1633 THR A HB   2  
ATOM 5021  H HG1  . THR A 1 126 ? 0.906   0.183   -11.684 1.00 0.64  ? 1633 THR A HG1  2  
ATOM 5022  H HG21 . THR A 1 126 ? -0.064  1.889   -13.840 1.00 1.35  ? 1633 THR A HG21 2  
ATOM 5023  H HG22 . THR A 1 126 ? 1.639   1.483   -13.661 1.00 1.23  ? 1633 THR A HG22 2  
ATOM 5024  H HG23 . THR A 1 126 ? 1.129   3.173   -13.704 1.00 1.21  ? 1633 THR A HG23 2  
ATOM 5025  N N    . CYS A 1 127 ? 2.513   1.841   -8.778  1.00 0.38  ? 1634 CYS A N    2  
ATOM 5026  C CA   . CYS A 1 127 ? 2.504   1.898   -7.301  1.00 0.35  ? 1634 CYS A CA   2  
ATOM 5027  C C    . CYS A 1 127 ? 1.090   1.865   -6.732  1.00 0.31  ? 1634 CYS A C    2  
ATOM 5028  O O    . CYS A 1 127 ? 0.754   2.546   -5.763  1.00 0.31  ? 1634 CYS A O    2  
ATOM 5029  C CB   . CYS A 1 127 ? 3.316   3.093   -6.796  1.00 0.41  ? 1634 CYS A CB   2  
ATOM 5030  S SG   . CYS A 1 127 ? 5.047   3.101   -7.412  1.00 0.53  ? 1634 CYS A SG   2  
ATOM 5031  H H    . CYS A 1 127 ? 3.090   1.143   -9.156  1.00 0.41  ? 1634 CYS A H    2  
ATOM 5032  H HA   . CYS A 1 127 ? 2.989   0.990   -6.972  1.00 0.37  ? 1634 CYS A HA   2  
ATOM 5033  H HB2  . CYS A 1 127 ? 2.841   4.007   -7.118  1.00 0.42  ? 1634 CYS A HB2  2  
ATOM 5034  H HB3  . CYS A 1 127 ? 3.351   3.068   -5.717  1.00 0.43  ? 1634 CYS A HB3  2  
ATOM 5035  N N    . THR A 1 128 ? 0.286   1.055   -7.355  1.00 0.33  ? 1635 THR A N    2  
ATOM 5036  C CA   . THR A 1 128 ? -1.087  0.864   -7.006  1.00 0.32  ? 1635 THR A CA   2  
ATOM 5037  C C    . THR A 1 128 ? -1.203  -0.439  -6.202  1.00 0.28  ? 1635 THR A C    2  
ATOM 5038  O O    . THR A 1 128 ? -0.708  -1.492  -6.635  1.00 0.32  ? 1635 THR A O    2  
ATOM 5039  C CB   . THR A 1 128 ? -1.934  0.798   -8.300  1.00 0.38  ? 1635 THR A CB   2  
ATOM 5040  O OG1  . THR A 1 128 ? -1.734  2.014   -9.050  1.00 0.46  ? 1635 THR A OG1  2  
ATOM 5041  C CG2  . THR A 1 128 ? -3.424  0.618   -8.008  1.00 0.41  ? 1635 THR A CG2  2  
ATOM 5042  H H    . THR A 1 128 ? 0.674   0.532   -8.083  1.00 0.39  ? 1635 THR A H    2  
ATOM 5043  H HA   . THR A 1 128 ? -1.394  1.715   -6.417  1.00 0.33  ? 1635 THR A HA   2  
ATOM 5044  H HB   . THR A 1 128 ? -1.576  -0.034  -8.892  1.00 0.41  ? 1635 THR A HB   2  
ATOM 5045  H HG1  . THR A 1 128 ? -0.849  2.339   -8.842  1.00 0.89  ? 1635 THR A HG1  2  
ATOM 5046  H HG21 . THR A 1 128 ? -3.959  0.554   -8.943  1.00 1.04  ? 1635 THR A HG21 2  
ATOM 5047  H HG22 . THR A 1 128 ? -3.810  1.452   -7.440  1.00 1.11  ? 1635 THR A HG22 2  
ATOM 5048  H HG23 . THR A 1 128 ? -3.577  -0.297  -7.455  1.00 1.08  ? 1635 THR A HG23 2  
ATOM 5049  N N    . LEU A 1 129 ? -1.827  -0.361  -5.054  1.00 0.25  ? 1636 LEU A N    2  
ATOM 5050  C CA   . LEU A 1 129 ? -1.897  -1.507  -4.145  1.00 0.24  ? 1636 LEU A CA   2  
ATOM 5051  C C    . LEU A 1 129 ? -3.295  -2.108  -4.197  1.00 0.23  ? 1636 LEU A C    2  
ATOM 5052  O O    . LEU A 1 129 ? -4.291  -1.408  -3.960  1.00 0.28  ? 1636 LEU A O    2  
ATOM 5053  C CB   . LEU A 1 129 ? -1.497  -1.167  -2.641  1.00 0.27  ? 1636 LEU A CB   2  
ATOM 5054  C CG   . LEU A 1 129 ? -0.151  -0.467  -2.325  1.00 0.32  ? 1636 LEU A CG   2  
ATOM 5055  C CD1  . LEU A 1 129 ? -0.010  0.887   -2.999  1.00 0.85  ? 1636 LEU A CD1  2  
ATOM 5056  C CD2  . LEU A 1 129 ? -0.056  -0.252  -0.852  1.00 0.86  ? 1636 LEU A CD2  2  
ATOM 5057  H H    . LEU A 1 129 ? -2.281  0.489   -4.847  1.00 0.27  ? 1636 LEU A H    2  
ATOM 5058  H HA   . LEU A 1 129 ? -1.213  -2.248  -4.534  1.00 0.24  ? 1636 LEU A HA   2  
ATOM 5059  H HB2  . LEU A 1 129 ? -2.237  -0.779  -1.960  1.00 0.34  ? 1636 LEU A HB2  2  
ATOM 5060  H HB3  . LEU A 1 129 ? -1.354  -2.158  -2.247  1.00 0.26  ? 1636 LEU A HB3  2  
ATOM 5061  H HG   . LEU A 1 129 ? 0.665   -1.114  -2.610  1.00 0.83  ? 1636 LEU A HG   2  
ATOM 5062  H HD11 . LEU A 1 129 ? 0.932   1.329   -2.711  1.00 1.40  ? 1636 LEU A HD11 2  
ATOM 5063  H HD12 . LEU A 1 129 ? -0.820  1.533   -2.692  1.00 1.36  ? 1636 LEU A HD12 2  
ATOM 5064  H HD13 . LEU A 1 129 ? -0.029  0.760   -4.071  1.00 1.56  ? 1636 LEU A HD13 2  
ATOM 5065  H HD21 . LEU A 1 129 ? -0.867  0.409   -0.580  1.00 1.36  ? 1636 LEU A HD21 2  
ATOM 5066  H HD22 . LEU A 1 129 ? 0.881   0.237   -0.629  1.00 1.31  ? 1636 LEU A HD22 2  
ATOM 5067  H HD23 . LEU A 1 129 ? -0.155  -1.189  -0.324  1.00 1.40  ? 1636 LEU A HD23 2  
ATOM 5068  N N    . PHE A 1 130 ? -3.377  -3.379  -4.537  1.00 0.22  ? 1637 PHE A N    2  
ATOM 5069  C CA   . PHE A 1 130 ? -4.655  -4.058  -4.650  1.00 0.23  ? 1637 PHE A CA   2  
ATOM 5070  C C    . PHE A 1 130 ? -4.962  -4.885  -3.425  1.00 0.22  ? 1637 PHE A C    2  
ATOM 5071  O O    . PHE A 1 130 ? -4.253  -5.857  -3.107  1.00 0.26  ? 1637 PHE A O    2  
ATOM 5072  C CB   . PHE A 1 130 ? -4.718  -4.931  -5.909  1.00 0.28  ? 1637 PHE A CB   2  
ATOM 5073  C CG   . PHE A 1 130 ? -4.636  -4.138  -7.182  1.00 0.31  ? 1637 PHE A CG   2  
ATOM 5074  C CD1  . PHE A 1 130 ? -5.774  -3.565  -7.725  1.00 0.38  ? 1637 PHE A CD1  2  
ATOM 5075  C CD2  . PHE A 1 130 ? -3.425  -3.953  -7.830  1.00 0.37  ? 1637 PHE A CD2  2  
ATOM 5076  C CE1  . PHE A 1 130 ? -5.706  -2.826  -8.886  1.00 0.45  ? 1637 PHE A CE1  2  
ATOM 5077  C CE2  . PHE A 1 130 ? -3.351  -3.213  -8.993  1.00 0.43  ? 1637 PHE A CE2  2  
ATOM 5078  C CZ   . PHE A 1 130 ? -4.493  -2.651  -9.521  1.00 0.45  ? 1637 PHE A CZ   2  
ATOM 5079  H H    . PHE A 1 130 ? -2.561  -3.893  -4.721  1.00 0.25  ? 1637 PHE A H    2  
ATOM 5080  H HA   . PHE A 1 130 ? -5.412  -3.292  -4.734  1.00 0.23  ? 1637 PHE A HA   2  
ATOM 5081  H HB2  . PHE A 1 130 ? -3.900  -5.636  -5.886  1.00 0.29  ? 1637 PHE A HB2  2  
ATOM 5082  H HB3  . PHE A 1 130 ? -5.643  -5.492  -5.908  1.00 0.31  ? 1637 PHE A HB3  2  
ATOM 5083  H HD1  . PHE A 1 130 ? -6.724  -3.702  -7.230  1.00 0.43  ? 1637 PHE A HD1  2  
ATOM 5084  H HD2  . PHE A 1 130 ? -2.531  -4.395  -7.414  1.00 0.41  ? 1637 PHE A HD2  2  
ATOM 5085  H HE1  . PHE A 1 130 ? -6.600  -2.384  -9.300  1.00 0.54  ? 1637 PHE A HE1  2  
ATOM 5086  H HE2  . PHE A 1 130 ? -2.402  -3.075  -9.491  1.00 0.50  ? 1637 PHE A HE2  2  
ATOM 5087  H HZ   . PHE A 1 130 ? -4.439  -2.071  -10.431 1.00 0.52  ? 1637 PHE A HZ   2  
ATOM 5088  N N    . PHE A 1 131 ? -6.013  -4.513  -2.758  1.00 0.21  ? 1638 PHE A N    2  
ATOM 5089  C CA   . PHE A 1 131 ? -6.477  -5.204  -1.574  1.00 0.22  ? 1638 PHE A CA   2  
ATOM 5090  C C    . PHE A 1 131 ? -7.868  -5.775  -1.834  1.00 0.22  ? 1638 PHE A C    2  
ATOM 5091  O O    . PHE A 1 131 ? -8.730  -5.101  -2.408  1.00 0.26  ? 1638 PHE A O    2  
ATOM 5092  C CB   . PHE A 1 131 ? -6.535  -4.277  -0.329  1.00 0.25  ? 1638 PHE A CB   2  
ATOM 5093  C CG   . PHE A 1 131 ? -5.213  -3.715  0.162   1.00 0.28  ? 1638 PHE A CG   2  
ATOM 5094  C CD1  . PHE A 1 131 ? -4.294  -4.516  0.845   1.00 0.42  ? 1638 PHE A CD1  2  
ATOM 5095  C CD2  . PHE A 1 131 ? -4.870  -2.395  -0.096  1.00 0.29  ? 1638 PHE A CD2  2  
ATOM 5096  C CE1  . PHE A 1 131 ? -3.086  -4.005  1.266   1.00 0.50  ? 1638 PHE A CE1  2  
ATOM 5097  C CE2  . PHE A 1 131 ? -3.650  -1.885  0.322   1.00 0.34  ? 1638 PHE A CE2  2  
ATOM 5098  C CZ   . PHE A 1 131 ? -2.812  -2.670  1.121   1.00 0.43  ? 1638 PHE A CZ   2  
ATOM 5099  H H    . PHE A 1 131 ? -6.520  -3.745  -3.102  1.00 0.23  ? 1638 PHE A H    2  
ATOM 5100  H HA   . PHE A 1 131 ? -5.795  -6.021  -1.385  1.00 0.24  ? 1638 PHE A HA   2  
ATOM 5101  H HB2  . PHE A 1 131 ? -7.177  -3.437  -0.544  1.00 0.26  ? 1638 PHE A HB2  2  
ATOM 5102  H HB3  . PHE A 1 131 ? -6.972  -4.843  0.481   1.00 0.28  ? 1638 PHE A HB3  2  
ATOM 5103  H HD1  . PHE A 1 131 ? -4.503  -5.553  1.060   1.00 0.51  ? 1638 PHE A HD1  2  
ATOM 5104  H HD2  . PHE A 1 131 ? -5.563  -1.757  -0.624  1.00 0.34  ? 1638 PHE A HD2  2  
ATOM 5105  H HE1  . PHE A 1 131 ? -2.396  -4.634  1.807   1.00 0.64  ? 1638 PHE A HE1  2  
ATOM 5106  H HE2  . PHE A 1 131 ? -3.396  -0.855  0.117   1.00 0.39  ? 1638 PHE A HE2  2  
ATOM 5107  H HZ   . PHE A 1 131 ? -1.887  -2.252  1.494   1.00 0.50  ? 1638 PHE A HZ   2  
ATOM 5108  N N    . SER A 1 132 ? -8.068  -7.001  -1.446  1.00 0.25  ? 1639 SER A N    2  
ATOM 5109  C CA   . SER A 1 132 ? -9.349  -7.656  -1.562  1.00 0.25  ? 1639 SER A CA   2  
ATOM 5110  C C    . SER A 1 132 ? -9.846  -8.070  -0.184  1.00 0.24  ? 1639 SER A C    2  
ATOM 5111  O O    . SER A 1 132 ? -9.065  -8.523  0.644   1.00 0.33  ? 1639 SER A O    2  
ATOM 5112  C CB   . SER A 1 132 ? -9.222  -8.855  -2.491  1.00 0.29  ? 1639 SER A CB   2  
ATOM 5113  O OG   . SER A 1 132 ? -8.891  -8.415  -3.806  1.00 1.04  ? 1639 SER A OG   2  
ATOM 5114  H H    . SER A 1 132 ? -7.321  -7.503  -1.047  1.00 0.30  ? 1639 SER A H    2  
ATOM 5115  H HA   . SER A 1 132 ? -10.054 -6.963  -1.989  1.00 0.26  ? 1639 SER A HA   2  
ATOM 5116  H HB2  . SER A 1 132 ? -8.423  -9.473  -2.111  1.00 0.71  ? 1639 SER A HB2  2  
ATOM 5117  H HB3  . SER A 1 132 ? -10.122 -9.449  -2.539  1.00 0.78  ? 1639 SER A HB3  2  
ATOM 5118  H HG   . SER A 1 132 ? -8.318  -7.647  -3.695  1.00 1.34  ? 1639 SER A HG   2  
ATOM 5119  N N    . TRP A 1 133 ? -11.124 -7.888  0.055   1.00 0.23  ? 1640 TRP A N    2  
ATOM 5120  C CA   . TRP A 1 133 ? -11.749 -8.211  1.293   1.00 0.23  ? 1640 TRP A CA   2  
ATOM 5121  C C    . TRP A 1 133 ? -13.054 -8.840  0.887   1.00 0.25  ? 1640 TRP A C    2  
ATOM 5122  O O    . TRP A 1 133 ? -13.960 -8.157  0.394   1.00 0.31  ? 1640 TRP A O    2  
ATOM 5123  C CB   . TRP A 1 133 ? -11.990 -6.913  2.107   1.00 0.27  ? 1640 TRP A CB   2  
ATOM 5124  C CG   . TRP A 1 133 ? -12.481 -7.095  3.537   1.00 0.28  ? 1640 TRP A CG   2  
ATOM 5125  C CD1  . TRP A 1 133 ? -13.077 -8.190  4.097   1.00 0.30  ? 1640 TRP A CD1  2  
ATOM 5126  C CD2  . TRP A 1 133 ? -12.432 -6.111  4.577   1.00 0.39  ? 1640 TRP A CD2  2  
ATOM 5127  N NE1  . TRP A 1 133 ? -13.381 -7.944  5.408   1.00 0.36  ? 1640 TRP A NE1  2  
ATOM 5128  C CE2  . TRP A 1 133 ? -13.001 -6.683  5.727   1.00 0.43  ? 1640 TRP A CE2  2  
ATOM 5129  C CE3  . TRP A 1 133 ? -11.958 -4.809  4.648   1.00 0.51  ? 1640 TRP A CE3  2  
ATOM 5130  C CZ2  . TRP A 1 133 ? -13.109 -5.994  6.930   1.00 0.57  ? 1640 TRP A CZ2  2  
ATOM 5131  C CZ3  . TRP A 1 133 ? -12.069 -4.128  5.836   1.00 0.66  ? 1640 TRP A CZ3  2  
ATOM 5132  C CH2  . TRP A 1 133 ? -12.639 -4.718  6.964   1.00 0.68  ? 1640 TRP A CH2  2  
ATOM 5133  H H    . TRP A 1 133 ? -11.747 -7.537  -0.617  1.00 0.31  ? 1640 TRP A H    2  
ATOM 5134  H HA   . TRP A 1 133 ? -11.122 -8.897  1.845   1.00 0.23  ? 1640 TRP A HA   2  
ATOM 5135  H HB2  . TRP A 1 133 ? -11.065 -6.361  2.159   1.00 0.32  ? 1640 TRP A HB2  2  
ATOM 5136  H HB3  . TRP A 1 133 ? -12.718 -6.312  1.581   1.00 0.29  ? 1640 TRP A HB3  2  
ATOM 5137  H HD1  . TRP A 1 133 ? -13.271 -9.118  3.584   1.00 0.33  ? 1640 TRP A HD1  2  
ATOM 5138  H HE1  . TRP A 1 133 ? -13.814 -8.573  6.029   1.00 0.40  ? 1640 TRP A HE1  2  
ATOM 5139  H HE3  . TRP A 1 133 ? -11.513 -4.332  3.788   1.00 0.52  ? 1640 TRP A HE3  2  
ATOM 5140  H HZ2  . TRP A 1 133 ? -13.547 -6.445  7.807   1.00 0.61  ? 1640 TRP A HZ2  2  
ATOM 5141  H HZ3  . TRP A 1 133 ? -11.714 -3.114  5.894   1.00 0.78  ? 1640 TRP A HZ3  2  
ATOM 5142  H HH2  . TRP A 1 133 ? -12.702 -4.140  7.874   1.00 0.80  ? 1640 TRP A HH2  2  
ATOM 5143  N N    . HIS A 1 134 ? -13.131 -10.129 0.979   1.00 0.28  ? 1641 HIS A N    2  
ATOM 5144  C CA   . HIS A 1 134 ? -14.313 -10.801 0.544   1.00 0.34  ? 1641 HIS A CA   2  
ATOM 5145  C C    . HIS A 1 134 ? -15.234 -11.038 1.728   1.00 0.33  ? 1641 HIS A C    2  
ATOM 5146  O O    . HIS A 1 134 ? -15.074 -11.990 2.498   1.00 0.39  ? 1641 HIS A O    2  
ATOM 5147  C CB   . HIS A 1 134 ? -13.991 -12.073 -0.247  1.00 0.48  ? 1641 HIS A CB   2  
ATOM 5148  C CG   . HIS A 1 134 ? -13.259 -11.841 -1.556  1.00 0.51  ? 1641 HIS A CG   2  
ATOM 5149  N ND1  . HIS A 1 134 ? -13.800 -12.138 -2.785  1.00 0.73  ? 1641 HIS A ND1  2  
ATOM 5150  C CD2  . HIS A 1 134 ? -12.019 -11.364 -1.816  1.00 0.64  ? 1641 HIS A CD2  2  
ATOM 5151  C CE1  . HIS A 1 134 ? -12.939 -11.853 -3.735  1.00 0.90  ? 1641 HIS A CE1  2  
ATOM 5152  N NE2  . HIS A 1 134 ? -11.852 -11.382 -3.176  1.00 0.85  ? 1641 HIS A NE2  2  
ATOM 5153  H H    . HIS A 1 134 ? -12.400 -10.645 1.390   1.00 0.30  ? 1641 HIS A H    2  
ATOM 5154  H HA   . HIS A 1 134 ? -14.820 -10.102 -0.105  1.00 0.38  ? 1641 HIS A HA   2  
ATOM 5155  H HB2  . HIS A 1 134 ? -13.427 -12.774 0.348   1.00 0.65  ? 1641 HIS A HB2  2  
ATOM 5156  H HB3  . HIS A 1 134 ? -14.947 -12.496 -0.506  1.00 0.67  ? 1641 HIS A HB3  2  
ATOM 5157  H HD1  . HIS A 1 134 ? -14.690 -12.541 -2.962  1.00 0.86  ? 1641 HIS A HD1  2  
ATOM 5158  H HD2  . HIS A 1 134 ? -11.297 -11.029 -1.085  1.00 0.74  ? 1641 HIS A HD2  2  
ATOM 5159  H HE1  . HIS A 1 134 ? -13.100 -11.983 -4.796  1.00 1.14  ? 1641 HIS A HE1  2  
ATOM 5160  H HE2  . HIS A 1 134 ? -10.979 -11.409 -3.640  1.00 0.89  ? 1641 HIS A HE2  2  
ATOM 5161  N N    . THR A 1 135 ? -16.189 -10.163 1.831   1.00 0.33  ? 1642 THR A N    2  
ATOM 5162  C CA   . THR A 1 135 ? -17.084 -10.044 2.959   1.00 0.35  ? 1642 THR A CA   2  
ATOM 5163  C C    . THR A 1 135 ? -18.553 -10.143 2.493   1.00 0.38  ? 1642 THR A C    2  
ATOM 5164  O O    . THR A 1 135 ? -18.871 -9.799  1.344   1.00 0.38  ? 1642 THR A O    2  
ATOM 5165  C CB   . THR A 1 135 ? -16.856 -8.644  3.632   1.00 0.37  ? 1642 THR A CB   2  
ATOM 5166  O OG1  . THR A 1 135 ? -17.830 -8.390  4.653   1.00 0.48  ? 1642 THR A OG1  2  
ATOM 5167  C CG2  . THR A 1 135 ? -16.908 -7.515  2.608   1.00 0.32  ? 1642 THR A CG2  2  
ATOM 5168  H H    . THR A 1 135 ? -16.327 -9.566  1.066   1.00 0.36  ? 1642 THR A H    2  
ATOM 5169  H HA   . THR A 1 135 ? -16.811 -10.809 3.666   1.00 0.39  ? 1642 THR A HA   2  
ATOM 5170  H HB   . THR A 1 135 ? -15.877 -8.649  4.089   1.00 0.40  ? 1642 THR A HB   2  
ATOM 5171  H HG1  . THR A 1 135 ? -17.360 -8.309  5.497   1.00 0.61  ? 1642 THR A HG1  2  
ATOM 5172  H HG21 . THR A 1 135 ? -17.874 -7.515  2.124   1.00 1.11  ? 1642 THR A HG21 2  
ATOM 5173  H HG22 . THR A 1 135 ? -16.143 -7.678  1.864   1.00 1.04  ? 1642 THR A HG22 2  
ATOM 5174  H HG23 . THR A 1 135 ? -16.757 -6.572  3.110   1.00 1.03  ? 1642 THR A HG23 2  
ATOM 5175  N N    . PRO A 1 136 ? -19.473 -10.648 3.364   1.00 0.46  ? 1643 PRO A N    2  
ATOM 5176  C CA   . PRO A 1 136 ? -20.899 -10.701 3.055   1.00 0.52  ? 1643 PRO A CA   2  
ATOM 5177  C C    . PRO A 1 136 ? -21.590 -9.335  3.202   1.00 0.50  ? 1643 PRO A C    2  
ATOM 5178  O O    . PRO A 1 136 ? -22.764 -9.195  2.872   1.00 0.57  ? 1643 PRO A O    2  
ATOM 5179  C CB   . PRO A 1 136 ? -21.462 -11.692 4.076   1.00 0.63  ? 1643 PRO A CB   2  
ATOM 5180  C CG   . PRO A 1 136 ? -20.540 -11.608 5.239   1.00 0.66  ? 1643 PRO A CG   2  
ATOM 5181  C CD   . PRO A 1 136 ? -19.182 -11.272 4.690   1.00 0.54  ? 1643 PRO A CD   2  
ATOM 5182  H HA   . PRO A 1 136 ? -21.071 -11.067 2.053   1.00 0.54  ? 1643 PRO A HA   2  
ATOM 5183  H HB2  . PRO A 1 136 ? -22.461 -11.385 4.348   1.00 0.67  ? 1643 PRO A HB2  2  
ATOM 5184  H HB3  . PRO A 1 136 ? -21.498 -12.690 3.664   1.00 0.69  ? 1643 PRO A HB3  2  
ATOM 5185  H HG2  . PRO A 1 136 ? -20.872 -10.833 5.914   1.00 0.72  ? 1643 PRO A HG2  2  
ATOM 5186  H HG3  . PRO A 1 136 ? -20.510 -12.560 5.750   1.00 0.78  ? 1643 PRO A HG3  2  
ATOM 5187  H HD2  . PRO A 1 136 ? -18.696 -10.578 5.360   1.00 0.54  ? 1643 PRO A HD2  2  
ATOM 5188  H HD3  . PRO A 1 136 ? -18.619 -12.187 4.586   1.00 0.56  ? 1643 PRO A HD3  2  
ATOM 5189  N N    . LEU A 1 137 ? -20.858 -8.321  3.691   1.00 0.47  ? 1644 LEU A N    2  
ATOM 5190  C CA   . LEU A 1 137 ? -21.424 -6.969  3.814   1.00 0.48  ? 1644 LEU A CA   2  
ATOM 5191  C C    . LEU A 1 137 ? -21.629 -6.378  2.419   1.00 0.52  ? 1644 LEU A C    2  
ATOM 5192  O O    . LEU A 1 137 ? -22.550 -5.599  2.183   1.00 0.60  ? 1644 LEU A O    2  
ATOM 5193  C CB   . LEU A 1 137 ? -20.523 -6.056  4.717   1.00 0.58  ? 1644 LEU A CB   2  
ATOM 5194  C CG   . LEU A 1 137 ? -21.009 -4.594  5.008   1.00 0.66  ? 1644 LEU A CG   2  
ATOM 5195  C CD1  . LEU A 1 137 ? -20.357 -4.068  6.266   1.00 0.97  ? 1644 LEU A CD1  2  
ATOM 5196  C CD2  . LEU A 1 137 ? -20.656 -3.639  3.866   1.00 0.96  ? 1644 LEU A CD2  2  
ATOM 5197  H H    . LEU A 1 137 ? -19.937 -8.502  3.986   1.00 0.48  ? 1644 LEU A H    2  
ATOM 5198  H HA   . LEU A 1 137 ? -22.395 -7.082  4.275   1.00 0.49  ? 1644 LEU A HA   2  
ATOM 5199  H HB2  . LEU A 1 137 ? -20.407 -6.554  5.669   1.00 0.83  ? 1644 LEU A HB2  2  
ATOM 5200  H HB3  . LEU A 1 137 ? -19.549 -5.999  4.254   1.00 0.85  ? 1644 LEU A HB3  2  
ATOM 5201  H HG   . LEU A 1 137 ? -22.081 -4.584  5.146   1.00 1.11  ? 1644 LEU A HG   2  
ATOM 5202  H HD11 . LEU A 1 137 ? -19.287 -4.054  6.128   1.00 1.36  ? 1644 LEU A HD11 2  
ATOM 5203  H HD12 . LEU A 1 137 ? -20.610 -4.703  7.103   1.00 1.66  ? 1644 LEU A HD12 2  
ATOM 5204  H HD13 . LEU A 1 137 ? -20.705 -3.062  6.453   1.00 1.48  ? 1644 LEU A HD13 2  
ATOM 5205  H HD21 . LEU A 1 137 ? -21.144 -3.957  2.957   1.00 1.41  ? 1644 LEU A HD21 2  
ATOM 5206  H HD22 . LEU A 1 137 ? -19.585 -3.634  3.719   1.00 1.47  ? 1644 LEU A HD22 2  
ATOM 5207  H HD23 . LEU A 1 137 ? -20.982 -2.642  4.124   1.00 1.56  ? 1644 LEU A HD23 2  
ATOM 5208  N N    . ALA A 1 138 ? -20.819 -6.833  1.487   1.00 0.50  ? 1645 ALA A N    2  
ATOM 5209  C CA   . ALA A 1 138 ? -20.846 -6.347  0.118   1.00 0.59  ? 1645 ALA A CA   2  
ATOM 5210  C C    . ALA A 1 138 ? -21.803 -7.177  -0.730  1.00 0.66  ? 1645 ALA A C    2  
ATOM 5211  O O    . ALA A 1 138 ? -21.771 -7.129  -1.954  1.00 0.84  ? 1645 ALA A O    2  
ATOM 5212  C CB   . ALA A 1 138 ? -19.456 -6.411  -0.459  1.00 0.72  ? 1645 ALA A CB   2  
ATOM 5213  H H    . ALA A 1 138 ? -20.189 -7.549  1.717   1.00 0.45  ? 1645 ALA A H    2  
ATOM 5214  H HA   . ALA A 1 138 ? -21.170 -5.315  0.115   1.00 0.62  ? 1645 ALA A HA   2  
ATOM 5215  H HB1  . ALA A 1 138 ? -18.807 -5.711  0.046   1.00 1.29  ? 1645 ALA A HB1  2  
ATOM 5216  H HB2  . ALA A 1 138 ? -19.494 -6.240  -1.521  1.00 1.28  ? 1645 ALA A HB2  2  
ATOM 5217  H HB3  . ALA A 1 138 ? -19.091 -7.410  -0.300  1.00 1.23  ? 1645 ALA A HB3  2  
ATOM 5218  N N    . CYS A 1 139 ? -22.630 -7.934  -0.081  1.00 0.62  ? 1646 CYS A N    2  
ATOM 5219  C CA   . CYS A 1 139 ? -23.599 -8.738  -0.749  1.00 0.75  ? 1646 CYS A CA   2  
ATOM 5220  C C    . CYS A 1 139 ? -24.939 -8.049  -0.714  1.00 0.85  ? 1646 CYS A C    2  
ATOM 5221  O O    . CYS A 1 139 ? -25.186 -7.175  0.139   1.00 0.89  ? 1646 CYS A O    2  
ATOM 5222  C CB   . CYS A 1 139 ? -23.699 -10.089 -0.066  1.00 0.87  ? 1646 CYS A CB   2  
ATOM 5223  S SG   . CYS A 1 139 ? -22.155 -11.043 -0.068  1.00 1.19  ? 1646 CYS A SG   2  
ATOM 5224  H H    . CYS A 1 139 ? -22.612 -7.965  0.897   1.00 0.60  ? 1646 CYS A H    2  
ATOM 5225  H HA   . CYS A 1 139 ? -23.287 -8.887  -1.771  1.00 0.92  ? 1646 CYS A HA   2  
ATOM 5226  H HB2  . CYS A 1 139 ? -23.989 -9.942  0.964   1.00 1.48  ? 1646 CYS A HB2  2  
ATOM 5227  H HB3  . CYS A 1 139 ? -24.453 -10.678 -0.565  1.00 1.22  ? 1646 CYS A HB3  2  
ATOM 5228  N N    . GLU A 1 140 ? -25.766 -8.391  -1.642  1.00 1.08  ? 1647 GLU A N    2  
ATOM 5229  C CA   . GLU A 1 140 ? -27.106 -7.914  -1.711  1.00 1.37  ? 1647 GLU A CA   2  
ATOM 5230  C C    . GLU A 1 140 ? -28.017 -9.060  -1.289  1.00 1.48  ? 1647 GLU A C    2  
ATOM 5231  O O    . GLU A 1 140 ? -27.674 -10.229 -1.506  1.00 1.50  ? 1647 GLU A O    2  
ATOM 5232  C CB   . GLU A 1 140 ? -27.462 -7.444  -3.155  1.00 1.75  ? 1647 GLU A CB   2  
ATOM 5233  C CG   . GLU A 1 140 ? -27.485 -8.537  -4.250  1.00 2.13  ? 1647 GLU A CG   2  
ATOM 5234  C CD   . GLU A 1 140 ? -26.118 -9.100  -4.630  1.00 2.58  ? 1647 GLU A CD   2  
ATOM 5235  O OE1  . GLU A 1 140 ? -25.539 -9.853  -3.825  1.00 3.14  ? 1647 GLU A OE1  2  
ATOM 5236  O OE2  . GLU A 1 140 ? -25.596 -8.798  -5.719  1.00 2.88  ? 1647 GLU A OE2  2  
ATOM 5237  H H    . GLU A 1 140 ? -25.482 -9.028  -2.343  1.00 1.15  ? 1647 GLU A H    2  
ATOM 5238  H HA   . GLU A 1 140 ? -27.216 -7.089  -1.022  1.00 1.45  ? 1647 GLU A HA   2  
ATOM 5239  H HB2  . GLU A 1 140 ? -28.443 -6.994  -3.133  1.00 2.23  ? 1647 GLU A HB2  2  
ATOM 5240  H HB3  . GLU A 1 140 ? -26.749 -6.689  -3.449  1.00 2.14  ? 1647 GLU A HB3  2  
ATOM 5241  H HG2  . GLU A 1 140 ? -28.120 -9.351  -3.931  1.00 2.45  ? 1647 GLU A HG2  2  
ATOM 5242  H HG3  . GLU A 1 140 ? -27.929 -8.098  -5.132  1.00 2.59  ? 1647 GLU A HG3  2  
ATOM 5243  N N    . PRO A 1 141 ? -29.148 -8.774  -0.637  1.00 1.76  ? 1648 PRO A N    2  
ATOM 5244  C CA   . PRO A 1 141 ? -30.077 -9.811  -0.261  1.00 2.03  ? 1648 PRO A CA   2  
ATOM 5245  C C    . PRO A 1 141 ? -30.847 -10.306 -1.480  1.00 2.21  ? 1648 PRO A C    2  
ATOM 5246  O O    . PRO A 1 141 ? -31.878 -9.726  -1.877  1.00 2.55  ? 1648 PRO A O    2  
ATOM 5247  C CB   . PRO A 1 141 ? -31.011 -9.112  0.734   1.00 2.55  ? 1648 PRO A CB   2  
ATOM 5248  C CG   . PRO A 1 141 ? -30.955 -7.677  0.365   1.00 2.58  ? 1648 PRO A CG   2  
ATOM 5249  C CD   . PRO A 1 141 ? -29.585 -7.443  -0.198  1.00 2.03  ? 1648 PRO A CD   2  
ATOM 5250  H HA   . PRO A 1 141 ? -29.575 -10.641 0.215   1.00 1.99  ? 1648 PRO A HA   2  
ATOM 5251  H HB2  . PRO A 1 141 ? -32.011 -9.509  0.644   1.00 2.92  ? 1648 PRO A HB2  2  
ATOM 5252  H HB3  . PRO A 1 141 ? -30.640 -9.266  1.736   1.00 2.71  ? 1648 PRO A HB3  2  
ATOM 5253  H HG2  . PRO A 1 141 ? -31.710 -7.464  -0.378  1.00 2.88  ? 1648 PRO A HG2  2  
ATOM 5254  H HG3  . PRO A 1 141 ? -31.110 -7.067  1.243   1.00 2.86  ? 1648 PRO A HG3  2  
ATOM 5255  H HD2  . PRO A 1 141 ? -29.642 -6.766  -1.037  1.00 2.12  ? 1648 PRO A HD2  2  
ATOM 5256  H HD3  . PRO A 1 141 ? -28.923 -7.050  0.558   1.00 1.94  ? 1648 PRO A HD3  2  
ATOM 5257  N N    . GLU A 1 142 ? -30.350 -11.369 -2.059  1.00 2.23  ? 1649 GLU A N    2  
ATOM 5258  C CA   . GLU A 1 142 ? -30.963 -11.979 -3.207  1.00 2.59  ? 1649 GLU A CA   2  
ATOM 5259  C C    . GLU A 1 142 ? -32.132 -12.800 -2.748  1.00 2.73  ? 1649 GLU A C    2  
ATOM 5260  O O    . GLU A 1 142 ? -33.280 -12.405 -2.988  1.00 3.18  ? 1649 GLU A O    2  
ATOM 5261  C CB   . GLU A 1 142 ? -29.970 -12.850 -3.975  1.00 3.20  ? 1649 GLU A CB   2  
ATOM 5262  C CG   . GLU A 1 142 ? -28.769 -12.104 -4.534  1.00 3.71  ? 1649 GLU A CG   2  
ATOM 5263  C CD   . GLU A 1 142 ? -27.862 -13.007 -5.329  1.00 4.21  ? 1649 GLU A CD   2  
ATOM 5264  O OE1  . GLU A 1 142 ? -28.102 -13.208 -6.538  1.00 4.48  ? 1649 GLU A OE1  2  
ATOM 5265  O OE2  . GLU A 1 142 ? -26.871 -13.520 -4.764  1.00 4.72  ? 1649 GLU A OE2  2  
ATOM 5266  O OXT  . GLU A 1 142 ? -31.906 -13.818 -2.055  1.00 3.07  ? 1649 GLU A OXT  2  
ATOM 5267  H H    . GLU A 1 142 ? -29.523 -11.743 -1.687  1.00 2.17  ? 1649 GLU A H    2  
ATOM 5268  H HA   . GLU A 1 142 ? -31.320 -11.189 -3.852  1.00 2.87  ? 1649 GLU A HA   2  
ATOM 5269  H HB2  . GLU A 1 142 ? -29.604 -13.622 -3.315  1.00 3.68  ? 1649 GLU A HB2  2  
ATOM 5270  H HB3  . GLU A 1 142 ? -30.489 -13.317 -4.799  1.00 3.42  ? 1649 GLU A HB3  2  
ATOM 5271  H HG2  . GLU A 1 142 ? -29.120 -11.310 -5.176  1.00 4.08  ? 1649 GLU A HG2  2  
ATOM 5272  H HG3  . GLU A 1 142 ? -28.209 -11.682 -3.712  1.00 3.96  ? 1649 GLU A HG3  2  
ATOM 5273  N N    . ALA B 2 1   ? 10.121  13.589  10.162  1.00 9.97  ? 1    ALA B N    2  
ATOM 5274  C CA   . ALA B 2 1   ? 9.732   14.466  9.069   1.00 9.24  ? 1    ALA B CA   2  
ATOM 5275  C C    . ALA B 2 1   ? 9.126   13.654  7.949   1.00 8.32  ? 1    ALA B C    2  
ATOM 5276  O O    . ALA B 2 1   ? 9.614   12.570  7.627   1.00 8.34  ? 1    ALA B O    2  
ATOM 5277  C CB   . ALA B 2 1   ? 10.935  15.240  8.550   1.00 9.68  ? 1    ALA B CB   2  
ATOM 5278  H H1   . ALA B 2 1   ? 10.546  14.139  10.939  1.00 10.26 ? 1    ALA B H1   2  
ATOM 5279  H H2   . ALA B 2 1   ? 10.809  12.882  9.825   1.00 10.22 ? 1    ALA B H2   2  
ATOM 5280  H H3   . ALA B 2 1   ? 9.280   13.090  10.529  1.00 10.14 ? 1    ALA B H3   2  
ATOM 5281  H HA   . ALA B 2 1   ? 9.003   15.177  9.431   1.00 9.24  ? 1    ALA B HA   2  
ATOM 5282  H HB1  . ALA B 2 1   ? 11.673  14.547  8.173   1.00 10.04 ? 1    ALA B HB1  2  
ATOM 5283  H HB2  . ALA B 2 1   ? 11.364  15.822  9.354   1.00 9.77  ? 1    ALA B HB2  2  
ATOM 5284  H HB3  . ALA B 2 1   ? 10.623  15.901  7.755   1.00 9.78  ? 1    ALA B HB3  2  
ATOM 5285  N N    . TYR B 2 2   ? 8.076   14.165  7.367   1.00 7.68  ? 2    TYR B N    2  
ATOM 5286  C CA   . TYR B 2 2   ? 7.424   13.522  6.252   1.00 6.91  ? 2    TYR B CA   2  
ATOM 5287  C C    . TYR B 2 2   ? 8.159   13.914  4.980   1.00 6.01  ? 2    TYR B C    2  
ATOM 5288  O O    . TYR B 2 2   ? 8.118   15.077  4.544   1.00 6.08  ? 2    TYR B O    2  
ATOM 5289  C CB   . TYR B 2 2   ? 5.916   13.914  6.217   1.00 7.21  ? 2    TYR B CB   2  
ATOM 5290  C CG   . TYR B 2 2   ? 5.088   13.430  5.007   1.00 6.80  ? 2    TYR B CG   2  
ATOM 5291  C CD1  . TYR B 2 2   ? 4.513   12.148  4.956   1.00 6.75  ? 2    TYR B CD1  2  
ATOM 5292  C CD2  . TYR B 2 2   ? 4.853   14.285  3.929   1.00 6.74  ? 2    TYR B CD2  2  
ATOM 5293  C CE1  . TYR B 2 2   ? 3.738   11.751  3.861   1.00 6.73  ? 2    TYR B CE1  2  
ATOM 5294  C CE2  . TYR B 2 2   ? 4.086   13.886  2.841   1.00 6.64  ? 2    TYR B CE2  2  
ATOM 5295  C CZ   . TYR B 2 2   ? 3.534   12.625  2.814   1.00 6.68  ? 2    TYR B CZ   2  
ATOM 5296  O OH   . TYR B 2 2   ? 2.750   12.242  1.734   1.00 6.93  ? 2    TYR B OH   2  
ATOM 5297  H H    . TYR B 2 2   ? 7.727   15.030  7.689   1.00 7.83  ? 2    TYR B H    2  
ATOM 5298  H HA   . TYR B 2 2   ? 7.530   12.461  6.408   1.00 6.99  ? 2    TYR B HA   2  
ATOM 5299  H HB2  . TYR B 2 2   ? 5.445   13.530  7.109   1.00 7.94  ? 2    TYR B HB2  2  
ATOM 5300  H HB3  . TYR B 2 2   ? 5.854   14.993  6.250   1.00 7.23  ? 2    TYR B HB3  2  
ATOM 5301  H HD1  . TYR B 2 2   ? 4.660   11.455  5.772   1.00 6.91  ? 2    TYR B HD1  2  
ATOM 5302  H HD2  . TYR B 2 2   ? 5.291   15.273  3.956   1.00 6.94  ? 2    TYR B HD2  2  
ATOM 5303  H HE1  . TYR B 2 2   ? 3.293   10.766  3.817   1.00 6.93  ? 2    TYR B HE1  2  
ATOM 5304  H HE2  . TYR B 2 2   ? 3.912   14.554  2.008   1.00 6.72  ? 2    TYR B HE2  2  
ATOM 5305  H HH   . TYR B 2 2   ? 3.105   12.696  0.952   1.00 6.91  ? 2    TYR B HH   2  
ATOM 5306  N N    . ARG B 2 3   ? 8.873   12.974  4.435   1.00 5.37  ? 3    ARG B N    2  
ATOM 5307  C CA   . ARG B 2 3   ? 9.644   13.201  3.247   1.00 4.66  ? 3    ARG B CA   2  
ATOM 5308  C C    . ARG B 2 3   ? 9.001   12.497  2.072   1.00 4.12  ? 3    ARG B C    2  
ATOM 5309  O O    . ARG B 2 3   ? 8.677   11.311  2.157   1.00 4.20  ? 3    ARG B O    2  
ATOM 5310  C CB   . ARG B 2 3   ? 11.114  12.784  3.442   1.00 4.56  ? 3    ARG B CB   2  
ATOM 5311  C CG   . ARG B 2 3   ? 11.337  11.353  3.915   1.00 4.51  ? 3    ARG B CG   2  
ATOM 5312  C CD   . ARG B 2 3   ? 12.813  11.073  4.175   1.00 4.76  ? 3    ARG B CD   2  
ATOM 5313  N NE   . ARG B 2 3   ? 13.384  11.972  5.206   1.00 5.07  ? 3    ARG B NE   2  
ATOM 5314  C CZ   . ARG B 2 3   ? 14.358  11.639  6.072   1.00 5.48  ? 3    ARG B CZ   2  
ATOM 5315  N NH1  . ARG B 2 3   ? 14.835  10.405  6.104   1.00 5.57  ? 3    ARG B NH1  2  
ATOM 5316  N NH2  . ARG B 2 3   ? 14.850  12.542  6.910   1.00 6.11  ? 3    ARG B NH2  2  
ATOM 5317  H H    . ARG B 2 3   ? 8.855   12.073  4.831   1.00 5.53  ? 3    ARG B H    2  
ATOM 5318  H HA   . ARG B 2 3   ? 9.606   14.267  3.070   1.00 4.95  ? 3    ARG B HA   2  
ATOM 5319  H HB2  . ARG B 2 3   ? 11.630  12.900  2.500   1.00 4.24  ? 3    ARG B HB2  2  
ATOM 5320  H HB3  . ARG B 2 3   ? 11.561  13.453  4.161   1.00 5.22  ? 3    ARG B HB3  2  
ATOM 5321  H HG2  . ARG B 2 3   ? 10.786  11.195  4.830   1.00 5.11  ? 3    ARG B HG2  2  
ATOM 5322  H HG3  . ARG B 2 3   ? 10.978  10.675  3.155   1.00 4.04  ? 3    ARG B HG3  2  
ATOM 5323  H HD2  . ARG B 2 3   ? 12.919  10.050  4.505   1.00 4.84  ? 3    ARG B HD2  2  
ATOM 5324  H HD3  . ARG B 2 3   ? 13.357  11.208  3.253   1.00 5.08  ? 3    ARG B HD3  2  
ATOM 5325  H HE   . ARG B 2 3   ? 13.017  12.892  5.203   1.00 5.24  ? 3    ARG B HE   2  
ATOM 5326  H HH11 . ARG B 2 3   ? 14.511  9.665   5.491   1.00 5.42  ? 3    ARG B HH11 2  
ATOM 5327  H HH12 . ARG B 2 3   ? 15.560  10.098  6.729   1.00 6.03  ? 3    ARG B HH12 2  
ATOM 5328  H HH21 . ARG B 2 3   ? 14.521  13.492  6.939   1.00 6.35  ? 3    ARG B HH21 2  
ATOM 5329  H HH22 . ARG B 2 3   ? 15.596  12.321  7.548   1.00 6.56  ? 3    ARG B HH22 2  
ATOM 5330  N N    . PRO B 2 4   ? 8.770   13.215  0.970   1.00 4.08  ? 4    PRO B N    2  
ATOM 5331  C CA   . PRO B 2 4   ? 8.106   12.674  -0.215  1.00 4.17  ? 4    PRO B CA   2  
ATOM 5332  C C    . PRO B 2 4   ? 9.013   11.799  -1.102  1.00 3.73  ? 4    PRO B C    2  
ATOM 5333  O O    . PRO B 2 4   ? 9.053   11.962  -2.334  1.00 4.12  ? 4    PRO B O    2  
ATOM 5334  C CB   . PRO B 2 4   ? 7.685   13.929  -0.942  1.00 4.81  ? 4    PRO B CB   2  
ATOM 5335  C CG   . PRO B 2 4   ? 8.723   14.924  -0.617  1.00 4.84  ? 4    PRO B CG   2  
ATOM 5336  C CD   . PRO B 2 4   ? 9.107   14.646  0.787   1.00 4.56  ? 4    PRO B CD   2  
ATOM 5337  H HA   . PRO B 2 4   ? 7.225   12.112  0.059   1.00 4.57  ? 4    PRO B HA   2  
ATOM 5338  H HB2  . PRO B 2 4   ? 7.643   13.748  -2.002  1.00 4.98  ? 4    PRO B HB2  2  
ATOM 5339  H HB3  . PRO B 2 4   ? 6.724   14.218  -0.551  1.00 5.36  ? 4    PRO B HB3  2  
ATOM 5340  H HG2  . PRO B 2 4   ? 9.573   14.798  -1.271  1.00 4.72  ? 4    PRO B HG2  2  
ATOM 5341  H HG3  . PRO B 2 4   ? 8.321   15.923  -0.708  1.00 5.51  ? 4    PRO B HG3  2  
ATOM 5342  H HD2  . PRO B 2 4   ? 10.165  14.824  0.911   1.00 4.55  ? 4    PRO B HD2  2  
ATOM 5343  H HD3  . PRO B 2 4   ? 8.510   15.273  1.432   1.00 5.09  ? 4    PRO B HD3  2  
ATOM 5344  N N    . SER B 2 5   ? 9.718   10.904  -0.451  1.00 3.33  ? 5    SER B N    2  
ATOM 5345  C CA   . SER B 2 5   ? 10.594  9.902   -1.057  1.00 3.26  ? 5    SER B CA   2  
ATOM 5346  C C    . SER B 2 5   ? 11.508  10.475  -2.149  1.00 2.82  ? 5    SER B C    2  
ATOM 5347  O O    . SER B 2 5   ? 11.494  10.009  -3.297  1.00 2.91  ? 5    SER B O    2  
ATOM 5348  C CB   . SER B 2 5   ? 9.753   8.760   -1.610  1.00 4.08  ? 5    SER B CB   2  
ATOM 5349  O OG   . SER B 2 5   ? 8.896   8.227   -0.612  1.00 4.60  ? 5    SER B OG   2  
ATOM 5350  H H    . SER B 2 5   ? 9.601   10.923  0.522   1.00 3.42  ? 5    SER B H    2  
ATOM 5351  H HA   . SER B 2 5   ? 11.216  9.503   -0.270  1.00 3.37  ? 5    SER B HA   2  
ATOM 5352  H HB2  . SER B 2 5   ? 9.142   9.141   -2.415  1.00 4.31  ? 5    SER B HB2  2  
ATOM 5353  H HB3  . SER B 2 5   ? 10.401  7.977   -1.976  1.00 4.46  ? 5    SER B HB3  2  
ATOM 5354  H HG   . SER B 2 5   ? 8.032   8.118   -1.032  1.00 4.91  ? 5    SER B HG   2  
ATOM 5355  N N    . GLU B 2 6   ? 12.274  11.479  -1.814  1.00 2.79  ? 6    GLU B N    2  
ATOM 5356  C CA   . GLU B 2 6   ? 13.184  12.048  -2.777  1.00 2.83  ? 6    GLU B CA   2  
ATOM 5357  C C    . GLU B 2 6   ? 14.522  11.325  -2.675  1.00 2.71  ? 6    GLU B C    2  
ATOM 5358  O O    . GLU B 2 6   ? 15.088  10.889  -3.691  1.00 2.87  ? 6    GLU B O    2  
ATOM 5359  C CB   . GLU B 2 6   ? 13.315  13.582  -2.614  1.00 3.19  ? 6    GLU B CB   2  
ATOM 5360  C CG   . GLU B 2 6   ? 11.979  14.334  -2.710  1.00 3.41  ? 6    GLU B CG   2  
ATOM 5361  C CD   . GLU B 2 6   ? 12.133  15.822  -2.603  1.00 3.74  ? 6    GLU B CD   2  
ATOM 5362  O OE1  . GLU B 2 6   ? 12.296  16.341  -1.481  1.00 4.23  ? 6    GLU B OE1  2  
ATOM 5363  O OE2  . GLU B 2 6   ? 12.053  16.515  -3.643  1.00 3.88  ? 6    GLU B OE2  2  
ATOM 5364  H H    . GLU B 2 6   ? 12.246  11.833  -0.894  1.00 3.08  ? 6    GLU B H    2  
ATOM 5365  H HA   . GLU B 2 6   ? 12.796  11.813  -3.758  1.00 2.97  ? 6    GLU B HA   2  
ATOM 5366  H HB2  . GLU B 2 6   ? 13.760  13.826  -1.661  1.00 3.28  ? 6    GLU B HB2  2  
ATOM 5367  H HB3  . GLU B 2 6   ? 13.954  13.956  -3.401  1.00 3.43  ? 6    GLU B HB3  2  
ATOM 5368  H HG2  . GLU B 2 6   ? 11.503  14.138  -3.659  1.00 3.61  ? 6    GLU B HG2  2  
ATOM 5369  H HG3  . GLU B 2 6   ? 11.325  14.008  -1.912  1.00 3.54  ? 6    GLU B HG3  2  
ATOM 5370  N N    . THR B 2 7   ? 14.990  11.146  -1.452  1.00 2.63  ? 7    THR B N    2  
ATOM 5371  C CA   . THR B 2 7   ? 16.192  10.412  -1.169  1.00 2.57  ? 7    THR B CA   2  
ATOM 5372  C C    . THR B 2 7   ? 15.885  9.489   0.012   1.00 2.39  ? 7    THR B C    2  
ATOM 5373  O O    . THR B 2 7   ? 15.181  9.900   0.952   1.00 2.45  ? 7    THR B O    2  
ATOM 5374  C CB   . THR B 2 7   ? 17.386  11.362  -0.814  1.00 2.76  ? 7    THR B CB   2  
ATOM 5375  O OG1  . THR B 2 7   ? 17.053  12.213  0.302   1.00 2.82  ? 7    THR B OG1  2  
ATOM 5376  C CG2  . THR B 2 7   ? 17.771  12.236  -2.000  1.00 3.14  ? 7    THR B CG2  2  
ATOM 5377  H H    . THR B 2 7   ? 14.522  11.486  -0.659  1.00 2.71  ? 7    THR B H    2  
ATOM 5378  H HA   . THR B 2 7   ? 16.433  9.826   -2.044  1.00 2.72  ? 7    THR B HA   2  
ATOM 5379  H HB   . THR B 2 7   ? 18.234  10.751  -0.539  1.00 2.75  ? 7    THR B HB   2  
ATOM 5380  H HG1  . THR B 2 7   ? 17.775  12.113  0.943   1.00 2.92  ? 7    THR B HG1  2  
ATOM 5381  H HG21 . THR B 2 7   ? 18.606  12.867  -1.732  1.00 3.45  ? 7    THR B HG21 2  
ATOM 5382  H HG22 . THR B 2 7   ? 16.925  12.853  -2.264  1.00 3.48  ? 7    THR B HG22 2  
ATOM 5383  H HG23 . THR B 2 7   ? 18.035  11.613  -2.842  1.00 3.24  ? 7    THR B HG23 2  
ATOM 5384  N N    . LEU B 2 8   ? 16.346  8.262   -0.031  1.00 2.43  ? 8    LEU B N    2  
ATOM 5385  C CA   . LEU B 2 8   ? 16.068  7.325   1.031   1.00 2.40  ? 8    LEU B CA   2  
ATOM 5386  C C    . LEU B 2 8   ? 17.374  6.928   1.708   1.00 2.21  ? 8    LEU B C    2  
ATOM 5387  O O    . LEU B 2 8   ? 18.059  6.039   1.256   1.00 2.36  ? 8    LEU B O    2  
ATOM 5388  C CB   . LEU B 2 8   ? 15.339  6.053   0.514   1.00 2.82  ? 8    LEU B CB   2  
ATOM 5389  C CG   . LEU B 2 8   ? 13.872  6.189   0.027   1.00 3.42  ? 8    LEU B CG   2  
ATOM 5390  C CD1  . LEU B 2 8   ? 13.750  6.989   -1.268  1.00 3.96  ? 8    LEU B CD1  2  
ATOM 5391  C CD2  . LEU B 2 8   ? 13.252  4.815   -0.138  1.00 3.94  ? 8    LEU B CD2  2  
ATOM 5392  H H    . LEU B 2 8   ? 16.928  7.958   -0.763  1.00 2.65  ? 8    LEU B H    2  
ATOM 5393  H HA   . LEU B 2 8   ? 15.411  7.842   1.716   1.00 2.44  ? 8    LEU B HA   2  
ATOM 5394  H HB2  . LEU B 2 8   ? 15.915  5.659   -0.311  1.00 2.74  ? 8    LEU B HB2  2  
ATOM 5395  H HB3  . LEU B 2 8   ? 15.360  5.321   1.308   1.00 3.13  ? 8    LEU B HB3  2  
ATOM 5396  H HG   . LEU B 2 8   ? 13.309  6.713   0.784   1.00 3.68  ? 8    LEU B HG   2  
ATOM 5397  H HD11 . LEU B 2 8   ? 12.710  7.057   -1.553  1.00 4.23  ? 8    LEU B HD11 2  
ATOM 5398  H HD12 . LEU B 2 8   ? 14.305  6.493   -2.051  1.00 4.35  ? 8    LEU B HD12 2  
ATOM 5399  H HD13 . LEU B 2 8   ? 14.149  7.980   -1.115  1.00 4.24  ? 8    LEU B HD13 2  
ATOM 5400  H HD21 . LEU B 2 8   ? 13.814  4.250   -0.866  1.00 4.29  ? 8    LEU B HD21 2  
ATOM 5401  H HD22 . LEU B 2 8   ? 12.230  4.920   -0.473  1.00 4.13  ? 8    LEU B HD22 2  
ATOM 5402  H HD23 . LEU B 2 8   ? 13.267  4.297   0.810   1.00 4.30  ? 8    LEU B HD23 2  
ATOM 5403  N N    . CYS B 2 9   ? 17.743  7.599   2.760   1.00 2.15  ? 9    CYS B N    2  
ATOM 5404  C CA   . CYS B 2 9   ? 18.967  7.288   3.414   1.00 2.11  ? 9    CYS B CA   2  
ATOM 5405  C C    . CYS B 2 9   ? 18.705  6.794   4.815   1.00 2.19  ? 9    CYS B C    2  
ATOM 5406  O O    . CYS B 2 9   ? 18.263  7.553   5.697   1.00 2.84  ? 9    CYS B O    2  
ATOM 5407  C CB   . CYS B 2 9   ? 19.869  8.507   3.412   1.00 2.28  ? 9    CYS B CB   2  
ATOM 5408  S SG   . CYS B 2 9   ? 21.551  8.242   4.060   1.00 2.37  ? 9    CYS B SG   2  
ATOM 5409  H H    . CYS B 2 9   ? 17.211  8.343   3.124   1.00 2.32  ? 9    CYS B H    2  
ATOM 5410  H HA   . CYS B 2 9   ? 19.451  6.503   2.851   1.00 2.03  ? 9    CYS B HA   2  
ATOM 5411  H HB2  . CYS B 2 9   ? 19.978  8.799   2.380   1.00 2.65  ? 9    CYS B HB2  2  
ATOM 5412  H HB3  . CYS B 2 9   ? 19.406  9.304   3.974   1.00 2.56  ? 9    CYS B HB3  2  
ATOM 5413  N N    . GLY B 2 10  ? 18.942  5.526   5.009   1.00 1.97  ? 10   GLY B N    2  
ATOM 5414  C CA   . GLY B 2 10  ? 18.776  4.919   6.303   1.00 2.09  ? 10   GLY B CA   2  
ATOM 5415  C C    . GLY B 2 10  ? 17.543  4.042   6.399   1.00 1.88  ? 10   GLY B C    2  
ATOM 5416  O O    . GLY B 2 10  ? 17.384  3.092   5.617   1.00 1.88  ? 10   GLY B O    2  
ATOM 5417  H H    . GLY B 2 10  ? 19.246  4.990   4.246   1.00 2.07  ? 10   GLY B H    2  
ATOM 5418  H HA2  . GLY B 2 10  ? 19.646  4.315   6.518   1.00 2.28  ? 10   GLY B HA2  2  
ATOM 5419  H HA3  . GLY B 2 10  ? 18.705  5.701   7.045   1.00 2.27  ? 10   GLY B HA3  2  
ATOM 5420  N N    . GLY B 2 11  ? 16.672  4.388   7.336   1.00 1.84  ? 11   GLY B N    2  
ATOM 5421  C CA   . GLY B 2 11  ? 15.471  3.630   7.639   1.00 1.77  ? 11   GLY B CA   2  
ATOM 5422  C C    . GLY B 2 11  ? 14.616  3.312   6.442   1.00 1.58  ? 11   GLY B C    2  
ATOM 5423  O O    . GLY B 2 11  ? 14.296  2.163   6.216   1.00 1.50  ? 11   GLY B O    2  
ATOM 5424  H H    . GLY B 2 11  ? 16.881  5.186   7.873   1.00 1.94  ? 11   GLY B H    2  
ATOM 5425  H HA2  . GLY B 2 11  ? 15.762  2.699   8.103   1.00 1.85  ? 11   GLY B HA2  2  
ATOM 5426  H HA3  . GLY B 2 11  ? 14.883  4.195   8.349   1.00 1.89  ? 11   GLY B HA3  2  
ATOM 5427  N N    . GLU B 2 12  ? 14.274  4.322   5.666   1.00 1.53  ? 12   GLU B N    2  
ATOM 5428  C CA   . GLU B 2 12  ? 13.413  4.163   4.483   1.00 1.40  ? 12   GLU B CA   2  
ATOM 5429  C C    . GLU B 2 12  ? 14.005  3.169   3.516   1.00 1.33  ? 12   GLU B C    2  
ATOM 5430  O O    . GLU B 2 12  ? 13.301  2.329   2.961   1.00 1.25  ? 12   GLU B O    2  
ATOM 5431  C CB   . GLU B 2 12  ? 13.229  5.478   3.727   1.00 1.44  ? 12   GLU B CB   2  
ATOM 5432  C CG   . GLU B 2 12  ? 12.824  6.666   4.576   1.00 1.56  ? 12   GLU B CG   2  
ATOM 5433  C CD   . GLU B 2 12  ? 14.000  7.319   5.248   1.00 2.03  ? 12   GLU B CD   2  
ATOM 5434  O OE1  . GLU B 2 12  ? 14.378  6.916   6.370   1.00 2.50  ? 12   GLU B OE1  2  
ATOM 5435  O OE2  . GLU B 2 12  ? 14.575  8.235   4.666   1.00 2.55  ? 12   GLU B OE2  2  
ATOM 5436  H H    . GLU B 2 12  ? 14.583  5.225   5.918   1.00 1.62  ? 12   GLU B H    2  
ATOM 5437  H HA   . GLU B 2 12  ? 12.446  3.812   4.809   1.00 1.40  ? 12   GLU B HA   2  
ATOM 5438  H HB2  . GLU B 2 12  ? 14.166  5.682   3.233   1.00 1.51  ? 12   GLU B HB2  2  
ATOM 5439  H HB3  . GLU B 2 12  ? 12.503  5.348   2.940   1.00 1.39  ? 12   GLU B HB3  2  
ATOM 5440  H HG2  . GLU B 2 12  ? 12.320  7.393   3.957   1.00 1.79  ? 12   GLU B HG2  2  
ATOM 5441  H HG3  . GLU B 2 12  ? 12.150  6.300   5.336   1.00 1.99  ? 12   GLU B HG3  2  
ATOM 5442  N N    . LEU B 2 13  ? 15.302  3.275   3.322   1.00 1.40  ? 13   LEU B N    2  
ATOM 5443  C CA   . LEU B 2 13  ? 16.017  2.433   2.413   1.00 1.41  ? 13   LEU B CA   2  
ATOM 5444  C C    . LEU B 2 13  ? 15.898  0.979   2.852   1.00 1.37  ? 13   LEU B C    2  
ATOM 5445  O O    . LEU B 2 13  ? 15.467  0.128   2.095   1.00 1.27  ? 13   LEU B O    2  
ATOM 5446  C CB   . LEU B 2 13  ? 17.469  2.859   2.418   1.00 1.61  ? 13   LEU B CB   2  
ATOM 5447  C CG   . LEU B 2 13  ? 18.210  2.771   1.098   1.00 1.79  ? 13   LEU B CG   2  
ATOM 5448  C CD1  . LEU B 2 13  ? 19.597  3.289   1.280   1.00 2.35  ? 13   LEU B CD1  2  
ATOM 5449  C CD2  . LEU B 2 13  ? 18.243  1.358   0.584   1.00 2.02  ? 13   LEU B CD2  2  
ATOM 5450  H H    . LEU B 2 13  ? 15.816  3.957   3.803   1.00 1.49  ? 13   LEU B H    2  
ATOM 5451  H HA   . LEU B 2 13  ? 15.620  2.558   1.417   1.00 1.38  ? 13   LEU B HA   2  
ATOM 5452  H HB2  . LEU B 2 13  ? 17.499  3.870   2.792   1.00 1.84  ? 13   LEU B HB2  2  
ATOM 5453  H HB3  . LEU B 2 13  ? 18.000  2.220   3.115   1.00 1.72  ? 13   LEU B HB3  2  
ATOM 5454  H HG   . LEU B 2 13  ? 17.714  3.395   0.368   1.00 2.18  ? 13   LEU B HG   2  
ATOM 5455  H HD11 . LEU B 2 13  ? 20.121  3.224   0.340   1.00 2.68  ? 13   LEU B HD11 2  
ATOM 5456  H HD12 . LEU B 2 13  ? 20.072  2.704   2.055   1.00 2.82  ? 13   LEU B HD12 2  
ATOM 5457  H HD13 . LEU B 2 13  ? 19.530  4.319   1.602   1.00 2.72  ? 13   LEU B HD13 2  
ATOM 5458  H HD21 . LEU B 2 13  ? 17.220  1.040   0.435   1.00 2.36  ? 13   LEU B HD21 2  
ATOM 5459  H HD22 . LEU B 2 13  ? 18.705  0.725   1.328   1.00 2.41  ? 13   LEU B HD22 2  
ATOM 5460  H HD23 . LEU B 2 13  ? 18.783  1.310   -0.349  1.00 2.37  ? 13   LEU B HD23 2  
ATOM 5461  N N    . VAL B 2 14  ? 16.221  0.715   4.088   1.00 1.48  ? 14   VAL B N    2  
ATOM 5462  C CA   . VAL B 2 14  ? 16.198  -0.651  4.553   1.00 1.51  ? 14   VAL B CA   2  
ATOM 5463  C C    . VAL B 2 14  ? 14.782  -1.166  4.723   1.00 1.39  ? 14   VAL B C    2  
ATOM 5464  O O    . VAL B 2 14  ? 14.531  -2.351  4.544   1.00 1.39  ? 14   VAL B O    2  
ATOM 5465  C CB   . VAL B 2 14  ? 17.045  -0.903  5.824   1.00 1.73  ? 14   VAL B CB   2  
ATOM 5466  C CG1  . VAL B 2 14  ? 18.490  -0.487  5.575   1.00 2.11  ? 14   VAL B CG1  2  
ATOM 5467  C CG2  . VAL B 2 14  ? 16.471  -0.202  7.061   1.00 1.63  ? 14   VAL B CG2  2  
ATOM 5468  H H    . VAL B 2 14  ? 16.455  1.461   4.682   1.00 1.57  ? 14   VAL B H    2  
ATOM 5469  H HA   . VAL B 2 14  ? 16.626  -1.228  3.744   1.00 1.51  ? 14   VAL B HA   2  
ATOM 5470  H HB   . VAL B 2 14  ? 17.021  -1.974  5.976   1.00 2.16  ? 14   VAL B HB   2  
ATOM 5471  H HG11 . VAL B 2 14  ? 19.102  -0.714  6.436   1.00 2.48  ? 14   VAL B HG11 2  
ATOM 5472  H HG12 . VAL B 2 14  ? 18.535  0.577   5.391   1.00 2.44  ? 14   VAL B HG12 2  
ATOM 5473  H HG13 . VAL B 2 14  ? 18.878  -1.004  4.709   1.00 2.50  ? 14   VAL B HG13 2  
ATOM 5474  H HG21 . VAL B 2 14  ? 17.079  -0.424  7.926   1.00 1.98  ? 14   VAL B HG21 2  
ATOM 5475  H HG22 . VAL B 2 14  ? 15.459  -0.534  7.245   1.00 2.03  ? 14   VAL B HG22 2  
ATOM 5476  H HG23 . VAL B 2 14  ? 16.460  0.867   6.910   1.00 1.86  ? 14   VAL B HG23 2  
ATOM 5477  N N    . ASP B 2 15  ? 13.858  -0.277  5.047   1.00 1.34  ? 15   ASP B N    2  
ATOM 5478  C CA   . ASP B 2 15  ? 12.466  -0.666  5.170   1.00 1.28  ? 15   ASP B CA   2  
ATOM 5479  C C    . ASP B 2 15  ? 11.851  -1.018  3.819   1.00 1.09  ? 15   ASP B C    2  
ATOM 5480  O O    . ASP B 2 15  ? 11.161  -1.998  3.717   1.00 1.03  ? 15   ASP B O    2  
ATOM 5481  C CB   . ASP B 2 15  ? 11.641  0.380   5.890   1.00 1.42  ? 15   ASP B CB   2  
ATOM 5482  C CG   . ASP B 2 15  ? 10.244  -0.107  6.200   1.00 1.57  ? 15   ASP B CG   2  
ATOM 5483  O OD1  . ASP B 2 15  ? 10.100  -1.292  6.588   1.00 2.04  ? 15   ASP B OD1  2  
ATOM 5484  O OD2  . ASP B 2 15  ? 9.291   0.702   6.157   1.00 1.59  ? 15   ASP B OD2  2  
ATOM 5485  H H    . ASP B 2 15  ? 14.117  0.647   5.273   1.00 1.39  ? 15   ASP B H    2  
ATOM 5486  H HA   . ASP B 2 15  ? 12.463  -1.572  5.761   1.00 1.40  ? 15   ASP B HA   2  
ATOM 5487  H HB2  . ASP B 2 15  ? 12.129  0.638   6.818   1.00 1.57  ? 15   ASP B HB2  2  
ATOM 5488  H HB3  . ASP B 2 15  ? 11.567  1.261   5.269   1.00 1.40  ? 15   ASP B HB3  2  
ATOM 5489  N N    . THR B 2 16  ? 12.125  -0.234  2.771   1.00 1.04  ? 16   THR B N    2  
ATOM 5490  C CA   . THR B 2 16  ? 11.636  -0.567  1.434   1.00 0.95  ? 16   THR B CA   2  
ATOM 5491  C C    . THR B 2 16  ? 12.247  -1.915  0.964   1.00 0.95  ? 16   THR B C    2  
ATOM 5492  O O    . THR B 2 16  ? 11.559  -2.767  0.345   1.00 0.93  ? 16   THR B O    2  
ATOM 5493  C CB   . THR B 2 16  ? 11.918  0.582   0.420   1.00 1.03  ? 16   THR B CB   2  
ATOM 5494  O OG1  . THR B 2 16  ? 13.290  0.975   0.497   1.00 1.84  ? 16   THR B OG1  2  
ATOM 5495  C CG2  . THR B 2 16  ? 11.042  1.799   0.703   1.00 1.54  ? 16   THR B CG2  2  
ATOM 5496  H H    . THR B 2 16  ? 12.640  0.594   2.875   1.00 1.10  ? 16   THR B H    2  
ATOM 5497  H HA   . THR B 2 16  ? 10.569  -0.711  1.526   1.00 0.92  ? 16   THR B HA   2  
ATOM 5498  H HB   . THR B 2 16  ? 11.709  0.223   -0.577  1.00 1.43  ? 16   THR B HB   2  
ATOM 5499  H HG1  . THR B 2 16  ? 13.408  1.535   1.274   1.00 2.31  ? 16   THR B HG1  2  
ATOM 5500  H HG21 . THR B 2 16  ? 9.994   1.552   0.635   1.00 2.11  ? 16   THR B HG21 2  
ATOM 5501  H HG22 . THR B 2 16  ? 11.271  2.575   -0.014  1.00 1.98  ? 16   THR B HG22 2  
ATOM 5502  H HG23 . THR B 2 16  ? 11.262  2.168   1.694   1.00 2.03  ? 16   THR B HG23 2  
ATOM 5503  N N    . LEU B 2 17  ? 13.529  -2.110  1.298   1.00 1.04  ? 17   LEU B N    2  
ATOM 5504  C CA   . LEU B 2 17  ? 14.211  -3.376  1.101   1.00 1.11  ? 17   LEU B CA   2  
ATOM 5505  C C    . LEU B 2 17  ? 13.475  -4.514  1.817   1.00 1.11  ? 17   LEU B C    2  
ATOM 5506  O O    . LEU B 2 17  ? 13.152  -5.530  1.224   1.00 1.15  ? 17   LEU B O    2  
ATOM 5507  C CB   . LEU B 2 17  ? 15.663  -3.293  1.586   1.00 1.24  ? 17   LEU B CB   2  
ATOM 5508  C CG   . LEU B 2 17  ? 16.720  -3.002  0.506   1.00 1.34  ? 17   LEU B CG   2  
ATOM 5509  C CD1  . LEU B 2 17  ? 16.767  -4.153  -0.484  1.00 1.74  ? 17   LEU B CD1  2  
ATOM 5510  C CD2  . LEU B 2 17  ? 16.441  -1.702  -0.243  1.00 1.46  ? 17   LEU B CD2  2  
ATOM 5511  H H    . LEU B 2 17  ? 14.035  -1.345  1.650   1.00 1.07  ? 17   LEU B H    2  
ATOM 5512  H HA   . LEU B 2 17  ? 14.230  -3.544  0.037   1.00 1.11  ? 17   LEU B HA   2  
ATOM 5513  H HB2  . LEU B 2 17  ? 15.735  -2.529  2.347   1.00 1.25  ? 17   LEU B HB2  2  
ATOM 5514  H HB3  . LEU B 2 17  ? 15.910  -4.240  2.041   1.00 1.32  ? 17   LEU B HB3  2  
ATOM 5515  H HG   . LEU B 2 17  ? 17.671  -2.922  1.012   1.00 1.73  ? 17   LEU B HG   2  
ATOM 5516  H HD11 . LEU B 2 17  ? 17.507  -3.959  -1.246  1.00 2.14  ? 17   LEU B HD11 2  
ATOM 5517  H HD12 . LEU B 2 17  ? 15.795  -4.248  -0.944  1.00 2.27  ? 17   LEU B HD12 2  
ATOM 5518  H HD13 . LEU B 2 17  ? 17.004  -5.069  0.036   1.00 2.06  ? 17   LEU B HD13 2  
ATOM 5519  H HD21 . LEU B 2 17  ? 15.467  -1.760  -0.707  1.00 1.88  ? 17   LEU B HD21 2  
ATOM 5520  H HD22 . LEU B 2 17  ? 17.188  -1.564  -1.011  1.00 1.93  ? 17   LEU B HD22 2  
ATOM 5521  H HD23 . LEU B 2 17  ? 16.468  -0.858  0.431   1.00 1.76  ? 17   LEU B HD23 2  
ATOM 5522  N N    . GLN B 2 18  ? 13.169  -4.288  3.072   1.00 1.12  ? 18   GLN B N    2  
ATOM 5523  C CA   . GLN B 2 18  ? 12.456  -5.245  3.942   1.00 1.15  ? 18   GLN B CA   2  
ATOM 5524  C C    . GLN B 2 18  ? 11.019  -5.434  3.439   1.00 1.05  ? 18   GLN B C    2  
ATOM 5525  O O    . GLN B 2 18  ? 10.449  -6.514  3.541   1.00 1.10  ? 18   GLN B O    2  
ATOM 5526  C CB   . GLN B 2 18  ? 12.503  -4.694  5.391   1.00 1.24  ? 18   GLN B CB   2  
ATOM 5527  C CG   . GLN B 2 18  ? 11.934  -5.530  6.556   1.00 1.32  ? 18   GLN B CG   2  
ATOM 5528  C CD   . GLN B 2 18  ? 10.438  -5.508  6.692   1.00 1.70  ? 18   GLN B CD   2  
ATOM 5529  O OE1  . GLN B 2 18  ? 9.719   -6.388  6.210   1.00 2.39  ? 18   GLN B OE1  2  
ATOM 5530  N NE2  . GLN B 2 18  ? 9.955   -4.491  7.313   1.00 1.82  ? 18   GLN B NE2  2  
ATOM 5531  H H    . GLN B 2 18  ? 13.449  -3.417  3.435   1.00 1.14  ? 18   GLN B H    2  
ATOM 5532  H HA   . GLN B 2 18  ? 12.973  -6.191  3.902   1.00 1.23  ? 18   GLN B HA   2  
ATOM 5533  H HB2  . GLN B 2 18  ? 13.521  -4.462  5.669   1.00 1.34  ? 18   GLN B HB2  2  
ATOM 5534  H HB3  . GLN B 2 18  ? 11.932  -3.780  5.342   1.00 1.24  ? 18   GLN B HB3  2  
ATOM 5535  H HG2  . GLN B 2 18  ? 12.184  -6.567  6.410   1.00 1.45  ? 18   GLN B HG2  2  
ATOM 5536  H HG3  . GLN B 2 18  ? 12.369  -5.180  7.480   1.00 1.59  ? 18   GLN B HG3  2  
ATOM 5537  H HE21 . GLN B 2 18  ? 10.571  -3.798  7.654   1.00 1.80  ? 18   GLN B HE21 2  
ATOM 5538  H HE22 . GLN B 2 18  ? 8.987   -4.440  7.400   1.00 2.27  ? 18   GLN B HE22 2  
ATOM 5539  N N    . PHE B 2 19  ? 10.469  -4.397  2.882   1.00 0.96  ? 19   PHE B N    2  
ATOM 5540  C CA   . PHE B 2 19  ? 9.129   -4.417  2.337   1.00 0.87  ? 19   PHE B CA   2  
ATOM 5541  C C    . PHE B 2 19  ? 8.932   -5.564  1.350   1.00 0.90  ? 19   PHE B C    2  
ATOM 5542  O O    . PHE B 2 19  ? 8.051   -6.420  1.560   1.00 0.95  ? 19   PHE B O    2  
ATOM 5543  C CB   . PHE B 2 19  ? 8.758   -3.068  1.702   1.00 0.81  ? 19   PHE B CB   2  
ATOM 5544  C CG   . PHE B 2 19  ? 7.375   -3.030  1.181   1.00 0.74  ? 19   PHE B CG   2  
ATOM 5545  C CD1  . PHE B 2 19  ? 6.315   -2.981  2.048   1.00 0.80  ? 19   PHE B CD1  2  
ATOM 5546  C CD2  . PHE B 2 19  ? 7.132   -3.046  -0.182  1.00 0.79  ? 19   PHE B CD2  2  
ATOM 5547  C CE1  . PHE B 2 19  ? 5.037   -2.949  1.577   1.00 0.83  ? 19   PHE B CE1  2  
ATOM 5548  C CE2  . PHE B 2 19  ? 5.854   -3.008  -0.663  1.00 0.81  ? 19   PHE B CE2  2  
ATOM 5549  C CZ   . PHE B 2 19  ? 4.796   -2.959  0.214   1.00 0.79  ? 19   PHE B CZ   2  
ATOM 5550  H H    . PHE B 2 19  ? 10.980  -3.556  2.900   1.00 0.99  ? 19   PHE B H    2  
ATOM 5551  H HA   . PHE B 2 19  ? 8.462   -4.594  3.168   1.00 0.88  ? 19   PHE B HA   2  
ATOM 5552  H HB2  . PHE B 2 19  ? 8.837   -2.288  2.444   1.00 0.85  ? 19   PHE B HB2  2  
ATOM 5553  H HB3  . PHE B 2 19  ? 9.409   -2.826  0.875   1.00 0.85  ? 19   PHE B HB3  2  
ATOM 5554  H HD1  . PHE B 2 19  ? 6.502   -2.976  3.113   1.00 0.95  ? 19   PHE B HD1  2  
ATOM 5555  H HD2  . PHE B 2 19  ? 7.960   -3.094  -0.874  1.00 0.94  ? 19   PHE B HD2  2  
ATOM 5556  H HE1  . PHE B 2 19  ? 4.222   -2.913  2.284   1.00 1.00  ? 19   PHE B HE1  2  
ATOM 5557  H HE2  . PHE B 2 19  ? 5.687   -3.023  -1.729  1.00 0.96  ? 19   PHE B HE2  2  
ATOM 5558  H HZ   . PHE B 2 19  ? 3.780   -2.925  -0.158  1.00 0.88  ? 19   PHE B HZ   2  
ATOM 5559  N N    . VAL B 2 20  ? 9.736   -5.621  0.303   1.00 0.92  ? 20   VAL B N    2  
ATOM 5560  C CA   . VAL B 2 20  ? 9.559   -6.704  -0.635  1.00 0.98  ? 20   VAL B CA   2  
ATOM 5561  C C    . VAL B 2 20  ? 10.554  -7.861  -0.409  1.00 1.11  ? 20   VAL B C    2  
ATOM 5562  O O    . VAL B 2 20  ? 10.246  -9.010  -0.697  1.00 1.22  ? 20   VAL B O    2  
ATOM 5563  C CB   . VAL B 2 20  ? 9.482   -6.246  -2.141  1.00 0.99  ? 20   VAL B CB   2  
ATOM 5564  C CG1  . VAL B 2 20  ? 10.760  -5.643  -2.647  1.00 1.16  ? 20   VAL B CG1  2  
ATOM 5565  C CG2  . VAL B 2 20  ? 9.027   -7.373  -3.039  1.00 1.37  ? 20   VAL B CG2  2  
ATOM 5566  H H    . VAL B 2 20  ? 10.438  -4.949  0.165   1.00 0.92  ? 20   VAL B H    2  
ATOM 5567  H HA   . VAL B 2 20  ? 8.595   -7.116  -0.366  1.00 1.00  ? 20   VAL B HA   2  
ATOM 5568  H HB   . VAL B 2 20  ? 8.745   -5.460  -2.207  1.00 1.08  ? 20   VAL B HB   2  
ATOM 5569  H HG11 . VAL B 2 20  ? 11.572  -6.332  -2.464  1.00 1.51  ? 20   VAL B HG11 2  
ATOM 5570  H HG12 . VAL B 2 20  ? 10.894  -4.686  -2.169  1.00 1.70  ? 20   VAL B HG12 2  
ATOM 5571  H HG13 . VAL B 2 20  ? 10.657  -5.485  -3.710  1.00 1.58  ? 20   VAL B HG13 2  
ATOM 5572  H HG21 . VAL B 2 20  ? 9.733   -8.186  -2.942  1.00 1.77  ? 20   VAL B HG21 2  
ATOM 5573  H HG22 . VAL B 2 20  ? 9.001   -7.033  -4.064  1.00 1.83  ? 20   VAL B HG22 2  
ATOM 5574  H HG23 . VAL B 2 20  ? 8.049   -7.707  -2.733  1.00 1.81  ? 20   VAL B HG23 2  
ATOM 5575  N N    . CYS B 2 21  ? 11.715  -7.577  0.164   1.00 1.14  ? 21   CYS B N    2  
ATOM 5576  C CA   . CYS B 2 21  ? 12.733  -8.632  0.346   1.00 1.28  ? 21   CYS B CA   2  
ATOM 5577  C C    . CYS B 2 21  ? 12.886  -9.098  1.812   1.00 1.38  ? 21   CYS B C    2  
ATOM 5578  O O    . CYS B 2 21  ? 13.681  -9.994  2.091   1.00 1.66  ? 21   CYS B O    2  
ATOM 5579  C CB   . CYS B 2 21  ? 14.098  -8.156  -0.181  1.00 1.33  ? 21   CYS B CB   2  
ATOM 5580  S SG   . CYS B 2 21  ? 14.128  -7.711  -1.956  1.00 1.38  ? 21   CYS B SG   2  
ATOM 5581  H H    . CYS B 2 21  ? 11.937  -6.659  0.453   1.00 1.09  ? 21   CYS B H    2  
ATOM 5582  H HA   . CYS B 2 21  ? 12.426  -9.479  -0.249  1.00 1.36  ? 21   CYS B HA   2  
ATOM 5583  H HB2  . CYS B 2 21  ? 14.399  -7.279  0.375   1.00 1.32  ? 21   CYS B HB2  2  
ATOM 5584  H HB3  . CYS B 2 21  ? 14.825  -8.939  -0.023  1.00 1.44  ? 21   CYS B HB3  2  
ATOM 5585  N N    . GLY B 2 22  ? 12.094  -8.533  2.719   1.00 1.25  ? 22   GLY B N    2  
ATOM 5586  C CA   . GLY B 2 22  ? 12.218  -8.776  4.173   1.00 1.36  ? 22   GLY B CA   2  
ATOM 5587  C C    . GLY B 2 22  ? 12.149  -10.219 4.638   1.00 1.38  ? 22   GLY B C    2  
ATOM 5588  O O    . GLY B 2 22  ? 12.650  -10.524 5.722   1.00 1.53  ? 22   GLY B O    2  
ATOM 5589  H H    . GLY B 2 22  ? 11.398  -7.903  2.430   1.00 1.13  ? 22   GLY B H    2  
ATOM 5590  H HA2  . GLY B 2 22  ? 13.166  -8.375  4.500   1.00 1.50  ? 22   GLY B HA2  2  
ATOM 5591  H HA3  . GLY B 2 22  ? 11.436  -8.213  4.662   1.00 1.44  ? 22   GLY B HA3  2  
ATOM 5592  N N    . ASP B 2 23  ? 11.518  -11.099 3.863   1.00 1.38  ? 23   ASP B N    2  
ATOM 5593  C CA   . ASP B 2 23  ? 11.490  -12.526 4.193   1.00 1.53  ? 23   ASP B CA   2  
ATOM 5594  C C    . ASP B 2 23  ? 12.912  -13.062 4.273   1.00 1.53  ? 23   ASP B C    2  
ATOM 5595  O O    . ASP B 2 23  ? 13.252  -13.832 5.183   1.00 1.72  ? 23   ASP B O    2  
ATOM 5596  C CB   . ASP B 2 23  ? 10.674  -13.329 3.162   1.00 1.68  ? 23   ASP B CB   2  
ATOM 5597  C CG   . ASP B 2 23  ? 11.201  -13.190 1.755   1.00 2.19  ? 23   ASP B CG   2  
ATOM 5598  O OD1  . ASP B 2 23  ? 10.913  -12.184 1.083   1.00 2.72  ? 23   ASP B OD1  2  
ATOM 5599  O OD2  . ASP B 2 23  ? 11.902  -14.090 1.298   1.00 2.67  ? 23   ASP B OD2  2  
ATOM 5600  H H    . ASP B 2 23  ? 11.052  -10.804 3.052   1.00 1.37  ? 23   ASP B H    2  
ATOM 5601  H HA   . ASP B 2 23  ? 11.032  -12.625 5.167   1.00 1.66  ? 23   ASP B HA   2  
ATOM 5602  H HB2  . ASP B 2 23  ? 10.700  -14.375 3.427   1.00 1.99  ? 23   ASP B HB2  2  
ATOM 5603  H HB3  . ASP B 2 23  ? 9.651   -12.985 3.181   1.00 1.99  ? 23   ASP B HB3  2  
ATOM 5604  N N    . ARG B 2 24  ? 13.739  -12.621 3.353   1.00 1.44  ? 24   ARG B N    2  
ATOM 5605  C CA   . ARG B 2 24  ? 15.131  -12.980 3.325   1.00 1.54  ? 24   ARG B CA   2  
ATOM 5606  C C    . ARG B 2 24  ? 15.900  -11.949 4.134   1.00 1.55  ? 24   ARG B C    2  
ATOM 5607  O O    . ARG B 2 24  ? 16.701  -12.289 5.001   1.00 1.73  ? 24   ARG B O    2  
ATOM 5608  C CB   . ARG B 2 24  ? 15.647  -12.992 1.878   1.00 1.62  ? 24   ARG B CB   2  
ATOM 5609  C CG   . ARG B 2 24  ? 17.105  -13.422 1.726   1.00 1.85  ? 24   ARG B CG   2  
ATOM 5610  C CD   . ARG B 2 24  ? 17.298  -14.899 2.021   1.00 2.35  ? 24   ARG B CD   2  
ATOM 5611  N NE   . ARG B 2 24  ? 16.631  -15.745 1.018   1.00 2.81  ? 24   ARG B NE   2  
ATOM 5612  C CZ   . ARG B 2 24  ? 16.474  -17.079 1.104   1.00 3.62  ? 24   ARG B CZ   2  
ATOM 5613  N NH1  . ARG B 2 24  ? 16.875  -17.734 2.198   1.00 4.13  ? 24   ARG B NH1  2  
ATOM 5614  N NH2  . ARG B 2 24  ? 15.885  -17.748 0.110   1.00 4.33  ? 24   ARG B NH2  2  
ATOM 5615  H H    . ARG B 2 24  ? 13.383  -12.013 2.669   1.00 1.41  ? 24   ARG B H    2  
ATOM 5616  H HA   . ARG B 2 24  ? 15.252  -13.960 3.763   1.00 1.65  ? 24   ARG B HA   2  
ATOM 5617  H HB2  . ARG B 2 24  ? 15.039  -13.671 1.300   1.00 1.68  ? 24   ARG B HB2  2  
ATOM 5618  H HB3  . ARG B 2 24  ? 15.544  -11.997 1.469   1.00 1.56  ? 24   ARG B HB3  2  
ATOM 5619  H HG2  . ARG B 2 24  ? 17.404  -13.238 0.705   1.00 2.16  ? 24   ARG B HG2  2  
ATOM 5620  H HG3  . ARG B 2 24  ? 17.717  -12.839 2.399   1.00 1.99  ? 24   ARG B HG3  2  
ATOM 5621  H HD2  . ARG B 2 24  ? 18.356  -15.118 2.019   1.00 2.72  ? 24   ARG B HD2  2  
ATOM 5622  H HD3  . ARG B 2 24  ? 16.885  -15.117 2.995   1.00 2.77  ? 24   ARG B HD3  2  
ATOM 5623  H HE   . ARG B 2 24  ? 16.309  -15.246 0.227   1.00 2.89  ? 24   ARG B HE   2  
ATOM 5624  H HH11 . ARG B 2 24  ? 17.292  -17.263 2.988   1.00 4.04  ? 24   ARG B HH11 2  
ATOM 5625  H HH12 . ARG B 2 24  ? 16.794  -18.733 2.293   1.00 4.90  ? 24   ARG B HH12 2  
ATOM 5626  H HH21 . ARG B 2 24  ? 15.530  -17.305 -0.725  1.00 4.44  ? 24   ARG B HH21 2  
ATOM 5627  H HH22 . ARG B 2 24  ? 15.778  -18.752 0.137   1.00 5.02  ? 24   ARG B HH22 2  
ATOM 5628  N N    . GLY B 2 25  ? 15.625  -10.700 3.851   1.00 1.46  ? 25   GLY B N    2  
ATOM 5629  C CA   . GLY B 2 25  ? 16.260  -9.608  4.508   1.00 1.52  ? 25   GLY B CA   2  
ATOM 5630  C C    . GLY B 2 25  ? 16.772  -8.632  3.493   1.00 1.48  ? 25   GLY B C    2  
ATOM 5631  O O    . GLY B 2 25  ? 16.219  -8.525  2.400   1.00 1.53  ? 25   GLY B O    2  
ATOM 5632  H H    . GLY B 2 25  ? 14.978  -10.480 3.143   1.00 1.40  ? 25   GLY B H    2  
ATOM 5633  H HA2  . GLY B 2 25  ? 15.549  -9.120  5.158   1.00 1.55  ? 25   GLY B HA2  2  
ATOM 5634  H HA3  . GLY B 2 25  ? 17.090  -9.974  5.093   1.00 1.63  ? 25   GLY B HA3  2  
ATOM 5635  N N    . PHE B 2 26  ? 17.795  -7.933  3.837   1.00 1.46  ? 26   PHE B N    2  
ATOM 5636  C CA   . PHE B 2 26  ? 18.445  -7.020  2.944   1.00 1.46  ? 26   PHE B CA   2  
ATOM 5637  C C    . PHE B 2 26  ? 19.940  -7.160  3.102   1.00 1.62  ? 26   PHE B C    2  
ATOM 5638  O O    . PHE B 2 26  ? 20.437  -7.330  4.219   1.00 1.65  ? 26   PHE B O    2  
ATOM 5639  C CB   . PHE B 2 26  ? 17.977  -5.565  3.168   1.00 1.37  ? 26   PHE B CB   2  
ATOM 5640  C CG   . PHE B 2 26  ? 17.967  -5.090  4.602   1.00 1.36  ? 26   PHE B CG   2  
ATOM 5641  C CD1  . PHE B 2 26  ? 19.111  -4.583  5.197   1.00 1.49  ? 26   PHE B CD1  2  
ATOM 5642  C CD2  . PHE B 2 26  ? 16.798  -5.140  5.347   1.00 1.32  ? 26   PHE B CD2  2  
ATOM 5643  C CE1  . PHE B 2 26  ? 19.092  -4.146  6.504   1.00 1.55  ? 26   PHE B CE1  2  
ATOM 5644  C CE2  . PHE B 2 26  ? 16.775  -4.704  6.652   1.00 1.36  ? 26   PHE B CE2  2  
ATOM 5645  C CZ   . PHE B 2 26  ? 17.921  -4.207  7.231   1.00 1.45  ? 26   PHE B CZ   2  
ATOM 5646  H H    . PHE B 2 26  ? 18.154  -8.020  4.754   1.00 1.48  ? 26   PHE B H    2  
ATOM 5647  H HA   . PHE B 2 26  ? 18.168  -7.331  1.948   1.00 1.49  ? 26   PHE B HA   2  
ATOM 5648  H HB2  . PHE B 2 26  ? 18.664  -4.923  2.639   1.00 1.42  ? 26   PHE B HB2  2  
ATOM 5649  H HB3  . PHE B 2 26  ? 16.986  -5.443  2.757   1.00 1.31  ? 26   PHE B HB3  2  
ATOM 5650  H HD1  . PHE B 2 26  ? 20.027  -4.538  4.625   1.00 1.61  ? 26   PHE B HD1  2  
ATOM 5651  H HD2  . PHE B 2 26  ? 15.899  -5.531  4.893   1.00 1.33  ? 26   PHE B HD2  2  
ATOM 5652  H HE1  . PHE B 2 26  ? 19.992  -3.755  6.956   1.00 1.71  ? 26   PHE B HE1  2  
ATOM 5653  H HE2  . PHE B 2 26  ? 15.858  -4.753  7.221   1.00 1.38  ? 26   PHE B HE2  2  
ATOM 5654  H HZ   . PHE B 2 26  ? 17.902  -3.865  8.255   1.00 1.52  ? 26   PHE B HZ   2  
ATOM 5655  N N    . TYR B 2 27  ? 20.659  -7.126  2.007   1.00 1.77  ? 27   TYR B N    2  
ATOM 5656  C CA   . TYR B 2 27  ? 22.089  -7.335  2.059   1.00 2.00  ? 27   TYR B CA   2  
ATOM 5657  C C    . TYR B 2 27  ? 22.869  -6.215  1.411   1.00 2.07  ? 27   TYR B C    2  
ATOM 5658  O O    . TYR B 2 27  ? 23.537  -5.461  2.102   1.00 2.53  ? 27   TYR B O    2  
ATOM 5659  C CB   . TYR B 2 27  ? 22.495  -8.727  1.534   1.00 2.27  ? 27   TYR B CB   2  
ATOM 5660  C CG   . TYR B 2 27  ? 22.403  -9.828  2.575   1.00 2.21  ? 27   TYR B CG   2  
ATOM 5661  C CD1  . TYR B 2 27  ? 21.179  -10.326 3.025   1.00 2.35  ? 27   TYR B CD1  2  
ATOM 5662  C CD2  . TYR B 2 27  ? 23.557  -10.365 3.116   1.00 2.56  ? 27   TYR B CD2  2  
ATOM 5663  C CE1  . TYR B 2 27  ? 21.121  -11.314 3.980   1.00 2.56  ? 27   TYR B CE1  2  
ATOM 5664  C CE2  . TYR B 2 27  ? 23.502  -11.355 4.065   1.00 2.98  ? 27   TYR B CE2  2  
ATOM 5665  C CZ   . TYR B 2 27  ? 22.284  -11.823 4.495   1.00 2.85  ? 27   TYR B CZ   2  
ATOM 5666  O OH   . TYR B 2 27  ? 22.232  -12.803 5.451   1.00 3.42  ? 27   TYR B OH   2  
ATOM 5667  H H    . TYR B 2 27  ? 20.227  -6.914  1.150   1.00 1.76  ? 27   TYR B H    2  
ATOM 5668  H HA   . TYR B 2 27  ? 22.335  -7.298  3.111   1.00 2.04  ? 27   TYR B HA   2  
ATOM 5669  H HB2  . TYR B 2 27  ? 21.840  -8.998  0.719   1.00 2.65  ? 27   TYR B HB2  2  
ATOM 5670  H HB3  . TYR B 2 27  ? 23.512  -8.703  1.172   1.00 2.57  ? 27   TYR B HB3  2  
ATOM 5671  H HD1  . TYR B 2 27  ? 20.256  -9.932  2.632   1.00 2.63  ? 27   TYR B HD1  2  
ATOM 5672  H HD2  . TYR B 2 27  ? 24.515  -9.998  2.781   1.00 2.81  ? 27   TYR B HD2  2  
ATOM 5673  H HE1  . TYR B 2 27  ? 20.165  -11.685 4.321   1.00 2.80  ? 27   TYR B HE1  2  
ATOM 5674  H HE2  . TYR B 2 27  ? 24.415  -11.760 4.475   1.00 3.60  ? 27   TYR B HE2  2  
ATOM 5675  H HH   . TYR B 2 27  ? 21.559  -13.450 5.174   1.00 3.67  ? 27   TYR B HH   2  
ATOM 5676  N N    . PHE B 2 28  ? 22.735  -6.106  0.075   1.00 1.95  ? 28   PHE B N    2  
ATOM 5677  C CA   . PHE B 2 28  ? 23.246  -4.979  -0.789  1.00 2.01  ? 28   PHE B CA   2  
ATOM 5678  C C    . PHE B 2 28  ? 24.676  -4.467  -0.513  1.00 2.20  ? 28   PHE B C    2  
ATOM 5679  O O    . PHE B 2 28  ? 25.041  -3.381  -0.973  1.00 2.26  ? 28   PHE B O    2  
ATOM 5680  C CB   . PHE B 2 28  ? 22.244  -3.792  -0.845  1.00 1.96  ? 28   PHE B CB   2  
ATOM 5681  C CG   . PHE B 2 28  ? 21.924  -3.126  0.484   1.00 1.99  ? 28   PHE B CG   2  
ATOM 5682  C CD1  . PHE B 2 28  ? 22.721  -2.104  0.993   1.00 2.17  ? 28   PHE B CD1  2  
ATOM 5683  C CD2  . PHE B 2 28  ? 20.813  -3.514  1.205   1.00 1.98  ? 28   PHE B CD2  2  
ATOM 5684  C CE1  . PHE B 2 28  ? 22.411  -1.497  2.189   1.00 2.24  ? 28   PHE B CE1  2  
ATOM 5685  C CE2  . PHE B 2 28  ? 20.501  -2.914  2.401   1.00 2.08  ? 28   PHE B CE2  2  
ATOM 5686  C CZ   . PHE B 2 28  ? 21.298  -1.903  2.896   1.00 2.17  ? 28   PHE B CZ   2  
ATOM 5687  H H    . PHE B 2 28  ? 22.269  -6.828  -0.398  1.00 2.06  ? 28   PHE B H    2  
ATOM 5688  H HA   . PHE B 2 28  ? 23.278  -5.399  -1.784  1.00 2.03  ? 28   PHE B HA   2  
ATOM 5689  H HB2  . PHE B 2 28  ? 22.647  -3.026  -1.491  1.00 2.02  ? 28   PHE B HB2  2  
ATOM 5690  H HB3  . PHE B 2 28  ? 21.318  -4.148  -1.271  1.00 1.90  ? 28   PHE B HB3  2  
ATOM 5691  H HD1  . PHE B 2 28  ? 23.597  -1.781  0.449   1.00 2.32  ? 28   PHE B HD1  2  
ATOM 5692  H HD2  . PHE B 2 28  ? 20.192  -4.309  0.823   1.00 1.99  ? 28   PHE B HD2  2  
ATOM 5693  H HE1  . PHE B 2 28  ? 23.036  -0.706  2.576   1.00 2.44  ? 28   PHE B HE1  2  
ATOM 5694  H HE2  . PHE B 2 28  ? 19.627  -3.242  2.945   1.00 2.19  ? 28   PHE B HE2  2  
ATOM 5695  H HZ   . PHE B 2 28  ? 21.049  -1.430  3.836   1.00 2.28  ? 28   PHE B HZ   2  
ATOM 5696  N N    . SER B 2 29  ? 25.471  -5.229  0.172   1.00 2.41  ? 29   SER B N    2  
ATOM 5697  C CA   . SER B 2 29  ? 26.784  -4.816  0.521   1.00 2.66  ? 29   SER B CA   2  
ATOM 5698  C C    . SER B 2 29  ? 27.631  -6.040  0.799   1.00 2.58  ? 29   SER B C    2  
ATOM 5699  O O    . SER B 2 29  ? 27.185  -6.987  1.468   1.00 2.79  ? 29   SER B O    2  
ATOM 5700  C CB   . SER B 2 29  ? 26.742  -3.906  1.763   1.00 3.13  ? 29   SER B CB   2  
ATOM 5701  O OG   . SER B 2 29  ? 28.040  -3.441  2.105   1.00 3.68  ? 29   SER B OG   2  
ATOM 5702  H H    . SER B 2 29  ? 25.165  -6.109  0.471   1.00 2.48  ? 29   SER B H    2  
ATOM 5703  H HA   . SER B 2 29  ? 27.177  -4.249  -0.310  1.00 2.71  ? 29   SER B HA   2  
ATOM 5704  H HB2  . SER B 2 29  ? 26.108  -3.056  1.562   1.00 3.33  ? 29   SER B HB2  2  
ATOM 5705  H HB3  . SER B 2 29  ? 26.341  -4.469  2.594   1.00 3.32  ? 29   SER B HB3  2  
ATOM 5706  H HG   . SER B 2 29  ? 28.058  -3.273  3.062   1.00 3.85  ? 29   SER B HG   2  
ATOM 5707  N N    . ARG B 2 30  ? 28.812  -6.061  0.249   1.00 2.55  ? 30   ARG B N    2  
ATOM 5708  C CA   . ARG B 2 30  ? 29.734  -7.135  0.475   1.00 2.65  ? 30   ARG B CA   2  
ATOM 5709  C C    . ARG B 2 30  ? 31.003  -6.496  1.017   1.00 2.99  ? 30   ARG B C    2  
ATOM 5710  O O    . ARG B 2 30  ? 31.687  -5.808  0.273   1.00 3.28  ? 30   ARG B O    2  
ATOM 5711  C CB   . ARG B 2 30  ? 30.043  -7.826  -0.869  1.00 2.70  ? 30   ARG B CB   2  
ATOM 5712  C CG   . ARG B 2 30  ? 28.816  -8.304  -1.673  1.00 2.63  ? 30   ARG B CG   2  
ATOM 5713  C CD   . ARG B 2 30  ? 28.165  -9.573  -1.122  1.00 2.46  ? 30   ARG B CD   2  
ATOM 5714  N NE   . ARG B 2 30  ? 27.693  -9.496  0.281   1.00 2.71  ? 30   ARG B NE   2  
ATOM 5715  C CZ   . ARG B 2 30  ? 27.391  -10.584 1.004   1.00 3.07  ? 30   ARG B CZ   2  
ATOM 5716  N NH1  . ARG B 2 30  ? 27.223  -11.746 0.391   1.00 3.21  ? 30   ARG B NH1  2  
ATOM 5717  N NH2  . ARG B 2 30  ? 27.170  -10.494 2.311   1.00 3.81  ? 30   ARG B NH2  2  
ATOM 5718  H H    . ARG B 2 30  ? 29.102  -5.306  -0.306  1.00 2.65  ? 30   ARG B H    2  
ATOM 5719  H HA   . ARG B 2 30  ? 29.320  -7.845  1.175   1.00 2.72  ? 30   ARG B HA   2  
ATOM 5720  H HB2  . ARG B 2 30  ? 30.592  -7.134  -1.489  1.00 2.85  ? 30   ARG B HB2  2  
ATOM 5721  H HB3  . ARG B 2 30  ? 30.670  -8.684  -0.674  1.00 2.90  ? 30   ARG B HB3  2  
ATOM 5722  H HG2  . ARG B 2 30  ? 28.070  -7.525  -1.716  1.00 2.87  ? 30   ARG B HG2  2  
ATOM 5723  H HG3  . ARG B 2 30  ? 29.149  -8.506  -2.682  1.00 2.91  ? 30   ARG B HG3  2  
ATOM 5724  H HD2  . ARG B 2 30  ? 27.312  -9.803  -1.743  1.00 2.70  ? 30   ARG B HD2  2  
ATOM 5725  H HD3  . ARG B 2 30  ? 28.878  -10.380 -1.208  1.00 2.74  ? 30   ARG B HD3  2  
ATOM 5726  H HE   . ARG B 2 30  ? 27.663  -8.603  0.699   1.00 3.07  ? 30   ARG B HE   2  
ATOM 5727  H HH11 . ARG B 2 30  ? 27.285  -11.832 -0.609  1.00 3.17  ? 30   ARG B HH11 2  
ATOM 5728  H HH12 . ARG B 2 30  ? 27.080  -12.601 0.910   1.00 3.73  ? 30   ARG B HH12 2  
ATOM 5729  H HH21 . ARG B 2 30  ? 27.214  -9.627  2.826   1.00 4.18  ? 30   ARG B HH21 2  
ATOM 5730  H HH22 . ARG B 2 30  ? 26.946  -11.302 2.877   1.00 4.27  ? 30   ARG B HH22 2  
ATOM 5731  N N    . PRO B 2 31  ? 31.303  -6.671  2.313   1.00 3.17  ? 31   PRO B N    2  
ATOM 5732  C CA   . PRO B 2 31  ? 32.518  -6.100  2.935   1.00 3.60  ? 31   PRO B CA   2  
ATOM 5733  C C    . PRO B 2 31  ? 33.813  -6.744  2.428   1.00 3.72  ? 31   PRO B C    2  
ATOM 5734  O O    . PRO B 2 31  ? 34.830  -6.056  2.220   1.00 4.02  ? 31   PRO B O    2  
ATOM 5735  C CB   . PRO B 2 31  ? 32.333  -6.385  4.433   1.00 3.86  ? 31   PRO B CB   2  
ATOM 5736  C CG   . PRO B 2 31  ? 30.882  -6.686  4.595   1.00 3.76  ? 31   PRO B CG   2  
ATOM 5737  C CD   . PRO B 2 31  ? 30.443  -7.328  3.314   1.00 3.25  ? 31   PRO B CD   2  
ATOM 5738  H HA   . PRO B 2 31  ? 32.571  -5.034  2.774   1.00 3.85  ? 31   PRO B HA   2  
ATOM 5739  H HB2  . PRO B 2 31  ? 32.948  -7.227  4.719   1.00 3.96  ? 31   PRO B HB2  2  
ATOM 5740  H HB3  . PRO B 2 31  ? 32.621  -5.515  5.004   1.00 4.20  ? 31   PRO B HB3  2  
ATOM 5741  H HG2  . PRO B 2 31  ? 30.741  -7.365  5.422   1.00 4.07  ? 31   PRO B HG2  2  
ATOM 5742  H HG3  . PRO B 2 31  ? 30.335  -5.769  4.764   1.00 3.95  ? 31   PRO B HG3  2  
ATOM 5743  H HD2  . PRO B 2 31  ? 30.559  -8.400  3.351   1.00 3.28  ? 31   PRO B HD2  2  
ATOM 5744  H HD3  . PRO B 2 31  ? 29.406  -7.089  3.132   1.00 3.18  ? 31   PRO B HD3  2  
ATOM 5745  N N    . ALA B 2 32  ? 33.782  -8.049  2.233   1.00 3.72  ? 32   ALA B N    2  
ATOM 5746  C CA   . ALA B 2 32  ? 34.906  -8.786  1.767   1.00 4.11  ? 32   ALA B CA   2  
ATOM 5747  C C    . ALA B 2 32  ? 34.437  -10.118 1.272   1.00 4.50  ? 32   ALA B C    2  
ATOM 5748  O O    . ALA B 2 32  ? 33.233  -10.425 1.376   1.00 4.92  ? 32   ALA B O    2  
ATOM 5749  C CB   . ALA B 2 32  ? 35.921  -8.977  2.863   1.00 4.78  ? 32   ALA B CB   2  
ATOM 5750  H H    . ALA B 2 32  ? 32.978  -8.582  2.391   1.00 3.61  ? 32   ALA B H    2  
ATOM 5751  H HA   . ALA B 2 32  ? 35.366  -8.233  0.962   1.00 4.05  ? 32   ALA B HA   2  
ATOM 5752  H HB1  . ALA B 2 32  ? 36.252  -8.012  3.218   1.00 5.02  ? 32   ALA B HB1  2  
ATOM 5753  H HB2  . ALA B 2 32  ? 36.754  -9.516  2.434   1.00 5.08  ? 32   ALA B HB2  2  
ATOM 5754  H HB3  . ALA B 2 32  ? 35.486  -9.550  3.666   1.00 5.12  ? 32   ALA B HB3  2  
ATOM 5755  N N    . SER B 2 33  ? 35.370  -10.885 0.753   1.00 4.79  ? 33   SER B N    2  
ATOM 5756  C CA   . SER B 2 33  ? 35.191  -12.174 0.206   1.00 5.55  ? 33   SER B CA   2  
ATOM 5757  C C    . SER B 2 33  ? 36.481  -12.545 -0.437  1.00 6.06  ? 33   SER B C    2  
ATOM 5758  O O    . SER B 2 33  ? 37.235  -11.682 -0.899  1.00 5.86  ? 33   SER B O    2  
ATOM 5759  C CB   . SER B 2 33  ? 34.091  -12.164 -0.832  1.00 5.88  ? 33   SER B CB   2  
ATOM 5760  O OG   . SER B 2 33  ? 34.035  -13.357 -1.598  1.00 6.72  ? 33   SER B OG   2  
ATOM 5761  H H    . SER B 2 33  ? 36.305  -10.601 0.715   1.00 4.77  ? 33   SER B H    2  
ATOM 5762  H HA   . SER B 2 33  ? 34.942  -12.862 1.000   1.00 5.80  ? 33   SER B HA   2  
ATOM 5763  H HB2  . SER B 2 33  ? 33.182  -12.076 -0.264  1.00 5.86  ? 33   SER B HB2  2  
ATOM 5764  H HB3  . SER B 2 33  ? 34.213  -11.306 -1.469  1.00 5.82  ? 33   SER B HB3  2  
ATOM 5765  H HG   . SER B 2 33  ? 33.372  -13.958 -1.215  1.00 6.93  ? 33   SER B HG   2  
ATOM 5766  N N    . ARG B 2 34  ? 36.708  -13.804 -0.518  1.00 6.92  ? 34   ARG B N    2  
ATOM 5767  C CA   . ARG B 2 34  ? 37.925  -14.360 -1.075  1.00 7.72  ? 34   ARG B CA   2  
ATOM 5768  C C    . ARG B 2 34  ? 37.788  -14.423 -2.605  1.00 8.17  ? 34   ARG B C    2  
ATOM 5769  O O    . ARG B 2 34  ? 38.644  -14.939 -3.325  1.00 8.95  ? 34   ARG B O    2  
ATOM 5770  C CB   . ARG B 2 34  ? 38.135  -15.736 -0.479  1.00 8.57  ? 34   ARG B CB   2  
ATOM 5771  C CG   . ARG B 2 34  ? 39.545  -16.293 -0.629  1.00 9.48  ? 34   ARG B CG   2  
ATOM 5772  C CD   . ARG B 2 34  ? 39.648  -17.724 -0.102  1.00 10.00 ? 34   ARG B CD   2  
ATOM 5773  N NE   . ARG B 2 34  ? 39.081  -17.848 1.239   1.00 10.50 ? 34   ARG B NE   2  
ATOM 5774  C CZ   . ARG B 2 34  ? 39.541  -18.609 2.225   1.00 11.06 ? 34   ARG B CZ   2  
ATOM 5775  N NH1  . ARG B 2 34  ? 40.612  -19.368 2.057   1.00 11.22 ? 34   ARG B NH1  2  
ATOM 5776  N NH2  . ARG B 2 34  ? 38.886  -18.615 3.374   1.00 11.63 ? 34   ARG B NH2  2  
ATOM 5777  H H    . ARG B 2 34  ? 35.983  -14.382 -0.175  1.00 7.14  ? 34   ARG B H    2  
ATOM 5778  H HA   . ARG B 2 34  ? 38.754  -13.716 -0.818  1.00 7.56  ? 34   ARG B HA   2  
ATOM 5779  H HB2  . ARG B 2 34  ? 37.904  -15.621 0.572   1.00 8.20  ? 34   ARG B HB2  2  
ATOM 5780  H HB3  . ARG B 2 34  ? 37.426  -16.421 -0.922  1.00 8.99  ? 34   ARG B HB3  2  
ATOM 5781  H HG2  . ARG B 2 34  ? 39.818  -16.277 -1.675  1.00 9.92  ? 34   ARG B HG2  2  
ATOM 5782  H HG3  . ARG B 2 34  ? 40.222  -15.662 -0.073  1.00 9.53  ? 34   ARG B HG3  2  
ATOM 5783  H HD2  . ARG B 2 34  ? 39.121  -18.394 -0.765  1.00 10.20 ? 34   ARG B HD2  2  
ATOM 5784  H HD3  . ARG B 2 34  ? 40.688  -18.014 -0.065  1.00 10.03 ? 34   ARG B HD3  2  
ATOM 5785  H HE   . ARG B 2 34  ? 38.262  -17.321 1.412   1.00 10.53 ? 34   ARG B HE   2  
ATOM 5786  H HH11 . ARG B 2 34  ? 41.124  -19.418 1.189   1.00 10.95 ? 34   ARG B HH11 2  
ATOM 5787  H HH12 . ARG B 2 34  ? 40.972  -19.942 2.805   1.00 11.73 ? 34   ARG B HH12 2  
ATOM 5788  H HH21 . ARG B 2 34  ? 38.060  -18.048 3.469   1.00 11.70 ? 34   ARG B HH21 2  
ATOM 5789  H HH22 . ARG B 2 34  ? 39.156  -19.162 4.177   1.00 12.14 ? 34   ARG B HH22 2  
ATOM 5790  N N    . VAL B 2 35  ? 36.672  -13.917 -3.072  1.00 7.81  ? 35   VAL B N    2  
ATOM 5791  C CA   . VAL B 2 35  ? 36.375  -13.788 -4.479  1.00 8.33  ? 35   VAL B CA   2  
ATOM 5792  C C    . VAL B 2 35  ? 36.645  -12.333 -4.905  1.00 7.66  ? 35   VAL B C    2  
ATOM 5793  O O    . VAL B 2 35  ? 36.559  -11.963 -6.086  1.00 8.09  ? 35   VAL B O    2  
ATOM 5794  C CB   . VAL B 2 35  ? 34.883  -14.189 -4.744  1.00 8.82  ? 35   VAL B CB   2  
ATOM 5795  C CG1  . VAL B 2 35  ? 34.502  -14.079 -6.210  1.00 9.61  ? 35   VAL B CG1  2  
ATOM 5796  C CG2  . VAL B 2 35  ? 34.622  -15.601 -4.238  1.00 9.47  ? 35   VAL B CG2  2  
ATOM 5797  H H    . VAL B 2 35  ? 35.994  -13.632 -2.418  1.00 7.32  ? 35   VAL B H    2  
ATOM 5798  H HA   . VAL B 2 35  ? 37.028  -14.441 -5.036  1.00 9.01  ? 35   VAL B HA   2  
ATOM 5799  H HB   . VAL B 2 35  ? 34.251  -13.516 -4.184  1.00 8.27  ? 35   VAL B HB   2  
ATOM 5800  H HG11 . VAL B 2 35  ? 35.122  -14.742 -6.794  1.00 9.90  ? 35   VAL B HG11 2  
ATOM 5801  H HG12 . VAL B 2 35  ? 34.669  -13.059 -6.525  1.00 9.79  ? 35   VAL B HG12 2  
ATOM 5802  H HG13 . VAL B 2 35  ? 33.460  -14.335 -6.337  1.00 9.89  ? 35   VAL B HG13 2  
ATOM 5803  H HG21 . VAL B 2 35  ? 33.591  -15.864 -4.422  1.00 9.62  ? 35   VAL B HG21 2  
ATOM 5804  H HG22 . VAL B 2 35  ? 34.822  -15.646 -3.178  1.00 9.75  ? 35   VAL B HG22 2  
ATOM 5805  H HG23 . VAL B 2 35  ? 35.268  -16.294 -4.755  1.00 9.67  ? 35   VAL B HG23 2  
ATOM 5806  N N    . SER B 2 36  ? 37.006  -11.515 -3.902  1.00 6.71  ? 36   SER B N    2  
ATOM 5807  C CA   . SER B 2 36  ? 37.276  -10.089 -4.068  1.00 6.10  ? 36   SER B CA   2  
ATOM 5808  C C    . SER B 2 36  ? 35.999  -9.384  -4.561  1.00 5.54  ? 36   SER B C    2  
ATOM 5809  O O    . SER B 2 36  ? 36.032  -8.360  -5.235  1.00 5.31  ? 36   SER B O    2  
ATOM 5810  C CB   . SER B 2 36  ? 38.506  -9.868  -5.015  1.00 6.44  ? 36   SER B CB   2  
ATOM 5811  O OG   . SER B 2 36  ? 38.819  -8.487  -5.207  1.00 6.53  ? 36   SER B OG   2  
ATOM 5812  H H    . SER B 2 36  ? 37.134  -11.908 -3.012  1.00 6.51  ? 36   SER B H    2  
ATOM 5813  H HA   . SER B 2 36  ? 37.502  -9.710  -3.084  1.00 6.14  ? 36   SER B HA   2  
ATOM 5814  H HB2  . SER B 2 36  ? 39.391  -10.342 -4.616  1.00 6.82  ? 36   SER B HB2  2  
ATOM 5815  H HB3  . SER B 2 36  ? 38.269  -10.309 -5.970  1.00 6.60  ? 36   SER B HB3  2  
ATOM 5816  H HG   . SER B 2 36  ? 38.361  -8.260  -6.034  1.00 6.58  ? 36   SER B HG   2  
ATOM 5817  N N    . ARG B 2 37  ? 34.872  -9.927  -4.151  1.00 5.74  ? 37   ARG B N    2  
ATOM 5818  C CA   . ARG B 2 37  ? 33.570  -9.471  -4.623  1.00 5.75  ? 37   ARG B CA   2  
ATOM 5819  C C    . ARG B 2 37  ? 33.034  -8.293  -3.817  1.00 5.29  ? 37   ARG B C    2  
ATOM 5820  O O    . ARG B 2 37  ? 31.837  -7.993  -3.888  1.00 5.64  ? 37   ARG B O    2  
ATOM 5821  C CB   . ARG B 2 37  ? 32.535  -10.604 -4.702  1.00 6.47  ? 37   ARG B CB   2  
ATOM 5822  C CG   . ARG B 2 37  ? 32.061  -11.131 -3.361  1.00 7.24  ? 37   ARG B CG   2  
ATOM 5823  C CD   . ARG B 2 37  ? 30.990  -12.195 -3.526  1.00 8.13  ? 37   ARG B CD   2  
ATOM 5824  N NE   . ARG B 2 37  ? 30.470  -12.655 -2.232  1.00 8.59  ? 37   ARG B NE   2  
ATOM 5825  C CZ   . ARG B 2 37  ? 29.615  -13.661 -2.079  1.00 9.42  ? 37   ARG B CZ   2  
ATOM 5826  N NH1  . ARG B 2 37  ? 29.243  -14.375 -3.121  1.00 9.86  ? 37   ARG B NH1  2  
ATOM 5827  N NH2  . ARG B 2 37  ? 29.192  -13.984 -0.867  1.00 10.00 ? 37   ARG B NH2  2  
ATOM 5828  H H    . ARG B 2 37  ? 34.961  -10.658 -3.503  1.00 6.18  ? 37   ARG B H    2  
ATOM 5829  H HA   . ARG B 2 37  ? 33.741  -9.101  -5.625  1.00 5.92  ? 37   ARG B HA   2  
ATOM 5830  H HB2  . ARG B 2 37  ? 31.678  -10.235 -5.246  1.00 6.44  ? 37   ARG B HB2  2  
ATOM 5831  H HB3  . ARG B 2 37  ? 32.975  -11.417 -5.259  1.00 6.79  ? 37   ARG B HB3  2  
ATOM 5832  H HG2  . ARG B 2 37  ? 32.904  -11.554 -2.834  1.00 7.36  ? 37   ARG B HG2  2  
ATOM 5833  H HG3  . ARG B 2 37  ? 31.660  -10.308 -2.787  1.00 7.28  ? 37   ARG B HG3  2  
ATOM 5834  H HD2  . ARG B 2 37  ? 30.164  -11.795 -4.097  1.00 8.28  ? 37   ARG B HD2  2  
ATOM 5835  H HD3  . ARG B 2 37  ? 31.404  -13.046 -4.046  1.00 8.54  ? 37   ARG B HD3  2  
ATOM 5836  H HE   . ARG B 2 37  ? 30.788  -12.160 -1.435  1.00 8.43  ? 37   ARG B HE   2  
ATOM 5837  H HH11 . ARG B 2 37  ? 29.607  -14.204 -4.046  1.00 9.63  ? 37   ARG B HH11 2  
ATOM 5838  H HH12 . ARG B 2 37  ? 28.568  -15.122 -3.091  1.00 10.58 ? 37   ARG B HH12 2  
ATOM 5839  H HH21 . ARG B 2 37  ? 29.490  -13.488 -0.045  1.00 9.90  ? 37   ARG B HH21 2  
ATOM 5840  H HH22 . ARG B 2 37  ? 28.581  -14.765 -0.690  1.00 10.71 ? 37   ARG B HH22 2  
ATOM 5841  N N    . ARG B 2 38  ? 33.895  -7.704  -2.976  1.00 4.85  ? 38   ARG B N    2  
ATOM 5842  C CA   . ARG B 2 38  ? 33.549  -6.532  -2.160  1.00 4.66  ? 38   ARG B CA   2  
ATOM 5843  C C    . ARG B 2 38  ? 32.828  -5.498  -3.016  1.00 4.10  ? 38   ARG B C    2  
ATOM 5844  O O    . ARG B 2 38  ? 33.405  -4.943  -3.941  1.00 3.96  ? 38   ARG B O    2  
ATOM 5845  C CB   . ARG B 2 38  ? 34.816  -5.893  -1.582  1.00 5.06  ? 38   ARG B CB   2  
ATOM 5846  C CG   . ARG B 2 38  ? 34.547  -4.651  -0.748  1.00 5.56  ? 38   ARG B CG   2  
ATOM 5847  C CD   . ARG B 2 38  ? 35.830  -4.047  -0.229  1.00 6.01  ? 38   ARG B CD   2  
ATOM 5848  N NE   . ARG B 2 38  ? 35.586  -2.836  0.547   1.00 6.54  ? 38   ARG B NE   2  
ATOM 5849  C CZ   . ARG B 2 38  ? 36.457  -1.834  0.698   1.00 7.27  ? 38   ARG B CZ   2  
ATOM 5850  N NH1  . ARG B 2 38  ? 37.632  -1.864  0.072   1.00 7.58  ? 38   ARG B NH1  2  
ATOM 5851  N NH2  . ARG B 2 38  ? 36.139  -0.789  1.451   1.00 7.94  ? 38   ARG B NH2  2  
ATOM 5852  H H    . ARG B 2 38  ? 34.809  -8.054  -2.930  1.00 4.85  ? 38   ARG B H    2  
ATOM 5853  H HA   . ARG B 2 38  ? 32.911  -6.855  -1.349  1.00 5.01  ? 38   ARG B HA   2  
ATOM 5854  H HB2  . ARG B 2 38  ? 35.348  -6.607  -0.972  1.00 5.29  ? 38   ARG B HB2  2  
ATOM 5855  H HB3  . ARG B 2 38  ? 35.452  -5.607  -2.408  1.00 5.11  ? 38   ARG B HB3  2  
ATOM 5856  H HG2  . ARG B 2 38  ? 34.033  -3.925  -1.360  1.00 5.80  ? 38   ARG B HG2  2  
ATOM 5857  H HG3  . ARG B 2 38  ? 33.919  -4.923  0.088   1.00 5.77  ? 38   ARG B HG3  2  
ATOM 5858  H HD2  . ARG B 2 38  ? 36.330  -4.770  0.398   1.00 6.10  ? 38   ARG B HD2  2  
ATOM 5859  H HD3  . ARG B 2 38  ? 36.469  -3.801  -1.064  1.00 6.21  ? 38   ARG B HD3  2  
ATOM 5860  H HE   . ARG B 2 38  ? 34.697  -2.798  0.986   1.00 6.55  ? 38   ARG B HE   2  
ATOM 5861  H HH11 . ARG B 2 38  ? 37.884  -2.628  -0.528  1.00 7.31  ? 38   ARG B HH11 2  
ATOM 5862  H HH12 . ARG B 2 38  ? 38.313  -1.130  0.187   1.00 8.27  ? 38   ARG B HH12 2  
ATOM 5863  H HH21 . ARG B 2 38  ? 35.254  -0.718  1.927   1.00 7.97  ? 38   ARG B HH21 2  
ATOM 5864  H HH22 . ARG B 2 38  ? 36.759  -0.008  1.566   1.00 8.60  ? 38   ARG B HH22 2  
ATOM 5865  N N    . SER B 2 39  ? 31.566  -5.305  -2.758  1.00 4.23  ? 39   SER B N    2  
ATOM 5866  C CA   . SER B 2 39  ? 30.768  -4.383  -3.495  1.00 4.13  ? 39   SER B CA   2  
ATOM 5867  C C    . SER B 2 39  ? 29.607  -3.924  -2.649  1.00 3.72  ? 39   SER B C    2  
ATOM 5868  O O    . SER B 2 39  ? 28.621  -4.654  -2.462  1.00 4.10  ? 39   SER B O    2  
ATOM 5869  C CB   . SER B 2 39  ? 30.254  -5.011  -4.810  1.00 5.02  ? 39   SER B CB   2  
ATOM 5870  O OG   . SER B 2 39  ? 31.336  -5.360  -5.684  1.00 5.76  ? 39   SER B OG   2  
ATOM 5871  H H    . SER B 2 39  ? 31.131  -5.793  -2.029  1.00 4.67  ? 39   SER B H    2  
ATOM 5872  H HA   . SER B 2 39  ? 31.383  -3.530  -3.739  1.00 4.08  ? 39   SER B HA   2  
ATOM 5873  H HB2  . SER B 2 39  ? 29.692  -5.906  -4.584  1.00 5.31  ? 39   SER B HB2  2  
ATOM 5874  H HB3  . SER B 2 39  ? 29.612  -4.305  -5.315  1.00 5.15  ? 39   SER B HB3  2  
ATOM 5875  H HG   . SER B 2 39  ? 32.149  -5.334  -5.154  1.00 5.79  ? 39   SER B HG   2  
ATOM 5876  N N    . ARG B 2 40  ? 29.763  -2.783  -2.058  1.00 3.23  ? 40   ARG B N    2  
ATOM 5877  C CA   . ARG B 2 40  ? 28.670  -2.153  -1.371  1.00 2.98  ? 40   ARG B CA   2  
ATOM 5878  C C    . ARG B 2 40  ? 27.897  -1.365  -2.387  1.00 2.50  ? 40   ARG B C    2  
ATOM 5879  O O    . ARG B 2 40  ? 28.486  -0.864  -3.350  1.00 2.57  ? 40   ARG B O    2  
ATOM 5880  C CB   . ARG B 2 40  ? 29.152  -1.309  -0.148  1.00 3.36  ? 40   ARG B CB   2  
ATOM 5881  C CG   . ARG B 2 40  ? 30.338  -0.360  -0.384  1.00 3.83  ? 40   ARG B CG   2  
ATOM 5882  C CD   . ARG B 2 40  ? 29.969  1.096   -0.738  1.00 4.14  ? 40   ARG B CD   2  
ATOM 5883  N NE   . ARG B 2 40  ? 29.454  1.265   -2.096  1.00 4.69  ? 40   ARG B NE   2  
ATOM 5884  C CZ   . ARG B 2 40  ? 29.073  2.422   -2.637  1.00 5.27  ? 40   ARG B CZ   2  
ATOM 5885  N NH1  . ARG B 2 40  ? 29.204  3.556   -1.960  1.00 5.33  ? 40   ARG B NH1  2  
ATOM 5886  N NH2  . ARG B 2 40  ? 28.605  2.448   -3.875  1.00 6.03  ? 40   ARG B NH2  2  
ATOM 5887  H H    . ARG B 2 40  ? 30.644  -2.344  -2.117  1.00 3.27  ? 40   ARG B H    2  
ATOM 5888  H HA   . ARG B 2 40  ? 28.028  -2.954  -1.031  1.00 3.20  ? 40   ARG B HA   2  
ATOM 5889  H HB2  . ARG B 2 40  ? 28.329  -0.713  0.215   1.00 3.35  ? 40   ARG B HB2  2  
ATOM 5890  H HB3  . ARG B 2 40  ? 29.431  -2.001  0.633   1.00 3.80  ? 40   ARG B HB3  2  
ATOM 5891  H HG2  . ARG B 2 40  ? 31.002  -0.373  0.468   1.00 4.27  ? 40   ARG B HG2  2  
ATOM 5892  H HG3  . ARG B 2 40  ? 30.829  -0.802  -1.237  1.00 3.96  ? 40   ARG B HG3  2  
ATOM 5893  H HD2  . ARG B 2 40  ? 29.220  1.452   -0.047  1.00 4.23  ? 40   ARG B HD2  2  
ATOM 5894  H HD3  . ARG B 2 40  ? 30.852  1.709   -0.627  1.00 4.31  ? 40   ARG B HD3  2  
ATOM 5895  H HE   . ARG B 2 40  ? 29.383  0.445   -2.642  1.00 4.83  ? 40   ARG B HE   2  
ATOM 5896  H HH11 . ARG B 2 40  ? 29.591  3.597   -1.029  1.00 5.05  ? 40   ARG B HH11 2  
ATOM 5897  H HH12 . ARG B 2 40  ? 28.931  4.448   -2.339  1.00 5.86  ? 40   ARG B HH12 2  
ATOM 5898  H HH21 . ARG B 2 40  ? 28.534  1.624   -4.447  1.00 6.25  ? 40   ARG B HH21 2  
ATOM 5899  H HH22 . ARG B 2 40  ? 28.272  3.305   -4.278  1.00 6.57  ? 40   ARG B HH22 2  
ATOM 5900  N N    . GLY B 2 41  ? 26.628  -1.296  -2.240  1.00 2.37  ? 41   GLY B N    2  
ATOM 5901  C CA   . GLY B 2 41  ? 25.851  -0.593  -3.192  1.00 2.23  ? 41   GLY B CA   2  
ATOM 5902  C C    . GLY B 2 41  ? 24.609  -0.057  -2.592  1.00 2.11  ? 41   GLY B C    2  
ATOM 5903  O O    . GLY B 2 41  ? 24.252  -0.443  -1.486  1.00 2.30  ? 41   GLY B O    2  
ATOM 5904  H H    . GLY B 2 41  ? 26.167  -1.727  -1.486  1.00 2.62  ? 41   GLY B H    2  
ATOM 5905  H HA2  . GLY B 2 41  ? 26.450  0.218   -3.578  1.00 2.38  ? 41   GLY B HA2  2  
ATOM 5906  H HA3  . GLY B 2 41  ? 25.599  -1.264  -3.999  1.00 2.42  ? 41   GLY B HA3  2  
ATOM 5907  N N    . ILE B 2 42  ? 24.001  0.888   -3.299  1.00 2.07  ? 42   ILE B N    2  
ATOM 5908  C CA   . ILE B 2 42  ? 22.734  1.580   -3.011  1.00 1.96  ? 42   ILE B CA   2  
ATOM 5909  C C    . ILE B 2 42  ? 22.743  2.433   -1.757  1.00 1.97  ? 42   ILE B C    2  
ATOM 5910  O O    . ILE B 2 42  ? 22.104  3.464   -1.737  1.00 1.99  ? 42   ILE B O    2  
ATOM 5911  C CB   . ILE B 2 42  ? 21.454  0.705   -3.075  1.00 1.84  ? 42   ILE B CB   2  
ATOM 5912  C CG1  . ILE B 2 42  ? 21.300  -0.176  -1.842  1.00 1.79  ? 42   ILE B CG1  2  
ATOM 5913  C CG2  . ILE B 2 42  ? 21.508  -0.145  -4.326  1.00 1.88  ? 42   ILE B CG2  2  
ATOM 5914  C CD1  . ILE B 2 42  ? 19.953  -0.850  -1.742  1.00 1.67  ? 42   ILE B CD1  2  
ATOM 5915  H H    . ILE B 2 42  ? 24.455  1.206   -4.115  1.00 2.28  ? 42   ILE B H    2  
ATOM 5916  H HA   . ILE B 2 42  ? 22.667  2.301   -3.815  1.00 2.03  ? 42   ILE B HA   2  
ATOM 5917  H HB   . ILE B 2 42  ? 20.603  1.367   -3.160  1.00 1.82  ? 42   ILE B HB   2  
ATOM 5918  H HG12 . ILE B 2 42  ? 22.056  -0.944  -1.925  1.00 1.87  ? 42   ILE B HG12 2  
ATOM 5919  H HG13 . ILE B 2 42  ? 21.493  0.405   -0.951  1.00 1.81  ? 42   ILE B HG13 2  
ATOM 5920  H HG21 . ILE B 2 42  ? 21.603  0.507   -5.182  1.00 2.21  ? 42   ILE B HG21 2  
ATOM 5921  H HG22 . ILE B 2 42  ? 20.608  -0.725  -4.438  1.00 2.12  ? 42   ILE B HG22 2  
ATOM 5922  H HG23 . ILE B 2 42  ? 22.370  -0.795  -4.289  1.00 2.04  ? 42   ILE B HG23 2  
ATOM 5923  H HD11 . ILE B 2 42  ? 19.174  -0.135  -1.966  1.00 1.95  ? 42   ILE B HD11 2  
ATOM 5924  H HD12 . ILE B 2 42  ? 19.810  -1.205  -0.731  1.00 1.92  ? 42   ILE B HD12 2  
ATOM 5925  H HD13 . ILE B 2 42  ? 19.912  -1.678  -2.428  1.00 1.92  ? 42   ILE B HD13 2  
ATOM 5926  N N    . VAL B 2 43  ? 23.474  2.009   -0.736  1.00 1.99  ? 43   VAL B N    2  
ATOM 5927  C CA   . VAL B 2 43  ? 23.590  2.716   0.519   1.00 2.04  ? 43   VAL B CA   2  
ATOM 5928  C C    . VAL B 2 43  ? 23.888  4.203   0.338   1.00 2.11  ? 43   VAL B C    2  
ATOM 5929  O O    . VAL B 2 43  ? 23.200  5.065   0.906   1.00 2.13  ? 43   VAL B O    2  
ATOM 5930  C CB   . VAL B 2 43  ? 24.612  2.019   1.508   1.00 2.13  ? 43   VAL B CB   2  
ATOM 5931  C CG1  . VAL B 2 43  ? 25.933  1.667   0.845   1.00 2.24  ? 43   VAL B CG1  2  
ATOM 5932  C CG2  . VAL B 2 43  ? 24.881  2.897   2.714   1.00 2.24  ? 43   VAL B CG2  2  
ATOM 5933  H H    . VAL B 2 43  ? 23.929  1.143   -0.837  1.00 1.99  ? 43   VAL B H    2  
ATOM 5934  H HA   . VAL B 2 43  ? 22.618  2.638   0.969   1.00 2.00  ? 43   VAL B HA   2  
ATOM 5935  H HB   . VAL B 2 43  ? 24.162  1.103   1.863   1.00 2.07  ? 43   VAL B HB   2  
ATOM 5936  H HG11 . VAL B 2 43  ? 26.469  2.568   0.591   1.00 2.47  ? 43   VAL B HG11 2  
ATOM 5937  H HG12 . VAL B 2 43  ? 25.738  1.081   -0.040  1.00 2.57  ? 43   VAL B HG12 2  
ATOM 5938  H HG13 . VAL B 2 43  ? 26.521  1.080   1.534   1.00 2.43  ? 43   VAL B HG13 2  
ATOM 5939  H HG21 . VAL B 2 43  ? 23.949  3.122   3.208   1.00 2.51  ? 43   VAL B HG21 2  
ATOM 5940  H HG22 . VAL B 2 43  ? 25.356  3.808   2.373   1.00 2.37  ? 43   VAL B HG22 2  
ATOM 5941  H HG23 . VAL B 2 43  ? 25.543  2.376   3.387   1.00 2.60  ? 43   VAL B HG23 2  
ATOM 5942  N N    . GLU B 2 44  ? 24.799  4.490   -0.543  1.00 2.18  ? 44   GLU B N    2  
ATOM 5943  C CA   . GLU B 2 44  ? 25.284  5.808   -0.714  1.00 2.27  ? 44   GLU B CA   2  
ATOM 5944  C C    . GLU B 2 44  ? 24.548  6.477   -1.881  1.00 2.24  ? 44   GLU B C    2  
ATOM 5945  O O    . GLU B 2 44  ? 24.182  7.653   -1.803  1.00 2.28  ? 44   GLU B O    2  
ATOM 5946  C CB   . GLU B 2 44  ? 26.784  5.714   -0.916  1.00 2.40  ? 44   GLU B CB   2  
ATOM 5947  C CG   . GLU B 2 44  ? 27.540  6.963   -0.641  1.00 2.54  ? 44   GLU B CG   2  
ATOM 5948  C CD   . GLU B 2 44  ? 29.027  6.738   -0.755  1.00 2.88  ? 44   GLU B CD   2  
ATOM 5949  O OE1  . GLU B 2 44  ? 29.514  6.409   -1.847  1.00 3.04  ? 44   GLU B OE1  2  
ATOM 5950  O OE2  . GLU B 2 44  ? 29.729  6.810   0.267   1.00 3.36  ? 44   GLU B OE2  2  
ATOM 5951  H H    . GLU B 2 44  ? 25.126  3.789   -1.146  1.00 2.18  ? 44   GLU B H    2  
ATOM 5952  H HA   . GLU B 2 44  ? 25.075  6.411   0.157   1.00 2.30  ? 44   GLU B HA   2  
ATOM 5953  H HB2  . GLU B 2 44  ? 27.201  4.937   -0.294  1.00 2.43  ? 44   GLU B HB2  2  
ATOM 5954  H HB3  . GLU B 2 44  ? 26.964  5.444   -1.947  1.00 2.40  ? 44   GLU B HB3  2  
ATOM 5955  H HG2  . GLU B 2 44  ? 27.179  7.689   -1.342  1.00 2.65  ? 44   GLU B HG2  2  
ATOM 5956  H HG3  . GLU B 2 44  ? 27.309  7.311   0.355   1.00 2.59  ? 44   GLU B HG3  2  
ATOM 5957  N N    . GLU B 2 45  ? 24.285  5.701   -2.924  1.00 2.18  ? 45   GLU B N    2  
ATOM 5958  C CA   . GLU B 2 45  ? 23.560  6.168   -4.094  1.00 2.16  ? 45   GLU B CA   2  
ATOM 5959  C C    . GLU B 2 45  ? 22.151  6.609   -3.715  1.00 2.11  ? 45   GLU B C    2  
ATOM 5960  O O    . GLU B 2 45  ? 21.738  7.681   -4.050  1.00 2.25  ? 45   GLU B O    2  
ATOM 5961  C CB   . GLU B 2 45  ? 23.479  5.093   -5.207  1.00 2.15  ? 45   GLU B CB   2  
ATOM 5962  C CG   . GLU B 2 45  ? 24.818  4.521   -5.682  1.00 2.38  ? 45   GLU B CG   2  
ATOM 5963  C CD   . GLU B 2 45  ? 25.349  3.406   -4.802  1.00 2.65  ? 45   GLU B CD   2  
ATOM 5964  O OE1  . GLU B 2 45  ? 25.763  3.672   -3.651  1.00 3.08  ? 45   GLU B OE1  2  
ATOM 5965  O OE2  . GLU B 2 45  ? 25.331  2.241   -5.242  1.00 3.03  ? 45   GLU B OE2  2  
ATOM 5966  H H    . GLU B 2 45  ? 24.642  4.784   -2.942  1.00 2.17  ? 45   GLU B H    2  
ATOM 5967  H HA   . GLU B 2 45  ? 24.092  7.026   -4.480  1.00 2.24  ? 45   GLU B HA   2  
ATOM 5968  H HB2  . GLU B 2 45  ? 22.885  4.268   -4.843  1.00 2.30  ? 45   GLU B HB2  2  
ATOM 5969  H HB3  . GLU B 2 45  ? 22.975  5.525   -6.059  1.00 2.35  ? 45   GLU B HB3  2  
ATOM 5970  H HG2  . GLU B 2 45  ? 24.693  4.132   -6.682  1.00 2.66  ? 45   GLU B HG2  2  
ATOM 5971  H HG3  . GLU B 2 45  ? 25.542  5.322   -5.703  1.00 2.86  ? 45   GLU B HG3  2  
ATOM 5972  N N    . CYS B 2 46  ? 21.461  5.796   -2.954  1.00 1.99  ? 46   CYS B N    2  
ATOM 5973  C CA   . CYS B 2 46  ? 20.082  6.088   -2.554  1.00 1.96  ? 46   CYS B CA   2  
ATOM 5974  C C    . CYS B 2 46  ? 20.077  7.122   -1.416  1.00 2.04  ? 46   CYS B C    2  
ATOM 5975  O O    . CYS B 2 46  ? 19.065  7.772   -1.148  1.00 2.10  ? 46   CYS B O    2  
ATOM 5976  C CB   . CYS B 2 46  ? 19.385  4.766   -2.149  1.00 1.87  ? 46   CYS B CB   2  
ATOM 5977  S SG   . CYS B 2 46  ? 17.608  4.838   -1.721  1.00 2.23  ? 46   CYS B SG   2  
ATOM 5978  H H    . CYS B 2 46  ? 21.871  4.964   -2.625  1.00 1.97  ? 46   CYS B H    2  
ATOM 5979  H HA   . CYS B 2 46  ? 19.569  6.516   -3.403  1.00 1.98  ? 46   CYS B HA   2  
ATOM 5980  H HB2  . CYS B 2 46  ? 19.472  4.072   -2.971  1.00 2.07  ? 46   CYS B HB2  2  
ATOM 5981  H HB3  . CYS B 2 46  ? 19.912  4.353   -1.301  1.00 2.01  ? 46   CYS B HB3  2  
ATOM 5982  N N    . CYS B 2 47  ? 21.233  7.305   -0.783  1.00 2.09  ? 47   CYS B N    2  
ATOM 5983  C CA   . CYS B 2 47  ? 21.350  8.285   0.271   1.00 2.19  ? 47   CYS B CA   2  
ATOM 5984  C C    . CYS B 2 47  ? 21.512  9.700   -0.312  1.00 2.27  ? 47   CYS B C    2  
ATOM 5985  O O    . CYS B 2 47  ? 20.814  10.641  0.100   1.00 2.37  ? 47   CYS B O    2  
ATOM 5986  C CB   . CYS B 2 47  ? 22.526  7.944   1.191   1.00 2.25  ? 47   CYS B CB   2  
ATOM 5987  S SG   . CYS B 2 47  ? 22.743  9.048   2.625   1.00 2.37  ? 47   CYS B SG   2  
ATOM 5988  H H    . CYS B 2 47  ? 22.008  6.766   -1.043  1.00 2.10  ? 47   CYS B H    2  
ATOM 5989  H HA   . CYS B 2 47  ? 20.438  8.254   0.847   1.00 2.17  ? 47   CYS B HA   2  
ATOM 5990  H HB2  . CYS B 2 47  ? 22.389  6.944   1.577   1.00 2.29  ? 47   CYS B HB2  2  
ATOM 5991  H HB3  . CYS B 2 47  ? 23.437  7.971   0.612   1.00 2.48  ? 47   CYS B HB3  2  
ATOM 5992  N N    . PHE B 2 48  ? 22.410  9.853   -1.273  1.00 2.29  ? 48   PHE B N    2  
ATOM 5993  C CA   . PHE B 2 48  ? 22.696  11.170  -1.836  1.00 2.39  ? 48   PHE B CA   2  
ATOM 5994  C C    . PHE B 2 48  ? 21.967  11.447  -3.153  1.00 2.37  ? 48   PHE B C    2  
ATOM 5995  O O    . PHE B 2 48  ? 21.724  12.604  -3.503  1.00 2.47  ? 48   PHE B O    2  
ATOM 5996  C CB   . PHE B 2 48  ? 24.197  11.384  -1.992  1.00 2.48  ? 48   PHE B CB   2  
ATOM 5997  C CG   . PHE B 2 48  ? 24.942  11.543  -0.693  1.00 2.56  ? 48   PHE B CG   2  
ATOM 5998  C CD1  . PHE B 2 48  ? 25.113  12.800  -0.139  1.00 2.71  ? 48   PHE B CD1  2  
ATOM 5999  C CD2  . PHE B 2 48  ? 25.478  10.446  -0.032  1.00 2.54  ? 48   PHE B CD2  2  
ATOM 6000  C CE1  . PHE B 2 48  ? 25.797  12.967  1.046   1.00 2.82  ? 48   PHE B CE1  2  
ATOM 6001  C CE2  . PHE B 2 48  ? 26.168  10.608  1.158   1.00 2.64  ? 48   PHE B CE2  2  
ATOM 6002  C CZ   . PHE B 2 48  ? 26.326  11.871  1.696   1.00 2.78  ? 48   PHE B CZ   2  
ATOM 6003  H H    . PHE B 2 48  ? 22.901  9.072   -1.613  1.00 2.26  ? 48   PHE B H    2  
ATOM 6004  H HA   . PHE B 2 48  ? 22.335  11.889  -1.116  1.00 2.44  ? 48   PHE B HA   2  
ATOM 6005  H HB2  . PHE B 2 48  ? 24.621  10.529  -2.498  1.00 2.44  ? 48   PHE B HB2  2  
ATOM 6006  H HB3  . PHE B 2 48  ? 24.367  12.270  -2.586  1.00 2.57  ? 48   PHE B HB3  2  
ATOM 6007  H HD1  . PHE B 2 48  ? 24.700  13.660  -0.646  1.00 2.77  ? 48   PHE B HD1  2  
ATOM 6008  H HD2  . PHE B 2 48  ? 25.354  9.459   -0.453  1.00 2.47  ? 48   PHE B HD2  2  
ATOM 6009  H HE1  . PHE B 2 48  ? 25.920  13.955  1.465   1.00 2.97  ? 48   PHE B HE1  2  
ATOM 6010  H HE2  . PHE B 2 48  ? 26.583  9.756   1.673   1.00 2.64  ? 48   PHE B HE2  2  
ATOM 6011  H HZ   . PHE B 2 48  ? 26.863  12.002  2.624   1.00 2.88  ? 48   PHE B HZ   2  
ATOM 6012  N N    . ARG B 2 49  ? 21.631  10.421  -3.876  1.00 2.29  ? 49   ARG B N    2  
ATOM 6013  C CA   . ARG B 2 49  ? 20.917  10.576  -5.143  1.00 2.28  ? 49   ARG B CA   2  
ATOM 6014  C C    . ARG B 2 49  ? 19.504  10.056  -4.961  1.00 2.15  ? 49   ARG B C    2  
ATOM 6015  O O    . ARG B 2 49  ? 19.140  9.607   -3.873  1.00 2.17  ? 49   ARG B O    2  
ATOM 6016  C CB   . ARG B 2 49  ? 21.600  9.782   -6.283  1.00 2.32  ? 49   ARG B CB   2  
ATOM 6017  C CG   . ARG B 2 49  ? 23.052  10.134  -6.556  1.00 2.59  ? 49   ARG B CG   2  
ATOM 6018  C CD   . ARG B 2 49  ? 23.212  11.581  -6.977  1.00 2.43  ? 49   ARG B CD   2  
ATOM 6019  N NE   . ARG B 2 49  ? 24.560  11.851  -7.473  1.00 2.85  ? 49   ARG B NE   2  
ATOM 6020  C CZ   . ARG B 2 49  ? 25.112  13.060  -7.630  1.00 3.35  ? 49   ARG B CZ   2  
ATOM 6021  N NH1  . ARG B 2 49  ? 24.522  14.153  -7.131  1.00 3.64  ? 49   ARG B NH1  2  
ATOM 6022  N NH2  . ARG B 2 49  ? 26.278  13.167  -8.261  1.00 4.09  ? 49   ARG B NH2  2  
ATOM 6023  H H    . ARG B 2 49  ? 21.817  9.510   -3.554  1.00 2.26  ? 49   ARG B H    2  
ATOM 6024  H HA   . ARG B 2 49  ? 20.887  11.626  -5.397  1.00 2.37  ? 49   ARG B HA   2  
ATOM 6025  H HB2  . ARG B 2 49  ? 21.532  8.717   -6.112  1.00 2.30  ? 49   ARG B HB2  2  
ATOM 6026  H HB3  . ARG B 2 49  ? 21.045  9.993   -7.186  1.00 2.41  ? 49   ARG B HB3  2  
ATOM 6027  H HG2  . ARG B 2 49  ? 23.628  9.969   -5.659  1.00 3.15  ? 49   ARG B HG2  2  
ATOM 6028  H HG3  . ARG B 2 49  ? 23.422  9.494   -7.343  1.00 2.91  ? 49   ARG B HG3  2  
ATOM 6029  H HD2  . ARG B 2 49  ? 22.499  11.799  -7.759  1.00 2.60  ? 49   ARG B HD2  2  
ATOM 6030  H HD3  . ARG B 2 49  ? 23.019  12.218  -6.125  1.00 2.67  ? 49   ARG B HD3  2  
ATOM 6031  H HE   . ARG B 2 49  ? 25.042  11.036  -7.754  1.00 3.20  ? 49   ARG B HE   2  
ATOM 6032  H HH11 . ARG B 2 49  ? 23.651  14.118  -6.624  1.00 3.51  ? 49   ARG B HH11 2  
ATOM 6033  H HH12 . ARG B 2 49  ? 24.934  15.067  -7.236  1.00 4.32  ? 49   ARG B HH12 2  
ATOM 6034  H HH21 . ARG B 2 49  ? 26.745  12.350  -8.625  1.00 4.36  ? 49   ARG B HH21 2  
ATOM 6035  H HH22 . ARG B 2 49  ? 26.749  14.043  -8.415  1.00 4.65  ? 49   ARG B HH22 2  
ATOM 6036  N N    . SER B 2 50  ? 18.716  10.113  -6.003  1.00 2.09  ? 50   SER B N    2  
ATOM 6037  C CA   . SER B 2 50  ? 17.394  9.583   -5.940  1.00 2.02  ? 50   SER B CA   2  
ATOM 6038  C C    . SER B 2 50  ? 17.472  8.145   -6.442  1.00 1.87  ? 50   SER B C    2  
ATOM 6039  O O    . SER B 2 50  ? 18.123  7.863   -7.464  1.00 1.92  ? 50   SER B O    2  
ATOM 6040  C CB   . SER B 2 50  ? 16.419  10.435  -6.778  1.00 2.16  ? 50   SER B CB   2  
ATOM 6041  O OG   . SER B 2 50  ? 15.054  10.137  -6.460  1.00 2.67  ? 50   SER B OG   2  
ATOM 6042  H H    . SER B 2 50  ? 19.040  10.497  -6.849  1.00 2.12  ? 50   SER B H    2  
ATOM 6043  H HA   . SER B 2 50  ? 17.089  9.577   -4.903  1.00 2.02  ? 50   SER B HA   2  
ATOM 6044  H HB2  . SER B 2 50  ? 16.599  11.481  -6.582  1.00 2.49  ? 50   SER B HB2  2  
ATOM 6045  H HB3  . SER B 2 50  ? 16.581  10.234  -7.826  1.00 2.20  ? 50   SER B HB3  2  
ATOM 6046  H HG   . SER B 2 50  ? 14.955  10.376  -5.525  1.00 2.86  ? 50   SER B HG   2  
ATOM 6047  N N    . CYS B 2 51  ? 16.878  7.255   -5.720  1.00 1.76  ? 51   CYS B N    2  
ATOM 6048  C CA   . CYS B 2 51  ? 16.934  5.849   -6.002  1.00 1.65  ? 51   CYS B CA   2  
ATOM 6049  C C    . CYS B 2 51  ? 15.580  5.333   -6.450  1.00 1.53  ? 51   CYS B C    2  
ATOM 6050  O O    . CYS B 2 51  ? 14.546  5.733   -5.904  1.00 1.59  ? 51   CYS B O    2  
ATOM 6051  C CB   . CYS B 2 51  ? 17.419  5.144   -4.749  1.00 1.66  ? 51   CYS B CB   2  
ATOM 6052  S SG   . CYS B 2 51  ? 16.708  5.857   -3.225  1.00 2.11  ? 51   CYS B SG   2  
ATOM 6053  H H    . CYS B 2 51  ? 16.347  7.522   -4.941  1.00 1.79  ? 51   CYS B H    2  
ATOM 6054  H HA   . CYS B 2 51  ? 17.662  5.691   -6.784  1.00 1.70  ? 51   CYS B HA   2  
ATOM 6055  H HB2  . CYS B 2 51  ? 17.158  4.096   -4.788  1.00 1.78  ? 51   CYS B HB2  2  
ATOM 6056  H HB3  . CYS B 2 51  ? 18.490  5.255   -4.681  1.00 1.92  ? 51   CYS B HB3  2  
ATOM 6057  N N    . ASP B 2 52  ? 15.584  4.494   -7.468  1.00 1.44  ? 52   ASP B N    2  
ATOM 6058  C CA   . ASP B 2 52  ? 14.359  3.952   -8.021  1.00 1.35  ? 52   ASP B CA   2  
ATOM 6059  C C    . ASP B 2 52  ? 14.216  2.442   -7.766  1.00 1.17  ? 52   ASP B C    2  
ATOM 6060  O O    . ASP B 2 52  ? 15.130  1.809   -7.209  1.00 1.27  ? 52   ASP B O    2  
ATOM 6061  C CB   . ASP B 2 52  ? 14.293  4.202   -9.531  1.00 1.55  ? 52   ASP B CB   2  
ATOM 6062  C CG   . ASP B 2 52  ? 15.303  3.372   -10.307 1.00 1.89  ? 52   ASP B CG   2  
ATOM 6063  O OD1  . ASP B 2 52  ? 16.492  3.781   -10.412 1.00 2.16  ? 52   ASP B OD1  2  
ATOM 6064  O OD2  . ASP B 2 52  ? 14.924  2.312   -10.836 1.00 2.67  ? 52   ASP B OD2  2  
ATOM 6065  H H    . ASP B 2 52  ? 16.427  4.240   -7.894  1.00 1.49  ? 52   ASP B H    2  
ATOM 6066  H HA   . ASP B 2 52  ? 13.535  4.473   -7.559  1.00 1.38  ? 52   ASP B HA   2  
ATOM 6067  H HB2  . ASP B 2 52  ? 13.305  3.951   -9.887  1.00 1.93  ? 52   ASP B HB2  2  
ATOM 6068  H HB3  . ASP B 2 52  ? 14.486  5.246   -9.726  1.00 2.04  ? 52   ASP B HB3  2  
ATOM 6069  N N    . LEU B 2 53  ? 13.095  1.892   -8.205  1.00 0.99  ? 53   LEU B N    2  
ATOM 6070  C CA   . LEU B 2 53  ? 12.724  0.462   -8.044  1.00 0.92  ? 53   LEU B CA   2  
ATOM 6071  C C    . LEU B 2 53  ? 13.816  -0.512  -8.507  1.00 1.02  ? 53   LEU B C    2  
ATOM 6072  O O    . LEU B 2 53  ? 14.276  -1.370  -7.730  1.00 1.10  ? 53   LEU B O    2  
ATOM 6073  C CB   . LEU B 2 53  ? 11.450  0.172   -8.864  1.00 1.01  ? 53   LEU B CB   2  
ATOM 6074  C CG   . LEU B 2 53  ? 10.863  -1.234  -8.762  1.00 1.33  ? 53   LEU B CG   2  
ATOM 6075  C CD1  . LEU B 2 53  ? 10.391  -1.528  -7.346  1.00 1.72  ? 53   LEU B CD1  2  
ATOM 6076  C CD2  . LEU B 2 53  ? 9.732   -1.395  -9.764  1.00 1.90  ? 53   LEU B CD2  2  
ATOM 6077  H H    . LEU B 2 53  ? 12.469  2.504   -8.652  1.00 1.00  ? 53   LEU B H    2  
ATOM 6078  H HA   . LEU B 2 53  ? 12.492  0.280   -7.007  1.00 0.96  ? 53   LEU B HA   2  
ATOM 6079  H HB2  . LEU B 2 53  ? 10.681  0.870   -8.569  1.00 1.38  ? 53   LEU B HB2  2  
ATOM 6080  H HB3  . LEU B 2 53  ? 11.672  0.338   -9.909  1.00 1.54  ? 53   LEU B HB3  2  
ATOM 6081  H HG   . LEU B 2 53  ? 11.632  -1.950  -9.006  1.00 1.81  ? 53   LEU B HG   2  
ATOM 6082  H HD11 . LEU B 2 53  ? 9.959   -2.517  -7.303  1.00 2.24  ? 53   LEU B HD11 2  
ATOM 6083  H HD12 . LEU B 2 53  ? 9.653   -0.794  -7.053  1.00 2.15  ? 53   LEU B HD12 2  
ATOM 6084  H HD13 . LEU B 2 53  ? 11.234  -1.473  -6.672  1.00 2.04  ? 53   LEU B HD13 2  
ATOM 6085  H HD21 . LEU B 2 53  ? 9.323   -2.392  -9.693  1.00 2.34  ? 53   LEU B HD21 2  
ATOM 6086  H HD22 . LEU B 2 53  ? 10.105  -1.231  -10.765 1.00 2.36  ? 53   LEU B HD22 2  
ATOM 6087  H HD23 . LEU B 2 53  ? 8.954   -0.674  -9.556  1.00 2.26  ? 53   LEU B HD23 2  
ATOM 6088  N N    . ALA B 2 54  ? 14.254  -0.332  -9.742  1.00 1.12  ? 54   ALA B N    2  
ATOM 6089  C CA   . ALA B 2 54  ? 15.137  -1.266  -10.442 1.00 1.30  ? 54   ALA B CA   2  
ATOM 6090  C C    . ALA B 2 54  ? 16.414  -1.539  -9.676  1.00 1.38  ? 54   ALA B C    2  
ATOM 6091  O O    . ALA B 2 54  ? 16.881  -2.688  -9.579  1.00 1.52  ? 54   ALA B O    2  
ATOM 6092  C CB   . ALA B 2 54  ? 15.460  -0.701  -11.798 1.00 1.47  ? 54   ALA B CB   2  
ATOM 6093  H H    . ALA B 2 54  ? 14.008  0.498   -10.208 1.00 1.11  ? 54   ALA B H    2  
ATOM 6094  H HA   . ALA B 2 54  ? 14.604  -2.193  -10.591 1.00 1.33  ? 54   ALA B HA   2  
ATOM 6095  H HB1  . ALA B 2 54  ? 16.086  -1.390  -12.345 1.00 1.92  ? 54   ALA B HB1  2  
ATOM 6096  H HB2  . ALA B 2 54  ? 15.975  0.240   -11.656 1.00 1.78  ? 54   ALA B HB2  2  
ATOM 6097  H HB3  . ALA B 2 54  ? 14.541  -0.525  -12.338 1.00 1.73  ? 54   ALA B HB3  2  
ATOM 6098  N N    . LEU B 2 55  ? 16.947  -0.499  -9.114  1.00 1.36  ? 55   LEU B N    2  
ATOM 6099  C CA   . LEU B 2 55  ? 18.174  -0.563  -8.374  1.00 1.47  ? 55   LEU B CA   2  
ATOM 6100  C C    . LEU B 2 55  ? 18.049  -1.445  -7.140  1.00 1.43  ? 55   LEU B C    2  
ATOM 6101  O O    . LEU B 2 55  ? 18.899  -2.308  -6.885  1.00 1.52  ? 55   LEU B O    2  
ATOM 6102  C CB   . LEU B 2 55  ? 18.601  0.835   -7.978  1.00 1.53  ? 55   LEU B CB   2  
ATOM 6103  C CG   . LEU B 2 55  ? 19.831  0.920   -7.097  1.00 1.68  ? 55   LEU B CG   2  
ATOM 6104  C CD1  . LEU B 2 55  ? 21.042  0.335   -7.795  1.00 1.97  ? 55   LEU B CD1  2  
ATOM 6105  C CD2  . LEU B 2 55  ? 20.073  2.349   -6.640  1.00 1.78  ? 55   LEU B CD2  2  
ATOM 6106  H H    . LEU B 2 55  ? 16.470  0.352   -9.212  1.00 1.32  ? 55   LEU B H    2  
ATOM 6107  H HA   . LEU B 2 55  ? 18.934  -0.973  -9.022  1.00 1.57  ? 55   LEU B HA   2  
ATOM 6108  H HB2  . LEU B 2 55  ? 18.801  1.354   -8.903  1.00 1.68  ? 55   LEU B HB2  2  
ATOM 6109  H HB3  . LEU B 2 55  ? 17.779  1.304   -7.456  1.00 1.51  ? 55   LEU B HB3  2  
ATOM 6110  H HG   . LEU B 2 55  ? 19.649  0.314   -6.219  1.00 1.82  ? 55   LEU B HG   2  
ATOM 6111  H HD11 . LEU B 2 55  ? 21.891  0.399   -7.131  1.00 2.35  ? 55   LEU B HD11 2  
ATOM 6112  H HD12 . LEU B 2 55  ? 21.249  0.868   -8.712  1.00 2.27  ? 55   LEU B HD12 2  
ATOM 6113  H HD13 . LEU B 2 55  ? 20.831  -0.704  -8.010  1.00 2.29  ? 55   LEU B HD13 2  
ATOM 6114  H HD21 . LEU B 2 55  ? 20.937  2.381   -5.993  1.00 2.06  ? 55   LEU B HD21 2  
ATOM 6115  H HD22 . LEU B 2 55  ? 19.202  2.682   -6.097  1.00 2.14  ? 55   LEU B HD22 2  
ATOM 6116  H HD23 . LEU B 2 55  ? 20.234  2.991   -7.495  1.00 2.10  ? 55   LEU B HD23 2  
ATOM 6117  N N    . LEU B 2 56  ? 16.992  -1.268  -6.395  1.00 1.33  ? 56   LEU B N    2  
ATOM 6118  C CA   . LEU B 2 56  ? 16.849  -1.999  -5.198  1.00 1.34  ? 56   LEU B CA   2  
ATOM 6119  C C    . LEU B 2 56  ? 16.359  -3.400  -5.471  1.00 1.32  ? 56   LEU B C    2  
ATOM 6120  O O    . LEU B 2 56  ? 16.621  -4.315  -4.699  1.00 1.41  ? 56   LEU B O    2  
ATOM 6121  C CB   . LEU B 2 56  ? 15.997  -1.226  -4.200  1.00 1.27  ? 56   LEU B CB   2  
ATOM 6122  C CG   . LEU B 2 56  ? 14.518  -1.002  -4.525  1.00 1.16  ? 56   LEU B CG   2  
ATOM 6123  C CD1  . LEU B 2 56  ? 13.657  -2.071  -3.862  1.00 0.91  ? 56   LEU B CD1  2  
ATOM 6124  C CD2  . LEU B 2 56  ? 14.083  0.403   -4.117  1.00 1.53  ? 56   LEU B CD2  2  
ATOM 6125  H H    . LEU B 2 56  ? 16.277  -0.636  -6.620  1.00 1.27  ? 56   LEU B H    2  
ATOM 6126  H HA   . LEU B 2 56  ? 17.849  -2.080  -4.810  1.00 1.46  ? 56   LEU B HA   2  
ATOM 6127  H HB2  . LEU B 2 56  ? 16.052  -1.756  -3.268  1.00 1.31  ? 56   LEU B HB2  2  
ATOM 6128  H HB3  . LEU B 2 56  ? 16.464  -0.265  -4.075  1.00 1.34  ? 56   LEU B HB3  2  
ATOM 6129  H HG   . LEU B 2 56  ? 14.390  -1.102  -5.594  1.00 1.23  ? 56   LEU B HG   2  
ATOM 6130  H HD11 . LEU B 2 56  ? 13.952  -3.044  -4.224  1.00 1.35  ? 56   LEU B HD11 2  
ATOM 6131  H HD12 . LEU B 2 56  ? 12.613  -1.900  -4.081  1.00 1.35  ? 56   LEU B HD12 2  
ATOM 6132  H HD13 . LEU B 2 56  ? 13.823  -2.026  -2.794  1.00 1.31  ? 56   LEU B HD13 2  
ATOM 6133  H HD21 . LEU B 2 56  ? 14.198  0.524   -3.049  1.00 1.81  ? 56   LEU B HD21 2  
ATOM 6134  H HD22 . LEU B 2 56  ? 13.053  0.573   -4.397  1.00 2.01  ? 56   LEU B HD22 2  
ATOM 6135  H HD23 . LEU B 2 56  ? 14.714  1.119   -4.624  1.00 1.92  ? 56   LEU B HD23 2  
ATOM 6136  N N    . GLU B 2 57  ? 15.688  -3.570  -6.588  1.00 1.25  ? 57   GLU B N    2  
ATOM 6137  C CA   . GLU B 2 57  ? 15.197  -4.861  -6.975  1.00 1.30  ? 57   GLU B CA   2  
ATOM 6138  C C    . GLU B 2 57  ? 16.364  -5.786  -7.386  1.00 1.44  ? 57   GLU B C    2  
ATOM 6139  O O    . GLU B 2 57  ? 16.401  -6.966  -7.007  1.00 1.53  ? 57   GLU B O    2  
ATOM 6140  C CB   . GLU B 2 57  ? 14.184  -4.733  -8.111  1.00 1.32  ? 57   GLU B CB   2  
ATOM 6141  C CG   . GLU B 2 57  ? 13.477  -6.030  -8.460  1.00 1.50  ? 57   GLU B CG   2  
ATOM 6142  C CD   . GLU B 2 57  ? 12.500  -5.866  -9.587  1.00 1.67  ? 57   GLU B CD   2  
ATOM 6143  O OE1  . GLU B 2 57  ? 11.618  -4.988  -9.504  1.00 1.83  ? 57   GLU B OE1  2  
ATOM 6144  O OE2  . GLU B 2 57  ? 12.574  -6.630  -10.569 1.00 2.27  ? 57   GLU B OE2  2  
ATOM 6145  H H    . GLU B 2 57  ? 15.487  -2.779  -7.137  1.00 1.19  ? 57   GLU B H    2  
ATOM 6146  H HA   . GLU B 2 57  ? 14.701  -5.237  -6.095  1.00 1.30  ? 57   GLU B HA   2  
ATOM 6147  H HB2  . GLU B 2 57  ? 13.436  -4.008  -7.830  1.00 1.32  ? 57   GLU B HB2  2  
ATOM 6148  H HB3  . GLU B 2 57  ? 14.699  -4.382  -8.994  1.00 1.49  ? 57   GLU B HB3  2  
ATOM 6149  H HG2  . GLU B 2 57  ? 14.215  -6.764  -8.748  1.00 1.91  ? 57   GLU B HG2  2  
ATOM 6150  H HG3  . GLU B 2 57  ? 12.946  -6.380  -7.586  1.00 1.97  ? 57   GLU B HG3  2  
ATOM 6151  N N    . THR B 2 58  ? 17.303  -5.242  -8.161  1.00 1.51  ? 58   THR B N    2  
ATOM 6152  C CA   . THR B 2 58  ? 18.469  -5.994  -8.607  1.00 1.69  ? 58   THR B CA   2  
ATOM 6153  C C    . THR B 2 58  ? 19.358  -6.424  -7.428  1.00 1.77  ? 58   THR B C    2  
ATOM 6154  O O    . THR B 2 58  ? 19.812  -7.577  -7.372  1.00 1.92  ? 58   THR B O    2  
ATOM 6155  C CB   . THR B 2 58  ? 19.295  -5.199  -9.653  1.00 1.80  ? 58   THR B CB   2  
ATOM 6156  O OG1  . THR B 2 58  ? 19.551  -3.874  -9.167  1.00 2.33  ? 58   THR B OG1  2  
ATOM 6157  C CG2  . THR B 2 58  ? 18.567  -5.099  -10.984 1.00 1.73  ? 58   THR B CG2  2  
ATOM 6158  H H    . THR B 2 58  ? 17.203  -4.315  -8.471  1.00 1.46  ? 58   THR B H    2  
ATOM 6159  H HA   . THR B 2 58  ? 18.104  -6.898  -9.071  1.00 1.76  ? 58   THR B HA   2  
ATOM 6160  H HB   . THR B 2 58  ? 20.238  -5.705  -9.801  1.00 2.02  ? 58   THR B HB   2  
ATOM 6161  H HG1  . THR B 2 58  ? 18.806  -3.314  -9.429  1.00 2.67  ? 58   THR B HG1  2  
ATOM 6162  H HG21 . THR B 2 58  ? 19.163  -4.498  -11.655 1.00 2.01  ? 58   THR B HG21 2  
ATOM 6163  H HG22 . THR B 2 58  ? 17.614  -4.614  -10.835 1.00 2.05  ? 58   THR B HG22 2  
ATOM 6164  H HG23 . THR B 2 58  ? 18.418  -6.077  -11.417 1.00 2.06  ? 58   THR B HG23 2  
ATOM 6165  N N    . TYR B 2 59  ? 19.578  -5.517  -6.484  1.00 1.73  ? 59   TYR B N    2  
ATOM 6166  C CA   . TYR B 2 59  ? 20.381  -5.821  -5.306  1.00 1.88  ? 59   TYR B CA   2  
ATOM 6167  C C    . TYR B 2 59  ? 19.607  -6.731  -4.350  1.00 1.95  ? 59   TYR B C    2  
ATOM 6168  O O    . TYR B 2 59  ? 20.044  -7.856  -4.074  1.00 2.30  ? 59   TYR B O    2  
ATOM 6169  C CB   . TYR B 2 59  ? 20.864  -4.536  -4.587  1.00 1.88  ? 59   TYR B CB   2  
ATOM 6170  C CG   . TYR B 2 59  ? 22.262  -4.037  -4.998  1.00 2.06  ? 59   TYR B CG   2  
ATOM 6171  C CD1  . TYR B 2 59  ? 23.395  -4.529  -4.355  1.00 2.32  ? 59   TYR B CD1  2  
ATOM 6172  C CD2  . TYR B 2 59  ? 22.455  -3.075  -5.996  1.00 2.08  ? 59   TYR B CD2  2  
ATOM 6173  C CE1  . TYR B 2 59  ? 24.664  -4.087  -4.687  1.00 2.57  ? 59   TYR B CE1  2  
ATOM 6174  C CE2  . TYR B 2 59  ? 23.729  -2.632  -6.326  1.00 2.32  ? 59   TYR B CE2  2  
ATOM 6175  C CZ   . TYR B 2 59  ? 24.821  -3.138  -5.671  1.00 2.56  ? 59   TYR B CZ   2  
ATOM 6176  O OH   . TYR B 2 59  ? 26.088  -2.688  -6.002  1.00 2.86  ? 59   TYR B OH   2  
ATOM 6177  H H    . TYR B 2 59  ? 19.168  -4.633  -6.594  1.00 1.65  ? 59   TYR B H    2  
ATOM 6178  H HA   . TYR B 2 59  ? 21.242  -6.373  -5.653  1.00 1.98  ? 59   TYR B HA   2  
ATOM 6179  H HB2  . TYR B 2 59  ? 20.160  -3.745  -4.800  1.00 1.82  ? 59   TYR B HB2  2  
ATOM 6180  H HB3  . TYR B 2 59  ? 20.873  -4.711  -3.522  1.00 1.93  ? 59   TYR B HB3  2  
ATOM 6181  H HD1  . TYR B 2 59  ? 23.277  -5.275  -3.582  1.00 2.39  ? 59   TYR B HD1  2  
ATOM 6182  H HD2  . TYR B 2 59  ? 21.621  -2.649  -6.528  1.00 2.00  ? 59   TYR B HD2  2  
ATOM 6183  H HE1  . TYR B 2 59  ? 25.525  -4.487  -4.172  1.00 2.84  ? 59   TYR B HE1  2  
ATOM 6184  H HE2  . TYR B 2 59  ? 23.872  -1.894  -7.100  1.00 2.39  ? 59   TYR B HE2  2  
ATOM 6185  H HH   . TYR B 2 59  ? 26.082  -1.716  -6.022  1.00 3.20  ? 59   TYR B HH   2  
ATOM 6186  N N    . CYS B 2 60  ? 18.457  -6.248  -3.890  1.00 1.73  ? 60   CYS B N    2  
ATOM 6187  C CA   . CYS B 2 60  ? 17.544  -6.961  -2.975  1.00 1.77  ? 60   CYS B CA   2  
ATOM 6188  C C    . CYS B 2 60  ? 18.256  -7.627  -1.764  1.00 1.79  ? 60   CYS B C    2  
ATOM 6189  O O    . CYS B 2 60  ? 18.641  -6.953  -0.792  1.00 2.30  ? 60   CYS B O    2  
ATOM 6190  C CB   . CYS B 2 60  ? 16.609  -7.948  -3.755  1.00 1.99  ? 60   CYS B CB   2  
ATOM 6191  S SG   . CYS B 2 60  ? 15.497  -8.994  -2.736  1.00 2.21  ? 60   CYS B SG   2  
ATOM 6192  H H    . CYS B 2 60  ? 18.167  -5.358  -4.189  1.00 1.62  ? 60   CYS B H    2  
ATOM 6193  H HA   . CYS B 2 60  ? 16.921  -6.185  -2.552  1.00 1.97  ? 60   CYS B HA   2  
ATOM 6194  H HB2  . CYS B 2 60  ? 15.958  -7.403  -4.424  1.00 2.21  ? 60   CYS B HB2  2  
ATOM 6195  H HB3  . CYS B 2 60  ? 17.227  -8.612  -4.341  1.00 2.05  ? 60   CYS B HB3  2  
ATOM 6196  N N    . ALA B 2 61  ? 18.516  -8.906  -1.872  1.00 1.81  ? 61   ALA B N    2  
ATOM 6197  C CA   . ALA B 2 61  ? 19.091  -9.681  -0.820  1.00 2.03  ? 61   ALA B CA   2  
ATOM 6198  C C    . ALA B 2 61  ? 19.806  -10.844 -1.448  1.00 2.45  ? 61   ALA B C    2  
ATOM 6199  O O    . ALA B 2 61  ? 19.809  -10.973 -2.670  1.00 3.19  ? 61   ALA B O    2  
ATOM 6200  C CB   . ALA B 2 61  ? 17.991  -10.183 0.106   1.00 1.94  ? 61   ALA B CB   2  
ATOM 6201  H H    . ALA B 2 61  ? 18.336  -9.378  -2.711  1.00 2.06  ? 61   ALA B H    2  
ATOM 6202  H HA   . ALA B 2 61  ? 19.781  -9.070  -0.257  1.00 2.22  ? 61   ALA B HA   2  
ATOM 6203  H HB1  . ALA B 2 61  ? 17.509  -9.344  0.586   1.00 2.12  ? 61   ALA B HB1  2  
ATOM 6204  H HB2  . ALA B 2 61  ? 18.406  -10.850 0.848   1.00 2.13  ? 61   ALA B HB2  2  
ATOM 6205  H HB3  . ALA B 2 61  ? 17.261  -10.722 -0.479  1.00 2.27  ? 61   ALA B HB3  2  
ATOM 6206  N N    . THR B 2 62  ? 20.419  -11.647 -0.641  1.00 2.33  ? 62   THR B N    2  
ATOM 6207  C CA   . THR B 2 62  ? 21.108  -12.837 -1.053  1.00 2.79  ? 62   THR B CA   2  
ATOM 6208  C C    . THR B 2 62  ? 20.925  -13.876 0.034   1.00 3.01  ? 62   THR B C    2  
ATOM 6209  O O    . THR B 2 62  ? 20.659  -13.527 1.184   1.00 3.05  ? 62   THR B O    2  
ATOM 6210  C CB   . THR B 2 62  ? 22.625  -12.556 -1.243  1.00 3.14  ? 62   THR B CB   2  
ATOM 6211  O OG1  . THR B 2 62  ? 23.134  -11.768 -0.156  1.00 3.39  ? 62   THR B OG1  2  
ATOM 6212  C CG2  . THR B 2 62  ? 22.902  -11.864 -2.556  1.00 3.68  ? 62   THR B CG2  2  
ATOM 6213  H H    . THR B 2 62  ? 20.434  -11.482 0.324   1.00 2.17  ? 62   THR B H    2  
ATOM 6214  H HA   . THR B 2 62  ? 20.695  -13.219 -1.975  1.00 3.27  ? 62   THR B HA   2  
ATOM 6215  H HB   . THR B 2 62  ? 23.136  -13.507 -1.232  1.00 3.37  ? 62   THR B HB   2  
ATOM 6216  H HG1  . THR B 2 62  ? 24.020  -11.467 -0.382  1.00 3.74  ? 62   THR B HG1  2  
ATOM 6217  H HG21 . THR B 2 62  ? 23.962  -11.681 -2.653  1.00 4.14  ? 62   THR B HG21 2  
ATOM 6218  H HG22 . THR B 2 62  ? 22.368  -10.925 -2.584  1.00 3.96  ? 62   THR B HG22 2  
ATOM 6219  H HG23 . THR B 2 62  ? 22.569  -12.491 -3.370  1.00 3.81  ? 62   THR B HG23 2  
ATOM 6220  N N    . PRO B 2 63  ? 21.033  -15.176 -0.322  1.00 3.66  ? 63   PRO B N    2  
ATOM 6221  C CA   . PRO B 2 63  ? 20.930  -16.290 0.645   1.00 4.31  ? 63   PRO B CA   2  
ATOM 6222  C C    . PRO B 2 63  ? 22.175  -16.396 1.521   1.00 4.40  ? 63   PRO B C    2  
ATOM 6223  O O    . PRO B 2 63  ? 22.312  -17.315 2.333   1.00 5.06  ? 63   PRO B O    2  
ATOM 6224  C CB   . PRO B 2 63  ? 20.806  -17.517 -0.240  1.00 5.08  ? 63   PRO B CB   2  
ATOM 6225  C CG   . PRO B 2 63  ? 21.402  -17.132 -1.548  1.00 4.98  ? 63   PRO B CG   2  
ATOM 6226  C CD   . PRO B 2 63  ? 21.205  -15.661 -1.706  1.00 4.19  ? 63   PRO B CD   2  
ATOM 6227  H HA   . PRO B 2 63  ? 20.057  -16.189 1.272   1.00 4.51  ? 63   PRO B HA   2  
ATOM 6228  H HB2  . PRO B 2 63  ? 21.324  -18.350 0.211   1.00 5.47  ? 63   PRO B HB2  2  
ATOM 6229  H HB3  . PRO B 2 63  ? 19.759  -17.736 -0.340  1.00 5.54  ? 63   PRO B HB3  2  
ATOM 6230  H HG2  . PRO B 2 63  ? 22.462  -17.336 -1.544  1.00 5.10  ? 63   PRO B HG2  2  
ATOM 6231  H HG3  . PRO B 2 63  ? 20.915  -17.662 -2.352  1.00 5.59  ? 63   PRO B HG3  2  
ATOM 6232  H HD2  . PRO B 2 63  ? 22.109  -15.251 -2.126  1.00 4.15  ? 63   PRO B HD2  2  
ATOM 6233  H HD3  . PRO B 2 63  ? 20.362  -15.404 -2.333  1.00 4.36  ? 63   PRO B HD3  2  
ATOM 6234  N N    . ALA B 2 64  ? 23.098  -15.486 1.258   1.00 4.07  ? 64   ALA B N    2  
ATOM 6235  C CA   . ALA B 2 64  ? 24.337  -15.260 2.020   1.00 4.49  ? 64   ALA B CA   2  
ATOM 6236  C C    . ALA B 2 64  ? 25.382  -16.347 1.828   1.00 4.55  ? 64   ALA B C    2  
ATOM 6237  O O    . ALA B 2 64  ? 26.427  -16.330 2.467   1.00 4.94  ? 64   ALA B O    2  
ATOM 6238  C CB   . ALA B 2 64  ? 24.048  -15.021 3.498   1.00 5.10  ? 64   ALA B CB   2  
ATOM 6239  H H    . ALA B 2 64  ? 22.882  -14.935 0.477   1.00 3.80  ? 64   ALA B H    2  
ATOM 6240  H HA   . ALA B 2 64  ? 24.763  -14.349 1.624   1.00 4.81  ? 64   ALA B HA   2  
ATOM 6241  H HB1  . ALA B 2 64  ? 24.958  -14.722 3.997   1.00 5.36  ? 64   ALA B HB1  2  
ATOM 6242  H HB2  . ALA B 2 64  ? 23.674  -15.931 3.941   1.00 5.29  ? 64   ALA B HB2  2  
ATOM 6243  H HB3  . ALA B 2 64  ? 23.308  -14.241 3.597   1.00 5.51  ? 64   ALA B HB3  2  
ATOM 6244  N N    . LYS B 2 65  ? 25.109  -17.271 0.957   1.00 4.63  ? 65   LYS B N    2  
ATOM 6245  C CA   . LYS B 2 65  ? 26.029  -18.339 0.662   1.00 5.27  ? 65   LYS B CA   2  
ATOM 6246  C C    . LYS B 2 65  ? 25.914  -18.659 -0.810  1.00 5.65  ? 65   LYS B C    2  
ATOM 6247  O O    . LYS B 2 65  ? 25.922  -19.802 -1.251  1.00 5.93  ? 65   LYS B O    2  
ATOM 6248  C CB   . LYS B 2 65  ? 25.697  -19.526 1.558   1.00 5.85  ? 65   LYS B CB   2  
ATOM 6249  C CG   . LYS B 2 65  ? 26.634  -20.725 1.458   1.00 6.65  ? 65   LYS B CG   2  
ATOM 6250  C CD   . LYS B 2 65  ? 28.077  -20.366 1.744   1.00 7.41  ? 65   LYS B CD   2  
ATOM 6251  C CE   . LYS B 2 65  ? 28.982  -21.564 1.519   1.00 8.15  ? 65   LYS B CE   2  
ATOM 6252  N NZ   . LYS B 2 65  ? 28.904  -22.064 0.127   1.00 8.51  ? 65   LYS B NZ   2  
ATOM 6253  H H    . LYS B 2 65  ? 24.234  -17.262 0.520   1.00 4.56  ? 65   LYS B H    2  
ATOM 6254  H HA   . LYS B 2 65  ? 27.034  -17.994 0.861   1.00 5.51  ? 65   LYS B HA   2  
ATOM 6255  H HB2  . LYS B 2 65  ? 25.701  -19.117 2.552   1.00 5.88  ? 65   LYS B HB2  2  
ATOM 6256  H HB3  . LYS B 2 65  ? 24.688  -19.845 1.337   1.00 6.03  ? 65   LYS B HB3  2  
ATOM 6257  H HG2  . LYS B 2 65  ? 26.311  -21.470 2.171   1.00 6.88  ? 65   LYS B HG2  2  
ATOM 6258  H HG3  . LYS B 2 65  ? 26.558  -21.134 0.461   1.00 6.78  ? 65   LYS B HG3  2  
ATOM 6259  H HD2  . LYS B 2 65  ? 28.378  -19.565 1.083   1.00 7.54  ? 65   LYS B HD2  2  
ATOM 6260  H HD3  . LYS B 2 65  ? 28.165  -20.043 2.770   1.00 7.58  ? 65   LYS B HD3  2  
ATOM 6261  H HE2  . LYS B 2 65  ? 30.001  -21.269 1.723   1.00 8.50  ? 65   LYS B HE2  2  
ATOM 6262  H HE3  . LYS B 2 65  ? 28.701  -22.358 2.195   1.00 8.37  ? 65   LYS B HE3  2  
ATOM 6263  H HZ1  . LYS B 2 65  ? 29.535  -22.885 0.002   1.00 8.59  ? 65   LYS B HZ1  2  
ATOM 6264  H HZ2  . LYS B 2 65  ? 29.213  -21.357 -0.571  1.00 8.70  ? 65   LYS B HZ2  2  
ATOM 6265  H HZ3  . LYS B 2 65  ? 27.946  -22.385 -0.138  1.00 8.80  ? 65   LYS B HZ3  2  
ATOM 6266  N N    . SER B 2 66  ? 25.779  -17.630 -1.551  1.00 6.08  ? 66   SER B N    2  
ATOM 6267  C CA   . SER B 2 66  ? 25.646  -17.737 -2.971  1.00 6.85  ? 66   SER B CA   2  
ATOM 6268  C C    . SER B 2 66  ? 26.942  -17.298 -3.625  1.00 7.46  ? 66   SER B C    2  
ATOM 6269  O O    . SER B 2 66  ? 27.209  -16.097 -3.730  1.00 8.12  ? 66   SER B O    2  
ATOM 6270  C CB   . SER B 2 66  ? 24.458  -16.882 -3.454  1.00 7.35  ? 66   SER B CB   2  
ATOM 6271  O OG   . SER B 2 66  ? 24.196  -17.053 -4.836  1.00 7.52  ? 66   SER B OG   2  
ATOM 6272  H H    . SER B 2 66  ? 25.798  -16.761 -1.095  1.00 6.13  ? 66   SER B H    2  
ATOM 6273  H HA   . SER B 2 66  ? 25.457  -18.771 -3.216  1.00 6.99  ? 66   SER B HA   2  
ATOM 6274  H HB2  . SER B 2 66  ? 23.573  -17.161 -2.903  1.00 7.38  ? 66   SER B HB2  2  
ATOM 6275  H HB3  . SER B 2 66  ? 24.677  -15.840 -3.265  1.00 7.87  ? 66   SER B HB3  2  
ATOM 6276  H HG   . SER B 2 66  ? 24.823  -16.504 -5.335  1.00 7.68  ? 66   SER B HG   2  
ATOM 6277  N N    . GLU B 2 67  ? 27.766  -18.259 -3.989  1.00 7.51  ? 67   GLU B N    2  
ATOM 6278  C CA   . GLU B 2 67  ? 28.996  -18.007 -4.697  1.00 8.31  ? 67   GLU B CA   2  
ATOM 6279  C C    . GLU B 2 67  ? 29.497  -19.321 -5.243  1.00 8.57  ? 67   GLU B C    2  
ATOM 6280  O O    . GLU B 2 67  ? 30.278  -20.009 -4.556  1.00 8.74  ? 67   GLU B O    2  
ATOM 6281  C CB   . GLU B 2 67  ? 30.053  -17.341 -3.799  1.00 8.74  ? 67   GLU B CB   2  
ATOM 6282  C CG   . GLU B 2 67  ? 31.297  -16.858 -4.544  1.00 9.47  ? 67   GLU B CG   2  
ATOM 6283  C CD   . GLU B 2 67  ? 30.973  -15.944 -5.719  1.00 9.82  ? 67   GLU B CD   2  
ATOM 6284  O OE1  . GLU B 2 67  ? 30.438  -14.824 -5.511  1.00 10.21 ? 67   GLU B OE1  2  
ATOM 6285  O OE2  . GLU B 2 67  ? 31.219  -16.346 -6.878  1.00 9.89  ? 67   GLU B OE2  2  
ATOM 6286  O OXT  . GLU B 2 67  ? 29.062  -19.697 -6.345  1.00 8.84  ? 67   GLU B OXT  2  
ATOM 6287  H H    . GLU B 2 67  ? 27.553  -19.200 -3.788  1.00 7.18  ? 67   GLU B H    2  
ATOM 6288  H HA   . GLU B 2 67  ? 28.764  -17.359 -5.530  1.00 8.70  ? 67   GLU B HA   2  
ATOM 6289  H HB2  . GLU B 2 67  ? 29.605  -16.490 -3.308  1.00 8.63  ? 67   GLU B HB2  2  
ATOM 6290  H HB3  . GLU B 2 67  ? 30.364  -18.053 -3.049  1.00 8.93  ? 67   GLU B HB3  2  
ATOM 6291  H HG2  . GLU B 2 67  ? 31.925  -16.317 -3.854  1.00 9.74  ? 67   GLU B HG2  2  
ATOM 6292  H HG3  . GLU B 2 67  ? 31.833  -17.720 -4.915  1.00 9.75  ? 67   GLU B HG3  2  
ATOM 6293  N N    . MET A 1 1   ? -31.399 13.425  -3.336  1.00 8.13  ? 1508 MET A N    3  
ATOM 6294  C CA   . MET A 1 1   ? -31.392 12.088  -2.755  1.00 7.50  ? 1508 MET A CA   3  
ATOM 6295  C C    . MET A 1 1   ? -30.103 11.890  -2.008  1.00 6.73  ? 1508 MET A C    3  
ATOM 6296  O O    . MET A 1 1   ? -29.144 12.617  -2.231  1.00 6.84  ? 1508 MET A O    3  
ATOM 6297  C CB   . MET A 1 1   ? -31.508 11.010  -3.836  1.00 7.83  ? 1508 MET A CB   3  
ATOM 6298  C CG   . MET A 1 1   ? -32.798 11.017  -4.625  1.00 8.25  ? 1508 MET A CG   3  
ATOM 6299  S SD   . MET A 1 1   ? -32.825 9.733   -5.900  1.00 8.94  ? 1508 MET A SD   3  
ATOM 6300  C CE   . MET A 1 1   ? -32.677 8.249   -4.897  1.00 9.34  ? 1508 MET A CE   3  
ATOM 6301  H H1   . MET A 1 1   ? -32.292 13.666  -3.818  1.00 8.35  ? 1508 MET A H1   3  
ATOM 6302  H H2   . MET A 1 1   ? -30.613 13.507  -4.017  1.00 8.44  ? 1508 MET A H2   3  
ATOM 6303  H H3   . MET A 1 1   ? -31.213 14.128  -2.588  1.00 8.31  ? 1508 MET A H3   3  
ATOM 6304  H HA   . MET A 1 1   ? -32.220 12.003  -2.067  1.00 7.66  ? 1508 MET A HA   3  
ATOM 6305  H HB2  . MET A 1 1   ? -30.695 11.140  -4.535  1.00 8.12  ? 1508 MET A HB2  3  
ATOM 6306  H HB3  . MET A 1 1   ? -31.402 10.044  -3.366  1.00 7.83  ? 1508 MET A HB3  3  
ATOM 6307  H HG2  . MET A 1 1   ? -33.623 10.853  -3.947  1.00 8.43  ? 1508 MET A HG2  3  
ATOM 6308  H HG3  . MET A 1 1   ? -32.910 11.980  -5.101  1.00 8.28  ? 1508 MET A HG3  3  
ATOM 6309  H HE1  . MET A 1 1   ? -31.753 8.283   -4.337  1.00 9.55  ? 1508 MET A HE1  3  
ATOM 6310  H HE2  . MET A 1 1   ? -32.677 7.379   -5.538  1.00 9.74  ? 1508 MET A HE2  3  
ATOM 6311  H HE3  . MET A 1 1   ? -33.510 8.191   -4.212  1.00 9.25  ? 1508 MET A HE3  3  
ATOM 6312  N N    . LYS A 1 2   ? -30.079 10.914  -1.131  1.00 6.29  ? 1509 LYS A N    3  
ATOM 6313  C CA   . LYS A 1 2   ? -28.919 10.613  -0.331  1.00 5.88  ? 1509 LYS A CA   3  
ATOM 6314  C C    . LYS A 1 2   ? -28.691 9.090   -0.336  1.00 5.23  ? 1509 LYS A C    3  
ATOM 6315  O O    . LYS A 1 2   ? -28.268 8.470   0.649   1.00 5.51  ? 1509 LYS A O    3  
ATOM 6316  C CB   . LYS A 1 2   ? -29.109 11.209  1.087   1.00 6.62  ? 1509 LYS A CB   3  
ATOM 6317  C CG   . LYS A 1 2   ? -27.940 11.030  2.052   1.00 7.06  ? 1509 LYS A CG   3  
ATOM 6318  C CD   . LYS A 1 2   ? -28.065 11.937  3.264   1.00 7.86  ? 1509 LYS A CD   3  
ATOM 6319  C CE   . LYS A 1 2   ? -27.939 13.405  2.862   1.00 8.52  ? 1509 LYS A CE   3  
ATOM 6320  N NZ   . LYS A 1 2   ? -26.617 13.705  2.258   1.00 9.04  ? 1509 LYS A NZ   3  
ATOM 6321  H H    . LYS A 1 2   ? -30.881 10.360  -0.977  1.00 6.49  ? 1509 LYS A H    3  
ATOM 6322  H HA   . LYS A 1 2   ? -28.072 11.083  -0.810  1.00 5.90  ? 1509 LYS A HA   3  
ATOM 6323  H HB2  . LYS A 1 2   ? -29.286 12.270  0.990   1.00 7.05  ? 1509 LYS A HB2  3  
ATOM 6324  H HB3  . LYS A 1 2   ? -29.985 10.758  1.530   1.00 6.74  ? 1509 LYS A HB3  3  
ATOM 6325  H HG2  . LYS A 1 2   ? -27.916 10.004  2.387   1.00 6.93  ? 1509 LYS A HG2  3  
ATOM 6326  H HG3  . LYS A 1 2   ? -27.022 11.261  1.531   1.00 7.28  ? 1509 LYS A HG3  3  
ATOM 6327  H HD2  . LYS A 1 2   ? -29.032 11.782  3.721   1.00 8.13  ? 1509 LYS A HD2  3  
ATOM 6328  H HD3  . LYS A 1 2   ? -27.285 11.697  3.970   1.00 8.01  ? 1509 LYS A HD3  3  
ATOM 6329  H HE2  . LYS A 1 2   ? -28.713 13.635  2.144   1.00 8.69  ? 1509 LYS A HE2  3  
ATOM 6330  H HE3  . LYS A 1 2   ? -28.074 14.018  3.742   1.00 8.71  ? 1509 LYS A HE3  3  
ATOM 6331  H HZ1  . LYS A 1 2   ? -25.868 13.547  2.964   1.00 9.17  ? 1509 LYS A HZ1  3  
ATOM 6332  H HZ2  . LYS A 1 2   ? -26.547 14.697  1.943   1.00 9.28  ? 1509 LYS A HZ2  3  
ATOM 6333  H HZ3  . LYS A 1 2   ? -26.401 13.090  1.441   1.00 9.32  ? 1509 LYS A HZ3  3  
ATOM 6334  N N    . SER A 1 3   ? -29.004 8.491   -1.457  1.00 4.76  ? 1510 SER A N    3  
ATOM 6335  C CA   . SER A 1 3   ? -28.770 7.093   -1.644  1.00 4.45  ? 1510 SER A CA   3  
ATOM 6336  C C    . SER A 1 3   ? -27.334 6.916   -2.123  1.00 3.64  ? 1510 SER A C    3  
ATOM 6337  O O    . SER A 1 3   ? -26.654 5.945   -1.787  1.00 3.88  ? 1510 SER A O    3  
ATOM 6338  C CB   . SER A 1 3   ? -29.782 6.529   -2.644  1.00 5.16  ? 1510 SER A CB   3  
ATOM 6339  O OG   . SER A 1 3   ? -31.110 6.778   -2.199  1.00 5.81  ? 1510 SER A OG   3  
ATOM 6340  H H    . SER A 1 3   ? -29.397 9.002   -2.197  1.00 4.93  ? 1510 SER A H    3  
ATOM 6341  H HA   . SER A 1 3   ? -28.884 6.604   -0.689  1.00 4.75  ? 1510 SER A HA   3  
ATOM 6342  H HB2  . SER A 1 3   ? -29.652 6.984   -3.614  1.00 5.40  ? 1510 SER A HB2  3  
ATOM 6343  H HB3  . SER A 1 3   ? -29.643 5.461   -2.724  1.00 5.37  ? 1510 SER A HB3  3  
ATOM 6344  H HG   . SER A 1 3   ? -31.083 6.766   -1.227  1.00 5.97  ? 1510 SER A HG   3  
ATOM 6345  N N    . ASN A 1 4   ? -26.894 7.875   -2.898  1.00 3.10  ? 1511 ASN A N    3  
ATOM 6346  C CA   . ASN A 1 4   ? -25.542 7.953   -3.367  1.00 2.64  ? 1511 ASN A CA   3  
ATOM 6347  C C    . ASN A 1 4   ? -24.938 9.234   -2.883  1.00 2.46  ? 1511 ASN A C    3  
ATOM 6348  O O    . ASN A 1 4   ? -25.266 10.303  -3.383  1.00 2.95  ? 1511 ASN A O    3  
ATOM 6349  C CB   . ASN A 1 4   ? -25.444 7.923   -4.910  1.00 2.88  ? 1511 ASN A CB   3  
ATOM 6350  C CG   . ASN A 1 4   ? -25.798 6.596   -5.542  1.00 2.85  ? 1511 ASN A CG   3  
ATOM 6351  O OD1  . ASN A 1 4   ? -25.631 5.553   -4.946  1.00 3.42  ? 1511 ASN A OD1  3  
ATOM 6352  N ND2  . ASN A 1 4   ? -26.231 6.625   -6.772  1.00 2.85  ? 1511 ASN A ND2  3  
ATOM 6353  H H    . ASN A 1 4   ? -27.528 8.574   -3.176  1.00 3.39  ? 1511 ASN A H    3  
ATOM 6354  H HA   . ASN A 1 4   ? -24.989 7.116   -2.965  1.00 2.86  ? 1511 ASN A HA   3  
ATOM 6355  H HB2  . ASN A 1 4   ? -26.119 8.665   -5.312  1.00 3.16  ? 1511 ASN A HB2  3  
ATOM 6356  H HB3  . ASN A 1 4   ? -24.435 8.184   -5.194  1.00 3.48  ? 1511 ASN A HB3  3  
ATOM 6357  H HD21 . ASN A 1 4   ? -26.292 7.510   -7.206  1.00 2.88  ? 1511 ASN A HD21 3  
ATOM 6358  H HD22 . ASN A 1 4   ? -26.468 5.789   -7.226  1.00 3.22  ? 1511 ASN A HD22 3  
ATOM 6359  N N    . GLU A 1 5   ? -24.113 9.153   -1.869  1.00 2.44  ? 1512 GLU A N    3  
ATOM 6360  C CA   . GLU A 1 5   ? -23.362 10.320  -1.431  1.00 2.69  ? 1512 GLU A CA   3  
ATOM 6361  C C    . GLU A 1 5   ? -22.211 10.521  -2.362  1.00 2.20  ? 1512 GLU A C    3  
ATOM 6362  O O    . GLU A 1 5   ? -21.724 11.639  -2.552  1.00 2.74  ? 1512 GLU A O    3  
ATOM 6363  C CB   . GLU A 1 5   ? -22.859 10.137  -0.023  1.00 3.65  ? 1512 GLU A CB   3  
ATOM 6364  C CG   . GLU A 1 5   ? -23.949 10.169  0.995   1.00 4.47  ? 1512 GLU A CG   3  
ATOM 6365  C CD   . GLU A 1 5   ? -24.531 11.541  1.160   1.00 5.30  ? 1512 GLU A CD   3  
ATOM 6366  O OE1  . GLU A 1 5   ? -25.461 11.913  0.432   1.00 5.61  ? 1512 GLU A OE1  3  
ATOM 6367  O OE2  . GLU A 1 5   ? -24.060 12.288  2.032   1.00 5.95  ? 1512 GLU A OE2  3  
ATOM 6368  H H    . GLU A 1 5   ? -24.022 8.300   -1.392  1.00 2.68  ? 1512 GLU A H    3  
ATOM 6369  H HA   . GLU A 1 5   ? -24.015 11.179  -1.477  1.00 3.17  ? 1512 GLU A HA   3  
ATOM 6370  H HB2  . GLU A 1 5   ? -22.353 9.185   0.049   1.00 3.77  ? 1512 GLU A HB2  3  
ATOM 6371  H HB3  . GLU A 1 5   ? -22.159 10.927  0.205   1.00 4.13  ? 1512 GLU A HB3  3  
ATOM 6372  H HG2  . GLU A 1 5   ? -24.721 9.496   0.651   1.00 4.63  ? 1512 GLU A HG2  3  
ATOM 6373  H HG3  . GLU A 1 5   ? -23.557 9.825   1.939   1.00 4.71  ? 1512 GLU A HG3  3  
ATOM 6374  N N    . HIS A 1 6   ? -21.765 9.389   -2.923  1.00 1.95  ? 1513 HIS A N    3  
ATOM 6375  C CA   . HIS A 1 6   ? -20.694 9.305   -3.932  1.00 2.20  ? 1513 HIS A CA   3  
ATOM 6376  C C    . HIS A 1 6   ? -19.326 9.539   -3.309  1.00 2.18  ? 1513 HIS A C    3  
ATOM 6377  O O    . HIS A 1 6   ? -18.419 8.749   -3.478  1.00 2.90  ? 1513 HIS A O    3  
ATOM 6378  C CB   . HIS A 1 6   ? -20.949 10.288  -5.101  1.00 3.02  ? 1513 HIS A CB   3  
ATOM 6379  C CG   . HIS A 1 6   ? -19.947 10.229  -6.219  1.00 3.77  ? 1513 HIS A CG   3  
ATOM 6380  N ND1  . HIS A 1 6   ? -18.969 11.176  -6.407  1.00 4.48  ? 1513 HIS A ND1  3  
ATOM 6381  C CD2  . HIS A 1 6   ? -19.829 9.365   -7.245  1.00 4.42  ? 1513 HIS A CD2  3  
ATOM 6382  C CE1  . HIS A 1 6   ? -18.305 10.897  -7.508  1.00 5.33  ? 1513 HIS A CE1  3  
ATOM 6383  N NE2  . HIS A 1 6   ? -18.808 9.803   -8.034  1.00 5.30  ? 1513 HIS A NE2  3  
ATOM 6384  H H    . HIS A 1 6   ? -22.196 8.569   -2.598  1.00 2.23  ? 1513 HIS A H    3  
ATOM 6385  H HA   . HIS A 1 6   ? -20.709 8.297   -4.320  1.00 2.69  ? 1513 HIS A HA   3  
ATOM 6386  H HB2  . HIS A 1 6   ? -21.918 10.076  -5.528  1.00 3.35  ? 1513 HIS A HB2  3  
ATOM 6387  H HB3  . HIS A 1 6   ? -20.955 11.293  -4.707  1.00 3.43  ? 1513 HIS A HB3  3  
ATOM 6388  H HD1  . HIS A 1 6   ? -18.760 11.932  -5.799  1.00 4.64  ? 1513 HIS A HD1  3  
ATOM 6389  H HD2  . HIS A 1 6   ? -20.435 8.486   -7.412  1.00 4.57  ? 1513 HIS A HD2  3  
ATOM 6390  H HE1  . HIS A 1 6   ? -17.482 11.471  -7.908  1.00 6.14  ? 1513 HIS A HE1  3  
ATOM 6391  H HE2  . HIS A 1 6   ? -18.875 9.676   -9.012  1.00 5.92  ? 1513 HIS A HE2  3  
ATOM 6392  N N    . ASP A 1 7   ? -19.200 10.601  -2.586  1.00 2.06  ? 1514 ASP A N    3  
ATOM 6393  C CA   . ASP A 1 7   ? -17.949 10.974  -1.976  1.00 2.48  ? 1514 ASP A CA   3  
ATOM 6394  C C    . ASP A 1 7   ? -17.956 10.643  -0.494  1.00 1.88  ? 1514 ASP A C    3  
ATOM 6395  O O    . ASP A 1 7   ? -17.339 11.330  0.333   1.00 2.21  ? 1514 ASP A O    3  
ATOM 6396  C CB   . ASP A 1 7   ? -17.626 12.451  -2.252  1.00 3.42  ? 1514 ASP A CB   3  
ATOM 6397  C CG   . ASP A 1 7   ? -17.304 12.711  -3.716  1.00 4.29  ? 1514 ASP A CG   3  
ATOM 6398  O OD1  . ASP A 1 7   ? -18.240 12.937  -4.507  1.00 4.55  ? 1514 ASP A OD1  3  
ATOM 6399  O OD2  . ASP A 1 7   ? -16.104 12.706  -4.106  1.00 5.06  ? 1514 ASP A OD2  3  
ATOM 6400  H H    . ASP A 1 7   ? -19.991 11.168  -2.438  1.00 2.23  ? 1514 ASP A H    3  
ATOM 6401  H HA   . ASP A 1 7   ? -17.189 10.362  -2.438  1.00 3.01  ? 1514 ASP A HA   3  
ATOM 6402  H HB2  . ASP A 1 7   ? -18.476 13.056  -1.978  1.00 3.71  ? 1514 ASP A HB2  3  
ATOM 6403  H HB3  . ASP A 1 7   ? -16.772 12.741  -1.657  1.00 3.65  ? 1514 ASP A HB3  3  
ATOM 6404  N N    . ASP A 1 8   ? -18.659 9.575   -0.178  1.00 1.41  ? 1515 ASP A N    3  
ATOM 6405  C CA   . ASP A 1 8   ? -18.734 9.009   1.146   1.00 1.15  ? 1515 ASP A CA   3  
ATOM 6406  C C    . ASP A 1 8   ? -18.929 7.532   0.905   1.00 1.08  ? 1515 ASP A C    3  
ATOM 6407  O O    . ASP A 1 8   ? -19.314 7.142   -0.209  1.00 1.97  ? 1515 ASP A O    3  
ATOM 6408  C CB   . ASP A 1 8   ? -19.927 9.563   1.957   1.00 1.48  ? 1515 ASP A CB   3  
ATOM 6409  C CG   . ASP A 1 8   ? -19.743 9.373   3.464   1.00 2.07  ? 1515 ASP A CG   3  
ATOM 6410  O OD1  . ASP A 1 8   ? -19.709 8.212   3.922   1.00 2.90  ? 1515 ASP A OD1  3  
ATOM 6411  O OD2  . ASP A 1 8   ? -19.622 10.360  4.213   1.00 2.33  ? 1515 ASP A OD2  3  
ATOM 6412  H H    . ASP A 1 8   ? -19.125 9.073   -0.879  1.00 1.68  ? 1515 ASP A H    3  
ATOM 6413  H HA   . ASP A 1 8   ? -17.797 9.179   1.656   1.00 1.40  ? 1515 ASP A HA   3  
ATOM 6414  H HB2  . ASP A 1 8   ? -20.041 10.619  1.764   1.00 1.83  ? 1515 ASP A HB2  3  
ATOM 6415  H HB3  . ASP A 1 8   ? -20.839 9.058   1.671   1.00 1.85  ? 1515 ASP A HB3  3  
ATOM 6416  N N    . CYS A 1 9   ? -18.723 6.735   1.906   1.00 0.81  ? 1516 CYS A N    3  
ATOM 6417  C CA   . CYS A 1 9   ? -18.753 5.284   1.793   1.00 0.69  ? 1516 CYS A CA   3  
ATOM 6418  C C    . CYS A 1 9   ? -20.166 4.738   1.791   1.00 0.61  ? 1516 CYS A C    3  
ATOM 6419  O O    . CYS A 1 9   ? -20.537 3.927   2.661   1.00 0.65  ? 1516 CYS A O    3  
ATOM 6420  C CB   . CYS A 1 9   ? -17.992 4.657   2.937   1.00 0.80  ? 1516 CYS A CB   3  
ATOM 6421  S SG   . CYS A 1 9   ? -16.237 5.051   2.993   1.00 1.19  ? 1516 CYS A SG   3  
ATOM 6422  H H    . CYS A 1 9   ? -18.591 7.144   2.790   1.00 1.41  ? 1516 CYS A H    3  
ATOM 6423  H HA   . CYS A 1 9   ? -18.264 5.005   0.872   1.00 0.82  ? 1516 CYS A HA   3  
ATOM 6424  H HB2  . CYS A 1 9   ? -18.425 4.994   3.866   1.00 1.27  ? 1516 CYS A HB2  3  
ATOM 6425  H HB3  . CYS A 1 9   ? -18.090 3.582   2.874   1.00 1.18  ? 1516 CYS A HB3  3  
ATOM 6426  N N    . GLN A 1 10  ? -20.942 5.148   0.822   1.00 0.58  ? 1517 GLN A N    3  
ATOM 6427  C CA   . GLN A 1 10  ? -22.301 4.706   0.709   1.00 0.58  ? 1517 GLN A CA   3  
ATOM 6428  C C    . GLN A 1 10  ? -22.856 5.008   -0.672  1.00 0.60  ? 1517 GLN A C    3  
ATOM 6429  O O    . GLN A 1 10  ? -22.776 6.154   -1.171  1.00 0.73  ? 1517 GLN A O    3  
ATOM 6430  C CB   . GLN A 1 10  ? -23.190 5.310   1.828   1.00 0.65  ? 1517 GLN A CB   3  
ATOM 6431  C CG   . GLN A 1 10  ? -23.135 6.829   1.935   1.00 0.74  ? 1517 GLN A CG   3  
ATOM 6432  C CD   . GLN A 1 10  ? -24.029 7.372   3.005   1.00 0.90  ? 1517 GLN A CD   3  
ATOM 6433  O OE1  . GLN A 1 10  ? -23.620 7.533   4.156   1.00 1.44  ? 1517 GLN A OE1  3  
ATOM 6434  N NE2  . GLN A 1 10  ? -25.237 7.671   2.652   1.00 1.52  ? 1517 GLN A NE2  3  
ATOM 6435  H H    . GLN A 1 10  ? -20.567 5.751   0.137   1.00 0.61  ? 1517 GLN A H    3  
ATOM 6436  H HA   . GLN A 1 10  ? -22.272 3.633   0.831   1.00 0.58  ? 1517 GLN A HA   3  
ATOM 6437  H HB2  . GLN A 1 10  ? -24.219 5.038   1.647   1.00 0.72  ? 1517 GLN A HB2  3  
ATOM 6438  H HB3  . GLN A 1 10  ? -22.886 4.899   2.779   1.00 0.64  ? 1517 GLN A HB3  3  
ATOM 6439  H HG2  . GLN A 1 10  ? -22.137 7.140   2.207   1.00 0.71  ? 1517 GLN A HG2  3  
ATOM 6440  H HG3  . GLN A 1 10  ? -23.418 7.267   0.990   1.00 0.82  ? 1517 GLN A HG3  3  
ATOM 6441  H HE21 . GLN A 1 10  ? -25.513 7.533   1.719   1.00 2.18  ? 1517 GLN A HE21 3  
ATOM 6442  H HE22 . GLN A 1 10  ? -25.836 8.042   3.343   1.00 1.63  ? 1517 GLN A HE22 3  
ATOM 6443  N N    . VAL A 1 11  ? -23.424 3.991   -1.268  1.00 0.51  ? 1518 VAL A N    3  
ATOM 6444  C CA   . VAL A 1 11  ? -24.009 4.039   -2.578  1.00 0.53  ? 1518 VAL A CA   3  
ATOM 6445  C C    . VAL A 1 11  ? -25.177 3.066   -2.655  1.00 0.54  ? 1518 VAL A C    3  
ATOM 6446  O O    . VAL A 1 11  ? -25.156 2.001   -2.026  1.00 0.51  ? 1518 VAL A O    3  
ATOM 6447  C CB   . VAL A 1 11  ? -22.985 3.699   -3.726  1.00 0.51  ? 1518 VAL A CB   3  
ATOM 6448  C CG1  . VAL A 1 11  ? -22.080 4.870   -4.056  1.00 0.94  ? 1518 VAL A CG1  3  
ATOM 6449  C CG2  . VAL A 1 11  ? -22.132 2.483   -3.380  1.00 0.84  ? 1518 VAL A CG2  3  
ATOM 6450  H H    . VAL A 1 11  ? -23.479 3.121   -0.820  1.00 0.47  ? 1518 VAL A H    3  
ATOM 6451  H HA   . VAL A 1 11  ? -24.382 5.041   -2.736  1.00 0.60  ? 1518 VAL A HA   3  
ATOM 6452  H HB   . VAL A 1 11  ? -23.556 3.456   -4.605  1.00 0.93  ? 1518 VAL A HB   3  
ATOM 6453  H HG11 . VAL A 1 11  ? -22.689 5.702   -4.375  1.00 1.47  ? 1518 VAL A HG11 3  
ATOM 6454  H HG12 . VAL A 1 11  ? -21.415 4.582   -4.857  1.00 1.51  ? 1518 VAL A HG12 3  
ATOM 6455  H HG13 . VAL A 1 11  ? -21.506 5.144   -3.183  1.00 1.48  ? 1518 VAL A HG13 3  
ATOM 6456  H HG21 . VAL A 1 11  ? -22.745 1.604   -3.247  1.00 1.37  ? 1518 VAL A HG21 3  
ATOM 6457  H HG22 . VAL A 1 11  ? -21.549 2.673   -2.486  1.00 1.33  ? 1518 VAL A HG22 3  
ATOM 6458  H HG23 . VAL A 1 11  ? -21.428 2.318   -4.185  1.00 1.52  ? 1518 VAL A HG23 3  
ATOM 6459  N N    . THR A 1 12  ? -26.191 3.449   -3.365  1.00 0.64  ? 1519 THR A N    3  
ATOM 6460  C CA   . THR A 1 12  ? -27.313 2.611   -3.619  1.00 0.69  ? 1519 THR A CA   3  
ATOM 6461  C C    . THR A 1 12  ? -27.347 2.306   -5.092  1.00 0.78  ? 1519 THR A C    3  
ATOM 6462  O O    . THR A 1 12  ? -27.390 3.221   -5.918  1.00 0.89  ? 1519 THR A O    3  
ATOM 6463  C CB   . THR A 1 12  ? -28.635 3.298   -3.243  1.00 0.79  ? 1519 THR A CB   3  
ATOM 6464  O OG1  . THR A 1 12  ? -28.609 3.678   -1.866  1.00 0.78  ? 1519 THR A OG1  3  
ATOM 6465  C CG2  . THR A 1 12  ? -29.813 2.367   -3.497  1.00 0.85  ? 1519 THR A CG2  3  
ATOM 6466  H H    . THR A 1 12  ? -26.185 4.349   -3.766  1.00 0.72  ? 1519 THR A H    3  
ATOM 6467  H HA   . THR A 1 12  ? -27.213 1.697   -3.052  1.00 0.66  ? 1519 THR A HA   3  
ATOM 6468  H HB   . THR A 1 12  ? -28.751 4.182   -3.852  1.00 0.87  ? 1519 THR A HB   3  
ATOM 6469  H HG1  . THR A 1 12  ? -27.725 4.025   -1.690  1.00 1.09  ? 1519 THR A HG1  3  
ATOM 6470  H HG21 . THR A 1 12  ? -29.710 1.486   -2.879  1.00 1.36  ? 1519 THR A HG21 3  
ATOM 6471  H HG22 . THR A 1 12  ? -29.795 2.069   -4.536  1.00 1.35  ? 1519 THR A HG22 3  
ATOM 6472  H HG23 . THR A 1 12  ? -30.740 2.872   -3.272  1.00 1.30  ? 1519 THR A HG23 3  
ATOM 6473  N N    . ASN A 1 13  ? -27.296 1.057   -5.427  1.00 0.80  ? 1520 ASN A N    3  
ATOM 6474  C CA   . ASN A 1 13  ? -27.376 0.660   -6.808  1.00 0.95  ? 1520 ASN A CA   3  
ATOM 6475  C C    . ASN A 1 13  ? -28.819 0.668   -7.247  1.00 0.98  ? 1520 ASN A C    3  
ATOM 6476  O O    . ASN A 1 13  ? -29.628 -0.034  -6.675  1.00 0.96  ? 1520 ASN A O    3  
ATOM 6477  C CB   . ASN A 1 13  ? -26.780 -0.715  -6.997  1.00 1.09  ? 1520 ASN A CB   3  
ATOM 6478  C CG   . ASN A 1 13  ? -26.972 -1.228  -8.395  1.00 1.30  ? 1520 ASN A CG   3  
ATOM 6479  O OD1  . ASN A 1 13  ? -27.888 -1.988  -8.651  1.00 1.34  ? 1520 ASN A OD1  3  
ATOM 6480  N ND2  . ASN A 1 13  ? -26.205 -0.733  -9.310  1.00 1.74  ? 1520 ASN A ND2  3  
ATOM 6481  H H    . ASN A 1 13  ? -27.224 0.380   -4.722  1.00 0.78  ? 1520 ASN A H    3  
ATOM 6482  H HA   . ASN A 1 13  ? -26.821 1.374   -7.397  1.00 1.07  ? 1520 ASN A HA   3  
ATOM 6483  H HB2  . ASN A 1 13  ? -25.726 -0.717  -6.761  1.00 1.19  ? 1520 ASN A HB2  3  
ATOM 6484  H HB3  . ASN A 1 13  ? -27.315 -1.380  -6.337  1.00 1.10  ? 1520 ASN A HB3  3  
ATOM 6485  H HD21 . ASN A 1 13  ? -25.557 -0.036  -9.044  1.00 2.02  ? 1520 ASN A HD21 3  
ATOM 6486  H HD22 . ASN A 1 13  ? -26.275 -1.080  -10.230 1.00 1.91  ? 1520 ASN A HD22 3  
ATOM 6487  N N    . PRO A 1 14  ? -29.156 1.445   -8.281  1.00 1.13  ? 1521 PRO A N    3  
ATOM 6488  C CA   . PRO A 1 14  ? -30.542 1.614   -8.738  1.00 1.26  ? 1521 PRO A CA   3  
ATOM 6489  C C    . PRO A 1 14  ? -31.125 0.362   -9.393  1.00 1.30  ? 1521 PRO A C    3  
ATOM 6490  O O    . PRO A 1 14  ? -32.340 0.215   -9.472  1.00 1.40  ? 1521 PRO A O    3  
ATOM 6491  C CB   . PRO A 1 14  ? -30.459 2.758   -9.757  1.00 1.47  ? 1521 PRO A CB   3  
ATOM 6492  C CG   . PRO A 1 14  ? -29.095 3.336   -9.592  1.00 1.58  ? 1521 PRO A CG   3  
ATOM 6493  C CD   . PRO A 1 14  ? -28.226 2.232   -9.095  1.00 1.30  ? 1521 PRO A CD   3  
ATOM 6494  H HA   . PRO A 1 14  ? -31.184 1.910   -7.922  1.00 1.25  ? 1521 PRO A HA   3  
ATOM 6495  H HB2  . PRO A 1 14  ? -30.612 2.370   -10.754 1.00 1.57  ? 1521 PRO A HB2  3  
ATOM 6496  H HB3  . PRO A 1 14  ? -31.223 3.489   -9.536  1.00 1.57  ? 1521 PRO A HB3  3  
ATOM 6497  H HG2  . PRO A 1 14  ? -28.730 3.688   -10.543 1.00 1.79  ? 1521 PRO A HG2  3  
ATOM 6498  H HG3  . PRO A 1 14  ? -29.129 4.136   -8.866  1.00 1.82  ? 1521 PRO A HG3  3  
ATOM 6499  H HD2  . PRO A 1 14  ? -27.830 1.652   -9.915  1.00 1.38  ? 1521 PRO A HD2  3  
ATOM 6500  H HD3  . PRO A 1 14  ? -27.424 2.625   -8.487  1.00 1.27  ? 1521 PRO A HD3  3  
ATOM 6501  N N    . SER A 1 15  ? -30.262 -0.540  -9.832  1.00 1.30  ? 1522 SER A N    3  
ATOM 6502  C CA   . SER A 1 15  ? -30.698 -1.758  -10.480 1.00 1.40  ? 1522 SER A CA   3  
ATOM 6503  C C    . SER A 1 15  ? -31.318 -2.726  -9.472  1.00 1.36  ? 1522 SER A C    3  
ATOM 6504  O O    . SER A 1 15  ? -32.232 -3.470  -9.798  1.00 1.46  ? 1522 SER A O    3  
ATOM 6505  C CB   . SER A 1 15  ? -29.513 -2.424  -11.178 1.00 1.53  ? 1522 SER A CB   3  
ATOM 6506  O OG   . SER A 1 15  ? -28.871 -1.527  -12.083 1.00 1.65  ? 1522 SER A OG   3  
ATOM 6507  H H    . SER A 1 15  ? -29.298 -0.388  -9.736  1.00 1.29  ? 1522 SER A H    3  
ATOM 6508  H HA   . SER A 1 15  ? -31.437 -1.503  -11.224 1.00 1.48  ? 1522 SER A HA   3  
ATOM 6509  H HB2  . SER A 1 15  ? -28.798 -2.712  -10.420 1.00 1.50  ? 1522 SER A HB2  3  
ATOM 6510  H HB3  . SER A 1 15  ? -29.840 -3.308  -11.703 1.00 1.62  ? 1522 SER A HB3  3  
ATOM 6511  H HG   . SER A 1 15  ? -29.471 -1.356  -12.827 1.00 1.89  ? 1522 SER A HG   3  
ATOM 6512  N N    . THR A 1 16  ? -30.833 -2.705  -8.251  1.00 1.29  ? 1523 THR A N    3  
ATOM 6513  C CA   . THR A 1 16  ? -31.339 -3.646  -7.265  1.00 1.35  ? 1523 THR A CA   3  
ATOM 6514  C C    . THR A 1 16  ? -31.858 -2.938  -6.000  1.00 1.25  ? 1523 THR A C    3  
ATOM 6515  O O    . THR A 1 16  ? -32.495 -3.544  -5.142  1.00 1.36  ? 1523 THR A O    3  
ATOM 6516  C CB   . THR A 1 16  ? -30.276 -4.764  -6.956  1.00 1.47  ? 1523 THR A CB   3  
ATOM 6517  O OG1  . THR A 1 16  ? -30.737 -5.719  -5.979  1.00 1.61  ? 1523 THR A OG1  3  
ATOM 6518  C CG2  . THR A 1 16  ? -28.953 -4.158  -6.510  1.00 1.42  ? 1523 THR A CG2  3  
ATOM 6519  H H    . THR A 1 16  ? -30.117 -2.063  -8.041  1.00 1.25  ? 1523 THR A H    3  
ATOM 6520  H HA   . THR A 1 16  ? -32.204 -4.114  -7.715  1.00 1.46  ? 1523 THR A HA   3  
ATOM 6521  H HB   . THR A 1 16  ? -30.099 -5.306  -7.871  1.00 1.57  ? 1523 THR A HB   3  
ATOM 6522  H HG1  . THR A 1 16  ? -31.658 -5.961  -6.189  1.00 1.99  ? 1523 THR A HG1  3  
ATOM 6523  H HG21 . THR A 1 16  ? -29.090 -3.631  -5.579  1.00 1.81  ? 1523 THR A HG21 3  
ATOM 6524  H HG22 . THR A 1 16  ? -28.629 -3.466  -7.276  1.00 1.69  ? 1523 THR A HG22 3  
ATOM 6525  H HG23 . THR A 1 16  ? -28.211 -4.933  -6.390  1.00 1.70  ? 1523 THR A HG23 3  
ATOM 6526  N N    . GLY A 1 17  ? -31.594 -1.646  -5.914  1.00 1.13  ? 1524 GLY A N    3  
ATOM 6527  C CA   . GLY A 1 17  ? -32.085 -0.831  -4.821  1.00 1.08  ? 1524 GLY A CA   3  
ATOM 6528  C C    . GLY A 1 17  ? -31.449 -1.158  -3.501  1.00 0.99  ? 1524 GLY A C    3  
ATOM 6529  O O    . GLY A 1 17  ? -32.099 -1.087  -2.468  1.00 1.06  ? 1524 GLY A O    3  
ATOM 6530  H H    . GLY A 1 17  ? -31.045 -1.204  -6.597  1.00 1.11  ? 1524 GLY A H    3  
ATOM 6531  H HA2  . GLY A 1 17  ? -31.874 0.209   -5.027  1.00 1.06  ? 1524 GLY A HA2  3  
ATOM 6532  H HA3  . GLY A 1 17  ? -33.153 -0.963  -4.736  1.00 1.19  ? 1524 GLY A HA3  3  
ATOM 6533  N N    . HIS A 1 18  ? -30.190 -1.528  -3.508  1.00 0.91  ? 1525 HIS A N    3  
ATOM 6534  C CA   . HIS A 1 18  ? -29.534 -1.827  -2.249  1.00 0.85  ? 1525 HIS A CA   3  
ATOM 6535  C C    . HIS A 1 18  ? -28.557 -0.740  -1.864  1.00 0.72  ? 1525 HIS A C    3  
ATOM 6536  O O    . HIS A 1 18  ? -27.631 -0.421  -2.620  1.00 0.68  ? 1525 HIS A O    3  
ATOM 6537  C CB   . HIS A 1 18  ? -28.851 -3.210  -2.232  1.00 0.90  ? 1525 HIS A CB   3  
ATOM 6538  C CG   . HIS A 1 18  ? -28.354 -3.613  -0.855  1.00 0.91  ? 1525 HIS A CG   3  
ATOM 6539  N ND1  . HIS A 1 18  ? -27.146 -4.234  -0.629  1.00 1.12  ? 1525 HIS A ND1  3  
ATOM 6540  C CD2  . HIS A 1 18  ? -28.930 -3.476  0.375   1.00 1.26  ? 1525 HIS A CD2  3  
ATOM 6541  C CE1  . HIS A 1 18  ? -27.003 -4.454  0.666   1.00 1.05  ? 1525 HIS A CE1  3  
ATOM 6542  N NE2  . HIS A 1 18  ? -28.063 -4.005  1.289   1.00 1.12  ? 1525 HIS A NE2  3  
ATOM 6543  H H    . HIS A 1 18  ? -29.725 -1.588  -4.368  1.00 0.93  ? 1525 HIS A H    3  
ATOM 6544  H HA   . HIS A 1 18  ? -30.316 -1.825  -1.503  1.00 0.91  ? 1525 HIS A HA   3  
ATOM 6545  H HB2  . HIS A 1 18  ? -29.557 -3.957  -2.563  1.00 1.03  ? 1525 HIS A HB2  3  
ATOM 6546  H HB3  . HIS A 1 18  ? -28.005 -3.194  -2.902  1.00 0.89  ? 1525 HIS A HB3  3  
ATOM 6547  H HD1  . HIS A 1 18  ? -26.478 -4.509  -1.293  1.00 1.59  ? 1525 HIS A HD1  3  
ATOM 6548  H HD2  . HIS A 1 18  ? -29.892 -3.031  0.586   1.00 1.82  ? 1525 HIS A HD2  3  
ATOM 6549  H HE1  . HIS A 1 18  ? -26.150 -4.922  1.133   1.00 1.33  ? 1525 HIS A HE1  3  
ATOM 6550  H HE2  . HIS A 1 18  ? -28.093 -3.850  2.267   1.00 1.40  ? 1525 HIS A HE2  3  
ATOM 6551  N N    . LEU A 1 19  ? -28.803 -0.174  -0.715  1.00 0.68  ? 1526 LEU A N    3  
ATOM 6552  C CA   . LEU A 1 19  ? -27.959 0.832   -0.111  1.00 0.60  ? 1526 LEU A CA   3  
ATOM 6553  C C    . LEU A 1 19  ? -26.802 0.132   0.615   1.00 0.54  ? 1526 LEU A C    3  
ATOM 6554  O O    . LEU A 1 19  ? -27.030 -0.684  1.520   1.00 0.57  ? 1526 LEU A O    3  
ATOM 6555  C CB   . LEU A 1 19  ? -28.835 1.694   0.868   1.00 0.66  ? 1526 LEU A CB   3  
ATOM 6556  C CG   . LEU A 1 19  ? -28.195 2.813   1.771   1.00 0.64  ? 1526 LEU A CG   3  
ATOM 6557  C CD1  . LEU A 1 19  ? -27.543 2.247   3.018   1.00 0.64  ? 1526 LEU A CD1  3  
ATOM 6558  C CD2  . LEU A 1 19  ? -27.199 3.685   1.032   1.00 0.64  ? 1526 LEU A CD2  3  
ATOM 6559  H H    . LEU A 1 19  ? -29.621 -0.448  -0.239  1.00 0.75  ? 1526 LEU A H    3  
ATOM 6560  H HA   . LEU A 1 19  ? -27.622 1.465   -0.919  1.00 0.58  ? 1526 LEU A HA   3  
ATOM 6561  H HB2  . LEU A 1 19  ? -29.597 2.169   0.267   1.00 0.71  ? 1526 LEU A HB2  3  
ATOM 6562  H HB3  . LEU A 1 19  ? -29.347 1.012   1.533   1.00 0.70  ? 1526 LEU A HB3  3  
ATOM 6563  H HG   . LEU A 1 19  ? -29.006 3.439   2.100   1.00 0.71  ? 1526 LEU A HG   3  
ATOM 6564  H HD11 . LEU A 1 19  ? -27.108 3.050   3.594   1.00 1.13  ? 1526 LEU A HD11 3  
ATOM 6565  H HD12 . LEU A 1 19  ? -26.774 1.552   2.720   1.00 1.25  ? 1526 LEU A HD12 3  
ATOM 6566  H HD13 . LEU A 1 19  ? -28.285 1.734   3.611   1.00 1.15  ? 1526 LEU A HD13 3  
ATOM 6567  H HD21 . LEU A 1 19  ? -27.036 4.574   1.624   1.00 1.12  ? 1526 LEU A HD21 3  
ATOM 6568  H HD22 . LEU A 1 19  ? -27.550 3.947   0.046   1.00 1.30  ? 1526 LEU A HD22 3  
ATOM 6569  H HD23 . LEU A 1 19  ? -26.263 3.149   0.991   1.00 1.16  ? 1526 LEU A HD23 3  
ATOM 6570  N N    . PHE A 1 20  ? -25.592 0.356   0.167   1.00 0.47  ? 1527 PHE A N    3  
ATOM 6571  C CA   . PHE A 1 20  ? -24.442 -0.157  0.858   1.00 0.45  ? 1527 PHE A CA   3  
ATOM 6572  C C    . PHE A 1 20  ? -23.862 0.893   1.768   1.00 0.44  ? 1527 PHE A C    3  
ATOM 6573  O O    . PHE A 1 20  ? -23.498 1.978   1.321   1.00 0.48  ? 1527 PHE A O    3  
ATOM 6574  C CB   . PHE A 1 20  ? -23.343 -0.646  -0.082  1.00 0.43  ? 1527 PHE A CB   3  
ATOM 6575  C CG   . PHE A 1 20  ? -23.716 -1.767  -0.998  1.00 0.45  ? 1527 PHE A CG   3  
ATOM 6576  C CD1  . PHE A 1 20  ? -23.702 -3.075  -0.555  1.00 0.59  ? 1527 PHE A CD1  3  
ATOM 6577  C CD2  . PHE A 1 20  ? -24.107 -1.508  -2.295  1.00 0.44  ? 1527 PHE A CD2  3  
ATOM 6578  C CE1  . PHE A 1 20  ? -24.067 -4.101  -1.397  1.00 0.65  ? 1527 PHE A CE1  3  
ATOM 6579  C CE2  . PHE A 1 20  ? -24.472 -2.533  -3.140  1.00 0.49  ? 1527 PHE A CE2  3  
ATOM 6580  C CZ   . PHE A 1 20  ? -24.366 -3.857  -2.698  1.00 0.58  ? 1527 PHE A CZ   3  
ATOM 6581  H H    . PHE A 1 20  ? -25.448 0.855   -0.667  1.00 0.47  ? 1527 PHE A H    3  
ATOM 6582  H HA   . PHE A 1 20  ? -24.788 -0.979  1.460   1.00 0.49  ? 1527 PHE A HA   3  
ATOM 6583  H HB2  . PHE A 1 20  ? -22.951 0.174   -0.663  1.00 0.42  ? 1527 PHE A HB2  3  
ATOM 6584  H HB3  . PHE A 1 20  ? -22.540 -0.998  0.547   1.00 0.48  ? 1527 PHE A HB3  3  
ATOM 6585  H HD1  . PHE A 1 20  ? -23.402 -3.290  0.460   1.00 0.70  ? 1527 PHE A HD1  3  
ATOM 6586  H HD2  . PHE A 1 20  ? -24.123 -0.488  -2.649  1.00 0.49  ? 1527 PHE A HD2  3  
ATOM 6587  H HE1  . PHE A 1 20  ? -24.060 -5.116  -1.037  1.00 0.80  ? 1527 PHE A HE1  3  
ATOM 6588  H HE2  . PHE A 1 20  ? -24.774 -2.317  -4.155  1.00 0.55  ? 1527 PHE A HE2  3  
ATOM 6589  H HZ   . PHE A 1 20  ? -24.626 -4.670  -3.362  1.00 0.66  ? 1527 PHE A HZ   3  
ATOM 6590  N N    . ASP A 1 21  ? -23.795 0.572   3.024   1.00 0.44  ? 1528 ASP A N    3  
ATOM 6591  C CA   . ASP A 1 21  ? -23.177 1.418   4.008   1.00 0.48  ? 1528 ASP A CA   3  
ATOM 6592  C C    . ASP A 1 21  ? -21.854 0.791   4.356   1.00 0.41  ? 1528 ASP A C    3  
ATOM 6593  O O    . ASP A 1 21  ? -21.807 -0.279  4.973   1.00 0.46  ? 1528 ASP A O    3  
ATOM 6594  C CB   . ASP A 1 21  ? -24.047 1.523   5.270   1.00 0.64  ? 1528 ASP A CB   3  
ATOM 6595  C CG   . ASP A 1 21  ? -23.455 2.446   6.323   1.00 0.81  ? 1528 ASP A CG   3  
ATOM 6596  O OD1  . ASP A 1 21  ? -22.491 2.072   7.000   1.00 0.81  ? 1528 ASP A OD1  3  
ATOM 6597  O OD2  . ASP A 1 21  ? -23.959 3.583   6.494   1.00 1.17  ? 1528 ASP A OD2  3  
ATOM 6598  H H    . ASP A 1 21  ? -24.176 -0.285  3.325   1.00 0.47  ? 1528 ASP A H    3  
ATOM 6599  H HA   . ASP A 1 21  ? -23.021 2.398   3.583   1.00 0.51  ? 1528 ASP A HA   3  
ATOM 6600  H HB2  . ASP A 1 21  ? -25.015 1.916   4.992   1.00 0.81  ? 1528 ASP A HB2  3  
ATOM 6601  H HB3  . ASP A 1 21  ? -24.151 0.534   5.698   1.00 0.70  ? 1528 ASP A HB3  3  
ATOM 6602  N N    . LEU A 1 22  ? -20.785 1.418   3.947   1.00 0.38  ? 1529 LEU A N    3  
ATOM 6603  C CA   . LEU A 1 22  ? -19.470 0.882   4.182   1.00 0.36  ? 1529 LEU A CA   3  
ATOM 6604  C C    . LEU A 1 22  ? -18.924 1.396   5.489   1.00 0.40  ? 1529 LEU A C    3  
ATOM 6605  O O    . LEU A 1 22  ? -17.871 0.967   5.953   1.00 0.41  ? 1529 LEU A O    3  
ATOM 6606  C CB   . LEU A 1 22  ? -18.514 1.192   3.023   1.00 0.39  ? 1529 LEU A CB   3  
ATOM 6607  C CG   . LEU A 1 22  ? -18.695 0.414   1.699   1.00 0.40  ? 1529 LEU A CG   3  
ATOM 6608  C CD1  . LEU A 1 22  ? -18.529 -1.075  1.901   1.00 0.52  ? 1529 LEU A CD1  3  
ATOM 6609  C CD2  . LEU A 1 22  ? -20.012 0.713   0.981   1.00 0.60  ? 1529 LEU A CD2  3  
ATOM 6610  H H    . LEU A 1 22  ? -20.850 2.283   3.480   1.00 0.42  ? 1529 LEU A H    3  
ATOM 6611  H HA   . LEU A 1 22  ? -19.578 -0.189  4.265   1.00 0.36  ? 1529 LEU A HA   3  
ATOM 6612  H HB2  . LEU A 1 22  ? -18.605 2.244   2.797   1.00 0.44  ? 1529 LEU A HB2  3  
ATOM 6613  H HB3  . LEU A 1 22  ? -17.509 1.017   3.377   1.00 0.42  ? 1529 LEU A HB3  3  
ATOM 6614  H HG   . LEU A 1 22  ? -17.889 0.753   1.070   1.00 0.70  ? 1529 LEU A HG   3  
ATOM 6615  H HD11 . LEU A 1 22  ? -17.535 -1.277  2.276   1.00 1.20  ? 1529 LEU A HD11 3  
ATOM 6616  H HD12 . LEU A 1 22  ? -18.670 -1.576  0.954   1.00 1.15  ? 1529 LEU A HD12 3  
ATOM 6617  H HD13 . LEU A 1 22  ? -19.262 -1.430  2.609   1.00 1.15  ? 1529 LEU A HD13 3  
ATOM 6618  H HD21 . LEU A 1 22  ? -20.855 0.386   1.569   1.00 1.29  ? 1529 LEU A HD21 3  
ATOM 6619  H HD22 . LEU A 1 22  ? -20.010 0.166   0.051   1.00 1.20  ? 1529 LEU A HD22 3  
ATOM 6620  H HD23 . LEU A 1 22  ? -20.089 1.767   0.758   1.00 1.18  ? 1529 LEU A HD23 3  
ATOM 6621  N N    . SER A 1 23  ? -19.683 2.265   6.120   1.00 0.48  ? 1530 SER A N    3  
ATOM 6622  C CA   . SER A 1 23  ? -19.292 2.816   7.409   1.00 0.57  ? 1530 SER A CA   3  
ATOM 6623  C C    . SER A 1 23  ? -19.448 1.745   8.496   1.00 0.56  ? 1530 SER A C    3  
ATOM 6624  O O    . SER A 1 23  ? -18.908 1.870   9.594   1.00 0.60  ? 1530 SER A O    3  
ATOM 6625  C CB   . SER A 1 23  ? -20.076 4.097   7.761   1.00 0.71  ? 1530 SER A CB   3  
ATOM 6626  O OG   . SER A 1 23  ? -20.005 5.049   6.689   1.00 0.84  ? 1530 SER A OG   3  
ATOM 6627  H H    . SER A 1 23  ? -20.534 2.498   5.693   1.00 0.52  ? 1530 SER A H    3  
ATOM 6628  H HA   . SER A 1 23  ? -18.238 3.046   7.334   1.00 0.59  ? 1530 SER A HA   3  
ATOM 6629  H HB2  . SER A 1 23  ? -21.102 3.913   8.048   1.00 0.72  ? 1530 SER A HB2  3  
ATOM 6630  H HB3  . SER A 1 23  ? -19.585 4.547   8.612   1.00 0.82  ? 1530 SER A HB3  3  
ATOM 6631  H HG   . SER A 1 23  ? -20.891 5.098   6.292   1.00 0.91  ? 1530 SER A HG   3  
ATOM 6632  N N    . SER A 1 24  ? -20.179 0.681   8.173   1.00 0.58  ? 1531 SER A N    3  
ATOM 6633  C CA   . SER A 1 24  ? -20.296 -0.473  9.043   1.00 0.65  ? 1531 SER A CA   3  
ATOM 6634  C C    . SER A 1 24  ? -18.923 -1.183  9.157   1.00 0.61  ? 1531 SER A C    3  
ATOM 6635  O O    . SER A 1 24  ? -18.658 -1.912  10.112  1.00 0.71  ? 1531 SER A O    3  
ATOM 6636  C CB   . SER A 1 24  ? -21.334 -1.430  8.466   1.00 0.73  ? 1531 SER A CB   3  
ATOM 6637  O OG   . SER A 1 24  ? -22.541 -0.745  8.169   1.00 1.59  ? 1531 SER A OG   3  
ATOM 6638  H H    . SER A 1 24  ? -20.704 0.695   7.341   1.00 0.60  ? 1531 SER A H    3  
ATOM 6639  H HA   . SER A 1 24  ? -20.617 -0.142  10.020  1.00 0.73  ? 1531 SER A HA   3  
ATOM 6640  H HB2  . SER A 1 24  ? -20.957 -1.878  7.558   1.00 1.24  ? 1531 SER A HB2  3  
ATOM 6641  H HB3  . SER A 1 24  ? -21.545 -2.204  9.190   1.00 1.07  ? 1531 SER A HB3  3  
ATOM 6642  H HG   . SER A 1 24  ? -22.556 0.092   8.654   1.00 1.98  ? 1531 SER A HG   3  
ATOM 6643  N N    . LEU A 1 25  ? -18.065 -0.960  8.170   1.00 0.54  ? 1532 LEU A N    3  
ATOM 6644  C CA   . LEU A 1 25  ? -16.724 -1.519  8.155   1.00 0.56  ? 1532 LEU A CA   3  
ATOM 6645  C C    . LEU A 1 25  ? -15.691 -0.486  8.567   1.00 0.57  ? 1532 LEU A C    3  
ATOM 6646  O O    . LEU A 1 25  ? -14.498 -0.775  8.568   1.00 0.61  ? 1532 LEU A O    3  
ATOM 6647  C CB   . LEU A 1 25  ? -16.401 -2.032  6.759   1.00 0.56  ? 1532 LEU A CB   3  
ATOM 6648  C CG   . LEU A 1 25  ? -17.281 -3.158  6.253   1.00 0.55  ? 1532 LEU A CG   3  
ATOM 6649  C CD1  . LEU A 1 25  ? -17.021 -3.397  4.784   1.00 0.57  ? 1532 LEU A CD1  3  
ATOM 6650  C CD2  . LEU A 1 25  ? -17.018 -4.430  7.044   1.00 0.65  ? 1532 LEU A CD2  3  
ATOM 6651  H H    . LEU A 1 25  ? -18.334 -0.422  7.393   1.00 0.54  ? 1532 LEU A H    3  
ATOM 6652  H HA   . LEU A 1 25  ? -16.679 -2.344  8.847   1.00 0.61  ? 1532 LEU A HA   3  
ATOM 6653  H HB2  . LEU A 1 25  ? -16.482 -1.204  6.069   1.00 0.55  ? 1532 LEU A HB2  3  
ATOM 6654  H HB3  . LEU A 1 25  ? -15.377 -2.378  6.755   1.00 0.62  ? 1532 LEU A HB3  3  
ATOM 6655  H HG   . LEU A 1 25  ? -18.311 -2.868  6.402   1.00 0.55  ? 1532 LEU A HG   3  
ATOM 6656  H HD11 . LEU A 1 25  ? -17.650 -4.199  4.425   1.00 1.19  ? 1532 LEU A HD11 3  
ATOM 6657  H HD12 . LEU A 1 25  ? -15.982 -3.654  4.646   1.00 1.08  ? 1532 LEU A HD12 3  
ATOM 6658  H HD13 . LEU A 1 25  ? -17.244 -2.490  4.241   1.00 1.24  ? 1532 LEU A HD13 3  
ATOM 6659  H HD21 . LEU A 1 25  ? -17.342 -4.297  8.066   1.00 1.34  ? 1532 LEU A HD21 3  
ATOM 6660  H HD22 . LEU A 1 25  ? -15.953 -4.618  7.039   1.00 1.14  ? 1532 LEU A HD22 3  
ATOM 6661  H HD23 . LEU A 1 25  ? -17.531 -5.267  6.596   1.00 1.16  ? 1532 LEU A HD23 3  
ATOM 6662  N N    . SER A 1 26  ? -16.153 0.696   8.944   1.00 0.58  ? 1533 SER A N    3  
ATOM 6663  C CA   . SER A 1 26  ? -15.261 1.796   9.319   1.00 0.62  ? 1533 SER A CA   3  
ATOM 6664  C C    . SER A 1 26  ? -14.381 1.427   10.503  1.00 0.68  ? 1533 SER A C    3  
ATOM 6665  O O    . SER A 1 26  ? -14.708 0.544   11.317  1.00 0.75  ? 1533 SER A O    3  
ATOM 6666  C CB   . SER A 1 26  ? -16.044 3.093   9.615   1.00 0.68  ? 1533 SER A CB   3  
ATOM 6667  O OG   . SER A 1 26  ? -15.201 4.190   9.972   1.00 1.52  ? 1533 SER A OG   3  
ATOM 6668  H H    . SER A 1 26  ? -17.124 0.812   8.980   1.00 0.59  ? 1533 SER A H    3  
ATOM 6669  H HA   . SER A 1 26  ? -14.614 1.973   8.472   1.00 0.65  ? 1533 SER A HA   3  
ATOM 6670  H HB2  . SER A 1 26  ? -16.609 3.398   8.750   1.00 1.19  ? 1533 SER A HB2  3  
ATOM 6671  H HB3  . SER A 1 26  ? -16.689 2.888   10.453  1.00 1.19  ? 1533 SER A HB3  3  
ATOM 6672  H HG   . SER A 1 26  ? -15.395 4.379   10.902  1.00 1.93  ? 1533 SER A HG   3  
ATOM 6673  N N    . GLY A 1 27  ? -13.321 2.133   10.609  1.00 0.76  ? 1534 GLY A N    3  
ATOM 6674  C CA   . GLY A 1 27  ? -12.325 1.880   11.602  1.00 0.89  ? 1534 GLY A CA   3  
ATOM 6675  C C    . GLY A 1 27  ? -11.215 2.900   11.497  1.00 0.95  ? 1534 GLY A C    3  
ATOM 6676  O O    . GLY A 1 27  ? -10.544 2.970   10.471  1.00 1.10  ? 1534 GLY A O    3  
ATOM 6677  H H    . GLY A 1 27  ? -13.268 2.887   9.979   1.00 0.79  ? 1534 GLY A H    3  
ATOM 6678  H HA2  . GLY A 1 27  ? -12.796 1.940   12.579  1.00 0.92  ? 1534 GLY A HA2  3  
ATOM 6679  H HA3  . GLY A 1 27  ? -11.933 0.894   11.377  1.00 1.07  ? 1534 GLY A HA3  3  
ATOM 6680  N N    . ARG A 1 28  ? -11.049 3.704   12.529  1.00 1.07  ? 1535 ARG A N    3  
ATOM 6681  C CA   . ARG A 1 28  ? -10.066 4.786   12.543  1.00 1.36  ? 1535 ARG A CA   3  
ATOM 6682  C C    . ARG A 1 28  ? -8.728  4.350   13.146  1.00 1.25  ? 1535 ARG A C    3  
ATOM 6683  O O    . ARG A 1 28  ? -7.664  4.772   12.676  1.00 1.46  ? 1535 ARG A O    3  
ATOM 6684  C CB   . ARG A 1 28  ? -10.641 5.990   13.302  1.00 1.78  ? 1535 ARG A CB   3  
ATOM 6685  C CG   . ARG A 1 28  ? -9.682  7.149   13.518  1.00 2.21  ? 1535 ARG A CG   3  
ATOM 6686  C CD   . ARG A 1 28  ? -10.374 8.301   14.236  1.00 2.72  ? 1535 ARG A CD   3  
ATOM 6687  N NE   . ARG A 1 28  ? -11.530 8.828   13.483  1.00 3.19  ? 1535 ARG A NE   3  
ATOM 6688  C CZ   . ARG A 1 28  ? -12.535 9.544   14.000  1.00 3.82  ? 1535 ARG A CZ   3  
ATOM 6689  N NH1  . ARG A 1 28  ? -12.596 9.800   15.307  1.00 4.05  ? 1535 ARG A NH1  3  
ATOM 6690  N NH2  . ARG A 1 28  ? -13.496 9.985   13.205  1.00 4.62  ? 1535 ARG A NH2  3  
ATOM 6691  H H    . ARG A 1 28  ? -11.590 3.560   13.334  1.00 1.11  ? 1535 ARG A H    3  
ATOM 6692  H HA   . ARG A 1 28  ? -9.896  5.085   11.519  1.00 1.48  ? 1535 ARG A HA   3  
ATOM 6693  H HB2  . ARG A 1 28  ? -11.486 6.368   12.745  1.00 1.87  ? 1535 ARG A HB2  3  
ATOM 6694  H HB3  . ARG A 1 28  ? -10.994 5.658   14.267  1.00 1.80  ? 1535 ARG A HB3  3  
ATOM 6695  H HG2  . ARG A 1 28  ? -8.879  6.788   14.145  1.00 2.48  ? 1535 ARG A HG2  3  
ATOM 6696  H HG3  . ARG A 1 28  ? -9.267  7.482   12.579  1.00 2.35  ? 1535 ARG A HG3  3  
ATOM 6697  H HD2  . ARG A 1 28  ? -10.715 7.953   15.199  1.00 3.08  ? 1535 ARG A HD2  3  
ATOM 6698  H HD3  . ARG A 1 28  ? -9.658  9.096   14.378  1.00 3.09  ? 1535 ARG A HD3  3  
ATOM 6699  H HE   . ARG A 1 28  ? -11.542 8.642   12.510  1.00 3.43  ? 1535 ARG A HE   3  
ATOM 6700  H HH11 . ARG A 1 28  ? -11.918 9.476   15.977  1.00 3.88  ? 1535 ARG A HH11 3  
ATOM 6701  H HH12 . ARG A 1 28  ? -13.337 10.368  15.683  1.00 4.70  ? 1535 ARG A HH12 3  
ATOM 6702  H HH21 . ARG A 1 28  ? -13.512 9.806   12.215  1.00 4.90  ? 1535 ARG A HH21 3  
ATOM 6703  H HH22 . ARG A 1 28  ? -14.278 10.526  13.538  1.00 5.21  ? 1535 ARG A HH22 3  
ATOM 6704  N N    . ALA A 1 29  ? -8.784  3.501   14.173  1.00 1.08  ? 1536 ALA A N    3  
ATOM 6705  C CA   . ALA A 1 29  ? -7.584  3.061   14.881  1.00 1.24  ? 1536 ALA A CA   3  
ATOM 6706  C C    . ALA A 1 29  ? -6.636  2.366   13.929  1.00 1.01  ? 1536 ALA A C    3  
ATOM 6707  O O    . ALA A 1 29  ? -5.461  2.741   13.803  1.00 1.27  ? 1536 ALA A O    3  
ATOM 6708  C CB   . ALA A 1 29  ? -7.935  2.163   16.055  1.00 1.45  ? 1536 ALA A CB   3  
ATOM 6709  H H    . ALA A 1 29  ? -9.654  3.137   14.449  1.00 1.01  ? 1536 ALA A H    3  
ATOM 6710  H HA   . ALA A 1 29  ? -7.092  3.946   15.258  1.00 1.60  ? 1536 ALA A HA   3  
ATOM 6711  H HB1  . ALA A 1 29  ? -8.408  1.262   15.692  1.00 1.84  ? 1536 ALA A HB1  3  
ATOM 6712  H HB2  . ALA A 1 29  ? -8.610  2.683   16.719  1.00 1.94  ? 1536 ALA A HB2  3  
ATOM 6713  H HB3  . ALA A 1 29  ? -7.034  1.903   16.591  1.00 1.68  ? 1536 ALA A HB3  3  
ATOM 6714  N N    . GLY A 1 30  ? -7.145  1.372   13.253  1.00 0.74  ? 1537 GLY A N    3  
ATOM 6715  C CA   . GLY A 1 30  ? -6.397  0.738   12.236  1.00 0.84  ? 1537 GLY A CA   3  
ATOM 6716  C C    . GLY A 1 30  ? -6.490  -0.749  12.273  1.00 0.72  ? 1537 GLY A C    3  
ATOM 6717  O O    . GLY A 1 30  ? -6.755  -1.354  13.319  1.00 0.85  ? 1537 GLY A O    3  
ATOM 6718  H H    . GLY A 1 30  ? -8.046  1.041   13.474  1.00 0.70  ? 1537 GLY A H    3  
ATOM 6719  H HA2  . GLY A 1 30  ? -6.777  1.072   11.281  1.00 1.02  ? 1537 GLY A HA2  3  
ATOM 6720  H HA3  . GLY A 1 30  ? -5.361  1.029   12.325  1.00 1.08  ? 1537 GLY A HA3  3  
ATOM 6721  N N    . PHE A 1 31  ? -6.315  -1.322  11.130  1.00 0.52  ? 1538 PHE A N    3  
ATOM 6722  C CA   . PHE A 1 31  ? -6.246  -2.746  10.947  1.00 0.49  ? 1538 PHE A CA   3  
ATOM 6723  C C    . PHE A 1 31  ? -4.836  -3.043  10.481  1.00 0.46  ? 1538 PHE A C    3  
ATOM 6724  O O    . PHE A 1 31  ? -4.279  -2.266  9.692   1.00 0.43  ? 1538 PHE A O    3  
ATOM 6725  C CB   . PHE A 1 31  ? -7.247  -3.220  9.870   1.00 0.54  ? 1538 PHE A CB   3  
ATOM 6726  C CG   . PHE A 1 31  ? -8.675  -2.793  10.104  1.00 0.65  ? 1538 PHE A CG   3  
ATOM 6727  C CD1  . PHE A 1 31  ? -9.402  -3.308  11.160  1.00 0.80  ? 1538 PHE A CD1  3  
ATOM 6728  C CD2  . PHE A 1 31  ? -9.288  -1.867  9.266   1.00 0.68  ? 1538 PHE A CD2  3  
ATOM 6729  C CE1  . PHE A 1 31  ? -10.706 -2.916  11.378  1.00 0.93  ? 1538 PHE A CE1  3  
ATOM 6730  C CE2  . PHE A 1 31  ? -10.590 -1.473  9.482   1.00 0.82  ? 1538 PHE A CE2  3  
ATOM 6731  C CZ   . PHE A 1 31  ? -11.299 -1.998  10.537  1.00 0.93  ? 1538 PHE A CZ   3  
ATOM 6732  H H    . PHE A 1 31  ? -6.222  -0.742  10.344  1.00 0.45  ? 1538 PHE A H    3  
ATOM 6733  H HA   . PHE A 1 31  ? -6.443  -3.239  11.888  1.00 0.52  ? 1538 PHE A HA   3  
ATOM 6734  H HB2  . PHE A 1 31  ? -6.946  -2.852  8.901   1.00 0.55  ? 1538 PHE A HB2  3  
ATOM 6735  H HB3  . PHE A 1 31  ? -7.227  -4.301  9.844   1.00 0.56  ? 1538 PHE A HB3  3  
ATOM 6736  H HD1  . PHE A 1 31  ? -8.944  -4.029  11.821  1.00 0.85  ? 1538 PHE A HD1  3  
ATOM 6737  H HD2  . PHE A 1 31  ? -8.747  -1.452  8.429   1.00 0.66  ? 1538 PHE A HD2  3  
ATOM 6738  H HE1  . PHE A 1 31  ? -11.262 -3.328  12.207  1.00 1.07  ? 1538 PHE A HE1  3  
ATOM 6739  H HE2  . PHE A 1 31  ? -11.053 -0.754  8.823   1.00 0.88  ? 1538 PHE A HE2  3  
ATOM 6740  H HZ   . PHE A 1 31  ? -12.320 -1.693  10.710  1.00 1.05  ? 1538 PHE A HZ   3  
ATOM 6741  N N    . THR A 1 32  ? -4.253  -4.100  10.972  1.00 0.50  ? 1539 THR A N    3  
ATOM 6742  C CA   . THR A 1 32  ? -2.917  -4.463  10.593  1.00 0.50  ? 1539 THR A CA   3  
ATOM 6743  C C    . THR A 1 32  ? -2.899  -5.671  9.668   1.00 0.51  ? 1539 THR A C    3  
ATOM 6744  O O    . THR A 1 32  ? -3.525  -6.706  9.949   1.00 0.64  ? 1539 THR A O    3  
ATOM 6745  C CB   . THR A 1 32  ? -2.032  -4.731  11.829  1.00 0.58  ? 1539 THR A CB   3  
ATOM 6746  O OG1  . THR A 1 32  ? -2.762  -5.476  12.818  1.00 1.03  ? 1539 THR A OG1  3  
ATOM 6747  C CG2  . THR A 1 32  ? -1.495  -3.449  12.436  1.00 0.78  ? 1539 THR A CG2  3  
ATOM 6748  H H    . THR A 1 32  ? -4.713  -4.683  11.614  1.00 0.56  ? 1539 THR A H    3  
ATOM 6749  H HA   . THR A 1 32  ? -2.498  -3.624  10.058  1.00 0.46  ? 1539 THR A HA   3  
ATOM 6750  H HB   . THR A 1 32  ? -1.200  -5.341  11.506  1.00 0.77  ? 1539 THR A HB   3  
ATOM 6751  H HG1  . THR A 1 32  ? -2.088  -5.789  13.443  1.00 1.46  ? 1539 THR A HG1  3  
ATOM 6752  H HG21 . THR A 1 32  ? -0.846  -2.957  11.728  1.00 1.42  ? 1539 THR A HG21 3  
ATOM 6753  H HG22 . THR A 1 32  ? -0.925  -3.697  13.320  1.00 1.32  ? 1539 THR A HG22 3  
ATOM 6754  H HG23 . THR A 1 32  ? -2.315  -2.800  12.706  1.00 1.30  ? 1539 THR A HG23 3  
ATOM 6755  N N    . ALA A 1 33  ? -2.219  -5.533  8.574   1.00 0.44  ? 1540 ALA A N    3  
ATOM 6756  C CA   . ALA A 1 33  ? -2.045  -6.614  7.640   1.00 0.47  ? 1540 ALA A CA   3  
ATOM 6757  C C    . ALA A 1 33  ? -0.563  -6.821  7.437   1.00 0.50  ? 1540 ALA A C    3  
ATOM 6758  O O    . ALA A 1 33  ? 0.206   -5.846  7.412   1.00 0.49  ? 1540 ALA A O    3  
ATOM 6759  C CB   . ALA A 1 33  ? -2.748  -6.312  6.324   1.00 0.46  ? 1540 ALA A CB   3  
ATOM 6760  H H    . ALA A 1 33  ? -1.798  -4.666  8.378   1.00 0.41  ? 1540 ALA A H    3  
ATOM 6761  H HA   . ALA A 1 33  ? -2.468  -7.508  8.078   1.00 0.53  ? 1540 ALA A HA   3  
ATOM 6762  H HB1  . ALA A 1 33  ? -2.603  -7.138  5.645   1.00 1.12  ? 1540 ALA A HB1  3  
ATOM 6763  H HB2  . ALA A 1 33  ? -2.332  -5.412  5.896   1.00 1.02  ? 1540 ALA A HB2  3  
ATOM 6764  H HB3  . ALA A 1 33  ? -3.804  -6.174  6.504   1.00 1.19  ? 1540 ALA A HB3  3  
ATOM 6765  N N    . ALA A 1 34  ? -0.154  -8.056  7.335   1.00 0.57  ? 1541 ALA A N    3  
ATOM 6766  C CA   . ALA A 1 34  ? 1.244   -8.387  7.199   1.00 0.63  ? 1541 ALA A CA   3  
ATOM 6767  C C    . ALA A 1 34  ? 1.684   -8.265  5.761   1.00 0.63  ? 1541 ALA A C    3  
ATOM 6768  O O    . ALA A 1 34  ? 1.040   -8.808  4.853   1.00 0.70  ? 1541 ALA A O    3  
ATOM 6769  C CB   . ALA A 1 34  ? 1.517   -9.784  7.728   1.00 0.74  ? 1541 ALA A CB   3  
ATOM 6770  H H    . ALA A 1 34  ? -0.822  -8.780  7.324   1.00 0.61  ? 1541 ALA A H    3  
ATOM 6771  H HA   . ALA A 1 34  ? 1.812   -7.684  7.791   1.00 0.64  ? 1541 ALA A HA   3  
ATOM 6772  H HB1  . ALA A 1 34  ? 2.575   -9.993  7.668   1.00 1.37  ? 1541 ALA A HB1  3  
ATOM 6773  H HB2  . ALA A 1 34  ? 0.974   -10.507 7.137   1.00 1.19  ? 1541 ALA A HB2  3  
ATOM 6774  H HB3  . ALA A 1 34  ? 1.197   -9.850  8.758   1.00 1.25  ? 1541 ALA A HB3  3  
ATOM 6775  N N    . TYR A 1 35  ? 2.756   -7.547  5.555   1.00 0.66  ? 1542 TYR A N    3  
ATOM 6776  C CA   . TYR A 1 35  ? 3.299   -7.353  4.248   1.00 0.71  ? 1542 TYR A CA   3  
ATOM 6777  C C    . TYR A 1 35  ? 4.722   -7.879  4.259   1.00 0.84  ? 1542 TYR A C    3  
ATOM 6778  O O    . TYR A 1 35  ? 4.940   -9.089  4.195   1.00 0.96  ? 1542 TYR A O    3  
ATOM 6779  C CB   . TYR A 1 35  ? 3.242   -5.878  3.794   1.00 0.68  ? 1542 TYR A CB   3  
ATOM 6780  C CG   . TYR A 1 35  ? 3.251   -5.684  2.275   1.00 0.63  ? 1542 TYR A CG   3  
ATOM 6781  C CD1  . TYR A 1 35  ? 4.322   -6.093  1.469   1.00 0.99  ? 1542 TYR A CD1  3  
ATOM 6782  C CD2  . TYR A 1 35  ? 2.178   -5.074  1.655   1.00 0.62  ? 1542 TYR A CD2  3  
ATOM 6783  C CE1  . TYR A 1 35  ? 4.300   -5.900  0.104   1.00 0.97  ? 1542 TYR A CE1  3  
ATOM 6784  C CE2  . TYR A 1 35  ? 2.159   -4.878  0.288   1.00 0.66  ? 1542 TYR A CE2  3  
ATOM 6785  C CZ   . TYR A 1 35  ? 3.217   -5.293  -0.478  1.00 0.63  ? 1542 TYR A CZ   3  
ATOM 6786  O OH   . TYR A 1 35  ? 3.191   -5.103  -1.833  1.00 0.71  ? 1542 TYR A OH   3  
ATOM 6787  H H    . TYR A 1 35  ? 3.225   -7.141  6.315   1.00 0.71  ? 1542 TYR A H    3  
ATOM 6788  H HA   . TYR A 1 35  ? 2.722   -7.967  3.571   1.00 0.75  ? 1542 TYR A HA   3  
ATOM 6789  H HB2  . TYR A 1 35  ? 2.339   -5.428  4.176   1.00 0.74  ? 1542 TYR A HB2  3  
ATOM 6790  H HB3  . TYR A 1 35  ? 4.096   -5.357  4.202   1.00 0.74  ? 1542 TYR A HB3  3  
ATOM 6791  H HD1  . TYR A 1 35  ? 5.180   -6.580  1.906   1.00 1.38  ? 1542 TYR A HD1  3  
ATOM 6792  H HD2  . TYR A 1 35  ? 1.351   -4.750  2.269   1.00 0.88  ? 1542 TYR A HD2  3  
ATOM 6793  H HE1  . TYR A 1 35  ? 5.131   -6.219  -0.509  1.00 1.33  ? 1542 TYR A HE1  3  
ATOM 6794  H HE2  . TYR A 1 35  ? 1.311   -4.405  -0.183  1.00 0.96  ? 1542 TYR A HE2  3  
ATOM 6795  H HH   . TYR A 1 35  ? 3.508   -5.915  -2.255  1.00 1.19  ? 1542 TYR A HH   3  
ATOM 6796  N N    . SER A 1 36  ? 5.680   -6.978  4.370   1.00 0.90  ? 1543 SER A N    3  
ATOM 6797  C CA   . SER A 1 36  ? 7.075   -7.321  4.371   1.00 1.10  ? 1543 SER A CA   3  
ATOM 6798  C C    . SER A 1 36  ? 7.436   -8.135  5.623   1.00 1.18  ? 1543 SER A C    3  
ATOM 6799  O O    . SER A 1 36  ? 6.647   -8.147  6.592   1.00 1.13  ? 1543 SER A O    3  
ATOM 6800  C CB   . SER A 1 36  ? 7.869   -6.035  4.328   1.00 1.19  ? 1543 SER A CB   3  
ATOM 6801  O OG   . SER A 1 36  ? 7.346   -5.191  3.318   1.00 1.91  ? 1543 SER A OG   3  
ATOM 6802  H H    . SER A 1 36  ? 5.468   -6.028  4.473   1.00 0.88  ? 1543 SER A H    3  
ATOM 6803  H HA   . SER A 1 36  ? 7.296   -7.893  3.482   1.00 1.20  ? 1543 SER A HA   3  
ATOM 6804  H HB2  . SER A 1 36  ? 7.797   -5.532  5.281   1.00 1.38  ? 1543 SER A HB2  3  
ATOM 6805  H HB3  . SER A 1 36  ? 8.903   -6.249  4.102   1.00 1.60  ? 1543 SER A HB3  3  
ATOM 6806  H HG   . SER A 1 36  ? 7.877   -5.343  2.525   1.00 1.98  ? 1543 SER A HG   3  
ATOM 6807  N N    . LYS A 1 37  ? 8.576   -8.794  5.627   1.00 1.37  ? 1544 LYS A N    3  
ATOM 6808  C CA   . LYS A 1 37  ? 8.951   -9.642  6.753   1.00 1.50  ? 1544 LYS A CA   3  
ATOM 6809  C C    . LYS A 1 37  ? 8.961   -8.842  8.073   1.00 1.51  ? 1544 LYS A C    3  
ATOM 6810  O O    . LYS A 1 37  ? 8.433   -9.301  9.090   1.00 1.71  ? 1544 LYS A O    3  
ATOM 6811  C CB   . LYS A 1 37  ? 10.289  -10.382 6.481   1.00 1.70  ? 1544 LYS A CB   3  
ATOM 6812  C CG   . LYS A 1 37  ? 10.720  -11.377 7.560   1.00 2.05  ? 1544 LYS A CG   3  
ATOM 6813  C CD   . LYS A 1 37  ? 9.751   -12.550 7.674   1.00 2.36  ? 1544 LYS A CD   3  
ATOM 6814  C CE   . LYS A 1 37  ? 10.126  -13.470 8.818   1.00 2.99  ? 1544 LYS A CE   3  
ATOM 6815  N NZ   . LYS A 1 37  ? 11.365  -14.219 8.555   1.00 3.59  ? 1544 LYS A NZ   3  
ATOM 6816  H H    . LYS A 1 37  ? 9.176   -8.734  4.846   1.00 1.46  ? 1544 LYS A H    3  
ATOM 6817  H HA   . LYS A 1 37  ? 8.150   -10.359 6.839   1.00 1.56  ? 1544 LYS A HA   3  
ATOM 6818  H HB2  . LYS A 1 37  ? 10.182  -10.939 5.560   1.00 1.89  ? 1544 LYS A HB2  3  
ATOM 6819  H HB3  . LYS A 1 37  ? 11.088  -9.669  6.344   1.00 2.12  ? 1544 LYS A HB3  3  
ATOM 6820  H HG2  . LYS A 1 37  ? 11.699  -11.760 7.313   1.00 2.58  ? 1544 LYS A HG2  3  
ATOM 6821  H HG3  . LYS A 1 37  ? 10.764  -10.863 8.509   1.00 2.43  ? 1544 LYS A HG3  3  
ATOM 6822  H HD2  . LYS A 1 37  ? 8.739   -12.201 7.812   1.00 2.45  ? 1544 LYS A HD2  3  
ATOM 6823  H HD3  . LYS A 1 37  ? 9.827   -13.135 6.765   1.00 2.83  ? 1544 LYS A HD3  3  
ATOM 6824  H HE2  . LYS A 1 37  ? 10.264  -12.875 9.707   1.00 3.22  ? 1544 LYS A HE2  3  
ATOM 6825  H HE3  . LYS A 1 37  ? 9.318   -14.168 8.978   1.00 3.43  ? 1544 LYS A HE3  3  
ATOM 6826  H HZ1  . LYS A 1 37  ? 11.241  -14.890 7.769   1.00 3.96  ? 1544 LYS A HZ1  3  
ATOM 6827  H HZ2  . LYS A 1 37  ? 11.614  -14.776 9.401   1.00 3.94  ? 1544 LYS A HZ2  3  
ATOM 6828  H HZ3  . LYS A 1 37  ? 12.180  -13.606 8.329   1.00 3.91  ? 1544 LYS A HZ3  3  
ATOM 6829  N N    . SER A 1 38  ? 9.474   -7.633  8.026   1.00 1.42  ? 1545 SER A N    3  
ATOM 6830  C CA   . SER A 1 38  ? 9.506   -6.787  9.156   1.00 1.49  ? 1545 SER A CA   3  
ATOM 6831  C C    . SER A 1 38  ? 8.538   -5.611  8.948   1.00 1.28  ? 1545 SER A C    3  
ATOM 6832  O O    . SER A 1 38  ? 8.803   -4.487  9.395   1.00 1.37  ? 1545 SER A O    3  
ATOM 6833  C CB   . SER A 1 38  ? 10.920  -6.272  9.305   1.00 1.81  ? 1545 SER A CB   3  
ATOM 6834  O OG   . SER A 1 38  ? 11.857  -7.337  9.464   1.00 2.46  ? 1545 SER A OG   3  
ATOM 6835  H H    . SER A 1 38  ? 9.875   -7.236  7.226   1.00 1.41  ? 1545 SER A H    3  
ATOM 6836  H HA   . SER A 1 38  ? 9.242   -7.346  10.041  1.00 1.69  ? 1545 SER A HA   3  
ATOM 6837  H HB2  . SER A 1 38  ? 11.180  -5.707  8.423   1.00 2.07  ? 1545 SER A HB2  3  
ATOM 6838  H HB3  . SER A 1 38  ? 10.956  -5.629  10.163  1.00 1.97  ? 1545 SER A HB3  3  
ATOM 6839  H HG   . SER A 1 38  ? 11.826  -7.580  10.403  1.00 2.81  ? 1545 SER A HG   3  
ATOM 6840  N N    . GLY A 1 39  ? 7.423   -5.859  8.270   1.00 1.20  ? 1546 GLY A N    3  
ATOM 6841  C CA   . GLY A 1 39  ? 6.526   -4.765  7.982   1.00 1.26  ? 1546 GLY A CA   3  
ATOM 6842  C C    . GLY A 1 39  ? 5.053   -5.112  8.005   1.00 0.99  ? 1546 GLY A C    3  
ATOM 6843  O O    . GLY A 1 39  ? 4.625   -6.141  7.458   1.00 1.08  ? 1546 GLY A O    3  
ATOM 6844  H H    . GLY A 1 39  ? 7.217   -6.776  7.979   1.00 1.22  ? 1546 GLY A H    3  
ATOM 6845  H HA2  . GLY A 1 39  ? 6.690   -3.991  8.715   1.00 1.36  ? 1546 GLY A HA2  3  
ATOM 6846  H HA3  . GLY A 1 39  ? 6.773   -4.369  7.007   1.00 1.68  ? 1546 GLY A HA3  3  
ATOM 6847  N N    . VAL A 1 40  ? 4.283   -4.259  8.651   1.00 0.79  ? 1547 VAL A N    3  
ATOM 6848  C CA   . VAL A 1 40  ? 2.841   -4.358  8.689   1.00 0.57  ? 1547 VAL A CA   3  
ATOM 6849  C C    . VAL A 1 40  ? 2.255   -3.079  8.128   1.00 0.49  ? 1547 VAL A C    3  
ATOM 6850  O O    . VAL A 1 40  ? 2.869   -1.999  8.235   1.00 0.56  ? 1547 VAL A O    3  
ATOM 6851  C CB   . VAL A 1 40  ? 2.274   -4.602  10.126  1.00 0.57  ? 1547 VAL A CB   3  
ATOM 6852  C CG1  . VAL A 1 40  ? 2.694   -5.956  10.651  1.00 0.64  ? 1547 VAL A CG1  3  
ATOM 6853  C CG2  . VAL A 1 40  ? 2.692   -3.498  11.098  1.00 0.73  ? 1547 VAL A CG2  3  
ATOM 6854  H H    . VAL A 1 40  ? 4.683   -3.499  9.126   1.00 0.89  ? 1547 VAL A H    3  
ATOM 6855  H HA   . VAL A 1 40  ? 2.550   -5.176  8.047   1.00 0.61  ? 1547 VAL A HA   3  
ATOM 6856  H HB   . VAL A 1 40  ? 1.197   -4.603  10.056  1.00 0.54  ? 1547 VAL A HB   3  
ATOM 6857  H HG11 . VAL A 1 40  ? 3.771   -6.020  10.669  1.00 1.12  ? 1547 VAL A HG11 3  
ATOM 6858  H HG12 . VAL A 1 40  ? 2.287   -6.727  10.016  1.00 1.08  ? 1547 VAL A HG12 3  
ATOM 6859  H HG13 . VAL A 1 40  ? 2.309   -6.083  11.652  1.00 1.31  ? 1547 VAL A HG13 3  
ATOM 6860  H HG21 . VAL A 1 40  ? 2.274   -3.700  12.074  1.00 1.24  ? 1547 VAL A HG21 3  
ATOM 6861  H HG22 . VAL A 1 40  ? 2.325   -2.548  10.739  1.00 1.22  ? 1547 VAL A HG22 3  
ATOM 6862  H HG23 . VAL A 1 40  ? 3.770   -3.468  11.166  1.00 1.38  ? 1547 VAL A HG23 3  
ATOM 6863  N N    . VAL A 1 41  ? 1.125   -3.187  7.509   1.00 0.42  ? 1548 VAL A N    3  
ATOM 6864  C CA   . VAL A 1 41  ? 0.479   -2.044  6.947   1.00 0.37  ? 1548 VAL A CA   3  
ATOM 6865  C C    . VAL A 1 41  ? -0.691  -1.627  7.831   1.00 0.32  ? 1548 VAL A C    3  
ATOM 6866  O O    . VAL A 1 41  ? -1.415  -2.481  8.369   1.00 0.35  ? 1548 VAL A O    3  
ATOM 6867  C CB   . VAL A 1 41  ? 0.018   -2.301  5.466   1.00 0.40  ? 1548 VAL A CB   3  
ATOM 6868  C CG1  . VAL A 1 41  ? -1.074  -3.346  5.353   1.00 0.58  ? 1548 VAL A CG1  3  
ATOM 6869  C CG2  . VAL A 1 41  ? -0.376  -1.012  4.763   1.00 0.57  ? 1548 VAL A CG2  3  
ATOM 6870  H H    . VAL A 1 41  ? 0.699   -4.071  7.438   1.00 0.46  ? 1548 VAL A H    3  
ATOM 6871  H HA   . VAL A 1 41  ? 1.201   -1.240  6.947   1.00 0.38  ? 1548 VAL A HA   3  
ATOM 6872  H HB   . VAL A 1 41  ? 0.876   -2.706  4.950   1.00 0.69  ? 1548 VAL A HB   3  
ATOM 6873  H HG11 . VAL A 1 41  ? -1.942  -3.023  5.910   1.00 1.21  ? 1548 VAL A HG11 3  
ATOM 6874  H HG12 . VAL A 1 41  ? -0.717  -4.283  5.755   1.00 1.21  ? 1548 VAL A HG12 3  
ATOM 6875  H HG13 . VAL A 1 41  ? -1.343  -3.479  4.315   1.00 1.23  ? 1548 VAL A HG13 3  
ATOM 6876  H HG21 . VAL A 1 41  ? -0.719  -1.245  3.764   1.00 1.17  ? 1548 VAL A HG21 3  
ATOM 6877  H HG22 . VAL A 1 41  ? 0.504   -0.385  4.706   1.00 1.24  ? 1548 VAL A HG22 3  
ATOM 6878  H HG23 . VAL A 1 41  ? -1.149  -0.508  5.320   1.00 1.17  ? 1548 VAL A HG23 3  
ATOM 6879  N N    . TYR A 1 42  ? -0.812  -0.344  8.034   1.00 0.31  ? 1549 TYR A N    3  
ATOM 6880  C CA   . TYR A 1 42  ? -1.899  0.240   8.758   1.00 0.31  ? 1549 TYR A CA   3  
ATOM 6881  C C    . TYR A 1 42  ? -2.916  0.735   7.784   1.00 0.29  ? 1549 TYR A C    3  
ATOM 6882  O O    . TYR A 1 42  ? -2.599  1.510   6.871   1.00 0.37  ? 1549 TYR A O    3  
ATOM 6883  C CB   . TYR A 1 42  ? -1.446  1.387   9.674   1.00 0.40  ? 1549 TYR A CB   3  
ATOM 6884  C CG   . TYR A 1 42  ? -0.672  0.965   10.906  1.00 0.53  ? 1549 TYR A CG   3  
ATOM 6885  C CD1  . TYR A 1 42  ? -1.334  0.458   12.016  1.00 0.59  ? 1549 TYR A CD1  3  
ATOM 6886  C CD2  . TYR A 1 42  ? 0.706   1.094   10.972  1.00 0.70  ? 1549 TYR A CD2  3  
ATOM 6887  C CE1  . TYR A 1 42  ? -0.643  0.089   13.155  1.00 0.76  ? 1549 TYR A CE1  3  
ATOM 6888  C CE2  . TYR A 1 42  ? 1.402   0.724   12.113  1.00 0.87  ? 1549 TYR A CE2  3  
ATOM 6889  C CZ   . TYR A 1 42  ? 0.726   0.228   13.193  1.00 0.88  ? 1549 TYR A CZ   3  
ATOM 6890  O OH   . TYR A 1 42  ? 1.427   -0.153  14.319  1.00 1.08  ? 1549 TYR A OH   3  
ATOM 6891  H H    . TYR A 1 42  ? -0.151  0.274   7.647   1.00 0.32  ? 1549 TYR A H    3  
ATOM 6892  H HA   . TYR A 1 42  ? -2.373  -0.521  9.353   1.00 0.34  ? 1549 TYR A HA   3  
ATOM 6893  H HB2  . TYR A 1 42  ? -0.820  2.065   9.115   1.00 0.46  ? 1549 TYR A HB2  3  
ATOM 6894  H HB3  . TYR A 1 42  ? -2.322  1.927   10.003  1.00 0.39  ? 1549 TYR A HB3  3  
ATOM 6895  H HD1  . TYR A 1 42  ? -2.409  0.351   11.981  1.00 0.57  ? 1549 TYR A HD1  3  
ATOM 6896  H HD2  . TYR A 1 42  ? 1.239   1.486   10.119  1.00 0.77  ? 1549 TYR A HD2  3  
ATOM 6897  H HE1  . TYR A 1 42  ? -1.177  -0.300  14.009  1.00 0.86  ? 1549 TYR A HE1  3  
ATOM 6898  H HE2  . TYR A 1 42  ? 2.475   0.830   12.172  1.00 1.03  ? 1549 TYR A HE2  3  
ATOM 6899  H HH   . TYR A 1 42  ? 2.236   0.383   14.377  1.00 1.29  ? 1549 TYR A HH   3  
ATOM 6900  N N    . MET A 1 43  ? -4.114  0.286   7.954   1.00 0.26  ? 1550 MET A N    3  
ATOM 6901  C CA   . MET A 1 43  ? -5.192  0.678   7.073   1.00 0.25  ? 1550 MET A CA   3  
ATOM 6902  C C    . MET A 1 43  ? -6.433  0.998   7.872   1.00 0.29  ? 1550 MET A C    3  
ATOM 6903  O O    . MET A 1 43  ? -6.765  0.291   8.833   1.00 0.40  ? 1550 MET A O    3  
ATOM 6904  C CB   . MET A 1 43  ? -5.487  -0.384  5.962   1.00 0.32  ? 1550 MET A CB   3  
ATOM 6905  C CG   . MET A 1 43  ? -6.128  -1.716  6.405   1.00 0.35  ? 1550 MET A CG   3  
ATOM 6906  S SD   . MET A 1 43  ? -6.371  -2.857  5.032   1.00 0.78  ? 1550 MET A SD   3  
ATOM 6907  C CE   . MET A 1 43  ? -7.362  -1.860  3.934   1.00 0.62  ? 1550 MET A CE   3  
ATOM 6908  H H    . MET A 1 43  ? -4.256  -0.312  8.718   1.00 0.32  ? 1550 MET A H    3  
ATOM 6909  H HA   . MET A 1 43  ? -4.877  1.594   6.598   1.00 0.24  ? 1550 MET A HA   3  
ATOM 6910  H HB2  . MET A 1 43  ? -6.165  0.059   5.247   1.00 0.38  ? 1550 MET A HB2  3  
ATOM 6911  H HB3  . MET A 1 43  ? -4.565  -0.614  5.453   1.00 0.35  ? 1550 MET A HB3  3  
ATOM 6912  H HG2  . MET A 1 43  ? -5.511  -2.258  7.101   1.00 0.45  ? 1550 MET A HG2  3  
ATOM 6913  H HG3  . MET A 1 43  ? -7.097  -1.518  6.840   1.00 0.48  ? 1550 MET A HG3  3  
ATOM 6914  H HE1  . MET A 1 43  ? -7.589  -2.423  3.041   1.00 1.20  ? 1550 MET A HE1  3  
ATOM 6915  H HE2  . MET A 1 43  ? -6.802  -0.973  3.677   1.00 1.14  ? 1550 MET A HE2  3  
ATOM 6916  H HE3  . MET A 1 43  ? -8.278  -1.578  4.433   1.00 1.47  ? 1550 MET A HE3  3  
ATOM 6917  N N    . SER A 1 44  ? -7.041  2.091   7.544   1.00 0.28  ? 1551 SER A N    3  
ATOM 6918  C CA   . SER A 1 44  ? -8.278  2.508   8.140   1.00 0.31  ? 1551 SER A CA   3  
ATOM 6919  C C    . SER A 1 44  ? -9.371  2.576   7.065   1.00 0.30  ? 1551 SER A C    3  
ATOM 6920  O O    . SER A 1 44  ? -9.122  3.053   5.956   1.00 0.36  ? 1551 SER A O    3  
ATOM 6921  C CB   . SER A 1 44  ? -8.057  3.862   8.796   1.00 0.34  ? 1551 SER A CB   3  
ATOM 6922  O OG   . SER A 1 44  ? -7.385  4.737   7.903   1.00 0.97  ? 1551 SER A OG   3  
ATOM 6923  H H    . SER A 1 44  ? -6.631  2.698   6.884   1.00 0.30  ? 1551 SER A H    3  
ATOM 6924  H HA   . SER A 1 44  ? -8.556  1.789   8.895   1.00 0.34  ? 1551 SER A HA   3  
ATOM 6925  H HB2  . SER A 1 44  ? -9.010  4.294   9.062   1.00 0.61  ? 1551 SER A HB2  3  
ATOM 6926  H HB3  . SER A 1 44  ? -7.452  3.738   9.683   1.00 0.73  ? 1551 SER A HB3  3  
ATOM 6927  H HG   . SER A 1 44  ? -8.044  5.292   7.466   1.00 1.40  ? 1551 SER A HG   3  
ATOM 6928  N N    . ILE A 1 45  ? -10.557 2.101   7.380   1.00 0.30  ? 1552 ILE A N    3  
ATOM 6929  C CA   . ILE A 1 45  ? -11.653 2.077   6.421   1.00 0.32  ? 1552 ILE A CA   3  
ATOM 6930  C C    . ILE A 1 45  ? -12.555 3.287   6.617   1.00 0.36  ? 1552 ILE A C    3  
ATOM 6931  O O    . ILE A 1 45  ? -13.101 3.486   7.713   1.00 0.42  ? 1552 ILE A O    3  
ATOM 6932  C CB   . ILE A 1 45  ? -12.499 0.767   6.541   1.00 0.37  ? 1552 ILE A CB   3  
ATOM 6933  C CG1  . ILE A 1 45  ? -11.653 -0.478  6.208   1.00 0.39  ? 1552 ILE A CG1  3  
ATOM 6934  C CG2  . ILE A 1 45  ? -13.751 0.819   5.653   1.00 0.37  ? 1552 ILE A CG2  3  
ATOM 6935  C CD1  . ILE A 1 45  ? -11.140 -0.527  4.780   1.00 0.35  ? 1552 ILE A CD1  3  
ATOM 6936  H H    . ILE A 1 45  ? -10.719 1.786   8.295   1.00 0.36  ? 1552 ILE A H    3  
ATOM 6937  H HA   . ILE A 1 45  ? -11.224 2.121   5.430   1.00 0.30  ? 1552 ILE A HA   3  
ATOM 6938  H HB   . ILE A 1 45  ? -12.834 0.693   7.565   1.00 0.42  ? 1552 ILE A HB   3  
ATOM 6939  H HG12 . ILE A 1 45  ? -10.794 -0.502  6.863   1.00 0.42  ? 1552 ILE A HG12 3  
ATOM 6940  H HG13 . ILE A 1 45  ? -12.250 -1.362  6.380   1.00 0.45  ? 1552 ILE A HG13 3  
ATOM 6941  H HG21 . ILE A 1 45  ? -13.454 0.945   4.623   1.00 1.09  ? 1552 ILE A HG21 3  
ATOM 6942  H HG22 . ILE A 1 45  ? -14.366 1.655   5.954   1.00 1.11  ? 1552 ILE A HG22 3  
ATOM 6943  H HG23 . ILE A 1 45  ? -14.315 -0.096  5.764   1.00 1.04  ? 1552 ILE A HG23 3  
ATOM 6944  H HD11 . ILE A 1 45  ? -11.982 -0.548  4.102   1.00 0.98  ? 1552 ILE A HD11 3  
ATOM 6945  H HD12 . ILE A 1 45  ? -10.532 -1.407  4.632   1.00 1.05  ? 1552 ILE A HD12 3  
ATOM 6946  H HD13 . ILE A 1 45  ? -10.551 0.355   4.584   1.00 1.09  ? 1552 ILE A HD13 3  
ATOM 6947  N N    . CYS A 1 46  ? -12.648 4.124   5.571   1.00 0.38  ? 1553 CYS A N    3  
ATOM 6948  C CA   . CYS A 1 46  ? -13.543 5.299   5.537   1.00 0.48  ? 1553 CYS A CA   3  
ATOM 6949  C C    . CYS A 1 46  ? -13.140 6.350   6.550   1.00 0.47  ? 1553 CYS A C    3  
ATOM 6950  O O    . CYS A 1 46  ? -13.943 7.200   6.980   1.00 0.69  ? 1553 CYS A O    3  
ATOM 6951  C CB   . CYS A 1 46  ? -14.998 4.879   5.720   1.00 0.60  ? 1553 CYS A CB   3  
ATOM 6952  S SG   . CYS A 1 46  ? -15.578 3.771   4.411   1.00 1.40  ? 1553 CYS A SG   3  
ATOM 6953  H H    . CYS A 1 46  ? -12.082 3.962   4.783   1.00 0.36  ? 1553 CYS A H    3  
ATOM 6954  H HA   . CYS A 1 46  ? -13.434 5.740   4.556   1.00 0.53  ? 1553 CYS A HA   3  
ATOM 6955  H HB2  . CYS A 1 46  ? -15.106 4.367   6.664   1.00 0.94  ? 1553 CYS A HB2  3  
ATOM 6956  H HB3  . CYS A 1 46  ? -15.627 5.758   5.712   1.00 1.11  ? 1553 CYS A HB3  3  
ATOM 6957  N N    . GLY A 1 47  ? -11.900 6.314   6.883   1.00 0.34  ? 1554 GLY A N    3  
ATOM 6958  C CA   . GLY A 1 47  ? -11.353 7.190   7.837   1.00 0.35  ? 1554 GLY A CA   3  
ATOM 6959  C C    . GLY A 1 47  ? -9.875  7.177   7.748   1.00 0.30  ? 1554 GLY A C    3  
ATOM 6960  O O    . GLY A 1 47  ? -9.305  6.455   6.909   1.00 0.31  ? 1554 GLY A O    3  
ATOM 6961  H H    . GLY A 1 47  ? -11.319 5.661   6.444   1.00 0.35  ? 1554 GLY A H    3  
ATOM 6962  H HA2  . GLY A 1 47  ? -11.721 8.189   7.654   1.00 0.40  ? 1554 GLY A HA2  3  
ATOM 6963  H HA3  . GLY A 1 47  ? -11.648 6.874   8.826   1.00 0.38  ? 1554 GLY A HA3  3  
ATOM 6964  N N    . GLU A 1 48  ? -9.255  7.909   8.606   1.00 0.31  ? 1555 GLU A N    3  
ATOM 6965  C CA   . GLU A 1 48  ? -7.829  8.067   8.601   1.00 0.30  ? 1555 GLU A CA   3  
ATOM 6966  C C    . GLU A 1 48  ? -7.200  7.356   9.787   1.00 0.32  ? 1555 GLU A C    3  
ATOM 6967  O O    . GLU A 1 48  ? -7.771  7.316   10.882  1.00 0.42  ? 1555 GLU A O    3  
ATOM 6968  C CB   . GLU A 1 48  ? -7.494  9.543   8.571   1.00 0.36  ? 1555 GLU A CB   3  
ATOM 6969  C CG   . GLU A 1 48  ? -8.199  10.354  9.632   1.00 0.47  ? 1555 GLU A CG   3  
ATOM 6970  C CD   . GLU A 1 48  ? -7.951  11.816  9.489   1.00 0.93  ? 1555 GLU A CD   3  
ATOM 6971  O OE1  . GLU A 1 48  ? -6.875  12.285  9.880   1.00 1.62  ? 1555 GLU A OE1  3  
ATOM 6972  O OE2  . GLU A 1 48  ? -8.837  12.532  8.975   1.00 0.89  ? 1555 GLU A OE2  3  
ATOM 6973  H H    . GLU A 1 48  ? -9.770  8.351   9.312   1.00 0.39  ? 1555 GLU A H    3  
ATOM 6974  H HA   . GLU A 1 48  ? -7.464  7.613   7.691   1.00 0.28  ? 1555 GLU A HA   3  
ATOM 6975  H HB2  . GLU A 1 48  ? -6.429  9.628   8.725   1.00 0.37  ? 1555 GLU A HB2  3  
ATOM 6976  H HB3  . GLU A 1 48  ? -7.751  9.937   7.599   1.00 0.39  ? 1555 GLU A HB3  3  
ATOM 6977  H HG2  . GLU A 1 48  ? -9.262  10.178  9.549   1.00 0.72  ? 1555 GLU A HG2  3  
ATOM 6978  H HG3  . GLU A 1 48  ? -7.862  10.032  10.607  1.00 0.77  ? 1555 GLU A HG3  3  
ATOM 6979  N N    . ASN A 1 49  ? -6.024  6.822   9.562   1.00 0.31  ? 1556 ASN A N    3  
ATOM 6980  C CA   . ASN A 1 49  ? -5.354  5.974   10.516  1.00 0.38  ? 1556 ASN A CA   3  
ATOM 6981  C C    . ASN A 1 49  ? -4.633  6.788   11.592  1.00 0.41  ? 1556 ASN A C    3  
ATOM 6982  O O    . ASN A 1 49  ? -4.041  7.832   11.308  1.00 0.46  ? 1556 ASN A O    3  
ATOM 6983  C CB   . ASN A 1 49  ? -4.400  5.002   9.789   1.00 0.42  ? 1556 ASN A CB   3  
ATOM 6984  C CG   . ASN A 1 49  ? -3.644  4.087   10.734  1.00 0.58  ? 1556 ASN A CG   3  
ATOM 6985  O OD1  . ASN A 1 49  ? -2.556  4.407   11.203  1.00 0.83  ? 1556 ASN A OD1  3  
ATOM 6986  N ND2  . ASN A 1 49  ? -4.209  2.955   11.028  1.00 0.87  ? 1556 ASN A ND2  3  
ATOM 6987  H H    . ASN A 1 49  ? -5.575  7.032   8.715   1.00 0.32  ? 1556 ASN A H    3  
ATOM 6988  H HA   . ASN A 1 49  ? -6.141  5.391   10.970  1.00 0.45  ? 1556 ASN A HA   3  
ATOM 6989  H HB2  . ASN A 1 49  ? -5.009  4.371   9.159   1.00 0.45  ? 1556 ASN A HB2  3  
ATOM 6990  H HB3  . ASN A 1 49  ? -3.706  5.530   9.156   1.00 0.40  ? 1556 ASN A HB3  3  
ATOM 6991  H HD21 . ASN A 1 49  ? -5.084  2.775   10.614  1.00 1.12  ? 1556 ASN A HD21 3  
ATOM 6992  H HD22 . ASN A 1 49  ? -3.751  2.351   11.654  1.00 1.00  ? 1556 ASN A HD22 3  
ATOM 6993  N N    . GLU A 1 50  ? -4.619  6.252   12.799  1.00 0.57  ? 1557 GLU A N    3  
ATOM 6994  C CA   . GLU A 1 50  ? -4.143  6.949   13.994  1.00 0.67  ? 1557 GLU A CA   3  
ATOM 6995  C C    . GLU A 1 50  ? -2.631  6.849   14.186  1.00 0.62  ? 1557 GLU A C    3  
ATOM 6996  O O    . GLU A 1 50  ? -2.113  7.202   15.249  1.00 0.74  ? 1557 GLU A O    3  
ATOM 6997  C CB   . GLU A 1 50  ? -4.840  6.349   15.218  1.00 0.95  ? 1557 GLU A CB   3  
ATOM 6998  C CG   . GLU A 1 50  ? -6.317  6.681   15.348  1.00 1.65  ? 1557 GLU A CG   3  
ATOM 6999  C CD   . GLU A 1 50  ? -6.553  8.067   15.847  1.00 2.05  ? 1557 GLU A CD   3  
ATOM 7000  O OE1  . GLU A 1 50  ? -6.455  9.033   15.071  1.00 2.49  ? 1557 GLU A OE1  3  
ATOM 7001  O OE2  . GLU A 1 50  ? -6.879  8.214   17.045  1.00 2.40  ? 1557 GLU A OE2  3  
ATOM 7002  H H    . GLU A 1 50  ? -4.916  5.321   12.904  1.00 0.70  ? 1557 GLU A H    3  
ATOM 7003  H HA   . GLU A 1 50  ? -4.434  7.986   13.930  1.00 0.71  ? 1557 GLU A HA   3  
ATOM 7004  H HB2  . GLU A 1 50  ? -4.748  5.274   15.172  1.00 1.22  ? 1557 GLU A HB2  3  
ATOM 7005  H HB3  . GLU A 1 50  ? -4.334  6.699   16.105  1.00 1.40  ? 1557 GLU A HB3  3  
ATOM 7006  H HG2  . GLU A 1 50  ? -6.828  6.604   14.400  1.00 2.11  ? 1557 GLU A HG2  3  
ATOM 7007  H HG3  . GLU A 1 50  ? -6.764  5.995   16.052  1.00 2.10  ? 1557 GLU A HG3  3  
ATOM 7008  N N    . ASN A 1 51  ? -1.922  6.356   13.204  1.00 0.56  ? 1558 ASN A N    3  
ATOM 7009  C CA   . ASN A 1 51  ? -0.480  6.180   13.372  1.00 0.62  ? 1558 ASN A CA   3  
ATOM 7010  C C    . ASN A 1 51  ? 0.322   6.982   12.374  1.00 0.54  ? 1558 ASN A C    3  
ATOM 7011  O O    . ASN A 1 51  ? 1.542   7.125   12.517  1.00 0.68  ? 1558 ASN A O    3  
ATOM 7012  C CB   . ASN A 1 51  ? -0.064  4.701   13.301  1.00 0.79  ? 1558 ASN A CB   3  
ATOM 7013  C CG   . ASN A 1 51  ? -0.771  3.825   14.314  1.00 0.87  ? 1558 ASN A CG   3  
ATOM 7014  O OD1  . ASN A 1 51  ? -0.333  3.681   15.465  1.00 1.38  ? 1558 ASN A OD1  3  
ATOM 7015  N ND2  . ASN A 1 51  ? -1.856  3.233   13.897  1.00 0.85  ? 1558 ASN A ND2  3  
ATOM 7016  H H    . ASN A 1 51  ? -2.380  6.094   12.376  1.00 0.56  ? 1558 ASN A H    3  
ATOM 7017  H HA   . ASN A 1 51  ? -0.237  6.546   14.358  1.00 0.71  ? 1558 ASN A HA   3  
ATOM 7018  H HB2  . ASN A 1 51  ? -0.284  4.320   12.314  1.00 1.20  ? 1558 ASN A HB2  3  
ATOM 7019  H HB3  . ASN A 1 51  ? 1.001   4.633   13.474  1.00 1.02  ? 1558 ASN A HB3  3  
ATOM 7020  H HD21 . ASN A 1 51  ? -2.127  3.410   12.970  1.00 0.93  ? 1558 ASN A HD21 3  
ATOM 7021  H HD22 . ASN A 1 51  ? -2.352  2.611   14.485  1.00 1.10  ? 1558 ASN A HD22 3  
ATOM 7022  N N    . CYS A 1 52  ? -0.323  7.530   11.393  1.00 0.44  ? 1559 CYS A N    3  
ATOM 7023  C CA   . CYS A 1 52  ? 0.385   8.259   10.368  1.00 0.41  ? 1559 CYS A CA   3  
ATOM 7024  C C    . CYS A 1 52  ? -0.296  9.605   10.117  1.00 0.39  ? 1559 CYS A C    3  
ATOM 7025  O O    . CYS A 1 52  ? -1.422  9.778   10.588  1.00 0.42  ? 1559 CYS A O    3  
ATOM 7026  C CB   . CYS A 1 52  ? 0.498   7.408   9.086   1.00 0.42  ? 1559 CYS A CB   3  
ATOM 7027  S SG   . CYS A 1 52  ? 1.388   5.826   9.312   1.00 1.21  ? 1559 CYS A SG   3  
ATOM 7028  H H    . CYS A 1 52  ? -1.301  7.501   11.342  1.00 0.46  ? 1559 CYS A H    3  
ATOM 7029  H HA   . CYS A 1 52  ? 1.378   8.455   10.749  1.00 0.46  ? 1559 CYS A HA   3  
ATOM 7030  H HB2  . CYS A 1 52  ? -0.494  7.175   8.729   1.00 0.83  ? 1559 CYS A HB2  3  
ATOM 7031  H HB3  . CYS A 1 52  ? 1.019   7.978   8.332   1.00 0.94  ? 1559 CYS A HB3  3  
ATOM 7032  N N    . PRO A 1 53  ? 0.392   10.578  9.429   1.00 0.45  ? 1560 PRO A N    3  
ATOM 7033  C CA   . PRO A 1 53  ? -0.118  11.936  9.114   1.00 0.49  ? 1560 PRO A CA   3  
ATOM 7034  C C    . PRO A 1 53  ? -1.648  12.041  8.905   1.00 0.41  ? 1560 PRO A C    3  
ATOM 7035  O O    . PRO A 1 53  ? -2.245  11.253  8.162   1.00 0.42  ? 1560 PRO A O    3  
ATOM 7036  C CB   . PRO A 1 53  ? 0.612   12.269  7.795   1.00 0.57  ? 1560 PRO A CB   3  
ATOM 7037  C CG   . PRO A 1 53  ? 1.670   11.211  7.617   1.00 0.71  ? 1560 PRO A CG   3  
ATOM 7038  C CD   . PRO A 1 53  ? 1.751   10.455  8.908   1.00 0.58  ? 1560 PRO A CD   3  
ATOM 7039  H HA   . PRO A 1 53  ? 0.189   12.651  9.863   1.00 0.57  ? 1560 PRO A HA   3  
ATOM 7040  H HB2  . PRO A 1 53  ? -0.100  12.248  6.983   1.00 0.61  ? 1560 PRO A HB2  3  
ATOM 7041  H HB3  . PRO A 1 53  ? 1.049   13.254  7.865   1.00 0.69  ? 1560 PRO A HB3  3  
ATOM 7042  H HG2  . PRO A 1 53  ? 1.389   10.544  6.815   1.00 0.90  ? 1560 PRO A HG2  3  
ATOM 7043  H HG3  . PRO A 1 53  ? 2.618   11.678  7.396   1.00 0.98  ? 1560 PRO A HG3  3  
ATOM 7044  H HD2  . PRO A 1 53  ? 2.008   9.422   8.729   1.00 0.61  ? 1560 PRO A HD2  3  
ATOM 7045  H HD3  . PRO A 1 53  ? 2.463   10.917  9.576   1.00 0.70  ? 1560 PRO A HD3  3  
ATOM 7046  N N    . PRO A 1 54  ? -2.286  13.033  9.568   1.00 0.47  ? 1561 PRO A N    3  
ATOM 7047  C CA   . PRO A 1 54  ? -3.731  13.286  9.467   1.00 0.46  ? 1561 PRO A CA   3  
ATOM 7048  C C    . PRO A 1 54  ? -4.197  13.340  8.008   1.00 0.41  ? 1561 PRO A C    3  
ATOM 7049  O O    . PRO A 1 54  ? -3.610  14.049  7.180   1.00 0.46  ? 1561 PRO A O    3  
ATOM 7050  C CB   . PRO A 1 54  ? -3.885  14.664  10.133  1.00 0.56  ? 1561 PRO A CB   3  
ATOM 7051  C CG   . PRO A 1 54  ? -2.785  14.709  11.121  1.00 0.80  ? 1561 PRO A CG   3  
ATOM 7052  C CD   . PRO A 1 54  ? -1.636  13.996  10.477  1.00 0.63  ? 1561 PRO A CD   3  
ATOM 7053  H HA   . PRO A 1 54  ? -4.301  12.547  10.010  1.00 0.48  ? 1561 PRO A HA   3  
ATOM 7054  H HB2  . PRO A 1 54  ? -3.775  15.447  9.398   1.00 0.66  ? 1561 PRO A HB2  3  
ATOM 7055  H HB3  . PRO A 1 54  ? -4.844  14.755  10.623  1.00 0.66  ? 1561 PRO A HB3  3  
ATOM 7056  H HG2  . PRO A 1 54  ? -2.522  15.735  11.333  1.00 1.15  ? 1561 PRO A HG2  3  
ATOM 7057  H HG3  . PRO A 1 54  ? -3.081  14.199  12.026  1.00 1.13  ? 1561 PRO A HG3  3  
ATOM 7058  H HD2  . PRO A 1 54  ? -1.021  14.693  9.926   1.00 0.78  ? 1561 PRO A HD2  3  
ATOM 7059  H HD3  . PRO A 1 54  ? -1.045  13.481  11.221  1.00 0.77  ? 1561 PRO A HD3  3  
ATOM 7060  N N    . GLY A 1 55  ? -5.215  12.577  7.702   1.00 0.41  ? 1562 GLY A N    3  
ATOM 7061  C CA   . GLY A 1 55  ? -5.729  12.514  6.369   1.00 0.46  ? 1562 GLY A CA   3  
ATOM 7062  C C    . GLY A 1 55  ? -5.304  11.270  5.607   1.00 0.38  ? 1562 GLY A C    3  
ATOM 7063  O O    . GLY A 1 55  ? -5.745  11.062  4.484   1.00 0.45  ? 1562 GLY A O    3  
ATOM 7064  H H    . GLY A 1 55  ? -5.663  12.089  8.428   1.00 0.44  ? 1562 GLY A H    3  
ATOM 7065  H HA2  . GLY A 1 55  ? -6.808  12.539  6.416   1.00 0.55  ? 1562 GLY A HA2  3  
ATOM 7066  H HA3  . GLY A 1 55  ? -5.387  13.385  5.828   1.00 0.54  ? 1562 GLY A HA3  3  
ATOM 7067  N N    . VAL A 1 56  ? -4.467  10.432  6.191   1.00 0.35  ? 1563 VAL A N    3  
ATOM 7068  C CA   . VAL A 1 56  ? -4.006  9.250   5.472   1.00 0.37  ? 1563 VAL A CA   3  
ATOM 7069  C C    . VAL A 1 56  ? -4.811  7.999   5.877   1.00 0.27  ? 1563 VAL A C    3  
ATOM 7070  O O    . VAL A 1 56  ? -5.134  7.799   7.053   1.00 0.28  ? 1563 VAL A O    3  
ATOM 7071  C CB   . VAL A 1 56  ? -2.478  9.003   5.656   1.00 0.53  ? 1563 VAL A CB   3  
ATOM 7072  C CG1  . VAL A 1 56  ? -2.141  8.421   7.011   1.00 0.68  ? 1563 VAL A CG1  3  
ATOM 7073  C CG2  . VAL A 1 56  ? -1.934  8.147   4.553   1.00 0.98  ? 1563 VAL A CG2  3  
ATOM 7074  H H    . VAL A 1 56  ? -4.146  10.603  7.102   1.00 0.42  ? 1563 VAL A H    3  
ATOM 7075  H HA   . VAL A 1 56  ? -4.202  9.436   4.425   1.00 0.48  ? 1563 VAL A HA   3  
ATOM 7076  H HB   . VAL A 1 56  ? -1.993  9.967   5.596   1.00 1.09  ? 1563 VAL A HB   3  
ATOM 7077  H HG11 . VAL A 1 56  ? -1.074  8.269   7.084   1.00 1.27  ? 1563 VAL A HG11 3  
ATOM 7078  H HG12 . VAL A 1 56  ? -2.652  7.475   7.116   1.00 1.22  ? 1563 VAL A HG12 3  
ATOM 7079  H HG13 . VAL A 1 56  ? -2.471  9.100   7.784   1.00 1.34  ? 1563 VAL A HG13 3  
ATOM 7080  H HG21 . VAL A 1 56  ? -2.399  7.174   4.589   1.00 1.53  ? 1563 VAL A HG21 3  
ATOM 7081  H HG22 . VAL A 1 56  ? -0.863  8.059   4.652   1.00 1.50  ? 1563 VAL A HG22 3  
ATOM 7082  H HG23 . VAL A 1 56  ? -2.161  8.610   3.605   1.00 1.48  ? 1563 VAL A HG23 3  
ATOM 7083  N N    . GLY A 1 57  ? -5.150  7.192   4.889   1.00 0.25  ? 1564 GLY A N    3  
ATOM 7084  C CA   . GLY A 1 57  ? -5.923  5.986   5.124   1.00 0.25  ? 1564 GLY A CA   3  
ATOM 7085  C C    . GLY A 1 57  ? -5.077  4.721   5.114   1.00 0.24  ? 1564 GLY A C    3  
ATOM 7086  O O    . GLY A 1 57  ? -5.397  3.747   5.789   1.00 0.28  ? 1564 GLY A O    3  
ATOM 7087  H H    . GLY A 1 57  ? -4.880  7.428   3.974   1.00 0.28  ? 1564 GLY A H    3  
ATOM 7088  H HA2  . GLY A 1 57  ? -6.455  6.063   6.060   1.00 0.27  ? 1564 GLY A HA2  3  
ATOM 7089  H HA3  . GLY A 1 57  ? -6.657  5.908   4.335   1.00 0.29  ? 1564 GLY A HA3  3  
ATOM 7090  N N    . ALA A 1 58  ? -4.015  4.723   4.329   1.00 0.23  ? 1565 ALA A N    3  
ATOM 7091  C CA   . ALA A 1 58  ? -3.142  3.577   4.223   1.00 0.24  ? 1565 ALA A CA   3  
ATOM 7092  C C    . ALA A 1 58  ? -1.699  4.004   4.425   1.00 0.23  ? 1565 ALA A C    3  
ATOM 7093  O O    . ALA A 1 58  ? -1.233  4.968   3.796   1.00 0.23  ? 1565 ALA A O    3  
ATOM 7094  C CB   . ALA A 1 58  ? -3.317  2.928   2.871   1.00 0.28  ? 1565 ALA A CB   3  
ATOM 7095  H H    . ALA A 1 58  ? -3.788  5.508   3.788   1.00 0.24  ? 1565 ALA A H    3  
ATOM 7096  H HA   . ALA A 1 58  ? -3.413  2.865   4.988   1.00 0.26  ? 1565 ALA A HA   3  
ATOM 7097  H HB1  . ALA A 1 58  ? -3.039  3.642   2.111   1.00 1.01  ? 1565 ALA A HB1  3  
ATOM 7098  H HB2  . ALA A 1 58  ? -4.346  2.637   2.732   1.00 1.08  ? 1565 ALA A HB2  3  
ATOM 7099  H HB3  . ALA A 1 58  ? -2.677  2.060   2.798   1.00 0.96  ? 1565 ALA A HB3  3  
ATOM 7100  N N    . CYS A 1 59  ? -0.995  3.301   5.279   1.00 0.26  ? 1566 CYS A N    3  
ATOM 7101  C CA   . CYS A 1 59  ? 0.368   3.650   5.627   1.00 0.28  ? 1566 CYS A CA   3  
ATOM 7102  C C    . CYS A 1 59  ? 1.108   2.415   6.152   1.00 0.33  ? 1566 CYS A C    3  
ATOM 7103  O O    . CYS A 1 59  ? 0.533   1.636   6.886   1.00 0.37  ? 1566 CYS A O    3  
ATOM 7104  C CB   . CYS A 1 59  ? 0.294   4.715   6.730   1.00 0.32  ? 1566 CYS A CB   3  
ATOM 7105  S SG   . CYS A 1 59  ? 1.878   5.259   7.428   1.00 0.43  ? 1566 CYS A SG   3  
ATOM 7106  H H    . CYS A 1 59  ? -1.399  2.520   5.722   1.00 0.29  ? 1566 CYS A H    3  
ATOM 7107  H HA   . CYS A 1 59  ? 0.860   4.076   4.767   1.00 0.30  ? 1566 CYS A HA   3  
ATOM 7108  H HB2  . CYS A 1 59  ? -0.194  5.594   6.340   1.00 0.36  ? 1566 CYS A HB2  3  
ATOM 7109  H HB3  . CYS A 1 59  ? -0.305  4.322   7.538   1.00 0.38  ? 1566 CYS A HB3  3  
ATOM 7110  N N    . PHE A 1 60  ? 2.365   2.216   5.765   1.00 0.39  ? 1567 PHE A N    3  
ATOM 7111  C CA   . PHE A 1 60  ? 3.144   1.110   6.334   1.00 0.48  ? 1567 PHE A CA   3  
ATOM 7112  C C    . PHE A 1 60  ? 3.778   1.576   7.653   1.00 0.61  ? 1567 PHE A C    3  
ATOM 7113  O O    . PHE A 1 60  ? 4.336   2.673   7.715   1.00 0.63  ? 1567 PHE A O    3  
ATOM 7114  C CB   . PHE A 1 60  ? 4.227   0.584   5.374   1.00 0.59  ? 1567 PHE A CB   3  
ATOM 7115  C CG   . PHE A 1 60  ? 3.684   -0.084  4.156   1.00 0.61  ? 1567 PHE A CG   3  
ATOM 7116  C CD1  . PHE A 1 60  ? 3.131   -1.325  4.241   1.00 0.73  ? 1567 PHE A CD1  3  
ATOM 7117  C CD2  . PHE A 1 60  ? 3.732   0.542   2.928   1.00 0.86  ? 1567 PHE A CD2  3  
ATOM 7118  C CE1  . PHE A 1 60  ? 2.630   -1.962  3.126   1.00 0.91  ? 1567 PHE A CE1  3  
ATOM 7119  C CE2  . PHE A 1 60  ? 3.239   -0.080  1.802   1.00 1.03  ? 1567 PHE A CE2  3  
ATOM 7120  C CZ   . PHE A 1 60  ? 2.670   -1.306  1.891   1.00 0.99  ? 1567 PHE A CZ   3  
ATOM 7121  H H    . PHE A 1 60  ? 2.759   2.828   5.109   1.00 0.41  ? 1567 PHE A H    3  
ATOM 7122  H HA   . PHE A 1 60  ? 2.396   0.347   6.502   1.00 0.46  ? 1567 PHE A HA   3  
ATOM 7123  H HB2  . PHE A 1 60  ? 4.848   1.404   5.048   1.00 0.71  ? 1567 PHE A HB2  3  
ATOM 7124  H HB3  . PHE A 1 60  ? 4.843   -0.140  5.884   1.00 0.69  ? 1567 PHE A HB3  3  
ATOM 7125  H HD1  . PHE A 1 60  ? 3.095   -1.778  5.216   1.00 0.87  ? 1567 PHE A HD1  3  
ATOM 7126  H HD2  . PHE A 1 60  ? 4.171   1.526   2.850   1.00 1.06  ? 1567 PHE A HD2  3  
ATOM 7127  H HE1  . PHE A 1 60  ? 2.194   -2.946  3.211   1.00 1.13  ? 1567 PHE A HE1  3  
ATOM 7128  H HE2  . PHE A 1 60  ? 3.281   0.420   0.846   1.00 1.30  ? 1567 PHE A HE2  3  
ATOM 7129  H HZ   . PHE A 1 60  ? 2.273   -1.783  1.008   1.00 1.18  ? 1567 PHE A HZ   3  
ATOM 7130  N N    . GLY A 1 61  ? 3.752   0.723   8.675   1.00 0.76  ? 1568 GLY A N    3  
ATOM 7131  C CA   . GLY A 1 61  ? 4.083   1.149   10.020  1.00 1.03  ? 1568 GLY A CA   3  
ATOM 7132  C C    . GLY A 1 61  ? 5.539   1.440   10.309  1.00 0.82  ? 1568 GLY A C    3  
ATOM 7133  O O    . GLY A 1 61  ? 5.834   2.123   11.282  1.00 1.13  ? 1568 GLY A O    3  
ATOM 7134  H H    . GLY A 1 61  ? 3.526   -0.228  8.545   1.00 0.72  ? 1568 GLY A H    3  
ATOM 7135  H HA2  . GLY A 1 61  ? 3.525   2.048   10.234  1.00 1.32  ? 1568 GLY A HA2  3  
ATOM 7136  H HA3  . GLY A 1 61  ? 3.741   0.384   10.701  1.00 1.43  ? 1568 GLY A HA3  3  
ATOM 7137  N N    . GLN A 1 62  ? 6.445   0.955   9.494   1.00 0.83  ? 1569 GLN A N    3  
ATOM 7138  C CA   . GLN A 1 62  ? 7.857   1.128   9.802   1.00 1.01  ? 1569 GLN A CA   3  
ATOM 7139  C C    . GLN A 1 62  ? 8.299   2.564   9.572   1.00 0.89  ? 1569 GLN A C    3  
ATOM 7140  O O    . GLN A 1 62  ? 8.551   3.318   10.507  1.00 1.08  ? 1569 GLN A O    3  
ATOM 7141  C CB   . GLN A 1 62  ? 8.770   0.259   8.952   1.00 1.47  ? 1569 GLN A CB   3  
ATOM 7142  C CG   . GLN A 1 62  ? 8.432   -1.200  8.783   1.00 1.83  ? 1569 GLN A CG   3  
ATOM 7143  C CD   . GLN A 1 62  ? 7.288   -1.400  7.838   1.00 2.05  ? 1569 GLN A CD   3  
ATOM 7144  O OE1  . GLN A 1 62  ? 6.133   -1.532  8.248   1.00 2.58  ? 1569 GLN A OE1  3  
ATOM 7145  N NE2  . GLN A 1 62  ? 7.572   -1.244  6.592   1.00 2.40  ? 1569 GLN A NE2  3  
ATOM 7146  H H    . GLN A 1 62  ? 6.148   0.462   8.700   1.00 1.05  ? 1569 GLN A H    3  
ATOM 7147  H HA   . GLN A 1 62  ? 8.000   0.856   10.833  1.00 1.24  ? 1569 GLN A HA   3  
ATOM 7148  H HB2  . GLN A 1 62  ? 8.805   0.684   7.961   1.00 1.56  ? 1569 GLN A HB2  3  
ATOM 7149  H HB3  . GLN A 1 62  ? 9.765   0.325   9.371   1.00 1.69  ? 1569 GLN A HB3  3  
ATOM 7150  H HG2  . GLN A 1 62  ? 9.299   -1.709  8.389   1.00 2.22  ? 1569 GLN A HG2  3  
ATOM 7151  H HG3  . GLN A 1 62  ? 8.169   -1.614  9.745   1.00 2.41  ? 1569 GLN A HG3  3  
ATOM 7152  H HE21 . GLN A 1 62  ? 8.510   -0.987  6.411   1.00 2.27  ? 1569 GLN A HE21 3  
ATOM 7153  H HE22 . GLN A 1 62  ? 6.900   -1.365  5.892   1.00 3.09  ? 1569 GLN A HE22 3  
ATOM 7154  N N    . THR A 1 63  ? 8.350   2.936   8.323   1.00 0.86  ? 1570 THR A N    3  
ATOM 7155  C CA   . THR A 1 63  ? 8.814   4.234   7.901   1.00 1.01  ? 1570 THR A CA   3  
ATOM 7156  C C    . THR A 1 63  ? 7.693   5.263   7.820   1.00 0.80  ? 1570 THR A C    3  
ATOM 7157  O O    . THR A 1 63  ? 7.927   6.435   7.507   1.00 0.93  ? 1570 THR A O    3  
ATOM 7158  C CB   . THR A 1 63  ? 9.474   4.069   6.541   1.00 1.48  ? 1570 THR A CB   3  
ATOM 7159  O OG1  . THR A 1 63  ? 8.866   2.903   5.898   1.00 2.17  ? 1570 THR A OG1  3  
ATOM 7160  C CG2  . THR A 1 63  ? 10.977  3.890   6.638   1.00 1.93  ? 1570 THR A CG2  3  
ATOM 7161  H H    . THR A 1 63  ? 8.129   2.319   7.590   1.00 0.98  ? 1570 THR A H    3  
ATOM 7162  H HA   . THR A 1 63  ? 9.547   4.598   8.602   1.00 1.23  ? 1570 THR A HA   3  
ATOM 7163  H HB   . THR A 1 63  ? 9.234   4.942   5.950   1.00 1.87  ? 1570 THR A HB   3  
ATOM 7164  H HG1  . THR A 1 63  ? 9.459   2.131   5.864   1.00 2.52  ? 1570 THR A HG1  3  
ATOM 7165  H HG21 . THR A 1 63  ? 11.345  3.732   5.634   1.00 2.20  ? 1570 THR A HG21 3  
ATOM 7166  H HG22 . THR A 1 63  ? 11.219  3.017   7.226   1.00 2.46  ? 1570 THR A HG22 3  
ATOM 7167  H HG23 . THR A 1 63  ? 11.469  4.764   7.042   1.00 2.40  ? 1570 THR A HG23 3  
ATOM 7168  N N    . ARG A 1 64  ? 6.477   4.792   8.097   1.00 0.62  ? 1571 ARG A N    3  
ATOM 7169  C CA   . ARG A 1 64  ? 5.256   5.616   8.106   1.00 0.57  ? 1571 ARG A CA   3  
ATOM 7170  C C    . ARG A 1 64  ? 5.021   6.242   6.729   1.00 0.47  ? 1571 ARG A C    3  
ATOM 7171  O O    . ARG A 1 64  ? 4.617   7.398   6.618   1.00 0.57  ? 1571 ARG A O    3  
ATOM 7172  C CB   . ARG A 1 64  ? 5.320   6.701   9.219   1.00 0.87  ? 1571 ARG A CB   3  
ATOM 7173  C CG   . ARG A 1 64  ? 5.520   6.140   10.631  1.00 1.13  ? 1571 ARG A CG   3  
ATOM 7174  C CD   . ARG A 1 64  ? 4.335   5.293   11.089  1.00 1.32  ? 1571 ARG A CD   3  
ATOM 7175  N NE   . ARG A 1 64  ? 4.685   4.438   12.235  1.00 1.46  ? 1571 ARG A NE   3  
ATOM 7176  C CZ   . ARG A 1 64  ? 4.177   4.525   13.469  1.00 2.01  ? 1571 ARG A CZ   3  
ATOM 7177  N NH1  . ARG A 1 64  ? 3.278   5.451   13.763  1.00 2.62  ? 1571 ARG A NH1  3  
ATOM 7178  N NH2  . ARG A 1 64  ? 4.569   3.675   14.401  1.00 2.24  ? 1571 ARG A NH2  3  
ATOM 7179  H H    . ARG A 1 64  ? 6.420   3.832   8.295   1.00 0.65  ? 1571 ARG A H    3  
ATOM 7180  H HA   . ARG A 1 64  ? 4.420   4.960   8.303   1.00 0.60  ? 1571 ARG A HA   3  
ATOM 7181  H HB2  . ARG A 1 64  ? 6.138   7.372   9.004   1.00 0.98  ? 1571 ARG A HB2  3  
ATOM 7182  H HB3  . ARG A 1 64  ? 4.396   7.262   9.205   1.00 1.02  ? 1571 ARG A HB3  3  
ATOM 7183  H HG2  . ARG A 1 64  ? 6.425   5.557   10.680  1.00 1.78  ? 1571 ARG A HG2  3  
ATOM 7184  H HG3  . ARG A 1 64  ? 5.619   6.978   11.304  1.00 1.61  ? 1571 ARG A HG3  3  
ATOM 7185  H HD2  . ARG A 1 64  ? 3.543   5.962   11.393  1.00 1.83  ? 1571 ARG A HD2  3  
ATOM 7186  H HD3  . ARG A 1 64  ? 3.975   4.673   10.280  1.00 1.89  ? 1571 ARG A HD3  3  
ATOM 7187  H HE   . ARG A 1 64  ? 5.345   3.731   12.029  1.00 1.50  ? 1571 ARG A HE   3  
ATOM 7188  H HH11 . ARG A 1 64  ? 2.940   6.116   13.089  1.00 2.69  ? 1571 ARG A HH11 3  
ATOM 7189  H HH12 . ARG A 1 64  ? 2.876   5.531   14.685  1.00 3.19  ? 1571 ARG A HH12 3  
ATOM 7190  H HH21 . ARG A 1 64  ? 5.243   2.951   14.214  1.00 2.19  ? 1571 ARG A HH21 3  
ATOM 7191  H HH22 . ARG A 1 64  ? 4.236   3.719   15.351  1.00 2.70  ? 1571 ARG A HH22 3  
ATOM 7192  N N    . ILE A 1 65  ? 5.338   5.484   5.685   1.00 0.43  ? 1572 ILE A N    3  
ATOM 7193  C CA   . ILE A 1 65  ? 5.157   5.933   4.320   1.00 0.43  ? 1572 ILE A CA   3  
ATOM 7194  C C    . ILE A 1 65  ? 3.673   5.887   3.953   1.00 0.40  ? 1572 ILE A C    3  
ATOM 7195  O O    . ILE A 1 65  ? 3.007   4.845   4.101   1.00 0.44  ? 1572 ILE A O    3  
ATOM 7196  C CB   . ILE A 1 65  ? 5.977   5.069   3.313   1.00 0.53  ? 1572 ILE A CB   3  
ATOM 7197  C CG1  . ILE A 1 65  ? 7.470   4.999   3.743   1.00 0.65  ? 1572 ILE A CG1  3  
ATOM 7198  C CG2  . ILE A 1 65  ? 5.824   5.600   1.867   1.00 0.60  ? 1572 ILE A CG2  3  
ATOM 7199  C CD1  . ILE A 1 65  ? 8.365   4.233   2.771   1.00 0.92  ? 1572 ILE A CD1  3  
ATOM 7200  H H    . ILE A 1 65  ? 5.717   4.597   5.837   1.00 0.50  ? 1572 ILE A H    3  
ATOM 7201  H HA   . ILE A 1 65  ? 5.494   6.958   4.261   1.00 0.47  ? 1572 ILE A HA   3  
ATOM 7202  H HB   . ILE A 1 65  ? 5.562   4.073   3.333   1.00 0.56  ? 1572 ILE A HB   3  
ATOM 7203  H HG12 . ILE A 1 65  ? 7.905   5.965   3.964   1.00 0.71  ? 1572 ILE A HG12 3  
ATOM 7204  H HG13 . ILE A 1 65  ? 7.488   4.444   4.669   1.00 0.73  ? 1572 ILE A HG13 3  
ATOM 7205  H HG21 . ILE A 1 65  ? 6.421   5.025   1.176   1.00 1.12  ? 1572 ILE A HG21 3  
ATOM 7206  H HG22 . ILE A 1 65  ? 6.101   6.642   1.793   1.00 1.25  ? 1572 ILE A HG22 3  
ATOM 7207  H HG23 . ILE A 1 65  ? 4.789   5.536   1.564   1.00 1.19  ? 1572 ILE A HG23 3  
ATOM 7208  H HD11 . ILE A 1 65  ? 7.969   3.238   2.639   1.00 1.39  ? 1572 ILE A HD11 3  
ATOM 7209  H HD12 . ILE A 1 65  ? 9.368   4.153   3.168   1.00 1.51  ? 1572 ILE A HD12 3  
ATOM 7210  H HD13 . ILE A 1 65  ? 8.386   4.741   1.818   1.00 1.36  ? 1572 ILE A HD13 3  
ATOM 7211  N N    . SER A 1 66  ? 3.180   7.010   3.509   1.00 0.42  ? 1573 SER A N    3  
ATOM 7212  C CA   . SER A 1 66  ? 1.796   7.175   3.111   1.00 0.42  ? 1573 SER A CA   3  
ATOM 7213  C C    . SER A 1 66  ? 1.562   6.501   1.767   1.00 0.33  ? 1573 SER A C    3  
ATOM 7214  O O    . SER A 1 66  ? 2.272   6.776   0.789   1.00 0.41  ? 1573 SER A O    3  
ATOM 7215  C CB   . SER A 1 66  ? 1.452   8.685   3.032   1.00 0.54  ? 1573 SER A CB   3  
ATOM 7216  O OG   . SER A 1 66  ? 0.188   8.923   2.432   1.00 0.80  ? 1573 SER A OG   3  
ATOM 7217  H H    . SER A 1 66  ? 3.821   7.758   3.431   1.00 0.50  ? 1573 SER A H    3  
ATOM 7218  H HA   . SER A 1 66  ? 1.168   6.711   3.856   1.00 0.49  ? 1573 SER A HA   3  
ATOM 7219  H HB2  . SER A 1 66  ? 1.374   9.103   4.028   1.00 0.78  ? 1573 SER A HB2  3  
ATOM 7220  H HB3  . SER A 1 66  ? 2.207   9.208   2.467   1.00 0.96  ? 1573 SER A HB3  3  
ATOM 7221  H HG   . SER A 1 66  ? -0.071  9.814   2.719   1.00 0.71  ? 1573 SER A HG   3  
ATOM 7222  N N    . VAL A 1 67  ? 0.598   5.608   1.702   1.00 0.26  ? 1574 VAL A N    3  
ATOM 7223  C CA   . VAL A 1 67  ? 0.318   4.935   0.452   1.00 0.27  ? 1574 VAL A CA   3  
ATOM 7224  C C    . VAL A 1 67  ? -1.122  5.142   0.002   1.00 0.27  ? 1574 VAL A C    3  
ATOM 7225  O O    . VAL A 1 67  ? -1.638  4.414   -0.855  1.00 0.38  ? 1574 VAL A O    3  
ATOM 7226  C CB   . VAL A 1 67  ? 0.691   3.425   0.462   1.00 0.42  ? 1574 VAL A CB   3  
ATOM 7227  C CG1  . VAL A 1 67  ? 2.163   3.231   0.722   1.00 0.98  ? 1574 VAL A CG1  3  
ATOM 7228  C CG2  . VAL A 1 67  ? -0.113  2.671   1.469   1.00 0.69  ? 1574 VAL A CG2  3  
ATOM 7229  H H    . VAL A 1 67  ? 0.066   5.393   2.503   1.00 0.30  ? 1574 VAL A H    3  
ATOM 7230  H HA   . VAL A 1 67  ? 0.939   5.428   -0.283  1.00 0.30  ? 1574 VAL A HA   3  
ATOM 7231  H HB   . VAL A 1 67  ? 0.475   3.023   -0.518  1.00 0.93  ? 1574 VAL A HB   3  
ATOM 7232  H HG11 . VAL A 1 67  ? 2.380   2.173   0.708   1.00 1.52  ? 1574 VAL A HG11 3  
ATOM 7233  H HG12 . VAL A 1 67  ? 2.404   3.658   1.684   1.00 1.51  ? 1574 VAL A HG12 3  
ATOM 7234  H HG13 . VAL A 1 67  ? 2.729   3.729   -0.051  1.00 1.60  ? 1574 VAL A HG13 3  
ATOM 7235  H HG21 . VAL A 1 67  ? 0.171   1.631   1.460   1.00 1.29  ? 1574 VAL A HG21 3  
ATOM 7236  H HG22 . VAL A 1 67  ? -1.146  2.772   1.176   1.00 1.32  ? 1574 VAL A HG22 3  
ATOM 7237  H HG23 . VAL A 1 67  ? 0.047   3.107   2.444   1.00 1.37  ? 1574 VAL A HG23 3  
ATOM 7238  N N    . GLY A 1 68  ? -1.771  6.128   0.585   1.00 0.23  ? 1575 GLY A N    3  
ATOM 7239  C CA   . GLY A 1 68  ? -3.100  6.457   0.165   1.00 0.27  ? 1575 GLY A CA   3  
ATOM 7240  C C    . GLY A 1 68  ? -3.791  7.395   1.115   1.00 0.24  ? 1575 GLY A C    3  
ATOM 7241  O O    . GLY A 1 68  ? -3.915  7.095   2.309   1.00 0.29  ? 1575 GLY A O    3  
ATOM 7242  H H    . GLY A 1 68  ? -1.359  6.614   1.332   1.00 0.25  ? 1575 GLY A H    3  
ATOM 7243  H HA2  . GLY A 1 68  ? -3.054  6.915   -0.811  1.00 0.33  ? 1575 GLY A HA2  3  
ATOM 7244  H HA3  . GLY A 1 68  ? -3.675  5.546   0.094   1.00 0.34  ? 1575 GLY A HA3  3  
ATOM 7245  N N    . LYS A 1 69  ? -4.229  8.534   0.606   1.00 0.27  ? 1576 LYS A N    3  
ATOM 7246  C CA   . LYS A 1 69  ? -4.961  9.502   1.395   1.00 0.30  ? 1576 LYS A CA   3  
ATOM 7247  C C    . LYS A 1 69  ? -6.358  8.936   1.673   1.00 0.28  ? 1576 LYS A C    3  
ATOM 7248  O O    . LYS A 1 69  ? -6.941  8.261   0.818   1.00 0.33  ? 1576 LYS A O    3  
ATOM 7249  C CB   . LYS A 1 69  ? -5.046  10.860  0.643   1.00 0.42  ? 1576 LYS A CB   3  
ATOM 7250  C CG   . LYS A 1 69  ? -5.861  11.920  1.373   1.00 0.57  ? 1576 LYS A CG   3  
ATOM 7251  C CD   . LYS A 1 69  ? -5.987  13.249  0.615   1.00 0.88  ? 1576 LYS A CD   3  
ATOM 7252  C CE   . LYS A 1 69  ? -4.778  14.182  0.768   1.00 1.39  ? 1576 LYS A CE   3  
ATOM 7253  N NZ   . LYS A 1 69  ? -3.562  13.731  0.076   1.00 2.19  ? 1576 LYS A NZ   3  
ATOM 7254  H H    . LYS A 1 69  ? -4.090  8.743   -0.345  1.00 0.32  ? 1576 LYS A H    3  
ATOM 7255  H HA   . LYS A 1 69  ? -4.447  9.634   2.335   1.00 0.33  ? 1576 LYS A HA   3  
ATOM 7256  H HB2  . LYS A 1 69  ? -4.052  11.250  0.480   1.00 0.46  ? 1576 LYS A HB2  3  
ATOM 7257  H HB3  . LYS A 1 69  ? -5.508  10.689  -0.318  1.00 0.45  ? 1576 LYS A HB3  3  
ATOM 7258  H HG2  . LYS A 1 69  ? -6.853  11.533  1.546   1.00 0.66  ? 1576 LYS A HG2  3  
ATOM 7259  H HG3  . LYS A 1 69  ? -5.385  12.102  2.326   1.00 0.68  ? 1576 LYS A HG3  3  
ATOM 7260  H HD2  . LYS A 1 69  ? -6.110  13.031  -0.435  1.00 1.35  ? 1576 LYS A HD2  3  
ATOM 7261  H HD3  . LYS A 1 69  ? -6.871  13.759  0.971   1.00 1.58  ? 1576 LYS A HD3  3  
ATOM 7262  H HE2  . LYS A 1 69  ? -5.043  15.150  0.371   1.00 1.83  ? 1576 LYS A HE2  3  
ATOM 7263  H HE3  . LYS A 1 69  ? -4.568  14.287  1.823   1.00 2.02  ? 1576 LYS A HE3  3  
ATOM 7264  H HZ1  . LYS A 1 69  ? -3.153  12.845  0.444   1.00 2.66  ? 1576 LYS A HZ1  3  
ATOM 7265  H HZ2  . LYS A 1 69  ? -2.839  14.476  0.175   1.00 2.68  ? 1576 LYS A HZ2  3  
ATOM 7266  H HZ3  . LYS A 1 69  ? -3.734  13.647  -0.949  1.00 2.63  ? 1576 LYS A HZ3  3  
ATOM 7267  N N    . ALA A 1 70  ? -6.860  9.182   2.870   1.00 0.27  ? 1577 ALA A N    3  
ATOM 7268  C CA   . ALA A 1 70  ? -8.149  8.680   3.307   1.00 0.30  ? 1577 ALA A CA   3  
ATOM 7269  C C    . ALA A 1 70  ? -9.277  9.418   2.623   1.00 0.32  ? 1577 ALA A C    3  
ATOM 7270  O O    . ALA A 1 70  ? -9.778  10.436  3.124   1.00 0.61  ? 1577 ALA A O    3  
ATOM 7271  C CB   . ALA A 1 70  ? -8.283  8.802   4.813   1.00 0.38  ? 1577 ALA A CB   3  
ATOM 7272  H H    . ALA A 1 70  ? -6.352  9.757   3.490   1.00 0.28  ? 1577 ALA A H    3  
ATOM 7273  H HA   . ALA A 1 70  ? -8.207  7.633   3.045   1.00 0.33  ? 1577 ALA A HA   3  
ATOM 7274  H HB1  . ALA A 1 70  ? -8.247  9.843   5.092   1.00 1.08  ? 1577 ALA A HB1  3  
ATOM 7275  H HB2  . ALA A 1 70  ? -7.472  8.271   5.290   1.00 1.00  ? 1577 ALA A HB2  3  
ATOM 7276  H HB3  . ALA A 1 70  ? -9.225  8.377   5.127   1.00 1.07  ? 1577 ALA A HB3  3  
ATOM 7277  N N    . ASN A 1 71  ? -9.655  8.927   1.491   1.00 0.43  ? 1578 ASN A N    3  
ATOM 7278  C CA   . ASN A 1 71  ? -10.732 9.501   0.721   1.00 0.54  ? 1578 ASN A CA   3  
ATOM 7279  C C    . ASN A 1 71  ? -11.880 8.550   0.787   1.00 0.48  ? 1578 ASN A C    3  
ATOM 7280  O O    . ASN A 1 71  ? -11.689 7.353   0.867   1.00 0.51  ? 1578 ASN A O    3  
ATOM 7281  C CB   . ASN A 1 71  ? -10.335 9.724   -0.769  1.00 0.73  ? 1578 ASN A CB   3  
ATOM 7282  C CG   . ASN A 1 71  ? -9.125  10.651  -0.976  1.00 1.15  ? 1578 ASN A CG   3  
ATOM 7283  O OD1  . ASN A 1 71  ? -8.853  11.533  -0.143  1.00 1.95  ? 1578 ASN A OD1  3  
ATOM 7284  N ND2  . ASN A 1 71  ? -8.430  10.536  -2.120  1.00 1.31  ? 1578 ASN A ND2  3  
ATOM 7285  H H    . ASN A 1 71  ? -9.208  8.115   1.168   1.00 0.67  ? 1578 ASN A H    3  
ATOM 7286  H HA   . ASN A 1 71  ? -11.047 10.434  1.164   1.00 0.69  ? 1578 ASN A HA   3  
ATOM 7287  H HB2  . ASN A 1 71  ? -10.110 8.751   -1.180  1.00 1.16  ? 1578 ASN A HB2  3  
ATOM 7288  H HB3  . ASN A 1 71  ? -11.189 10.142  -1.282  1.00 1.31  ? 1578 ASN A HB3  3  
ATOM 7289  H HD21 . ASN A 1 71  ? -8.648  9.911   -2.845  1.00 1.28  ? 1578 ASN A HD21 3  
ATOM 7290  H HD22 . ASN A 1 71  ? -7.637  11.116  -2.214  1.00 1.88  ? 1578 ASN A HD22 3  
ATOM 7291  N N    . LYS A 1 72  ? -13.057 9.053   0.698   1.00 0.56  ? 1579 LYS A N    3  
ATOM 7292  C CA   . LYS A 1 72  ? -14.234 8.230   0.802   1.00 0.61  ? 1579 LYS A CA   3  
ATOM 7293  C C    . LYS A 1 72  ? -14.770 8.095   -0.575  1.00 0.63  ? 1579 LYS A C    3  
ATOM 7294  O O    . LYS A 1 72  ? -15.963 8.239   -0.839  1.00 0.80  ? 1579 LYS A O    3  
ATOM 7295  C CB   . LYS A 1 72  ? -15.260 8.876   1.718   1.00 0.80  ? 1579 LYS A CB   3  
ATOM 7296  C CG   . LYS A 1 72  ? -14.756 9.128   3.126   1.00 1.30  ? 1579 LYS A CG   3  
ATOM 7297  C CD   . LYS A 1 72  ? -15.819 9.780   3.982   1.00 1.42  ? 1579 LYS A CD   3  
ATOM 7298  C CE   . LYS A 1 72  ? -16.256 11.124  3.413   1.00 2.07  ? 1579 LYS A CE   3  
ATOM 7299  N NZ   . LYS A 1 72  ? -17.338 11.742  4.199   1.00 2.68  ? 1579 LYS A NZ   3  
ATOM 7300  H H    . LYS A 1 72  ? -13.170 10.001  0.461   1.00 0.65  ? 1579 LYS A H    3  
ATOM 7301  H HA   . LYS A 1 72  ? -13.949 7.260   1.184   1.00 0.61  ? 1579 LYS A HA   3  
ATOM 7302  H HB2  . LYS A 1 72  ? -15.565 9.821   1.293   1.00 1.24  ? 1579 LYS A HB2  3  
ATOM 7303  H HB3  . LYS A 1 72  ? -16.123 8.231   1.782   1.00 1.20  ? 1579 LYS A HB3  3  
ATOM 7304  H HG2  . LYS A 1 72  ? -14.478 8.185   3.574   1.00 1.84  ? 1579 LYS A HG2  3  
ATOM 7305  H HG3  . LYS A 1 72  ? -13.894 9.777   3.077   1.00 1.78  ? 1579 LYS A HG3  3  
ATOM 7306  H HD2  . LYS A 1 72  ? -16.670 9.120   4.044   1.00 1.78  ? 1579 LYS A HD2  3  
ATOM 7307  H HD3  . LYS A 1 72  ? -15.379 9.937   4.955   1.00 1.75  ? 1579 LYS A HD3  3  
ATOM 7308  H HE2  . LYS A 1 72  ? -15.407 11.792  3.409   1.00 2.51  ? 1579 LYS A HE2  3  
ATOM 7309  H HE3  . LYS A 1 72  ? -16.594 10.976  2.398   1.00 2.58  ? 1579 LYS A HE3  3  
ATOM 7310  H HZ1  . LYS A 1 72  ? -17.637 12.639  3.762   1.00 3.11  ? 1579 LYS A HZ1  3  
ATOM 7311  H HZ2  . LYS A 1 72  ? -17.050 11.982  5.173   1.00 3.11  ? 1579 LYS A HZ2  3  
ATOM 7312  H HZ3  . LYS A 1 72  ? -18.184 11.130  4.253   1.00 2.98  ? 1579 LYS A HZ3  3  
ATOM 7313  N N    . ARG A 1 73  ? -13.865 7.825   -1.460  1.00 0.58  ? 1580 ARG A N    3  
ATOM 7314  C CA   . ARG A 1 73  ? -14.155 7.793   -2.841  1.00 0.65  ? 1580 ARG A CA   3  
ATOM 7315  C C    . ARG A 1 73  ? -14.692 6.424   -3.194  1.00 0.57  ? 1580 ARG A C    3  
ATOM 7316  O O    . ARG A 1 73  ? -13.981 5.561   -3.720  1.00 0.61  ? 1580 ARG A O    3  
ATOM 7317  C CB   . ARG A 1 73  ? -12.917 8.170   -3.664  1.00 0.82  ? 1580 ARG A CB   3  
ATOM 7318  C CG   . ARG A 1 73  ? -13.275 8.639   -5.033  1.00 0.97  ? 1580 ARG A CG   3  
ATOM 7319  C CD   . ARG A 1 73  ? -12.079 9.125   -5.812  1.00 1.18  ? 1580 ARG A CD   3  
ATOM 7320  N NE   . ARG A 1 73  ? -12.481 9.589   -7.148  1.00 1.84  ? 1580 ARG A NE   3  
ATOM 7321  C CZ   . ARG A 1 73  ? -11.703 10.243  -8.017  1.00 2.52  ? 1580 ARG A CZ   3  
ATOM 7322  N NH1  . ARG A 1 73  ? -10.515 10.710  -7.646  1.00 2.72  ? 1580 ARG A NH1  3  
ATOM 7323  N NH2  . ARG A 1 73  ? -12.164 10.494  -9.227  1.00 3.47  ? 1580 ARG A NH2  3  
ATOM 7324  H H    . ARG A 1 73  ? -12.976 7.603   -1.118  1.00 0.57  ? 1580 ARG A H    3  
ATOM 7325  H HA   . ARG A 1 73  ? -14.932 8.523   -3.015  1.00 0.73  ? 1580 ARG A HA   3  
ATOM 7326  H HB2  . ARG A 1 73  ? -12.376 8.973   -3.182  1.00 0.91  ? 1580 ARG A HB2  3  
ATOM 7327  H HB3  . ARG A 1 73  ? -12.273 7.310   -3.769  1.00 0.81  ? 1580 ARG A HB3  3  
ATOM 7328  H HG2  . ARG A 1 73  ? -13.768 7.843   -5.568  1.00 1.23  ? 1580 ARG A HG2  3  
ATOM 7329  H HG3  . ARG A 1 73  ? -13.959 9.463   -4.885  1.00 1.23  ? 1580 ARG A HG3  3  
ATOM 7330  H HD2  . ARG A 1 73  ? -11.617 9.937   -5.269  1.00 1.51  ? 1580 ARG A HD2  3  
ATOM 7331  H HD3  . ARG A 1 73  ? -11.374 8.312   -5.916  1.00 1.74  ? 1580 ARG A HD3  3  
ATOM 7332  H HE   . ARG A 1 73  ? -13.403 9.364   -7.418  1.00 2.25  ? 1580 ARG A HE   3  
ATOM 7333  H HH11 . ARG A 1 73  ? -10.161 10.606  -6.710  1.00 2.59  ? 1580 ARG A HH11 3  
ATOM 7334  H HH12 . ARG A 1 73  ? -9.907  11.194  -8.292  1.00 3.38  ? 1580 ARG A HH12 3  
ATOM 7335  H HH21 . ARG A 1 73  ? -13.089 10.219  -9.507  1.00 3.87  ? 1580 ARG A HH21 3  
ATOM 7336  H HH22 . ARG A 1 73  ? -11.619 10.930  -9.952  1.00 4.04  ? 1580 ARG A HH22 3  
ATOM 7337  N N    . LEU A 1 74  ? -15.935 6.240   -2.832  1.00 0.55  ? 1581 LEU A N    3  
ATOM 7338  C CA   . LEU A 1 74  ? -16.662 4.996   -3.035  1.00 0.49  ? 1581 LEU A CA   3  
ATOM 7339  C C    . LEU A 1 74  ? -17.171 4.953   -4.461  1.00 0.46  ? 1581 LEU A C    3  
ATOM 7340  O O    . LEU A 1 74  ? -17.781 5.917   -4.949  1.00 0.51  ? 1581 LEU A O    3  
ATOM 7341  C CB   . LEU A 1 74  ? -17.887 4.920   -2.074  1.00 0.52  ? 1581 LEU A CB   3  
ATOM 7342  C CG   . LEU A 1 74  ? -18.476 3.526   -1.719  1.00 0.51  ? 1581 LEU A CG   3  
ATOM 7343  C CD1  . LEU A 1 74  ? -18.857 2.699   -2.914  1.00 0.64  ? 1581 LEU A CD1  3  
ATOM 7344  C CD2  . LEU A 1 74  ? -17.584 2.749   -0.808  1.00 0.61  ? 1581 LEU A CD2  3  
ATOM 7345  H H    . LEU A 1 74  ? -16.342 7.011   -2.376  1.00 0.66  ? 1581 LEU A H    3  
ATOM 7346  H HA   . LEU A 1 74  ? -15.999 4.168   -2.832  1.00 0.49  ? 1581 LEU A HA   3  
ATOM 7347  H HB2  . LEU A 1 74  ? -17.630 5.399   -1.143  1.00 0.57  ? 1581 LEU A HB2  3  
ATOM 7348  H HB3  . LEU A 1 74  ? -18.708 5.466   -2.526  1.00 0.54  ? 1581 LEU A HB3  3  
ATOM 7349  H HG   . LEU A 1 74  ? -19.400 3.696   -1.191  1.00 0.80  ? 1581 LEU A HG   3  
ATOM 7350  H HD11 . LEU A 1 74  ? -19.594 3.229   -3.499  1.00 1.25  ? 1581 LEU A HD11 3  
ATOM 7351  H HD12 . LEU A 1 74  ? -19.287 1.774   -2.565  1.00 1.20  ? 1581 LEU A HD12 3  
ATOM 7352  H HD13 . LEU A 1 74  ? -17.993 2.481   -3.524  1.00 1.28  ? 1581 LEU A HD13 3  
ATOM 7353  H HD21 . LEU A 1 74  ? -18.108 1.822   -0.630  1.00 1.32  ? 1581 LEU A HD21 3  
ATOM 7354  H HD22 . LEU A 1 74  ? -17.469 3.291   0.120   1.00 1.16  ? 1581 LEU A HD22 3  
ATOM 7355  H HD23 . LEU A 1 74  ? -16.633 2.556   -1.279  1.00 1.21  ? 1581 LEU A HD23 3  
ATOM 7356  N N    . ARG A 1 75  ? -16.877 3.896   -5.136  1.00 0.43  ? 1582 ARG A N    3  
ATOM 7357  C CA   . ARG A 1 75  ? -17.439 3.669   -6.437  1.00 0.43  ? 1582 ARG A CA   3  
ATOM 7358  C C    . ARG A 1 75  ? -18.096 2.286   -6.496  1.00 0.39  ? 1582 ARG A C    3  
ATOM 7359  O O    . ARG A 1 75  ? -17.575 1.323   -5.904  1.00 0.40  ? 1582 ARG A O    3  
ATOM 7360  C CB   . ARG A 1 75  ? -16.393 3.859   -7.546  1.00 0.51  ? 1582 ARG A CB   3  
ATOM 7361  C CG   . ARG A 1 75  ? -15.220 2.893   -7.496  1.00 0.85  ? 1582 ARG A CG   3  
ATOM 7362  C CD   . ARG A 1 75  ? -14.167 3.281   -8.511  1.00 0.89  ? 1582 ARG A CD   3  
ATOM 7363  N NE   . ARG A 1 75  ? -13.661 4.636   -8.238  1.00 1.42  ? 1582 ARG A NE   3  
ATOM 7364  C CZ   . ARG A 1 75  ? -12.487 5.135   -8.624  1.00 1.83  ? 1582 ARG A CZ   3  
ATOM 7365  N NH1  . ARG A 1 75  ? -11.645 4.420   -9.380  1.00 1.54  ? 1582 ARG A NH1  3  
ATOM 7366  N NH2  . ARG A 1 75  ? -12.177 6.365   -8.263  1.00 2.85  ? 1582 ARG A NH2  3  
ATOM 7367  H H    . ARG A 1 75  ? -16.273 3.239   -4.723  1.00 0.43  ? 1582 ARG A H    3  
ATOM 7368  H HA   . ARG A 1 75  ? -18.205 4.426   -6.531  1.00 0.44  ? 1582 ARG A HA   3  
ATOM 7369  H HB2  . ARG A 1 75  ? -16.862 3.755   -8.513  1.00 0.85  ? 1582 ARG A HB2  3  
ATOM 7370  H HB3  . ARG A 1 75  ? -15.997 4.861   -7.468  1.00 0.77  ? 1582 ARG A HB3  3  
ATOM 7371  H HG2  . ARG A 1 75  ? -14.784 2.920   -6.508  1.00 1.16  ? 1582 ARG A HG2  3  
ATOM 7372  H HG3  . ARG A 1 75  ? -15.572 1.896   -7.712  1.00 1.23  ? 1582 ARG A HG3  3  
ATOM 7373  H HD2  . ARG A 1 75  ? -13.358 2.567   -8.461  1.00 1.48  ? 1582 ARG A HD2  3  
ATOM 7374  H HD3  . ARG A 1 75  ? -14.605 3.255   -9.498  1.00 1.27  ? 1582 ARG A HD3  3  
ATOM 7375  H HE   . ARG A 1 75  ? -14.256 5.220   -7.706  1.00 1.90  ? 1582 ARG A HE   3  
ATOM 7376  H HH11 . ARG A 1 75  ? -11.857 3.486   -9.698  1.00 1.41  ? 1582 ARG A HH11 3  
ATOM 7377  H HH12 . ARG A 1 75  ? -10.747 4.777   -9.668  1.00 1.89  ? 1582 ARG A HH12 3  
ATOM 7378  H HH21 . ARG A 1 75  ? -12.818 6.909   -7.716  1.00 3.40  ? 1582 ARG A HH21 3  
ATOM 7379  H HH22 . ARG A 1 75  ? -11.294 6.793   -8.507  1.00 3.24  ? 1582 ARG A HH22 3  
ATOM 7380  N N    . TYR A 1 76  ? -19.231 2.185   -7.162  1.00 0.41  ? 1583 TYR A N    3  
ATOM 7381  C CA   . TYR A 1 76  ? -19.879 0.915   -7.358  1.00 0.41  ? 1583 TYR A CA   3  
ATOM 7382  C C    . TYR A 1 76  ? -19.535 0.460   -8.741  1.00 0.47  ? 1583 TYR A C    3  
ATOM 7383  O O    . TYR A 1 76  ? -20.043 0.998   -9.735  1.00 0.57  ? 1583 TYR A O    3  
ATOM 7384  C CB   . TYR A 1 76  ? -21.401 1.028   -7.186  1.00 0.50  ? 1583 TYR A CB   3  
ATOM 7385  C CG   . TYR A 1 76  ? -22.178 -0.285  -7.369  1.00 0.54  ? 1583 TYR A CG   3  
ATOM 7386  C CD1  . TYR A 1 76  ? -22.530 -0.754  -8.640  1.00 0.78  ? 1583 TYR A CD1  3  
ATOM 7387  C CD2  . TYR A 1 76  ? -22.577 -1.038  -6.270  1.00 0.56  ? 1583 TYR A CD2  3  
ATOM 7388  C CE1  . TYR A 1 76  ? -23.241 -1.923  -8.798  1.00 0.86  ? 1583 TYR A CE1  3  
ATOM 7389  C CE2  . TYR A 1 76  ? -23.291 -2.213  -6.429  1.00 0.65  ? 1583 TYR A CE2  3  
ATOM 7390  C CZ   . TYR A 1 76  ? -23.620 -2.647  -7.694  1.00 0.74  ? 1583 TYR A CZ   3  
ATOM 7391  O OH   . TYR A 1 76  ? -24.315 -3.829  -7.863  1.00 0.84  ? 1583 TYR A OH   3  
ATOM 7392  H H    . TYR A 1 76  ? -19.641 2.983   -7.573  1.00 0.47  ? 1583 TYR A H    3  
ATOM 7393  H HA   . TYR A 1 76  ? -19.474 0.210   -6.648  1.00 0.36  ? 1583 TYR A HA   3  
ATOM 7394  H HB2  . TYR A 1 76  ? -21.578 1.363   -6.177  1.00 0.49  ? 1583 TYR A HB2  3  
ATOM 7395  H HB3  . TYR A 1 76  ? -21.792 1.763   -7.874  1.00 0.58  ? 1583 TYR A HB3  3  
ATOM 7396  H HD1  . TYR A 1 76  ? -22.228 -0.202  -9.520  1.00 0.99  ? 1583 TYR A HD1  3  
ATOM 7397  H HD2  . TYR A 1 76  ? -22.320 -0.701  -5.276  1.00 0.69  ? 1583 TYR A HD2  3  
ATOM 7398  H HE1  . TYR A 1 76  ? -23.505 -2.265  -9.787  1.00 1.10  ? 1583 TYR A HE1  3  
ATOM 7399  H HE2  . TYR A 1 76  ? -23.591 -2.784  -5.563  1.00 0.79  ? 1583 TYR A HE2  3  
ATOM 7400  H HH   . TYR A 1 76  ? -24.955 -3.957  -7.154  1.00 1.26  ? 1583 TYR A HH   3  
ATOM 7401  N N    . VAL A 1 77  ? -18.674 -0.487  -8.820  1.00 0.45  ? 1584 VAL A N    3  
ATOM 7402  C CA   . VAL A 1 77  ? -18.196 -0.944  -10.091 1.00 0.54  ? 1584 VAL A CA   3  
ATOM 7403  C C    . VAL A 1 77  ? -18.300 -2.477  -10.203 1.00 0.59  ? 1584 VAL A C    3  
ATOM 7404  O O    . VAL A 1 77  ? -17.483 -3.213  -9.677  1.00 0.57  ? 1584 VAL A O    3  
ATOM 7405  C CB   . VAL A 1 77  ? -16.746 -0.383  -10.377 1.00 0.58  ? 1584 VAL A CB   3  
ATOM 7406  C CG1  . VAL A 1 77  ? -15.749 -0.764  -9.293  1.00 1.05  ? 1584 VAL A CG1  3  
ATOM 7407  C CG2  . VAL A 1 77  ? -16.242 -0.797  -11.739 1.00 1.03  ? 1584 VAL A CG2  3  
ATOM 7408  H H    . VAL A 1 77  ? -18.352 -0.901  -7.985  1.00 0.40  ? 1584 VAL A H    3  
ATOM 7409  H HA   . VAL A 1 77  ? -18.873 -0.546  -10.834 1.00 0.59  ? 1584 VAL A HA   3  
ATOM 7410  H HB   . VAL A 1 77  ? -16.791 0.698   -10.347 1.00 1.00  ? 1584 VAL A HB   3  
ATOM 7411  H HG11 . VAL A 1 77  ? -14.779 -0.357  -9.542  1.00 1.57  ? 1584 VAL A HG11 3  
ATOM 7412  H HG12 . VAL A 1 77  ? -15.690 -1.840  -9.228  1.00 1.71  ? 1584 VAL A HG12 3  
ATOM 7413  H HG13 . VAL A 1 77  ? -16.089 -0.353  -8.355  1.00 1.47  ? 1584 VAL A HG13 3  
ATOM 7414  H HG21 . VAL A 1 77  ? -15.256 -0.377  -11.878 1.00 1.59  ? 1584 VAL A HG21 3  
ATOM 7415  H HG22 . VAL A 1 77  ? -16.927 -0.433  -12.491 1.00 1.63  ? 1584 VAL A HG22 3  
ATOM 7416  H HG23 . VAL A 1 77  ? -16.188 -1.873  -11.775 1.00 1.49  ? 1584 VAL A HG23 3  
ATOM 7417  N N    . ASP A 1 78  ? -19.378 -2.924  -10.839 1.00 0.69  ? 1585 ASP A N    3  
ATOM 7418  C CA   . ASP A 1 78  ? -19.679 -4.361  -11.061 1.00 0.78  ? 1585 ASP A CA   3  
ATOM 7419  C C    . ASP A 1 78  ? -19.903 -5.083  -9.725  1.00 0.71  ? 1585 ASP A C    3  
ATOM 7420  O O    . ASP A 1 78  ? -19.279 -6.078  -9.408  1.00 0.70  ? 1585 ASP A O    3  
ATOM 7421  C CB   . ASP A 1 78  ? -18.603 -5.058  -11.947 1.00 0.88  ? 1585 ASP A CB   3  
ATOM 7422  C CG   . ASP A 1 78  ? -18.909 -6.512  -12.216 1.00 1.04  ? 1585 ASP A CG   3  
ATOM 7423  O OD1  . ASP A 1 78  ? -19.978 -6.818  -12.778 1.00 1.17  ? 1585 ASP A OD1  3  
ATOM 7424  O OD2  . ASP A 1 78  ? -18.060 -7.387  -11.910 1.00 1.11  ? 1585 ASP A OD2  3  
ATOM 7425  H H    . ASP A 1 78  ? -20.014 -2.252  -11.183 1.00 0.73  ? 1585 ASP A H    3  
ATOM 7426  H HA   . ASP A 1 78  ? -20.630 -4.378  -11.575 1.00 0.88  ? 1585 ASP A HA   3  
ATOM 7427  H HB2  . ASP A 1 78  ? -18.542 -4.567  -12.907 1.00 0.95  ? 1585 ASP A HB2  3  
ATOM 7428  H HB3  . ASP A 1 78  ? -17.645 -4.996  -11.453 1.00 0.83  ? 1585 ASP A HB3  3  
ATOM 7429  N N    . GLN A 1 79  ? -20.755 -4.461  -8.914  1.00 0.72  ? 1586 GLN A N    3  
ATOM 7430  C CA   . GLN A 1 79  ? -21.189 -4.904  -7.548  1.00 0.73  ? 1586 GLN A CA   3  
ATOM 7431  C C    . GLN A 1 79  ? -20.031 -4.886  -6.577  1.00 0.59  ? 1586 GLN A C    3  
ATOM 7432  O O    . GLN A 1 79  ? -20.116 -5.354  -5.446  1.00 0.65  ? 1586 GLN A O    3  
ATOM 7433  C CB   . GLN A 1 79  ? -21.969 -6.260  -7.496  1.00 0.90  ? 1586 GLN A CB   3  
ATOM 7434  C CG   . GLN A 1 79  ? -21.133 -7.535  -7.532  1.00 0.98  ? 1586 GLN A CG   3  
ATOM 7435  C CD   . GLN A 1 79  ? -21.966 -8.792  -7.375  1.00 1.23  ? 1586 GLN A CD   3  
ATOM 7436  O OE1  . GLN A 1 79  ? -21.606 -9.857  -7.873  1.00 1.61  ? 1586 GLN A OE1  3  
ATOM 7437  N NE2  . GLN A 1 79  ? -23.090 -8.691  -6.719  1.00 1.86  ? 1586 GLN A NE2  3  
ATOM 7438  H H    . GLN A 1 79  ? -21.102 -3.607  -9.242  1.00 0.77  ? 1586 GLN A H    3  
ATOM 7439  H HA   . GLN A 1 79  ? -21.842 -4.109  -7.214  1.00 0.80  ? 1586 GLN A HA   3  
ATOM 7440  H HB2  . GLN A 1 79  ? -22.539 -6.283  -6.579  1.00 0.93  ? 1586 GLN A HB2  3  
ATOM 7441  H HB3  . GLN A 1 79  ? -22.667 -6.290  -8.321  1.00 1.05  ? 1586 GLN A HB3  3  
ATOM 7442  H HG2  . GLN A 1 79  ? -20.612 -7.584  -8.477  1.00 1.03  ? 1586 GLN A HG2  3  
ATOM 7443  H HG3  . GLN A 1 79  ? -20.412 -7.494  -6.727  1.00 0.92  ? 1586 GLN A HG3  3  
ATOM 7444  H HE21 . GLN A 1 79  ? -23.387 -7.829  -6.345  1.00 2.43  ? 1586 GLN A HE21 3  
ATOM 7445  H HE22 . GLN A 1 79  ? -23.642 -9.492  -6.599  1.00 2.04  ? 1586 GLN A HE22 3  
ATOM 7446  N N    . VAL A 1 80  ? -18.966 -4.330  -7.034  1.00 0.48  ? 1587 VAL A N    3  
ATOM 7447  C CA   . VAL A 1 80  ? -17.786 -4.191  -6.286  1.00 0.39  ? 1587 VAL A CA   3  
ATOM 7448  C C    . VAL A 1 80  ? -17.765 -2.812  -5.688  1.00 0.32  ? 1587 VAL A C    3  
ATOM 7449  O O    . VAL A 1 80  ? -17.907 -1.801  -6.399  1.00 0.33  ? 1587 VAL A O    3  
ATOM 7450  C CB   . VAL A 1 80  ? -16.525 -4.467  -7.162  1.00 0.41  ? 1587 VAL A CB   3  
ATOM 7451  C CG1  . VAL A 1 80  ? -15.267 -3.995  -6.484  1.00 0.37  ? 1587 VAL A CG1  3  
ATOM 7452  C CG2  . VAL A 1 80  ? -16.404 -5.957  -7.478  1.00 0.49  ? 1587 VAL A CG2  3  
ATOM 7453  H H    . VAL A 1 80  ? -18.989 -3.984  -7.949  1.00 0.53  ? 1587 VAL A H    3  
ATOM 7454  H HA   . VAL A 1 80  ? -17.829 -4.921  -5.489  1.00 0.42  ? 1587 VAL A HA   3  
ATOM 7455  H HB   . VAL A 1 80  ? -16.632 -3.941  -8.099  1.00 0.45  ? 1587 VAL A HB   3  
ATOM 7456  H HG11 . VAL A 1 80  ? -15.370 -2.936  -6.298  1.00 1.01  ? 1587 VAL A HG11 3  
ATOM 7457  H HG12 . VAL A 1 80  ? -14.429 -4.173  -7.142  1.00 1.02  ? 1587 VAL A HG12 3  
ATOM 7458  H HG13 . VAL A 1 80  ? -15.135 -4.526  -5.555  1.00 1.09  ? 1587 VAL A HG13 3  
ATOM 7459  H HG21 . VAL A 1 80  ? -15.522 -6.125  -8.078  1.00 1.13  ? 1587 VAL A HG21 3  
ATOM 7460  H HG22 . VAL A 1 80  ? -17.272 -6.303  -8.020  1.00 1.07  ? 1587 VAL A HG22 3  
ATOM 7461  H HG23 . VAL A 1 80  ? -16.312 -6.513  -6.555  1.00 1.16  ? 1587 VAL A HG23 3  
ATOM 7462  N N    . LEU A 1 81  ? -17.665 -2.783  -4.396  1.00 0.28  ? 1588 LEU A N    3  
ATOM 7463  C CA   . LEU A 1 81  ? -17.627 -1.567  -3.643  1.00 0.25  ? 1588 LEU A CA   3  
ATOM 7464  C C    . LEU A 1 81  ? -16.183 -1.222  -3.463  1.00 0.24  ? 1588 LEU A C    3  
ATOM 7465  O O    . LEU A 1 81  ? -15.462 -1.902  -2.735  1.00 0.28  ? 1588 LEU A O    3  
ATOM 7466  C CB   . LEU A 1 81  ? -18.331 -1.750  -2.274  1.00 0.28  ? 1588 LEU A CB   3  
ATOM 7467  C CG   . LEU A 1 81  ? -19.883 -1.901  -2.259  1.00 0.30  ? 1588 LEU A CG   3  
ATOM 7468  C CD1  . LEU A 1 81  ? -20.540 -0.654  -2.738  1.00 0.29  ? 1588 LEU A CD1  3  
ATOM 7469  C CD2  . LEU A 1 81  ? -20.376 -3.062  -3.090  1.00 0.36  ? 1588 LEU A CD2  3  
ATOM 7470  H H    . LEU A 1 81  ? -17.582 -3.631  -3.910  1.00 0.30  ? 1588 LEU A H    3  
ATOM 7471  H HA   . LEU A 1 81  ? -18.121 -0.792  -4.211  1.00 0.23  ? 1588 LEU A HA   3  
ATOM 7472  H HB2  . LEU A 1 81  ? -17.914 -2.628  -1.803  1.00 0.34  ? 1588 LEU A HB2  3  
ATOM 7473  H HB3  . LEU A 1 81  ? -18.074 -0.889  -1.674  1.00 0.29  ? 1588 LEU A HB3  3  
ATOM 7474  H HG   . LEU A 1 81  ? -20.197 -2.061  -1.238  1.00 0.34  ? 1588 LEU A HG   3  
ATOM 7475  H HD11 . LEU A 1 81  ? -20.360 0.126   -2.015  1.00 1.02  ? 1588 LEU A HD11 3  
ATOM 7476  H HD12 . LEU A 1 81  ? -21.597 -0.842  -2.851  1.00 1.04  ? 1588 LEU A HD12 3  
ATOM 7477  H HD13 . LEU A 1 81  ? -20.127 -0.372  -3.694  1.00 1.06  ? 1588 LEU A HD13 3  
ATOM 7478  H HD21 . LEU A 1 81  ? -19.920 -3.973  -2.747  1.00 0.97  ? 1588 LEU A HD21 3  
ATOM 7479  H HD22 . LEU A 1 81  ? -20.103 -2.889  -4.121  1.00 1.00  ? 1588 LEU A HD22 3  
ATOM 7480  H HD23 . LEU A 1 81  ? -21.449 -3.131  -3.003  1.00 1.11  ? 1588 LEU A HD23 3  
ATOM 7481  N N    . GLN A 1 82  ? -15.740 -0.222  -4.147  1.00 0.24  ? 1589 GLN A N    3  
ATOM 7482  C CA   . GLN A 1 82  ? -14.349 0.069   -4.153  1.00 0.25  ? 1589 GLN A CA   3  
ATOM 7483  C C    . GLN A 1 82  ? -14.026 1.451   -3.639  1.00 0.24  ? 1589 GLN A C    3  
ATOM 7484  O O    . GLN A 1 82  ? -14.578 2.454   -4.102  1.00 0.36  ? 1589 GLN A O    3  
ATOM 7485  C CB   . GLN A 1 82  ? -13.785 -0.210  -5.546  1.00 0.39  ? 1589 GLN A CB   3  
ATOM 7486  C CG   . GLN A 1 82  ? -12.307 0.047   -5.741  1.00 0.48  ? 1589 GLN A CG   3  
ATOM 7487  C CD   . GLN A 1 82  ? -11.813 -0.625  -7.003  1.00 0.75  ? 1589 GLN A CD   3  
ATOM 7488  O OE1  . GLN A 1 82  ? -11.432 -1.793  -6.976  1.00 1.74  ? 1589 GLN A OE1  3  
ATOM 7489  N NE2  . GLN A 1 82  ? -11.787 0.087   -8.102  1.00 0.66  ? 1589 GLN A NE2  3  
ATOM 7490  H H    . GLN A 1 82  ? -16.360 0.336   -4.668  1.00 0.27  ? 1589 GLN A H    3  
ATOM 7491  H HA   . GLN A 1 82  ? -13.889 -0.636  -3.478  1.00 0.30  ? 1589 GLN A HA   3  
ATOM 7492  H HB2  . GLN A 1 82  ? -13.924 -1.266  -5.721  1.00 0.50  ? 1589 GLN A HB2  3  
ATOM 7493  H HB3  . GLN A 1 82  ? -14.341 0.356   -6.280  1.00 0.46  ? 1589 GLN A HB3  3  
ATOM 7494  H HG2  . GLN A 1 82  ? -12.171 1.115   -5.838  1.00 0.53  ? 1589 GLN A HG2  3  
ATOM 7495  H HG3  . GLN A 1 82  ? -11.724 -0.293  -4.901  1.00 0.66  ? 1589 GLN A HG3  3  
ATOM 7496  H HE21 . GLN A 1 82  ? -12.076 1.022   -8.114  1.00 1.25  ? 1589 GLN A HE21 3  
ATOM 7497  H HE22 . GLN A 1 82  ? -11.456 -0.365  -8.913  1.00 0.79  ? 1589 GLN A HE22 3  
ATOM 7498  N N    . LEU A 1 83  ? -13.166 1.461   -2.656  1.00 0.25  ? 1590 LEU A N    3  
ATOM 7499  C CA   . LEU A 1 83  ? -12.625 2.649   -2.034  1.00 0.30  ? 1590 LEU A CA   3  
ATOM 7500  C C    . LEU A 1 83  ? -11.242 2.853   -2.588  1.00 0.30  ? 1590 LEU A C    3  
ATOM 7501  O O    . LEU A 1 83  ? -10.414 1.930   -2.555  1.00 0.37  ? 1590 LEU A O    3  
ATOM 7502  C CB   . LEU A 1 83  ? -12.507 2.442   -0.511  1.00 0.37  ? 1590 LEU A CB   3  
ATOM 7503  C CG   . LEU A 1 83  ? -13.730 2.730   0.344   1.00 0.41  ? 1590 LEU A CG   3  
ATOM 7504  C CD1  . LEU A 1 83  ? -13.501 2.194   1.736   1.00 0.56  ? 1590 LEU A CD1  3  
ATOM 7505  C CD2  . LEU A 1 83  ? -13.938 4.223   0.433   1.00 0.72  ? 1590 LEU A CD2  3  
ATOM 7506  H H    . LEU A 1 83  ? -12.828 0.592   -2.342  1.00 0.30  ? 1590 LEU A H    3  
ATOM 7507  H HA   . LEU A 1 83  ? -13.282 3.480   -2.253  1.00 0.31  ? 1590 LEU A HA   3  
ATOM 7508  H HB2  . LEU A 1 83  ? -12.302 1.389   -0.386  1.00 0.57  ? 1590 LEU A HB2  3  
ATOM 7509  H HB3  . LEU A 1 83  ? -11.663 2.989   -0.112  1.00 0.64  ? 1590 LEU A HB3  3  
ATOM 7510  H HG   . LEU A 1 83  ? -14.615 2.283   -0.084  1.00 0.76  ? 1590 LEU A HG   3  
ATOM 7511  H HD11 . LEU A 1 83  ? -13.297 1.137   1.665   1.00 1.11  ? 1590 LEU A HD11 3  
ATOM 7512  H HD12 . LEU A 1 83  ? -14.382 2.363   2.337   1.00 1.26  ? 1590 LEU A HD12 3  
ATOM 7513  H HD13 . LEU A 1 83  ? -12.654 2.697   2.180   1.00 1.16  ? 1590 LEU A HD13 3  
ATOM 7514  H HD21 . LEU A 1 83  ? -13.064 4.650   0.908   1.00 1.30  ? 1590 LEU A HD21 3  
ATOM 7515  H HD22 . LEU A 1 83  ? -14.808 4.430   1.038   1.00 1.23  ? 1590 LEU A HD22 3  
ATOM 7516  H HD23 . LEU A 1 83  ? -14.056 4.634   -0.558  1.00 1.40  ? 1590 LEU A HD23 3  
ATOM 7517  N N    . VAL A 1 84  ? -10.971 4.003   -3.106  1.00 0.31  ? 1591 VAL A N    3  
ATOM 7518  C CA   . VAL A 1 84  ? -9.672  4.236   -3.662  1.00 0.31  ? 1591 VAL A CA   3  
ATOM 7519  C C    . VAL A 1 84  ? -8.904  5.238   -2.840  1.00 0.31  ? 1591 VAL A C    3  
ATOM 7520  O O    . VAL A 1 84  ? -9.333  6.386   -2.668  1.00 0.38  ? 1591 VAL A O    3  
ATOM 7521  C CB   . VAL A 1 84  ? -9.736  4.667   -5.146  1.00 0.35  ? 1591 VAL A CB   3  
ATOM 7522  C CG1  . VAL A 1 84  ? -8.351  4.828   -5.716  1.00 1.01  ? 1591 VAL A CG1  3  
ATOM 7523  C CG2  . VAL A 1 84  ? -10.450 3.625   -5.940  1.00 0.81  ? 1591 VAL A CG2  3  
ATOM 7524  H H    . VAL A 1 84  ? -11.649 4.711   -3.117  1.00 0.39  ? 1591 VAL A H    3  
ATOM 7525  H HA   . VAL A 1 84  ? -9.160  3.288   -3.606  1.00 0.29  ? 1591 VAL A HA   3  
ATOM 7526  H HB   . VAL A 1 84  ? -10.279 5.597   -5.232  1.00 0.74  ? 1591 VAL A HB   3  
ATOM 7527  H HG11 . VAL A 1 84  ? -7.851  3.876   -5.607  1.00 1.70  ? 1591 VAL A HG11 3  
ATOM 7528  H HG12 . VAL A 1 84  ? -7.814  5.609   -5.201  1.00 1.50  ? 1591 VAL A HG12 3  
ATOM 7529  H HG13 . VAL A 1 84  ? -8.438  5.058   -6.768  1.00 1.49  ? 1591 VAL A HG13 3  
ATOM 7530  H HG21 . VAL A 1 84  ? -9.850  2.732   -5.858  1.00 1.29  ? 1591 VAL A HG21 3  
ATOM 7531  H HG22 . VAL A 1 84  ? -10.516 3.948   -6.968  1.00 1.42  ? 1591 VAL A HG22 3  
ATOM 7532  H HG23 . VAL A 1 84  ? -11.424 3.456   -5.509  1.00 1.49  ? 1591 VAL A HG23 3  
ATOM 7533  N N    . TYR A 1 85  ? -7.776  4.812   -2.337  1.00 0.27  ? 1592 TYR A N    3  
ATOM 7534  C CA   . TYR A 1 85  ? -6.940  5.689   -1.535  1.00 0.27  ? 1592 TYR A CA   3  
ATOM 7535  C C    . TYR A 1 85  ? -5.775  6.093   -2.365  1.00 0.29  ? 1592 TYR A C    3  
ATOM 7536  O O    . TYR A 1 85  ? -4.788  5.374   -2.472  1.00 0.50  ? 1592 TYR A O    3  
ATOM 7537  C CB   . TYR A 1 85  ? -6.464  5.038   -0.223  1.00 0.25  ? 1592 TYR A CB   3  
ATOM 7538  C CG   . TYR A 1 85  ? -7.505  4.906   0.883   1.00 0.23  ? 1592 TYR A CG   3  
ATOM 7539  C CD1  . TYR A 1 85  ? -8.758  5.477   0.727   1.00 0.31  ? 1592 TYR A CD1  3  
ATOM 7540  C CD2  . TYR A 1 85  ? -7.257  4.202   2.064   1.00 0.30  ? 1592 TYR A CD2  3  
ATOM 7541  C CE1  . TYR A 1 85  ? -9.722  5.354   1.702   1.00 0.34  ? 1592 TYR A CE1  3  
ATOM 7542  C CE2  . TYR A 1 85  ? -8.224  4.087   3.036   1.00 0.33  ? 1592 TYR A CE2  3  
ATOM 7543  C CZ   . TYR A 1 85  ? -9.350  4.674   2.942   1.00 0.31  ? 1592 TYR A CZ   3  
ATOM 7544  O OH   . TYR A 1 85  ? -10.407 4.558   3.813   1.00 0.38  ? 1592 TYR A OH   3  
ATOM 7545  H H    . TYR A 1 85  ? -7.460  3.898   -2.569  1.00 0.28  ? 1592 TYR A H    3  
ATOM 7546  H HA   . TYR A 1 85  ? -7.501  6.589   -1.316  1.00 0.29  ? 1592 TYR A HA   3  
ATOM 7547  H HB2  . TYR A 1 85  ? -6.106  4.042   -0.441  1.00 0.25  ? 1592 TYR A HB2  3  
ATOM 7548  H HB3  . TYR A 1 85  ? -5.641  5.619   0.164   1.00 0.27  ? 1592 TYR A HB3  3  
ATOM 7549  H HD1  . TYR A 1 85  ? -8.981  6.026   -0.177  1.00 0.41  ? 1592 TYR A HD1  3  
ATOM 7550  H HD2  . TYR A 1 85  ? -6.302  3.729   2.238   1.00 0.40  ? 1592 TYR A HD2  3  
ATOM 7551  H HE1  . TYR A 1 85  ? -10.704 5.784   1.568   1.00 0.46  ? 1592 TYR A HE1  3  
ATOM 7552  H HE2  . TYR A 1 85  ? -8.012  3.537   3.942   1.00 0.43  ? 1592 TYR A HE2  3  
ATOM 7553  H HH   . TYR A 1 85  ? -11.230 4.608   3.310   1.00 1.08  ? 1592 TYR A HH   3  
ATOM 7554  N N    . LYS A 1 86  ? -5.900  7.221   -2.963  1.00 0.33  ? 1593 LYS A N    3  
ATOM 7555  C CA   . LYS A 1 86  ? -4.929  7.713   -3.878  1.00 0.36  ? 1593 LYS A CA   3  
ATOM 7556  C C    . LYS A 1 86  ? -4.140  8.857   -3.289  1.00 0.37  ? 1593 LYS A C    3  
ATOM 7557  O O    . LYS A 1 86  ? -4.478  9.370   -2.211  1.00 0.40  ? 1593 LYS A O    3  
ATOM 7558  C CB   . LYS A 1 86  ? -5.623  8.107   -5.193  1.00 0.46  ? 1593 LYS A CB   3  
ATOM 7559  C CG   . LYS A 1 86  ? -6.844  9.029   -5.027  1.00 0.57  ? 1593 LYS A CG   3  
ATOM 7560  C CD   . LYS A 1 86  ? -7.579  9.233   -6.345  1.00 0.90  ? 1593 LYS A CD   3  
ATOM 7561  C CE   . LYS A 1 86  ? -6.719  9.923   -7.376  1.00 0.99  ? 1593 LYS A CE   3  
ATOM 7562  N NZ   . LYS A 1 86  ? -6.458  11.344  -7.077  1.00 1.59  ? 1593 LYS A NZ   3  
ATOM 7563  H H    . LYS A 1 86  ? -6.682  7.779   -2.767  1.00 0.51  ? 1593 LYS A H    3  
ATOM 7564  H HA   . LYS A 1 86  ? -4.249  6.903   -4.096  1.00 0.38  ? 1593 LYS A HA   3  
ATOM 7565  H HB2  . LYS A 1 86  ? -4.906  8.619   -5.819  1.00 0.55  ? 1593 LYS A HB2  3  
ATOM 7566  H HB3  . LYS A 1 86  ? -5.939  7.207   -5.696  1.00 0.49  ? 1593 LYS A HB3  3  
ATOM 7567  H HG2  . LYS A 1 86  ? -7.538  8.571   -4.337  1.00 0.91  ? 1593 LYS A HG2  3  
ATOM 7568  H HG3  . LYS A 1 86  ? -6.520  9.988   -4.649  1.00 0.87  ? 1593 LYS A HG3  3  
ATOM 7569  H HD2  . LYS A 1 86  ? -7.873  8.269   -6.732  1.00 1.53  ? 1593 LYS A HD2  3  
ATOM 7570  H HD3  . LYS A 1 86  ? -8.462  9.829   -6.162  1.00 1.50  ? 1593 LYS A HD3  3  
ATOM 7571  H HE2  . LYS A 1 86  ? -5.776  9.410   -7.297  1.00 1.55  ? 1593 LYS A HE2  3  
ATOM 7572  H HE3  . LYS A 1 86  ? -7.139  9.806   -8.363  1.00 1.51  ? 1593 LYS A HE3  3  
ATOM 7573  H HZ1  . LYS A 1 86  ? -5.852  11.741  -7.826  1.00 1.91  ? 1593 LYS A HZ1  3  
ATOM 7574  H HZ2  . LYS A 1 86  ? -5.909  11.466  -6.194  1.00 2.21  ? 1593 LYS A HZ2  3  
ATOM 7575  H HZ3  . LYS A 1 86  ? -7.320  11.932  -7.019  1.00 2.06  ? 1593 LYS A HZ3  3  
ATOM 7576  N N    . ASP A 1 87  ? -3.093  9.229   -3.998  1.00 0.44  ? 1594 ASP A N    3  
ATOM 7577  C CA   . ASP A 1 87  ? -2.194  10.336  -3.668  1.00 0.51  ? 1594 ASP A CA   3  
ATOM 7578  C C    . ASP A 1 87  ? -1.568  10.183  -2.302  1.00 0.42  ? 1594 ASP A C    3  
ATOM 7579  O O    . ASP A 1 87  ? -1.738  11.037  -1.430  1.00 0.53  ? 1594 ASP A O    3  
ATOM 7580  C CB   . ASP A 1 87  ? -2.888  11.698  -3.780  1.00 0.70  ? 1594 ASP A CB   3  
ATOM 7581  C CG   . ASP A 1 87  ? -3.542  11.929  -5.106  1.00 0.93  ? 1594 ASP A CG   3  
ATOM 7582  O OD1  . ASP A 1 87  ? -2.831  12.130  -6.129  1.00 1.11  ? 1594 ASP A OD1  3  
ATOM 7583  O OD2  . ASP A 1 87  ? -4.780  11.904  -5.162  1.00 1.05  ? 1594 ASP A OD2  3  
ATOM 7584  H H    . ASP A 1 87  ? -2.905  8.745   -4.829  1.00 0.50  ? 1594 ASP A H    3  
ATOM 7585  H HA   . ASP A 1 87  ? -1.395  10.307  -4.394  1.00 0.60  ? 1594 ASP A HA   3  
ATOM 7586  H HB2  . ASP A 1 87  ? -3.666  11.746  -3.034  1.00 0.69  ? 1594 ASP A HB2  3  
ATOM 7587  H HB3  . ASP A 1 87  ? -2.168  12.485  -3.603  1.00 0.78  ? 1594 ASP A HB3  3  
ATOM 7588  N N    . GLY A 1 88  ? -0.904  9.069   -2.089  1.00 0.41  ? 1595 GLY A N    3  
ATOM 7589  C CA   . GLY A 1 88  ? -0.150  8.889   -0.864  1.00 0.48  ? 1595 GLY A CA   3  
ATOM 7590  C C    . GLY A 1 88  ? 1.142   9.705   -0.887  1.00 0.53  ? 1595 GLY A C    3  
ATOM 7591  O O    . GLY A 1 88  ? 1.110   10.941  -0.914  1.00 0.78  ? 1595 GLY A O    3  
ATOM 7592  H H    . GLY A 1 88  ? -0.968  8.352   -2.756  1.00 0.49  ? 1595 GLY A H    3  
ATOM 7593  H HA2  . GLY A 1 88  ? -0.761  9.226   -0.039  1.00 0.54  ? 1595 GLY A HA2  3  
ATOM 7594  H HA3  . GLY A 1 88  ? 0.088   7.843   -0.734  1.00 0.56  ? 1595 GLY A HA3  3  
ATOM 7595  N N    . SER A 1 89  ? 2.260   9.050   -0.868  1.00 0.44  ? 1596 SER A N    3  
ATOM 7596  C CA   . SER A 1 89  ? 3.525   9.742   -0.963  1.00 0.50  ? 1596 SER A CA   3  
ATOM 7597  C C    . SER A 1 89  ? 4.229   9.333   -2.274  1.00 0.47  ? 1596 SER A C    3  
ATOM 7598  O O    . SER A 1 89  ? 3.734   8.430   -2.979  1.00 0.44  ? 1596 SER A O    3  
ATOM 7599  C CB   . SER A 1 89  ? 4.369   9.414   0.273   1.00 0.68  ? 1596 SER A CB   3  
ATOM 7600  O OG   . SER A 1 89  ? 4.602   8.028   0.389   1.00 1.07  ? 1596 SER A OG   3  
ATOM 7601  H H    . SER A 1 89  ? 2.273   8.074   -0.746  1.00 0.47  ? 1596 SER A H    3  
ATOM 7602  H HA   . SER A 1 89  ? 3.320   10.802  -0.991  1.00 0.57  ? 1596 SER A HA   3  
ATOM 7603  H HB2  . SER A 1 89  ? 5.323   9.916   0.197   1.00 1.17  ? 1596 SER A HB2  3  
ATOM 7604  H HB3  . SER A 1 89  ? 3.854   9.757   1.159   1.00 1.13  ? 1596 SER A HB3  3  
ATOM 7605  H HG   . SER A 1 89  ? 3.779   7.583   0.634   1.00 1.36  ? 1596 SER A HG   3  
ATOM 7606  N N    . PRO A 1 90  ? 5.330   10.022  -2.663  1.00 0.56  ? 1597 PRO A N    3  
ATOM 7607  C CA   . PRO A 1 90  ? 6.095   9.687   -3.866  1.00 0.62  ? 1597 PRO A CA   3  
ATOM 7608  C C    . PRO A 1 90  ? 6.860   8.371   -3.721  1.00 0.59  ? 1597 PRO A C    3  
ATOM 7609  O O    . PRO A 1 90  ? 7.678   8.189   -2.802  1.00 0.70  ? 1597 PRO A O    3  
ATOM 7610  C CB   . PRO A 1 90  ? 7.075   10.858  -4.022  1.00 0.80  ? 1597 PRO A CB   3  
ATOM 7611  C CG   . PRO A 1 90  ? 6.532   11.922  -3.140  1.00 1.01  ? 1597 PRO A CG   3  
ATOM 7612  C CD   . PRO A 1 90  ? 5.898   11.207  -2.002  1.00 0.66  ? 1597 PRO A CD   3  
ATOM 7613  H HA   . PRO A 1 90  ? 5.454   9.628   -4.733  1.00 0.65  ? 1597 PRO A HA   3  
ATOM 7614  H HB2  . PRO A 1 90  ? 8.063   10.553  -3.707  1.00 0.86  ? 1597 PRO A HB2  3  
ATOM 7615  H HB3  . PRO A 1 90  ? 7.101   11.178  -5.054  1.00 0.90  ? 1597 PRO A HB3  3  
ATOM 7616  H HG2  . PRO A 1 90  ? 7.335   12.554  -2.789  1.00 1.35  ? 1597 PRO A HG2  3  
ATOM 7617  H HG3  . PRO A 1 90  ? 5.796   12.505  -3.675  1.00 1.40  ? 1597 PRO A HG3  3  
ATOM 7618  H HD2  . PRO A 1 90  ? 6.640   10.928  -1.268  1.00 0.75  ? 1597 PRO A HD2  3  
ATOM 7619  H HD3  . PRO A 1 90  ? 5.118   11.808  -1.557  1.00 0.79  ? 1597 PRO A HD3  3  
ATOM 7620  N N    . CYS A 1 91  ? 6.578   7.482   -4.615  1.00 0.52  ? 1598 CYS A N    3  
ATOM 7621  C CA   . CYS A 1 91  ? 7.175   6.168   -4.675  1.00 0.53  ? 1598 CYS A CA   3  
ATOM 7622  C C    . CYS A 1 91  ? 8.615   6.286   -5.253  1.00 0.71  ? 1598 CYS A C    3  
ATOM 7623  O O    . CYS A 1 91  ? 8.857   7.089   -6.155  1.00 0.75  ? 1598 CYS A O    3  
ATOM 7624  C CB   . CYS A 1 91  ? 6.259   5.297   -5.570  1.00 0.51  ? 1598 CYS A CB   3  
ATOM 7625  S SG   . CYS A 1 91  ? 6.632   3.516   -5.612  1.00 0.54  ? 1598 CYS A SG   3  
ATOM 7626  H H    . CYS A 1 91  ? 5.908   7.726   -5.295  1.00 0.52  ? 1598 CYS A H    3  
ATOM 7627  H HA   . CYS A 1 91  ? 7.208   5.750   -3.678  1.00 0.54  ? 1598 CYS A HA   3  
ATOM 7628  H HB2  . CYS A 1 91  ? 5.250   5.386   -5.196  1.00 0.52  ? 1598 CYS A HB2  3  
ATOM 7629  H HB3  . CYS A 1 91  ? 6.267   5.665   -6.588  1.00 0.60  ? 1598 CYS A HB3  3  
ATOM 7630  N N    . PRO A 1 92  ? 9.598   5.497   -4.714  1.00 0.90  ? 1599 PRO A N    3  
ATOM 7631  C CA   . PRO A 1 92  ? 11.024  5.575   -5.113  1.00 1.18  ? 1599 PRO A CA   3  
ATOM 7632  C C    . PRO A 1 92  ? 11.293  5.005   -6.506  1.00 1.35  ? 1599 PRO A C    3  
ATOM 7633  O O    . PRO A 1 92  ? 12.407  5.081   -7.014  1.00 1.70  ? 1599 PRO A O    3  
ATOM 7634  C CB   . PRO A 1 92  ? 11.756  4.734   -4.052  1.00 1.28  ? 1599 PRO A CB   3  
ATOM 7635  C CG   . PRO A 1 92  ? 10.737  4.431   -3.004  1.00 1.18  ? 1599 PRO A CG   3  
ATOM 7636  C CD   . PRO A 1 92  ? 9.403   4.485   -3.677  1.00 0.93  ? 1599 PRO A CD   3  
ATOM 7637  H HA   . PRO A 1 92  ? 11.383  6.594   -5.075  1.00 1.31  ? 1599 PRO A HA   3  
ATOM 7638  H HB2  . PRO A 1 92  ? 12.132  3.830   -4.507  1.00 1.41  ? 1599 PRO A HB2  3  
ATOM 7639  H HB3  . PRO A 1 92  ? 12.579  5.303   -3.645  1.00 1.45  ? 1599 PRO A HB3  3  
ATOM 7640  H HG2  . PRO A 1 92  ? 10.909  3.443   -2.603  1.00 1.37  ? 1599 PRO A HG2  3  
ATOM 7641  H HG3  . PRO A 1 92  ? 10.791  5.168   -2.217  1.00 1.36  ? 1599 PRO A HG3  3  
ATOM 7642  H HD2  . PRO A 1 92  ? 9.159   3.527   -4.114  1.00 0.99  ? 1599 PRO A HD2  3  
ATOM 7643  H HD3  . PRO A 1 92  ? 8.637   4.790   -2.981  1.00 0.91  ? 1599 PRO A HD3  3  
ATOM 7644  N N    . SER A 1 93  ? 10.291  4.394   -7.079  1.00 1.31  ? 1600 SER A N    3  
ATOM 7645  C CA   . SER A 1 93  ? 10.349  3.902   -8.424  1.00 1.59  ? 1600 SER A CA   3  
ATOM 7646  C C    . SER A 1 93  ? 10.590  5.070   -9.394  1.00 1.38  ? 1600 SER A C    3  
ATOM 7647  O O    . SER A 1 93  ? 11.531  5.054   -10.229 1.00 1.40  ? 1600 SER A O    3  
ATOM 7648  C CB   . SER A 1 93  ? 9.028   3.205   -8.731  1.00 1.93  ? 1600 SER A CB   3  
ATOM 7649  O OG   . SER A 1 93  ? 7.944   4.054   -8.395  1.00 2.26  ? 1600 SER A OG   3  
ATOM 7650  H H    . SER A 1 93  ? 9.471   4.253   -6.566  1.00 1.26  ? 1600 SER A H    3  
ATOM 7651  H HA   . SER A 1 93  ? 11.152  3.186   -8.504  1.00 1.89  ? 1600 SER A HA   3  
ATOM 7652  H HB2  . SER A 1 93  ? 8.979   2.967   -9.783  1.00 1.88  ? 1600 SER A HB2  3  
ATOM 7653  H HB3  . SER A 1 93  ? 8.953   2.299   -8.148  1.00 2.21  ? 1600 SER A HB3  3  
ATOM 7654  H HG   . SER A 1 93  ? 7.211   3.513   -8.069  1.00 2.80  ? 1600 SER A HG   3  
ATOM 7655  N N    . LYS A 1 94  ? 9.776   6.080   -9.254  1.00 1.28  ? 1601 LYS A N    3  
ATOM 7656  C CA   . LYS A 1 94  ? 9.829   7.226   -10.033 1.00 1.26  ? 1601 LYS A CA   3  
ATOM 7657  C C    . LYS A 1 94  ? 9.205   8.340   -9.207  1.00 1.10  ? 1601 LYS A C    3  
ATOM 7658  O O    . LYS A 1 94  ? 8.030   8.246   -8.826  1.00 0.94  ? 1601 LYS A O    3  
ATOM 7659  C CB   . LYS A 1 94  ? 9.029   6.994   -11.318 1.00 1.44  ? 1601 LYS A CB   3  
ATOM 7660  C CG   . LYS A 1 94  ? 9.036   8.142   -12.288 1.00 1.77  ? 1601 LYS A CG   3  
ATOM 7661  C CD   . LYS A 1 94  ? 10.369  8.282   -12.977 1.00 2.13  ? 1601 LYS A CD   3  
ATOM 7662  C CE   . LYS A 1 94  ? 10.395  9.533   -13.765 1.00 2.60  ? 1601 LYS A CE   3  
ATOM 7663  N NZ   . LYS A 1 94  ? 11.674  9.737   -14.454 1.00 3.01  ? 1601 LYS A NZ   3  
ATOM 7664  H H    . LYS A 1 94  ? 9.059   6.076   -8.585  1.00 1.31  ? 1601 LYS A H    3  
ATOM 7665  H HA   . LYS A 1 94  ? 10.864  7.405   -10.265 1.00 1.40  ? 1601 LYS A HA   3  
ATOM 7666  H HB2  . LYS A 1 94  ? 9.435   6.131   -11.825 1.00 1.70  ? 1601 LYS A HB2  3  
ATOM 7667  H HB3  . LYS A 1 94  ? 8.005   6.783   -11.048 1.00 1.38  ? 1601 LYS A HB3  3  
ATOM 7668  H HG2  . LYS A 1 94  ? 8.275   7.974   -13.037 1.00 2.10  ? 1601 LYS A HG2  3  
ATOM 7669  H HG3  . LYS A 1 94  ? 8.820   9.052   -11.749 1.00 2.13  ? 1601 LYS A HG3  3  
ATOM 7670  H HD2  . LYS A 1 94  ? 11.189  8.322   -12.279 1.00 2.59  ? 1601 LYS A HD2  3  
ATOM 7671  H HD3  . LYS A 1 94  ? 10.493  7.452   -13.656 1.00 2.51  ? 1601 LYS A HD3  3  
ATOM 7672  H HE2  . LYS A 1 94  ? 9.582   9.526   -14.477 1.00 3.03  ? 1601 LYS A HE2  3  
ATOM 7673  H HE3  . LYS A 1 94  ? 10.245  10.305  -13.024 1.00 3.02  ? 1601 LYS A HE3  3  
ATOM 7674  H HZ1  . LYS A 1 94  ? 12.453  9.834   -13.768 1.00 3.45  ? 1601 LYS A HZ1  3  
ATOM 7675  H HZ2  . LYS A 1 94  ? 11.616  10.587  -15.054 1.00 3.26  ? 1601 LYS A HZ2  3  
ATOM 7676  H HZ3  . LYS A 1 94  ? 11.890  8.920   -15.066 1.00 3.29  ? 1601 LYS A HZ3  3  
ATOM 7677  N N    . SER A 1 95  ? 9.982   9.355   -8.900  1.00 1.23  ? 1602 SER A N    3  
ATOM 7678  C CA   . SER A 1 95  ? 9.527   10.452  -8.141  1.00 1.24  ? 1602 SER A CA   3  
ATOM 7679  C C    . SER A 1 95  ? 8.363   11.125  -8.878  1.00 1.14  ? 1602 SER A C    3  
ATOM 7680  O O    . SER A 1 95  ? 8.436   11.373  -10.087 1.00 1.25  ? 1602 SER A O    3  
ATOM 7681  C CB   . SER A 1 95  ? 10.703  11.398  -7.903  1.00 1.53  ? 1602 SER A CB   3  
ATOM 7682  O OG   . SER A 1 95  ? 11.481  11.552  -9.082  1.00 2.07  ? 1602 SER A OG   3  
ATOM 7683  H H    . SER A 1 95  ? 10.903  9.426   -9.209  1.00 1.39  ? 1602 SER A H    3  
ATOM 7684  H HA   . SER A 1 95  ? 9.234   10.034  -7.188  1.00 1.24  ? 1602 SER A HA   3  
ATOM 7685  H HB2  . SER A 1 95  ? 10.333  12.366  -7.601  1.00 1.93  ? 1602 SER A HB2  3  
ATOM 7686  H HB3  . SER A 1 95  ? 11.333  10.994  -7.123  1.00 1.67  ? 1602 SER A HB3  3  
ATOM 7687  H HG   . SER A 1 95  ? 11.552  12.509  -9.244  1.00 2.44  ? 1602 SER A HG   3  
ATOM 7688  N N    . GLY A 1 96  ? 7.300   11.373  -8.180  1.00 1.06  ? 1603 GLY A N    3  
ATOM 7689  C CA   . GLY A 1 96  ? 6.114   11.898  -8.797  1.00 1.08  ? 1603 GLY A CA   3  
ATOM 7690  C C    . GLY A 1 96  ? 5.018   10.848  -8.901  1.00 0.95  ? 1603 GLY A C    3  
ATOM 7691  O O    . GLY A 1 96  ? 3.840   11.193  -9.041  1.00 1.06  ? 1603 GLY A O    3  
ATOM 7692  H H    . GLY A 1 96  ? 7.304   11.190  -7.219  1.00 1.07  ? 1603 GLY A H    3  
ATOM 7693  H HA2  . GLY A 1 96  ? 5.755   12.732  -8.215  1.00 1.20  ? 1603 GLY A HA2  3  
ATOM 7694  H HA3  . GLY A 1 96  ? 6.361   12.242  -9.792  1.00 1.20  ? 1603 GLY A HA3  3  
ATOM 7695  N N    . LEU A 1 97  ? 5.381   9.572   -8.843  1.00 0.81  ? 1604 LEU A N    3  
ATOM 7696  C CA   . LEU A 1 97  ? 4.385   8.518   -8.783  1.00 0.78  ? 1604 LEU A CA   3  
ATOM 7697  C C    . LEU A 1 97  ? 3.931   8.398   -7.355  1.00 0.60  ? 1604 LEU A C    3  
ATOM 7698  O O    . LEU A 1 97  ? 4.752   8.233   -6.457  1.00 0.64  ? 1604 LEU A O    3  
ATOM 7699  C CB   . LEU A 1 97  ? 4.930   7.149   -9.233  1.00 1.01  ? 1604 LEU A CB   3  
ATOM 7700  C CG   . LEU A 1 97  ? 5.486   7.022   -10.648 1.00 1.11  ? 1604 LEU A CG   3  
ATOM 7701  C CD1  . LEU A 1 97  ? 5.878   5.578   -10.917 1.00 1.84  ? 1604 LEU A CD1  3  
ATOM 7702  C CD2  . LEU A 1 97  ? 4.492   7.509   -11.684 1.00 1.51  ? 1604 LEU A CD2  3  
ATOM 7703  H H    . LEU A 1 97  ? 6.328   9.316   -8.847  1.00 0.82  ? 1604 LEU A H    3  
ATOM 7704  H HA   . LEU A 1 97  ? 3.539   8.797   -9.394  1.00 0.90  ? 1604 LEU A HA   3  
ATOM 7705  H HB2  . LEU A 1 97  ? 5.726   6.870   -8.559  1.00 1.67  ? 1604 LEU A HB2  3  
ATOM 7706  H HB3  . LEU A 1 97  ? 4.134   6.429   -9.121  1.00 1.47  ? 1604 LEU A HB3  3  
ATOM 7707  H HG   . LEU A 1 97  ? 6.384   7.620   -10.717 1.00 1.88  ? 1604 LEU A HG   3  
ATOM 7708  H HD11 . LEU A 1 97  ? 5.029   4.932   -10.748 1.00 2.23  ? 1604 LEU A HD11 3  
ATOM 7709  H HD12 . LEU A 1 97  ? 6.679   5.291   -10.252 1.00 2.37  ? 1604 LEU A HD12 3  
ATOM 7710  H HD13 . LEU A 1 97  ? 6.209   5.477   -11.940 1.00 2.38  ? 1604 LEU A HD13 3  
ATOM 7711  H HD21 . LEU A 1 97  ? 4.304   8.562   -11.536 1.00 1.94  ? 1604 LEU A HD21 3  
ATOM 7712  H HD22 . LEU A 1 97  ? 3.569   6.956   -11.595 1.00 2.01  ? 1604 LEU A HD22 3  
ATOM 7713  H HD23 . LEU A 1 97  ? 4.914   7.358   -12.668 1.00 2.05  ? 1604 LEU A HD23 3  
ATOM 7714  N N    . SER A 1 98  ? 2.675   8.507   -7.131  1.00 0.57  ? 1605 SER A N    3  
ATOM 7715  C CA   . SER A 1 98  ? 2.152   8.411   -5.816  1.00 0.45  ? 1605 SER A CA   3  
ATOM 7716  C C    . SER A 1 98  ? 1.546   7.026   -5.577  1.00 0.39  ? 1605 SER A C    3  
ATOM 7717  O O    . SER A 1 98  ? 0.991   6.411   -6.500  1.00 0.46  ? 1605 SER A O    3  
ATOM 7718  C CB   . SER A 1 98  ? 1.138   9.522   -5.635  1.00 0.52  ? 1605 SER A CB   3  
ATOM 7719  O OG   . SER A 1 98  ? 0.309   9.651   -6.791  1.00 1.41  ? 1605 SER A OG   3  
ATOM 7720  H H    . SER A 1 98  ? 2.026   8.653   -7.851  1.00 0.71  ? 1605 SER A H    3  
ATOM 7721  H HA   . SER A 1 98  ? 2.972   8.584   -5.136  1.00 0.43  ? 1605 SER A HA   3  
ATOM 7722  H HB2  . SER A 1 98  ? 0.528   9.298   -4.776  1.00 1.11  ? 1605 SER A HB2  3  
ATOM 7723  H HB3  . SER A 1 98  ? 1.667   10.447  -5.464  1.00 1.16  ? 1605 SER A HB3  3  
ATOM 7724  H HG   . SER A 1 98  ? 0.204   10.601  -6.970  1.00 1.96  ? 1605 SER A HG   3  
ATOM 7725  N N    . TYR A 1 99  ? 1.708   6.518   -4.359  1.00 0.32  ? 1606 TYR A N    3  
ATOM 7726  C CA   . TYR A 1 99  ? 1.145   5.238   -3.980  1.00 0.28  ? 1606 TYR A CA   3  
ATOM 7727  C C    . TYR A 1 99  ? -0.372  5.343   -3.928  1.00 0.27  ? 1606 TYR A C    3  
ATOM 7728  O O    . TYR A 1 99  ? -0.921  6.439   -3.660  1.00 0.32  ? 1606 TYR A O    3  
ATOM 7729  C CB   . TYR A 1 99  ? 1.637   4.799   -2.604  1.00 0.27  ? 1606 TYR A CB   3  
ATOM 7730  C CG   . TYR A 1 99  ? 3.096   4.502   -2.451  1.00 0.32  ? 1606 TYR A CG   3  
ATOM 7731  C CD1  . TYR A 1 99  ? 4.000   5.502   -2.131  1.00 0.37  ? 1606 TYR A CD1  3  
ATOM 7732  C CD2  . TYR A 1 99  ? 3.580   3.234   -2.691  1.00 0.41  ? 1606 TYR A CD2  3  
ATOM 7733  C CE1  . TYR A 1 99  ? 5.350   5.237   -2.054  1.00 0.46  ? 1606 TYR A CE1  3  
ATOM 7734  C CE2  . TYR A 1 99  ? 4.914   2.955   -2.606  1.00 0.49  ? 1606 TYR A CE2  3  
ATOM 7735  C CZ   . TYR A 1 99  ? 5.773   3.952   -2.044  1.00 0.54  ? 1606 TYR A CZ   3  
ATOM 7736  O OH   . TYR A 1 99  ? 7.134   3.670   -2.219  1.00 0.60  ? 1606 TYR A OH   3  
ATOM 7737  H H    . TYR A 1 99  ? 2.219   7.016   -3.691  1.00 0.35  ? 1606 TYR A H    3  
ATOM 7738  H HA   . TYR A 1 99  ? 1.452   4.511   -4.717  1.00 0.31  ? 1606 TYR A HA   3  
ATOM 7739  H HB2  . TYR A 1 99  ? 1.443   5.574   -1.879  1.00 0.30  ? 1606 TYR A HB2  3  
ATOM 7740  H HB3  . TYR A 1 99  ? 1.092   3.925   -2.292  1.00 0.31  ? 1606 TYR A HB3  3  
ATOM 7741  H HD1  . TYR A 1 99  ? 3.636   6.502   -1.942  1.00 0.40  ? 1606 TYR A HD1  3  
ATOM 7742  H HD2  . TYR A 1 99  ? 2.883   2.446   -2.937  1.00 0.46  ? 1606 TYR A HD2  3  
ATOM 7743  H HE1  . TYR A 1 99  ? 6.040   6.030   -1.805  1.00 0.54  ? 1606 TYR A HE1  3  
ATOM 7744  H HE2  . TYR A 1 99  ? 5.269   1.953   -2.794  1.00 0.57  ? 1606 TYR A HE2  3  
ATOM 7745  H HH   . TYR A 1 99  ? 7.333   2.984   -2.873  1.00 1.06  ? 1606 TYR A HH   3  
ATOM 7746  N N    . LYS A 1 100 ? -1.036  4.227   -4.140  1.00 0.26  ? 1607 LYS A N    3  
ATOM 7747  C CA   . LYS A 1 100 ? -2.472  4.176   -4.147  1.00 0.25  ? 1607 LYS A CA   3  
ATOM 7748  C C    . LYS A 1 100 ? -2.937  2.818   -3.722  1.00 0.24  ? 1607 LYS A C    3  
ATOM 7749  O O    . LYS A 1 100 ? -2.516  1.802   -4.281  1.00 0.29  ? 1607 LYS A O    3  
ATOM 7750  C CB   . LYS A 1 100 ? -3.037  4.557   -5.529  1.00 0.29  ? 1607 LYS A CB   3  
ATOM 7751  C CG   . LYS A 1 100 ? -4.535  4.339   -5.723  1.00 0.88  ? 1607 LYS A CG   3  
ATOM 7752  C CD   . LYS A 1 100 ? -5.005  4.932   -7.049  1.00 0.81  ? 1607 LYS A CD   3  
ATOM 7753  C CE   . LYS A 1 100 ? -4.419  4.231   -8.270  1.00 0.74  ? 1607 LYS A CE   3  
ATOM 7754  N NZ   . LYS A 1 100 ? -4.986  2.883   -8.483  1.00 1.45  ? 1607 LYS A NZ   3  
ATOM 7755  H H    . LYS A 1 100 ? -0.561  3.374   -4.263  1.00 0.29  ? 1607 LYS A H    3  
ATOM 7756  H HA   . LYS A 1 100 ? -2.819  4.899   -3.423  1.00 0.27  ? 1607 LYS A HA   3  
ATOM 7757  H HB2  . LYS A 1 100 ? -2.895  5.621   -5.641  1.00 0.76  ? 1607 LYS A HB2  3  
ATOM 7758  H HB3  . LYS A 1 100 ? -2.504  4.027   -6.301  1.00 0.84  ? 1607 LYS A HB3  3  
ATOM 7759  H HG2  . LYS A 1 100 ? -4.736  3.276   -5.728  1.00 1.42  ? 1607 LYS A HG2  3  
ATOM 7760  H HG3  . LYS A 1 100 ? -5.064  4.820   -4.913  1.00 1.38  ? 1607 LYS A HG3  3  
ATOM 7761  H HD2  . LYS A 1 100 ? -6.080  4.869   -7.102  1.00 1.30  ? 1607 LYS A HD2  3  
ATOM 7762  H HD3  . LYS A 1 100 ? -4.707  5.969   -7.072  1.00 1.28  ? 1607 LYS A HD3  3  
ATOM 7763  H HE2  . LYS A 1 100 ? -4.632  4.829   -9.142  1.00 1.30  ? 1607 LYS A HE2  3  
ATOM 7764  H HE3  . LYS A 1 100 ? -3.349  4.152   -8.144  1.00 1.46  ? 1607 LYS A HE3  3  
ATOM 7765  H HZ1  . LYS A 1 100 ? -4.632  2.499   -9.388  1.00 2.00  ? 1607 LYS A HZ1  3  
ATOM 7766  H HZ2  . LYS A 1 100 ? -6.026  2.926   -8.569  1.00 1.99  ? 1607 LYS A HZ2  3  
ATOM 7767  H HZ3  . LYS A 1 100 ? -4.753  2.208   -7.731  1.00 1.94  ? 1607 LYS A HZ3  3  
ATOM 7768  N N    . SER A 1 101 ? -3.794  2.805   -2.764  1.00 0.24  ? 1608 SER A N    3  
ATOM 7769  C CA   . SER A 1 101 ? -4.327  1.607   -2.221  1.00 0.24  ? 1608 SER A CA   3  
ATOM 7770  C C    . SER A 1 101 ? -5.745  1.436   -2.731  1.00 0.24  ? 1608 SER A C    3  
ATOM 7771  O O    . SER A 1 101 ? -6.585  2.331   -2.588  1.00 0.29  ? 1608 SER A O    3  
ATOM 7772  C CB   . SER A 1 101 ? -4.303  1.708   -0.706  1.00 0.29  ? 1608 SER A CB   3  
ATOM 7773  O OG   . SER A 1 101 ? -2.984  1.960   -0.250  1.00 1.15  ? 1608 SER A OG   3  
ATOM 7774  H H    . SER A 1 101 ? -4.110  3.667   -2.407  1.00 0.28  ? 1608 SER A H    3  
ATOM 7775  H HA   . SER A 1 101 ? -3.716  0.774   -2.533  1.00 0.26  ? 1608 SER A HA   3  
ATOM 7776  H HB2  . SER A 1 101 ? -4.945  2.517   -0.391  1.00 0.83  ? 1608 SER A HB2  3  
ATOM 7777  H HB3  . SER A 1 101 ? -4.649  0.779   -0.278  1.00 1.06  ? 1608 SER A HB3  3  
ATOM 7778  H HG   . SER A 1 101 ? -2.629  2.745   -0.689  1.00 1.61  ? 1608 SER A HG   3  
ATOM 7779  N N    . VAL A 1 102 ? -5.987  0.341   -3.381  1.00 0.22  ? 1609 VAL A N    3  
ATOM 7780  C CA   . VAL A 1 102 ? -7.271  0.064   -3.957  1.00 0.22  ? 1609 VAL A CA   3  
ATOM 7781  C C    . VAL A 1 102 ? -7.995  -0.966  -3.101  1.00 0.22  ? 1609 VAL A C    3  
ATOM 7782  O O    . VAL A 1 102 ? -7.617  -2.140  -3.062  1.00 0.24  ? 1609 VAL A O    3  
ATOM 7783  C CB   . VAL A 1 102 ? -7.116  -0.452  -5.412  1.00 0.23  ? 1609 VAL A CB   3  
ATOM 7784  C CG1  . VAL A 1 102 ? -8.460  -0.642  -6.074  1.00 0.25  ? 1609 VAL A CG1  3  
ATOM 7785  C CG2  . VAL A 1 102 ? -6.239  0.488   -6.237  1.00 0.25  ? 1609 VAL A CG2  3  
ATOM 7786  H H    . VAL A 1 102 ? -5.274  -0.330  -3.493  1.00 0.25  ? 1609 VAL A H    3  
ATOM 7787  H HA   . VAL A 1 102 ? -7.860  0.970   -3.959  1.00 0.23  ? 1609 VAL A HA   3  
ATOM 7788  H HB   . VAL A 1 102 ? -6.631  -1.415  -5.375  1.00 0.24  ? 1609 VAL A HB   3  
ATOM 7789  H HG11 . VAL A 1 102 ? -8.318  -1.006  -7.081  1.00 1.09  ? 1609 VAL A HG11 3  
ATOM 7790  H HG12 . VAL A 1 102 ? -8.982  0.303   -6.103  1.00 1.00  ? 1609 VAL A HG12 3  
ATOM 7791  H HG13 . VAL A 1 102 ? -9.040  -1.357  -5.511  1.00 1.06  ? 1609 VAL A HG13 3  
ATOM 7792  H HG21 . VAL A 1 102 ? -6.128  0.086   -7.233  1.00 1.03  ? 1609 VAL A HG21 3  
ATOM 7793  H HG22 . VAL A 1 102 ? -5.264  0.573   -5.782  1.00 1.06  ? 1609 VAL A HG22 3  
ATOM 7794  H HG23 . VAL A 1 102 ? -6.689  1.468   -6.303  1.00 1.06  ? 1609 VAL A HG23 3  
ATOM 7795  N N    . ILE A 1 103 ? -9.002  -0.511  -2.400  1.00 0.22  ? 1610 ILE A N    3  
ATOM 7796  C CA   . ILE A 1 103 ? -9.769  -1.357  -1.515  1.00 0.22  ? 1610 ILE A CA   3  
ATOM 7797  C C    . ILE A 1 103 ? -11.022 -1.823  -2.228  1.00 0.23  ? 1610 ILE A C    3  
ATOM 7798  O O    . ILE A 1 103 ? -11.934 -1.043  -2.492  1.00 0.34  ? 1610 ILE A O    3  
ATOM 7799  C CB   . ILE A 1 103 ? -10.135 -0.623  -0.203  1.00 0.27  ? 1610 ILE A CB   3  
ATOM 7800  C CG1  . ILE A 1 103 ? -8.850  -0.167  0.501   1.00 0.33  ? 1610 ILE A CG1  3  
ATOM 7801  C CG2  . ILE A 1 103 ? -10.955 -1.538  0.709   1.00 0.28  ? 1610 ILE A CG2  3  
ATOM 7802  C CD1  . ILE A 1 103 ? -9.074  0.626   1.764   1.00 0.45  ? 1610 ILE A CD1  3  
ATOM 7803  H H    . ILE A 1 103 ? -9.272  0.431   -2.504  1.00 0.24  ? 1610 ILE A H    3  
ATOM 7804  H HA   . ILE A 1 103 ? -9.164  -2.221  -1.280  1.00 0.22  ? 1610 ILE A HA   3  
ATOM 7805  H HB   . ILE A 1 103 ? -10.730 0.245   -0.445  1.00 0.34  ? 1610 ILE A HB   3  
ATOM 7806  H HG12 . ILE A 1 103 ? -8.267  -1.038  0.765   1.00 0.69  ? 1610 ILE A HG12 3  
ATOM 7807  H HG13 . ILE A 1 103 ? -8.279  0.443   -0.181  1.00 0.67  ? 1610 ILE A HG13 3  
ATOM 7808  H HG21 . ILE A 1 103 ? -11.864 -1.823  0.199   1.00 1.04  ? 1610 ILE A HG21 3  
ATOM 7809  H HG22 . ILE A 1 103 ? -11.197 -1.021  1.625   1.00 1.03  ? 1610 ILE A HG22 3  
ATOM 7810  H HG23 . ILE A 1 103 ? -10.377 -2.422  0.931   1.00 1.08  ? 1610 ILE A HG23 3  
ATOM 7811  H HD11 . ILE A 1 103 ? -9.691  0.056   2.444   1.00 1.17  ? 1610 ILE A HD11 3  
ATOM 7812  H HD12 . ILE A 1 103 ? -9.541  1.570   1.535   1.00 1.20  ? 1610 ILE A HD12 3  
ATOM 7813  H HD13 . ILE A 1 103 ? -8.111  0.793   2.222   1.00 1.10  ? 1610 ILE A HD13 3  
ATOM 7814  N N    . SER A 1 104 ? -11.046 -3.069  -2.529  1.00 0.23  ? 1611 SER A N    3  
ATOM 7815  C CA   . SER A 1 104 ? -12.079 -3.665  -3.298  1.00 0.24  ? 1611 SER A CA   3  
ATOM 7816  C C    . SER A 1 104 ? -12.879 -4.654  -2.433  1.00 0.22  ? 1611 SER A C    3  
ATOM 7817  O O    . SER A 1 104 ? -12.378 -5.722  -2.044  1.00 0.25  ? 1611 SER A O    3  
ATOM 7818  C CB   . SER A 1 104 ? -11.413 -4.363  -4.503  1.00 0.30  ? 1611 SER A CB   3  
ATOM 7819  O OG   . SER A 1 104 ? -12.327 -4.666  -5.537  1.00 1.26  ? 1611 SER A OG   3  
ATOM 7820  H H    . SER A 1 104 ? -10.315 -3.633  -2.214  1.00 0.30  ? 1611 SER A H    3  
ATOM 7821  H HA   . SER A 1 104 ? -12.749 -2.905  -3.660  1.00 0.27  ? 1611 SER A HA   3  
ATOM 7822  H HB2  . SER A 1 104 ? -10.646 -3.720  -4.904  1.00 1.06  ? 1611 SER A HB2  3  
ATOM 7823  H HB3  . SER A 1 104 ? -10.957 -5.281  -4.161  1.00 1.11  ? 1611 SER A HB3  3  
ATOM 7824  H HG   . SER A 1 104 ? -12.353 -3.876  -6.092  1.00 1.89  ? 1611 SER A HG   3  
ATOM 7825  N N    . PHE A 1 105 ? -14.097 -4.273  -2.095  1.00 0.21  ? 1612 PHE A N    3  
ATOM 7826  C CA   . PHE A 1 105 ? -14.978 -5.130  -1.334  1.00 0.21  ? 1612 PHE A CA   3  
ATOM 7827  C C    . PHE A 1 105 ? -15.700 -6.065  -2.266  1.00 0.23  ? 1612 PHE A C    3  
ATOM 7828  O O    . PHE A 1 105 ? -16.453 -5.624  -3.167  1.00 0.26  ? 1612 PHE A O    3  
ATOM 7829  C CB   . PHE A 1 105 ? -15.976 -4.330  -0.498  1.00 0.23  ? 1612 PHE A CB   3  
ATOM 7830  C CG   . PHE A 1 105 ? -15.342 -3.533  0.596   1.00 0.21  ? 1612 PHE A CG   3  
ATOM 7831  C CD1  . PHE A 1 105 ? -14.704 -4.148  1.658   1.00 0.22  ? 1612 PHE A CD1  3  
ATOM 7832  C CD2  . PHE A 1 105 ? -15.367 -2.159  0.545   1.00 0.23  ? 1612 PHE A CD2  3  
ATOM 7833  C CE1  . PHE A 1 105 ? -14.107 -3.395  2.648   1.00 0.24  ? 1612 PHE A CE1  3  
ATOM 7834  C CE2  . PHE A 1 105 ? -14.773 -1.406  1.521   1.00 0.24  ? 1612 PHE A CE2  3  
ATOM 7835  C CZ   . PHE A 1 105 ? -14.196 -2.099  2.664   1.00 0.24  ? 1612 PHE A CZ   3  
ATOM 7836  H H    . PHE A 1 105 ? -14.428 -3.391  -2.382  1.00 0.23  ? 1612 PHE A H    3  
ATOM 7837  H HA   . PHE A 1 105 ? -14.357 -5.721  -0.676  1.00 0.22  ? 1612 PHE A HA   3  
ATOM 7838  H HB2  . PHE A 1 105 ? -16.511 -3.646  -1.139  1.00 0.26  ? 1612 PHE A HB2  3  
ATOM 7839  H HB3  . PHE A 1 105 ? -16.680 -5.012  -0.045  1.00 0.27  ? 1612 PHE A HB3  3  
ATOM 7840  H HD1  . PHE A 1 105 ? -14.674 -5.226  1.716   1.00 0.25  ? 1612 PHE A HD1  3  
ATOM 7841  H HD2  . PHE A 1 105 ? -15.867 -1.669  -0.276  1.00 0.27  ? 1612 PHE A HD2  3  
ATOM 7842  H HE1  . PHE A 1 105 ? -13.614 -3.889  3.472   1.00 0.28  ? 1612 PHE A HE1  3  
ATOM 7843  H HE2  . PHE A 1 105 ? -14.804 -0.329  1.459   1.00 0.28  ? 1612 PHE A HE2  3  
ATOM 7844  H HZ   . PHE A 1 105 ? -13.745 -1.573  3.491   1.00 0.27  ? 1612 PHE A HZ   3  
ATOM 7845  N N    . VAL A 1 106 ? -15.482 -7.338  -2.069  1.00 0.26  ? 1613 VAL A N    3  
ATOM 7846  C CA   . VAL A 1 106 ? -16.013 -8.340  -2.936  1.00 0.33  ? 1613 VAL A CA   3  
ATOM 7847  C C    . VAL A 1 106 ? -17.085 -9.136  -2.226  1.00 0.35  ? 1613 VAL A C    3  
ATOM 7848  O O    . VAL A 1 106 ? -16.864 -9.670  -1.135  1.00 0.34  ? 1613 VAL A O    3  
ATOM 7849  C CB   . VAL A 1 106 ? -14.908 -9.298  -3.429  1.00 0.40  ? 1613 VAL A CB   3  
ATOM 7850  C CG1  . VAL A 1 106 ? -15.443 -10.232 -4.499  1.00 0.50  ? 1613 VAL A CG1  3  
ATOM 7851  C CG2  . VAL A 1 106 ? -13.718 -8.524  -3.944  1.00 0.43  ? 1613 VAL A CG2  3  
ATOM 7852  H H    . VAL A 1 106 ? -14.958 -7.625  -1.288  1.00 0.27  ? 1613 VAL A H    3  
ATOM 7853  H HA   . VAL A 1 106 ? -16.445 -7.849  -3.795  1.00 0.38  ? 1613 VAL A HA   3  
ATOM 7854  H HB   . VAL A 1 106 ? -14.589 -9.901  -2.593  1.00 0.40  ? 1613 VAL A HB   3  
ATOM 7855  H HG11 . VAL A 1 106 ? -16.254 -10.812 -4.086  1.00 1.11  ? 1613 VAL A HG11 3  
ATOM 7856  H HG12 . VAL A 1 106 ? -14.653 -10.892 -4.827  1.00 1.23  ? 1613 VAL A HG12 3  
ATOM 7857  H HG13 . VAL A 1 106 ? -15.803 -9.650  -5.334  1.00 1.06  ? 1613 VAL A HG13 3  
ATOM 7858  H HG21 . VAL A 1 106 ? -13.318 -7.909  -3.151  1.00 1.08  ? 1613 VAL A HG21 3  
ATOM 7859  H HG22 . VAL A 1 106 ? -14.027 -7.894  -4.766  1.00 1.09  ? 1613 VAL A HG22 3  
ATOM 7860  H HG23 . VAL A 1 106 ? -12.958 -9.213  -4.283  1.00 1.14  ? 1613 VAL A HG23 3  
ATOM 7861  N N    . CYS A 1 107 ? -18.229 -9.169  -2.840  1.00 0.42  ? 1614 CYS A N    3  
ATOM 7862  C CA   . CYS A 1 107 ? -19.380 -9.897  -2.383  1.00 0.47  ? 1614 CYS A CA   3  
ATOM 7863  C C    . CYS A 1 107 ? -19.092 -11.393 -2.248  1.00 0.51  ? 1614 CYS A C    3  
ATOM 7864  O O    . CYS A 1 107 ? -18.830 -12.078 -3.252  1.00 0.58  ? 1614 CYS A O    3  
ATOM 7865  C CB   . CYS A 1 107 ? -20.529 -9.692  -3.380  1.00 0.59  ? 1614 CYS A CB   3  
ATOM 7866  S SG   . CYS A 1 107 ? -21.990 -10.740 -3.072  1.00 0.77  ? 1614 CYS A SG   3  
ATOM 7867  H H    . CYS A 1 107 ? -18.311 -8.636  -3.666  1.00 0.48  ? 1614 CYS A H    3  
ATOM 7868  H HA   . CYS A 1 107 ? -19.691 -9.481  -1.437  1.00 0.45  ? 1614 CYS A HA   3  
ATOM 7869  H HB2  . CYS A 1 107 ? -20.852 -8.664  -3.335  1.00 0.63  ? 1614 CYS A HB2  3  
ATOM 7870  H HB3  . CYS A 1 107 ? -20.170 -9.907  -4.376  1.00 0.60  ? 1614 CYS A HB3  3  
ATOM 7871  N N    . ARG A 1 108 ? -19.053 -11.884 -1.028  1.00 0.51  ? 1615 ARG A N    3  
ATOM 7872  C CA   . ARG A 1 108 ? -18.979 -13.306 -0.799  1.00 0.57  ? 1615 ARG A CA   3  
ATOM 7873  C C    . ARG A 1 108 ? -19.915 -13.708 0.343   1.00 0.61  ? 1615 ARG A C    3  
ATOM 7874  O O    . ARG A 1 108 ? -19.571 -13.533 1.506   1.00 0.67  ? 1615 ARG A O    3  
ATOM 7875  C CB   . ARG A 1 108 ? -17.547 -13.772 -0.494  1.00 0.69  ? 1615 ARG A CB   3  
ATOM 7876  C CG   . ARG A 1 108 ? -17.438 -15.264 -0.162  1.00 1.17  ? 1615 ARG A CG   3  
ATOM 7877  C CD   . ARG A 1 108 ? -15.998 -15.682 0.044   1.00 1.19  ? 1615 ARG A CD   3  
ATOM 7878  N NE   . ARG A 1 108 ? -15.862 -17.073 0.525   1.00 1.74  ? 1615 ARG A NE   3  
ATOM 7879  C CZ   . ARG A 1 108 ? -15.027 -17.991 0.009   1.00 1.99  ? 1615 ARG A CZ   3  
ATOM 7880  N NH1  . ARG A 1 108 ? -14.368 -17.735 -1.109  1.00 2.19  ? 1615 ARG A NH1  3  
ATOM 7881  N NH2  . ARG A 1 108 ? -14.862 -19.155 0.609   1.00 2.53  ? 1615 ARG A NH2  3  
ATOM 7882  H H    . ARG A 1 108 ? -19.052 -11.273 -0.255  1.00 0.50  ? 1615 ARG A H    3  
ATOM 7883  H HA   . ARG A 1 108 ? -19.302 -13.740 -1.734  1.00 0.61  ? 1615 ARG A HA   3  
ATOM 7884  H HB2  . ARG A 1 108 ? -16.923 -13.570 -1.353  1.00 0.63  ? 1615 ARG A HB2  3  
ATOM 7885  H HB3  . ARG A 1 108 ? -17.174 -13.209 0.349   1.00 0.91  ? 1615 ARG A HB3  3  
ATOM 7886  H HG2  . ARG A 1 108 ? -17.990 -15.464 0.744   1.00 1.65  ? 1615 ARG A HG2  3  
ATOM 7887  H HG3  . ARG A 1 108 ? -17.861 -15.836 -0.974  1.00 1.58  ? 1615 ARG A HG3  3  
ATOM 7888  H HD2  . ARG A 1 108 ? -15.478 -15.592 -0.899  1.00 1.21  ? 1615 ARG A HD2  3  
ATOM 7889  H HD3  . ARG A 1 108 ? -15.544 -15.018 0.765   1.00 1.47  ? 1615 ARG A HD3  3  
ATOM 7890  H HE   . ARG A 1 108 ? -16.412 -17.303 1.316   1.00 2.22  ? 1615 ARG A HE   3  
ATOM 7891  H HH11 . ARG A 1 108 ? -14.461 -16.869 -1.621  1.00 2.21  ? 1615 ARG A HH11 3  
ATOM 7892  H HH12 . ARG A 1 108 ? -13.720 -18.389 -1.524  1.00 2.68  ? 1615 ARG A HH12 3  
ATOM 7893  H HH21 . ARG A 1 108 ? -15.320 -19.403 1.473   1.00 2.92  ? 1615 ARG A HH21 3  
ATOM 7894  H HH22 . ARG A 1 108 ? -14.278 -19.872 0.206   1.00 2.77  ? 1615 ARG A HH22 3  
ATOM 7895  N N    . PRO A 1 109 ? -21.128 -14.216 0.035   1.00 0.67  ? 1616 PRO A N    3  
ATOM 7896  C CA   . PRO A 1 109 ? -22.061 -14.695 1.067   1.00 0.83  ? 1616 PRO A CA   3  
ATOM 7897  C C    . PRO A 1 109 ? -21.468 -15.870 1.885   1.00 0.95  ? 1616 PRO A C    3  
ATOM 7898  O O    . PRO A 1 109 ? -21.736 -16.017 3.076   1.00 1.10  ? 1616 PRO A O    3  
ATOM 7899  C CB   . PRO A 1 109 ? -23.284 -15.154 0.267   1.00 0.94  ? 1616 PRO A CB   3  
ATOM 7900  C CG   . PRO A 1 109 ? -23.175 -14.467 -1.048  1.00 0.92  ? 1616 PRO A CG   3  
ATOM 7901  C CD   . PRO A 1 109 ? -21.712 -14.338 -1.324  1.00 0.69  ? 1616 PRO A CD   3  
ATOM 7902  H HA   . PRO A 1 109 ? -22.334 -13.898 1.743   1.00 0.89  ? 1616 PRO A HA   3  
ATOM 7903  H HB2  . PRO A 1 109 ? -23.271 -16.228 0.158   1.00 1.14  ? 1616 PRO A HB2  3  
ATOM 7904  H HB3  . PRO A 1 109 ? -24.177 -14.848 0.789   1.00 1.05  ? 1616 PRO A HB3  3  
ATOM 7905  H HG2  . PRO A 1 109 ? -23.650 -15.062 -1.814  1.00 1.22  ? 1616 PRO A HG2  3  
ATOM 7906  H HG3  . PRO A 1 109 ? -23.633 -13.490 -0.991  1.00 1.07  ? 1616 PRO A HG3  3  
ATOM 7907  H HD2  . PRO A 1 109 ? -21.364 -15.228 -1.828  1.00 0.71  ? 1616 PRO A HD2  3  
ATOM 7908  H HD3  . PRO A 1 109 ? -21.534 -13.461 -1.928  1.00 0.71  ? 1616 PRO A HD3  3  
ATOM 7909  N N    . GLU A 1 110 ? -20.620 -16.658 1.237   1.00 0.99  ? 1617 GLU A N    3  
ATOM 7910  C CA   . GLU A 1 110 ? -19.910 -17.805 1.827   1.00 1.19  ? 1617 GLU A CA   3  
ATOM 7911  C C    . GLU A 1 110 ? -18.723 -17.406 2.700   1.00 1.17  ? 1617 GLU A C    3  
ATOM 7912  O O    . GLU A 1 110 ? -17.602 -17.898 2.513   1.00 1.74  ? 1617 GLU A O    3  
ATOM 7913  C CB   . GLU A 1 110 ? -19.514 -18.821 0.785   1.00 1.39  ? 1617 GLU A CB   3  
ATOM 7914  C CG   . GLU A 1 110 ? -20.695 -19.536 0.191   1.00 1.76  ? 1617 GLU A CG   3  
ATOM 7915  C CD   . GLU A 1 110 ? -21.512 -20.247 1.230   1.00 2.32  ? 1617 GLU A CD   3  
ATOM 7916  O OE1  . GLU A 1 110 ? -20.972 -21.123 1.935   1.00 2.53  ? 1617 GLU A OE1  3  
ATOM 7917  O OE2  . GLU A 1 110 ? -22.709 -19.917 1.385   1.00 3.05  ? 1617 GLU A OE2  3  
ATOM 7918  H H    . GLU A 1 110 ? -20.467 -16.471 0.287   1.00 0.96  ? 1617 GLU A H    3  
ATOM 7919  H HA   . GLU A 1 110 ? -20.629 -18.266 2.489   1.00 1.33  ? 1617 GLU A HA   3  
ATOM 7920  H HB2  . GLU A 1 110 ? -18.981 -18.322 -0.010  1.00 1.44  ? 1617 GLU A HB2  3  
ATOM 7921  H HB3  . GLU A 1 110 ? -18.866 -19.556 1.240   1.00 1.72  ? 1617 GLU A HB3  3  
ATOM 7922  H HG2  . GLU A 1 110 ? -21.331 -18.784 -0.250  1.00 2.26  ? 1617 GLU A HG2  3  
ATOM 7923  H HG3  . GLU A 1 110 ? -20.357 -20.242 -0.550  1.00 2.04  ? 1617 GLU A HG3  3  
ATOM 7924  N N    . ALA A 1 111 ? -18.964 -16.412 3.507   1.00 0.85  ? 1618 ALA A N    3  
ATOM 7925  C CA   . ALA A 1 111 ? -18.055 -15.853 4.497   1.00 0.78  ? 1618 ALA A CA   3  
ATOM 7926  C C    . ALA A 1 111 ? -17.108 -16.899 5.122   1.00 0.93  ? 1618 ALA A C    3  
ATOM 7927  O O    . ALA A 1 111 ? -17.545 -17.965 5.584   1.00 1.55  ? 1618 ALA A O    3  
ATOM 7928  C CB   . ALA A 1 111 ? -18.876 -15.222 5.603   1.00 0.78  ? 1618 ALA A CB   3  
ATOM 7929  H H    . ALA A 1 111 ? -19.853 -16.016 3.403   1.00 1.00  ? 1618 ALA A H    3  
ATOM 7930  H HA   . ALA A 1 111 ? -17.533 -15.059 3.992   1.00 0.78  ? 1618 ALA A HA   3  
ATOM 7931  H HB1  . ALA A 1 111 ? -19.481 -14.419 5.209   1.00 1.23  ? 1618 ALA A HB1  3  
ATOM 7932  H HB2  . ALA A 1 111 ? -18.243 -14.858 6.398   1.00 1.23  ? 1618 ALA A HB2  3  
ATOM 7933  H HB3  . ALA A 1 111 ? -19.532 -15.976 6.012   1.00 1.20  ? 1618 ALA A HB3  3  
ATOM 7934  N N    . GLY A 1 112 ? -15.832 -16.584 5.141   1.00 0.86  ? 1619 GLY A N    3  
ATOM 7935  C CA   . GLY A 1 112 ? -14.852 -17.452 5.703   1.00 0.93  ? 1619 GLY A CA   3  
ATOM 7936  C C    . GLY A 1 112 ? -13.569 -16.692 5.947   1.00 0.76  ? 1619 GLY A C    3  
ATOM 7937  O O    . GLY A 1 112 ? -13.612 -15.504 6.276   1.00 0.73  ? 1619 GLY A O    3  
ATOM 7938  H H    . GLY A 1 112 ? -15.499 -15.739 4.782   1.00 1.16  ? 1619 GLY A H    3  
ATOM 7939  H HA2  . GLY A 1 112 ? -15.223 -17.851 6.635   1.00 1.12  ? 1619 GLY A HA2  3  
ATOM 7940  H HA3  . GLY A 1 112 ? -14.653 -18.262 5.017   1.00 1.04  ? 1619 GLY A HA3  3  
ATOM 7941  N N    . PRO A 1 113 ? -12.410 -17.311 5.724   1.00 0.73  ? 1620 PRO A N    3  
ATOM 7942  C CA   . PRO A 1 113 ? -11.098 -16.670 5.957   1.00 0.65  ? 1620 PRO A CA   3  
ATOM 7943  C C    . PRO A 1 113 ? -10.681 -15.738 4.806   1.00 0.56  ? 1620 PRO A C    3  
ATOM 7944  O O    . PRO A 1 113 ? -9.525  -15.335 4.678   1.00 0.62  ? 1620 PRO A O    3  
ATOM 7945  C CB   . PRO A 1 113 ? -10.141 -17.847 6.071   1.00 0.71  ? 1620 PRO A CB   3  
ATOM 7946  C CG   . PRO A 1 113 ? -10.765 -18.958 5.290   1.00 0.80  ? 1620 PRO A CG   3  
ATOM 7947  C CD   . PRO A 1 113 ? -12.275 -18.702 5.253   1.00 0.88  ? 1620 PRO A CD   3  
ATOM 7948  H HA   . PRO A 1 113 ? -11.102 -16.105 6.878   1.00 0.72  ? 1620 PRO A HA   3  
ATOM 7949  H HB2  . PRO A 1 113 ? -9.198  -17.551 5.638   1.00 0.79  ? 1620 PRO A HB2  3  
ATOM 7950  H HB3  . PRO A 1 113 ? -10.010 -18.111 7.109   1.00 0.90  ? 1620 PRO A HB3  3  
ATOM 7951  H HG2  . PRO A 1 113 ? -10.316 -18.975 4.307   1.00 0.95  ? 1620 PRO A HG2  3  
ATOM 7952  H HG3  . PRO A 1 113 ? -10.545 -19.890 5.793   1.00 0.97  ? 1620 PRO A HG3  3  
ATOM 7953  H HD2  . PRO A 1 113 ? -12.727 -18.843 4.280   1.00 1.02  ? 1620 PRO A HD2  3  
ATOM 7954  H HD3  . PRO A 1 113 ? -12.811 -19.340 5.940   1.00 1.06  ? 1620 PRO A HD3  3  
ATOM 7955  N N    . THR A 1 114 ? -11.637 -15.423 3.992   1.00 0.53  ? 1621 THR A N    3  
ATOM 7956  C CA   . THR A 1 114 ? -11.495 -14.560 2.864   1.00 0.54  ? 1621 THR A CA   3  
ATOM 7957  C C    . THR A 1 114 ? -12.073 -13.191 3.221   1.00 0.43  ? 1621 THR A C    3  
ATOM 7958  O O    . THR A 1 114 ? -11.941 -12.206 2.479   1.00 0.39  ? 1621 THR A O    3  
ATOM 7959  C CB   . THR A 1 114 ? -12.299 -15.176 1.715   1.00 0.73  ? 1621 THR A CB   3  
ATOM 7960  O OG1  . THR A 1 114 ? -13.597 -15.554 2.227   1.00 0.95  ? 1621 THR A OG1  3  
ATOM 7961  C CG2  . THR A 1 114 ? -11.606 -16.417 1.175   1.00 0.97  ? 1621 THR A CG2  3  
ATOM 7962  H H    . THR A 1 114 ? -12.528 -15.801 4.141   1.00 0.57  ? 1621 THR A H    3  
ATOM 7963  H HA   . THR A 1 114 ? -10.459 -14.486 2.571   1.00 0.64  ? 1621 THR A HA   3  
ATOM 7964  H HB   . THR A 1 114 ? -12.415 -14.447 0.926   1.00 0.81  ? 1621 THR A HB   3  
ATOM 7965  H HG1  . THR A 1 114 ? -13.957 -16.246 1.662   1.00 1.52  ? 1621 THR A HG1  3  
ATOM 7966  H HG21 . THR A 1 114 ? -11.501 -17.144 1.967   1.00 1.40  ? 1621 THR A HG21 3  
ATOM 7967  H HG22 . THR A 1 114 ? -10.629 -16.148 0.799   1.00 1.38  ? 1621 THR A HG22 3  
ATOM 7968  H HG23 . THR A 1 114 ? -12.195 -16.839 0.375   1.00 1.58  ? 1621 THR A HG23 3  
ATOM 7969  N N    . ASN A 1 115 ? -12.681 -13.145 4.388   1.00 0.42  ? 1622 ASN A N    3  
ATOM 7970  C CA   . ASN A 1 115 ? -13.359 -11.970 4.899   1.00 0.40  ? 1622 ASN A CA   3  
ATOM 7971  C C    . ASN A 1 115 ? -12.398 -11.202 5.783   1.00 0.39  ? 1622 ASN A C    3  
ATOM 7972  O O    . ASN A 1 115 ? -12.584 -11.059 6.994   1.00 0.48  ? 1622 ASN A O    3  
ATOM 7973  C CB   . ASN A 1 115 ? -14.631 -12.418 5.645   1.00 0.49  ? 1622 ASN A CB   3  
ATOM 7974  C CG   . ASN A 1 115 ? -15.502 -11.296 6.193   1.00 0.51  ? 1622 ASN A CG   3  
ATOM 7975  O OD1  . ASN A 1 115 ? -15.499 -10.174 5.704   1.00 0.59  ? 1622 ASN A OD1  3  
ATOM 7976  N ND2  . ASN A 1 115 ? -16.282 -11.611 7.192   1.00 0.72  ? 1622 ASN A ND2  3  
ATOM 7977  H H    . ASN A 1 115 ? -12.653 -13.946 4.951   1.00 0.46  ? 1622 ASN A H    3  
ATOM 7978  H HA   . ASN A 1 115 ? -13.631 -11.347 4.059   1.00 0.38  ? 1622 ASN A HA   3  
ATOM 7979  H HB2  . ASN A 1 115 ? -15.227 -12.987 4.950   1.00 0.54  ? 1622 ASN A HB2  3  
ATOM 7980  H HB3  . ASN A 1 115 ? -14.348 -13.064 6.462   1.00 0.55  ? 1622 ASN A HB3  3  
ATOM 7981  H HD21 . ASN A 1 115 ? -16.245 -12.536 7.528   1.00 0.88  ? 1622 ASN A HD21 3  
ATOM 7982  H HD22 . ASN A 1 115 ? -16.899 -10.933 7.541   1.00 0.80  ? 1622 ASN A HD22 3  
ATOM 7983  N N    . ARG A 1 116 ? -11.341 -10.769 5.158   1.00 0.35  ? 1623 ARG A N    3  
ATOM 7984  C CA   . ARG A 1 116 ? -10.283 -10.035 5.776   1.00 0.37  ? 1623 ARG A CA   3  
ATOM 7985  C C    . ARG A 1 116 ? -9.497  -9.353  4.671   1.00 0.33  ? 1623 ARG A C    3  
ATOM 7986  O O    . ARG A 1 116 ? -9.313  -9.940  3.602   1.00 0.32  ? 1623 ARG A O    3  
ATOM 7987  C CB   . ARG A 1 116 ? -9.389  -10.971 6.617   1.00 0.43  ? 1623 ARG A CB   3  
ATOM 7988  C CG   . ARG A 1 116 ? -8.716  -12.116 5.865   1.00 0.49  ? 1623 ARG A CG   3  
ATOM 7989  C CD   . ARG A 1 116 ? -7.958  -13.022 6.832   1.00 0.67  ? 1623 ARG A CD   3  
ATOM 7990  N NE   . ARG A 1 116 ? -8.853  -13.699 7.780   1.00 1.57  ? 1623 ARG A NE   3  
ATOM 7991  C CZ   . ARG A 1 116 ? -8.452  -14.473 8.791   1.00 2.13  ? 1623 ARG A CZ   3  
ATOM 7992  N NH1  . ARG A 1 116 ? -7.159  -14.767 8.944   1.00 1.99  ? 1623 ARG A NH1  3  
ATOM 7993  N NH2  . ARG A 1 116 ? -9.353  -14.989 9.622   1.00 3.26  ? 1623 ARG A NH2  3  
ATOM 7994  H H    . ARG A 1 116 ? -11.246 -10.948 4.198   1.00 0.35  ? 1623 ARG A H    3  
ATOM 7995  H HA   . ARG A 1 116 ? -10.723 -9.281  6.412   1.00 0.41  ? 1623 ARG A HA   3  
ATOM 7996  H HB2  . ARG A 1 116 ? -8.609  -10.377 7.070   1.00 0.46  ? 1623 ARG A HB2  3  
ATOM 7997  H HB3  . ARG A 1 116 ? -9.993  -11.394 7.407   1.00 0.48  ? 1623 ARG A HB3  3  
ATOM 7998  H HG2  . ARG A 1 116 ? -9.472  -12.695 5.355   1.00 0.50  ? 1623 ARG A HG2  3  
ATOM 7999  H HG3  . ARG A 1 116 ? -8.021  -11.707 5.147   1.00 0.52  ? 1623 ARG A HG3  3  
ATOM 8000  H HD2  . ARG A 1 116 ? -7.394  -13.772 6.302   1.00 1.26  ? 1623 ARG A HD2  3  
ATOM 8001  H HD3  . ARG A 1 116 ? -7.277  -12.410 7.404   1.00 1.22  ? 1623 ARG A HD3  3  
ATOM 8002  H HE   . ARG A 1 116 ? -9.820  -13.544 7.642   1.00 2.16  ? 1623 ARG A HE   3  
ATOM 8003  H HH11 . ARG A 1 116 ? -6.444  -14.431 8.314   1.00 1.83  ? 1623 ARG A HH11 3  
ATOM 8004  H HH12 . ARG A 1 116 ? -6.822  -15.338 9.700   1.00 2.53  ? 1623 ARG A HH12 3  
ATOM 8005  H HH21 . ARG A 1 116 ? -10.342 -14.823 9.526   1.00 3.82  ? 1623 ARG A HH21 3  
ATOM 8006  H HH22 . ARG A 1 116 ? -9.095  -15.577 10.397  1.00 3.73  ? 1623 ARG A HH22 3  
ATOM 8007  N N    . PRO A 1 117 ? -9.092  -8.095  4.876   1.00 0.36  ? 1624 PRO A N    3  
ATOM 8008  C CA   . PRO A 1 117 ? -8.366  -7.325  3.862   1.00 0.36  ? 1624 PRO A CA   3  
ATOM 8009  C C    . PRO A 1 117 ? -6.978  -7.913  3.572   1.00 0.36  ? 1624 PRO A C    3  
ATOM 8010  O O    . PRO A 1 117 ? -6.070  -7.847  4.410   1.00 0.47  ? 1624 PRO A O    3  
ATOM 8011  C CB   . PRO A 1 117 ? -8.245  -5.928  4.487   1.00 0.47  ? 1624 PRO A CB   3  
ATOM 8012  C CG   . PRO A 1 117 ? -8.378  -6.149  5.955   1.00 0.59  ? 1624 PRO A CG   3  
ATOM 8013  C CD   . PRO A 1 117 ? -9.297  -7.321  6.117   1.00 0.43  ? 1624 PRO A CD   3  
ATOM 8014  H HA   . PRO A 1 117 ? -8.931  -7.268  2.943   1.00 0.36  ? 1624 PRO A HA   3  
ATOM 8015  H HB2  . PRO A 1 117 ? -7.286  -5.499  4.236   1.00 0.51  ? 1624 PRO A HB2  3  
ATOM 8016  H HB3  . PRO A 1 117 ? -9.036  -5.296  4.112   1.00 0.54  ? 1624 PRO A HB3  3  
ATOM 8017  H HG2  . PRO A 1 117 ? -7.412  -6.371  6.382   1.00 0.76  ? 1624 PRO A HG2  3  
ATOM 8018  H HG3  . PRO A 1 117 ? -8.802  -5.273  6.423   1.00 0.77  ? 1624 PRO A HG3  3  
ATOM 8019  H HD2  . PRO A 1 117 ? -9.021  -7.902  6.985   1.00 0.48  ? 1624 PRO A HD2  3  
ATOM 8020  H HD3  . PRO A 1 117 ? -10.321 -6.987  6.195   1.00 0.47  ? 1624 PRO A HD3  3  
ATOM 8021  N N    . MET A 1 118 ? -6.827  -8.514  2.412   1.00 0.35  ? 1625 MET A N    3  
ATOM 8022  C CA   . MET A 1 118 ? -5.560  -9.113  2.025   1.00 0.46  ? 1625 MET A CA   3  
ATOM 8023  C C    . MET A 1 118 ? -4.983  -8.403  0.810   1.00 0.40  ? 1625 MET A C    3  
ATOM 8024  O O    . MET A 1 118 ? -5.731  -7.914  -0.049  1.00 0.41  ? 1625 MET A O    3  
ATOM 8025  C CB   . MET A 1 118 ? -5.701  -10.624 1.754   1.00 0.68  ? 1625 MET A CB   3  
ATOM 8026  C CG   . MET A 1 118 ? -6.158  -11.416 2.970   1.00 0.87  ? 1625 MET A CG   3  
ATOM 8027  S SD   . MET A 1 118 ? -6.065  -13.217 2.762   1.00 1.37  ? 1625 MET A SD   3  
ATOM 8028  C CE   . MET A 1 118 ? -7.118  -13.476 1.330   1.00 0.77  ? 1625 MET A CE   3  
ATOM 8029  H H    . MET A 1 118 ? -7.597  -8.546  1.799   1.00 0.36  ? 1625 MET A H    3  
ATOM 8030  H HA   . MET A 1 118 ? -4.895  -8.970  2.863   1.00 0.56  ? 1625 MET A HA   3  
ATOM 8031  H HB2  . MET A 1 118 ? -6.422  -10.771 0.963   1.00 0.70  ? 1625 MET A HB2  3  
ATOM 8032  H HB3  . MET A 1 118 ? -4.745  -11.013 1.435   1.00 0.77  ? 1625 MET A HB3  3  
ATOM 8033  H HG2  . MET A 1 118 ? -5.510  -11.135 3.784   1.00 0.96  ? 1625 MET A HG2  3  
ATOM 8034  H HG3  . MET A 1 118 ? -7.174  -11.136 3.207   1.00 0.72  ? 1625 MET A HG3  3  
ATOM 8035  H HE1  . MET A 1 118 ? -7.175  -14.530 1.104   1.00 1.43  ? 1625 MET A HE1  3  
ATOM 8036  H HE2  . MET A 1 118 ? -6.674  -12.969 0.488   1.00 1.35  ? 1625 MET A HE2  3  
ATOM 8037  H HE3  . MET A 1 118 ? -8.108  -13.083 1.507   1.00 1.27  ? 1625 MET A HE3  3  
ATOM 8038  N N    . LEU A 1 119 ? -3.660  -8.342  0.748   1.00 0.42  ? 1626 LEU A N    3  
ATOM 8039  C CA   . LEU A 1 119 ? -2.949  -7.672  -0.323  1.00 0.41  ? 1626 LEU A CA   3  
ATOM 8040  C C    . LEU A 1 119 ? -2.805  -8.665  -1.466  1.00 0.42  ? 1626 LEU A C    3  
ATOM 8041  O O    . LEU A 1 119 ? -2.145  -9.698  -1.319  1.00 0.51  ? 1626 LEU A O    3  
ATOM 8042  C CB   . LEU A 1 119 ? -1.551  -7.267  0.195   1.00 0.50  ? 1626 LEU A CB   3  
ATOM 8043  C CG   . LEU A 1 119 ? -0.885  -6.001  -0.403  1.00 0.59  ? 1626 LEU A CG   3  
ATOM 8044  C CD1  . LEU A 1 119 ? -0.545  -6.108  -1.871  1.00 0.78  ? 1626 LEU A CD1  3  
ATOM 8045  C CD2  . LEU A 1 119 ? -1.749  -4.813  -0.195  1.00 0.89  ? 1626 LEU A CD2  3  
ATOM 8046  H H    . LEU A 1 119 ? -3.127  -8.779  1.444   1.00 0.51  ? 1626 LEU A H    3  
ATOM 8047  H HA   . LEU A 1 119 ? -3.497  -6.789  -0.618  1.00 0.39  ? 1626 LEU A HA   3  
ATOM 8048  H HB2  . LEU A 1 119 ? -1.627  -7.119  1.262   1.00 0.56  ? 1626 LEU A HB2  3  
ATOM 8049  H HB3  . LEU A 1 119 ? -0.887  -8.103  0.026   1.00 0.59  ? 1626 LEU A HB3  3  
ATOM 8050  H HG   . LEU A 1 119 ? 0.037   -5.815  0.128   1.00 0.98  ? 1626 LEU A HG   3  
ATOM 8051  H HD11 . LEU A 1 119 ? -1.398  -6.444  -2.439  1.00 1.41  ? 1626 LEU A HD11 3  
ATOM 8052  H HD12 . LEU A 1 119 ? 0.304   -6.756  -2.029  1.00 1.25  ? 1626 LEU A HD12 3  
ATOM 8053  H HD13 . LEU A 1 119 ? -0.310  -5.096  -2.185  1.00 1.34  ? 1626 LEU A HD13 3  
ATOM 8054  H HD21 . LEU A 1 119 ? -2.083  -4.788  0.831   1.00 1.40  ? 1626 LEU A HD21 3  
ATOM 8055  H HD22 . LEU A 1 119 ? -2.582  -4.855  -0.881  1.00 1.43  ? 1626 LEU A HD22 3  
ATOM 8056  H HD23 . LEU A 1 119 ? -1.149  -3.938  -0.389  1.00 1.42  ? 1626 LEU A HD23 3  
ATOM 8057  N N    . ILE A 1 120 ? -3.441  -8.367  -2.584  1.00 0.37  ? 1627 ILE A N    3  
ATOM 8058  C CA   . ILE A 1 120 ? -3.423  -9.246  -3.745  1.00 0.41  ? 1627 ILE A CA   3  
ATOM 8059  C C    . ILE A 1 120 ? -2.074  -9.189  -4.383  1.00 0.42  ? 1627 ILE A C    3  
ATOM 8060  O O    . ILE A 1 120 ? -1.407  -10.199 -4.558  1.00 0.49  ? 1627 ILE A O    3  
ATOM 8061  C CB   . ILE A 1 120 ? -4.452  -8.811  -4.834  1.00 0.41  ? 1627 ILE A CB   3  
ATOM 8062  C CG1  . ILE A 1 120 ? -5.861  -8.689  -4.256  1.00 0.48  ? 1627 ILE A CG1  3  
ATOM 8063  C CG2  . ILE A 1 120 ? -4.445  -9.812  -6.002  1.00 0.46  ? 1627 ILE A CG2  3  
ATOM 8064  C CD1  . ILE A 1 120 ? -6.397  -9.987  -3.686  1.00 0.58  ? 1627 ILE A CD1  3  
ATOM 8065  H H    . ILE A 1 120 ? -3.937  -7.519  -2.629  1.00 0.34  ? 1627 ILE A H    3  
ATOM 8066  H HA   . ILE A 1 120 ? -3.650  -10.256 -3.436  1.00 0.46  ? 1627 ILE A HA   3  
ATOM 8067  H HB   . ILE A 1 120 ? -4.129  -7.856  -5.222  1.00 0.39  ? 1627 ILE A HB   3  
ATOM 8068  H HG12 . ILE A 1 120 ? -5.848  -7.952  -3.465  1.00 0.48  ? 1627 ILE A HG12 3  
ATOM 8069  H HG13 . ILE A 1 120 ? -6.524  -8.357  -5.042  1.00 0.60  ? 1627 ILE A HG13 3  
ATOM 8070  H HG21 . ILE A 1 120 ? -3.454  -9.867  -6.425  1.00 1.14  ? 1627 ILE A HG21 3  
ATOM 8071  H HG22 . ILE A 1 120 ? -5.146  -9.505  -6.764  1.00 1.07  ? 1627 ILE A HG22 3  
ATOM 8072  H HG23 . ILE A 1 120 ? -4.728  -10.785 -5.627  1.00 1.12  ? 1627 ILE A HG23 3  
ATOM 8073  H HD11 . ILE A 1 120 ? -6.374  -10.749 -4.452  1.00 1.08  ? 1627 ILE A HD11 3  
ATOM 8074  H HD12 . ILE A 1 120 ? -7.418  -9.848  -3.362  1.00 1.23  ? 1627 ILE A HD12 3  
ATOM 8075  H HD13 . ILE A 1 120 ? -5.778  -10.291 -2.854  1.00 1.22  ? 1627 ILE A HD13 3  
ATOM 8076  N N    . SER A 1 121 ? -1.667  -7.987  -4.696  1.00 0.37  ? 1628 SER A N    3  
ATOM 8077  C CA   . SER A 1 121 ? -0.466  -7.762  -5.425  1.00 0.40  ? 1628 SER A CA   3  
ATOM 8078  C C    . SER A 1 121 ? -0.192  -6.287  -5.486  1.00 0.35  ? 1628 SER A C    3  
ATOM 8079  O O    . SER A 1 121 ? -1.114  -5.468  -5.327  1.00 0.35  ? 1628 SER A O    3  
ATOM 8080  C CB   . SER A 1 121 ? -0.606  -8.350  -6.848  1.00 0.48  ? 1628 SER A CB   3  
ATOM 8081  O OG   . SER A 1 121 ? -1.791  -7.883  -7.484  1.00 1.39  ? 1628 SER A OG   3  
ATOM 8082  H H    . SER A 1 121 ? -2.160  -7.193  -4.387  1.00 0.34  ? 1628 SER A H    3  
ATOM 8083  H HA   . SER A 1 121 ? 0.348   -8.263  -4.925  1.00 0.46  ? 1628 SER A HA   3  
ATOM 8084  H HB2  . SER A 1 121 ? 0.239   -8.080  -7.465  1.00 1.12  ? 1628 SER A HB2  3  
ATOM 8085  H HB3  . SER A 1 121 ? -0.661  -9.427  -6.779  1.00 0.97  ? 1628 SER A HB3  3  
ATOM 8086  H HG   . SER A 1 121 ? -2.401  -7.623  -6.787  1.00 1.88  ? 1628 SER A HG   3  
ATOM 8087  N N    . LEU A 1 122 ? 1.042   -5.964  -5.629  1.00 0.37  ? 1629 LEU A N    3  
ATOM 8088  C CA   . LEU A 1 122 ? 1.479   -4.631  -5.821  1.00 0.38  ? 1629 LEU A CA   3  
ATOM 8089  C C    . LEU A 1 122 ? 1.890   -4.467  -7.262  1.00 0.46  ? 1629 LEU A C    3  
ATOM 8090  O O    . LEU A 1 122 ? 2.774   -5.194  -7.740  1.00 0.62  ? 1629 LEU A O    3  
ATOM 8091  C CB   . LEU A 1 122 ? 2.690   -4.359  -4.911  1.00 0.49  ? 1629 LEU A CB   3  
ATOM 8092  C CG   . LEU A 1 122 ? 3.434   -3.021  -5.094  1.00 0.71  ? 1629 LEU A CG   3  
ATOM 8093  C CD1  . LEU A 1 122 ? 2.552   -1.832  -4.762  1.00 1.00  ? 1629 LEU A CD1  3  
ATOM 8094  C CD2  . LEU A 1 122 ? 4.701   -2.996  -4.254  1.00 1.25  ? 1629 LEU A CD2  3  
ATOM 8095  H H    . LEU A 1 122 ? 1.737   -6.661  -5.582  1.00 0.43  ? 1629 LEU A H    3  
ATOM 8096  H HA   . LEU A 1 122 ? 0.690   -3.939  -5.568  1.00 0.34  ? 1629 LEU A HA   3  
ATOM 8097  H HB2  . LEU A 1 122 ? 2.350   -4.412  -3.887  1.00 0.51  ? 1629 LEU A HB2  3  
ATOM 8098  H HB3  . LEU A 1 122 ? 3.398   -5.159  -5.068  1.00 0.62  ? 1629 LEU A HB3  3  
ATOM 8099  H HG   . LEU A 1 122 ? 3.722   -2.929  -6.130  1.00 1.39  ? 1629 LEU A HG   3  
ATOM 8100  H HD11 . LEU A 1 122 ? 3.125   -0.924  -4.885  1.00 1.51  ? 1629 LEU A HD11 3  
ATOM 8101  H HD12 . LEU A 1 122 ? 2.207   -1.906  -3.743  1.00 1.59  ? 1629 LEU A HD12 3  
ATOM 8102  H HD13 . LEU A 1 122 ? 1.702   -1.808  -5.427  1.00 1.59  ? 1629 LEU A HD13 3  
ATOM 8103  H HD21 . LEU A 1 122 ? 5.352   -3.802  -4.561  1.00 1.92  ? 1629 LEU A HD21 3  
ATOM 8104  H HD22 . LEU A 1 122 ? 4.445   -3.119  -3.212  1.00 1.71  ? 1629 LEU A HD22 3  
ATOM 8105  H HD23 . LEU A 1 122 ? 5.207   -2.053  -4.393  1.00 1.66  ? 1629 LEU A HD23 3  
ATOM 8106  N N    . ASP A 1 123 ? 1.210   -3.601  -7.980  1.00 0.45  ? 1630 ASP A N    3  
ATOM 8107  C CA   . ASP A 1 123 ? 1.718   -3.190  -9.291  1.00 0.57  ? 1630 ASP A CA   3  
ATOM 8108  C C    . ASP A 1 123 ? 2.862   -2.288  -8.950  1.00 0.55  ? 1630 ASP A C    3  
ATOM 8109  O O    . ASP A 1 123 ? 2.680   -1.131  -8.587  1.00 0.51  ? 1630 ASP A O    3  
ATOM 8110  C CB   . ASP A 1 123 ? 0.677   -2.474  -10.226 1.00 0.66  ? 1630 ASP A CB   3  
ATOM 8111  C CG   . ASP A 1 123 ? 1.286   -2.098  -11.574 1.00 0.81  ? 1630 ASP A CG   3  
ATOM 8112  O OD1  . ASP A 1 123 ? 2.115   -1.164  -11.631 1.00 0.73  ? 1630 ASP A OD1  3  
ATOM 8113  O OD2  . ASP A 1 123 ? 0.974   -2.754  -12.589 1.00 1.09  ? 1630 ASP A OD2  3  
ATOM 8114  H H    . ASP A 1 123 ? 0.397   -3.235  -7.567  1.00 0.42  ? 1630 ASP A H    3  
ATOM 8115  H HA   . ASP A 1 123 ? 2.138   -4.074  -9.753  1.00 0.67  ? 1630 ASP A HA   3  
ATOM 8116  H HB2  . ASP A 1 123 ? -0.146  -3.141  -10.435 1.00 0.71  ? 1630 ASP A HB2  3  
ATOM 8117  H HB3  . ASP A 1 123 ? 0.251   -1.563  -9.836  1.00 0.62  ? 1630 ASP A HB3  3  
ATOM 8118  N N    . LYS A 1 124 ? 4.018   -2.853  -9.017  1.00 0.67  ? 1631 LYS A N    3  
ATOM 8119  C CA   . LYS A 1 124 ? 5.225   -2.296  -8.471  1.00 0.75  ? 1631 LYS A CA   3  
ATOM 8120  C C    . LYS A 1 124 ? 5.803   -1.252  -9.417  1.00 0.67  ? 1631 LYS A C    3  
ATOM 8121  O O    . LYS A 1 124 ? 6.690   -0.487  -9.058  1.00 0.73  ? 1631 LYS A O    3  
ATOM 8122  C CB   . LYS A 1 124 ? 6.156   -3.503  -8.215  1.00 1.06  ? 1631 LYS A CB   3  
ATOM 8123  C CG   . LYS A 1 124 ? 7.366   -3.318  -7.307  1.00 1.71  ? 1631 LYS A CG   3  
ATOM 8124  C CD   . LYS A 1 124 ? 8.564   -2.746  -8.020  1.00 2.34  ? 1631 LYS A CD   3  
ATOM 8125  C CE   . LYS A 1 124 ? 9.821   -2.934  -7.189  1.00 3.07  ? 1631 LYS A CE   3  
ATOM 8126  N NZ   . LYS A 1 124 ? 10.038  -4.366  -6.866  1.00 3.60  ? 1631 LYS A NZ   3  
ATOM 8127  H H    . LYS A 1 124 ? 4.075   -3.708  -9.497  1.00 0.80  ? 1631 LYS A H    3  
ATOM 8128  H HA   . LYS A 1 124 ? 4.996   -1.836  -7.522  1.00 0.77  ? 1631 LYS A HA   3  
ATOM 8129  H HB2  . LYS A 1 124 ? 5.562   -4.291  -7.779  1.00 1.52  ? 1631 LYS A HB2  3  
ATOM 8130  H HB3  . LYS A 1 124 ? 6.507   -3.852  -9.175  1.00 1.47  ? 1631 LYS A HB3  3  
ATOM 8131  H HG2  . LYS A 1 124 ? 7.097   -2.646  -6.506  1.00 2.29  ? 1631 LYS A HG2  3  
ATOM 8132  H HG3  . LYS A 1 124 ? 7.630   -4.278  -6.889  1.00 2.22  ? 1631 LYS A HG3  3  
ATOM 8133  H HD2  . LYS A 1 124 ? 8.686   -3.250  -8.967  1.00 2.74  ? 1631 LYS A HD2  3  
ATOM 8134  H HD3  . LYS A 1 124 ? 8.407   -1.690  -8.185  1.00 2.69  ? 1631 LYS A HD3  3  
ATOM 8135  H HE2  . LYS A 1 124 ? 10.669  -2.563  -7.746  1.00 3.46  ? 1631 LYS A HE2  3  
ATOM 8136  H HE3  . LYS A 1 124 ? 9.719   -2.376  -6.270  1.00 3.45  ? 1631 LYS A HE3  3  
ATOM 8137  H HZ1  . LYS A 1 124 ? 9.372   -4.726  -6.146  1.00 3.98  ? 1631 LYS A HZ1  3  
ATOM 8138  H HZ2  . LYS A 1 124 ? 11.023  -4.597  -6.600  1.00 3.93  ? 1631 LYS A HZ2  3  
ATOM 8139  H HZ3  . LYS A 1 124 ? 9.865   -4.946  -7.717  1.00 3.83  ? 1631 LYS A HZ3  3  
ATOM 8140  N N    . GLN A 1 125 ? 5.255   -1.199  -10.601 1.00 0.66  ? 1632 GLN A N    3  
ATOM 8141  C CA   . GLN A 1 125 ? 5.685   -0.260  -11.584 1.00 0.68  ? 1632 GLN A CA   3  
ATOM 8142  C C    . GLN A 1 125 ? 4.957   1.085   -11.413 1.00 0.57  ? 1632 GLN A C    3  
ATOM 8143  O O    . GLN A 1 125 ? 5.583   2.146   -11.447 1.00 0.60  ? 1632 GLN A O    3  
ATOM 8144  C CB   . GLN A 1 125 ? 5.481   -0.849  -12.984 1.00 0.85  ? 1632 GLN A CB   3  
ATOM 8145  C CG   . GLN A 1 125 ? 5.929   0.050   -14.116 1.00 1.42  ? 1632 GLN A CG   3  
ATOM 8146  C CD   . GLN A 1 125 ? 7.403   0.456   -14.041 1.00 1.66  ? 1632 GLN A CD   3  
ATOM 8147  O OE1  . GLN A 1 125 ? 7.775   1.542   -14.484 1.00 2.60  ? 1632 GLN A OE1  3  
ATOM 8148  N NE2  . GLN A 1 125 ? 8.251   -0.398  -13.513 1.00 1.55  ? 1632 GLN A NE2  3  
ATOM 8149  H H    . GLN A 1 125 ? 4.526   -1.820  -10.817 1.00 0.70  ? 1632 GLN A H    3  
ATOM 8150  H HA   . GLN A 1 125 ? 6.742   -0.096  -11.432 1.00 0.74  ? 1632 GLN A HA   3  
ATOM 8151  H HB2  . GLN A 1 125 ? 6.034   -1.774  -13.054 1.00 1.30  ? 1632 GLN A HB2  3  
ATOM 8152  H HB3  . GLN A 1 125 ? 4.429   -1.061  -13.115 1.00 1.21  ? 1632 GLN A HB3  3  
ATOM 8153  H HG2  . GLN A 1 125 ? 5.758   -0.481  -15.040 1.00 1.88  ? 1632 GLN A HG2  3  
ATOM 8154  H HG3  . GLN A 1 125 ? 5.313   0.936   -14.085 1.00 2.07  ? 1632 GLN A HG3  3  
ATOM 8155  H HE21 . GLN A 1 125 ? 7.934   -1.274  -13.185 1.00 1.66  ? 1632 GLN A HE21 3  
ATOM 8156  H HE22 . GLN A 1 125 ? 9.200   -0.161  -13.439 1.00 1.98  ? 1632 GLN A HE22 3  
ATOM 8157  N N    . THR A 1 126 ? 3.645   1.037   -11.228 1.00 0.52  ? 1633 THR A N    3  
ATOM 8158  C CA   . THR A 1 126 ? 2.869   2.252   -11.040 1.00 0.52  ? 1633 THR A CA   3  
ATOM 8159  C C    . THR A 1 126 ? 2.644   2.558   -9.536  1.00 0.45  ? 1633 THR A C    3  
ATOM 8160  O O    . THR A 1 126 ? 2.048   3.578   -9.181  1.00 0.53  ? 1633 THR A O    3  
ATOM 8161  C CB   . THR A 1 126 ? 1.489   2.169   -11.772 1.00 0.63  ? 1633 THR A CB   3  
ATOM 8162  O OG1  . THR A 1 126 ? 0.735   1.031   -11.302 1.00 0.63  ? 1633 THR A OG1  3  
ATOM 8163  C CG2  . THR A 1 126 ? 1.664   2.056   -13.288 1.00 0.75  ? 1633 THR A CG2  3  
ATOM 8164  H H    . THR A 1 126 ? 3.177   0.169   -11.244 1.00 0.55  ? 1633 THR A H    3  
ATOM 8165  H HA   . THR A 1 126 ? 3.431   3.067   -11.481 1.00 0.57  ? 1633 THR A HA   3  
ATOM 8166  H HB   . THR A 1 126 ? 0.929   3.067   -11.551 1.00 0.69  ? 1633 THR A HB   3  
ATOM 8167  H HG1  . THR A 1 126 ? 1.260   0.234   -11.507 1.00 0.64  ? 1633 THR A HG1  3  
ATOM 8168  H HG21 . THR A 1 126 ? 2.149   2.937   -13.684 1.00 1.35  ? 1633 THR A HG21 3  
ATOM 8169  H HG22 . THR A 1 126 ? 0.693   1.951   -13.749 1.00 1.23  ? 1633 THR A HG22 3  
ATOM 8170  H HG23 . THR A 1 126 ? 2.258   1.183   -13.516 1.00 1.21  ? 1633 THR A HG23 3  
ATOM 8171  N N    . CYS A 1 127 ? 3.120   1.631   -8.670  1.00 0.38  ? 1634 CYS A N    3  
ATOM 8172  C CA   . CYS A 1 127 ? 3.013   1.719   -7.204  1.00 0.35  ? 1634 CYS A CA   3  
ATOM 8173  C C    . CYS A 1 127 ? 1.558   1.689   -6.740  1.00 0.31  ? 1634 CYS A C    3  
ATOM 8174  O O    . CYS A 1 127 ? 1.103   2.503   -5.936  1.00 0.31  ? 1634 CYS A O    3  
ATOM 8175  C CB   . CYS A 1 127 ? 3.802   2.914   -6.670  1.00 0.41  ? 1634 CYS A CB   3  
ATOM 8176  S SG   . CYS A 1 127 ? 5.553   2.842   -7.194  1.00 0.53  ? 1634 CYS A SG   3  
ATOM 8177  H H    . CYS A 1 127 ? 3.572   0.832   -9.015  1.00 0.41  ? 1634 CYS A H    3  
ATOM 8178  H HA   . CYS A 1 127 ? 3.464   0.810   -6.830  1.00 0.37  ? 1634 CYS A HA   3  
ATOM 8179  H HB2  . CYS A 1 127 ? 3.362   3.828   -7.042  1.00 0.42  ? 1634 CYS A HB2  3  
ATOM 8180  H HB3  . CYS A 1 127 ? 3.777   2.912   -5.590  1.00 0.43  ? 1634 CYS A HB3  3  
ATOM 8181  N N    . THR A 1 128 ? 0.864   0.701   -7.229  1.00 0.33  ? 1635 THR A N    3  
ATOM 8182  C CA   . THR A 1 128 ? -0.549  0.517   -6.977  1.00 0.32  ? 1635 THR A CA   3  
ATOM 8183  C C    . THR A 1 128 ? -0.747  -0.757  -6.141  1.00 0.28  ? 1635 THR A C    3  
ATOM 8184  O O    . THR A 1 128 ? -0.333  -1.837  -6.549  1.00 0.32  ? 1635 THR A O    3  
ATOM 8185  C CB   . THR A 1 128 ? -1.305  0.386   -8.327  1.00 0.38  ? 1635 THR A CB   3  
ATOM 8186  O OG1  . THR A 1 128 ? -0.983  1.505   -9.165  1.00 0.46  ? 1635 THR A OG1  3  
ATOM 8187  C CG2  . THR A 1 128 ? -2.817  0.321   -8.131  1.00 0.41  ? 1635 THR A CG2  3  
ATOM 8188  H H    . THR A 1 128 ? 1.360   0.043   -7.760  1.00 0.39  ? 1635 THR A H    3  
ATOM 8189  H HA   . THR A 1 128 ? -0.906  1.384   -6.442  1.00 0.33  ? 1635 THR A HA   3  
ATOM 8190  H HB   . THR A 1 128 ? -0.971  -0.510  -8.828  1.00 0.41  ? 1635 THR A HB   3  
ATOM 8191  H HG1  . THR A 1 128 ? -0.349  1.192   -9.829  1.00 0.89  ? 1635 THR A HG1  3  
ATOM 8192  H HG21 . THR A 1 128 ? -3.201  1.238   -7.706  1.00 1.04  ? 1635 THR A HG21 3  
ATOM 8193  H HG22 . THR A 1 128 ? -3.068  -0.505  -7.481  1.00 1.11  ? 1635 THR A HG22 3  
ATOM 8194  H HG23 . THR A 1 128 ? -3.284  0.159   -9.092  1.00 1.08  ? 1635 THR A HG23 3  
ATOM 8195  N N    . LEU A 1 129 ? -1.376  -0.629  -5.000  1.00 0.25  ? 1636 LEU A N    3  
ATOM 8196  C CA   . LEU A 1 129 ? -1.533  -1.742  -4.085  1.00 0.24  ? 1636 LEU A CA   3  
ATOM 8197  C C    . LEU A 1 129 ? -2.974  -2.229  -4.157  1.00 0.23  ? 1636 LEU A C    3  
ATOM 8198  O O    . LEU A 1 129 ? -3.904  -1.420  -4.072  1.00 0.28  ? 1636 LEU A O    3  
ATOM 8199  C CB   . LEU A 1 129 ? -1.230  -1.334  -2.617  1.00 0.27  ? 1636 LEU A CB   3  
ATOM 8200  C CG   . LEU A 1 129 ? 0.142   -0.668  -2.228  1.00 0.32  ? 1636 LEU A CG   3  
ATOM 8201  C CD1  . LEU A 1 129 ? 0.399   0.654   -2.939  1.00 0.85  ? 1636 LEU A CD1  3  
ATOM 8202  C CD2  . LEU A 1 129 ? 0.163   -0.393  -0.755  1.00 0.86  ? 1636 LEU A CD2  3  
ATOM 8203  H H    . LEU A 1 129 ? -1.793  0.229   -4.757  1.00 0.27  ? 1636 LEU A H    3  
ATOM 8204  H HA   . LEU A 1 129 ? -0.863  -2.536  -4.384  1.00 0.24  ? 1636 LEU A HA   3  
ATOM 8205  H HB2  . LEU A 1 129 ? -2.047  -0.769  -2.210  1.00 0.34  ? 1636 LEU A HB2  3  
ATOM 8206  H HB3  . LEU A 1 129 ? -1.267  -2.274  -2.090  1.00 0.26  ? 1636 LEU A HB3  3  
ATOM 8207  H HG   . LEU A 1 129 ? 0.956   -1.343  -2.442  1.00 0.83  ? 1636 LEU A HG   3  
ATOM 8208  H HD11 . LEU A 1 129 ? 1.333   1.060   -2.579  1.00 1.40  ? 1636 LEU A HD11 3  
ATOM 8209  H HD12 . LEU A 1 129 ? -0.403  1.338   -2.708  1.00 1.36  ? 1636 LEU A HD12 3  
ATOM 8210  H HD13 . LEU A 1 129 ? 0.466   0.490   -4.004  1.00 1.56  ? 1636 LEU A HD13 3  
ATOM 8211  H HD21 . LEU A 1 129 ? 1.142   -0.028  -0.480  1.00 1.36  ? 1636 LEU A HD21 3  
ATOM 8212  H HD22 . LEU A 1 129 ? -0.112  -1.269  -0.190  1.00 1.31  ? 1636 LEU A HD22 3  
ATOM 8213  H HD23 . LEU A 1 129 ? -0.552  0.400   -0.587  1.00 1.40  ? 1636 LEU A HD23 3  
ATOM 8214  N N    . PHE A 1 130 ? -3.171  -3.515  -4.331  1.00 0.22  ? 1637 PHE A N    3  
ATOM 8215  C CA   . PHE A 1 130 ? -4.520  -4.059  -4.416  1.00 0.23  ? 1637 PHE A CA   3  
ATOM 8216  C C    . PHE A 1 130 ? -4.900  -4.803  -3.134  1.00 0.22  ? 1637 PHE A C    3  
ATOM 8217  O O    . PHE A 1 130 ? -4.119  -5.618  -2.625  1.00 0.26  ? 1637 PHE A O    3  
ATOM 8218  C CB   . PHE A 1 130 ? -4.661  -4.996  -5.620  1.00 0.28  ? 1637 PHE A CB   3  
ATOM 8219  C CG   . PHE A 1 130 ? -4.350  -4.355  -6.944  1.00 0.31  ? 1637 PHE A CG   3  
ATOM 8220  C CD1  . PHE A 1 130 ? -5.193  -3.397  -7.479  1.00 0.38  ? 1637 PHE A CD1  3  
ATOM 8221  C CD2  . PHE A 1 130 ? -3.213  -4.711  -7.650  1.00 0.37  ? 1637 PHE A CD2  3  
ATOM 8222  C CE1  . PHE A 1 130 ? -4.906  -2.809  -8.692  1.00 0.45  ? 1637 PHE A CE1  3  
ATOM 8223  C CE2  . PHE A 1 130 ? -2.922  -4.124  -8.864  1.00 0.43  ? 1637 PHE A CE2  3  
ATOM 8224  C CZ   . PHE A 1 130 ? -3.768  -3.173  -9.384  1.00 0.45  ? 1637 PHE A CZ   3  
ATOM 8225  H H    . PHE A 1 130 ? -2.399  -4.117  -4.407  1.00 0.25  ? 1637 PHE A H    3  
ATOM 8226  H HA   . PHE A 1 130 ? -5.199  -3.229  -4.543  1.00 0.23  ? 1637 PHE A HA   3  
ATOM 8227  H HB2  . PHE A 1 130 ? -3.979  -5.822  -5.494  1.00 0.29  ? 1637 PHE A HB2  3  
ATOM 8228  H HB3  . PHE A 1 130 ? -5.674  -5.366  -5.653  1.00 0.31  ? 1637 PHE A HB3  3  
ATOM 8229  H HD1  . PHE A 1 130 ? -6.084  -3.111  -6.939  1.00 0.43  ? 1637 PHE A HD1  3  
ATOM 8230  H HD2  . PHE A 1 130 ? -2.549  -5.459  -7.241  1.00 0.41  ? 1637 PHE A HD2  3  
ATOM 8231  H HE1  . PHE A 1 130 ? -5.570  -2.061  -9.101  1.00 0.54  ? 1637 PHE A HE1  3  
ATOM 8232  H HE2  . PHE A 1 130 ? -2.034  -4.411  -9.408  1.00 0.50  ? 1637 PHE A HE2  3  
ATOM 8233  H HZ   . PHE A 1 130 ? -3.543  -2.712  -10.334 1.00 0.52  ? 1637 PHE A HZ   3  
ATOM 8234  N N    . PHE A 1 131 ? -6.103  -4.558  -2.660  1.00 0.21  ? 1638 PHE A N    3  
ATOM 8235  C CA   . PHE A 1 131 ? -6.638  -5.151  -1.433  1.00 0.22  ? 1638 PHE A CA   3  
ATOM 8236  C C    . PHE A 1 131 ? -8.002  -5.769  -1.741  1.00 0.22  ? 1638 PHE A C    3  
ATOM 8237  O O    . PHE A 1 131 ? -8.812  -5.159  -2.447  1.00 0.26  ? 1638 PHE A O    3  
ATOM 8238  C CB   . PHE A 1 131 ? -6.843  -4.094  -0.290  1.00 0.25  ? 1638 PHE A CB   3  
ATOM 8239  C CG   . PHE A 1 131 ? -5.610  -3.399  0.296   1.00 0.28  ? 1638 PHE A CG   3  
ATOM 8240  C CD1  . PHE A 1 131 ? -4.940  -3.950  1.383   1.00 0.42  ? 1638 PHE A CD1  3  
ATOM 8241  C CD2  . PHE A 1 131 ? -5.146  -2.178  -0.206  1.00 0.29  ? 1638 PHE A CD2  3  
ATOM 8242  C CE1  . PHE A 1 131 ? -3.845  -3.312  1.944   1.00 0.50  ? 1638 PHE A CE1  3  
ATOM 8243  C CE2  . PHE A 1 131 ? -4.059  -1.550  0.354   1.00 0.34  ? 1638 PHE A CE2  3  
ATOM 8244  C CZ   . PHE A 1 131 ? -3.407  -2.107  1.424   1.00 0.43  ? 1638 PHE A CZ   3  
ATOM 8245  H H    . PHE A 1 131 ? -6.707  -3.980  -3.180  1.00 0.23  ? 1638 PHE A H    3  
ATOM 8246  H HA   . PHE A 1 131 ? -5.984  -5.938  -1.091  1.00 0.24  ? 1638 PHE A HA   3  
ATOM 8247  H HB2  . PHE A 1 131 ? -7.501  -3.316  -0.644  1.00 0.26  ? 1638 PHE A HB2  3  
ATOM 8248  H HB3  . PHE A 1 131 ? -7.335  -4.613  0.520   1.00 0.28  ? 1638 PHE A HB3  3  
ATOM 8249  H HD1  . PHE A 1 131 ? -5.269  -4.890  1.802   1.00 0.51  ? 1638 PHE A HD1  3  
ATOM 8250  H HD2  . PHE A 1 131 ? -5.619  -1.678  -1.036  1.00 0.34  ? 1638 PHE A HD2  3  
ATOM 8251  H HE1  . PHE A 1 131 ? -3.335  -3.754  2.788   1.00 0.64  ? 1638 PHE A HE1  3  
ATOM 8252  H HE2  . PHE A 1 131 ? -3.719  -0.611  -0.058  1.00 0.39  ? 1638 PHE A HE2  3  
ATOM 8253  H HZ   . PHE A 1 131 ? -2.554  -1.591  1.845   1.00 0.50  ? 1638 PHE A HZ   3  
ATOM 8254  N N    . SER A 1 132 ? -8.248  -6.946  -1.222  1.00 0.25  ? 1639 SER A N    3  
ATOM 8255  C CA   . SER A 1 132 ? -9.523  -7.612  -1.388  1.00 0.25  ? 1639 SER A CA   3  
ATOM 8256  C C    . SER A 1 132 ? -10.066 -7.940  -0.025  1.00 0.24  ? 1639 SER A C    3  
ATOM 8257  O O    . SER A 1 132 ? -9.296  -8.070  0.942   1.00 0.33  ? 1639 SER A O    3  
ATOM 8258  C CB   . SER A 1 132 ? -9.394  -8.891  -2.225  1.00 0.29  ? 1639 SER A CB   3  
ATOM 8259  O OG   . SER A 1 132 ? -10.661 -9.428  -2.564  1.00 1.04  ? 1639 SER A OG   3  
ATOM 8260  H H    . SER A 1 132 ? -7.558  -7.380  -0.674  1.00 0.30  ? 1639 SER A H    3  
ATOM 8261  H HA   . SER A 1 132 ? -10.223 -6.947  -1.866  1.00 0.26  ? 1639 SER A HA   3  
ATOM 8262  H HB2  . SER A 1 132 ? -8.912  -8.659  -3.159  1.00 0.71  ? 1639 SER A HB2  3  
ATOM 8263  H HB3  . SER A 1 132 ? -8.838  -9.636  -1.675  1.00 0.78  ? 1639 SER A HB3  3  
ATOM 8264  H HG   . SER A 1 132 ? -10.717 -9.424  -3.534  1.00 1.34  ? 1639 SER A HG   3  
ATOM 8265  N N    . TRP A 1 133 ? -11.361 -8.066  0.057   1.00 0.23  ? 1640 TRP A N    3  
ATOM 8266  C CA   . TRP A 1 133 ? -12.048 -8.347  1.267   1.00 0.23  ? 1640 TRP A CA   3  
ATOM 8267  C C    . TRP A 1 133 ? -13.349 -8.999  0.829   1.00 0.25  ? 1640 TRP A C    3  
ATOM 8268  O O    . TRP A 1 133 ? -14.237 -8.333  0.281   1.00 0.31  ? 1640 TRP A O    3  
ATOM 8269  C CB   . TRP A 1 133 ? -12.318 -7.025  2.027   1.00 0.27  ? 1640 TRP A CB   3  
ATOM 8270  C CG   . TRP A 1 133 ? -12.784 -7.179  3.458   1.00 0.28  ? 1640 TRP A CG   3  
ATOM 8271  C CD1  . TRP A 1 133 ? -13.492 -8.206  3.993   1.00 0.30  ? 1640 TRP A CD1  3  
ATOM 8272  C CD2  . TRP A 1 133 ? -12.589 -6.240  4.527   1.00 0.39  ? 1640 TRP A CD2  3  
ATOM 8273  N NE1  . TRP A 1 133 ? -13.742 -7.977  5.313   1.00 0.36  ? 1640 TRP A NE1  3  
ATOM 8274  C CE2  . TRP A 1 133 ? -13.204 -6.778  5.670   1.00 0.43  ? 1640 TRP A CE2  3  
ATOM 8275  C CE3  . TRP A 1 133 ? -11.952 -5.002  4.628   1.00 0.51  ? 1640 TRP A CE3  3  
ATOM 8276  C CZ2  . TRP A 1 133 ? -13.204 -6.119  6.897   1.00 0.57  ? 1640 TRP A CZ2  3  
ATOM 8277  C CZ3  . TRP A 1 133 ? -11.956 -4.352  5.843   1.00 0.66  ? 1640 TRP A CZ3  3  
ATOM 8278  C CH2  . TRP A 1 133 ? -12.577 -4.911  6.962   1.00 0.68  ? 1640 TRP A CH2  3  
ATOM 8279  H H    . TRP A 1 133 ? -11.910 -7.996  -0.756  1.00 0.31  ? 1640 TRP A H    3  
ATOM 8280  H HA   . TRP A 1 133 ? -11.448 -9.015  1.866   1.00 0.23  ? 1640 TRP A HA   3  
ATOM 8281  H HB2  . TRP A 1 133 ? -11.406 -6.446  2.048   1.00 0.32  ? 1640 TRP A HB2  3  
ATOM 8282  H HB3  . TRP A 1 133 ? -13.070 -6.465  1.489   1.00 0.29  ? 1640 TRP A HB3  3  
ATOM 8283  H HD1  . TRP A 1 133 ? -13.800 -9.085  3.449   1.00 0.33  ? 1640 TRP A HD1  3  
ATOM 8284  H HE1  . TRP A 1 133 ? -14.243 -8.594  5.893   1.00 0.40  ? 1640 TRP A HE1  3  
ATOM 8285  H HE3  . TRP A 1 133 ? -11.466 -4.553  3.774   1.00 0.52  ? 1640 TRP A HE3  3  
ATOM 8286  H HZ2  . TRP A 1 133 ? -13.679 -6.535  7.772   1.00 0.61  ? 1640 TRP A HZ2  3  
ATOM 8287  H HZ3  . TRP A 1 133 ? -11.474 -3.392  5.937   1.00 0.78  ? 1640 TRP A HZ3  3  
ATOM 8288  H HH2  . TRP A 1 133 ? -12.554 -4.363  7.893   1.00 0.80  ? 1640 TRP A HH2  3  
ATOM 8289  N N    . HIS A 1 134 ? -13.433 -10.294 0.983   1.00 0.28  ? 1641 HIS A N    3  
ATOM 8290  C CA   . HIS A 1 134 ? -14.597 -11.022 0.532   1.00 0.34  ? 1641 HIS A CA   3  
ATOM 8291  C C    . HIS A 1 134 ? -15.584 -11.167 1.669   1.00 0.33  ? 1641 HIS A C    3  
ATOM 8292  O O    . HIS A 1 134 ? -15.451 -12.036 2.514   1.00 0.39  ? 1641 HIS A O    3  
ATOM 8293  C CB   . HIS A 1 134 ? -14.227 -12.391 -0.052  1.00 0.48  ? 1641 HIS A CB   3  
ATOM 8294  C CG   . HIS A 1 134 ? -13.348 -12.354 -1.272  1.00 0.51  ? 1641 HIS A CG   3  
ATOM 8295  N ND1  . HIS A 1 134 ? -13.783 -12.713 -2.527  1.00 0.73  ? 1641 HIS A ND1  3  
ATOM 8296  C CD2  . HIS A 1 134 ? -12.040 -12.044 -1.416  1.00 0.64  ? 1641 HIS A CD2  3  
ATOM 8297  C CE1  . HIS A 1 134 ? -12.787 -12.628 -3.379  1.00 0.90  ? 1641 HIS A CE1  3  
ATOM 8298  N NE2  . HIS A 1 134 ? -11.727 -12.225 -2.731  1.00 0.85  ? 1641 HIS A NE2  3  
ATOM 8299  H H    . HIS A 1 134 ? -12.717 -10.780 1.454   1.00 0.30  ? 1641 HIS A H    3  
ATOM 8300  H HA   . HIS A 1 134 ? -15.064 -10.426 -0.237  1.00 0.38  ? 1641 HIS A HA   3  
ATOM 8301  H HB2  . HIS A 1 134 ? -13.737 -12.996 0.696   1.00 0.65  ? 1641 HIS A HB2  3  
ATOM 8302  H HB3  . HIS A 1 134 ? -15.153 -12.859 -0.345  1.00 0.67  ? 1641 HIS A HB3  3  
ATOM 8303  H HD1  . HIS A 1 134 ? -14.696 -13.002 -2.782  1.00 0.86  ? 1641 HIS A HD1  3  
ATOM 8304  H HD2  . HIS A 1 134 ? -11.379 -11.695 -0.637  1.00 0.74  ? 1641 HIS A HD2  3  
ATOM 8305  H HE1  . HIS A 1 134 ? -12.836 -12.850 -4.435  1.00 1.14  ? 1641 HIS A HE1  3  
ATOM 8306  H HE2  . HIS A 1 134 ? -10.818 -12.177 -3.118  1.00 0.89  ? 1641 HIS A HE2  3  
ATOM 8307  N N    . THR A 1 135 ? -16.574 -10.337 1.642   1.00 0.33  ? 1642 THR A N    3  
ATOM 8308  C CA   . THR A 1 135 ? -17.549 -10.223 2.695   1.00 0.35  ? 1642 THR A CA   3  
ATOM 8309  C C    . THR A 1 135 ? -18.957 -10.177 2.083   1.00 0.38  ? 1642 THR A C    3  
ATOM 8310  O O    . THR A 1 135 ? -19.134 -9.682  0.955   1.00 0.38  ? 1642 THR A O    3  
ATOM 8311  C CB   . THR A 1 135 ? -17.299 -8.910  3.527   1.00 0.37  ? 1642 THR A CB   3  
ATOM 8312  O OG1  . THR A 1 135 ? -18.353 -8.698  4.490   1.00 0.48  ? 1642 THR A OG1  3  
ATOM 8313  C CG2  . THR A 1 135 ? -17.185 -7.681  2.627   1.00 0.32  ? 1642 THR A CG2  3  
ATOM 8314  H H    . THR A 1 135 ? -16.686 -9.794  0.832   1.00 0.36  ? 1642 THR A H    3  
ATOM 8315  H HA   . THR A 1 135 ? -17.397 -11.075 3.337   1.00 0.39  ? 1642 THR A HA   3  
ATOM 8316  H HB   . THR A 1 135 ? -16.371 -9.037  4.067   1.00 0.40  ? 1642 THR A HB   3  
ATOM 8317  H HG1  . THR A 1 135 ? -18.030 -8.980  5.360   1.00 0.61  ? 1642 THR A HG1  3  
ATOM 8318  H HG21 . THR A 1 135 ? -17.013 -6.806  3.235   1.00 1.11  ? 1642 THR A HG21 3  
ATOM 8319  H HG22 . THR A 1 135 ? -18.099 -7.560  2.066   1.00 1.04  ? 1642 THR A HG22 3  
ATOM 8320  H HG23 . THR A 1 135 ? -16.360 -7.819  1.942   1.00 1.03  ? 1642 THR A HG23 3  
ATOM 8321  N N    . PRO A 1 136 ? -19.985 -10.726 2.780   1.00 0.46  ? 1643 PRO A N    3  
ATOM 8322  C CA   . PRO A 1 136 ? -21.357 -10.665 2.307   1.00 0.52  ? 1643 PRO A CA   3  
ATOM 8323  C C    . PRO A 1 136 ? -21.989 -9.294  2.530   1.00 0.50  ? 1643 PRO A C    3  
ATOM 8324  O O    . PRO A 1 136 ? -23.134 -9.069  2.139   1.00 0.57  ? 1643 PRO A O    3  
ATOM 8325  C CB   . PRO A 1 136 ? -22.093 -11.729 3.124   1.00 0.63  ? 1643 PRO A CB   3  
ATOM 8326  C CG   . PRO A 1 136 ? -21.300 -11.876 4.376   1.00 0.66  ? 1643 PRO A CG   3  
ATOM 8327  C CD   . PRO A 1 136 ? -19.879 -11.502 4.050   1.00 0.54  ? 1643 PRO A CD   3  
ATOM 8328  H HA   . PRO A 1 136 ? -21.416 -10.904 1.254   1.00 0.54  ? 1643 PRO A HA   3  
ATOM 8329  H HB2  . PRO A 1 136 ? -23.088 -11.370 3.339   1.00 0.67  ? 1643 PRO A HB2  3  
ATOM 8330  H HB3  . PRO A 1 136 ? -22.165 -12.660 2.581   1.00 0.69  ? 1643 PRO A HB3  3  
ATOM 8331  H HG2  . PRO A 1 136 ? -21.690 -11.213 5.133   1.00 0.72  ? 1643 PRO A HG2  3  
ATOM 8332  H HG3  . PRO A 1 136 ? -21.347 -12.898 4.719   1.00 0.78  ? 1643 PRO A HG3  3  
ATOM 8333  H HD2  . PRO A 1 136 ? -19.479 -10.903 4.856   1.00 0.54  ? 1643 PRO A HD2  3  
ATOM 8334  H HD3  . PRO A 1 136 ? -19.317 -12.414 3.913   1.00 0.56  ? 1643 PRO A HD3  3  
ATOM 8335  N N    . LEU A 1 137 ? -21.255 -8.370  3.158   1.00 0.47  ? 1644 LEU A N    3  
ATOM 8336  C CA   . LEU A 1 137 ? -21.767 -7.016  3.351   1.00 0.48  ? 1644 LEU A CA   3  
ATOM 8337  C C    . LEU A 1 137 ? -21.829 -6.310  1.990   1.00 0.52  ? 1644 LEU A C    3  
ATOM 8338  O O    . LEU A 1 137 ? -22.718 -5.506  1.730   1.00 0.60  ? 1644 LEU A O    3  
ATOM 8339  C CB   . LEU A 1 137 ? -20.902 -6.229  4.391   1.00 0.58  ? 1644 LEU A CB   3  
ATOM 8340  C CG   . LEU A 1 137 ? -21.379 -4.798  4.798   1.00 0.66  ? 1644 LEU A CG   3  
ATOM 8341  C CD1  . LEU A 1 137 ? -20.808 -4.421  6.151   1.00 0.97  ? 1644 LEU A CD1  3  
ATOM 8342  C CD2  . LEU A 1 137 ? -20.935 -3.743  3.785   1.00 0.96  ? 1644 LEU A CD2  3  
ATOM 8343  H H    . LEU A 1 137 ? -20.366 -8.618  3.501   1.00 0.48  ? 1644 LEU A H    3  
ATOM 8344  H HA   . LEU A 1 137 ? -22.775 -7.119  3.730   1.00 0.49  ? 1644 LEU A HA   3  
ATOM 8345  H HB2  . LEU A 1 137 ? -20.850 -6.824  5.291   1.00 0.83  ? 1644 LEU A HB2  3  
ATOM 8346  H HB3  . LEU A 1 137 ? -19.903 -6.146  3.992   1.00 0.85  ? 1644 LEU A HB3  3  
ATOM 8347  H HG   . LEU A 1 137 ? -22.456 -4.781  4.866   1.00 1.11  ? 1644 LEU A HG   3  
ATOM 8348  H HD11 . LEU A 1 137 ? -21.129 -5.135  6.895   1.00 1.36  ? 1644 LEU A HD11 3  
ATOM 8349  H HD12 . LEU A 1 137 ? -21.159 -3.435  6.419   1.00 1.66  ? 1644 LEU A HD12 3  
ATOM 8350  H HD13 . LEU A 1 137 ? -19.731 -4.408  6.098   1.00 1.48  ? 1644 LEU A HD13 3  
ATOM 8351  H HD21 . LEU A 1 137 ? -21.370 -3.959  2.820   1.00 1.41  ? 1644 LEU A HD21 3  
ATOM 8352  H HD22 . LEU A 1 137 ? -19.858 -3.749  3.703   1.00 1.47  ? 1644 LEU A HD22 3  
ATOM 8353  H HD23 . LEU A 1 137 ? -21.260 -2.767  4.116   1.00 1.56  ? 1644 LEU A HD23 3  
ATOM 8354  N N    . ALA A 1 138 ? -20.944 -6.714  1.097   1.00 0.50  ? 1645 ALA A N    3  
ATOM 8355  C CA   . ALA A 1 138 ? -20.835 -6.135  -0.238  1.00 0.59  ? 1645 ALA A CA   3  
ATOM 8356  C C    . ALA A 1 138 ? -21.766 -6.856  -1.220  1.00 0.66  ? 1645 ALA A C    3  
ATOM 8357  O O    . ALA A 1 138 ? -21.573 -6.807  -2.425  1.00 0.84  ? 1645 ALA A O    3  
ATOM 8358  C CB   . ALA A 1 138 ? -19.395 -6.251  -0.699  1.00 0.72  ? 1645 ALA A CB   3  
ATOM 8359  H H    . ALA A 1 138 ? -20.341 -7.453  1.328   1.00 0.45  ? 1645 ALA A H    3  
ATOM 8360  H HA   . ALA A 1 138 ? -21.097 -5.087  -0.188  1.00 0.62  ? 1645 ALA A HA   3  
ATOM 8361  H HB1  . ALA A 1 138 ? -18.761 -5.603  -0.111  1.00 1.29  ? 1645 ALA A HB1  3  
ATOM 8362  H HB2  . ALA A 1 138 ? -19.297 -6.066  -1.755  1.00 1.28  ? 1645 ALA A HB2  3  
ATOM 8363  H HB3  . ALA A 1 138 ? -19.097 -7.270  -0.522  1.00 1.23  ? 1645 ALA A HB3  3  
ATOM 8364  N N    . CYS A 1 139 ? -22.763 -7.509  -0.692  1.00 0.62  ? 1646 CYS A N    3  
ATOM 8365  C CA   . CYS A 1 139 ? -23.709 -8.243  -1.471  1.00 0.75  ? 1646 CYS A CA   3  
ATOM 8366  C C    . CYS A 1 139 ? -25.065 -7.597  -1.389  1.00 0.85  ? 1646 CYS A C    3  
ATOM 8367  O O    . CYS A 1 139 ? -25.388 -6.914  -0.407  1.00 0.89  ? 1646 CYS A O    3  
ATOM 8368  C CB   . CYS A 1 139 ? -23.812 -9.657  -0.939  1.00 0.87  ? 1646 CYS A CB   3  
ATOM 8369  S SG   . CYS A 1 139 ? -22.282 -10.623 -1.071  1.00 1.19  ? 1646 CYS A SG   3  
ATOM 8370  H H    . CYS A 1 139 ? -22.902 -7.503  0.274   1.00 0.60  ? 1646 CYS A H    3  
ATOM 8371  H HA   . CYS A 1 139 ? -23.370 -8.287  -2.494  1.00 0.92  ? 1646 CYS A HA   3  
ATOM 8372  H HB2  . CYS A 1 139 ? -24.083 -9.616  0.106   1.00 1.48  ? 1646 CYS A HB2  3  
ATOM 8373  H HB3  . CYS A 1 139 ? -24.585 -10.175 -1.484  1.00 1.22  ? 1646 CYS A HB3  3  
ATOM 8374  N N    . GLU A 1 140 ? -25.840 -7.774  -2.410  1.00 1.08  ? 1647 GLU A N    3  
ATOM 8375  C CA   . GLU A 1 140 ? -27.189 -7.329  -2.422  1.00 1.37  ? 1647 GLU A CA   3  
ATOM 8376  C C    . GLU A 1 140 ? -28.085 -8.567  -2.348  1.00 1.48  ? 1647 GLU A C    3  
ATOM 8377  O O    . GLU A 1 140 ? -27.889 -9.526  -3.107  1.00 1.50  ? 1647 GLU A O    3  
ATOM 8378  C CB   . GLU A 1 140 ? -27.496 -6.440  -3.662  1.00 1.75  ? 1647 GLU A CB   3  
ATOM 8379  C CG   . GLU A 1 140 ? -27.373 -7.103  -5.037  1.00 2.13  ? 1647 GLU A CG   3  
ATOM 8380  C CD   . GLU A 1 140 ? -25.978 -7.575  -5.387  1.00 2.58  ? 1647 GLU A CD   3  
ATOM 8381  O OE1  . GLU A 1 140 ? -25.595 -8.681  -4.977  1.00 3.14  ? 1647 GLU A OE1  3  
ATOM 8382  O OE2  . GLU A 1 140 ? -25.242 -6.816  -6.061  1.00 2.88  ? 1647 GLU A OE2  3  
ATOM 8383  H H    . GLU A 1 140 ? -25.519 -8.240  -3.220  1.00 1.15  ? 1647 GLU A H    3  
ATOM 8384  H HA   . GLU A 1 140 ? -27.327 -6.756  -1.518  1.00 1.45  ? 1647 GLU A HA   3  
ATOM 8385  H HB2  . GLU A 1 140 ? -28.509 -6.076  -3.574  1.00 2.23  ? 1647 GLU A HB2  3  
ATOM 8386  H HB3  . GLU A 1 140 ? -26.829 -5.591  -3.634  1.00 2.14  ? 1647 GLU A HB3  3  
ATOM 8387  H HG2  . GLU A 1 140 ? -28.029 -7.961  -5.064  1.00 2.45  ? 1647 GLU A HG2  3  
ATOM 8388  H HG3  . GLU A 1 140 ? -27.697 -6.393  -5.783  1.00 2.59  ? 1647 GLU A HG3  3  
ATOM 8389  N N    . PRO A 1 141 ? -29.022 -8.600  -1.393  1.00 1.76  ? 1648 PRO A N    3  
ATOM 8390  C CA   . PRO A 1 141 ? -29.879 -9.766  -1.169  1.00 2.03  ? 1648 PRO A CA   3  
ATOM 8391  C C    . PRO A 1 141 ? -30.870 -10.017 -2.310  1.00 2.21  ? 1648 PRO A C    3  
ATOM 8392  O O    . PRO A 1 141 ? -31.913 -9.362  -2.413  1.00 2.55  ? 1648 PRO A O    3  
ATOM 8393  C CB   . PRO A 1 141 ? -30.609 -9.434  0.137   1.00 2.55  ? 1648 PRO A CB   3  
ATOM 8394  C CG   . PRO A 1 141 ? -30.589 -7.950  0.219   1.00 2.58  ? 1648 PRO A CG   3  
ATOM 8395  C CD   . PRO A 1 141 ? -29.322 -7.508  -0.448  1.00 2.03  ? 1648 PRO A CD   3  
ATOM 8396  H HA   . PRO A 1 141 ? -29.283 -10.655 -1.031  1.00 1.99  ? 1648 PRO A HA   3  
ATOM 8397  H HB2  . PRO A 1 141 ? -31.617 -9.818  0.105   1.00 2.92  ? 1648 PRO A HB2  3  
ATOM 8398  H HB3  . PRO A 1 141 ? -30.072 -9.872  0.964   1.00 2.71  ? 1648 PRO A HB3  3  
ATOM 8399  H HG2  . PRO A 1 141 ? -31.442 -7.543  -0.300  1.00 2.88  ? 1648 PRO A HG2  3  
ATOM 8400  H HG3  . PRO A 1 141 ? -30.595 -7.640  1.254   1.00 2.86  ? 1648 PRO A HG3  3  
ATOM 8401  H HD2  . PRO A 1 141 ? -29.502 -6.584  -0.972  1.00 2.12  ? 1648 PRO A HD2  3  
ATOM 8402  H HD3  . PRO A 1 141 ? -28.529 -7.388  0.276   1.00 1.94  ? 1648 PRO A HD3  3  
ATOM 8403  N N    . GLU A 1 142 ? -30.527 -10.950 -3.160  1.00 2.23  ? 1649 GLU A N    3  
ATOM 8404  C CA   . GLU A 1 142 ? -31.348 -11.344 -4.264  1.00 2.59  ? 1649 GLU A CA   3  
ATOM 8405  C C    . GLU A 1 142 ? -31.060 -12.823 -4.517  1.00 2.73  ? 1649 GLU A C    3  
ATOM 8406  O O    . GLU A 1 142 ? -30.239 -13.167 -5.391  1.00 3.18  ? 1649 GLU A O    3  
ATOM 8407  C CB   . GLU A 1 142 ? -31.040 -10.464 -5.499  1.00 3.20  ? 1649 GLU A CB   3  
ATOM 8408  C CG   . GLU A 1 142 ? -31.953 -10.678 -6.711  1.00 3.71  ? 1649 GLU A CG   3  
ATOM 8409  C CD   . GLU A 1 142 ? -33.418 -10.423 -6.419  1.00 4.21  ? 1649 GLU A CD   3  
ATOM 8410  O OE1  . GLU A 1 142 ? -33.822 -9.253  -6.243  1.00 4.72  ? 1649 GLU A OE1  3  
ATOM 8411  O OE2  . GLU A 1 142 ? -34.206 -11.381 -6.395  1.00 4.48  ? 1649 GLU A OE2  3  
ATOM 8412  O OXT  . GLU A 1 142 ? -31.583 -13.660 -3.753  1.00 3.07  ? 1649 GLU A OXT  3  
ATOM 8413  H H    . GLU A 1 142 ? -29.669 -11.419 -3.052  1.00 2.17  ? 1649 GLU A H    3  
ATOM 8414  H HA   . GLU A 1 142 ? -32.381 -11.230 -3.971  1.00 2.87  ? 1649 GLU A HA   3  
ATOM 8415  H HB2  . GLU A 1 142 ? -31.120 -9.428  -5.206  1.00 3.68  ? 1649 GLU A HB2  3  
ATOM 8416  H HB3  . GLU A 1 142 ? -30.022 -10.656 -5.807  1.00 3.42  ? 1649 GLU A HB3  3  
ATOM 8417  H HG2  . GLU A 1 142 ? -31.643 -10.007 -7.498  1.00 4.08  ? 1649 GLU A HG2  3  
ATOM 8418  H HG3  . GLU A 1 142 ? -31.839 -11.697 -7.050  1.00 3.96  ? 1649 GLU A HG3  3  
ATOM 8419  N N    . ALA B 2 1   ? 1.484   17.773  1.673   1.00 9.97  ? 1    ALA B N    3  
ATOM 8420  C CA   . ALA B 2 1   ? 2.803   17.490  2.213   1.00 9.24  ? 1    ALA B CA   3  
ATOM 8421  C C    . ALA B 2 1   ? 3.734   17.122  1.084   1.00 8.32  ? 1    ALA B C    3  
ATOM 8422  O O    . ALA B 2 1   ? 3.903   15.944  0.764   1.00 8.34  ? 1    ALA B O    3  
ATOM 8423  C CB   . ALA B 2 1   ? 2.741   16.378  3.244   1.00 9.68  ? 1    ALA B CB   3  
ATOM 8424  H H1   . ALA B 2 1   ? 1.550   18.630  1.077   1.00 10.26 ? 1    ALA B H1   3  
ATOM 8425  H H2   . ALA B 2 1   ? 0.755   17.899  2.408   1.00 10.22 ? 1    ALA B H2   3  
ATOM 8426  H H3   . ALA B 2 1   ? 1.212   16.997  1.031   1.00 10.14 ? 1    ALA B H3   3  
ATOM 8427  H HA   . ALA B 2 1   ? 3.174   18.385  2.692   1.00 9.24  ? 1    ALA B HA   3  
ATOM 8428  H HB1  . ALA B 2 1   ? 3.729   16.203  3.645   1.00 10.04 ? 1    ALA B HB1  3  
ATOM 8429  H HB2  . ALA B 2 1   ? 2.376   15.474  2.779   1.00 9.77  ? 1    ALA B HB2  3  
ATOM 8430  H HB3  . ALA B 2 1   ? 2.075   16.665  4.044   1.00 9.78  ? 1    ALA B HB3  3  
ATOM 8431  N N    . TYR B 2 2   ? 4.319   18.104  0.462   1.00 7.68  ? 2    TYR B N    3  
ATOM 8432  C CA   . TYR B 2 2   ? 5.207   17.844  -0.639  1.00 6.91  ? 2    TYR B CA   3  
ATOM 8433  C C    . TYR B 2 2   ? 6.589   18.279  -0.229  1.00 6.01  ? 2    TYR B C    3  
ATOM 8434  O O    . TYR B 2 2   ? 6.760   19.354  0.351   1.00 6.08  ? 2    TYR B O    3  
ATOM 8435  C CB   . TYR B 2 2   ? 4.753   18.608  -1.896  1.00 7.21  ? 2    TYR B CB   3  
ATOM 8436  C CG   . TYR B 2 2   ? 5.356   18.112  -3.217  1.00 6.80  ? 2    TYR B CG   3  
ATOM 8437  C CD1  . TYR B 2 2   ? 6.644   18.472  -3.634  1.00 6.75  ? 2    TYR B CD1  3  
ATOM 8438  C CD2  . TYR B 2 2   ? 4.608   17.296  -4.054  1.00 6.74  ? 2    TYR B CD2  3  
ATOM 8439  C CE1  . TYR B 2 2   ? 7.157   18.020  -4.859  1.00 6.73  ? 2    TYR B CE1  3  
ATOM 8440  C CE2  . TYR B 2 2   ? 5.110   16.841  -5.264  1.00 6.64  ? 2    TYR B CE2  3  
ATOM 8441  C CZ   . TYR B 2 2   ? 6.375   17.201  -5.664  1.00 6.68  ? 2    TYR B CZ   3  
ATOM 8442  O OH   . TYR B 2 2   ? 6.847   16.760  -6.900  1.00 6.93  ? 2    TYR B OH   3  
ATOM 8443  H H    . TYR B 2 2   ? 4.183   19.030  0.774   1.00 7.83  ? 2    TYR B H    3  
ATOM 8444  H HA   . TYR B 2 2   ? 5.206   16.782  -0.837  1.00 6.99  ? 2    TYR B HA   3  
ATOM 8445  H HB2  . TYR B 2 2   ? 3.680   18.522  -1.982  1.00 7.94  ? 2    TYR B HB2  3  
ATOM 8446  H HB3  . TYR B 2 2   ? 5.010   19.651  -1.779  1.00 7.23  ? 2    TYR B HB3  3  
ATOM 8447  H HD1  . TYR B 2 2   ? 7.233   19.108  -2.987  1.00 6.91  ? 2    TYR B HD1  3  
ATOM 8448  H HD2  . TYR B 2 2   ? 3.613   17.016  -3.738  1.00 6.94  ? 2    TYR B HD2  3  
ATOM 8449  H HE1  . TYR B 2 2   ? 8.153   18.298  -5.179  1.00 6.93  ? 2    TYR B HE1  3  
ATOM 8450  H HE2  . TYR B 2 2   ? 4.518   16.201  -5.904  1.00 6.72  ? 2    TYR B HE2  3  
ATOM 8451  H HH   . TYR B 2 2   ? 7.672   16.258  -6.797  1.00 6.91  ? 2    TYR B HH   3  
ATOM 8452  N N    . ARG B 2 3   ? 7.543   17.448  -0.444  1.00 5.37  ? 3    ARG B N    3  
ATOM 8453  C CA   . ARG B 2 3   ? 8.902   17.794  -0.147  1.00 4.66  ? 3    ARG B CA   3  
ATOM 8454  C C    . ARG B 2 3   ? 9.693   17.922  -1.451  1.00 4.12  ? 3    ARG B C    3  
ATOM 8455  O O    . ARG B 2 3   ? 9.583   17.066  -2.339  1.00 4.20  ? 3    ARG B O    3  
ATOM 8456  C CB   . ARG B 2 3   ? 9.533   16.776  0.824   1.00 4.56  ? 3    ARG B CB   3  
ATOM 8457  C CG   . ARG B 2 3   ? 9.505   15.331  0.367   1.00 4.51  ? 3    ARG B CG   3  
ATOM 8458  C CD   . ARG B 2 3   ? 10.168  14.426  1.388   1.00 4.76  ? 3    ARG B CD   3  
ATOM 8459  N NE   . ARG B 2 3   ? 10.110  13.017  0.997   1.00 5.07  ? 3    ARG B NE   3  
ATOM 8460  C CZ   . ARG B 2 3   ? 10.498  11.989  1.751   1.00 5.48  ? 3    ARG B CZ   3  
ATOM 8461  N NH1  . ARG B 2 3   ? 11.081  12.192  2.927   1.00 5.57  ? 3    ARG B NH1  3  
ATOM 8462  N NH2  . ARG B 2 3   ? 10.337  10.751  1.326   1.00 6.11  ? 3    ARG B NH2  3  
ATOM 8463  H H    . ARG B 2 3   ? 7.336   16.561  -0.815  1.00 5.53  ? 3    ARG B H    3  
ATOM 8464  H HA   . ARG B 2 3   ? 8.847   18.758  0.337   1.00 4.95  ? 3    ARG B HA   3  
ATOM 8465  H HB2  . ARG B 2 3   ? 10.566  17.049  0.981   1.00 4.24  ? 3    ARG B HB2  3  
ATOM 8466  H HB3  . ARG B 2 3   ? 9.016   16.842  1.770   1.00 5.22  ? 3    ARG B HB3  3  
ATOM 8467  H HG2  . ARG B 2 3   ? 8.479   15.022  0.237   1.00 5.11  ? 3    ARG B HG2  3  
ATOM 8468  H HG3  . ARG B 2 3   ? 10.033  15.250  -0.571  1.00 4.04  ? 3    ARG B HG3  3  
ATOM 8469  H HD2  . ARG B 2 3   ? 11.203  14.717  1.486   1.00 4.84  ? 3    ARG B HD2  3  
ATOM 8470  H HD3  . ARG B 2 3   ? 9.669   14.548  2.338   1.00 5.08  ? 3    ARG B HD3  3  
ATOM 8471  H HE   . ARG B 2 3   ? 9.726   12.855  0.098   1.00 5.24  ? 3    ARG B HE   3  
ATOM 8472  H HH11 . ARG B 2 3   ? 11.257  13.108  3.306   1.00 5.42  ? 3    ARG B HH11 3  
ATOM 8473  H HH12 . ARG B 2 3   ? 11.380  11.398  3.470   1.00 6.03  ? 3    ARG B HH12 3  
ATOM 8474  H HH21 . ARG B 2 3   ? 9.935   10.508  0.431   1.00 6.35  ? 3    ARG B HH21 3  
ATOM 8475  H HH22 . ARG B 2 3   ? 10.600  9.985   1.927   1.00 6.56  ? 3    ARG B HH22 3  
ATOM 8476  N N    . PRO B 2 4   ? 10.439  19.060  -1.613  1.00 4.08  ? 4    PRO B N    3  
ATOM 8477  C CA   . PRO B 2 4   ? 11.244  19.350  -2.814  1.00 4.17  ? 4    PRO B CA   3  
ATOM 8478  C C    . PRO B 2 4   ? 12.291  18.274  -3.118  1.00 3.73  ? 4    PRO B C    3  
ATOM 8479  O O    . PRO B 2 4   ? 12.736  18.132  -4.262  1.00 4.12  ? 4    PRO B O    3  
ATOM 8480  C CB   . PRO B 2 4   ? 11.906  20.695  -2.497  1.00 4.81  ? 4    PRO B CB   3  
ATOM 8481  C CG   . PRO B 2 4   ? 11.798  20.852  -1.032  1.00 4.84  ? 4    PRO B CG   3  
ATOM 8482  C CD   . PRO B 2 4   ? 10.527  20.180  -0.648  1.00 4.56  ? 4    PRO B CD   3  
ATOM 8483  H HA   . PRO B 2 4   ? 10.606  19.454  -3.679  1.00 4.57  ? 4    PRO B HA   3  
ATOM 8484  H HB2  . PRO B 2 4   ? 12.936  20.653  -2.807  1.00 4.98  ? 4    PRO B HB2  3  
ATOM 8485  H HB3  . PRO B 2 4   ? 11.393  21.489  -3.022  1.00 5.36  ? 4    PRO B HB3  3  
ATOM 8486  H HG2  . PRO B 2 4   ? 12.636  20.371  -0.549  1.00 4.72  ? 4    PRO B HG2  3  
ATOM 8487  H HG3  . PRO B 2 4   ? 11.762  21.899  -0.772  1.00 5.51  ? 4    PRO B HG3  3  
ATOM 8488  H HD2  . PRO B 2 4   ? 10.607  19.842  0.374   1.00 4.55  ? 4    PRO B HD2  3  
ATOM 8489  H HD3  . PRO B 2 4   ? 9.709   20.872  -0.776  1.00 5.09  ? 4    PRO B HD3  3  
ATOM 8490  N N    . SER B 2 5   ? 12.711  17.562  -2.102  1.00 3.33  ? 5    SER B N    3  
ATOM 8491  C CA   . SER B 2 5   ? 13.534  16.404  -2.292  1.00 3.26  ? 5    SER B CA   3  
ATOM 8492  C C    . SER B 2 5   ? 12.570  15.241  -2.510  1.00 2.82  ? 5    SER B C    3  
ATOM 8493  O O    . SER B 2 5   ? 11.997  14.711  -1.562  1.00 2.91  ? 5    SER B O    3  
ATOM 8494  C CB   . SER B 2 5   ? 14.409  16.171  -1.060  1.00 4.08  ? 5    SER B CB   3  
ATOM 8495  O OG   . SER B 2 5   ? 15.175  17.332  -0.751  1.00 4.60  ? 5    SER B OG   3  
ATOM 8496  H H    . SER B 2 5   ? 12.437  17.813  -1.191  1.00 3.42  ? 5    SER B H    3  
ATOM 8497  H HA   . SER B 2 5   ? 14.142  16.554  -3.172  1.00 3.37  ? 5    SER B HA   3  
ATOM 8498  H HB2  . SER B 2 5   ? 13.801  15.906  -0.206  1.00 4.31  ? 5    SER B HB2  3  
ATOM 8499  H HB3  . SER B 2 5   ? 15.090  15.359  -1.268  1.00 4.46  ? 5    SER B HB3  3  
ATOM 8500  H HG   . SER B 2 5   ? 15.005  18.004  -1.428  1.00 4.91  ? 5    SER B HG   3  
ATOM 8501  N N    . GLU B 2 6   ? 12.380  14.869  -3.759  1.00 2.79  ? 6    GLU B N    3  
ATOM 8502  C CA   . GLU B 2 6   ? 11.323  13.934  -4.127  1.00 2.83  ? 6    GLU B CA   3  
ATOM 8503  C C    . GLU B 2 6   ? 11.680  12.503  -3.800  1.00 2.71  ? 6    GLU B C    3  
ATOM 8504  O O    . GLU B 2 6   ? 10.797  11.649  -3.675  1.00 2.87  ? 6    GLU B O    3  
ATOM 8505  C CB   . GLU B 2 6   ? 10.926  14.075  -5.603  1.00 3.19  ? 6    GLU B CB   3  
ATOM 8506  C CG   . GLU B 2 6   ? 10.417  15.459  -6.017  1.00 3.41  ? 6    GLU B CG   3  
ATOM 8507  C CD   . GLU B 2 6   ? 9.939   15.484  -7.441  1.00 3.74  ? 6    GLU B CD   3  
ATOM 8508  O OE1  . GLU B 2 6   ? 8.793   15.079  -7.709  1.00 3.88  ? 6    GLU B OE1  3  
ATOM 8509  O OE2  . GLU B 2 6   ? 10.714  15.898  -8.325  1.00 4.23  ? 6    GLU B OE2  3  
ATOM 8510  H H    . GLU B 2 6   ? 13.006  15.217  -4.435  1.00 3.08  ? 6    GLU B H    3  
ATOM 8511  H HA   . GLU B 2 6   ? 10.463  14.166  -3.517  1.00 2.97  ? 6    GLU B HA   3  
ATOM 8512  H HB2  . GLU B 2 6   ? 11.782  13.841  -6.215  1.00 3.28  ? 6    GLU B HB2  3  
ATOM 8513  H HB3  . GLU B 2 6   ? 10.149  13.355  -5.814  1.00 3.43  ? 6    GLU B HB3  3  
ATOM 8514  H HG2  . GLU B 2 6   ? 9.587   15.779  -5.402  1.00 3.61  ? 6    GLU B HG2  3  
ATOM 8515  H HG3  . GLU B 2 6   ? 11.227  16.166  -5.933  1.00 3.54  ? 6    GLU B HG3  3  
ATOM 8516  N N    . THR B 2 7   ? 12.932  12.240  -3.661  1.00 2.63  ? 7    THR B N    3  
ATOM 8517  C CA   . THR B 2 7   ? 13.364  10.921  -3.306  1.00 2.57  ? 7    THR B CA   3  
ATOM 8518  C C    . THR B 2 7   ? 13.636  10.838  -1.795  1.00 2.39  ? 7    THR B C    3  
ATOM 8519  O O    . THR B 2 7   ? 14.047  11.835  -1.162  1.00 2.45  ? 7    THR B O    3  
ATOM 8520  C CB   . THR B 2 7   ? 14.581  10.483  -4.149  1.00 2.76  ? 7    THR B CB   3  
ATOM 8521  O OG1  . THR B 2 7   ? 15.572  11.530  -4.194  1.00 2.82  ? 7    THR B OG1  3  
ATOM 8522  C CG2  . THR B 2 7   ? 14.148  10.127  -5.569  1.00 3.14  ? 7    THR B CG2  3  
ATOM 8523  H H    . THR B 2 7   ? 13.583  12.964  -3.777  1.00 2.71  ? 7    THR B H    3  
ATOM 8524  H HA   . THR B 2 7   ? 12.526  10.280  -3.542  1.00 2.72  ? 7    THR B HA   3  
ATOM 8525  H HB   . THR B 2 7   ? 15.019  9.610   -3.689  1.00 2.75  ? 7    THR B HB   3  
ATOM 8526  H HG1  . THR B 2 7   ? 16.418  11.055  -4.165  1.00 2.92  ? 7    THR B HG1  3  
ATOM 8527  H HG21 . THR B 2 7   ? 13.683  10.986  -6.028  1.00 3.45  ? 7    THR B HG21 3  
ATOM 8528  H HG22 . THR B 2 7   ? 13.445  9.308   -5.544  1.00 3.48  ? 7    THR B HG22 3  
ATOM 8529  H HG23 . THR B 2 7   ? 15.012  9.838   -6.150  1.00 3.24  ? 7    THR B HG23 3  
ATOM 8530  N N    . LEU B 2 8   ? 13.362  9.676   -1.229  1.00 2.43  ? 8    LEU B N    3  
ATOM 8531  C CA   . LEU B 2 8   ? 13.478  9.432   0.195   1.00 2.40  ? 8    LEU B CA   3  
ATOM 8532  C C    . LEU B 2 8   ? 14.929  9.264   0.662   1.00 2.21  ? 8    LEU B C    3  
ATOM 8533  O O    . LEU B 2 8   ? 15.819  9.047   -0.148  1.00 2.36  ? 8    LEU B O    3  
ATOM 8534  C CB   . LEU B 2 8   ? 12.563  8.262   0.600   1.00 2.82  ? 8    LEU B CB   3  
ATOM 8535  C CG   . LEU B 2 8   ? 12.562  6.985   -0.269  1.00 3.42  ? 8    LEU B CG   3  
ATOM 8536  C CD1  . LEU B 2 8   ? 13.890  6.240   -0.228  1.00 3.96  ? 8    LEU B CD1  3  
ATOM 8537  C CD2  . LEU B 2 8   ? 11.430  6.077   0.165   1.00 3.94  ? 8    LEU B CD2  3  
ATOM 8538  H H    . LEU B 2 8   ? 13.089  8.918   -1.784  1.00 2.65  ? 8    LEU B H    3  
ATOM 8539  H HA   . LEU B 2 8   ? 13.102  10.324  0.674   1.00 2.44  ? 8    LEU B HA   3  
ATOM 8540  H HB2  . LEU B 2 8   ? 12.841  7.967   1.602   1.00 2.74  ? 8    LEU B HB2  3  
ATOM 8541  H HB3  . LEU B 2 8   ? 11.552  8.640   0.640   1.00 3.13  ? 8    LEU B HB3  3  
ATOM 8542  H HG   . LEU B 2 8   ? 12.377  7.269   -1.294  1.00 3.68  ? 8    LEU B HG   3  
ATOM 8543  H HD11 . LEU B 2 8   ? 14.676  6.886   -0.591  1.00 4.23  ? 8    LEU B HD11 3  
ATOM 8544  H HD12 . LEU B 2 8   ? 13.832  5.360   -0.851  1.00 4.35  ? 8    LEU B HD12 3  
ATOM 8545  H HD13 . LEU B 2 8   ? 14.108  5.948   0.788   1.00 4.24  ? 8    LEU B HD13 3  
ATOM 8546  H HD21 . LEU B 2 8   ? 11.564  5.805   1.201   1.00 4.29  ? 8    LEU B HD21 3  
ATOM 8547  H HD22 . LEU B 2 8   ? 11.429  5.186   -0.445  1.00 4.13  ? 8    LEU B HD22 3  
ATOM 8548  H HD23 . LEU B 2 8   ? 10.490  6.594   0.049   1.00 4.30  ? 8    LEU B HD23 3  
ATOM 8549  N N    . CYS B 2 9   ? 15.163  9.367   1.962   1.00 2.15  ? 9    CYS B N    3  
ATOM 8550  C CA   . CYS B 2 9   ? 16.523  9.334   2.481   1.00 2.11  ? 9    CYS B CA   3  
ATOM 8551  C C    . CYS B 2 9   ? 16.561  8.766   3.913   1.00 2.19  ? 9    CYS B C    3  
ATOM 8552  O O    . CYS B 2 9   ? 15.546  8.772   4.621   1.00 2.84  ? 9    CYS B O    3  
ATOM 8553  C CB   . CYS B 2 9   ? 17.092  10.773  2.445   1.00 2.28  ? 9    CYS B CB   3  
ATOM 8554  S SG   . CYS B 2 9   ? 18.828  10.971  2.988   1.00 2.37  ? 9    CYS B SG   3  
ATOM 8555  H H    . CYS B 2 9   ? 14.415  9.465   2.600   1.00 2.32  ? 9    CYS B H    3  
ATOM 8556  H HA   . CYS B 2 9   ? 17.123  8.713   1.832   1.00 2.03  ? 9    CYS B HA   3  
ATOM 8557  H HB2  . CYS B 2 9   ? 17.037  11.143  1.432   1.00 2.65  ? 9    CYS B HB2  3  
ATOM 8558  H HB3  . CYS B 2 9   ? 16.476  11.400  3.074   1.00 2.56  ? 9    CYS B HB3  3  
ATOM 8559  N N    . GLY B 2 10  ? 17.715  8.232   4.307   1.00 1.97  ? 10   GLY B N    3  
ATOM 8560  C CA   . GLY B 2 10  ? 17.922  7.751   5.665   1.00 2.09  ? 10   GLY B CA   3  
ATOM 8561  C C    . GLY B 2 10  ? 17.231  6.439   5.938   1.00 1.88  ? 10   GLY B C    3  
ATOM 8562  O O    . GLY B 2 10  ? 17.444  5.455   5.220   1.00 1.88  ? 10   GLY B O    3  
ATOM 8563  H H    . GLY B 2 10  ? 18.447  8.149   3.651   1.00 2.07  ? 10   GLY B H    3  
ATOM 8564  H HA2  . GLY B 2 10  ? 18.981  7.624   5.832   1.00 2.28  ? 10   GLY B HA2  3  
ATOM 8565  H HA3  . GLY B 2 10  ? 17.550  8.494   6.356   1.00 2.27  ? 10   GLY B HA3  3  
ATOM 8566  N N    . GLY B 2 11  ? 16.389  6.429   6.963   1.00 1.84  ? 11   GLY B N    3  
ATOM 8567  C CA   . GLY B 2 11  ? 15.626  5.238   7.328   1.00 1.77  ? 11   GLY B CA   3  
ATOM 8568  C C    . GLY B 2 11  ? 14.716  4.775   6.204   1.00 1.58  ? 11   GLY B C    3  
ATOM 8569  O O    . GLY B 2 11  ? 14.439  3.584   6.059   1.00 1.50  ? 11   GLY B O    3  
ATOM 8570  H H    . GLY B 2 11  ? 16.305  7.250   7.504   1.00 1.94  ? 11   GLY B H    3  
ATOM 8571  H HA2  . GLY B 2 11  ? 16.313  4.442   7.575   1.00 1.85  ? 11   GLY B HA2  3  
ATOM 8572  H HA3  . GLY B 2 11  ? 15.023  5.461   8.196   1.00 1.89  ? 11   GLY B HA3  3  
ATOM 8573  N N    . GLU B 2 12  ? 14.299  5.719   5.378   1.00 1.53  ? 12   GLU B N    3  
ATOM 8574  C CA   . GLU B 2 12  ? 13.441  5.452   4.244   1.00 1.40  ? 12   GLU B CA   3  
ATOM 8575  C C    . GLU B 2 12  ? 14.179  4.584   3.222   1.00 1.33  ? 12   GLU B C    3  
ATOM 8576  O O    . GLU B 2 12  ? 13.579  3.780   2.518   1.00 1.25  ? 12   GLU B O    3  
ATOM 8577  C CB   . GLU B 2 12  ? 13.033  6.770   3.606   1.00 1.44  ? 12   GLU B CB   3  
ATOM 8578  C CG   . GLU B 2 12  ? 12.330  7.730   4.547   1.00 1.56  ? 12   GLU B CG   3  
ATOM 8579  C CD   . GLU B 2 12  ? 11.960  9.034   3.881   1.00 2.03  ? 12   GLU B CD   3  
ATOM 8580  O OE1  . GLU B 2 12  ? 12.854  9.866   3.609   1.00 2.55  ? 12   GLU B OE1  3  
ATOM 8581  O OE2  . GLU B 2 12  ? 10.759  9.260   3.614   1.00 2.50  ? 12   GLU B OE2  3  
ATOM 8582  H H    . GLU B 2 12  ? 14.578  6.645   5.539   1.00 1.62  ? 12   GLU B H    3  
ATOM 8583  H HA   . GLU B 2 12  ? 12.558  4.938   4.590   1.00 1.40  ? 12   GLU B HA   3  
ATOM 8584  H HB2  . GLU B 2 12  ? 13.927  7.252   3.244   1.00 1.51  ? 12   GLU B HB2  3  
ATOM 8585  H HB3  . GLU B 2 12  ? 12.398  6.595   2.752   1.00 1.39  ? 12   GLU B HB3  3  
ATOM 8586  H HG2  . GLU B 2 12  ? 11.427  7.259   4.905   1.00 1.79  ? 12   GLU B HG2  3  
ATOM 8587  H HG3  . GLU B 2 12  ? 12.978  7.937   5.386   1.00 1.99  ? 12   GLU B HG3  3  
ATOM 8588  N N    . LEU B 2 13  ? 15.492  4.734   3.177   1.00 1.40  ? 13   LEU B N    3  
ATOM 8589  C CA   . LEU B 2 13  ? 16.321  3.979   2.261   1.00 1.41  ? 13   LEU B CA   3  
ATOM 8590  C C    . LEU B 2 13  ? 16.410  2.541   2.730   1.00 1.37  ? 13   LEU B C    3  
ATOM 8591  O O    . LEU B 2 13  ? 16.144  1.610   1.990   1.00 1.27  ? 13   LEU B O    3  
ATOM 8592  C CB   . LEU B 2 13  ? 17.739  4.568   2.204   1.00 1.61  ? 13   LEU B CB   3  
ATOM 8593  C CG   . LEU B 2 13  ? 18.257  4.980   0.824   1.00 1.79  ? 13   LEU B CG   3  
ATOM 8594  C CD1  . LEU B 2 13  ? 18.129  3.830   -0.165  1.00 2.35  ? 13   LEU B CD1  3  
ATOM 8595  C CD2  . LEU B 2 13  ? 17.545  6.227   0.326   1.00 2.02  ? 13   LEU B CD2  3  
ATOM 8596  H H    . LEU B 2 13  ? 15.922  5.358   3.801   1.00 1.49  ? 13   LEU B H    3  
ATOM 8597  H HA   . LEU B 2 13  ? 15.883  4.014   1.274   1.00 1.38  ? 13   LEU B HA   3  
ATOM 8598  H HB2  . LEU B 2 13  ? 17.778  5.423   2.863   1.00 1.84  ? 13   LEU B HB2  3  
ATOM 8599  H HB3  . LEU B 2 13  ? 18.413  3.823   2.600   1.00 1.72  ? 13   LEU B HB3  3  
ATOM 8600  H HG   . LEU B 2 13  ? 19.310  5.204   0.916   1.00 2.18  ? 13   LEU B HG   3  
ATOM 8601  H HD11 . LEU B 2 13  ? 18.696  2.986   0.200   1.00 2.68  ? 13   LEU B HD11 3  
ATOM 8602  H HD12 . LEU B 2 13  ? 18.489  4.127   -1.139  1.00 2.82  ? 13   LEU B HD12 3  
ATOM 8603  H HD13 . LEU B 2 13  ? 17.089  3.549   -0.238  1.00 2.72  ? 13   LEU B HD13 3  
ATOM 8604  H HD21 . LEU B 2 13  ? 16.483  6.042   0.247   1.00 2.36  ? 13   LEU B HD21 3  
ATOM 8605  H HD22 . LEU B 2 13  ? 17.931  6.498   -0.645  1.00 2.41  ? 13   LEU B HD22 3  
ATOM 8606  H HD23 . LEU B 2 13  ? 17.714  7.047   1.009   1.00 2.37  ? 13   LEU B HD23 3  
ATOM 8607  N N    . VAL B 2 14  ? 16.746  2.374   3.979   1.00 1.48  ? 14   VAL B N    3  
ATOM 8608  C CA   . VAL B 2 14  ? 16.937  1.055   4.522   1.00 1.51  ? 14   VAL B CA   3  
ATOM 8609  C C    . VAL B 2 14  ? 15.617  0.261   4.606   1.00 1.39  ? 14   VAL B C    3  
ATOM 8610  O O    . VAL B 2 14  ? 15.588  -0.942  4.319   1.00 1.39  ? 14   VAL B O    3  
ATOM 8611  C CB   . VAL B 2 14  ? 17.720  1.081   5.881   1.00 1.73  ? 14   VAL B CB   3  
ATOM 8612  C CG1  . VAL B 2 14  ? 16.991  1.885   6.958   1.00 2.11  ? 14   VAL B CG1  3  
ATOM 8613  C CG2  . VAL B 2 14  ? 18.021  -0.327  6.379   1.00 1.63  ? 14   VAL B CG2  3  
ATOM 8614  H H    . VAL B 2 14  ? 16.862  3.170   4.540   1.00 1.57  ? 14   VAL B H    3  
ATOM 8615  H HA   . VAL B 2 14  ? 17.550  0.539   3.796   1.00 1.51  ? 14   VAL B HA   3  
ATOM 8616  H HB   . VAL B 2 14  ? 18.658  1.568   5.645   1.00 2.16  ? 14   VAL B HB   3  
ATOM 8617  H HG11 . VAL B 2 14  ? 16.016  1.448   7.118   1.00 2.48  ? 14   VAL B HG11 3  
ATOM 8618  H HG12 . VAL B 2 14  ? 16.868  2.916   6.660   1.00 2.44  ? 14   VAL B HG12 3  
ATOM 8619  H HG13 . VAL B 2 14  ? 17.542  1.845   7.886   1.00 2.50  ? 14   VAL B HG13 3  
ATOM 8620  H HG21 . VAL B 2 14  ? 17.090  -0.864  6.489   1.00 1.98  ? 14   VAL B HG21 3  
ATOM 8621  H HG22 . VAL B 2 14  ? 18.519  -0.288  7.338   1.00 2.03  ? 14   VAL B HG22 3  
ATOM 8622  H HG23 . VAL B 2 14  ? 18.645  -0.841  5.665   1.00 1.86  ? 14   VAL B HG23 3  
ATOM 8623  N N    . ASP B 2 15  ? 14.525  0.927   4.943   1.00 1.34  ? 15   ASP B N    3  
ATOM 8624  C CA   . ASP B 2 15  ? 13.253  0.220   5.040   1.00 1.28  ? 15   ASP B CA   3  
ATOM 8625  C C    . ASP B 2 15  ? 12.618  -0.103  3.668   1.00 1.09  ? 15   ASP B C    3  
ATOM 8626  O O    . ASP B 2 15  ? 11.829  -1.018  3.575   1.00 1.03  ? 15   ASP B O    3  
ATOM 8627  C CB   . ASP B 2 15  ? 12.282  0.929   5.962   1.00 1.42  ? 15   ASP B CB   3  
ATOM 8628  C CG   . ASP B 2 15  ? 11.102  0.067   6.382   1.00 1.57  ? 15   ASP B CG   3  
ATOM 8629  O OD1  . ASP B 2 15  ? 11.299  -0.934  7.102   1.00 2.04  ? 15   ASP B OD1  3  
ATOM 8630  O OD2  . ASP B 2 15  ? 9.949   0.358   5.929   1.00 1.59  ? 15   ASP B OD2  3  
ATOM 8631  H H    . ASP B 2 15  ? 14.574  1.878   5.201   1.00 1.39  ? 15   ASP B H    3  
ATOM 8632  H HA   . ASP B 2 15  ? 13.498  -0.735  5.484   1.00 1.40  ? 15   ASP B HA   3  
ATOM 8633  H HB2  . ASP B 2 15  ? 12.807  1.237   6.854   1.00 1.57  ? 15   ASP B HB2  3  
ATOM 8634  H HB3  . ASP B 2 15  ? 11.901  1.806   5.459   1.00 1.40  ? 15   ASP B HB3  3  
ATOM 8635  N N    . THR B 2 16  ? 12.968  0.621   2.590   1.00 1.04  ? 16   THR B N    3  
ATOM 8636  C CA   . THR B 2 16  ? 12.471  0.242   1.271   1.00 0.95  ? 16   THR B CA   3  
ATOM 8637  C C    . THR B 2 16  ? 13.174  -1.051  0.815   1.00 0.95  ? 16   THR B C    3  
ATOM 8638  O O    . THR B 2 16  ? 12.540  -1.970  0.226   1.00 0.93  ? 16   THR B O    3  
ATOM 8639  C CB   . THR B 2 16  ? 12.624  1.387   0.237   1.00 1.03  ? 16   THR B CB   3  
ATOM 8640  O OG1  . THR B 2 16  ? 13.911  1.986   0.363   1.00 1.84  ? 16   THR B OG1  3  
ATOM 8641  C CG2  . THR B 2 16  ? 11.556  2.453   0.432   1.00 1.54  ? 16   THR B CG2  3  
ATOM 8642  H H    . THR B 2 16  ? 13.546  1.409   2.632   1.00 1.10  ? 16   THR B H    3  
ATOM 8643  H HA   . THR B 2 16  ? 11.424  0.005   1.401   1.00 0.92  ? 16   THR B HA   3  
ATOM 8644  H HB   . THR B 2 16  ? 12.527  0.970   -0.754  1.00 1.43  ? 16   THR B HB   3  
ATOM 8645  H HG1  . THR B 2 16  ? 13.834  2.745   0.954   1.00 2.31  ? 16   THR B HG1  3  
ATOM 8646  H HG21 . THR B 2 16  ? 10.569  2.038   0.304   1.00 2.11  ? 16   THR B HG21 3  
ATOM 8647  H HG22 . THR B 2 16  ? 11.707  3.242   -0.291  1.00 1.98  ? 16   THR B HG22 3  
ATOM 8648  H HG23 . THR B 2 16  ? 11.648  2.868   1.425   1.00 2.03  ? 16   THR B HG23 3  
ATOM 8649  N N    . LEU B 2 17  ? 14.485  -1.124  1.122   1.00 1.04  ? 17   LEU B N    3  
ATOM 8650  C CA   . LEU B 2 17  ? 15.265  -2.346  0.984   1.00 1.11  ? 17   LEU B CA   3  
ATOM 8651  C C    . LEU B 2 17  ? 14.558  -3.494  1.725   1.00 1.11  ? 17   LEU B C    3  
ATOM 8652  O O    . LEU B 2 17  ? 14.336  -4.558  1.179   1.00 1.15  ? 17   LEU B O    3  
ATOM 8653  C CB   . LEU B 2 17  ? 16.714  -2.156  1.527   1.00 1.24  ? 17   LEU B CB   3  
ATOM 8654  C CG   . LEU B 2 17  ? 17.787  -1.662  0.525   1.00 1.34  ? 17   LEU B CG   3  
ATOM 8655  C CD1  . LEU B 2 17  ? 18.026  -2.716  -0.544  1.00 1.74  ? 17   LEU B CD1  3  
ATOM 8656  C CD2  . LEU B 2 17  ? 17.398  -0.339  -0.136  1.00 1.46  ? 17   LEU B CD2  3  
ATOM 8657  H H    . LEU B 2 17  ? 14.930  -0.297  1.406   1.00 1.07  ? 17   LEU B H    3  
ATOM 8658  H HA   . LEU B 2 17  ? 15.325  -2.554  -0.071  1.00 1.11  ? 17   LEU B HA   3  
ATOM 8659  H HB2  . LEU B 2 17  ? 16.700  -1.458  2.352   1.00 1.25  ? 17   LEU B HB2  3  
ATOM 8660  H HB3  . LEU B 2 17  ? 17.044  -3.111  1.909   1.00 1.32  ? 17   LEU B HB3  3  
ATOM 8661  H HG   . LEU B 2 17  ? 18.709  -1.519  1.075   1.00 1.73  ? 17   LEU B HG   3  
ATOM 8662  H HD11 . LEU B 2 17  ? 18.768  -2.367  -1.248  1.00 2.14  ? 17   LEU B HD11 3  
ATOM 8663  H HD12 . LEU B 2 17  ? 17.100  -2.905  -1.068  1.00 2.27  ? 17   LEU B HD12 3  
ATOM 8664  H HD13 . LEU B 2 17  ? 18.366  -3.632  -0.085  1.00 2.06  ? 17   LEU B HD13 3  
ATOM 8665  H HD21 . LEU B 2 17  ? 18.164  -0.046  -0.838  1.00 1.88  ? 17   LEU B HD21 3  
ATOM 8666  H HD22 . LEU B 2 17  ? 17.283  0.440   0.604   1.00 1.93  ? 17   LEU B HD22 3  
ATOM 8667  H HD23 . LEU B 2 17  ? 16.468  -0.468  -0.670  1.00 1.76  ? 17   LEU B HD23 3  
ATOM 8668  N N    . GLN B 2 18  ? 14.151  -3.206  2.945   1.00 1.12  ? 18   GLN B N    3  
ATOM 8669  C CA   . GLN B 2 18  ? 13.423  -4.142  3.827   1.00 1.15  ? 18   GLN B CA   3  
ATOM 8670  C C    . GLN B 2 18  ? 12.062  -4.503  3.206   1.00 1.05  ? 18   GLN B C    3  
ATOM 8671  O O    . GLN B 2 18  ? 11.674  -5.657  3.197   1.00 1.10  ? 18   GLN B O    3  
ATOM 8672  C CB   . GLN B 2 18  ? 13.261  -3.452  5.215   1.00 1.24  ? 18   GLN B CB   3  
ATOM 8673  C CG   . GLN B 2 18  ? 12.609  -4.211  6.393   1.00 1.32  ? 18   GLN B CG   3  
ATOM 8674  C CD   . GLN B 2 18  ? 11.135  -4.441  6.288   1.00 1.70  ? 18   GLN B CD   3  
ATOM 8675  O OE1  . GLN B 2 18  ? 10.670  -5.499  5.863   1.00 2.39  ? 18   GLN B OE1  3  
ATOM 8676  N NE2  . GLN B 2 18  ? 10.386  -3.453  6.608   1.00 1.82  ? 18   GLN B NE2  3  
ATOM 8677  H H    . GLN B 2 18  ? 14.360  -2.304  3.266   1.00 1.14  ? 18   GLN B H    3  
ATOM 8678  H HA   . GLN B 2 18  ? 14.015  -5.037  3.942   1.00 1.23  ? 18   GLN B HA   3  
ATOM 8679  H HB2  . GLN B 2 18  ? 14.230  -3.147  5.582   1.00 1.34  ? 18   GLN B HB2  3  
ATOM 8680  H HB3  . GLN B 2 18  ? 12.665  -2.568  5.043   1.00 1.24  ? 18   GLN B HB3  3  
ATOM 8681  H HG2  . GLN B 2 18  ? 13.023  -5.201  6.458   1.00 1.45  ? 18   GLN B HG2  3  
ATOM 8682  H HG3  . GLN B 2 18  ? 12.809  -3.674  7.308   1.00 1.59  ? 18   GLN B HG3  3  
ATOM 8683  H HE21 . GLN B 2 18  ? 10.790  -2.595  6.898   1.00 1.80  ? 18   GLN B HE21 3  
ATOM 8684  H HE22 . GLN B 2 18  ? 9.430   -3.600  6.529   1.00 2.27  ? 18   GLN B HE22 3  
ATOM 8685  N N    . PHE B 2 19  ? 11.377  -3.507  2.671   1.00 0.96  ? 19   PHE B N    3  
ATOM 8686  C CA   . PHE B 2 19  ? 10.044  -3.665  2.092   1.00 0.87  ? 19   PHE B CA   3  
ATOM 8687  C C    . PHE B 2 19  ? 9.952   -4.841  1.121   1.00 0.90  ? 19   PHE B C    3  
ATOM 8688  O O    . PHE B 2 19  ? 9.085   -5.719  1.284   1.00 0.95  ? 19   PHE B O    3  
ATOM 8689  C CB   . PHE B 2 19  ? 9.555   -2.372  1.417   1.00 0.81  ? 19   PHE B CB   3  
ATOM 8690  C CG   . PHE B 2 19  ? 8.143   -2.461  0.915   1.00 0.74  ? 19   PHE B CG   3  
ATOM 8691  C CD1  . PHE B 2 19  ? 7.059   -2.306  1.777   1.00 0.80  ? 19   PHE B CD1  3  
ATOM 8692  C CD2  . PHE B 2 19  ? 7.898   -2.703  -0.422  1.00 0.79  ? 19   PHE B CD2  3  
ATOM 8693  C CE1  . PHE B 2 19  ? 5.767   -2.392  1.303   1.00 0.83  ? 19   PHE B CE1  3  
ATOM 8694  C CE2  . PHE B 2 19  ? 6.613   -2.789  -0.895  1.00 0.81  ? 19   PHE B CE2  3  
ATOM 8695  C CZ   . PHE B 2 19  ? 5.526   -2.617  0.011   1.00 0.79  ? 19   PHE B CZ   3  
ATOM 8696  H H    . PHE B 2 19  ? 11.773  -2.607  2.714   1.00 0.99  ? 19   PHE B H    3  
ATOM 8697  H HA   . PHE B 2 19  ? 9.380   -3.880  2.917   1.00 0.88  ? 19   PHE B HA   3  
ATOM 8698  H HB2  . PHE B 2 19  ? 9.600   -1.561  2.128   1.00 0.85  ? 19   PHE B HB2  3  
ATOM 8699  H HB3  . PHE B 2 19  ? 10.188  -2.135  0.575   1.00 0.85  ? 19   PHE B HB3  3  
ATOM 8700  H HD1  . PHE B 2 19  ? 7.227   -2.107  2.825   1.00 0.95  ? 19   PHE B HD1  3  
ATOM 8701  H HD2  . PHE B 2 19  ? 8.732   -2.821  -1.100  1.00 0.94  ? 19   PHE B HD2  3  
ATOM 8702  H HE1  . PHE B 2 19  ? 4.933   -2.271  1.979   1.00 1.00  ? 19   PHE B HE1  3  
ATOM 8703  H HE2  . PHE B 2 19  ? 6.440   -2.978  -1.944  1.00 0.96  ? 19   PHE B HE2  3  
ATOM 8704  H HZ   . PHE B 2 19  ? 4.499   -2.678  -0.328  1.00 0.88  ? 19   PHE B HZ   3  
ATOM 8705  N N    . VAL B 2 20  ? 10.799  -4.884  0.119   1.00 0.92  ? 20   VAL B N    3  
ATOM 8706  C CA   . VAL B 2 20  ? 10.715  -6.013  -0.787  1.00 0.98  ? 20   VAL B CA   3  
ATOM 8707  C C    . VAL B 2 20  ? 11.754  -7.096  -0.468  1.00 1.11  ? 20   VAL B C    3  
ATOM 8708  O O    . VAL B 2 20  ? 11.525  -8.278  -0.711  1.00 1.22  ? 20   VAL B O    3  
ATOM 8709  C CB   . VAL B 2 20  ? 10.715  -5.622  -2.305  1.00 0.99  ? 20   VAL B CB   3  
ATOM 8710  C CG1  . VAL B 2 20  ? 11.998  -4.963  -2.737  1.00 1.16  ? 20   VAL B CG1  3  
ATOM 8711  C CG2  . VAL B 2 20  ? 10.405  -6.818  -3.181  1.00 1.37  ? 20   VAL B CG2  3  
ATOM 8712  H H    . VAL B 2 20  ? 11.471  -4.179  -0.003  1.00 0.92  ? 20   VAL B H    3  
ATOM 8713  H HA   . VAL B 2 20  ? 9.758   -6.464  -0.560  1.00 1.00  ? 20   VAL B HA   3  
ATOM 8714  H HB   . VAL B 2 20  ? 9.925   -4.899  -2.448  1.00 1.08  ? 20   VAL B HB   3  
ATOM 8715  H HG11 . VAL B 2 20  ? 11.973  -4.819  -3.808  1.00 1.51  ? 20   VAL B HG11 3  
ATOM 8716  H HG12 . VAL B 2 20  ? 12.834  -5.595  -2.469  1.00 1.70  ? 20   VAL B HG12 3  
ATOM 8717  H HG13 . VAL B 2 20  ? 12.046  -4.003  -2.253  1.00 1.58  ? 20   VAL B HG13 3  
ATOM 8718  H HG21 . VAL B 2 20  ? 11.155  -7.577  -3.015  1.00 1.77  ? 20   VAL B HG21 3  
ATOM 8719  H HG22 . VAL B 2 20  ? 10.413  -6.518  -4.218  1.00 1.83  ? 20   VAL B HG22 3  
ATOM 8720  H HG23 . VAL B 2 20  ? 9.432   -7.209  -2.920  1.00 1.81  ? 20   VAL B HG23 3  
ATOM 8721  N N    . CYS B 2 21  ? 12.853  -6.725  0.136   1.00 1.14  ? 21   CYS B N    3  
ATOM 8722  C CA   . CYS B 2 21  ? 13.912  -7.690  0.372   1.00 1.28  ? 21   CYS B CA   3  
ATOM 8723  C C    . CYS B 2 21  ? 13.945  -8.184  1.808   1.00 1.38  ? 21   CYS B C    3  
ATOM 8724  O O    . CYS B 2 21  ? 14.940  -8.715  2.248   1.00 1.66  ? 21   CYS B O    3  
ATOM 8725  C CB   . CYS B 2 21  ? 15.268  -7.129  -0.039  1.00 1.33  ? 21   CYS B CB   3  
ATOM 8726  S SG   . CYS B 2 21  ? 15.403  -6.707  -1.803  1.00 1.38  ? 21   CYS B SG   3  
ATOM 8727  H H    . CYS B 2 21  ? 12.989  -5.803  0.454   1.00 1.09  ? 21   CYS B H    3  
ATOM 8728  H HA   . CYS B 2 21  ? 13.699  -8.539  -0.258  1.00 1.36  ? 21   CYS B HA   3  
ATOM 8729  H HB2  . CYS B 2 21  ? 15.471  -6.232  0.528   1.00 1.32  ? 21   CYS B HB2  3  
ATOM 8730  H HB3  . CYS B 2 21  ? 16.027  -7.863  0.179   1.00 1.44  ? 21   CYS B HB3  3  
ATOM 8731  N N    . GLY B 2 22  ? 12.857  -8.014  2.525   1.00 1.25  ? 22   GLY B N    3  
ATOM 8732  C CA   . GLY B 2 22  ? 12.779  -8.496  3.904   1.00 1.36  ? 22   GLY B CA   3  
ATOM 8733  C C    . GLY B 2 22  ? 13.037  -9.997  4.045   1.00 1.38  ? 22   GLY B C    3  
ATOM 8734  O O    . GLY B 2 22  ? 13.789  -10.423 4.922   1.00 1.53  ? 22   GLY B O    3  
ATOM 8735  H H    . GLY B 2 22  ? 12.109  -7.492  2.153   1.00 1.13  ? 22   GLY B H    3  
ATOM 8736  H HA2  . GLY B 2 22  ? 13.507  -7.963  4.497   1.00 1.50  ? 22   GLY B HA2  3  
ATOM 8737  H HA3  . GLY B 2 22  ? 11.794  -8.275  4.287   1.00 1.44  ? 22   GLY B HA3  3  
ATOM 8738  N N    . ASP B 2 23  ? 12.415  -10.790 3.193   1.00 1.38  ? 23   ASP B N    3  
ATOM 8739  C CA   . ASP B 2 23  ? 12.567  -12.243 3.226   1.00 1.53  ? 23   ASP B CA   3  
ATOM 8740  C C    . ASP B 2 23  ? 13.936  -12.674 2.709   1.00 1.53  ? 23   ASP B C    3  
ATOM 8741  O O    . ASP B 2 23  ? 14.544  -13.597 3.245   1.00 1.72  ? 23   ASP B O    3  
ATOM 8742  C CB   . ASP B 2 23  ? 11.486  -12.919 2.382   1.00 1.68  ? 23   ASP B CB   3  
ATOM 8743  C CG   . ASP B 2 23  ? 10.088  -12.507 2.764   1.00 2.19  ? 23   ASP B CG   3  
ATOM 8744  O OD1  . ASP B 2 23  ? 9.594   -11.488 2.227   1.00 2.67  ? 23   ASP B OD1  3  
ATOM 8745  O OD2  . ASP B 2 23  ? 9.450   -13.192 3.580   1.00 2.72  ? 23   ASP B OD2  3  
ATOM 8746  H H    . ASP B 2 23  ? 11.787  -10.409 2.542   1.00 1.37  ? 23   ASP B H    3  
ATOM 8747  H HA   . ASP B 2 23  ? 12.457  -12.570 4.248   1.00 1.66  ? 23   ASP B HA   3  
ATOM 8748  H HB2  . ASP B 2 23  ? 11.639  -12.661 1.345   1.00 1.99  ? 23   ASP B HB2  3  
ATOM 8749  H HB3  . ASP B 2 23  ? 11.573  -13.990 2.494   1.00 1.99  ? 23   ASP B HB3  3  
ATOM 8750  N N    . ARG B 2 24  ? 14.415  -12.011 1.673   1.00 1.44  ? 24   ARG B N    3  
ATOM 8751  C CA   . ARG B 2 24  ? 15.686  -12.359 1.050   1.00 1.54  ? 24   ARG B CA   3  
ATOM 8752  C C    . ARG B 2 24  ? 16.871  -11.878 1.884   1.00 1.55  ? 24   ARG B C    3  
ATOM 8753  O O    . ARG B 2 24  ? 17.890  -12.568 2.012   1.00 1.73  ? 24   ARG B O    3  
ATOM 8754  C CB   . ARG B 2 24  ? 15.766  -11.752 -0.359  1.00 1.62  ? 24   ARG B CB   3  
ATOM 8755  C CG   . ARG B 2 24  ? 17.078  -12.001 -1.086  1.00 1.85  ? 24   ARG B CG   3  
ATOM 8756  C CD   . ARG B 2 24  ? 17.140  -11.237 -2.397  1.00 2.35  ? 24   ARG B CD   3  
ATOM 8757  N NE   . ARG B 2 24  ? 16.136  -11.685 -3.381  1.00 2.81  ? 24   ARG B NE   3  
ATOM 8758  C CZ   . ARG B 2 24  ? 15.652  -10.924 -4.371  1.00 3.62  ? 24   ARG B CZ   3  
ATOM 8759  N NH1  . ARG B 2 24  ? 15.802  -9.615  -4.331  1.00 4.13  ? 24   ARG B NH1  3  
ATOM 8760  N NH2  . ARG B 2 24  ? 14.950  -11.462 -5.352  1.00 4.33  ? 24   ARG B NH2  3  
ATOM 8761  H H    . ARG B 2 24  ? 13.902  -11.262 1.296   1.00 1.41  ? 24   ARG B H    3  
ATOM 8762  H HA   . ARG B 2 24  ? 15.734  -13.434 0.960   1.00 1.65  ? 24   ARG B HA   3  
ATOM 8763  H HB2  . ARG B 2 24  ? 14.971  -12.172 -0.959  1.00 1.68  ? 24   ARG B HB2  3  
ATOM 8764  H HB3  . ARG B 2 24  ? 15.615  -10.685 -0.286  1.00 1.56  ? 24   ARG B HB3  3  
ATOM 8765  H HG2  . ARG B 2 24  ? 17.894  -11.680 -0.455  1.00 2.16  ? 24   ARG B HG2  3  
ATOM 8766  H HG3  . ARG B 2 24  ? 17.173  -13.058 -1.289  1.00 1.99  ? 24   ARG B HG3  3  
ATOM 8767  H HD2  . ARG B 2 24  ? 16.979  -10.190 -2.191  1.00 2.72  ? 24   ARG B HD2  3  
ATOM 8768  H HD3  . ARG B 2 24  ? 18.124  -11.367 -2.821  1.00 2.77  ? 24   ARG B HD3  3  
ATOM 8769  H HE   . ARG B 2 24  ? 15.857  -12.632 -3.321  1.00 2.89  ? 24   ARG B HE   3  
ATOM 8770  H HH11 . ARG B 2 24  ? 16.269  -9.145  -3.578  1.00 4.04  ? 24   ARG B HH11 3  
ATOM 8771  H HH12 . ARG B 2 24  ? 15.430  -9.025  -5.055  1.00 4.90  ? 24   ARG B HH12 3  
ATOM 8772  H HH21 . ARG B 2 24  ? 14.746  -12.450 -5.411  1.00 4.44  ? 24   ARG B HH21 3  
ATOM 8773  H HH22 . ARG B 2 24  ? 14.590  -10.888 -6.098  1.00 5.02  ? 24   ARG B HH22 3  
ATOM 8774  N N    . GLY B 2 25  ? 16.721  -10.725 2.444   1.00 1.46  ? 25   GLY B N    3  
ATOM 8775  C CA   . GLY B 2 25  ? 17.770  -10.081 3.158   1.00 1.52  ? 25   GLY B CA   3  
ATOM 8776  C C    . GLY B 2 25  ? 18.108  -8.812  2.437   1.00 1.48  ? 25   GLY B C    3  
ATOM 8777  O O    . GLY B 2 25  ? 17.879  -8.717  1.227   1.00 1.53  ? 25   GLY B O    3  
ATOM 8778  H H    . GLY B 2 25  ? 15.871  -10.235 2.361   1.00 1.40  ? 25   GLY B H    3  
ATOM 8779  H HA2  . GLY B 2 25  ? 17.444  -9.864  4.165   1.00 1.55  ? 25   GLY B HA2  3  
ATOM 8780  H HA3  . GLY B 2 25  ? 18.645  -10.715 3.179   1.00 1.63  ? 25   GLY B HA3  3  
ATOM 8781  N N    . PHE B 2 26  ? 18.585  -7.834  3.138   1.00 1.46  ? 26   PHE B N    3  
ATOM 8782  C CA   . PHE B 2 26  ? 18.918  -6.568  2.518   1.00 1.46  ? 26   PHE B CA   3  
ATOM 8783  C C    . PHE B 2 26  ? 20.224  -6.046  3.066   1.00 1.62  ? 26   PHE B C    3  
ATOM 8784  O O    . PHE B 2 26  ? 20.548  -6.304  4.235   1.00 1.65  ? 26   PHE B O    3  
ATOM 8785  C CB   . PHE B 2 26  ? 17.783  -5.537  2.751   1.00 1.37  ? 26   PHE B CB   3  
ATOM 8786  C CG   . PHE B 2 26  ? 17.425  -5.304  4.197   1.00 1.36  ? 26   PHE B CG   3  
ATOM 8787  C CD1  . PHE B 2 26  ? 18.108  -4.369  4.931   1.00 1.49  ? 26   PHE B CD1  3  
ATOM 8788  C CD2  . PHE B 2 26  ? 16.401  -6.006  4.803   1.00 1.32  ? 26   PHE B CD2  3  
ATOM 8789  C CE1  . PHE B 2 26  ? 17.792  -4.125  6.250   1.00 1.55  ? 26   PHE B CE1  3  
ATOM 8790  C CE2  . PHE B 2 26  ? 16.075  -5.775  6.123   1.00 1.36  ? 26   PHE B CE2  3  
ATOM 8791  C CZ   . PHE B 2 26  ? 16.771  -4.832  6.849   1.00 1.45  ? 26   PHE B CZ   3  
ATOM 8792  H H    . PHE B 2 26  ? 18.724  -7.939  4.109   1.00 1.48  ? 26   PHE B H    3  
ATOM 8793  H HA   . PHE B 2 26  ? 19.022  -6.731  1.456   1.00 1.49  ? 26   PHE B HA   3  
ATOM 8794  H HB2  . PHE B 2 26  ? 18.098  -4.569  2.385   1.00 1.42  ? 26   PHE B HB2  3  
ATOM 8795  H HB3  . PHE B 2 26  ? 16.891  -5.852  2.230   1.00 1.31  ? 26   PHE B HB3  3  
ATOM 8796  H HD1  . PHE B 2 26  ? 18.908  -3.853  4.424   1.00 1.61  ? 26   PHE B HD1  3  
ATOM 8797  H HD2  . PHE B 2 26  ? 15.861  -6.745  4.235   1.00 1.33  ? 26   PHE B HD2  3  
ATOM 8798  H HE1  . PHE B 2 26  ? 18.342  -3.385  6.811   1.00 1.71  ? 26   PHE B HE1  3  
ATOM 8799  H HE2  . PHE B 2 26  ? 15.273  -6.332  6.586   1.00 1.38  ? 26   PHE B HE2  3  
ATOM 8800  H HZ   . PHE B 2 26  ? 16.518  -4.646  7.882   1.00 1.52  ? 26   PHE B HZ   3  
ATOM 8801  N N    . TYR B 2 27  ? 20.992  -5.357  2.239   1.00 1.77  ? 27   TYR B N    3  
ATOM 8802  C CA   . TYR B 2 27  ? 22.204  -4.716  2.686   1.00 2.00  ? 27   TYR B CA   3  
ATOM 8803  C C    . TYR B 2 27  ? 22.754  -3.816  1.595   1.00 2.07  ? 27   TYR B C    3  
ATOM 8804  O O    . TYR B 2 27  ? 22.728  -4.180  0.419   1.00 2.53  ? 27   TYR B O    3  
ATOM 8805  C CB   . TYR B 2 27  ? 23.296  -5.730  3.155   1.00 2.27  ? 27   TYR B CB   3  
ATOM 8806  C CG   . TYR B 2 27  ? 23.858  -6.673  2.100   1.00 2.21  ? 27   TYR B CG   3  
ATOM 8807  C CD1  . TYR B 2 27  ? 24.891  -6.282  1.258   1.00 2.56  ? 27   TYR B CD1  3  
ATOM 8808  C CD2  . TYR B 2 27  ? 23.327  -7.943  1.932   1.00 2.35  ? 27   TYR B CD2  3  
ATOM 8809  C CE1  . TYR B 2 27  ? 25.373  -7.138  0.286   1.00 2.98  ? 27   TYR B CE1  3  
ATOM 8810  C CE2  . TYR B 2 27  ? 23.804  -8.795  0.971   1.00 2.56  ? 27   TYR B CE2  3  
ATOM 8811  C CZ   . TYR B 2 27  ? 24.940  -8.385  0.208   1.00 2.85  ? 27   TYR B CZ   3  
ATOM 8812  O OH   . TYR B 2 27  ? 25.299  -9.262  -0.808  1.00 3.42  ? 27   TYR B OH   3  
ATOM 8813  H H    . TYR B 2 27  ? 20.760  -5.255  1.287   1.00 1.76  ? 27   TYR B H    3  
ATOM 8814  H HA   . TYR B 2 27  ? 21.886  -4.135  3.540   1.00 2.04  ? 27   TYR B HA   3  
ATOM 8815  H HB2  . TYR B 2 27  ? 24.131  -5.175  3.557   1.00 2.65  ? 27   TYR B HB2  3  
ATOM 8816  H HB3  . TYR B 2 27  ? 22.877  -6.332  3.950   1.00 2.57  ? 27   TYR B HB3  3  
ATOM 8817  H HD1  . TYR B 2 27  ? 25.321  -5.298  1.370   1.00 2.81  ? 27   TYR B HD1  3  
ATOM 8818  H HD2  . TYR B 2 27  ? 22.522  -8.262  2.577   1.00 2.63  ? 27   TYR B HD2  3  
ATOM 8819  H HE1  . TYR B 2 27  ? 26.170  -6.823  -0.372  1.00 3.60  ? 27   TYR B HE1  3  
ATOM 8820  H HE2  . TYR B 2 27  ? 23.371  -9.778  0.860   1.00 2.80  ? 27   TYR B HE2  3  
ATOM 8821  H HH   . TYR B 2 27  ? 26.251  -9.347  -0.655  1.00 3.67  ? 27   TYR B HH   3  
ATOM 8822  N N    . PHE B 2 28  ? 23.187  -2.638  1.964   1.00 1.95  ? 28   PHE B N    3  
ATOM 8823  C CA   . PHE B 2 28  ? 23.852  -1.764  1.031   1.00 2.01  ? 28   PHE B CA   3  
ATOM 8824  C C    . PHE B 2 28  ? 25.295  -1.437  1.461   1.00 2.20  ? 28   PHE B C    3  
ATOM 8825  O O    . PHE B 2 28  ? 26.145  -1.148  0.623   1.00 2.26  ? 28   PHE B O    3  
ATOM 8826  C CB   . PHE B 2 28  ? 23.024  -0.506  0.690   1.00 1.96  ? 28   PHE B CB   3  
ATOM 8827  C CG   . PHE B 2 28  ? 22.535  0.325   1.857   1.00 1.99  ? 28   PHE B CG   3  
ATOM 8828  C CD1  . PHE B 2 28  ? 23.387  1.186   2.537   1.00 2.17  ? 28   PHE B CD1  3  
ATOM 8829  C CD2  . PHE B 2 28  ? 21.207  0.268   2.244   1.00 1.98  ? 28   PHE B CD2  3  
ATOM 8830  C CE1  . PHE B 2 28  ? 22.924  1.966   3.575   1.00 2.24  ? 28   PHE B CE1  3  
ATOM 8831  C CE2  . PHE B 2 28  ? 20.740  1.044   3.282   1.00 2.08  ? 28   PHE B CE2  3  
ATOM 8832  C CZ   . PHE B 2 28  ? 21.597  1.894   3.948   1.00 2.17  ? 28   PHE B CZ   3  
ATOM 8833  H H    . PHE B 2 28  ? 23.027  -2.331  2.882   1.00 2.06  ? 28   PHE B H    3  
ATOM 8834  H HA   . PHE B 2 28  ? 23.949  -2.356  0.130   1.00 2.03  ? 28   PHE B HA   3  
ATOM 8835  H HB2  . PHE B 2 28  ? 23.628  0.145   0.076   1.00 2.02  ? 28   PHE B HB2  3  
ATOM 8836  H HB3  . PHE B 2 28  ? 22.164  -0.814  0.114   1.00 1.90  ? 28   PHE B HB3  3  
ATOM 8837  H HD1  . PHE B 2 28  ? 24.425  1.246   2.246   1.00 2.32  ? 28   PHE B HD1  3  
ATOM 8838  H HD2  . PHE B 2 28  ? 20.532  -0.397  1.725   1.00 1.99  ? 28   PHE B HD2  3  
ATOM 8839  H HE1  . PHE B 2 28  ? 23.597  2.631   4.095   1.00 2.44  ? 28   PHE B HE1  3  
ATOM 8840  H HE2  . PHE B 2 28  ? 19.701  0.990   3.569   1.00 2.19  ? 28   PHE B HE2  3  
ATOM 8841  H HZ   . PHE B 2 28  ? 21.232  2.505   4.762   1.00 2.28  ? 28   PHE B HZ   3  
ATOM 8842  N N    . SER B 2 29  ? 25.581  -1.509  2.754   1.00 2.41  ? 29   SER B N    3  
ATOM 8843  C CA   . SER B 2 29  ? 26.911  -1.287  3.227   1.00 2.66  ? 29   SER B CA   3  
ATOM 8844  C C    . SER B 2 29  ? 27.719  -2.548  3.018   1.00 2.58  ? 29   SER B C    3  
ATOM 8845  O O    . SER B 2 29  ? 27.228  -3.649  3.254   1.00 2.79  ? 29   SER B O    3  
ATOM 8846  C CB   . SER B 2 29  ? 26.891  -0.878  4.690   1.00 3.13  ? 29   SER B CB   3  
ATOM 8847  O OG   . SER B 2 29  ? 26.178  0.350   4.856   1.00 3.68  ? 29   SER B OG   3  
ATOM 8848  H H    . SER B 2 29  ? 24.912  -1.735  3.434   1.00 2.48  ? 29   SER B H    3  
ATOM 8849  H HA   . SER B 2 29  ? 27.333  -0.486  2.638   1.00 2.71  ? 29   SER B HA   3  
ATOM 8850  H HB2  . SER B 2 29  ? 26.419  -1.647  5.284   1.00 3.33  ? 29   SER B HB2  3  
ATOM 8851  H HB3  . SER B 2 29  ? 27.904  -0.734  5.033   1.00 3.32  ? 29   SER B HB3  3  
ATOM 8852  H HG   . SER B 2 29  ? 26.312  0.859   4.035   1.00 3.85  ? 29   SER B HG   3  
ATOM 8853  N N    . ARG B 2 30  ? 28.930  -2.392  2.577   1.00 2.55  ? 30   ARG B N    3  
ATOM 8854  C CA   . ARG B 2 30  ? 29.780  -3.500  2.210   1.00 2.65  ? 30   ARG B CA   3  
ATOM 8855  C C    . ARG B 2 30  ? 31.060  -3.453  3.054   1.00 2.99  ? 30   ARG B C    3  
ATOM 8856  O O    . ARG B 2 30  ? 31.289  -2.473  3.773   1.00 3.28  ? 30   ARG B O    3  
ATOM 8857  C CB   . ARG B 2 30  ? 30.079  -3.389  0.708   1.00 2.70  ? 30   ARG B CB   3  
ATOM 8858  C CG   . ARG B 2 30  ? 28.850  -3.538  -0.172  1.00 2.63  ? 30   ARG B CG   3  
ATOM 8859  C CD   . ARG B 2 30  ? 28.278  -4.955  -0.085  1.00 2.46  ? 30   ARG B CD   3  
ATOM 8860  N NE   . ARG B 2 30  ? 29.205  -6.005  -0.592  1.00 2.71  ? 30   ARG B NE   3  
ATOM 8861  C CZ   . ARG B 2 30  ? 29.250  -7.284  -0.162  1.00 3.07  ? 30   ARG B CZ   3  
ATOM 8862  N NH1  . ARG B 2 30  ? 28.688  -7.640  0.997   1.00 3.21  ? 30   ARG B NH1  3  
ATOM 8863  N NH2  . ARG B 2 30  ? 29.925  -8.184  -0.860  1.00 3.81  ? 30   ARG B NH2  3  
ATOM 8864  H H    . ARG B 2 30  ? 29.308  -1.490  2.510   1.00 2.65  ? 30   ARG B H    3  
ATOM 8865  H HA   . ARG B 2 30  ? 29.251  -4.422  2.403   1.00 2.72  ? 30   ARG B HA   3  
ATOM 8866  H HB2  . ARG B 2 30  ? 30.522  -2.424  0.510   1.00 2.85  ? 30   ARG B HB2  3  
ATOM 8867  H HB3  . ARG B 2 30  ? 30.785  -4.160  0.438   1.00 2.90  ? 30   ARG B HB3  3  
ATOM 8868  H HG2  . ARG B 2 30  ? 28.111  -2.851  0.218   1.00 2.87  ? 30   ARG B HG2  3  
ATOM 8869  H HG3  . ARG B 2 30  ? 29.067  -3.262  -1.194  1.00 2.91  ? 30   ARG B HG3  3  
ATOM 8870  H HD2  . ARG B 2 30  ? 28.050  -5.171  0.948   1.00 2.70  ? 30   ARG B HD2  3  
ATOM 8871  H HD3  . ARG B 2 30  ? 27.365  -4.990  -0.663  1.00 2.74  ? 30   ARG B HD3  3  
ATOM 8872  H HE   . ARG B 2 30  ? 29.765  -5.755  -1.364  1.00 3.07  ? 30   ARG B HE   3  
ATOM 8873  H HH11 . ARG B 2 30  ? 28.215  -6.993  1.615   1.00 3.17  ? 30   ARG B HH11 3  
ATOM 8874  H HH12 . ARG B 2 30  ? 28.695  -8.585  1.329   1.00 3.73  ? 30   ARG B HH12 3  
ATOM 8875  H HH21 . ARG B 2 30  ? 30.404  -7.931  -1.712  1.00 4.18  ? 30   ARG B HH21 3  
ATOM 8876  H HH22 . ARG B 2 30  ? 29.961  -9.154  -0.586  1.00 4.27  ? 30   ARG B HH22 3  
ATOM 8877  N N    . PRO B 2 31  ? 31.885  -4.527  3.031   1.00 3.17  ? 31   PRO B N    3  
ATOM 8878  C CA   . PRO B 2 31  ? 33.087  -4.645  3.869   1.00 3.60  ? 31   PRO B CA   3  
ATOM 8879  C C    . PRO B 2 31  ? 34.315  -3.891  3.344   1.00 3.72  ? 31   PRO B C    3  
ATOM 8880  O O    . PRO B 2 31  ? 35.438  -4.153  3.786   1.00 4.02  ? 31   PRO B O    3  
ATOM 8881  C CB   . PRO B 2 31  ? 33.370  -6.158  3.891   1.00 3.86  ? 31   PRO B CB   3  
ATOM 8882  C CG   . PRO B 2 31  ? 32.234  -6.795  3.159   1.00 3.76  ? 31   PRO B CG   3  
ATOM 8883  C CD   . PRO B 2 31  ? 31.703  -5.752  2.241   1.00 3.25  ? 31   PRO B CD   3  
ATOM 8884  H HA   . PRO B 2 31  ? 32.886  -4.317  4.878   1.00 3.85  ? 31   PRO B HA   3  
ATOM 8885  H HB2  . PRO B 2 31  ? 34.307  -6.337  3.387   1.00 3.96  ? 31   PRO B HB2  3  
ATOM 8886  H HB3  . PRO B 2 31  ? 33.431  -6.504  4.914   1.00 4.20  ? 31   PRO B HB3  3  
ATOM 8887  H HG2  . PRO B 2 31  ? 32.590  -7.644  2.595   1.00 4.07  ? 31   PRO B HG2  3  
ATOM 8888  H HG3  . PRO B 2 31  ? 31.472  -7.102  3.860   1.00 3.95  ? 31   PRO B HG3  3  
ATOM 8889  H HD2  . PRO B 2 31  ? 32.280  -5.719  1.328   1.00 3.28  ? 31   PRO B HD2  3  
ATOM 8890  H HD3  . PRO B 2 31  ? 30.658  -5.921  2.030   1.00 3.18  ? 31   PRO B HD3  3  
ATOM 8891  N N    . ALA B 2 32  ? 34.124  -2.995  2.388   1.00 3.72  ? 32   ALA B N    3  
ATOM 8892  C CA   . ALA B 2 32  ? 35.230  -2.173  1.907   1.00 4.11  ? 32   ALA B CA   3  
ATOM 8893  C C    . ALA B 2 32  ? 35.660  -1.222  2.984   1.00 4.50  ? 32   ALA B C    3  
ATOM 8894  O O    . ALA B 2 32  ? 36.832  -1.165  3.361   1.00 4.92  ? 32   ALA B O    3  
ATOM 8895  C CB   . ALA B 2 32  ? 34.872  -1.442  0.639   1.00 4.78  ? 32   ALA B CB   3  
ATOM 8896  H H    . ALA B 2 32  ? 33.223  -2.909  2.012   1.00 3.61  ? 32   ALA B H    3  
ATOM 8897  H HA   . ALA B 2 32  ? 36.082  -2.797  1.722   1.00 4.05  ? 32   ALA B HA   3  
ATOM 8898  H HB1  . ALA B 2 32  ? 35.731  -0.891  0.284   1.00 5.02  ? 32   ALA B HB1  3  
ATOM 8899  H HB2  . ALA B 2 32  ? 34.061  -0.758  0.839   1.00 5.08  ? 32   ALA B HB2  3  
ATOM 8900  H HB3  . ALA B 2 32  ? 34.565  -2.155  -0.112  1.00 5.12  ? 32   ALA B HB3  3  
ATOM 8901  N N    . SER B 2 33  ? 34.709  -0.530  3.510   1.00 4.79  ? 33   SER B N    3  
ATOM 8902  C CA   . SER B 2 33  ? 34.882  0.364   4.563   1.00 5.55  ? 33   SER B CA   3  
ATOM 8903  C C    . SER B 2 33  ? 33.529  0.706   5.055   1.00 6.06  ? 33   SER B C    3  
ATOM 8904  O O    . SER B 2 33  ? 32.553  0.723   4.294   1.00 5.86  ? 33   SER B O    3  
ATOM 8905  C CB   . SER B 2 33  ? 35.633  1.616   4.117   1.00 5.88  ? 33   SER B CB   3  
ATOM 8906  O OG   . SER B 2 33  ? 35.669  2.615   5.115   1.00 6.72  ? 33   SER B OG   3  
ATOM 8907  H H    . SER B 2 33  ? 33.787  -0.610  3.194   1.00 4.77  ? 33   SER B H    3  
ATOM 8908  H HA   . SER B 2 33  ? 35.453  -0.147  5.323   1.00 5.80  ? 33   SER B HA   3  
ATOM 8909  H HB2  . SER B 2 33  ? 36.654  1.303   3.971   1.00 5.86  ? 33   SER B HB2  3  
ATOM 8910  H HB3  . SER B 2 33  ? 35.193  2.009   3.216   1.00 5.82  ? 33   SER B HB3  3  
ATOM 8911  H HG   . SER B 2 33  ? 36.510  3.087   5.026   1.00 6.93  ? 33   SER B HG   3  
ATOM 8912  N N    . ARG B 2 34  ? 33.468  0.997   6.284   1.00 6.92  ? 34   ARG B N    3  
ATOM 8913  C CA   . ARG B 2 34  ? 32.238  1.310   6.947   1.00 7.72  ? 34   ARG B CA   3  
ATOM 8914  C C    . ARG B 2 34  ? 32.033  2.828   6.874   1.00 8.17  ? 34   ARG B C    3  
ATOM 8915  O O    . ARG B 2 34  ? 31.081  3.383   7.398   1.00 8.95  ? 34   ARG B O    3  
ATOM 8916  C CB   . ARG B 2 34  ? 32.336  0.795   8.374   1.00 8.57  ? 34   ARG B CB   3  
ATOM 8917  C CG   . ARG B 2 34  ? 31.052  0.835   9.189   1.00 9.48  ? 34   ARG B CG   3  
ATOM 8918  C CD   . ARG B 2 34  ? 31.322  0.378   10.601  1.00 10.00 ? 34   ARG B CD   3  
ATOM 8919  N NE   . ARG B 2 34  ? 32.424  1.138   11.207  1.00 10.50 ? 34   ARG B NE   3  
ATOM 8920  C CZ   . ARG B 2 34  ? 32.783  1.072   12.483  1.00 11.06 ? 34   ARG B CZ   3  
ATOM 8921  N NH1  . ARG B 2 34  ? 32.012  0.445   13.368  1.00 11.22 ? 34   ARG B NH1  3  
ATOM 8922  N NH2  . ARG B 2 34  ? 33.902  1.661   12.885  1.00 11.63 ? 34   ARG B NH2  3  
ATOM 8923  H H    . ARG B 2 34  ? 34.330  1.021   6.763   1.00 7.14  ? 34   ARG B H    3  
ATOM 8924  H HA   . ARG B 2 34  ? 31.427  0.815   6.431   1.00 7.56  ? 34   ARG B HA   3  
ATOM 8925  H HB2  . ARG B 2 34  ? 32.676  -0.230  8.310   1.00 8.20  ? 34   ARG B HB2  3  
ATOM 8926  H HB3  . ARG B 2 34  ? 33.092  1.367   8.892   1.00 8.99  ? 34   ARG B HB3  3  
ATOM 8927  H HG2  . ARG B 2 34  ? 30.635  1.830   9.217   1.00 9.92  ? 34   ARG B HG2  3  
ATOM 8928  H HG3  . ARG B 2 34  ? 30.338  0.158   8.742   1.00 9.53  ? 34   ARG B HG3  3  
ATOM 8929  H HD2  . ARG B 2 34  ? 30.432  0.515   11.200  1.00 10.20 ? 34   ARG B HD2  3  
ATOM 8930  H HD3  . ARG B 2 34  ? 31.592  -0.667  10.589  1.00 10.03 ? 34   ARG B HD3  3  
ATOM 8931  H HE   . ARG B 2 34  ? 32.948  1.697   10.582  1.00 10.53 ? 34   ARG B HE   3  
ATOM 8932  H HH11 . ARG B 2 34  ? 31.141  0.012   13.116  1.00 10.95 ? 34   ARG B HH11 3  
ATOM 8933  H HH12 . ARG B 2 34  ? 32.300  0.381   14.333  1.00 11.73 ? 34   ARG B HH12 3  
ATOM 8934  H HH21 . ARG B 2 34  ? 34.519  2.153   12.260  1.00 11.70 ? 34   ARG B HH21 3  
ATOM 8935  H HH22 . ARG B 2 34  ? 34.161  1.662   13.856  1.00 12.14 ? 34   ARG B HH22 3  
ATOM 8936  N N    . VAL B 2 35  ? 32.962  3.479   6.177   1.00 7.81  ? 35   VAL B N    3  
ATOM 8937  C CA   . VAL B 2 35  ? 32.899  4.909   5.897   1.00 8.33  ? 35   VAL B CA   3  
ATOM 8938  C C    . VAL B 2 35  ? 32.153  5.091   4.579   1.00 7.66  ? 35   VAL B C    3  
ATOM 8939  O O    . VAL B 2 35  ? 31.832  6.197   4.156   1.00 8.09  ? 35   VAL B O    3  
ATOM 8940  C CB   . VAL B 2 35  ? 34.334  5.526   5.822   1.00 8.82  ? 35   VAL B CB   3  
ATOM 8941  C CG1  . VAL B 2 35  ? 34.291  7.032   5.601   1.00 9.61  ? 35   VAL B CG1  3  
ATOM 8942  C CG2  . VAL B 2 35  ? 35.104  5.208   7.092   1.00 9.47  ? 35   VAL B CG2  3  
ATOM 8943  H H    . VAL B 2 35  ? 33.726  2.955   5.839   1.00 7.32  ? 35   VAL B H    3  
ATOM 8944  H HA   . VAL B 2 35  ? 32.321  5.415   6.655   1.00 9.01  ? 35   VAL B HA   3  
ATOM 8945  H HB   . VAL B 2 35  ? 34.855  5.074   4.991   1.00 8.27  ? 35   VAL B HB   3  
ATOM 8946  H HG11 . VAL B 2 35  ? 35.292  7.431   5.545   1.00 9.90  ? 35   VAL B HG11 3  
ATOM 8947  H HG12 . VAL B 2 35  ? 33.758  7.493   6.420   1.00 9.79  ? 35   VAL B HG12 3  
ATOM 8948  H HG13 . VAL B 2 35  ? 33.762  7.222   4.678   1.00 9.89  ? 35   VAL B HG13 3  
ATOM 8949  H HG21 . VAL B 2 35  ? 35.183  4.137   7.207   1.00 9.62  ? 35   VAL B HG21 3  
ATOM 8950  H HG22 . VAL B 2 35  ? 34.583  5.622   7.942   1.00 9.75  ? 35   VAL B HG22 3  
ATOM 8951  H HG23 . VAL B 2 35  ? 36.094  5.637   7.033   1.00 9.67  ? 35   VAL B HG23 3  
ATOM 8952  N N    . SER B 2 36  ? 31.873  3.956   3.952   1.00 6.71  ? 36   SER B N    3  
ATOM 8953  C CA   . SER B 2 36  ? 31.117  3.863   2.756   1.00 6.10  ? 36   SER B CA   3  
ATOM 8954  C C    . SER B 2 36  ? 31.834  4.497   1.567   1.00 5.54  ? 36   SER B C    3  
ATOM 8955  O O    . SER B 2 36  ? 31.209  5.015   0.650   1.00 5.31  ? 36   SER B O    3  
ATOM 8956  C CB   . SER B 2 36  ? 29.715  4.416   2.988   1.00 6.44  ? 36   SER B CB   3  
ATOM 8957  O OG   . SER B 2 36  ? 29.097  3.751   4.097   1.00 6.53  ? 36   SER B OG   3  
ATOM 8958  H H    . SER B 2 36  ? 32.164  3.113   4.341   1.00 6.51  ? 36   SER B H    3  
ATOM 8959  H HA   . SER B 2 36  ? 31.027  2.811   2.543   1.00 6.14  ? 36   SER B HA   3  
ATOM 8960  H HB2  . SER B 2 36  ? 29.781  5.474   3.191   1.00 6.82  ? 36   SER B HB2  3  
ATOM 8961  H HB3  . SER B 2 36  ? 29.144  4.220   2.097   1.00 6.60  ? 36   SER B HB3  3  
ATOM 8962  H HG   . SER B 2 36  ? 29.187  2.802   3.920   1.00 6.58  ? 36   SER B HG   3  
ATOM 8963  N N    . ARG B 2 37  ? 33.167  4.447   1.604   1.00 5.74  ? 37   ARG B N    3  
ATOM 8964  C CA   . ARG B 2 37  ? 33.980  4.924   0.490   1.00 5.75  ? 37   ARG B CA   3  
ATOM 8965  C C    . ARG B 2 37  ? 33.745  4.089   -0.755  1.00 5.29  ? 37   ARG B C    3  
ATOM 8966  O O    . ARG B 2 37  ? 33.125  4.559   -1.707  1.00 5.64  ? 37   ARG B O    3  
ATOM 8967  C CB   . ARG B 2 37  ? 35.467  4.990   0.831   1.00 6.47  ? 37   ARG B CB   3  
ATOM 8968  C CG   . ARG B 2 37  ? 35.844  6.064   1.832   1.00 7.24  ? 37   ARG B CG   3  
ATOM 8969  C CD   . ARG B 2 37  ? 35.329  7.441   1.397   1.00 8.13  ? 37   ARG B CD   3  
ATOM 8970  N NE   . ARG B 2 37  ? 35.880  7.847   0.097   1.00 8.59  ? 37   ARG B NE   3  
ATOM 8971  C CZ   . ARG B 2 37  ? 35.205  8.505   -0.862  1.00 9.42  ? 37   ARG B CZ   3  
ATOM 8972  N NH1  . ARG B 2 37  ? 33.937  8.855   -0.671  1.00 9.86  ? 37   ARG B NH1  3  
ATOM 8973  N NH2  . ARG B 2 37  ? 35.805  8.801   -2.012  1.00 10.00 ? 37   ARG B NH2  3  
ATOM 8974  H H    . ARG B 2 37  ? 33.576  4.109   2.429   1.00 6.18  ? 37   ARG B H    3  
ATOM 8975  H HA   . ARG B 2 37  ? 33.631  5.915   0.252   1.00 5.92  ? 37   ARG B HA   3  
ATOM 8976  H HB2  . ARG B 2 37  ? 35.738  4.038   1.264   1.00 6.44  ? 37   ARG B HB2  3  
ATOM 8977  H HB3  . ARG B 2 37  ? 36.034  5.145   -0.077  1.00 6.79  ? 37   ARG B HB3  3  
ATOM 8978  H HG2  . ARG B 2 37  ? 35.460  5.799   2.804   1.00 7.36  ? 37   ARG B HG2  3  
ATOM 8979  H HG3  . ARG B 2 37  ? 36.925  6.089   1.861   1.00 7.28  ? 37   ARG B HG3  3  
ATOM 8980  H HD2  . ARG B 2 37  ? 34.252  7.400   1.315   1.00 8.28  ? 37   ARG B HD2  3  
ATOM 8981  H HD3  . ARG B 2 37  ? 35.602  8.177   2.139   1.00 8.54  ? 37   ARG B HD3  3  
ATOM 8982  H HE   . ARG B 2 37  ? 36.830  7.602   -0.027  1.00 8.43  ? 37   ARG B HE   3  
ATOM 8983  H HH11 . ARG B 2 37  ? 33.422  8.645   0.168   1.00 9.63  ? 37   ARG B HH11 3  
ATOM 8984  H HH12 . ARG B 2 37  ? 33.422  9.387   -1.358  1.00 10.58 ? 37   ARG B HH12 3  
ATOM 8985  H HH21 . ARG B 2 37  ? 36.764  8.564   -2.217  1.00 9.90  ? 37   ARG B HH21 3  
ATOM 8986  H HH22 . ARG B 2 37  ? 35.329  9.262   -2.773  1.00 10.71 ? 37   ARG B HH22 3  
ATOM 8987  N N    . ARG B 2 38  ? 34.225  2.861   -0.756  1.00 4.85  ? 38   ARG B N    3  
ATOM 8988  C CA   . ARG B 2 38  ? 33.974  1.972   -1.857  1.00 4.66  ? 38   ARG B CA   3  
ATOM 8989  C C    . ARG B 2 38  ? 32.624  1.311   -1.696  1.00 4.10  ? 38   ARG B C    3  
ATOM 8990  O O    . ARG B 2 38  ? 31.996  0.890   -2.651  1.00 3.96  ? 38   ARG B O    3  
ATOM 8991  C CB   . ARG B 2 38  ? 35.091  0.956   -1.986  1.00 5.06  ? 38   ARG B CB   3  
ATOM 8992  C CG   . ARG B 2 38  ? 36.415  1.545   -2.441  1.00 5.56  ? 38   ARG B CG   3  
ATOM 8993  C CD   . ARG B 2 38  ? 37.504  0.482   -2.514  1.00 6.01  ? 38   ARG B CD   3  
ATOM 8994  N NE   . ARG B 2 38  ? 37.891  -0.033  -1.188  1.00 6.54  ? 38   ARG B NE   3  
ATOM 8995  C CZ   . ARG B 2 38  ? 37.975  -1.335  -0.858  1.00 7.27  ? 38   ARG B CZ   3  
ATOM 8996  N NH1  . ARG B 2 38  ? 37.514  -2.268  -1.689  1.00 7.58  ? 38   ARG B NH1  3  
ATOM 8997  N NH2  . ARG B 2 38  ? 38.462  -1.687  0.329   1.00 7.94  ? 38   ARG B NH2  3  
ATOM 8998  H H    . ARG B 2 38  ? 34.808  2.514   -0.043  1.00 4.85  ? 38   ARG B H    3  
ATOM 8999  H HA   . ARG B 2 38  ? 33.939  2.585   -2.739  1.00 5.01  ? 38   ARG B HA   3  
ATOM 9000  H HB2  . ARG B 2 38  ? 35.246  0.503   -1.017  1.00 5.29  ? 38   ARG B HB2  3  
ATOM 9001  H HB3  . ARG B 2 38  ? 34.789  0.191   -2.678  1.00 5.11  ? 38   ARG B HB3  3  
ATOM 9002  H HG2  . ARG B 2 38  ? 36.280  1.990   -3.416  1.00 5.80  ? 38   ARG B HG2  3  
ATOM 9003  H HG3  . ARG B 2 38  ? 36.711  2.310   -1.737  1.00 5.77  ? 38   ARG B HG3  3  
ATOM 9004  H HD2  . ARG B 2 38  ? 37.136  -0.344  -3.104  1.00 6.10  ? 38   ARG B HD2  3  
ATOM 9005  H HD3  . ARG B 2 38  ? 38.377  0.899   -2.995  1.00 6.21  ? 38   ARG B HD3  3  
ATOM 9006  H HE   . ARG B 2 38  ? 38.148  0.658   -0.536  1.00 6.55  ? 38   ARG B HE   3  
ATOM 9007  H HH11 . ARG B 2 38  ? 37.088  -2.047  -2.578  1.00 7.31  ? 38   ARG B HH11 3  
ATOM 9008  H HH12 . ARG B 2 38  ? 37.559  -3.255  -1.486  1.00 8.27  ? 38   ARG B HH12 3  
ATOM 9009  H HH21 . ARG B 2 38  ? 38.777  -0.996  0.992   1.00 7.97  ? 38   ARG B HH21 3  
ATOM 9010  H HH22 . ARG B 2 38  ? 38.530  -2.650  0.626   1.00 8.60  ? 38   ARG B HH22 3  
ATOM 9011  N N    . SER B 2 39  ? 32.171  1.297   -0.491  1.00 4.23  ? 39   SER B N    3  
ATOM 9012  C CA   . SER B 2 39  ? 30.887  0.726   -0.152  1.00 4.13  ? 39   SER B CA   3  
ATOM 9013  C C    . SER B 2 39  ? 29.846  1.815   -0.129  1.00 3.72  ? 39   SER B C    3  
ATOM 9014  O O    . SER B 2 39  ? 29.234  2.098   0.907   1.00 4.10  ? 39   SER B O    3  
ATOM 9015  C CB   . SER B 2 39  ? 30.953  0.063   1.192   1.00 5.02  ? 39   SER B CB   3  
ATOM 9016  O OG   . SER B 2 39  ? 32.006  -0.869  1.232   1.00 5.76  ? 39   SER B OG   3  
ATOM 9017  H H    . SER B 2 39  ? 32.750  1.726   0.167   1.00 4.67  ? 39   SER B H    3  
ATOM 9018  H HA   . SER B 2 39  ? 30.629  -0.006  -0.901  1.00 4.08  ? 39   SER B HA   3  
ATOM 9019  H HB2  . SER B 2 39  ? 31.068  0.810   1.962   1.00 5.31  ? 39   SER B HB2  3  
ATOM 9020  H HB3  . SER B 2 39  ? 30.018  -0.458  1.337   1.00 5.15  ? 39   SER B HB3  3  
ATOM 9021  H HG   . SER B 2 39  ? 32.109  -1.225  0.332   1.00 5.79  ? 39   SER B HG   3  
ATOM 9022  N N    . ARG B 2 40  ? 29.683  2.424   -1.263  1.00 3.23  ? 40   ARG B N    3  
ATOM 9023  C CA   . ARG B 2 40  ? 28.762  3.518   -1.456  1.00 2.98  ? 40   ARG B CA   3  
ATOM 9024  C C    . ARG B 2 40  ? 27.347  3.115   -1.081  1.00 2.50  ? 40   ARG B C    3  
ATOM 9025  O O    . ARG B 2 40  ? 26.689  3.819   -0.325  1.00 2.57  ? 40   ARG B O    3  
ATOM 9026  C CB   . ARG B 2 40  ? 28.897  4.075   -2.889  1.00 3.36  ? 40   ARG B CB   3  
ATOM 9027  C CG   . ARG B 2 40  ? 27.843  5.083   -3.300  1.00 3.83  ? 40   ARG B CG   3  
ATOM 9028  C CD   . ARG B 2 40  ? 27.728  6.267   -2.341  1.00 4.14  ? 40   ARG B CD   3  
ATOM 9029  N NE   . ARG B 2 40  ? 28.928  7.113   -2.291  1.00 4.69  ? 40   ARG B NE   3  
ATOM 9030  C CZ   . ARG B 2 40  ? 28.911  8.422   -2.533  1.00 5.27  ? 40   ARG B CZ   3  
ATOM 9031  N NH1  . ARG B 2 40  ? 27.897  8.952   -3.175  1.00 5.33  ? 40   ARG B NH1  3  
ATOM 9032  N NH2  . ARG B 2 40  ? 29.957  9.171   -2.237  1.00 6.03  ? 40   ARG B NH2  3  
ATOM 9033  H H    . ARG B 2 40  ? 30.211  2.070   -2.010  1.00 3.27  ? 40   ARG B H    3  
ATOM 9034  H HA   . ARG B 2 40  ? 29.041  4.282   -0.758  1.00 3.20  ? 40   ARG B HA   3  
ATOM 9035  H HB2  . ARG B 2 40  ? 29.858  4.561   -2.971  1.00 3.35  ? 40   ARG B HB2  3  
ATOM 9036  H HB3  . ARG B 2 40  ? 28.874  3.253   -3.589  1.00 3.80  ? 40   ARG B HB3  3  
ATOM 9037  H HG2  . ARG B 2 40  ? 28.108  5.461   -4.277  1.00 4.27  ? 40   ARG B HG2  3  
ATOM 9038  H HG3  . ARG B 2 40  ? 26.891  4.578   -3.368  1.00 3.96  ? 40   ARG B HG3  3  
ATOM 9039  H HD2  . ARG B 2 40  ? 26.897  6.884   -2.649  1.00 4.23  ? 40   ARG B HD2  3  
ATOM 9040  H HD3  . ARG B 2 40  ? 27.531  5.888   -1.349  1.00 4.31  ? 40   ARG B HD3  3  
ATOM 9041  H HE   . ARG B 2 40  ? 29.757  6.686   -1.969  1.00 4.83  ? 40   ARG B HE   3  
ATOM 9042  H HH11 . ARG B 2 40  ? 27.131  8.393   -3.527  1.00 5.05  ? 40   ARG B HH11 3  
ATOM 9043  H HH12 . ARG B 2 40  ? 27.790  9.946   -3.308  1.00 5.86  ? 40   ARG B HH12 3  
ATOM 9044  H HH21 . ARG B 2 40  ? 30.788  8.784   -1.824  1.00 6.25  ? 40   ARG B HH21 3  
ATOM 9045  H HH22 . ARG B 2 40  ? 29.963  10.159  -2.423  1.00 6.57  ? 40   ARG B HH22 3  
ATOM 9046  N N    . GLY B 2 41  ? 26.936  1.999   -1.572  1.00 2.37  ? 41   GLY B N    3  
ATOM 9047  C CA   . GLY B 2 41  ? 25.692  1.390   -1.206  1.00 2.23  ? 41   GLY B CA   3  
ATOM 9048  C C    . GLY B 2 41  ? 24.490  2.286   -1.288  1.00 2.11  ? 41   GLY B C    3  
ATOM 9049  O O    . GLY B 2 41  ? 23.824  2.466   -0.285  1.00 2.30  ? 41   GLY B O    3  
ATOM 9050  H H    . GLY B 2 41  ? 27.520  1.562   -2.222  1.00 2.62  ? 41   GLY B H    3  
ATOM 9051  H HA2  . GLY B 2 41  ? 25.521  0.543   -1.852  1.00 2.38  ? 41   GLY B HA2  3  
ATOM 9052  H HA3  . GLY B 2 41  ? 25.783  1.025   -0.193  1.00 2.42  ? 41   GLY B HA3  3  
ATOM 9053  N N    . ILE B 2 42  ? 24.280  2.908   -2.477  1.00 2.07  ? 42   ILE B N    3  
ATOM 9054  C CA   . ILE B 2 42  ? 23.049  3.699   -2.914  1.00 1.96  ? 42   ILE B CA   3  
ATOM 9055  C C    . ILE B 2 42  ? 22.546  4.847   -1.994  1.00 1.97  ? 42   ILE B C    3  
ATOM 9056  O O    . ILE B 2 42  ? 21.783  5.712   -2.451  1.00 1.99  ? 42   ILE B O    3  
ATOM 9057  C CB   . ILE B 2 42  ? 21.858  2.759   -3.245  1.00 1.84  ? 42   ILE B CB   3  
ATOM 9058  C CG1  . ILE B 2 42  ? 21.401  2.026   -1.962  1.00 1.79  ? 42   ILE B CG1  3  
ATOM 9059  C CG2  . ILE B 2 42  ? 22.326  1.756   -4.293  1.00 1.88  ? 42   ILE B CG2  3  
ATOM 9060  C CD1  . ILE B 2 42  ? 20.135  1.206   -2.093  1.00 1.67  ? 42   ILE B CD1  3  
ATOM 9061  H H    . ILE B 2 42  ? 25.002  2.832   -3.136  1.00 2.28  ? 42   ILE B H    3  
ATOM 9062  H HA   . ILE B 2 42  ? 23.325  4.177   -3.842  1.00 2.03  ? 42   ILE B HA   3  
ATOM 9063  H HB   . ILE B 2 42  ? 21.040  3.324   -3.671  1.00 1.82  ? 42   ILE B HB   3  
ATOM 9064  H HG12 . ILE B 2 42  ? 22.241  1.378   -1.733  1.00 1.87  ? 42   ILE B HG12 3  
ATOM 9065  H HG13 . ILE B 2 42  ? 21.307  2.703   -1.121  1.00 1.81  ? 42   ILE B HG13 3  
ATOM 9066  H HG21 . ILE B 2 42  ? 21.527  1.086   -4.570  1.00 2.21  ? 42   ILE B HG21 3  
ATOM 9067  H HG22 . ILE B 2 42  ? 23.144  1.199   -3.858  1.00 2.12  ? 42   ILE B HG22 3  
ATOM 9068  H HG23 . ILE B 2 42  ? 22.687  2.282   -5.164  1.00 2.04  ? 42   ILE B HG23 3  
ATOM 9069  H HD11 . ILE B 2 42  ? 20.295  0.373   -2.758  1.00 1.95  ? 42   ILE B HD11 3  
ATOM 9070  H HD12 . ILE B 2 42  ? 19.347  1.836   -2.478  1.00 1.92  ? 42   ILE B HD12 3  
ATOM 9071  H HD13 . ILE B 2 42  ? 19.841  0.841   -1.120  1.00 1.92  ? 42   ILE B HD13 3  
ATOM 9072  N N    . VAL B 2 43  ? 22.946  4.834   -0.755  1.00 1.99  ? 43   VAL B N    3  
ATOM 9073  C CA   . VAL B 2 43  ? 22.512  5.756   0.284   1.00 2.04  ? 43   VAL B CA   3  
ATOM 9074  C C    . VAL B 2 43  ? 22.571  7.237   -0.109  1.00 2.11  ? 43   VAL B C    3  
ATOM 9075  O O    . VAL B 2 43  ? 21.618  7.983   0.142   1.00 2.13  ? 43   VAL B O    3  
ATOM 9076  C CB   . VAL B 2 43  ? 23.242  5.466   1.651   1.00 2.13  ? 43   VAL B CB   3  
ATOM 9077  C CG1  . VAL B 2 43  ? 24.738  5.448   1.498   1.00 2.24  ? 43   VAL B CG1  3  
ATOM 9078  C CG2  . VAL B 2 43  ? 22.859  6.464   2.716   1.00 2.24  ? 43   VAL B CG2  3  
ATOM 9079  H H    . VAL B 2 43  ? 23.554  4.094   -0.523  1.00 1.99  ? 43   VAL B H    3  
ATOM 9080  H HA   . VAL B 2 43  ? 21.470  5.533   0.440   1.00 2.00  ? 43   VAL B HA   3  
ATOM 9081  H HB   . VAL B 2 43  ? 22.939  4.485   1.987   1.00 2.07  ? 43   VAL B HB   3  
ATOM 9082  H HG11 . VAL B 2 43  ? 25.079  6.428   1.201   1.00 2.47  ? 43   VAL B HG11 3  
ATOM 9083  H HG12 . VAL B 2 43  ? 24.987  4.720   0.740   1.00 2.57  ? 43   VAL B HG12 3  
ATOM 9084  H HG13 . VAL B 2 43  ? 25.191  5.169   2.437   1.00 2.43  ? 43   VAL B HG13 3  
ATOM 9085  H HG21 . VAL B 2 43  ? 23.219  7.436   2.407   1.00 2.51  ? 43   VAL B HG21 3  
ATOM 9086  H HG22 . VAL B 2 43  ? 23.324  6.186   3.650   1.00 2.37  ? 43   VAL B HG22 3  
ATOM 9087  H HG23 . VAL B 2 43  ? 21.785  6.488   2.816   1.00 2.60  ? 43   VAL B HG23 3  
ATOM 9088  N N    . GLU B 2 44  ? 23.609  7.630   -0.800  1.00 2.18  ? 44   GLU B N    3  
ATOM 9089  C CA   . GLU B 2 44  ? 23.809  9.024   -1.092  1.00 2.27  ? 44   GLU B CA   3  
ATOM 9090  C C    . GLU B 2 44  ? 23.146  9.366   -2.426  1.00 2.24  ? 44   GLU B C    3  
ATOM 9091  O O    . GLU B 2 44  ? 22.549  10.434  -2.576  1.00 2.28  ? 44   GLU B O    3  
ATOM 9092  C CB   . GLU B 2 44  ? 25.320  9.316   -1.031  1.00 2.40  ? 44   GLU B CB   3  
ATOM 9093  C CG   . GLU B 2 44  ? 25.744  10.774  -0.850  1.00 2.54  ? 44   GLU B CG   3  
ATOM 9094  C CD   . GLU B 2 44  ? 25.818  11.587  -2.130  1.00 2.88  ? 44   GLU B CD   3  
ATOM 9095  O OE1  . GLU B 2 44  ? 26.761  11.385  -2.929  1.00 3.04  ? 44   GLU B OE1  3  
ATOM 9096  O OE2  . GLU B 2 44  ? 24.964  12.451  -2.364  1.00 3.36  ? 44   GLU B OE2  3  
ATOM 9097  H H    . GLU B 2 44  ? 24.238  6.964   -1.148  1.00 2.18  ? 44   GLU B H    3  
ATOM 9098  H HA   . GLU B 2 44  ? 23.301  9.591   -0.329  1.00 2.30  ? 44   GLU B HA   3  
ATOM 9099  H HB2  . GLU B 2 44  ? 25.736  8.758   -0.206  1.00 2.43  ? 44   GLU B HB2  3  
ATOM 9100  H HB3  . GLU B 2 44  ? 25.767  8.948   -1.943  1.00 2.40  ? 44   GLU B HB3  3  
ATOM 9101  H HG2  . GLU B 2 44  ? 25.049  11.246  -0.170  1.00 2.65  ? 44   GLU B HG2  3  
ATOM 9102  H HG3  . GLU B 2 44  ? 26.702  10.763  -0.357  1.00 2.59  ? 44   GLU B HG3  3  
ATOM 9103  N N    . GLU B 2 45  ? 23.167  8.406   -3.344  1.00 2.18  ? 45   GLU B N    3  
ATOM 9104  C CA   . GLU B 2 45  ? 22.553  8.557   -4.660  1.00 2.16  ? 45   GLU B CA   3  
ATOM 9105  C C    . GLU B 2 45  ? 21.068  8.706   -4.522  1.00 2.11  ? 45   GLU B C    3  
ATOM 9106  O O    . GLU B 2 45  ? 20.495  9.625   -5.021  1.00 2.25  ? 45   GLU B O    3  
ATOM 9107  C CB   . GLU B 2 45  ? 22.826  7.344   -5.577  1.00 2.15  ? 45   GLU B CB   3  
ATOM 9108  C CG   . GLU B 2 45  ? 24.266  7.147   -6.005  1.00 2.38  ? 45   GLU B CG   3  
ATOM 9109  C CD   . GLU B 2 45  ? 25.188  7.001   -4.847  1.00 2.65  ? 45   GLU B CD   3  
ATOM 9110  O OE1  . GLU B 2 45  ? 24.940  6.140   -3.982  1.00 3.08  ? 45   GLU B OE1  3  
ATOM 9111  O OE2  . GLU B 2 45  ? 26.131  7.793   -4.742  1.00 3.03  ? 45   GLU B OE2  3  
ATOM 9112  H H    . GLU B 2 45  ? 23.622  7.558   -3.145  1.00 2.17  ? 45   GLU B H    3  
ATOM 9113  H HA   . GLU B 2 45  ? 22.959  9.443   -5.127  1.00 2.24  ? 45   GLU B HA   3  
ATOM 9114  H HB2  . GLU B 2 45  ? 22.516  6.449   -5.058  1.00 2.30  ? 45   GLU B HB2  3  
ATOM 9115  H HB3  . GLU B 2 45  ? 22.219  7.450   -6.464  1.00 2.35  ? 45   GLU B HB3  3  
ATOM 9116  H HG2  . GLU B 2 45  ? 24.333  6.257   -6.613  1.00 2.66  ? 45   GLU B HG2  3  
ATOM 9117  H HG3  . GLU B 2 45  ? 24.570  8.004   -6.588  1.00 2.86  ? 45   GLU B HG3  3  
ATOM 9118  N N    . CYS B 2 46  ? 20.452  7.822   -3.802  1.00 1.99  ? 46   CYS B N    3  
ATOM 9119  C CA   . CYS B 2 46  ? 19.009  7.858   -3.697  1.00 1.96  ? 46   CYS B CA   3  
ATOM 9120  C C    . CYS B 2 46  ? 18.557  9.026   -2.798  1.00 2.04  ? 46   CYS B C    3  
ATOM 9121  O O    . CYS B 2 46  ? 17.463  9.559   -2.956  1.00 2.10  ? 46   CYS B O    3  
ATOM 9122  C CB   . CYS B 2 46  ? 18.482  6.491   -3.227  1.00 1.87  ? 46   CYS B CB   3  
ATOM 9123  S SG   . CYS B 2 46  ? 16.666  6.259   -3.300  1.00 2.23  ? 46   CYS B SG   3  
ATOM 9124  H H    . CYS B 2 46  ? 20.973  7.130   -3.329  1.00 1.97  ? 46   CYS B H    3  
ATOM 9125  H HA   . CYS B 2 46  ? 18.624  8.060   -4.688  1.00 1.98  ? 46   CYS B HA   3  
ATOM 9126  H HB2  . CYS B 2 46  ? 18.919  5.731   -3.858  1.00 2.07  ? 46   CYS B HB2  3  
ATOM 9127  H HB3  . CYS B 2 46  ? 18.800  6.327   -2.208  1.00 2.01  ? 46   CYS B HB3  3  
ATOM 9128  N N    . CYS B 2 47  ? 19.454  9.483   -1.927  1.00 2.09  ? 47   CYS B N    3  
ATOM 9129  C CA   . CYS B 2 47  ? 19.130  10.578  -1.031  1.00 2.19  ? 47   CYS B CA   3  
ATOM 9130  C C    . CYS B 2 47  ? 19.184  11.940  -1.743  1.00 2.27  ? 47   CYS B C    3  
ATOM 9131  O O    . CYS B 2 47  ? 18.337  12.799  -1.495  1.00 2.37  ? 47   CYS B O    3  
ATOM 9132  C CB   . CYS B 2 47  ? 20.046  10.576  0.204   1.00 2.25  ? 47   CYS B CB   3  
ATOM 9133  S SG   . CYS B 2 47  ? 19.727  11.910  1.428   1.00 2.37  ? 47   CYS B SG   3  
ATOM 9134  H H    . CYS B 2 47  ? 20.345  9.080   -1.894  1.00 2.10  ? 47   CYS B H    3  
ATOM 9135  H HA   . CYS B 2 47  ? 18.114  10.419  -0.701  1.00 2.17  ? 47   CYS B HA   3  
ATOM 9136  H HB2  . CYS B 2 47  ? 19.933  9.635   0.721   1.00 2.29  ? 47   CYS B HB2  3  
ATOM 9137  H HB3  . CYS B 2 47  ? 21.070  10.673  -0.127  1.00 2.48  ? 47   CYS B HB3  3  
ATOM 9138  N N    . PHE B 2 48  ? 20.162  12.151  -2.634  1.00 2.29  ? 48   PHE B N    3  
ATOM 9139  C CA   . PHE B 2 48  ? 20.298  13.468  -3.283  1.00 2.39  ? 48   PHE B CA   3  
ATOM 9140  C C    . PHE B 2 48  ? 20.150  13.427  -4.811  1.00 2.37  ? 48   PHE B C    3  
ATOM 9141  O O    . PHE B 2 48  ? 20.365  14.433  -5.498  1.00 2.47  ? 48   PHE B O    3  
ATOM 9142  C CB   . PHE B 2 48  ? 21.613  14.144  -2.890  1.00 2.48  ? 48   PHE B CB   3  
ATOM 9143  C CG   . PHE B 2 48  ? 21.755  14.401  -1.416  1.00 2.56  ? 48   PHE B CG   3  
ATOM 9144  C CD1  . PHE B 2 48  ? 21.090  15.449  -0.824  1.00 2.71  ? 48   PHE B CD1  3  
ATOM 9145  C CD2  . PHE B 2 48  ? 22.543  13.587  -0.630  1.00 2.54  ? 48   PHE B CD2  3  
ATOM 9146  C CE1  . PHE B 2 48  ? 21.205  15.691  0.529   1.00 2.82  ? 48   PHE B CE1  3  
ATOM 9147  C CE2  . PHE B 2 48  ? 22.668  13.819  0.724   1.00 2.64  ? 48   PHE B CE2  3  
ATOM 9148  C CZ   . PHE B 2 48  ? 22.033  14.876  1.299   1.00 2.78  ? 48   PHE B CZ   3  
ATOM 9149  H H    . PHE B 2 48  ? 20.816  11.445  -2.840  1.00 2.26  ? 48   PHE B H    3  
ATOM 9150  H HA   . PHE B 2 48  ? 19.489  14.074  -2.902  1.00 2.44  ? 48   PHE B HA   3  
ATOM 9151  H HB2  . PHE B 2 48  ? 22.437  13.515  -3.193  1.00 2.44  ? 48   PHE B HB2  3  
ATOM 9152  H HB3  . PHE B 2 48  ? 21.686  15.092  -3.403  1.00 2.57  ? 48   PHE B HB3  3  
ATOM 9153  H HD1  . PHE B 2 48  ? 20.476  16.081  -1.445  1.00 2.77  ? 48   PHE B HD1  3  
ATOM 9154  H HD2  . PHE B 2 48  ? 23.070  12.760  -1.083  1.00 2.47  ? 48   PHE B HD2  3  
ATOM 9155  H HE1  . PHE B 2 48  ? 20.673  16.513  0.986   1.00 2.97  ? 48   PHE B HE1  3  
ATOM 9156  H HE2  . PHE B 2 48  ? 23.289  13.174  1.328   1.00 2.64  ? 48   PHE B HE2  3  
ATOM 9157  H HZ   . PHE B 2 48  ? 22.141  15.059  2.358   1.00 2.88  ? 48   PHE B HZ   3  
ATOM 9158  N N    . ARG B 2 49  ? 19.809  12.294  -5.339  1.00 2.29  ? 49   ARG B N    3  
ATOM 9159  C CA   . ARG B 2 49  ? 19.555  12.141  -6.761  1.00 2.28  ? 49   ARG B CA   3  
ATOM 9160  C C    . ARG B 2 49  ? 18.234  11.429  -6.892  1.00 2.15  ? 49   ARG B C    3  
ATOM 9161  O O    . ARG B 2 49  ? 17.692  10.928  -5.899  1.00 2.17  ? 49   ARG B O    3  
ATOM 9162  C CB   . ARG B 2 49  ? 20.626  11.277  -7.461  1.00 2.32  ? 49   ARG B CB   3  
ATOM 9163  C CG   . ARG B 2 49  ? 22.058  11.775  -7.420  1.00 2.59  ? 49   ARG B CG   3  
ATOM 9164  C CD   . ARG B 2 49  ? 22.943  10.754  -8.104  1.00 2.43  ? 49   ARG B CD   3  
ATOM 9165  N NE   . ARG B 2 49  ? 24.371  11.106  -8.157  1.00 2.85  ? 49   ARG B NE   3  
ATOM 9166  C CZ   . ARG B 2 49  ? 25.275  10.375  -8.822  1.00 3.35  ? 49   ARG B CZ   3  
ATOM 9167  N NH1  . ARG B 2 49  ? 24.889  9.274   -9.452  1.00 3.64  ? 49   ARG B NH1  3  
ATOM 9168  N NH2  . ARG B 2 49  ? 26.559  10.729  -8.847  1.00 4.09  ? 49   ARG B NH2  3  
ATOM 9169  H H    . ARG B 2 49  ? 19.688  11.497  -4.778  1.00 2.26  ? 49   ARG B H    3  
ATOM 9170  H HA   . ARG B 2 49  ? 19.502  13.116  -7.222  1.00 2.37  ? 49   ARG B HA   3  
ATOM 9171  H HB2  . ARG B 2 49  ? 20.622  10.285  -7.034  1.00 2.30  ? 49   ARG B HB2  3  
ATOM 9172  H HB3  . ARG B 2 49  ? 20.338  11.188  -8.498  1.00 2.41  ? 49   ARG B HB3  3  
ATOM 9173  H HG2  . ARG B 2 49  ? 22.125  12.721  -7.936  1.00 3.15  ? 49   ARG B HG2  3  
ATOM 9174  H HG3  . ARG B 2 49  ? 22.373  11.883  -6.392  1.00 2.91  ? 49   ARG B HG3  3  
ATOM 9175  H HD2  . ARG B 2 49  ? 22.848  9.816   -7.577  1.00 2.60  ? 49   ARG B HD2  3  
ATOM 9176  H HD3  . ARG B 2 49  ? 22.581  10.620  -9.113  1.00 2.67  ? 49   ARG B HD3  3  
ATOM 9177  H HE   . ARG B 2 49  ? 24.651  11.922  -7.670  1.00 3.20  ? 49   ARG B HE   3  
ATOM 9178  H HH11 . ARG B 2 49  ? 23.929  8.957   -9.439  1.00 3.51  ? 49   ARG B HH11 3  
ATOM 9179  H HH12 . ARG B 2 49  ? 25.513  8.707   -9.999  1.00 4.32  ? 49   ARG B HH12 3  
ATOM 9180  H HH21 . ARG B 2 49  ? 26.910  11.549  -8.380  1.00 4.36  ? 49   ARG B HH21 3  
ATOM 9181  H HH22 . ARG B 2 49  ? 27.245  10.174  -9.335  1.00 4.65  ? 49   ARG B HH22 3  
ATOM 9182  N N    . SER B 2 50  ? 17.725  11.380  -8.078  1.00 2.09  ? 50   SER B N    3  
ATOM 9183  C CA   . SER B 2 50  ? 16.515  10.698  -8.350  1.00 2.02  ? 50   SER B CA   3  
ATOM 9184  C C    . SER B 2 50  ? 16.828  9.243   -8.647  1.00 1.87  ? 50   SER B C    3  
ATOM 9185  O O    . SER B 2 50  ? 17.284  8.892   -9.742  1.00 1.92  ? 50   SER B O    3  
ATOM 9186  C CB   . SER B 2 50  ? 15.796  11.372  -9.514  1.00 2.16  ? 50   SER B CB   3  
ATOM 9187  O OG   . SER B 2 50  ? 15.552  12.743  -9.206  1.00 2.67  ? 50   SER B OG   3  
ATOM 9188  H H    . SER B 2 50  ? 18.196  11.815  -8.828  1.00 2.12  ? 50   SER B H    3  
ATOM 9189  H HA   . SER B 2 50  ? 15.893  10.754  -7.469  1.00 2.02  ? 50   SER B HA   3  
ATOM 9190  H HB2  . SER B 2 50  ? 16.411  11.314  -10.401 1.00 2.49  ? 50   SER B HB2  3  
ATOM 9191  H HB3  . SER B 2 50  ? 14.851  10.881  -9.691  1.00 2.20  ? 50   SER B HB3  3  
ATOM 9192  H HG   . SER B 2 50  ? 15.529  12.813  -8.238  1.00 2.86  ? 50   SER B HG   3  
ATOM 9193  N N    . CYS B 2 51  ? 16.635  8.424   -7.661  1.00 1.76  ? 51   CYS B N    3  
ATOM 9194  C CA   . CYS B 2 51  ? 16.871  7.020   -7.750  1.00 1.65  ? 51   CYS B CA   3  
ATOM 9195  C C    . CYS B 2 51  ? 15.644  6.384   -8.332  1.00 1.53  ? 51   CYS B C    3  
ATOM 9196  O O    . CYS B 2 51  ? 14.528  6.884   -8.125  1.00 1.59  ? 51   CYS B O    3  
ATOM 9197  C CB   . CYS B 2 51  ? 17.179  6.477   -6.340  1.00 1.66  ? 51   CYS B CB   3  
ATOM 9198  S SG   . CYS B 2 51  ? 16.071  7.145   -5.042  1.00 2.11  ? 51   CYS B SG   3  
ATOM 9199  H H    . CYS B 2 51  ? 16.263  8.748   -6.815  1.00 1.79  ? 51   CYS B H    3  
ATOM 9200  H HA   . CYS B 2 51  ? 17.720  6.846   -8.394  1.00 1.70  ? 51   CYS B HA   3  
ATOM 9201  H HB2  . CYS B 2 51  ? 17.089  5.402   -6.313  1.00 1.78  ? 51   CYS B HB2  3  
ATOM 9202  H HB3  . CYS B 2 51  ? 18.188  6.754   -6.072  1.00 1.92  ? 51   CYS B HB3  3  
ATOM 9203  N N    . ASP B 2 52  ? 15.829  5.392   -9.153  1.00 1.44  ? 52   ASP B N    3  
ATOM 9204  C CA   . ASP B 2 52  ? 14.703  4.689   -9.681  1.00 1.35  ? 52   ASP B CA   3  
ATOM 9205  C C    . ASP B 2 52  ? 14.570  3.318   -9.028  1.00 1.17  ? 52   ASP B C    3  
ATOM 9206  O O    . ASP B 2 52  ? 15.489  2.892   -8.308  1.00 1.27  ? 52   ASP B O    3  
ATOM 9207  C CB   . ASP B 2 52  ? 14.753  4.552   -11.208 1.00 1.55  ? 52   ASP B CB   3  
ATOM 9208  C CG   . ASP B 2 52  ? 15.693  3.474   -11.691 1.00 1.89  ? 52   ASP B CG   3  
ATOM 9209  O OD1  . ASP B 2 52  ? 16.912  3.712   -11.692 1.00 2.16  ? 52   ASP B OD1  3  
ATOM 9210  O OD2  . ASP B 2 52  ? 15.234  2.370   -12.056 1.00 2.67  ? 52   ASP B OD2  3  
ATOM 9211  H H    . ASP B 2 52  ? 16.735  5.144   -9.441  1.00 1.49  ? 52   ASP B H    3  
ATOM 9212  H HA   . ASP B 2 52  ? 13.851  5.296   -9.411  1.00 1.38  ? 52   ASP B HA   3  
ATOM 9213  H HB2  . ASP B 2 52  ? 13.762  4.316   -11.567 1.00 1.93  ? 52   ASP B HB2  3  
ATOM 9214  H HB3  . ASP B 2 52  ? 15.062  5.496   -11.632 1.00 2.04  ? 52   ASP B HB3  3  
ATOM 9215  N N    . LEU B 2 53  ? 13.488  2.627   -9.286  1.00 0.99  ? 53   LEU B N    3  
ATOM 9216  C CA   . LEU B 2 53  ? 13.236  1.337   -8.654  1.00 0.92  ? 53   LEU B CA   3  
ATOM 9217  C C    . LEU B 2 53  ? 14.275  0.269   -8.992  1.00 1.02  ? 53   LEU B C    3  
ATOM 9218  O O    . LEU B 2 53  ? 14.683  -0.486  -8.105  1.00 1.10  ? 53   LEU B O    3  
ATOM 9219  C CB   . LEU B 2 53  ? 11.805  0.799   -8.917  1.00 1.01  ? 53   LEU B CB   3  
ATOM 9220  C CG   . LEU B 2 53  ? 11.385  0.475   -10.368 1.00 1.33  ? 53   LEU B CG   3  
ATOM 9221  C CD1  . LEU B 2 53  ? 10.054  -0.238  -10.352 1.00 1.72  ? 53   LEU B CD1  3  
ATOM 9222  C CD2  . LEU B 2 53  ? 11.261  1.735   -11.214 1.00 1.90  ? 53   LEU B CD2  3  
ATOM 9223  H H    . LEU B 2 53  ? 12.836  3.006   -9.911  1.00 1.00  ? 53   LEU B H    3  
ATOM 9224  H HA   . LEU B 2 53  ? 13.319  1.516   -7.592  1.00 0.96  ? 53   LEU B HA   3  
ATOM 9225  H HB2  . LEU B 2 53  ? 11.690  -0.108  -8.344  1.00 1.38  ? 53   LEU B HB2  3  
ATOM 9226  H HB3  . LEU B 2 53  ? 11.110  1.526   -8.522  1.00 1.54  ? 53   LEU B HB3  3  
ATOM 9227  H HG   . LEU B 2 53  ? 12.118  -0.178  -10.816 1.00 1.81  ? 53   LEU B HG   3  
ATOM 9228  H HD11 . LEU B 2 53  ? 10.152  -1.149  -9.780  1.00 2.24  ? 53   LEU B HD11 3  
ATOM 9229  H HD12 . LEU B 2 53  ? 9.750   -0.469  -11.362 1.00 2.15  ? 53   LEU B HD12 3  
ATOM 9230  H HD13 . LEU B 2 53  ? 9.319   0.401   -9.883  1.00 2.04  ? 53   LEU B HD13 3  
ATOM 9231  H HD21 . LEU B 2 53  ? 10.941  1.479   -12.213 1.00 2.34  ? 53   LEU B HD21 3  
ATOM 9232  H HD22 . LEU B 2 53  ? 12.220  2.230   -11.256 1.00 2.36  ? 53   LEU B HD22 3  
ATOM 9233  H HD23 . LEU B 2 53  ? 10.540  2.398   -10.756 1.00 2.26  ? 53   LEU B HD23 3  
ATOM 9234  N N    . ALA B 2 54  ? 14.765  0.266   -10.241 1.00 1.12  ? 54   ALA B N    3  
ATOM 9235  C CA   . ALA B 2 54  ? 15.662  -0.788  -10.738 1.00 1.30  ? 54   ALA B CA   3  
ATOM 9236  C C    . ALA B 2 54  ? 16.912  -0.897  -9.908  1.00 1.38  ? 54   ALA B C    3  
ATOM 9237  O O    . ALA B 2 54  ? 17.396  -1.995  -9.652  1.00 1.52  ? 54   ALA B O    3  
ATOM 9238  C CB   . ALA B 2 54  ? 16.037  -0.537  -12.184 1.00 1.47  ? 54   ALA B CB   3  
ATOM 9239  H H    . ALA B 2 54  ? 14.563  1.016   -10.845 1.00 1.11  ? 54   ALA B H    3  
ATOM 9240  H HA   . ALA B 2 54  ? 15.131  -1.726  -10.689 1.00 1.33  ? 54   ALA B HA   3  
ATOM 9241  H HB1  . ALA B 2 54  ? 16.571  0.403   -12.234 1.00 1.92  ? 54   ALA B HB1  3  
ATOM 9242  H HB2  . ALA B 2 54  ? 15.142  -0.471  -12.784 1.00 1.78  ? 54   ALA B HB2  3  
ATOM 9243  H HB3  . ALA B 2 54  ? 16.670  -1.332  -12.547 1.00 1.73  ? 54   ALA B HB3  3  
ATOM 9244  N N    . LEU B 2 55  ? 17.393  0.240   -9.453  1.00 1.36  ? 55   LEU B N    3  
ATOM 9245  C CA   . LEU B 2 55  ? 18.606  0.320   -8.678  1.00 1.47  ? 55   LEU B CA   3  
ATOM 9246  C C    . LEU B 2 55  ? 18.487  -0.470  -7.402  1.00 1.43  ? 55   LEU B C    3  
ATOM 9247  O O    . LEU B 2 55  ? 19.250  -1.396  -7.175  1.00 1.52  ? 55   LEU B O    3  
ATOM 9248  C CB   . LEU B 2 55  ? 18.963  1.783   -8.393  1.00 1.53  ? 55   LEU B CB   3  
ATOM 9249  C CG   . LEU B 2 55  ? 20.163  2.043   -7.463  1.00 1.68  ? 55   LEU B CG   3  
ATOM 9250  C CD1  . LEU B 2 55  ? 21.460  1.521   -8.067  1.00 1.97  ? 55   LEU B CD1  3  
ATOM 9251  C CD2  . LEU B 2 55  ? 20.278  3.529   -7.131  1.00 1.78  ? 55   LEU B CD2  3  
ATOM 9252  H H    . LEU B 2 55  ? 16.883  1.054   -9.642  1.00 1.32  ? 55   LEU B H    3  
ATOM 9253  H HA   . LEU B 2 55  ? 19.398  -0.112  -9.272  1.00 1.57  ? 55   LEU B HA   3  
ATOM 9254  H HB2  . LEU B 2 55  ? 19.211  2.194   -9.361  1.00 1.68  ? 55   LEU B HB2  3  
ATOM 9255  H HB3  . LEU B 2 55  ? 18.095  2.291   -8.004  1.00 1.51  ? 55   LEU B HB3  3  
ATOM 9256  H HG   . LEU B 2 55  ? 19.998  1.504   -6.541  1.00 1.82  ? 55   LEU B HG   3  
ATOM 9257  H HD11 . LEU B 2 55  ? 22.272  1.694   -7.375  1.00 2.35  ? 55   LEU B HD11 3  
ATOM 9258  H HD12 . LEU B 2 55  ? 21.675  2.040   -8.990  1.00 2.27  ? 55   LEU B HD12 3  
ATOM 9259  H HD13 . LEU B 2 55  ? 21.375  0.461   -8.258  1.00 2.29  ? 55   LEU B HD13 3  
ATOM 9260  H HD21 . LEU B 2 55  ? 19.369  3.865   -6.657  1.00 2.06  ? 55   LEU B HD21 3  
ATOM 9261  H HD22 . LEU B 2 55  ? 20.446  4.099   -8.034  1.00 2.14  ? 55   LEU B HD22 3  
ATOM 9262  H HD23 . LEU B 2 55  ? 21.107  3.680   -6.455  1.00 2.10  ? 55   LEU B HD23 3  
ATOM 9263  N N    . LEU B 2 56  ? 17.493  -0.157  -6.603  1.00 1.33  ? 56   LEU B N    3  
ATOM 9264  C CA   . LEU B 2 56  ? 17.328  -0.805  -5.340  1.00 1.34  ? 56   LEU B CA   3  
ATOM 9265  C C    . LEU B 2 56  ? 16.841  -2.230  -5.523  1.00 1.32  ? 56   LEU B C    3  
ATOM 9266  O O    . LEU B 2 56  ? 17.124  -3.103  -4.704  1.00 1.41  ? 56   LEU B O    3  
ATOM 9267  C CB   . LEU B 2 56  ? 16.414  0.035   -4.441  1.00 1.27  ? 56   LEU B CB   3  
ATOM 9268  C CG   . LEU B 2 56  ? 14.931  0.151   -4.826  1.00 1.16  ? 56   LEU B CG   3  
ATOM 9269  C CD1  . LEU B 2 56  ? 14.100  -0.883  -4.083  1.00 0.91  ? 56   LEU B CD1  3  
ATOM 9270  C CD2  . LEU B 2 56  ? 14.412  1.560   -4.576  1.00 1.53  ? 56   LEU B CD2  3  
ATOM 9271  H H    . LEU B 2 56  ? 16.832  0.523   -6.848  1.00 1.27  ? 56   LEU B H    3  
ATOM 9272  H HA   . LEU B 2 56  ? 18.302  -0.866  -4.887  1.00 1.46  ? 56   LEU B HA   3  
ATOM 9273  H HB2  . LEU B 2 56  ? 16.468  -0.386  -3.453  1.00 1.31  ? 56   LEU B HB2  3  
ATOM 9274  H HB3  . LEU B 2 56  ? 16.830  1.028   -4.405  1.00 1.34  ? 56   LEU B HB3  3  
ATOM 9275  H HG   . LEU B 2 56  ? 14.839  -0.065  -5.881  1.00 1.23  ? 56   LEU B HG   3  
ATOM 9276  H HD11 . LEU B 2 56  ? 14.446  -1.871  -4.346  1.00 1.35  ? 56   LEU B HD11 3  
ATOM 9277  H HD12 . LEU B 2 56  ? 13.059  -0.774  -4.345  1.00 1.35  ? 56   LEU B HD12 3  
ATOM 9278  H HD13 . LEU B 2 56  ? 14.232  -0.731  -3.020  1.00 1.31  ? 56   LEU B HD13 3  
ATOM 9279  H HD21 . LEU B 2 56  ? 14.990  2.252   -5.171  1.00 1.81  ? 56   LEU B HD21 3  
ATOM 9280  H HD22 . LEU B 2 56  ? 14.510  1.802   -3.528  1.00 2.01  ? 56   LEU B HD22 3  
ATOM 9281  H HD23 . LEU B 2 56  ? 13.372  1.623   -4.866  1.00 1.92  ? 56   LEU B HD23 3  
ATOM 9282  N N    . GLU B 2 57  ? 16.157  -2.452  -6.619  1.00 1.25  ? 57   GLU B N    3  
ATOM 9283  C CA   . GLU B 2 57  ? 15.638  -3.745  -6.953  1.00 1.30  ? 57   GLU B CA   3  
ATOM 9284  C C    . GLU B 2 57  ? 16.771  -4.735  -7.304  1.00 1.44  ? 57   GLU B C    3  
ATOM 9285  O O    . GLU B 2 57  ? 16.890  -5.801  -6.680  1.00 1.53  ? 57   GLU B O    3  
ATOM 9286  C CB   . GLU B 2 57  ? 14.611  -3.611  -8.090  1.00 1.32  ? 57   GLU B CB   3  
ATOM 9287  C CG   . GLU B 2 57  ? 14.004  -4.909  -8.577  1.00 1.50  ? 57   GLU B CG   3  
ATOM 9288  C CD   . GLU B 2 57  ? 13.409  -5.732  -7.470  1.00 1.67  ? 57   GLU B CD   3  
ATOM 9289  O OE1  . GLU B 2 57  ? 12.463  -5.288  -6.818  1.00 1.83  ? 57   GLU B OE1  3  
ATOM 9290  O OE2  . GLU B 2 57  ? 13.857  -6.865  -7.263  1.00 2.27  ? 57   GLU B OE2  3  
ATOM 9291  H H    . GLU B 2 57  ? 15.974  -1.694  -7.218  1.00 1.19  ? 57   GLU B H    3  
ATOM 9292  H HA   . GLU B 2 57  ? 15.125  -4.075  -6.063  1.00 1.30  ? 57   GLU B HA   3  
ATOM 9293  H HB2  . GLU B 2 57  ? 13.803  -2.980  -7.751  1.00 1.32  ? 57   GLU B HB2  3  
ATOM 9294  H HB3  . GLU B 2 57  ? 15.095  -3.127  -8.926  1.00 1.49  ? 57   GLU B HB3  3  
ATOM 9295  H HG2  . GLU B 2 57  ? 13.227  -4.681  -9.291  1.00 1.91  ? 57   GLU B HG2  3  
ATOM 9296  H HG3  . GLU B 2 57  ? 14.775  -5.487  -9.065  1.00 1.97  ? 57   GLU B HG3  3  
ATOM 9297  N N    . THR B 2 58  ? 17.615  -4.384  -8.266  1.00 1.51  ? 58   THR B N    3  
ATOM 9298  C CA   . THR B 2 58  ? 18.679  -5.289  -8.660  1.00 1.69  ? 58   THR B CA   3  
ATOM 9299  C C    . THR B 2 58  ? 19.856  -5.263  -7.657  1.00 1.77  ? 58   THR B C    3  
ATOM 9300  O O    . THR B 2 58  ? 20.686  -6.173  -7.664  1.00 1.92  ? 58   THR B O    3  
ATOM 9301  C CB   . THR B 2 58  ? 19.179  -5.060  -10.131 1.00 1.80  ? 58   THR B CB   3  
ATOM 9302  O OG1  . THR B 2 58  ? 20.045  -6.144  -10.534 1.00 2.33  ? 58   THR B OG1  3  
ATOM 9303  C CG2  . THR B 2 58  ? 19.946  -3.759  -10.257 1.00 1.73  ? 58   THR B CG2  3  
ATOM 9304  H H    . THR B 2 58  ? 17.505  -3.520  -8.731  1.00 1.46  ? 58   THR B H    3  
ATOM 9305  H HA   . THR B 2 58  ? 18.258  -6.282  -8.597  1.00 1.76  ? 58   THR B HA   3  
ATOM 9306  H HB   . THR B 2 58  ? 18.329  -5.042  -10.799 1.00 2.02  ? 58   THR B HB   3  
ATOM 9307  H HG1  . THR B 2 58  ? 20.673  -6.269  -9.812  1.00 2.67  ? 58   THR B HG1  3  
ATOM 9308  H HG21 . THR B 2 58  ? 19.298  -2.941  -9.979  1.00 2.01  ? 58   THR B HG21 3  
ATOM 9309  H HG22 . THR B 2 58  ? 20.284  -3.633  -11.275 1.00 2.05  ? 58   THR B HG22 3  
ATOM 9310  H HG23 . THR B 2 58  ? 20.794  -3.788  -9.590  1.00 2.06  ? 58   THR B HG23 3  
ATOM 9311  N N    . TYR B 2 59  ? 19.935  -4.223  -6.812  1.00 1.73  ? 59   TYR B N    3  
ATOM 9312  C CA   . TYR B 2 59  ? 20.955  -4.165  -5.787  1.00 1.88  ? 59   TYR B CA   3  
ATOM 9313  C C    . TYR B 2 59  ? 20.502  -5.101  -4.686  1.00 1.95  ? 59   TYR B C    3  
ATOM 9314  O O    . TYR B 2 59  ? 21.023  -6.208  -4.580  1.00 2.30  ? 59   TYR B O    3  
ATOM 9315  C CB   . TYR B 2 59  ? 21.069  -2.741  -5.247  1.00 1.88  ? 59   TYR B CB   3  
ATOM 9316  C CG   . TYR B 2 59  ? 22.419  -2.375  -4.698  1.00 2.06  ? 59   TYR B CG   3  
ATOM 9317  C CD1  . TYR B 2 59  ? 22.715  -2.659  -3.381  1.00 2.32  ? 59   TYR B CD1  3  
ATOM 9318  C CD2  . TYR B 2 59  ? 23.402  -1.775  -5.481  1.00 2.08  ? 59   TYR B CD2  3  
ATOM 9319  C CE1  . TYR B 2 59  ? 23.933  -2.364  -2.844  1.00 2.57  ? 59   TYR B CE1  3  
ATOM 9320  C CE2  . TYR B 2 59  ? 24.645  -1.478  -4.946  1.00 2.32  ? 59   TYR B CE2  3  
ATOM 9321  C CZ   . TYR B 2 59  ? 24.913  -1.627  -3.753  1.00 2.56  ? 59   TYR B CZ   3  
ATOM 9322  O OH   . TYR B 2 59  ? 26.133  -1.511  -3.072  1.00 2.86  ? 59   TYR B OH   3  
ATOM 9323  H H    . TYR B 2 59  ? 19.312  -3.469  -6.880  1.00 1.65  ? 59   TYR B H    3  
ATOM 9324  H HA   . TYR B 2 59  ? 21.898  -4.494  -6.198  1.00 1.98  ? 59   TYR B HA   3  
ATOM 9325  H HB2  . TYR B 2 59  ? 20.847  -2.047  -6.043  1.00 1.82  ? 59   TYR B HB2  3  
ATOM 9326  H HB3  . TYR B 2 59  ? 20.342  -2.611  -4.458  1.00 1.93  ? 59   TYR B HB3  3  
ATOM 9327  H HD1  . TYR B 2 59  ? 21.956  -3.121  -2.765  1.00 2.39  ? 59   TYR B HD1  3  
ATOM 9328  H HD2  . TYR B 2 59  ? 23.188  -1.545  -6.514  1.00 2.00  ? 59   TYR B HD2  3  
ATOM 9329  H HE1  . TYR B 2 59  ? 24.125  -2.600  -1.808  1.00 2.84  ? 59   TYR B HE1  3  
ATOM 9330  H HE2  . TYR B 2 59  ? 25.403  -1.008  -5.555  1.00 2.39  ? 59   TYR B HE2  3  
ATOM 9331  H HH   . TYR B 2 59  ? 26.381  -2.328  -2.612  1.00 3.20  ? 59   TYR B HH   3  
ATOM 9332  N N    . CYS B 2 60  ? 19.490  -4.658  -3.921  1.00 1.73  ? 60   CYS B N    3  
ATOM 9333  C CA   . CYS B 2 60  ? 18.817  -5.431  -2.852  1.00 1.77  ? 60   CYS B CA   3  
ATOM 9334  C C    . CYS B 2 60  ? 19.782  -6.070  -1.811  1.00 1.79  ? 60   CYS B C    3  
ATOM 9335  O O    . CYS B 2 60  ? 19.975  -5.563  -0.690  1.00 2.30  ? 60   CYS B O    3  
ATOM 9336  C CB   . CYS B 2 60  ? 17.897  -6.491  -3.503  1.00 1.99  ? 60   CYS B CB   3  
ATOM 9337  S SG   . CYS B 2 60  ? 17.103  -7.650  -2.351  1.00 2.21  ? 60   CYS B SG   3  
ATOM 9338  H H    . CYS B 2 60  ? 19.146  -3.758  -4.098  1.00 1.62  ? 60   CYS B H    3  
ATOM 9339  H HA   . CYS B 2 60  ? 18.184  -4.735  -2.320  1.00 1.97  ? 60   CYS B HA   3  
ATOM 9340  H HB2  . CYS B 2 60  ? 17.098  -6.005  -4.042  1.00 2.21  ? 60   CYS B HB2  3  
ATOM 9341  H HB3  . CYS B 2 60  ? 18.484  -7.074  -4.198  1.00 2.05  ? 60   CYS B HB3  3  
ATOM 9342  N N    . ALA B 2 61  ? 20.387  -7.137  -2.225  1.00 1.81  ? 61   ALA B N    3  
ATOM 9343  C CA   . ALA B 2 61  ? 21.281  -7.941  -1.463  1.00 2.03  ? 61   ALA B CA   3  
ATOM 9344  C C    . ALA B 2 61  ? 22.040  -8.725  -2.472  1.00 2.45  ? 61   ALA B C    3  
ATOM 9345  O O    . ALA B 2 61  ? 23.270  -8.759  -2.500  1.00 3.19  ? 61   ALA B O    3  
ATOM 9346  C CB   . ALA B 2 61  ? 20.509  -8.910  -0.585  1.00 1.94  ? 61   ALA B CB   3  
ATOM 9347  H H    . ALA B 2 61  ? 20.272  -7.371  -3.170  1.00 2.06  ? 61   ALA B H    3  
ATOM 9348  H HA   . ALA B 2 61  ? 21.918  -7.310  -0.861  1.00 2.22  ? 61   ALA B HA   3  
ATOM 9349  H HB1  . ALA B 2 61  ? 19.866  -8.376  0.093   1.00 2.12  ? 61   ALA B HB1  3  
ATOM 9350  H HB2  . ALA B 2 61  ? 21.203  -9.525  -0.032  1.00 2.13  ? 61   ALA B HB2  3  
ATOM 9351  H HB3  . ALA B 2 61  ? 19.910  -9.548  -1.218  1.00 2.27  ? 61   ALA B HB3  3  
ATOM 9352  N N    . THR B 2 62  ? 21.262  -9.316  -3.328  1.00 2.33  ? 62   THR B N    3  
ATOM 9353  C CA   . THR B 2 62  ? 21.679  -10.103 -4.423  1.00 2.79  ? 62   THR B CA   3  
ATOM 9354  C C    . THR B 2 62  ? 20.662  -9.889  -5.537  1.00 3.01  ? 62   THR B C    3  
ATOM 9355  O O    . THR B 2 62  ? 19.483  -9.564  -5.267  1.00 3.05  ? 62   THR B O    3  
ATOM 9356  C CB   . THR B 2 62  ? 21.638  -11.560 -3.998  1.00 3.14  ? 62   THR B CB   3  
ATOM 9357  O OG1  . THR B 2 62  ? 20.467  -11.747 -3.187  1.00 3.39  ? 62   THR B OG1  3  
ATOM 9358  C CG2  . THR B 2 62  ? 22.896  -11.967 -3.236  1.00 3.68  ? 62   THR B CG2  3  
ATOM 9359  H H    . THR B 2 62  ? 20.289  -9.263  -3.229  1.00 2.17  ? 62   THR B H    3  
ATOM 9360  H HA   . THR B 2 62  ? 22.675  -9.846  -4.753  1.00 3.27  ? 62   THR B HA   3  
ATOM 9361  H HB   . THR B 2 62  ? 21.536  -12.166 -4.887  1.00 3.37  ? 62   THR B HB   3  
ATOM 9362  H HG1  . THR B 2 62  ? 20.740  -11.968 -2.283  1.00 3.74  ? 62   THR B HG1  3  
ATOM 9363  H HG21 . THR B 2 62  ? 22.822  -13.004 -2.947  1.00 4.14  ? 62   THR B HG21 3  
ATOM 9364  H HG22 . THR B 2 62  ? 22.996  -11.353 -2.353  1.00 3.96  ? 62   THR B HG22 3  
ATOM 9365  H HG23 . THR B 2 62  ? 23.761  -11.830 -3.868  1.00 3.81  ? 62   THR B HG23 3  
ATOM 9366  N N    . PRO B 2 63  ? 21.101  -9.994  -6.784  1.00 3.66  ? 63   PRO B N    3  
ATOM 9367  C CA   . PRO B 2 63  ? 20.231  -9.831  -7.942  1.00 4.31  ? 63   PRO B CA   3  
ATOM 9368  C C    . PRO B 2 63  ? 19.352  -11.053 -8.223  1.00 4.40  ? 63   PRO B C    3  
ATOM 9369  O O    . PRO B 2 63  ? 18.376  -10.963 -8.979  1.00 5.06  ? 63   PRO B O    3  
ATOM 9370  C CB   . PRO B 2 63  ? 21.208  -9.606  -9.086  1.00 5.08  ? 63   PRO B CB   3  
ATOM 9371  C CG   . PRO B 2 63  ? 22.477  -10.261 -8.668  1.00 4.98  ? 63   PRO B CG   3  
ATOM 9372  C CD   . PRO B 2 63  ? 22.516  -10.214 -7.173  1.00 4.19  ? 63   PRO B CD   3  
ATOM 9373  H HA   . PRO B 2 63  ? 19.600  -8.962  -7.836  1.00 4.51  ? 63   PRO B HA   3  
ATOM 9374  H HB2  . PRO B 2 63  ? 20.816  -10.033 -9.997  1.00 5.47  ? 63   PRO B HB2  3  
ATOM 9375  H HB3  . PRO B 2 63  ? 21.342  -8.547  -9.198  1.00 5.54  ? 63   PRO B HB3  3  
ATOM 9376  H HG2  . PRO B 2 63  ? 22.483  -11.290 -8.991  1.00 5.10  ? 63   PRO B HG2  3  
ATOM 9377  H HG3  . PRO B 2 63  ? 23.321  -9.729  -9.081  1.00 5.59  ? 63   PRO B HG3  3  
ATOM 9378  H HD2  . PRO B 2 63  ? 22.868  -11.165 -6.811  1.00 4.15  ? 63   PRO B HD2  3  
ATOM 9379  H HD3  . PRO B 2 63  ? 23.157  -9.428  -6.800  1.00 4.36  ? 63   PRO B HD3  3  
ATOM 9380  N N    . ALA B 2 64  ? 19.711  -12.180 -7.647  1.00 4.07  ? 64   ALA B N    3  
ATOM 9381  C CA   . ALA B 2 64  ? 18.974  -13.424 -7.848  1.00 4.49  ? 64   ALA B CA   3  
ATOM 9382  C C    . ALA B 2 64  ? 18.935  -14.269 -6.568  1.00 4.55  ? 64   ALA B C    3  
ATOM 9383  O O    . ALA B 2 64  ? 19.268  -15.463 -6.584  1.00 4.94  ? 64   ALA B O    3  
ATOM 9384  C CB   . ALA B 2 64  ? 19.582  -14.213 -8.997  1.00 5.10  ? 64   ALA B CB   3  
ATOM 9385  H H    . ALA B 2 64  ? 20.514  -12.163 -7.084  1.00 3.80  ? 64   ALA B H    3  
ATOM 9386  H HA   . ALA B 2 64  ? 17.961  -13.162 -8.114  1.00 4.81  ? 64   ALA B HA   3  
ATOM 9387  H HB1  . ALA B 2 64  ? 18.984  -15.091 -9.188  1.00 5.36  ? 64   ALA B HB1  3  
ATOM 9388  H HB2  . ALA B 2 64  ? 20.586  -14.512 -8.734  1.00 5.29  ? 64   ALA B HB2  3  
ATOM 9389  H HB3  . ALA B 2 64  ? 19.610  -13.596 -9.883  1.00 5.51  ? 64   ALA B HB3  3  
ATOM 9390  N N    . LYS B 2 65  ? 18.528  -13.618 -5.472  1.00 4.63  ? 65   LYS B N    3  
ATOM 9391  C CA   . LYS B 2 65  ? 18.385  -14.212 -4.138  1.00 5.27  ? 65   LYS B CA   3  
ATOM 9392  C C    . LYS B 2 65  ? 19.752  -14.603 -3.510  1.00 5.65  ? 65   LYS B C    3  
ATOM 9393  O O    . LYS B 2 65  ? 20.670  -15.050 -4.193  1.00 5.93  ? 65   LYS B O    3  
ATOM 9394  C CB   . LYS B 2 65  ? 17.388  -15.370 -4.185  1.00 5.85  ? 65   LYS B CB   3  
ATOM 9395  C CG   . LYS B 2 65  ? 17.041  -15.995 -2.845  1.00 6.65  ? 65   LYS B CG   3  
ATOM 9396  C CD   . LYS B 2 65  ? 15.915  -17.001 -3.008  1.00 7.41  ? 65   LYS B CD   3  
ATOM 9397  C CE   . LYS B 2 65  ? 15.428  -17.558 -1.678  1.00 8.15  ? 65   LYS B CE   3  
ATOM 9398  N NZ   . LYS B 2 65  ? 16.477  -18.298 -0.948  1.00 8.51  ? 65   LYS B NZ   3  
ATOM 9399  H H    . LYS B 2 65  ? 18.288  -12.680 -5.571  1.00 4.56  ? 65   LYS B H    3  
ATOM 9400  H HA   . LYS B 2 65  ? 17.971  -13.423 -3.524  1.00 5.51  ? 65   LYS B HA   3  
ATOM 9401  H HB2  . LYS B 2 65  ? 16.477  -15.018 -4.647  1.00 5.88  ? 65   LYS B HB2  3  
ATOM 9402  H HB3  . LYS B 2 65  ? 17.835  -16.105 -4.832  1.00 6.03  ? 65   LYS B HB3  3  
ATOM 9403  H HG2  . LYS B 2 65  ? 17.916  -16.497 -2.457  1.00 6.88  ? 65   LYS B HG2  3  
ATOM 9404  H HG3  . LYS B 2 65  ? 16.731  -15.215 -2.165  1.00 6.78  ? 65   LYS B HG3  3  
ATOM 9405  H HD2  . LYS B 2 65  ? 15.084  -16.517 -3.500  1.00 7.54  ? 65   LYS B HD2  3  
ATOM 9406  H HD3  . LYS B 2 65  ? 16.265  -17.817 -3.624  1.00 7.58  ? 65   LYS B HD3  3  
ATOM 9407  H HE2  . LYS B 2 65  ? 15.080  -16.747 -1.057  1.00 8.50  ? 65   LYS B HE2  3  
ATOM 9408  H HE3  . LYS B 2 65  ? 14.603  -18.227 -1.874  1.00 8.37  ? 65   LYS B HE3  3  
ATOM 9409  H HZ1  . LYS B 2 65  ? 16.880  -19.057 -1.541  1.00 8.59  ? 65   LYS B HZ1  3  
ATOM 9410  H HZ2  . LYS B 2 65  ? 16.038  -18.736 -0.107  1.00 8.70  ? 65   LYS B HZ2  3  
ATOM 9411  H HZ3  . LYS B 2 65  ? 17.230  -17.661 -0.608  1.00 8.80  ? 65   LYS B HZ3  3  
ATOM 9412  N N    . SER B 2 66  ? 19.876  -14.421 -2.202  1.00 6.08  ? 66   SER B N    3  
ATOM 9413  C CA   . SER B 2 66  ? 21.136  -14.617 -1.496  1.00 6.85  ? 66   SER B CA   3  
ATOM 9414  C C    . SER B 2 66  ? 21.365  -16.079 -1.122  1.00 7.46  ? 66   SER B C    3  
ATOM 9415  O O    . SER B 2 66  ? 21.931  -16.385 -0.059  1.00 8.12  ? 66   SER B O    3  
ATOM 9416  C CB   . SER B 2 66  ? 21.131  -13.747 -0.248  1.00 7.35  ? 66   SER B CB   3  
ATOM 9417  O OG   . SER B 2 66  ? 20.806  -12.400 -0.578  1.00 7.52  ? 66   SER B OG   3  
ATOM 9418  H H    . SER B 2 66  ? 19.114  -14.136 -1.657  1.00 6.13  ? 66   SER B H    3  
ATOM 9419  H HA   . SER B 2 66  ? 21.938  -14.280 -2.137  1.00 6.99  ? 66   SER B HA   3  
ATOM 9420  H HB2  . SER B 2 66  ? 20.400  -14.124 0.452   1.00 7.38  ? 66   SER B HB2  3  
ATOM 9421  H HB3  . SER B 2 66  ? 22.110  -13.765 0.206   1.00 7.87  ? 66   SER B HB3  3  
ATOM 9422  H HG   . SER B 2 66  ? 20.786  -11.919 0.267   1.00 7.68  ? 66   SER B HG   3  
ATOM 9423  N N    . GLU B 2 67  ? 20.933  -16.956 -1.974  1.00 7.51  ? 67   GLU B N    3  
ATOM 9424  C CA   . GLU B 2 67  ? 21.066  -18.357 -1.782  1.00 8.31  ? 67   GLU B CA   3  
ATOM 9425  C C    . GLU B 2 67  ? 20.896  -18.991 -3.137  1.00 8.57  ? 67   GLU B C    3  
ATOM 9426  O O    . GLU B 2 67  ? 21.899  -19.374 -3.748  1.00 8.74  ? 67   GLU B O    3  
ATOM 9427  C CB   . GLU B 2 67  ? 20.010  -18.885 -0.811  1.00 8.74  ? 67   GLU B CB   3  
ATOM 9428  C CG   . GLU B 2 67  ? 20.273  -20.300 -0.349  1.00 9.47  ? 67   GLU B CG   3  
ATOM 9429  C CD   . GLU B 2 67  ? 19.150  -20.871 0.462   1.00 9.82  ? 67   GLU B CD   3  
ATOM 9430  O OE1  . GLU B 2 67  ? 18.908  -20.395 1.596   1.00 10.21 ? 67   GLU B OE1  3  
ATOM 9431  O OE2  . GLU B 2 67  ? 18.477  -21.798 -0.026  1.00 9.89  ? 67   GLU B OE2  3  
ATOM 9432  O OXT  . GLU B 2 67  ? 19.767  -19.011 -3.640  1.00 8.84  ? 67   GLU B OXT  3  
ATOM 9433  H H    . GLU B 2 67  ? 20.525  -16.659 -2.815  1.00 7.18  ? 67   GLU B H    3  
ATOM 9434  H HA   . GLU B 2 67  ? 22.057  -18.564 -1.405  1.00 8.70  ? 67   GLU B HA   3  
ATOM 9435  H HB2  . GLU B 2 67  ? 19.980  -18.243 0.057   1.00 8.63  ? 67   GLU B HB2  3  
ATOM 9436  H HB3  . GLU B 2 67  ? 19.046  -18.862 -1.298  1.00 8.93  ? 67   GLU B HB3  3  
ATOM 9437  H HG2  . GLU B 2 67  ? 20.419  -20.925 -1.217  1.00 9.74  ? 67   GLU B HG2  3  
ATOM 9438  H HG3  . GLU B 2 67  ? 21.172  -20.305 0.250   1.00 9.75  ? 67   GLU B HG3  3  
ATOM 9439  N N    . MET A 1 1   ? -24.669 5.354   -13.097 1.00 8.13  ? 1508 MET A N    4  
ATOM 9440  C CA   . MET A 1 1   ? -23.747 6.439   -13.411 1.00 7.50  ? 1508 MET A CA   4  
ATOM 9441  C C    . MET A 1 1   ? -24.255 7.694   -12.762 1.00 6.73  ? 1508 MET A C    4  
ATOM 9442  O O    . MET A 1 1   ? -25.113 7.615   -11.878 1.00 6.84  ? 1508 MET A O    4  
ATOM 9443  C CB   . MET A 1 1   ? -23.623 6.638   -14.940 1.00 7.83  ? 1508 MET A CB   4  
ATOM 9444  C CG   . MET A 1 1   ? -22.954 5.492   -15.702 1.00 8.25  ? 1508 MET A CG   4  
ATOM 9445  S SD   . MET A 1 1   ? -23.854 3.929   -15.607 1.00 8.94  ? 1508 MET A SD   4  
ATOM 9446  C CE   . MET A 1 1   ? -22.776 2.862   -16.564 1.00 9.34  ? 1508 MET A CE   4  
ATOM 9447  H H1   . MET A 1 1   ? -24.386 4.441   -13.506 1.00 8.35  ? 1508 MET A H1   4  
ATOM 9448  H H2   . MET A 1 1   ? -25.609 5.611   -13.472 1.00 8.44  ? 1508 MET A H2   4  
ATOM 9449  H H3   . MET A 1 1   ? -24.806 5.248   -12.071 1.00 8.31  ? 1508 MET A H3   4  
ATOM 9450  H HA   . MET A 1 1   ? -22.779 6.222   -12.990 1.00 7.66  ? 1508 MET A HA   4  
ATOM 9451  H HB2  . MET A 1 1   ? -24.614 6.772   -15.350 1.00 8.12  ? 1508 MET A HB2  4  
ATOM 9452  H HB3  . MET A 1 1   ? -23.055 7.540   -15.120 1.00 7.83  ? 1508 MET A HB3  4  
ATOM 9453  H HG2  . MET A 1 1   ? -22.872 5.772   -16.742 1.00 8.43  ? 1508 MET A HG2  4  
ATOM 9454  H HG3  . MET A 1 1   ? -21.964 5.348   -15.296 1.00 8.28  ? 1508 MET A HG3  4  
ATOM 9455  H HE1  . MET A 1 1   ? -23.191 1.866   -16.595 1.00 9.55  ? 1508 MET A HE1  4  
ATOM 9456  H HE2  . MET A 1 1   ? -21.801 2.831   -16.102 1.00 9.74  ? 1508 MET A HE2  4  
ATOM 9457  H HE3  . MET A 1 1   ? -22.688 3.247   -17.568 1.00 9.25  ? 1508 MET A HE3  4  
ATOM 9458  N N    . LYS A 1 2   ? -23.708 8.843   -13.167 1.00 6.29  ? 1509 LYS A N    4  
ATOM 9459  C CA   . LYS A 1 2   ? -24.134 10.148  -12.679 1.00 5.88  ? 1509 LYS A CA   4  
ATOM 9460  C C    . LYS A 1 2   ? -23.859 10.297  -11.190 1.00 5.23  ? 1509 LYS A C    4  
ATOM 9461  O O    . LYS A 1 2   ? -24.790 10.397  -10.399 1.00 5.51  ? 1509 LYS A O    4  
ATOM 9462  C CB   . LYS A 1 2   ? -25.619 10.390  -12.973 1.00 6.62  ? 1509 LYS A CB   4  
ATOM 9463  C CG   . LYS A 1 2   ? -25.985 10.370  -14.447 1.00 7.06  ? 1509 LYS A CG   4  
ATOM 9464  C CD   . LYS A 1 2   ? -27.436 10.763  -14.664 1.00 7.86  ? 1509 LYS A CD   4  
ATOM 9465  C CE   . LYS A 1 2   ? -27.699 12.182  -14.177 1.00 8.52  ? 1509 LYS A CE   4  
ATOM 9466  N NZ   . LYS A 1 2   ? -26.856 13.173  -14.876 1.00 9.04  ? 1509 LYS A NZ   4  
ATOM 9467  H H    . LYS A 1 2   ? -22.974 8.833   -13.822 1.00 6.49  ? 1509 LYS A H    4  
ATOM 9468  H HA   . LYS A 1 2   ? -23.553 10.893  -13.204 1.00 5.90  ? 1509 LYS A HA   4  
ATOM 9469  H HB2  . LYS A 1 2   ? -26.157 9.582   -12.499 1.00 7.05  ? 1509 LYS A HB2  4  
ATOM 9470  H HB3  . LYS A 1 2   ? -25.924 11.331  -12.542 1.00 6.74  ? 1509 LYS A HB3  4  
ATOM 9471  H HG2  . LYS A 1 2   ? -25.352 11.068  -14.974 1.00 6.93  ? 1509 LYS A HG2  4  
ATOM 9472  H HG3  . LYS A 1 2   ? -25.828 9.374   -14.834 1.00 7.28  ? 1509 LYS A HG3  4  
ATOM 9473  H HD2  . LYS A 1 2   ? -27.661 10.703  -15.718 1.00 8.13  ? 1509 LYS A HD2  4  
ATOM 9474  H HD3  . LYS A 1 2   ? -28.069 10.079  -14.117 1.00 8.01  ? 1509 LYS A HD3  4  
ATOM 9475  H HE2  . LYS A 1 2   ? -28.738 12.424  -14.351 1.00 8.69  ? 1509 LYS A HE2  4  
ATOM 9476  H HE3  . LYS A 1 2   ? -27.494 12.228  -13.117 1.00 8.71  ? 1509 LYS A HE3  4  
ATOM 9477  H HZ1  . LYS A 1 2   ? -27.019 14.134  -14.506 1.00 9.17  ? 1509 LYS A HZ1  4  
ATOM 9478  H HZ2  . LYS A 1 2   ? -27.058 13.185  -15.900 1.00 9.28  ? 1509 LYS A HZ2  4  
ATOM 9479  H HZ3  . LYS A 1 2   ? -25.841 12.961  -14.773 1.00 9.32  ? 1509 LYS A HZ3  4  
ATOM 9480  N N    . SER A 1 3   ? -22.576 10.291  -10.835 1.00 4.76  ? 1510 SER A N    4  
ATOM 9481  C CA   . SER A 1 3   ? -22.120 10.429  -9.458  1.00 4.45  ? 1510 SER A CA   4  
ATOM 9482  C C    . SER A 1 3   ? -22.752 9.381   -8.534  1.00 3.64  ? 1510 SER A C    4  
ATOM 9483  O O    . SER A 1 3   ? -23.770 9.642   -7.869  1.00 3.88  ? 1510 SER A O    4  
ATOM 9484  C CB   . SER A 1 3   ? -22.398 11.821  -8.930  1.00 5.16  ? 1510 SER A CB   4  
ATOM 9485  O OG   . SER A 1 3   ? -21.762 12.813  -9.735  1.00 5.81  ? 1510 SER A OG   4  
ATOM 9486  H H    . SER A 1 3   ? -21.885 10.184  -11.525 1.00 4.93  ? 1510 SER A H    4  
ATOM 9487  H HA   . SER A 1 3   ? -21.047 10.292  -9.488  1.00 4.75  ? 1510 SER A HA   4  
ATOM 9488  H HB2  . SER A 1 3   ? -23.465 11.981  -8.906  1.00 5.40  ? 1510 SER A HB2  4  
ATOM 9489  H HB3  . SER A 1 3   ? -21.988 11.849  -7.932  1.00 5.37  ? 1510 SER A HB3  4  
ATOM 9490  H HG   . SER A 1 3   ? -22.228 12.859  -10.583 1.00 5.97  ? 1510 SER A HG   4  
ATOM 9491  N N    . ASN A 1 4   ? -22.145 8.215   -8.469  1.00 3.10  ? 1511 ASN A N    4  
ATOM 9492  C CA   . ASN A 1 4   ? -22.683 7.130   -7.661  1.00 2.64  ? 1511 ASN A CA   4  
ATOM 9493  C C    . ASN A 1 4   ? -22.459 7.380   -6.184  1.00 2.46  ? 1511 ASN A C    4  
ATOM 9494  O O    . ASN A 1 4   ? -23.127 6.798   -5.345  1.00 2.95  ? 1511 ASN A O    4  
ATOM 9495  C CB   . ASN A 1 4   ? -22.138 5.714   -8.077  1.00 2.88  ? 1511 ASN A CB   4  
ATOM 9496  C CG   . ASN A 1 4   ? -20.609 5.474   -7.993  1.00 2.85  ? 1511 ASN A CG   4  
ATOM 9497  O OD1  . ASN A 1 4   ? -20.049 4.714   -8.782  1.00 3.42  ? 1511 ASN A OD1  4  
ATOM 9498  N ND2  . ASN A 1 4   ? -19.955 6.041   -7.032  1.00 2.85  ? 1511 ASN A ND2  4  
ATOM 9499  H H    . ASN A 1 4   ? -21.299 8.106   -8.951  1.00 3.39  ? 1511 ASN A H    4  
ATOM 9500  H HA   . ASN A 1 4   ? -23.750 7.141   -7.823  1.00 2.86  ? 1511 ASN A HA   4  
ATOM 9501  H HB2  . ASN A 1 4   ? -22.551 5.016   -7.365  1.00 3.16  ? 1511 ASN A HB2  4  
ATOM 9502  H HB3  . ASN A 1 4   ? -22.480 5.472   -9.072  1.00 3.48  ? 1511 ASN A HB3  4  
ATOM 9503  H HD21 . ASN A 1 4   ? -20.476 6.586   -6.407  1.00 2.88  ? 1511 ASN A HD21 4  
ATOM 9504  H HD22 . ASN A 1 4   ? -18.987 5.925   -6.934  1.00 3.22  ? 1511 ASN A HD22 4  
ATOM 9505  N N    . GLU A 1 5   ? -21.535 8.256   -5.875  1.00 2.44  ? 1512 GLU A N    4  
ATOM 9506  C CA   . GLU A 1 5   ? -21.153 8.495   -4.517  1.00 2.69  ? 1512 GLU A CA   4  
ATOM 9507  C C    . GLU A 1 5   ? -21.913 9.652   -3.877  1.00 2.20  ? 1512 GLU A C    4  
ATOM 9508  O O    . GLU A 1 5   ? -22.279 10.636  -4.537  1.00 2.74  ? 1512 GLU A O    4  
ATOM 9509  C CB   . GLU A 1 5   ? -19.632 8.684   -4.370  1.00 3.65  ? 1512 GLU A CB   4  
ATOM 9510  C CG   . GLU A 1 5   ? -19.007 9.812   -5.197  1.00 4.47  ? 1512 GLU A CG   4  
ATOM 9511  C CD   . GLU A 1 5   ? -18.874 9.493   -6.680  1.00 5.30  ? 1512 GLU A CD   4  
ATOM 9512  O OE1  . GLU A 1 5   ? -19.812 9.741   -7.438  1.00 5.61  ? 1512 GLU A OE1  4  
ATOM 9513  O OE2  . GLU A 1 5   ? -17.829 8.977   -7.110  1.00 5.95  ? 1512 GLU A OE2  4  
ATOM 9514  H H    . GLU A 1 5   ? -21.104 8.799   -6.578  1.00 2.68  ? 1512 GLU A H    4  
ATOM 9515  H HA   . GLU A 1 5   ? -21.418 7.589   -3.992  1.00 3.17  ? 1512 GLU A HA   4  
ATOM 9516  H HB2  . GLU A 1 5   ? -19.396 8.859   -3.331  1.00 3.77  ? 1512 GLU A HB2  4  
ATOM 9517  H HB3  . GLU A 1 5   ? -19.186 7.752   -4.680  1.00 4.13  ? 1512 GLU A HB3  4  
ATOM 9518  H HG2  . GLU A 1 5   ? -19.644 10.677  -5.084  1.00 4.63  ? 1512 GLU A HG2  4  
ATOM 9519  H HG3  . GLU A 1 5   ? -18.031 10.033  -4.789  1.00 4.71  ? 1512 GLU A HG3  4  
ATOM 9520  N N    . HIS A 1 6   ? -22.165 9.490   -2.606  1.00 1.95  ? 1513 HIS A N    4  
ATOM 9521  C CA   . HIS A 1 6   ? -22.808 10.445  -1.731  1.00 2.20  ? 1513 HIS A CA   4  
ATOM 9522  C C    . HIS A 1 6   ? -22.608 9.844   -0.366  1.00 2.18  ? 1513 HIS A C    4  
ATOM 9523  O O    . HIS A 1 6   ? -22.608 8.617   -0.278  1.00 2.90  ? 1513 HIS A O    4  
ATOM 9524  C CB   . HIS A 1 6   ? -24.317 10.539  -2.022  1.00 3.02  ? 1513 HIS A CB   4  
ATOM 9525  C CG   . HIS A 1 6   ? -25.003 11.708  -1.367  1.00 3.77  ? 1513 HIS A CG   4  
ATOM 9526  N ND1  . HIS A 1 6   ? -25.583 11.659  -0.121  1.00 4.48  ? 1513 HIS A ND1  4  
ATOM 9527  C CD2  . HIS A 1 6   ? -25.211 12.962  -1.816  1.00 4.42  ? 1513 HIS A CD2  4  
ATOM 9528  C CE1  . HIS A 1 6   ? -26.116 12.824  0.158   1.00 5.33  ? 1513 HIS A CE1  4  
ATOM 9529  N NE2  . HIS A 1 6   ? -25.904 13.635  -0.855  1.00 5.30  ? 1513 HIS A NE2  4  
ATOM 9530  H H    . HIS A 1 6   ? -21.897 8.656   -2.162  1.00 2.23  ? 1513 HIS A H    4  
ATOM 9531  H HA   . HIS A 1 6   ? -22.322 11.406  -1.809  1.00 2.69  ? 1513 HIS A HA   4  
ATOM 9532  H HB2  . HIS A 1 6   ? -24.479 10.607  -3.087  1.00 3.35  ? 1513 HIS A HB2  4  
ATOM 9533  H HB3  . HIS A 1 6   ? -24.775 9.639   -1.643  1.00 3.43  ? 1513 HIS A HB3  4  
ATOM 9534  H HD1  . HIS A 1 6   ? -25.591 10.895  0.512   1.00 4.64  ? 1513 HIS A HD1  4  
ATOM 9535  H HD2  . HIS A 1 6   ? -24.885 13.362  -2.766  1.00 4.57  ? 1513 HIS A HD2  4  
ATOM 9536  H HE1  . HIS A 1 6   ? -26.640 13.077  1.068   1.00 6.14  ? 1513 HIS A HE1  4  
ATOM 9537  H HE2  . HIS A 1 6   ? -26.538 14.360  -1.087  1.00 5.92  ? 1513 HIS A HE2  4  
ATOM 9538  N N    . ASP A 1 7   ? -22.420 10.669  0.675   1.00 2.06  ? 1514 ASP A N    4  
ATOM 9539  C CA   . ASP A 1 7   ? -22.136 10.224  2.022   1.00 2.48  ? 1514 ASP A CA   4  
ATOM 9540  C C    . ASP A 1 7   ? -20.719 9.558   2.080   1.00 1.88  ? 1514 ASP A C    4  
ATOM 9541  O O    . ASP A 1 7   ? -20.203 9.145   1.037   1.00 2.21  ? 1514 ASP A O    4  
ATOM 9542  C CB   . ASP A 1 7   ? -23.278 9.304   2.523   1.00 3.42  ? 1514 ASP A CB   4  
ATOM 9543  C CG   . ASP A 1 7   ? -24.600 10.020  2.724   1.00 4.29  ? 1514 ASP A CG   4  
ATOM 9544  O OD1  . ASP A 1 7   ? -24.783 10.706  3.764   1.00 4.55  ? 1514 ASP A OD1  4  
ATOM 9545  O OD2  . ASP A 1 7   ? -25.490 9.917   1.843   1.00 5.06  ? 1514 ASP A OD2  4  
ATOM 9546  H H    . ASP A 1 7   ? -22.483 11.634  0.598   1.00 2.23  ? 1514 ASP A H    4  
ATOM 9547  H HA   . ASP A 1 7   ? -22.135 11.137  2.601   1.00 3.01  ? 1514 ASP A HA   4  
ATOM 9548  H HB2  . ASP A 1 7   ? -23.449 8.613   1.712   1.00 3.71  ? 1514 ASP A HB2  4  
ATOM 9549  H HB3  . ASP A 1 7   ? -23.052 8.736   3.402   1.00 3.65  ? 1514 ASP A HB3  4  
ATOM 9550  N N    . ASP A 1 8   ? -20.038 9.606   3.261   1.00 1.41  ? 1515 ASP A N    4  
ATOM 9551  C CA   . ASP A 1 8   ? -18.712 8.933   3.494   1.00 1.15  ? 1515 ASP A CA   4  
ATOM 9552  C C    . ASP A 1 8   ? -18.516 7.659   2.668   1.00 1.08  ? 1515 ASP A C    4  
ATOM 9553  O O    . ASP A 1 8   ? -17.773 7.666   1.689   1.00 1.97  ? 1515 ASP A O    4  
ATOM 9554  C CB   . ASP A 1 8   ? -18.489 8.579   4.983   1.00 1.48  ? 1515 ASP A CB   4  
ATOM 9555  C CG   . ASP A 1 8   ? -18.245 9.755   5.896   1.00 2.07  ? 1515 ASP A CG   4  
ATOM 9556  O OD1  . ASP A 1 8   ? -19.224 10.396  6.332   1.00 2.90  ? 1515 ASP A OD1  4  
ATOM 9557  O OD2  . ASP A 1 8   ? -17.070 10.103  6.145   1.00 2.33  ? 1515 ASP A OD2  4  
ATOM 9558  H H    . ASP A 1 8   ? -20.353 10.198  3.980   1.00 1.68  ? 1515 ASP A H    4  
ATOM 9559  H HA   . ASP A 1 8   ? -17.948 9.638   3.201   1.00 1.40  ? 1515 ASP A HA   4  
ATOM 9560  H HB2  . ASP A 1 8   ? -19.361 8.059   5.349   1.00 1.83  ? 1515 ASP A HB2  4  
ATOM 9561  H HB3  . ASP A 1 8   ? -17.644 7.910   5.050   1.00 1.85  ? 1515 ASP A HB3  4  
ATOM 9562  N N    . CYS A 1 9   ? -19.179 6.586   3.045   1.00 0.81  ? 1516 CYS A N    4  
ATOM 9563  C CA   . CYS A 1 9   ? -19.050 5.341   2.319   1.00 0.69  ? 1516 CYS A CA   4  
ATOM 9564  C C    . CYS A 1 9   ? -20.351 4.590   2.289   1.00 0.61  ? 1516 CYS A C    4  
ATOM 9565  O O    . CYS A 1 9   ? -20.553 3.624   3.058   1.00 0.65  ? 1516 CYS A O    4  
ATOM 9566  C CB   . CYS A 1 9   ? -18.002 4.437   2.941   1.00 0.80  ? 1516 CYS A CB   4  
ATOM 9567  S SG   . CYS A 1 9   ? -16.317 5.067   2.961   1.00 1.19  ? 1516 CYS A SG   4  
ATOM 9568  H H    . CYS A 1 9   ? -19.769 6.607   3.832   1.00 1.41  ? 1516 CYS A H    4  
ATOM 9569  H HA   . CYS A 1 9   ? -18.740 5.572   1.311   1.00 0.82  ? 1516 CYS A HA   4  
ATOM 9570  H HB2  . CYS A 1 9   ? -18.278 4.244   3.966   1.00 1.27  ? 1516 CYS A HB2  4  
ATOM 9571  H HB3  . CYS A 1 9   ? -17.998 3.501   2.404   1.00 1.18  ? 1516 CYS A HB3  4  
ATOM 9572  N N    . GLN A 1 10  ? -21.240 4.996   1.437   1.00 0.58  ? 1517 GLN A N    4  
ATOM 9573  C CA   . GLN A 1 10  ? -22.458 4.279   1.285   1.00 0.58  ? 1517 GLN A CA   4  
ATOM 9574  C C    . GLN A 1 10  ? -23.037 4.579   -0.073  1.00 0.60  ? 1517 GLN A C    4  
ATOM 9575  O O    . GLN A 1 10  ? -23.125 5.731   -0.488  1.00 0.73  ? 1517 GLN A O    4  
ATOM 9576  C CB   . GLN A 1 10  ? -23.463 4.568   2.435   1.00 0.65  ? 1517 GLN A CB   4  
ATOM 9577  C CG   . GLN A 1 10  ? -24.129 5.930   2.413   1.00 0.74  ? 1517 GLN A CG   4  
ATOM 9578  C CD   . GLN A 1 10  ? -25.119 6.102   3.532   1.00 0.90  ? 1517 GLN A CD   4  
ATOM 9579  O OE1  . GLN A 1 10  ? -24.959 5.546   4.618   1.00 1.44  ? 1517 GLN A OE1  4  
ATOM 9580  N NE2  . GLN A 1 10  ? -26.153 6.835   3.279   1.00 1.52  ? 1517 GLN A NE2  4  
ATOM 9581  H H    . GLN A 1 10  ? -21.083 5.780   0.864   1.00 0.61  ? 1517 GLN A H    4  
ATOM 9582  H HA   . GLN A 1 10  ? -22.194 3.230   1.298   1.00 0.58  ? 1517 GLN A HA   4  
ATOM 9583  H HB2  . GLN A 1 10  ? -24.226 3.808   2.456   1.00 0.72  ? 1517 GLN A HB2  4  
ATOM 9584  H HB3  . GLN A 1 10  ? -22.913 4.493   3.364   1.00 0.64  ? 1517 GLN A HB3  4  
ATOM 9585  H HG2  . GLN A 1 10  ? -23.385 6.702   2.519   1.00 0.71  ? 1517 GLN A HG2  4  
ATOM 9586  H HG3  . GLN A 1 10  ? -24.650 6.050   1.474   1.00 0.82  ? 1517 GLN A HG3  4  
ATOM 9587  H HE21 . GLN A 1 10  ? -26.228 7.223   2.373   1.00 2.18  ? 1517 GLN A HE21 4  
ATOM 9588  H HE22 . GLN A 1 10  ? -26.828 6.983   3.982   1.00 1.63  ? 1517 GLN A HE22 4  
ATOM 9589  N N    . VAL A 1 11  ? -23.389 3.563   -0.779  1.00 0.51  ? 1518 VAL A N    4  
ATOM 9590  C CA   . VAL A 1 11  ? -23.922 3.723   -2.088  1.00 0.53  ? 1518 VAL A CA   4  
ATOM 9591  C C    . VAL A 1 11  ? -25.166 2.918   -2.259  1.00 0.54  ? 1518 VAL A C    4  
ATOM 9592  O O    . VAL A 1 11  ? -25.247 1.766   -1.820  1.00 0.51  ? 1518 VAL A O    4  
ATOM 9593  C CB   . VAL A 1 11  ? -22.903 3.401   -3.222  1.00 0.51  ? 1518 VAL A CB   4  
ATOM 9594  C CG1  . VAL A 1 11  ? -21.879 4.509   -3.361  1.00 0.94  ? 1518 VAL A CG1  4  
ATOM 9595  C CG2  . VAL A 1 11  ? -22.185 2.077   -2.990  1.00 0.84  ? 1518 VAL A CG2  4  
ATOM 9596  H H    . VAL A 1 11  ? -23.323 2.654   -0.419  1.00 0.47  ? 1518 VAL A H    4  
ATOM 9597  H HA   . VAL A 1 11  ? -24.197 4.764   -2.177  1.00 0.60  ? 1518 VAL A HA   4  
ATOM 9598  H HB   . VAL A 1 11  ? -23.467 3.326   -4.138  1.00 0.93  ? 1518 VAL A HB   4  
ATOM 9599  H HG11 . VAL A 1 11  ? -21.187 4.251   -4.150  1.00 1.47  ? 1518 VAL A HG11 4  
ATOM 9600  H HG12 . VAL A 1 11  ? -21.348 4.622   -2.428  1.00 1.51  ? 1518 VAL A HG12 4  
ATOM 9601  H HG13 . VAL A 1 11  ? -22.387 5.430   -3.607  1.00 1.48  ? 1518 VAL A HG13 4  
ATOM 9602  H HG21 . VAL A 1 11  ? -21.516 1.924   -3.828  1.00 1.37  ? 1518 VAL A HG21 4  
ATOM 9603  H HG22 . VAL A 1 11  ? -22.876 1.254   -2.912  1.00 1.33  ? 1518 VAL A HG22 4  
ATOM 9604  H HG23 . VAL A 1 11  ? -21.572 2.139   -2.097  1.00 1.52  ? 1518 VAL A HG23 4  
ATOM 9605  N N    . THR A 1 12  ? -26.136 3.522   -2.846  1.00 0.64  ? 1519 THR A N    4  
ATOM 9606  C CA   . THR A 1 12  ? -27.354 2.862   -3.132  1.00 0.69  ? 1519 THR A CA   4  
ATOM 9607  C C    . THR A 1 12  ? -27.384 2.607   -4.610  1.00 0.78  ? 1519 THR A C    4  
ATOM 9608  O O    . THR A 1 12  ? -27.101 3.508   -5.405  1.00 0.89  ? 1519 THR A O    4  
ATOM 9609  C CB   . THR A 1 12  ? -28.579 3.715   -2.753  1.00 0.79  ? 1519 THR A CB   4  
ATOM 9610  O OG1  . THR A 1 12  ? -28.440 4.191   -1.399  1.00 0.78  ? 1519 THR A OG1  4  
ATOM 9611  C CG2  . THR A 1 12  ? -29.851 2.875   -2.874  1.00 0.85  ? 1519 THR A CG2  4  
ATOM 9612  H H    . THR A 1 12  ? -26.018 4.452   -3.142  1.00 0.72  ? 1519 THR A H    4  
ATOM 9613  H HA   . THR A 1 12  ? -27.384 1.928   -2.591  1.00 0.66  ? 1519 THR A HA   4  
ATOM 9614  H HB   . THR A 1 12  ? -28.647 4.556   -3.426  1.00 0.87  ? 1519 THR A HB   4  
ATOM 9615  H HG1  . THR A 1 12  ? -27.531 4.503   -1.300  1.00 1.09  ? 1519 THR A HG1  4  
ATOM 9616  H HG21 . THR A 1 12  ? -29.809 2.044   -2.186  1.00 1.36  ? 1519 THR A HG21 4  
ATOM 9617  H HG22 . THR A 1 12  ? -29.905 2.478   -3.880  1.00 1.35  ? 1519 THR A HG22 4  
ATOM 9618  H HG23 . THR A 1 12  ? -30.726 3.476   -2.677  1.00 1.30  ? 1519 THR A HG23 4  
ATOM 9619  N N    . ASN A 1 13  ? -27.658 1.406   -4.981  1.00 0.80  ? 1520 ASN A N    4  
ATOM 9620  C CA   . ASN A 1 13  ? -27.779 1.078   -6.355  1.00 0.95  ? 1520 ASN A CA   4  
ATOM 9621  C C    . ASN A 1 13  ? -29.210 1.295   -6.767  1.00 0.98  ? 1520 ASN A C    4  
ATOM 9622  O O    . ASN A 1 13  ? -30.077 0.580   -6.317  1.00 0.96  ? 1520 ASN A O    4  
ATOM 9623  C CB   . ASN A 1 13  ? -27.355 -0.360  -6.602  1.00 1.09  ? 1520 ASN A CB   4  
ATOM 9624  C CG   . ASN A 1 13  ? -27.638 -0.793  -8.012  1.00 1.30  ? 1520 ASN A CG   4  
ATOM 9625  O OD1  . ASN A 1 13  ? -28.670 -1.380  -8.285  1.00 1.34  ? 1520 ASN A OD1  4  
ATOM 9626  N ND2  . ASN A 1 13  ? -26.788 -0.424  -8.911  1.00 1.74  ? 1520 ASN A ND2  4  
ATOM 9627  H H    . ASN A 1 13  ? -27.810 0.710   -4.304  1.00 0.78  ? 1520 ASN A H    4  
ATOM 9628  H HA   . ASN A 1 13  ? -27.142 1.743   -6.919  1.00 1.07  ? 1520 ASN A HA   4  
ATOM 9629  H HB2  . ASN A 1 13  ? -26.295 -0.456  -6.421  1.00 1.19  ? 1520 ASN A HB2  4  
ATOM 9630  H HB3  . ASN A 1 13  ? -27.895 -1.010  -5.929  1.00 1.10  ? 1520 ASN A HB3  4  
ATOM 9631  H HD21 . ASN A 1 13  ? -26.029 0.127   -8.606  1.00 2.02  ? 1520 ASN A HD21 4  
ATOM 9632  H HD22 . ASN A 1 13  ? -26.914 -0.723  -9.840  1.00 1.91  ? 1520 ASN A HD22 4  
ATOM 9633  N N    . PRO A 1 14  ? -29.477 2.282   -7.623  1.00 1.13  ? 1521 PRO A N    4  
ATOM 9634  C CA   . PRO A 1 14  ? -30.846 2.649   -8.014  1.00 1.26  ? 1521 PRO A CA   4  
ATOM 9635  C C    . PRO A 1 14  ? -31.508 1.621   -8.925  1.00 1.30  ? 1521 PRO A C    4  
ATOM 9636  O O    . PRO A 1 14  ? -32.708 1.693   -9.194  1.00 1.40  ? 1521 PRO A O    4  
ATOM 9637  C CB   . PRO A 1 14  ? -30.665 3.969   -8.748  1.00 1.47  ? 1521 PRO A CB   4  
ATOM 9638  C CG   . PRO A 1 14  ? -29.275 3.922   -9.274  1.00 1.58  ? 1521 PRO A CG   4  
ATOM 9639  C CD   . PRO A 1 14  ? -28.474 3.136   -8.284  1.00 1.30  ? 1521 PRO A CD   4  
ATOM 9640  H HA   . PRO A 1 14  ? -31.468 2.802   -7.146  1.00 1.25  ? 1521 PRO A HA   4  
ATOM 9641  H HB2  . PRO A 1 14  ? -31.390 4.039   -9.545  1.00 1.57  ? 1521 PRO A HB2  4  
ATOM 9642  H HB3  . PRO A 1 14  ? -30.797 4.791   -8.059  1.00 1.57  ? 1521 PRO A HB3  4  
ATOM 9643  H HG2  . PRO A 1 14  ? -29.264 3.433   -10.237 1.00 1.79  ? 1521 PRO A HG2  4  
ATOM 9644  H HG3  . PRO A 1 14  ? -28.884 4.925   -9.361  1.00 1.82  ? 1521 PRO A HG3  4  
ATOM 9645  H HD2  . PRO A 1 14  ? -27.736 2.533   -8.793  1.00 1.38  ? 1521 PRO A HD2  4  
ATOM 9646  H HD3  . PRO A 1 14  ? -27.997 3.790   -7.569  1.00 1.27  ? 1521 PRO A HD3  4  
ATOM 9647  N N    . SER A 1 15  ? -30.734 0.678   -9.398  1.00 1.30  ? 1522 SER A N    4  
ATOM 9648  C CA   . SER A 1 15  ? -31.241 -0.358  -10.243 1.00 1.40  ? 1522 SER A CA   4  
ATOM 9649  C C    . SER A 1 15  ? -32.058 -1.367  -9.423  1.00 1.36  ? 1522 SER A C    4  
ATOM 9650  O O    . SER A 1 15  ? -33.124 -1.826  -9.864  1.00 1.46  ? 1522 SER A O    4  
ATOM 9651  C CB   . SER A 1 15  ? -30.079 -1.033  -10.962 1.00 1.53  ? 1522 SER A CB   4  
ATOM 9652  O OG   . SER A 1 15  ? -29.302 -0.066  -11.674 1.00 1.65  ? 1522 SER A OG   4  
ATOM 9653  H H    . SER A 1 15  ? -29.778 0.681   -9.184  1.00 1.29  ? 1522 SER A H    4  
ATOM 9654  H HA   . SER A 1 15  ? -31.888 0.095   -10.977 1.00 1.48  ? 1522 SER A HA   4  
ATOM 9655  H HB2  . SER A 1 15  ? -29.449 -1.500  -10.219 1.00 1.50  ? 1522 SER A HB2  4  
ATOM 9656  H HB3  . SER A 1 15  ? -30.443 -1.787  -11.641 1.00 1.62  ? 1522 SER A HB3  4  
ATOM 9657  H HG   . SER A 1 15  ? -28.909 -0.513  -12.443 1.00 1.89  ? 1522 SER A HG   4  
ATOM 9658  N N    . THR A 1 16  ? -31.597 -1.677  -8.221  1.00 1.29  ? 1523 THR A N    4  
ATOM 9659  C CA   . THR A 1 16  ? -32.304 -2.631  -7.390  1.00 1.35  ? 1523 THR A CA   4  
ATOM 9660  C C    . THR A 1 16  ? -32.709 -2.028  -6.014  1.00 1.25  ? 1523 THR A C    4  
ATOM 9661  O O    . THR A 1 16  ? -33.482 -2.619  -5.271  1.00 1.36  ? 1523 THR A O    4  
ATOM 9662  C CB   . THR A 1 16  ? -31.495 -3.976  -7.264  1.00 1.47  ? 1523 THR A CB   4  
ATOM 9663  O OG1  . THR A 1 16  ? -32.186 -4.935  -6.457  1.00 1.61  ? 1523 THR A OG1  4  
ATOM 9664  C CG2  . THR A 1 16  ? -30.092 -3.750  -6.718  1.00 1.42  ? 1523 THR A CG2  4  
ATOM 9665  H H    . THR A 1 16  ? -30.749 -1.286  -7.911  1.00 1.25  ? 1523 THR A H    4  
ATOM 9666  H HA   . THR A 1 16  ? -33.232 -2.838  -7.905  1.00 1.46  ? 1523 THR A HA   4  
ATOM 9667  H HB   . THR A 1 16  ? -31.410 -4.405  -8.254  1.00 1.57  ? 1523 THR A HB   4  
ATOM 9668  H HG1  . THR A 1 16  ? -33.020 -5.097  -6.931  1.00 1.99  ? 1523 THR A HG1  4  
ATOM 9669  H HG21 . THR A 1 16  ? -29.593 -3.026  -7.348  1.00 1.81  ? 1523 THR A HG21 4  
ATOM 9670  H HG22 . THR A 1 16  ? -29.543 -4.681  -6.742  1.00 1.69  ? 1523 THR A HG22 4  
ATOM 9671  H HG23 . THR A 1 16  ? -30.142 -3.389  -5.704  1.00 1.70  ? 1523 THR A HG23 4  
ATOM 9672  N N    . GLY A 1 17  ? -32.197 -0.851  -5.708  1.00 1.13  ? 1524 GLY A N    4  
ATOM 9673  C CA   . GLY A 1 17  ? -32.554 -0.150  -4.480  1.00 1.08  ? 1524 GLY A CA   4  
ATOM 9674  C C    . GLY A 1 17  ? -31.801 -0.640  -3.262  1.00 0.99  ? 1524 GLY A C    4  
ATOM 9675  O O    . GLY A 1 17  ? -32.240 -0.430  -2.129  1.00 1.06  ? 1524 GLY A O    4  
ATOM 9676  H H    . GLY A 1 17  ? -31.554 -0.409  -6.305  1.00 1.11  ? 1524 GLY A H    4  
ATOM 9677  H HA2  . GLY A 1 17  ? -32.325 0.897   -4.616  1.00 1.06  ? 1524 GLY A HA2  4  
ATOM 9678  H HA3  . GLY A 1 17  ? -33.613 -0.239  -4.296  1.00 1.19  ? 1524 GLY A HA3  4  
ATOM 9679  N N    . HIS A 1 18  ? -30.659 -1.249  -3.479  1.00 0.91  ? 1525 HIS A N    4  
ATOM 9680  C CA   . HIS A 1 18  ? -29.887 -1.786  -2.372  1.00 0.85  ? 1525 HIS A CA   4  
ATOM 9681  C C    . HIS A 1 18  ? -28.857 -0.778  -1.898  1.00 0.72  ? 1525 HIS A C    4  
ATOM 9682  O O    . HIS A 1 18  ? -28.054 -0.274  -2.691  1.00 0.68  ? 1525 HIS A O    4  
ATOM 9683  C CB   . HIS A 1 18  ? -29.232 -3.143  -2.723  1.00 0.90  ? 1525 HIS A CB   4  
ATOM 9684  C CG   . HIS A 1 18  ? -28.468 -3.778  -1.575  1.00 0.91  ? 1525 HIS A CG   4  
ATOM 9685  N ND1  . HIS A 1 18  ? -27.274 -4.424  -1.737  1.00 1.12  ? 1525 HIS A ND1  4  
ATOM 9686  C CD2  . HIS A 1 18  ? -28.750 -3.854  -0.245  1.00 1.26  ? 1525 HIS A CD2  4  
ATOM 9687  C CE1  . HIS A 1 18  ? -26.847 -4.856  -0.568  1.00 1.05  ? 1525 HIS A CE1  4  
ATOM 9688  N NE2  . HIS A 1 18  ? -27.723 -4.526  0.349   1.00 1.12  ? 1525 HIS A NE2  4  
ATOM 9689  H H    . HIS A 1 18  ? -30.333 -1.302  -4.399  1.00 0.93  ? 1525 HIS A H    4  
ATOM 9690  H HA   . HIS A 1 18  ? -30.584 -1.938  -1.561  1.00 0.91  ? 1525 HIS A HA   4  
ATOM 9691  H HB2  . HIS A 1 18  ? -30.005 -3.838  -3.018  1.00 1.03  ? 1525 HIS A HB2  4  
ATOM 9692  H HB3  . HIS A 1 18  ? -28.546 -3.003  -3.545  1.00 0.89  ? 1525 HIS A HB3  4  
ATOM 9693  H HD1  . HIS A 1 18  ? -26.840 -4.645  -2.603  1.00 1.59  ? 1525 HIS A HD1  4  
ATOM 9694  H HD2  . HIS A 1 18  ? -29.626 -3.457  0.248   1.00 1.82  ? 1525 HIS A HD2  4  
ATOM 9695  H HE1  . HIS A 1 18  ? -25.924 -5.389  -0.394  1.00 1.33  ? 1525 HIS A HE1  4  
ATOM 9696  H HE2  . HIS A 1 18  ? -27.744 -4.918  1.255   1.00 1.40  ? 1525 HIS A HE2  4  
ATOM 9697  N N    . LEU A 1 19  ? -28.914 -0.492  -0.626  1.00 0.68  ? 1526 LEU A N    4  
ATOM 9698  C CA   . LEU A 1 19  ? -28.029 0.437   0.039   1.00 0.60  ? 1526 LEU A CA   4  
ATOM 9699  C C    . LEU A 1 19  ? -26.838 -0.328  0.658   1.00 0.54  ? 1526 LEU A C    4  
ATOM 9700  O O    . LEU A 1 19  ? -27.031 -1.210  1.504   1.00 0.57  ? 1526 LEU A O    4  
ATOM 9701  C CB   . LEU A 1 19  ? -28.863 1.209   1.128   1.00 0.66  ? 1526 LEU A CB   4  
ATOM 9702  C CG   . LEU A 1 19  ? -28.180 2.232   2.096   1.00 0.64  ? 1526 LEU A CG   4  
ATOM 9703  C CD1  . LEU A 1 19  ? -27.465 1.548   3.239   1.00 0.64  ? 1526 LEU A CD1  4  
ATOM 9704  C CD2  . LEU A 1 19  ? -27.221 3.161   1.391   1.00 0.64  ? 1526 LEU A CD2  4  
ATOM 9705  H H    . LEU A 1 19  ? -29.607 -0.934  -0.080  1.00 0.75  ? 1526 LEU A H    4  
ATOM 9706  H HA   . LEU A 1 19  ? -27.719 1.147   -0.714  1.00 0.58  ? 1526 LEU A HA   4  
ATOM 9707  H HB2  . LEU A 1 19  ? -29.655 1.740   0.622   1.00 0.71  ? 1526 LEU A HB2  4  
ATOM 9708  H HB3  . LEU A 1 19  ? -29.343 0.467   1.751   1.00 0.70  ? 1526 LEU A HB3  4  
ATOM 9709  H HG   . LEU A 1 19  ? -28.963 2.829   2.529   1.00 0.71  ? 1526 LEU A HG   4  
ATOM 9710  H HD11 . LEU A 1 19  ? -26.723 0.885   2.826   1.00 1.13  ? 1526 LEU A HD11 4  
ATOM 9711  H HD12 . LEU A 1 19  ? -28.177 0.986   3.824   1.00 1.25  ? 1526 LEU A HD12 4  
ATOM 9712  H HD13 . LEU A 1 19  ? -26.985 2.289   3.862   1.00 1.15  ? 1526 LEU A HD13 4  
ATOM 9713  H HD21 . LEU A 1 19  ? -27.027 3.996   2.048   1.00 1.12  ? 1526 LEU A HD21 4  
ATOM 9714  H HD22 . LEU A 1 19  ? -27.618 3.509   0.448   1.00 1.30  ? 1526 LEU A HD22 4  
ATOM 9715  H HD23 . LEU A 1 19  ? -26.296 2.625   1.257   1.00 1.16  ? 1526 LEU A HD23 4  
ATOM 9716  N N    . PHE A 1 20  ? -25.638 -0.053  0.189   1.00 0.47  ? 1527 PHE A N    4  
ATOM 9717  C CA   . PHE A 1 20  ? -24.441 -0.602  0.798   1.00 0.45  ? 1527 PHE A CA   4  
ATOM 9718  C C    . PHE A 1 20  ? -23.890 0.352   1.832   1.00 0.44  ? 1527 PHE A C    4  
ATOM 9719  O O    . PHE A 1 20  ? -23.530 1.478   1.506   1.00 0.48  ? 1527 PHE A O    4  
ATOM 9720  C CB   . PHE A 1 20  ? -23.333 -0.922  -0.215  1.00 0.43  ? 1527 PHE A CB   4  
ATOM 9721  C CG   . PHE A 1 20  ? -23.629 -2.033  -1.173  1.00 0.45  ? 1527 PHE A CG   4  
ATOM 9722  C CD1  . PHE A 1 20  ? -23.359 -3.351  -0.850  1.00 0.59  ? 1527 PHE A CD1  4  
ATOM 9723  C CD2  . PHE A 1 20  ? -24.199 -1.752  -2.398  1.00 0.44  ? 1527 PHE A CD2  4  
ATOM 9724  C CE1  . PHE A 1 20  ? -23.650 -4.358  -1.734  1.00 0.65  ? 1527 PHE A CE1  4  
ATOM 9725  C CE2  . PHE A 1 20  ? -24.493 -2.757  -3.285  1.00 0.49  ? 1527 PHE A CE2  4  
ATOM 9726  C CZ   . PHE A 1 20  ? -24.131 -4.108  -2.928  1.00 0.58  ? 1527 PHE A CZ   4  
ATOM 9727  H H    . PHE A 1 20  ? -25.537 0.519   -0.603  1.00 0.47  ? 1527 PHE A H    4  
ATOM 9728  H HA   . PHE A 1 20  ? -24.742 -1.505  1.298   1.00 0.49  ? 1527 PHE A HA   4  
ATOM 9729  H HB2  . PHE A 1 20  ? -23.034 -0.048  -0.773  1.00 0.42  ? 1527 PHE A HB2  4  
ATOM 9730  H HB3  . PHE A 1 20  ? -22.476 -1.227  0.365   1.00 0.48  ? 1527 PHE A HB3  4  
ATOM 9731  H HD1  . PHE A 1 20  ? -22.921 -3.597  0.105   1.00 0.70  ? 1527 PHE A HD1  4  
ATOM 9732  H HD2  . PHE A 1 20  ? -24.414 -0.725  -2.656  1.00 0.49  ? 1527 PHE A HD2  4  
ATOM 9733  H HE1  . PHE A 1 20  ? -23.434 -5.384  -1.470  1.00 0.80  ? 1527 PHE A HE1  4  
ATOM 9734  H HE2  . PHE A 1 20  ? -24.939 -2.523  -4.240  1.00 0.55  ? 1527 PHE A HE2  4  
ATOM 9735  H HZ   . PHE A 1 20  ? -24.330 -4.920  -3.611  1.00 0.66  ? 1527 PHE A HZ   4  
ATOM 9736  N N    . ASP A 1 21  ? -23.829 -0.100  3.056   1.00 0.44  ? 1528 ASP A N    4  
ATOM 9737  C CA   . ASP A 1 21  ? -23.285 0.683   4.152   1.00 0.48  ? 1528 ASP A CA   4  
ATOM 9738  C C    . ASP A 1 21  ? -21.909 0.174   4.486   1.00 0.41  ? 1528 ASP A C    4  
ATOM 9739  O O    . ASP A 1 21  ? -21.761 -0.946  4.983   1.00 0.46  ? 1528 ASP A O    4  
ATOM 9740  C CB   . ASP A 1 21  ? -24.178 0.593   5.399   1.00 0.64  ? 1528 ASP A CB   4  
ATOM 9741  C CG   . ASP A 1 21  ? -23.573 1.296   6.607   1.00 0.81  ? 1528 ASP A CG   4  
ATOM 9742  O OD1  . ASP A 1 21  ? -23.785 2.513   6.767   1.00 1.17  ? 1528 ASP A OD1  4  
ATOM 9743  O OD2  . ASP A 1 21  ? -22.870 0.639   7.417   1.00 0.81  ? 1528 ASP A OD2  4  
ATOM 9744  H H    . ASP A 1 21  ? -24.151 -1.012  3.239   1.00 0.47  ? 1528 ASP A H    4  
ATOM 9745  H HA   . ASP A 1 21  ? -23.219 1.714   3.836   1.00 0.51  ? 1528 ASP A HA   4  
ATOM 9746  H HB2  . ASP A 1 21  ? -25.130 1.061   5.184   1.00 0.81  ? 1528 ASP A HB2  4  
ATOM 9747  H HB3  . ASP A 1 21  ? -24.317 -0.452  5.648   1.00 0.70  ? 1528 ASP A HB3  4  
ATOM 9748  N N    . LEU A 1 22  ? -20.900 0.958   4.199   1.00 0.38  ? 1529 LEU A N    4  
ATOM 9749  C CA   . LEU A 1 22  ? -19.549 0.560   4.489   1.00 0.36  ? 1529 LEU A CA   4  
ATOM 9750  C C    . LEU A 1 22  ? -19.087 1.201   5.780   1.00 0.40  ? 1529 LEU A C    4  
ATOM 9751  O O    . LEU A 1 22  ? -17.950 1.005   6.224   1.00 0.41  ? 1529 LEU A O    4  
ATOM 9752  C CB   . LEU A 1 22  ? -18.606 0.914   3.333   1.00 0.39  ? 1529 LEU A CB   4  
ATOM 9753  C CG   . LEU A 1 22  ? -18.708 0.082   2.036   1.00 0.40  ? 1529 LEU A CG   4  
ATOM 9754  C CD1  . LEU A 1 22  ? -18.441 -1.384  2.295   1.00 0.52  ? 1529 LEU A CD1  4  
ATOM 9755  C CD2  . LEU A 1 22  ? -20.027 0.262   1.287   1.00 0.60  ? 1529 LEU A CD2  4  
ATOM 9756  H H    . LEU A 1 22  ? -21.019 1.836   3.769   1.00 0.42  ? 1529 LEU A H    4  
ATOM 9757  H HA   . LEU A 1 22  ? -19.548 -0.511  4.624   1.00 0.36  ? 1529 LEU A HA   4  
ATOM 9758  H HB2  . LEU A 1 22  ? -18.779 1.947   3.073   1.00 0.44  ? 1529 LEU A HB2  4  
ATOM 9759  H HB3  . LEU A 1 22  ? -17.594 0.831   3.702   1.00 0.42  ? 1529 LEU A HB3  4  
ATOM 9760  H HG   . LEU A 1 22  ? -17.916 0.463   1.413   1.00 0.70  ? 1529 LEU A HG   4  
ATOM 9761  H HD11 . LEU A 1 22  ? -17.447 -1.497  2.704   1.00 1.20  ? 1529 LEU A HD11 4  
ATOM 9762  H HD12 . LEU A 1 22  ? -18.512 -1.925  1.364   1.00 1.15  ? 1529 LEU A HD12 4  
ATOM 9763  H HD13 . LEU A 1 22  ? -19.167 -1.769  2.996   1.00 1.15  ? 1529 LEU A HD13 4  
ATOM 9764  H HD21 . LEU A 1 22  ? -19.975 -0.325  0.383   1.00 1.29  ? 1529 LEU A HD21 4  
ATOM 9765  H HD22 . LEU A 1 22  ? -20.178 1.297   1.020   1.00 1.20  ? 1529 LEU A HD22 4  
ATOM 9766  H HD23 . LEU A 1 22  ? -20.849 -0.108  1.884   1.00 1.18  ? 1529 LEU A HD23 4  
ATOM 9767  N N    . SER A 1 23  ? -20.001 1.922   6.405   1.00 0.48  ? 1530 SER A N    4  
ATOM 9768  C CA   . SER A 1 23  ? -19.741 2.620   7.658   1.00 0.57  ? 1530 SER A CA   4  
ATOM 9769  C C    . SER A 1 23  ? -19.443 1.593   8.760   1.00 0.56  ? 1530 SER A C    4  
ATOM 9770  O O    . SER A 1 23  ? -18.677 1.849   9.689   1.00 0.60  ? 1530 SER A O    4  
ATOM 9771  C CB   . SER A 1 23  ? -20.962 3.454   8.037   1.00 0.71  ? 1530 SER A CB   4  
ATOM 9772  O OG   . SER A 1 23  ? -21.600 3.956   6.857   1.00 0.84  ? 1530 SER A OG   4  
ATOM 9773  H H    . SER A 1 23  ? -20.887 1.989   5.992   1.00 0.52  ? 1530 SER A H    4  
ATOM 9774  H HA   . SER A 1 23  ? -18.887 3.267   7.523   1.00 0.59  ? 1530 SER A HA   4  
ATOM 9775  H HB2  . SER A 1 23  ? -21.660 2.882   8.633   1.00 0.72  ? 1530 SER A HB2  4  
ATOM 9776  H HB3  . SER A 1 23  ? -20.632 4.300   8.622   1.00 0.82  ? 1530 SER A HB3  4  
ATOM 9777  H HG   . SER A 1 23  ? -22.451 3.482   6.807   1.00 0.91  ? 1530 SER A HG   4  
ATOM 9778  N N    . SER A 1 24  ? -20.035 0.421   8.613   1.00 0.58  ? 1531 SER A N    4  
ATOM 9779  C CA   . SER A 1 24  ? -19.851 -0.685  9.528   1.00 0.65  ? 1531 SER A CA   4  
ATOM 9780  C C    . SER A 1 24  ? -18.376 -1.134  9.542   1.00 0.61  ? 1531 SER A C    4  
ATOM 9781  O O    . SER A 1 24  ? -17.839 -1.544  10.578  1.00 0.71  ? 1531 SER A O    4  
ATOM 9782  C CB   . SER A 1 24  ? -20.758 -1.847  9.090   1.00 0.73  ? 1531 SER A CB   4  
ATOM 9783  O OG   . SER A 1 24  ? -20.763 -2.913  10.026  1.00 1.59  ? 1531 SER A OG   4  
ATOM 9784  H H    . SER A 1 24  ? -20.658 0.315   7.860   1.00 0.60  ? 1531 SER A H    4  
ATOM 9785  H HA   . SER A 1 24  ? -20.143 -0.368  10.517  1.00 0.73  ? 1531 SER A HA   4  
ATOM 9786  H HB2  . SER A 1 24  ? -21.768 -1.482  8.978   1.00 1.24  ? 1531 SER A HB2  4  
ATOM 9787  H HB3  . SER A 1 24  ? -20.412 -2.220  8.137   1.00 1.07  ? 1531 SER A HB3  4  
ATOM 9788  H HG   . SER A 1 24  ? -21.644 -2.897  10.431  1.00 1.98  ? 1531 SER A HG   4  
ATOM 9789  N N    . LEU A 1 25  ? -17.717 -1.004  8.410   1.00 0.54  ? 1532 LEU A N    4  
ATOM 9790  C CA   . LEU A 1 25  ? -16.349 -1.462  8.270   1.00 0.56  ? 1532 LEU A CA   4  
ATOM 9791  C C    . LEU A 1 25  ? -15.372 -0.324  8.486   1.00 0.57  ? 1532 LEU A C    4  
ATOM 9792  O O    . LEU A 1 25  ? -14.175 -0.507  8.398   1.00 0.61  ? 1532 LEU A O    4  
ATOM 9793  C CB   . LEU A 1 25  ? -16.141 -2.068  6.885   1.00 0.56  ? 1532 LEU A CB   4  
ATOM 9794  C CG   . LEU A 1 25  ? -17.031 -3.258  6.525   1.00 0.55  ? 1532 LEU A CG   4  
ATOM 9795  C CD1  . LEU A 1 25  ? -16.811 -3.647  5.083   1.00 0.57  ? 1532 LEU A CD1  4  
ATOM 9796  C CD2  . LEU A 1 25  ? -16.747 -4.447  7.437   1.00 0.65  ? 1532 LEU A CD2  4  
ATOM 9797  H H    . LEU A 1 25  ? -18.144 -0.570  7.642   1.00 0.54  ? 1532 LEU A H    4  
ATOM 9798  H HA   . LEU A 1 25  ? -16.169 -2.222  9.012   1.00 0.61  ? 1532 LEU A HA   4  
ATOM 9799  H HB2  . LEU A 1 25  ? -16.310 -1.292  6.153   1.00 0.55  ? 1532 LEU A HB2  4  
ATOM 9800  H HB3  . LEU A 1 25  ? -15.112 -2.385  6.809   1.00 0.62  ? 1532 LEU A HB3  4  
ATOM 9801  H HG   . LEU A 1 25  ? -18.064 -2.970  6.650   1.00 0.55  ? 1532 LEU A HG   4  
ATOM 9802  H HD11 . LEU A 1 25  ? -17.068 -2.804  4.457   1.00 1.19  ? 1532 LEU A HD11 4  
ATOM 9803  H HD12 . LEU A 1 25  ? -17.428 -4.496  4.829   1.00 1.08  ? 1532 LEU A HD12 4  
ATOM 9804  H HD13 . LEU A 1 25  ? -15.770 -3.892  4.939   1.00 1.24  ? 1532 LEU A HD13 4  
ATOM 9805  H HD21 . LEU A 1 25  ? -17.339 -5.291  7.118   1.00 1.34  ? 1532 LEU A HD21 4  
ATOM 9806  H HD22 . LEU A 1 25  ? -17.012 -4.196  8.454   1.00 1.14  ? 1532 LEU A HD22 4  
ATOM 9807  H HD23 . LEU A 1 25  ? -15.698 -4.697  7.384   1.00 1.16  ? 1532 LEU A HD23 4  
ATOM 9808  N N    . SER A 1 26  ? -15.892 0.838   8.781   1.00 0.58  ? 1533 SER A N    4  
ATOM 9809  C CA   . SER A 1 26  ? -15.069 2.007   8.965   1.00 0.62  ? 1533 SER A CA   4  
ATOM 9810  C C    . SER A 1 26  ? -14.326 1.982   10.312  1.00 0.68  ? 1533 SER A C    4  
ATOM 9811  O O    . SER A 1 26  ? -14.692 1.225   11.245  1.00 0.75  ? 1533 SER A O    4  
ATOM 9812  C CB   . SER A 1 26  ? -15.930 3.254   8.859   1.00 0.68  ? 1533 SER A CB   4  
ATOM 9813  O OG   . SER A 1 26  ? -16.682 3.234   7.654   1.00 1.52  ? 1533 SER A OG   4  
ATOM 9814  H H    . SER A 1 26  ? -16.862 0.910   8.892   1.00 0.59  ? 1533 SER A H    4  
ATOM 9815  H HA   . SER A 1 26  ? -14.340 2.031   8.169   1.00 0.65  ? 1533 SER A HA   4  
ATOM 9816  H HB2  . SER A 1 26  ? -16.595 3.300   9.707   1.00 1.19  ? 1533 SER A HB2  4  
ATOM 9817  H HB3  . SER A 1 26  ? -15.291 4.125   8.857   1.00 1.19  ? 1533 SER A HB3  4  
ATOM 9818  H HG   . SER A 1 26  ? -16.478 2.435   7.155   1.00 1.93  ? 1533 SER A HG   4  
ATOM 9819  N N    . GLY A 1 27  ? -13.293 2.782   10.404  1.00 0.76  ? 1534 GLY A N    4  
ATOM 9820  C CA   . GLY A 1 27  ? -12.537 2.884   11.612  1.00 0.89  ? 1534 GLY A CA   4  
ATOM 9821  C C    . GLY A 1 27  ? -11.425 3.888   11.484  1.00 0.95  ? 1534 GLY A C    4  
ATOM 9822  O O    . GLY A 1 27  ? -10.785 3.980   10.440  1.00 1.10  ? 1534 GLY A O    4  
ATOM 9823  H H    . GLY A 1 27  ? -13.028 3.320   9.625   1.00 0.79  ? 1534 GLY A H    4  
ATOM 9824  H HA2  . GLY A 1 27  ? -13.214 3.247   12.380  1.00 0.92  ? 1534 GLY A HA2  4  
ATOM 9825  H HA3  . GLY A 1 27  ? -12.105 1.920   11.859  1.00 1.07  ? 1534 GLY A HA3  4  
ATOM 9826  N N    . ARG A 1 28  ? -11.226 4.646   12.534  1.00 1.07  ? 1535 ARG A N    4  
ATOM 9827  C CA   . ARG A 1 28  ? -10.199 5.684   12.597  1.00 1.36  ? 1535 ARG A CA   4  
ATOM 9828  C C    . ARG A 1 28  ? -8.907  5.088   13.212  1.00 1.25  ? 1535 ARG A C    4  
ATOM 9829  O O    . ARG A 1 28  ? -7.794  5.506   12.882  1.00 1.46  ? 1535 ARG A O    4  
ATOM 9830  C CB   . ARG A 1 28  ? -10.749 6.889   13.423  1.00 1.78  ? 1535 ARG A CB   4  
ATOM 9831  C CG   . ARG A 1 28  ? -10.033 8.246   13.239  1.00 2.21  ? 1535 ARG A CG   4  
ATOM 9832  C CD   . ARG A 1 28  ? -8.640  8.293   13.889  1.00 2.72  ? 1535 ARG A CD   4  
ATOM 9833  N NE   . ARG A 1 28  ? -7.913  9.584   13.699  1.00 3.19  ? 1535 ARG A NE   4  
ATOM 9834  C CZ   . ARG A 1 28  ? -7.053  10.112  14.593  1.00 3.82  ? 1535 ARG A CZ   4  
ATOM 9835  N NH1  . ARG A 1 28  ? -7.034  9.673   15.848  1.00 4.05  ? 1535 ARG A NH1  4  
ATOM 9836  N NH2  . ARG A 1 28  ? -6.295  11.134  14.257  1.00 4.62  ? 1535 ARG A NH2  4  
ATOM 9837  H H    . ARG A 1 28  ? -11.803 4.471   13.311  1.00 1.11  ? 1535 ARG A H    4  
ATOM 9838  H HA   . ARG A 1 28  ? -9.990  6.005   11.587  1.00 1.48  ? 1535 ARG A HA   4  
ATOM 9839  H HB2  . ARG A 1 28  ? -11.786 7.036   13.160  1.00 1.87  ? 1535 ARG A HB2  4  
ATOM 9840  H HB3  . ARG A 1 28  ? -10.702 6.624   14.469  1.00 1.80  ? 1535 ARG A HB3  4  
ATOM 9841  H HG2  . ARG A 1 28  ? -9.958  8.404   12.173  1.00 2.48  ? 1535 ARG A HG2  4  
ATOM 9842  H HG3  . ARG A 1 28  ? -10.670 9.006   13.668  1.00 2.35  ? 1535 ARG A HG3  4  
ATOM 9843  H HD2  . ARG A 1 28  ? -8.755  8.122   14.950  1.00 3.08  ? 1535 ARG A HD2  4  
ATOM 9844  H HD3  . ARG A 1 28  ? -8.046  7.494   13.471  1.00 3.09  ? 1535 ARG A HD3  4  
ATOM 9845  H HE   . ARG A 1 28  ? -8.008  10.018  12.822  1.00 3.43  ? 1535 ARG A HE   4  
ATOM 9846  H HH11 . ARG A 1 28  ? -7.668  8.957   16.169  1.00 3.88  ? 1535 ARG A HH11 4  
ATOM 9847  H HH12 . ARG A 1 28  ? -6.381  10.011  16.542  1.00 4.70  ? 1535 ARG A HH12 4  
ATOM 9848  H HH21 . ARG A 1 28  ? -6.334  11.564  13.346  1.00 4.90  ? 1535 ARG A HH21 4  
ATOM 9849  H HH22 . ARG A 1 28  ? -5.611  11.520  14.888  1.00 5.21  ? 1535 ARG A HH22 4  
ATOM 9850  N N    . ALA A 1 29  ? -9.067  4.098   14.098  1.00 1.08  ? 1536 ALA A N    4  
ATOM 9851  C CA   . ALA A 1 29  ? -7.915  3.449   14.730  1.00 1.24  ? 1536 ALA A CA   4  
ATOM 9852  C C    . ALA A 1 29  ? -7.217  2.554   13.724  1.00 1.01  ? 1536 ALA A C    4  
ATOM 9853  O O    . ALA A 1 29  ? -5.993  2.373   13.757  1.00 1.27  ? 1536 ALA A O    4  
ATOM 9854  C CB   . ALA A 1 29  ? -8.324  2.656   15.968  1.00 1.45  ? 1536 ALA A CB   4  
ATOM 9855  H H    . ALA A 1 29  ? -9.969  3.789   14.326  1.00 1.01  ? 1536 ALA A H    4  
ATOM 9856  H HA   . ALA A 1 29  ? -7.227  4.229   15.020  1.00 1.60  ? 1536 ALA A HA   4  
ATOM 9857  H HB1  . ALA A 1 29  ? -8.824  3.308   16.669  1.00 1.84  ? 1536 ALA A HB1  4  
ATOM 9858  H HB2  . ALA A 1 29  ? -7.441  2.245   16.435  1.00 1.94  ? 1536 ALA A HB2  4  
ATOM 9859  H HB3  . ALA A 1 29  ? -8.986  1.851   15.685  1.00 1.68  ? 1536 ALA A HB3  4  
ATOM 9860  N N    . GLY A 1 30  ? -8.001  1.971   12.856  1.00 0.74  ? 1537 GLY A N    4  
ATOM 9861  C CA   . GLY A 1 30  ? -7.463  1.239   11.768  1.00 0.84  ? 1537 GLY A CA   4  
ATOM 9862  C C    . GLY A 1 30  ? -7.593  -0.244  11.924  1.00 0.72  ? 1537 GLY A C    4  
ATOM 9863  O O    . GLY A 1 30  ? -8.184  -0.737  12.898  1.00 0.85  ? 1537 GLY A O    4  
ATOM 9864  H H    . GLY A 1 30  ? -8.974  2.008   12.998  1.00 0.70  ? 1537 GLY A H    4  
ATOM 9865  H HA2  . GLY A 1 30  ? -7.976  1.537   10.864  1.00 1.02  ? 1537 GLY A HA2  4  
ATOM 9866  H HA3  . GLY A 1 30  ? -6.417  1.487   11.668  1.00 1.08  ? 1537 GLY A HA3  4  
ATOM 9867  N N    . PHE A 1 31  ? -7.062  -0.945  10.965  1.00 0.52  ? 1538 PHE A N    4  
ATOM 9868  C CA   . PHE A 1 31  ? -7.046  -2.383  10.923  1.00 0.49  ? 1538 PHE A CA   4  
ATOM 9869  C C    . PHE A 1 31  ? -5.674  -2.794  10.436  1.00 0.46  ? 1538 PHE A C    4  
ATOM 9870  O O    . PHE A 1 31  ? -5.070  -2.071  9.626   1.00 0.43  ? 1538 PHE A O    4  
ATOM 9871  C CB   . PHE A 1 31  ? -8.122  -2.920  9.943   1.00 0.54  ? 1538 PHE A CB   4  
ATOM 9872  C CG   . PHE A 1 31  ? -9.547  -2.545  10.293  1.00 0.65  ? 1538 PHE A CG   4  
ATOM 9873  C CD1  . PHE A 1 31  ? -10.266 -3.293  11.210  1.00 0.80  ? 1538 PHE A CD1  4  
ATOM 9874  C CD2  . PHE A 1 31  ? -10.162 -1.442  9.706   1.00 0.68  ? 1538 PHE A CD2  4  
ATOM 9875  C CE1  . PHE A 1 31  ? -11.566 -2.954  11.536  1.00 0.93  ? 1538 PHE A CE1  4  
ATOM 9876  C CE2  . PHE A 1 31  ? -11.457 -1.100  10.032  1.00 0.82  ? 1538 PHE A CE2  4  
ATOM 9877  C CZ   . PHE A 1 31  ? -12.160 -1.855  10.947  1.00 0.93  ? 1538 PHE A CZ   4  
ATOM 9878  H H    . PHE A 1 31  ? -6.645  -0.471  10.211  1.00 0.45  ? 1538 PHE A H    4  
ATOM 9879  H HA   . PHE A 1 31  ? -7.223  -2.773  11.914  1.00 0.52  ? 1538 PHE A HA   4  
ATOM 9880  H HB2  . PHE A 1 31  ? -7.917  -2.534  8.955   1.00 0.55  ? 1538 PHE A HB2  4  
ATOM 9881  H HB3  . PHE A 1 31  ? -8.058  -3.998  9.915   1.00 0.56  ? 1538 PHE A HB3  4  
ATOM 9882  H HD1  . PHE A 1 31  ? -9.804  -4.152  11.674  1.00 0.85  ? 1538 PHE A HD1  4  
ATOM 9883  H HD2  . PHE A 1 31  ? -9.626  -0.842  8.986   1.00 0.66  ? 1538 PHE A HD2  4  
ATOM 9884  H HE1  . PHE A 1 31  ? -12.115 -3.546  12.254  1.00 1.07  ? 1538 PHE A HE1  4  
ATOM 9885  H HE2  . PHE A 1 31  ? -11.921 -0.241  9.570   1.00 0.88  ? 1538 PHE A HE2  4  
ATOM 9886  H HZ   . PHE A 1 31  ? -13.175 -1.588  11.203  1.00 1.05  ? 1538 PHE A HZ   4  
ATOM 9887  N N    . THR A 1 32  ? -5.176  -3.896  10.930  1.00 0.50  ? 1539 THR A N    4  
ATOM 9888  C CA   . THR A 1 32  ? -3.886  -4.397  10.532  1.00 0.50  ? 1539 THR A CA   4  
ATOM 9889  C C    . THR A 1 32  ? -4.040  -5.546  9.560   1.00 0.51  ? 1539 THR A C    4  
ATOM 9890  O O    . THR A 1 32  ? -4.738  -6.527  9.839   1.00 0.64  ? 1539 THR A O    4  
ATOM 9891  C CB   . THR A 1 32  ? -3.016  -4.835  11.745  1.00 0.58  ? 1539 THR A CB   4  
ATOM 9892  O OG1  . THR A 1 32  ? -3.755  -5.679  12.652  1.00 1.03  ? 1539 THR A OG1  4  
ATOM 9893  C CG2  . THR A 1 32  ? -2.445  -3.647  12.492  1.00 0.78  ? 1539 THR A CG2  4  
ATOM 9894  H H    . THR A 1 32  ? -5.710  -4.415  11.576  1.00 0.56  ? 1539 THR A H    4  
ATOM 9895  H HA   . THR A 1 32  ? -3.369  -3.606  10.010  1.00 0.46  ? 1539 THR A HA   4  
ATOM 9896  H HB   . THR A 1 32  ? -2.198  -5.421  11.351  1.00 0.77  ? 1539 THR A HB   4  
ATOM 9897  H HG1  . THR A 1 32  ? -4.685  -5.407  12.658  1.00 1.46  ? 1539 THR A HG1  4  
ATOM 9898  H HG21 . THR A 1 32  ? -1.889  -4.014  13.343  1.00 1.42  ? 1539 THR A HG21 4  
ATOM 9899  H HG22 . THR A 1 32  ? -3.239  -2.998  12.827  1.00 1.32  ? 1539 THR A HG22 4  
ATOM 9900  H HG23 . THR A 1 32  ? -1.767  -3.113  11.841  1.00 1.30  ? 1539 THR A HG23 4  
ATOM 9901  N N    . ALA A 1 33  ? -3.432  -5.415  8.419   1.00 0.44  ? 1540 ALA A N    4  
ATOM 9902  C CA   . ALA A 1 33  ? -3.473  -6.453  7.423   1.00 0.47  ? 1540 ALA A CA   4  
ATOM 9903  C C    . ALA A 1 33  ? -2.073  -6.960  7.181   1.00 0.50  ? 1540 ALA A C    4  
ATOM 9904  O O    . ALA A 1 33  ? -1.129  -6.159  7.072   1.00 0.49  ? 1540 ALA A O    4  
ATOM 9905  C CB   . ALA A 1 33  ? -4.094  -5.941  6.138   1.00 0.46  ? 1540 ALA A CB   4  
ATOM 9906  H H    . ALA A 1 33  ? -2.922  -4.594  8.242   1.00 0.41  ? 1540 ALA A H    4  
ATOM 9907  H HA   . ALA A 1 33  ? -4.079  -7.260  7.808   1.00 0.53  ? 1540 ALA A HA   4  
ATOM 9908  H HB1  . ALA A 1 33  ? -3.496  -5.131  5.746   1.00 1.12  ? 1540 ALA A HB1  4  
ATOM 9909  H HB2  . ALA A 1 33  ? -5.096  -5.588  6.335   1.00 1.02  ? 1540 ALA A HB2  4  
ATOM 9910  H HB3  . ALA A 1 33  ? -4.133  -6.740  5.413   1.00 1.19  ? 1540 ALA A HB3  4  
ATOM 9911  N N    . ALA A 1 34  ? -1.931  -8.265  7.125   1.00 0.57  ? 1541 ALA A N    4  
ATOM 9912  C CA   . ALA A 1 34  ? -0.646  -8.885  6.934   1.00 0.63  ? 1541 ALA A CA   4  
ATOM 9913  C C    . ALA A 1 34  ? -0.338  -9.034  5.462   1.00 0.63  ? 1541 ALA A C    4  
ATOM 9914  O O    . ALA A 1 34  ? -1.125  -9.621  4.694   1.00 0.70  ? 1541 ALA A O    4  
ATOM 9915  C CB   . ALA A 1 34  ? -0.591  -10.227 7.630   1.00 0.74  ? 1541 ALA A CB   4  
ATOM 9916  H H    . ALA A 1 34  ? -2.721  -8.845  7.205   1.00 0.61  ? 1541 ALA A H    4  
ATOM 9917  H HA   . ALA A 1 34  ? 0.102   -8.242  7.376   1.00 0.64  ? 1541 ALA A HA   4  
ATOM 9918  H HB1  . ALA A 1 34  ? 0.394   -10.654 7.517   1.00 1.37  ? 1541 ALA A HB1  4  
ATOM 9919  H HB2  . ALA A 1 34  ? -1.324  -10.888 7.192   1.00 1.19  ? 1541 ALA A HB2  4  
ATOM 9920  H HB3  . ALA A 1 34  ? -0.809  -10.096 8.681   1.00 1.25  ? 1541 ALA A HB3  4  
ATOM 9921  N N    . TYR A 1 35  ? 0.776   -8.499  5.074   1.00 0.66  ? 1542 TYR A N    4  
ATOM 9922  C CA   . TYR A 1 35  ? 1.233   -8.526  3.719   1.00 0.71  ? 1542 TYR A CA   4  
ATOM 9923  C C    . TYR A 1 35  ? 2.622   -9.168  3.656   1.00 0.84  ? 1542 TYR A C    4  
ATOM 9924  O O    . TYR A 1 35  ? 2.732   -10.391 3.690   1.00 0.96  ? 1542 TYR A O    4  
ATOM 9925  C CB   . TYR A 1 35  ? 1.145   -7.114  3.100   1.00 0.68  ? 1542 TYR A CB   4  
ATOM 9926  C CG   . TYR A 1 35  ? 1.727   -6.913  1.709   1.00 0.63  ? 1542 TYR A CG   4  
ATOM 9927  C CD1  . TYR A 1 35  ? 1.889   -7.950  0.791   1.00 0.99  ? 1542 TYR A CD1  4  
ATOM 9928  C CD2  . TYR A 1 35  ? 2.116   -5.659  1.339   1.00 0.62  ? 1542 TYR A CD2  4  
ATOM 9929  C CE1  . TYR A 1 35  ? 2.439   -7.709  -0.459  1.00 0.97  ? 1542 TYR A CE1  4  
ATOM 9930  C CE2  . TYR A 1 35  ? 2.652   -5.395  0.109   1.00 0.66  ? 1542 TYR A CE2  4  
ATOM 9931  C CZ   . TYR A 1 35  ? 2.819   -6.425  -0.797  1.00 0.63  ? 1542 TYR A CZ   4  
ATOM 9932  O OH   . TYR A 1 35  ? 3.371   -6.176  -2.040  1.00 0.71  ? 1542 TYR A OH   4  
ATOM 9933  H H    . TYR A 1 35  ? 1.346   -8.050  5.739   1.00 0.71  ? 1542 TYR A H    4  
ATOM 9934  H HA   . TYR A 1 35  ? 0.559   -9.185  3.190   1.00 0.75  ? 1542 TYR A HA   4  
ATOM 9935  H HB2  . TYR A 1 35  ? 0.106   -6.831  3.042   1.00 0.74  ? 1542 TYR A HB2  4  
ATOM 9936  H HB3  . TYR A 1 35  ? 1.643   -6.427  3.769   1.00 0.74  ? 1542 TYR A HB3  4  
ATOM 9937  H HD1  . TYR A 1 35  ? 1.584   -8.947  1.075   1.00 1.38  ? 1542 TYR A HD1  4  
ATOM 9938  H HD2  . TYR A 1 35  ? 1.977   -4.869  2.064   1.00 0.88  ? 1542 TYR A HD2  4  
ATOM 9939  H HE1  . TYR A 1 35  ? 2.562   -8.511  -1.169  1.00 1.33  ? 1542 TYR A HE1  4  
ATOM 9940  H HE2  . TYR A 1 35  ? 2.923   -4.372  -0.108  1.00 0.96  ? 1542 TYR A HE2  4  
ATOM 9941  H HH   . TYR A 1 35  ? 4.139   -5.606  -1.922  1.00 1.19  ? 1542 TYR A HH   4  
ATOM 9942  N N    . SER A 1 36  ? 3.658   -8.357  3.545   1.00 0.90  ? 1543 SER A N    4  
ATOM 9943  C CA   . SER A 1 36  ? 5.020   -8.830  3.522   1.00 1.10  ? 1543 SER A CA   4  
ATOM 9944  C C    . SER A 1 36  ? 5.350   -9.515  4.856   1.00 1.18  ? 1543 SER A C    4  
ATOM 9945  O O    . SER A 1 36  ? 4.652   -9.256  5.848   1.00 1.13  ? 1543 SER A O    4  
ATOM 9946  C CB   . SER A 1 36  ? 5.936   -7.631  3.303   1.00 1.19  ? 1543 SER A CB   4  
ATOM 9947  O OG   . SER A 1 36  ? 5.495   -6.870  2.185   1.00 1.91  ? 1543 SER A OG   4  
ATOM 9948  H H    . SER A 1 36  ? 3.523   -7.391  3.460   1.00 0.88  ? 1543 SER A H    4  
ATOM 9949  H HA   . SER A 1 36  ? 5.146   -9.525  2.703   1.00 1.20  ? 1543 SER A HA   4  
ATOM 9950  H HB2  . SER A 1 36  ? 5.920   -7.003  4.182   1.00 1.38  ? 1543 SER A HB2  4  
ATOM 9951  H HB3  . SER A 1 36  ? 6.943   -7.974  3.115   1.00 1.60  ? 1543 SER A HB3  4  
ATOM 9952  H HG   . SER A 1 36  ? 6.272   -6.637  1.658   1.00 1.98  ? 1543 SER A HG   4  
ATOM 9953  N N    . LYS A 1 37  ? 6.380   -10.363 4.902   1.00 1.37  ? 1544 LYS A N    4  
ATOM 9954  C CA   . LYS A 1 37  ? 6.692   -11.120 6.125   1.00 1.50  ? 1544 LYS A CA   4  
ATOM 9955  C C    . LYS A 1 37  ? 6.774   -10.224 7.383   1.00 1.51  ? 1544 LYS A C    4  
ATOM 9956  O O    . LYS A 1 37  ? 6.240   -10.573 8.437   1.00 1.71  ? 1544 LYS A O    4  
ATOM 9957  C CB   . LYS A 1 37  ? 7.954   -11.985 5.951   1.00 1.70  ? 1544 LYS A CB   4  
ATOM 9958  C CG   . LYS A 1 37  ? 8.333   -12.743 7.206   1.00 2.05  ? 1544 LYS A CG   4  
ATOM 9959  C CD   . LYS A 1 37  ? 9.496   -13.677 6.987   1.00 2.36  ? 1544 LYS A CD   4  
ATOM 9960  C CE   . LYS A 1 37  ? 9.825   -14.424 8.269   1.00 2.99  ? 1544 LYS A CE   4  
ATOM 9961  N NZ   . LYS A 1 37  ? 8.662   -15.187 8.780   1.00 3.59  ? 1544 LYS A NZ   4  
ATOM 9962  H H    . LYS A 1 37  ? 6.931   -10.498 4.099   1.00 1.46  ? 1544 LYS A H    4  
ATOM 9963  H HA   . LYS A 1 37  ? 5.848   -11.777 6.279   1.00 1.56  ? 1544 LYS A HA   4  
ATOM 9964  H HB2  . LYS A 1 37  ? 7.761   -12.710 5.174   1.00 1.89  ? 1544 LYS A HB2  4  
ATOM 9965  H HB3  . LYS A 1 37  ? 8.794   -11.377 5.651   1.00 2.12  ? 1544 LYS A HB3  4  
ATOM 9966  H HG2  . LYS A 1 37  ? 8.601   -12.034 7.975   1.00 2.58  ? 1544 LYS A HG2  4  
ATOM 9967  H HG3  . LYS A 1 37  ? 7.477   -13.316 7.532   1.00 2.43  ? 1544 LYS A HG3  4  
ATOM 9968  H HD2  . LYS A 1 37  ? 9.239   -14.389 6.218   1.00 2.45  ? 1544 LYS A HD2  4  
ATOM 9969  H HD3  . LYS A 1 37  ? 10.359  -13.104 6.682   1.00 2.83  ? 1544 LYS A HD3  4  
ATOM 9970  H HE2  . LYS A 1 37  ? 10.634  -15.112 8.073   1.00 3.22  ? 1544 LYS A HE2  4  
ATOM 9971  H HE3  . LYS A 1 37  ? 10.135  -13.710 9.017   1.00 3.43  ? 1544 LYS A HE3  4  
ATOM 9972  H HZ1  . LYS A 1 37  ? 7.877   -14.547 9.033   1.00 3.96  ? 1544 LYS A HZ1  4  
ATOM 9973  H HZ2  . LYS A 1 37  ? 8.927   -15.718 9.636   1.00 3.94  ? 1544 LYS A HZ2  4  
ATOM 9974  H HZ3  . LYS A 1 37  ? 8.323   -15.873 8.071   1.00 3.91  ? 1544 LYS A HZ3  4  
ATOM 9975  N N    . SER A 1 38  ? 7.369   -9.065  7.245   1.00 1.42  ? 1545 SER A N    4  
ATOM 9976  C CA   . SER A 1 38  ? 7.466   -8.128  8.333   1.00 1.49  ? 1545 SER A CA   4  
ATOM 9977  C C    . SER A 1 38  ? 6.697   -6.853  7.948   1.00 1.28  ? 1545 SER A C    4  
ATOM 9978  O O    . SER A 1 38  ? 7.072   -5.747  8.323   1.00 1.37  ? 1545 SER A O    4  
ATOM 9979  C CB   . SER A 1 38  ? 8.964   -7.823  8.606   1.00 1.81  ? 1545 SER A CB   4  
ATOM 9980  O OG   . SER A 1 38  ? 9.165   -6.998  9.750   1.00 2.46  ? 1545 SER A OG   4  
ATOM 9981  H H    . SER A 1 38  ? 7.765   -8.818  6.386   1.00 1.41  ? 1545 SER A H    4  
ATOM 9982  H HA   . SER A 1 38  ? 7.022   -8.568  9.212   1.00 1.69  ? 1545 SER A HA   4  
ATOM 9983  H HB2  . SER A 1 38  ? 9.489   -8.753  8.765   1.00 2.07  ? 1545 SER A HB2  4  
ATOM 9984  H HB3  . SER A 1 38  ? 9.385   -7.329  7.742   1.00 1.97  ? 1545 SER A HB3  4  
ATOM 9985  H HG   . SER A 1 38  ? 9.164   -6.073  9.450   1.00 2.81  ? 1545 SER A HG   4  
ATOM 9986  N N    . GLY A 1 39  ? 5.612   -7.012  7.210   1.00 1.20  ? 1546 GLY A N    4  
ATOM 9987  C CA   . GLY A 1 39  ? 4.890   -5.858  6.726   1.00 1.26  ? 1546 GLY A CA   4  
ATOM 9988  C C    . GLY A 1 39  ? 3.412   -5.880  7.025   1.00 0.99  ? 1546 GLY A C    4  
ATOM 9989  O O    . GLY A 1 39  ? 2.688   -6.780  6.571   1.00 1.08  ? 1546 GLY A O    4  
ATOM 9990  H H    . GLY A 1 39  ? 5.272   -7.913  7.008   1.00 1.22  ? 1546 GLY A H    4  
ATOM 9991  H HA2  . GLY A 1 39  ? 5.314   -4.973  7.177   1.00 1.36  ? 1546 GLY A HA2  4  
ATOM 9992  H HA3  . GLY A 1 39  ? 5.026   -5.793  5.656   1.00 1.68  ? 1546 GLY A HA3  4  
ATOM 9993  N N    . VAL A 1 40  ? 2.957   -4.895  7.780   1.00 0.79  ? 1547 VAL A N    4  
ATOM 9994  C CA   . VAL A 1 40  ? 1.550   -4.748  8.085   1.00 0.57  ? 1547 VAL A CA   4  
ATOM 9995  C C    . VAL A 1 40  ? 1.073   -3.362  7.678   1.00 0.49  ? 1547 VAL A C    4  
ATOM 9996  O O    . VAL A 1 40  ? 1.792   -2.351  7.862   1.00 0.56  ? 1547 VAL A O    4  
ATOM 9997  C CB   . VAL A 1 40  ? 1.197   -4.995  9.596   1.00 0.57  ? 1547 VAL A CB   4  
ATOM 9998  C CG1  . VAL A 1 40  ? 1.470   -6.428  10.017  1.00 0.64  ? 1547 VAL A CG1  4  
ATOM 9999  C CG2  . VAL A 1 40  ? 1.923   -4.024  10.519  1.00 0.73  ? 1547 VAL A CG2  4  
ATOM 10000 H H    . VAL A 1 40  ? 3.575   -4.219  8.135   1.00 0.89  ? 1547 VAL A H    4  
ATOM 10001 H HA   . VAL A 1 40  ? 1.022   -5.472  7.482   1.00 0.61  ? 1547 VAL A HA   4  
ATOM 10002 H HB   . VAL A 1 40  ? 0.134   -4.831  9.707   1.00 0.54  ? 1547 VAL A HB   4  
ATOM 10003 H HG11 . VAL A 1 40  ? 1.216   -6.532  11.062  1.00 1.12  ? 1547 VAL A HG11 4  
ATOM 10004 H HG12 . VAL A 1 40  ? 2.513   -6.662  9.869   1.00 1.08  ? 1547 VAL A HG12 4  
ATOM 10005 H HG13 . VAL A 1 40  ? 0.857   -7.098  9.434   1.00 1.31  ? 1547 VAL A HG13 4  
ATOM 10006 H HG21 . VAL A 1 40  ? 2.990   -4.135  10.396  1.00 1.24  ? 1547 VAL A HG21 4  
ATOM 10007 H HG22 . VAL A 1 40  ? 1.649   -4.232  11.542  1.00 1.22  ? 1547 VAL A HG22 4  
ATOM 10008 H HG23 . VAL A 1 40  ? 1.631   -3.016  10.265  1.00 1.38  ? 1547 VAL A HG23 4  
ATOM 10009 N N    . VAL A 1 41  ? -0.089  -3.312  7.085   1.00 0.42  ? 1548 VAL A N    4  
ATOM 10010 C CA   . VAL A 1 41  ? -0.698  -2.051  6.731   1.00 0.37  ? 1548 VAL A CA   4  
ATOM 10011 C C    . VAL A 1 41  ? -1.666  -1.612  7.785   1.00 0.32  ? 1548 VAL A C    4  
ATOM 10012 O O    . VAL A 1 41  ? -2.480  -2.406  8.265   1.00 0.35  ? 1548 VAL A O    4  
ATOM 10013 C CB   . VAL A 1 41  ? -1.441  -2.033  5.348   1.00 0.40  ? 1548 VAL A CB   4  
ATOM 10014 C CG1  . VAL A 1 41  ? -0.605  -1.371  4.290   1.00 0.58  ? 1548 VAL A CG1  4  
ATOM 10015 C CG2  . VAL A 1 41  ? -1.840  -3.424  4.889   1.00 0.57  ? 1548 VAL A CG2  4  
ATOM 10016 H H    . VAL A 1 41  ? -0.550  -4.159  6.895   1.00 0.46  ? 1548 VAL A H    4  
ATOM 10017 H HA   . VAL A 1 41  ? 0.099   -1.321  6.693   1.00 0.38  ? 1548 VAL A HA   4  
ATOM 10018 H HB   . VAL A 1 41  ? -2.338  -1.444  5.468   1.00 0.69  ? 1548 VAL A HB   4  
ATOM 10019 H HG11 . VAL A 1 41  ? -0.392  -0.352  4.580   1.00 1.21  ? 1548 VAL A HG11 4  
ATOM 10020 H HG12 . VAL A 1 41  ? -1.142  -1.376  3.353   1.00 1.21  ? 1548 VAL A HG12 4  
ATOM 10021 H HG13 . VAL A 1 41  ? 0.323   -1.910  4.168   1.00 1.23  ? 1548 VAL A HG13 4  
ATOM 10022 H HG21 . VAL A 1 41  ? -2.335  -3.344  3.932   1.00 1.17  ? 1548 VAL A HG21 4  
ATOM 10023 H HG22 . VAL A 1 41  ? -2.534  -3.847  5.602   1.00 1.24  ? 1548 VAL A HG22 4  
ATOM 10024 H HG23 . VAL A 1 41  ? -0.959  -4.042  4.781   1.00 1.17  ? 1548 VAL A HG23 4  
ATOM 10025 N N    . TYR A 1 42  ? -1.550  -0.374  8.157   1.00 0.31  ? 1549 TYR A N    4  
ATOM 10026 C CA   . TYR A 1 42  ? -2.487  0.272   9.012   1.00 0.31  ? 1549 TYR A CA   4  
ATOM 10027 C C    . TYR A 1 42  ? -3.438  1.012   8.128   1.00 0.29  ? 1549 TYR A C    4  
ATOM 10028 O O    . TYR A 1 42  ? -3.128  2.089   7.614   1.00 0.37  ? 1549 TYR A O    4  
ATOM 10029 C CB   . TYR A 1 42  ? -1.812  1.244   9.999   1.00 0.40  ? 1549 TYR A CB   4  
ATOM 10030 C CG   . TYR A 1 42  ? -1.133  0.598   11.188  1.00 0.53  ? 1549 TYR A CG   4  
ATOM 10031 C CD1  . TYR A 1 42  ? -1.846  0.207   12.317  1.00 0.59  ? 1549 TYR A CD1  4  
ATOM 10032 C CD2  . TYR A 1 42  ? 0.232   0.347   11.159  1.00 0.70  ? 1549 TYR A CD2  4  
ATOM 10033 C CE1  . TYR A 1 42  ? -1.206  -0.420  13.378  1.00 0.76  ? 1549 TYR A CE1  4  
ATOM 10034 C CE2  . TYR A 1 42  ? 0.871   -0.268  12.212  1.00 0.87  ? 1549 TYR A CE2  4  
ATOM 10035 C CZ   . TYR A 1 42  ? 0.074   -0.522  13.429  1.00 0.88  ? 1549 TYR A CZ   4  
ATOM 10036 O OH   . TYR A 1 42  ? 0.788   -1.286  14.361  1.00 1.08  ? 1549 TYR A OH   4  
ATOM 10037 H H    . TYR A 1 42  ? -0.804  0.159   7.796   1.00 0.32  ? 1549 TYR A H    4  
ATOM 10038 H HA   . TYR A 1 42  ? -3.053  -0.465  9.555   1.00 0.34  ? 1549 TYR A HA   4  
ATOM 10039 H HB2  . TYR A 1 42  ? -1.070  1.837   9.486   1.00 0.46  ? 1549 TYR A HB2  4  
ATOM 10040 H HB3  . TYR A 1 42  ? -2.570  1.912   10.381  1.00 0.39  ? 1549 TYR A HB3  4  
ATOM 10041 H HD1  . TYR A 1 42  ? -2.909  0.392   12.361  1.00 0.57  ? 1549 TYR A HD1  4  
ATOM 10042 H HD2  . TYR A 1 42  ? 0.799   0.650   10.291  1.00 0.77  ? 1549 TYR A HD2  4  
ATOM 10043 H HE1  . TYR A 1 42  ? -1.755  -0.723  14.258  1.00 0.86  ? 1549 TYR A HE1  4  
ATOM 10044 H HE2  . TYR A 1 42  ? 1.934   -0.452  12.165  1.00 1.03  ? 1549 TYR A HE2  4  
ATOM 10045 H HH   . TYR A 1 42  ? 1.554   -0.747  14.619  1.00 1.29  ? 1549 TYR A HH   4  
ATOM 10046 N N    . MET A 1 43  ? -4.567  0.425   7.916   1.00 0.26  ? 1550 MET A N    4  
ATOM 10047 C CA   . MET A 1 43  ? -5.567  1.031   7.056   1.00 0.25  ? 1550 MET A CA   4  
ATOM 10048 C C    . MET A 1 43  ? -6.755  1.490   7.834   1.00 0.29  ? 1550 MET A C    4  
ATOM 10049 O O    . MET A 1 43  ? -7.155  0.846   8.798   1.00 0.40  ? 1550 MET A O    4  
ATOM 10050 C CB   . MET A 1 43  ? -6.035  0.128   5.901   1.00 0.32  ? 1550 MET A CB   4  
ATOM 10051 C CG   . MET A 1 43  ? -6.702  -1.202  6.293   1.00 0.35  ? 1550 MET A CG   4  
ATOM 10052 S SD   . MET A 1 43  ? -7.851  -1.801  5.034   1.00 0.78  ? 1550 MET A SD   4  
ATOM 10053 C CE   . MET A 1 43  ? -6.816  -1.834  3.596   1.00 0.62  ? 1550 MET A CE   4  
ATOM 10054 H H    . MET A 1 43  ? -4.708  -0.431  8.377   1.00 0.32  ? 1550 MET A H    4  
ATOM 10055 H HA   . MET A 1 43  ? -5.108  1.910   6.629   1.00 0.24  ? 1550 MET A HA   4  
ATOM 10056 H HB2  . MET A 1 43  ? -6.761  0.698   5.345   1.00 0.38  ? 1550 MET A HB2  4  
ATOM 10057 H HB3  . MET A 1 43  ? -5.186  -0.083  5.268   1.00 0.35  ? 1550 MET A HB3  4  
ATOM 10058 H HG2  . MET A 1 43  ? -5.935  -1.952  6.411   1.00 0.45  ? 1550 MET A HG2  4  
ATOM 10059 H HG3  . MET A 1 43  ? -7.249  -1.115  7.216   1.00 0.48  ? 1550 MET A HG3  4  
ATOM 10060 H HE1  . MET A 1 43  ? -6.003  -2.514  3.793   1.00 1.20  ? 1550 MET A HE1  4  
ATOM 10061 H HE2  . MET A 1 43  ? -6.437  -0.839  3.421   1.00 1.14  ? 1550 MET A HE2  4  
ATOM 10062 H HE3  . MET A 1 43  ? -7.391  -2.174  2.746   1.00 1.47  ? 1550 MET A HE3  4  
ATOM 10063 N N    . SER A 1 44  ? -7.285  2.600   7.444   1.00 0.28  ? 1551 SER A N    4  
ATOM 10064 C CA   . SER A 1 44  ? -8.463  3.139   8.024   1.00 0.31  ? 1551 SER A CA   4  
ATOM 10065 C C    . SER A 1 44  ? -9.556  3.232   6.961   1.00 0.30  ? 1551 SER A C    4  
ATOM 10066 O O    . SER A 1 44  ? -9.448  4.009   5.998   1.00 0.36  ? 1551 SER A O    4  
ATOM 10067 C CB   . SER A 1 44  ? -8.138  4.499   8.595   1.00 0.34  ? 1551 SER A CB   4  
ATOM 10068 O OG   . SER A 1 44  ? -7.412  5.268   7.646   1.00 0.97  ? 1551 SER A OG   4  
ATOM 10069 H H    . SER A 1 44  ? -6.870  3.138   6.730   1.00 0.30  ? 1551 SER A H    4  
ATOM 10070 H HA   . SER A 1 44  ? -8.771  2.486   8.827   1.00 0.34  ? 1551 SER A HA   4  
ATOM 10071 H HB2  . SER A 1 44  ? -9.054  5.016   8.840   1.00 0.61  ? 1551 SER A HB2  4  
ATOM 10072 H HB3  . SER A 1 44  ? -7.535  4.385   9.482   1.00 0.73  ? 1551 SER A HB3  4  
ATOM 10073 H HG   . SER A 1 44  ? -8.052  5.798   7.150   1.00 1.40  ? 1551 SER A HG   4  
ATOM 10074 N N    . ILE A 1 45  ? -10.565 2.415   7.094   1.00 0.30  ? 1552 ILE A N    4  
ATOM 10075 C CA   . ILE A 1 45  ? -11.660 2.417   6.160   1.00 0.32  ? 1552 ILE A CA   4  
ATOM 10076 C C    . ILE A 1 45  ? -12.550 3.627   6.423   1.00 0.36  ? 1552 ILE A C    4  
ATOM 10077 O O    . ILE A 1 45  ? -13.038 3.801   7.550   1.00 0.42  ? 1552 ILE A O    4  
ATOM 10078 C CB   . ILE A 1 45  ? -12.493 1.101   6.280   1.00 0.37  ? 1552 ILE A CB   4  
ATOM 10079 C CG1  . ILE A 1 45  ? -11.636 -0.136  5.937   1.00 0.39  ? 1552 ILE A CG1  4  
ATOM 10080 C CG2  . ILE A 1 45  ? -13.749 1.144   5.413   1.00 0.37  ? 1552 ILE A CG2  4  
ATOM 10081 C CD1  . ILE A 1 45  ? -11.151 -0.182  4.498   1.00 0.35  ? 1552 ILE A CD1  4  
ATOM 10082 H H    . ILE A 1 45  ? -10.597 1.788   7.845   1.00 0.36  ? 1552 ILE A H    4  
ATOM 10083 H HA   . ILE A 1 45  ? -11.259 2.489   5.161   1.00 0.30  ? 1552 ILE A HA   4  
ATOM 10084 H HB   . ILE A 1 45  ? -12.817 1.015   7.306   1.00 0.42  ? 1552 ILE A HB   4  
ATOM 10085 H HG12 . ILE A 1 45  ? -10.763 -0.145  6.572   1.00 0.42  ? 1552 ILE A HG12 4  
ATOM 10086 H HG13 . ILE A 1 45  ? -12.217 -1.027  6.122   1.00 0.45  ? 1552 ILE A HG13 4  
ATOM 10087 H HG21 . ILE A 1 45  ? -14.368 1.971   5.731   1.00 1.09  ? 1552 ILE A HG21 4  
ATOM 10088 H HG22 . ILE A 1 45  ? -14.302 0.223   5.529   1.00 1.11  ? 1552 ILE A HG22 4  
ATOM 10089 H HG23 . ILE A 1 45  ? -13.465 1.285   4.382   1.00 1.04  ? 1552 ILE A HG23 4  
ATOM 10090 H HD11 . ILE A 1 45  ? -12.003 -0.253  3.838   1.00 0.98  ? 1552 ILE A HD11 4  
ATOM 10091 H HD12 . ILE A 1 45  ? -10.495 -1.026  4.349   1.00 1.05  ? 1552 ILE A HD12 4  
ATOM 10092 H HD13 . ILE A 1 45  ? -10.611 0.726   4.279   1.00 1.09  ? 1552 ILE A HD13 4  
ATOM 10093 N N    . CYS A 1 46  ? -12.678 4.491   5.413   1.00 0.38  ? 1553 CYS A N    4  
ATOM 10094 C CA   . CYS A 1 46  ? -13.584 5.648   5.447   1.00 0.48  ? 1553 CYS A CA   4  
ATOM 10095 C C    . CYS A 1 46  ? -13.183 6.654   6.514   1.00 0.47  ? 1553 CYS A C    4  
ATOM 10096 O O    . CYS A 1 46  ? -14.028 7.222   7.239   1.00 0.69  ? 1553 CYS A O    4  
ATOM 10097 C CB   . CYS A 1 46  ? -15.015 5.180   5.648   1.00 0.60  ? 1553 CYS A CB   4  
ATOM 10098 S SG   . CYS A 1 46  ? -15.514 3.953   4.422   1.00 1.40  ? 1553 CYS A SG   4  
ATOM 10099 H H    . CYS A 1 46  ? -12.132 4.359   4.606   1.00 0.36  ? 1553 CYS A H    4  
ATOM 10100 H HA   . CYS A 1 46  ? -13.515 6.135   4.485   1.00 0.53  ? 1553 CYS A HA   4  
ATOM 10101 H HB2  . CYS A 1 46  ? -15.111 4.736   6.627   1.00 0.94  ? 1553 CYS A HB2  4  
ATOM 10102 H HB3  . CYS A 1 46  ? -15.683 6.025   5.565   1.00 1.11  ? 1553 CYS A HB3  4  
ATOM 10103 N N    . GLY A 1 47  ? -11.911 6.873   6.604   1.00 0.34  ? 1554 GLY A N    4  
ATOM 10104 C CA   . GLY A 1 47  ? -11.364 7.789   7.542   1.00 0.35  ? 1554 GLY A CA   4  
ATOM 10105 C C    . GLY A 1 47  ? -9.883  7.727   7.487   1.00 0.30  ? 1554 GLY A C    4  
ATOM 10106 O O    . GLY A 1 47  ? -9.332  6.976   6.671   1.00 0.31  ? 1554 GLY A O    4  
ATOM 10107 H H    . GLY A 1 47  ? -11.289 6.388   6.019   1.00 0.35  ? 1554 GLY A H    4  
ATOM 10108 H HA2  . GLY A 1 47  ? -11.697 8.789   7.304   1.00 0.40  ? 1554 GLY A HA2  4  
ATOM 10109 H HA3  . GLY A 1 47  ? -11.689 7.525   8.538   1.00 0.38  ? 1554 GLY A HA3  4  
ATOM 10110 N N    . GLU A 1 48  ? -9.235  8.478   8.314   1.00 0.31  ? 1555 GLU A N    4  
ATOM 10111 C CA   . GLU A 1 48  ? -7.803  8.497   8.354   1.00 0.30  ? 1555 GLU A CA   4  
ATOM 10112 C C    . GLU A 1 48  ? -7.304  7.836   9.629   1.00 0.32  ? 1555 GLU A C    4  
ATOM 10113 O O    . GLU A 1 48  ? -7.941  7.930   10.683  1.00 0.42  ? 1555 GLU A O    4  
ATOM 10114 C CB   . GLU A 1 48  ? -7.278  9.915   8.240   1.00 0.36  ? 1555 GLU A CB   4  
ATOM 10115 C CG   . GLU A 1 48  ? -7.803  10.853  9.294   1.00 0.47  ? 1555 GLU A CG   4  
ATOM 10116 C CD   . GLU A 1 48  ? -7.175  12.190  9.207   1.00 0.93  ? 1555 GLU A CD   4  
ATOM 10117 O OE1  . GLU A 1 48  ? -6.064  12.382  9.736   1.00 1.62  ? 1555 GLU A OE1  4  
ATOM 10118 O OE2  . GLU A 1 48  ? -7.780  13.083  8.592   1.00 0.89  ? 1555 GLU A OE2  4  
ATOM 10119 H H    . GLU A 1 48  ? -9.728  9.036   8.958   1.00 0.39  ? 1555 GLU A H    4  
ATOM 10120 H HA   . GLU A 1 48  ? -7.456  7.926   7.505   1.00 0.28  ? 1555 GLU A HA   4  
ATOM 10121 H HB2  . GLU A 1 48  ? -6.202  9.880   8.318   1.00 0.37  ? 1555 GLU A HB2  4  
ATOM 10122 H HB3  . GLU A 1 48  ? -7.546  10.306  7.269   1.00 0.39  ? 1555 GLU A HB3  4  
ATOM 10123 H HG2  . GLU A 1 48  ? -8.870  10.962  9.170   1.00 0.72  ? 1555 GLU A HG2  4  
ATOM 10124 H HG3  . GLU A 1 48  ? -7.593  10.431  10.267  1.00 0.77  ? 1555 GLU A HG3  4  
ATOM 10125 N N    . ASN A 1 49  ? -6.185  7.183   9.524   1.00 0.31  ? 1556 ASN A N    4  
ATOM 10126 C CA   . ASN A 1 49  ? -5.625  6.430   10.605  1.00 0.38  ? 1556 ASN A CA   4  
ATOM 10127 C C    . ASN A 1 49  ? -4.611  7.300   11.351  1.00 0.41  ? 1556 ASN A C    4  
ATOM 10128 O O    . ASN A 1 49  ? -3.841  8.041   10.729  1.00 0.46  ? 1556 ASN A O    4  
ATOM 10129 C CB   . ASN A 1 49  ? -4.960  5.153   10.041  1.00 0.42  ? 1556 ASN A CB   4  
ATOM 10130 C CG   . ASN A 1 49  ? -4.541  4.142   11.101  1.00 0.58  ? 1556 ASN A CG   4  
ATOM 10131 O OD1  . ASN A 1 49  ? -4.161  4.486   12.206  1.00 0.83  ? 1556 ASN A OD1  4  
ATOM 10132 N ND2  . ASN A 1 49  ? -4.620  2.881   10.769  1.00 0.87  ? 1556 ASN A ND2  4  
ATOM 10133 H H    . ASN A 1 49  ? -5.704  7.216   8.665   1.00 0.32  ? 1556 ASN A H    4  
ATOM 10134 H HA   . ASN A 1 49  ? -6.461  6.142   11.227  1.00 0.45  ? 1556 ASN A HA   4  
ATOM 10135 H HB2  . ASN A 1 49  ? -5.654  4.664   9.375   1.00 0.45  ? 1556 ASN A HB2  4  
ATOM 10136 H HB3  . ASN A 1 49  ? -4.083  5.442   9.478   1.00 0.40  ? 1556 ASN A HB3  4  
ATOM 10137 H HD21 . ASN A 1 49  ? -4.934  2.683   9.858   1.00 1.12  ? 1556 ASN A HD21 4  
ATOM 10138 H HD22 . ASN A 1 49  ? -4.392  2.217   11.454  1.00 1.00  ? 1556 ASN A HD22 4  
ATOM 10139 N N    . GLU A 1 50  ? -4.614  7.207   12.676  1.00 0.57  ? 1557 GLU A N    4  
ATOM 10140 C CA   . GLU A 1 50  ? -3.749  8.022   13.534  1.00 0.67  ? 1557 GLU A CA   4  
ATOM 10141 C C    . GLU A 1 50  ? -2.315  7.505   13.568  1.00 0.62  ? 1557 GLU A C    4  
ATOM 10142 O O    . GLU A 1 50  ? -1.413  8.194   14.035  1.00 0.74  ? 1557 GLU A O    4  
ATOM 10143 C CB   . GLU A 1 50  ? -4.286  8.074   14.971  1.00 0.95  ? 1557 GLU A CB   4  
ATOM 10144 C CG   . GLU A 1 50  ? -4.246  6.748   15.741  1.00 1.65  ? 1557 GLU A CG   4  
ATOM 10145 C CD   . GLU A 1 50  ? -4.670  6.921   17.160  1.00 2.05  ? 1557 GLU A CD   4  
ATOM 10146 O OE1  . GLU A 1 50  ? -3.899  7.470   17.966  1.00 2.40  ? 1557 GLU A OE1  4  
ATOM 10147 O OE2  . GLU A 1 50  ? -5.791  6.501   17.506  1.00 2.49  ? 1557 GLU A OE2  4  
ATOM 10148 H H    . GLU A 1 50  ? -5.232  6.564   13.082  1.00 0.70  ? 1557 GLU A H    4  
ATOM 10149 H HA   . GLU A 1 50  ? -3.748  9.027   13.138  1.00 0.71  ? 1557 GLU A HA   4  
ATOM 10150 H HB2  . GLU A 1 50  ? -3.703  8.792   15.530  1.00 1.22  ? 1557 GLU A HB2  4  
ATOM 10151 H HB3  . GLU A 1 50  ? -5.311  8.412   14.942  1.00 1.40  ? 1557 GLU A HB3  4  
ATOM 10152 H HG2  . GLU A 1 50  ? -4.905  6.009   15.310  1.00 2.11  ? 1557 GLU A HG2  4  
ATOM 10153 H HG3  . GLU A 1 50  ? -3.232  6.376   15.742  1.00 2.10  ? 1557 GLU A HG3  4  
ATOM 10154 N N    . ASN A 1 51  ? -2.109  6.297   13.081  1.00 0.56  ? 1558 ASN A N    4  
ATOM 10155 C CA   . ASN A 1 51  ? -0.784  5.657   13.114  1.00 0.62  ? 1558 ASN A CA   4  
ATOM 10156 C C    . ASN A 1 51  ? 0.170   6.254   12.101  1.00 0.54  ? 1558 ASN A C    4  
ATOM 10157 O O    . ASN A 1 51  ? 1.349   5.922   12.075  1.00 0.68  ? 1558 ASN A O    4  
ATOM 10158 C CB   . ASN A 1 51  ? -0.877  4.135   12.895  1.00 0.79  ? 1558 ASN A CB   4  
ATOM 10159 C CG   . ASN A 1 51  ? -1.452  3.377   14.079  1.00 0.87  ? 1558 ASN A CG   4  
ATOM 10160 O OD1  . ASN A 1 51  ? -0.725  2.935   14.960  1.00 1.38  ? 1558 ASN A OD1  4  
ATOM 10161 N ND2  . ASN A 1 51  ? -2.741  3.218   14.115  1.00 0.85  ? 1558 ASN A ND2  4  
ATOM 10162 H H    . ASN A 1 51  ? -2.878  5.825   12.689  1.00 0.56  ? 1558 ASN A H    4  
ATOM 10163 H HA   . ASN A 1 51  ? -0.374  5.830   14.097  1.00 0.71  ? 1558 ASN A HA   4  
ATOM 10164 H HB2  . ASN A 1 51  ? -1.507  3.941   12.040  1.00 1.20  ? 1558 ASN A HB2  4  
ATOM 10165 H HB3  . ASN A 1 51  ? 0.113   3.752   12.691  1.00 1.02  ? 1558 ASN A HB3  4  
ATOM 10166 H HD21 . ASN A 1 51  ? -3.302  3.587   13.394  1.00 0.93  ? 1558 ASN A HD21 4  
ATOM 10167 H HD22 . ASN A 1 51  ? -3.137  2.718   14.868  1.00 1.10  ? 1558 ASN A HD22 4  
ATOM 10168 N N    . CYS A 1 52  ? -0.330  7.092   11.261  1.00 0.44  ? 1559 CYS A N    4  
ATOM 10169 C CA   . CYS A 1 52  ? 0.479   7.709   10.261  1.00 0.41  ? 1559 CYS A CA   4  
ATOM 10170 C C    . CYS A 1 52  ? 0.059   9.200   10.204  1.00 0.39  ? 1559 CYS A C    4  
ATOM 10171 O O    . CYS A 1 52  ? -0.910  9.557   10.902  1.00 0.42  ? 1559 CYS A O    4  
ATOM 10172 C CB   . CYS A 1 52  ? 0.242   6.958   8.933   1.00 0.42  ? 1559 CYS A CB   4  
ATOM 10173 S SG   . CYS A 1 52  ? 1.658   6.881   7.768   1.00 1.21  ? 1559 CYS A SG   4  
ATOM 10174 H H    . CYS A 1 52  ? -1.271  7.366   11.326  1.00 0.46  ? 1559 CYS A H    4  
ATOM 10175 H HA   . CYS A 1 52  ? 1.516   7.631   10.558  1.00 0.46  ? 1559 CYS A HA   4  
ATOM 10176 H HB2  . CYS A 1 52  ? -0.032  5.939   9.159   1.00 0.83  ? 1559 CYS A HB2  4  
ATOM 10177 H HB3  . CYS A 1 52  ? -0.583  7.428   8.418   1.00 0.94  ? 1559 CYS A HB3  4  
ATOM 10178 N N    . PRO A 1 53  ? 0.804   10.097  9.492   1.00 0.45  ? 1560 PRO A N    4  
ATOM 10179 C CA   . PRO A 1 53  ? 0.419   11.515  9.283   1.00 0.49  ? 1560 PRO A CA   4  
ATOM 10180 C C    . PRO A 1 53  ? -1.102  11.748  9.046   1.00 0.41  ? 1560 PRO A C    4  
ATOM 10181 O O    . PRO A 1 53  ? -1.818  10.888  8.502   1.00 0.42  ? 1560 PRO A O    4  
ATOM 10182 C CB   . PRO A 1 53  ? 1.183   11.845  8.011   1.00 0.57  ? 1560 PRO A CB   4  
ATOM 10183 C CG   . PRO A 1 53  ? 2.457   11.100  8.147   1.00 0.71  ? 1560 PRO A CG   4  
ATOM 10184 C CD   . PRO A 1 53  ? 2.133   9.838   8.899   1.00 0.58  ? 1560 PRO A CD   4  
ATOM 10185 H HA   . PRO A 1 53  ? 0.770   12.152  10.080  1.00 0.57  ? 1560 PRO A HA   4  
ATOM 10186 H HB2  . PRO A 1 53  ? 0.615   11.516  7.154   1.00 0.61  ? 1560 PRO A HB2  4  
ATOM 10187 H HB3  . PRO A 1 53  ? 1.355   12.911  7.951   1.00 0.69  ? 1560 PRO A HB3  4  
ATOM 10188 H HG2  . PRO A 1 53  ? 2.848   10.860  7.169   1.00 0.90  ? 1560 PRO A HG2  4  
ATOM 10189 H HG3  . PRO A 1 53  ? 3.169   11.693  8.701   1.00 0.98  ? 1560 PRO A HG3  4  
ATOM 10190 H HD2  . PRO A 1 53  ? 2.092   8.999   8.221   1.00 0.61  ? 1560 PRO A HD2  4  
ATOM 10191 H HD3  . PRO A 1 53  ? 2.869   9.662   9.669   1.00 0.70  ? 1560 PRO A HD3  4  
ATOM 10192 N N    . PRO A 1 54  ? -1.605  12.927  9.469   1.00 0.47  ? 1561 PRO A N    4  
ATOM 10193 C CA   . PRO A 1 54  ? -3.006  13.306  9.297   1.00 0.46  ? 1561 PRO A CA   4  
ATOM 10194 C C    . PRO A 1 54  ? -3.397  13.285  7.823   1.00 0.41  ? 1561 PRO A C    4  
ATOM 10195 O O    . PRO A 1 54  ? -2.737  13.918  6.982   1.00 0.46  ? 1561 PRO A O    4  
ATOM 10196 C CB   . PRO A 1 54  ? -3.060  14.743  9.839   1.00 0.56  ? 1561 PRO A CB   4  
ATOM 10197 C CG   . PRO A 1 54  ? -1.903  14.834  10.761  1.00 0.80  ? 1561 PRO A CG   4  
ATOM 10198 C CD   . PRO A 1 54  ? -0.838  13.984  10.151  1.00 0.63  ? 1561 PRO A CD   4  
ATOM 10199 H HA   . PRO A 1 54  ? -3.662  12.667  9.870   1.00 0.48  ? 1561 PRO A HA   4  
ATOM 10200 H HB2  . PRO A 1 54  ? -2.964  15.443  9.022   1.00 0.66  ? 1561 PRO A HB2  4  
ATOM 10201 H HB3  . PRO A 1 54  ? -3.990  14.916  10.361  1.00 0.66  ? 1561 PRO A HB3  4  
ATOM 10202 H HG2  . PRO A 1 54  ? -1.570  15.858  10.840  1.00 1.15  ? 1561 PRO A HG2  4  
ATOM 10203 H HG3  . PRO A 1 54  ? -2.177  14.448  11.732  1.00 1.13  ? 1561 PRO A HG3  4  
ATOM 10204 H HD2  . PRO A 1 54  ? -0.257  14.558  9.443   1.00 0.78  ? 1561 PRO A HD2  4  
ATOM 10205 H HD3  . PRO A 1 54  ? -0.201  13.565  10.915  1.00 0.77  ? 1561 PRO A HD3  4  
ATOM 10206 N N    . GLY A 1 55  ? -4.436  12.554  7.518   1.00 0.41  ? 1562 GLY A N    4  
ATOM 10207 C CA   . GLY A 1 55  ? -4.895  12.429  6.166   1.00 0.46  ? 1562 GLY A CA   4  
ATOM 10208 C C    . GLY A 1 55  ? -4.590  11.088  5.570   1.00 0.38  ? 1562 GLY A C    4  
ATOM 10209 O O    . GLY A 1 55  ? -5.037  10.779  4.481   1.00 0.45  ? 1562 GLY A O    4  
ATOM 10210 H H    . GLY A 1 55  ? -4.929  12.125  8.254   1.00 0.44  ? 1562 GLY A H    4  
ATOM 10211 H HA2  . GLY A 1 55  ? -5.964  12.581  6.147   1.00 0.55  ? 1562 GLY A HA2  4  
ATOM 10212 H HA3  . GLY A 1 55  ? -4.425  13.195  5.566   1.00 0.54  ? 1562 GLY A HA3  4  
ATOM 10213 N N    . VAL A 1 56  ? -3.844  10.290  6.272   1.00 0.35  ? 1563 VAL A N    4  
ATOM 10214 C CA   . VAL A 1 56  ? -3.473  9.001   5.799   1.00 0.37  ? 1563 VAL A CA   4  
ATOM 10215 C C    . VAL A 1 56  ? -4.577  7.974   5.970   1.00 0.27  ? 1563 VAL A C    4  
ATOM 10216 O O    . VAL A 1 56  ? -5.055  7.729   7.073   1.00 0.28  ? 1563 VAL A O    4  
ATOM 10217 C CB   . VAL A 1 56  ? -2.168  8.542   6.465   1.00 0.53  ? 1563 VAL A CB   4  
ATOM 10218 C CG1  . VAL A 1 56  ? -2.006  7.066   6.372   1.00 0.68  ? 1563 VAL A CG1  4  
ATOM 10219 C CG2  . VAL A 1 56  ? -1.026  9.180   5.757   1.00 0.98  ? 1563 VAL A CG2  4  
ATOM 10220 H H    . VAL A 1 56  ? -3.497  10.546  7.153   1.00 0.42  ? 1563 VAL A H    4  
ATOM 10221 H HA   . VAL A 1 56  ? -3.276  9.100   4.741   1.00 0.48  ? 1563 VAL A HA   4  
ATOM 10222 H HB   . VAL A 1 56  ? -2.134  8.859   7.496   1.00 1.09  ? 1563 VAL A HB   4  
ATOM 10223 H HG11 . VAL A 1 56  ? -1.863  6.796   5.339   1.00 1.27  ? 1563 VAL A HG11 4  
ATOM 10224 H HG12 . VAL A 1 56  ? -2.909  6.626   6.765   1.00 1.22  ? 1563 VAL A HG12 4  
ATOM 10225 H HG13 . VAL A 1 56  ? -1.155  6.765   6.965   1.00 1.34  ? 1563 VAL A HG13 4  
ATOM 10226 H HG21 . VAL A 1 56  ? -0.091  8.890   6.211   1.00 1.53  ? 1563 VAL A HG21 4  
ATOM 10227 H HG22 . VAL A 1 56  ? -1.144  10.253  5.755   1.00 1.50  ? 1563 VAL A HG22 4  
ATOM 10228 H HG23 . VAL A 1 56  ? -1.069  8.795   4.745   1.00 1.48  ? 1563 VAL A HG23 4  
ATOM 10229 N N    . GLY A 1 57  ? -4.968  7.397   4.865   1.00 0.25  ? 1564 GLY A N    4  
ATOM 10230 C CA   . GLY A 1 57  ? -5.949  6.341   4.880   1.00 0.25  ? 1564 GLY A CA   4  
ATOM 10231 C C    . GLY A 1 57  ? -5.280  4.973   4.840   1.00 0.24  ? 1564 GLY A C    4  
ATOM 10232 O O    . GLY A 1 57  ? -5.764  4.008   5.433   1.00 0.28  ? 1564 GLY A O    4  
ATOM 10233 H H    . GLY A 1 57  ? -4.571  7.713   4.023   1.00 0.28  ? 1564 GLY A H    4  
ATOM 10234 H HA2  . GLY A 1 57  ? -6.551  6.435   5.775   1.00 0.27  ? 1564 GLY A HA2  4  
ATOM 10235 H HA3  . GLY A 1 57  ? -6.590  6.441   4.015   1.00 0.29  ? 1564 GLY A HA3  4  
ATOM 10236 N N    . ALA A 1 58  ? -4.167  4.886   4.127   1.00 0.23  ? 1565 ALA A N    4  
ATOM 10237 C CA   . ALA A 1 58  ? -3.415  3.656   4.034   1.00 0.24  ? 1565 ALA A CA   4  
ATOM 10238 C C    . ALA A 1 58  ? -1.952  3.933   4.299   1.00 0.23  ? 1565 ALA A C    4  
ATOM 10239 O O    . ALA A 1 58  ? -1.355  4.798   3.650   1.00 0.23  ? 1565 ALA A O    4  
ATOM 10240 C CB   . ALA A 1 58  ? -3.586  3.041   2.662   1.00 0.28  ? 1565 ALA A CB   4  
ATOM 10241 H H    . ALA A 1 58  ? -3.821  5.661   3.632   1.00 0.24  ? 1565 ALA A H    4  
ATOM 10242 H HA   . ALA A 1 58  ? -3.788  2.964   4.774   1.00 0.26  ? 1565 ALA A HA   4  
ATOM 10243 H HB1  . ALA A 1 58  ? -3.227  3.745   1.924   1.00 1.01  ? 1565 ALA A HB1  4  
ATOM 10244 H HB2  . ALA A 1 58  ? -4.624  2.816   2.477   1.00 1.08  ? 1565 ALA A HB2  4  
ATOM 10245 H HB3  . ALA A 1 58  ? -3.002  2.134   2.597   1.00 0.96  ? 1565 ALA A HB3  4  
ATOM 10246 N N    . CYS A 1 59  ? -1.379  3.235   5.245   1.00 0.26  ? 1566 CYS A N    4  
ATOM 10247 C CA   . CYS A 1 59  ? 0.009   3.430   5.589   1.00 0.28  ? 1566 CYS A CA   4  
ATOM 10248 C C    . CYS A 1 59  ? 0.602   2.137   6.120   1.00 0.33  ? 1566 CYS A C    4  
ATOM 10249 O O    . CYS A 1 59  ? -0.055  1.418   6.856   1.00 0.37  ? 1566 CYS A O    4  
ATOM 10250 C CB   . CYS A 1 59  ? 0.101   4.509   6.676   1.00 0.32  ? 1566 CYS A CB   4  
ATOM 10251 S SG   . CYS A 1 59  ? 1.778   4.911   7.283   1.00 0.43  ? 1566 CYS A SG   4  
ATOM 10252 H H    . CYS A 1 59  ? -1.890  2.574   5.764   1.00 0.29  ? 1566 CYS A H    4  
ATOM 10253 H HA   . CYS A 1 59  ? 0.517   3.788   4.706   1.00 0.30  ? 1566 CYS A HA   4  
ATOM 10254 H HB2  . CYS A 1 59  ? -0.317  5.424   6.285   1.00 0.36  ? 1566 CYS A HB2  4  
ATOM 10255 H HB3  . CYS A 1 59  ? -0.494  4.194   7.520   1.00 0.38  ? 1566 CYS A HB3  4  
ATOM 10256 N N    . PHE A 1 60  ? 1.807   1.822   5.725   1.00 0.39  ? 1567 PHE A N    4  
ATOM 10257 C CA   . PHE A 1 60  ? 2.510   0.707   6.299   1.00 0.48  ? 1567 PHE A CA   4  
ATOM 10258 C C    . PHE A 1 60  ? 3.219   1.171   7.557   1.00 0.61  ? 1567 PHE A C    4  
ATOM 10259 O O    . PHE A 1 60  ? 3.851   2.242   7.557   1.00 0.63  ? 1567 PHE A O    4  
ATOM 10260 C CB   . PHE A 1 60  ? 3.561   0.132   5.354   1.00 0.59  ? 1567 PHE A CB   4  
ATOM 10261 C CG   . PHE A 1 60  ? 3.049   -0.860  4.381   1.00 0.61  ? 1567 PHE A CG   4  
ATOM 10262 C CD1  . PHE A 1 60  ? 2.956   -2.196  4.729   1.00 0.73  ? 1567 PHE A CD1  4  
ATOM 10263 C CD2  . PHE A 1 60  ? 2.671   -0.473  3.132   1.00 0.86  ? 1567 PHE A CD2  4  
ATOM 10264 C CE1  . PHE A 1 60  ? 2.487   -3.120  3.833   1.00 0.91  ? 1567 PHE A CE1  4  
ATOM 10265 C CE2  . PHE A 1 60  ? 2.199   -1.387  2.221   1.00 1.03  ? 1567 PHE A CE2  4  
ATOM 10266 C CZ   . PHE A 1 60  ? 2.106   -2.711  2.573   1.00 0.99  ? 1567 PHE A CZ   4  
ATOM 10267 H H    . PHE A 1 60  ? 2.242   2.376   5.043   1.00 0.41  ? 1567 PHE A H    4  
ATOM 10268 H HA   . PHE A 1 60  ? 1.741   -0.031  6.473   1.00 0.46  ? 1567 PHE A HA   4  
ATOM 10269 H HB2  . PHE A 1 60  ? 4.004   0.939   4.791   1.00 0.71  ? 1567 PHE A HB2  4  
ATOM 10270 H HB3  . PHE A 1 60  ? 4.332   -0.344  5.945   1.00 0.69  ? 1567 PHE A HB3  4  
ATOM 10271 H HD1  . PHE A 1 60  ? 3.256   -2.508  5.718   1.00 0.87  ? 1567 PHE A HD1  4  
ATOM 10272 H HD2  . PHE A 1 60  ? 2.754   0.571   2.890   1.00 1.06  ? 1567 PHE A HD2  4  
ATOM 10273 H HE1  . PHE A 1 60  ? 2.414   -4.160  4.112   1.00 1.13  ? 1567 PHE A HE1  4  
ATOM 10274 H HE2  . PHE A 1 60  ? 1.907   -1.072  1.231   1.00 1.30  ? 1567 PHE A HE2  4  
ATOM 10275 H HZ   . PHE A 1 60  ? 1.736   -3.436  1.864   1.00 1.18  ? 1567 PHE A HZ   4  
ATOM 10276 N N    . GLY A 1 61  ? 3.207   0.354   8.597   1.00 0.76  ? 1568 GLY A N    4  
ATOM 10277 C CA   . GLY A 1 61  ? 3.839   0.745   9.836   1.00 1.03  ? 1568 GLY A CA   4  
ATOM 10278 C C    . GLY A 1 61  ? 5.302   0.373   9.845   1.00 0.82  ? 1568 GLY A C    4  
ATOM 10279 O O    . GLY A 1 61  ? 5.905   0.225   10.904  1.00 1.13  ? 1568 GLY A O    4  
ATOM 10280 H H    . GLY A 1 61  ? 2.802   -0.541  8.546   1.00 0.72  ? 1568 GLY A H    4  
ATOM 10281 H HA2  . GLY A 1 61  ? 3.745   1.814   9.959   1.00 1.32  ? 1568 GLY A HA2  4  
ATOM 10282 H HA3  . GLY A 1 61  ? 3.346   0.246   10.657  1.00 1.43  ? 1568 GLY A HA3  4  
ATOM 10283 N N    . GLN A 1 62  ? 5.866   0.228   8.656   1.00 0.83  ? 1569 GLN A N    4  
ATOM 10284 C CA   . GLN A 1 62  ? 7.244   -0.174  8.484   1.00 1.01  ? 1569 GLN A CA   4  
ATOM 10285 C C    . GLN A 1 62  ? 8.185   0.924   8.983   1.00 0.89  ? 1569 GLN A C    4  
ATOM 10286 O O    . GLN A 1 62  ? 8.840   0.769   10.009  1.00 1.08  ? 1569 GLN A O    4  
ATOM 10287 C CB   . GLN A 1 62  ? 7.501   -0.428  7.008   1.00 1.47  ? 1569 GLN A CB   4  
ATOM 10288 C CG   . GLN A 1 62  ? 6.526   -1.369  6.329   1.00 1.83  ? 1569 GLN A CG   4  
ATOM 10289 C CD   . GLN A 1 62  ? 6.431   -2.699  7.009   1.00 2.05  ? 1569 GLN A CD   4  
ATOM 10290 O OE1  . GLN A 1 62  ? 5.585   -2.909  7.898   1.00 2.58  ? 1569 GLN A OE1  4  
ATOM 10291 N NE2  . GLN A 1 62  ? 7.274   -3.601  6.617   1.00 2.40  ? 1569 GLN A NE2  4  
ATOM 10292 H H    . GLN A 1 62  ? 5.311   0.386   7.865   1.00 1.05  ? 1569 GLN A H    4  
ATOM 10293 H HA   . GLN A 1 62  ? 7.416   -1.089  9.032   1.00 1.24  ? 1569 GLN A HA   4  
ATOM 10294 H HB2  . GLN A 1 62  ? 7.463   0.518   6.488   1.00 1.56  ? 1569 GLN A HB2  4  
ATOM 10295 H HB3  . GLN A 1 62  ? 8.495   -0.838  6.901   1.00 1.69  ? 1569 GLN A HB3  4  
ATOM 10296 H HG2  . GLN A 1 62  ? 5.548   -0.914  6.322   1.00 2.22  ? 1569 GLN A HG2  4  
ATOM 10297 H HG3  . GLN A 1 62  ? 6.855   -1.522  5.311   1.00 2.41  ? 1569 GLN A HG3  4  
ATOM 10298 H HE21 . GLN A 1 62  ? 7.907   -3.358  5.900   1.00 2.27  ? 1569 GLN A HE21 4  
ATOM 10299 H HE22 . GLN A 1 62  ? 7.262   -4.469  7.078   1.00 3.09  ? 1569 GLN A HE22 4  
ATOM 10300 N N    . THR A 1 63  ? 8.242   2.020   8.248   1.00 0.86  ? 1570 THR A N    4  
ATOM 10301 C CA   . THR A 1 63  ? 8.976   3.188   8.674   1.00 1.01  ? 1570 THR A CA   4  
ATOM 10302 C C    . THR A 1 63  ? 8.062   4.427   8.492   1.00 0.80  ? 1570 THR A C    4  
ATOM 10303 O O    . THR A 1 63  ? 8.502   5.537   8.158   1.00 0.93  ? 1570 THR A O    4  
ATOM 10304 C CB   . THR A 1 63  ? 10.377  3.313   7.950   1.00 1.48  ? 1570 THR A CB   4  
ATOM 10305 O OG1  . THR A 1 63  ? 11.179  4.346   8.547   1.00 2.17  ? 1570 THR A OG1  4  
ATOM 10306 C CG2  . THR A 1 63  ? 10.243  3.578   6.461   1.00 1.93  ? 1570 THR A CG2  4  
ATOM 10307 H H    . THR A 1 63  ? 7.809   2.024   7.370   1.00 0.98  ? 1570 THR A H    4  
ATOM 10308 H HA   . THR A 1 63  ? 9.124   3.066   9.739   1.00 1.23  ? 1570 THR A HA   4  
ATOM 10309 H HB   . THR A 1 63  ? 10.890  2.372   8.091   1.00 1.87  ? 1570 THR A HB   4  
ATOM 10310 H HG1  . THR A 1 63  ? 11.262  4.093   9.482   1.00 2.52  ? 1570 THR A HG1  4  
ATOM 10311 H HG21 . THR A 1 63  ? 9.710   4.505   6.307   1.00 2.20  ? 1570 THR A HG21 4  
ATOM 10312 H HG22 . THR A 1 63  ? 9.697   2.768   5.999   1.00 2.46  ? 1570 THR A HG22 4  
ATOM 10313 H HG23 . THR A 1 63  ? 11.227  3.649   6.018   1.00 2.40  ? 1570 THR A HG23 4  
ATOM 10314 N N    . ARG A 1 64  ? 6.763   4.180   8.727   1.00 0.62  ? 1571 ARG A N    4  
ATOM 10315 C CA   . ARG A 1 64  ? 5.670   5.171   8.593   1.00 0.57  ? 1571 ARG A CA   4  
ATOM 10316 C C    . ARG A 1 64  ? 5.554   5.625   7.125   1.00 0.47  ? 1571 ARG A C    4  
ATOM 10317 O O    . ARG A 1 64  ? 5.745   6.802   6.806   1.00 0.57  ? 1571 ARG A O    4  
ATOM 10318 C CB   . ARG A 1 64  ? 5.897   6.402   9.520   1.00 0.87  ? 1571 ARG A CB   4  
ATOM 10319 C CG   . ARG A 1 64  ? 6.154   6.076   10.997  1.00 1.13  ? 1571 ARG A CG   4  
ATOM 10320 C CD   . ARG A 1 64  ? 4.928   5.463   11.712  1.00 1.32  ? 1571 ARG A CD   4  
ATOM 10321 N NE   . ARG A 1 64  ? 5.247   5.000   13.095  1.00 1.46  ? 1571 ARG A NE   4  
ATOM 10322 C CZ   . ARG A 1 64  ? 4.367   4.822   14.089  1.00 2.01  ? 1571 ARG A CZ   4  
ATOM 10323 N NH1  . ARG A 1 64  ? 3.083   5.054   13.915  1.00 2.62  ? 1571 ARG A NH1  4  
ATOM 10324 N NH2  . ARG A 1 64  ? 4.798   4.404   15.261  1.00 2.24  ? 1571 ARG A NH2  4  
ATOM 10325 H H    . ARG A 1 64  ? 6.567   3.270   9.032   1.00 0.65  ? 1571 ARG A H    4  
ATOM 10326 H HA   . ARG A 1 64  ? 4.746   4.680   8.864   1.00 0.60  ? 1571 ARG A HA   4  
ATOM 10327 H HB2  . ARG A 1 64  ? 6.749   6.955   9.151   1.00 0.98  ? 1571 ARG A HB2  4  
ATOM 10328 H HB3  . ARG A 1 64  ? 5.025   7.037   9.461   1.00 1.02  ? 1571 ARG A HB3  4  
ATOM 10329 H HG2  . ARG A 1 64  ? 7.001   5.408   11.033  1.00 1.78  ? 1571 ARG A HG2  4  
ATOM 10330 H HG3  . ARG A 1 64  ? 6.425   7.007   11.477  1.00 1.61  ? 1571 ARG A HG3  4  
ATOM 10331 H HD2  . ARG A 1 64  ? 4.170   6.230   11.785  1.00 1.83  ? 1571 ARG A HD2  4  
ATOM 10332 H HD3  . ARG A 1 64  ? 4.524   4.636   11.150  1.00 1.89  ? 1571 ARG A HD3  4  
ATOM 10333 H HE   . ARG A 1 64  ? 6.189   4.797   13.292  1.00 1.50  ? 1571 ARG A HE   4  
ATOM 10334 H HH11 . ARG A 1 64  ? 2.693   5.373   13.042  1.00 2.69  ? 1571 ARG A HH11 4  
ATOM 10335 H HH12 . ARG A 1 64  ? 2.415   4.935   14.663  1.00 3.19  ? 1571 ARG A HH12 4  
ATOM 10336 H HH21 . ARG A 1 64  ? 5.777   4.220   15.402  1.00 2.19  ? 1571 ARG A HH21 4  
ATOM 10337 H HH22 . ARG A 1 64  ? 4.204   4.265   16.066  1.00 2.70  ? 1571 ARG A HH22 4  
ATOM 10338 N N    . ILE A 1 65  ? 5.271   4.680   6.240   1.00 0.43  ? 1572 ILE A N    4  
ATOM 10339 C CA   . ILE A 1 65  ? 5.178   4.965   4.798   1.00 0.43  ? 1572 ILE A CA   4  
ATOM 10340 C C    . ILE A 1 65  ? 3.709   5.003   4.350   1.00 0.40  ? 1572 ILE A C    4  
ATOM 10341 O O    . ILE A 1 65  ? 3.011   3.979   4.400   1.00 0.44  ? 1572 ILE A O    4  
ATOM 10342 C CB   . ILE A 1 65  ? 5.938   3.901   3.938   1.00 0.53  ? 1572 ILE A CB   4  
ATOM 10343 C CG1  . ILE A 1 65  ? 7.406   3.741   4.419   1.00 0.65  ? 1572 ILE A CG1  4  
ATOM 10344 C CG2  . ILE A 1 65  ? 5.855   4.237   2.428   1.00 0.60  ? 1572 ILE A CG2  4  
ATOM 10345 C CD1  . ILE A 1 65  ? 8.233   2.761   3.596   1.00 0.92  ? 1572 ILE A CD1  4  
ATOM 10346 H H    . ILE A 1 65  ? 5.084   3.779   6.575   1.00 0.50  ? 1572 ILE A H    4  
ATOM 10347 H HA   . ILE A 1 65  ? 5.618   5.935   4.623   1.00 0.47  ? 1572 ILE A HA   4  
ATOM 10348 H HB   . ILE A 1 65  ? 5.431   2.956   4.058   1.00 0.56  ? 1572 ILE A HB   4  
ATOM 10349 H HG12 . ILE A 1 65  ? 7.943   4.675   4.511   1.00 0.71  ? 1572 ILE A HG12 4  
ATOM 10350 H HG13 . ILE A 1 65  ? 7.352   3.325   5.414   1.00 0.73  ? 1572 ILE A HG13 4  
ATOM 10351 H HG21 . ILE A 1 65  ? 6.263   5.211   2.204   1.00 1.12  ? 1572 ILE A HG21 4  
ATOM 10352 H HG22 . ILE A 1 65  ? 4.816   4.234   2.132   1.00 1.25  ? 1572 ILE A HG22 4  
ATOM 10353 H HG23 . ILE A 1 65  ? 6.375   3.484   1.852   1.00 1.19  ? 1572 ILE A HG23 4  
ATOM 10354 H HD11 . ILE A 1 65  ? 8.324   3.116   2.580   1.00 1.39  ? 1572 ILE A HD11 4  
ATOM 10355 H HD12 . ILE A 1 65  ? 7.740   1.800   3.595   1.00 1.51  ? 1572 ILE A HD12 4  
ATOM 10356 H HD13 . ILE A 1 65  ? 9.213   2.652   4.037   1.00 1.36  ? 1572 ILE A HD13 4  
ATOM 10357 N N    . SER A 1 66  ? 3.261   6.161   3.915   1.00 0.42  ? 1573 SER A N    4  
ATOM 10358 C CA   . SER A 1 66  ? 1.884   6.349   3.460   1.00 0.42  ? 1573 SER A CA   4  
ATOM 10359 C C    . SER A 1 66  ? 1.713   5.839   2.026   1.00 0.33  ? 1573 SER A C    4  
ATOM 10360 O O    . SER A 1 66  ? 2.605   5.994   1.186   1.00 0.41  ? 1573 SER A O    4  
ATOM 10361 C CB   . SER A 1 66  ? 1.482   7.842   3.548   1.00 0.54  ? 1573 SER A CB   4  
ATOM 10362 O OG   . SER A 1 66  ? 0.210   8.089   2.940   1.00 0.80  ? 1573 SER A OG   4  
ATOM 10363 H H    . SER A 1 66  ? 3.899   6.909   3.880   1.00 0.50  ? 1573 SER A H    4  
ATOM 10364 H HA   . SER A 1 66  ? 1.241   5.776   4.112   1.00 0.49  ? 1573 SER A HA   4  
ATOM 10365 H HB2  . SER A 1 66  ? 1.390   8.140   4.583   1.00 0.78  ? 1573 SER A HB2  4  
ATOM 10366 H HB3  . SER A 1 66  ? 2.225   8.450   3.053   1.00 0.96  ? 1573 SER A HB3  4  
ATOM 10367 H HG   . SER A 1 66  ? -0.003  9.031   3.045   1.00 0.71  ? 1573 SER A HG   4  
ATOM 10368 N N    . VAL A 1 67  ? 0.582   5.230   1.739   1.00 0.26  ? 1574 VAL A N    4  
ATOM 10369 C CA   . VAL A 1 67  ? 0.313   4.744   0.394   1.00 0.27  ? 1574 VAL A CA   4  
ATOM 10370 C C    . VAL A 1 67  ? -1.079  5.138   -0.078  1.00 0.27  ? 1574 VAL A C    4  
ATOM 10371 O O    . VAL A 1 67  ? -1.613  4.560   -1.033  1.00 0.38  ? 1574 VAL A O    4  
ATOM 10372 C CB   . VAL A 1 67  ? 0.498   3.212   0.237   1.00 0.42  ? 1574 VAL A CB   4  
ATOM 10373 C CG1  . VAL A 1 67  ? 1.929   2.799   0.481   1.00 0.98  ? 1574 VAL A CG1  4  
ATOM 10374 C CG2  . VAL A 1 67  ? -0.421  2.469   1.153   1.00 0.69  ? 1574 VAL A CG2  4  
ATOM 10375 H H    . VAL A 1 67  ? -0.089  5.107   2.451   1.00 0.30  ? 1574 VAL A H    4  
ATOM 10376 H HA   . VAL A 1 67  ? 1.023   5.239   -0.253  1.00 0.30  ? 1574 VAL A HA   4  
ATOM 10377 H HB   . VAL A 1 67  ? 0.247   2.950   -0.779  1.00 0.93  ? 1574 VAL A HB   4  
ATOM 10378 H HG11 . VAL A 1 67  ? 2.009   1.732   0.346   1.00 1.52  ? 1574 VAL A HG11 4  
ATOM 10379 H HG12 . VAL A 1 67  ? 2.212   3.100   1.478   1.00 1.51  ? 1574 VAL A HG12 4  
ATOM 10380 H HG13 . VAL A 1 67  ? 2.562   3.303   -0.234  1.00 1.60  ? 1574 VAL A HG13 4  
ATOM 10381 H HG21 . VAL A 1 67  ? -0.297  1.409   0.994   1.00 1.29  ? 1574 VAL A HG21 4  
ATOM 10382 H HG22 . VAL A 1 67  ? -1.426  2.769   0.901   1.00 1.32  ? 1574 VAL A HG22 4  
ATOM 10383 H HG23 . VAL A 1 67  ? -0.191  2.733   2.174   1.00 1.37  ? 1574 VAL A HG23 4  
ATOM 10384 N N    . GLY A 1 68  ? -1.670  6.098   0.584   1.00 0.23  ? 1575 GLY A N    4  
ATOM 10385 C CA   . GLY A 1 68  ? -2.964  6.537   0.168   1.00 0.27  ? 1575 GLY A CA   4  
ATOM 10386 C C    . GLY A 1 68  ? -3.558  7.514   1.128   1.00 0.24  ? 1575 GLY A C    4  
ATOM 10387 O O    . GLY A 1 68  ? -3.550  7.282   2.349   1.00 0.29  ? 1575 GLY A O    4  
ATOM 10388 H H    . GLY A 1 68  ? -1.249  6.513   1.371   1.00 0.25  ? 1575 GLY A H    4  
ATOM 10389 H HA2  . GLY A 1 68  ? -2.875  6.995   -0.806  1.00 0.33  ? 1575 GLY A HA2  4  
ATOM 10390 H HA3  . GLY A 1 68  ? -3.615  5.679   0.092   1.00 0.34  ? 1575 GLY A HA3  4  
ATOM 10391 N N    . LYS A 1 69  ? -4.054  8.602   0.606   1.00 0.27  ? 1576 LYS A N    4  
ATOM 10392 C CA   . LYS A 1 69  ? -4.682  9.602   1.408   1.00 0.30  ? 1576 LYS A CA   4  
ATOM 10393 C C    . LYS A 1 69  ? -6.138  9.210   1.599   1.00 0.28  ? 1576 LYS A C    4  
ATOM 10394 O O    . LYS A 1 69  ? -6.753  8.615   0.703   1.00 0.33  ? 1576 LYS A O    4  
ATOM 10395 C CB   . LYS A 1 69  ? -4.542  10.975  0.736   1.00 0.42  ? 1576 LYS A CB   4  
ATOM 10396 C CG   . LYS A 1 69  ? -5.109  12.139  1.537   1.00 0.57  ? 1576 LYS A CG   4  
ATOM 10397 C CD   . LYS A 1 69  ? -4.775  13.476  0.901   1.00 0.88  ? 1576 LYS A CD   4  
ATOM 10398 C CE   . LYS A 1 69  ? -5.386  13.634  -0.477  1.00 1.39  ? 1576 LYS A CE   4  
ATOM 10399 N NZ   . LYS A 1 69  ? -4.976  14.906  -1.097  1.00 2.19  ? 1576 LYS A NZ   4  
ATOM 10400 H H    . LYS A 1 69  ? -4.031  8.752   -0.364  1.00 0.32  ? 1576 LYS A H    4  
ATOM 10401 H HA   . LYS A 1 69  ? -4.193  9.619   2.371   1.00 0.33  ? 1576 LYS A HA   4  
ATOM 10402 H HB2  . LYS A 1 69  ? -3.494  11.172  0.565   1.00 0.46  ? 1576 LYS A HB2  4  
ATOM 10403 H HB3  . LYS A 1 69  ? -5.047  10.944  -0.219  1.00 0.45  ? 1576 LYS A HB3  4  
ATOM 10404 H HG2  . LYS A 1 69  ? -6.184  12.038  1.592   1.00 0.66  ? 1576 LYS A HG2  4  
ATOM 10405 H HG3  . LYS A 1 69  ? -4.696  12.108  2.535   1.00 0.68  ? 1576 LYS A HG3  4  
ATOM 10406 H HD2  . LYS A 1 69  ? -5.147  14.268  1.534   1.00 1.35  ? 1576 LYS A HD2  4  
ATOM 10407 H HD3  . LYS A 1 69  ? -3.702  13.561  0.821   1.00 1.58  ? 1576 LYS A HD3  4  
ATOM 10408 H HE2  . LYS A 1 69  ? -5.062  12.814  -1.101  1.00 1.83  ? 1576 LYS A HE2  4  
ATOM 10409 H HE3  . LYS A 1 69  ? -6.461  13.616  -0.385  1.00 2.02  ? 1576 LYS A HE3  4  
ATOM 10410 H HZ1  . LYS A 1 69  ? -5.272  15.735  -0.536  1.00 2.66  ? 1576 LYS A HZ1  4  
ATOM 10411 H HZ2  . LYS A 1 69  ? -5.347  15.008  -2.067  1.00 2.68  ? 1576 LYS A HZ2  4  
ATOM 10412 H HZ3  . LYS A 1 69  ? -3.935  14.934  -1.173  1.00 2.63  ? 1576 LYS A HZ3  4  
ATOM 10413 N N    . ALA A 1 70  ? -6.649  9.495   2.772   1.00 0.27  ? 1577 ALA A N    4  
ATOM 10414 C CA   . ALA A 1 70  ? -7.987  9.152   3.160   1.00 0.30  ? 1577 ALA A CA   4  
ATOM 10415 C C    . ALA A 1 70  ? -9.014  9.942   2.388   1.00 0.32  ? 1577 ALA A C    4  
ATOM 10416 O O    . ALA A 1 70  ? -9.355  11.080  2.747   1.00 0.61  ? 1577 ALA A O    4  
ATOM 10417 C CB   . ALA A 1 70  ? -8.171  9.362   4.649   1.00 0.38  ? 1577 ALA A CB   4  
ATOM 10418 H H    . ALA A 1 70  ? -6.087  9.978   3.421   1.00 0.28  ? 1577 ALA A H    4  
ATOM 10419 H HA   . ALA A 1 70  ? -8.131  8.102   2.959   1.00 0.33  ? 1577 ALA A HA   4  
ATOM 10420 H HB1  . ALA A 1 70  ? -9.158  9.032   4.941   1.00 1.08  ? 1577 ALA A HB1  4  
ATOM 10421 H HB2  . ALA A 1 70  ? -8.060  10.410  4.882   1.00 1.00  ? 1577 ALA A HB2  4  
ATOM 10422 H HB3  . ALA A 1 70  ? -7.429  8.792   5.189   1.00 1.07  ? 1577 ALA A HB3  4  
ATOM 10423 N N    . ASN A 1 71  ? -9.441  9.366   1.308   1.00 0.43  ? 1578 ASN A N    4  
ATOM 10424 C CA   . ASN A 1 71  ? -10.525 9.890   0.528   1.00 0.54  ? 1578 ASN A CA   4  
ATOM 10425 C C    . ASN A 1 71  ? -11.749 9.091   0.875   1.00 0.48  ? 1578 ASN A C    4  
ATOM 10426 O O    . ASN A 1 71  ? -11.657 8.111   1.611   1.00 0.51  ? 1578 ASN A O    4  
ATOM 10427 C CB   . ASN A 1 71  ? -10.250 9.808   -0.989  1.00 0.73  ? 1578 ASN A CB   4  
ATOM 10428 C CG   . ASN A 1 71  ? -9.173  10.805  -1.478  1.00 1.15  ? 1578 ASN A CG   4  
ATOM 10429 O OD1  . ASN A 1 71  ? -8.972  11.866  -0.872  1.00 1.95  ? 1578 ASN A OD1  4  
ATOM 10430 N ND2  . ASN A 1 71  ? -8.528  10.527  -2.611  1.00 1.31  ? 1578 ASN A ND2  4  
ATOM 10431 H H    . ASN A 1 71  ? -9.003  8.535   1.031   1.00 0.67  ? 1578 ASN A H    4  
ATOM 10432 H HA   . ASN A 1 71  ? -10.681 10.919  0.818   1.00 0.69  ? 1578 ASN A HA   4  
ATOM 10433 H HB2  . ASN A 1 71  ? -9.948  8.791   -1.186  1.00 1.16  ? 1578 ASN A HB2  4  
ATOM 10434 H HB3  . ASN A 1 71  ? -11.183 10.007  -1.500  1.00 1.31  ? 1578 ASN A HB3  4  
ATOM 10435 H HD21 . ASN A 1 71  ? -8.718  9.724   -3.141  1.00 1.28  ? 1578 ASN A HD21 4  
ATOM 10436 H HD22 . ASN A 1 71  ? -7.851  11.186  -2.894  1.00 1.88  ? 1578 ASN A HD22 4  
ATOM 10437 N N    . LYS A 1 72  ? -12.878 9.475   0.372   1.00 0.56  ? 1579 LYS A N    4  
ATOM 10438 C CA   . LYS A 1 72  ? -14.094 8.774   0.673   1.00 0.61  ? 1579 LYS A CA   4  
ATOM 10439 C C    . LYS A 1 72  ? -14.968 8.737   -0.550  1.00 0.63  ? 1579 LYS A C    4  
ATOM 10440 O O    . LYS A 1 72  ? -16.122 9.165   -0.549  1.00 0.80  ? 1579 LYS A O    4  
ATOM 10441 C CB   . LYS A 1 72  ? -14.800 9.392   1.904   1.00 0.80  ? 1579 LYS A CB   4  
ATOM 10442 C CG   . LYS A 1 72  ? -15.081 10.892  1.818   1.00 1.30  ? 1579 LYS A CG   4  
ATOM 10443 C CD   . LYS A 1 72  ? -15.632 11.419  3.134   1.00 1.42  ? 1579 LYS A CD   4  
ATOM 10444 C CE   . LYS A 1 72  ? -14.612 11.256  4.252   1.00 2.07  ? 1579 LYS A CE   4  
ATOM 10445 N NZ   . LYS A 1 72  ? -15.126 11.717  5.551   1.00 2.68  ? 1579 LYS A NZ   4  
ATOM 10446 H H    . LYS A 1 72  ? -12.922 10.255  -0.232  1.00 0.65  ? 1579 LYS A H    4  
ATOM 10447 H HA   . LYS A 1 72  ? -13.811 7.757   0.911   1.00 0.61  ? 1579 LYS A HA   4  
ATOM 10448 H HB2  . LYS A 1 72  ? -15.746 8.890   2.045   1.00 1.24  ? 1579 LYS A HB2  4  
ATOM 10449 H HB3  . LYS A 1 72  ? -14.182 9.212   2.772   1.00 1.20  ? 1579 LYS A HB3  4  
ATOM 10450 H HG2  . LYS A 1 72  ? -14.160 11.408  1.589   1.00 1.84  ? 1579 LYS A HG2  4  
ATOM 10451 H HG3  . LYS A 1 72  ? -15.802 11.069  1.034   1.00 1.78  ? 1579 LYS A HG3  4  
ATOM 10452 H HD2  . LYS A 1 72  ? -15.871 12.467  3.024   1.00 1.78  ? 1579 LYS A HD2  4  
ATOM 10453 H HD3  . LYS A 1 72  ? -16.525 10.868  3.389   1.00 1.75  ? 1579 LYS A HD3  4  
ATOM 10454 H HE2  . LYS A 1 72  ? -14.354 10.211  4.333   1.00 2.51  ? 1579 LYS A HE2  4  
ATOM 10455 H HE3  . LYS A 1 72  ? -13.729 11.822  3.998   1.00 2.58  ? 1579 LYS A HE3  4  
ATOM 10456 H HZ1  . LYS A 1 72  ? -15.424 12.716  5.511   1.00 3.11  ? 1579 LYS A HZ1  4  
ATOM 10457 H HZ2  . LYS A 1 72  ? -14.360 11.637  6.257   1.00 3.11  ? 1579 LYS A HZ2  4  
ATOM 10458 H HZ3  . LYS A 1 72  ? -15.929 11.122  5.864   1.00 2.98  ? 1579 LYS A HZ3  4  
ATOM 10459 N N    . ARG A 1 73  ? -14.401 8.245   -1.617  1.00 0.58  ? 1580 ARG A N    4  
ATOM 10460 C CA   . ARG A 1 73  ? -15.118 8.172   -2.839  1.00 0.65  ? 1580 ARG A CA   4  
ATOM 10461 C C    . ARG A 1 73  ? -15.514 6.726   -3.117  1.00 0.57  ? 1580 ARG A C    4  
ATOM 10462 O O    . ARG A 1 73  ? -14.863 6.021   -3.894  1.00 0.61  ? 1580 ARG A O    4  
ATOM 10463 C CB   . ARG A 1 73  ? -14.313 8.758   -3.999  1.00 0.82  ? 1580 ARG A CB   4  
ATOM 10464 C CG   . ARG A 1 73  ? -15.186 9.000   -5.191  1.00 0.97  ? 1580 ARG A CG   4  
ATOM 10465 C CD   . ARG A 1 73  ? -14.427 9.484   -6.402  1.00 1.18  ? 1580 ARG A CD   4  
ATOM 10466 N NE   . ARG A 1 73  ? -15.348 9.709   -7.532  1.00 1.84  ? 1580 ARG A NE   4  
ATOM 10467 C CZ   . ARG A 1 73  ? -15.013 10.165  -8.737  1.00 2.52  ? 1580 ARG A CZ   4  
ATOM 10468 N NH1  . ARG A 1 73  ? -13.743 10.411  -9.035  1.00 2.72  ? 1580 ARG A NH1  4  
ATOM 10469 N NH2  . ARG A 1 73  ? -15.955 10.383  -9.648  1.00 3.47  ? 1580 ARG A NH2  4  
ATOM 10470 H H    . ARG A 1 73  ? -13.485 7.901   -1.573  1.00 0.57  ? 1580 ARG A H    4  
ATOM 10471 H HA   . ARG A 1 73  ? -16.022 8.750   -2.713  1.00 0.73  ? 1580 ARG A HA   4  
ATOM 10472 H HB2  . ARG A 1 73  ? -13.872 9.697   -3.695  1.00 0.91  ? 1580 ARG A HB2  4  
ATOM 10473 H HB3  . ARG A 1 73  ? -13.527 8.073   -4.288  1.00 0.81  ? 1580 ARG A HB3  4  
ATOM 10474 H HG2  . ARG A 1 73  ? -15.715 8.090   -5.425  1.00 1.23  ? 1580 ARG A HG2  4  
ATOM 10475 H HG3  . ARG A 1 73  ? -15.880 9.764   -4.872  1.00 1.23  ? 1580 ARG A HG3  4  
ATOM 10476 H HD2  . ARG A 1 73  ? -13.923 10.407  -6.153  1.00 1.51  ? 1580 ARG A HD2  4  
ATOM 10477 H HD3  . ARG A 1 73  ? -13.697 8.740   -6.683  1.00 1.74  ? 1580 ARG A HD3  4  
ATOM 10478 H HE   . ARG A 1 73  ? -16.304 9.497   -7.328  1.00 2.25  ? 1580 ARG A HE   4  
ATOM 10479 H HH11 . ARG A 1 73  ? -12.979 10.276  -8.385  1.00 2.59  ? 1580 ARG A HH11 4  
ATOM 10480 H HH12 . ARG A 1 73  ? -13.492 10.750  -9.954  1.00 3.38  ? 1580 ARG A HH12 4  
ATOM 10481 H HH21 . ARG A 1 73  ? -16.928 10.220  -9.448  1.00 3.87  ? 1580 ARG A HH21 4  
ATOM 10482 H HH22 . ARG A 1 73  ? -15.739 10.725  -10.566 1.00 4.04  ? 1580 ARG A HH22 4  
ATOM 10483 N N    . LEU A 1 74  ? -16.538 6.284   -2.417  1.00 0.55  ? 1581 LEU A N    4  
ATOM 10484 C CA   . LEU A 1 74  ? -17.101 4.939   -2.583  1.00 0.49  ? 1581 LEU A CA   4  
ATOM 10485 C C    . LEU A 1 74  ? -17.668 4.796   -4.011  1.00 0.46  ? 1581 LEU A C    4  
ATOM 10486 O O    . LEU A 1 74  ? -18.478 5.608   -4.459  1.00 0.51  ? 1581 LEU A O    4  
ATOM 10487 C CB   . LEU A 1 74  ? -18.250 4.716   -1.551  1.00 0.52  ? 1581 LEU A CB   4  
ATOM 10488 C CG   . LEU A 1 74  ? -18.646 3.260   -1.178  1.00 0.51  ? 1581 LEU A CG   4  
ATOM 10489 C CD1  . LEU A 1 74  ? -19.017 2.421   -2.355  1.00 0.64  ? 1581 LEU A CD1  4  
ATOM 10490 C CD2  . LEU A 1 74  ? -17.595 2.567   -0.385  1.00 0.61  ? 1581 LEU A CD2  4  
ATOM 10491 H H    . LEU A 1 74  ? -16.887 6.887   -1.725  1.00 0.66  ? 1581 LEU A H    4  
ATOM 10492 H HA   . LEU A 1 74  ? -16.320 4.212   -2.416  1.00 0.49  ? 1581 LEU A HA   4  
ATOM 10493 H HB2  . LEU A 1 74  ? -17.981 5.214   -0.633  1.00 0.57  ? 1581 LEU A HB2  4  
ATOM 10494 H HB3  . LEU A 1 74  ? -19.152 5.173   -1.942  1.00 0.54  ? 1581 LEU A HB3  4  
ATOM 10495 H HG   . LEU A 1 74  ? -19.529 3.316   -0.559  1.00 0.80  ? 1581 LEU A HG   4  
ATOM 10496 H HD11 . LEU A 1 74  ? -18.202 2.376   -3.061  1.00 1.25  ? 1581 LEU A HD11 4  
ATOM 10497 H HD12 . LEU A 1 74  ? -19.893 2.843   -2.827  1.00 1.20  ? 1581 LEU A HD12 4  
ATOM 10498 H HD13 . LEU A 1 74  ? -19.245 1.428   -2.006  1.00 1.28  ? 1581 LEU A HD13 4  
ATOM 10499 H HD21 . LEU A 1 74  ? -18.009 1.584   -0.208  1.00 1.32  ? 1581 LEU A HD21 4  
ATOM 10500 H HD22 . LEU A 1 74  ? -17.436 3.090   0.546   1.00 1.16  ? 1581 LEU A HD22 4  
ATOM 10501 H HD23 . LEU A 1 74  ? -16.688 2.483   -0.961  1.00 1.21  ? 1581 LEU A HD23 4  
ATOM 10502 N N    . ARG A 1 75  ? -17.230 3.782   -4.701  1.00 0.43  ? 1582 ARG A N    4  
ATOM 10503 C CA   . ARG A 1 75  ? -17.717 3.478   -6.040  1.00 0.43  ? 1582 ARG A CA   4  
ATOM 10504 C C    . ARG A 1 75  ? -18.307 2.068   -6.078  1.00 0.39  ? 1582 ARG A C    4  
ATOM 10505 O O    . ARG A 1 75  ? -17.814 1.175   -5.395  1.00 0.40  ? 1582 ARG A O    4  
ATOM 10506 C CB   . ARG A 1 75  ? -16.587 3.588   -7.069  1.00 0.51  ? 1582 ARG A CB   4  
ATOM 10507 C CG   . ARG A 1 75  ? -16.049 4.981   -7.304  1.00 0.85  ? 1582 ARG A CG   4  
ATOM 10508 C CD   . ARG A 1 75  ? -14.918 4.911   -8.303  1.00 0.89  ? 1582 ARG A CD   4  
ATOM 10509 N NE   . ARG A 1 75  ? -14.366 6.229   -8.662  1.00 1.42  ? 1582 ARG A NE   4  
ATOM 10510 C CZ   . ARG A 1 75  ? -13.091 6.426   -9.039  1.00 1.83  ? 1582 ARG A CZ   4  
ATOM 10511 N NH1  . ARG A 1 75  ? -12.208 5.432   -8.951  1.00 1.54  ? 1582 ARG A NH1  4  
ATOM 10512 N NH2  . ARG A 1 75  ? -12.699 7.614   -9.467  1.00 2.85  ? 1582 ARG A NH2  4  
ATOM 10513 H H    . ARG A 1 75  ? -16.542 3.212   -4.287  1.00 0.43  ? 1582 ARG A H    4  
ATOM 10514 H HA   . ARG A 1 75  ? -18.489 4.198   -6.265  1.00 0.44  ? 1582 ARG A HA   4  
ATOM 10515 H HB2  . ARG A 1 75  ? -15.758 2.992   -6.714  1.00 0.85  ? 1582 ARG A HB2  4  
ATOM 10516 H HB3  . ARG A 1 75  ? -16.895 3.186   -8.023  1.00 0.77  ? 1582 ARG A HB3  4  
ATOM 10517 H HG2  . ARG A 1 75  ? -16.836 5.608   -7.694  1.00 1.16  ? 1582 ARG A HG2  4  
ATOM 10518 H HG3  . ARG A 1 75  ? -15.678 5.385   -6.374  1.00 1.23  ? 1582 ARG A HG3  4  
ATOM 10519 H HD2  . ARG A 1 75  ? -14.131 4.313   -7.863  1.00 1.48  ? 1582 ARG A HD2  4  
ATOM 10520 H HD3  . ARG A 1 75  ? -15.270 4.409   -9.193  1.00 1.27  ? 1582 ARG A HD3  4  
ATOM 10521 H HE   . ARG A 1 75  ? -15.020 6.968   -8.657  1.00 1.90  ? 1582 ARG A HE   4  
ATOM 10522 H HH11 . ARG A 1 75  ? -12.468 4.524   -8.595  1.00 1.41  ? 1582 ARG A HH11 4  
ATOM 10523 H HH12 . ARG A 1 75  ? -11.243 5.492   -9.232  1.00 1.89  ? 1582 ARG A HH12 4  
ATOM 10524 H HH21 . ARG A 1 75  ? -13.317 8.398   -9.534  1.00 3.40  ? 1582 ARG A HH21 4  
ATOM 10525 H HH22 . ARG A 1 75  ? -11.738 7.784   -9.735  1.00 3.24  ? 1582 ARG A HH22 4  
ATOM 10526 N N    . TYR A 1 76  ? -19.352 1.871   -6.855  1.00 0.41  ? 1583 TYR A N    4  
ATOM 10527 C CA   . TYR A 1 76  ? -19.964 0.569   -6.984  1.00 0.41  ? 1583 TYR A CA   4  
ATOM 10528 C C    . TYR A 1 76  ? -19.802 0.060   -8.407  1.00 0.47  ? 1583 TYR A C    4  
ATOM 10529 O O    . TYR A 1 76  ? -20.406 0.592   -9.337  1.00 0.57  ? 1583 TYR A O    4  
ATOM 10530 C CB   . TYR A 1 76  ? -21.439 0.645   -6.556  1.00 0.50  ? 1583 TYR A CB   4  
ATOM 10531 C CG   . TYR A 1 76  ? -22.248 -0.629  -6.726  1.00 0.54  ? 1583 TYR A CG   4  
ATOM 10532 C CD1  . TYR A 1 76  ? -21.965 -1.767  -5.990  1.00 0.56  ? 1583 TYR A CD1  4  
ATOM 10533 C CD2  . TYR A 1 76  ? -23.308 -0.682  -7.624  1.00 0.78  ? 1583 TYR A CD2  4  
ATOM 10534 C CE1  . TYR A 1 76  ? -22.713 -2.913  -6.144  1.00 0.65  ? 1583 TYR A CE1  4  
ATOM 10535 C CE2  . TYR A 1 76  ? -24.056 -1.823  -7.778  1.00 0.86  ? 1583 TYR A CE2  4  
ATOM 10536 C CZ   . TYR A 1 76  ? -23.759 -2.934  -7.039  1.00 0.74  ? 1583 TYR A CZ   4  
ATOM 10537 O OH   . TYR A 1 76  ? -24.509 -4.076  -7.198  1.00 0.84  ? 1583 TYR A OH   4  
ATOM 10538 H H    . TYR A 1 76  ? -19.757 2.601   -7.371  1.00 0.47  ? 1583 TYR A H    4  
ATOM 10539 H HA   . TYR A 1 76  ? -19.440 -0.110  -6.331  1.00 0.36  ? 1583 TYR A HA   4  
ATOM 10540 H HB2  . TYR A 1 76  ? -21.461 0.896   -5.508  1.00 0.49  ? 1583 TYR A HB2  4  
ATOM 10541 H HB3  . TYR A 1 76  ? -21.925 1.435   -7.110  1.00 0.58  ? 1583 TYR A HB3  4  
ATOM 10542 H HD1  . TYR A 1 76  ? -21.146 -1.757  -5.286  1.00 0.69  ? 1583 TYR A HD1  4  
ATOM 10543 H HD2  . TYR A 1 76  ? -23.557 0.188   -8.212  1.00 0.99  ? 1583 TYR A HD2  4  
ATOM 10544 H HE1  . TYR A 1 76  ? -22.476 -3.790  -5.560  1.00 0.79  ? 1583 TYR A HE1  4  
ATOM 10545 H HE2  . TYR A 1 76  ? -24.874 -1.839  -8.483  1.00 1.10  ? 1583 TYR A HE2  4  
ATOM 10546 H HH   . TYR A 1 76  ? -24.704 -4.477  -6.341  1.00 1.26  ? 1583 TYR A HH   4  
ATOM 10547 N N    . VAL A 1 77  ? -18.954 -0.938  -8.567  1.00 0.45  ? 1584 VAL A N    4  
ATOM 10548 C CA   . VAL A 1 77  ? -18.668 -1.518  -9.879  1.00 0.54  ? 1584 VAL A CA   4  
ATOM 10549 C C    . VAL A 1 77  ? -18.909 -3.042  -9.910  1.00 0.59  ? 1584 VAL A C    4  
ATOM 10550 O O    . VAL A 1 77  ? -18.025 -3.838  -9.617  1.00 0.57  ? 1584 VAL A O    4  
ATOM 10551 C CB   . VAL A 1 77  ? -17.224 -1.159  -10.400 1.00 0.58  ? 1584 VAL A CB   4  
ATOM 10552 C CG1  . VAL A 1 77  ? -17.145 0.308   -10.794 1.00 1.05  ? 1584 VAL A CG1  4  
ATOM 10553 C CG2  . VAL A 1 77  ? -16.155 -1.442  -9.344  1.00 1.03  ? 1584 VAL A CG2  4  
ATOM 10554 H H    . VAL A 1 77  ? -18.507 -1.302  -7.767  1.00 0.40  ? 1584 VAL A H    4  
ATOM 10555 H HA   . VAL A 1 77  ? -19.389 -1.078  -10.555 1.00 0.59  ? 1584 VAL A HA   4  
ATOM 10556 H HB   . VAL A 1 77  ? -17.021 -1.768  -11.270 1.00 1.00  ? 1584 VAL A HB   4  
ATOM 10557 H HG11 . VAL A 1 77  ? -16.144 0.537   -11.130 1.00 1.57  ? 1584 VAL A HG11 4  
ATOM 10558 H HG12 . VAL A 1 77  ? -17.383 0.918   -9.935  1.00 1.71  ? 1584 VAL A HG12 4  
ATOM 10559 H HG13 . VAL A 1 77  ? -17.851 0.510   -11.587 1.00 1.47  ? 1584 VAL A HG13 4  
ATOM 10560 H HG21 . VAL A 1 77  ? -16.167 -2.492  -9.093  1.00 1.59  ? 1584 VAL A HG21 4  
ATOM 10561 H HG22 . VAL A 1 77  ? -16.358 -0.859  -8.458  1.00 1.63  ? 1584 VAL A HG22 4  
ATOM 10562 H HG23 . VAL A 1 77  ? -15.183 -1.176  -9.734  1.00 1.49  ? 1584 VAL A HG23 4  
ATOM 10563 N N    . ASP A 1 78  ? -20.134 -3.417  -10.242 1.00 0.69  ? 1585 ASP A N    4  
ATOM 10564 C CA   . ASP A 1 78  ? -20.587 -4.846  -10.375 1.00 0.78  ? 1585 ASP A CA   4  
ATOM 10565 C C    . ASP A 1 78  ? -20.319 -5.626  -9.084  1.00 0.71  ? 1585 ASP A C    4  
ATOM 10566 O O    . ASP A 1 78  ? -19.517 -6.568  -9.032  1.00 0.70  ? 1585 ASP A O    4  
ATOM 10567 C CB   . ASP A 1 78  ? -19.966 -5.561  -11.608 1.00 0.88  ? 1585 ASP A CB   4  
ATOM 10568 C CG   . ASP A 1 78  ? -20.616 -6.909  -11.888 1.00 1.04  ? 1585 ASP A CG   4  
ATOM 10569 O OD1  . ASP A 1 78  ? -21.740 -6.932  -12.435 1.00 1.17  ? 1585 ASP A OD1  4  
ATOM 10570 O OD2  . ASP A 1 78  ? -19.999 -7.962  -11.623 1.00 1.11  ? 1585 ASP A OD2  4  
ATOM 10571 H H    . ASP A 1 78  ? -20.786 -2.690  -10.399 1.00 0.73  ? 1585 ASP A H    4  
ATOM 10572 H HA   . ASP A 1 78  ? -21.661 -4.802  -10.489 1.00 0.88  ? 1585 ASP A HA   4  
ATOM 10573 H HB2  . ASP A 1 78  ? -20.049 -4.964  -12.504 1.00 0.95  ? 1585 ASP A HB2  4  
ATOM 10574 H HB3  . ASP A 1 78  ? -18.919 -5.739  -11.408 1.00 0.83  ? 1585 ASP A HB3  4  
ATOM 10575 N N    . GLN A 1 79  ? -20.922 -5.106  -8.026  1.00 0.72  ? 1586 GLN A N    4  
ATOM 10576 C CA   . GLN A 1 79  ? -20.889 -5.604  -6.639  1.00 0.73  ? 1586 GLN A CA   4  
ATOM 10577 C C    . GLN A 1 79  ? -19.513 -5.560  -6.037  1.00 0.59  ? 1586 GLN A C    4  
ATOM 10578 O O    . GLN A 1 79  ? -19.208 -6.228  -5.052  1.00 0.65  ? 1586 GLN A O    4  
ATOM 10579 C CB   . GLN A 1 79  ? -21.672 -6.922  -6.351  1.00 0.90  ? 1586 GLN A CB   4  
ATOM 10580 C CG   . GLN A 1 79  ? -21.174 -8.192  -7.009  1.00 0.98  ? 1586 GLN A CG   4  
ATOM 10581 C CD   . GLN A 1 79  ? -21.990 -9.412  -6.596  1.00 1.23  ? 1586 GLN A CD   4  
ATOM 10582 O OE1  . GLN A 1 79  ? -21.468 -10.530 -6.527  1.00 1.61  ? 1586 GLN A OE1  4  
ATOM 10583 N NE2  . GLN A 1 79  ? -23.266 -9.229  -6.337  1.00 1.86  ? 1586 GLN A NE2  4  
ATOM 10584 H H    . GLN A 1 79  ? -21.408 -4.276  -8.190  1.00 0.77  ? 1586 GLN A H    4  
ATOM 10585 H HA   . GLN A 1 79  ? -21.393 -4.796  -6.122  1.00 0.80  ? 1586 GLN A HA   4  
ATOM 10586 H HB2  . GLN A 1 79  ? -21.665 -7.104  -5.286  1.00 0.93  ? 1586 GLN A HB2  4  
ATOM 10587 H HB3  . GLN A 1 79  ? -22.697 -6.768  -6.655  1.00 1.05  ? 1586 GLN A HB3  4  
ATOM 10588 H HG2  . GLN A 1 79  ? -21.237 -8.077  -8.081  1.00 1.03  ? 1586 GLN A HG2  4  
ATOM 10589 H HG3  . GLN A 1 79  ? -20.144 -8.349  -6.722  1.00 0.92  ? 1586 GLN A HG3  4  
ATOM 10590 H HE21 . GLN A 1 79  ? -23.642 -8.320  -6.422  1.00 2.43  ? 1586 GLN A HE21 4  
ATOM 10591 H HE22 . GLN A 1 79  ? -23.816 -9.991  -6.059  1.00 2.04  ? 1586 GLN A HE22 4  
ATOM 10592 N N    . VAL A 1 80  ? -18.682 -4.786  -6.663  1.00 0.48  ? 1587 VAL A N    4  
ATOM 10593 C CA   . VAL A 1 80  ? -17.403 -4.463  -6.153  1.00 0.39  ? 1587 VAL A CA   4  
ATOM 10594 C C    . VAL A 1 80  ? -17.504 -3.069  -5.576  1.00 0.32  ? 1587 VAL A C    4  
ATOM 10595 O O    . VAL A 1 80  ? -17.898 -2.118  -6.270  1.00 0.33  ? 1587 VAL A O    4  
ATOM 10596 C CB   . VAL A 1 80  ? -16.294 -4.526  -7.243  1.00 0.41  ? 1587 VAL A CB   4  
ATOM 10597 C CG1  . VAL A 1 80  ? -15.021 -3.862  -6.762  1.00 0.37  ? 1587 VAL A CG1  4  
ATOM 10598 C CG2  . VAL A 1 80  ? -15.995 -5.965  -7.625  1.00 0.49  ? 1587 VAL A CG2  4  
ATOM 10599 H H    . VAL A 1 80  ? -18.956 -4.416  -7.528  1.00 0.53  ? 1587 VAL A H    4  
ATOM 10600 H HA   . VAL A 1 80  ? -17.185 -5.167  -5.362  1.00 0.42  ? 1587 VAL A HA   4  
ATOM 10601 H HB   . VAL A 1 80  ? -16.656 -4.012  -8.122  1.00 0.45  ? 1587 VAL A HB   4  
ATOM 10602 H HG11 . VAL A 1 80  ? -15.274 -2.838  -6.525  1.00 1.01  ? 1587 VAL A HG11 4  
ATOM 10603 H HG12 . VAL A 1 80  ? -14.286 -3.886  -7.553  1.00 1.02  ? 1587 VAL A HG12 4  
ATOM 10604 H HG13 . VAL A 1 80  ? -14.653 -4.364  -5.880  1.00 1.09  ? 1587 VAL A HG13 4  
ATOM 10605 H HG21 . VAL A 1 80  ? -15.216 -5.982  -8.374  1.00 1.13  ? 1587 VAL A HG21 4  
ATOM 10606 H HG22 . VAL A 1 80  ? -16.879 -6.443  -8.021  1.00 1.07  ? 1587 VAL A HG22 4  
ATOM 10607 H HG23 . VAL A 1 80  ? -15.656 -6.506  -6.754  1.00 1.16  ? 1587 VAL A HG23 4  
ATOM 10608 N N    . LEU A 1 81  ? -17.229 -2.973  -4.326  1.00 0.28  ? 1588 LEU A N    4  
ATOM 10609 C CA   . LEU A 1 81  ? -17.289 -1.727  -3.604  1.00 0.25  ? 1588 LEU A CA   4  
ATOM 10610 C C    . LEU A 1 81  ? -15.892 -1.164  -3.561  1.00 0.24  ? 1588 LEU A C    4  
ATOM 10611 O O    . LEU A 1 81  ? -15.019 -1.705  -2.883  1.00 0.28  ? 1588 LEU A O    4  
ATOM 10612 C CB   . LEU A 1 81  ? -17.855 -1.941  -2.172  1.00 0.28  ? 1588 LEU A CB   4  
ATOM 10613 C CG   . LEU A 1 81  ? -19.367 -2.304  -2.014  1.00 0.30  ? 1588 LEU A CG   4  
ATOM 10614 C CD1  . LEU A 1 81  ? -20.238 -1.160  -2.429  1.00 0.29  ? 1588 LEU A CD1  4  
ATOM 10615 C CD2  . LEU A 1 81  ? -19.764 -3.535  -2.801  1.00 0.36  ? 1588 LEU A CD2  4  
ATOM 10616 H H    . LEU A 1 81  ? -16.954 -3.795  -3.862  1.00 0.30  ? 1588 LEU A H    4  
ATOM 10617 H HA   . LEU A 1 81  ? -17.929 -1.051  -4.152  1.00 0.23  ? 1588 LEU A HA   4  
ATOM 10618 H HB2  . LEU A 1 81  ? -17.284 -2.732  -1.711  1.00 0.34  ? 1588 LEU A HB2  4  
ATOM 10619 H HB3  . LEU A 1 81  ? -17.674 -1.035  -1.611  1.00 0.29  ? 1588 LEU A HB3  4  
ATOM 10620 H HG   . LEU A 1 81  ? -19.562 -2.493  -0.969  1.00 0.34  ? 1588 LEU A HG   4  
ATOM 10621 H HD11 . LEU A 1 81  ? -20.138 -0.369  -1.705  1.00 1.02  ? 1588 LEU A HD11 4  
ATOM 10622 H HD12 . LEU A 1 81  ? -21.264 -1.495  -2.485  1.00 1.04  ? 1588 LEU A HD12 4  
ATOM 10623 H HD13 . LEU A 1 81  ? -19.912 -0.810  -3.394  1.00 1.06  ? 1588 LEU A HD13 4  
ATOM 10624 H HD21 . LEU A 1 81  ? -19.733 -3.288  -3.852  1.00 0.97  ? 1588 LEU A HD21 4  
ATOM 10625 H HD22 . LEU A 1 81  ? -20.754 -3.864  -2.526  1.00 1.00  ? 1588 LEU A HD22 4  
ATOM 10626 H HD23 . LEU A 1 81  ? -19.026 -4.299  -2.613  1.00 1.11  ? 1588 LEU A HD23 4  
ATOM 10627 N N    . GLN A 1 82  ? -15.674 -0.128  -4.306  1.00 0.24  ? 1589 GLN A N    4  
ATOM 10628 C CA   . GLN A 1 82  ? -14.349 0.426   -4.464  1.00 0.25  ? 1589 GLN A CA   4  
ATOM 10629 C C    . GLN A 1 82  ? -14.133 1.644   -3.589  1.00 0.24  ? 1589 GLN A C    4  
ATOM 10630 O O    . GLN A 1 82  ? -14.966 2.552   -3.541  1.00 0.36  ? 1589 GLN A O    4  
ATOM 10631 C CB   . GLN A 1 82  ? -14.071 0.801   -5.935  1.00 0.39  ? 1589 GLN A CB   4  
ATOM 10632 C CG   . GLN A 1 82  ? -12.642 1.277   -6.186  1.00 0.48  ? 1589 GLN A CG   4  
ATOM 10633 C CD   . GLN A 1 82  ? -12.429 1.783   -7.592  1.00 0.75  ? 1589 GLN A CD   4  
ATOM 10634 O OE1  . GLN A 1 82  ? -12.600 2.963   -7.870  1.00 1.74  ? 1589 GLN A OE1  4  
ATOM 10635 N NE2  . GLN A 1 82  ? -12.067 0.917   -8.477  1.00 0.66  ? 1589 GLN A NE2  4  
ATOM 10636 H H    . GLN A 1 82  ? -16.452 0.293   -4.740  1.00 0.27  ? 1589 GLN A H    4  
ATOM 10637 H HA   . GLN A 1 82  ? -13.641 -0.336  -4.178  1.00 0.30  ? 1589 GLN A HA   4  
ATOM 10638 H HB2  . GLN A 1 82  ? -14.245 -0.061  -6.561  1.00 0.50  ? 1589 GLN A HB2  4  
ATOM 10639 H HB3  . GLN A 1 82  ? -14.730 1.600   -6.247  1.00 0.46  ? 1589 GLN A HB3  4  
ATOM 10640 H HG2  . GLN A 1 82  ? -12.419 2.080   -5.501  1.00 0.53  ? 1589 GLN A HG2  4  
ATOM 10641 H HG3  . GLN A 1 82  ? -11.965 0.454   -6.005  1.00 0.66  ? 1589 GLN A HG3  4  
ATOM 10642 H HE21 . GLN A 1 82  ? -11.948 -0.018  -8.185  1.00 1.25  ? 1589 GLN A HE21 4  
ATOM 10643 H HE22 . GLN A 1 82  ? -11.924 1.221   -9.395  1.00 0.79  ? 1589 GLN A HE22 4  
ATOM 10644 N N    . LEU A 1 83  ? -13.037 1.622   -2.898  1.00 0.25  ? 1590 LEU A N    4  
ATOM 10645 C CA   . LEU A 1 83  ? -12.522 2.737   -2.148  1.00 0.30  ? 1590 LEU A CA   4  
ATOM 10646 C C    . LEU A 1 83  ? -11.104 2.962   -2.622  1.00 0.30  ? 1590 LEU A C    4  
ATOM 10647 O O    . LEU A 1 83  ? -10.191 2.200   -2.282  1.00 0.37  ? 1590 LEU A O    4  
ATOM 10648 C CB   . LEU A 1 83  ? -12.527 2.460   -0.635  1.00 0.37  ? 1590 LEU A CB   4  
ATOM 10649 C CG   . LEU A 1 83  ? -13.764 2.864   0.150   1.00 0.41  ? 1590 LEU A CG   4  
ATOM 10650 C CD1  . LEU A 1 83  ? -13.621 2.375   1.572   1.00 0.56  ? 1590 LEU A CD1  4  
ATOM 10651 C CD2  . LEU A 1 83  ? -13.888 4.374   0.162   1.00 0.72  ? 1590 LEU A CD2  4  
ATOM 10652 H H    . LEU A 1 83  ? -12.514 0.787   -2.885  1.00 0.30  ? 1590 LEU A H    4  
ATOM 10653 H HA   . LEU A 1 83  ? -13.143 3.590   -2.384  1.00 0.31  ? 1590 LEU A HA   4  
ATOM 10654 H HB2  . LEU A 1 83  ? -12.429 1.392   -0.517  1.00 0.57  ? 1590 LEU A HB2  4  
ATOM 10655 H HB3  . LEU A 1 83  ? -11.672 2.933   -0.174  1.00 0.64  ? 1590 LEU A HB3  4  
ATOM 10656 H HG   . LEU A 1 83  ? -14.656 2.445   -0.292  1.00 0.76  ? 1590 LEU A HG   4  
ATOM 10657 H HD11 . LEU A 1 83  ? -14.496 2.647   2.143   1.00 1.11  ? 1590 LEU A HD11 4  
ATOM 10658 H HD12 . LEU A 1 83  ? -12.745 2.839   2.002   1.00 1.26  ? 1590 LEU A HD12 4  
ATOM 10659 H HD13 . LEU A 1 83  ? -13.499 1.303   1.564   1.00 1.16  ? 1590 LEU A HD13 4  
ATOM 10660 H HD21 . LEU A 1 83  ? -13.955 4.755   -0.846  1.00 1.30  ? 1590 LEU A HD21 4  
ATOM 10661 H HD22 . LEU A 1 83  ? -13.005 4.764   0.648   1.00 1.23  ? 1590 LEU A HD22 4  
ATOM 10662 H HD23 . LEU A 1 83  ? -14.759 4.661   0.733   1.00 1.40  ? 1590 LEU A HD23 4  
ATOM 10663 N N    . VAL A 1 84  ? -10.926 3.946   -3.443  1.00 0.31  ? 1591 VAL A N    4  
ATOM 10664 C CA   . VAL A 1 84  ? -9.631  4.208   -3.998  1.00 0.31  ? 1591 VAL A CA   4  
ATOM 10665 C C    . VAL A 1 84  ? -8.907  5.293   -3.172  1.00 0.31  ? 1591 VAL A C    4  
ATOM 10666 O O    . VAL A 1 84  ? -9.454  6.378   -2.907  1.00 0.38  ? 1591 VAL A O    4  
ATOM 10667 C CB   . VAL A 1 84  ? -9.715  4.552   -5.530  1.00 0.35  ? 1591 VAL A CB   4  
ATOM 10668 C CG1  . VAL A 1 84  ? -10.266 5.934   -5.809  1.00 1.01  ? 1591 VAL A CG1  4  
ATOM 10669 C CG2  . VAL A 1 84  ? -8.392  4.317   -6.244  1.00 0.81  ? 1591 VAL A CG2  4  
ATOM 10670 H H    . VAL A 1 84  ? -11.686 4.520   -3.664  1.00 0.39  ? 1591 VAL A H    4  
ATOM 10671 H HA   . VAL A 1 84  ? -9.058  3.303   -3.884  1.00 0.29  ? 1591 VAL A HA   4  
ATOM 10672 H HB   . VAL A 1 84  ? -10.432 3.851   -5.937  1.00 0.74  ? 1591 VAL A HB   4  
ATOM 10673 H HG11 . VAL A 1 84  ? -11.296 6.018   -5.502  1.00 1.70  ? 1591 VAL A HG11 4  
ATOM 10674 H HG12 . VAL A 1 84  ? -10.172 6.158   -6.861  1.00 1.50  ? 1591 VAL A HG12 4  
ATOM 10675 H HG13 . VAL A 1 84  ? -9.660  6.609   -5.223  1.00 1.49  ? 1591 VAL A HG13 4  
ATOM 10676 H HG21 . VAL A 1 84  ? -7.620  4.943   -5.823  1.00 1.29  ? 1591 VAL A HG21 4  
ATOM 10677 H HG22 . VAL A 1 84  ? -8.518  4.545   -7.291  1.00 1.42  ? 1591 VAL A HG22 4  
ATOM 10678 H HG23 . VAL A 1 84  ? -8.119  3.275   -6.147  1.00 1.49  ? 1591 VAL A HG23 4  
ATOM 10679 N N    . TYR A 1 85  ? -7.714  4.977   -2.729  1.00 0.27  ? 1592 TYR A N    4  
ATOM 10680 C CA   . TYR A 1 85  ? -6.924  5.871   -1.914  1.00 0.27  ? 1592 TYR A CA   4  
ATOM 10681 C C    . TYR A 1 85  ? -5.676  6.206   -2.672  1.00 0.29  ? 1592 TYR A C    4  
ATOM 10682 O O    . TYR A 1 85  ? -4.810  5.356   -2.877  1.00 0.50  ? 1592 TYR A O    4  
ATOM 10683 C CB   . TYR A 1 85  ? -6.539  5.255   -0.545  1.00 0.25  ? 1592 TYR A CB   4  
ATOM 10684 C CG   . TYR A 1 85  ? -7.629  5.151   0.532   1.00 0.23  ? 1592 TYR A CG   4  
ATOM 10685 C CD1  . TYR A 1 85  ? -8.896  5.653   0.270   1.00 0.31  ? 1592 TYR A CD1  4  
ATOM 10686 C CD2  . TYR A 1 85  ? -7.422  4.540   1.772   1.00 0.30  ? 1592 TYR A CD2  4  
ATOM 10687 C CE1  . TYR A 1 85  ? -9.913  5.562   1.195   1.00 0.34  ? 1592 TYR A CE1  4  
ATOM 10688 C CE2  . TYR A 1 85  ? -8.445  4.451   2.701   1.00 0.33  ? 1592 TYR A CE2  4  
ATOM 10689 C CZ   . TYR A 1 85  ? -9.522  4.963   2.567   1.00 0.31  ? 1592 TYR A CZ   4  
ATOM 10690 O OH   . TYR A 1 85  ? -10.715 4.899   3.316   1.00 0.38  ? 1592 TYR A OH   4  
ATOM 10691 H H    . TYR A 1 85  ? -7.288  4.129   -2.997  1.00 0.28  ? 1592 TYR A H    4  
ATOM 10692 H HA   . TYR A 1 85  ? -7.495  6.776   -1.755  1.00 0.29  ? 1592 TYR A HA   4  
ATOM 10693 H HB2  . TYR A 1 85  ? -6.179  4.251   -0.716  1.00 0.25  ? 1592 TYR A HB2  4  
ATOM 10694 H HB3  . TYR A 1 85  ? -5.725  5.836   -0.136  1.00 0.27  ? 1592 TYR A HB3  4  
ATOM 10695 H HD1  . TYR A 1 85  ? -9.086  6.128   -0.681  1.00 0.41  ? 1592 TYR A HD1  4  
ATOM 10696 H HD2  . TYR A 1 85  ? -6.457  4.132   2.030   1.00 0.40  ? 1592 TYR A HD2  4  
ATOM 10697 H HE1  . TYR A 1 85  ? -10.898 5.944   0.973   1.00 0.46  ? 1592 TYR A HE1  4  
ATOM 10698 H HE2  . TYR A 1 85  ? -8.264  3.971   3.651   1.00 0.43  ? 1592 TYR A HE2  4  
ATOM 10699 H HH   . TYR A 1 85  ? -11.519 4.907   2.778   1.00 1.08  ? 1592 TYR A HH   4  
ATOM 10700 N N    . LYS A 1 86  ? -5.589  7.414   -3.090  1.00 0.33  ? 1593 LYS A N    4  
ATOM 10701 C CA   . LYS A 1 86  ? -4.488  7.872   -3.880  1.00 0.36  ? 1593 LYS A CA   4  
ATOM 10702 C C    . LYS A 1 86  ? -3.949  9.144   -3.293  1.00 0.37  ? 1593 LYS A C    4  
ATOM 10703 O O    . LYS A 1 86  ? -4.444  9.593   -2.250  1.00 0.40  ? 1593 LYS A O    4  
ATOM 10704 C CB   . LYS A 1 86  ? -4.925  8.088   -5.333  1.00 0.46  ? 1593 LYS A CB   4  
ATOM 10705 C CG   . LYS A 1 86  ? -6.119  9.011   -5.499  1.00 0.57  ? 1593 LYS A CG   4  
ATOM 10706 C CD   . LYS A 1 86  ? -6.360  9.314   -6.956  1.00 0.90  ? 1593 LYS A CD   4  
ATOM 10707 C CE   . LYS A 1 86  ? -7.569  10.205  -7.148  1.00 0.99  ? 1593 LYS A CE   4  
ATOM 10708 N NZ   . LYS A 1 86  ? -7.612  10.773  -8.509  1.00 1.59  ? 1593 LYS A NZ   4  
ATOM 10709 H H    . LYS A 1 86  ? -6.277  8.058   -2.828  1.00 0.51  ? 1593 LYS A H    4  
ATOM 10710 H HA   . LYS A 1 86  ? -3.719  7.114   -3.856  1.00 0.38  ? 1593 LYS A HA   4  
ATOM 10711 H HB2  . LYS A 1 86  ? -4.100  8.505   -5.893  1.00 0.55  ? 1593 LYS A HB2  4  
ATOM 10712 H HB3  . LYS A 1 86  ? -5.177  7.128   -5.759  1.00 0.49  ? 1593 LYS A HB3  4  
ATOM 10713 H HG2  . LYS A 1 86  ? -6.993  8.542   -5.077  1.00 0.91  ? 1593 LYS A HG2  4  
ATOM 10714 H HG3  . LYS A 1 86  ? -5.924  9.936   -4.975  1.00 0.87  ? 1593 LYS A HG3  4  
ATOM 10715 H HD2  . LYS A 1 86  ? -5.492  9.814   -7.359  1.00 1.53  ? 1593 LYS A HD2  4  
ATOM 10716 H HD3  . LYS A 1 86  ? -6.520  8.386   -7.484  1.00 1.50  ? 1593 LYS A HD3  4  
ATOM 10717 H HE2  . LYS A 1 86  ? -8.463  9.620   -6.989  1.00 1.55  ? 1593 LYS A HE2  4  
ATOM 10718 H HE3  . LYS A 1 86  ? -7.531  11.009  -6.428  1.00 1.51  ? 1593 LYS A HE3  4  
ATOM 10719 H HZ1  . LYS A 1 86  ? -6.771  11.378  -8.638  1.00 1.91  ? 1593 LYS A HZ1  4  
ATOM 10720 H HZ2  . LYS A 1 86  ? -8.473  11.345  -8.644  1.00 2.21  ? 1593 LYS A HZ2  4  
ATOM 10721 H HZ3  . LYS A 1 86  ? -7.604  10.047  -9.255  1.00 2.06  ? 1593 LYS A HZ3  4  
ATOM 10722 N N    . ASP A 1 87  ? -2.929  9.697   -3.937  1.00 0.44  ? 1594 ASP A N    4  
ATOM 10723 C CA   . ASP A 1 87  ? -2.285  10.944  -3.531  1.00 0.51  ? 1594 ASP A CA   4  
ATOM 10724 C C    . ASP A 1 87  ? -1.682  10.797  -2.158  1.00 0.42  ? 1594 ASP A C    4  
ATOM 10725 O O    . ASP A 1 87  ? -1.816  11.665  -1.286  1.00 0.53  ? 1594 ASP A O    4  
ATOM 10726 C CB   . ASP A 1 87  ? -3.234  12.166  -3.612  1.00 0.70  ? 1594 ASP A CB   4  
ATOM 10727 C CG   . ASP A 1 87  ? -3.624  12.548  -5.030  1.00 0.93  ? 1594 ASP A CG   4  
ATOM 10728 O OD1  . ASP A 1 87  ? -2.814  13.195  -5.733  1.00 1.11  ? 1594 ASP A OD1  4  
ATOM 10729 O OD2  . ASP A 1 87  ? -4.773  12.259  -5.455  1.00 1.05  ? 1594 ASP A OD2  4  
ATOM 10730 H H    . ASP A 1 87  ? -2.558  9.225   -4.721  1.00 0.50  ? 1594 ASP A H    4  
ATOM 10731 H HA   . ASP A 1 87  ? -1.465  11.091  -4.219  1.00 0.60  ? 1594 ASP A HA   4  
ATOM 10732 H HB2  . ASP A 1 87  ? -4.139  11.933  -3.071  1.00 0.69  ? 1594 ASP A HB2  4  
ATOM 10733 H HB3  . ASP A 1 87  ? -2.753  13.013  -3.144  1.00 0.78  ? 1594 ASP A HB3  4  
ATOM 10734 N N    . GLY A 1 88  ? -1.037  9.663   -1.960  1.00 0.41  ? 1595 GLY A N    4  
ATOM 10735 C CA   . GLY A 1 88  ? -0.388  9.383   -0.715  1.00 0.48  ? 1595 GLY A CA   4  
ATOM 10736 C C    . GLY A 1 88  ? 1.044   9.848   -0.738  1.00 0.53  ? 1595 GLY A C    4  
ATOM 10737 O O    . GLY A 1 88  ? 1.338   10.950  -1.227  1.00 0.78  ? 1595 GLY A O    4  
ATOM 10738 H H    . GLY A 1 88  ? -1.003  9.015   -2.695  1.00 0.49  ? 1595 GLY A H    4  
ATOM 10739 H HA2  . GLY A 1 88  ? -0.919  9.895   0.075   1.00 0.54  ? 1595 GLY A HA2  4  
ATOM 10740 H HA3  . GLY A 1 88  ? -0.417  8.319   -0.533  1.00 0.56  ? 1595 GLY A HA3  4  
ATOM 10741 N N    . SER A 1 89  ? 1.938   9.021   -0.274  1.00 0.44  ? 1596 SER A N    4  
ATOM 10742 C CA   . SER A 1 89  ? 3.324   9.379   -0.223  1.00 0.50  ? 1596 SER A CA   4  
ATOM 10743 C C    . SER A 1 89  ? 3.960   9.045   -1.562  1.00 0.47  ? 1596 SER A C    4  
ATOM 10744 O O    . SER A 1 89  ? 3.502   8.118   -2.268  1.00 0.44  ? 1596 SER A O    4  
ATOM 10745 C CB   . SER A 1 89  ? 4.001   8.591   0.906   1.00 0.68  ? 1596 SER A CB   4  
ATOM 10746 O OG   . SER A 1 89  ? 5.374   8.937   1.100   1.00 1.07  ? 1596 SER A OG   4  
ATOM 10747 H H    . SER A 1 89  ? 1.689   8.121   0.024   1.00 0.47  ? 1596 SER A H    4  
ATOM 10748 H HA   . SER A 1 89  ? 3.410   10.437  -0.023  1.00 0.57  ? 1596 SER A HA   4  
ATOM 10749 H HB2  . SER A 1 89  ? 3.471   8.762   1.831   1.00 1.17  ? 1596 SER A HB2  4  
ATOM 10750 H HB3  . SER A 1 89  ? 3.943   7.543   0.655   1.00 1.13  ? 1596 SER A HB3  4  
ATOM 10751 H HG   . SER A 1 89  ? 5.913   8.374   0.531   1.00 1.36  ? 1596 SER A HG   4  
ATOM 10752 N N    . PRO A 1 90  ? 4.965   9.827   -1.969  1.00 0.56  ? 1597 PRO A N    4  
ATOM 10753 C CA   . PRO A 1 90  ? 5.730   9.549   -3.160  1.00 0.62  ? 1597 PRO A CA   4  
ATOM 10754 C C    . PRO A 1 90  ? 6.465   8.224   -3.001  1.00 0.59  ? 1597 PRO A C    4  
ATOM 10755 O O    . PRO A 1 90  ? 6.973   7.909   -1.910  1.00 0.70  ? 1597 PRO A O    4  
ATOM 10756 C CB   . PRO A 1 90  ? 6.732   10.709  -3.238  1.00 0.80  ? 1597 PRO A CB   4  
ATOM 10757 C CG   . PRO A 1 90  ? 6.164   11.773  -2.372  1.00 1.01  ? 1597 PRO A CG   4  
ATOM 10758 C CD   . PRO A 1 90  ? 5.419   11.062  -1.298  1.00 0.66  ? 1597 PRO A CD   4  
ATOM 10759 H HA   . PRO A 1 90  ? 5.108   9.522   -4.043  1.00 0.65  ? 1597 PRO A HA   4  
ATOM 10760 H HB2  . PRO A 1 90  ? 7.693   10.376  -2.874  1.00 0.86  ? 1597 PRO A HB2  4  
ATOM 10761 H HB3  . PRO A 1 90  ? 6.824   11.040  -4.262  1.00 0.90  ? 1597 PRO A HB3  4  
ATOM 10762 H HG2  . PRO A 1 90  ? 6.960   12.367  -1.948  1.00 1.35  ? 1597 PRO A HG2  4  
ATOM 10763 H HG3  . PRO A 1 90  ? 5.494   12.397  -2.946  1.00 1.40  ? 1597 PRO A HG3  4  
ATOM 10764 H HD2  . PRO A 1 90  ? 6.076   10.835  -0.472  1.00 0.75  ? 1597 PRO A HD2  4  
ATOM 10765 H HD3  . PRO A 1 90  ? 4.576   11.650  -0.966  1.00 0.79  ? 1597 PRO A HD3  4  
ATOM 10766 N N    . CYS A 1 91  ? 6.496   7.475   -4.056  1.00 0.52  ? 1598 CYS A N    4  
ATOM 10767 C CA   . CYS A 1 91  ? 7.105   6.167   -4.108  1.00 0.53  ? 1598 CYS A CA   4  
ATOM 10768 C C    . CYS A 1 91  ? 8.615   6.362   -4.257  1.00 0.71  ? 1598 CYS A C    4  
ATOM 10769 O O    . CYS A 1 91  ? 9.079   6.824   -5.290  1.00 0.75  ? 1598 CYS A O    4  
ATOM 10770 C CB   . CYS A 1 91  ? 6.512   5.414   -5.337  1.00 0.51  ? 1598 CYS A CB   4  
ATOM 10771 S SG   . CYS A 1 91  ? 6.983   3.659   -5.523  1.00 0.54  ? 1598 CYS A SG   4  
ATOM 10772 H H    . CYS A 1 91  ? 6.109   7.833   -4.890  1.00 0.52  ? 1598 CYS A H    4  
ATOM 10773 H HA   . CYS A 1 91  ? 6.878   5.625   -3.201  1.00 0.54  ? 1598 CYS A HA   4  
ATOM 10774 H HB2  . CYS A 1 91  ? 5.435   5.435   -5.262  1.00 0.52  ? 1598 CYS A HB2  4  
ATOM 10775 H HB3  . CYS A 1 91  ? 6.799   5.925   -6.246  1.00 0.60  ? 1598 CYS A HB3  4  
ATOM 10776 N N    . PRO A 1 92  ? 9.402   6.038   -3.199  1.00 0.90  ? 1599 PRO A N    4  
ATOM 10777 C CA   . PRO A 1 92  ? 10.867  6.247   -3.185  1.00 1.18  ? 1599 PRO A CA   4  
ATOM 10778 C C    . PRO A 1 92  ? 11.561  5.502   -4.319  1.00 1.35  ? 1599 PRO A C    4  
ATOM 10779 O O    . PRO A 1 92  ? 12.539  5.989   -4.897  1.00 1.70  ? 1599 PRO A O    4  
ATOM 10780 C CB   . PRO A 1 92  ? 11.299  5.670   -1.826  1.00 1.28  ? 1599 PRO A CB   4  
ATOM 10781 C CG   . PRO A 1 92  ? 10.070  5.706   -0.993  1.00 1.18  ? 1599 PRO A CG   4  
ATOM 10782 C CD   . PRO A 1 92  ? 8.939   5.434   -1.934  1.00 0.93  ? 1599 PRO A CD   4  
ATOM 10783 H HA   . PRO A 1 92  ? 11.118  7.297   -3.235  1.00 1.31  ? 1599 PRO A HA   4  
ATOM 10784 H HB2  . PRO A 1 92  ? 11.661  4.661   -1.958  1.00 1.41  ? 1599 PRO A HB2  4  
ATOM 10785 H HB3  . PRO A 1 92  ? 12.078  6.287   -1.404  1.00 1.45  ? 1599 PRO A HB3  4  
ATOM 10786 H HG2  . PRO A 1 92  ? 10.120  4.942   -0.231  1.00 1.37  ? 1599 PRO A HG2  4  
ATOM 10787 H HG3  . PRO A 1 92  ? 9.956   6.681   -0.543  1.00 1.36  ? 1599 PRO A HG3  4  
ATOM 10788 H HD2  . PRO A 1 92  ? 8.787   4.370   -2.046  1.00 0.99  ? 1599 PRO A HD2  4  
ATOM 10789 H HD3  . PRO A 1 92  ? 8.035   5.913   -1.590  1.00 0.91  ? 1599 PRO A HD3  4  
ATOM 10790 N N    . SER A 1 93  ? 11.017  4.353   -4.645  1.00 1.31  ? 1600 SER A N    4  
ATOM 10791 C CA   . SER A 1 93  ? 11.491  3.474   -5.678  1.00 1.59  ? 1600 SER A CA   4  
ATOM 10792 C C    . SER A 1 93  ? 11.484  4.130   -7.093  1.00 1.38  ? 1600 SER A C    4  
ATOM 10793 O O    . SER A 1 93  ? 12.215  3.683   -7.998  1.00 1.40  ? 1600 SER A O    4  
ATOM 10794 C CB   . SER A 1 93  ? 10.587  2.269   -5.644  1.00 1.93  ? 1600 SER A CB   4  
ATOM 10795 O OG   . SER A 1 93  ? 10.394  1.855   -4.287  1.00 2.26  ? 1600 SER A OG   4  
ATOM 10796 H H    . SER A 1 93  ? 10.251  4.010   -4.137  1.00 1.26  ? 1600 SER A H    4  
ATOM 10797 H HA   . SER A 1 93  ? 12.489  3.144   -5.433  1.00 1.89  ? 1600 SER A HA   4  
ATOM 10798 H HB2  . SER A 1 93  ? 9.631   2.521   -6.079  1.00 1.88  ? 1600 SER A HB2  4  
ATOM 10799 H HB3  . SER A 1 93  ? 11.039  1.457   -6.192  1.00 2.21  ? 1600 SER A HB3  4  
ATOM 10800 H HG   . SER A 1 93  ? 11.064  1.209   -4.046  1.00 2.80  ? 1600 SER A HG   4  
ATOM 10801 N N    . LYS A 1 94  ? 10.668  5.164   -7.292  1.00 1.28  ? 1601 LYS A N    4  
ATOM 10802 C CA   . LYS A 1 94  ? 10.636  5.854   -8.570  1.00 1.26  ? 1601 LYS A CA   4  
ATOM 10803 C C    . LYS A 1 94  ? 10.089  7.273   -8.395  1.00 1.10  ? 1601 LYS A C    4  
ATOM 10804 O O    . LYS A 1 94  ? 8.943   7.461   -7.958  1.00 0.94  ? 1601 LYS A O    4  
ATOM 10805 C CB   . LYS A 1 94  ? 9.794   5.086   -9.601  1.00 1.44  ? 1601 LYS A CB   4  
ATOM 10806 C CG   . LYS A 1 94  ? 9.758   5.717   -11.003 1.00 1.77  ? 1601 LYS A CG   4  
ATOM 10807 C CD   . LYS A 1 94  ? 11.120  5.699   -11.704 1.00 2.13  ? 1601 LYS A CD   4  
ATOM 10808 C CE   . LYS A 1 94  ? 11.620  4.279   -11.960 1.00 2.60  ? 1601 LYS A CE   4  
ATOM 10809 N NZ   . LYS A 1 94  ? 10.718  3.526   -12.862 1.00 3.01  ? 1601 LYS A NZ   4  
ATOM 10810 H H    . LYS A 1 94  ? 10.084  5.488   -6.571  1.00 1.31  ? 1601 LYS A H    4  
ATOM 10811 H HA   . LYS A 1 94  ? 11.666  5.866   -8.893  1.00 1.40  ? 1601 LYS A HA   4  
ATOM 10812 H HB2  . LYS A 1 94  ? 10.191  4.087   -9.694  1.00 1.70  ? 1601 LYS A HB2  4  
ATOM 10813 H HB3  . LYS A 1 94  ? 8.780   5.023   -9.235  1.00 1.38  ? 1601 LYS A HB3  4  
ATOM 10814 H HG2  . LYS A 1 94  ? 9.053   5.170   -11.613 1.00 2.10  ? 1601 LYS A HG2  4  
ATOM 10815 H HG3  . LYS A 1 94  ? 9.425   6.740   -10.909 1.00 2.13  ? 1601 LYS A HG3  4  
ATOM 10816 H HD2  . LYS A 1 94  ? 11.003  6.184   -12.663 1.00 2.59  ? 1601 LYS A HD2  4  
ATOM 10817 H HD3  . LYS A 1 94  ? 11.855  6.245   -11.133 1.00 2.51  ? 1601 LYS A HD3  4  
ATOM 10818 H HE2  . LYS A 1 94  ? 12.602  4.334   -12.407 1.00 3.03  ? 1601 LYS A HE2  4  
ATOM 10819 H HE3  . LYS A 1 94  ? 11.686  3.763   -11.013 1.00 3.02  ? 1601 LYS A HE3  4  
ATOM 10820 H HZ1  . LYS A 1 94  ? 10.507  4.087   -13.717 1.00 3.45  ? 1601 LYS A HZ1  4  
ATOM 10821 H HZ2  . LYS A 1 94  ? 9.812   3.274   -12.407 1.00 3.26  ? 1601 LYS A HZ2  4  
ATOM 10822 H HZ3  . LYS A 1 94  ? 11.164  2.640   -13.179 1.00 3.29  ? 1601 LYS A HZ3  4  
ATOM 10823 N N    . SER A 1 95  ? 10.880  8.260   -8.753  1.00 1.23  ? 1602 SER A N    4  
ATOM 10824 C CA   . SER A 1 95  ? 10.504  9.614   -8.600  1.00 1.24  ? 1602 SER A CA   4  
ATOM 10825 C C    . SER A 1 95  ? 9.392   9.956   -9.595  1.00 1.14  ? 1602 SER A C    4  
ATOM 10826 O O    . SER A 1 95  ? 9.460   9.576   -10.777 1.00 1.25  ? 1602 SER A O    4  
ATOM 10827 C CB   . SER A 1 95  ? 11.719  10.500  -8.822  1.00 1.53  ? 1602 SER A CB   4  
ATOM 10828 O OG   . SER A 1 95  ? 12.798  10.095  -7.963  1.00 2.07  ? 1602 SER A OG   4  
ATOM 10829 H H    . SER A 1 95  ? 11.748  8.100   -9.165  1.00 1.39  ? 1602 SER A H    4  
ATOM 10830 H HA   . SER A 1 95  ? 10.201  9.714   -7.568  1.00 1.24  ? 1602 SER A HA   4  
ATOM 10831 H HB2  . SER A 1 95  ? 12.038  10.423  -9.851  1.00 1.93  ? 1602 SER A HB2  4  
ATOM 10832 H HB3  . SER A 1 95  ? 11.463  11.526  -8.597  1.00 1.67  ? 1602 SER A HB3  4  
ATOM 10833 H HG   . SER A 1 95  ? 12.405  9.641   -7.196  1.00 2.44  ? 1602 SER A HG   4  
ATOM 10834 N N    . GLY A 1 96  ? 8.380   10.619  -9.116  1.00 1.06  ? 1603 GLY A N    4  
ATOM 10835 C CA   . GLY A 1 96  ? 7.263   10.981  -9.944  1.00 1.08  ? 1603 GLY A CA   4  
ATOM 10836 C C    . GLY A 1 96  ? 6.041   10.131  -9.666  1.00 0.95  ? 1603 GLY A C    4  
ATOM 10837 O O    . GLY A 1 96  ? 4.925   10.490  -10.042 1.00 1.06  ? 1603 GLY A O    4  
ATOM 10838 H H    . GLY A 1 96  ? 8.385   10.892  -8.175  1.00 1.07  ? 1603 GLY A H    4  
ATOM 10839 H HA2  . GLY A 1 96  ? 7.016   12.018  -9.766  1.00 1.20  ? 1603 GLY A HA2  4  
ATOM 10840 H HA3  . GLY A 1 96  ? 7.542   10.861  -10.980 1.00 1.20  ? 1603 GLY A HA3  4  
ATOM 10841 N N    . LEU A 1 97  ? 6.229   9.017   -9.014  1.00 0.81  ? 1604 LEU A N    4  
ATOM 10842 C CA   . LEU A 1 97  ? 5.130   8.143   -8.719  1.00 0.78  ? 1604 LEU A CA   4  
ATOM 10843 C C    . LEU A 1 97  ? 4.717   8.284   -7.273  1.00 0.60  ? 1604 LEU A C    4  
ATOM 10844 O O    . LEU A 1 97  ? 5.558   8.399   -6.387  1.00 0.64  ? 1604 LEU A O    4  
ATOM 10845 C CB   . LEU A 1 97  ? 5.504   6.689   -8.990  1.00 1.01  ? 1604 LEU A CB   4  
ATOM 10846 C CG   . LEU A 1 97  ? 6.050   6.356   -10.379 1.00 1.11  ? 1604 LEU A CG   4  
ATOM 10847 C CD1  . LEU A 1 97  ? 6.298   4.876   -10.484 1.00 1.84  ? 1604 LEU A CD1  4  
ATOM 10848 C CD2  . LEU A 1 97  ? 5.120   6.823   -11.486 1.00 1.51  ? 1604 LEU A CD2  4  
ATOM 10849 H H    . LEU A 1 97  ? 7.123   8.758   -8.712  1.00 0.82  ? 1604 LEU A H    4  
ATOM 10850 H HA   . LEU A 1 97  ? 4.294   8.407   -9.347  1.00 0.90  ? 1604 LEU A HA   4  
ATOM 10851 H HB2  . LEU A 1 97  ? 6.251   6.399   -8.266  1.00 1.67  ? 1604 LEU A HB2  4  
ATOM 10852 H HB3  . LEU A 1 97  ? 4.625   6.086   -8.823  1.00 1.47  ? 1604 LEU A HB3  4  
ATOM 10853 H HG   . LEU A 1 97  ? 7.005   6.851   -10.497 1.00 1.88  ? 1604 LEU A HG   4  
ATOM 10854 H HD11 . LEU A 1 97  ? 5.382   4.345   -10.275 1.00 2.23  ? 1604 LEU A HD11 4  
ATOM 10855 H HD12 . LEU A 1 97  ? 7.055   4.588   -9.770  1.00 2.37  ? 1604 LEU A HD12 4  
ATOM 10856 H HD13 . LEU A 1 97  ? 6.634   4.636   -11.482 1.00 2.38  ? 1604 LEU A HD13 4  
ATOM 10857 H HD21 . LEU A 1 97  ? 5.040   7.899   -11.457 1.00 1.94  ? 1604 LEU A HD21 4  
ATOM 10858 H HD22 . LEU A 1 97  ? 4.143   6.381   -11.357 1.00 2.01  ? 1604 LEU A HD22 4  
ATOM 10859 H HD23 . LEU A 1 97  ? 5.532   6.523   -12.439 1.00 2.05  ? 1604 LEU A HD23 4  
ATOM 10860 N N    . SER A 1 98  ? 3.448   8.292   -7.045  1.00 0.57  ? 1605 SER A N    4  
ATOM 10861 C CA   . SER A 1 98  ? 2.893   8.325   -5.717  1.00 0.45  ? 1605 SER A CA   4  
ATOM 10862 C C    . SER A 1 98  ? 2.123   7.020   -5.502  1.00 0.39  ? 1605 SER A C    4  
ATOM 10863 O O    . SER A 1 98  ? 1.576   6.446   -6.467  1.00 0.46  ? 1605 SER A O    4  
ATOM 10864 C CB   . SER A 1 98  ? 1.969   9.539   -5.599  1.00 0.52  ? 1605 SER A CB   4  
ATOM 10865 O OG   . SER A 1 98  ? 2.672   10.725  -5.962  1.00 1.41  ? 1605 SER A OG   4  
ATOM 10866 H H    . SER A 1 98  ? 2.831   8.285   -7.812  1.00 0.71  ? 1605 SER A H    4  
ATOM 10867 H HA   . SER A 1 98  ? 3.698   8.402   -5.000  1.00 0.43  ? 1605 SER A HA   4  
ATOM 10868 H HB2  . SER A 1 98  ? 1.111   9.402   -6.237  1.00 1.11  ? 1605 SER A HB2  4  
ATOM 10869 H HB3  . SER A 1 98  ? 1.627   9.647   -4.580  1.00 1.16  ? 1605 SER A HB3  4  
ATOM 10870 H HG   . SER A 1 98  ? 2.596   10.852  -6.921  1.00 1.96  ? 1605 SER A HG   4  
ATOM 10871 N N    . TYR A 1 99  ? 2.115   6.530   -4.272  1.00 0.32  ? 1606 TYR A N    4  
ATOM 10872 C CA   . TYR A 1 99  ? 1.457   5.293   -3.945  1.00 0.28  ? 1606 TYR A CA   4  
ATOM 10873 C C    . TYR A 1 99  ? -0.059  5.429   -4.019  1.00 0.27  ? 1606 TYR A C    4  
ATOM 10874 O O    . TYR A 1 99  ? -0.602  6.520   -3.777  1.00 0.32  ? 1606 TYR A O    4  
ATOM 10875 C CB   . TYR A 1 99  ? 1.838   4.859   -2.549  1.00 0.27  ? 1606 TYR A CB   4  
ATOM 10876 C CG   . TYR A 1 99  ? 3.230   4.311   -2.385  1.00 0.32  ? 1606 TYR A CG   4  
ATOM 10877 C CD1  . TYR A 1 99  ? 3.586   3.095   -2.943  1.00 0.41  ? 1606 TYR A CD1  4  
ATOM 10878 C CD2  . TYR A 1 99  ? 4.205   5.041   -1.720  1.00 0.37  ? 1606 TYR A CD2  4  
ATOM 10879 C CE1  . TYR A 1 99  ? 4.869   2.612   -2.833  1.00 0.49  ? 1606 TYR A CE1  4  
ATOM 10880 C CE2  . TYR A 1 99  ? 5.494   4.571   -1.610  1.00 0.46  ? 1606 TYR A CE2  4  
ATOM 10881 C CZ   . TYR A 1 99  ? 5.761   3.253   -1.997  1.00 0.54  ? 1606 TYR A CZ   4  
ATOM 10882 O OH   . TYR A 1 99  ? 7.103   2.880   -2.068  1.00 0.60  ? 1606 TYR A OH   4  
ATOM 10883 H H    . TYR A 1 99  ? 2.544   7.002   -3.525  1.00 0.35  ? 1606 TYR A H    4  
ATOM 10884 H HA   . TYR A 1 99  ? 1.821   4.553   -4.642  1.00 0.31  ? 1606 TYR A HA   4  
ATOM 10885 H HB2  . TYR A 1 99  ? 1.778   5.732   -1.916  1.00 0.30  ? 1606 TYR A HB2  4  
ATOM 10886 H HB3  . TYR A 1 99  ? 1.134   4.136   -2.171  1.00 0.31  ? 1606 TYR A HB3  4  
ATOM 10887 H HD1  . TYR A 1 99  ? 2.837   2.519   -3.465  1.00 0.46  ? 1606 TYR A HD1  4  
ATOM 10888 H HD2  . TYR A 1 99  ? 3.940   5.992   -1.280  1.00 0.40  ? 1606 TYR A HD2  4  
ATOM 10889 H HE1  . TYR A 1 99  ? 5.127   1.658   -3.268  1.00 0.57  ? 1606 TYR A HE1  4  
ATOM 10890 H HE2  . TYR A 1 99  ? 6.237   5.155   -1.090  1.00 0.54  ? 1606 TYR A HE2  4  
ATOM 10891 H HH   . TYR A 1 99  ? 7.423   2.631   -2.939  1.00 1.06  ? 1606 TYR A HH   4  
ATOM 10892 N N    . LYS A 1 100 ? -0.725  4.342   -4.342  1.00 0.26  ? 1607 LYS A N    4  
ATOM 10893 C CA   . LYS A 1 100 ? -2.165  4.291   -4.404  1.00 0.25  ? 1607 LYS A CA   4  
ATOM 10894 C C    . LYS A 1 100 ? -2.617  2.910   -4.020  1.00 0.24  ? 1607 LYS A C    4  
ATOM 10895 O O    . LYS A 1 100 ? -2.034  1.908   -4.450  1.00 0.29  ? 1607 LYS A O    4  
ATOM 10896 C CB   . LYS A 1 100 ? -2.716  4.698   -5.799  1.00 0.29  ? 1607 LYS A CB   4  
ATOM 10897 C CG   . LYS A 1 100 ? -4.198  4.383   -6.024  1.00 0.88  ? 1607 LYS A CG   4  
ATOM 10898 C CD   . LYS A 1 100 ? -4.732  4.800   -7.410  1.00 0.81  ? 1607 LYS A CD   4  
ATOM 10899 C CE   . LYS A 1 100 ? -4.119  4.018   -8.592  1.00 0.74  ? 1607 LYS A CE   4  
ATOM 10900 N NZ   . LYS A 1 100 ? -2.754  4.458   -8.959  1.00 1.45  ? 1607 LYS A NZ   4  
ATOM 10901 H H    . LYS A 1 100 ? -0.262  3.493   -4.521  1.00 0.29  ? 1607 LYS A H    4  
ATOM 10902 H HA   . LYS A 1 100 ? -2.539  4.982   -3.661  1.00 0.27  ? 1607 LYS A HA   4  
ATOM 10903 H HB2  . LYS A 1 100 ? -2.645  5.773   -5.852  1.00 0.76  ? 1607 LYS A HB2  4  
ATOM 10904 H HB3  . LYS A 1 100 ? -2.132  4.250   -6.587  1.00 0.84  ? 1607 LYS A HB3  4  
ATOM 10905 H HG2  . LYS A 1 100 ? -4.337  3.317   -5.924  1.00 1.42  ? 1607 LYS A HG2  4  
ATOM 10906 H HG3  . LYS A 1 100 ? -4.765  4.901   -5.261  1.00 1.38  ? 1607 LYS A HG3  4  
ATOM 10907 H HD2  . LYS A 1 100 ? -5.800  4.643   -7.425  1.00 1.30  ? 1607 LYS A HD2  4  
ATOM 10908 H HD3  . LYS A 1 100 ? -4.532  5.853   -7.547  1.00 1.28  ? 1607 LYS A HD3  4  
ATOM 10909 H HE2  . LYS A 1 100 ? -4.075  2.974   -8.323  1.00 1.30  ? 1607 LYS A HE2  4  
ATOM 10910 H HE3  . LYS A 1 100 ? -4.770  4.131   -9.446  1.00 1.46  ? 1607 LYS A HE3  4  
ATOM 10911 H HZ1  . LYS A 1 100 ? -2.032  4.295   -8.226  1.00 2.00  ? 1607 LYS A HZ1  4  
ATOM 10912 H HZ2  . LYS A 1 100 ? -2.760  5.486   -9.142  1.00 1.99  ? 1607 LYS A HZ2  4  
ATOM 10913 H HZ3  . LYS A 1 100 ? -2.436  4.002   -9.840  1.00 1.94  ? 1607 LYS A HZ3  4  
ATOM 10914 N N    . SER A 1 101 ? -3.610  2.862   -3.212  1.00 0.24  ? 1608 SER A N    4  
ATOM 10915 C CA   . SER A 1 101 ? -4.160  1.651   -2.734  1.00 0.24  ? 1608 SER A CA   4  
ATOM 10916 C C    . SER A 1 101 ? -5.623  1.542   -3.161  1.00 0.24  ? 1608 SER A C    4  
ATOM 10917 O O    . SER A 1 101 ? -6.414  2.478   -2.979  1.00 0.29  ? 1608 SER A O    4  
ATOM 10918 C CB   . SER A 1 101 ? -3.969  1.597   -1.222  1.00 0.29  ? 1608 SER A CB   4  
ATOM 10919 O OG   . SER A 1 101 ? -4.152  2.881   -0.642  1.00 1.15  ? 1608 SER A OG   4  
ATOM 10920 H H    . SER A 1 101 ? -4.042  3.695   -2.914  1.00 0.28  ? 1608 SER A H    4  
ATOM 10921 H HA   . SER A 1 101 ? -3.607  0.839   -3.182  1.00 0.26  ? 1608 SER A HA   4  
ATOM 10922 H HB2  . SER A 1 101 ? -4.687  0.914   -0.795  1.00 0.83  ? 1608 SER A HB2  4  
ATOM 10923 H HB3  . SER A 1 101 ? -2.968  1.255   -1.000  1.00 1.06  ? 1608 SER A HB3  4  
ATOM 10924 H HG   . SER A 1 101 ? -3.401  3.429   -0.900  1.00 1.61  ? 1608 SER A HG   4  
ATOM 10925 N N    . VAL A 1 102 ? -5.958  0.450   -3.797  1.00 0.22  ? 1609 VAL A N    4  
ATOM 10926 C CA   . VAL A 1 102 ? -7.296  0.239   -4.277  1.00 0.22  ? 1609 VAL A CA   4  
ATOM 10927 C C    . VAL A 1 102 ? -7.985  -0.809  -3.417  1.00 0.22  ? 1609 VAL A C    4  
ATOM 10928 O O    . VAL A 1 102 ? -7.693  -2.007  -3.516  1.00 0.24  ? 1609 VAL A O    4  
ATOM 10929 C CB   . VAL A 1 102 ? -7.301  -0.215  -5.764  1.00 0.23  ? 1609 VAL A CB   4  
ATOM 10930 C CG1  . VAL A 1 102 ? -8.718  -0.309  -6.291  1.00 0.25  ? 1609 VAL A CG1  4  
ATOM 10931 C CG2  . VAL A 1 102 ? -6.459  0.715   -6.642  1.00 0.25  ? 1609 VAL A CG2  4  
ATOM 10932 H H    . VAL A 1 102 ? -5.286  -0.249  -3.957  1.00 0.25  ? 1609 VAL A H    4  
ATOM 10933 H HA   . VAL A 1 102 ? -7.846  1.165   -4.189  1.00 0.23  ? 1609 VAL A HA   4  
ATOM 10934 H HB   . VAL A 1 102 ? -6.873  -1.206  -5.809  1.00 0.24  ? 1609 VAL A HB   4  
ATOM 10935 H HG11 . VAL A 1 102 ? -9.265  -1.028  -5.700  1.00 1.09  ? 1609 VAL A HG11 4  
ATOM 10936 H HG12 . VAL A 1 102 ? -8.698  -0.625  -7.324  1.00 1.00  ? 1609 VAL A HG12 4  
ATOM 10937 H HG13 . VAL A 1 102 ? -9.192  0.658   -6.213  1.00 1.06  ? 1609 VAL A HG13 4  
ATOM 10938 H HG21 . VAL A 1 102 ? -5.443  0.734   -6.276  1.00 1.03  ? 1609 VAL A HG21 4  
ATOM 10939 H HG22 . VAL A 1 102 ? -6.865  1.716   -6.636  1.00 1.06  ? 1609 VAL A HG22 4  
ATOM 10940 H HG23 . VAL A 1 102 ? -6.460  0.342   -7.656  1.00 1.06  ? 1609 VAL A HG23 4  
ATOM 10941 N N    . ILE A 1 103 ? -8.872  -0.356  -2.576  1.00 0.22  ? 1610 ILE A N    4  
ATOM 10942 C CA   . ILE A 1 103 ? -9.615  -1.203  -1.691  1.00 0.22  ? 1610 ILE A CA   4  
ATOM 10943 C C    . ILE A 1 103 ? -10.878 -1.626  -2.402  1.00 0.23  ? 1610 ILE A C    4  
ATOM 10944 O O    . ILE A 1 103 ? -11.677 -0.789  -2.817  1.00 0.34  ? 1610 ILE A O    4  
ATOM 10945 C CB   . ILE A 1 103 ? -9.966  -0.452  -0.379  1.00 0.27  ? 1610 ILE A CB   4  
ATOM 10946 C CG1  . ILE A 1 103 ? -8.678  -0.032  0.345   1.00 0.33  ? 1610 ILE A CG1  4  
ATOM 10947 C CG2  . ILE A 1 103 ? -10.845 -1.319  0.533   1.00 0.28  ? 1610 ILE A CG2  4  
ATOM 10948 C CD1  . ILE A 1 103 ? -8.900  0.864   1.531   1.00 0.45  ? 1610 ILE A CD1  4  
ATOM 10949 H H    . ILE A 1 103 ? -9.086  0.600   -2.553  1.00 0.24  ? 1610 ILE A H    4  
ATOM 10950 H HA   . ILE A 1 103 ? -9.018  -2.072  -1.457  1.00 0.22  ? 1610 ILE A HA   4  
ATOM 10951 H HB   . ILE A 1 103 ? -10.524 0.436   -0.637  1.00 0.34  ? 1610 ILE A HB   4  
ATOM 10952 H HG12 . ILE A 1 103 ? -8.183  -0.920  0.709   1.00 0.69  ? 1610 ILE A HG12 4  
ATOM 10953 H HG13 . ILE A 1 103 ? -8.009  0.477   -0.332  1.00 0.67  ? 1610 ILE A HG13 4  
ATOM 10954 H HG21 . ILE A 1 103 ? -10.321 -2.228  0.785   1.00 1.04  ? 1610 ILE A HG21 4  
ATOM 10955 H HG22 . ILE A 1 103 ? -11.759 -1.568  0.014   1.00 1.03  ? 1610 ILE A HG22 4  
ATOM 10956 H HG23 . ILE A 1 103 ? -11.078 -0.771  1.434   1.00 1.08  ? 1610 ILE A HG23 4  
ATOM 10957 H HD11 . ILE A 1 103 ? -9.376  1.782   1.222   1.00 1.17  ? 1610 ILE A HD11 4  
ATOM 10958 H HD12 . ILE A 1 103 ? -7.933  1.105   1.941   1.00 1.20  ? 1610 ILE A HD12 4  
ATOM 10959 H HD13 . ILE A 1 103 ? -9.514  0.355   2.259   1.00 1.10  ? 1610 ILE A HD13 4  
ATOM 10960 N N    . SER A 1 104 ? -11.024 -2.892  -2.581  1.00 0.23  ? 1611 SER A N    4  
ATOM 10961 C CA   . SER A 1 104 ? -12.140 -3.437  -3.278  1.00 0.24  ? 1611 SER A CA   4  
ATOM 10962 C C    . SER A 1 104 ? -12.862 -4.462  -2.411  1.00 0.22  ? 1611 SER A C    4  
ATOM 10963 O O    . SER A 1 104 ? -12.288 -5.490  -2.024  1.00 0.25  ? 1611 SER A O    4  
ATOM 10964 C CB   . SER A 1 104 ? -11.647 -4.075  -4.573  1.00 0.30  ? 1611 SER A CB   4  
ATOM 10965 O OG   . SER A 1 104 ? -10.891 -3.128  -5.327  1.00 1.26  ? 1611 SER A OG   4  
ATOM 10966 H H    . SER A 1 104 ? -10.350 -3.509  -2.230  1.00 0.30  ? 1611 SER A H    4  
ATOM 10967 H HA   . SER A 1 104 ? -12.817 -2.634  -3.527  1.00 0.27  ? 1611 SER A HA   4  
ATOM 10968 H HB2  . SER A 1 104 ? -11.015 -4.916  -4.331  1.00 1.06  ? 1611 SER A HB2  4  
ATOM 10969 H HB3  . SER A 1 104 ? -12.486 -4.414  -5.161  1.00 1.11  ? 1611 SER A HB3  4  
ATOM 10970 H HG   . SER A 1 104 ? -10.107 -2.953  -4.794  1.00 1.89  ? 1611 SER A HG   4  
ATOM 10971 N N    . PHE A 1 105 ? -14.087 -4.161  -2.077  1.00 0.21  ? 1612 PHE A N    4  
ATOM 10972 C CA   . PHE A 1 105 ? -14.906 -5.069  -1.320  1.00 0.21  ? 1612 PHE A CA   4  
ATOM 10973 C C    . PHE A 1 105 ? -15.569 -6.024  -2.272  1.00 0.23  ? 1612 PHE A C    4  
ATOM 10974 O O    . PHE A 1 105 ? -16.262 -5.603  -3.211  1.00 0.26  ? 1612 PHE A O    4  
ATOM 10975 C CB   . PHE A 1 105 ? -15.942 -4.341  -0.450  1.00 0.23  ? 1612 PHE A CB   4  
ATOM 10976 C CG   . PHE A 1 105 ? -15.335 -3.499  0.629   1.00 0.21  ? 1612 PHE A CG   4  
ATOM 10977 C CD1  . PHE A 1 105 ? -14.704 -4.073  1.725   1.00 0.22  ? 1612 PHE A CD1  4  
ATOM 10978 C CD2  . PHE A 1 105 ? -15.394 -2.128  0.544   1.00 0.23  ? 1612 PHE A CD2  4  
ATOM 10979 C CE1  . PHE A 1 105 ? -14.151 -3.284  2.707   1.00 0.24  ? 1612 PHE A CE1  4  
ATOM 10980 C CE2  . PHE A 1 105 ? -14.845 -1.336  1.520   1.00 0.24  ? 1612 PHE A CE2  4  
ATOM 10981 C CZ   . PHE A 1 105 ? -14.203 -1.975  2.642   1.00 0.24  ? 1612 PHE A CZ   4  
ATOM 10982 H H    . PHE A 1 105 ? -14.448 -3.296  -2.378  1.00 0.23  ? 1612 PHE A H    4  
ATOM 10983 H HA   . PHE A 1 105 ? -14.242 -5.638  -0.685  1.00 0.22  ? 1612 PHE A HA   4  
ATOM 10984 H HB2  . PHE A 1 105 ? -16.550 -3.690  -1.059  1.00 0.26  ? 1612 PHE A HB2  4  
ATOM 10985 H HB3  . PHE A 1 105 ? -16.575 -5.079  0.019   1.00 0.27  ? 1612 PHE A HB3  4  
ATOM 10986 H HD1  . PHE A 1 105 ? -14.631 -5.147  1.815   1.00 0.25  ? 1612 PHE A HD1  4  
ATOM 10987 H HD2  . PHE A 1 105 ? -15.884 -1.670  -0.304  1.00 0.27  ? 1612 PHE A HD2  4  
ATOM 10988 H HE1  . PHE A 1 105 ? -13.668 -3.752  3.551   1.00 0.28  ? 1612 PHE A HE1  4  
ATOM 10989 H HE2  . PHE A 1 105 ? -14.903 -0.262  1.434   1.00 0.28  ? 1612 PHE A HE2  4  
ATOM 10990 H HZ   . PHE A 1 105 ? -13.756 -1.402  3.440   1.00 0.27  ? 1612 PHE A HZ   4  
ATOM 10991 N N    . VAL A 1 106 ? -15.338 -7.283  -2.049  1.00 0.26  ? 1613 VAL A N    4  
ATOM 10992 C CA   . VAL A 1 106 ? -15.788 -8.324  -2.924  1.00 0.33  ? 1613 VAL A CA   4  
ATOM 10993 C C    . VAL A 1 106 ? -16.862 -9.139  -2.233  1.00 0.35  ? 1613 VAL A C    4  
ATOM 10994 O O    . VAL A 1 106 ? -16.731 -9.487  -1.045  1.00 0.34  ? 1613 VAL A O    4  
ATOM 10995 C CB   . VAL A 1 106 ? -14.598 -9.249  -3.323  1.00 0.40  ? 1613 VAL A CB   4  
ATOM 10996 C CG1  . VAL A 1 106 ? -15.039 -10.356 -4.270  1.00 0.50  ? 1613 VAL A CG1  4  
ATOM 10997 C CG2  . VAL A 1 106 ? -13.475 -8.437  -3.945  1.00 0.43  ? 1613 VAL A CG2  4  
ATOM 10998 H H    . VAL A 1 106 ? -14.866 -7.550  -1.228  1.00 0.27  ? 1613 VAL A H    4  
ATOM 10999 H HA   . VAL A 1 106 ? -16.190 -7.876  -3.821  1.00 0.38  ? 1613 VAL A HA   4  
ATOM 11000 H HB   . VAL A 1 106 ? -14.217 -9.716  -2.429  1.00 0.40  ? 1613 VAL A HB   4  
ATOM 11001 H HG11 . VAL A 1 106 ? -14.192 -10.977 -4.518  1.00 1.11  ? 1613 VAL A HG11 4  
ATOM 11002 H HG12 . VAL A 1 106 ? -15.440 -9.914  -5.170  1.00 1.23  ? 1613 VAL A HG12 4  
ATOM 11003 H HG13 . VAL A 1 106 ? -15.799 -10.953 -3.790  1.00 1.06  ? 1613 VAL A HG13 4  
ATOM 11004 H HG21 . VAL A 1 106 ? -12.657 -9.095  -4.200  1.00 1.08  ? 1613 VAL A HG21 4  
ATOM 11005 H HG22 . VAL A 1 106 ? -13.131 -7.699  -3.234  1.00 1.09  ? 1613 VAL A HG22 4  
ATOM 11006 H HG23 . VAL A 1 106 ? -13.835 -7.944  -4.836  1.00 1.14  ? 1613 VAL A HG23 4  
ATOM 11007 N N    . CYS A 1 107 ? -17.904 -9.422  -2.966  1.00 0.42  ? 1614 CYS A N    4  
ATOM 11008 C CA   . CYS A 1 107 ? -19.015 -10.192 -2.489  1.00 0.47  ? 1614 CYS A CA   4  
ATOM 11009 C C    . CYS A 1 107 ? -18.601 -11.644 -2.254  1.00 0.51  ? 1614 CYS A C    4  
ATOM 11010 O O    . CYS A 1 107 ? -18.335 -12.387 -3.208  1.00 0.58  ? 1614 CYS A O    4  
ATOM 11011 C CB   . CYS A 1 107 ? -20.158 -10.130 -3.502  1.00 0.59  ? 1614 CYS A CB   4  
ATOM 11012 S SG   . CYS A 1 107 ? -21.594 -11.177 -3.091  1.00 0.77  ? 1614 CYS A SG   4  
ATOM 11013 H H    . CYS A 1 107 ? -17.918 -9.106  -3.899  1.00 0.48  ? 1614 CYS A H    4  
ATOM 11014 H HA   . CYS A 1 107 ? -19.356 -9.741  -1.569  1.00 0.45  ? 1614 CYS A HA   4  
ATOM 11015 H HB2  . CYS A 1 107 ? -20.510 -9.112  -3.572  1.00 0.63  ? 1614 CYS A HB2  4  
ATOM 11016 H HB3  . CYS A 1 107 ? -19.787 -10.441 -4.467  1.00 0.60  ? 1614 CYS A HB3  4  
ATOM 11017 N N    . ARG A 1 108 ? -18.491 -12.030 -1.003  1.00 0.51  ? 1615 ARG A N    4  
ATOM 11018 C CA   . ARG A 1 108 ? -18.179 -13.390 -0.660  1.00 0.57  ? 1615 ARG A CA   4  
ATOM 11019 C C    . ARG A 1 108 ? -19.149 -13.858 0.422   1.00 0.61  ? 1615 ARG A C    4  
ATOM 11020 O O    . ARG A 1 108 ? -18.910 -13.626 1.598   1.00 0.67  ? 1615 ARG A O    4  
ATOM 11021 C CB   . ARG A 1 108 ? -16.737 -13.478 -0.149  1.00 0.69  ? 1615 ARG A CB   4  
ATOM 11022 C CG   . ARG A 1 108 ? -16.256 -14.868 0.263   1.00 1.17  ? 1615 ARG A CG   4  
ATOM 11023 C CD   . ARG A 1 108 ? -16.222 -15.814 -0.910  1.00 1.19  ? 1615 ARG A CD   4  
ATOM 11024 N NE   . ARG A 1 108 ? -15.706 -17.135 -0.543  1.00 1.74  ? 1615 ARG A NE   4  
ATOM 11025 C CZ   . ARG A 1 108 ? -15.747 -18.210 -1.337  1.00 1.99  ? 1615 ARG A CZ   4  
ATOM 11026 N NH1  . ARG A 1 108 ? -16.245 -18.112 -2.563  1.00 2.19  ? 1615 ARG A NH1  4  
ATOM 11027 N NH2  . ARG A 1 108 ? -15.269 -19.372 -0.910  1.00 2.53  ? 1615 ARG A NH2  4  
ATOM 11028 H H    . ARG A 1 108 ? -18.611 -11.378 -0.274  1.00 0.50  ? 1615 ARG A H    4  
ATOM 11029 H HA   . ARG A 1 108 ? -18.274 -13.964 -1.568  1.00 0.61  ? 1615 ARG A HA   4  
ATOM 11030 H HB2  . ARG A 1 108 ? -16.076 -13.123 -0.927  1.00 0.63  ? 1615 ARG A HB2  4  
ATOM 11031 H HB3  . ARG A 1 108 ? -16.639 -12.822 0.703   1.00 0.91  ? 1615 ARG A HB3  4  
ATOM 11032 H HG2  . ARG A 1 108 ? -15.262 -14.788 0.674   1.00 1.65  ? 1615 ARG A HG2  4  
ATOM 11033 H HG3  . ARG A 1 108 ? -16.925 -15.259 1.015   1.00 1.58  ? 1615 ARG A HG3  4  
ATOM 11034 H HD2  . ARG A 1 108 ? -17.223 -15.925 -1.298  1.00 1.21  ? 1615 ARG A HD2  4  
ATOM 11035 H HD3  . ARG A 1 108 ? -15.587 -15.392 -1.674  1.00 1.47  ? 1615 ARG A HD3  4  
ATOM 11036 H HE   . ARG A 1 108 ? -15.301 -17.199 0.358   1.00 2.22  ? 1615 ARG A HE   4  
ATOM 11037 H HH11 . ARG A 1 108 ? -16.604 -17.244 -2.939  1.00 2.21  ? 1615 ARG A HH11 4  
ATOM 11038 H HH12 . ARG A 1 108 ? -16.296 -18.889 -3.199  1.00 2.68  ? 1615 ARG A HH12 4  
ATOM 11039 H HH21 . ARG A 1 108 ? -14.860 -19.495 0.003   1.00 2.92  ? 1615 ARG A HH21 4  
ATOM 11040 H HH22 . ARG A 1 108 ? -15.300 -20.197 -1.482  1.00 2.77  ? 1615 ARG A HH22 4  
ATOM 11041 N N    . PRO A 1 109 ? -20.264 -14.515 0.055   1.00 0.67  ? 1616 PRO A N    4  
ATOM 11042 C CA   . PRO A 1 109 ? -21.269 -14.958 1.037   1.00 0.83  ? 1616 PRO A CA   4  
ATOM 11043 C C    . PRO A 1 109 ? -20.731 -16.060 1.972   1.00 0.95  ? 1616 PRO A C    4  
ATOM 11044 O O    . PRO A 1 109 ? -21.160 -16.195 3.118   1.00 1.10  ? 1616 PRO A O    4  
ATOM 11045 C CB   . PRO A 1 109 ? -22.425 -15.477 0.171   1.00 0.94  ? 1616 PRO A CB   4  
ATOM 11046 C CG   . PRO A 1 109 ? -22.154 -14.959 -1.204  1.00 0.92  ? 1616 PRO A CG   4  
ATOM 11047 C CD   . PRO A 1 109 ? -20.666 -14.874 -1.323  1.00 0.69  ? 1616 PRO A CD   4  
ATOM 11048 H HA   . PRO A 1 109 ? -21.602 -14.126 1.642   1.00 0.89  ? 1616 PRO A HA   4  
ATOM 11049 H HB2  . PRO A 1 109 ? -22.449 -16.556 0.193   1.00 1.14  ? 1616 PRO A HB2  4  
ATOM 11050 H HB3  . PRO A 1 109 ? -23.349 -15.075 0.556   1.00 1.05  ? 1616 PRO A HB3  4  
ATOM 11051 H HG2  . PRO A 1 109 ? -22.549 -15.648 -1.936  1.00 1.22  ? 1616 PRO A HG2  4  
ATOM 11052 H HG3  . PRO A 1 109 ? -22.599 -13.982 -1.324  1.00 1.07  ? 1616 PRO A HG3  4  
ATOM 11053 H HD2  . PRO A 1 109 ? -20.270 -15.836 -1.619  1.00 0.71  ? 1616 PRO A HD2  4  
ATOM 11054 H HD3  . PRO A 1 109 ? -20.402 -14.112 -2.039  1.00 0.71  ? 1616 PRO A HD3  4  
ATOM 11055 N N    . GLU A 1 110 ? -19.760 -16.798 1.477   1.00 0.99  ? 1617 GLU A N    4  
ATOM 11056 C CA   . GLU A 1 110 ? -19.073 -17.870 2.192   1.00 1.19  ? 1617 GLU A CA   4  
ATOM 11057 C C    . GLU A 1 110 ? -18.033 -17.352 3.191   1.00 1.17  ? 1617 GLU A C    4  
ATOM 11058 O O    . GLU A 1 110 ? -16.898 -17.838 3.201   1.00 1.74  ? 1617 GLU A O    4  
ATOM 11059 C CB   . GLU A 1 110 ? -18.424 -18.850 1.237   1.00 1.39  ? 1617 GLU A CB   4  
ATOM 11060 C CG   . GLU A 1 110 ? -19.393 -19.668 0.430   1.00 1.76  ? 1617 GLU A CG   4  
ATOM 11061 C CD   . GLU A 1 110 ? -18.692 -20.734 -0.351  1.00 2.32  ? 1617 GLU A CD   4  
ATOM 11062 O OE1  . GLU A 1 110 ? -18.359 -21.787 0.237   1.00 2.53  ? 1617 GLU A OE1  4  
ATOM 11063 O OE2  . GLU A 1 110 ? -18.440 -20.545 -1.561  1.00 3.05  ? 1617 GLU A OE2  4  
ATOM 11064 H H    . GLU A 1 110 ? -19.498 -16.610 0.555   1.00 0.96  ? 1617 GLU A H    4  
ATOM 11065 H HA   . GLU A 1 110 ? -19.829 -18.399 2.753   1.00 1.33  ? 1617 GLU A HA   4  
ATOM 11066 H HB2  . GLU A 1 110 ? -17.794 -18.301 0.552   1.00 1.44  ? 1617 GLU A HB2  4  
ATOM 11067 H HB3  . GLU A 1 110 ? -17.809 -19.521 1.817   1.00 1.72  ? 1617 GLU A HB3  4  
ATOM 11068 H HG2  . GLU A 1 110 ? -20.094 -20.131 1.108   1.00 2.26  ? 1617 GLU A HG2  4  
ATOM 11069 H HG3  . GLU A 1 110 ? -19.928 -19.027 -0.255  1.00 2.04  ? 1617 GLU A HG3  4  
ATOM 11070 N N    . ALA A 1 111 ? -18.406 -16.315 3.933   1.00 0.85  ? 1618 ALA A N    4  
ATOM 11071 C CA   . ALA A 1 111 ? -17.590 -15.659 4.959   1.00 0.78  ? 1618 ALA A CA   4  
ATOM 11072 C C    . ALA A 1 111 ? -16.633 -16.622 5.677   1.00 0.93  ? 1618 ALA A C    4  
ATOM 11073 O O    . ALA A 1 111 ? -17.042 -17.674 6.176   1.00 1.55  ? 1618 ALA A O    4  
ATOM 11074 C CB   . ALA A 1 111 ? -18.493 -15.008 5.981   1.00 0.78  ? 1618 ALA A CB   4  
ATOM 11075 H H    . ALA A 1 111 ? -19.302 -15.963 3.771   1.00 1.00  ? 1618 ALA A H    4  
ATOM 11076 H HA   . ALA A 1 111 ? -17.068 -14.873 4.439   1.00 0.78  ? 1618 ALA A HA   4  
ATOM 11077 H HB1  . ALA A 1 111 ? -19.120 -15.764 6.430   1.00 1.23  ? 1618 ALA A HB1  4  
ATOM 11078 H HB2  . ALA A 1 111 ? -19.104 -14.250 5.520   1.00 1.23  ? 1618 ALA A HB2  4  
ATOM 11079 H HB3  . ALA A 1 111 ? -17.893 -14.558 6.759   1.00 1.20  ? 1618 ALA A HB3  4  
ATOM 11080 N N    . GLY A 1 112 ? -15.380 -16.275 5.686   1.00 0.86  ? 1619 GLY A N    4  
ATOM 11081 C CA   . GLY A 1 112 ? -14.387 -17.066 6.305   1.00 0.93  ? 1619 GLY A CA   4  
ATOM 11082 C C    . GLY A 1 112 ? -13.126 -16.269 6.422   1.00 0.76  ? 1619 GLY A C    4  
ATOM 11083 O O    . GLY A 1 112 ? -13.196 -15.047 6.597   1.00 0.73  ? 1619 GLY A O    4  
ATOM 11084 H H    . GLY A 1 112 ? -15.063 -15.440 5.288   1.00 1.16  ? 1619 GLY A H    4  
ATOM 11085 H HA2  . GLY A 1 112 ? -14.725 -17.363 7.288   1.00 1.12  ? 1619 GLY A HA2  4  
ATOM 11086 H HA3  . GLY A 1 112 ? -14.193 -17.944 5.706   1.00 1.04  ? 1619 GLY A HA3  4  
ATOM 11087 N N    . PRO A 1 113 ? -11.961 -16.885 6.212   1.00 0.73  ? 1620 PRO A N    4  
ATOM 11088 C CA   . PRO A 1 113 ? -10.668 -16.209 6.383   1.00 0.65  ? 1620 PRO A CA   4  
ATOM 11089 C C    . PRO A 1 113 ? -10.331 -15.245 5.240   1.00 0.56  ? 1620 PRO A C    4  
ATOM 11090 O O    . PRO A 1 113 ? -9.240  -14.703 5.164   1.00 0.62  ? 1620 PRO A O    4  
ATOM 11091 C CB   . PRO A 1 113 ? -9.659  -17.354 6.454   1.00 0.71  ? 1620 PRO A CB   4  
ATOM 11092 C CG   . PRO A 1 113 ? -10.293 -18.505 5.745   1.00 0.80  ? 1620 PRO A CG   4  
ATOM 11093 C CD   . PRO A 1 113 ? -11.809 -18.300 5.809   1.00 0.88  ? 1620 PRO A CD   4  
ATOM 11094 H HA   . PRO A 1 113 ? -10.650 -15.655 7.310   1.00 0.72  ? 1620 PRO A HA   4  
ATOM 11095 H HB2  . PRO A 1 113 ? -8.745  -17.048 5.971   1.00 0.79  ? 1620 PRO A HB2  4  
ATOM 11096 H HB3  . PRO A 1 113 ? -9.468  -17.589 7.490   1.00 0.90  ? 1620 PRO A HB3  4  
ATOM 11097 H HG2  . PRO A 1 113 ? -9.914  -18.527 4.732   1.00 0.95  ? 1620 PRO A HG2  4  
ATOM 11098 H HG3  . PRO A 1 113 ? -10.005 -19.416 6.251   1.00 0.97  ? 1620 PRO A HG3  4  
ATOM 11099 H HD2  . PRO A 1 113 ? -12.316 -18.514 4.878   1.00 1.02  ? 1620 PRO A HD2  4  
ATOM 11100 H HD3  . PRO A 1 113 ? -12.270 -18.918 6.564   1.00 1.06  ? 1620 PRO A HD3  4  
ATOM 11101 N N    . THR A 1 114 ? -11.284 -15.027 4.395   1.00 0.53  ? 1621 THR A N    4  
ATOM 11102 C CA   . THR A 1 114 ? -11.168 -14.169 3.265   1.00 0.54  ? 1621 THR A CA   4  
ATOM 11103 C C    . THR A 1 114 ? -11.724 -12.776 3.604   1.00 0.43  ? 1621 THR A C    4  
ATOM 11104 O O    . THR A 1 114 ? -11.535 -11.793 2.861   1.00 0.39  ? 1621 THR A O    4  
ATOM 11105 C CB   . THR A 1 114 ? -11.966 -14.804 2.124   1.00 0.73  ? 1621 THR A CB   4  
ATOM 11106 O OG1  . THR A 1 114 ? -13.251 -15.233 2.642   1.00 0.95  ? 1621 THR A OG1  4  
ATOM 11107 C CG2  . THR A 1 114 ? -11.229 -16.001 1.560   1.00 0.97  ? 1621 THR A CG2  4  
ATOM 11108 H H    . THR A 1 114 ? -12.149 -15.467 4.526   1.00 0.57  ? 1621 THR A H    4  
ATOM 11109 H HA   . THR A 1 114 ? -10.133 -14.102 2.966   1.00 0.64  ? 1621 THR A HA   4  
ATOM 11110 H HB   . THR A 1 114 ? -12.117 -14.069 1.347   1.00 0.81  ? 1621 THR A HB   4  
ATOM 11111 H HG1  . THR A 1 114 ? -13.498 -16.090 2.260   1.00 1.52  ? 1621 THR A HG1  4  
ATOM 11112 H HG21 . THR A 1 114 ? -10.272 -15.682 1.176   1.00 1.40  ? 1621 THR A HG21 4  
ATOM 11113 H HG22 . THR A 1 114 ? -11.811 -16.448 0.769   1.00 1.38  ? 1621 THR A HG22 4  
ATOM 11114 H HG23 . THR A 1 114 ? -11.076 -16.720 2.352   1.00 1.58  ? 1621 THR A HG23 4  
ATOM 11115 N N    . ASN A 1 115 ? -12.382 -12.701 4.752   1.00 0.42  ? 1622 ASN A N    4  
ATOM 11116 C CA   . ASN A 1 115 ? -13.015 -11.473 5.242   1.00 0.40  ? 1622 ASN A CA   4  
ATOM 11117 C C    . ASN A 1 115 ? -11.980 -10.636 6.004   1.00 0.39  ? 1622 ASN A C    4  
ATOM 11118 O O    . ASN A 1 115 ? -12.053 -10.448 7.227   1.00 0.48  ? 1622 ASN A O    4  
ATOM 11119 C CB   . ASN A 1 115 ? -14.231 -11.848 6.132   1.00 0.49  ? 1622 ASN A CB   4  
ATOM 11120 C CG   . ASN A 1 115 ? -15.050 -10.662 6.650   1.00 0.51  ? 1622 ASN A CG   4  
ATOM 11121 O OD1  . ASN A 1 115 ? -15.124 -9.609  6.027   1.00 0.59  ? 1622 ASN A OD1  4  
ATOM 11122 N ND2  . ASN A 1 115 ? -15.712 -10.848 7.760   1.00 0.72  ? 1622 ASN A ND2  4  
ATOM 11123 H H    . ASN A 1 115 ? -12.445 -13.514 5.298   1.00 0.46  ? 1622 ASN A H    4  
ATOM 11124 H HA   . ASN A 1 115 ? -13.355 -10.921 4.379   1.00 0.38  ? 1622 ASN A HA   4  
ATOM 11125 H HB2  . ASN A 1 115 ? -14.889 -12.469 5.545   1.00 0.54  ? 1622 ASN A HB2  4  
ATOM 11126 H HB3  . ASN A 1 115 ? -13.877 -12.419 6.977   1.00 0.55  ? 1622 ASN A HB3  4  
ATOM 11127 H HD21 . ASN A 1 115 ? -15.662 -11.726 8.199   1.00 0.88  ? 1622 ASN A HD21 4  
ATOM 11128 H HD22 . ASN A 1 115 ? -16.235 -10.099 8.126   1.00 0.80  ? 1622 ASN A HD22 4  
ATOM 11129 N N    . ARG A 1 116 ? -10.998 -10.179 5.267   1.00 0.35  ? 1623 ARG A N    4  
ATOM 11130 C CA   . ARG A 1 116 ? -9.870  -9.441  5.783   1.00 0.37  ? 1623 ARG A CA   4  
ATOM 11131 C C    . ARG A 1 116 ? -9.167  -8.788  4.608   1.00 0.33  ? 1623 ARG A C    4  
ATOM 11132 O O    . ARG A 1 116 ? -9.189  -9.349  3.514   1.00 0.32  ? 1623 ARG A O    4  
ATOM 11133 C CB   . ARG A 1 116 ? -8.896  -10.362 6.542   1.00 0.43  ? 1623 ARG A CB   4  
ATOM 11134 C CG   . ARG A 1 116 ? -8.210  -11.421 5.693   1.00 0.49  ? 1623 ARG A CG   4  
ATOM 11135 C CD   . ARG A 1 116 ? -7.270  -12.278 6.520   1.00 0.67  ? 1623 ARG A CD   4  
ATOM 11136 N NE   . ARG A 1 116 ? -7.978  -13.107 7.515   1.00 1.57  ? 1623 ARG A NE   4  
ATOM 11137 C CZ   . ARG A 1 116 ? -7.436  -14.165 8.130   1.00 2.13  ? 1623 ARG A CZ   4  
ATOM 11138 N NH1  . ARG A 1 116 ? -6.132  -14.394 8.041   1.00 1.99  ? 1623 ARG A NH1  4  
ATOM 11139 N NH2  . ARG A 1 116 ? -8.182  -14.955 8.880   1.00 3.26  ? 1623 ARG A NH2  4  
ATOM 11140 H H    . ARG A 1 116 ? -11.006 -10.344 4.298   1.00 0.35  ? 1623 ARG A H    4  
ATOM 11141 H HA   . ARG A 1 116 ? -10.242 -8.673  6.446   1.00 0.41  ? 1623 ARG A HA   4  
ATOM 11142 H HB2  . ARG A 1 116 ? -8.143  -9.740  6.998   1.00 0.46  ? 1623 ARG A HB2  4  
ATOM 11143 H HB3  . ARG A 1 116 ? -9.449  -10.858 7.328   1.00 0.48  ? 1623 ARG A HB3  4  
ATOM 11144 H HG2  . ARG A 1 116 ? -8.963  -12.057 5.250   1.00 0.50  ? 1623 ARG A HG2  4  
ATOM 11145 H HG3  . ARG A 1 116 ? -7.648  -10.930 4.913   1.00 0.52  ? 1623 ARG A HG3  4  
ATOM 11146 H HD2  . ARG A 1 116 ? -6.721  -12.927 5.855   1.00 1.26  ? 1623 ARG A HD2  4  
ATOM 11147 H HD3  . ARG A 1 116 ? -6.577  -11.629 7.035   1.00 1.22  ? 1623 ARG A HD3  4  
ATOM 11148 H HE   . ARG A 1 116 ? -8.923  -12.862 7.668   1.00 2.16  ? 1623 ARG A HE   4  
ATOM 11149 H HH11 . ARG A 1 116 ? -5.509  -13.792 7.524   1.00 1.83  ? 1623 ARG A HH11 4  
ATOM 11150 H HH12 . ARG A 1 116 ? -5.688  -15.188 8.481   1.00 2.53  ? 1623 ARG A HH12 4  
ATOM 11151 H HH21 . ARG A 1 116 ? -9.172  -14.809 9.029   1.00 3.82  ? 1623 ARG A HH21 4  
ATOM 11152 H HH22 . ARG A 1 116 ? -7.813  -15.772 9.344   1.00 3.73  ? 1623 ARG A HH22 4  
ATOM 11153 N N    . PRO A 1 117 ? -8.669  -7.548  4.776   1.00 0.36  ? 1624 PRO A N    4  
ATOM 11154 C CA   . PRO A 1 117 ? -7.947  -6.836  3.714   1.00 0.36  ? 1624 PRO A CA   4  
ATOM 11155 C C    . PRO A 1 117 ? -6.749  -7.660  3.214   1.00 0.36  ? 1624 PRO A C    4  
ATOM 11156 O O    . PRO A 1 117 ? -5.747  -7.811  3.922   1.00 0.47  ? 1624 PRO A O    4  
ATOM 11157 C CB   . PRO A 1 117 ? -7.436  -5.560  4.393   1.00 0.47  ? 1624 PRO A CB   4  
ATOM 11158 C CG   . PRO A 1 117 ? -8.220  -5.414  5.650   1.00 0.59  ? 1624 PRO A CG   4  
ATOM 11159 C CD   . PRO A 1 117 ? -8.735  -6.771  6.025   1.00 0.43  ? 1624 PRO A CD   4  
ATOM 11160 H HA   . PRO A 1 117 ? -8.600  -6.588  2.888   1.00 0.36  ? 1624 PRO A HA   4  
ATOM 11161 H HB2  . PRO A 1 117 ? -6.382  -5.665  4.603   1.00 0.51  ? 1624 PRO A HB2  4  
ATOM 11162 H HB3  . PRO A 1 117 ? -7.590  -4.718  3.735   1.00 0.54  ? 1624 PRO A HB3  4  
ATOM 11163 H HG2  . PRO A 1 117 ? -7.579  -5.036  6.434   1.00 0.76  ? 1624 PRO A HG2  4  
ATOM 11164 H HG3  . PRO A 1 117 ? -9.042  -4.733  5.485   1.00 0.77  ? 1624 PRO A HG3  4  
ATOM 11165 H HD2  . PRO A 1 117 ? -8.109  -7.218  6.783   1.00 0.48  ? 1624 PRO A HD2  4  
ATOM 11166 H HD3  . PRO A 1 117 ? -9.754  -6.698  6.376   1.00 0.47  ? 1624 PRO A HD3  4  
ATOM 11167 N N    . MET A 1 118 ? -6.870  -8.200  2.032   1.00 0.35  ? 1625 MET A N    4  
ATOM 11168 C CA   . MET A 1 118 ? -5.851  -9.047  1.447   1.00 0.46  ? 1625 MET A CA   4  
ATOM 11169 C C    . MET A 1 118 ? -5.141  -8.287  0.334   1.00 0.40  ? 1625 MET A C    4  
ATOM 11170 O O    . MET A 1 118 ? -5.800  -7.668  -0.506  1.00 0.41  ? 1625 MET A O    4  
ATOM 11171 C CB   . MET A 1 118 ? -6.497  -10.325 0.878   1.00 0.68  ? 1625 MET A CB   4  
ATOM 11172 C CG   . MET A 1 118 ? -7.209  -11.186 1.930   1.00 0.87  ? 1625 MET A CG   4  
ATOM 11173 S SD   . MET A 1 118 ? -8.132  -12.575 1.227   1.00 1.37  ? 1625 MET A SD   4  
ATOM 11174 C CE   . MET A 1 118 ? -6.804  -13.533 0.511   1.00 0.77  ? 1625 MET A CE   4  
ATOM 11175 H H    . MET A 1 118 ? -7.691  -8.011  1.519   1.00 0.36  ? 1625 MET A H    4  
ATOM 11176 H HA   . MET A 1 118 ? -5.161  -9.319  2.232   1.00 0.56  ? 1625 MET A HA   4  
ATOM 11177 H HB2  . MET A 1 118 ? -7.207  -10.051 0.112   1.00 0.70  ? 1625 MET A HB2  4  
ATOM 11178 H HB3  . MET A 1 118 ? -5.721  -10.924 0.425   1.00 0.77  ? 1625 MET A HB3  4  
ATOM 11179 H HG2  . MET A 1 118 ? -6.457  -11.591 2.591   1.00 0.96  ? 1625 MET A HG2  4  
ATOM 11180 H HG3  . MET A 1 118 ? -7.888  -10.578 2.512   1.00 0.72  ? 1625 MET A HG3  4  
ATOM 11181 H HE1  . MET A 1 118 ? -6.115  -13.826 1.287   1.00 1.43  ? 1625 MET A HE1  4  
ATOM 11182 H HE2  . MET A 1 118 ? -6.292  -12.935 -0.226  1.00 1.35  ? 1625 MET A HE2  4  
ATOM 11183 H HE3  . MET A 1 118 ? -7.217  -14.413 0.040   1.00 1.27  ? 1625 MET A HE3  4  
ATOM 11184 N N    . LEU A 1 119 ? -3.818  -8.316  0.328   1.00 0.42  ? 1626 LEU A N    4  
ATOM 11185 C CA   . LEU A 1 119 ? -3.037  -7.631  -0.688  1.00 0.41  ? 1626 LEU A CA   4  
ATOM 11186 C C    . LEU A 1 119 ? -2.935  -8.583  -1.864  1.00 0.42  ? 1626 LEU A C    4  
ATOM 11187 O O    . LEU A 1 119 ? -2.338  -9.653  -1.749  1.00 0.51  ? 1626 LEU A O    4  
ATOM 11188 C CB   . LEU A 1 119 ? -1.622  -7.360  -0.132  1.00 0.50  ? 1626 LEU A CB   4  
ATOM 11189 C CG   . LEU A 1 119 ? -0.803  -6.178  -0.723  1.00 0.59  ? 1626 LEU A CG   4  
ATOM 11190 C CD1  . LEU A 1 119 ? -0.533  -6.271  -2.194  1.00 0.78  ? 1626 LEU A CD1  4  
ATOM 11191 C CD2  . LEU A 1 119 ? -1.466  -4.906  -0.464  1.00 0.89  ? 1626 LEU A CD2  4  
ATOM 11192 H H    . LEU A 1 119 ? -3.322  -8.826  1.008   1.00 0.51  ? 1626 LEU A H    4  
ATOM 11193 H HA   . LEU A 1 119 ? -3.517  -6.702  -0.954  1.00 0.39  ? 1626 LEU A HA   4  
ATOM 11194 H HB2  . LEU A 1 119 ? -1.716  -7.184  0.928   1.00 0.56  ? 1626 LEU A HB2  4  
ATOM 11195 H HB3  . LEU A 1 119 ? -1.044  -8.262  -0.265  1.00 0.59  ? 1626 LEU A HB3  4  
ATOM 11196 H HG   . LEU A 1 119 ? 0.152   -6.140  -0.221  1.00 0.98  ? 1626 LEU A HG   4  
ATOM 11197 H HD11 . LEU A 1 119 ? -0.142  -5.303  -2.481  1.00 1.41  ? 1626 LEU A HD11 4  
ATOM 11198 H HD12 . LEU A 1 119 ? -1.454  -6.453  -2.725  1.00 1.25  ? 1626 LEU A HD12 4  
ATOM 11199 H HD13 . LEU A 1 119 ? 0.199   -7.037  -2.402  1.00 1.34  ? 1626 LEU A HD13 4  
ATOM 11200 H HD21 . LEU A 1 119 ? -2.331  -4.864  -1.111  1.00 1.40  ? 1626 LEU A HD21 4  
ATOM 11201 H HD22 . LEU A 1 119 ? -0.754  -4.121  -0.663  1.00 1.43  ? 1626 LEU A HD22 4  
ATOM 11202 H HD23 . LEU A 1 119 ? -1.777  -4.885  0.569   1.00 1.42  ? 1626 LEU A HD23 4  
ATOM 11203 N N    . ILE A 1 120 ? -3.541  -8.209  -2.977  1.00 0.37  ? 1627 ILE A N    4  
ATOM 11204 C CA   . ILE A 1 120 ? -3.531  -9.046  -4.164  1.00 0.41  ? 1627 ILE A CA   4  
ATOM 11205 C C    . ILE A 1 120 ? -2.146  -9.077  -4.727  1.00 0.42  ? 1627 ILE A C    4  
ATOM 11206 O O    . ILE A 1 120 ? -1.556  -10.138 -4.886  1.00 0.49  ? 1627 ILE A O    4  
ATOM 11207 C CB   . ILE A 1 120 ? -4.481  -8.529  -5.283  1.00 0.41  ? 1627 ILE A CB   4  
ATOM 11208 C CG1  . ILE A 1 120 ? -5.915  -8.369  -4.766  1.00 0.48  ? 1627 ILE A CG1  4  
ATOM 11209 C CG2  . ILE A 1 120 ? -4.455  -9.500  -6.474  1.00 0.46  ? 1627 ILE A CG2  4  
ATOM 11210 C CD1  . ILE A 1 120 ? -6.548  -9.672  -4.312  1.00 0.58  ? 1627 ILE A CD1  4  
ATOM 11211 H H    . ILE A 1 120 ? -3.993  -7.334  -2.997  1.00 0.34  ? 1627 ILE A H    4  
ATOM 11212 H HA   . ILE A 1 120 ? -3.832  -10.045 -3.882  1.00 0.46  ? 1627 ILE A HA   4  
ATOM 11213 H HB   . ILE A 1 120 ? -4.104  -7.576  -5.625  1.00 0.39  ? 1627 ILE A HB   4  
ATOM 11214 H HG12 . ILE A 1 120 ? -5.898  -7.691  -3.926  1.00 0.48  ? 1627 ILE A HG12 4  
ATOM 11215 H HG13 . ILE A 1 120 ? -6.531  -7.948  -5.549  1.00 0.60  ? 1627 ILE A HG13 4  
ATOM 11216 H HG21 . ILE A 1 120 ? -5.115  -9.159  -7.257  1.00 1.14  ? 1627 ILE A HG21 4  
ATOM 11217 H HG22 . ILE A 1 120 ? -4.785  -10.469 -6.131  1.00 1.07  ? 1627 ILE A HG22 4  
ATOM 11218 H HG23 . ILE A 1 120 ? -3.446  -9.583  -6.851  1.00 1.12  ? 1627 ILE A HG23 4  
ATOM 11219 H HD11 . ILE