data_2L35
# 
_entry.id   2L35 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L35         
RCSB  RCSB101897   
WWPDB D_1000101897 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2L34 PDB 'DAP12 transmembrane homodimer'     
unspecified 2HAC PDB 'Zeta transmembrane homodimer'      
unspecified 2K4F PDB 'Mouse CD3epsilon Cytoplasmic Tail' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L35 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-09-06 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Call, M.E.'          1 
'Wucherpfennig, K.W.' 2 
'Chou, J.J.'          3 
# 
_citation.id                        primary 
_citation.title                     'The structural basis for intramembrane assembly of an activating immunoreceptor complex.' 
_citation.journal_abbrev            Nat.Immunol. 
_citation.journal_volume            11 
_citation.page_first                1023 
_citation.page_last                 1029 
_citation.year                      2010 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1529-2908 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20890284 
_citation.pdbx_database_id_DOI      10.1038/ni.1943 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Call, M.E.'          1 
primary 'Wucherpfennig, K.W.' 2 
primary 'Chou, J.J.'          3 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man DAP12-NKG2C_TM                                 6478.848 1 ? ? ?                    
'THE FUSION PROTEIN OF DAP12 (RESIDUES 1-33) AND NKG2C (RESIDUES 35-63)' 
2 polymer man 'TYRO protein tyrosine kinase-binding protein' 3217.884 1 ? ? 'UNP RESIDUES 35-66' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'DNAX-activation protein 12, Killer-activating receptor-associated protein, KAR-associated protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN 
CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGRLGTAEVLGIISIVLVATVLKTIVLIPFLEQN A ? 
2 'polypeptide(L)' no no CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR                                CSTVSPGVLAGIVVGDLVLTVLIALAVYFLGR B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  CYS n 
1 2  SER n 
1 3  THR n 
1 4  VAL n 
1 5  SER n 
1 6  PRO n 
1 7  GLY n 
1 8  VAL n 
1 9  LEU n 
1 10 ALA n 
1 11 GLY n 
1 12 ILE n 
1 13 VAL n 
1 14 VAL n 
1 15 GLY n 
1 16 ASP n 
1 17 LEU n 
1 18 VAL n 
1 19 LEU n 
1 20 THR n 
1 21 VAL n 
1 22 LEU n 
1 23 ILE n 
1 24 ALA n 
1 25 LEU n 
1 26 ALA n 
1 27 VAL n 
1 28 TYR n 
1 29 PHE n 
1 30 LEU n 
1 31 GLY n 
1 32 ARG n 
1 33 LEU n 
1 34 GLY n 
1 35 THR n 
1 36 ALA n 
1 37 GLU n 
1 38 VAL n 
1 39 LEU n 
1 40 GLY n 
1 41 ILE n 
1 42 ILE n 
1 43 SER n 
1 44 ILE n 
1 45 VAL n 
1 46 LEU n 
1 47 VAL n 
1 48 ALA n 
1 49 THR n 
1 50 VAL n 
1 51 LEU n 
1 52 LYS n 
1 53 THR n 
1 54 ILE n 
1 55 VAL n 
1 56 LEU n 
1 57 ILE n 
1 58 PRO n 
1 59 PHE n 
1 60 LEU n 
1 61 GLU n 
1 62 GLN n 
1 63 ASN n 
2 1  CYS n 
2 2  SER n 
2 3  THR n 
2 4  VAL n 
2 5  SER n 
2 6  PRO n 
2 7  GLY n 
2 8  VAL n 
2 9  LEU n 
2 10 ALA n 
2 11 GLY n 
2 12 ILE n 
2 13 VAL n 
2 14 VAL n 
2 15 GLY n 
2 16 ASP n 
2 17 LEU n 
2 18 VAL n 
2 19 LEU n 
2 20 THR n 
2 21 VAL n 
2 22 LEU n 
2 23 ILE n 
2 24 ALA n 
2 25 LEU n 
2 26 ALA n 
2 27 VAL n 
2 28 TYR n 
2 29 PHE n 
2 30 LEU n 
2 31 GLY n 
2 32 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'TYROBP, DAP12, KARAP' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? vector trpLE ? ? ? ? ? 
2 1 sample ? ? ? human ? 'TYROBP, DAP12, KARAP' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? vector trpLE ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TYOBP_HUMAN O43914 1 CSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRL 35 ? 
2 PDB 2L35        2L35   1 TAEVLGIISIVLVATVLKTIVLIPFLEQN     35 ? 
3 UNP TYOBP_HUMAN O43914 2 CSTVSPGVLAGIVMGDLVLTVLIALAVYFLGR  35 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2L35 A 1  ? 33 ? O43914 35 ? 67 ? 1  33 
2 2 2L35 A 35 ? 63 ? 2L35   35 ? 63 ? 35 63 
3 3 2L35 B 1  ? 32 ? O43914 35 ? 66 ? 1  32 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L35 VAL A 14 ? UNP O43914 MET 48 CONFLICT 14 1 
1 2L35 GLY A 34 ? UNP O43914 ?   ?  LINKER   34 2 
3 2L35 VAL B 14 ? UNP O43914 MET 48 CONFLICT 14 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  3 '2D 1H-13C HSQC'  
1 3  1 '3D HNCA'         
1 4  1 '3D HN(CO)CA'     
1 5  1 '3D HNCACB'       
1 6  1 '3D HN(COCA)CB'   
1 7  3 '3D 1H-15N NOESY' 
1 8  3 '3D 1H-13C NOESY' 
1 9  5 '3D 1H-15N NOESY' 
1 10 5 '2D 1H-13C HSQC'  
1 11 2 '2D 1H-15N HSQC'  
1 12 4 '2D 1H-13C HSQC'  
1 13 2 '3D HNCA'         
1 14 2 '3D HN(CO)CA'     
1 15 2 '3D HNCACB'       
1 16 2 '3D HN(COCA)CB'   
1 17 4 '3D 1H-15N NOESY' 
1 18 4 '3D 1H-13C NOESY' 
1 19 6 '3D 1H-15N NOESY' 
1 20 6 '2D 1H-13C HSQC'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.5-1 mM [U-100% 13C; U-100% 15N; U-80% 2H] DAP12-NKG2C TM-1, 0.5-1 mM DAP12 TM-2, 25 mM SDS-3, 250 mM Foscholine-14-4, 20 mM sodium phosphate-5, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
;0.5-1 mM DAP12-NKG2C TM-6, 0.5-1 mM [U-100% 13C; U-100% 15N; U-80% 2H] DAP12 TM-7, 25 mM SDS-8, 250 mM Foscholine-14-9, 20 mM sodium phosphate-10, 95% H2O/5% D2O
;
2 '95% H2O/5% D2O' 
;0.5-1 mM [U-100% 13C; U-100% 15N] DAP12-NKG2C TM-11, 0.5-1 mM DAP12 TM-12, 25 mM [U-100% 2H] SDS-13, 250 mM [U-100% 2H] Foscholine-14-14, 20 mM sodium phosphate-15, 95% H2O/5% D2O
;
3 '95% H2O/5% D2O' 
;0.5-1 mM DAP12-NKG2C TM-16, 0.5-1 mM [U-100% 13C; U-100% 15N] DAP12 TM-17, 25 mM [U-100% 2H] SDS-18, 250 mM [U-100% 2H] Foscholine-14-19, 20 mM sodium phosphate-20, 95% H2O/5% D2O
;
4 '95% H2O/5% D2O' 
;0.5-1 mM [U-100% 15N; U-100% 2H] DAP12-NKG2C TM-21, 0.5-1 mM [U-10% 13C] DAP12 TM-22, 25 mM [U-100% 2H] SDS-23, 250 mM [U-100% 2H] Foscholine-14-24, 20 mM sodium phosphate-25, 95% H2O/5% D2O
;
5 '95% H2O/5% D2O' 
;0.5-1 mM [U-10% 13C] DAP12-NKG2C TM-26, 0.5-1 mM [U-100% 15N; U-90% 2H] DAP12 TM-27, 25 mM [U-100% 2H] SDS-28, 250 mM [U-100% 2H] Foscholine-14-29, 20 mM sodium phosphate-30, 95% H2O/5% D2O
;
6 '95% H2O/5% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2L35 
_pdbx_nmr_refine.method             'simulated annealing, molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            75 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L35 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L35 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis'             NMRPipe    ? 1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ? 2 
'Bartels et al.'                                    'data analysis'             XEASY      ? 3 
'Bartels et al.'                                    'chemical shift assignment' XEASY      ? 4 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH ? 5 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ? 6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L35 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L35 
_struct.title                     'Structure of the DAP12-NKG2C transmembrane heterotrimer' 
_struct.pdbx_descriptor           'DAP12-NKG2C_TM, TYRO protein tyrosine kinase-binding protein' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L35 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'Immunoreceptor, transmembrane assembly, DAP12-NKG2C complex, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 7  ? GLY A 31 ? GLY A 7  GLY A 31 1 ? 25 
HELX_P HELX_P2 2 VAL A 38 ? GLU A 61 ? VAL A 38 GLU A 61 1 ? 24 
HELX_P HELX_P3 3 VAL B 4  ? GLY B 31 ? VAL B 4  GLY B 31 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            1 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           B 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            1 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             1 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             1 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.020 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    2L35 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . CYS A 1 1  ? 73.944  23.408  -18.308 1.00 0.00 ? 1  CYS A N    1  
ATOM 2     C CA   . CYS A 1 1  ? 73.144  22.371  -17.596 1.00 0.00 ? 1  CYS A CA   1  
ATOM 3     C C    . CYS A 1 1  ? 72.870  21.206  -18.541 1.00 0.00 ? 1  CYS A C    1  
ATOM 4     O O    . CYS A 1 1  ? 72.030  21.304  -19.436 1.00 0.00 ? 1  CYS A O    1  
ATOM 5     C CB   . CYS A 1 1  ? 71.824  22.985  -17.124 1.00 0.00 ? 1  CYS A CB   1  
ATOM 6     S SG   . CYS A 1 1  ? 70.818  21.711  -16.323 1.00 0.00 ? 1  CYS A SG   1  
ATOM 7     H HA   . CYS A 1 1  ? 73.700  22.016  -16.741 1.00 0.00 ? 1  CYS A HA   1  
ATOM 8     H HB2  . CYS A 1 1  ? 72.027  23.778  -16.421 1.00 0.00 ? 1  CYS A HB2  1  
ATOM 9     H HB3  . CYS A 1 1  ? 71.290  23.385  -17.973 1.00 0.00 ? 1  CYS A HB3  1  
ATOM 10    N N    . SER A 1 2  ? 73.583  20.102  -18.335 1.00 0.00 ? 2  SER A N    1  
ATOM 11    C CA   . SER A 1 2  ? 73.410  18.923  -19.175 1.00 0.00 ? 2  SER A CA   1  
ATOM 12    C C    . SER A 1 2  ? 73.952  17.681  -18.474 1.00 0.00 ? 2  SER A C    1  
ATOM 13    O O    . SER A 1 2  ? 74.610  17.779  -17.439 1.00 0.00 ? 2  SER A O    1  
ATOM 14    C CB   . SER A 1 2  ? 74.136  19.119  -20.506 1.00 0.00 ? 2  SER A CB   1  
ATOM 15    O OG   . SER A 1 2  ? 73.792  20.387  -21.047 1.00 0.00 ? 2  SER A OG   1  
ATOM 16    H H    . SER A 1 2  ? 74.239  20.082  -17.607 1.00 0.00 ? 2  SER A H    1  
ATOM 17    H HA   . SER A 1 2  ? 72.356  18.782  -19.370 1.00 0.00 ? 2  SER A HA   1  
ATOM 18    H HB2  . SER A 1 2  ? 75.200  19.077  -20.348 1.00 0.00 ? 2  SER A HB2  1  
ATOM 19    H HB3  . SER A 1 2  ? 73.846  18.334  -21.192 1.00 0.00 ? 2  SER A HB3  1  
ATOM 20    H HG   . SER A 1 2  ? 72.855  20.377  -21.255 1.00 0.00 ? 2  SER A HG   1  
ATOM 21    N N    . THR A 1 3  ? 73.672  16.512  -19.047 1.00 0.00 ? 3  THR A N    1  
ATOM 22    C CA   . THR A 1 3  ? 74.136  15.250  -18.473 1.00 0.00 ? 3  THR A CA   1  
ATOM 23    C C    . THR A 1 3  ? 74.311  14.199  -19.565 1.00 0.00 ? 3  THR A C    1  
ATOM 24    O O    . THR A 1 3  ? 73.551  14.171  -20.533 1.00 0.00 ? 3  THR A O    1  
ATOM 25    C CB   . THR A 1 3  ? 73.128  14.749  -17.435 1.00 0.00 ? 3  THR A CB   1  
ATOM 26    O OG1  . THR A 1 3  ? 73.447  13.411  -17.077 1.00 0.00 ? 3  THR A OG1  1  
ATOM 27    C CG2  . THR A 1 3  ? 71.718  14.800  -18.025 1.00 0.00 ? 3  THR A CG2  1  
ATOM 28    H H    . THR A 1 3  ? 73.143  16.497  -19.873 1.00 0.00 ? 3  THR A H    1  
ATOM 29    H HA   . THR A 1 3  ? 75.087  15.409  -17.986 1.00 0.00 ? 3  THR A HA   1  
ATOM 30    H HB   . THR A 1 3  ? 73.170  15.377  -16.559 1.00 0.00 ? 3  THR A HB   1  
ATOM 31    H HG1  . THR A 1 3  ? 74.049  13.062  -17.738 1.00 0.00 ? 3  THR A HG1  1  
ATOM 32    H HG21 . THR A 1 3  ? 71.038  14.263  -17.379 1.00 0.00 ? 3  THR A HG21 1  
ATOM 33    H HG22 . THR A 1 3  ? 71.720  14.345  -19.003 1.00 0.00 ? 3  THR A HG22 1  
ATOM 34    H HG23 . THR A 1 3  ? 71.399  15.829  -18.106 1.00 0.00 ? 3  THR A HG23 1  
ATOM 35    N N    . VAL A 1 4  ? 75.319  13.338  -19.397 1.00 0.00 ? 4  VAL A N    1  
ATOM 36    C CA   . VAL A 1 4  ? 75.607  12.276  -20.369 1.00 0.00 ? 4  VAL A CA   1  
ATOM 37    C C    . VAL A 1 4  ? 75.301  12.734  -21.792 1.00 0.00 ? 4  VAL A C    1  
ATOM 38    O O    . VAL A 1 4  ? 74.928  11.935  -22.652 1.00 0.00 ? 4  VAL A O    1  
ATOM 39    C CB   . VAL A 1 4  ? 74.799  11.018  -20.033 1.00 0.00 ? 4  VAL A CB   1  
ATOM 40    C CG1  . VAL A 1 4  ? 75.246  10.481  -18.672 1.00 0.00 ? 4  VAL A CG1  1  
ATOM 41    C CG2  . VAL A 1 4  ? 73.304  11.352  -19.977 1.00 0.00 ? 4  VAL A CG2  1  
ATOM 42    H H    . VAL A 1 4  ? 75.884  13.419  -18.602 1.00 0.00 ? 4  VAL A H    1  
ATOM 43    H HA   . VAL A 1 4  ? 76.659  12.032  -20.314 1.00 0.00 ? 4  VAL A HA   1  
ATOM 44    H HB   . VAL A 1 4  ? 74.973  10.267  -20.790 1.00 0.00 ? 4  VAL A HB   1  
ATOM 45    H HG11 . VAL A 1 4  ? 75.303  11.295  -17.964 1.00 0.00 ? 4  VAL A HG11 1  
ATOM 46    H HG12 . VAL A 1 4  ? 76.218  10.019  -18.769 1.00 0.00 ? 4  VAL A HG12 1  
ATOM 47    H HG13 . VAL A 1 4  ? 74.534  9.749   -18.321 1.00 0.00 ? 4  VAL A HG13 1  
ATOM 48    H HG21 . VAL A 1 4  ? 73.022  11.903  -20.861 1.00 0.00 ? 4  VAL A HG21 1  
ATOM 49    H HG22 . VAL A 1 4  ? 73.099  11.947  -19.100 1.00 0.00 ? 4  VAL A HG22 1  
ATOM 50    H HG23 . VAL A 1 4  ? 72.734  10.436  -19.927 1.00 0.00 ? 4  VAL A HG23 1  
ATOM 51    N N    . SER A 1 5  ? 75.478  14.028  -22.025 1.00 0.00 ? 5  SER A N    1  
ATOM 52    C CA   . SER A 1 5  ? 75.241  14.612  -23.339 1.00 0.00 ? 5  SER A CA   1  
ATOM 53    C C    . SER A 1 5  ? 76.485  14.457  -24.221 1.00 0.00 ? 5  SER A C    1  
ATOM 54    O O    . SER A 1 5  ? 76.380  14.096  -25.393 1.00 0.00 ? 5  SER A O    1  
ATOM 55    C CB   . SER A 1 5  ? 74.859  16.097  -23.184 1.00 0.00 ? 5  SER A CB   1  
ATOM 56    O OG   . SER A 1 5  ? 73.505  16.269  -23.579 1.00 0.00 ? 5  SER A OG   1  
ATOM 57    H H    . SER A 1 5  ? 75.790  14.603  -21.294 1.00 0.00 ? 5  SER A H    1  
ATOM 58    H HA   . SER A 1 5  ? 74.417  14.093  -23.808 1.00 0.00 ? 5  SER A HA   1  
ATOM 59    H HB2  . SER A 1 5  ? 74.962  16.388  -22.152 1.00 0.00 ? 5  SER A HB2  1  
ATOM 60    H HB3  . SER A 1 5  ? 75.503  16.720  -23.794 1.00 0.00 ? 5  SER A HB3  1  
ATOM 61    H HG   . SER A 1 5  ? 73.303  17.208  -23.547 1.00 0.00 ? 5  SER A HG   1  
ATOM 62    N N    . PRO A 1 6  ? 77.652  14.719  -23.681 1.00 0.00 ? 6  PRO A N    1  
ATOM 63    C CA   . PRO A 1 6  ? 78.935  14.604  -24.436 1.00 0.00 ? 6  PRO A CA   1  
ATOM 64    C C    . PRO A 1 6  ? 79.028  13.325  -25.251 1.00 0.00 ? 6  PRO A C    1  
ATOM 65    O O    . PRO A 1 6  ? 79.454  13.358  -26.405 1.00 0.00 ? 6  PRO A O    1  
ATOM 66    C CB   . PRO A 1 6  ? 79.988  14.659  -23.328 1.00 0.00 ? 6  PRO A CB   1  
ATOM 67    C CG   . PRO A 1 6  ? 79.367  15.546  -22.306 1.00 0.00 ? 6  PRO A CG   1  
ATOM 68    C CD   . PRO A 1 6  ? 77.891  15.160  -22.291 1.00 0.00 ? 6  PRO A CD   1  
ATOM 69    H HA   . PRO A 1 6  ? 79.069  15.445  -25.081 1.00 0.00 ? 6  PRO A HA   1  
ATOM 70    H HB2  . PRO A 1 6  ? 80.163  13.670  -22.924 1.00 0.00 ? 6  PRO A HB2  1  
ATOM 71    H HB3  . PRO A 1 6  ? 80.907  15.093  -23.691 1.00 0.00 ? 6  PRO A HB3  1  
ATOM 72    H HG2  . PRO A 1 6  ? 79.815  15.378  -21.338 1.00 0.00 ? 6  PRO A HG2  1  
ATOM 73    H HG3  . PRO A 1 6  ? 79.470  16.580  -22.593 1.00 0.00 ? 6  PRO A HG3  1  
ATOM 74    H HD2  . PRO A 1 6  ? 77.731  14.350  -21.592 1.00 0.00 ? 6  PRO A HD2  1  
ATOM 75    H HD3  . PRO A 1 6  ? 77.271  16.009  -22.051 1.00 0.00 ? 6  PRO A HD3  1  
ATOM 76    N N    . GLY A 1 7  ? 78.636  12.202  -24.663 1.00 0.00 ? 7  GLY A N    1  
ATOM 77    C CA   . GLY A 1 7  ? 78.713  10.933  -25.388 1.00 0.00 ? 7  GLY A CA   1  
ATOM 78    C C    . GLY A 1 7  ? 80.175  10.542  -25.543 1.00 0.00 ? 7  GLY A C    1  
ATOM 79    O O    . GLY A 1 7  ? 80.578  9.430   -25.195 1.00 0.00 ? 7  GLY A O    1  
ATOM 80    H H    . GLY A 1 7  ? 78.303  12.228  -23.733 1.00 0.00 ? 7  GLY A H    1  
ATOM 81    H HA2  . GLY A 1 7  ? 78.184  10.158  -24.844 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 82    H HA3  . GLY A 1 7  ? 78.273  11.051  -26.366 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 83    N N    . VAL A 1 8  ? 80.980  11.485  -26.030 1.00 0.00 ? 8  VAL A N    1  
ATOM 84    C CA   . VAL A 1 8  ? 82.400  11.241  -26.179 1.00 0.00 ? 8  VAL A CA   1  
ATOM 85    C C    . VAL A 1 8  ? 82.930  10.753  -24.845 1.00 0.00 ? 8  VAL A C    1  
ATOM 86    O O    . VAL A 1 8  ? 83.802  9.883   -24.784 1.00 0.00 ? 8  VAL A O    1  
ATOM 87    C CB   . VAL A 1 8  ? 83.124  12.521  -26.602 1.00 0.00 ? 8  VAL A CB   1  
ATOM 88    C CG1  . VAL A 1 8  ? 84.636  12.293  -26.565 1.00 0.00 ? 8  VAL A CG1  1  
ATOM 89    C CG2  . VAL A 1 8  ? 82.701  12.892  -28.023 1.00 0.00 ? 8  VAL A CG2  1  
ATOM 90    H H    . VAL A 1 8  ? 80.617  12.360  -26.262 1.00 0.00 ? 8  VAL A H    1  
ATOM 91    H HA   . VAL A 1 8  ? 82.556  10.476  -26.926 1.00 0.00 ? 8  VAL A HA   1  
ATOM 92    H HB   . VAL A 1 8  ? 82.863  13.322  -25.924 1.00 0.00 ? 8  VAL A HB   1  
ATOM 93    H HG11 . VAL A 1 8  ? 84.872  11.362  -27.060 1.00 0.00 ? 8  VAL A HG11 1  
ATOM 94    H HG12 . VAL A 1 8  ? 84.970  12.249  -25.539 1.00 0.00 ? 8  VAL A HG12 1  
ATOM 95    H HG13 . VAL A 1 8  ? 85.135  13.106  -27.072 1.00 0.00 ? 8  VAL A HG13 1  
ATOM 96    H HG21 . VAL A 1 8  ? 83.332  13.687  -28.391 1.00 0.00 ? 8  VAL A HG21 1  
ATOM 97    H HG22 . VAL A 1 8  ? 81.673  13.222  -28.018 1.00 0.00 ? 8  VAL A HG22 1  
ATOM 98    H HG23 . VAL A 1 8  ? 82.798  12.029  -28.665 1.00 0.00 ? 8  VAL A HG23 1  
ATOM 99    N N    . LEU A 1 9  ? 82.361  11.293  -23.765 1.00 0.00 ? 9  LEU A N    1  
ATOM 100   C CA   . LEU A 1 9  ? 82.772  10.852  -22.441 1.00 0.00 ? 9  LEU A CA   1  
ATOM 101   C C    . LEU A 1 9  ? 82.599  9.330   -22.374 1.00 0.00 ? 9  LEU A C    1  
ATOM 102   O O    . LEU A 1 9  ? 83.471  8.604   -21.878 1.00 0.00 ? 9  LEU A O    1  
ATOM 103   C CB   . LEU A 1 9  ? 81.936  11.536  -21.348 1.00 0.00 ? 9  LEU A CB   1  
ATOM 104   C CG   . LEU A 1 9  ? 82.463  12.959  -21.072 1.00 0.00 ? 9  LEU A CG   1  
ATOM 105   C CD1  . LEU A 1 9  ? 81.530  13.654  -20.069 1.00 0.00 ? 9  LEU A CD1  1  
ATOM 106   C CD2  . LEU A 1 9  ? 83.897  12.910  -20.490 1.00 0.00 ? 9  LEU A CD2  1  
ATOM 107   H H    . LEU A 1 9  ? 81.641  11.971  -23.868 1.00 0.00 ? 9  LEU A H    1  
ATOM 108   H HA   . LEU A 1 9  ? 83.811  11.094  -22.302 1.00 0.00 ? 9  LEU A HA   1  
ATOM 109   H HB2  . LEU A 1 9  ? 80.907  11.595  -21.672 1.00 0.00 ? 9  LEU A HB2  1  
ATOM 110   H HB3  . LEU A 1 9  ? 81.990  10.957  -20.441 1.00 0.00 ? 9  LEU A HB3  1  
ATOM 111   H HG   . LEU A 1 9  ? 82.467  13.521  -21.996 1.00 0.00 ? 9  LEU A HG   1  
ATOM 112   H HD11 . LEU A 1 9  ? 80.503  13.426  -20.311 1.00 0.00 ? 9  LEU A HD11 1  
ATOM 113   H HD12 . LEU A 1 9  ? 81.683  14.721  -20.116 1.00 0.00 ? 9  LEU A HD12 1  
ATOM 114   H HD13 . LEU A 1 9  ? 81.749  13.305  -19.070 1.00 0.00 ? 9  LEU A HD13 1  
ATOM 115   H HD21 . LEU A 1 9  ? 84.045  13.730  -19.799 1.00 0.00 ? 9  LEU A HD21 1  
ATOM 116   H HD22 . LEU A 1 9  ? 84.613  12.999  -21.294 1.00 0.00 ? 9  LEU A HD22 1  
ATOM 117   H HD23 . LEU A 1 9  ? 84.053  11.974  -19.972 1.00 0.00 ? 9  LEU A HD23 1  
ATOM 118   N N    . ALA A 1 10 ? 81.487  8.843   -22.929 1.00 0.00 ? 10 ALA A N    1  
ATOM 119   C CA   . ALA A 1 10 ? 81.246  7.412   -22.970 1.00 0.00 ? 10 ALA A CA   1  
ATOM 120   C C    . ALA A 1 10 ? 82.399  6.763   -23.717 1.00 0.00 ? 10 ALA A C    1  
ATOM 121   O O    . ALA A 1 10 ? 82.876  5.685   -23.352 1.00 0.00 ? 10 ALA A O    1  
ATOM 122   C CB   . ALA A 1 10 ? 79.921  7.112   -23.680 1.00 0.00 ? 10 ALA A CB   1  
ATOM 123   H H    . ALA A 1 10 ? 80.845  9.454   -23.348 1.00 0.00 ? 10 ALA A H    1  
ATOM 124   H HA   . ALA A 1 10 ? 81.207  7.025   -21.962 1.00 0.00 ? 10 ALA A HA   1  
ATOM 125   H HB1  . ALA A 1 10 ? 79.591  6.118   -23.422 1.00 0.00 ? 10 ALA A HB1  1  
ATOM 126   H HB2  . ALA A 1 10 ? 80.057  7.180   -24.750 1.00 0.00 ? 10 ALA A HB2  1  
ATOM 127   H HB3  . ALA A 1 10 ? 79.176  7.830   -23.367 1.00 0.00 ? 10 ALA A HB3  1  
ATOM 128   N N    . GLY A 1 11 ? 82.865  7.457   -24.751 1.00 0.00 ? 11 GLY A N    1  
ATOM 129   C CA   . GLY A 1 11 ? 83.991  6.973   -25.533 1.00 0.00 ? 11 GLY A CA   1  
ATOM 130   C C    . GLY A 1 11 ? 85.219  6.853   -24.640 1.00 0.00 ? 11 GLY A C    1  
ATOM 131   O O    . GLY A 1 11 ? 86.098  6.029   -24.878 1.00 0.00 ? 11 GLY A O    1  
ATOM 132   H H    . GLY A 1 11 ? 82.454  8.323   -24.976 1.00 0.00 ? 11 GLY A H    1  
ATOM 133   H HA2  . GLY A 1 11 ? 83.749  6.005   -25.949 1.00 0.00 ? 11 GLY A HA2  1  
ATOM 134   H HA3  . GLY A 1 11 ? 84.200  7.667   -26.333 1.00 0.00 ? 11 GLY A HA3  1  
ATOM 135   N N    . ILE A 1 12 ? 85.257  7.684   -23.599 1.00 0.00 ? 12 ILE A N    1  
ATOM 136   C CA   . ILE A 1 12 ? 86.371  7.664   -22.653 1.00 0.00 ? 12 ILE A CA   1  
ATOM 137   C C    . ILE A 1 12 ? 86.316  6.364   -21.859 1.00 0.00 ? 12 ILE A C    1  
ATOM 138   O O    . ILE A 1 12 ? 87.344  5.744   -21.582 1.00 0.00 ? 12 ILE A O    1  
ATOM 139   C CB   . ILE A 1 12 ? 86.315  8.930   -21.725 1.00 0.00 ? 12 ILE A CB   1  
ATOM 140   C CG1  . ILE A 1 12 ? 87.687  9.643   -21.685 1.00 0.00 ? 12 ILE A CG1  1  
ATOM 141   C CG2  . ILE A 1 12 ? 85.900  8.587   -20.271 1.00 0.00 ? 12 ILE A CG2  1  
ATOM 142   C CD1  . ILE A 1 12 ? 87.506  11.091  -21.211 1.00 0.00 ? 12 ILE A CD1  1  
ATOM 143   H H    . ILE A 1 12 ? 84.517  8.310   -23.464 1.00 0.00 ? 12 ILE A H    1  
ATOM 144   H HA   . ILE A 1 12 ? 87.289  7.665   -23.221 1.00 0.00 ? 12 ILE A HA   1  
ATOM 145   H HB   . ILE A 1 12 ? 85.587  9.614   -22.133 1.00 0.00 ? 12 ILE A HB   1  
ATOM 146   H HG12 . ILE A 1 12 ? 88.344  9.122   -21.005 1.00 0.00 ? 12 ILE A HG12 1  
ATOM 147   H HG13 . ILE A 1 12 ? 88.127  9.654   -22.671 1.00 0.00 ? 12 ILE A HG13 1  
ATOM 148   H HG21 . ILE A 1 12 ? 85.674  9.499   -19.735 1.00 0.00 ? 12 ILE A HG21 1  
ATOM 149   H HG22 . ILE A 1 12 ? 86.709  8.075   -19.769 1.00 0.00 ? 12 ILE A HG22 1  
ATOM 150   H HG23 . ILE A 1 12 ? 85.028  7.957   -20.274 1.00 0.00 ? 12 ILE A HG23 1  
ATOM 151   H HD11 . ILE A 1 12 ? 87.223  11.710  -22.051 1.00 0.00 ? 12 ILE A HD11 1  
ATOM 152   H HD12 . ILE A 1 12 ? 88.435  11.452  -20.799 1.00 0.00 ? 12 ILE A HD12 1  
ATOM 153   H HD13 . ILE A 1 12 ? 86.735  11.137  -20.456 1.00 0.00 ? 12 ILE A HD13 1  
ATOM 154   N N    . VAL A 1 13 ? 85.103  5.951   -21.512 1.00 0.00 ? 13 VAL A N    1  
ATOM 155   C CA   . VAL A 1 13 ? 84.925  4.713   -20.765 1.00 0.00 ? 13 VAL A CA   1  
ATOM 156   C C    . VAL A 1 13 ? 85.434  3.535   -21.587 1.00 0.00 ? 13 VAL A C    1  
ATOM 157   O O    . VAL A 1 13 ? 86.243  2.728   -21.115 1.00 0.00 ? 13 VAL A O    1  
ATOM 158   C CB   . VAL A 1 13 ? 83.447  4.505   -20.432 1.00 0.00 ? 13 VAL A CB   1  
ATOM 159   C CG1  . VAL A 1 13 ? 83.277  3.201   -19.651 1.00 0.00 ? 13 VAL A CG1  1  
ATOM 160   C CG2  . VAL A 1 13 ? 82.947  5.677   -19.586 1.00 0.00 ? 13 VAL A CG2  1  
ATOM 161   H H    . VAL A 1 13 ? 84.317  6.489   -21.767 1.00 0.00 ? 13 VAL A H    1  
ATOM 162   H HA   . VAL A 1 13 ? 85.487  4.771   -19.851 1.00 0.00 ? 13 VAL A HA   1  
ATOM 163   H HB   . VAL A 1 13 ? 82.877  4.451   -21.348 1.00 0.00 ? 13 VAL A HB   1  
ATOM 164   H HG11 . VAL A 1 13 ? 82.270  3.139   -19.268 1.00 0.00 ? 13 VAL A HG11 1  
ATOM 165   H HG12 . VAL A 1 13 ? 83.977  3.182   -18.828 1.00 0.00 ? 13 VAL A HG12 1  
ATOM 166   H HG13 . VAL A 1 13 ? 83.467  2.362   -20.303 1.00 0.00 ? 13 VAL A HG13 1  
ATOM 167   H HG21 . VAL A 1 13 ? 81.894  5.547   -19.378 1.00 0.00 ? 13 VAL A HG21 1  
ATOM 168   H HG22 . VAL A 1 13 ? 83.096  6.600   -20.126 1.00 0.00 ? 13 VAL A HG22 1  
ATOM 169   H HG23 . VAL A 1 13 ? 83.497  5.709   -18.659 1.00 0.00 ? 13 VAL A HG23 1  
ATOM 170   N N    . VAL A 1 14 ? 84.966  3.451   -22.826 1.00 0.00 ? 14 VAL A N    1  
ATOM 171   C CA   . VAL A 1 14 ? 85.389  2.376   -23.714 1.00 0.00 ? 14 VAL A CA   1  
ATOM 172   C C    . VAL A 1 14 ? 86.900  2.421   -23.907 1.00 0.00 ? 14 VAL A C    1  
ATOM 173   O O    . VAL A 1 14 ? 87.568  1.389   -23.882 1.00 0.00 ? 14 VAL A O    1  
ATOM 174   C CB   . VAL A 1 14 ? 84.695  2.515   -25.071 1.00 0.00 ? 14 VAL A CB   1  
ATOM 175   C CG1  . VAL A 1 14 ? 85.217  1.438   -26.024 1.00 0.00 ? 14 VAL A CG1  1  
ATOM 176   C CG2  . VAL A 1 14 ? 83.186  2.347   -24.889 1.00 0.00 ? 14 VAL A CG2  1  
ATOM 177   H H    . VAL A 1 14 ? 84.331  4.129   -23.150 1.00 0.00 ? 14 VAL A H    1  
ATOM 178   H HA   . VAL A 1 14 ? 85.116  1.428   -23.276 1.00 0.00 ? 14 VAL A HA   1  
ATOM 179   H HB   . VAL A 1 14 ? 84.904  3.491   -25.484 1.00 0.00 ? 14 VAL A HB   1  
ATOM 180   H HG11 . VAL A 1 14 ? 85.215  0.482   -25.522 1.00 0.00 ? 14 VAL A HG11 1  
ATOM 181   H HG12 . VAL A 1 14 ? 86.223  1.682   -26.328 1.00 0.00 ? 14 VAL A HG12 1  
ATOM 182   H HG13 . VAL A 1 14 ? 84.579  1.388   -26.894 1.00 0.00 ? 14 VAL A HG13 1  
ATOM 183   H HG21 . VAL A 1 14 ? 82.848  2.979   -24.082 1.00 0.00 ? 14 VAL A HG21 1  
ATOM 184   H HG22 . VAL A 1 14 ? 82.963  1.316   -24.656 1.00 0.00 ? 14 VAL A HG22 1  
ATOM 185   H HG23 . VAL A 1 14 ? 82.680  2.627   -25.801 1.00 0.00 ? 14 VAL A HG23 1  
ATOM 186   N N    . GLY A 1 15 ? 87.424  3.629   -24.097 1.00 0.00 ? 15 GLY A N    1  
ATOM 187   C CA   . GLY A 1 15 ? 88.856  3.821   -24.298 1.00 0.00 ? 15 GLY A CA   1  
ATOM 188   C C    . GLY A 1 15 ? 89.662  3.290   -23.116 1.00 0.00 ? 15 GLY A C    1  
ATOM 189   O O    . GLY A 1 15 ? 90.733  2.714   -23.293 1.00 0.00 ? 15 GLY A O    1  
ATOM 190   H H    . GLY A 1 15 ? 86.833  4.411   -24.105 1.00 0.00 ? 15 GLY A H    1  
ATOM 191   H HA2  . GLY A 1 15 ? 89.157  3.305   -25.196 1.00 0.00 ? 15 GLY A HA2  1  
ATOM 192   H HA3  . GLY A 1 15 ? 89.056  4.875   -24.414 1.00 0.00 ? 15 GLY A HA3  1  
ATOM 193   N N    . ASP A 1 16 ? 89.146  3.495   -21.909 1.00 0.00 ? 16 ASP A N    1  
ATOM 194   C CA   . ASP A 1 16 ? 89.837  3.034   -20.711 1.00 0.00 ? 16 ASP A CA   1  
ATOM 195   C C    . ASP A 1 16 ? 89.900  1.510   -20.678 1.00 0.00 ? 16 ASP A C    1  
ATOM 196   O O    . ASP A 1 16 ? 90.953  0.924   -20.406 1.00 0.00 ? 16 ASP A O    1  
ATOM 197   C CB   . ASP A 1 16 ? 89.114  3.541   -19.462 1.00 0.00 ? 16 ASP A CB   1  
ATOM 198   C CG   . ASP A 1 16 ? 89.979  3.304   -18.228 1.00 0.00 ? 16 ASP A CG   1  
ATOM 199   O OD1  . ASP A 1 16 ? 90.918  2.532   -18.326 1.00 0.00 ? 16 ASP A OD1  1  
ATOM 200   O OD2  . ASP A 1 16 ? 89.687  3.898   -17.203 1.00 0.00 ? 16 ASP A OD2  1  
ATOM 201   H H    . ASP A 1 16 ? 88.291  3.965   -21.823 1.00 0.00 ? 16 ASP A H    1  
ATOM 202   H HA   . ASP A 1 16 ? 90.844  3.425   -20.714 1.00 0.00 ? 16 ASP A HA   1  
ATOM 203   H HB2  . ASP A 1 16 ? 88.919  4.598   -19.566 1.00 0.00 ? 16 ASP A HB2  1  
ATOM 204   H HB3  . ASP A 1 16 ? 88.180  3.013   -19.351 1.00 0.00 ? 16 ASP A HB3  1  
ATOM 205   N N    . LEU A 1 17 ? 88.765  0.873   -20.953 1.00 0.00 ? 17 LEU A N    1  
ATOM 206   C CA   . LEU A 1 17 ? 88.705  -0.586  -20.943 1.00 0.00 ? 17 LEU A CA   1  
ATOM 207   C C    . LEU A 1 17 ? 89.742  -1.178  -21.899 1.00 0.00 ? 17 LEU A C    1  
ATOM 208   O O    . LEU A 1 17 ? 90.528  -2.051  -21.514 1.00 0.00 ? 17 LEU A O    1  
ATOM 209   C CB   . LEU A 1 17 ? 87.301  -1.052  -21.350 1.00 0.00 ? 17 LEU A CB   1  
ATOM 210   C CG   . LEU A 1 17 ? 87.146  -2.566  -21.102 1.00 0.00 ? 17 LEU A CG   1  
ATOM 211   C CD1  . LEU A 1 17 ? 86.912  -2.852  -19.609 1.00 0.00 ? 17 LEU A CD1  1  
ATOM 212   C CD2  . LEU A 1 17 ? 85.951  -3.089  -21.908 1.00 0.00 ? 17 LEU A CD2  1  
ATOM 213   H H    . LEU A 1 17 ? 87.955  1.391   -21.159 1.00 0.00 ? 17 LEU A H    1  
ATOM 214   H HA   . LEU A 1 17 ? 88.914  -0.933  -19.945 1.00 0.00 ? 17 LEU A HA   1  
ATOM 215   H HB2  . LEU A 1 17 ? 86.565  -0.510  -20.776 1.00 0.00 ? 17 LEU A HB2  1  
ATOM 216   H HB3  . LEU A 1 17 ? 87.154  -0.847  -22.400 1.00 0.00 ? 17 LEU A HB3  1  
ATOM 217   H HG   . LEU A 1 17 ? 88.042  -3.076  -21.424 1.00 0.00 ? 17 LEU A HG   1  
ATOM 218   H HD11 . LEU A 1 17 ? 87.846  -2.777  -19.074 1.00 0.00 ? 17 LEU A HD11 1  
ATOM 219   H HD12 . LEU A 1 17 ? 86.517  -3.851  -19.492 1.00 0.00 ? 17 LEU A HD12 1  
ATOM 220   H HD13 . LEU A 1 17 ? 86.208  -2.141  -19.204 1.00 0.00 ? 17 LEU A HD13 1  
ATOM 221   H HD21 . LEU A 1 17 ? 86.193  -3.075  -22.960 1.00 0.00 ? 17 LEU A HD21 1  
ATOM 222   H HD22 . LEU A 1 17 ? 85.092  -2.460  -21.728 1.00 0.00 ? 17 LEU A HD22 1  
ATOM 223   H HD23 . LEU A 1 17 ? 85.726  -4.100  -21.604 1.00 0.00 ? 17 LEU A HD23 1  
ATOM 224   N N    . VAL A 1 18 ? 89.747  -0.703  -23.143 1.00 0.00 ? 18 VAL A N    1  
ATOM 225   C CA   . VAL A 1 18 ? 90.700  -1.215  -24.117 1.00 0.00 ? 18 VAL A CA   1  
ATOM 226   C C    . VAL A 1 18 ? 92.125  -0.851  -23.715 1.00 0.00 ? 18 VAL A C    1  
ATOM 227   O O    . VAL A 1 18 ? 93.062  -1.555  -24.064 1.00 0.00 ? 18 VAL A O    1  
ATOM 228   C CB   . VAL A 1 18 ? 90.402  -0.674  -25.517 1.00 0.00 ? 18 VAL A CB   1  
ATOM 229   C CG1  . VAL A 1 18 ? 89.043  -1.195  -25.988 1.00 0.00 ? 18 VAL A CG1  1  
ATOM 230   C CG2  . VAL A 1 18 ? 90.371  0.847   -25.473 1.00 0.00 ? 18 VAL A CG2  1  
ATOM 231   H H    . VAL A 1 18 ? 89.106  -0.005  -23.405 1.00 0.00 ? 18 VAL A H    1  
ATOM 232   H HA   . VAL A 1 18 ? 90.618  -2.291  -24.142 1.00 0.00 ? 18 VAL A HA   1  
ATOM 233   H HB   . VAL A 1 18 ? 91.171  -1.002  -26.200 1.00 0.00 ? 18 VAL A HB   1  
ATOM 234   H HG11 . VAL A 1 18 ? 89.030  -2.274  -25.927 1.00 0.00 ? 18 VAL A HG11 1  
ATOM 235   H HG12 . VAL A 1 18 ? 88.876  -0.890  -27.011 1.00 0.00 ? 18 VAL A HG12 1  
ATOM 236   H HG13 . VAL A 1 18 ? 88.265  -0.789  -25.360 1.00 0.00 ? 18 VAL A HG13 1  
ATOM 237   H HG21 . VAL A 1 18 ? 89.983  1.229   -26.406 1.00 0.00 ? 18 VAL A HG21 1  
ATOM 238   H HG22 . VAL A 1 18 ? 91.371  1.225   -25.314 1.00 0.00 ? 18 VAL A HG22 1  
ATOM 239   H HG23 . VAL A 1 18 ? 89.736  1.159   -24.666 1.00 0.00 ? 18 VAL A HG23 1  
ATOM 240   N N    . LEU A 1 19 ? 92.292  0.248   -22.979 1.00 0.00 ? 19 LEU A N    1  
ATOM 241   C CA   . LEU A 1 19 ? 93.631  0.650   -22.555 1.00 0.00 ? 19 LEU A CA   1  
ATOM 242   C C    . LEU A 1 19 ? 94.245  -0.452  -21.686 1.00 0.00 ? 19 LEU A C    1  
ATOM 243   O O    . LEU A 1 19 ? 95.316  -0.984  -21.998 1.00 0.00 ? 19 LEU A O    1  
ATOM 244   C CB   . LEU A 1 19 ? 93.563  1.978   -21.767 1.00 0.00 ? 19 LEU A CB   1  
ATOM 245   C CG   . LEU A 1 19 ? 94.843  2.816   -21.972 1.00 0.00 ? 19 LEU A CG   1  
ATOM 246   C CD1  . LEU A 1 19 ? 96.081  1.965   -21.665 1.00 0.00 ? 19 LEU A CD1  1  
ATOM 247   C CD2  . LEU A 1 19 ? 94.921  3.349   -23.420 1.00 0.00 ? 19 LEU A CD2  1  
ATOM 248   H H    . LEU A 1 19 ? 91.513  0.789   -22.720 1.00 0.00 ? 19 LEU A H    1  
ATOM 249   H HA   . LEU A 1 19 ? 94.241  0.783   -23.433 1.00 0.00 ? 19 LEU A HA   1  
ATOM 250   H HB2  . LEU A 1 19 ? 92.712  2.546   -22.102 1.00 0.00 ? 19 LEU A HB2  1  
ATOM 251   H HB3  . LEU A 1 19 ? 93.446  1.768   -20.712 1.00 0.00 ? 19 LEU A HB3  1  
ATOM 252   H HG   . LEU A 1 19 ? 94.821  3.653   -21.288 1.00 0.00 ? 19 LEU A HG   1  
ATOM 253   H HD11 . LEU A 1 19 ? 96.923  2.615   -21.473 1.00 0.00 ? 19 LEU A HD11 1  
ATOM 254   H HD12 . LEU A 1 19 ? 96.303  1.333   -22.509 1.00 0.00 ? 19 LEU A HD12 1  
ATOM 255   H HD13 . LEU A 1 19 ? 95.896  1.354   -20.793 1.00 0.00 ? 19 LEU A HD13 1  
ATOM 256   H HD21 . LEU A 1 19 ? 93.927  3.512   -23.809 1.00 0.00 ? 19 LEU A HD21 1  
ATOM 257   H HD22 . LEU A 1 19 ? 95.441  2.641   -24.050 1.00 0.00 ? 19 LEU A HD22 1  
ATOM 258   H HD23 . LEU A 1 19 ? 95.460  4.285   -23.423 1.00 0.00 ? 19 LEU A HD23 1  
ATOM 259   N N    . THR A 1 20 ? 93.553  -0.796  -20.599 1.00 0.00 ? 20 THR A N    1  
ATOM 260   C CA   . THR A 1 20 ? 94.032  -1.838  -19.698 1.00 0.00 ? 20 THR A CA   1  
ATOM 261   C C    . THR A 1 20 ? 94.247  -3.153  -20.443 1.00 0.00 ? 20 THR A C    1  
ATOM 262   O O    . THR A 1 20 ? 95.231  -3.854  -20.209 1.00 0.00 ? 20 THR A O    1  
ATOM 263   C CB   . THR A 1 20 ? 93.012  -2.058  -18.582 1.00 0.00 ? 20 THR A CB   1  
ATOM 264   O OG1  . THR A 1 20 ? 92.823  -0.844  -17.876 1.00 0.00 ? 20 THR A OG1  1  
ATOM 265   C CG2  . THR A 1 20 ? 93.518  -3.138  -17.624 1.00 0.00 ? 20 THR A CG2  1  
ATOM 266   H H    . THR A 1 20 ? 92.703  -0.339  -20.393 1.00 0.00 ? 20 THR A H    1  
ATOM 267   H HA   . THR A 1 20 ? 94.966  -1.524  -19.260 1.00 0.00 ? 20 THR A HA   1  
ATOM 268   H HB   . THR A 1 20 ? 92.073  -2.376  -19.011 1.00 0.00 ? 20 THR A HB   1  
ATOM 269   H HG1  . THR A 1 20 ? 91.879  -0.705  -17.774 1.00 0.00 ? 20 THR A HG1  1  
ATOM 270   H HG21 . THR A 1 20 ? 94.563  -2.969  -17.409 1.00 0.00 ? 20 THR A HG21 1  
ATOM 271   H HG22 . THR A 1 20 ? 93.397  -4.110  -18.080 1.00 0.00 ? 20 THR A HG22 1  
ATOM 272   H HG23 . THR A 1 20 ? 92.951  -3.099  -16.706 1.00 0.00 ? 20 THR A HG23 1  
ATOM 273   N N    . VAL A 1 21 ? 93.310  -3.496  -21.322 1.00 0.00 ? 21 VAL A N    1  
ATOM 274   C CA   . VAL A 1 21 ? 93.400  -4.749  -22.072 1.00 0.00 ? 21 VAL A CA   1  
ATOM 275   C C    . VAL A 1 21 ? 94.592  -4.767  -23.035 1.00 0.00 ? 21 VAL A C    1  
ATOM 276   O O    . VAL A 1 21 ? 95.220  -5.807  -23.227 1.00 0.00 ? 21 VAL A O    1  
ATOM 277   C CB   . VAL A 1 21 ? 92.106  -4.972  -22.858 1.00 0.00 ? 21 VAL A CB   1  
ATOM 278   C CG1  . VAL A 1 21 ? 92.224  -6.250  -23.692 1.00 0.00 ? 21 VAL A CG1  1  
ATOM 279   C CG2  . VAL A 1 21 ? 90.936  -5.112  -21.881 1.00 0.00 ? 21 VAL A CG2  1  
ATOM 280   H H    . VAL A 1 21 ? 92.533  -2.907  -21.455 1.00 0.00 ? 21 VAL A H    1  
ATOM 281   H HA   . VAL A 1 21 ? 93.515  -5.561  -21.370 1.00 0.00 ? 21 VAL A HA   1  
ATOM 282   H HB   . VAL A 1 21 ? 91.932  -4.130  -23.512 1.00 0.00 ? 21 VAL A HB   1  
ATOM 283   H HG11 . VAL A 1 21 ? 91.248  -6.536  -24.055 1.00 0.00 ? 21 VAL A HG11 1  
ATOM 284   H HG12 . VAL A 1 21 ? 92.626  -7.044  -23.079 1.00 0.00 ? 21 VAL A HG12 1  
ATOM 285   H HG13 . VAL A 1 21 ? 92.882  -6.074  -24.530 1.00 0.00 ? 21 VAL A HG13 1  
ATOM 286   H HG21 . VAL A 1 21 ? 90.996  -4.333  -21.134 1.00 0.00 ? 21 VAL A HG21 1  
ATOM 287   H HG22 . VAL A 1 21 ? 90.983  -6.077  -21.399 1.00 0.00 ? 21 VAL A HG22 1  
ATOM 288   H HG23 . VAL A 1 21 ? 90.005  -5.024  -22.420 1.00 0.00 ? 21 VAL A HG23 1  
ATOM 289   N N    . LEU A 1 22 ? 94.884  -3.630  -23.660 1.00 0.00 ? 22 LEU A N    1  
ATOM 290   C CA   . LEU A 1 22 ? 95.985  -3.559  -24.622 1.00 0.00 ? 22 LEU A CA   1  
ATOM 291   C C    . LEU A 1 22 ? 97.340  -3.737  -23.934 1.00 0.00 ? 22 LEU A C    1  
ATOM 292   O O    . LEU A 1 22 ? 98.128  -4.599  -24.320 1.00 0.00 ? 22 LEU A O    1  
ATOM 293   C CB   . LEU A 1 22 ? 95.941  -2.205  -25.359 1.00 0.00 ? 22 LEU A CB   1  
ATOM 294   C CG   . LEU A 1 22 ? 96.551  -2.316  -26.773 1.00 0.00 ? 22 LEU A CG   1  
ATOM 295   C CD1  . LEU A 1 22 ? 97.968  -2.897  -26.692 1.00 0.00 ? 22 LEU A CD1  1  
ATOM 296   C CD2  . LEU A 1 22 ? 95.671  -3.208  -27.679 1.00 0.00 ? 22 LEU A CD2  1  
ATOM 297   H H    . LEU A 1 22 ? 94.340  -2.833  -23.489 1.00 0.00 ? 22 LEU A H    1  
ATOM 298   H HA   . LEU A 1 22 ? 95.859  -4.351  -25.339 1.00 0.00 ? 22 LEU A HA   1  
ATOM 299   H HB2  . LEU A 1 22 ? 94.916  -1.881  -25.443 1.00 0.00 ? 22 LEU A HB2  1  
ATOM 300   H HB3  . LEU A 1 22 ? 96.495  -1.467  -24.794 1.00 0.00 ? 22 LEU A HB3  1  
ATOM 301   H HG   . LEU A 1 22 ? 96.608  -1.326  -27.204 1.00 0.00 ? 22 LEU A HG   1  
ATOM 302   H HD11 . LEU A 1 22 ? 98.494  -2.685  -27.611 1.00 0.00 ? 22 LEU A HD11 1  
ATOM 303   H HD12 . LEU A 1 22 ? 97.911  -3.965  -26.551 1.00 0.00 ? 22 LEU A HD12 1  
ATOM 304   H HD13 . LEU A 1 22 ? 98.496  -2.447  -25.865 1.00 0.00 ? 22 LEU A HD13 1  
ATOM 305   H HD21 . LEU A 1 22 ? 96.008  -4.235  -27.632 1.00 0.00 ? 22 LEU A HD21 1  
ATOM 306   H HD22 . LEU A 1 22 ? 95.746  -2.859  -28.699 1.00 0.00 ? 22 LEU A HD22 1  
ATOM 307   H HD23 . LEU A 1 22 ? 94.640  -3.154  -27.362 1.00 0.00 ? 22 LEU A HD23 1  
ATOM 308   N N    . ILE A 1 23 ? 97.615  -2.922  -22.920 1.00 0.00 ? 23 ILE A N    1  
ATOM 309   C CA   . ILE A 1 23 ? 98.891  -3.021  -22.220 1.00 0.00 ? 23 ILE A CA   1  
ATOM 310   C C    . ILE A 1 23 ? 98.991  -4.351  -21.477 1.00 0.00 ? 23 ILE A C    1  
ATOM 311   O O    . ILE A 1 23 ? 100.018 -5.033  -21.531 1.00 0.00 ? 23 ILE A O    1  
ATOM 312   C CB   . ILE A 1 23 ? 99.035  -1.860  -21.238 1.00 0.00 ? 23 ILE A CB   1  
ATOM 313   C CG1  . ILE A 1 23 ? 98.673  -0.544  -21.939 1.00 0.00 ? 23 ILE A CG1  1  
ATOM 314   C CG2  . ILE A 1 23 ? 100.478 -1.789  -20.732 1.00 0.00 ? 23 ILE A CG2  1  
ATOM 315   C CD1  . ILE A 1 23 ? 99.469  -0.395  -23.241 1.00 0.00 ? 23 ILE A CD1  1  
ATOM 316   H H    . ILE A 1 23 ? 96.959  -2.245  -22.642 1.00 0.00 ? 23 ILE A H    1  
ATOM 317   H HA   . ILE A 1 23 ? 99.691  -2.968  -22.943 1.00 0.00 ? 23 ILE A HA   1  
ATOM 318   H HB   . ILE A 1 23 ? 98.369  -2.016  -20.406 1.00 0.00 ? 23 ILE A HB   1  
ATOM 319   H HG12 . ILE A 1 23 ? 97.619  -0.545  -22.163 1.00 0.00 ? 23 ILE A HG12 1  
ATOM 320   H HG13 . ILE A 1 23 ? 98.901  0.283   -21.284 1.00 0.00 ? 23 ILE A HG13 1  
ATOM 321   H HG21 . ILE A 1 23 ? 100.582 -0.952  -20.057 1.00 0.00 ? 23 ILE A HG21 1  
ATOM 322   H HG22 . ILE A 1 23 ? 101.147 -1.660  -21.570 1.00 0.00 ? 23 ILE A HG22 1  
ATOM 323   H HG23 . ILE A 1 23 ? 100.723 -2.704  -20.213 1.00 0.00 ? 23 ILE A HG23 1  
ATOM 324   H HD11 . ILE A 1 23 ? 99.013  -0.998  -24.012 1.00 0.00 ? 23 ILE A HD11 1  
ATOM 325   H HD12 . ILE A 1 23 ? 100.487 -0.718  -23.086 1.00 0.00 ? 23 ILE A HD12 1  
ATOM 326   H HD13 . ILE A 1 23 ? 99.464  0.641   -23.547 1.00 0.00 ? 23 ILE A HD13 1  
ATOM 327   N N    . ALA A 1 24 ? 97.913  -4.719  -20.795 1.00 0.00 ? 24 ALA A N    1  
ATOM 328   C CA   . ALA A 1 24 ? 97.884  -5.973  -20.055 1.00 0.00 ? 24 ALA A CA   1  
ATOM 329   C C    . ALA A 1 24 ? 98.162  -7.138  -20.997 1.00 0.00 ? 24 ALA A C    1  
ATOM 330   O O    . ALA A 1 24 ? 98.868  -8.083  -20.646 1.00 0.00 ? 24 ALA A O    1  
ATOM 331   C CB   . ALA A 1 24 ? 96.516  -6.161  -19.400 1.00 0.00 ? 24 ALA A CB   1  
ATOM 332   H H    . ALA A 1 24 ? 97.121  -4.142  -20.794 1.00 0.00 ? 24 ALA A H    1  
ATOM 333   H HA   . ALA A 1 24 ? 98.642  -5.950  -19.288 1.00 0.00 ? 24 ALA A HA   1  
ATOM 334   H HB1  . ALA A 1 24 ? 95.749  -6.152  -20.160 1.00 0.00 ? 24 ALA A HB1  1  
ATOM 335   H HB2  . ALA A 1 24 ? 96.340  -5.357  -18.700 1.00 0.00 ? 24 ALA A HB2  1  
ATOM 336   H HB3  . ALA A 1 24 ? 96.497  -7.105  -18.878 1.00 0.00 ? 24 ALA A HB3  1  
ATOM 337   N N    . LEU A 1 25 ? 97.601  -7.056  -22.199 1.00 0.00 ? 25 LEU A N    1  
ATOM 338   C CA   . LEU A 1 25 ? 97.791  -8.099  -23.197 1.00 0.00 ? 25 LEU A CA   1  
ATOM 339   C C    . LEU A 1 25 ? 99.238  -8.104  -23.678 1.00 0.00 ? 25 LEU A C    1  
ATOM 340   O O    . LEU A 1 25 ? 99.800  -9.157  -23.978 1.00 0.00 ? 25 LEU A O    1  
ATOM 341   C CB   . LEU A 1 25 ? 96.843  -7.861  -24.381 1.00 0.00 ? 25 LEU A CB   1  
ATOM 342   C CG   . LEU A 1 25 ? 97.115  -8.869  -25.508 1.00 0.00 ? 25 LEU A CG   1  
ATOM 343   C CD1  . LEU A 1 25 ? 97.038  -10.304 -24.967 1.00 0.00 ? 25 LEU A CD1  1  
ATOM 344   C CD2  . LEU A 1 25 ? 96.062  -8.682  -26.606 1.00 0.00 ? 25 LEU A CD2  1  
ATOM 345   H H    . LEU A 1 25 ? 97.051  -6.276  -22.420 1.00 0.00 ? 25 LEU A H    1  
ATOM 346   H HA   . LEU A 1 25 ? 97.563  -9.054  -22.749 1.00 0.00 ? 25 LEU A HA   1  
ATOM 347   H HB2  . LEU A 1 25 ? 95.821  -7.969  -24.046 1.00 0.00 ? 25 LEU A HB2  1  
ATOM 348   H HB3  . LEU A 1 25 ? 96.989  -6.859  -24.758 1.00 0.00 ? 25 LEU A HB3  1  
ATOM 349   H HG   . LEU A 1 25 ? 98.097  -8.693  -25.921 1.00 0.00 ? 25 LEU A HG   1  
ATOM 350   H HD11 . LEU A 1 25 ? 96.867  -10.992 -25.783 1.00 0.00 ? 25 LEU A HD11 1  
ATOM 351   H HD12 . LEU A 1 25 ? 96.228  -10.381 -24.256 1.00 0.00 ? 25 LEU A HD12 1  
ATOM 352   H HD13 . LEU A 1 25 ? 97.969  -10.554 -24.480 1.00 0.00 ? 25 LEU A HD13 1  
ATOM 353   H HD21 . LEU A 1 25 ? 95.113  -9.071  -26.266 1.00 0.00 ? 25 LEU A HD21 1  
ATOM 354   H HD22 . LEU A 1 25 ? 96.371  -9.212  -27.495 1.00 0.00 ? 25 LEU A HD22 1  
ATOM 355   H HD23 . LEU A 1 25 ? 95.959  -7.631  -26.831 1.00 0.00 ? 25 LEU A HD23 1  
ATOM 356   N N    . ALA A 1 26 ? 99.836  -6.919  -23.747 1.00 0.00 ? 26 ALA A N    1  
ATOM 357   C CA   . ALA A 1 26 ? 101.220 -6.799  -24.191 1.00 0.00 ? 26 ALA A CA   1  
ATOM 358   C C    . ALA A 1 26 ? 102.147 -7.597  -23.281 1.00 0.00 ? 26 ALA A C    1  
ATOM 359   O O    . ALA A 1 26 ? 102.958 -8.392  -23.752 1.00 0.00 ? 26 ALA A O    1  
ATOM 360   C CB   . ALA A 1 26 ? 101.643 -5.328  -24.191 1.00 0.00 ? 26 ALA A CB   1  
ATOM 361   H H    . ALA A 1 26 ? 99.339  -6.113  -23.495 1.00 0.00 ? 26 ALA A H    1  
ATOM 362   H HA   . ALA A 1 26 ? 101.300 -7.184  -25.196 1.00 0.00 ? 26 ALA A HA   1  
ATOM 363   H HB1  . ALA A 1 26 ? 100.863 -4.729  -24.634 1.00 0.00 ? 26 ALA A HB1  1  
ATOM 364   H HB2  . ALA A 1 26 ? 102.553 -5.216  -24.763 1.00 0.00 ? 26 ALA A HB2  1  
ATOM 365   H HB3  . ALA A 1 26 ? 101.814 -5.003  -23.175 1.00 0.00 ? 26 ALA A HB3  1  
ATOM 366   N N    . VAL A 1 27 ? 102.022 -7.380  -21.975 1.00 0.00 ? 27 VAL A N    1  
ATOM 367   C CA   . VAL A 1 27 ? 102.864 -8.091  -21.015 1.00 0.00 ? 27 VAL A CA   1  
ATOM 368   C C    . VAL A 1 27 ? 102.514 -9.577  -20.988 1.00 0.00 ? 27 VAL A C    1  
ATOM 369   O O    . VAL A 1 27 ? 103.398 -10.428 -20.890 1.00 0.00 ? 27 VAL A O    1  
ATOM 370   C CB   . VAL A 1 27 ? 102.699 -7.500  -19.613 1.00 0.00 ? 27 VAL A CB   1  
ATOM 371   C CG1  . VAL A 1 27 ? 103.336 -6.111  -19.569 1.00 0.00 ? 27 VAL A CG1  1  
ATOM 372   C CG2  . VAL A 1 27 ? 101.212 -7.389  -19.265 1.00 0.00 ? 27 VAL A CG2  1  
ATOM 373   H H    . VAL A 1 27 ? 101.358 -6.730  -21.653 1.00 0.00 ? 27 VAL A H    1  
ATOM 374   H HA   . VAL A 1 27 ? 103.896 -7.984  -21.315 1.00 0.00 ? 27 VAL A HA   1  
ATOM 375   H HB   . VAL A 1 27 ? 103.191 -8.141  -18.895 1.00 0.00 ? 27 VAL A HB   1  
ATOM 376   H HG11 . VAL A 1 27 ? 104.375 -6.182  -19.854 1.00 0.00 ? 27 VAL A HG11 1  
ATOM 377   H HG12 . VAL A 1 27 ? 103.264 -5.714  -18.566 1.00 0.00 ? 27 VAL A HG12 1  
ATOM 378   H HG13 . VAL A 1 27 ? 102.818 -5.457  -20.254 1.00 0.00 ? 27 VAL A HG13 1  
ATOM 379   H HG21 . VAL A 1 27 ? 101.105 -6.944  -18.286 1.00 0.00 ? 27 VAL A HG21 1  
ATOM 380   H HG22 . VAL A 1 27 ? 100.767 -8.372  -19.262 1.00 0.00 ? 27 VAL A HG22 1  
ATOM 381   H HG23 . VAL A 1 27 ? 100.716 -6.770  -19.996 1.00 0.00 ? 27 VAL A HG23 1  
ATOM 382   N N    . TYR A 1 28 ? 101.224 -9.881  -21.074 1.00 0.00 ? 28 TYR A N    1  
ATOM 383   C CA   . TYR A 1 28 ? 100.773 -11.269 -21.055 1.00 0.00 ? 28 TYR A CA   1  
ATOM 384   C C    . TYR A 1 28 ? 101.364 -12.047 -22.228 1.00 0.00 ? 28 TYR A C    1  
ATOM 385   O O    . TYR A 1 28 ? 101.646 -13.239 -22.114 1.00 0.00 ? 28 TYR A O    1  
ATOM 386   C CB   . TYR A 1 28 ? 99.246  -11.322 -21.123 1.00 0.00 ? 28 TYR A CB   1  
ATOM 387   C CG   . TYR A 1 28 ? 98.785  -12.752 -20.966 1.00 0.00 ? 28 TYR A CG   1  
ATOM 388   C CD1  . TYR A 1 28 ? 98.723  -13.595 -22.082 1.00 0.00 ? 28 TYR A CD1  1  
ATOM 389   C CD2  . TYR A 1 28 ? 98.418  -13.234 -19.703 1.00 0.00 ? 28 TYR A CD2  1  
ATOM 390   C CE1  . TYR A 1 28 ? 98.296  -14.920 -21.935 1.00 0.00 ? 28 TYR A CE1  1  
ATOM 391   C CE2  . TYR A 1 28 ? 97.990  -14.559 -19.557 1.00 0.00 ? 28 TYR A CE2  1  
ATOM 392   C CZ   . TYR A 1 28 ? 97.930  -15.402 -20.673 1.00 0.00 ? 28 TYR A CZ   1  
ATOM 393   O OH   . TYR A 1 28 ? 97.508  -16.708 -20.529 1.00 0.00 ? 28 TYR A OH   1  
ATOM 394   H H    . TYR A 1 28 ? 100.563 -9.160  -21.147 1.00 0.00 ? 28 TYR A H    1  
ATOM 395   H HA   . TYR A 1 28 ? 101.097 -11.729 -20.133 1.00 0.00 ? 28 TYR A HA   1  
ATOM 396   H HB2  . TYR A 1 28 ? 98.829  -10.719 -20.329 1.00 0.00 ? 28 TYR A HB2  1  
ATOM 397   H HB3  . TYR A 1 28 ? 98.914  -10.941 -22.077 1.00 0.00 ? 28 TYR A HB3  1  
ATOM 398   H HD1  . TYR A 1 28 ? 99.005  -13.223 -23.055 1.00 0.00 ? 28 TYR A HD1  1  
ATOM 399   H HD2  . TYR A 1 28 ? 98.466  -12.584 -18.842 1.00 0.00 ? 28 TYR A HD2  1  
ATOM 400   H HE1  . TYR A 1 28 ? 98.248  -15.570 -22.797 1.00 0.00 ? 28 TYR A HE1  1  
ATOM 401   H HE2  . TYR A 1 28 ? 97.708  -14.932 -18.583 1.00 0.00 ? 28 TYR A HE2  1  
ATOM 402   H HH   . TYR A 1 28 ? 97.312  -16.857 -19.601 1.00 0.00 ? 28 TYR A HH   1  
ATOM 403   N N    . PHE A 1 29 ? 101.544 -11.365 -23.356 1.00 0.00 ? 29 PHE A N    1  
ATOM 404   C CA   . PHE A 1 29 ? 102.096 -12.004 -24.544 1.00 0.00 ? 29 PHE A CA   1  
ATOM 405   C C    . PHE A 1 29 ? 103.445 -12.646 -24.235 1.00 0.00 ? 29 PHE A C    1  
ATOM 406   O O    . PHE A 1 29 ? 103.674 -13.813 -24.554 1.00 0.00 ? 29 PHE A O    1  
ATOM 407   C CB   . PHE A 1 29 ? 102.266 -10.969 -25.657 1.00 0.00 ? 29 PHE A CB   1  
ATOM 408   C CG   . PHE A 1 29 ? 102.743 -11.651 -26.917 1.00 0.00 ? 29 PHE A CG   1  
ATOM 409   C CD1  . PHE A 1 29 ? 104.108 -11.893 -27.106 1.00 0.00 ? 29 PHE A CD1  1  
ATOM 410   C CD2  . PHE A 1 29 ? 101.820 -12.041 -27.894 1.00 0.00 ? 29 PHE A CD2  1  
ATOM 411   C CE1  . PHE A 1 29 ? 104.552 -12.525 -28.275 1.00 0.00 ? 29 PHE A CE1  1  
ATOM 412   C CE2  . PHE A 1 29 ? 102.264 -12.673 -29.062 1.00 0.00 ? 29 PHE A CE2  1  
ATOM 413   C CZ   . PHE A 1 29 ? 103.629 -12.915 -29.252 1.00 0.00 ? 29 PHE A CZ   1  
ATOM 414   H H    . PHE A 1 29 ? 101.297 -10.418 -23.391 1.00 0.00 ? 29 PHE A H    1  
ATOM 415   H HA   . PHE A 1 29 ? 101.413 -12.768 -24.881 1.00 0.00 ? 29 PHE A HA   1  
ATOM 416   H HB2  . PHE A 1 29 ? 101.318 -10.486 -25.847 1.00 0.00 ? 29 PHE A HB2  1  
ATOM 417   H HB3  . PHE A 1 29 ? 102.991 -10.229 -25.353 1.00 0.00 ? 29 PHE A HB3  1  
ATOM 418   H HD1  . PHE A 1 29 ? 104.820 -11.592 -26.352 1.00 0.00 ? 29 PHE A HD1  1  
ATOM 419   H HD2  . PHE A 1 29 ? 100.767 -11.854 -27.748 1.00 0.00 ? 29 PHE A HD2  1  
ATOM 420   H HE1  . PHE A 1 29 ? 105.606 -12.712 -28.421 1.00 0.00 ? 29 PHE A HE1  1  
ATOM 421   H HE2  . PHE A 1 29 ? 101.552 -12.974 -29.817 1.00 0.00 ? 29 PHE A HE2  1  
ATOM 422   H HZ   . PHE A 1 29 ? 103.972 -13.402 -30.154 1.00 0.00 ? 29 PHE A HZ   1  
ATOM 423   N N    . LEU A 1 30 ? 104.334 -11.878 -23.614 1.00 0.00 ? 30 LEU A N    1  
ATOM 424   C CA   . LEU A 1 30 ? 105.657 -12.385 -23.269 1.00 0.00 ? 30 LEU A CA   1  
ATOM 425   C C    . LEU A 1 30 ? 105.556 -13.457 -22.188 1.00 0.00 ? 30 LEU A C    1  
ATOM 426   O O    . LEU A 1 30 ? 106.216 -14.493 -22.265 1.00 0.00 ? 30 LEU A O    1  
ATOM 427   C CB   . LEU A 1 30 ? 106.545 -11.237 -22.774 1.00 0.00 ? 30 LEU A CB   1  
ATOM 428   C CG   . LEU A 1 30 ? 108.027 -11.669 -22.774 1.00 0.00 ? 30 LEU A CG   1  
ATOM 429   C CD1  . LEU A 1 30 ? 108.641 -11.474 -24.167 1.00 0.00 ? 30 LEU A CD1  1  
ATOM 430   C CD2  . LEU A 1 30 ? 108.811 -10.823 -21.766 1.00 0.00 ? 30 LEU A CD2  1  
ATOM 431   H H    . LEU A 1 30 ? 104.096 -10.955 -23.386 1.00 0.00 ? 30 LEU A H    1  
ATOM 432   H HA   . LEU A 1 30 ? 106.102 -12.819 -24.149 1.00 0.00 ? 30 LEU A HA   1  
ATOM 433   H HB2  . LEU A 1 30 ? 106.413 -10.380 -23.420 1.00 0.00 ? 30 LEU A HB2  1  
ATOM 434   H HB3  . LEU A 1 30 ? 106.247 -10.972 -21.768 1.00 0.00 ? 30 LEU A HB3  1  
ATOM 435   H HG   . LEU A 1 30 ? 108.099 -12.713 -22.496 1.00 0.00 ? 30 LEU A HG   1  
ATOM 436   H HD11 . LEU A 1 30 ? 108.195 -12.166 -24.863 1.00 0.00 ? 30 LEU A HD11 1  
ATOM 437   H HD12 . LEU A 1 30 ? 109.705 -11.656 -24.117 1.00 0.00 ? 30 LEU A HD12 1  
ATOM 438   H HD13 . LEU A 1 30 ? 108.467 -10.462 -24.502 1.00 0.00 ? 30 LEU A HD13 1  
ATOM 439   H HD21 . LEU A 1 30 ? 108.614 -9.776  -21.945 1.00 0.00 ? 30 LEU A HD21 1  
ATOM 440   H HD22 . LEU A 1 30 ? 109.867 -11.014 -21.878 1.00 0.00 ? 30 LEU A HD22 1  
ATOM 441   H HD23 . LEU A 1 30 ? 108.504 -11.080 -20.763 1.00 0.00 ? 30 LEU A HD23 1  
ATOM 442   N N    . GLY A 1 31 ? 104.729 -13.199 -21.179 1.00 0.00 ? 31 GLY A N    1  
ATOM 443   C CA   . GLY A 1 31 ? 104.553 -14.150 -20.087 1.00 0.00 ? 31 GLY A CA   1  
ATOM 444   C C    . GLY A 1 31 ? 103.935 -15.450 -20.589 1.00 0.00 ? 31 GLY A C    1  
ATOM 445   O O    . GLY A 1 31 ? 103.023 -15.436 -21.416 1.00 0.00 ? 31 GLY A O    1  
ATOM 446   H H    . GLY A 1 31 ? 104.229 -12.356 -21.171 1.00 0.00 ? 31 GLY A H    1  
ATOM 447   H HA2  . GLY A 1 31 ? 105.515 -14.360 -19.643 1.00 0.00 ? 31 GLY A HA2  1  
ATOM 448   H HA3  . GLY A 1 31 ? 103.905 -13.716 -19.341 1.00 0.00 ? 31 GLY A HA3  1  
ATOM 449   N N    . ARG A 1 32 ? 104.437 -16.572 -20.082 1.00 0.00 ? 32 ARG A N    1  
ATOM 450   C CA   . ARG A 1 32 ? 103.925 -17.876 -20.488 1.00 0.00 ? 32 ARG A CA   1  
ATOM 451   C C    . ARG A 1 32 ? 104.361 -18.955 -19.501 1.00 0.00 ? 32 ARG A C    1  
ATOM 452   O O    . ARG A 1 32 ? 105.158 -19.831 -19.838 1.00 0.00 ? 32 ARG A O    1  
ATOM 453   C CB   . ARG A 1 32 ? 104.435 -18.225 -21.886 1.00 0.00 ? 32 ARG A CB   1  
ATOM 454   C CG   . ARG A 1 32 ? 103.673 -19.439 -22.421 1.00 0.00 ? 32 ARG A CG   1  
ATOM 455   C CD   . ARG A 1 32 ? 104.243 -19.841 -23.782 1.00 0.00 ? 32 ARG A CD   1  
ATOM 456   N NE   . ARG A 1 32 ? 104.031 -18.774 -24.753 1.00 0.00 ? 32 ARG A NE   1  
ATOM 457   C CZ   . ARG A 1 32 ? 104.585 -18.823 -25.961 1.00 0.00 ? 32 ARG A CZ   1  
ATOM 458   N NH1  . ARG A 1 32 ? 105.333 -19.839 -26.294 1.00 0.00 ? 32 ARG A NH1  1  
ATOM 459   N NH2  . ARG A 1 32 ? 104.380 -17.855 -26.812 1.00 0.00 ? 32 ARG A NH2  1  
ATOM 460   H H    . ARG A 1 32 ? 105.163 -16.522 -19.426 1.00 0.00 ? 32 ARG A H    1  
ATOM 461   H HA   . ARG A 1 32 ? 102.847 -17.838 -20.510 1.00 0.00 ? 32 ARG A HA   1  
ATOM 462   H HB2  . ARG A 1 32 ? 104.283 -17.383 -22.546 1.00 0.00 ? 32 ARG A HB2  1  
ATOM 463   H HB3  . ARG A 1 32 ? 105.489 -18.458 -21.837 1.00 0.00 ? 32 ARG A HB3  1  
ATOM 464   H HG2  . ARG A 1 32 ? 103.776 -20.262 -21.729 1.00 0.00 ? 32 ARG A HG2  1  
ATOM 465   H HG3  . ARG A 1 32 ? 102.628 -19.189 -22.531 1.00 0.00 ? 32 ARG A HG3  1  
ATOM 466   H HD2  . ARG A 1 32 ? 105.301 -20.028 -23.685 1.00 0.00 ? 32 ARG A HD2  1  
ATOM 467   H HD3  . ARG A 1 32 ? 103.752 -20.741 -24.123 1.00 0.00 ? 32 ARG A HD3  1  
ATOM 468   H HE   . ARG A 1 32 ? 103.470 -18.007 -24.512 1.00 0.00 ? 32 ARG A HE   1  
ATOM 469   H HH11 . ARG A 1 32 ? 105.490 -20.580 -25.642 1.00 0.00 ? 32 ARG A HH11 1  
ATOM 470   H HH12 . ARG A 1 32 ? 105.750 -19.876 -27.203 1.00 0.00 ? 32 ARG A HH12 1  
ATOM 471   H HH21 . ARG A 1 32 ? 103.807 -17.078 -26.556 1.00 0.00 ? 32 ARG A HH21 1  
ATOM 472   H HH22 . ARG A 1 32 ? 104.797 -17.892 -27.720 1.00 0.00 ? 32 ARG A HH22 1  
ATOM 473   N N    . LEU A 1 33 ? 103.833 -18.886 -18.283 1.00 0.00 ? 33 LEU A N    1  
ATOM 474   C CA   . LEU A 1 33 ? 104.175 -19.865 -17.256 1.00 0.00 ? 33 LEU A CA   1  
ATOM 475   C C    . LEU A 1 33 ? 105.685 -20.085 -17.212 1.00 0.00 ? 33 LEU A C    1  
ATOM 476   O O    . LEU A 1 33 ? 106.211 -20.983 -17.870 1.00 0.00 ? 33 LEU A O    1  
ATOM 477   C CB   . LEU A 1 33 ? 103.466 -21.195 -17.544 1.00 0.00 ? 33 LEU A CB   1  
ATOM 478   C CG   . LEU A 1 33 ? 101.992 -21.100 -17.136 1.00 0.00 ? 33 LEU A CG   1  
ATOM 479   C CD1  . LEU A 1 33 ? 101.289 -20.024 -17.970 1.00 0.00 ? 33 LEU A CD1  1  
ATOM 480   C CD2  . LEU A 1 33 ? 101.316 -22.453 -17.372 1.00 0.00 ? 33 LEU A CD2  1  
ATOM 481   H H    . LEU A 1 33 ? 103.202 -18.166 -18.072 1.00 0.00 ? 33 LEU A H    1  
ATOM 482   H HA   . LEU A 1 33 ? 103.849 -19.494 -16.296 1.00 0.00 ? 33 LEU A HA   1  
ATOM 483   H HB2  . LEU A 1 33 ? 103.533 -21.414 -18.600 1.00 0.00 ? 33 LEU A HB2  1  
ATOM 484   H HB3  . LEU A 1 33 ? 103.941 -21.987 -16.983 1.00 0.00 ? 33 LEU A HB3  1  
ATOM 485   H HG   . LEU A 1 33 ? 101.927 -20.842 -16.089 1.00 0.00 ? 33 LEU A HG   1  
ATOM 486   H HD11 . LEU A 1 33 ? 101.542 -19.047 -17.584 1.00 0.00 ? 33 LEU A HD11 1  
ATOM 487   H HD12 . LEU A 1 33 ? 100.220 -20.163 -17.915 1.00 0.00 ? 33 LEU A HD12 1  
ATOM 488   H HD13 . LEU A 1 33 ? 101.610 -20.097 -19.000 1.00 0.00 ? 33 LEU A HD13 1  
ATOM 489   H HD21 . LEU A 1 33 ? 101.270 -22.653 -18.432 1.00 0.00 ? 33 LEU A HD21 1  
ATOM 490   H HD22 . LEU A 1 33 ? 100.315 -22.433 -16.966 1.00 0.00 ? 33 LEU A HD22 1  
ATOM 491   H HD23 . LEU A 1 33 ? 101.886 -23.231 -16.884 1.00 0.00 ? 33 LEU A HD23 1  
ATOM 492   N N    . GLY A 1 34 ? 106.378 -19.260 -16.433 1.00 0.00 ? 34 GLY A N    1  
ATOM 493   C CA   . GLY A 1 34 ? 107.826 -19.376 -16.311 1.00 0.00 ? 34 GLY A CA   1  
ATOM 494   C C    . GLY A 1 34 ? 108.421 -18.127 -15.671 1.00 0.00 ? 34 GLY A C    1  
ATOM 495   O O    . GLY A 1 34 ? 109.402 -18.204 -14.930 1.00 0.00 ? 34 GLY A O    1  
ATOM 496   H H    . GLY A 1 34 ? 105.906 -18.563 -15.931 1.00 0.00 ? 34 GLY A H    1  
ATOM 497   H HA2  . GLY A 1 34 ? 108.062 -20.236 -15.701 1.00 0.00 ? 34 GLY A HA2  1  
ATOM 498   H HA3  . GLY A 1 34 ? 108.255 -19.506 -17.293 1.00 0.00 ? 34 GLY A HA3  1  
ATOM 499   N N    . THR A 1 35 ? 107.822 -16.977 -15.959 1.00 0.00 ? 35 THR A N    1  
ATOM 500   C CA   . THR A 1 35 ? 108.302 -15.715 -15.404 1.00 0.00 ? 35 THR A CA   1  
ATOM 501   C C    . THR A 1 35 ? 107.915 -15.595 -13.934 1.00 0.00 ? 35 THR A C    1  
ATOM 502   O O    . THR A 1 35 ? 108.496 -14.802 -13.192 1.00 0.00 ? 35 THR A O    1  
ATOM 503   C CB   . THR A 1 35 ? 107.711 -14.540 -16.186 1.00 0.00 ? 35 THR A CB   1  
ATOM 504   O OG1  . THR A 1 35 ? 106.292 -14.625 -16.163 1.00 0.00 ? 35 THR A OG1  1  
ATOM 505   C CG2  . THR A 1 35 ? 108.203 -14.588 -17.633 1.00 0.00 ? 35 THR A CG2  1  
ATOM 506   H H    . THR A 1 35 ? 107.043 -16.974 -16.555 1.00 0.00 ? 35 THR A H    1  
ATOM 507   H HA   . THR A 1 35 ? 109.377 -15.683 -15.487 1.00 0.00 ? 35 THR A HA   1  
ATOM 508   H HB   . THR A 1 35 ? 108.024 -13.613 -15.734 1.00 0.00 ? 35 THR A HB   1  
ATOM 509   H HG1  . THR A 1 35 ? 105.985 -14.718 -17.069 1.00 0.00 ? 35 THR A HG1  1  
ATOM 510   H HG21 . THR A 1 35 ? 108.010 -15.566 -18.047 1.00 0.00 ? 35 THR A HG21 1  
ATOM 511   H HG22 . THR A 1 35 ? 109.265 -14.390 -17.658 1.00 0.00 ? 35 THR A HG22 1  
ATOM 512   H HG23 . THR A 1 35 ? 107.684 -13.841 -18.215 1.00 0.00 ? 35 THR A HG23 1  
ATOM 513   N N    . ALA A 1 36 ? 106.930 -16.384 -13.519 1.00 0.00 ? 36 ALA A N    1  
ATOM 514   C CA   . ALA A 1 36 ? 106.473 -16.356 -12.134 1.00 0.00 ? 36 ALA A CA   1  
ATOM 515   C C    . ALA A 1 36 ? 105.989 -14.958 -11.762 1.00 0.00 ? 36 ALA A C    1  
ATOM 516   O O    . ALA A 1 36 ? 106.053 -14.033 -12.572 1.00 0.00 ? 36 ALA A O    1  
ATOM 517   C CB   . ALA A 1 36 ? 107.610 -16.772 -11.199 1.00 0.00 ? 36 ALA A CB   1  
ATOM 518   H H    . ALA A 1 36 ? 106.502 -16.996 -14.154 1.00 0.00 ? 36 ALA A H    1  
ATOM 519   H HA   . ALA A 1 36 ? 105.655 -17.051 -12.020 1.00 0.00 ? 36 ALA A HA   1  
ATOM 520   H HB1  . ALA A 1 36 ? 108.318 -15.960 -11.111 1.00 0.00 ? 36 ALA A HB1  1  
ATOM 521   H HB2  . ALA A 1 36 ? 108.108 -17.641 -11.602 1.00 0.00 ? 36 ALA A HB2  1  
ATOM 522   H HB3  . ALA A 1 36 ? 107.208 -17.007 -10.225 1.00 0.00 ? 36 ALA A HB3  1  
ATOM 523   N N    . GLU A 1 37 ? 105.506 -14.811 -10.534 1.00 0.00 ? 37 GLU A N    1  
ATOM 524   C CA   . GLU A 1 37 ? 105.012 -13.519 -10.068 1.00 0.00 ? 37 GLU A CA   1  
ATOM 525   C C    . GLU A 1 37 ? 103.961 -12.975 -11.029 1.00 0.00 ? 37 GLU A C    1  
ATOM 526   O O    . GLU A 1 37 ? 103.616 -11.794 -10.985 1.00 0.00 ? 37 GLU A O    1  
ATOM 527   C CB   . GLU A 1 37 ? 106.171 -12.526 -9.958  1.00 0.00 ? 37 GLU A CB   1  
ATOM 528   C CG   . GLU A 1 37 ? 107.226 -13.073 -8.994  1.00 0.00 ? 37 GLU A CG   1  
ATOM 529   C CD   . GLU A 1 37 ? 106.645 -13.182 -7.589  1.00 0.00 ? 37 GLU A CD   1  
ATOM 530   O OE1  . GLU A 1 37 ? 106.110 -12.193 -7.113  1.00 0.00 ? 37 GLU A OE1  1  
ATOM 531   O OE2  . GLU A 1 37 ? 106.744 -14.250 -7.009  1.00 0.00 ? 37 GLU A OE2  1  
ATOM 532   H H    . GLU A 1 37 ? 105.478 -15.582 -9.931  1.00 0.00 ? 37 GLU A H    1  
ATOM 533   H HA   . GLU A 1 37 ? 104.565 -13.644 -9.094  1.00 0.00 ? 37 GLU A HA   1  
ATOM 534   H HB2  . GLU A 1 37 ? 106.613 -12.380 -10.934 1.00 0.00 ? 37 GLU A HB2  1  
ATOM 535   H HB3  . GLU A 1 37 ? 105.802 -11.582 -9.587  1.00 0.00 ? 37 GLU A HB3  1  
ATOM 536   H HG2  . GLU A 1 37 ? 107.542 -14.052 -9.328  1.00 0.00 ? 37 GLU A HG2  1  
ATOM 537   H HG3  . GLU A 1 37 ? 108.077 -12.409 -8.980  1.00 0.00 ? 37 GLU A HG3  1  
ATOM 538   N N    . VAL A 1 38 ? 103.455 -13.847 -11.895 1.00 0.00 ? 38 VAL A N    1  
ATOM 539   C CA   . VAL A 1 38 ? 102.440 -13.449 -12.865 1.00 0.00 ? 38 VAL A CA   1  
ATOM 540   C C    . VAL A 1 38 ? 101.221 -12.870 -12.154 1.00 0.00 ? 38 VAL A C    1  
ATOM 541   O O    . VAL A 1 38 ? 100.487 -12.060 -12.720 1.00 0.00 ? 38 VAL A O    1  
ATOM 542   C CB   . VAL A 1 38 ? 102.019 -14.655 -13.705 1.00 0.00 ? 38 VAL A CB   1  
ATOM 543   C CG1  . VAL A 1 38 ? 103.245 -15.248 -14.401 1.00 0.00 ? 38 VAL A CG1  1  
ATOM 544   C CG2  . VAL A 1 38 ? 101.389 -15.714 -12.796 1.00 0.00 ? 38 VAL A CG2  1  
ATOM 545   H H    . VAL A 1 38 ? 103.768 -14.775 -11.882 1.00 0.00 ? 38 VAL A H    1  
ATOM 546   H HA   . VAL A 1 38 ? 102.855 -12.696 -13.518 1.00 0.00 ? 38 VAL A HA   1  
ATOM 547   H HB   . VAL A 1 38 ? 101.300 -14.342 -14.448 1.00 0.00 ? 38 VAL A HB   1  
ATOM 548   H HG11 . VAL A 1 38 ? 103.699 -14.497 -15.031 1.00 0.00 ? 38 VAL A HG11 1  
ATOM 549   H HG12 . VAL A 1 38 ? 102.944 -16.090 -15.005 1.00 0.00 ? 38 VAL A HG12 1  
ATOM 550   H HG13 . VAL A 1 38 ? 103.958 -15.574 -13.659 1.00 0.00 ? 38 VAL A HG13 1  
ATOM 551   H HG21 . VAL A 1 38 ? 100.404 -15.389 -12.494 1.00 0.00 ? 38 VAL A HG21 1  
ATOM 552   H HG22 . VAL A 1 38 ? 102.007 -15.850 -11.921 1.00 0.00 ? 38 VAL A HG22 1  
ATOM 553   H HG23 . VAL A 1 38 ? 101.312 -16.648 -13.331 1.00 0.00 ? 38 VAL A HG23 1  
ATOM 554   N N    . LEU A 1 39 ? 101.010 -13.297 -10.913 1.00 0.00 ? 39 LEU A N    1  
ATOM 555   C CA   . LEU A 1 39 ? 99.873  -12.823 -10.131 1.00 0.00 ? 39 LEU A CA   1  
ATOM 556   C C    . LEU A 1 39 ? 99.743  -11.304 -10.235 1.00 0.00 ? 39 LEU A C    1  
ATOM 557   O O    . LEU A 1 39 ? 98.644  -10.761 -10.136 1.00 0.00 ? 39 LEU A O    1  
ATOM 558   C CB   . LEU A 1 39 ? 100.052 -13.229 -8.663  1.00 0.00 ? 39 LEU A CB   1  
ATOM 559   C CG   . LEU A 1 39 ? 98.793  -12.881 -7.850  1.00 0.00 ? 39 LEU A CG   1  
ATOM 560   C CD1  . LEU A 1 39 ? 97.604  -13.754 -8.294  1.00 0.00 ? 39 LEU A CD1  1  
ATOM 561   C CD2  . LEU A 1 39 ? 99.083  -13.122 -6.364  1.00 0.00 ? 39 LEU A CD2  1  
ATOM 562   H H    . LEU A 1 39 ? 101.628 -13.946 -10.518 1.00 0.00 ? 39 LEU A H    1  
ATOM 563   H HA   . LEU A 1 39 ? 98.975  -13.280 -10.514 1.00 0.00 ? 39 LEU A HA   1  
ATOM 564   H HB2  . LEU A 1 39 ? 100.234 -14.292 -8.606  1.00 0.00 ? 39 LEU A HB2  1  
ATOM 565   H HB3  . LEU A 1 39 ? 100.898 -12.701 -8.249  1.00 0.00 ? 39 LEU A HB3  1  
ATOM 566   H HG   . LEU A 1 39 ? 98.546  -11.840 -8.000  1.00 0.00 ? 39 LEU A HG   1  
ATOM 567   H HD11 . LEU A 1 39 ? 97.119  -13.295 -9.142  1.00 0.00 ? 39 LEU A HD11 1  
ATOM 568   H HD12 . LEU A 1 39 ? 96.892  -13.839 -7.485  1.00 0.00 ? 39 LEU A HD12 1  
ATOM 569   H HD13 . LEU A 1 39 ? 97.952  -14.739 -8.569  1.00 0.00 ? 39 LEU A HD13 1  
ATOM 570   H HD21 . LEU A 1 39 ? 98.247  -12.776 -5.774  1.00 0.00 ? 39 LEU A HD21 1  
ATOM 571   H HD22 . LEU A 1 39 ? 99.974  -12.581 -6.079  1.00 0.00 ? 39 LEU A HD22 1  
ATOM 572   H HD23 . LEU A 1 39 ? 99.233  -14.177 -6.193  1.00 0.00 ? 39 LEU A HD23 1  
ATOM 573   N N    . GLY A 1 40 ? 100.868 -10.626 -10.435 1.00 0.00 ? 40 GLY A N    1  
ATOM 574   C CA   . GLY A 1 40 ? 100.858 -9.171  -10.550 1.00 0.00 ? 40 GLY A CA   1  
ATOM 575   C C    . GLY A 1 40 ? 99.905  -8.715  -11.651 1.00 0.00 ? 40 GLY A C    1  
ATOM 576   O O    . GLY A 1 40 ? 99.078  -7.825  -11.443 1.00 0.00 ? 40 GLY A O    1  
ATOM 577   H H    . GLY A 1 40 ? 101.717 -11.110 -10.507 1.00 0.00 ? 40 GLY A H    1  
ATOM 578   H HA2  . GLY A 1 40 ? 100.545 -8.743  -9.608  1.00 0.00 ? 40 GLY A HA2  1  
ATOM 579   H HA3  . GLY A 1 40 ? 101.855 -8.826  -10.782 1.00 0.00 ? 40 GLY A HA3  1  
ATOM 580   N N    . ILE A 1 41 ? 100.026 -9.332  -12.823 1.00 0.00 ? 41 ILE A N    1  
ATOM 581   C CA   . ILE A 1 41 ? 99.171  -8.984  -13.954 1.00 0.00 ? 41 ILE A CA   1  
ATOM 582   C C    . ILE A 1 41 ? 97.698  -9.138  -13.567 1.00 0.00 ? 41 ILE A C    1  
ATOM 583   O O    . ILE A 1 41 ? 96.857  -8.314  -13.930 1.00 0.00 ? 41 ILE A O    1  
ATOM 584   C CB   . ILE A 1 41 ? 99.499  -9.880  -15.158 1.00 0.00 ? 41 ILE A CB   1  
ATOM 585   C CG1  . ILE A 1 41 ? 100.866 -9.487  -15.737 1.00 0.00 ? 41 ILE A CG1  1  
ATOM 586   C CG2  . ILE A 1 41 ? 98.432  -9.711  -16.245 1.00 0.00 ? 41 ILE A CG2  1  
ATOM 587   C CD1  . ILE A 1 41 ? 101.984 -9.804  -14.736 1.00 0.00 ? 41 ILE A CD1  1  
ATOM 588   H H    . ILE A 1 41 ? 100.703 -10.033 -12.930 1.00 0.00 ? 41 ILE A H    1  
ATOM 589   H HA   . ILE A 1 41 ? 99.354  -7.955  -14.226 1.00 0.00 ? 41 ILE A HA   1  
ATOM 590   H HB   . ILE A 1 41 ? 99.524  -10.913 -14.839 1.00 0.00 ? 41 ILE A HB   1  
ATOM 591   H HG12 . ILE A 1 41 ? 101.037 -10.037 -16.650 1.00 0.00 ? 41 ILE A HG12 1  
ATOM 592   H HG13 . ILE A 1 41 ? 100.871 -8.428  -15.952 1.00 0.00 ? 41 ILE A HG13 1  
ATOM 593   H HG21 . ILE A 1 41 ? 97.526  -10.215 -15.941 1.00 0.00 ? 41 ILE A HG21 1  
ATOM 594   H HG22 . ILE A 1 41 ? 98.788  -10.138 -17.170 1.00 0.00 ? 41 ILE A HG22 1  
ATOM 595   H HG23 . ILE A 1 41 ? 98.228  -8.660  -16.387 1.00 0.00 ? 41 ILE A HG23 1  
ATOM 596   H HD11 . ILE A 1 41 ? 102.069 -8.999  -14.023 1.00 0.00 ? 41 ILE A HD11 1  
ATOM 597   H HD12 . ILE A 1 41 ? 102.919 -9.910  -15.268 1.00 0.00 ? 41 ILE A HD12 1  
ATOM 598   H HD13 . ILE A 1 41 ? 101.762 -10.726 -14.218 1.00 0.00 ? 41 ILE A HD13 1  
ATOM 599   N N    . ILE A 1 42 ? 97.395  -10.198 -12.831 1.00 0.00 ? 42 ILE A N    1  
ATOM 600   C CA   . ILE A 1 42 ? 96.026  -10.445 -12.403 1.00 0.00 ? 42 ILE A CA   1  
ATOM 601   C C    . ILE A 1 42 ? 95.562  -9.340  -11.454 1.00 0.00 ? 42 ILE A C    1  
ATOM 602   O O    . ILE A 1 42 ? 94.426  -8.884  -11.534 1.00 0.00 ? 42 ILE A O    1  
ATOM 603   C CB   . ILE A 1 42 ? 95.929  -11.812 -11.710 1.00 0.00 ? 42 ILE A CB   1  
ATOM 604   C CG1  . ILE A 1 42 ? 96.076  -12.930 -12.753 1.00 0.00 ? 42 ILE A CG1  1  
ATOM 605   C CG2  . ILE A 1 42 ? 94.569  -11.957 -11.017 1.00 0.00 ? 42 ILE A CG2  1  
ATOM 606   C CD1  . ILE A 1 42 ? 97.477  -12.896 -13.377 1.00 0.00 ? 42 ILE A CD1  1  
ATOM 607   H H    . ILE A 1 42 ? 98.103  -10.823 -12.569 1.00 0.00 ? 42 ILE A H    1  
ATOM 608   H HA   . ILE A 1 42 ? 95.384  -10.449 -13.272 1.00 0.00 ? 42 ILE A HA   1  
ATOM 609   H HB   . ILE A 1 42 ? 96.716  -11.898 -10.976 1.00 0.00 ? 42 ILE A HB   1  
ATOM 610   H HG12 . ILE A 1 42 ? 95.920  -13.886 -12.276 1.00 0.00 ? 42 ILE A HG12 1  
ATOM 611   H HG13 . ILE A 1 42 ? 95.337  -12.793 -13.529 1.00 0.00 ? 42 ILE A HG13 1  
ATOM 612   H HG21 . ILE A 1 42 ? 94.408  -12.991 -10.748 1.00 0.00 ? 42 ILE A HG21 1  
ATOM 613   H HG22 . ILE A 1 42 ? 93.787  -11.633 -11.688 1.00 0.00 ? 42 ILE A HG22 1  
ATOM 614   H HG23 . ILE A 1 42 ? 94.554  -11.347 -10.125 1.00 0.00 ? 42 ILE A HG23 1  
ATOM 615   H HD11 . ILE A 1 42 ? 97.716  -13.874 -13.770 1.00 0.00 ? 42 ILE A HD11 1  
ATOM 616   H HD12 . ILE A 1 42 ? 98.205  -12.624 -12.629 1.00 0.00 ? 42 ILE A HD12 1  
ATOM 617   H HD13 . ILE A 1 42 ? 97.496  -12.174 -14.180 1.00 0.00 ? 42 ILE A HD13 1  
ATOM 618   N N    . SER A 1 43 ? 96.447  -8.927  -10.552 1.00 0.00 ? 43 SER A N    1  
ATOM 619   C CA   . SER A 1 43 ? 96.115  -7.887  -9.582  1.00 0.00 ? 43 SER A CA   1  
ATOM 620   C C    . SER A 1 43 ? 95.688  -6.589  -10.271 1.00 0.00 ? 43 SER A C    1  
ATOM 621   O O    . SER A 1 43 ? 94.638  -6.028  -9.954  1.00 0.00 ? 43 SER A O    1  
ATOM 622   C CB   . SER A 1 43 ? 97.321  -7.614  -8.682  1.00 0.00 ? 43 SER A CB   1  
ATOM 623   O OG   . SER A 1 43 ? 96.887  -6.947  -7.504  1.00 0.00 ? 43 SER A OG   1  
ATOM 624   H H    . SER A 1 43 ? 97.339  -9.336  -10.531 1.00 0.00 ? 43 SER A H    1  
ATOM 625   H HA   . SER A 1 43 ? 95.299  -8.236  -8.967  1.00 0.00 ? 43 SER A HA   1  
ATOM 626   H HB2  . SER A 1 43 ? 97.787  -8.546  -8.410  1.00 0.00 ? 43 SER A HB2  1  
ATOM 627   H HB3  . SER A 1 43 ? 98.036  -7.000  -9.215  1.00 0.00 ? 43 SER A HB3  1  
ATOM 628   H HG   . SER A 1 43 ? 97.443  -6.174  -7.380  1.00 0.00 ? 43 SER A HG   1  
ATOM 629   N N    . ILE A 1 44 ? 96.507  -6.109  -11.202 1.00 0.00 ? 44 ILE A N    1  
ATOM 630   C CA   . ILE A 1 44 ? 96.192  -4.866  -11.907 1.00 0.00 ? 44 ILE A CA   1  
ATOM 631   C C    . ILE A 1 44 ? 94.904  -5.011  -12.721 1.00 0.00 ? 44 ILE A C    1  
ATOM 632   O O    . ILE A 1 44 ? 94.081  -4.095  -12.767 1.00 0.00 ? 44 ILE A O    1  
ATOM 633   C CB   . ILE A 1 44 ? 97.358  -4.454  -12.820 1.00 0.00 ? 44 ILE A CB   1  
ATOM 634   C CG1  . ILE A 1 44 ? 97.787  -5.646  -13.683 1.00 0.00 ? 44 ILE A CG1  1  
ATOM 635   C CG2  . ILE A 1 44 ? 98.545  -3.994  -11.964 1.00 0.00 ? 44 ILE A CG2  1  
ATOM 636   C CD1  . ILE A 1 44 ? 99.053  -5.303  -14.477 1.00 0.00 ? 44 ILE A CD1  1  
ATOM 637   H H    . ILE A 1 44 ? 97.337  -6.589  -11.410 1.00 0.00 ? 44 ILE A H    1  
ATOM 638   H HA   . ILE A 1 44 ? 96.040  -4.089  -11.174 1.00 0.00 ? 44 ILE A HA   1  
ATOM 639   H HB   . ILE A 1 44 ? 97.042  -3.641  -13.459 1.00 0.00 ? 44 ILE A HB   1  
ATOM 640   H HG12 . ILE A 1 44 ? 97.989  -6.489  -13.045 1.00 0.00 ? 44 ILE A HG12 1  
ATOM 641   H HG13 . ILE A 1 44 ? 96.993  -5.897  -14.368 1.00 0.00 ? 44 ILE A HG13 1  
ATOM 642   H HG21 . ILE A 1 44 ? 99.286  -3.528  -12.596 1.00 0.00 ? 44 ILE A HG21 1  
ATOM 643   H HG22 . ILE A 1 44 ? 98.981  -4.848  -11.468 1.00 0.00 ? 44 ILE A HG22 1  
ATOM 644   H HG23 . ILE A 1 44 ? 98.207  -3.282  -11.226 1.00 0.00 ? 44 ILE A HG23 1  
ATOM 645   H HD11 . ILE A 1 44 ? 99.099  -5.920  -15.363 1.00 0.00 ? 44 ILE A HD11 1  
ATOM 646   H HD12 . ILE A 1 44 ? 99.923  -5.489  -13.864 1.00 0.00 ? 44 ILE A HD12 1  
ATOM 647   H HD13 . ILE A 1 44 ? 99.035  -4.263  -14.766 1.00 0.00 ? 44 ILE A HD13 1  
ATOM 648   N N    . VAL A 1 45 ? 94.716  -6.160  -13.355 1.00 0.00 ? 45 VAL A N    1  
ATOM 649   C CA   . VAL A 1 45 ? 93.503  -6.376  -14.138 1.00 0.00 ? 45 VAL A CA   1  
ATOM 650   C C    . VAL A 1 45 ? 92.283  -6.373  -13.216 1.00 0.00 ? 45 VAL A C    1  
ATOM 651   O O    . VAL A 1 45 ? 91.181  -5.999  -13.623 1.00 0.00 ? 45 VAL A O    1  
ATOM 652   C CB   . VAL A 1 45 ? 93.590  -7.713  -14.888 1.00 0.00 ? 45 VAL A CB   1  
ATOM 653   C CG1  . VAL A 1 45 ? 92.227  -8.064  -15.497 1.00 0.00 ? 45 VAL A CG1  1  
ATOM 654   C CG2  . VAL A 1 45 ? 94.621  -7.597  -16.009 1.00 0.00 ? 45 VAL A CG2  1  
ATOM 655   H H    . VAL A 1 45 ? 95.389  -6.873  -13.290 1.00 0.00 ? 45 VAL A H    1  
ATOM 656   H HA   . VAL A 1 45 ? 93.403  -5.576  -14.857 1.00 0.00 ? 45 VAL A HA   1  
ATOM 657   H HB   . VAL A 1 45 ? 93.887  -8.492  -14.201 1.00 0.00 ? 45 VAL A HB   1  
ATOM 658   H HG11 . VAL A 1 45 ? 92.348  -8.860  -16.216 1.00 0.00 ? 45 VAL A HG11 1  
ATOM 659   H HG12 . VAL A 1 45 ? 91.818  -7.193  -15.989 1.00 0.00 ? 45 VAL A HG12 1  
ATOM 660   H HG13 . VAL A 1 45 ? 91.555  -8.383  -14.715 1.00 0.00 ? 45 VAL A HG13 1  
ATOM 661   H HG21 . VAL A 1 45 ? 94.740  -8.556  -16.489 1.00 0.00 ? 45 VAL A HG21 1  
ATOM 662   H HG22 . VAL A 1 45 ? 95.568  -7.280  -15.598 1.00 0.00 ? 45 VAL A HG22 1  
ATOM 663   H HG23 . VAL A 1 45 ? 94.284  -6.871  -16.733 1.00 0.00 ? 45 VAL A HG23 1  
ATOM 664   N N    . LEU A 1 46 ? 92.491  -6.812  -11.979 1.00 0.00 ? 46 LEU A N    1  
ATOM 665   C CA   . LEU A 1 46 ? 91.409  -6.885  -11.002 1.00 0.00 ? 46 LEU A CA   1  
ATOM 666   C C    . LEU A 1 46 ? 90.967  -5.493  -10.531 1.00 0.00 ? 46 LEU A C    1  
ATOM 667   O O    . LEU A 1 46 ? 89.768  -5.206  -10.479 1.00 0.00 ? 46 LEU A O    1  
ATOM 668   C CB   . LEU A 1 46 ? 91.870  -7.734  -9.794  1.00 0.00 ? 46 LEU A CB   1  
ATOM 669   C CG   . LEU A 1 46 ? 90.703  -8.556  -9.203  1.00 0.00 ? 46 LEU A CG   1  
ATOM 670   C CD1  . LEU A 1 46 ? 89.513  -7.639  -8.898  1.00 0.00 ? 46 LEU A CD1  1  
ATOM 671   C CD2  . LEU A 1 46 ? 90.269  -9.671  -10.182 1.00 0.00 ? 46 LEU A CD2  1  
ATOM 672   H H    . LEU A 1 46 ? 93.389  -7.107  -11.720 1.00 0.00 ? 46 LEU A H    1  
ATOM 673   H HA   . LEU A 1 46 ? 90.570  -7.369  -11.471 1.00 0.00 ? 46 LEU A HA   1  
ATOM 674   H HB2  . LEU A 1 46 ? 92.647  -8.407  -10.114 1.00 0.00 ? 46 LEU A HB2  1  
ATOM 675   H HB3  . LEU A 1 46 ? 92.267  -7.086  -9.026  1.00 0.00 ? 46 LEU A HB3  1  
ATOM 676   H HG   . LEU A 1 46 ? 91.036  -9.011  -8.279  1.00 0.00 ? 46 LEU A HG   1  
ATOM 677   H HD11 . LEU A 1 46 ? 88.872  -8.116  -8.171  1.00 0.00 ? 46 LEU A HD11 1  
ATOM 678   H HD12 . LEU A 1 46 ? 88.955  -7.458  -9.802  1.00 0.00 ? 46 LEU A HD12 1  
ATOM 679   H HD13 . LEU A 1 46 ? 89.870  -6.701  -8.499  1.00 0.00 ? 46 LEU A HD13 1  
ATOM 680   H HD21 . LEU A 1 46 ? 91.116  -10.004 -10.765 1.00 0.00 ? 46 LEU A HD21 1  
ATOM 681   H HD22 . LEU A 1 46 ? 89.499  -9.306  -10.847 1.00 0.00 ? 46 LEU A HD22 1  
ATOM 682   H HD23 . LEU A 1 46 ? 89.879  -10.505 -9.617  1.00 0.00 ? 46 LEU A HD23 1  
ATOM 683   N N    . VAL A 1 47 ? 91.927  -4.636  -10.171 1.00 0.00 ? 47 VAL A N    1  
ATOM 684   C CA   . VAL A 1 47 ? 91.583  -3.303  -9.687  1.00 0.00 ? 47 VAL A CA   1  
ATOM 685   C C    . VAL A 1 47 ? 90.981  -2.461  -10.811 1.00 0.00 ? 47 VAL A C    1  
ATOM 686   O O    . VAL A 1 47 ? 90.151  -1.587  -10.569 1.00 0.00 ? 47 VAL A O    1  
ATOM 687   C CB   . VAL A 1 47 ? 92.820  -2.606  -9.080  1.00 0.00 ? 47 VAL A CB   1  
ATOM 688   C CG1  . VAL A 1 47 ? 93.699  -2.000  -10.176 1.00 0.00 ? 47 VAL A CG1  1  
ATOM 689   C CG2  . VAL A 1 47 ? 92.364  -1.489  -8.134  1.00 0.00 ? 47 VAL A CG2  1  
ATOM 690   H H    . VAL A 1 47 ? 92.868  -4.905  -10.222 1.00 0.00 ? 47 VAL A H    1  
ATOM 691   H HA   . VAL A 1 47 ? 90.845  -3.415  -8.910  1.00 0.00 ? 47 VAL A HA   1  
ATOM 692   H HB   . VAL A 1 47 ? 93.395  -3.330  -8.523  1.00 0.00 ? 47 VAL A HB   1  
ATOM 693   H HG11 . VAL A 1 47 ? 93.862  -2.730  -10.947 1.00 0.00 ? 47 VAL A HG11 1  
ATOM 694   H HG12 . VAL A 1 47 ? 94.648  -1.708  -9.753  1.00 0.00 ? 47 VAL A HG12 1  
ATOM 695   H HG13 . VAL A 1 47 ? 93.210  -1.134  -10.595 1.00 0.00 ? 47 VAL A HG13 1  
ATOM 696   H HG21 . VAL A 1 47 ? 91.691  -0.827  -8.659  1.00 0.00 ? 47 VAL A HG21 1  
ATOM 697   H HG22 . VAL A 1 47 ? 93.224  -0.933  -7.792  1.00 0.00 ? 47 VAL A HG22 1  
ATOM 698   H HG23 . VAL A 1 47 ? 91.854  -1.921  -7.286  1.00 0.00 ? 47 VAL A HG23 1  
ATOM 699   N N    . ALA A 1 48 ? 91.407  -2.729  -12.039 1.00 0.00 ? 48 ALA A N    1  
ATOM 700   C CA   . ALA A 1 48 ? 90.903  -1.984  -13.186 1.00 0.00 ? 48 ALA A CA   1  
ATOM 701   C C    . ALA A 1 48 ? 89.448  -2.337  -13.483 1.00 0.00 ? 48 ALA A C    1  
ATOM 702   O O    . ALA A 1 48 ? 88.589  -1.455  -13.584 1.00 0.00 ? 48 ALA A O    1  
ATOM 703   C CB   . ALA A 1 48 ? 91.765  -2.294  -14.413 1.00 0.00 ? 48 ALA A CB   1  
ATOM 704   H H    . ALA A 1 48 ? 92.077  -3.437  -12.177 1.00 0.00 ? 48 ALA A H    1  
ATOM 705   H HA   . ALA A 1 48 ? 90.961  -0.932  -12.974 1.00 0.00 ? 48 ALA A HA   1  
ATOM 706   H HB1  . ALA A 1 48 ? 91.498  -3.265  -14.804 1.00 0.00 ? 48 ALA A HB1  1  
ATOM 707   H HB2  . ALA A 1 48 ? 92.807  -2.295  -14.130 1.00 0.00 ? 48 ALA A HB2  1  
ATOM 708   H HB3  . ALA A 1 48 ? 91.601  -1.546  -15.171 1.00 0.00 ? 48 ALA A HB3  1  
ATOM 709   N N    . THR A 1 49 ? 89.178  -3.627  -13.631 1.00 0.00 ? 49 THR A N    1  
ATOM 710   C CA   . THR A 1 49 ? 87.826  -4.078  -13.931 1.00 0.00 ? 49 THR A CA   1  
ATOM 711   C C    . THR A 1 49 ? 86.840  -3.621  -12.860 1.00 0.00 ? 49 THR A C    1  
ATOM 712   O O    . THR A 1 49 ? 85.762  -3.121  -13.176 1.00 0.00 ? 49 THR A O    1  
ATOM 713   C CB   . THR A 1 49 ? 87.797  -5.606  -14.031 1.00 0.00 ? 49 THR A CB   1  
ATOM 714   O OG1  . THR A 1 49 ? 88.902  -6.049  -14.805 1.00 0.00 ? 49 THR A OG1  1  
ATOM 715   C CG2  . THR A 1 49 ? 86.493  -6.050  -14.699 1.00 0.00 ? 49 THR A CG2  1  
ATOM 716   H H    . THR A 1 49 ? 89.900  -4.286  -13.546 1.00 0.00 ? 49 THR A H    1  
ATOM 717   H HA   . THR A 1 49 ? 87.525  -3.664  -14.881 1.00 0.00 ? 49 THR A HA   1  
ATOM 718   H HB   . THR A 1 49 ? 87.854  -6.033  -13.042 1.00 0.00 ? 49 THR A HB   1  
ATOM 719   H HG1  . THR A 1 49 ? 89.401  -6.676  -14.278 1.00 0.00 ? 49 THR A HG1  1  
ATOM 720   H HG21 . THR A 1 49 ? 86.485  -7.126  -14.793 1.00 0.00 ? 49 THR A HG21 1  
ATOM 721   H HG22 . THR A 1 49 ? 86.420  -5.601  -15.679 1.00 0.00 ? 49 THR A HG22 1  
ATOM 722   H HG23 . THR A 1 49 ? 85.655  -5.735  -14.096 1.00 0.00 ? 49 THR A HG23 1  
ATOM 723   N N    . VAL A 1 50 ? 87.202  -3.812  -11.597 1.00 0.00 ? 50 VAL A N    1  
ATOM 724   C CA   . VAL A 1 50 ? 86.317  -3.430  -10.499 1.00 0.00 ? 50 VAL A CA   1  
ATOM 725   C C    . VAL A 1 50 ? 86.218  -1.913  -10.349 1.00 0.00 ? 50 VAL A C    1  
ATOM 726   O O    . VAL A 1 50 ? 85.203  -1.407  -9.878  1.00 0.00 ? 50 VAL A O    1  
ATOM 727   C CB   . VAL A 1 50 ? 86.817  -4.038  -9.186  1.00 0.00 ? 50 VAL A CB   1  
ATOM 728   C CG1  . VAL A 1 50 ? 86.956  -5.556  -9.343  1.00 0.00 ? 50 VAL A CG1  1  
ATOM 729   C CG2  . VAL A 1 50 ? 88.172  -3.420  -8.824  1.00 0.00 ? 50 VAL A CG2  1  
ATOM 730   H H    . VAL A 1 50 ? 88.070  -4.230  -11.398 1.00 0.00 ? 50 VAL A H    1  
ATOM 731   H HA   . VAL A 1 50 ? 85.332  -3.820  -10.701 1.00 0.00 ? 50 VAL A HA   1  
ATOM 732   H HB   . VAL A 1 50 ? 86.103  -3.828  -8.403  1.00 0.00 ? 50 VAL A HB   1  
ATOM 733   H HG11 . VAL A 1 50 ? 87.561  -5.946  -8.538  1.00 0.00 ? 50 VAL A HG11 1  
ATOM 734   H HG12 . VAL A 1 50 ? 87.426  -5.781  -10.287 1.00 0.00 ? 50 VAL A HG12 1  
ATOM 735   H HG13 . VAL A 1 50 ? 85.978  -6.013  -9.311  1.00 0.00 ? 50 VAL A HG13 1  
ATOM 736   H HG21 . VAL A 1 50 ? 88.722  -4.090  -8.178  1.00 0.00 ? 50 VAL A HG21 1  
ATOM 737   H HG22 . VAL A 1 50 ? 88.014  -2.480  -8.312  1.00 0.00 ? 50 VAL A HG22 1  
ATOM 738   H HG23 . VAL A 1 50 ? 88.737  -3.243  -9.725  1.00 0.00 ? 50 VAL A HG23 1  
ATOM 739   N N    . LEU A 1 51 ? 87.263  -1.179  -10.724 1.00 0.00 ? 51 LEU A N    1  
ATOM 740   C CA   . LEU A 1 51 ? 87.219  0.273   -10.585 1.00 0.00 ? 51 LEU A CA   1  
ATOM 741   C C    . LEU A 1 51 ? 86.194  0.876   -11.533 1.00 0.00 ? 51 LEU A C    1  
ATOM 742   O O    . LEU A 1 51 ? 85.286  1.581   -11.097 1.00 0.00 ? 51 LEU A O    1  
ATOM 743   C CB   . LEU A 1 51 ? 88.608  0.864   -10.852 1.00 0.00 ? 51 LEU A CB   1  
ATOM 744   C CG   . LEU A 1 51 ? 88.562  2.399   -10.841 1.00 0.00 ? 51 LEU A CG   1  
ATOM 745   C CD1  . LEU A 1 51 ? 87.948  2.898   -9.527  1.00 0.00 ? 51 LEU A CD1  1  
ATOM 746   C CD2  . LEU A 1 51 ? 89.989  2.941   -10.974 1.00 0.00 ? 51 LEU A CD2  1  
ATOM 747   H H    . LEU A 1 51 ? 88.072  -1.610  -11.085 1.00 0.00 ? 51 LEU A H    1  
ATOM 748   H HA   . LEU A 1 51 ? 86.921  0.509   -9.576  1.00 0.00 ? 51 LEU A HA   1  
ATOM 749   H HB2  . LEU A 1 51 ? 89.289  0.524   -10.088 1.00 0.00 ? 51 LEU A HB2  1  
ATOM 750   H HB3  . LEU A 1 51 ? 88.959  0.527   -11.816 1.00 0.00 ? 51 LEU A HB3  1  
ATOM 751   H HG   . LEU A 1 51 ? 87.968  2.751   -11.671 1.00 0.00 ? 51 LEU A HG   1  
ATOM 752   H HD11 . LEU A 1 51 ? 86.874  2.829   -9.585  1.00 0.00 ? 51 LEU A HD11 1  
ATOM 753   H HD12 . LEU A 1 51 ? 88.229  3.929   -9.361  1.00 0.00 ? 51 LEU A HD12 1  
ATOM 754   H HD13 . LEU A 1 51 ? 88.303  2.293   -8.706  1.00 0.00 ? 51 LEU A HD13 1  
ATOM 755   H HD21 . LEU A 1 51 ? 90.429  2.573   -11.890 1.00 0.00 ? 51 LEU A HD21 1  
ATOM 756   H HD22 . LEU A 1 51 ? 90.580  2.609   -10.133 1.00 0.00 ? 51 LEU A HD22 1  
ATOM 757   H HD23 . LEU A 1 51 ? 89.965  4.020   -10.995 1.00 0.00 ? 51 LEU A HD23 1  
ATOM 758   N N    . LYS A 1 52 ? 86.329  0.591   -12.822 1.00 0.00 ? 52 LYS A N    1  
ATOM 759   C CA   . LYS A 1 52 ? 85.383  1.122   -13.800 1.00 0.00 ? 52 LYS A CA   1  
ATOM 760   C C    . LYS A 1 52 ? 83.991  0.546   -13.550 1.00 0.00 ? 52 LYS A C    1  
ATOM 761   O O    . LYS A 1 52 ? 82.999  1.262   -13.581 1.00 0.00 ? 52 LYS A O    1  
ATOM 762   C CB   . LYS A 1 52 ? 85.831  0.762   -15.231 1.00 0.00 ? 52 LYS A CB   1  
ATOM 763   C CG   . LYS A 1 52 ? 86.950  1.709   -15.720 1.00 0.00 ? 52 LYS A CG   1  
ATOM 764   C CD   . LYS A 1 52 ? 88.328  1.217   -15.235 1.00 0.00 ? 52 LYS A CD   1  
ATOM 765   C CE   . LYS A 1 52 ? 88.896  0.185   -16.217 1.00 0.00 ? 52 LYS A CE   1  
ATOM 766   N NZ   . LYS A 1 52 ? 89.185  0.846   -17.521 1.00 0.00 ? 52 LYS A NZ   1  
ATOM 767   H H    . LYS A 1 52 ? 87.068  0.015   -13.119 1.00 0.00 ? 52 LYS A H    1  
ATOM 768   H HA   . LYS A 1 52 ? 85.331  2.195   -13.701 1.00 0.00 ? 52 LYS A HA   1  
ATOM 769   H HB2  . LYS A 1 52 ? 86.190  -0.255  -15.240 1.00 0.00 ? 52 LYS A HB2  1  
ATOM 770   H HB3  . LYS A 1 52 ? 84.986  0.841   -15.902 1.00 0.00 ? 52 LYS A HB3  1  
ATOM 771   H HG2  . LYS A 1 52 ? 86.940  1.739   -16.801 1.00 0.00 ? 52 LYS A HG2  1  
ATOM 772   H HG3  . LYS A 1 52 ? 86.776  2.705   -15.344 1.00 0.00 ? 52 LYS A HG3  1  
ATOM 773   H HD2  . LYS A 1 52 ? 89.006  2.057   -15.173 1.00 0.00 ? 52 LYS A HD2  1  
ATOM 774   H HD3  . LYS A 1 52 ? 88.232  0.766   -14.262 1.00 0.00 ? 52 LYS A HD3  1  
ATOM 775   H HE2  . LYS A 1 52 ? 89.807  -0.225  -15.815 1.00 0.00 ? 52 LYS A HE2  1  
ATOM 776   H HE3  . LYS A 1 52 ? 88.181  -0.608  -16.367 1.00 0.00 ? 52 LYS A HE3  1  
ATOM 777   H HZ1  . LYS A 1 52 ? 90.157  1.215   -17.515 1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 778   H HZ2  . LYS A 1 52 ? 88.516  1.628   -17.669 1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 779   H HZ3  . LYS A 1 52 ? 89.085  0.153   -18.291 1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 780   N N    . THR A 1 53 ? 83.931  -0.755  -13.326 1.00 0.00 ? 53 THR A N    1  
ATOM 781   C CA   . THR A 1 53 ? 82.659  -1.432  -13.104 1.00 0.00 ? 53 THR A CA   1  
ATOM 782   C C    . THR A 1 53 ? 81.907  -0.907  -11.875 1.00 0.00 ? 53 THR A C    1  
ATOM 783   O O    . THR A 1 53 ? 80.692  -0.711  -11.929 1.00 0.00 ? 53 THR A O    1  
ATOM 784   C CB   . THR A 1 53 ? 82.912  -2.934  -12.942 1.00 0.00 ? 53 THR A CB   1  
ATOM 785   O OG1  . THR A 1 53 ? 83.608  -3.421  -14.081 1.00 0.00 ? 53 THR A OG1  1  
ATOM 786   C CG2  . THR A 1 53 ? 81.581  -3.670  -12.807 1.00 0.00 ? 53 THR A CG2  1  
ATOM 787   H H    . THR A 1 53 ? 84.756  -1.282  -13.332 1.00 0.00 ? 53 THR A H    1  
ATOM 788   H HA   . THR A 1 53 ? 82.038  -1.287  -13.974 1.00 0.00 ? 53 THR A HA   1  
ATOM 789   H HB   . THR A 1 53 ? 83.504  -3.105  -12.056 1.00 0.00 ? 53 THR A HB   1  
ATOM 790   H HG1  . THR A 1 53 ? 83.914  -4.310  -13.883 1.00 0.00 ? 53 THR A HG1  1  
ATOM 791   H HG21 . THR A 1 53 ? 81.750  -4.735  -12.874 1.00 0.00 ? 53 THR A HG21 1  
ATOM 792   H HG22 . THR A 1 53 ? 80.920  -3.361  -13.601 1.00 0.00 ? 53 THR A HG22 1  
ATOM 793   H HG23 . THR A 1 53 ? 81.136  -3.436  -11.852 1.00 0.00 ? 53 THR A HG23 1  
ATOM 794   N N    . ILE A 1 54 ? 82.609  -0.724  -10.758 1.00 0.00 ? 54 ILE A N    1  
ATOM 795   C CA   . ILE A 1 54 ? 81.956  -0.276  -9.525  1.00 0.00 ? 54 ILE A CA   1  
ATOM 796   C C    . ILE A 1 54 ? 81.553  1.196   -9.547  1.00 0.00 ? 54 ILE A C    1  
ATOM 797   O O    . ILE A 1 54 ? 80.476  1.540   -9.078  1.00 0.00 ? 54 ILE A O    1  
ATOM 798   C CB   . ILE A 1 54 ? 82.863  -0.546  -8.318  1.00 0.00 ? 54 ILE A CB   1  
ATOM 799   C CG1  . ILE A 1 54 ? 83.041  -2.055  -8.140  1.00 0.00 ? 54 ILE A CG1  1  
ATOM 800   C CG2  . ILE A 1 54 ? 82.232  0.034   -7.046  1.00 0.00 ? 54 ILE A CG2  1  
ATOM 801   C CD1  . ILE A 1 54 ? 84.173  -2.314  -7.145  1.00 0.00 ? 54 ILE A CD1  1  
ATOM 802   H H    . ILE A 1 54 ? 83.574  -0.922  -10.751 1.00 0.00 ? 54 ILE A H    1  
ATOM 803   H HA   . ILE A 1 54 ? 81.053  -0.855  -9.409  1.00 0.00 ? 54 ILE A HA   1  
ATOM 804   H HB   . ILE A 1 54 ? 83.826  -0.087  -8.484  1.00 0.00 ? 54 ILE A HB   1  
ATOM 805   H HG12 . ILE A 1 54 ? 82.123  -2.483  -7.763  1.00 0.00 ? 54 ILE A HG12 1  
ATOM 806   H HG13 . ILE A 1 54 ? 83.286  -2.506  -9.089  1.00 0.00 ? 54 ILE A HG13 1  
ATOM 807   H HG21 . ILE A 1 54 ? 82.739  -0.360  -6.180  1.00 0.00 ? 54 ILE A HG21 1  
ATOM 808   H HG22 . ILE A 1 54 ? 81.188  -0.236  -7.007  1.00 0.00 ? 54 ILE A HG22 1  
ATOM 809   H HG23 . ILE A 1 54 ? 82.324  1.110   -7.058  1.00 0.00 ? 54 ILE A HG23 1  
ATOM 810   H HD11 . ILE A 1 54 ? 85.094  -1.903  -7.533  1.00 0.00 ? 54 ILE A HD11 1  
ATOM 811   H HD12 . ILE A 1 54 ? 84.286  -3.379  -6.997  1.00 0.00 ? 54 ILE A HD12 1  
ATOM 812   H HD13 . ILE A 1 54 ? 83.938  -1.843  -6.203  1.00 0.00 ? 54 ILE A HD13 1  
ATOM 813   N N    . VAL A 1 55 ? 82.413  2.071   -10.036 1.00 0.00 ? 55 VAL A N    1  
ATOM 814   C CA   . VAL A 1 55 ? 82.076  3.494   -10.046 1.00 0.00 ? 55 VAL A CA   1  
ATOM 815   C C    . VAL A 1 55 ? 81.094  3.826   -11.170 1.00 0.00 ? 55 VAL A C    1  
ATOM 816   O O    . VAL A 1 55 ? 80.276  4.736   -11.043 1.00 0.00 ? 55 VAL A O    1  
ATOM 817   C CB   . VAL A 1 55 ? 83.345  4.335   -10.203 1.00 0.00 ? 55 VAL A CB   1  
ATOM 818   C CG1  . VAL A 1 55 ? 84.358  3.925   -9.132  1.00 0.00 ? 55 VAL A CG1  1  
ATOM 819   C CG2  . VAL A 1 55 ? 83.945  4.120   -11.605 1.00 0.00 ? 55 VAL A CG2  1  
ATOM 820   H H    . VAL A 1 55 ? 83.285  1.769   -10.373 1.00 0.00 ? 55 VAL A H    1  
ATOM 821   H HA   . VAL A 1 55 ? 81.615  3.747   -9.102  1.00 0.00 ? 55 VAL A HA   1  
ATOM 822   H HB   . VAL A 1 55 ? 83.095  5.379   -10.073 1.00 0.00 ? 55 VAL A HB   1  
ATOM 823   H HG11 . VAL A 1 55 ? 83.948  4.129   -8.154  1.00 0.00 ? 55 VAL A HG11 1  
ATOM 824   H HG12 . VAL A 1 55 ? 85.269  4.488   -9.265  1.00 0.00 ? 55 VAL A HG12 1  
ATOM 825   H HG13 . VAL A 1 55 ? 84.568  2.869   -9.220  1.00 0.00 ? 55 VAL A HG13 1  
ATOM 826   H HG21 . VAL A 1 55 ? 83.476  4.801   -12.298 1.00 0.00 ? 55 VAL A HG21 1  
ATOM 827   H HG22 . VAL A 1 55 ? 83.771  3.105   -11.929 1.00 0.00 ? 55 VAL A HG22 1  
ATOM 828   H HG23 . VAL A 1 55 ? 85.011  4.310   -11.582 1.00 0.00 ? 55 VAL A HG23 1  
ATOM 829   N N    . LEU A 1 56 ? 81.212  3.111   -12.284 1.00 0.00 ? 56 LEU A N    1  
ATOM 830   C CA   . LEU A 1 56 ? 80.367  3.360   -13.446 1.00 0.00 ? 56 LEU A CA   1  
ATOM 831   C C    . LEU A 1 56 ? 78.957  2.758   -13.347 1.00 0.00 ? 56 LEU A C    1  
ATOM 832   O O    . LEU A 1 56 ? 78.000  3.388   -13.784 1.00 0.00 ? 56 LEU A O    1  
ATOM 833   C CB   . LEU A 1 56 ? 81.062  2.800   -14.690 1.00 0.00 ? 56 LEU A CB   1  
ATOM 834   C CG   . LEU A 1 56 ? 80.393  3.337   -15.976 1.00 0.00 ? 56 LEU A CG   1  
ATOM 835   C CD1  . LEU A 1 56 ? 81.017  4.680   -16.373 1.00 0.00 ? 56 LEU A CD1  1  
ATOM 836   C CD2  . LEU A 1 56 ? 80.598  2.338   -17.122 1.00 0.00 ? 56 LEU A CD2  1  
ATOM 837   H H    . LEU A 1 56 ? 81.902  2.417   -12.340 1.00 0.00 ? 56 LEU A H    1  
ATOM 838   H HA   . LEU A 1 56 ? 80.271  4.426   -13.572 1.00 0.00 ? 56 LEU A HA   1  
ATOM 839   H HB2  . LEU A 1 56 ? 82.103  3.091   -14.674 1.00 0.00 ? 56 LEU A HB2  1  
ATOM 840   H HB3  . LEU A 1 56 ? 80.993  1.724   -14.668 1.00 0.00 ? 56 LEU A HB3  1  
ATOM 841   H HG   . LEU A 1 56 ? 79.333  3.474   -15.808 1.00 0.00 ? 56 LEU A HG   1  
ATOM 842   H HD11 . LEU A 1 56 ? 80.803  5.418   -15.614 1.00 0.00 ? 56 LEU A HD11 1  
ATOM 843   H HD12 . LEU A 1 56 ? 80.604  5.004   -17.316 1.00 0.00 ? 56 LEU A HD12 1  
ATOM 844   H HD13 . LEU A 1 56 ? 82.088  4.566   -16.471 1.00 0.00 ? 56 LEU A HD13 1  
ATOM 845   H HD21 . LEU A 1 56 ? 80.014  1.449   -16.934 1.00 0.00 ? 56 LEU A HD21 1  
ATOM 846   H HD22 . LEU A 1 56 ? 81.644  2.075   -17.185 1.00 0.00 ? 56 LEU A HD22 1  
ATOM 847   H HD23 . LEU A 1 56 ? 80.283  2.787   -18.052 1.00 0.00 ? 56 LEU A HD23 1  
ATOM 848   N N    . ILE A 1 57 ? 78.813  1.532   -12.843 1.00 0.00 ? 57 ILE A N    1  
ATOM 849   C CA   . ILE A 1 57 ? 77.477  0.924   -12.818 1.00 0.00 ? 57 ILE A CA   1  
ATOM 850   C C    . ILE A 1 57 ? 76.484  1.678   -11.917 1.00 0.00 ? 57 ILE A C    1  
ATOM 851   O O    . ILE A 1 57 ? 75.470  2.170   -12.410 1.00 0.00 ? 57 ILE A O    1  
ATOM 852   C CB   . ILE A 1 57 ? 77.574  -0.575  -12.426 1.00 0.00 ? 57 ILE A CB   1  
ATOM 853   C CG1  . ILE A 1 57 ? 78.029  -1.385  -13.653 1.00 0.00 ? 57 ILE A CG1  1  
ATOM 854   C CG2  . ILE A 1 57 ? 76.208  -1.106  -11.949 1.00 0.00 ? 57 ILE A CG2  1  
ATOM 855   C CD1  . ILE A 1 57 ? 78.249  -2.850  -13.266 1.00 0.00 ? 57 ILE A CD1  1  
ATOM 856   H H    . ILE A 1 57 ? 79.600  1.019   -12.529 1.00 0.00 ? 57 ILE A H    1  
ATOM 857   H HA   . ILE A 1 57 ? 77.084  0.983   -13.824 1.00 0.00 ? 57 ILE A HA   1  
ATOM 858   H HB   . ILE A 1 57 ? 78.300  -0.694  -11.636 1.00 0.00 ? 57 ILE A HB   1  
ATOM 859   H HG12 . ILE A 1 57 ? 77.270  -1.328  -14.420 1.00 0.00 ? 57 ILE A HG12 1  
ATOM 860   H HG13 . ILE A 1 57 ? 78.952  -0.972  -14.031 1.00 0.00 ? 57 ILE A HG13 1  
ATOM 861   H HG21 . ILE A 1 57 ? 75.449  -0.841  -12.669 1.00 0.00 ? 57 ILE A HG21 1  
ATOM 862   H HG22 . ILE A 1 57 ? 75.963  -0.669  -10.992 1.00 0.00 ? 57 ILE A HG22 1  
ATOM 863   H HG23 . ILE A 1 57 ? 76.244  -2.178  -11.846 1.00 0.00 ? 57 ILE A HG23 1  
ATOM 864   H HD11 . ILE A 1 57 ? 77.308  -3.290  -12.973 1.00 0.00 ? 57 ILE A HD11 1  
ATOM 865   H HD12 . ILE A 1 57 ? 78.942  -2.904  -12.441 1.00 0.00 ? 57 ILE A HD12 1  
ATOM 866   H HD13 . ILE A 1 57 ? 78.650  -3.390  -14.110 1.00 0.00 ? 57 ILE A HD13 1  
ATOM 867   N N    . PRO A 1 58 ? 76.722  1.774   -10.638 1.00 0.00 ? 58 PRO A N    1  
ATOM 868   C CA   . PRO A 1 58 ? 75.787  2.474   -9.713  1.00 0.00 ? 58 PRO A CA   1  
ATOM 869   C C    . PRO A 1 58 ? 75.349  3.834   -10.245 1.00 0.00 ? 58 PRO A C    1  
ATOM 870   O O    . PRO A 1 58 ? 74.260  4.307   -9.919  1.00 0.00 ? 58 PRO A O    1  
ATOM 871   C CB   . PRO A 1 58 ? 76.578  2.592   -8.388  1.00 0.00 ? 58 PRO A CB   1  
ATOM 872   C CG   . PRO A 1 58 ? 77.982  2.170   -8.715  1.00 0.00 ? 58 PRO A CG   1  
ATOM 873   C CD   . PRO A 1 58 ? 77.878  1.241   -9.921  1.00 0.00 ? 58 PRO A CD   1  
ATOM 874   H HA   . PRO A 1 58 ? 74.914  1.860   -9.560  1.00 0.00 ? 58 PRO A HA   1  
ATOM 875   H HB2  . PRO A 1 58 ? 76.564  3.614   -8.023  1.00 0.00 ? 58 PRO A HB2  1  
ATOM 876   H HB3  . PRO A 1 58 ? 76.160  1.929   -7.641  1.00 0.00 ? 58 PRO A HB3  1  
ATOM 877   H HG2  . PRO A 1 58 ? 78.585  3.036   -8.963  1.00 0.00 ? 58 PRO A HG2  1  
ATOM 878   H HG3  . PRO A 1 58 ? 78.422  1.639   -7.884  1.00 0.00 ? 58 PRO A HG3  1  
ATOM 879   H HD2  . PRO A 1 58 ? 78.765  1.298   -10.525 1.00 0.00 ? 58 PRO A HD2  1  
ATOM 880   H HD3  . PRO A 1 58 ? 77.686  0.227   -9.605  1.00 0.00 ? 58 PRO A HD3  1  
ATOM 881   N N    . PHE A 1 59 ? 76.184  4.462   -11.069 1.00 0.00 ? 59 PHE A N    1  
ATOM 882   C CA   . PHE A 1 59 ? 75.829  5.768   -11.630 1.00 0.00 ? 59 PHE A CA   1  
ATOM 883   C C    . PHE A 1 59 ? 75.089  5.579   -12.956 1.00 0.00 ? 59 PHE A C    1  
ATOM 884   O O    . PHE A 1 59 ? 73.908  5.908   -13.062 1.00 0.00 ? 59 PHE A O    1  
ATOM 885   C CB   . PHE A 1 59 ? 77.092  6.646   -11.823 1.00 0.00 ? 59 PHE A CB   1  
ATOM 886   C CG   . PHE A 1 59 ? 76.793  8.074   -11.417 1.00 0.00 ? 59 PHE A CG   1  
ATOM 887   C CD1  . PHE A 1 59 ? 76.231  8.967   -12.335 1.00 0.00 ? 59 PHE A CD1  1  
ATOM 888   C CD2  . PHE A 1 59 ? 77.069  8.495   -10.111 1.00 0.00 ? 59 PHE A CD2  1  
ATOM 889   C CE1  . PHE A 1 59 ? 75.947  10.281  -11.948 1.00 0.00 ? 59 PHE A CE1  1  
ATOM 890   C CE2  . PHE A 1 59 ? 76.784  9.807   -9.721  1.00 0.00 ? 59 PHE A CE2  1  
ATOM 891   C CZ   . PHE A 1 59 ? 76.223  10.701  -10.640 1.00 0.00 ? 59 PHE A CZ   1  
ATOM 892   H H    . PHE A 1 59 ? 77.036  4.041   -11.311 1.00 0.00 ? 59 PHE A H    1  
ATOM 893   H HA   . PHE A 1 59 ? 75.157  6.266   -10.939 1.00 0.00 ? 59 PHE A HA   1  
ATOM 894   H HB2  . PHE A 1 59 ? 77.893  6.268   -11.203 1.00 0.00 ? 59 PHE A HB2  1  
ATOM 895   H HB3  . PHE A 1 59 ? 77.405  6.624   -12.855 1.00 0.00 ? 59 PHE A HB3  1  
ATOM 896   H HD1  . PHE A 1 59 ? 76.018  8.642   -13.343 1.00 0.00 ? 59 PHE A HD1  1  
ATOM 897   H HD2  . PHE A 1 59 ? 77.503  7.804   -9.402  1.00 0.00 ? 59 PHE A HD2  1  
ATOM 898   H HE1  . PHE A 1 59 ? 75.514  10.970  -12.655 1.00 0.00 ? 59 PHE A HE1  1  
ATOM 899   H HE2  . PHE A 1 59 ? 76.997  10.130  -8.714  1.00 0.00 ? 59 PHE A HE2  1  
ATOM 900   H HZ   . PHE A 1 59 ? 76.000  11.713  -10.337 1.00 0.00 ? 59 PHE A HZ   1  
ATOM 901   N N    . LEU A 1 60 ? 75.780  5.047   -13.962 1.00 0.00 ? 60 LEU A N    1  
ATOM 902   C CA   . LEU A 1 60 ? 75.146  4.828   -15.257 1.00 0.00 ? 60 LEU A CA   1  
ATOM 903   C C    . LEU A 1 60 ? 73.909  3.937   -15.109 1.00 0.00 ? 60 LEU A C    1  
ATOM 904   O O    . LEU A 1 60 ? 73.076  3.875   -16.013 1.00 0.00 ? 60 LEU A O    1  
ATOM 905   C CB   . LEU A 1 60 ? 76.139  4.179   -16.237 1.00 0.00 ? 60 LEU A CB   1  
ATOM 906   C CG   . LEU A 1 60 ? 77.105  5.236   -16.808 1.00 0.00 ? 60 LEU A CG   1  
ATOM 907   C CD1  . LEU A 1 60 ? 76.383  6.153   -17.817 1.00 0.00 ? 60 LEU A CD1  1  
ATOM 908   C CD2  . LEU A 1 60 ? 77.686  6.082   -15.667 1.00 0.00 ? 60 LEU A CD2  1  
ATOM 909   H H    . LEU A 1 60 ? 76.725  4.798   -13.835 1.00 0.00 ? 60 LEU A H    1  
ATOM 910   H HA   . LEU A 1 60 ? 74.832  5.779   -15.655 1.00 0.00 ? 60 LEU A HA   1  
ATOM 911   H HB2  . LEU A 1 60 ? 76.706  3.424   -15.717 1.00 0.00 ? 60 LEU A HB2  1  
ATOM 912   H HB3  . LEU A 1 60 ? 75.598  3.714   -17.048 1.00 0.00 ? 60 LEU A HB3  1  
ATOM 913   H HG   . LEU A 1 60 ? 77.914  4.729   -17.317 1.00 0.00 ? 60 LEU A HG   1  
ATOM 914   H HD11 . LEU A 1 60 ? 75.909  6.974   -17.299 1.00 0.00 ? 60 LEU A HD11 1  
ATOM 915   H HD12 . LEU A 1 60 ? 75.635  5.592   -18.357 1.00 0.00 ? 60 LEU A HD12 1  
ATOM 916   H HD13 . LEU A 1 60 ? 77.104  6.545   -18.519 1.00 0.00 ? 60 LEU A HD13 1  
ATOM 917   H HD21 . LEU A 1 60 ? 76.924  6.745   -15.283 1.00 0.00 ? 60 LEU A HD21 1  
ATOM 918   H HD22 . LEU A 1 60 ? 78.513  6.663   -16.036 1.00 0.00 ? 60 LEU A HD22 1  
ATOM 919   H HD23 . LEU A 1 60 ? 78.030  5.436   -14.877 1.00 0.00 ? 60 LEU A HD23 1  
ATOM 920   N N    . GLU A 1 61 ? 73.785  3.249   -13.970 1.00 0.00 ? 61 GLU A N    1  
ATOM 921   C CA   . GLU A 1 61 ? 72.631  2.378   -13.752 1.00 0.00 ? 61 GLU A CA   1  
ATOM 922   C C    . GLU A 1 61 ? 71.402  3.198   -13.372 1.00 0.00 ? 61 GLU A C    1  
ATOM 923   O O    . GLU A 1 61 ? 71.494  4.155   -12.603 1.00 0.00 ? 61 GLU A O    1  
ATOM 924   C CB   . GLU A 1 61 ? 72.934  1.362   -12.649 1.00 0.00 ? 61 GLU A CB   1  
ATOM 925   C CG   . GLU A 1 61 ? 71.684  0.526   -12.362 1.00 0.00 ? 61 GLU A CG   1  
ATOM 926   C CD   . GLU A 1 61 ? 72.050  -0.681  -11.503 1.00 0.00 ? 61 GLU A CD   1  
ATOM 927   O OE1  . GLU A 1 61 ? 72.735  -0.492  -10.511 1.00 0.00 ? 61 GLU A OE1  1  
ATOM 928   O OE2  . GLU A 1 61 ? 71.640  -1.776  -11.851 1.00 0.00 ? 61 GLU A OE2  1  
ATOM 929   H H    . GLU A 1 61 ? 74.474  3.329   -13.272 1.00 0.00 ? 61 GLU A H    1  
ATOM 930   H HA   . GLU A 1 61 ? 72.422  1.844   -14.667 1.00 0.00 ? 61 GLU A HA   1  
ATOM 931   H HB2  . GLU A 1 61 ? 73.732  0.711   -12.971 1.00 0.00 ? 61 GLU A HB2  1  
ATOM 932   H HB3  . GLU A 1 61 ? 73.230  1.881   -11.749 1.00 0.00 ? 61 GLU A HB3  1  
ATOM 933   H HG2  . GLU A 1 61 ? 70.959  1.132   -11.839 1.00 0.00 ? 61 GLU A HG2  1  
ATOM 934   H HG3  . GLU A 1 61 ? 71.259  0.184   -13.295 1.00 0.00 ? 61 GLU A HG3  1  
ATOM 935   N N    . GLN A 1 62 ? 70.250  2.812   -13.915 1.00 0.00 ? 62 GLN A N    1  
ATOM 936   C CA   . GLN A 1 62 ? 69.005  3.514   -13.626 1.00 0.00 ? 62 GLN A CA   1  
ATOM 937   C C    . GLN A 1 62 ? 68.601  3.304   -12.172 1.00 0.00 ? 62 GLN A C    1  
ATOM 938   O O    . GLN A 1 62 ? 67.827  2.399   -11.857 1.00 0.00 ? 62 GLN A O    1  
ATOM 939   C CB   . GLN A 1 62 ? 67.893  3.002   -14.545 1.00 0.00 ? 62 GLN A CB   1  
ATOM 940   C CG   . GLN A 1 62 ? 68.275  3.258   -16.005 1.00 0.00 ? 62 GLN A CG   1  
ATOM 941   C CD   . GLN A 1 62 ? 68.313  4.758   -16.282 1.00 0.00 ? 62 GLN A CD   1  
ATOM 942   O OE1  . GLN A 1 62 ? 67.350  5.468   -15.991 1.00 0.00 ? 62 GLN A OE1  1  
ATOM 943   N NE2  . GLN A 1 62 ? 69.373  5.284   -16.831 1.00 0.00 ? 62 GLN A NE2  1  
ATOM 944   H H    . GLN A 1 62 ? 70.239  2.040   -14.519 1.00 0.00 ? 62 GLN A H    1  
ATOM 945   H HA   . GLN A 1 62 ? 69.147  4.569   -13.803 1.00 0.00 ? 62 GLN A HA   1  
ATOM 946   H HB2  . GLN A 1 62 ? 67.757  1.942   -14.389 1.00 0.00 ? 62 GLN A HB2  1  
ATOM 947   H HB3  . GLN A 1 62 ? 66.973  3.520   -14.320 1.00 0.00 ? 62 GLN A HB3  1  
ATOM 948   H HG2  . GLN A 1 62 ? 69.249  2.834   -16.198 1.00 0.00 ? 62 GLN A HG2  1  
ATOM 949   H HG3  . GLN A 1 62 ? 67.547  2.795   -16.652 1.00 0.00 ? 62 GLN A HG3  1  
ATOM 950   H HE21 . GLN A 1 62 ? 70.137  4.715   -17.063 1.00 0.00 ? 62 GLN A HE21 1  
ATOM 951   H HE22 . GLN A 1 62 ? 69.405  6.246   -17.013 1.00 0.00 ? 62 GLN A HE22 1  
ATOM 952   N N    . ASN A 1 63 ? 69.132  4.142   -11.288 1.00 0.00 ? 63 ASN A N    1  
ATOM 953   C CA   . ASN A 1 63 ? 68.821  4.036   -9.867  1.00 0.00 ? 63 ASN A CA   1  
ATOM 954   C C    . ASN A 1 63 ? 69.170  2.646   -9.344  1.00 0.00 ? 63 ASN A C    1  
ATOM 955   C CB   . ASN A 1 63 ? 67.334  4.312   -9.636  1.00 0.00 ? 63 ASN A CB   1  
ATOM 956   C CG   . ASN A 1 63 ? 67.042  4.370   -8.141  1.00 0.00 ? 63 ASN A CG   1  
ATOM 957   O OD1  . ASN A 1 63 ? 67.831  4.921   -7.374  1.00 0.00 ? 63 ASN A OD1  1  
ATOM 958   N ND2  . ASN A 1 63 ? 65.948  3.831   -7.679  1.00 0.00 ? 63 ASN A ND2  1  
ATOM 959   H H    . ASN A 1 63 ? 69.744  4.842   -11.596 1.00 0.00 ? 63 ASN A H    1  
ATOM 960   H HA   . ASN A 1 63 ? 69.400  4.770   -9.326  1.00 0.00 ? 63 ASN A HA   1  
ATOM 961   H HB2  . ASN A 1 63 ? 67.071  5.256   -10.091 1.00 0.00 ? 63 ASN A HB2  1  
ATOM 962   H HB3  . ASN A 1 63 ? 66.749  3.522   -10.084 1.00 0.00 ? 63 ASN A HB3  1  
ATOM 963   H HD21 . ASN A 1 63 ? 65.321  3.392   -8.291  1.00 0.00 ? 63 ASN A HD21 1  
ATOM 964   H HD22 . ASN A 1 63 ? 65.752  3.863   -6.719  1.00 0.00 ? 63 ASN A HD22 1  
ATOM 965   N N    . CYS B 2 1  ? 73.804  23.472  -14.772 1.00 0.00 ? 1  CYS B N    1  
ATOM 966   C CA   . CYS B 2 1  ? 73.552  22.651  -13.555 1.00 0.00 ? 1  CYS B CA   1  
ATOM 967   C C    . CYS B 2 1  ? 74.879  22.128  -13.013 1.00 0.00 ? 1  CYS B C    1  
ATOM 968   O O    . CYS B 2 1  ? 75.949  22.558  -13.447 1.00 0.00 ? 1  CYS B O    1  
ATOM 969   C CB   . CYS B 2 1  ? 72.636  21.478  -13.916 1.00 0.00 ? 1  CYS B CB   1  
ATOM 970   S SG   . CYS B 2 1  ? 70.995  22.107  -14.350 1.00 0.00 ? 1  CYS B SG   1  
ATOM 971   H HA   . CYS B 2 1  ? 73.074  23.261  -12.804 1.00 0.00 ? 1  CYS B HA   1  
ATOM 972   H HB2  . CYS B 2 1  ? 73.051  20.943  -14.756 1.00 0.00 ? 1  CYS B HB2  1  
ATOM 973   H HB3  . CYS B 2 1  ? 72.554  20.812  -13.069 1.00 0.00 ? 1  CYS B HB3  1  
ATOM 974   N N    . SER B 2 2  ? 74.802  21.202  -12.065 1.00 0.00 ? 2  SER B N    1  
ATOM 975   C CA   . SER B 2 2  ? 76.005  20.628  -11.471 1.00 0.00 ? 2  SER B CA   1  
ATOM 976   C C    . SER B 2 2  ? 76.705  19.705  -12.465 1.00 0.00 ? 2  SER B C    1  
ATOM 977   O O    . SER B 2 2  ? 77.910  19.474  -12.370 1.00 0.00 ? 2  SER B O    1  
ATOM 978   C CB   . SER B 2 2  ? 75.641  19.843  -10.211 1.00 0.00 ? 2  SER B CB   1  
ATOM 979   O OG   . SER B 2 2  ? 76.831  19.469  -9.530  1.00 0.00 ? 2  SER B OG   1  
ATOM 980   H H    . SER B 2 2  ? 73.923  20.898  -11.758 1.00 0.00 ? 2  SER B H    1  
ATOM 981   H HA   . SER B 2 2  ? 76.679  21.427  -11.201 1.00 0.00 ? 2  SER B HA   1  
ATOM 982   H HB2  . SER B 2 2  ? 75.039  20.457  -9.563  1.00 0.00 ? 2  SER B HB2  1  
ATOM 983   H HB3  . SER B 2 2  ? 75.080  18.959  -10.489 1.00 0.00 ? 2  SER B HB3  1  
ATOM 984   H HG   . SER B 2 2  ? 76.724  18.567  -9.219  1.00 0.00 ? 2  SER B HG   1  
ATOM 985   N N    . THR B 2 3  ? 75.940  19.182  -13.418 1.00 0.00 ? 3  THR B N    1  
ATOM 986   C CA   . THR B 2 3  ? 76.493  18.285  -14.427 1.00 0.00 ? 3  THR B CA   1  
ATOM 987   C C    . THR B 2 3  ? 77.264  17.144  -13.769 1.00 0.00 ? 3  THR B C    1  
ATOM 988   O O    . THR B 2 3  ? 78.409  17.314  -13.354 1.00 0.00 ? 3  THR B O    1  
ATOM 989   C CB   . THR B 2 3  ? 77.425  19.061  -15.360 1.00 0.00 ? 3  THR B CB   1  
ATOM 990   O OG1  . THR B 2 3  ? 78.584  19.463  -14.643 1.00 0.00 ? 3  THR B OG1  1  
ATOM 991   C CG2  . THR B 2 3  ? 76.700  20.296  -15.896 1.00 0.00 ? 3  THR B CG2  1  
ATOM 992   H H    . THR B 2 3  ? 74.985  19.403  -13.444 1.00 0.00 ? 3  THR B H    1  
ATOM 993   H HA   . THR B 2 3  ? 75.685  17.871  -15.010 1.00 0.00 ? 3  THR B HA   1  
ATOM 994   H HB   . THR B 2 3  ? 77.713  18.431  -16.188 1.00 0.00 ? 3  THR B HB   1  
ATOM 995   H HG1  . THR B 2 3  ? 78.633  18.940  -13.840 1.00 0.00 ? 3  THR B HG1  1  
ATOM 996   H HG21 . THR B 2 3  ? 77.368  20.859  -16.530 1.00 0.00 ? 3  THR B HG21 1  
ATOM 997   H HG22 . THR B 2 3  ? 76.383  20.913  -15.069 1.00 0.00 ? 3  THR B HG22 1  
ATOM 998   H HG23 . THR B 2 3  ? 75.838  19.987  -16.466 1.00 0.00 ? 3  THR B HG23 1  
ATOM 999   N N    . VAL B 2 4  ? 76.625  15.981  -13.679 1.00 0.00 ? 4  VAL B N    1  
ATOM 1000  C CA   . VAL B 2 4  ? 77.257  14.815  -13.070 1.00 0.00 ? 4  VAL B CA   1  
ATOM 1001  C C    . VAL B 2 4  ? 78.219  14.154  -14.046 1.00 0.00 ? 4  VAL B C    1  
ATOM 1002  O O    . VAL B 2 4  ? 79.323  13.761  -13.672 1.00 0.00 ? 4  VAL B O    1  
ATOM 1003  C CB   . VAL B 2 4  ? 76.192  13.806  -12.645 1.00 0.00 ? 4  VAL B CB   1  
ATOM 1004  C CG1  . VAL B 2 4  ? 75.242  14.457  -11.638 1.00 0.00 ? 4  VAL B CG1  1  
ATOM 1005  C CG2  . VAL B 2 4  ? 75.399  13.353  -13.876 1.00 0.00 ? 4  VAL B CG2  1  
ATOM 1006  H H    . VAL B 2 4  ? 75.712  15.905  -14.028 1.00 0.00 ? 4  VAL B H    1  
ATOM 1007  H HA   . VAL B 2 4  ? 77.810  15.129  -12.198 1.00 0.00 ? 4  VAL B HA   1  
ATOM 1008  H HB   . VAL B 2 4  ? 76.671  12.953  -12.189 1.00 0.00 ? 4  VAL B HB   1  
ATOM 1009  H HG11 . VAL B 2 4  ? 74.619  13.697  -11.188 1.00 0.00 ? 4  VAL B HG11 1  
ATOM 1010  H HG12 . VAL B 2 4  ? 74.621  15.180  -12.145 1.00 0.00 ? 4  VAL B HG12 1  
ATOM 1011  H HG13 . VAL B 2 4  ? 75.817  14.953  -10.869 1.00 0.00 ? 4  VAL B HG13 1  
ATOM 1012  H HG21 . VAL B 2 4  ? 75.996  12.663  -14.454 1.00 0.00 ? 4  VAL B HG21 1  
ATOM 1013  H HG22 . VAL B 2 4  ? 75.153  14.212  -14.483 1.00 0.00 ? 4  VAL B HG22 1  
ATOM 1014  H HG23 . VAL B 2 4  ? 74.490  12.865  -13.560 1.00 0.00 ? 4  VAL B HG23 1  
ATOM 1015  N N    . SER B 2 5  ? 77.792  14.036  -15.299 1.00 0.00 ? 5  SER B N    1  
ATOM 1016  C CA   . SER B 2 5  ? 78.621  13.423  -16.333 1.00 0.00 ? 5  SER B CA   1  
ATOM 1017  C C    . SER B 2 5  ? 80.092  13.819  -16.170 1.00 0.00 ? 5  SER B C    1  
ATOM 1018  O O    . SER B 2 5  ? 80.950  12.955  -16.001 1.00 0.00 ? 5  SER B O    1  
ATOM 1019  C CB   . SER B 2 5  ? 78.106  13.839  -17.722 1.00 0.00 ? 5  SER B CB   1  
ATOM 1020  O OG   . SER B 2 5  ? 79.199  14.211  -18.551 1.00 0.00 ? 5  SER B OG   1  
ATOM 1021  H H    . SER B 2 5  ? 76.901  14.368  -15.535 1.00 0.00 ? 5  SER B H    1  
ATOM 1022  H HA   . SER B 2 5  ? 78.548  12.349  -16.235 1.00 0.00 ? 5  SER B HA   1  
ATOM 1023  H HB2  . SER B 2 5  ? 77.582  13.016  -18.184 1.00 0.00 ? 5  SER B HB2  1  
ATOM 1024  H HB3  . SER B 2 5  ? 77.427  14.674  -17.613 1.00 0.00 ? 5  SER B HB3  1  
ATOM 1025  H HG   . SER B 2 5  ? 78.855  14.402  -19.427 1.00 0.00 ? 5  SER B HG   1  
ATOM 1026  N N    . PRO B 2 6  ? 80.411  15.089  -16.214 1.00 0.00 ? 6  PRO B N    1  
ATOM 1027  C CA   . PRO B 2 6  ? 81.823  15.544  -16.063 1.00 0.00 ? 6  PRO B CA   1  
ATOM 1028  C C    . PRO B 2 6  ? 82.380  15.218  -14.673 1.00 0.00 ? 6  PRO B C    1  
ATOM 1029  O O    . PRO B 2 6  ? 83.427  15.733  -14.282 1.00 0.00 ? 6  PRO B O    1  
ATOM 1030  C CB   . PRO B 2 6  ? 81.755  17.064  -16.313 1.00 0.00 ? 6  PRO B CB   1  
ATOM 1031  C CG   . PRO B 2 6  ? 80.334  17.444  -16.043 1.00 0.00 ? 6  PRO B CG   1  
ATOM 1032  C CD   . PRO B 2 6  ? 79.486  16.224  -16.411 1.00 0.00 ? 6  PRO B CD   1  
ATOM 1033  H HA   . PRO B 2 6  ? 82.438  15.082  -16.819 1.00 0.00 ? 6  PRO B HA   1  
ATOM 1034  H HB2  . PRO B 2 6  ? 82.426  17.591  -15.644 1.00 0.00 ? 6  PRO B HB2  1  
ATOM 1035  H HB3  . PRO B 2 6  ? 82.006  17.285  -17.342 1.00 0.00 ? 6  PRO B HB3  1  
ATOM 1036  H HG2  . PRO B 2 6  ? 80.208  17.686  -14.993 1.00 0.00 ? 6  PRO B HG2  1  
ATOM 1037  H HG3  . PRO B 2 6  ? 80.045  18.287  -16.653 1.00 0.00 ? 6  PRO B HG3  1  
ATOM 1038  H HD2  . PRO B 2 6  ? 78.634  16.152  -15.754 1.00 0.00 ? 6  PRO B HD2  1  
ATOM 1039  H HD3  . PRO B 2 6  ? 79.171  16.275  -17.441 1.00 0.00 ? 6  PRO B HD3  1  
ATOM 1040  N N    . GLY B 2 7  ? 81.673  14.356  -13.932 1.00 0.00 ? 7  GLY B N    1  
ATOM 1041  C CA   . GLY B 2 7  ? 82.105  13.961  -12.588 1.00 0.00 ? 7  GLY B CA   1  
ATOM 1042  C C    . GLY B 2 7  ? 82.502  12.488  -12.539 1.00 0.00 ? 7  GLY B C    1  
ATOM 1043  O O    . GLY B 2 7  ? 83.674  12.166  -12.341 1.00 0.00 ? 7  GLY B O    1  
ATOM 1044  H H    . GLY B 2 7  ? 80.847  13.979  -14.294 1.00 0.00 ? 7  GLY B H    1  
ATOM 1045  H HA2  . GLY B 2 7  ? 82.958  14.557  -12.295 1.00 0.00 ? 7  GLY B HA2  1  
ATOM 1046  H HA3  . GLY B 2 7  ? 81.297  14.129  -11.891 1.00 0.00 ? 7  GLY B HA3  1  
ATOM 1047  N N    . VAL B 2 8  ? 81.535  11.593  -12.720 1.00 0.00 ? 8  VAL B N    1  
ATOM 1048  C CA   . VAL B 2 8  ? 81.841  10.162  -12.691 1.00 0.00 ? 8  VAL B CA   1  
ATOM 1049  C C    . VAL B 2 8  ? 82.709  9.814   -13.895 1.00 0.00 ? 8  VAL B C    1  
ATOM 1050  O O    . VAL B 2 8  ? 83.779  9.215   -13.760 1.00 0.00 ? 8  VAL B O    1  
ATOM 1051  C CB   . VAL B 2 8  ? 80.536  9.317   -12.708 1.00 0.00 ? 8  VAL B CB   1  
ATOM 1052  C CG1  . VAL B 2 8  ? 80.192  8.814   -11.299 1.00 0.00 ? 8  VAL B CG1  1  
ATOM 1053  C CG2  . VAL B 2 8  ? 79.377  10.175  -13.227 1.00 0.00 ? 8  VAL B CG2  1  
ATOM 1054  H H    . VAL B 2 8  ? 80.614  11.892  -12.880 1.00 0.00 ? 8  VAL B H    1  
ATOM 1055  H HA   . VAL B 2 8  ? 82.402  9.949   -11.793 1.00 0.00 ? 8  VAL B HA   1  
ATOM 1056  H HB   . VAL B 2 8  ? 80.660  8.460   -13.359 1.00 0.00 ? 8  VAL B HB   1  
ATOM 1057  H HG11 . VAL B 2 8  ? 79.904  9.649   -10.677 1.00 0.00 ? 8  VAL B HG11 1  
ATOM 1058  H HG12 . VAL B 2 8  ? 81.051  8.322   -10.868 1.00 0.00 ? 8  VAL B HG12 1  
ATOM 1059  H HG13 . VAL B 2 8  ? 79.376  8.112   -11.361 1.00 0.00 ? 8  VAL B HG13 1  
ATOM 1060  H HG21 . VAL B 2 8  ? 78.544  9.537   -13.484 1.00 0.00 ? 8  VAL B HG21 1  
ATOM 1061  H HG22 . VAL B 2 8  ? 79.696  10.721  -14.102 1.00 0.00 ? 8  VAL B HG22 1  
ATOM 1062  H HG23 . VAL B 2 8  ? 79.073  10.871  -12.460 1.00 0.00 ? 8  VAL B HG23 1  
ATOM 1063  N N    . LEU B 2 9  ? 82.246  10.211  -15.071 1.00 0.00 ? 9  LEU B N    1  
ATOM 1064  C CA   . LEU B 2 9  ? 82.990  9.951   -16.288 1.00 0.00 ? 9  LEU B CA   1  
ATOM 1065  C C    . LEU B 2 9  ? 84.381  10.578  -16.166 1.00 0.00 ? 9  LEU B C    1  
ATOM 1066  O O    . LEU B 2 9  ? 85.397  9.977   -16.558 1.00 0.00 ? 9  LEU B O    1  
ATOM 1067  C CB   . LEU B 2 9  ? 82.220  10.512  -17.487 1.00 0.00 ? 9  LEU B CB   1  
ATOM 1068  C CG   . LEU B 2 9  ? 80.720  10.188  -17.335 1.00 0.00 ? 9  LEU B CG   1  
ATOM 1069  C CD1  . LEU B 2 9  ? 79.979  10.517  -18.637 1.00 0.00 ? 9  LEU B CD1  1  
ATOM 1070  C CD2  . LEU B 2 9  ? 80.530  8.698   -17.005 1.00 0.00 ? 9  LEU B CD2  1  
ATOM 1071  H H    . LEU B 2 9  ? 81.396  10.695  -15.117 1.00 0.00 ? 9  LEU B H    1  
ATOM 1072  H HA   . LEU B 2 9  ? 83.096  8.886   -16.412 1.00 0.00 ? 9  LEU B HA   1  
ATOM 1073  H HB2  . LEU B 2 9  ? 82.356  11.583  -17.536 1.00 0.00 ? 9  LEU B HB2  1  
ATOM 1074  H HB3  . LEU B 2 9  ? 82.592  10.059  -18.392 1.00 0.00 ? 9  LEU B HB3  1  
ATOM 1075  H HG   . LEU B 2 9  ? 80.306  10.784  -16.536 1.00 0.00 ? 9  LEU B HG   1  
ATOM 1076  H HD11 . LEU B 2 9  ? 80.252  11.509  -18.968 1.00 0.00 ? 9  LEU B HD11 1  
ATOM 1077  H HD12 . LEU B 2 9  ? 78.913  10.479  -18.463 1.00 0.00 ? 9  LEU B HD12 1  
ATOM 1078  H HD13 . LEU B 2 9  ? 80.245  9.797   -19.395 1.00 0.00 ? 9  LEU B HD13 1  
ATOM 1079  H HD21 . LEU B 2 9  ? 81.182  8.103   -17.627 1.00 0.00 ? 9  LEU B HD21 1  
ATOM 1080  H HD22 . LEU B 2 9  ? 79.502  8.414   -17.185 1.00 0.00 ? 9  LEU B HD22 1  
ATOM 1081  H HD23 . LEU B 2 9  ? 80.769  8.524   -15.965 1.00 0.00 ? 9  LEU B HD23 1  
ATOM 1082  N N    . ALA B 2 10 ? 84.432  11.770  -15.566 1.00 0.00 ? 10 ALA B N    1  
ATOM 1083  C CA   . ALA B 2 10 ? 85.705  12.434  -15.346 1.00 0.00 ? 10 ALA B CA   1  
ATOM 1084  C C    . ALA B 2 10 ? 86.586  11.507  -14.511 1.00 0.00 ? 10 ALA B C    1  
ATOM 1085  O O    . ALA B 2 10 ? 87.798  11.383  -14.727 1.00 0.00 ? 10 ALA B O    1  
ATOM 1086  C CB   . ALA B 2 10 ? 85.487  13.756  -14.605 1.00 0.00 ? 10 ALA B CB   1  
ATOM 1087  H H    . ALA B 2 10 ? 83.605  12.188  -15.232 1.00 0.00 ? 10 ALA B H    1  
ATOM 1088  H HA   . ALA B 2 10 ? 86.174  12.635  -16.295 1.00 0.00 ? 10 ALA B HA   1  
ATOM 1089  H HB1  . ALA B 2 10 ? 84.738  13.620  -13.840 1.00 0.00 ? 10 ALA B HB1  1  
ATOM 1090  H HB2  . ALA B 2 10 ? 85.155  14.509  -15.304 1.00 0.00 ? 10 ALA B HB2  1  
ATOM 1091  H HB3  . ALA B 2 10 ? 86.414  14.075  -14.149 1.00 0.00 ? 10 ALA B HB3  1  
ATOM 1092  N N    . GLY B 2 11 ? 85.940  10.843  -13.558 1.00 0.00 ? 11 GLY B N    1  
ATOM 1093  C CA   . GLY B 2 11 ? 86.626  9.911   -12.681 1.00 0.00 ? 11 GLY B CA   1  
ATOM 1094  C C    . GLY B 2 11 ? 87.165  8.720   -13.461 1.00 0.00 ? 11 GLY B C    1  
ATOM 1095  O O    . GLY B 2 11 ? 88.193  8.152   -13.095 1.00 0.00 ? 11 GLY B O    1  
ATOM 1096  H H    . GLY B 2 11 ? 84.976  10.980  -13.449 1.00 0.00 ? 11 GLY B H    1  
ATOM 1097  H HA2  . GLY B 2 11 ? 87.446  10.420  -12.196 1.00 0.00 ? 11 GLY B HA2  1  
ATOM 1098  H HA3  . GLY B 2 11 ? 85.934  9.557   -11.931 1.00 0.00 ? 11 GLY B HA3  1  
ATOM 1099  N N    . ILE B 2 12 ? 86.480  8.337   -14.541 1.00 0.00 ? 12 ILE B N    1  
ATOM 1100  C CA   . ILE B 2 12 ? 86.941  7.210   -15.334 1.00 0.00 ? 12 ILE B CA   1  
ATOM 1101  C C    . ILE B 2 12 ? 88.263  7.555   -15.997 1.00 0.00 ? 12 ILE B C    1  
ATOM 1102  O O    . ILE B 2 12 ? 89.190  6.745   -15.999 1.00 0.00 ? 12 ILE B O    1  
ATOM 1103  C CB   . ILE B 2 12 ? 85.895  6.839   -16.386 1.00 0.00 ? 12 ILE B CB   1  
ATOM 1104  C CG1  . ILE B 2 12 ? 84.567  6.501   -15.678 1.00 0.00 ? 12 ILE B CG1  1  
ATOM 1105  C CG2  . ILE B 2 12 ? 86.383  5.638   -17.219 1.00 0.00 ? 12 ILE B CG2  1  
ATOM 1106  C CD1  . ILE B 2 12 ? 84.737  5.320   -14.710 1.00 0.00 ? 12 ILE B CD1  1  
ATOM 1107  H H    . ILE B 2 12 ? 85.663  8.816   -14.810 1.00 0.00 ? 12 ILE B H    1  
ATOM 1108  H HA   . ILE B 2 12 ? 87.097  6.366   -14.680 1.00 0.00 ? 12 ILE B HA   1  
ATOM 1109  H HB   . ILE B 2 12 ? 85.741  7.685   -17.040 1.00 0.00 ? 12 ILE B HB   1  
ATOM 1110  H HG12 . ILE B 2 12 ? 84.240  7.361   -15.120 1.00 0.00 ? 12 ILE B HG12 1  
ATOM 1111  H HG13 . ILE B 2 12 ? 83.822  6.251   -16.416 1.00 0.00 ? 12 ILE B HG13 1  
ATOM 1112  H HG21 . ILE B 2 12 ? 86.971  5.991   -18.054 1.00 0.00 ? 12 ILE B HG21 1  
ATOM 1113  H HG22 . ILE B 2 12 ? 85.531  5.087   -17.588 1.00 0.00 ? 12 ILE B HG22 1  
ATOM 1114  H HG23 . ILE B 2 12 ? 86.987  4.985   -16.604 1.00 0.00 ? 12 ILE B HG23 1  
ATOM 1115  H HD11 . ILE B 2 12 ? 85.469  4.626   -15.089 1.00 0.00 ? 12 ILE B HD11 1  
ATOM 1116  H HD12 . ILE B 2 12 ? 83.791  4.815   -14.598 1.00 0.00 ? 12 ILE B HD12 1  
ATOM 1117  H HD13 . ILE B 2 12 ? 85.061  5.692   -13.749 1.00 0.00 ? 12 ILE B HD13 1  
ATOM 1118  N N    . VAL B 2 13 ? 88.363  8.764   -16.540 1.00 0.00 ? 13 VAL B N    1  
ATOM 1119  C CA   . VAL B 2 13 ? 89.619  9.173   -17.174 1.00 0.00 ? 13 VAL B CA   1  
ATOM 1120  C C    . VAL B 2 13 ? 90.734  9.133   -16.128 1.00 0.00 ? 13 VAL B C    1  
ATOM 1121  O O    . VAL B 2 13 ? 91.842  8.669   -16.399 1.00 0.00 ? 13 VAL B O    1  
ATOM 1122  C CB   . VAL B 2 13 ? 89.494  10.578  -17.833 1.00 0.00 ? 13 VAL B CB   1  
ATOM 1123  C CG1  . VAL B 2 13 ? 88.021  10.919  -18.003 1.00 0.00 ? 13 VAL B CG1  1  
ATOM 1124  C CG2  . VAL B 2 13 ? 90.153  11.681  -16.983 1.00 0.00 ? 13 VAL B CG2  1  
ATOM 1125  H H    . VAL B 2 13 ? 87.597  9.385   -16.503 1.00 0.00 ? 13 VAL B H    1  
ATOM 1126  H HA   . VAL B 2 13 ? 89.857  8.447   -17.941 1.00 0.00 ? 13 VAL B HA   1  
ATOM 1127  H HB   . VAL B 2 13 ? 89.961  10.558  -18.811 1.00 0.00 ? 13 VAL B HB   1  
ATOM 1128  H HG11 . VAL B 2 13 ? 87.921  11.839  -18.559 1.00 0.00 ? 13 VAL B HG11 1  
ATOM 1129  H HG12 . VAL B 2 13 ? 87.575  11.036  -17.034 1.00 0.00 ? 13 VAL B HG12 1  
ATOM 1130  H HG13 . VAL B 2 13 ? 87.530  10.121  -18.529 1.00 0.00 ? 13 VAL B HG13 1  
ATOM 1131  H HG21 . VAL B 2 13 ? 89.929  12.645  -17.414 1.00 0.00 ? 13 VAL B HG21 1  
ATOM 1132  H HG22 . VAL B 2 13 ? 91.224  11.537  -16.967 1.00 0.00 ? 13 VAL B HG22 1  
ATOM 1133  H HG23 . VAL B 2 13 ? 89.768  11.642  -15.977 1.00 0.00 ? 13 VAL B HG23 1  
ATOM 1134  N N    . VAL B 2 14 ? 90.422  9.611   -14.923 1.00 0.00 ? 14 VAL B N    1  
ATOM 1135  C CA   . VAL B 2 14 ? 91.403  9.606   -13.843 1.00 0.00 ? 14 VAL B CA   1  
ATOM 1136  C C    . VAL B 2 14 ? 91.845  8.174   -13.556 1.00 0.00 ? 14 VAL B C    1  
ATOM 1137  O O    . VAL B 2 14 ? 93.031  7.901   -13.366 1.00 0.00 ? 14 VAL B O    1  
ATOM 1138  C CB   . VAL B 2 14 ? 90.800  10.231  -12.582 1.00 0.00 ? 14 VAL B CB   1  
ATOM 1139  C CG1  . VAL B 2 14 ? 91.767  10.064  -11.408 1.00 0.00 ? 14 VAL B CG1  1  
ATOM 1140  C CG2  . VAL B 2 14 ? 90.553  11.722  -12.824 1.00 0.00 ? 14 VAL B CG2  1  
ATOM 1141  H H    . VAL B 2 14 ? 89.516  9.963   -14.757 1.00 0.00 ? 14 VAL B H    1  
ATOM 1142  H HA   . VAL B 2 14 ? 92.262  10.186  -14.146 1.00 0.00 ? 14 VAL B HA   1  
ATOM 1143  H HB   . VAL B 2 14 ? 89.864  9.743   -12.350 1.00 0.00 ? 14 VAL B HB   1  
ATOM 1144  H HG11 . VAL B 2 14 ? 91.765  9.034   -11.084 1.00 0.00 ? 14 VAL B HG11 1  
ATOM 1145  H HG12 . VAL B 2 14 ? 91.455  10.699  -10.591 1.00 0.00 ? 14 VAL B HG12 1  
ATOM 1146  H HG13 . VAL B 2 14 ? 92.763  10.341  -11.720 1.00 0.00 ? 14 VAL B HG13 1  
ATOM 1147  H HG21 . VAL B 2 14 ? 90.214  12.184  -11.910 1.00 0.00 ? 14 VAL B HG21 1  
ATOM 1148  H HG22 . VAL B 2 14 ? 89.802  11.844  -13.588 1.00 0.00 ? 14 VAL B HG22 1  
ATOM 1149  H HG23 . VAL B 2 14 ? 91.471  12.191  -13.145 1.00 0.00 ? 14 VAL B HG23 1  
ATOM 1150  N N    . GLY B 2 15 ? 90.878  7.260   -13.538 1.00 0.00 ? 15 GLY B N    1  
ATOM 1151  C CA   . GLY B 2 15 ? 91.169  5.855   -13.286 1.00 0.00 ? 15 GLY B CA   1  
ATOM 1152  C C    . GLY B 2 15 ? 92.086  5.297   -14.368 1.00 0.00 ? 15 GLY B C    1  
ATOM 1153  O O    . GLY B 2 15 ? 92.993  4.515   -14.085 1.00 0.00 ? 15 GLY B O    1  
ATOM 1154  H H    . GLY B 2 15 ? 89.953  7.538   -13.705 1.00 0.00 ? 15 GLY B H    1  
ATOM 1155  H HA2  . GLY B 2 15 ? 91.649  5.758   -12.324 1.00 0.00 ? 15 GLY B HA2  1  
ATOM 1156  H HA3  . GLY B 2 15 ? 90.246  5.296   -13.283 1.00 0.00 ? 15 GLY B HA3  1  
ATOM 1157  N N    . ASP B 2 16 ? 91.844  5.711   -15.608 1.00 0.00 ? 16 ASP B N    1  
ATOM 1158  C CA   . ASP B 2 16 ? 92.658  5.254   -16.726 1.00 0.00 ? 16 ASP B CA   1  
ATOM 1159  C C    . ASP B 2 16 ? 94.106  5.684   -16.527 1.00 0.00 ? 16 ASP B C    1  
ATOM 1160  O O    . ASP B 2 16 ? 95.033  4.923   -16.803 1.00 0.00 ? 16 ASP B O    1  
ATOM 1161  C CB   . ASP B 2 16 ? 92.124  5.842   -18.035 1.00 0.00 ? 16 ASP B CB   1  
ATOM 1162  C CG   . ASP B 2 16 ? 92.805  5.172   -19.224 1.00 0.00 ? 16 ASP B CG   1  
ATOM 1163  O OD1  . ASP B 2 16 ? 93.735  4.416   -19.000 1.00 0.00 ? 16 ASP B OD1  1  
ATOM 1164  O OD2  . ASP B 2 16 ? 92.385  5.428   -20.341 1.00 0.00 ? 16 ASP B OD2  1  
ATOM 1165  H H    . ASP B 2 16 ? 91.112  6.340   -15.771 1.00 0.00 ? 16 ASP B H    1  
ATOM 1166  H HA   . ASP B 2 16 ? 92.612  4.177   -16.780 1.00 0.00 ? 16 ASP B HA   1  
ATOM 1167  H HB2  . ASP B 2 16 ? 91.058  5.677   -18.091 1.00 0.00 ? 16 ASP B HB2  1  
ATOM 1168  H HB3  . ASP B 2 16 ? 92.325  6.902   -18.058 1.00 0.00 ? 16 ASP B HB3  1  
ATOM 1169  N N    . LEU B 2 17 ? 94.289  6.906   -16.042 1.00 0.00 ? 17 LEU B N    1  
ATOM 1170  C CA   . LEU B 2 17 ? 95.627  7.431   -15.801 1.00 0.00 ? 17 LEU B CA   1  
ATOM 1171  C C    . LEU B 2 17 ? 96.337  6.592   -14.740 1.00 0.00 ? 17 LEU B C    1  
ATOM 1172  O O    . LEU B 2 17 ? 97.506  6.228   -14.895 1.00 0.00 ? 17 LEU B O    1  
ATOM 1173  C CB   . LEU B 2 17 ? 95.530  8.892   -15.345 1.00 0.00 ? 17 LEU B CB   1  
ATOM 1174  C CG   . LEU B 2 17 ? 96.907  9.422   -14.922 1.00 0.00 ? 17 LEU B CG   1  
ATOM 1175  C CD1  . LEU B 2 17 ? 97.931  9.186   -16.040 1.00 0.00 ? 17 LEU B CD1  1  
ATOM 1176  C CD2  . LEU B 2 17 ? 96.793  10.924  -14.641 1.00 0.00 ? 17 LEU B CD2  1  
ATOM 1177  H H    . LEU B 2 17 ? 93.508  7.466   -15.839 1.00 0.00 ? 17 LEU B H    1  
ATOM 1178  H HA   . LEU B 2 17 ? 96.188  7.385   -16.722 1.00 0.00 ? 17 LEU B HA   1  
ATOM 1179  H HB2  . LEU B 2 17 ? 95.152  9.494   -16.159 1.00 0.00 ? 17 LEU B HB2  1  
ATOM 1180  H HB3  . LEU B 2 17 ? 94.851  8.959   -14.508 1.00 0.00 ? 17 LEU B HB3  1  
ATOM 1181  H HG   . LEU B 2 17 ? 97.231  8.914   -14.024 1.00 0.00 ? 17 LEU B HG   1  
ATOM 1182  H HD11 . LEU B 2 17 ? 97.474  9.388   -16.998 1.00 0.00 ? 17 LEU B HD11 1  
ATOM 1183  H HD12 . LEU B 2 17 ? 98.266  8.161   -16.010 1.00 0.00 ? 17 LEU B HD12 1  
ATOM 1184  H HD13 . LEU B 2 17 ? 98.779  9.843   -15.901 1.00 0.00 ? 17 LEU B HD13 1  
ATOM 1185  H HD21 . LEU B 2 17 ? 97.704  11.274  -14.179 1.00 0.00 ? 17 LEU B HD21 1  
ATOM 1186  H HD22 . LEU B 2 17 ? 95.961  11.105  -13.978 1.00 0.00 ? 17 LEU B HD22 1  
ATOM 1187  H HD23 . LEU B 2 17 ? 96.635  11.453  -15.570 1.00 0.00 ? 17 LEU B HD23 1  
ATOM 1188  N N    . VAL B 2 18 ? 95.617  6.282   -13.666 1.00 0.00 ? 18 VAL B N    1  
ATOM 1189  C CA   . VAL B 2 18 ? 96.183  5.479   -12.588 1.00 0.00 ? 18 VAL B CA   1  
ATOM 1190  C C    . VAL B 2 18 ? 96.627  4.119   -13.118 1.00 0.00 ? 18 VAL B C    1  
ATOM 1191  O O    . VAL B 2 18 ? 97.714  3.643   -12.794 1.00 0.00 ? 18 VAL B O    1  
ATOM 1192  C CB   . VAL B 2 18 ? 95.150  5.295   -11.474 1.00 0.00 ? 18 VAL B CB   1  
ATOM 1193  C CG1  . VAL B 2 18 ? 95.699  4.337   -10.414 1.00 0.00 ? 18 VAL B CG1  1  
ATOM 1194  C CG2  . VAL B 2 18 ? 94.856  6.651   -10.826 1.00 0.00 ? 18 VAL B CG2  1  
ATOM 1195  H H    . VAL B 2 18 ? 94.690  6.594   -13.599 1.00 0.00 ? 18 VAL B H    1  
ATOM 1196  H HA   . VAL B 2 18 ? 97.043  5.994   -12.185 1.00 0.00 ? 18 VAL B HA   1  
ATOM 1197  H HB   . VAL B 2 18 ? 94.240  4.888   -11.890 1.00 0.00 ? 18 VAL B HB   1  
ATOM 1198  H HG11 . VAL B 2 18 ? 95.703  3.330   -10.805 1.00 0.00 ? 18 VAL B HG11 1  
ATOM 1199  H HG12 . VAL B 2 18 ? 95.076  4.379   -9.533  1.00 0.00 ? 18 VAL B HG12 1  
ATOM 1200  H HG13 . VAL B 2 18 ? 96.707  4.626   -10.155 1.00 0.00 ? 18 VAL B HG13 1  
ATOM 1201  H HG21 . VAL B 2 18 ? 95.748  7.017   -10.339 1.00 0.00 ? 18 VAL B HG21 1  
ATOM 1202  H HG22 . VAL B 2 18 ? 94.068  6.539   -10.096 1.00 0.00 ? 18 VAL B HG22 1  
ATOM 1203  H HG23 . VAL B 2 18 ? 94.547  7.353   -11.585 1.00 0.00 ? 18 VAL B HG23 1  
ATOM 1204  N N    . LEU B 2 19 ? 95.784  3.499   -13.940 1.00 0.00 ? 19 LEU B N    1  
ATOM 1205  C CA   . LEU B 2 19 ? 96.114  2.198   -14.509 1.00 0.00 ? 19 LEU B CA   1  
ATOM 1206  C C    . LEU B 2 19 ? 97.295  2.325   -15.463 1.00 0.00 ? 19 LEU B C    1  
ATOM 1207  O O    . LEU B 2 19 ? 98.075  1.395   -15.625 1.00 0.00 ? 19 LEU B O    1  
ATOM 1208  C CB   . LEU B 2 19 ? 94.914  1.619   -15.266 1.00 0.00 ? 19 LEU B CB   1  
ATOM 1209  C CG   . LEU B 2 19 ? 93.753  1.340   -14.302 1.00 0.00 ? 19 LEU B CG   1  
ATOM 1210  C CD1  . LEU B 2 19 ? 92.482  1.085   -15.121 1.00 0.00 ? 19 LEU B CD1  1  
ATOM 1211  C CD2  . LEU B 2 19 ? 94.058  0.103   -13.430 1.00 0.00 ? 19 LEU B CD2  1  
ATOM 1212  H H    . LEU B 2 19 ? 94.932  3.927   -14.171 1.00 0.00 ? 19 LEU B H    1  
ATOM 1213  H HA   . LEU B 2 19 ? 96.387  1.526   -13.712 1.00 0.00 ? 19 LEU B HA   1  
ATOM 1214  H HB2  . LEU B 2 19 ? 94.593  2.330   -16.013 1.00 0.00 ? 19 LEU B HB2  1  
ATOM 1215  H HB3  . LEU B 2 19 ? 95.207  0.702   -15.752 1.00 0.00 ? 19 LEU B HB3  1  
ATOM 1216  H HG   . LEU B 2 19 ? 93.602  2.202   -13.667 1.00 0.00 ? 19 LEU B HG   1  
ATOM 1217  H HD11 . LEU B 2 19 ? 92.137  2.015   -15.546 1.00 0.00 ? 19 LEU B HD11 1  
ATOM 1218  H HD12 . LEU B 2 19 ? 91.715  0.677   -14.481 1.00 0.00 ? 19 LEU B HD12 1  
ATOM 1219  H HD13 . LEU B 2 19 ? 92.699  0.387   -15.919 1.00 0.00 ? 19 LEU B HD13 1  
ATOM 1220  H HD21 . LEU B 2 19 ? 94.509  -0.671  -14.034 1.00 0.00 ? 19 LEU B HD21 1  
ATOM 1221  H HD22 . LEU B 2 19 ? 93.143  -0.271  -13.000 1.00 0.00 ? 19 LEU B HD22 1  
ATOM 1222  H HD23 . LEU B 2 19 ? 94.732  0.377   -12.632 1.00 0.00 ? 19 LEU B HD23 1  
ATOM 1223  N N    . THR B 2 20 ? 97.422  3.482   -16.097 1.00 0.00 ? 20 THR B N    1  
ATOM 1224  C CA   . THR B 2 20 ? 98.519  3.698   -17.027 1.00 0.00 ? 20 THR B CA   1  
ATOM 1225  C C    . THR B 2 20 ? 99.855  3.608   -16.297 1.00 0.00 ? 20 THR B C    1  
ATOM 1226  O O    . THR B 2 20 ? 100.764 2.896   -16.725 1.00 0.00 ? 20 THR B O    1  
ATOM 1227  C CB   . THR B 2 20 ? 98.385  5.073   -17.686 1.00 0.00 ? 20 THR B CB   1  
ATOM 1228  O OG1  . THR B 2 20 ? 97.067  5.226   -18.194 1.00 0.00 ? 20 THR B OG1  1  
ATOM 1229  C CG2  . THR B 2 20 ? 99.393  5.194   -18.828 1.00 0.00 ? 20 THR B CG2  1  
ATOM 1230  H H    . THR B 2 20 ? 96.773  4.197   -15.936 1.00 0.00 ? 20 THR B H    1  
ATOM 1231  H HA   . THR B 2 20 ? 98.486  2.939   -17.794 1.00 0.00 ? 20 THR B HA   1  
ATOM 1232  H HB   . THR B 2 20 ? 98.580  5.843   -16.956 1.00 0.00 ? 20 THR B HB   1  
ATOM 1233  H HG1  . THR B 2 20 ? 96.977  4.653   -18.960 1.00 0.00 ? 20 THR B HG1  1  
ATOM 1234  H HG21 . THR B 2 20 ? 99.350  6.190   -19.244 1.00 0.00 ? 20 THR B HG21 1  
ATOM 1235  H HG22 . THR B 2 20 ? 99.157  4.473   -19.597 1.00 0.00 ? 20 THR B HG22 1  
ATOM 1236  H HG23 . THR B 2 20 ? 100.389 5.005   -18.452 1.00 0.00 ? 20 THR B HG23 1  
ATOM 1237  N N    . VAL B 2 21 ? 99.963  4.338   -15.191 1.00 0.00 ? 21 VAL B N    1  
ATOM 1238  C CA   . VAL B 2 21 ? 101.194 4.340   -14.405 1.00 0.00 ? 21 VAL B CA   1  
ATOM 1239  C C    . VAL B 2 21 ? 101.404 3.007   -13.687 1.00 0.00 ? 21 VAL B C    1  
ATOM 1240  O O    . VAL B 2 21 ? 102.518 2.484   -13.649 1.00 0.00 ? 21 VAL B O    1  
ATOM 1241  C CB   . VAL B 2 21 ? 101.146 5.470   -13.374 1.00 0.00 ? 21 VAL B CB   1  
ATOM 1242  C CG1  . VAL B 2 21 ? 102.430 5.460   -12.542 1.00 0.00 ? 21 VAL B CG1  1  
ATOM 1243  C CG2  . VAL B 2 21 ? 101.019 6.813   -14.098 1.00 0.00 ? 21 VAL B CG2  1  
ATOM 1244  H H    . VAL B 2 21 ? 99.203  4.888   -14.900 1.00 0.00 ? 21 VAL B H    1  
ATOM 1245  H HA   . VAL B 2 21 ? 102.028 4.514   -15.067 1.00 0.00 ? 21 VAL B HA   1  
ATOM 1246  H HB   . VAL B 2 21 ? 100.295 5.328   -12.724 1.00 0.00 ? 21 VAL B HB   1  
ATOM 1247  H HG11 . VAL B 2 21 ? 102.482 6.362   -11.950 1.00 0.00 ? 21 VAL B HG11 1  
ATOM 1248  H HG12 . VAL B 2 21 ? 103.285 5.412   -13.201 1.00 0.00 ? 21 VAL B HG12 1  
ATOM 1249  H HG13 . VAL B 2 21 ? 102.430 4.600   -11.890 1.00 0.00 ? 21 VAL B HG13 1  
ATOM 1250  H HG21 . VAL B 2 21 ? 101.738 6.858   -14.903 1.00 0.00 ? 21 VAL B HG21 1  
ATOM 1251  H HG22 . VAL B 2 21 ? 101.208 7.616   -13.401 1.00 0.00 ? 21 VAL B HG22 1  
ATOM 1252  H HG23 . VAL B 2 21 ? 100.021 6.912   -14.500 1.00 0.00 ? 21 VAL B HG23 1  
ATOM 1253  N N    . LEU B 2 22 ? 100.337 2.470   -13.103 1.00 0.00 ? 22 LEU B N    1  
ATOM 1254  C CA   . LEU B 2 22 ? 100.430 1.207   -12.371 1.00 0.00 ? 22 LEU B CA   1  
ATOM 1255  C C    . LEU B 2 22 ? 100.847 0.063   -13.294 1.00 0.00 ? 22 LEU B C    1  
ATOM 1256  O O    . LEU B 2 22 ? 101.810 -0.655  -13.015 1.00 0.00 ? 22 LEU B O    1  
ATOM 1257  C CB   . LEU B 2 22 ? 99.076  0.889   -11.723 1.00 0.00 ? 22 LEU B CB   1  
ATOM 1258  C CG   . LEU B 2 22 ? 99.129  -0.453  -10.975 1.00 0.00 ? 22 LEU B CG   1  
ATOM 1259  C CD1  . LEU B 2 22 ? 100.240 -0.429  -9.912  1.00 0.00 ? 22 LEU B CD1  1  
ATOM 1260  C CD2  . LEU B 2 22 ? 97.777  -0.695  -10.295 1.00 0.00 ? 22 LEU B CD2  1  
ATOM 1261  H H    . LEU B 2 22 ? 99.476  2.936   -13.152 1.00 0.00 ? 22 LEU B H    1  
ATOM 1262  H HA   . LEU B 2 22 ? 101.170 1.317   -11.595 1.00 0.00 ? 22 LEU B HA   1  
ATOM 1263  H HB2  . LEU B 2 22 ? 98.821  1.674   -11.026 1.00 0.00 ? 22 LEU B HB2  1  
ATOM 1264  H HB3  . LEU B 2 22 ? 98.317  0.835   -12.491 1.00 0.00 ? 22 LEU B HB3  1  
ATOM 1265  H HG   . LEU B 2 22 ? 99.322  -1.252  -11.676 1.00 0.00 ? 22 LEU B HG   1  
ATOM 1266  H HD11 . LEU B 2 22 ? 101.187 -0.653  -10.377 1.00 0.00 ? 22 LEU B HD11 1  
ATOM 1267  H HD12 . LEU B 2 22 ? 100.032 -1.169  -9.151  1.00 0.00 ? 22 LEU B HD12 1  
ATOM 1268  H HD13 . LEU B 2 22 ? 100.285 0.550   -9.455  1.00 0.00 ? 22 LEU B HD13 1  
ATOM 1269  H HD21 . LEU B 2 22 ? 97.024  -0.879  -11.047 1.00 0.00 ? 22 LEU B HD21 1  
ATOM 1270  H HD22 . LEU B 2 22 ? 97.503  0.176   -9.718  1.00 0.00 ? 22 LEU B HD22 1  
ATOM 1271  H HD23 . LEU B 2 22 ? 97.849  -1.551  -9.642  1.00 0.00 ? 22 LEU B HD23 1  
ATOM 1272  N N    . ILE B 2 23 ? 100.123 -0.106  -14.395 1.00 0.00 ? 23 ILE B N    1  
ATOM 1273  C CA   . ILE B 2 23 ? 100.442 -1.169  -15.338 1.00 0.00 ? 23 ILE B CA   1  
ATOM 1274  C C    . ILE B 2 23 ? 101.860 -0.990  -15.863 1.00 0.00 ? 23 ILE B C    1  
ATOM 1275  O O    . ILE B 2 23 ? 102.663 -1.921  -15.834 1.00 0.00 ? 23 ILE B O    1  
ATOM 1276  C CB   . ILE B 2 23 ? 99.450  -1.165  -16.505 1.00 0.00 ? 23 ILE B CB   1  
ATOM 1277  C CG1  . ILE B 2 23 ? 98.033  -1.433  -15.982 1.00 0.00 ? 23 ILE B CG1  1  
ATOM 1278  C CG2  . ILE B 2 23 ? 99.836  -2.265  -17.497 1.00 0.00 ? 23 ILE B CG2  1  
ATOM 1279  C CD1  . ILE B 2 23 ? 97.011  -1.042  -17.050 1.00 0.00 ? 23 ILE B CD1  1  
ATOM 1280  H H    . ILE B 2 23 ? 99.367  0.492   -14.574 1.00 0.00 ? 23 ILE B H    1  
ATOM 1281  H HA   . ILE B 2 23 ? 100.375 -2.118  -14.827 1.00 0.00 ? 23 ILE B HA   1  
ATOM 1282  H HB   . ILE B 2 23 ? 99.481  -0.204  -17.000 1.00 0.00 ? 23 ILE B HB   1  
ATOM 1283  H HG12 . ILE B 2 23 ? 97.926  -2.482  -15.753 1.00 0.00 ? 23 ILE B HG12 1  
ATOM 1284  H HG13 . ILE B 2 23 ? 97.859  -0.853  -15.089 1.00 0.00 ? 23 ILE B HG13 1  
ATOM 1285  H HG21 . ILE B 2 23 ? 100.760 -2.002  -17.988 1.00 0.00 ? 23 ILE B HG21 1  
ATOM 1286  H HG22 . ILE B 2 23 ? 99.055  -2.373  -18.235 1.00 0.00 ? 23 ILE B HG22 1  
ATOM 1287  H HG23 . ILE B 2 23 ? 99.961  -3.198  -16.969 1.00 0.00 ? 23 ILE B HG23 1  
ATOM 1288  H HD11 . ILE B 2 23 ? 97.211  -1.590  -17.958 1.00 0.00 ? 23 ILE B HD11 1  
ATOM 1289  H HD12 . ILE B 2 23 ? 97.082  0.018   -17.248 1.00 0.00 ? 23 ILE B HD12 1  
ATOM 1290  H HD13 . ILE B 2 23 ? 96.017  -1.277  -16.701 1.00 0.00 ? 23 ILE B HD13 1  
ATOM 1291  N N    . ALA B 2 24 ? 102.173 0.216   -16.334 1.00 0.00 ? 24 ALA B N    1  
ATOM 1292  C CA   . ALA B 2 24 ? 103.510 0.494   -16.848 1.00 0.00 ? 24 ALA B CA   1  
ATOM 1293  C C    . ALA B 2 24 ? 104.560 0.000   -15.857 1.00 0.00 ? 24 ALA B C    1  
ATOM 1294  O O    . ALA B 2 24 ? 105.524 -0.671  -16.233 1.00 0.00 ? 24 ALA B O    1  
ATOM 1295  C CB   . ALA B 2 24 ? 103.683 1.996   -17.077 1.00 0.00 ? 24 ALA B CB   1  
ATOM 1296  H H    . ALA B 2 24 ? 101.499 0.929   -16.328 1.00 0.00 ? 24 ALA B H    1  
ATOM 1297  H HA   . ALA B 2 24 ? 103.640 -0.023  -17.787 1.00 0.00 ? 24 ALA B HA   1  
ATOM 1298  H HB1  . ALA B 2 24 ? 102.989 2.327   -17.837 1.00 0.00 ? 24 ALA B HB1  1  
ATOM 1299  H HB2  . ALA B 2 24 ? 104.693 2.197   -17.401 1.00 0.00 ? 24 ALA B HB2  1  
ATOM 1300  H HB3  . ALA B 2 24 ? 103.488 2.526   -16.157 1.00 0.00 ? 24 ALA B HB3  1  
ATOM 1301  N N    . LEU B 2 25 ? 104.356 0.317   -14.584 1.00 0.00 ? 25 LEU B N    1  
ATOM 1302  C CA   . LEU B 2 25 ? 105.284 -0.122  -13.555 1.00 0.00 ? 25 LEU B CA   1  
ATOM 1303  C C    . LEU B 2 25 ? 105.387 -1.641  -13.598 1.00 0.00 ? 25 LEU B C    1  
ATOM 1304  O O    . LEU B 2 25 ? 106.469 -2.206  -13.447 1.00 0.00 ? 25 LEU B O    1  
ATOM 1305  C CB   . LEU B 2 25 ? 104.801 0.339   -12.175 1.00 0.00 ? 25 LEU B CB   1  
ATOM 1306  C CG   . LEU B 2 25 ? 105.797 -0.087  -11.086 1.00 0.00 ? 25 LEU B CG   1  
ATOM 1307  C CD1  . LEU B 2 25 ? 107.165 0.579   -11.320 1.00 0.00 ? 25 LEU B CD1  1  
ATOM 1308  C CD2  . LEU B 2 25 ? 105.245 0.335   -9.719  1.00 0.00 ? 25 LEU B CD2  1  
ATOM 1309  H H    . LEU B 2 25 ? 103.566 0.840   -14.334 1.00 0.00 ? 25 LEU B H    1  
ATOM 1310  H HA   . LEU B 2 25 ? 106.254 0.306   -13.755 1.00 0.00 ? 25 LEU B HA   1  
ATOM 1311  H HB2  . LEU B 2 25 ? 104.708 1.415   -12.172 1.00 0.00 ? 25 LEU B HB2  1  
ATOM 1312  H HB3  . LEU B 2 25 ? 103.838 -0.103  -11.969 1.00 0.00 ? 25 LEU B HB3  1  
ATOM 1313  H HG   . LEU B 2 25 ? 105.915 -1.161  -11.106 1.00 0.00 ? 25 LEU B HG   1  
ATOM 1314  H HD11 . LEU B 2 25 ? 107.024 1.570   -11.728 1.00 0.00 ? 25 LEU B HD11 1  
ATOM 1315  H HD12 . LEU B 2 25 ? 107.741 -0.017  -12.014 1.00 0.00 ? 25 LEU B HD12 1  
ATOM 1316  H HD13 . LEU B 2 25 ? 107.703 0.649   -10.385 1.00 0.00 ? 25 LEU B HD13 1  
ATOM 1317  H HD21 . LEU B 2 25 ? 105.074 1.401   -9.715  1.00 0.00 ? 25 LEU B HD21 1  
ATOM 1318  H HD22 . LEU B 2 25 ? 105.958 0.081   -8.949  1.00 0.00 ? 25 LEU B HD22 1  
ATOM 1319  H HD23 . LEU B 2 25 ? 104.314 -0.180  -9.532  1.00 0.00 ? 25 LEU B HD23 1  
ATOM 1320  N N    . ALA B 2 26 ? 104.248 -2.292  -13.821 1.00 0.00 ? 26 ALA B N    1  
ATOM 1321  C CA   . ALA B 2 26 ? 104.218 -3.748  -13.900 1.00 0.00 ? 26 ALA B CA   1  
ATOM 1322  C C    . ALA B 2 26 ? 105.077 -4.229  -15.068 1.00 0.00 ? 26 ALA B C    1  
ATOM 1323  O O    . ALA B 2 26 ? 105.730 -5.270  -14.982 1.00 0.00 ? 26 ALA B O    1  
ATOM 1324  C CB   . ALA B 2 26 ? 102.776 -4.237  -14.078 1.00 0.00 ? 26 ALA B CB   1  
ATOM 1325  H H    . ALA B 2 26 ? 103.417 -1.784  -13.941 1.00 0.00 ? 26 ALA B H    1  
ATOM 1326  H HA   . ALA B 2 26 ? 104.613 -4.156  -12.982 1.00 0.00 ? 26 ALA B HA   1  
ATOM 1327  H HB1  . ALA B 2 26 ? 102.116 -3.637  -13.468 1.00 0.00 ? 26 ALA B HB1  1  
ATOM 1328  H HB2  . ALA B 2 26 ? 102.706 -5.270  -13.771 1.00 0.00 ? 26 ALA B HB2  1  
ATOM 1329  H HB3  . ALA B 2 26 ? 102.486 -4.150  -15.114 1.00 0.00 ? 26 ALA B HB3  1  
ATOM 1330  N N    . VAL B 2 27 ? 105.085 -3.461  -16.157 1.00 0.00 ? 27 VAL B N    1  
ATOM 1331  C CA   . VAL B 2 27 ? 105.884 -3.827  -17.320 1.00 0.00 ? 27 VAL B CA   1  
ATOM 1332  C C    . VAL B 2 27 ? 107.356 -3.854  -16.935 1.00 0.00 ? 27 VAL B C    1  
ATOM 1333  O O    . VAL B 2 27 ? 108.075 -4.803  -17.248 1.00 0.00 ? 27 VAL B O    1  
ATOM 1334  C CB   . VAL B 2 27 ? 105.677 -2.822  -18.460 1.00 0.00 ? 27 VAL B CB   1  
ATOM 1335  C CG1  . VAL B 2 27 ? 106.425 -3.306  -19.704 1.00 0.00 ? 27 VAL B CG1  1  
ATOM 1336  C CG2  . VAL B 2 27 ? 104.185 -2.698  -18.781 1.00 0.00 ? 27 VAL B CG2  1  
ATOM 1337  H H    . VAL B 2 27 ? 104.554 -2.638  -16.172 1.00 0.00 ? 27 VAL B H    1  
ATOM 1338  H HA   . VAL B 2 27 ? 105.589 -4.809  -17.658 1.00 0.00 ? 27 VAL B HA   1  
ATOM 1339  H HB   . VAL B 2 27 ? 106.066 -1.860  -18.165 1.00 0.00 ? 27 VAL B HB   1  
ATOM 1340  H HG11 . VAL B 2 27 ? 106.228 -2.635  -20.527 1.00 0.00 ? 27 VAL B HG11 1  
ATOM 1341  H HG12 . VAL B 2 27 ? 106.090 -4.300  -19.963 1.00 0.00 ? 27 VAL B HG12 1  
ATOM 1342  H HG13 . VAL B 2 27 ? 107.485 -3.326  -19.501 1.00 0.00 ? 27 VAL B HG13 1  
ATOM 1343  H HG21 . VAL B 2 27 ? 103.858 -3.573  -19.321 1.00 0.00 ? 27 VAL B HG21 1  
ATOM 1344  H HG22 . VAL B 2 27 ? 104.021 -1.819  -19.386 1.00 0.00 ? 27 VAL B HG22 1  
ATOM 1345  H HG23 . VAL B 2 27 ? 103.623 -2.611  -17.863 1.00 0.00 ? 27 VAL B HG23 1  
ATOM 1346  N N    . TYR B 2 28 ? 107.795 -2.807  -16.242 1.00 0.00 ? 28 TYR B N    1  
ATOM 1347  C CA   . TYR B 2 28 ? 109.184 -2.724  -15.804 1.00 0.00 ? 28 TYR B CA   1  
ATOM 1348  C C    . TYR B 2 28 ? 109.498 -3.861  -14.835 1.00 0.00 ? 28 TYR B C    1  
ATOM 1349  O O    . TYR B 2 28 ? 110.572 -4.462  -14.892 1.00 0.00 ? 28 TYR B O    1  
ATOM 1350  C CB   . TYR B 2 28 ? 109.439 -1.381  -15.117 1.00 0.00 ? 28 TYR B CB   1  
ATOM 1351  C CG   . TYR B 2 28 ? 110.915 -1.235  -14.827 1.00 0.00 ? 28 TYR B CG   1  
ATOM 1352  C CD1  . TYR B 2 28 ? 111.452 -1.764  -13.647 1.00 0.00 ? 28 TYR B CD1  1  
ATOM 1353  C CD2  . TYR B 2 28 ? 111.744 -0.570  -15.738 1.00 0.00 ? 28 TYR B CD2  1  
ATOM 1354  C CE1  . TYR B 2 28 ? 112.820 -1.628  -13.379 1.00 0.00 ? 28 TYR B CE1  1  
ATOM 1355  C CE2  . TYR B 2 28 ? 113.111 -0.433  -15.468 1.00 0.00 ? 28 TYR B CE2  1  
ATOM 1356  C CZ   . TYR B 2 28 ? 113.649 -0.962  -14.288 1.00 0.00 ? 28 TYR B CZ   1  
ATOM 1357  O OH   . TYR B 2 28 ? 114.996 -0.826  -14.024 1.00 0.00 ? 28 TYR B OH   1  
ATOM 1358  H H    . TYR B 2 28 ? 107.170 -2.081  -16.015 1.00 0.00 ? 28 TYR B H    1  
ATOM 1359  H HA   . TYR B 2 28 ? 109.829 -2.806  -16.665 1.00 0.00 ? 28 TYR B HA   1  
ATOM 1360  H HB2  . TYR B 2 28 ? 109.118 -0.579  -15.767 1.00 0.00 ? 28 TYR B HB2  1  
ATOM 1361  H HB3  . TYR B 2 28 ? 108.885 -1.339  -14.191 1.00 0.00 ? 28 TYR B HB3  1  
ATOM 1362  H HD1  . TYR B 2 28 ? 110.812 -2.277  -12.945 1.00 0.00 ? 28 TYR B HD1  1  
ATOM 1363  H HD2  . TYR B 2 28 ? 111.330 -0.162  -16.648 1.00 0.00 ? 28 TYR B HD2  1  
ATOM 1364  H HE1  . TYR B 2 28 ? 113.234 -2.035  -12.468 1.00 0.00 ? 28 TYR B HE1  1  
ATOM 1365  H HE2  . TYR B 2 28 ? 113.752 0.080   -16.171 1.00 0.00 ? 28 TYR B HE2  1  
ATOM 1366  H HH   . TYR B 2 28 ? 115.397 -1.698  -14.071 1.00 0.00 ? 28 TYR B HH   1  
ATOM 1367  N N    . PHE B 2 29 ? 108.550 -4.151  -13.949 1.00 0.00 ? 29 PHE B N    1  
ATOM 1368  C CA   . PHE B 2 29 ? 108.722 -5.217  -12.970 1.00 0.00 ? 29 PHE B CA   1  
ATOM 1369  C C    . PHE B 2 29 ? 109.046 -6.536  -13.669 1.00 0.00 ? 29 PHE B C    1  
ATOM 1370  O O    . PHE B 2 29 ? 109.942 -7.268  -13.248 1.00 0.00 ? 29 PHE B O    1  
ATOM 1371  C CB   . PHE B 2 29 ? 107.440 -5.358  -12.139 1.00 0.00 ? 29 PHE B CB   1  
ATOM 1372  C CG   . PHE B 2 29 ? 107.492 -6.615  -11.293 1.00 0.00 ? 29 PHE B CG   1  
ATOM 1373  C CD1  . PHE B 2 29 ? 108.519 -6.787  -10.357 1.00 0.00 ? 29 PHE B CD1  1  
ATOM 1374  C CD2  . PHE B 2 29 ? 106.511 -7.607  -11.446 1.00 0.00 ? 29 PHE B CD2  1  
ATOM 1375  C CE1  . PHE B 2 29 ? 108.567 -7.948  -9.576  1.00 0.00 ? 29 PHE B CE1  1  
ATOM 1376  C CE2  . PHE B 2 29 ? 106.560 -8.766  -10.664 1.00 0.00 ? 29 PHE B CE2  1  
ATOM 1377  C CZ   . PHE B 2 29 ? 107.588 -8.938  -9.730  1.00 0.00 ? 29 PHE B CZ   1  
ATOM 1378  H H    . PHE B 2 29 ? 107.715 -3.637  -13.954 1.00 0.00 ? 29 PHE B H    1  
ATOM 1379  H HA   . PHE B 2 29 ? 109.538 -4.961  -12.311 1.00 0.00 ? 29 PHE B HA   1  
ATOM 1380  H HB2  . PHE B 2 29 ? 107.340 -4.497  -11.495 1.00 0.00 ? 29 PHE B HB2  1  
ATOM 1381  H HB3  . PHE B 2 29 ? 106.590 -5.404  -12.802 1.00 0.00 ? 29 PHE B HB3  1  
ATOM 1382  H HD1  . PHE B 2 29 ? 109.274 -6.025  -10.238 1.00 0.00 ? 29 PHE B HD1  1  
ATOM 1383  H HD2  . PHE B 2 29 ? 105.718 -7.477  -12.167 1.00 0.00 ? 29 PHE B HD2  1  
ATOM 1384  H HE1  . PHE B 2 29 ? 109.359 -8.081  -8.854  1.00 0.00 ? 29 PHE B HE1  1  
ATOM 1385  H HE2  . PHE B 2 29 ? 105.803 -9.530  -10.783 1.00 0.00 ? 29 PHE B HE2  1  
ATOM 1386  H HZ   . PHE B 2 29 ? 107.625 -9.833  -9.126  1.00 0.00 ? 29 PHE B HZ   1  
ATOM 1387  N N    . LEU B 2 30 ? 108.314 -6.832  -14.738 1.00 0.00 ? 30 LEU B N    1  
ATOM 1388  C CA   . LEU B 2 30 ? 108.538 -8.065  -15.483 1.00 0.00 ? 30 LEU B CA   1  
ATOM 1389  C C    . LEU B 2 30 ? 109.965 -8.104  -16.021 1.00 0.00 ? 30 LEU B C    1  
ATOM 1390  O O    . LEU B 2 30 ? 110.642 -9.130  -15.942 1.00 0.00 ? 30 LEU B O    1  
ATOM 1391  C CB   . LEU B 2 30 ? 107.535 -8.162  -16.641 1.00 0.00 ? 30 LEU B CB   1  
ATOM 1392  C CG   . LEU B 2 30 ? 107.854 -9.370  -17.536 1.00 0.00 ? 30 LEU B CG   1  
ATOM 1393  C CD1  . LEU B 2 30 ? 107.941 -10.648 -16.691 1.00 0.00 ? 30 LEU B CD1  1  
ATOM 1394  C CD2  . LEU B 2 30 ? 106.742 -9.523  -18.578 1.00 0.00 ? 30 LEU B CD2  1  
ATOM 1395  H H    . LEU B 2 30 ? 107.612 -6.212  -15.029 1.00 0.00 ? 30 LEU B H    1  
ATOM 1396  H HA   . LEU B 2 30 ? 108.390 -8.903  -14.818 1.00 0.00 ? 30 LEU B HA   1  
ATOM 1397  H HB2  . LEU B 2 30 ? 106.539 -8.270  -16.240 1.00 0.00 ? 30 LEU B HB2  1  
ATOM 1398  H HB3  . LEU B 2 30 ? 107.586 -7.260  -17.231 1.00 0.00 ? 30 LEU B HB3  1  
ATOM 1399  H HG   . LEU B 2 30 ? 108.796 -9.208  -18.041 1.00 0.00 ? 30 LEU B HG   1  
ATOM 1400  H HD11 . LEU B 2 30 ? 107.815 -11.513 -17.326 1.00 0.00 ? 30 LEU B HD11 1  
ATOM 1401  H HD12 . LEU B 2 30 ? 107.166 -10.638 -15.940 1.00 0.00 ? 30 LEU B HD12 1  
ATOM 1402  H HD13 . LEU B 2 30 ? 108.907 -10.696 -16.211 1.00 0.00 ? 30 LEU B HD13 1  
ATOM 1403  H HD21 . LEU B 2 30 ? 106.866 -10.460 -19.102 1.00 0.00 ? 30 LEU B HD21 1  
ATOM 1404  H HD22 . LEU B 2 30 ? 106.794 -8.707  -19.284 1.00 0.00 ? 30 LEU B HD22 1  
ATOM 1405  H HD23 . LEU B 2 30 ? 105.781 -9.511  -18.084 1.00 0.00 ? 30 LEU B HD23 1  
ATOM 1406  N N    . GLY B 2 31 ? 110.418 -6.980  -16.569 1.00 0.00 ? 31 GLY B N    1  
ATOM 1407  C CA   . GLY B 2 31 ? 111.766 -6.898  -17.117 1.00 0.00 ? 31 GLY B CA   1  
ATOM 1408  C C    . GLY B 2 31 ? 111.883 -7.713  -18.400 1.00 0.00 ? 31 GLY B C    1  
ATOM 1409  O O    . GLY B 2 31 ? 111.320 -8.803  -18.508 1.00 0.00 ? 31 GLY B O    1  
ATOM 1410  H H    . GLY B 2 31 ? 109.835 -6.194  -16.605 1.00 0.00 ? 31 GLY B H    1  
ATOM 1411  H HA2  . GLY B 2 31 ? 112.001 -5.864  -17.329 1.00 0.00 ? 31 GLY B HA2  1  
ATOM 1412  H HA3  . GLY B 2 31 ? 112.468 -7.280  -16.392 1.00 0.00 ? 31 GLY B HA3  1  
ATOM 1413  N N    . ARG B 2 32 ? 112.616 -7.179  -19.370 1.00 0.00 ? 32 ARG B N    1  
ATOM 1414  C CA   . ARG B 2 32 ? 112.799 -7.865  -20.643 1.00 0.00 ? 32 ARG B CA   1  
ATOM 1415  C C    . ARG B 2 32 ? 113.699 -9.085  -20.469 1.00 0.00 ? 32 ARG B C    1  
ATOM 1416  O O    . ARG B 2 32 ? 113.496 -10.116 -21.111 1.00 0.00 ? 32 ARG B O    1  
ATOM 1417  C CB   . ARG B 2 32 ? 113.420 -6.912  -21.665 1.00 0.00 ? 32 ARG B CB   1  
ATOM 1418  C CG   . ARG B 2 32 ? 112.387 -5.859  -22.073 1.00 0.00 ? 32 ARG B CG   1  
ATOM 1419  C CD   . ARG B 2 32 ? 113.043 -4.830  -22.993 1.00 0.00 ? 32 ARG B CD   1  
ATOM 1420  N NE   . ARG B 2 32 ? 112.055 -3.857  -23.449 1.00 0.00 ? 32 ARG B NE   1  
ATOM 1421  C CZ   . ARG B 2 32 ? 111.578 -2.927  -22.627 1.00 0.00 ? 32 ARG B CZ   1  
ATOM 1422  N NH1  . ARG B 2 32 ? 111.989 -2.877  -21.390 1.00 0.00 ? 32 ARG B NH1  1  
ATOM 1423  N NH2  . ARG B 2 32 ? 110.698 -2.065  -23.059 1.00 0.00 ? 32 ARG B NH2  1  
ATOM 1424  H H    . ARG B 2 32 ? 113.041 -6.307  -19.228 1.00 0.00 ? 32 ARG B H    1  
ATOM 1425  H HA   . ARG B 2 32 ? 111.837 -8.189  -21.008 1.00 0.00 ? 32 ARG B HA   1  
ATOM 1426  H HB2  . ARG B 2 32 ? 114.278 -6.424  -21.227 1.00 0.00 ? 32 ARG B HB2  1  
ATOM 1427  H HB3  . ARG B 2 32 ? 113.727 -7.469  -22.538 1.00 0.00 ? 32 ARG B HB3  1  
ATOM 1428  H HG2  . ARG B 2 32 ? 111.570 -6.340  -22.593 1.00 0.00 ? 32 ARG B HG2  1  
ATOM 1429  H HG3  . ARG B 2 32 ? 112.010 -5.364  -21.192 1.00 0.00 ? 32 ARG B HG3  1  
ATOM 1430  H HD2  . ARG B 2 32 ? 113.826 -4.316  -22.456 1.00 0.00 ? 32 ARG B HD2  1  
ATOM 1431  H HD3  . ARG B 2 32 ? 113.470 -5.335  -23.848 1.00 0.00 ? 32 ARG B HD3  1  
ATOM 1432  H HE   . ARG B 2 32 ? 111.740 -3.889  -24.375 1.00 0.00 ? 32 ARG B HE   1  
ATOM 1433  H HH11 . ARG B 2 32 ? 112.663 -3.537  -21.059 1.00 0.00 ? 32 ARG B HH11 1  
ATOM 1434  H HH12 . ARG B 2 32 ? 111.630 -2.177  -20.772 1.00 0.00 ? 32 ARG B HH12 1  
ATOM 1435  H HH21 . ARG B 2 32 ? 110.383 -2.104  -24.007 1.00 0.00 ? 32 ARG B HH21 1  
ATOM 1436  H HH22 . ARG B 2 32 ? 110.339 -1.365  -22.441 1.00 0.00 ? 32 ARG B HH22 1  
ATOM 1437  N N    . CYS A 1 1  ? 73.540  22.741  -20.954 1.00 0.00 ? 1  CYS A N    2  
ATOM 1438  C CA   . CYS A 1 1  ? 72.468  22.260  -20.037 1.00 0.00 ? 1  CYS A CA   2  
ATOM 1439  C C    . CYS A 1 1  ? 71.958  20.907  -20.520 1.00 0.00 ? 1  CYS A C    2  
ATOM 1440  O O    . CYS A 1 1  ? 70.787  20.765  -20.874 1.00 0.00 ? 1  CYS A O    2  
ATOM 1441  C CB   . CYS A 1 1  ? 71.322  23.276  -20.020 1.00 0.00 ? 1  CYS A CB   2  
ATOM 1442  S SG   . CYS A 1 1  ? 70.072  22.755  -18.819 1.00 0.00 ? 1  CYS A SG   2  
ATOM 1443  H HA   . CYS A 1 1  ? 72.869  22.157  -19.039 1.00 0.00 ? 1  CYS A HA   2  
ATOM 1444  H HB2  . CYS A 1 1  ? 71.706  24.247  -19.743 1.00 0.00 ? 1  CYS A HB2  2  
ATOM 1445  H HB3  . CYS A 1 1  ? 70.877  23.331  -21.002 1.00 0.00 ? 1  CYS A HB3  2  
ATOM 1446  N N    . SER A 1 2  ? 72.844  19.915  -20.532 1.00 0.00 ? 2  SER A N    2  
ATOM 1447  C CA   . SER A 1 2  ? 72.471  18.576  -20.974 1.00 0.00 ? 2  SER A CA   2  
ATOM 1448  C C    . SER A 1 2  ? 73.477  17.546  -20.469 1.00 0.00 ? 2  SER A C    2  
ATOM 1449  O O    . SER A 1 2  ? 74.678  17.671  -20.704 1.00 0.00 ? 2  SER A O    2  
ATOM 1450  C CB   . SER A 1 2  ? 72.410  18.528  -22.500 1.00 0.00 ? 2  SER A CB   2  
ATOM 1451  O OG   . SER A 1 2  ? 72.156  17.193  -22.919 1.00 0.00 ? 2  SER A OG   2  
ATOM 1452  H H    . SER A 1 2  ? 73.763  20.088  -20.239 1.00 0.00 ? 2  SER A H    2  
ATOM 1453  H HA   . SER A 1 2  ? 71.495  18.336  -20.579 1.00 0.00 ? 2  SER A HA   2  
ATOM 1454  H HB2  . SER A 1 2  ? 71.618  19.167  -22.852 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1455  H HB3  . SER A 1 2  ? 73.353  18.870  -22.908 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1456  H HG   . SER A 1 2  ? 72.617  16.601  -22.319 1.00 0.00 ? 2  SER A HG   2  
ATOM 1457  N N    . THR A 1 3  ? 72.977  16.528  -19.773 1.00 0.00 ? 3  THR A N    2  
ATOM 1458  C CA   . THR A 1 3  ? 73.839  15.477  -19.237 1.00 0.00 ? 3  THR A CA   2  
ATOM 1459  C C    . THR A 1 3  ? 74.124  14.421  -20.301 1.00 0.00 ? 3  THR A C    2  
ATOM 1460  O O    . THR A 1 3  ? 73.424  14.345  -21.310 1.00 0.00 ? 3  THR A O    2  
ATOM 1461  C CB   . THR A 1 3  ? 73.164  14.818  -18.030 1.00 0.00 ? 3  THR A CB   2  
ATOM 1462  O OG1  . THR A 1 3  ? 72.173  13.908  -18.484 1.00 0.00 ? 3  THR A OG1  2  
ATOM 1463  C CG2  . THR A 1 3  ? 72.514  15.892  -17.157 1.00 0.00 ? 3  THR A CG2  2  
ATOM 1464  H H    . THR A 1 3  ? 72.010  16.481  -19.617 1.00 0.00 ? 3  THR A H    2  
ATOM 1465  H HA   . THR A 1 3  ? 74.773  15.915  -18.916 1.00 0.00 ? 3  THR A HA   2  
ATOM 1466  H HB   . THR A 1 3  ? 73.903  14.287  -17.450 1.00 0.00 ? 3  THR A HB   2  
ATOM 1467  H HG1  . THR A 1 3  ? 72.306  13.768  -19.425 1.00 0.00 ? 3  THR A HG1  2  
ATOM 1468  H HG21 . THR A 1 3  ? 71.640  16.281  -17.657 1.00 0.00 ? 3  THR A HG21 2  
ATOM 1469  H HG22 . THR A 1 3  ? 73.219  16.693  -16.987 1.00 0.00 ? 3  THR A HG22 2  
ATOM 1470  H HG23 . THR A 1 3  ? 72.225  15.460  -16.211 1.00 0.00 ? 3  THR A HG23 2  
ATOM 1471  N N    . VAL A 1 4  ? 75.156  13.607  -20.060 1.00 0.00 ? 4  VAL A N    2  
ATOM 1472  C CA   . VAL A 1 4  ? 75.545  12.543  -20.993 1.00 0.00 ? 4  VAL A CA   2  
ATOM 1473  C C    . VAL A 1 4  ? 75.296  12.958  -22.439 1.00 0.00 ? 4  VAL A C    2  
ATOM 1474  O O    . VAL A 1 4  ? 74.953  12.136  -23.288 1.00 0.00 ? 4  VAL A O    2  
ATOM 1475  C CB   . VAL A 1 4  ? 74.780  11.256  -20.671 1.00 0.00 ? 4  VAL A CB   2  
ATOM 1476  C CG1  . VAL A 1 4  ? 75.183  10.767  -19.277 1.00 0.00 ? 4  VAL A CG1  2  
ATOM 1477  C CG2  . VAL A 1 4  ? 73.271  11.523  -20.697 1.00 0.00 ? 4  VAL A CG2  2  
ATOM 1478  H H    . VAL A 1 4  ? 75.667  13.723  -19.232 1.00 0.00 ? 4  VAL A H    2  
ATOM 1479  H HA   . VAL A 1 4  ? 76.604  12.351  -20.878 1.00 0.00 ? 4  VAL A HA   2  
ATOM 1480  H HB   . VAL A 1 4  ? 75.027  10.499  -21.402 1.00 0.00 ? 4  VAL A HB   2  
ATOM 1481  H HG11 . VAL A 1 4  ? 74.481  10.018  -18.940 1.00 0.00 ? 4  VAL A HG11 2  
ATOM 1482  H HG12 . VAL A 1 4  ? 75.181  11.600  -18.587 1.00 0.00 ? 4  VAL A HG12 2  
ATOM 1483  H HG13 . VAL A 1 4  ? 76.173  10.338  -19.318 1.00 0.00 ? 4  VAL A HG13 2  
ATOM 1484  H HG21 . VAL A 1 4  ? 72.740  10.583  -20.660 1.00 0.00 ? 4  VAL A HG21 2  
ATOM 1485  H HG22 . VAL A 1 4  ? 73.011  12.047  -21.603 1.00 0.00 ? 4  VAL A HG22 2  
ATOM 1486  H HG23 . VAL A 1 4  ? 72.996  12.123  -19.841 1.00 0.00 ? 4  VAL A HG23 2  
ATOM 1487  N N    . SER A 1 5  ? 75.488  14.245  -22.705 1.00 0.00 ? 5  SER A N    2  
ATOM 1488  C CA   . SER A 1 5  ? 75.304  14.788  -24.045 1.00 0.00 ? 5  SER A CA   2  
ATOM 1489  C C    . SER A 1 5  ? 76.579  14.605  -24.873 1.00 0.00 ? 5  SER A C    2  
ATOM 1490  O O    . SER A 1 5  ? 76.516  14.230  -26.043 1.00 0.00 ? 5  SER A O    2  
ATOM 1491  C CB   . SER A 1 5  ? 74.935  16.282  -23.955 1.00 0.00 ? 5  SER A CB   2  
ATOM 1492  O OG   . SER A 1 5  ? 76.012  17.078  -24.437 1.00 0.00 ? 5  SER A OG   2  
ATOM 1493  H H    . SER A 1 5  ? 75.776  14.840  -21.980 1.00 0.00 ? 5  SER A H    2  
ATOM 1494  H HA   . SER A 1 5  ? 74.497  14.254  -24.531 1.00 0.00 ? 5  SER A HA   2  
ATOM 1495  H HB2  . SER A 1 5  ? 74.059  16.484  -24.552 1.00 0.00 ? 5  SER A HB2  2  
ATOM 1496  H HB3  . SER A 1 5  ? 74.725  16.534  -22.924 1.00 0.00 ? 5  SER A HB3  2  
ATOM 1497  H HG   . SER A 1 5  ? 76.054  17.876  -23.905 1.00 0.00 ? 5  SER A HG   2  
ATOM 1498  N N    . PRO A 1 6  ? 77.726  14.861  -24.290 1.00 0.00 ? 6  PRO A N    2  
ATOM 1499  C CA   . PRO A 1 6  ? 79.039  14.719  -24.991 1.00 0.00 ? 6  PRO A CA   2  
ATOM 1500  C C    . PRO A 1 6  ? 79.157  13.414  -25.763 1.00 0.00 ? 6  PRO A C    2  
ATOM 1501  O O    . PRO A 1 6  ? 79.623  13.410  -26.901 1.00 0.00 ? 6  PRO A O    2  
ATOM 1502  C CB   . PRO A 1 6  ? 80.049  14.804  -23.846 1.00 0.00 ? 6  PRO A CB   2  
ATOM 1503  C CG   . PRO A 1 6  ? 79.389  15.716  -22.871 1.00 0.00 ? 6  PRO A CG   2  
ATOM 1504  C CD   . PRO A 1 6  ? 77.918  15.318  -22.898 1.00 0.00 ? 6  PRO A CD   2  
ATOM 1505  H HA   . PRO A 1 6  ? 79.201  15.538  -25.655 1.00 0.00 ? 6  PRO A HA   2  
ATOM 1506  H HB2  . PRO A 1 6  ? 80.210  13.827  -23.409 1.00 0.00 ? 6  PRO A HB2  2  
ATOM 1507  H HB3  . PRO A 1 6  ? 80.981  15.230  -24.185 1.00 0.00 ? 6  PRO A HB3  2  
ATOM 1508  H HG2  . PRO A 1 6  ? 79.804  15.580  -21.885 1.00 0.00 ? 6  PRO A HG2  2  
ATOM 1509  H HG3  . PRO A 1 6  ? 79.494  16.742  -23.186 1.00 0.00 ? 6  PRO A HG3  2  
ATOM 1510  H HD2  . PRO A 1 6  ? 77.742  14.515  -22.197 1.00 0.00 ? 6  PRO A HD2  2  
ATOM 1511  H HD3  . PRO A 1 6  ? 77.283  16.164  -22.686 1.00 0.00 ? 6  PRO A HD3  2  
ATOM 1512  N N    . GLY A 1 7  ? 78.739  12.313  -25.153 1.00 0.00 ? 7  GLY A N    2  
ATOM 1513  C CA   . GLY A 1 7  ? 78.837  11.021  -25.834 1.00 0.00 ? 7  GLY A CA   2  
ATOM 1514  C C    . GLY A 1 7  ? 80.301  10.621  -25.923 1.00 0.00 ? 7  GLY A C    2  
ATOM 1515  O O    . GLY A 1 7  ? 80.683  9.505   -25.561 1.00 0.00 ? 7  GLY A O    2  
ATOM 1516  H H    . GLY A 1 7  ? 78.373  12.369  -24.237 1.00 0.00 ? 7  GLY A H    2  
ATOM 1517  H HA2  . GLY A 1 7  ? 78.285  10.265  -25.286 1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1518  H HA3  . GLY A 1 7  ? 78.433  11.109  -26.831 1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1519  N N    . VAL A 1 8  ? 81.133  11.561  -26.369 1.00 0.00 ? 8  VAL A N    2  
ATOM 1520  C CA   . VAL A 1 8  ? 82.558  11.309  -26.454 1.00 0.00 ? 8  VAL A CA   2  
ATOM 1521  C C    . VAL A 1 8  ? 83.025  10.839  -25.091 1.00 0.00 ? 8  VAL A C    2  
ATOM 1522  O O    . VAL A 1 8  ? 83.874  9.949   -24.977 1.00 0.00 ? 8  VAL A O    2  
ATOM 1523  C CB   . VAL A 1 8  ? 83.303  12.584  -26.861 1.00 0.00 ? 8  VAL A CB   2  
ATOM 1524  C CG1  . VAL A 1 8  ? 84.812  12.363  -26.734 1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1525  C CG2  . VAL A 1 8  ? 82.964  12.926  -28.313 1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1526  H H    . VAL A 1 8  ? 80.786  12.439  -26.614 1.00 0.00 ? 8  VAL A H    2  
ATOM 1527  H HA   . VAL A 1 8  ? 82.743  10.534  -27.183 1.00 0.00 ? 8  VAL A HA   2  
ATOM 1528  H HB   . VAL A 1 8  ? 83.002  13.397  -26.218 1.00 0.00 ? 8  VAL A HB   2  
ATOM 1529  H HG11 . VAL A 1 8  ? 85.080  11.425  -27.196 1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1530  H HG12 . VAL A 1 8  ? 85.086  12.340  -25.689 1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1531  H HG13 . VAL A 1 8  ? 85.337  13.169  -27.226 1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1532  H HG21 . VAL A 1 8  ? 83.097  12.049  -28.930 1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1533  H HG22 . VAL A 1 8  ? 83.618  13.713  -28.659 1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1534  H HG23 . VAL A 1 8  ? 81.937  13.256  -28.374 1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1535  N N    . LEU A 1 9  ? 82.431  11.415  -24.046 1.00 0.00 ? 9  LEU A N    2  
ATOM 1536  C CA   . LEU A 1 9  ? 82.784  10.995  -22.700 1.00 0.00 ? 9  LEU A CA   2  
ATOM 1537  C C    . LEU A 1 9  ? 82.581  9.477   -22.606 1.00 0.00 ? 9  LEU A C    2  
ATOM 1538  O O    . LEU A 1 9  ? 83.413  8.747   -22.052 1.00 0.00 ? 9  LEU A O    2  
ATOM 1539  C CB   . LEU A 1 9  ? 81.929  11.717  -21.652 1.00 0.00 ? 9  LEU A CB   2  
ATOM 1540  C CG   . LEU A 1 9  ? 82.406  13.172  -21.470 1.00 0.00 ? 9  LEU A CG   2  
ATOM 1541  C CD1  . LEU A 1 9  ? 81.454  13.889  -20.507 1.00 0.00 ? 9  LEU A CD1  2  
ATOM 1542  C CD2  . LEU A 1 9  ? 83.841  13.212  -20.894 1.00 0.00 ? 9  LEU A CD2  2  
ATOM 1543  H H    . LEU A 1 9  ? 81.732  12.109  -24.189 1.00 0.00 ? 9  LEU A H    2  
ATOM 1544  H HA   . LEU A 1 9  ? 83.821  11.222  -22.528 1.00 0.00 ? 9  LEU A HA   2  
ATOM 1545  H HB2  . LEU A 1 9  ? 80.897  11.718  -21.969 1.00 0.00 ? 9  LEU A HB2  2  
ATOM 1546  H HB3  . LEU A 1 9  ? 82.012  11.200  -20.712 1.00 0.00 ? 9  LEU A HB3  2  
ATOM 1547  H HG   . LEU A 1 9  ? 82.387  13.674  -22.428 1.00 0.00 ? 9  LEU A HG   2  
ATOM 1548  H HD11 . LEU A 1 9  ? 81.646  13.555  -19.498 1.00 0.00 ? 9  LEU A HD11 2  
ATOM 1549  H HD12 . LEU A 1 9  ? 80.433  13.664  -20.773 1.00 0.00 ? 9  LEU A HD12 2  
ATOM 1550  H HD13 . LEU A 1 9  ? 81.617  14.955  -20.569 1.00 0.00 ? 9  LEU A HD13 2  
ATOM 1551  H HD21 . LEU A 1 9  ? 83.971  14.098  -20.287 1.00 0.00 ? 9  LEU A HD21 2  
ATOM 1552  H HD22 . LEU A 1 9  ? 84.553  13.235  -21.704 1.00 0.00 ? 9  LEU A HD22 2  
ATOM 1553  H HD23 . LEU A 1 9  ? 84.017  12.335  -20.286 1.00 0.00 ? 9  LEU A HD23 2  
ATOM 1554  N N    . ALA A 1 10 ? 81.490  8.993   -23.203 1.00 0.00 ? 10 ALA A N    2  
ATOM 1555  C CA   . ALA A 1 10 ? 81.232  7.563   -23.220 1.00 0.00 ? 10 ALA A CA   2  
ATOM 1556  C C    . ALA A 1 10 ? 82.415  6.885   -23.891 1.00 0.00 ? 10 ALA A C    2  
ATOM 1557  O O    . ALA A 1 10 ? 82.869  5.815   -23.473 1.00 0.00 ? 10 ALA A O    2  
ATOM 1558  C CB   . ALA A 1 10 ? 79.939  7.261   -23.986 1.00 0.00 ? 10 ALA A CB   2  
ATOM 1559  H H    . ALA A 1 10 ? 80.879  9.601   -23.669 1.00 0.00 ? 10 ALA A H    2  
ATOM 1560  H HA   . ALA A 1 10 ? 81.141  7.203   -22.206 1.00 0.00 ? 10 ALA A HA   2  
ATOM 1561  H HB1  . ALA A 1 10 ? 79.574  6.285   -23.704 1.00 0.00 ? 10 ALA A HB1  2  
ATOM 1562  H HB2  . ALA A 1 10 ? 80.132  7.280   -25.049 1.00 0.00 ? 10 ALA A HB2  2  
ATOM 1563  H HB3  . ALA A 1 10 ? 79.196  8.006   -23.743 1.00 0.00 ? 10 ALA A HB3  2  
ATOM 1564  N N    . GLY A 1 11 ? 82.934  7.548   -24.921 1.00 0.00 ? 11 GLY A N    2  
ATOM 1565  C CA   . GLY A 1 11 ? 84.094  7.041   -25.635 1.00 0.00 ? 11 GLY A CA   2  
ATOM 1566  C C    . GLY A 1 11 ? 85.269  6.922   -24.673 1.00 0.00 ? 11 GLY A C    2  
ATOM 1567  O O    . GLY A 1 11 ? 86.151  6.084   -24.851 1.00 0.00 ? 11 GLY A O    2  
ATOM 1568  H H    . GLY A 1 11 ? 82.539  8.410   -25.188 1.00 0.00 ? 11 GLY A H    2  
ATOM 1569  H HA2  . GLY A 1 11 ? 83.864  6.070   -26.050 1.00 0.00 ? 11 GLY A HA2  2  
ATOM 1570  H HA3  . GLY A 1 11 ? 84.355  7.722   -26.431 1.00 0.00 ? 11 GLY A HA3  2  
ATOM 1571  N N    . ILE A 1 12 ? 85.261  7.769   -23.642 1.00 0.00 ? 12 ILE A N    2  
ATOM 1572  C CA   . ILE A 1 12 ? 86.322  7.754   -22.632 1.00 0.00 ? 12 ILE A CA   2  
ATOM 1573  C C    . ILE A 1 12 ? 86.224  6.456   -21.838 1.00 0.00 ? 12 ILE A C    2  
ATOM 1574  O O    . ILE A 1 12 ? 87.235  5.821   -21.534 1.00 0.00 ? 12 ILE A O    2  
ATOM 1575  C CB   . ILE A 1 12 ? 86.220  9.028   -21.717 1.00 0.00 ? 12 ILE A CB   2  
ATOM 1576  C CG1  . ILE A 1 12 ? 87.602  9.717   -21.572 1.00 0.00 ? 12 ILE A CG1  2  
ATOM 1577  C CG2  . ILE A 1 12 ? 85.679  8.705   -20.295 1.00 0.00 ? 12 ILE A CG2  2  
ATOM 1578  C CD1  . ILE A 1 12 ? 87.414  11.197  -21.217 1.00 0.00 ? 12 ILE A CD1  2  
ATOM 1579  H H    . ILE A 1 12 ? 84.523  8.406   -23.560 1.00 0.00 ? 12 ILE A H    2  
ATOM 1580  H HA   . ILE A 1 12 ? 87.268  7.749   -23.151 1.00 0.00 ? 12 ILE A HA   2  
ATOM 1581  H HB   . ILE A 1 12 ? 85.540  9.721   -22.185 1.00 0.00 ? 12 ILE A HB   2  
ATOM 1582  H HG12 . ILE A 1 12 ? 88.170  9.230   -20.792 1.00 0.00 ? 12 ILE A HG12 2  
ATOM 1583  H HG13 . ILE A 1 12 ? 88.148  9.654   -22.501 1.00 0.00 ? 12 ILE A HG13 2  
ATOM 1584  H HG21 . ILE A 1 12 ? 85.384  9.623   -19.805 1.00 0.00 ? 12 ILE A HG21 2  
ATOM 1585  H HG22 . ILE A 1 12 ? 86.447  8.221   -19.709 1.00 0.00 ? 12 ILE A HG22 2  
ATOM 1586  H HG23 . ILE A 1 12 ? 84.824  8.058   -20.361 1.00 0.00 ? 12 ILE A HG23 2  
ATOM 1587  H HD11 . ILE A 1 12 ? 86.603  11.303  -20.512 1.00 0.00 ? 12 ILE A HD11 2  
ATOM 1588  H HD12 . ILE A 1 12 ? 87.185  11.753  -22.114 1.00 0.00 ? 12 ILE A HD12 2  
ATOM 1589  H HD13 . ILE A 1 12 ? 88.325  11.578  -20.782 1.00 0.00 ? 12 ILE A HD13 2  
ATOM 1590  N N    . VAL A 1 13 ? 84.997  6.062   -21.522 1.00 0.00 ? 13 VAL A N    2  
ATOM 1591  C CA   . VAL A 1 13 ? 84.782  4.825   -20.780 1.00 0.00 ? 13 VAL A CA   2  
ATOM 1592  C C    . VAL A 1 13 ? 85.342  3.650   -21.573 1.00 0.00 ? 13 VAL A C    2  
ATOM 1593  O O    . VAL A 1 13 ? 86.157  2.862   -21.073 1.00 0.00 ? 13 VAL A O    2  
ATOM 1594  C CB   . VAL A 1 13 ? 83.285  4.614   -20.543 1.00 0.00 ? 13 VAL A CB   2  
ATOM 1595  C CG1  . VAL A 1 13 ? 83.067  3.322   -19.753 1.00 0.00 ? 13 VAL A CG1  2  
ATOM 1596  C CG2  . VAL A 1 13 ? 82.719  5.795   -19.752 1.00 0.00 ? 13 VAL A CG2  2  
ATOM 1597  H H    . VAL A 1 13 ? 84.226  6.609   -21.800 1.00 0.00 ? 13 VAL A H    2  
ATOM 1598  H HA   . VAL A 1 13 ? 85.288  4.887   -19.832 1.00 0.00 ? 13 VAL A HA   2  
ATOM 1599  H HB   . VAL A 1 13 ? 82.778  4.540   -21.494 1.00 0.00 ? 13 VAL A HB   2  
ATOM 1600  H HG11 . VAL A 1 13 ? 82.024  3.234   -19.495 1.00 0.00 ? 13 VAL A HG11 2  
ATOM 1601  H HG12 . VAL A 1 13 ? 83.661  3.347   -18.852 1.00 0.00 ? 13 VAL A HG12 2  
ATOM 1602  H HG13 . VAL A 1 13 ? 83.360  2.477   -20.356 1.00 0.00 ? 13 VAL A HG13 2  
ATOM 1603  H HG21 . VAL A 1 13 ? 81.653  5.666   -19.628 1.00 0.00 ? 13 VAL A HG21 2  
ATOM 1604  H HG22 . VAL A 1 13 ? 82.911  6.712   -20.288 1.00 0.00 ? 13 VAL A HG22 2  
ATOM 1605  H HG23 . VAL A 1 13 ? 83.190  5.839   -18.783 1.00 0.00 ? 13 VAL A HG23 2  
ATOM 1606  N N    . VAL A 1 14 ? 84.910  3.549   -22.825 1.00 0.00 ? 14 VAL A N    2  
ATOM 1607  C CA   . VAL A 1 14 ? 85.380  2.481   -23.693 1.00 0.00 ? 14 VAL A CA   2  
ATOM 1608  C C    . VAL A 1 14 ? 86.897  2.548   -23.826 1.00 0.00 ? 14 VAL A C    2  
ATOM 1609  O O    . VAL A 1 14 ? 87.568  1.523   -23.931 1.00 0.00 ? 14 VAL A O    2  
ATOM 1610  C CB   . VAL A 1 14 ? 84.738  2.606   -25.076 1.00 0.00 ? 14 VAL A CB   2  
ATOM 1611  C CG1  . VAL A 1 14 ? 85.095  1.380   -25.920 1.00 0.00 ? 14 VAL A CG1  2  
ATOM 1612  C CG2  . VAL A 1 14 ? 83.218  2.693   -24.923 1.00 0.00 ? 14 VAL A CG2  2  
ATOM 1613  H H    . VAL A 1 14 ? 84.268  4.211   -23.170 1.00 0.00 ? 14 VAL A H    2  
ATOM 1614  H HA   . VAL A 1 14 ? 85.105  1.529   -23.263 1.00 0.00 ? 14 VAL A HA   2  
ATOM 1615  H HB   . VAL A 1 14 ? 85.105  3.498   -25.563 1.00 0.00 ? 14 VAL A HB   2  
ATOM 1616  H HG11 . VAL A 1 14 ? 84.701  0.492   -25.450 1.00 0.00 ? 14 VAL A HG11 2  
ATOM 1617  H HG12 . VAL A 1 14 ? 86.169  1.299   -26.000 1.00 0.00 ? 14 VAL A HG12 2  
ATOM 1618  H HG13 . VAL A 1 14 ? 84.669  1.486   -26.906 1.00 0.00 ? 14 VAL A HG13 2  
ATOM 1619  H HG21 . VAL A 1 14 ? 82.762  2.785   -25.897 1.00 0.00 ? 14 VAL A HG21 2  
ATOM 1620  H HG22 . VAL A 1 14 ? 82.966  3.557   -24.325 1.00 0.00 ? 14 VAL A HG22 2  
ATOM 1621  H HG23 . VAL A 1 14 ? 82.853  1.801   -24.437 1.00 0.00 ? 14 VAL A HG23 2  
ATOM 1622  N N    . GLY A 1 15 ? 87.430  3.767   -23.822 1.00 0.00 ? 15 GLY A N    2  
ATOM 1623  C CA   . GLY A 1 15 ? 88.867  3.969   -23.944 1.00 0.00 ? 15 GLY A CA   2  
ATOM 1624  C C    . GLY A 1 15 ? 89.607  3.403   -22.738 1.00 0.00 ? 15 GLY A C    2  
ATOM 1625  O O    . GLY A 1 15 ? 90.722  2.895   -22.860 1.00 0.00 ? 15 GLY A O    2  
ATOM 1626  H H    . GLY A 1 15 ? 86.844  4.546   -23.736 1.00 0.00 ? 15 GLY A H    2  
ATOM 1627  H HA2  . GLY A 1 15 ? 89.214  3.481   -24.838 1.00 0.00 ? 15 GLY A HA2  2  
ATOM 1628  H HA3  . GLY A 1 15 ? 89.070  5.027   -24.016 1.00 0.00 ? 15 GLY A HA3  2  
ATOM 1629  N N    . ASP A 1 16 ? 88.985  3.497   -21.571 1.00 0.00 ? 16 ASP A N    2  
ATOM 1630  C CA   . ASP A 1 16 ? 89.603  2.994   -20.352 1.00 0.00 ? 16 ASP A CA   2  
ATOM 1631  C C    . ASP A 1 16 ? 89.673  1.473   -20.368 1.00 0.00 ? 16 ASP A C    2  
ATOM 1632  O O    . ASP A 1 16 ? 90.694  0.886   -20.010 1.00 0.00 ? 16 ASP A O    2  
ATOM 1633  C CB   . ASP A 1 16 ? 88.806  3.456   -19.132 1.00 0.00 ? 16 ASP A CB   2  
ATOM 1634  C CG   . ASP A 1 16 ? 89.604  3.190   -17.859 1.00 0.00 ? 16 ASP A CG   2  
ATOM 1635  O OD1  . ASP A 1 16 ? 90.520  2.388   -17.914 1.00 0.00 ? 16 ASP A OD1  2  
ATOM 1636  O OD2  . ASP A 1 16 ? 89.285  3.793   -16.848 1.00 0.00 ? 16 ASP A OD2  2  
ATOM 1637  H H    . ASP A 1 16 ? 88.099  3.914   -21.527 1.00 0.00 ? 16 ASP A H    2  
ATOM 1638  H HA   . ASP A 1 16 ? 90.605  3.387   -20.283 1.00 0.00 ? 16 ASP A HA   2  
ATOM 1639  H HB2  . ASP A 1 16 ? 88.604  4.514   -19.215 1.00 0.00 ? 16 ASP A HB2  2  
ATOM 1640  H HB3  . ASP A 1 16 ? 87.873  2.914   -19.088 1.00 0.00 ? 16 ASP A HB3  2  
ATOM 1641  N N    . LEU A 1 17 ? 88.578  0.836   -20.770 1.00 0.00 ? 17 LEU A N    2  
ATOM 1642  C CA   . LEU A 1 17 ? 88.538  -0.625  -20.805 1.00 0.00 ? 17 LEU A CA   2  
ATOM 1643  C C    . LEU A 1 17 ? 89.493  -1.186  -21.865 1.00 0.00 ? 17 LEU A C    2  
ATOM 1644  O O    . LEU A 1 17 ? 90.315  -2.069  -21.572 1.00 0.00 ? 17 LEU A O    2  
ATOM 1645  C CB   . LEU A 1 17 ? 87.108  -1.096  -21.091 1.00 0.00 ? 17 LEU A CB   2  
ATOM 1646  C CG   . LEU A 1 17 ? 87.010  -2.625  -20.962 1.00 0.00 ? 17 LEU A CG   2  
ATOM 1647  C CD1  . LEU A 1 17 ? 87.268  -3.063  -19.506 1.00 0.00 ? 17 LEU A CD1  2  
ATOM 1648  C CD2  . LEU A 1 17 ? 85.607  -3.067  -21.395 1.00 0.00 ? 17 LEU A CD2  2  
ATOM 1649  H H    . LEU A 1 17 ? 87.783  1.354   -21.035 1.00 0.00 ? 17 LEU A H    2  
ATOM 1650  H HA   . LEU A 1 17 ? 88.838  -0.997  -19.839 1.00 0.00 ? 17 LEU A HA   2  
ATOM 1651  H HB2  . LEU A 1 17 ? 86.433  -0.633  -20.387 1.00 0.00 ? 17 LEU A HB2  2  
ATOM 1652  H HB3  . LEU A 1 17 ? 86.831  -0.806  -22.093 1.00 0.00 ? 17 LEU A HB3  2  
ATOM 1653  H HG   . LEU A 1 17 ? 87.744  -3.087  -21.607 1.00 0.00 ? 17 LEU A HG   2  
ATOM 1654  H HD11 . LEU A 1 17 ? 86.763  -4.001  -19.310 1.00 0.00 ? 17 LEU A HD11 2  
ATOM 1655  H HD12 . LEU A 1 17 ? 86.898  -2.312  -18.824 1.00 0.00 ? 17 LEU A HD12 2  
ATOM 1656  H HD13 . LEU A 1 17 ? 88.329  -3.196  -19.352 1.00 0.00 ? 17 LEU A HD13 2  
ATOM 1657  H HD21 . LEU A 1 17 ? 85.499  -2.929  -22.461 1.00 0.00 ? 17 LEU A HD21 2  
ATOM 1658  H HD22 . LEU A 1 17 ? 84.867  -2.473  -20.879 1.00 0.00 ? 17 LEU A HD22 2  
ATOM 1659  H HD23 . LEU A 1 17 ? 85.466  -4.110  -21.150 1.00 0.00 ? 17 LEU A HD23 2  
ATOM 1660  N N    . VAL A 1 18 ? 89.390  -0.679  -23.094 1.00 0.00 ? 18 VAL A N    2  
ATOM 1661  C CA   . VAL A 1 18 ? 90.252  -1.160  -24.165 1.00 0.00 ? 18 VAL A CA   2  
ATOM 1662  C C    . VAL A 1 18 ? 91.716  -0.932  -23.809 1.00 0.00 ? 18 VAL A C    2  
ATOM 1663  O O    . VAL A 1 18 ? 92.573  -1.738  -24.155 1.00 0.00 ? 18 VAL A O    2  
ATOM 1664  C CB   . VAL A 1 18 ? 89.928  -0.451  -25.481 1.00 0.00 ? 18 VAL A CB   2  
ATOM 1665  C CG1  . VAL A 1 18 ? 88.449  -0.661  -25.834 1.00 0.00 ? 18 VAL A CG1  2  
ATOM 1666  C CG2  . VAL A 1 18 ? 90.221  1.039   -25.330 1.00 0.00 ? 18 VAL A CG2  2  
ATOM 1667  H H    . VAL A 1 18 ? 88.727  0.024   -23.281 1.00 0.00 ? 18 VAL A H    2  
ATOM 1668  H HA   . VAL A 1 18 ? 90.083  -2.217  -24.296 1.00 0.00 ? 18 VAL A HA   2  
ATOM 1669  H HB   . VAL A 1 18 ? 90.544  -0.861  -26.269 1.00 0.00 ? 18 VAL A HB   2  
ATOM 1670  H HG11 . VAL A 1 18 ? 87.847  -0.574  -24.942 1.00 0.00 ? 18 VAL A HG11 2  
ATOM 1671  H HG12 . VAL A 1 18 ? 88.318  -1.645  -26.259 1.00 0.00 ? 18 VAL A HG12 2  
ATOM 1672  H HG13 . VAL A 1 18 ? 88.139  0.084   -26.553 1.00 0.00 ? 18 VAL A HG13 2  
ATOM 1673  H HG21 . VAL A 1 18 ? 89.866  1.372   -24.370 1.00 0.00 ? 18 VAL A HG21 2  
ATOM 1674  H HG22 . VAL A 1 18 ? 89.721  1.590   -26.113 1.00 0.00 ? 18 VAL A HG22 2  
ATOM 1675  H HG23 . VAL A 1 18 ? 91.287  1.205   -25.396 1.00 0.00 ? 18 VAL A HG23 2  
ATOM 1676  N N    . LEU A 1 19 ? 92.003  0.169   -23.116 1.00 0.00 ? 19 LEU A N    2  
ATOM 1677  C CA   . LEU A 1 19 ? 93.380  0.463   -22.735 1.00 0.00 ? 19 LEU A CA   2  
ATOM 1678  C C    . LEU A 1 19 ? 93.908  -0.599  -21.771 1.00 0.00 ? 19 LEU A C    2  
ATOM 1679  O O    . LEU A 1 19 ? 94.968  -1.182  -22.002 1.00 0.00 ? 19 LEU A O    2  
ATOM 1680  C CB   . LEU A 1 19 ? 93.467  1.847   -22.079 1.00 0.00 ? 19 LEU A CB   2  
ATOM 1681  C CG   . LEU A 1 19 ? 94.933  2.219   -21.799 1.00 0.00 ? 19 LEU A CG   2  
ATOM 1682  C CD1  . LEU A 1 19 ? 95.706  2.397   -23.120 1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1683  C CD2  . LEU A 1 19 ? 94.969  3.528   -21.001 1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1684  H H    . LEU A 1 19 ? 91.284  0.791   -22.861 1.00 0.00 ? 19 LEU A H    2  
ATOM 1685  H HA   . LEU A 1 19 ? 93.991  0.460   -23.623 1.00 0.00 ? 19 LEU A HA   2  
ATOM 1686  H HB2  . LEU A 1 19 ? 93.032  2.581   -22.740 1.00 0.00 ? 19 LEU A HB2  2  
ATOM 1687  H HB3  . LEU A 1 19 ? 92.919  1.836   -21.149 1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1688  H HG   . LEU A 1 19 ? 95.397  1.436   -21.219 1.00 0.00 ? 19 LEU A HG   2  
ATOM 1689  H HD11 . LEU A 1 19 ? 95.053  2.811   -23.875 1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1690  H HD12 . LEU A 1 19 ? 96.077  1.440   -23.451 1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1691  H HD13 . LEU A 1 19 ? 96.542  3.066   -22.967 1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1692  H HD21 . LEU A 1 19 ? 94.685  3.334   -19.978 1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1693  H HD22 . LEU A 1 19 ? 94.282  4.238   -21.438 1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1694  H HD23 . LEU A 1 19 ? 95.969  3.936   -21.024 1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1695  N N    . THR A 1 20 ? 93.173  -0.847  -20.689 1.00 0.00 ? 20 THR A N    2  
ATOM 1696  C CA   . THR A 1 20 ? 93.596  -1.838  -19.708 1.00 0.00 ? 20 THR A CA   2  
ATOM 1697  C C    . THR A 1 20 ? 93.951  -3.165  -20.373 1.00 0.00 ? 20 THR A C    2  
ATOM 1698  O O    . THR A 1 20 ? 95.001  -3.742  -20.089 1.00 0.00 ? 20 THR A O    2  
ATOM 1699  C CB   . THR A 1 20 ? 92.480  -2.077  -18.686 1.00 0.00 ? 20 THR A CB   2  
ATOM 1700  O OG1  . THR A 1 20 ? 91.995  -0.826  -18.222 1.00 0.00 ? 20 THR A OG1  2  
ATOM 1701  C CG2  . THR A 1 20 ? 93.015  -2.891  -17.495 1.00 0.00 ? 20 THR A CG2  2  
ATOM 1702  H H    . THR A 1 20 ? 92.338  -0.351  -20.540 1.00 0.00 ? 20 THR A H    2  
ATOM 1703  H HA   . THR A 1 20 ? 94.465  -1.465  -19.190 1.00 0.00 ? 20 THR A HA   2  
ATOM 1704  H HB   . THR A 1 20 ? 91.675  -2.621  -19.156 1.00 0.00 ? 20 THR A HB   2  
ATOM 1705  H HG1  . THR A 1 20 ? 91.750  -0.301  -18.987 1.00 0.00 ? 20 THR A HG1  2  
ATOM 1706  H HG21 . THR A 1 20 ? 92.203  -3.440  -17.042 1.00 0.00 ? 20 THR A HG21 2  
ATOM 1707  H HG22 . THR A 1 20 ? 93.446  -2.222  -16.767 1.00 0.00 ? 20 THR A HG22 2  
ATOM 1708  H HG23 . THR A 1 20 ? 93.770  -3.587  -17.831 1.00 0.00 ? 20 THR A HG23 2  
ATOM 1709  N N    . VAL A 1 21 ? 93.065  -3.669  -21.229 1.00 0.00 ? 21 VAL A N    2  
ATOM 1710  C CA   . VAL A 1 21 ? 93.317  -4.958  -21.876 1.00 0.00 ? 21 VAL A CA   2  
ATOM 1711  C C    . VAL A 1 21 ? 94.442  -4.882  -22.915 1.00 0.00 ? 21 VAL A C    2  
ATOM 1712  O O    . VAL A 1 21 ? 95.148  -5.865  -23.129 1.00 0.00 ? 21 VAL A O    2  
ATOM 1713  C CB   . VAL A 1 21 ? 92.038  -5.482  -22.531 1.00 0.00 ? 21 VAL A CB   2  
ATOM 1714  C CG1  . VAL A 1 21 ? 91.516  -4.447  -23.521 1.00 0.00 ? 21 VAL A CG1  2  
ATOM 1715  C CG2  . VAL A 1 21 ? 92.336  -6.793  -23.266 1.00 0.00 ? 21 VAL A CG2  2  
ATOM 1716  H H    . VAL A 1 21 ? 92.224  -3.186  -21.407 1.00 0.00 ? 21 VAL A H    2  
ATOM 1717  H HA   . VAL A 1 21 ? 93.614  -5.662  -21.114 1.00 0.00 ? 21 VAL A HA   2  
ATOM 1718  H HB   . VAL A 1 21 ? 91.291  -5.657  -21.769 1.00 0.00 ? 21 VAL A HB   2  
ATOM 1719  H HG11 . VAL A 1 21 ? 90.515  -4.714  -23.829 1.00 0.00 ? 21 VAL A HG11 2  
ATOM 1720  H HG12 . VAL A 1 21 ? 92.165  -4.414  -24.384 1.00 0.00 ? 21 VAL A HG12 2  
ATOM 1721  H HG13 . VAL A 1 21 ? 91.502  -3.483  -23.041 1.00 0.00 ? 21 VAL A HG13 2  
ATOM 1722  H HG21 . VAL A 1 21 ? 92.924  -7.436  -22.627 1.00 0.00 ? 21 VAL A HG21 2  
ATOM 1723  H HG22 . VAL A 1 21 ? 92.886  -6.582  -24.170 1.00 0.00 ? 21 VAL A HG22 2  
ATOM 1724  H HG23 . VAL A 1 21 ? 91.408  -7.286  -23.514 1.00 0.00 ? 21 VAL A HG23 2  
ATOM 1725  N N    . LEU A 1 22 ? 94.611  -3.733  -23.568 1.00 0.00 ? 22 LEU A N    2  
ATOM 1726  C CA   . LEU A 1 22 ? 95.664  -3.607  -24.581 1.00 0.00 ? 22 LEU A CA   2  
ATOM 1727  C C    . LEU A 1 22 ? 97.047  -3.670  -23.930 1.00 0.00 ? 22 LEU A C    2  
ATOM 1728  O O    . LEU A 1 22 ? 97.885  -4.488  -24.310 1.00 0.00 ? 22 LEU A O    2  
ATOM 1729  C CB   . LEU A 1 22 ? 95.503  -2.283  -25.353 1.00 0.00 ? 22 LEU A CB   2  
ATOM 1730  C CG   . LEU A 1 22 ? 96.124  -2.371  -26.765 1.00 0.00 ? 22 LEU A CG   2  
ATOM 1731  C CD1  . LEU A 1 22 ? 97.598  -2.785  -26.675 1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1732  C CD2  . LEU A 1 22 ? 95.348  -3.380  -27.642 1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1733  H H    . LEU A 1 22 ? 94.023  -2.972  -23.377 1.00 0.00 ? 22 LEU A H    2  
ATOM 1734  H HA   . LEU A 1 22 ? 95.572  -4.429  -25.271 1.00 0.00 ? 22 LEU A HA   2  
ATOM 1735  H HB2  . LEU A 1 22 ? 94.455  -2.056  -25.448 1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1736  H HB3  . LEU A 1 22 ? 95.986  -1.485  -24.805 1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1737  H HG   . LEU A 1 22 ? 96.070  -1.393  -27.226 1.00 0.00 ? 22 LEU A HG   2  
ATOM 1738  H HD11 . LEU A 1 22 ? 98.101  -2.516  -27.593 1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1739  H HD12 . LEU A 1 22 ? 97.664  -3.852  -26.531 1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1740  H HD13 . LEU A 1 22 ? 98.068  -2.275  -25.848 1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1741  H HD21 . LEU A 1 22 ? 94.315  -3.425  -27.327 1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1742  H HD22 . LEU A 1 22 ? 95.790  -4.364  -27.560 1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1743  H HD23 . LEU A 1 22 ? 95.390  -3.059  -28.672 1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1744  N N    . ILE A 1 23 ? 97.284  -2.806  -22.947 1.00 0.00 ? 23 ILE A N    2  
ATOM 1745  C CA   . ILE A 1 23 ? 98.573  -2.784  -22.268 1.00 0.00 ? 23 ILE A CA   2  
ATOM 1746  C C    . ILE A 1 23 ? 98.808  -4.100  -21.530 1.00 0.00 ? 23 ILE A C    2  
ATOM 1747  O O    . ILE A 1 23 ? 99.854  -4.731  -21.685 1.00 0.00 ? 23 ILE A O    2  
ATOM 1748  C CB   . ILE A 1 23 ? 98.618  -1.610  -21.286 1.00 0.00 ? 23 ILE A CB   2  
ATOM 1749  C CG1  . ILE A 1 23 ? 98.190  -0.332  -22.010 1.00 0.00 ? 23 ILE A CG1  2  
ATOM 1750  C CG2  . ILE A 1 23 ? 100.042 -1.432  -20.755 1.00 0.00 ? 23 ILE A CG2  2  
ATOM 1751  C CD1  . ILE A 1 23 ? 98.272  0.853   -21.045 1.00 0.00 ? 23 ILE A CD1  2  
ATOM 1752  H H    . ILE A 1 23 ? 96.587  -2.174  -22.675 1.00 0.00 ? 23 ILE A H    2  
ATOM 1753  H HA   . ILE A 1 23 ? 99.353  -2.652  -23.003 1.00 0.00 ? 23 ILE A HA   2  
ATOM 1754  H HB   . ILE A 1 23 ? 97.944  -1.802  -20.465 1.00 0.00 ? 23 ILE A HB   2  
ATOM 1755  H HG12 . ILE A 1 23 ? 98.847  -0.158  -22.851 1.00 0.00 ? 23 ILE A HG12 2  
ATOM 1756  H HG13 . ILE A 1 23 ? 97.176  -0.438  -22.362 1.00 0.00 ? 23 ILE A HG13 2  
ATOM 1757  H HG21 . ILE A 1 23 ? 100.427 -2.384  -20.422 1.00 0.00 ? 23 ILE A HG21 2  
ATOM 1758  H HG22 . ILE A 1 23 ? 100.035 -0.737  -19.926 1.00 0.00 ? 23 ILE A HG22 2  
ATOM 1759  H HG23 . ILE A 1 23 ? 100.674 -1.045  -21.541 1.00 0.00 ? 23 ILE A HG23 2  
ATOM 1760  H HD11 . ILE A 1 23 ? 97.824  0.581   -20.101 1.00 0.00 ? 23 ILE A HD11 2  
ATOM 1761  H HD12 . ILE A 1 23 ? 97.742  1.696   -21.465 1.00 0.00 ? 23 ILE A HD12 2  
ATOM 1762  H HD13 . ILE A 1 23 ? 99.306  1.120   -20.890 1.00 0.00 ? 23 ILE A HD13 2  
ATOM 1763  N N    . ALA A 1 24 ? 97.825  -4.514  -20.736 1.00 0.00 ? 24 ALA A N    2  
ATOM 1764  C CA   . ALA A 1 24 ? 97.936  -5.761  -19.988 1.00 0.00 ? 24 ALA A CA   2  
ATOM 1765  C C    . ALA A 1 24 ? 98.260  -6.917  -20.929 1.00 0.00 ? 24 ALA A C    2  
ATOM 1766  O O    . ALA A 1 24 ? 99.084  -7.776  -20.614 1.00 0.00 ? 24 ALA A O    2  
ATOM 1767  C CB   . ALA A 1 24 ? 96.624  -6.050  -19.255 1.00 0.00 ? 24 ALA A CB   2  
ATOM 1768  H H    . ALA A 1 24 ? 97.010  -3.975  -20.656 1.00 0.00 ? 24 ALA A H    2  
ATOM 1769  H HA   . ALA A 1 24 ? 98.727  -5.666  -19.260 1.00 0.00 ? 24 ALA A HA   2  
ATOM 1770  H HB1  . ALA A 1 24 ? 95.834  -6.202  -19.977 1.00 0.00 ? 24 ALA A HB1  2  
ATOM 1771  H HB2  . ALA A 1 24 ? 96.374  -5.215  -18.619 1.00 0.00 ? 24 ALA A HB2  2  
ATOM 1772  H HB3  . ALA A 1 24 ? 96.735  -6.940  -18.654 1.00 0.00 ? 24 ALA A HB3  2  
ATOM 1773  N N    . LEU A 1 25 ? 97.609  -6.927  -22.086 1.00 0.00 ? 25 LEU A N    2  
ATOM 1774  C CA   . LEU A 1 25 ? 97.834  -7.975  -23.074 1.00 0.00 ? 25 LEU A CA   2  
ATOM 1775  C C    . LEU A 1 25 ? 99.274  -7.924  -23.573 1.00 0.00 ? 25 LEU A C    2  
ATOM 1776  O O    . LEU A 1 25 ? 99.928  -8.955  -23.724 1.00 0.00 ? 25 LEU A O    2  
ATOM 1777  C CB   . LEU A 1 25 ? 96.860  -7.798  -24.248 1.00 0.00 ? 25 LEU A CB   2  
ATOM 1778  C CG   . LEU A 1 25 ? 97.186  -8.785  -25.377 1.00 0.00 ? 25 LEU A CG   2  
ATOM 1779  C CD1  . LEU A 1 25 ? 97.224  -10.220 -24.832 1.00 0.00 ? 25 LEU A CD1  2  
ATOM 1780  C CD2  . LEU A 1 25 ? 96.102  -8.679  -26.456 1.00 0.00 ? 25 LEU A CD2  2  
ATOM 1781  H H    . LEU A 1 25 ? 96.966  -6.213  -22.282 1.00 0.00 ? 25 LEU A H    2  
ATOM 1782  H HA   . LEU A 1 25 ? 97.656  -8.934  -22.611 1.00 0.00 ? 25 LEU A HA   2  
ATOM 1783  H HB2  . LEU A 1 25 ? 95.852  -7.973  -23.902 1.00 0.00 ? 25 LEU A HB2  2  
ATOM 1784  H HB3  . LEU A 1 25 ? 96.937  -6.789  -24.624 1.00 0.00 ? 25 LEU A HB3  2  
ATOM 1785  H HG   . LEU A 1 25 ? 98.144  -8.540  -25.810 1.00 0.00 ? 25 LEU A HG   2  
ATOM 1786  H HD11 . LEU A 1 25 ? 98.174  -10.395 -24.350 1.00 0.00 ? 25 LEU A HD11 2  
ATOM 1787  H HD12 . LEU A 1 25 ? 97.100  -10.921 -25.644 1.00 0.00 ? 25 LEU A HD12 2  
ATOM 1788  H HD13 . LEU A 1 25 ? 96.427  -10.356 -24.115 1.00 0.00 ? 25 LEU A HD13 2  
ATOM 1789  H HD21 . LEU A 1 25 ? 95.149  -8.969  -26.038 1.00 0.00 ? 25 LEU A HD21 2  
ATOM 1790  H HD22 . LEU A 1 25 ? 96.347  -9.333  -27.280 1.00 0.00 ? 25 LEU A HD22 2  
ATOM 1791  H HD23 . LEU A 1 25 ? 96.045  -7.660  -26.810 1.00 0.00 ? 25 LEU A HD23 2  
ATOM 1792  N N    . ALA A 1 26 ? 99.762  -6.714  -23.822 1.00 0.00 ? 26 ALA A N    2  
ATOM 1793  C CA   . ALA A 1 26 ? 101.128 -6.537  -24.298 1.00 0.00 ? 26 ALA A CA   2  
ATOM 1794  C C    . ALA A 1 26 ? 102.109 -7.231  -23.362 1.00 0.00 ? 26 ALA A C    2  
ATOM 1795  O O    . ALA A 1 26 ? 102.988 -7.971  -23.804 1.00 0.00 ? 26 ALA A O    2  
ATOM 1796  C CB   . ALA A 1 26 ? 101.463 -5.047  -24.381 1.00 0.00 ? 26 ALA A CB   2  
ATOM 1797  H H    . ALA A 1 26 ? 99.196  -5.927  -23.679 1.00 0.00 ? 26 ALA A H    2  
ATOM 1798  H HA   . ALA A 1 26 ? 101.215 -6.970  -25.283 1.00 0.00 ? 26 ALA A HA   2  
ATOM 1799  H HB1  . ALA A 1 26 ? 100.664 -4.525  -24.886 1.00 0.00 ? 26 ALA A HB1  2  
ATOM 1800  H HB2  . ALA A 1 26 ? 102.383 -4.915  -24.930 1.00 0.00 ? 26 ALA A HB2  2  
ATOM 1801  H HB3  . ALA A 1 26 ? 101.579 -4.649  -23.384 1.00 0.00 ? 26 ALA A HB3  2  
ATOM 1802  N N    . VAL A 1 27 ? 101.952 -6.989  -22.064 1.00 0.00 ? 27 VAL A N    2  
ATOM 1803  C CA   . VAL A 1 27 ? 102.831 -7.602  -21.074 1.00 0.00 ? 27 VAL A CA   2  
ATOM 1804  C C    . VAL A 1 27 ? 102.671 -9.118  -21.080 1.00 0.00 ? 27 VAL A C    2  
ATOM 1805  O O    . VAL A 1 27 ? 103.648 -9.856  -20.952 1.00 0.00 ? 27 VAL A O    2  
ATOM 1806  C CB   . VAL A 1 27 ? 102.512 -7.063  -19.677 1.00 0.00 ? 27 VAL A CB   2  
ATOM 1807  C CG1  . VAL A 1 27 ? 103.596 -7.518  -18.697 1.00 0.00 ? 27 VAL A CG1  2  
ATOM 1808  C CG2  . VAL A 1 27 ? 102.460 -5.531  -19.715 1.00 0.00 ? 27 VAL A CG2  2  
ATOM 1809  H H    . VAL A 1 27 ? 101.231 -6.391  -21.767 1.00 0.00 ? 27 VAL A H    2  
ATOM 1810  H HA   . VAL A 1 27 ? 103.854 -7.357  -21.314 1.00 0.00 ? 27 VAL A HA   2  
ATOM 1811  H HB   . VAL A 1 27 ? 101.555 -7.449  -19.355 1.00 0.00 ? 27 VAL A HB   2  
ATOM 1812  H HG11 . VAL A 1 27 ? 103.563 -8.592  -18.597 1.00 0.00 ? 27 VAL A HG11 2  
ATOM 1813  H HG12 . VAL A 1 27 ? 103.426 -7.060  -17.735 1.00 0.00 ? 27 VAL A HG12 2  
ATOM 1814  H HG13 . VAL A 1 27 ? 104.566 -7.220  -19.071 1.00 0.00 ? 27 VAL A HG13 2  
ATOM 1815  H HG21 . VAL A 1 27 ? 103.260 -5.156  -20.337 1.00 0.00 ? 27 VAL A HG21 2  
ATOM 1816  H HG22 . VAL A 1 27 ? 102.569 -5.139  -18.713 1.00 0.00 ? 27 VAL A HG22 2  
ATOM 1817  H HG23 . VAL A 1 27 ? 101.512 -5.214  -20.119 1.00 0.00 ? 27 VAL A HG23 2  
ATOM 1818  N N    . TYR A 1 28 ? 101.433 -9.576  -21.222 1.00 0.00 ? 28 TYR A N    2  
ATOM 1819  C CA   . TYR A 1 28 ? 101.153 -11.008 -21.235 1.00 0.00 ? 28 TYR A CA   2  
ATOM 1820  C C    . TYR A 1 28 ? 101.909 -11.701 -22.365 1.00 0.00 ? 28 TYR A C    2  
ATOM 1821  O O    . TYR A 1 28 ? 102.545 -12.734 -22.153 1.00 0.00 ? 28 TYR A O    2  
ATOM 1822  C CB   . TYR A 1 28 ? 99.651  -11.241 -21.405 1.00 0.00 ? 28 TYR A CB   2  
ATOM 1823  C CG   . TYR A 1 28 ? 99.364  -12.722 -21.359 1.00 0.00 ? 28 TYR A CG   2  
ATOM 1824  C CD1  . TYR A 1 28 ? 99.511  -13.501 -22.513 1.00 0.00 ? 28 TYR A CD1  2  
ATOM 1825  C CD2  . TYR A 1 28 ? 98.950  -13.317 -20.160 1.00 0.00 ? 28 TYR A CD2  2  
ATOM 1826  C CE1  . TYR A 1 28 ? 99.244  -14.875 -22.469 1.00 0.00 ? 28 TYR A CE1  2  
ATOM 1827  C CE2  . TYR A 1 28 ? 98.684  -14.691 -20.117 1.00 0.00 ? 28 TYR A CE2  2  
ATOM 1828  C CZ   . TYR A 1 28 ? 98.831  -15.470 -21.271 1.00 0.00 ? 28 TYR A CZ   2  
ATOM 1829  O OH   . TYR A 1 28 ? 98.568  -16.824 -21.228 1.00 0.00 ? 28 TYR A OH   2  
ATOM 1830  H H    . TYR A 1 28 ? 100.692 -8.940  -21.314 1.00 0.00 ? 28 TYR A H    2  
ATOM 1831  H HA   . TYR A 1 28 ? 101.465 -11.433 -20.293 1.00 0.00 ? 28 TYR A HA   2  
ATOM 1832  H HB2  . TYR A 1 28 ? 99.117  -10.745 -20.608 1.00 0.00 ? 28 TYR A HB2  2  
ATOM 1833  H HB3  . TYR A 1 28 ? 99.331  -10.844 -22.356 1.00 0.00 ? 28 TYR A HB3  2  
ATOM 1834  H HD1  . TYR A 1 28 ? 99.830  -13.042 -23.437 1.00 0.00 ? 28 TYR A HD1  2  
ATOM 1835  H HD2  . TYR A 1 28 ? 98.837  -12.717 -19.271 1.00 0.00 ? 28 TYR A HD2  2  
ATOM 1836  H HE1  . TYR A 1 28 ? 99.358  -15.475 -23.360 1.00 0.00 ? 28 TYR A HE1  2  
ATOM 1837  H HE2  . TYR A 1 28 ? 98.365  -15.150 -19.193 1.00 0.00 ? 28 TYR A HE2  2  
ATOM 1838  H HH   . TYR A 1 28 ? 99.234  -17.272 -21.754 1.00 0.00 ? 28 TYR A HH   2  
ATOM 1839  N N    . PHE A 1 29 ? 101.833 -11.134 -23.565 1.00 0.00 ? 29 PHE A N    2  
ATOM 1840  C CA   . PHE A 1 29 ? 102.513 -11.717 -24.716 1.00 0.00 ? 29 PHE A CA   2  
ATOM 1841  C C    . PHE A 1 29 ? 104.020 -11.763 -24.485 1.00 0.00 ? 29 PHE A C    2  
ATOM 1842  O O    . PHE A 1 29 ? 104.658 -12.793 -24.700 1.00 0.00 ? 29 PHE A O    2  
ATOM 1843  C CB   . PHE A 1 29 ? 102.215 -10.896 -25.973 1.00 0.00 ? 29 PHE A CB   2  
ATOM 1844  C CG   . PHE A 1 29 ? 102.813 -11.585 -27.177 1.00 0.00 ? 29 PHE A CG   2  
ATOM 1845  C CD1  . PHE A 1 29 ? 102.064 -12.532 -27.886 1.00 0.00 ? 29 PHE A CD1  2  
ATOM 1846  C CD2  . PHE A 1 29 ? 104.118 -11.278 -27.582 1.00 0.00 ? 29 PHE A CD2  2  
ATOM 1847  C CE1  . PHE A 1 29 ? 102.620 -13.172 -29.000 1.00 0.00 ? 29 PHE A CE1  2  
ATOM 1848  C CE2  . PHE A 1 29 ? 104.673 -11.919 -28.697 1.00 0.00 ? 29 PHE A CE2  2  
ATOM 1849  C CZ   . PHE A 1 29 ? 103.923 -12.865 -29.406 1.00 0.00 ? 29 PHE A CZ   2  
ATOM 1850  H H    . PHE A 1 29 ? 101.308 -10.313 -23.678 1.00 0.00 ? 29 PHE A H    2  
ATOM 1851  H HA   . PHE A 1 29 ? 102.150 -12.722 -24.864 1.00 0.00 ? 29 PHE A HA   2  
ATOM 1852  H HB2  . PHE A 1 29 ? 101.145 -10.810 -26.101 1.00 0.00 ? 29 PHE A HB2  2  
ATOM 1853  H HB3  . PHE A 1 29 ? 102.646 -9.912  -25.872 1.00 0.00 ? 29 PHE A HB3  2  
ATOM 1854  H HD1  . PHE A 1 29 ? 101.058 -12.768 -27.573 1.00 0.00 ? 29 PHE A HD1  2  
ATOM 1855  H HD2  . PHE A 1 29 ? 104.696 -10.549 -27.035 1.00 0.00 ? 29 PHE A HD2  2  
ATOM 1856  H HE1  . PHE A 1 29 ? 102.042 -13.902 -29.548 1.00 0.00 ? 29 PHE A HE1  2  
ATOM 1857  H HE2  . PHE A 1 29 ? 105.679 -11.682 -29.009 1.00 0.00 ? 29 PHE A HE2  2  
ATOM 1858  H HZ   . PHE A 1 29 ? 104.352 -13.358 -30.266 1.00 0.00 ? 29 PHE A HZ   2  
ATOM 1859  N N    . LEU A 1 30 ? 104.582 -10.642 -24.049 1.00 0.00 ? 30 LEU A N    2  
ATOM 1860  C CA   . LEU A 1 30 ? 106.016 -10.564 -23.795 1.00 0.00 ? 30 LEU A CA   2  
ATOM 1861  C C    . LEU A 1 30 ? 106.402 -11.458 -22.619 1.00 0.00 ? 30 LEU A C    2  
ATOM 1862  O O    . LEU A 1 30 ? 107.447 -12.109 -22.639 1.00 0.00 ? 30 LEU A O    2  
ATOM 1863  C CB   . LEU A 1 30 ? 106.413 -9.114  -23.490 1.00 0.00 ? 30 LEU A CB   2  
ATOM 1864  C CG   . LEU A 1 30 ? 107.949 -8.964  -23.502 1.00 0.00 ? 30 LEU A CG   2  
ATOM 1865  C CD1  . LEU A 1 30 ? 108.460 -8.780  -24.938 1.00 0.00 ? 30 LEU A CD1  2  
ATOM 1866  C CD2  . LEU A 1 30 ? 108.352 -7.740  -22.672 1.00 0.00 ? 30 LEU A CD2  2  
ATOM 1867  H H    . LEU A 1 30 ? 104.023 -9.851  -23.897 1.00 0.00 ? 30 LEU A H    2  
ATOM 1868  H HA   . LEU A 1 30 ? 106.543 -10.896 -24.674 1.00 0.00 ? 30 LEU A HA   2  
ATOM 1869  H HB2  . LEU A 1 30 ? 105.976 -8.461  -24.233 1.00 0.00 ? 30 LEU A HB2  2  
ATOM 1870  H HB3  . LEU A 1 30 ? 106.034 -8.844  -22.515 1.00 0.00 ? 30 LEU A HB3  2  
ATOM 1871  H HG   . LEU A 1 30 ? 108.401 -9.848  -23.075 1.00 0.00 ? 30 LEU A HG   2  
ATOM 1872  H HD11 . LEU A 1 30 ? 109.506 -8.514  -24.913 1.00 0.00 ? 30 LEU A HD11 2  
ATOM 1873  H HD12 . LEU A 1 30 ? 107.903 -7.992  -25.424 1.00 0.00 ? 30 LEU A HD12 2  
ATOM 1874  H HD13 . LEU A 1 30 ? 108.339 -9.699  -25.490 1.00 0.00 ? 30 LEU A HD13 2  
ATOM 1875  H HD21 . LEU A 1 30 ? 109.414 -7.570  -22.774 1.00 0.00 ? 30 LEU A HD21 2  
ATOM 1876  H HD22 . LEU A 1 30 ? 108.112 -7.914  -21.634 1.00 0.00 ? 30 LEU A HD22 2  
ATOM 1877  H HD23 . LEU A 1 30 ? 107.813 -6.873  -23.026 1.00 0.00 ? 30 LEU A HD23 2  
ATOM 1878  N N    . GLY A 1 31 ? 105.554 -11.481 -21.596 1.00 0.00 ? 31 GLY A N    2  
ATOM 1879  C CA   . GLY A 1 31 ? 105.819 -12.293 -20.414 1.00 0.00 ? 31 GLY A CA   2  
ATOM 1880  C C    . GLY A 1 31 ? 105.522 -13.765 -20.678 1.00 0.00 ? 31 GLY A C    2  
ATOM 1881  O O    . GLY A 1 31 ? 106.276 -14.447 -21.373 1.00 0.00 ? 31 GLY A O    2  
ATOM 1882  H H    . GLY A 1 31 ? 104.740 -10.939 -21.635 1.00 0.00 ? 31 GLY A H    2  
ATOM 1883  H HA2  . GLY A 1 31 ? 106.858 -12.185 -20.138 1.00 0.00 ? 31 GLY A HA2  2  
ATOM 1884  H HA3  . GLY A 1 31 ? 105.199 -11.948 -19.601 1.00 0.00 ? 31 GLY A HA3  2  
ATOM 1885  N N    . ARG A 1 32 ? 104.420 -14.250 -20.114 1.00 0.00 ? 32 ARG A N    2  
ATOM 1886  C CA   . ARG A 1 32 ? 104.032 -15.646 -20.287 1.00 0.00 ? 32 ARG A CA   2  
ATOM 1887  C C    . ARG A 1 32 ? 105.111 -16.572 -19.735 1.00 0.00 ? 32 ARG A C    2  
ATOM 1888  O O    . ARG A 1 32 ? 105.929 -17.105 -20.484 1.00 0.00 ? 32 ARG A O    2  
ATOM 1889  C CB   . ARG A 1 32 ? 103.805 -15.950 -21.770 1.00 0.00 ? 32 ARG A CB   2  
ATOM 1890  C CG   . ARG A 1 32 ? 103.080 -17.291 -21.908 1.00 0.00 ? 32 ARG A CG   2  
ATOM 1891  C CD   . ARG A 1 32 ? 102.805 -17.574 -23.386 1.00 0.00 ? 32 ARG A CD   2  
ATOM 1892  N NE   . ARG A 1 32 ? 101.861 -16.599 -23.919 1.00 0.00 ? 32 ARG A NE   2  
ATOM 1893  C CZ   . ARG A 1 32 ? 101.406 -16.692 -25.163 1.00 0.00 ? 32 ARG A CZ   2  
ATOM 1894  N NH1  . ARG A 1 32 ? 101.798 -17.674 -25.930 1.00 0.00 ? 32 ARG A NH1  2  
ATOM 1895  N NH2  . ARG A 1 32 ? 100.565 -15.805 -25.618 1.00 0.00 ? 32 ARG A NH2  2  
ATOM 1896  H H    . ARG A 1 32 ? 103.860 -13.660 -19.567 1.00 0.00 ? 32 ARG A H    2  
ATOM 1897  H HA   . ARG A 1 32 ? 103.112 -15.822 -19.751 1.00 0.00 ? 32 ARG A HA   2  
ATOM 1898  H HB2  . ARG A 1 32 ? 103.203 -15.168 -22.209 1.00 0.00 ? 32 ARG A HB2  2  
ATOM 1899  H HB3  . ARG A 1 32 ? 104.755 -16.003 -22.278 1.00 0.00 ? 32 ARG A HB3  2  
ATOM 1900  H HG2  . ARG A 1 32 ? 103.698 -18.077 -21.499 1.00 0.00 ? 32 ARG A HG2  2  
ATOM 1901  H HG3  . ARG A 1 32 ? 102.144 -17.252 -21.371 1.00 0.00 ? 32 ARG A HG3  2  
ATOM 1902  H HD2  . ARG A 1 32 ? 103.729 -17.515 -23.940 1.00 0.00 ? 32 ARG A HD2  2  
ATOM 1903  H HD3  . ARG A 1 32 ? 102.392 -18.568 -23.488 1.00 0.00 ? 32 ARG A HD3  2  
ATOM 1904  H HE   . ARG A 1 32 ? 101.559 -15.861 -23.350 1.00 0.00 ? 32 ARG A HE   2  
ATOM 1905  H HH11 . ARG A 1 32 ? 102.441 -18.354 -25.581 1.00 0.00 ? 32 ARG A HH11 2  
ATOM 1906  H HH12 . ARG A 1 32 ? 101.455 -17.743 -26.867 1.00 0.00 ? 32 ARG A HH12 2  
ATOM 1907  H HH21 . ARG A 1 32 ? 100.264 -15.053 -25.030 1.00 0.00 ? 32 ARG A HH21 2  
ATOM 1908  H HH22 . ARG A 1 32 ? 100.222 -15.874 -26.555 1.00 0.00 ? 32 ARG A HH22 2  
ATOM 1909  N N    . LEU A 1 33 ? 105.105 -16.757 -18.419 1.00 0.00 ? 33 LEU A N    2  
ATOM 1910  C CA   . LEU A 1 33 ? 106.088 -17.621 -17.771 1.00 0.00 ? 33 LEU A CA   2  
ATOM 1911  C C    . LEU A 1 33 ? 107.504 -17.177 -18.128 1.00 0.00 ? 33 LEU A C    2  
ATOM 1912  O O    . LEU A 1 33 ? 107.695 -16.219 -18.876 1.00 0.00 ? 33 LEU A O    2  
ATOM 1913  C CB   . LEU A 1 33 ? 105.876 -19.077 -18.208 1.00 0.00 ? 33 LEU A CB   2  
ATOM 1914  C CG   . LEU A 1 33 ? 104.679 -19.678 -17.461 1.00 0.00 ? 33 LEU A CG   2  
ATOM 1915  C CD1  . LEU A 1 33 ? 103.414 -18.869 -17.769 1.00 0.00 ? 33 LEU A CD1  2  
ATOM 1916  C CD2  . LEU A 1 33 ? 104.483 -21.129 -17.907 1.00 0.00 ? 33 LEU A CD2  2  
ATOM 1917  H H    . LEU A 1 33 ? 104.429 -16.305 -17.873 1.00 0.00 ? 33 LEU A H    2  
ATOM 1918  H HA   . LEU A 1 33 ? 105.961 -17.554 -16.701 1.00 0.00 ? 33 LEU A HA   2  
ATOM 1919  H HB2  . LEU A 1 33 ? 105.687 -19.109 -19.271 1.00 0.00 ? 33 LEU A HB2  2  
ATOM 1920  H HB3  . LEU A 1 33 ? 106.760 -19.655 -17.984 1.00 0.00 ? 33 LEU A HB3  2  
ATOM 1921  H HG   . LEU A 1 33 ? 104.871 -19.650 -16.397 1.00 0.00 ? 33 LEU A HG   2  
ATOM 1922  H HD11 . LEU A 1 33 ? 102.541 -19.449 -17.508 1.00 0.00 ? 33 LEU A HD11 2  
ATOM 1923  H HD12 . LEU A 1 33 ? 103.385 -18.632 -18.823 1.00 0.00 ? 33 LEU A HD12 2  
ATOM 1924  H HD13 . LEU A 1 33 ? 103.422 -17.955 -17.195 1.00 0.00 ? 33 LEU A HD13 2  
ATOM 1925  H HD21 . LEU A 1 33 ? 104.437 -21.170 -18.986 1.00 0.00 ? 33 LEU A HD21 2  
ATOM 1926  H HD22 . LEU A 1 33 ? 103.561 -21.511 -17.492 1.00 0.00 ? 33 LEU A HD22 2  
ATOM 1927  H HD23 . LEU A 1 33 ? 105.310 -21.728 -17.558 1.00 0.00 ? 33 LEU A HD23 2  
ATOM 1928  N N    . GLY A 1 34 ? 108.493 -17.881 -17.585 1.00 0.00 ? 34 GLY A N    2  
ATOM 1929  C CA   . GLY A 1 34 ? 109.891 -17.554 -17.849 1.00 0.00 ? 34 GLY A CA   2  
ATOM 1930  C C    . GLY A 1 34 ? 110.367 -16.425 -16.942 1.00 0.00 ? 34 GLY A C    2  
ATOM 1931  O O    . GLY A 1 34 ? 111.514 -15.989 -17.028 1.00 0.00 ? 34 GLY A O    2  
ATOM 1932  H H    . GLY A 1 34 ? 108.280 -18.635 -16.996 1.00 0.00 ? 34 GLY A H    2  
ATOM 1933  H HA2  . GLY A 1 34 ? 110.499 -18.431 -17.676 1.00 0.00 ? 34 GLY A HA2  2  
ATOM 1934  H HA3  . GLY A 1 34 ? 109.997 -17.246 -18.879 1.00 0.00 ? 34 GLY A HA3  2  
ATOM 1935  N N    . THR A 1 35 ? 109.477 -15.956 -16.070 1.00 0.00 ? 35 THR A N    2  
ATOM 1936  C CA   . THR A 1 35 ? 109.813 -14.874 -15.145 1.00 0.00 ? 35 THR A CA   2  
ATOM 1937  C C    . THR A 1 35 ? 108.981 -14.983 -13.871 1.00 0.00 ? 35 THR A C    2  
ATOM 1938  O O    . THR A 1 35 ? 109.165 -14.209 -12.931 1.00 0.00 ? 35 THR A O    2  
ATOM 1939  C CB   . THR A 1 35 ? 109.556 -13.518 -15.808 1.00 0.00 ? 35 THR A CB   2  
ATOM 1940  O OG1  . THR A 1 35 ? 108.197 -13.443 -16.214 1.00 0.00 ? 35 THR A OG1  2  
ATOM 1941  C CG2  . THR A 1 35 ? 110.466 -13.359 -17.027 1.00 0.00 ? 35 THR A CG2  2  
ATOM 1942  H H    . THR A 1 35 ? 108.577 -16.344 -16.047 1.00 0.00 ? 35 THR A H    2  
ATOM 1943  H HA   . THR A 1 35 ? 110.859 -14.942 -14.884 1.00 0.00 ? 35 THR A HA   2  
ATOM 1944  H HB   . THR A 1 35 ? 109.765 -12.728 -15.103 1.00 0.00 ? 35 THR A HB   2  
ATOM 1945  H HG1  . THR A 1 35 ? 107.669 -13.215 -15.446 1.00 0.00 ? 35 THR A HG1  2  
ATOM 1946  H HG21 . THR A 1 35 ? 111.473 -13.646 -16.765 1.00 0.00 ? 35 THR A HG21 2  
ATOM 1947  H HG22 . THR A 1 35 ? 110.458 -12.328 -17.349 1.00 0.00 ? 35 THR A HG22 2  
ATOM 1948  H HG23 . THR A 1 35 ? 110.109 -13.988 -17.829 1.00 0.00 ? 35 THR A HG23 2  
ATOM 1949  N N    . ALA A 1 36 ? 108.064 -15.944 -13.849 1.00 0.00 ? 36 ALA A N    2  
ATOM 1950  C CA   . ALA A 1 36 ? 107.206 -16.142 -12.686 1.00 0.00 ? 36 ALA A CA   2  
ATOM 1951  C C    . ALA A 1 36 ? 106.641 -14.810 -12.203 1.00 0.00 ? 36 ALA A C    2  
ATOM 1952  O O    . ALA A 1 36 ? 106.642 -13.821 -12.936 1.00 0.00 ? 36 ALA A O    2  
ATOM 1953  C CB   . ALA A 1 36 ? 108.000 -16.801 -11.556 1.00 0.00 ? 36 ALA A CB   2  
ATOM 1954  H H    . ALA A 1 36 ? 107.961 -16.530 -14.628 1.00 0.00 ? 36 ALA A H    2  
ATOM 1955  H HA   . ALA A 1 36 ? 106.388 -16.790 -12.961 1.00 0.00 ? 36 ALA A HA   2  
ATOM 1956  H HB1  . ALA A 1 36 ? 108.494 -17.685 -11.932 1.00 0.00 ? 36 ALA A HB1  2  
ATOM 1957  H HB2  . ALA A 1 36 ? 107.328 -17.077 -10.757 1.00 0.00 ? 36 ALA A HB2  2  
ATOM 1958  H HB3  . ALA A 1 36 ? 108.738 -16.108 -11.182 1.00 0.00 ? 36 ALA A HB3  2  
ATOM 1959  N N    . GLU A 1 37 ? 106.158 -14.792 -10.964 1.00 0.00 ? 37 GLU A N    2  
ATOM 1960  C CA   . GLU A 1 37 ? 105.591 -13.576 -10.393 1.00 0.00 ? 37 GLU A CA   2  
ATOM 1961  C C    . GLU A 1 37 ? 104.496 -13.022 -11.299 1.00 0.00 ? 37 GLU A C    2  
ATOM 1962  O O    . GLU A 1 37 ? 104.281 -11.813 -11.367 1.00 0.00 ? 37 GLU A O    2  
ATOM 1963  C CB   . GLU A 1 37 ? 106.687 -12.524 -10.207 1.00 0.00 ? 37 GLU A CB   2  
ATOM 1964  C CG   . GLU A 1 37 ? 107.815 -13.109 -9.354  1.00 0.00 ? 37 GLU A CG   2  
ATOM 1965  C CD   . GLU A 1 37 ? 107.303 -13.420 -7.952  1.00 0.00 ? 37 GLU A CD   2  
ATOM 1966  O OE1  . GLU A 1 37 ? 106.281 -12.867 -7.579  1.00 0.00 ? 37 GLU A OE1  2  
ATOM 1967  O OE2  . GLU A 1 37 ? 107.939 -14.207 -7.270  1.00 0.00 ? 37 GLU A OE2  2  
ATOM 1968  H H    . GLU A 1 37 ? 106.184 -15.610 -10.425 1.00 0.00 ? 37 GLU A H    2  
ATOM 1969  H HA   . GLU A 1 37 ? 105.164 -13.808 -9.429  1.00 0.00 ? 37 GLU A HA   2  
ATOM 1970  H HB2  . GLU A 1 37 ? 107.077 -12.237 -11.173 1.00 0.00 ? 37 GLU A HB2  2  
ATOM 1971  H HB3  . GLU A 1 37 ? 106.275 -11.658 -9.712  1.00 0.00 ? 37 GLU A HB3  2  
ATOM 1972  H HG2  . GLU A 1 37 ? 108.178 -14.018 -9.813  1.00 0.00 ? 37 GLU A HG2  2  
ATOM 1973  H HG3  . GLU A 1 37 ? 108.622 -12.395 -9.289  1.00 0.00 ? 37 GLU A HG3  2  
ATOM 1974  N N    . VAL A 1 38 ? 103.806 -13.923 -11.991 1.00 0.00 ? 38 VAL A N    2  
ATOM 1975  C CA   . VAL A 1 38 ? 102.730 -13.529 -12.894 1.00 0.00 ? 38 VAL A CA   2  
ATOM 1976  C C    . VAL A 1 38 ? 101.592 -12.865 -12.123 1.00 0.00 ? 38 VAL A C    2  
ATOM 1977  O O    . VAL A 1 38 ? 100.808 -12.103 -12.688 1.00 0.00 ? 38 VAL A O    2  
ATOM 1978  C CB   . VAL A 1 38 ? 102.197 -14.757 -13.634 1.00 0.00 ? 38 VAL A CB   2  
ATOM 1979  C CG1  . VAL A 1 38 ? 103.255 -15.258 -14.619 1.00 0.00 ? 38 VAL A CG1  2  
ATOM 1980  C CG2  . VAL A 1 38 ? 101.878 -15.863 -12.625 1.00 0.00 ? 38 VAL A CG2  2  
ATOM 1981  H H    . VAL A 1 38 ? 104.024 -14.873 -11.893 1.00 0.00 ? 38 VAL A H    2  
ATOM 1982  H HA   . VAL A 1 38 ? 103.119 -12.830 -13.618 1.00 0.00 ? 38 VAL A HA   2  
ATOM 1983  H HB   . VAL A 1 38 ? 101.300 -14.490 -14.175 1.00 0.00 ? 38 VAL A HB   2  
ATOM 1984  H HG11 . VAL A 1 38 ? 102.926 -16.189 -15.058 1.00 0.00 ? 38 VAL A HG11 2  
ATOM 1985  H HG12 . VAL A 1 38 ? 104.186 -15.415 -14.098 1.00 0.00 ? 38 VAL A HG12 2  
ATOM 1986  H HG13 . VAL A 1 38 ? 103.397 -14.523 -15.398 1.00 0.00 ? 38 VAL A HG13 2  
ATOM 1987  H HG21 . VAL A 1 38 ? 102.800 -16.286 -12.252 1.00 0.00 ? 38 VAL A HG21 2  
ATOM 1988  H HG22 . VAL A 1 38 ? 101.297 -16.634 -13.108 1.00 0.00 ? 38 VAL A HG22 2  
ATOM 1989  H HG23 . VAL A 1 38 ? 101.314 -15.447 -11.803 1.00 0.00 ? 38 VAL A HG23 2  
ATOM 1990  N N    . LEU A 1 39 ? 101.505 -13.172 -10.834 1.00 0.00 ? 39 LEU A N    2  
ATOM 1991  C CA   . LEU A 1 39 ? 100.453 -12.616 -9.988  1.00 0.00 ? 39 LEU A CA   2  
ATOM 1992  C C    . LEU A 1 39 ? 100.268 -11.122 -10.249 1.00 0.00 ? 39 LEU A C    2  
ATOM 1993  O O    . LEU A 1 39 ? 99.177  -10.586 -10.063 1.00 0.00 ? 39 LEU A O    2  
ATOM 1994  C CB   . LEU A 1 39 ? 100.807 -12.850 -8.513  1.00 0.00 ? 39 LEU A CB   2  
ATOM 1995  C CG   . LEU A 1 39 ? 99.735  -12.245 -7.591  1.00 0.00 ? 39 LEU A CG   2  
ATOM 1996  C CD1  . LEU A 1 39 ? 98.356  -12.846 -7.909  1.00 0.00 ? 39 LEU A CD1  2  
ATOM 1997  C CD2  . LEU A 1 39 ? 100.105 -12.553 -6.136  1.00 0.00 ? 39 LEU A CD2  2  
ATOM 1998  H H    . LEU A 1 39 ? 102.155 -13.793 -10.444 1.00 0.00 ? 39 LEU A H    2  
ATOM 1999  H HA   . LEU A 1 39 ? 99.529  -13.127 -10.209 1.00 0.00 ? 39 LEU A HA   2  
ATOM 2000  H HB2  . LEU A 1 39 ? 100.877 -13.912 -8.328  1.00 0.00 ? 39 LEU A HB2  2  
ATOM 2001  H HB3  . LEU A 1 39 ? 101.760 -12.389 -8.299  1.00 0.00 ? 39 LEU A HB3  2  
ATOM 2002  H HG   . LEU A 1 39 ? 99.700  -11.175 -7.732  1.00 0.00 ? 39 LEU A HG   2  
ATOM 2003  H HD11 . LEU A 1 39 ? 97.707  -12.745 -7.051  1.00 0.00 ? 39 LEU A HD11 2  
ATOM 2004  H HD12 . LEU A 1 39 ? 98.462  -13.893 -8.157  1.00 0.00 ? 39 LEU A HD12 2  
ATOM 2005  H HD13 . LEU A 1 39 ? 97.921  -12.321 -8.748  1.00 0.00 ? 39 LEU A HD13 2  
ATOM 2006  H HD21 . LEU A 1 39 ? 99.265  -12.326 -5.496  1.00 0.00 ? 39 LEU A HD21 2  
ATOM 2007  H HD22 . LEU A 1 39 ? 100.952 -11.950 -5.845  1.00 0.00 ? 39 LEU A HD22 2  
ATOM 2008  H HD23 . LEU A 1 39 ? 100.357 -13.598 -6.042  1.00 0.00 ? 39 LEU A HD23 2  
ATOM 2009  N N    . GLY A 1 40 ? 101.335 -10.454 -10.676 1.00 0.00 ? 40 GLY A N    2  
ATOM 2010  C CA   . GLY A 1 40 ? 101.261 -9.020  -10.953 1.00 0.00 ? 40 GLY A CA   2  
ATOM 2011  C C    . GLY A 1 40 ? 100.243 -8.725  -12.053 1.00 0.00 ? 40 GLY A C    2  
ATOM 2012  O O    . GLY A 1 40 ? 99.380  -7.856  -11.903 1.00 0.00 ? 40 GLY A O    2  
ATOM 2013  H H    . GLY A 1 40 ? 102.182 -10.927 -10.806 1.00 0.00 ? 40 GLY A H    2  
ATOM 2014  H HA2  . GLY A 1 40 ? 100.970 -8.500  -10.051 1.00 0.00 ? 40 GLY A HA2  2  
ATOM 2015  H HA3  . GLY A 1 40 ? 102.231 -8.670  -11.267 1.00 0.00 ? 40 GLY A HA3  2  
ATOM 2016  N N    . ILE A 1 41 ? 100.348 -9.456  -13.157 1.00 0.00 ? 41 ILE A N    2  
ATOM 2017  C CA   . ILE A 1 41 ? 99.431  -9.267  -14.277 1.00 0.00 ? 41 ILE A CA   2  
ATOM 2018  C C    . ILE A 1 41 ? 97.986  -9.420  -13.801 1.00 0.00 ? 41 ILE A C    2  
ATOM 2019  O O    . ILE A 1 41 ? 97.130  -8.578  -14.083 1.00 0.00 ? 41 ILE A O    2  
ATOM 2020  C CB   . ILE A 1 41 ? 99.737  -10.289 -15.384 1.00 0.00 ? 41 ILE A CB   2  
ATOM 2021  C CG1  . ILE A 1 41 ? 101.054 -9.916  -16.079 1.00 0.00 ? 41 ILE A CG1  2  
ATOM 2022  C CG2  . ILE A 1 41 ? 98.610  -10.291 -16.422 1.00 0.00 ? 41 ILE A CG2  2  
ATOM 2023  C CD1  . ILE A 1 41 ? 102.231 -10.058 -15.108 1.00 0.00 ? 41 ILE A CD1  2  
ATOM 2024  H H    . ILE A 1 41 ? 101.053 -10.134 -13.219 1.00 0.00 ? 41 ILE A H    2  
ATOM 2025  H HA   . ILE A 1 41 ? 99.566  -8.272  -14.675 1.00 0.00 ? 41 ILE A HA   2  
ATOM 2026  H HB   . ILE A 1 41 ? 99.824  -11.273 -14.948 1.00 0.00 ? 41 ILE A HB   2  
ATOM 2027  H HG12 . ILE A 1 41 ? 101.208 -10.570 -16.925 1.00 0.00 ? 41 ILE A HG12 2  
ATOM 2028  H HG13 . ILE A 1 41 ? 100.999 -8.894  -16.424 1.00 0.00 ? 41 ILE A HG13 2  
ATOM 2029  H HG21 . ILE A 1 41 ? 98.937  -10.814 -17.310 1.00 0.00 ? 41 ILE A HG21 2  
ATOM 2030  H HG22 . ILE A 1 41 ? 98.354  -9.273  -16.678 1.00 0.00 ? 41 ILE A HG22 2  
ATOM 2031  H HG23 . ILE A 1 41 ? 97.744  -10.788 -16.013 1.00 0.00 ? 41 ILE A HG23 2  
ATOM 2032  H HD11 . ILE A 1 41 ? 102.308 -9.168  -14.502 1.00 0.00 ? 41 ILE A HD11 2  
ATOM 2033  H HD12 . ILE A 1 41 ? 103.144 -10.188 -15.669 1.00 0.00 ? 41 ILE A HD12 2  
ATOM 2034  H HD13 . ILE A 1 41 ? 102.079 -10.916 -14.470 1.00 0.00 ? 41 ILE A HD13 2  
ATOM 2035  N N    . ILE A 1 42 ? 97.722  -10.495 -13.072 1.00 0.00 ? 42 ILE A N    2  
ATOM 2036  C CA   . ILE A 1 42 ? 96.382  -10.739 -12.561 1.00 0.00 ? 42 ILE A CA   2  
ATOM 2037  C C    . ILE A 1 42 ? 95.965  -9.605  -11.628 1.00 0.00 ? 42 ILE A C    2  
ATOM 2038  O O    . ILE A 1 42 ? 94.787  -9.278  -11.528 1.00 0.00 ? 42 ILE A O    2  
ATOM 2039  C CB   . ILE A 1 42 ? 96.341  -12.080 -11.812 1.00 0.00 ? 42 ILE A CB   2  
ATOM 2040  C CG1  . ILE A 1 42 ? 96.470  -13.235 -12.815 1.00 0.00 ? 42 ILE A CG1  2  
ATOM 2041  C CG2  . ILE A 1 42 ? 95.011  -12.219 -11.063 1.00 0.00 ? 42 ILE A CG2  2  
ATOM 2042  C CD1  . ILE A 1 42 ? 97.861  -13.231 -13.463 1.00 0.00 ? 42 ILE A CD1  2  
ATOM 2043  H H    . ILE A 1 42 ? 98.439  -11.132 -12.872 1.00 0.00 ? 42 ILE A H    2  
ATOM 2044  H HA   . ILE A 1 42 ? 95.692  -10.781 -13.391 1.00 0.00 ? 42 ILE A HA   2  
ATOM 2045  H HB   . ILE A 1 42 ? 97.156  -12.121 -11.104 1.00 0.00 ? 42 ILE A HB   2  
ATOM 2046  H HG12 . ILE A 1 42 ? 96.320  -14.172 -12.299 1.00 0.00 ? 42 ILE A HG12 2  
ATOM 2047  H HG13 . ILE A 1 42 ? 95.720  -13.125 -13.583 1.00 0.00 ? 42 ILE A HG13 2  
ATOM 2048  H HG21 . ILE A 1 42 ? 94.198  -11.940 -11.717 1.00 0.00 ? 42 ILE A HG21 2  
ATOM 2049  H HG22 . ILE A 1 42 ? 95.016  -11.572 -10.198 1.00 0.00 ? 42 ILE A HG22 2  
ATOM 2050  H HG23 . ILE A 1 42 ? 94.883  -13.243 -10.745 1.00 0.00 ? 42 ILE A HG23 2  
ATOM 2051  H HD11 . ILE A 1 42 ? 98.094  -14.225 -13.815 1.00 0.00 ? 42 ILE A HD11 2  
ATOM 2052  H HD12 . ILE A 1 42 ? 98.604  -12.927 -12.739 1.00 0.00 ? 42 ILE A HD12 2  
ATOM 2053  H HD13 . ILE A 1 42 ? 97.868  -12.546 -14.297 1.00 0.00 ? 42 ILE A HD13 2  
ATOM 2054  N N    . SER A 1 43 ? 96.940  -9.020  -10.940 1.00 0.00 ? 43 SER A N    2  
ATOM 2055  C CA   . SER A 1 43 ? 96.661  -7.932  -10.006 1.00 0.00 ? 43 SER A CA   2  
ATOM 2056  C C    . SER A 1 43 ? 96.063  -6.722  -10.721 1.00 0.00 ? 43 SER A C    2  
ATOM 2057  O O    . SER A 1 43 ? 95.034  -6.192  -10.299 1.00 0.00 ? 43 SER A O    2  
ATOM 2058  C CB   . SER A 1 43 ? 97.948  -7.521  -9.288  1.00 0.00 ? 43 SER A CB   2  
ATOM 2059  O OG   . SER A 1 43 ? 97.616  -6.824  -8.094  1.00 0.00 ? 43 SER A OG   2  
ATOM 2060  H H    . SER A 1 43 ? 97.862  -9.328  -11.055 1.00 0.00 ? 43 SER A H    2  
ATOM 2061  H HA   . SER A 1 43 ? 95.955  -8.283  -9.270  1.00 0.00 ? 43 SER A HA   2  
ATOM 2062  H HB2  . SER A 1 43 ? 98.520  -8.399  -9.037  1.00 0.00 ? 43 SER A HB2  2  
ATOM 2063  H HB3  . SER A 1 43 ? 98.537  -6.884  -9.936  1.00 0.00 ? 43 SER A HB3  2  
ATOM 2064  H HG   . SER A 1 43 ? 97.237  -7.455  -7.477  1.00 0.00 ? 43 SER A HG   2  
ATOM 2065  N N    . ILE A 1 44 ? 96.714  -6.275  -11.792 1.00 0.00 ? 44 ILE A N    2  
ATOM 2066  C CA   . ILE A 1 44 ? 96.221  -5.113  -12.530 1.00 0.00 ? 44 ILE A CA   2  
ATOM 2067  C C    . ILE A 1 44 ? 94.880  -5.414  -13.201 1.00 0.00 ? 44 ILE A C    2  
ATOM 2068  O O    . ILE A 1 44 ? 94.005  -4.549  -13.285 1.00 0.00 ? 44 ILE A O    2  
ATOM 2069  C CB   . ILE A 1 44 ? 97.251  -4.670  -13.575 1.00 0.00 ? 44 ILE A CB   2  
ATOM 2070  C CG1  . ILE A 1 44 ? 97.680  -5.869  -14.422 1.00 0.00 ? 44 ILE A CG1  2  
ATOM 2071  C CG2  . ILE A 1 44 ? 98.473  -4.093  -12.858 1.00 0.00 ? 44 ILE A CG2  2  
ATOM 2072  C CD1  . ILE A 1 44 ? 98.523  -5.397  -15.612 1.00 0.00 ? 44 ILE A CD1  2  
ATOM 2073  H H    . ILE A 1 44 ? 97.537  -6.725  -12.083 1.00 0.00 ? 44 ILE A H    2  
ATOM 2074  H HA   . ILE A 1 44 ? 96.078  -4.303  -11.830 1.00 0.00 ? 44 ILE A HA   2  
ATOM 2075  H HB   . ILE A 1 44 ? 96.816  -3.912  -14.210 1.00 0.00 ? 44 ILE A HB   2  
ATOM 2076  H HG12 . ILE A 1 44 ? 98.263  -6.544  -13.815 1.00 0.00 ? 44 ILE A HG12 2  
ATOM 2077  H HG13 . ILE A 1 44 ? 96.805  -6.379  -14.789 1.00 0.00 ? 44 ILE A HG13 2  
ATOM 2078  H HG21 . ILE A 1 44 ? 98.218  -3.139  -12.424 1.00 0.00 ? 44 ILE A HG21 2  
ATOM 2079  H HG22 . ILE A 1 44 ? 99.279  -3.964  -13.564 1.00 0.00 ? 44 ILE A HG22 2  
ATOM 2080  H HG23 . ILE A 1 44 ? 98.785  -4.771  -12.078 1.00 0.00 ? 44 ILE A HG23 2  
ATOM 2081  H HD11 . ILE A 1 44 ? 97.873  -5.012  -16.383 1.00 0.00 ? 44 ILE A HD11 2  
ATOM 2082  H HD12 . ILE A 1 44 ? 99.088  -6.231  -16.005 1.00 0.00 ? 44 ILE A HD12 2  
ATOM 2083  H HD13 . ILE A 1 44 ? 99.205  -4.622  -15.294 1.00 0.00 ? 44 ILE A HD13 2  
ATOM 2084  N N    . VAL A 1 45 ? 94.708  -6.642  -13.674 1.00 0.00 ? 45 VAL A N    2  
ATOM 2085  C CA   . VAL A 1 45 ? 93.455  -7.013  -14.322 1.00 0.00 ? 45 VAL A CA   2  
ATOM 2086  C C    . VAL A 1 45 ? 92.308  -7.013  -13.308 1.00 0.00 ? 45 VAL A C    2  
ATOM 2087  O O    . VAL A 1 45 ? 91.190  -6.592  -13.617 1.00 0.00 ? 45 VAL A O    2  
ATOM 2088  C CB   . VAL A 1 45 ? 93.586  -8.400  -14.962 1.00 0.00 ? 45 VAL A CB   2  
ATOM 2089  C CG1  . VAL A 1 45 ? 92.220  -8.866  -15.475 1.00 0.00 ? 45 VAL A CG1  2  
ATOM 2090  C CG2  . VAL A 1 45 ? 94.566  -8.327  -16.135 1.00 0.00 ? 45 VAL A CG2  2  
ATOM 2091  H H    . VAL A 1 45 ? 95.429  -7.306  -13.585 1.00 0.00 ? 45 VAL A H    2  
ATOM 2092  H HA   . VAL A 1 45 ? 93.237  -6.292  -15.095 1.00 0.00 ? 45 VAL A HA   2  
ATOM 2093  H HB   . VAL A 1 45 ? 93.952  -9.102  -14.228 1.00 0.00 ? 45 VAL A HB   2  
ATOM 2094  H HG11 . VAL A 1 45 ? 91.743  -8.060  -16.012 1.00 0.00 ? 45 VAL A HG11 2  
ATOM 2095  H HG12 . VAL A 1 45 ? 91.602  -9.159  -14.640 1.00 0.00 ? 45 VAL A HG12 2  
ATOM 2096  H HG13 . VAL A 1 45 ? 92.352  -9.710  -16.137 1.00 0.00 ? 45 VAL A HG13 2  
ATOM 2097  H HG21 . VAL A 1 45 ? 94.254  -7.551  -16.817 1.00 0.00 ? 45 VAL A HG21 2  
ATOM 2098  H HG22 . VAL A 1 45 ? 94.582  -9.275  -16.652 1.00 0.00 ? 45 VAL A HG22 2  
ATOM 2099  H HG23 . VAL A 1 45 ? 95.555  -8.104  -15.765 1.00 0.00 ? 45 VAL A HG23 2  
ATOM 2100  N N    . LEU A 1 46 ? 92.591  -7.505  -12.107 1.00 0.00 ? 46 LEU A N    2  
ATOM 2101  C CA   . LEU A 1 46 ? 91.579  -7.584  -11.054 1.00 0.00 ? 46 LEU A CA   2  
ATOM 2102  C C    . LEU A 1 46 ? 91.164  -6.194  -10.556 1.00 0.00 ? 46 LEU A C    2  
ATOM 2103  O O    . LEU A 1 46 ? 89.975  -5.928  -10.372 1.00 0.00 ? 46 LEU A O    2  
ATOM 2104  C CB   . LEU A 1 46 ? 92.128  -8.425  -9.880  1.00 0.00 ? 46 LEU A CB   2  
ATOM 2105  C CG   . LEU A 1 46 ? 91.001  -9.208  -9.190  1.00 0.00 ? 46 LEU A CG   2  
ATOM 2106  C CD1  . LEU A 1 46 ? 91.563  -9.922  -7.958  1.00 0.00 ? 46 LEU A CD1  2  
ATOM 2107  C CD2  . LEU A 1 46 ? 89.882  -8.250  -8.764  1.00 0.00 ? 46 LEU A CD2  2  
ATOM 2108  H H    . LEU A 1 46 ? 93.495  -7.838  -11.927 1.00 0.00 ? 46 LEU A H    2  
ATOM 2109  H HA   . LEU A 1 46 ? 90.709  -8.078  -11.459 1.00 0.00 ? 46 LEU A HA   2  
ATOM 2110  H HB2  . LEU A 1 46 ? 92.855  -9.124  -10.257 1.00 0.00 ? 46 LEU A HB2  2  
ATOM 2111  H HB3  . LEU A 1 46 ? 92.605  -7.777  -9.157  1.00 0.00 ? 46 LEU A HB3  2  
ATOM 2112  H HG   . LEU A 1 46 ? 90.605  -9.942  -9.877  1.00 0.00 ? 46 LEU A HG   2  
ATOM 2113  H HD11 . LEU A 1 46 ? 91.951  -9.192  -7.263  1.00 0.00 ? 46 LEU A HD11 2  
ATOM 2114  H HD12 . LEU A 1 46 ? 92.357  -10.589 -8.261  1.00 0.00 ? 46 LEU A HD12 2  
ATOM 2115  H HD13 . LEU A 1 46 ? 90.778  -10.492 -7.482  1.00 0.00 ? 46 LEU A HD13 2  
ATOM 2116  H HD21 . LEU A 1 46 ? 89.264  -8.025  -9.617  1.00 0.00 ? 46 LEU A HD21 2  
ATOM 2117  H HD22 . LEU A 1 46 ? 90.311  -7.337  -8.376  1.00 0.00 ? 46 LEU A HD22 2  
ATOM 2118  H HD23 . LEU A 1 46 ? 89.277  -8.715  -7.998  1.00 0.00 ? 46 LEU A HD23 2  
ATOM 2119  N N    . VAL A 1 47 ? 92.135  -5.311  -10.324 1.00 0.00 ? 47 VAL A N    2  
ATOM 2120  C CA   . VAL A 1 47 ? 91.813  -3.978  -9.826  1.00 0.00 ? 47 VAL A CA   2  
ATOM 2121  C C    . VAL A 1 47 ? 91.104  -3.156  -10.897 1.00 0.00 ? 47 VAL A C    2  
ATOM 2122  O O    . VAL A 1 47 ? 90.305  -2.277  -10.581 1.00 0.00 ? 47 VAL A O    2  
ATOM 2123  C CB   . VAL A 1 47 ? 93.083  -3.258  -9.334  1.00 0.00 ? 47 VAL A CB   2  
ATOM 2124  C CG1  . VAL A 1 47 ? 93.874  -2.691  -10.515 1.00 0.00 ? 47 VAL A CG1  2  
ATOM 2125  C CG2  . VAL A 1 47 ? 92.690  -2.110  -8.398  1.00 0.00 ? 47 VAL A CG2  2  
ATOM 2126  H H    . VAL A 1 47 ? 93.071  -5.558  -10.477 1.00 0.00 ? 47 VAL A H    2  
ATOM 2127  H HA   . VAL A 1 47 ? 91.139  -4.090  -8.989  1.00 0.00 ? 47 VAL A HA   2  
ATOM 2128  H HB   . VAL A 1 47 ? 93.703  -3.961  -8.796  1.00 0.00 ? 47 VAL A HB   2  
ATOM 2129  H HG11 . VAL A 1 47 ? 94.855  -2.389  -10.178 1.00 0.00 ? 47 VAL A HG11 2  
ATOM 2130  H HG12 . VAL A 1 47 ? 93.354  -1.836  -10.922 1.00 0.00 ? 47 VAL A HG12 2  
ATOM 2131  H HG13 . VAL A 1 47 ? 93.972  -3.447  -11.272 1.00 0.00 ? 47 VAL A HG13 2  
ATOM 2132  H HG21 . VAL A 1 47 ? 91.949  -1.491  -8.880  1.00 0.00 ? 47 VAL A HG21 2  
ATOM 2133  H HG22 . VAL A 1 47 ? 93.564  -1.516  -8.171  1.00 0.00 ? 47 VAL A HG22 2  
ATOM 2134  H HG23 . VAL A 1 47 ? 92.283  -2.515  -7.484  1.00 0.00 ? 47 VAL A HG23 2  
ATOM 2135  N N    . ALA A 1 48 ? 91.391  -3.446  -12.162 1.00 0.00 ? 48 ALA A N    2  
ATOM 2136  C CA   . ALA A 1 48 ? 90.755  -2.716  -13.251 1.00 0.00 ? 48 ALA A CA   2  
ATOM 2137  C C    . ALA A 1 48 ? 89.282  -3.088  -13.363 1.00 0.00 ? 48 ALA A C    2  
ATOM 2138  O O    . ALA A 1 48 ? 88.415  -2.218  -13.392 1.00 0.00 ? 48 ALA A O    2  
ATOM 2139  C CB   . ALA A 1 48 ? 91.458  -3.024  -14.572 1.00 0.00 ? 48 ALA A CB   2  
ATOM 2140  H H    . ALA A 1 48 ? 92.039  -4.158  -12.366 1.00 0.00 ? 48 ALA A H    2  
ATOM 2141  H HA   . ALA A 1 48 ? 90.826  -1.660  -13.054 1.00 0.00 ? 48 ALA A HA   2  
ATOM 2142  H HB1  . ALA A 1 48 ? 92.527  -2.992  -14.428 1.00 0.00 ? 48 ALA A HB1  2  
ATOM 2143  H HB2  . ALA A 1 48 ? 91.171  -2.289  -15.309 1.00 0.00 ? 48 ALA A HB2  2  
ATOM 2144  H HB3  . ALA A 1 48 ? 91.169  -4.007  -14.913 1.00 0.00 ? 48 ALA A HB3  2  
ATOM 2145  N N    . THR A 1 49 ? 89.002  -4.383  -13.429 1.00 0.00 ? 49 THR A N    2  
ATOM 2146  C CA   . THR A 1 49 ? 87.623  -4.837  -13.542 1.00 0.00 ? 49 THR A CA   2  
ATOM 2147  C C    . THR A 1 49 ? 86.801  -4.374  -12.342 1.00 0.00 ? 49 THR A C    2  
ATOM 2148  O O    . THR A 1 49 ? 85.649  -3.968  -12.487 1.00 0.00 ? 49 THR A O    2  
ATOM 2149  C CB   . THR A 1 49 ? 87.582  -6.364  -13.640 1.00 0.00 ? 49 THR A CB   2  
ATOM 2150  O OG1  . THR A 1 49 ? 88.400  -6.924  -12.623 1.00 0.00 ? 49 THR A OG1  2  
ATOM 2151  C CG2  . THR A 1 49 ? 88.096  -6.804  -15.013 1.00 0.00 ? 49 THR A CG2  2  
ATOM 2152  H H    . THR A 1 49 ? 89.731  -5.041  -13.404 1.00 0.00 ? 49 THR A H    2  
ATOM 2153  H HA   . THR A 1 49 ? 87.192  -4.420  -14.441 1.00 0.00 ? 49 THR A HA   2  
ATOM 2154  H HB   . THR A 1 49 ? 86.567  -6.706  -13.515 1.00 0.00 ? 49 THR A HB   2  
ATOM 2155  H HG1  . THR A 1 49 ? 89.276  -7.065  -12.990 1.00 0.00 ? 49 THR A HG1  2  
ATOM 2156  H HG21 . THR A 1 49 ? 87.981  -7.873  -15.114 1.00 0.00 ? 49 THR A HG21 2  
ATOM 2157  H HG22 . THR A 1 49 ? 89.140  -6.544  -15.107 1.00 0.00 ? 49 THR A HG22 2  
ATOM 2158  H HG23 . THR A 1 49 ? 87.531  -6.306  -15.787 1.00 0.00 ? 49 THR A HG23 2  
ATOM 2159  N N    . VAL A 1 50 ? 87.398  -4.447  -11.158 1.00 0.00 ? 50 VAL A N    2  
ATOM 2160  C CA   . VAL A 1 50 ? 86.707  -4.043  -9.937  1.00 0.00 ? 50 VAL A CA   2  
ATOM 2161  C C    . VAL A 1 50 ? 86.510  -2.525  -9.875  1.00 0.00 ? 50 VAL A C    2  
ATOM 2162  O O    . VAL A 1 50 ? 85.453  -2.053  -9.457  1.00 0.00 ? 50 VAL A O    2  
ATOM 2163  C CB   . VAL A 1 50 ? 87.501  -4.528  -8.717  1.00 0.00 ? 50 VAL A CB   2  
ATOM 2164  C CG1  . VAL A 1 50 ? 86.927  -3.917  -7.434  1.00 0.00 ? 50 VAL A CG1  2  
ATOM 2165  C CG2  . VAL A 1 50 ? 87.406  -6.056  -8.634  1.00 0.00 ? 50 VAL A CG2  2  
ATOM 2166  H H    . VAL A 1 50 ? 88.317  -4.785  -11.101 1.00 0.00 ? 50 VAL A H    2  
ATOM 2167  H HA   . VAL A 1 50 ? 85.736  -4.514  -9.921  1.00 0.00 ? 50 VAL A HA   2  
ATOM 2168  H HB   . VAL A 1 50 ? 88.535  -4.236  -8.822  1.00 0.00 ? 50 VAL A HB   2  
ATOM 2169  H HG11 . VAL A 1 50 ? 87.326  -4.439  -6.578  1.00 0.00 ? 50 VAL A HG11 2  
ATOM 2170  H HG12 . VAL A 1 50 ? 85.851  -4.008  -7.443  1.00 0.00 ? 50 VAL A HG12 2  
ATOM 2171  H HG13 . VAL A 1 50 ? 87.200  -2.874  -7.381  1.00 0.00 ? 50 VAL A HG13 2  
ATOM 2172  H HG21 . VAL A 1 50 ? 87.533  -6.479  -9.619  1.00 0.00 ? 50 VAL A HG21 2  
ATOM 2173  H HG22 . VAL A 1 50 ? 86.438  -6.338  -8.244  1.00 0.00 ? 50 VAL A HG22 2  
ATOM 2174  H HG23 . VAL A 1 50 ? 88.180  -6.429  -7.980  1.00 0.00 ? 50 VAL A HG23 2  
ATOM 2175  N N    . LEU A 1 51 ? 87.525  -1.764  -10.276 1.00 0.00 ? 51 LEU A N    2  
ATOM 2176  C CA   . LEU A 1 51 ? 87.422  -0.308  -10.236 1.00 0.00 ? 51 LEU A CA   2  
ATOM 2177  C C    . LEU A 1 51 ? 86.364  0.184   -11.206 1.00 0.00 ? 51 LEU A C    2  
ATOM 2178  O O    . LEU A 1 51 ? 85.447  0.896   -10.813 1.00 0.00 ? 51 LEU A O    2  
ATOM 2179  C CB   . LEU A 1 51 ? 88.779  0.319   -10.584 1.00 0.00 ? 51 LEU A CB   2  
ATOM 2180  C CG   . LEU A 1 51 ? 88.747  1.842   -10.354 1.00 0.00 ? 51 LEU A CG   2  
ATOM 2181  C CD1  . LEU A 1 51 ? 88.763  2.165   -8.850  1.00 0.00 ? 51 LEU A CD1  2  
ATOM 2182  C CD2  . LEU A 1 51 ? 89.972  2.470   -11.026 1.00 0.00 ? 51 LEU A CD2  2  
ATOM 2183  H H    . LEU A 1 51 ? 88.354  -2.183  -10.595 1.00 0.00 ? 51 LEU A H    2  
ATOM 2184  H HA   . LEU A 1 51 ? 87.136  -0.004  -9.244  1.00 0.00 ? 51 LEU A HA   2  
ATOM 2185  H HB2  . LEU A 1 51 ? 89.547  -0.125  -9.968  1.00 0.00 ? 51 LEU A HB2  2  
ATOM 2186  H HB3  . LEU A 1 51 ? 89.001  0.123   -11.622 1.00 0.00 ? 51 LEU A HB3  2  
ATOM 2187  H HG   . LEU A 1 51 ? 87.850  2.253   -10.795 1.00 0.00 ? 51 LEU A HG   2  
ATOM 2188  H HD11 . LEU A 1 51 ? 87.765  2.072   -8.450  1.00 0.00 ? 51 LEU A HD11 2  
ATOM 2189  H HD12 . LEU A 1 51 ? 89.110  3.178   -8.701  1.00 0.00 ? 51 LEU A HD12 2  
ATOM 2190  H HD13 . LEU A 1 51 ? 89.422  1.483   -8.334  1.00 0.00 ? 51 LEU A HD13 2  
ATOM 2191  H HD21 . LEU A 1 51 ? 90.071  3.498   -10.709 1.00 0.00 ? 51 LEU A HD21 2  
ATOM 2192  H HD22 . LEU A 1 51 ? 89.852  2.434   -12.098 1.00 0.00 ? 51 LEU A HD22 2  
ATOM 2193  H HD23 . LEU A 1 51 ? 90.859  1.920   -10.745 1.00 0.00 ? 51 LEU A HD23 2  
ATOM 2194  N N    . LYS A 1 52 ? 86.492  -0.200  -12.468 1.00 0.00 ? 52 LYS A N    2  
ATOM 2195  C CA   . LYS A 1 52 ? 85.530  0.218   -13.477 1.00 0.00 ? 52 LYS A CA   2  
ATOM 2196  C C    . LYS A 1 52 ? 84.126  -0.235  -13.103 1.00 0.00 ? 52 LYS A C    2  
ATOM 2197  O O    . LYS A 1 52 ? 83.174  0.514   -13.241 1.00 0.00 ? 52 LYS A O    2  
ATOM 2198  C CB   . LYS A 1 52 ? 85.916  -0.365  -14.838 1.00 0.00 ? 52 LYS A CB   2  
ATOM 2199  C CG   . LYS A 1 52 ? 87.335  0.087   -15.217 1.00 0.00 ? 52 LYS A CG   2  
ATOM 2200  C CD   . LYS A 1 52 ? 87.378  1.617   -15.497 1.00 0.00 ? 52 LYS A CD   2  
ATOM 2201  C CE   . LYS A 1 52 ? 88.069  2.359   -14.342 1.00 0.00 ? 52 LYS A CE   2  
ATOM 2202  N NZ   . LYS A 1 52 ? 89.546  2.224   -14.480 1.00 0.00 ? 52 LYS A NZ   2  
ATOM 2203  H H    . LYS A 1 52 ? 87.244  -0.773  -12.725 1.00 0.00 ? 52 LYS A H    2  
ATOM 2204  H HA   . LYS A 1 52 ? 85.535  1.296   -13.547 1.00 0.00 ? 52 LYS A HA   2  
ATOM 2205  H HB2  . LYS A 1 52 ? 85.884  -1.444  -14.784 1.00 0.00 ? 52 LYS A HB2  2  
ATOM 2206  H HB3  . LYS A 1 52 ? 85.217  -0.023  -15.586 1.00 0.00 ? 52 LYS A HB3  2  
ATOM 2207  H HG2  . LYS A 1 52 ? 88.011  -0.159  -14.410 1.00 0.00 ? 52 LYS A HG2  2  
ATOM 2208  H HG3  . LYS A 1 52 ? 87.644  -0.448  -16.106 1.00 0.00 ? 52 LYS A HG3  2  
ATOM 2209  H HD2  . LYS A 1 52 ? 87.932  1.800   -16.408 1.00 0.00 ? 52 LYS A HD2  2  
ATOM 2210  H HD3  . LYS A 1 52 ? 86.374  2.002   -15.615 1.00 0.00 ? 52 LYS A HD3  2  
ATOM 2211  H HE2  . LYS A 1 52 ? 87.799  3.404   -14.374 1.00 0.00 ? 52 LYS A HE2  2  
ATOM 2212  H HE3  . LYS A 1 52 ? 87.757  1.936   -13.399 1.00 0.00 ? 52 LYS A HE3  2  
ATOM 2213  H HZ1  . LYS A 1 52 ? 89.987  3.163   -14.421 1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 2214  H HZ2  . LYS A 1 52 ? 89.770  1.791   -15.399 1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 2215  H HZ3  . LYS A 1 52 ? 89.913  1.623   -13.715 1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 2216  N N    . THR A 1 53 ? 83.996  -1.464  -12.638 1.00 0.00 ? 53 THR A N    2  
ATOM 2217  C CA   . THR A 1 53 ? 82.684  -1.985  -12.272 1.00 0.00 ? 53 THR A CA   2  
ATOM 2218  C C    . THR A 1 53 ? 82.023  -1.163  -11.159 1.00 0.00 ? 53 THR A C    2  
ATOM 2219  O O    . THR A 1 53 ? 80.856  -0.781  -11.267 1.00 0.00 ? 53 THR A O    2  
ATOM 2220  C CB   . THR A 1 53 ? 82.817  -3.440  -11.810 1.00 0.00 ? 53 THR A CB   2  
ATOM 2221  O OG1  . THR A 1 53 ? 83.331  -4.228  -12.873 1.00 0.00 ? 53 THR A OG1  2  
ATOM 2222  C CG2  . THR A 1 53 ? 81.445  -3.974  -11.393 1.00 0.00 ? 53 THR A CG2  2  
ATOM 2223  H H    . THR A 1 53 ? 84.789  -2.036  -12.549 1.00 0.00 ? 53 THR A H    2  
ATOM 2224  H HA   . THR A 1 53 ? 82.048  -1.961  -13.142 1.00 0.00 ? 53 THR A HA   2  
ATOM 2225  H HB   . THR A 1 53 ? 83.488  -3.489  -10.966 1.00 0.00 ? 53 THR A HB   2  
ATOM 2226  H HG1  . THR A 1 53 ? 83.697  -5.032  -12.495 1.00 0.00 ? 53 THR A HG1  2  
ATOM 2227  H HG21 . THR A 1 53 ? 80.711  -3.704  -12.139 1.00 0.00 ? 53 THR A HG21 2  
ATOM 2228  H HG22 . THR A 1 53 ? 81.165  -3.548  -10.442 1.00 0.00 ? 53 THR A HG22 2  
ATOM 2229  H HG23 . THR A 1 53 ? 81.490  -5.050  -11.307 1.00 0.00 ? 53 THR A HG23 2  
ATOM 2230  N N    . ILE A 1 54 ? 82.753  -0.928  -10.073 1.00 0.00 ? 54 ILE A N    2  
ATOM 2231  C CA   . ILE A 1 54 ? 82.192  -0.200  -8.937  1.00 0.00 ? 54 ILE A CA   2  
ATOM 2232  C C    . ILE A 1 54 ? 81.937  1.279   -9.224  1.00 0.00 ? 54 ILE A C    2  
ATOM 2233  O O    . ILE A 1 54 ? 80.905  1.805   -8.825  1.00 0.00 ? 54 ILE A O    2  
ATOM 2234  C CB   . ILE A 1 54 ? 83.114  -0.340  -7.723  1.00 0.00 ? 54 ILE A CB   2  
ATOM 2235  C CG1  . ILE A 1 54 ? 83.192  -1.813  -7.313  1.00 0.00 ? 54 ILE A CG1  2  
ATOM 2236  C CG2  . ILE A 1 54 ? 82.558  0.481   -6.555  1.00 0.00 ? 54 ILE A CG2  2  
ATOM 2237  C CD1  . ILE A 1 54 ? 84.306  -2.000  -6.281  1.00 0.00 ? 54 ILE A CD1  2  
ATOM 2238  H H    . ILE A 1 54 ? 83.671  -1.276  -10.020 1.00 0.00 ? 54 ILE A H    2  
ATOM 2239  H HA   . ILE A 1 54 ? 81.243  -0.651  -8.694  1.00 0.00 ? 54 ILE A HA   2  
ATOM 2240  H HB   . ILE A 1 54 ? 84.101  0.019   -7.977  1.00 0.00 ? 54 ILE A HB   2  
ATOM 2241  H HG12 . ILE A 1 54 ? 82.247  -2.116  -6.883  1.00 0.00 ? 54 ILE A HG12 2  
ATOM 2242  H HG13 . ILE A 1 54 ? 83.404  -2.417  -8.182  1.00 0.00 ? 54 ILE A HG13 2  
ATOM 2243  H HG21 . ILE A 1 54 ? 81.499  0.293   -6.456  1.00 0.00 ? 54 ILE A HG21 2  
ATOM 2244  H HG22 . ILE A 1 54 ? 82.722  1.531   -6.743  1.00 0.00 ? 54 ILE A HG22 2  
ATOM 2245  H HG23 . ILE A 1 54 ? 83.060  0.196   -5.642  1.00 0.00 ? 54 ILE A HG23 2  
ATOM 2246  H HD11 . ILE A 1 54 ? 85.255  -1.746  -6.727  1.00 0.00 ? 54 ILE A HD11 2  
ATOM 2247  H HD12 . ILE A 1 54 ? 84.324  -3.030  -5.955  1.00 0.00 ? 54 ILE A HD12 2  
ATOM 2248  H HD13 . ILE A 1 54 ? 84.122  -1.358  -5.433  1.00 0.00 ? 54 ILE A HD13 2  
ATOM 2249  N N    . VAL A 1 55 ? 82.873  1.961   -9.869  1.00 0.00 ? 55 VAL A N    2  
ATOM 2250  C CA   . VAL A 1 55 ? 82.688  3.388   -10.140 1.00 0.00 ? 55 VAL A CA   2  
ATOM 2251  C C    . VAL A 1 55 ? 81.709  3.627   -11.294 1.00 0.00 ? 55 VAL A C    2  
ATOM 2252  O O    . VAL A 1 55 ? 81.022  4.646   -11.328 1.00 0.00 ? 55 VAL A O    2  
ATOM 2253  C CB   . VAL A 1 55 ? 84.032  4.053   -10.459 1.00 0.00 ? 55 VAL A CB   2  
ATOM 2254  C CG1  . VAL A 1 55 ? 85.055  3.696   -9.376  1.00 0.00 ? 55 VAL A CG1  2  
ATOM 2255  C CG2  . VAL A 1 55 ? 84.535  3.578   -11.828 1.00 0.00 ? 55 VAL A CG2  2  
ATOM 2256  H H    . VAL A 1 55 ? 83.699  1.514   -10.148 1.00 0.00 ? 55 VAL A H    2  
ATOM 2257  H HA   . VAL A 1 55 ? 82.284  3.854   -9.252  1.00 0.00 ? 55 VAL A HA   2  
ATOM 2258  H HB   . VAL A 1 55 ? 83.899  5.126   -10.479 1.00 0.00 ? 55 VAL A HB   2  
ATOM 2259  H HG11 . VAL A 1 55 ? 86.027  4.069   -9.664  1.00 0.00 ? 55 VAL A HG11 2  
ATOM 2260  H HG12 . VAL A 1 55 ? 85.100  2.624   -9.259  1.00 0.00 ? 55 VAL A HG12 2  
ATOM 2261  H HG13 . VAL A 1 55 ? 84.759  4.149   -8.440  1.00 0.00 ? 55 VAL A HG13 2  
ATOM 2262  H HG21 . VAL A 1 55 ? 84.028  4.129   -12.601 1.00 0.00 ? 55 VAL A HG21 2  
ATOM 2263  H HG22 . VAL A 1 55 ? 84.330  2.527   -11.947 1.00 0.00 ? 55 VAL A HG22 2  
ATOM 2264  H HG23 . VAL A 1 55 ? 85.601  3.749   -11.904 1.00 0.00 ? 55 VAL A HG23 2  
ATOM 2265  N N    . LEU A 1 56 ? 81.672  2.702   -12.248 1.00 0.00 ? 56 LEU A N    2  
ATOM 2266  C CA   . LEU A 1 56 ? 80.800  2.844   -13.412 1.00 0.00 ? 56 LEU A CA   2  
ATOM 2267  C C    . LEU A 1 56 ? 79.325  2.557   -13.101 1.00 0.00 ? 56 LEU A C    2  
ATOM 2268  O O    . LEU A 1 56 ? 78.444  3.204   -13.667 1.00 0.00 ? 56 LEU A O    2  
ATOM 2269  C CB   . LEU A 1 56 ? 81.281  1.910   -14.529 1.00 0.00 ? 56 LEU A CB   2  
ATOM 2270  C CG   . LEU A 1 56 ? 80.542  2.210   -15.853 1.00 0.00 ? 56 LEU A CG   2  
ATOM 2271  C CD1  . LEU A 1 56 ? 81.252  3.342   -16.606 1.00 0.00 ? 56 LEU A CD1  2  
ATOM 2272  C CD2  . LEU A 1 56 ? 80.539  0.956   -16.735 1.00 0.00 ? 56 LEU A CD2  2  
ATOM 2273  H H    . LEU A 1 56 ? 82.257  1.919   -12.184 1.00 0.00 ? 56 LEU A H    2  
ATOM 2274  H HA   . LEU A 1 56 ? 80.883  3.855   -13.769 1.00 0.00 ? 56 LEU A HA   2  
ATOM 2275  H HB2  . LEU A 1 56 ? 82.341  2.054   -14.674 1.00 0.00 ? 56 LEU A HB2  2  
ATOM 2276  H HB3  . LEU A 1 56 ? 81.095  0.889   -14.232 1.00 0.00 ? 56 LEU A HB3  2  
ATOM 2277  H HG   . LEU A 1 56 ? 79.524  2.505   -15.649 1.00 0.00 ? 56 LEU A HG   2  
ATOM 2278  H HD11 . LEU A 1 56 ? 82.285  3.071   -16.772 1.00 0.00 ? 56 LEU A HD11 2  
ATOM 2279  H HD12 . LEU A 1 56 ? 81.207  4.250   -16.025 1.00 0.00 ? 56 LEU A HD12 2  
ATOM 2280  H HD13 . LEU A 1 56 ? 80.764  3.500   -17.555 1.00 0.00 ? 56 LEU A HD13 2  
ATOM 2281  H HD21 . LEU A 1 56 ? 79.975  0.174   -16.248 1.00 0.00 ? 56 LEU A HD21 2  
ATOM 2282  H HD22 . LEU A 1 56 ? 81.555  0.622   -16.890 1.00 0.00 ? 56 LEU A HD22 2  
ATOM 2283  H HD23 . LEU A 1 56 ? 80.087  1.186   -17.687 1.00 0.00 ? 56 LEU A HD23 2  
ATOM 2284  N N    . ILE A 1 57 ? 79.037  1.571   -12.252 1.00 0.00 ? 57 ILE A N    2  
ATOM 2285  C CA   . ILE A 1 57 ? 77.635  1.237   -11.976 1.00 0.00 ? 57 ILE A CA   2  
ATOM 2286  C C    . ILE A 1 57 ? 76.859  2.413   -11.349 1.00 0.00 ? 57 ILE A C    2  
ATOM 2287  O O    . ILE A 1 57 ? 75.783  2.758   -11.836 1.00 0.00 ? 57 ILE A O    2  
ATOM 2288  C CB   . ILE A 1 57 ? 77.552  -0.050  -11.100 1.00 0.00 ? 57 ILE A CB   2  
ATOM 2289  C CG1  . ILE A 1 57 ? 77.398  -1.307  -11.990 1.00 0.00 ? 57 ILE A CG1  2  
ATOM 2290  C CG2  . ILE A 1 57 ? 76.346  0.000   -10.144 1.00 0.00 ? 57 ILE A CG2  2  
ATOM 2291  C CD1  . ILE A 1 57 ? 78.376  -1.281  -13.175 1.00 0.00 ? 57 ILE A CD1  2  
ATOM 2292  H H    . ILE A 1 57 ? 79.763  1.042   -11.833 1.00 0.00 ? 57 ILE A H    2  
ATOM 2293  H HA   . ILE A 1 57 ? 77.164  1.037   -12.927 1.00 0.00 ? 57 ILE A HA   2  
ATOM 2294  H HB   . ILE A 1 57 ? 78.458  -0.139  -10.520 1.00 0.00 ? 57 ILE A HB   2  
ATOM 2295  H HG12 . ILE A 1 57 ? 77.590  -2.186  -11.394 1.00 0.00 ? 57 ILE A HG12 2  
ATOM 2296  H HG13 . ILE A 1 57 ? 76.386  -1.351  -12.367 1.00 0.00 ? 57 ILE A HG13 2  
ATOM 2297  H HG21 . ILE A 1 57 ? 75.459  0.265   -10.699 1.00 0.00 ? 57 ILE A HG21 2  
ATOM 2298  H HG22 . ILE A 1 57 ? 76.520  0.737   -9.377  1.00 0.00 ? 57 ILE A HG22 2  
ATOM 2299  H HG23 . ILE A 1 57 ? 76.209  -0.969  -9.687  1.00 0.00 ? 57 ILE A HG23 2  
ATOM 2300  H HD11 . ILE A 1 57 ? 79.240  -0.687  -12.932 1.00 0.00 ? 57 ILE A HD11 2  
ATOM 2301  H HD12 . ILE A 1 57 ? 77.885  -0.864  -14.041 1.00 0.00 ? 57 ILE A HD12 2  
ATOM 2302  H HD13 . ILE A 1 57 ? 78.691  -2.291  -13.398 1.00 0.00 ? 57 ILE A HD13 2  
ATOM 2303  N N    . PRO A 1 58 ? 77.345  3.025   -10.298 1.00 0.00 ? 58 PRO A N    2  
ATOM 2304  C CA   . PRO A 1 58 ? 76.622  4.157   -9.651  1.00 0.00 ? 58 PRO A CA   2  
ATOM 2305  C C    . PRO A 1 58 ? 76.691  5.418   -10.505 1.00 0.00 ? 58 PRO A C    2  
ATOM 2306  O O    . PRO A 1 58 ? 75.796  6.262   -10.467 1.00 0.00 ? 58 PRO A O    2  
ATOM 2307  C CB   . PRO A 1 58 ? 77.343  4.332   -8.308  1.00 0.00 ? 58 PRO A CB   2  
ATOM 2308  C CG   . PRO A 1 58 ? 78.731  3.826   -8.548  1.00 0.00 ? 58 PRO A CG   2  
ATOM 2309  C CD   . PRO A 1 58 ? 78.618  2.733   -9.622  1.00 0.00 ? 58 PRO A CD   2  
ATOM 2310  H HA   . PRO A 1 58 ? 75.591  3.887   -9.477  1.00 0.00 ? 58 PRO A HA   2  
ATOM 2311  H HB2  . PRO A 1 58 ? 77.360  5.376   -8.018  1.00 0.00 ? 58 PRO A HB2  2  
ATOM 2312  H HB3  . PRO A 1 58 ? 76.861  3.740   -7.543  1.00 0.00 ? 58 PRO A HB3  2  
ATOM 2313  H HG2  . PRO A 1 58 ? 79.364  4.634   -8.898  1.00 0.00 ? 58 PRO A HG2  2  
ATOM 2314  H HG3  . PRO A 1 58 ? 79.140  3.406   -7.640  1.00 0.00 ? 58 PRO A HG3  2  
ATOM 2315  H HD2  . PRO A 1 58 ? 79.441  2.808   -10.315 1.00 0.00 ? 58 PRO A HD2  2  
ATOM 2316  H HD3  . PRO A 1 58 ? 78.587  1.755   -9.170  1.00 0.00 ? 58 PRO A HD3  2  
ATOM 2317  N N    . PHE A 1 59 ? 77.765  5.530   -11.274 1.00 0.00 ? 59 PHE A N    2  
ATOM 2318  C CA   . PHE A 1 59 ? 77.967  6.669   -12.139 1.00 0.00 ? 59 PHE A CA   2  
ATOM 2319  C C    . PHE A 1 59 ? 76.926  6.670   -13.260 1.00 0.00 ? 59 PHE A C    2  
ATOM 2320  O O    . PHE A 1 59 ? 76.223  7.658   -13.463 1.00 0.00 ? 59 PHE A O    2  
ATOM 2321  C CB   . PHE A 1 59 ? 79.381  6.602   -12.734 1.00 0.00 ? 59 PHE A CB   2  
ATOM 2322  C CG   . PHE A 1 59 ? 80.422  7.156   -11.771 1.00 0.00 ? 59 PHE A CG   2  
ATOM 2323  C CD1  . PHE A 1 59 ? 80.222  7.131   -10.377 1.00 0.00 ? 59 PHE A CD1  2  
ATOM 2324  C CD2  . PHE A 1 59 ? 81.606  7.698   -12.288 1.00 0.00 ? 59 PHE A CD2  2  
ATOM 2325  C CE1  . PHE A 1 59 ? 81.203  7.647   -9.520  1.00 0.00 ? 59 PHE A CE1  2  
ATOM 2326  C CE2  . PHE A 1 59 ? 82.583  8.213   -11.429 1.00 0.00 ? 59 PHE A CE2  2  
ATOM 2327  C CZ   . PHE A 1 59 ? 82.381  8.187   -10.045 1.00 0.00 ? 59 PHE A CZ   2  
ATOM 2328  H H    . PHE A 1 59 ? 78.439  4.830   -11.261 1.00 0.00 ? 59 PHE A H    2  
ATOM 2329  H HA   . PHE A 1 59 ? 77.866  7.576   -11.565 1.00 0.00 ? 59 PHE A HA   2  
ATOM 2330  H HB2  . PHE A 1 59 ? 79.629  5.586   -12.976 1.00 0.00 ? 59 PHE A HB2  2  
ATOM 2331  H HB3  . PHE A 1 59 ? 79.400  7.168   -13.629 1.00 0.00 ? 59 PHE A HB3  2  
ATOM 2332  H HD1  . PHE A 1 59 ? 79.320  6.718   -9.959  1.00 0.00 ? 59 PHE A HD1  2  
ATOM 2333  H HD2  . PHE A 1 59 ? 81.766  7.721   -13.357 1.00 0.00 ? 59 PHE A HD2  2  
ATOM 2334  H HE1  . PHE A 1 59 ? 81.049  7.627   -8.452  1.00 0.00 ? 59 PHE A HE1  2  
ATOM 2335  H HE2  . PHE A 1 59 ? 83.491  8.630   -11.833 1.00 0.00 ? 59 PHE A HE2  2  
ATOM 2336  H HZ   . PHE A 1 59 ? 83.136  8.583   -9.383  1.00 0.00 ? 59 PHE A HZ   2  
ATOM 2337  N N    . LEU A 1 60 ? 76.836  5.556   -13.985 1.00 0.00 ? 60 LEU A N    2  
ATOM 2338  C CA   . LEU A 1 60 ? 75.878  5.451   -15.081 1.00 0.00 ? 60 LEU A CA   2  
ATOM 2339  C C    . LEU A 1 60 ? 74.476  5.181   -14.538 1.00 0.00 ? 60 LEU A C    2  
ATOM 2340  O O    . LEU A 1 60 ? 73.611  4.674   -15.251 1.00 0.00 ? 60 LEU A O    2  
ATOM 2341  C CB   . LEU A 1 60 ? 76.297  4.322   -16.036 1.00 0.00 ? 60 LEU A CB   2  
ATOM 2342  C CG   . LEU A 1 60 ? 77.426  4.796   -16.974 1.00 0.00 ? 60 LEU A CG   2  
ATOM 2343  C CD1  . LEU A 1 60 ? 76.889  5.784   -18.029 1.00 0.00 ? 60 LEU A CD1  2  
ATOM 2344  C CD2  . LEU A 1 60 ? 78.533  5.471   -16.151 1.00 0.00 ? 60 LEU A CD2  2  
ATOM 2345  H H    . LEU A 1 60 ? 77.423  4.792   -13.782 1.00 0.00 ? 60 LEU A H    2  
ATOM 2346  H HA   . LEU A 1 60 ? 75.863  6.383   -15.622 1.00 0.00 ? 60 LEU A HA   2  
ATOM 2347  H HB2  . LEU A 1 60 ? 76.649  3.482   -15.455 1.00 0.00 ? 60 LEU A HB2  2  
ATOM 2348  H HB3  . LEU A 1 60 ? 75.447  4.012   -16.627 1.00 0.00 ? 60 LEU A HB3  2  
ATOM 2349  H HG   . LEU A 1 60 ? 77.841  3.936   -17.481 1.00 0.00 ? 60 LEU A HG   2  
ATOM 2350  H HD11 . LEU A 1 60 ? 75.878  5.519   -18.301 1.00 0.00 ? 60 LEU A HD11 2  
ATOM 2351  H HD12 . LEU A 1 60 ? 77.515  5.739   -18.908 1.00 0.00 ? 60 LEU A HD12 2  
ATOM 2352  H HD13 . LEU A 1 60 ? 76.905  6.791   -17.635 1.00 0.00 ? 60 LEU A HD13 2  
ATOM 2353  H HD21 . LEU A 1 60 ? 79.416  5.584   -16.761 1.00 0.00 ? 60 LEU A HD21 2  
ATOM 2354  H HD22 . LEU A 1 60 ? 78.765  4.862   -15.291 1.00 0.00 ? 60 LEU A HD22 2  
ATOM 2355  H HD23 . LEU A 1 60 ? 78.196  6.443   -15.823 1.00 0.00 ? 60 LEU A HD23 2  
ATOM 2356  N N    . GLU A 1 61 ? 74.257  5.529   -13.271 1.00 0.00 ? 61 GLU A N    2  
ATOM 2357  C CA   . GLU A 1 61 ? 72.953  5.325   -12.636 1.00 0.00 ? 61 GLU A CA   2  
ATOM 2358  C C    . GLU A 1 61 ? 72.693  6.404   -11.590 1.00 0.00 ? 61 GLU A C    2  
ATOM 2359  O O    . GLU A 1 61 ? 73.623  7.046   -11.101 1.00 0.00 ? 61 GLU A O    2  
ATOM 2360  C CB   . GLU A 1 61 ? 72.901  3.949   -11.970 1.00 0.00 ? 61 GLU A CB   2  
ATOM 2361  C CG   . GLU A 1 61 ? 72.925  2.857   -13.041 1.00 0.00 ? 61 GLU A CG   2  
ATOM 2362  C CD   . GLU A 1 61 ? 72.681  1.495   -12.401 1.00 0.00 ? 61 GLU A CD   2  
ATOM 2363  O OE1  . GLU A 1 61 ? 72.398  1.463   -11.214 1.00 0.00 ? 61 GLU A OE1  2  
ATOM 2364  O OE2  . GLU A 1 61 ? 72.778  0.505   -13.106 1.00 0.00 ? 61 GLU A OE2  2  
ATOM 2365  H H    . GLU A 1 61 ? 74.986  5.932   -12.752 1.00 0.00 ? 61 GLU A H    2  
ATOM 2366  H HA   . GLU A 1 61 ? 72.178  5.377   -13.388 1.00 0.00 ? 61 GLU A HA   2  
ATOM 2367  H HB2  . GLU A 1 61 ? 73.755  3.833   -11.317 1.00 0.00 ? 61 GLU A HB2  2  
ATOM 2368  H HB3  . GLU A 1 61 ? 71.993  3.864   -11.392 1.00 0.00 ? 61 GLU A HB3  2  
ATOM 2369  H HG2  . GLU A 1 61 ? 72.155  3.054   -13.771 1.00 0.00 ? 61 GLU A HG2  2  
ATOM 2370  H HG3  . GLU A 1 61 ? 73.889  2.853   -13.527 1.00 0.00 ? 61 GLU A HG3  2  
ATOM 2371  N N    . GLN A 1 62 ? 71.423  6.596   -11.249 1.00 0.00 ? 62 GLN A N    2  
ATOM 2372  C CA   . GLN A 1 62 ? 71.049  7.600   -10.258 1.00 0.00 ? 62 GLN A CA   2  
ATOM 2373  C C    . GLN A 1 62 ? 71.548  7.193   -8.875  1.00 0.00 ? 62 GLN A C    2  
ATOM 2374  O O    . GLN A 1 62 ? 72.044  8.023   -8.114  1.00 0.00 ? 62 GLN A O    2  
ATOM 2375  C CB   . GLN A 1 62 ? 69.525  7.763   -10.231 1.00 0.00 ? 62 GLN A CB   2  
ATOM 2376  C CG   . GLN A 1 62 ? 69.143  9.018   -9.436  1.00 0.00 ? 62 GLN A CG   2  
ATOM 2377  C CD   . GLN A 1 62 ? 69.345  8.776   -7.944  1.00 0.00 ? 62 GLN A CD   2  
ATOM 2378  O OE1  . GLN A 1 62 ? 68.813  7.813   -7.392  1.00 0.00 ? 62 GLN A OE1  2  
ATOM 2379  N NE2  . GLN A 1 62 ? 70.089  9.597   -7.255  1.00 0.00 ? 62 GLN A NE2  2  
ATOM 2380  H H    . GLN A 1 62 ? 70.724  6.054   -11.672 1.00 0.00 ? 62 GLN A H    2  
ATOM 2381  H HA   . GLN A 1 62 ? 71.500  8.541   -10.530 1.00 0.00 ? 62 GLN A HA   2  
ATOM 2382  H HB2  . GLN A 1 62 ? 69.157  7.856   -11.243 1.00 0.00 ? 62 GLN A HB2  2  
ATOM 2383  H HB3  . GLN A 1 62 ? 69.079  6.898   -9.766  1.00 0.00 ? 62 GLN A HB3  2  
ATOM 2384  H HG2  . GLN A 1 62 ? 69.756  9.849   -9.751  1.00 0.00 ? 62 GLN A HG2  2  
ATOM 2385  H HG3  . GLN A 1 62 ? 68.104  9.253   -9.619  1.00 0.00 ? 62 GLN A HG3  2  
ATOM 2386  H HE21 . GLN A 1 62 ? 70.514  10.362  -7.697  1.00 0.00 ? 62 GLN A HE21 2  
ATOM 2387  H HE22 . GLN A 1 62 ? 70.224  9.448   -6.296  1.00 0.00 ? 62 GLN A HE22 2  
ATOM 2388  N N    . ASN A 1 63 ? 71.412  5.909   -8.555  1.00 0.00 ? 63 ASN A N    2  
ATOM 2389  C CA   . ASN A 1 63 ? 71.852  5.405   -7.259  1.00 0.00 ? 63 ASN A CA   2  
ATOM 2390  C C    . ASN A 1 63 ? 72.024  3.890   -7.304  1.00 0.00 ? 63 ASN A C    2  
ATOM 2391  C CB   . ASN A 1 63 ? 70.831  5.774   -6.181  1.00 0.00 ? 63 ASN A CB   2  
ATOM 2392  C CG   . ASN A 1 63 ? 69.529  5.015   -6.414  1.00 0.00 ? 63 ASN A CG   2  
ATOM 2393  O OD1  . ASN A 1 63 ? 69.214  4.081   -5.679  1.00 0.00 ? 63 ASN A OD1  2  
ATOM 2394  N ND2  . ASN A 1 63 ? 68.751  5.364   -7.402  1.00 0.00 ? 63 ASN A ND2  2  
ATOM 2395  H H    . ASN A 1 63 ? 71.009  5.292   -9.201  1.00 0.00 ? 63 ASN A H    2  
ATOM 2396  H HA   . ASN A 1 63 ? 72.801  5.857   -7.011  1.00 0.00 ? 63 ASN A HA   2  
ATOM 2397  H HB2  . ASN A 1 63 ? 71.228  5.515   -5.210  1.00 0.00 ? 63 ASN A HB2  2  
ATOM 2398  H HB3  . ASN A 1 63 ? 70.638  6.835   -6.219  1.00 0.00 ? 63 ASN A HB3  2  
ATOM 2399  H HD21 . ASN A 1 63 ? 69.004  6.109   -7.987  1.00 0.00 ? 63 ASN A HD21 2  
ATOM 2400  H HD22 . ASN A 1 63 ? 67.912  4.881   -7.558  1.00 0.00 ? 63 ASN A HD22 2  
ATOM 2401  N N    . CYS B 2 1  ? 72.528  23.034  -14.656 1.00 0.00 ? 1  CYS B N    2  
ATOM 2402  C CA   . CYS B 2 1  ? 71.673  21.826  -14.828 1.00 0.00 ? 1  CYS B CA   2  
ATOM 2403  C C    . CYS B 2 1  ? 72.417  20.602  -14.304 1.00 0.00 ? 1  CYS B C    2  
ATOM 2404  O O    . CYS B 2 1  ? 72.515  19.585  -14.990 1.00 0.00 ? 1  CYS B O    2  
ATOM 2405  C CB   . CYS B 2 1  ? 71.346  21.642  -16.312 1.00 0.00 ? 1  CYS B CB   2  
ATOM 2406  S SG   . CYS B 2 1  ? 70.874  23.236  -17.028 1.00 0.00 ? 1  CYS B SG   2  
ATOM 2407  H HA   . CYS B 2 1  ? 70.756  21.954  -14.272 1.00 0.00 ? 1  CYS B HA   2  
ATOM 2408  H HB2  . CYS B 2 1  ? 72.215  21.259  -16.826 1.00 0.00 ? 1  CYS B HB2  2  
ATOM 2409  H HB3  . CYS B 2 1  ? 70.529  20.944  -16.416 1.00 0.00 ? 1  CYS B HB3  2  
ATOM 2410  N N    . SER B 2 2  ? 72.937  20.708  -13.085 1.00 0.00 ? 2  SER B N    2  
ATOM 2411  C CA   . SER B 2 2  ? 73.671  19.603  -12.477 1.00 0.00 ? 2  SER B CA   2  
ATOM 2412  C C    . SER B 2 2  ? 74.915  19.269  -13.296 1.00 0.00 ? 2  SER B C    2  
ATOM 2413  O O    . SER B 2 2  ? 76.040  19.533  -12.870 1.00 0.00 ? 2  SER B O    2  
ATOM 2414  C CB   . SER B 2 2  ? 72.773  18.369  -12.379 1.00 0.00 ? 2  SER B CB   2  
ATOM 2415  O OG   . SER B 2 2  ? 73.332  17.454  -11.445 1.00 0.00 ? 2  SER B OG   2  
ATOM 2416  H H    . SER B 2 2  ? 72.827  21.544  -12.586 1.00 0.00 ? 2  SER B H    2  
ATOM 2417  H HA   . SER B 2 2  ? 73.976  19.891  -11.482 1.00 0.00 ? 2  SER B HA   2  
ATOM 2418  H HB2  . SER B 2 2  ? 71.792  18.662  -12.043 1.00 0.00 ? 2  SER B HB2  2  
ATOM 2419  H HB3  . SER B 2 2  ? 72.694  17.903  -13.353 1.00 0.00 ? 2  SER B HB3  2  
ATOM 2420  H HG   . SER B 2 2  ? 73.754  17.962  -10.748 1.00 0.00 ? 2  SER B HG   2  
ATOM 2421  N N    . THR B 2 3  ? 74.704  18.690  -14.473 1.00 0.00 ? 3  THR B N    2  
ATOM 2422  C CA   . THR B 2 3  ? 75.813  18.326  -15.348 1.00 0.00 ? 3  THR B CA   2  
ATOM 2423  C C    . THR B 2 3  ? 76.775  17.376  -14.639 1.00 0.00 ? 3  THR B C    2  
ATOM 2424  O O    . THR B 2 3  ? 77.939  17.708  -14.415 1.00 0.00 ? 3  THR B O    2  
ATOM 2425  C CB   . THR B 2 3  ? 76.568  19.582  -15.787 1.00 0.00 ? 3  THR B CB   2  
ATOM 2426  O OG1  . THR B 2 3  ? 77.418  20.016  -14.734 1.00 0.00 ? 3  THR B OG1  2  
ATOM 2427  C CG2  . THR B 2 3  ? 75.567  20.688  -16.125 1.00 0.00 ? 3  THR B CG2  2  
ATOM 2428  H H    . THR B 2 3  ? 73.786  18.505  -14.760 1.00 0.00 ? 3  THR B H    2  
ATOM 2429  H HA   . THR B 2 3  ? 75.420  17.834  -16.225 1.00 0.00 ? 3  THR B HA   2  
ATOM 2430  H HB   . THR B 2 3  ? 77.161  19.361  -16.660 1.00 0.00 ? 3  THR B HB   2  
ATOM 2431  H HG1  . THR B 2 3  ? 77.062  20.836  -14.384 1.00 0.00 ? 3  THR B HG1  2  
ATOM 2432  H HG21 . THR B 2 3  ? 74.777  20.283  -16.740 1.00 0.00 ? 3  THR B HG21 2  
ATOM 2433  H HG22 . THR B 2 3  ? 76.071  21.479  -16.661 1.00 0.00 ? 3  THR B HG22 2  
ATOM 2434  H HG23 . THR B 2 3  ? 75.146  21.084  -15.213 1.00 0.00 ? 3  THR B HG23 2  
ATOM 2435  N N    . VAL B 2 4  ? 76.281  16.191  -14.294 1.00 0.00 ? 4  VAL B N    2  
ATOM 2436  C CA   . VAL B 2 4  ? 77.108  15.197  -13.617 1.00 0.00 ? 4  VAL B CA   2  
ATOM 2437  C C    . VAL B 2 4  ? 78.072  14.549  -14.604 1.00 0.00 ? 4  VAL B C    2  
ATOM 2438  O O    . VAL B 2 4  ? 79.201  14.207  -14.255 1.00 0.00 ? 4  VAL B O    2  
ATOM 2439  C CB   . VAL B 2 4  ? 76.221  14.123  -12.985 1.00 0.00 ? 4  VAL B CB   2  
ATOM 2440  C CG1  . VAL B 2 4  ? 75.245  14.778  -12.006 1.00 0.00 ? 4  VAL B CG1  2  
ATOM 2441  C CG2  . VAL B 2 4  ? 75.432  13.404  -14.083 1.00 0.00 ? 4  VAL B CG2  2  
ATOM 2442  H H    . VAL B 2 4  ? 75.348  15.979  -14.502 1.00 0.00 ? 4  VAL B H    2  
ATOM 2443  H HA   . VAL B 2 4  ? 77.678  15.682  -12.841 1.00 0.00 ? 4  VAL B HA   2  
ATOM 2444  H HB   . VAL B 2 4  ? 76.838  13.411  -12.456 1.00 0.00 ? 4  VAL B HB   2  
ATOM 2445  H HG11 . VAL B 2 4  ? 74.520  15.359  -12.555 1.00 0.00 ? 4  VAL B HG11 2  
ATOM 2446  H HG12 . VAL B 2 4  ? 75.790  15.424  -11.333 1.00 0.00 ? 4  VAL B HG12 2  
ATOM 2447  H HG13 . VAL B 2 4  ? 74.738  14.013  -11.437 1.00 0.00 ? 4  VAL B HG13 2  
ATOM 2448  H HG21 . VAL B 2 4  ? 76.107  12.813  -14.683 1.00 0.00 ? 4  VAL B HG21 2  
ATOM 2449  H HG22 . VAL B 2 4  ? 74.939  14.133  -14.708 1.00 0.00 ? 4  VAL B HG22 2  
ATOM 2450  H HG23 . VAL B 2 4  ? 74.693  12.759  -13.630 1.00 0.00 ? 4  VAL B HG23 2  
ATOM 2451  N N    . SER B 2 5  ? 77.614  14.382  -15.841 1.00 0.00 ? 5  SER B N    2  
ATOM 2452  C CA   . SER B 2 5  ? 78.435  13.776  -16.883 1.00 0.00 ? 5  SER B CA   2  
ATOM 2453  C C    . SER B 2 5  ? 79.893  14.247  -16.793 1.00 0.00 ? 5  SER B C    2  
ATOM 2454  O O    . SER B 2 5  ? 80.794  13.435  -16.582 1.00 0.00 ? 5  SER B O    2  
ATOM 2455  C CB   . SER B 2 5  ? 77.850  14.109  -18.265 1.00 0.00 ? 5  SER B CB   2  
ATOM 2456  O OG   . SER B 2 5  ? 78.901  14.420  -19.172 1.00 0.00 ? 5  SER B OG   2  
ATOM 2457  H H    . SER B 2 5  ? 76.705  14.673  -16.060 1.00 0.00 ? 5  SER B H    2  
ATOM 2458  H HA   . SER B 2 5  ? 78.417  12.705  -16.745 1.00 0.00 ? 5  SER B HA   2  
ATOM 2459  H HB2  . SER B 2 5  ? 77.299  13.264  -18.646 1.00 0.00 ? 5  SER B HB2  2  
ATOM 2460  H HB3  . SER B 2 5  ? 77.180  14.954  -18.174 1.00 0.00 ? 5  SER B HB3  2  
ATOM 2461  H HG   . SER B 2 5  ? 78.740  13.940  -19.987 1.00 0.00 ? 5  SER B HG   2  
ATOM 2462  N N    . PRO B 2 6  ? 80.150  15.525  -16.952 1.00 0.00 ? 6  PRO B N    2  
ATOM 2463  C CA   . PRO B 2 6  ? 81.542  16.072  -16.886 1.00 0.00 ? 6  PRO B CA   2  
ATOM 2464  C C    . PRO B 2 6  ? 82.189  15.857  -15.514 1.00 0.00 ? 6  PRO B C    2  
ATOM 2465  O O    . PRO B 2 6  ? 83.251  16.410  -15.227 1.00 0.00 ? 6  PRO B O    2  
ATOM 2466  C CB   . PRO B 2 6  ? 81.369  17.570  -17.206 1.00 0.00 ? 6  PRO B CB   2  
ATOM 2467  C CG   . PRO B 2 6  ? 79.937  17.870  -16.897 1.00 0.00 ? 6  PRO B CG   2  
ATOM 2468  C CD   . PRO B 2 6  ? 79.163  16.590  -17.210 1.00 0.00 ? 6  PRO B CD   2  
ATOM 2469  H HA   . PRO B 2 6  ? 82.152  15.611  -17.649 1.00 0.00 ? 6  PRO B HA   2  
ATOM 2470  H HB2  . PRO B 2 6  ? 82.027  18.173  -16.590 1.00 0.00 ? 6  PRO B HB2  2  
ATOM 2471  H HB3  . PRO B 2 6  ? 81.565  17.756  -18.253 1.00 0.00 ? 6  PRO B HB3  2  
ATOM 2472  H HG2  . PRO B 2 6  ? 79.829  18.127  -15.849 1.00 0.00 ? 6  PRO B HG2  2  
ATOM 2473  H HG3  . PRO B 2 6  ? 79.576  18.677  -17.517 1.00 0.00 ? 6  PRO B HG3  2  
ATOM 2474  H HD2  . PRO B 2 6  ? 78.310  16.500  -16.558 1.00 0.00 ? 6  PRO B HD2  2  
ATOM 2475  H HD3  . PRO B 2 6  ? 78.859  16.575  -18.245 1.00 0.00 ? 6  PRO B HD3  2  
ATOM 2476  N N    . GLY B 2 7  ? 81.543  15.048  -14.672 1.00 0.00 ? 7  GLY B N    2  
ATOM 2477  C CA   . GLY B 2 7  ? 82.062  14.755  -13.330 1.00 0.00 ? 7  GLY B CA   2  
ATOM 2478  C C    . GLY B 2 7  ? 82.334  13.261  -13.163 1.00 0.00 ? 7  GLY B C    2  
ATOM 2479  O O    . GLY B 2 7  ? 83.480  12.839  -13.004 1.00 0.00 ? 7  GLY B O    2  
ATOM 2480  H H    . GLY B 2 7  ? 80.702  14.639  -14.956 1.00 0.00 ? 7  GLY B H    2  
ATOM 2481  H HA2  . GLY B 2 7  ? 82.983  15.301  -13.164 1.00 0.00 ? 7  GLY B HA2  2  
ATOM 2482  H HA3  . GLY B 2 7  ? 81.334  15.062  -12.595 1.00 0.00 ? 7  GLY B HA3  2  
ATOM 2483  N N    . VAL B 2 8  ? 81.274  12.463  -13.201 1.00 0.00 ? 8  VAL B N    2  
ATOM 2484  C CA   . VAL B 2 8  ? 81.409  11.017  -13.052 1.00 0.00 ? 8  VAL B CA   2  
ATOM 2485  C C    . VAL B 2 8  ? 82.288  10.446  -14.174 1.00 0.00 ? 8  VAL B C    2  
ATOM 2486  O O    . VAL B 2 8  ? 83.270  9.733   -13.921 1.00 0.00 ? 8  VAL B O    2  
ATOM 2487  C CB   . VAL B 2 8  ? 80.004  10.370  -13.072 1.00 0.00 ? 8  VAL B CB   2  
ATOM 2488  C CG1  . VAL B 2 8  ? 79.449  10.267  -11.644 1.00 0.00 ? 8  VAL B CG1  2  
ATOM 2489  C CG2  . VAL B 2 8  ? 79.049  11.230  -13.913 1.00 0.00 ? 8  VAL B CG2  2  
ATOM 2490  H H    . VAL B 2 8  ? 80.382  12.849  -13.328 1.00 0.00 ? 8  VAL B H    2  
ATOM 2491  H HA   . VAL B 2 8  ? 81.885  10.807  -12.104 1.00 0.00 ? 8  VAL B HA   2  
ATOM 2492  H HB   . VAL B 2 8  ? 80.062  9.383   -13.501 1.00 0.00 ? 8  VAL B HB   2  
ATOM 2493  H HG11 . VAL B 2 8  ? 80.099  9.646   -11.049 1.00 0.00 ? 8  VAL B HG11 2  
ATOM 2494  H HG12 . VAL B 2 8  ? 78.460  9.833   -11.673 1.00 0.00 ? 8  VAL B HG12 2  
ATOM 2495  H HG13 . VAL B 2 8  ? 79.395  11.254  -11.208 1.00 0.00 ? 8  VAL B HG13 2  
ATOM 2496  H HG21 . VAL B 2 8  ? 78.192  10.639  -14.200 1.00 0.00 ? 8  VAL B HG21 2  
ATOM 2497  H HG22 . VAL B 2 8  ? 79.559  11.575  -14.798 1.00 0.00 ? 8  VAL B HG22 2  
ATOM 2498  H HG23 . VAL B 2 8  ? 78.721  12.082  -13.335 1.00 0.00 ? 8  VAL B HG23 2  
ATOM 2499  N N    . LEU B 2 9  ? 81.946  10.775  -15.411 1.00 0.00 ? 9  LEU B N    2  
ATOM 2500  C CA   . LEU B 2 9  ? 82.723  10.301  -16.545 1.00 0.00 ? 9  LEU B CA   2  
ATOM 2501  C C    . LEU B 2 9  ? 84.157  10.820  -16.418 1.00 0.00 ? 9  LEU B C    2  
ATOM 2502  O O    . LEU B 2 9  ? 85.129  10.121  -16.752 1.00 0.00 ? 9  LEU B O    2  
ATOM 2503  C CB   . LEU B 2 9  ? 82.060  10.754  -17.848 1.00 0.00 ? 9  LEU B CB   2  
ATOM 2504  C CG   . LEU B 2 9  ? 80.543  10.496  -17.754 1.00 0.00 ? 9  LEU B CG   2  
ATOM 2505  C CD1  . LEU B 2 9  ? 79.870  10.783  -19.101 1.00 0.00 ? 9  LEU B CD1  2  
ATOM 2506  C CD2  . LEU B 2 9  ? 80.282  9.034   -17.353 1.00 0.00 ? 9  LEU B CD2  2  
ATOM 2507  H H    . LEU B 2 9  ? 81.171  11.354  -15.562 1.00 0.00 ? 9  LEU B H    2  
ATOM 2508  H HA   . LEU B 2 9  ? 82.743  9.226   -16.527 1.00 0.00 ? 9  LEU B HA   2  
ATOM 2509  H HB2  . LEU B 2 9  ? 82.243  11.809  -18.000 1.00 0.00 ? 9  LEU B HB2  2  
ATOM 2510  H HB3  . LEU B 2 9  ? 82.468  10.191  -18.673 1.00 0.00 ? 9  LEU B HB3  2  
ATOM 2511  H HG   . LEU B 2 9  ? 80.124  11.150  -17.008 1.00 0.00 ? 9  LEU B HG   2  
ATOM 2512  H HD11 . LEU B 2 9  ? 80.142  11.770  -19.438 1.00 0.00 ? 9  LEU B HD11 2  
ATOM 2513  H HD12 . LEU B 2 9  ? 78.797  10.728  -18.986 1.00 0.00 ? 9  LEU B HD12 2  
ATOM 2514  H HD13 . LEU B 2 9  ? 80.191  10.051  -19.828 1.00 0.00 ? 9  LEU B HD13 2  
ATOM 2515  H HD21 . LEU B 2 9  ? 79.258  8.770   -17.584 1.00 0.00 ? 9  LEU B HD21 2  
ATOM 2516  H HD22 . LEU B 2 9  ? 80.446  8.915   -16.291 1.00 0.00 ? 9  LEU B HD22 2  
ATOM 2517  H HD23 . LEU B 2 9  ? 80.951  8.385   -17.896 1.00 0.00 ? 9  LEU B HD23 2  
ATOM 2518  N N    . ALA B 2 10 ? 84.286  12.032  -15.872 1.00 0.00 ? 10 ALA B N    2  
ATOM 2519  C CA   . ALA B 2 10 ? 85.602  12.610  -15.643 1.00 0.00 ? 10 ALA B CA   2  
ATOM 2520  C C    . ALA B 2 10 ? 86.382  11.665  -14.728 1.00 0.00 ? 10 ALA B C    2  
ATOM 2521  O O    . ALA B 2 10 ? 87.596  11.476  -14.862 1.00 0.00 ? 10 ALA B O    2  
ATOM 2522  C CB   . ALA B 2 10 ? 85.468  13.990  -14.985 1.00 0.00 ? 10 ALA B CB   2  
ATOM 2523  H H    . ALA B 2 10 ? 83.486  12.521  -15.585 1.00 0.00 ? 10 ALA B H    2  
ATOM 2524  H HA   . ALA B 2 10 ? 86.113  12.718  -16.586 1.00 0.00 ? 10 ALA B HA   2  
ATOM 2525  H HB1  . ALA B 2 10 ? 84.599  14.493  -15.382 1.00 0.00 ? 10 ALA B HB1  2  
ATOM 2526  H HB2  . ALA B 2 10 ? 86.349  14.578  -15.196 1.00 0.00 ? 10 ALA B HB2  2  
ATOM 2527  H HB3  . ALA B 2 10 ? 85.360  13.880  -13.916 1.00 0.00 ? 10 ALA B HB3  2  
ATOM 2528  N N    . GLY B 2 11 ? 85.647  11.059  -13.798 1.00 0.00 ? 11 GLY B N    2  
ATOM 2529  C CA   . GLY B 2 11 ? 86.236  10.121  -12.858 1.00 0.00 ? 11 GLY B CA   2  
ATOM 2530  C C    . GLY B 2 11 ? 86.774  8.896   -13.586 1.00 0.00 ? 11 GLY B C    2  
ATOM 2531  O O    . GLY B 2 11 ? 87.848  8.399   -13.256 1.00 0.00 ? 11 GLY B O    2  
ATOM 2532  H H    . GLY B 2 11 ? 84.685  11.246  -13.750 1.00 0.00 ? 11 GLY B H    2  
ATOM 2533  H HA2  . GLY B 2 11 ? 87.046  10.606  -12.331 1.00 0.00 ? 11 GLY B HA2  2  
ATOM 2534  H HA3  . GLY B 2 11 ? 85.486  9.809   -12.149 1.00 0.00 ? 11 GLY B HA3  2  
ATOM 2535  N N    . ILE B 2 12 ? 86.031  8.408   -14.581 1.00 0.00 ? 12 ILE B N    2  
ATOM 2536  C CA   . ILE B 2 12 ? 86.486  7.245   -15.325 1.00 0.00 ? 12 ILE B CA   2  
ATOM 2537  C C    . ILE B 2 12 ? 87.847  7.525   -15.947 1.00 0.00 ? 12 ILE B C    2  
ATOM 2538  O O    . ILE B 2 12 ? 88.755  6.698   -15.862 1.00 0.00 ? 12 ILE B O    2  
ATOM 2539  C CB   . ILE B 2 12 ? 85.472  6.887   -16.414 1.00 0.00 ? 12 ILE B CB   2  
ATOM 2540  C CG1  . ILE B 2 12 ? 84.084  6.723   -15.771 1.00 0.00 ? 12 ILE B CG1  2  
ATOM 2541  C CG2  . ILE B 2 12 ? 85.892  5.588   -17.130 1.00 0.00 ? 12 ILE B CG2  2  
ATOM 2542  C CD1  . ILE B 2 12 ? 84.103  5.644   -14.687 1.00 0.00 ? 12 ILE B CD1  2  
ATOM 2543  H H    . ILE B 2 12 ? 85.174  8.833   -14.820 1.00 0.00 ? 12 ILE B H    2  
ATOM 2544  H HA   . ILE B 2 12 ? 86.582  6.411   -14.646 1.00 0.00 ? 12 ILE B HA   2  
ATOM 2545  H HB   . ILE B 2 12 ? 85.434  7.692   -17.135 1.00 0.00 ? 12 ILE B HB   2  
ATOM 2546  H HG12 . ILE B 2 12 ? 83.797  7.656   -15.317 1.00 0.00 ? 12 ILE B HG12 2  
ATOM 2547  H HG13 . ILE B 2 12 ? 83.364  6.456   -16.529 1.00 0.00 ? 12 ILE B HG13 2  
ATOM 2548  H HG21 . ILE B 2 12 ? 85.020  5.101   -17.539 1.00 0.00 ? 12 ILE B HG21 2  
ATOM 2549  H HG22 . ILE B 2 12 ? 86.374  4.921   -16.428 1.00 0.00 ? 12 ILE B HG22 2  
ATOM 2550  H HG23 . ILE B 2 12 ? 86.579  5.824   -17.931 1.00 0.00 ? 12 ILE B HG23 2  
ATOM 2551  H HD11 . ILE B 2 12 ? 83.102  5.262   -14.545 1.00 0.00 ? 12 ILE B HD11 2  
ATOM 2552  H HD12 . ILE B 2 12 ? 84.453  6.079   -13.762 1.00 0.00 ? 12 ILE B HD12 2  
ATOM 2553  H HD13 . ILE B 2 12 ? 84.758  4.837   -14.975 1.00 0.00 ? 12 ILE B HD13 2  
ATOM 2554  N N    . VAL B 2 13 ? 87.999  8.696   -16.564 1.00 0.00 ? 13 VAL B N    2  
ATOM 2555  C CA   . VAL B 2 13 ? 89.290  9.033   -17.171 1.00 0.00 ? 13 VAL B CA   2  
ATOM 2556  C C    . VAL B 2 13 ? 90.382  8.966   -16.103 1.00 0.00 ? 13 VAL B C    2  
ATOM 2557  O O    . VAL B 2 13 ? 91.452  8.402   -16.335 1.00 0.00 ? 13 VAL B O    2  
ATOM 2558  C CB   . VAL B 2 13 ? 89.256  10.425  -17.876 1.00 0.00 ? 13 VAL B CB   2  
ATOM 2559  C CG1  . VAL B 2 13 ? 87.810  10.858  -18.062 1.00 0.00 ? 13 VAL B CG1  2  
ATOM 2560  C CG2  . VAL B 2 13 ? 89.987  11.512  -17.068 1.00 0.00 ? 13 VAL B CG2  2  
ATOM 2561  H H    . VAL B 2 13 ? 87.246  9.330   -16.604 1.00 0.00 ? 13 VAL B H    2  
ATOM 2562  H HA   . VAL B 2 13 ? 89.510  8.275   -17.914 1.00 0.00 ? 13 VAL B HA   2  
ATOM 2563  H HB   . VAL B 2 13 ? 89.719  10.340  -18.853 1.00 0.00 ? 13 VAL B HB   2  
ATOM 2564  H HG11 . VAL B 2 13 ? 87.778  11.818  -18.554 1.00 0.00 ? 13 VAL B HG11 2  
ATOM 2565  H HG12 . VAL B 2 13 ? 87.338  10.933  -17.104 1.00 0.00 ? 13 VAL B HG12 2  
ATOM 2566  H HG13 . VAL B 2 13 ? 87.296  10.127  -18.657 1.00 0.00 ? 13 VAL B HG13 2  
ATOM 2567  H HG21 . VAL B 2 13 ? 89.842  12.470  -17.546 1.00 0.00 ? 13 VAL B HG21 2  
ATOM 2568  H HG22 . VAL B 2 13 ? 91.044  11.289  -17.030 1.00 0.00 ? 13 VAL B HG22 2  
ATOM 2569  H HG23 . VAL B 2 13 ? 89.590  11.549  -16.067 1.00 0.00 ? 13 VAL B HG23 2  
ATOM 2570  N N    . VAL B 2 14 ? 90.102  9.530   -14.927 1.00 0.00 ? 14 VAL B N    2  
ATOM 2571  C CA   . VAL B 2 14 ? 91.079  9.498   -13.842 1.00 0.00 ? 14 VAL B CA   2  
ATOM 2572  C C    . VAL B 2 14 ? 91.450  8.050   -13.537 1.00 0.00 ? 14 VAL B C    2  
ATOM 2573  O O    . VAL B 2 14 ? 92.619  7.725   -13.321 1.00 0.00 ? 14 VAL B O    2  
ATOM 2574  C CB   . VAL B 2 14 ? 90.509  10.169  -12.585 1.00 0.00 ? 14 VAL B CB   2  
ATOM 2575  C CG1  . VAL B 2 14 ? 91.475  9.976   -11.413 1.00 0.00 ? 14 VAL B CG1  2  
ATOM 2576  C CG2  . VAL B 2 14 ? 90.323  11.667  -12.843 1.00 0.00 ? 14 VAL B CG2  2  
ATOM 2577  H H    . VAL B 2 14 ? 89.228  9.963   -14.787 1.00 0.00 ? 14 VAL B H    2  
ATOM 2578  H HA   . VAL B 2 14 ? 91.967  10.029  -14.153 1.00 0.00 ? 14 VAL B HA   2  
ATOM 2579  H HB   . VAL B 2 14 ? 89.556  9.724   -12.342 1.00 0.00 ? 14 VAL B HB   2  
ATOM 2580  H HG11 . VAL B 2 14 ? 92.478  10.222  -11.727 1.00 0.00 ? 14 VAL B HG11 2  
ATOM 2581  H HG12 . VAL B 2 14 ? 91.442  8.947   -11.085 1.00 0.00 ? 14 VAL B HG12 2  
ATOM 2582  H HG13 . VAL B 2 14 ? 91.184  10.622  -10.597 1.00 0.00 ? 14 VAL B HG13 2  
ATOM 2583  H HG21 . VAL B 2 14 ? 91.221  12.071  -13.286 1.00 0.00 ? 14 VAL B HG21 2  
ATOM 2584  H HG22 . VAL B 2 14 ? 90.126  12.171  -11.908 1.00 0.00 ? 14 VAL B HG22 2  
ATOM 2585  H HG23 . VAL B 2 14 ? 89.492  11.816  -13.514 1.00 0.00 ? 14 VAL B HG23 2  
ATOM 2586  N N    . GLY B 2 15 ? 90.442  7.184   -13.537 1.00 0.00 ? 15 GLY B N    2  
ATOM 2587  C CA   . GLY B 2 15 ? 90.661  5.768   -13.274 1.00 0.00 ? 15 GLY B CA   2  
ATOM 2588  C C    . GLY B 2 15 ? 91.604  5.173   -14.312 1.00 0.00 ? 15 GLY B C    2  
ATOM 2589  O O    . GLY B 2 15 ? 92.494  4.389   -13.982 1.00 0.00 ? 15 GLY B O    2  
ATOM 2590  H H    . GLY B 2 15 ? 89.535  7.502   -13.725 1.00 0.00 ? 15 GLY B H    2  
ATOM 2591  H HA2  . GLY B 2 15 ? 91.091  5.650   -12.290 1.00 0.00 ? 15 GLY B HA2  2  
ATOM 2592  H HA3  . GLY B 2 15 ? 89.717  5.247   -13.316 1.00 0.00 ? 15 GLY B HA3  2  
ATOM 2593  N N    . ASP B 2 16 ? 91.407  5.558   -15.570 1.00 0.00 ? 16 ASP B N    2  
ATOM 2594  C CA   . ASP B 2 16 ? 92.250  5.062   -16.651 1.00 0.00 ? 16 ASP B CA   2  
ATOM 2595  C C    . ASP B 2 16 ? 93.703  5.452   -16.407 1.00 0.00 ? 16 ASP B C    2  
ATOM 2596  O O    . ASP B 2 16 ? 94.615  4.655   -16.623 1.00 0.00 ? 16 ASP B O    2  
ATOM 2597  C CB   . ASP B 2 16 ? 91.781  5.643   -17.987 1.00 0.00 ? 16 ASP B CB   2  
ATOM 2598  C CG   . ASP B 2 16 ? 92.415  4.873   -19.139 1.00 0.00 ? 16 ASP B CG   2  
ATOM 2599  O OD1  . ASP B 2 16 ? 92.563  3.669   -19.009 1.00 0.00 ? 16 ASP B OD1  2  
ATOM 2600  O OD2  . ASP B 2 16 ? 92.741  5.497   -20.135 1.00 0.00 ? 16 ASP B OD2  2  
ATOM 2601  H H    . ASP B 2 16 ? 90.685  6.188   -15.773 1.00 0.00 ? 16 ASP B H    2  
ATOM 2602  H HA   . ASP B 2 16 ? 92.175  3.985   -16.693 1.00 0.00 ? 16 ASP B HA   2  
ATOM 2603  H HB2  . ASP B 2 16 ? 90.707  5.569   -18.053 1.00 0.00 ? 16 ASP B HB2  2  
ATOM 2604  H HB3  . ASP B 2 16 ? 92.074  6.681   -18.047 1.00 0.00 ? 16 ASP B HB3  2  
ATOM 2605  N N    . LEU B 2 17 ? 93.907  6.682   -15.951 1.00 0.00 ? 17 LEU B N    2  
ATOM 2606  C CA   . LEU B 2 17 ? 95.253  7.171   -15.674 1.00 0.00 ? 17 LEU B CA   2  
ATOM 2607  C C    . LEU B 2 17 ? 95.908  6.316   -14.593 1.00 0.00 ? 17 LEU B C    2  
ATOM 2608  O O    . LEU B 2 17 ? 97.074  5.935   -14.705 1.00 0.00 ? 17 LEU B O    2  
ATOM 2609  C CB   . LEU B 2 17 ? 95.183  8.635   -15.221 1.00 0.00 ? 17 LEU B CB   2  
ATOM 2610  C CG   . LEU B 2 17 ? 96.561  9.126   -14.752 1.00 0.00 ? 17 LEU B CG   2  
ATOM 2611  C CD1  . LEU B 2 17 ? 97.611  8.867   -15.840 1.00 0.00 ? 17 LEU B CD1  2  
ATOM 2612  C CD2  . LEU B 2 17 ? 96.483  10.629  -14.465 1.00 0.00 ? 17 LEU B CD2  2  
ATOM 2613  H H    . LEU B 2 17 ? 93.139  7.272   -15.794 1.00 0.00 ? 17 LEU B H    2  
ATOM 2614  H HA   . LEU B 2 17 ? 95.839  7.109   -16.578 1.00 0.00 ? 17 LEU B HA   2  
ATOM 2615  H HB2  . LEU B 2 17 ? 94.851  9.247   -16.047 1.00 0.00 ? 17 LEU B HB2  2  
ATOM 2616  H HB3  . LEU B 2 17 ? 94.479  8.723   -14.407 1.00 0.00 ? 17 LEU B HB3  2  
ATOM 2617  H HG   . LEU B 2 17 ? 96.843  8.604   -13.850 1.00 0.00 ? 17 LEU B HG   2  
ATOM 2618  H HD11 . LEU B 2 17 ? 98.473  9.497   -15.669 1.00 0.00 ? 17 LEU B HD11 2  
ATOM 2619  H HD12 . LEU B 2 17 ? 97.191  9.090   -16.811 1.00 0.00 ? 17 LEU B HD12 2  
ATOM 2620  H HD13 . LEU B 2 17 ? 97.915  7.832   -15.809 1.00 0.00 ? 17 LEU B HD13 2  
ATOM 2621  H HD21 . LEU B 2 17 ? 95.718  10.815  -13.727 1.00 0.00 ? 17 LEU B HD21 2  
ATOM 2622  H HD22 . LEU B 2 17 ? 96.241  11.156  -15.377 1.00 0.00 ? 17 LEU B HD22 2  
ATOM 2623  H HD23 . LEU B 2 17 ? 97.436  10.973  -14.092 1.00 0.00 ? 17 LEU B HD23 2  
ATOM 2624  N N    . VAL B 2 18 ? 95.146  6.011   -13.548 1.00 0.00 ? 18 VAL B N    2  
ATOM 2625  C CA   . VAL B 2 18 ? 95.665  5.195   -12.461 1.00 0.00 ? 18 VAL B CA   2  
ATOM 2626  C C    . VAL B 2 18 ? 96.142  3.849   -12.999 1.00 0.00 ? 18 VAL B C    2  
ATOM 2627  O O    . VAL B 2 18 ? 97.248  3.408   -12.693 1.00 0.00 ? 18 VAL B O    2  
ATOM 2628  C CB   . VAL B 2 18 ? 94.582  4.991   -11.396 1.00 0.00 ? 18 VAL B CB   2  
ATOM 2629  C CG1  . VAL B 2 18 ? 95.060  3.974   -10.355 1.00 0.00 ? 18 VAL B CG1  2  
ATOM 2630  C CG2  . VAL B 2 18 ? 94.303  6.326   -10.702 1.00 0.00 ? 18 VAL B CG2  2  
ATOM 2631  H H    . VAL B 2 18 ? 94.221  6.336   -13.511 1.00 0.00 ? 18 VAL B H    2  
ATOM 2632  H HA   . VAL B 2 18 ? 96.503  5.707   -12.012 1.00 0.00 ? 18 VAL B HA   2  
ATOM 2633  H HB   . VAL B 2 18 ? 93.678  4.630   -11.864 1.00 0.00 ? 18 VAL B HB   2  
ATOM 2634  H HG11 . VAL B 2 18 ? 96.061  4.227   -10.037 1.00 0.00 ? 18 VAL B HG11 2  
ATOM 2635  H HG12 . VAL B 2 18 ? 95.058  2.985   -10.788 1.00 0.00 ? 18 VAL B HG12 2  
ATOM 2636  H HG13 . VAL B 2 18 ? 94.397  3.995   -9.502  1.00 0.00 ? 18 VAL B HG13 2  
ATOM 2637  H HG21 . VAL B 2 18 ? 95.196  6.663   -10.196 1.00 0.00 ? 18 VAL B HG21 2  
ATOM 2638  H HG22 . VAL B 2 18 ? 93.507  6.200   -9.982  1.00 0.00 ? 18 VAL B HG22 2  
ATOM 2639  H HG23 . VAL B 2 18 ? 94.009  7.060   -11.438 1.00 0.00 ? 18 VAL B HG23 2  
ATOM 2640  N N    . LEU B 2 19 ? 95.311  3.206   -13.813 1.00 0.00 ? 19 LEU B N    2  
ATOM 2641  C CA   . LEU B 2 19 ? 95.684  1.918   -14.387 1.00 0.00 ? 19 LEU B CA   2  
ATOM 2642  C C    . LEU B 2 19 ? 96.928  2.073   -15.250 1.00 0.00 ? 19 LEU B C    2  
ATOM 2643  O O    . LEU B 2 19 ? 97.778  1.191   -15.287 1.00 0.00 ? 19 LEU B O    2  
ATOM 2644  C CB   . LEU B 2 19 ? 94.541  1.350   -15.237 1.00 0.00 ? 19 LEU B CB   2  
ATOM 2645  C CG   . LEU B 2 19 ? 93.398  0.851   -14.342 1.00 0.00 ? 19 LEU B CG   2  
ATOM 2646  C CD1  . LEU B 2 19 ? 92.215  0.454   -15.233 1.00 0.00 ? 19 LEU B CD1  2  
ATOM 2647  C CD2  . LEU B 2 19 ? 93.855  -0.364  -13.498 1.00 0.00 ? 19 LEU B CD2  2  
ATOM 2648  H H    . LEU B 2 19 ? 94.443  3.604   -14.036 1.00 0.00 ? 19 LEU B H    2  
ATOM 2649  H HA   . LEU B 2 19 ? 95.904  1.232   -13.588 1.00 0.00 ? 19 LEU B HA   2  
ATOM 2650  H HB2  . LEU B 2 19 ? 94.167  2.124   -15.892 1.00 0.00 ? 19 LEU B HB2  2  
ATOM 2651  H HB3  . LEU B 2 19 ? 94.911  0.528   -15.833 1.00 0.00 ? 19 LEU B HB3  2  
ATOM 2652  H HG   . LEU B 2 19 ? 93.090  1.653   -13.683 1.00 0.00 ? 19 LEU B HG   2  
ATOM 2653  H HD11 . LEU B 2 19 ? 91.481  -0.075  -14.644 1.00 0.00 ? 19 LEU B HD11 2  
ATOM 2654  H HD12 . LEU B 2 19 ? 92.564  -0.184  -16.035 1.00 0.00 ? 19 LEU B HD12 2  
ATOM 2655  H HD13 . LEU B 2 19 ? 91.767  1.341   -15.655 1.00 0.00 ? 19 LEU B HD13 2  
ATOM 2656  H HD21 . LEU B 2 19 ? 93.013  -1.006  -13.288 1.00 0.00 ? 19 LEU B HD21 2  
ATOM 2657  H HD22 . LEU B 2 19 ? 94.268  -0.019  -12.563 1.00 0.00 ? 19 LEU B HD22 2  
ATOM 2658  H HD23 . LEU B 2 19 ? 94.605  -0.927  -14.035 1.00 0.00 ? 19 LEU B HD23 2  
ATOM 2659  N N    . THR B 2 20 ? 97.037  3.197   -15.943 1.00 0.00 ? 20 THR B N    2  
ATOM 2660  C CA   . THR B 2 20 ? 98.196  3.434   -16.791 1.00 0.00 ? 20 THR B CA   2  
ATOM 2661  C C    . THR B 2 20 ? 99.478  3.356   -15.966 1.00 0.00 ? 20 THR B C    2  
ATOM 2662  O O    . THR B 2 20 ? 100.468 2.758   -16.389 1.00 0.00 ? 20 THR B O    2  
ATOM 2663  C CB   . THR B 2 20 ? 98.094  4.812   -17.449 1.00 0.00 ? 20 THR B CB   2  
ATOM 2664  O OG1  . THR B 2 20 ? 96.805  4.968   -18.024 1.00 0.00 ? 20 THR B OG1  2  
ATOM 2665  C CG2  . THR B 2 20 ? 99.160  4.938   -18.539 1.00 0.00 ? 20 THR B CG2  2  
ATOM 2666  H H    . THR B 2 20 ? 96.334  3.876   -15.880 1.00 0.00 ? 20 THR B H    2  
ATOM 2667  H HA   . THR B 2 20 ? 98.228  2.679   -17.563 1.00 0.00 ? 20 THR B HA   2  
ATOM 2668  H HB   . THR B 2 20 ? 98.254  5.578   -16.707 1.00 0.00 ? 20 THR B HB   2  
ATOM 2669  H HG1  . THR B 2 20 ? 96.495  4.101   -18.296 1.00 0.00 ? 20 THR B HG1  2  
ATOM 2670  H HG21 . THR B 2 20 ? 99.188  5.957   -18.899 1.00 0.00 ? 20 THR B HG21 2  
ATOM 2671  H HG22 . THR B 2 20 ? 98.921  4.274   -19.355 1.00 0.00 ? 20 THR B HG22 2  
ATOM 2672  H HG23 . THR B 2 20 ? 100.126 4.675   -18.130 1.00 0.00 ? 20 THR B HG23 2  
ATOM 2673  N N    . VAL B 2 21 ? 99.449  3.971   -14.788 1.00 0.00 ? 21 VAL B N    2  
ATOM 2674  C CA   . VAL B 2 21 ? 100.615 3.978   -13.907 1.00 0.00 ? 21 VAL B CA   2  
ATOM 2675  C C    . VAL B 2 21 ? 100.897 2.589   -13.329 1.00 0.00 ? 21 VAL B C    2  
ATOM 2676  O O    . VAL B 2 21 ? 102.041 2.136   -13.322 1.00 0.00 ? 21 VAL B O    2  
ATOM 2677  C CB   . VAL B 2 21 ? 100.395 4.968   -12.763 1.00 0.00 ? 21 VAL B CB   2  
ATOM 2678  C CG1  . VAL B 2 21 ? 101.600 4.936   -11.818 1.00 0.00 ? 21 VAL B CG1  2  
ATOM 2679  C CG2  . VAL B 2 21 ? 100.234 6.380   -13.335 1.00 0.00 ? 21 VAL B CG2  2  
ATOM 2680  H H    . VAL B 2 21 ? 98.631  4.437   -14.507 1.00 0.00 ? 21 VAL B H    2  
ATOM 2681  H HA   . VAL B 2 21 ? 101.476 4.297   -14.476 1.00 0.00 ? 21 VAL B HA   2  
ATOM 2682  H HB   . VAL B 2 21 ? 99.503  4.695   -12.217 1.00 0.00 ? 21 VAL B HB   2  
ATOM 2683  H HG11 . VAL B 2 21 ? 101.575 5.801   -11.172 1.00 0.00 ? 21 VAL B HG11 2  
ATOM 2684  H HG12 . VAL B 2 21 ? 102.512 4.945   -12.396 1.00 0.00 ? 21 VAL B HG12 2  
ATOM 2685  H HG13 . VAL B 2 21 ? 101.562 4.039   -11.218 1.00 0.00 ? 21 VAL B HG13 2  
ATOM 2686  H HG21 . VAL B 2 21 ? 101.190 6.736   -13.689 1.00 0.00 ? 21 VAL B HG21 2  
ATOM 2687  H HG22 . VAL B 2 21 ? 99.866  7.041   -12.564 1.00 0.00 ? 21 VAL B HG22 2  
ATOM 2688  H HG23 . VAL B 2 21 ? 99.532  6.356   -14.155 1.00 0.00 ? 21 VAL B HG23 2  
ATOM 2689  N N    . LEU B 2 22 ? 99.857  1.926   -12.825 1.00 0.00 ? 22 LEU B N    2  
ATOM 2690  C CA   . LEU B 2 22 ? 100.029 0.601   -12.228 1.00 0.00 ? 22 LEU B CA   2  
ATOM 2691  C C    . LEU B 2 22 ? 100.545 -0.408  -13.262 1.00 0.00 ? 22 LEU B C    2  
ATOM 2692  O O    . LEU B 2 22 ? 101.540 -1.093  -13.022 1.00 0.00 ? 22 LEU B O    2  
ATOM 2693  C CB   . LEU B 2 22 ? 98.689  0.116   -11.630 1.00 0.00 ? 22 LEU B CB   2  
ATOM 2694  C CG   . LEU B 2 22 ? 98.565  0.557   -10.162 1.00 0.00 ? 22 LEU B CG   2  
ATOM 2695  C CD1  . LEU B 2 22 ? 98.539  2.084   -10.074 1.00 0.00 ? 22 LEU B CD1  2  
ATOM 2696  C CD2  . LEU B 2 22 ? 97.268  -0.006  -9.575  1.00 0.00 ? 22 LEU B CD2  2  
ATOM 2697  H H    . LEU B 2 22 ? 98.968  2.338   -12.842 1.00 0.00 ? 22 LEU B H    2  
ATOM 2698  H HA   . LEU B 2 22 ? 100.761 0.675   -11.438 1.00 0.00 ? 22 LEU B HA   2  
ATOM 2699  H HB2  . LEU B 2 22 ? 97.873  0.539   -12.196 1.00 0.00 ? 22 LEU B HB2  2  
ATOM 2700  H HB3  . LEU B 2 22 ? 98.633  -0.962  -11.678 1.00 0.00 ? 22 LEU B HB3  2  
ATOM 2701  H HG   . LEU B 2 22 ? 99.408  0.179   -9.601  1.00 0.00 ? 22 LEU B HG   2  
ATOM 2702  H HD11 . LEU B 2 22 ? 99.433  2.488   -10.525 1.00 0.00 ? 22 LEU B HD11 2  
ATOM 2703  H HD12 . LEU B 2 22 ? 98.493  2.383   -9.038  1.00 0.00 ? 22 LEU B HD12 2  
ATOM 2704  H HD13 . LEU B 2 22 ? 97.672  2.459   -10.594 1.00 0.00 ? 22 LEU B HD13 2  
ATOM 2705  H HD21 . LEU B 2 22 ? 96.422  0.457   -10.060 1.00 0.00 ? 22 LEU B HD21 2  
ATOM 2706  H HD22 . LEU B 2 22 ? 97.234  0.202   -8.515  1.00 0.00 ? 22 LEU B HD22 2  
ATOM 2707  H HD23 . LEU B 2 22 ? 97.235  -1.074  -9.733  1.00 0.00 ? 22 LEU B HD23 2  
ATOM 2708  N N    . ILE B 2 23 ? 99.873  -0.497  -14.405 1.00 0.00 ? 23 ILE B N    2  
ATOM 2709  C CA   . ILE B 2 23 ? 100.293 -1.428  -15.446 1.00 0.00 ? 23 ILE B CA   2  
ATOM 2710  C C    . ILE B 2 23 ? 101.734 -1.132  -15.854 1.00 0.00 ? 23 ILE B C    2  
ATOM 2711  O O    . ILE B 2 23 ? 102.576 -2.028  -15.886 1.00 0.00 ? 23 ILE B O    2  
ATOM 2712  C CB   . ILE B 2 23 ? 99.371  -1.319  -16.662 1.00 0.00 ? 23 ILE B CB   2  
ATOM 2713  C CG1  . ILE B 2 23 ? 97.926  -1.624  -16.239 1.00 0.00 ? 23 ILE B CG1  2  
ATOM 2714  C CG2  . ILE B 2 23 ? 99.811  -2.327  -17.724 1.00 0.00 ? 23 ILE B CG2  2  
ATOM 2715  C CD1  . ILE B 2 23 ? 96.960  -1.112  -17.310 1.00 0.00 ? 23 ILE B CD1  2  
ATOM 2716  H H    . ILE B 2 23 ? 99.088  0.070   -14.550 1.00 0.00 ? 23 ILE B H    2  
ATOM 2717  H HA   . ILE B 2 23 ? 100.237 -2.434  -15.057 1.00 0.00 ? 23 ILE B HA   2  
ATOM 2718  H HB   . ILE B 2 23 ? 99.429  -0.319  -17.067 1.00 0.00 ? 23 ILE B HB   2  
ATOM 2719  H HG12 . ILE B 2 23 ? 97.802  -2.690  -16.122 1.00 0.00 ? 23 ILE B HG12 2  
ATOM 2720  H HG13 . ILE B 2 23 ? 97.712  -1.136  -15.302 1.00 0.00 ? 23 ILE B HG13 2  
ATOM 2721  H HG21 . ILE B 2 23 ? 100.766 -2.030  -18.130 1.00 0.00 ? 23 ILE B HG21 2  
ATOM 2722  H HG22 . ILE B 2 23 ? 99.076  -2.359  -18.515 1.00 0.00 ? 23 ILE B HG22 2  
ATOM 2723  H HG23 . ILE B 2 23 ? 99.899  -3.306  -17.277 1.00 0.00 ? 23 ILE B HG23 2  
ATOM 2724  H HD11 . ILE B 2 23 ? 95.943  -1.259  -16.978 1.00 0.00 ? 23 ILE B HD11 2  
ATOM 2725  H HD12 . ILE B 2 23 ? 97.121  -1.657  -18.229 1.00 0.00 ? 23 ILE B HD12 2  
ATOM 2726  H HD13 . ILE B 2 23 ? 97.134  -0.060  -17.481 1.00 0.00 ? 23 ILE B HD13 2  
ATOM 2727  N N    . ALA B 2 24 ? 102.015 0.134   -16.149 1.00 0.00 ? 24 ALA B N    2  
ATOM 2728  C CA   . ALA B 2 24 ? 103.365 0.535   -16.533 1.00 0.00 ? 24 ALA B CA   2  
ATOM 2729  C C    . ALA B 2 24 ? 104.379 -0.026  -15.536 1.00 0.00 ? 24 ALA B C    2  
ATOM 2730  O O    . ALA B 2 24 ? 105.420 -0.569  -15.918 1.00 0.00 ? 24 ALA B O    2  
ATOM 2731  C CB   . ALA B 2 24 ? 103.466 2.061   -16.561 1.00 0.00 ? 24 ALA B CB   2  
ATOM 2732  H H    . ALA B 2 24 ? 101.306 0.811   -16.099 1.00 0.00 ? 24 ALA B H    2  
ATOM 2733  H HA   . ALA B 2 24 ? 103.580 0.151   -17.518 1.00 0.00 ? 24 ALA B HA   2  
ATOM 2734  H HB1  . ALA B 2 24 ? 102.804 2.452   -17.320 1.00 0.00 ? 24 ALA B HB1  2  
ATOM 2735  H HB2  . ALA B 2 24 ? 104.482 2.350   -16.785 1.00 0.00 ? 24 ALA B HB2  2  
ATOM 2736  H HB3  . ALA B 2 24 ? 103.183 2.458   -15.597 1.00 0.00 ? 24 ALA B HB3  2  
ATOM 2737  N N    . LEU B 2 25 ? 104.061 0.105   -14.253 1.00 0.00 ? 25 LEU B N    2  
ATOM 2738  C CA   . LEU B 2 25 ? 104.939 -0.395  -13.203 1.00 0.00 ? 25 LEU B CA   2  
ATOM 2739  C C    . LEU B 2 25 ? 105.031 -1.918  -13.276 1.00 0.00 ? 25 LEU B C    2  
ATOM 2740  O O    . LEU B 2 25 ? 106.046 -2.508  -12.910 1.00 0.00 ? 25 LEU B O    2  
ATOM 2741  C CB   . LEU B 2 25 ? 104.402 0.031   -11.828 1.00 0.00 ? 25 LEU B CB   2  
ATOM 2742  C CG   . LEU B 2 25 ? 105.523 -0.042  -10.767 1.00 0.00 ? 25 LEU B CG   2  
ATOM 2743  C CD1  . LEU B 2 25 ? 106.305 1.278   -10.735 1.00 0.00 ? 25 LEU B CD1  2  
ATOM 2744  C CD2  . LEU B 2 25 ? 104.912 -0.289  -9.382  1.00 0.00 ? 25 LEU B CD2  2  
ATOM 2745  H H    . LEU B 2 25 ? 103.218 0.540   -14.008 1.00 0.00 ? 25 LEU B H    2  
ATOM 2746  H HA   . LEU B 2 25 ? 105.925 0.022   -13.343 1.00 0.00 ? 25 LEU B HA   2  
ATOM 2747  H HB2  . LEU B 2 25 ? 104.024 1.043   -11.892 1.00 0.00 ? 25 LEU B HB2  2  
ATOM 2748  H HB3  . LEU B 2 25 ? 103.592 -0.631  -11.544 1.00 0.00 ? 25 LEU B HB3  2  
ATOM 2749  H HG   . LEU B 2 25 ? 106.200 -0.851  -11.008 1.00 0.00 ? 25 LEU B HG   2  
ATOM 2750  H HD11 . LEU B 2 25 ? 107.218 1.141   -10.174 1.00 0.00 ? 25 LEU B HD11 2  
ATOM 2751  H HD12 . LEU B 2 25 ? 105.705 2.040   -10.261 1.00 0.00 ? 25 LEU B HD12 2  
ATOM 2752  H HD13 . LEU B 2 25 ? 106.545 1.584   -11.742 1.00 0.00 ? 25 LEU B HD13 2  
ATOM 2753  H HD21 . LEU B 2 25 ? 104.128 0.431   -9.201  1.00 0.00 ? 25 LEU B HD21 2  
ATOM 2754  H HD22 . LEU B 2 25 ? 105.678 -0.186  -8.627  1.00 0.00 ? 25 LEU B HD22 2  
ATOM 2755  H HD23 . LEU B 2 25 ? 104.500 -1.287  -9.344  1.00 0.00 ? 25 LEU B HD23 2  
ATOM 2756  N N    . ALA B 2 26 ? 103.955 -2.542  -13.746 1.00 0.00 ? 26 ALA B N    2  
ATOM 2757  C CA   . ALA B 2 26 ? 103.909 -3.996  -13.861 1.00 0.00 ? 26 ALA B CA   2  
ATOM 2758  C C    . ALA B 2 26 ? 104.924 -4.502  -14.884 1.00 0.00 ? 26 ALA B C    2  
ATOM 2759  O O    . ALA B 2 26 ? 105.701 -5.412  -14.598 1.00 0.00 ? 26 ALA B O    2  
ATOM 2760  C CB   . ALA B 2 26 ? 102.503 -4.446  -14.266 1.00 0.00 ? 26 ALA B CB   2  
ATOM 2761  H H    . ALA B 2 26 ? 103.176 -2.014  -14.015 1.00 0.00 ? 26 ALA B H    2  
ATOM 2762  H HA   . ALA B 2 26 ? 104.143 -4.426  -12.900 1.00 0.00 ? 26 ALA B HA   2  
ATOM 2763  H HB1  . ALA B 2 26 ? 102.377 -5.492  -14.029 1.00 0.00 ? 26 ALA B HB1  2  
ATOM 2764  H HB2  . ALA B 2 26 ? 102.366 -4.299  -15.328 1.00 0.00 ? 26 ALA B HB2  2  
ATOM 2765  H HB3  . ALA B 2 26 ? 101.770 -3.865  -13.726 1.00 0.00 ? 26 ALA B HB3  2  
ATOM 2766  N N    . VAL B 2 27 ? 104.921 -3.914  -16.078 1.00 0.00 ? 27 VAL B N    2  
ATOM 2767  C CA   . VAL B 2 27 ? 105.860 -4.337  -17.112 1.00 0.00 ? 27 VAL B CA   2  
ATOM 2768  C C    . VAL B 2 27 ? 107.289 -4.049  -16.664 1.00 0.00 ? 27 VAL B C    2  
ATOM 2769  O O    . VAL B 2 27 ? 108.194 -4.849  -16.904 1.00 0.00 ? 27 VAL B O    2  
ATOM 2770  C CB   . VAL B 2 27 ? 105.554 -3.636  -18.441 1.00 0.00 ? 27 VAL B CB   2  
ATOM 2771  C CG1  . VAL B 2 27 ? 105.425 -2.133  -18.219 1.00 0.00 ? 27 VAL B CG1  2  
ATOM 2772  C CG2  . VAL B 2 27 ? 106.679 -3.910  -19.446 1.00 0.00 ? 27 VAL B CG2  2  
ATOM 2773  H H    . VAL B 2 27 ? 104.284 -3.192  -16.265 1.00 0.00 ? 27 VAL B H    2  
ATOM 2774  H HA   . VAL B 2 27 ? 105.754 -5.403  -17.252 1.00 0.00 ? 27 VAL B HA   2  
ATOM 2775  H HB   . VAL B 2 27 ? 104.624 -4.016  -18.834 1.00 0.00 ? 27 VAL B HB   2  
ATOM 2776  H HG11 . VAL B 2 27 ? 106.315 -1.759  -17.738 1.00 0.00 ? 27 VAL B HG11 2  
ATOM 2777  H HG12 . VAL B 2 27 ? 104.567 -1.941  -17.595 1.00 0.00 ? 27 VAL B HG12 2  
ATOM 2778  H HG13 . VAL B 2 27 ? 105.295 -1.638  -19.171 1.00 0.00 ? 27 VAL B HG13 2  
ATOM 2779  H HG21 . VAL B 2 27 ? 106.357 -3.621  -20.435 1.00 0.00 ? 27 VAL B HG21 2  
ATOM 2780  H HG22 . VAL B 2 27 ? 106.918 -4.964  -19.439 1.00 0.00 ? 27 VAL B HG22 2  
ATOM 2781  H HG23 . VAL B 2 27 ? 107.555 -3.342  -19.171 1.00 0.00 ? 27 VAL B HG23 2  
ATOM 2782  N N    . TYR B 2 28 ? 107.487 -2.916  -15.994 1.00 0.00 ? 28 TYR B N    2  
ATOM 2783  C CA   . TYR B 2 28 ? 108.817 -2.568  -15.505 1.00 0.00 ? 28 TYR B CA   2  
ATOM 2784  C C    . TYR B 2 28 ? 109.284 -3.631  -14.516 1.00 0.00 ? 28 TYR B C    2  
ATOM 2785  O O    . TYR B 2 28 ? 110.433 -4.072  -14.550 1.00 0.00 ? 28 TYR B O    2  
ATOM 2786  C CB   . TYR B 2 28 ? 108.786 -1.200  -14.818 1.00 0.00 ? 28 TYR B CB   2  
ATOM 2787  C CG   . TYR B 2 28 ? 110.198 -0.744  -14.531 1.00 0.00 ? 28 TYR B CG   2  
ATOM 2788  C CD1  . TYR B 2 28 ? 110.933 -0.079  -15.520 1.00 0.00 ? 28 TYR B CD1  2  
ATOM 2789  C CD2  . TYR B 2 28 ? 110.770 -0.982  -13.275 1.00 0.00 ? 28 TYR B CD2  2  
ATOM 2790  C CE1  . TYR B 2 28 ? 112.241 0.346   -15.253 1.00 0.00 ? 28 TYR B CE1  2  
ATOM 2791  C CE2  . TYR B 2 28 ? 112.078 -0.557  -13.009 1.00 0.00 ? 28 TYR B CE2  2  
ATOM 2792  C CZ   . TYR B 2 28 ? 112.812 0.108   -13.998 1.00 0.00 ? 28 TYR B CZ   2  
ATOM 2793  O OH   . TYR B 2 28 ? 114.101 0.529   -13.735 1.00 0.00 ? 28 TYR B OH   2  
ATOM 2794  H H    . TYR B 2 28 ? 106.728 -2.316  -15.814 1.00 0.00 ? 28 TYR B H    2  
ATOM 2795  H HA   . TYR B 2 28 ? 109.503 -2.531  -16.338 1.00 0.00 ? 28 TYR B HA   2  
ATOM 2796  H HB2  . TYR B 2 28 ? 108.301 -0.485  -15.466 1.00 0.00 ? 28 TYR B HB2  2  
ATOM 2797  H HB3  . TYR B 2 28 ? 108.238 -1.275  -13.891 1.00 0.00 ? 28 TYR B HB3  2  
ATOM 2798  H HD1  . TYR B 2 28 ? 110.493 0.104   -16.488 1.00 0.00 ? 28 TYR B HD1  2  
ATOM 2799  H HD2  . TYR B 2 28 ? 110.203 -1.494  -12.511 1.00 0.00 ? 28 TYR B HD2  2  
ATOM 2800  H HE1  . TYR B 2 28 ? 112.807 0.858   -16.016 1.00 0.00 ? 28 TYR B HE1  2  
ATOM 2801  H HE2  . TYR B 2 28 ? 112.518 -0.740  -12.040 1.00 0.00 ? 28 TYR B HE2  2  
ATOM 2802  H HH   . TYR B 2 28 ? 114.702 -0.163  -14.017 1.00 0.00 ? 28 TYR B HH   2  
ATOM 2803  N N    . PHE B 2 29 ? 108.369 -4.040  -13.642 1.00 0.00 ? 29 PHE B N    2  
ATOM 2804  C CA   . PHE B 2 29 ? 108.653 -5.056  -12.639 1.00 0.00 ? 29 PHE B CA   2  
ATOM 2805  C C    . PHE B 2 29 ? 109.052 -6.375  -13.304 1.00 0.00 ? 29 PHE B C    2  
ATOM 2806  O O    . PHE B 2 29 ? 110.036 -7.004  -12.912 1.00 0.00 ? 29 PHE B O    2  
ATOM 2807  C CB   . PHE B 2 29 ? 107.400 -5.247  -11.773 1.00 0.00 ? 29 PHE B CB   2  
ATOM 2808  C CG   . PHE B 2 29 ? 107.493 -6.521  -10.955 1.00 0.00 ? 29 PHE B CG   2  
ATOM 2809  C CD1  . PHE B 2 29 ? 108.583 -6.731  -10.102 1.00 0.00 ? 29 PHE B CD1  2  
ATOM 2810  C CD2  . PHE B 2 29 ? 106.484 -7.493  -11.051 1.00 0.00 ? 29 PHE B CD2  2  
ATOM 2811  C CE1  . PHE B 2 29 ? 108.665 -7.909  -9.347  1.00 0.00 ? 29 PHE B CE1  2  
ATOM 2812  C CE2  . PHE B 2 29 ? 106.567 -8.668  -10.298 1.00 0.00 ? 29 PHE B CE2  2  
ATOM 2813  C CZ   . PHE B 2 29 ? 107.658 -8.877  -9.446  1.00 0.00 ? 29 PHE B CZ   2  
ATOM 2814  H H    . PHE B 2 29 ? 107.471 -3.649  -13.675 1.00 0.00 ? 29 PHE B H    2  
ATOM 2815  H HA   . PHE B 2 29 ? 109.464 -4.717  -12.012 1.00 0.00 ? 29 PHE B HA   2  
ATOM 2816  H HB2  . PHE B 2 29 ? 107.301 -4.402  -11.109 1.00 0.00 ? 29 PHE B HB2  2  
ATOM 2817  H HB3  . PHE B 2 29 ? 106.532 -5.293  -12.413 1.00 0.00 ? 29 PHE B HB3  2  
ATOM 2818  H HD1  . PHE B 2 29 ? 109.360 -5.985  -10.025 1.00 0.00 ? 29 PHE B HD1  2  
ATOM 2819  H HD2  . PHE B 2 29 ? 105.641 -7.333  -11.708 1.00 0.00 ? 29 PHE B HD2  2  
ATOM 2820  H HE1  . PHE B 2 29 ? 109.507 -8.071  -8.690  1.00 0.00 ? 29 PHE B HE1  2  
ATOM 2821  H HE2  . PHE B 2 29 ? 105.788 -9.415  -10.374 1.00 0.00 ? 29 PHE B HE2  2  
ATOM 2822  H HZ   . PHE B 2 29 ? 107.722 -9.785  -8.864  1.00 0.00 ? 29 PHE B HZ   2  
ATOM 2823  N N    . LEU B 2 30 ? 108.282 -6.792  -14.304 1.00 0.00 ? 30 LEU B N    2  
ATOM 2824  C CA   . LEU B 2 30 ? 108.568 -8.040  -15.004 1.00 0.00 ? 30 LEU B CA   2  
ATOM 2825  C C    . LEU B 2 30 ? 109.943 -7.978  -15.666 1.00 0.00 ? 30 LEU B C    2  
ATOM 2826  O O    . LEU B 2 30 ? 110.696 -8.952  -15.649 1.00 0.00 ? 30 LEU B O    2  
ATOM 2827  C CB   . LEU B 2 30 ? 107.488 -8.310  -16.066 1.00 0.00 ? 30 LEU B CB   2  
ATOM 2828  C CG   . LEU B 2 30 ? 107.473 -9.808  -16.445 1.00 0.00 ? 30 LEU B CG   2  
ATOM 2829  C CD1  . LEU B 2 30 ? 106.565 -10.587 -15.483 1.00 0.00 ? 30 LEU B CD1  2  
ATOM 2830  C CD2  . LEU B 2 30 ? 106.942 -9.977  -17.875 1.00 0.00 ? 30 LEU B CD2  2  
ATOM 2831  H H    . LEU B 2 30 ? 107.508 -6.255  -14.573 1.00 0.00 ? 30 LEU B H    2  
ATOM 2832  H HA   . LEU B 2 30 ? 108.565 -8.846  -14.288 1.00 0.00 ? 30 LEU B HA   2  
ATOM 2833  H HB2  . LEU B 2 30 ? 106.522 -8.024  -15.672 1.00 0.00 ? 30 LEU B HB2  2  
ATOM 2834  H HB3  . LEU B 2 30 ? 107.700 -7.717  -16.945 1.00 0.00 ? 30 LEU B HB3  2  
ATOM 2835  H HG   . LEU B 2 30 ? 108.476 -10.208 -16.388 1.00 0.00 ? 30 LEU B HG   2  
ATOM 2836  H HD11 . LEU B 2 30 ? 106.773 -10.291 -14.467 1.00 0.00 ? 30 LEU B HD11 2  
ATOM 2837  H HD12 . LEU B 2 30 ? 106.749 -11.646 -15.593 1.00 0.00 ? 30 LEU B HD12 2  
ATOM 2838  H HD13 . LEU B 2 30 ? 105.531 -10.377 -15.715 1.00 0.00 ? 30 LEU B HD13 2  
ATOM 2839  H HD21 . LEU B 2 30 ? 106.713 -11.018 -18.054 1.00 0.00 ? 30 LEU B HD21 2  
ATOM 2840  H HD22 . LEU B 2 30 ? 107.692 -9.646  -18.578 1.00 0.00 ? 30 LEU B HD22 2  
ATOM 2841  H HD23 . LEU B 2 30 ? 106.047 -9.385  -17.999 1.00 0.00 ? 30 LEU B HD23 2  
ATOM 2842  N N    . GLY B 2 31 ? 110.262 -6.827  -16.249 1.00 0.00 ? 31 GLY B N    2  
ATOM 2843  C CA   . GLY B 2 31 ? 111.549 -6.649  -16.913 1.00 0.00 ? 31 GLY B CA   2  
ATOM 2844  C C    . GLY B 2 31 ? 111.816 -5.174  -17.188 1.00 0.00 ? 31 GLY B C    2  
ATOM 2845  O O    . GLY B 2 31 ? 112.411 -4.477  -16.366 1.00 0.00 ? 31 GLY B O    2  
ATOM 2846  H H    . GLY B 2 31 ? 109.623 -6.085  -16.231 1.00 0.00 ? 31 GLY B H    2  
ATOM 2847  H HA2  . GLY B 2 31 ? 112.332 -7.043  -16.280 1.00 0.00 ? 31 GLY B HA2  2  
ATOM 2848  H HA3  . GLY B 2 31 ? 111.542 -7.187  -17.849 1.00 0.00 ? 31 GLY B HA3  2  
ATOM 2849  N N    . ARG B 2 32 ? 111.371 -4.705  -18.348 1.00 0.00 ? 32 ARG B N    2  
ATOM 2850  C CA   . ARG B 2 32 ? 111.566 -3.309  -18.723 1.00 0.00 ? 32 ARG B CA   2  
ATOM 2851  C C    . ARG B 2 32 ? 110.665 -2.941  -19.898 1.00 0.00 ? 32 ARG B C    2  
ATOM 2852  O O    . ARG B 2 32 ? 111.054 -3.079  -21.057 1.00 0.00 ? 32 ARG B O    2  
ATOM 2853  C CB   . ARG B 2 32 ? 113.029 -3.070  -19.101 1.00 0.00 ? 32 ARG B CB   2  
ATOM 2854  C CG   . ARG B 2 32 ? 113.249 -1.582  -19.383 1.00 0.00 ? 32 ARG B CG   2  
ATOM 2855  C CD   . ARG B 2 32 ? 114.725 -1.334  -19.690 1.00 0.00 ? 32 ARG B CD   2  
ATOM 2856  N NE   . ARG B 2 32 ? 114.957 0.087   -19.935 1.00 0.00 ? 32 ARG B NE   2  
ATOM 2857  C CZ   . ARG B 2 32 ? 115.113 0.941   -18.927 1.00 0.00 ? 32 ARG B CZ   2  
ATOM 2858  N NH1  . ARG B 2 32 ? 115.059 0.514   -17.695 1.00 0.00 ? 32 ARG B NH1  2  
ATOM 2859  N NH2  . ARG B 2 32 ? 115.319 2.206   -19.171 1.00 0.00 ? 32 ARG B NH2  2  
ATOM 2860  H H    . ARG B 2 32 ? 110.901 -5.307  -18.963 1.00 0.00 ? 32 ARG B H    2  
ATOM 2861  H HA   . ARG B 2 32 ? 111.316 -2.683  -17.880 1.00 0.00 ? 32 ARG B HA   2  
ATOM 2862  H HB2  . ARG B 2 32 ? 113.666 -3.380  -18.285 1.00 0.00 ? 32 ARG B HB2  2  
ATOM 2863  H HB3  . ARG B 2 32 ? 113.271 -3.641  -19.984 1.00 0.00 ? 32 ARG B HB3  2  
ATOM 2864  H HG2  . ARG B 2 32 ? 112.649 -1.284  -20.230 1.00 0.00 ? 32 ARG B HG2  2  
ATOM 2865  H HG3  . ARG B 2 32 ? 112.962 -1.006  -18.517 1.00 0.00 ? 32 ARG B HG3  2  
ATOM 2866  H HD2  . ARG B 2 32 ? 115.325 -1.655  -18.853 1.00 0.00 ? 32 ARG B HD2  2  
ATOM 2867  H HD3  . ARG B 2 32 ? 115.007 -1.899  -20.567 1.00 0.00 ? 32 ARG B HD3  2  
ATOM 2868  H HE   . ARG B 2 32 ? 114.998 0.416   -20.856 1.00 0.00 ? 32 ARG B HE   2  
ATOM 2869  H HH11 . ARG B 2 32 ? 114.902 -0.455  -17.509 1.00 0.00 ? 32 ARG B HH11 2  
ATOM 2870  H HH12 . ARG B 2 32 ? 115.177 1.156   -16.938 1.00 0.00 ? 32 ARG B HH12 2  
ATOM 2871  H HH21 . ARG B 2 32 ? 115.360 2.534   -20.115 1.00 0.00 ? 32 ARG B HH21 2  
ATOM 2872  H HH22 . ARG B 2 32 ? 115.436 2.849   -18.413 1.00 0.00 ? 32 ARG B HH22 2  
ATOM 2873  N N    . CYS A 1 1  ? 70.656  21.851  -20.410 1.00 0.00 ? 1  CYS A N    3  
ATOM 2874  C CA   . CYS A 1 1  ? 70.647  20.801  -19.352 1.00 0.00 ? 1  CYS A CA   3  
ATOM 2875  C C    . CYS A 1 1  ? 70.495  19.430  -20.001 1.00 0.00 ? 1  CYS A C    3  
ATOM 2876  O O    . CYS A 1 1  ? 69.386  19.003  -20.322 1.00 0.00 ? 1  CYS A O    3  
ATOM 2877  C CB   . CYS A 1 1  ? 69.480  21.057  -18.395 1.00 0.00 ? 1  CYS A CB   3  
ATOM 2878  S SG   . CYS A 1 1  ? 69.559  19.879  -17.022 1.00 0.00 ? 1  CYS A SG   3  
ATOM 2879  H HA   . CYS A 1 1  ? 71.576  20.837  -18.803 1.00 0.00 ? 1  CYS A HA   3  
ATOM 2880  H HB2  . CYS A 1 1  ? 69.545  22.064  -18.010 1.00 0.00 ? 1  CYS A HB2  3  
ATOM 2881  H HB3  . CYS A 1 1  ? 68.546  20.933  -18.923 1.00 0.00 ? 1  CYS A HB3  3  
ATOM 2882  N N    . SER A 1 2  ? 71.618  18.743  -20.194 1.00 0.00 ? 2  SER A N    3  
ATOM 2883  C CA   . SER A 1 2  ? 71.599  17.420  -20.808 1.00 0.00 ? 2  SER A CA   3  
ATOM 2884  C C    . SER A 1 2  ? 72.862  16.643  -20.450 1.00 0.00 ? 2  SER A C    3  
ATOM 2885  O O    . SER A 1 2  ? 73.965  17.014  -20.848 1.00 0.00 ? 2  SER A O    3  
ATOM 2886  C CB   . SER A 1 2  ? 71.493  17.551  -22.328 1.00 0.00 ? 2  SER A CB   3  
ATOM 2887  O OG   . SER A 1 2  ? 71.359  16.258  -22.902 1.00 0.00 ? 2  SER A OG   3  
ATOM 2888  H H    . SER A 1 2  ? 72.474  19.135  -19.919 1.00 0.00 ? 2  SER A H    3  
ATOM 2889  H HA   . SER A 1 2  ? 70.739  16.876  -20.445 1.00 0.00 ? 2  SER A HA   3  
ATOM 2890  H HB2  . SER A 1 2  ? 70.628  18.142  -22.580 1.00 0.00 ? 2  SER A HB2  3  
ATOM 2891  H HB3  . SER A 1 2  ? 72.381  18.036  -22.708 1.00 0.00 ? 2  SER A HB3  3  
ATOM 2892  H HG   . SER A 1 2  ? 71.808  15.631  -22.330 1.00 0.00 ? 2  SER A HG   3  
ATOM 2893  N N    . THR A 1 3  ? 72.690  15.562  -19.693 1.00 0.00 ? 3  THR A N    3  
ATOM 2894  C CA   . THR A 1 3  ? 73.822  14.735  -19.285 1.00 0.00 ? 3  THR A CA   3  
ATOM 2895  C C    . THR A 1 3  ? 74.194  13.751  -20.389 1.00 0.00 ? 3  THR A C    3  
ATOM 2896  O O    . THR A 1 3  ? 73.508  13.666  -21.409 1.00 0.00 ? 3  THR A O    3  
ATOM 2897  C CB   . THR A 1 3  ? 73.470  13.962  -18.011 1.00 0.00 ? 3  THR A CB   3  
ATOM 2898  O OG1  . THR A 1 3  ? 72.693  12.822  -18.351 1.00 0.00 ? 3  THR A OG1  3  
ATOM 2899  C CG2  . THR A 1 3  ? 72.669  14.864  -17.070 1.00 0.00 ? 3  THR A CG2  3  
ATOM 2900  H H    . THR A 1 3  ? 71.787  15.315  -19.406 1.00 0.00 ? 3  THR A H    3  
ATOM 2901  H HA   . THR A 1 3  ? 74.671  15.372  -19.081 1.00 0.00 ? 3  THR A HA   3  
ATOM 2902  H HB   . THR A 1 3  ? 74.376  13.648  -17.517 1.00 0.00 ? 3  THR A HB   3  
ATOM 2903  H HG1  . THR A 1 3  ? 72.324  12.964  -19.225 1.00 0.00 ? 3  THR A HG1  3  
ATOM 2904  H HG21 . THR A 1 3  ? 72.641  14.422  -16.085 1.00 0.00 ? 3  THR A HG21 3  
ATOM 2905  H HG22 . THR A 1 3  ? 71.662  14.972  -17.445 1.00 0.00 ? 3  THR A HG22 3  
ATOM 2906  H HG23 . THR A 1 3  ? 73.139  15.836  -17.016 1.00 0.00 ? 3  THR A HG23 3  
ATOM 2907  N N    . VAL A 1 4  ? 75.285  13.014  -20.177 1.00 0.00 ? 4  VAL A N    3  
ATOM 2908  C CA   . VAL A 1 4  ? 75.760  12.032  -21.155 1.00 0.00 ? 4  VAL A CA   3  
ATOM 2909  C C    . VAL A 1 4  ? 75.545  12.525  -22.580 1.00 0.00 ? 4  VAL A C    3  
ATOM 2910  O O    . VAL A 1 4  ? 75.427  11.736  -23.518 1.00 0.00 ? 4  VAL A O    3  
ATOM 2911  C CB   . VAL A 1 4  ? 75.059  10.684  -20.940 1.00 0.00 ? 4  VAL A CB   3  
ATOM 2912  C CG1  . VAL A 1 4  ? 75.398  10.161  -19.543 1.00 0.00 ? 4  VAL A CG1  3  
ATOM 2913  C CG2  . VAL A 1 4  ? 73.538  10.846  -21.060 1.00 0.00 ? 4  VAL A CG2  3  
ATOM 2914  H H    . VAL A 1 4  ? 75.784  13.135  -19.342 1.00 0.00 ? 4  VAL A H    3  
ATOM 2915  H HA   . VAL A 1 4  ? 76.822  11.890  -21.010 1.00 0.00 ? 4  VAL A HA   3  
ATOM 2916  H HB   . VAL A 1 4  ? 75.406  9.978   -21.680 1.00 0.00 ? 4  VAL A HB   3  
ATOM 2917  H HG11 . VAL A 1 4  ? 74.781  9.303   -19.320 1.00 0.00 ? 4  VAL A HG11 3  
ATOM 2918  H HG12 . VAL A 1 4  ? 75.212  10.937  -18.812 1.00 0.00 ? 4  VAL A HG12 3  
ATOM 2919  H HG13 . VAL A 1 4  ? 76.439  9.876   -19.507 1.00 0.00 ? 4  VAL A HG13 3  
ATOM 2920  H HG21 . VAL A 1 4  ? 73.300  11.395  -21.959 1.00 0.00 ? 4  VAL A HG21 3  
ATOM 2921  H HG22 . VAL A 1 4  ? 73.163  11.380  -20.200 1.00 0.00 ? 4  VAL A HG22 3  
ATOM 2922  H HG23 . VAL A 1 4  ? 73.078  9.871   -21.103 1.00 0.00 ? 4  VAL A HG23 3  
ATOM 2923  N N    . SER A 1 5  ? 75.521  13.844  -22.730 1.00 0.00 ? 5  SER A N    3  
ATOM 2924  C CA   . SER A 1 5  ? 75.349  14.461  -24.037 1.00 0.00 ? 5  SER A CA   3  
ATOM 2925  C C    . SER A 1 5  ? 76.684  14.508  -24.792 1.00 0.00 ? 5  SER A C    3  
ATOM 2926  O O    . SER A 1 5  ? 76.710  14.353  -26.014 1.00 0.00 ? 5  SER A O    3  
ATOM 2927  C CB   . SER A 1 5  ? 74.780  15.877  -23.880 1.00 0.00 ? 5  SER A CB   3  
ATOM 2928  O OG   . SER A 1 5  ? 74.052  16.220  -25.052 1.00 0.00 ? 5  SER A OG   3  
ATOM 2929  H H    . SER A 1 5  ? 75.640  14.415  -21.942 1.00 0.00 ? 5  SER A H    3  
ATOM 2930  H HA   . SER A 1 5  ? 74.649  13.871  -24.611 1.00 0.00 ? 5  SER A HA   3  
ATOM 2931  H HB2  . SER A 1 5  ? 74.116  15.906  -23.032 1.00 0.00 ? 5  SER A HB2  3  
ATOM 2932  H HB3  . SER A 1 5  ? 75.586  16.582  -23.725 1.00 0.00 ? 5  SER A HB3  3  
ATOM 2933  H HG   . SER A 1 5  ? 74.667  16.236  -25.789 1.00 0.00 ? 5  SER A HG   3  
ATOM 2934  N N    . PRO A 1 6  ? 77.790  14.713  -24.104 1.00 0.00 ? 6  PRO A N    3  
ATOM 2935  C CA   . PRO A 1 6  ? 79.136  14.769  -24.752 1.00 0.00 ? 6  PRO A CA   3  
ATOM 2936  C C    . PRO A 1 6  ? 79.385  13.592  -25.682 1.00 0.00 ? 6  PRO A C    3  
ATOM 2937  O O    . PRO A 1 6  ? 79.943  13.761  -26.766 1.00 0.00 ? 6  PRO A O    3  
ATOM 2938  C CB   . PRO A 1 6  ? 80.099  14.760  -23.562 1.00 0.00 ? 6  PRO A CB   3  
ATOM 2939  C CG   . PRO A 1 6  ? 79.330  15.407  -22.464 1.00 0.00 ? 6  PRO A CG   3  
ATOM 2940  C CD   . PRO A 1 6  ? 77.897  14.916  -22.642 1.00 0.00 ? 6  PRO A CD   3  
ATOM 2941  H HA   . PRO A 1 6  ? 79.259  15.684  -25.291 1.00 0.00 ? 6  PRO A HA   3  
ATOM 2942  H HB2  . PRO A 1 6  ? 80.353  13.745  -23.296 1.00 0.00 ? 6  PRO A HB2  3  
ATOM 2943  H HB3  . PRO A 1 6  ? 80.988  15.332  -23.783 1.00 0.00 ? 6  PRO A HB3  3  
ATOM 2944  H HG2  . PRO A 1 6  ? 79.722  15.103  -21.501 1.00 0.00 ? 6  PRO A HG2  3  
ATOM 2945  H HG3  . PRO A 1 6  ? 79.363  16.481  -22.562 1.00 0.00 ? 6  PRO A HG3  3  
ATOM 2946  H HD2  . PRO A 1 6  ? 77.760  13.984  -22.110 1.00 0.00 ? 6  PRO A HD2  3  
ATOM 2947  H HD3  . PRO A 1 6  ? 77.190  15.659  -22.309 1.00 0.00 ? 6  PRO A HD3  3  
ATOM 2948  N N    . GLY A 1 7  ? 78.982  12.402  -25.257 1.00 0.00 ? 7  GLY A N    3  
ATOM 2949  C CA   . GLY A 1 7  ? 79.200  11.215  -26.085 1.00 0.00 ? 7  GLY A CA   3  
ATOM 2950  C C    . GLY A 1 7  ? 80.682  10.867  -26.079 1.00 0.00 ? 7  GLY A C    3  
ATOM 2951  O O    . GLY A 1 7  ? 81.065  9.716   -25.863 1.00 0.00 ? 7  GLY A O    3  
ATOM 2952  H H    . GLY A 1 7  ? 78.546  12.321  -24.374 1.00 0.00 ? 7  GLY A H    3  
ATOM 2953  H HA2  . GLY A 1 7  ? 78.630  10.378  -25.696 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2954  H HA3  . GLY A 1 7  ? 78.891  11.422  -27.097 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2955  N N    . VAL A 1 8  ? 81.516  11.881  -26.287 1.00 0.00 ? 8  VAL A N    3  
ATOM 2956  C CA   . VAL A 1 8  ? 82.951  11.677  -26.268 1.00 0.00 ? 8  VAL A CA   3  
ATOM 2957  C C    . VAL A 1 8  ? 83.338  11.130  -24.907 1.00 0.00 ? 8  VAL A C    3  
ATOM 2958  O O    . VAL A 1 8  ? 84.158  10.212  -24.802 1.00 0.00 ? 8  VAL A O    3  
ATOM 2959  C CB   . VAL A 1 8  ? 83.682  12.992  -26.544 1.00 0.00 ? 8  VAL A CB   3  
ATOM 2960  C CG1  . VAL A 1 8  ? 85.183  12.813  -26.298 1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2961  C CG2  . VAL A 1 8  ? 83.451  13.392  -28.002 1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2962  H H    . VAL A 1 8  ? 81.160  12.780  -26.429 1.00 0.00 ? 8  VAL A H    3  
ATOM 2963  H HA   . VAL A 1 8  ? 83.216  10.957  -27.028 1.00 0.00 ? 8  VAL A HA   3  
ATOM 2964  H HB   . VAL A 1 8  ? 83.298  13.763  -25.891 1.00 0.00 ? 8  VAL A HB   3  
ATOM 2965  H HG11 . VAL A 1 8  ? 85.717  13.660  -26.705 1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2966  H HG12 . VAL A 1 8  ? 85.521  11.908  -26.781 1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2967  H HG13 . VAL A 1 8  ? 85.369  12.746  -25.237 1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2968  H HG21 . VAL A 1 8  ? 84.027  14.277  -28.228 1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2969  H HG22 . VAL A 1 8  ? 82.403  13.593  -28.157 1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2970  H HG23 . VAL A 1 8  ? 83.762  12.584  -28.647 1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2971  N N    . LEU A 1 9  ? 82.718  11.670  -23.858 1.00 0.00 ? 9  LEU A N    3  
ATOM 2972  C CA   . LEU A 1 9  ? 83.010  11.171  -22.521 1.00 0.00 ? 9  LEU A CA   3  
ATOM 2973  C C    . LEU A 1 9  ? 82.780  9.652   -22.526 1.00 0.00 ? 9  LEU A C    3  
ATOM 2974  O O    . LEU A 1 9  ? 83.595  8.876   -22.012 1.00 0.00 ? 9  LEU A O    3  
ATOM 2975  C CB   . LEU A 1 9  ? 82.119  11.858  -21.469 1.00 0.00 ? 9  LEU A CB   3  
ATOM 2976  C CG   . LEU A 1 9  ? 82.771  13.167  -20.962 1.00 0.00 ? 9  LEU A CG   3  
ATOM 2977  C CD1  . LEU A 1 9  ? 83.934  12.859  -19.997 1.00 0.00 ? 9  LEU A CD1  3  
ATOM 2978  C CD2  . LEU A 1 9  ? 83.296  14.002  -22.146 1.00 0.00 ? 9  LEU A CD2  3  
ATOM 2979  H H    . LEU A 1 9  ? 82.045  12.390  -23.991 1.00 0.00 ? 9  LEU A H    3  
ATOM 2980  H HA   . LEU A 1 9  ? 84.045  11.368  -22.295 1.00 0.00 ? 9  LEU A HA   3  
ATOM 2981  H HB2  . LEU A 1 9  ? 81.164  12.088  -21.911 1.00 0.00 ? 9  LEU A HB2  3  
ATOM 2982  H HB3  . LEU A 1 9  ? 81.967  11.191  -20.635 1.00 0.00 ? 9  LEU A HB3  3  
ATOM 2983  H HG   . LEU A 1 9  ? 82.025  13.741  -20.431 1.00 0.00 ? 9  LEU A HG   3  
ATOM 2984  H HD11 . LEU A 1 9  ? 84.084  13.706  -19.343 1.00 0.00 ? 9  LEU A HD11 3  
ATOM 2985  H HD12 . LEU A 1 9  ? 84.840  12.678  -20.558 1.00 0.00 ? 9  LEU A HD12 3  
ATOM 2986  H HD13 . LEU A 1 9  ? 83.703  11.989  -19.404 1.00 0.00 ? 9  LEU A HD13 3  
ATOM 2987  H HD21 . LEU A 1 9  ? 82.639  13.892  -22.991 1.00 0.00 ? 9  LEU A HD21 3  
ATOM 2988  H HD22 . LEU A 1 9  ? 84.288  13.671  -22.420 1.00 0.00 ? 9  LEU A HD22 3  
ATOM 2989  H HD23 . LEU A 1 9  ? 83.335  15.043  -21.858 1.00 0.00 ? 9  LEU A HD23 3  
ATOM 2990  N N    . ALA A 1 10 ? 81.686  9.230   -23.159 1.00 0.00 ? 10 ALA A N    3  
ATOM 2991  C CA   . ALA A 1 10 ? 81.396  7.808   -23.268 1.00 0.00 ? 10 ALA A CA   3  
ATOM 2992  C C    . ALA A 1 10 ? 82.589  7.129   -23.925 1.00 0.00 ? 10 ALA A C    3  
ATOM 2993  O O    . ALA A 1 10 ? 82.982  6.023   -23.549 1.00 0.00 ? 10 ALA A O    3  
ATOM 2994  C CB   . ALA A 1 10 ? 80.125  7.581   -24.099 1.00 0.00 ? 10 ALA A CB   3  
ATOM 2995  H H    . ALA A 1 10 ? 81.089  9.879   -23.587 1.00 0.00 ? 10 ALA A H    3  
ATOM 2996  H HA   . ALA A 1 10 ? 81.254  7.397   -22.279 1.00 0.00 ? 10 ALA A HA   3  
ATOM 2997  H HB1  . ALA A 1 10 ? 79.412  8.362   -23.881 1.00 0.00 ? 10 ALA A HB1  3  
ATOM 2998  H HB2  . ALA A 1 10 ? 79.696  6.623   -23.846 1.00 0.00 ? 10 ALA A HB2  3  
ATOM 2999  H HB3  . ALA A 1 10 ? 80.368  7.599   -25.152 1.00 0.00 ? 10 ALA A HB3  3  
ATOM 3000  N N    . GLY A 1 11 ? 83.181  7.828   -24.892 1.00 0.00 ? 11 GLY A N    3  
ATOM 3001  C CA   . GLY A 1 11 ? 84.354  7.314   -25.579 1.00 0.00 ? 11 GLY A CA   3  
ATOM 3002  C C    . GLY A 1 11 ? 85.489  7.136   -24.581 1.00 0.00 ? 11 GLY A C    3  
ATOM 3003  O O    . GLY A 1 11 ? 86.362  6.290   -24.759 1.00 0.00 ? 11 GLY A O    3  
ATOM 3004  H H    . GLY A 1 11 ? 82.832  8.718   -25.129 1.00 0.00 ? 11 GLY A H    3  
ATOM 3005  H HA2  . GLY A 1 11 ? 84.118  6.363   -26.034 1.00 0.00 ? 11 GLY A HA2  3  
ATOM 3006  H HA3  . GLY A 1 11 ? 84.660  8.013   -26.342 1.00 0.00 ? 11 GLY A HA3  3  
ATOM 3007  N N    . ILE A 1 12 ? 85.458  7.941   -23.521 1.00 0.00 ? 12 ILE A N    3  
ATOM 3008  C CA   . ILE A 1 12 ? 86.483  7.864   -22.480 1.00 0.00 ? 12 ILE A CA   3  
ATOM 3009  C C    . ILE A 1 12 ? 86.330  6.545   -21.734 1.00 0.00 ? 12 ILE A C    3  
ATOM 3010  O O    . ILE A 1 12 ? 87.315  5.898   -21.376 1.00 0.00 ? 12 ILE A O    3  
ATOM 3011  C CB   . ILE A 1 12 ? 86.379  9.107   -21.524 1.00 0.00 ? 12 ILE A CB   3  
ATOM 3012  C CG1  . ILE A 1 12 ? 87.777  9.730   -21.281 1.00 0.00 ? 12 ILE A CG1  3  
ATOM 3013  C CG2  . ILE A 1 12 ? 85.752  8.756   -20.145 1.00 0.00 ? 12 ILE A CG2  3  
ATOM 3014  C CD1  . ILE A 1 12 ? 87.633  11.193  -20.843 1.00 0.00 ? 12 ILE A CD1  3  
ATOM 3015  H H    . ILE A 1 12 ? 84.731  8.590   -23.441 1.00 0.00 ? 12 ILE A H    3  
ATOM 3016  H HA   . ILE A 1 12 ? 87.445  7.856   -22.967 1.00 0.00 ? 12 ILE A HA   3  
ATOM 3017  H HB   . ILE A 1 12 ? 85.753  9.844   -22.001 1.00 0.00 ? 12 ILE A HB   3  
ATOM 3018  H HG12 . ILE A 1 12 ? 88.291  9.176   -20.510 1.00 0.00 ? 12 ILE A HG12 3  
ATOM 3019  H HG13 . ILE A 1 12 ? 88.359  9.699   -22.189 1.00 0.00 ? 12 ILE A HG13 3  
ATOM 3020  H HG21 . ILE A 1 12 ? 84.898  8.116   -20.274 1.00 0.00 ? 12 ILE A HG21 3  
ATOM 3021  H HG22 . ILE A 1 12 ? 85.432  9.663   -19.654 1.00 0.00 ? 12 ILE A HG22 3  
ATOM 3022  H HG23 . ILE A 1 12 ? 86.484  8.256   -19.526 1.00 0.00 ? 12 ILE A HG23 3  
ATOM 3023  H HD11 . ILE A 1 12 ? 88.502  11.481  -20.273 1.00 0.00 ? 12 ILE A HD11 3  
ATOM 3024  H HD12 . ILE A 1 12 ? 86.746  11.312  -20.237 1.00 0.00 ? 12 ILE A HD12 3  
ATOM 3025  H HD13 . ILE A 1 12 ? 87.557  11.822  -21.719 1.00 0.00 ? 12 ILE A HD13 3  
ATOM 3026  N N    . VAL A 1 13 ? 85.083  6.148   -21.517 1.00 0.00 ? 13 VAL A N    3  
ATOM 3027  C CA   . VAL A 1 13 ? 84.805  4.896   -20.829 1.00 0.00 ? 13 VAL A CA   3  
ATOM 3028  C C    . VAL A 1 13 ? 85.318  3.717   -21.654 1.00 0.00 ? 13 VAL A C    3  
ATOM 3029  O O    . VAL A 1 13 ? 86.052  2.855   -21.153 1.00 0.00 ? 13 VAL A O    3  
ATOM 3030  C CB   . VAL A 1 13 ? 83.300  4.756   -20.602 1.00 0.00 ? 13 VAL A CB   3  
ATOM 3031  C CG1  . VAL A 1 13 ? 83.006  3.430   -19.899 1.00 0.00 ? 13 VAL A CG1  3  
ATOM 3032  C CG2  . VAL A 1 13 ? 82.807  5.916   -19.729 1.00 0.00 ? 13 VAL A CG2  3  
ATOM 3033  H H    . VAL A 1 13 ? 84.336  6.711   -21.834 1.00 0.00 ? 13 VAL A H    3  
ATOM 3034  H HA   . VAL A 1 13 ? 85.307  4.900   -19.874 1.00 0.00 ? 13 VAL A HA   3  
ATOM 3035  H HB   . VAL A 1 13 ? 82.790  4.779   -21.554 1.00 0.00 ? 13 VAL A HB   3  
ATOM 3036  H HG11 . VAL A 1 13 ? 81.966  3.400   -19.614 1.00 0.00 ? 13 VAL A HG11 3  
ATOM 3037  H HG12 . VAL A 1 13 ? 83.624  3.345   -19.018 1.00 0.00 ? 13 VAL A HG12 3  
ATOM 3038  H HG13 . VAL A 1 13 ? 83.219  2.611   -20.569 1.00 0.00 ? 13 VAL A HG13 3  
ATOM 3039  H HG21 . VAL A 1 13 ? 82.763  6.817   -20.321 1.00 0.00 ? 13 VAL A HG21 3  
ATOM 3040  H HG22 . VAL A 1 13 ? 83.489  6.063   -18.906 1.00 0.00 ? 13 VAL A HG22 3  
ATOM 3041  H HG23 . VAL A 1 13 ? 81.823  5.688   -19.347 1.00 0.00 ? 13 VAL A HG23 3  
ATOM 3042  N N    . VAL A 1 14 ? 84.938  3.694   -22.928 1.00 0.00 ? 14 VAL A N    3  
ATOM 3043  C CA   . VAL A 1 14 ? 85.370  2.627   -23.823 1.00 0.00 ? 14 VAL A CA   3  
ATOM 3044  C C    . VAL A 1 14 ? 86.892  2.599   -23.912 1.00 0.00 ? 14 VAL A C    3  
ATOM 3045  O O    . VAL A 1 14 ? 87.513  1.540   -23.822 1.00 0.00 ? 14 VAL A O    3  
ATOM 3046  C CB   . VAL A 1 14 ? 84.781  2.845   -25.219 1.00 0.00 ? 14 VAL A CB   3  
ATOM 3047  C CG1  . VAL A 1 14 ? 85.317  1.776   -26.173 1.00 0.00 ? 14 VAL A CG1  3  
ATOM 3048  C CG2  . VAL A 1 14 ? 83.256  2.745   -25.149 1.00 0.00 ? 14 VAL A CG2  3  
ATOM 3049  H H    . VAL A 1 14 ? 84.363  4.412   -23.272 1.00 0.00 ? 14 VAL A H    3  
ATOM 3050  H HA   . VAL A 1 14 ? 85.021  1.680   -23.438 1.00 0.00 ? 14 VAL A HA   3  
ATOM 3051  H HB   . VAL A 1 14 ? 85.064  3.822   -25.581 1.00 0.00 ? 14 VAL A HB   3  
ATOM 3052  H HG11 . VAL A 1 14 ? 85.249  0.807   -25.701 1.00 0.00 ? 14 VAL A HG11 3  
ATOM 3053  H HG12 . VAL A 1 14 ? 86.349  1.990   -26.409 1.00 0.00 ? 14 VAL A HG12 3  
ATOM 3054  H HG13 . VAL A 1 14 ? 84.731  1.777   -27.079 1.00 0.00 ? 14 VAL A HG13 3  
ATOM 3055  H HG21 . VAL A 1 14 ? 82.974  1.754   -24.828 1.00 0.00 ? 14 VAL A HG21 3  
ATOM 3056  H HG22 . VAL A 1 14 ? 82.837  2.940   -26.125 1.00 0.00 ? 14 VAL A HG22 3  
ATOM 3057  H HG23 . VAL A 1 14 ? 82.879  3.472   -24.445 1.00 0.00 ? 14 VAL A HG23 3  
ATOM 3058  N N    . GLY A 1 15 ? 87.484  3.776   -24.087 1.00 0.00 ? 15 GLY A N    3  
ATOM 3059  C CA   . GLY A 1 15 ? 88.934  3.890   -24.187 1.00 0.00 ? 15 GLY A CA   3  
ATOM 3060  C C    . GLY A 1 15 ? 89.608  3.409   -22.910 1.00 0.00 ? 15 GLY A C    3  
ATOM 3061  O O    . GLY A 1 15 ? 90.736  2.923   -22.943 1.00 0.00 ? 15 GLY A O    3  
ATOM 3062  H H    . GLY A 1 15 ? 86.935  4.584   -24.148 1.00 0.00 ? 15 GLY A H    3  
ATOM 3063  H HA2  . GLY A 1 15 ? 89.279  3.295   -25.020 1.00 0.00 ? 15 GLY A HA2  3  
ATOM 3064  H HA3  . GLY A 1 15 ? 89.197  4.924   -24.355 1.00 0.00 ? 15 GLY A HA3  3  
ATOM 3065  N N    . ASP A 1 16 ? 88.913  3.547   -21.788 1.00 0.00 ? 16 ASP A N    3  
ATOM 3066  C CA   . ASP A 1 16 ? 89.462  3.120   -20.506 1.00 0.00 ? 16 ASP A CA   3  
ATOM 3067  C C    . ASP A 1 16 ? 89.599  1.602   -20.466 1.00 0.00 ? 16 ASP A C    3  
ATOM 3068  O O    . ASP A 1 16 ? 90.675  1.068   -20.171 1.00 0.00 ? 16 ASP A O    3  
ATOM 3069  C CB   . ASP A 1 16 ? 88.543  3.580   -19.373 1.00 0.00 ? 16 ASP A CB   3  
ATOM 3070  C CG   . ASP A 1 16 ? 89.230  3.376   -18.026 1.00 0.00 ? 16 ASP A CG   3  
ATOM 3071  O OD1  . ASP A 1 16 ? 90.374  2.956   -18.025 1.00 0.00 ? 16 ASP A OD1  3  
ATOM 3072  O OD2  . ASP A 1 16 ? 88.600  3.642   -17.016 1.00 0.00 ? 16 ASP A OD2  3  
ATOM 3073  H H    . ASP A 1 16 ? 88.018  3.945   -21.820 1.00 0.00 ? 16 ASP A H    3  
ATOM 3074  H HA   . ASP A 1 16 ? 90.436  3.566   -20.371 1.00 0.00 ? 16 ASP A HA   3  
ATOM 3075  H HB2  . ASP A 1 16 ? 88.312  4.627   -19.502 1.00 0.00 ? 16 ASP A HB2  3  
ATOM 3076  H HB3  . ASP A 1 16 ? 87.630  3.005   -19.397 1.00 0.00 ? 16 ASP A HB3  3  
ATOM 3077  N N    . LEU A 1 17 ? 88.504  0.908   -20.771 1.00 0.00 ? 17 LEU A N    3  
ATOM 3078  C CA   . LEU A 1 17 ? 88.520  -0.551  -20.769 1.00 0.00 ? 17 LEU A CA   3  
ATOM 3079  C C    . LEU A 1 17 ? 89.541  -1.066  -21.778 1.00 0.00 ? 17 LEU A C    3  
ATOM 3080  O O    . LEU A 1 17 ? 90.268  -2.021  -21.511 1.00 0.00 ? 17 LEU A O    3  
ATOM 3081  C CB   . LEU A 1 17 ? 87.127  -1.094  -21.113 1.00 0.00 ? 17 LEU A CB   3  
ATOM 3082  C CG   . LEU A 1 17 ? 87.093  -2.625  -20.958 1.00 0.00 ? 17 LEU A CG   3  
ATOM 3083  C CD1  . LEU A 1 17 ? 87.255  -3.024  -19.478 1.00 0.00 ? 17 LEU A CD1  3  
ATOM 3084  C CD2  . LEU A 1 17 ? 85.751  -3.145  -21.489 1.00 0.00 ? 17 LEU A CD2  3  
ATOM 3085  H H    . LEU A 1 17 ? 87.676  1.386   -21.001 1.00 0.00 ? 17 LEU A H    3  
ATOM 3086  H HA   . LEU A 1 17 ? 88.799  -0.896  -19.787 1.00 0.00 ? 17 LEU A HA   3  
ATOM 3087  H HB2  . LEU A 1 17 ? 86.397  -0.649  -20.453 1.00 0.00 ? 17 LEU A HB2  3  
ATOM 3088  H HB3  . LEU A 1 17 ? 86.888  -0.836  -22.133 1.00 0.00 ? 17 LEU A HB3  3  
ATOM 3089  H HG   . LEU A 1 17 ? 87.897  -3.061  -21.534 1.00 0.00 ? 17 LEU A HG   3  
ATOM 3090  H HD11 . LEU A 1 17 ? 86.795  -3.989  -19.305 1.00 0.00 ? 17 LEU A HD11 3  
ATOM 3091  H HD12 . LEU A 1 17 ? 86.784  -2.288  -18.844 1.00 0.00 ? 17 LEU A HD12 3  
ATOM 3092  H HD13 . LEU A 1 17 ? 88.305  -3.087  -19.235 1.00 0.00 ? 17 LEU A HD13 3  
ATOM 3093  H HD21 . LEU A 1 17 ? 84.945  -2.712  -20.915 1.00 0.00 ? 17 LEU A HD21 3  
ATOM 3094  H HD22 . LEU A 1 17 ? 85.721  -4.221  -21.398 1.00 0.00 ? 17 LEU A HD22 3  
ATOM 3095  H HD23 . LEU A 1 17 ? 85.644  -2.868  -22.528 1.00 0.00 ? 17 LEU A HD23 3  
ATOM 3096  N N    . VAL A 1 18 ? 89.588  -0.427  -22.940 1.00 0.00 ? 18 VAL A N    3  
ATOM 3097  C CA   . VAL A 1 18 ? 90.522  -0.831  -23.983 1.00 0.00 ? 18 VAL A CA   3  
ATOM 3098  C C    . VAL A 1 18 ? 91.962  -0.512  -23.585 1.00 0.00 ? 18 VAL A C    3  
ATOM 3099  O O    . VAL A 1 18 ? 92.892  -1.157  -24.058 1.00 0.00 ? 18 VAL A O    3  
ATOM 3100  C CB   . VAL A 1 18 ? 90.177  -0.129  -25.301 1.00 0.00 ? 18 VAL A CB   3  
ATOM 3101  C CG1  . VAL A 1 18 ? 91.251  -0.435  -26.349 1.00 0.00 ? 18 VAL A CG1  3  
ATOM 3102  C CG2  . VAL A 1 18 ? 88.824  -0.636  -25.805 1.00 0.00 ? 18 VAL A CG2  3  
ATOM 3103  H H    . VAL A 1 18 ? 88.984  0.329   -23.100 1.00 0.00 ? 18 VAL A H    3  
ATOM 3104  H HA   . VAL A 1 18 ? 90.434  -1.898  -24.129 1.00 0.00 ? 18 VAL A HA   3  
ATOM 3105  H HB   . VAL A 1 18 ? 90.126  0.939   -25.138 1.00 0.00 ? 18 VAL A HB   3  
ATOM 3106  H HG11 . VAL A 1 18 ? 92.147  0.125   -26.120 1.00 0.00 ? 18 VAL A HG11 3  
ATOM 3107  H HG12 . VAL A 1 18 ? 90.892  -0.153  -27.327 1.00 0.00 ? 18 VAL A HG12 3  
ATOM 3108  H HG13 . VAL A 1 18 ? 91.474  -1.491  -26.337 1.00 0.00 ? 18 VAL A HG13 3  
ATOM 3109  H HG21 . VAL A 1 18 ? 88.854  -1.711  -25.896 1.00 0.00 ? 18 VAL A HG21 3  
ATOM 3110  H HG22 . VAL A 1 18 ? 88.613  -0.198  -26.769 1.00 0.00 ? 18 VAL A HG22 3  
ATOM 3111  H HG23 . VAL A 1 18 ? 88.051  -0.356  -25.105 1.00 0.00 ? 18 VAL A HG23 3  
ATOM 3112  N N    . LEU A 1 19 ? 92.147  0.489   -22.732 1.00 0.00 ? 19 LEU A N    3  
ATOM 3113  C CA   . LEU A 1 19 ? 93.495  0.862   -22.313 1.00 0.00 ? 19 LEU A CA   3  
ATOM 3114  C C    . LEU A 1 19 ? 94.087  -0.195  -21.384 1.00 0.00 ? 19 LEU A C    3  
ATOM 3115  O O    . LEU A 1 19 ? 95.149  -0.751  -21.666 1.00 0.00 ? 19 LEU A O    3  
ATOM 3116  C CB   . LEU A 1 19 ? 93.474  2.223   -21.605 1.00 0.00 ? 19 LEU A CB   3  
ATOM 3117  C CG   . LEU A 1 19 ? 94.909  2.697   -21.314 1.00 0.00 ? 19 LEU A CG   3  
ATOM 3118  C CD1  . LEU A 1 19 ? 95.666  2.962   -22.630 1.00 0.00 ? 19 LEU A CD1  3  
ATOM 3119  C CD2  . LEU A 1 19 ? 94.854  3.986   -20.478 1.00 0.00 ? 19 LEU A CD2  3  
ATOM 3120  H H    . LEU A 1 19 ? 91.375  0.986   -22.387 1.00 0.00 ? 19 LEU A H    3  
ATOM 3121  H HA   . LEU A 1 19 ? 94.115  0.937   -23.191 1.00 0.00 ? 19 LEU A HA   3  
ATOM 3122  H HB2  . LEU A 1 19 ? 92.978  2.946   -22.236 1.00 0.00 ? 19 LEU A HB2  3  
ATOM 3123  H HB3  . LEU A 1 19 ? 92.935  2.132   -20.674 1.00 0.00 ? 19 LEU A HB3  3  
ATOM 3124  H HG   . LEU A 1 19 ? 95.430  1.934   -20.755 1.00 0.00 ? 19 LEU A HG   3  
ATOM 3125  H HD11 . LEU A 1 19 ? 94.981  3.330   -23.382 1.00 0.00 ? 19 LEU A HD11 3  
ATOM 3126  H HD12 . LEU A 1 19 ? 96.119  2.046   -22.976 1.00 0.00 ? 19 LEU A HD12 3  
ATOM 3127  H HD13 . LEU A 1 19 ? 96.443  3.696   -22.465 1.00 0.00 ? 19 LEU A HD13 3  
ATOM 3128  H HD21 . LEU A 1 19 ? 95.804  4.496   -20.537 1.00 0.00 ? 19 LEU A HD21 3  
ATOM 3129  H HD22 . LEU A 1 19 ? 94.645  3.737   -19.450 1.00 0.00 ? 19 LEU A HD22 3  
ATOM 3130  H HD23 . LEU A 1 19 ? 94.075  4.632   -20.858 1.00 0.00 ? 19 LEU A HD23 3  
ATOM 3131  N N    . THR A 1 20 ? 93.404  -0.473  -20.275 1.00 0.00 ? 20 THR A N    3  
ATOM 3132  C CA   . THR A 1 20 ? 93.902  -1.467  -19.332 1.00 0.00 ? 20 THR A CA   3  
ATOM 3133  C C    . THR A 1 20 ? 93.984  -2.852  -19.981 1.00 0.00 ? 20 THR A C    3  
ATOM 3134  O O    . THR A 1 20 ? 94.935  -3.600  -19.746 1.00 0.00 ? 20 THR A O    3  
ATOM 3135  C CB   . THR A 1 20 ? 92.991  -1.521  -18.101 1.00 0.00 ? 20 THR A CB   3  
ATOM 3136  O OG1  . THR A 1 20 ? 93.605  -2.315  -17.095 1.00 0.00 ? 20 THR A OG1  3  
ATOM 3137  C CG2  . THR A 1 20 ? 91.642  -2.132  -18.482 1.00 0.00 ? 20 THR A CG2  3  
ATOM 3138  H H    . THR A 1 20 ? 92.560  -0.001  -20.083 1.00 0.00 ? 20 THR A H    3  
ATOM 3139  H HA   . THR A 1 20 ? 94.892  -1.174  -19.015 1.00 0.00 ? 20 THR A HA   3  
ATOM 3140  H HB   . THR A 1 20 ? 92.835  -0.522  -17.726 1.00 0.00 ? 20 THR A HB   3  
ATOM 3141  H HG1  . THR A 1 20 ? 94.220  -1.757  -16.613 1.00 0.00 ? 20 THR A HG1  3  
ATOM 3142  H HG21 . THR A 1 20 ? 90.916  -1.908  -17.716 1.00 0.00 ? 20 THR A HG21 3  
ATOM 3143  H HG22 . THR A 1 20 ? 91.746  -3.203  -18.577 1.00 0.00 ? 20 THR A HG22 3  
ATOM 3144  H HG23 . THR A 1 20 ? 91.311  -1.717  -19.423 1.00 0.00 ? 20 THR A HG23 3  
ATOM 3145  N N    . VAL A 1 21 ? 92.979  -3.193  -20.785 1.00 0.00 ? 21 VAL A N    3  
ATOM 3146  C CA   . VAL A 1 21 ? 92.947  -4.498  -21.447 1.00 0.00 ? 21 VAL A CA   3  
ATOM 3147  C C    . VAL A 1 21 ? 94.029  -4.612  -22.524 1.00 0.00 ? 21 VAL A C    3  
ATOM 3148  O O    . VAL A 1 21 ? 94.692  -5.644  -22.638 1.00 0.00 ? 21 VAL A O    3  
ATOM 3149  C CB   . VAL A 1 21 ? 91.561  -4.727  -22.071 1.00 0.00 ? 21 VAL A CB   3  
ATOM 3150  C CG1  . VAL A 1 21 ? 91.584  -5.970  -22.967 1.00 0.00 ? 21 VAL A CG1  3  
ATOM 3151  C CG2  . VAL A 1 21 ? 90.529  -4.933  -20.957 1.00 0.00 ? 21 VAL A CG2  3  
ATOM 3152  H H    . VAL A 1 21 ? 92.241  -2.562  -20.932 1.00 0.00 ? 21 VAL A H    3  
ATOM 3153  H HA   . VAL A 1 21 ? 93.117  -5.264  -20.704 1.00 0.00 ? 21 VAL A HA   3  
ATOM 3154  H HB   . VAL A 1 21 ? 91.287  -3.864  -22.661 1.00 0.00 ? 21 VAL A HB   3  
ATOM 3155  H HG11 . VAL A 1 21 ? 92.106  -5.743  -23.885 1.00 0.00 ? 21 VAL A HG11 3  
ATOM 3156  H HG12 . VAL A 1 21 ? 90.571  -6.270  -23.195 1.00 0.00 ? 21 VAL A HG12 3  
ATOM 3157  H HG13 . VAL A 1 21 ? 92.090  -6.774  -22.455 1.00 0.00 ? 21 VAL A HG13 3  
ATOM 3158  H HG21 . VAL A 1 21 ? 90.474  -4.046  -20.347 1.00 0.00 ? 21 VAL A HG21 3  
ATOM 3159  H HG22 . VAL A 1 21 ? 90.823  -5.772  -20.345 1.00 0.00 ? 21 VAL A HG22 3  
ATOM 3160  H HG23 . VAL A 1 21 ? 89.561  -5.129  -21.396 1.00 0.00 ? 21 VAL A HG23 3  
ATOM 3161  N N    . LEU A 1 22 ? 94.188  -3.565  -23.326 1.00 0.00 ? 22 LEU A N    3  
ATOM 3162  C CA   . LEU A 1 22 ? 95.175  -3.583  -24.404 1.00 0.00 ? 22 LEU A CA   3  
ATOM 3163  C C    . LEU A 1 22 ? 96.588  -3.777  -23.860 1.00 0.00 ? 22 LEU A C    3  
ATOM 3164  O O    . LEU A 1 22 ? 97.318  -4.656  -24.320 1.00 0.00 ? 22 LEU A O    3  
ATOM 3165  C CB   . LEU A 1 22 ? 95.096  -2.277  -25.206 1.00 0.00 ? 22 LEU A CB   3  
ATOM 3166  C CG   . LEU A 1 22 ? 96.228  -2.207  -26.245 1.00 0.00 ? 22 LEU A CG   3  
ATOM 3167  C CD1  . LEU A 1 22 ? 96.231  -3.474  -27.111 1.00 0.00 ? 22 LEU A CD1  3  
ATOM 3168  C CD2  . LEU A 1 22 ? 96.009  -0.981  -27.137 1.00 0.00 ? 22 LEU A CD2  3  
ATOM 3169  H H    . LEU A 1 22 ? 93.622  -2.775  -23.203 1.00 0.00 ? 22 LEU A H    3  
ATOM 3170  H HA   . LEU A 1 22 ? 94.943  -4.406  -25.061 1.00 0.00 ? 22 LEU A HA   3  
ATOM 3171  H HB2  . LEU A 1 22 ? 94.146  -2.231  -25.716 1.00 0.00 ? 22 LEU A HB2  3  
ATOM 3172  H HB3  . LEU A 1 22 ? 95.181  -1.438  -24.532 1.00 0.00 ? 22 LEU A HB3  3  
ATOM 3173  H HG   . LEU A 1 22 ? 97.179  -2.114  -25.739 1.00 0.00 ? 22 LEU A HG   3  
ATOM 3174  H HD11 . LEU A 1 22 ? 95.213  -3.756  -27.342 1.00 0.00 ? 22 LEU A HD11 3  
ATOM 3175  H HD12 . LEU A 1 22 ? 96.713  -4.277  -26.573 1.00 0.00 ? 22 LEU A HD12 3  
ATOM 3176  H HD13 . LEU A 1 22 ? 96.769  -3.286  -28.029 1.00 0.00 ? 22 LEU A HD13 3  
ATOM 3177  H HD21 . LEU A 1 22 ? 96.760  -0.962  -27.912 1.00 0.00 ? 22 LEU A HD21 3  
ATOM 3178  H HD22 . LEU A 1 22 ? 96.083  -0.083  -26.541 1.00 0.00 ? 22 LEU A HD22 3  
ATOM 3179  H HD23 . LEU A 1 22 ? 95.028  -1.033  -27.587 1.00 0.00 ? 22 LEU A HD23 3  
ATOM 3180  N N    . ILE A 1 23 ? 96.978  -2.960  -22.885 1.00 0.00 ? 23 ILE A N    3  
ATOM 3181  C CA   . ILE A 1 23 ? 98.313  -3.077  -22.313 1.00 0.00 ? 23 ILE A CA   3  
ATOM 3182  C C    . ILE A 1 23 ? 98.474  -4.438  -21.641 1.00 0.00 ? 23 ILE A C    3  
ATOM 3183  O O    . ILE A 1 23 ? 99.510  -5.092  -21.782 1.00 0.00 ? 23 ILE A O    3  
ATOM 3184  C CB   . ILE A 1 23 ? 98.559  -1.948  -21.305 1.00 0.00 ? 23 ILE A CB   3  
ATOM 3185  C CG1  . ILE A 1 23 ? 98.308  -0.601  -21.986 1.00 0.00 ? 23 ILE A CG1  3  
ATOM 3186  C CG2  . ILE A 1 23 ? 100.011 -1.991  -20.814 1.00 0.00 ? 23 ILE A CG2  3  
ATOM 3187  C CD1  . ILE A 1 23 ? 98.332  0.514   -20.937 1.00 0.00 ? 23 ILE A CD1  3  
ATOM 3188  H H    . ILE A 1 23 ? 96.362  -2.273  -22.549 1.00 0.00 ? 23 ILE A H    3  
ATOM 3189  H HA   . ILE A 1 23 ? 99.039  -2.995  -23.109 1.00 0.00 ? 23 ILE A HA   3  
ATOM 3190  H HB   . ILE A 1 23 ? 97.887  -2.060  -20.467 1.00 0.00 ? 23 ILE A HB   3  
ATOM 3191  H HG12 . ILE A 1 23 ? 99.081  -0.420  -22.720 1.00 0.00 ? 23 ILE A HG12 3  
ATOM 3192  H HG13 . ILE A 1 23 ? 97.346  -0.614  -22.473 1.00 0.00 ? 23 ILE A HG13 3  
ATOM 3193  H HG21 . ILE A 1 23 ? 100.670 -1.708  -21.620 1.00 0.00 ? 23 ILE A HG21 3  
ATOM 3194  H HG22 . ILE A 1 23 ? 100.257 -2.988  -20.481 1.00 0.00 ? 23 ILE A HG22 3  
ATOM 3195  H HG23 . ILE A 1 23 ? 100.132 -1.299  -19.993 1.00 0.00 ? 23 ILE A HG23 3  
ATOM 3196  H HD11 . ILE A 1 23 ? 97.573  0.323   -20.193 1.00 0.00 ? 23 ILE A HD11 3  
ATOM 3197  H HD12 . ILE A 1 23 ? 98.136  1.462   -21.416 1.00 0.00 ? 23 ILE A HD12 3  
ATOM 3198  H HD13 . ILE A 1 23 ? 99.302  0.543   -20.465 1.00 0.00 ? 23 ILE A HD13 3  
ATOM 3199  N N    . ALA A 1 24 ? 97.444  -4.863  -20.916 1.00 0.00 ? 24 ALA A N    3  
ATOM 3200  C CA   . ALA A 1 24 ? 97.488  -6.154  -20.240 1.00 0.00 ? 24 ALA A CA   3  
ATOM 3201  C C    . ALA A 1 24 ? 97.775  -7.267  -21.242 1.00 0.00 ? 24 ALA A C    3  
ATOM 3202  O O    . ALA A 1 24 ? 98.586  -8.157  -20.985 1.00 0.00 ? 24 ALA A O    3  
ATOM 3203  C CB   . ALA A 1 24 ? 96.153  -6.422  -19.545 1.00 0.00 ? 24 ALA A CB   3  
ATOM 3204  H H    . ALA A 1 24 ? 96.640  -4.304  -20.842 1.00 0.00 ? 24 ALA A H    3  
ATOM 3205  H HA   . ALA A 1 24 ? 98.271  -6.136  -19.497 1.00 0.00 ? 24 ALA A HA   3  
ATOM 3206  H HB1  . ALA A 1 24 ? 95.348  -6.306  -20.257 1.00 0.00 ? 24 ALA A HB1  3  
ATOM 3207  H HB2  . ALA A 1 24 ? 96.021  -5.719  -18.736 1.00 0.00 ? 24 ALA A HB2  3  
ATOM 3208  H HB3  . ALA A 1 24 ? 96.146  -7.428  -19.156 1.00 0.00 ? 24 ALA A HB3  3  
ATOM 3209  N N    . LEU A 1 25 ? 97.107  -7.210  -22.388 1.00 0.00 ? 25 LEU A N    3  
ATOM 3210  C CA   . LEU A 1 25 ? 97.302  -8.215  -23.425 1.00 0.00 ? 25 LEU A CA   3  
ATOM 3211  C C    . LEU A 1 25 ? 98.719  -8.124  -23.981 1.00 0.00 ? 25 LEU A C    3  
ATOM 3212  O O    . LEU A 1 25 ? 99.333  -9.137  -24.317 1.00 0.00 ? 25 LEU A O    3  
ATOM 3213  C CB   . LEU A 1 25 ? 96.280  -8.003  -24.551 1.00 0.00 ? 25 LEU A CB   3  
ATOM 3214  C CG   . LEU A 1 25 ? 96.553  -8.959  -25.721 1.00 0.00 ? 25 LEU A CG   3  
ATOM 3215  C CD1  . LEU A 1 25 ? 96.594  -10.410 -25.221 1.00 0.00 ? 25 LEU A CD1  3  
ATOM 3216  C CD2  . LEU A 1 25 ? 95.437  -8.809  -26.759 1.00 0.00 ? 25 LEU A CD2  3  
ATOM 3217  H H    . LEU A 1 25 ? 96.474  -6.477  -22.539 1.00 0.00 ? 25 LEU A H    3  
ATOM 3218  H HA   . LEU A 1 25 ? 97.153  -9.193  -22.994 1.00 0.00 ? 25 LEU A HA   3  
ATOM 3219  H HB2  . LEU A 1 25 ? 95.285  -8.185  -24.167 1.00 0.00 ? 25 LEU A HB2  3  
ATOM 3220  H HB3  . LEU A 1 25 ? 96.344  -6.984  -24.902 1.00 0.00 ? 25 LEU A HB3  3  
ATOM 3221  H HG   . LEU A 1 25 ? 97.500  -8.711  -26.178 1.00 0.00 ? 25 LEU A HG   3  
ATOM 3222  H HD11 . LEU A 1 25 ? 95.827  -10.559 -24.474 1.00 0.00 ? 25 LEU A HD11 3  
ATOM 3223  H HD12 . LEU A 1 25 ? 97.562  -10.616 -24.788 1.00 0.00 ? 25 LEU A HD12 3  
ATOM 3224  H HD13 . LEU A 1 25 ? 96.425  -11.086 -26.049 1.00 0.00 ? 25 LEU A HD13 3  
ATOM 3225  H HD21 . LEU A 1 25 ? 94.478  -8.923  -26.276 1.00 0.00 ? 25 LEU A HD21 3  
ATOM 3226  H HD22 . LEU A 1 25 ? 95.549  -9.565  -27.522 1.00 0.00 ? 25 LEU A HD22 3  
ATOM 3227  H HD23 . LEU A 1 25 ? 95.497  -7.830  -27.212 1.00 0.00 ? 25 LEU A HD23 3  
ATOM 3228  N N    . ALA A 1 26 ? 99.230  -6.901  -24.080 1.00 0.00 ? 26 ALA A N    3  
ATOM 3229  C CA   . ALA A 1 26 ? 100.573 -6.684  -24.601 1.00 0.00 ? 26 ALA A CA   3  
ATOM 3230  C C    . ALA A 1 26 ? 101.603 -7.456  -23.782 1.00 0.00 ? 26 ALA A C    3  
ATOM 3231  O O    . ALA A 1 26 ? 102.428 -8.182  -24.337 1.00 0.00 ? 26 ALA A O    3  
ATOM 3232  C CB   . ALA A 1 26 ? 100.909 -5.192  -24.573 1.00 0.00 ? 26 ALA A CB   3  
ATOM 3233  H H    . ALA A 1 26 ? 98.692  -6.131  -23.799 1.00 0.00 ? 26 ALA A H    3  
ATOM 3234  H HA   . ALA A 1 26 ? 100.611 -7.030  -25.623 1.00 0.00 ? 26 ALA A HA   3  
ATOM 3235  H HB1  . ALA A 1 26 ? 101.089 -4.882  -23.555 1.00 0.00 ? 26 ALA A HB1  3  
ATOM 3236  H HB2  . ALA A 1 26 ? 100.083 -4.628  -24.980 1.00 0.00 ? 26 ALA A HB2  3  
ATOM 3237  H HB3  . ALA A 1 26 ? 101.794 -5.011  -25.166 1.00 0.00 ? 26 ALA A HB3  3  
ATOM 3238  N N    . VAL A 1 27 ? 101.555 -7.295  -22.463 1.00 0.00 ? 27 VAL A N    3  
ATOM 3239  C CA   . VAL A 1 27 ? 102.500 -7.989  -21.594 1.00 0.00 ? 27 VAL A CA   3  
ATOM 3240  C C    . VAL A 1 27 ? 102.217 -9.488  -21.587 1.00 0.00 ? 27 VAL A C    3  
ATOM 3241  O O    . VAL A 1 27 ? 103.133 -10.301 -21.459 1.00 0.00 ? 27 VAL A O    3  
ATOM 3242  C CB   . VAL A 1 27 ? 102.415 -7.441  -20.168 1.00 0.00 ? 27 VAL A CB   3  
ATOM 3243  C CG1  . VAL A 1 27 ? 102.932 -6.002  -20.143 1.00 0.00 ? 27 VAL A CG1  3  
ATOM 3244  C CG2  . VAL A 1 27 ? 100.963 -7.466  -19.693 1.00 0.00 ? 27 VAL A CG2  3  
ATOM 3245  H H    . VAL A 1 27 ? 100.878 -6.703  -22.070 1.00 0.00 ? 27 VAL A H    3  
ATOM 3246  H HA   . VAL A 1 27 ? 103.500 -7.827  -21.969 1.00 0.00 ? 27 VAL A HA   3  
ATOM 3247  H HB   . VAL A 1 27 ? 103.021 -8.051  -19.513 1.00 0.00 ? 27 VAL A HB   3  
ATOM 3248  H HG11 . VAL A 1 27 ? 102.851 -5.609  -19.140 1.00 0.00 ? 27 VAL A HG11 3  
ATOM 3249  H HG12 . VAL A 1 27 ? 102.342 -5.396  -20.816 1.00 0.00 ? 27 VAL A HG12 3  
ATOM 3250  H HG13 . VAL A 1 27 ? 103.965 -5.985  -20.454 1.00 0.00 ? 27 VAL A HG13 3  
ATOM 3251  H HG21 . VAL A 1 27 ? 100.374 -6.793  -20.299 1.00 0.00 ? 27 VAL A HG21 3  
ATOM 3252  H HG22 . VAL A 1 27 ? 100.917 -7.153  -18.660 1.00 0.00 ? 27 VAL A HG22 3  
ATOM 3253  H HG23 . VAL A 1 27 ? 100.573 -8.469  -19.782 1.00 0.00 ? 27 VAL A HG23 3  
ATOM 3254  N N    . TYR A 1 28 ? 100.945 -9.848  -21.725 1.00 0.00 ? 28 TYR A N    3  
ATOM 3255  C CA   . TYR A 1 28 ? 100.558 -11.253 -21.735 1.00 0.00 ? 28 TYR A CA   3  
ATOM 3256  C C    . TYR A 1 28 ? 101.202 -11.982 -22.911 1.00 0.00 ? 28 TYR A C    3  
ATOM 3257  O O    . TYR A 1 28 ? 101.667 -13.114 -22.772 1.00 0.00 ? 28 TYR A O    3  
ATOM 3258  C CB   . TYR A 1 28 ? 99.035  -11.377 -21.827 1.00 0.00 ? 28 TYR A CB   3  
ATOM 3259  C CG   . TYR A 1 28 ? 98.644  -12.835 -21.765 1.00 0.00 ? 28 TYR A CG   3  
ATOM 3260  C CD1  . TYR A 1 28 ? 98.572  -13.487 -20.528 1.00 0.00 ? 28 TYR A CD1  3  
ATOM 3261  C CD2  . TYR A 1 28 ? 98.354  -13.534 -22.943 1.00 0.00 ? 28 TYR A CD2  3  
ATOM 3262  C CE1  . TYR A 1 28 ? 98.208  -14.837 -20.469 1.00 0.00 ? 28 TYR A CE1  3  
ATOM 3263  C CE2  . TYR A 1 28 ? 97.990  -14.886 -22.882 1.00 0.00 ? 28 TYR A CE2  3  
ATOM 3264  C CZ   . TYR A 1 28 ? 97.918  -15.536 -21.645 1.00 0.00 ? 28 TYR A CZ   3  
ATOM 3265  O OH   . TYR A 1 28 ? 97.559  -16.868 -21.587 1.00 0.00 ? 28 TYR A OH   3  
ATOM 3266  H H    . TYR A 1 28 ? 100.256 -9.157  -21.823 1.00 0.00 ? 28 TYR A H    3  
ATOM 3267  H HA   . TYR A 1 28 ? 100.888 -11.713 -20.815 1.00 0.00 ? 28 TYR A HA   3  
ATOM 3268  H HB2  . TYR A 1 28 ? 98.581  -10.846 -21.004 1.00 0.00 ? 28 TYR A HB2  3  
ATOM 3269  H HB3  . TYR A 1 28 ? 98.696  -10.954 -22.761 1.00 0.00 ? 28 TYR A HB3  3  
ATOM 3270  H HD1  . TYR A 1 28 ? 98.796  -12.948 -19.620 1.00 0.00 ? 28 TYR A HD1  3  
ATOM 3271  H HD2  . TYR A 1 28 ? 98.409  -13.032 -23.897 1.00 0.00 ? 28 TYR A HD2  3  
ATOM 3272  H HE1  . TYR A 1 28 ? 98.153  -15.340 -19.514 1.00 0.00 ? 28 TYR A HE1  3  
ATOM 3273  H HE2  . TYR A 1 28 ? 97.765  -15.425 -23.791 1.00 0.00 ? 28 TYR A HE2  3  
ATOM 3274  H HH   . TYR A 1 28 ? 98.090  -17.347 -22.228 1.00 0.00 ? 28 TYR A HH   3  
ATOM 3275  N N    . PHE A 1 29 ? 101.225 -11.327 -24.068 1.00 0.00 ? 29 PHE A N    3  
ATOM 3276  C CA   . PHE A 1 29 ? 101.814 -11.927 -25.262 1.00 0.00 ? 29 PHE A CA   3  
ATOM 3277  C C    . PHE A 1 29 ? 103.298 -12.210 -25.046 1.00 0.00 ? 29 PHE A C    3  
ATOM 3278  O O    . PHE A 1 29 ? 103.790 -13.285 -25.386 1.00 0.00 ? 29 PHE A O    3  
ATOM 3279  C CB   . PHE A 1 29 ? 101.640 -10.988 -26.456 1.00 0.00 ? 29 PHE A CB   3  
ATOM 3280  C CG   . PHE A 1 29 ? 102.093 -11.685 -27.716 1.00 0.00 ? 29 PHE A CG   3  
ATOM 3281  C CD1  . PHE A 1 29 ? 101.198 -12.494 -28.428 1.00 0.00 ? 29 PHE A CD1  3  
ATOM 3282  C CD2  . PHE A 1 29 ? 103.406 -11.524 -28.173 1.00 0.00 ? 29 PHE A CD2  3  
ATOM 3283  C CE1  . PHE A 1 29 ? 101.618 -13.141 -29.597 1.00 0.00 ? 29 PHE A CE1  3  
ATOM 3284  C CE2  . PHE A 1 29 ? 103.825 -12.171 -29.341 1.00 0.00 ? 29 PHE A CE2  3  
ATOM 3285  C CZ   . PHE A 1 29 ? 102.931 -12.980 -30.054 1.00 0.00 ? 29 PHE A CZ   3  
ATOM 3286  H H    . PHE A 1 29 ? 100.839 -10.428 -24.123 1.00 0.00 ? 29 PHE A H    3  
ATOM 3287  H HA   . PHE A 1 29 ? 101.307 -12.856 -25.472 1.00 0.00 ? 29 PHE A HA   3  
ATOM 3288  H HB2  . PHE A 1 29 ? 100.599 -10.715 -26.549 1.00 0.00 ? 29 PHE A HB2  3  
ATOM 3289  H HB3  . PHE A 1 29 ? 102.233 -10.098 -26.304 1.00 0.00 ? 29 PHE A HB3  3  
ATOM 3290  H HD1  . PHE A 1 29 ? 100.186 -12.619 -28.076 1.00 0.00 ? 29 PHE A HD1  3  
ATOM 3291  H HD2  . PHE A 1 29 ? 104.096 -10.900 -27.623 1.00 0.00 ? 29 PHE A HD2  3  
ATOM 3292  H HE1  . PHE A 1 29 ? 100.928 -13.764 -30.146 1.00 0.00 ? 29 PHE A HE1  3  
ATOM 3293  H HE2  . PHE A 1 29 ? 104.839 -12.046 -29.694 1.00 0.00 ? 29 PHE A HE2  3  
ATOM 3294  H HZ   . PHE A 1 29 ? 103.255 -13.478 -30.955 1.00 0.00 ? 29 PHE A HZ   3  
ATOM 3295  N N    . LEU A 1 30 ? 104.006 -11.237 -24.481 1.00 0.00 ? 30 LEU A N    3  
ATOM 3296  C CA   . LEU A 1 30 ? 105.434 -11.394 -24.228 1.00 0.00 ? 30 LEU A CA   3  
ATOM 3297  C C    . LEU A 1 30 ? 105.683 -12.545 -23.257 1.00 0.00 ? 30 LEU A C    3  
ATOM 3298  O O    . LEU A 1 30 ? 106.588 -13.355 -23.460 1.00 0.00 ? 30 LEU A O    3  
ATOM 3299  C CB   . LEU A 1 30 ? 106.006 -10.096 -23.641 1.00 0.00 ? 30 LEU A CB   3  
ATOM 3300  C CG   . LEU A 1 30 ? 107.550 -10.145 -23.634 1.00 0.00 ? 30 LEU A CG   3  
ATOM 3301  C CD1  . LEU A 1 30 ? 108.105 -9.712  -24.998 1.00 0.00 ? 30 LEU A CD1  3  
ATOM 3302  C CD2  . LEU A 1 30 ? 108.090 -9.198  -22.556 1.00 0.00 ? 30 LEU A CD2  3  
ATOM 3303  H H    . LEU A 1 30 ? 103.561 -10.400 -24.232 1.00 0.00 ? 30 LEU A H    3  
ATOM 3304  H HA   . LEU A 1 30 ? 105.932 -11.607 -25.160 1.00 0.00 ? 30 LEU A HA   3  
ATOM 3305  H HB2  . LEU A 1 30 ? 105.670 -9.257  -24.235 1.00 0.00 ? 30 LEU A HB2  3  
ATOM 3306  H HB3  . LEU A 1 30 ? 105.645 -9.980  -22.629 1.00 0.00 ? 30 LEU A HB3  3  
ATOM 3307  H HG   . LEU A 1 30 ? 107.879 -11.153 -23.419 1.00 0.00 ? 30 LEU A HG   3  
ATOM 3308  H HD11 . LEU A 1 30 ? 107.840 -10.442 -25.747 1.00 0.00 ? 30 LEU A HD11 3  
ATOM 3309  H HD12 . LEU A 1 30 ? 109.180 -9.636  -24.938 1.00 0.00 ? 30 LEU A HD12 3  
ATOM 3310  H HD13 . LEU A 1 30 ? 107.692 -8.751  -25.268 1.00 0.00 ? 30 LEU A HD13 3  
ATOM 3311  H HD21 . LEU A 1 30 ? 107.650 -8.220  -22.682 1.00 0.00 ? 30 LEU A HD21 3  
ATOM 3312  H HD22 . LEU A 1 30 ? 109.164 -9.124  -22.648 1.00 0.00 ? 30 LEU A HD22 3  
ATOM 3313  H HD23 . LEU A 1 30 ? 107.839 -9.583  -21.579 1.00 0.00 ? 30 LEU A HD23 3  
ATOM 3314  N N    . GLY A 1 31 ? 104.876 -12.611 -22.204 1.00 0.00 ? 31 GLY A N    3  
ATOM 3315  C CA   . GLY A 1 31 ? 105.021 -13.667 -21.208 1.00 0.00 ? 31 GLY A CA   3  
ATOM 3316  C C    . GLY A 1 31 ? 104.578 -15.013 -21.773 1.00 0.00 ? 31 GLY A C    3  
ATOM 3317  O O    . GLY A 1 31 ? 103.787 -15.073 -22.712 1.00 0.00 ? 31 GLY A O    3  
ATOM 3318  H H    . GLY A 1 31 ? 104.173 -11.937 -22.094 1.00 0.00 ? 31 GLY A H    3  
ATOM 3319  H HA2  . GLY A 1 31 ? 106.056 -13.731 -20.906 1.00 0.00 ? 31 GLY A HA2  3  
ATOM 3320  H HA3  . GLY A 1 31 ? 104.413 -13.429 -20.348 1.00 0.00 ? 31 GLY A HA3  3  
ATOM 3321  N N    . ARG A 1 32 ? 105.095 -16.091 -21.190 1.00 0.00 ? 32 ARG A N    3  
ATOM 3322  C CA   . ARG A 1 32 ? 104.745 -17.433 -21.642 1.00 0.00 ? 32 ARG A CA   3  
ATOM 3323  C C    . ARG A 1 32 ? 105.104 -18.468 -20.581 1.00 0.00 ? 32 ARG A C    3  
ATOM 3324  O O    . ARG A 1 32 ? 106.210 -19.007 -20.576 1.00 0.00 ? 32 ARG A O    3  
ATOM 3325  C CB   . ARG A 1 32 ? 105.480 -17.755 -22.945 1.00 0.00 ? 32 ARG A CB   3  
ATOM 3326  C CG   . ARG A 1 32 ? 105.144 -19.181 -23.382 1.00 0.00 ? 32 ARG A CG   3  
ATOM 3327  C CD   . ARG A 1 32 ? 105.590 -19.392 -24.830 1.00 0.00 ? 32 ARG A CD   3  
ATOM 3328  N NE   . ARG A 1 32 ? 107.040 -19.272 -24.935 1.00 0.00 ? 32 ARG A NE   3  
ATOM 3329  C CZ   . ARG A 1 32 ? 107.645 -19.285 -26.119 1.00 0.00 ? 32 ARG A CZ   3  
ATOM 3330  N NH1  . ARG A 1 32 ? 106.939 -19.403 -27.211 1.00 0.00 ? 32 ARG A NH1  3  
ATOM 3331  N NH2  . ARG A 1 32 ? 108.944 -19.177 -26.191 1.00 0.00 ? 32 ARG A NH2  3  
ATOM 3332  H H    . ARG A 1 32 ? 105.721 -15.983 -20.444 1.00 0.00 ? 32 ARG A H    3  
ATOM 3333  H HA   . ARG A 1 32 ? 103.681 -17.474 -21.825 1.00 0.00 ? 32 ARG A HA   3  
ATOM 3334  H HB2  . ARG A 1 32 ? 105.173 -17.059 -23.713 1.00 0.00 ? 32 ARG A HB2  3  
ATOM 3335  H HB3  . ARG A 1 32 ? 106.546 -17.670 -22.787 1.00 0.00 ? 32 ARG A HB3  3  
ATOM 3336  H HG2  . ARG A 1 32 ? 105.657 -19.884 -22.740 1.00 0.00 ? 32 ARG A HG2  3  
ATOM 3337  H HG3  . ARG A 1 32 ? 104.079 -19.339 -23.309 1.00 0.00 ? 32 ARG A HG3  3  
ATOM 3338  H HD2  . ARG A 1 32 ? 105.291 -20.375 -25.157 1.00 0.00 ? 32 ARG A HD2  3  
ATOM 3339  H HD3  . ARG A 1 32 ? 105.121 -18.649 -25.458 1.00 0.00 ? 32 ARG A HD3  3  
ATOM 3340  H HE   . ARG A 1 32 ? 107.577 -19.182 -24.121 1.00 0.00 ? 32 ARG A HE   3  
ATOM 3341  H HH11 . ARG A 1 32 ? 105.944 -19.485 -27.156 1.00 0.00 ? 32 ARG A HH11 3  
ATOM 3342  H HH12 . ARG A 1 32 ? 107.394 -19.412 -28.101 1.00 0.00 ? 32 ARG A HH12 3  
ATOM 3343  H HH21 . ARG A 1 32 ? 109.484 -19.086 -25.354 1.00 0.00 ? 32 ARG A HH21 3  
ATOM 3344  H HH22 . ARG A 1 32 ? 109.398 -19.186 -27.080 1.00 0.00 ? 32 ARG A HH22 3  
ATOM 3345  N N    . LEU A 1 33 ? 104.161 -18.741 -19.686 1.00 0.00 ? 33 LEU A N    3  
ATOM 3346  C CA   . LEU A 1 33 ? 104.386 -19.714 -18.624 1.00 0.00 ? 33 LEU A CA   3  
ATOM 3347  C C    . LEU A 1 33 ? 105.680 -19.402 -17.876 1.00 0.00 ? 33 LEU A C    3  
ATOM 3348  O O    . LEU A 1 33 ? 106.419 -20.308 -17.491 1.00 0.00 ? 33 LEU A O    3  
ATOM 3349  C CB   . LEU A 1 33 ? 104.460 -21.125 -19.214 1.00 0.00 ? 33 LEU A CB   3  
ATOM 3350  C CG   . LEU A 1 33 ? 103.368 -21.296 -20.273 1.00 0.00 ? 33 LEU A CG   3  
ATOM 3351  C CD1  . LEU A 1 33 ? 103.366 -22.742 -20.774 1.00 0.00 ? 33 LEU A CD1  3  
ATOM 3352  C CD2  . LEU A 1 33 ? 102.004 -20.965 -19.660 1.00 0.00 ? 33 LEU A CD2  3  
ATOM 3353  H H    . LEU A 1 33 ? 103.298 -18.280 -19.741 1.00 0.00 ? 33 LEU A H    3  
ATOM 3354  H HA   . LEU A 1 33 ? 103.563 -19.671 -17.928 1.00 0.00 ? 33 LEU A HA   3  
ATOM 3355  H HB2  . LEU A 1 33 ? 105.429 -21.276 -19.670 1.00 0.00 ? 33 LEU A HB2  3  
ATOM 3356  H HB3  . LEU A 1 33 ? 104.314 -21.852 -18.430 1.00 0.00 ? 33 LEU A HB3  3  
ATOM 3357  H HG   . LEU A 1 33 ? 103.563 -20.630 -21.101 1.00 0.00 ? 33 LEU A HG   3  
ATOM 3358  H HD11 . LEU A 1 33 ? 103.276 -23.414 -19.933 1.00 0.00 ? 33 LEU A HD11 3  
ATOM 3359  H HD12 . LEU A 1 33 ? 104.288 -22.943 -21.299 1.00 0.00 ? 33 LEU A HD12 3  
ATOM 3360  H HD13 . LEU A 1 33 ? 102.531 -22.890 -21.443 1.00 0.00 ? 33 LEU A HD13 3  
ATOM 3361  H HD21 . LEU A 1 33 ? 101.924 -21.425 -18.687 1.00 0.00 ? 33 LEU A HD21 3  
ATOM 3362  H HD22 . LEU A 1 33 ? 101.219 -21.342 -20.301 1.00 0.00 ? 33 LEU A HD22 3  
ATOM 3363  H HD23 . LEU A 1 33 ? 101.902 -19.894 -19.563 1.00 0.00 ? 33 LEU A HD23 3  
ATOM 3364  N N    . GLY A 1 34 ? 105.947 -18.116 -17.675 1.00 0.00 ? 34 GLY A N    3  
ATOM 3365  C CA   . GLY A 1 34 ? 107.153 -17.697 -16.972 1.00 0.00 ? 34 GLY A CA   3  
ATOM 3366  C C    . GLY A 1 34 ? 107.273 -16.176 -16.951 1.00 0.00 ? 34 GLY A C    3  
ATOM 3367  O O    . GLY A 1 34 ? 107.484 -15.547 -17.988 1.00 0.00 ? 34 GLY A O    3  
ATOM 3368  H H    . GLY A 1 34 ? 105.320 -17.437 -18.004 1.00 0.00 ? 34 GLY A H    3  
ATOM 3369  H HA2  . GLY A 1 34 ? 107.118 -18.065 -15.956 1.00 0.00 ? 34 GLY A HA2  3  
ATOM 3370  H HA3  . GLY A 1 34 ? 108.016 -18.111 -17.470 1.00 0.00 ? 34 GLY A HA3  3  
ATOM 3371  N N    . THR A 1 35 ? 107.136 -15.593 -15.766 1.00 0.00 ? 35 THR A N    3  
ATOM 3372  C CA   . THR A 1 35 ? 107.231 -14.145 -15.622 1.00 0.00 ? 35 THR A CA   3  
ATOM 3373  C C    . THR A 1 35 ? 107.507 -13.766 -14.170 1.00 0.00 ? 35 THR A C    3  
ATOM 3374  O O    . THR A 1 35 ? 107.504 -14.621 -13.284 1.00 0.00 ? 35 THR A O    3  
ATOM 3375  C CB   . THR A 1 35 ? 105.927 -13.488 -16.083 1.00 0.00 ? 35 THR A CB   3  
ATOM 3376  O OG1  . THR A 1 35 ? 105.985 -12.092 -15.825 1.00 0.00 ? 35 THR A OG1  3  
ATOM 3377  C CG2  . THR A 1 35 ? 104.750 -14.101 -15.326 1.00 0.00 ? 35 THR A CG2  3  
ATOM 3378  H H    . THR A 1 35 ? 106.969 -16.145 -14.973 1.00 0.00 ? 35 THR A H    3  
ATOM 3379  H HA   . THR A 1 35 ? 108.040 -13.782 -16.238 1.00 0.00 ? 35 THR A HA   3  
ATOM 3380  H HB   . THR A 1 35 ? 105.795 -13.654 -17.141 1.00 0.00 ? 35 THR A HB   3  
ATOM 3381  H HG1  . THR A 1 35 ? 106.903 -11.818 -15.882 1.00 0.00 ? 35 THR A HG1  3  
ATOM 3382  H HG21 . THR A 1 35 ? 104.849 -13.889 -14.271 1.00 0.00 ? 35 THR A HG21 3  
ATOM 3383  H HG22 . THR A 1 35 ? 104.741 -15.170 -15.478 1.00 0.00 ? 35 THR A HG22 3  
ATOM 3384  H HG23 . THR A 1 35 ? 103.826 -13.678 -15.692 1.00 0.00 ? 35 THR A HG23 3  
ATOM 3385  N N    . ALA A 1 36 ? 107.745 -12.480 -13.934 1.00 0.00 ? 36 ALA A N    3  
ATOM 3386  C CA   . ALA A 1 36 ? 108.022 -12.000 -12.585 1.00 0.00 ? 36 ALA A CA   3  
ATOM 3387  C C    . ALA A 1 36 ? 106.744 -11.974 -11.752 1.00 0.00 ? 36 ALA A C    3  
ATOM 3388  O O    . ALA A 1 36 ? 105.884 -11.114 -11.944 1.00 0.00 ? 36 ALA A O    3  
ATOM 3389  C CB   . ALA A 1 36 ? 108.625 -10.595 -12.644 1.00 0.00 ? 36 ALA A CB   3  
ATOM 3390  H H    . ALA A 1 36 ? 107.735 -11.844 -14.679 1.00 0.00 ? 36 ALA A H    3  
ATOM 3391  H HA   . ALA A 1 36 ? 108.733 -12.664 -12.116 1.00 0.00 ? 36 ALA A HA   3  
ATOM 3392  H HB1  . ALA A 1 36 ? 109.389 -10.563 -13.406 1.00 0.00 ? 36 ALA A HB1  3  
ATOM 3393  H HB2  . ALA A 1 36 ? 109.060 -10.349 -11.687 1.00 0.00 ? 36 ALA A HB2  3  
ATOM 3394  H HB3  . ALA A 1 36 ? 107.849 -9.881  -12.880 1.00 0.00 ? 36 ALA A HB3  3  
ATOM 3395  N N    . GLU A 1 37 ? 106.628 -12.921 -10.827 1.00 0.00 ? 37 GLU A N    3  
ATOM 3396  C CA   . GLU A 1 37 ? 105.450 -12.998 -9.969  1.00 0.00 ? 37 GLU A CA   3  
ATOM 3397  C C    . GLU A 1 37 ? 104.174 -12.940 -10.804 1.00 0.00 ? 37 GLU A C    3  
ATOM 3398  O O    . GLU A 1 37 ? 103.744 -11.865 -11.222 1.00 0.00 ? 37 GLU A O    3  
ATOM 3399  C CB   . GLU A 1 37 ? 105.460 -11.846 -8.964  1.00 0.00 ? 37 GLU A CB   3  
ATOM 3400  C CG   . GLU A 1 37 ? 106.676 -11.980 -8.045  1.00 0.00 ? 37 GLU A CG   3  
ATOM 3401  C CD   . GLU A 1 37 ? 106.660 -10.874 -6.995  1.00 0.00 ? 37 GLU A CD   3  
ATOM 3402  O OE1  . GLU A 1 37 ? 105.694 -10.803 -6.252  1.00 0.00 ? 37 GLU A OE1  3  
ATOM 3403  O OE2  . GLU A 1 37 ? 107.613 -10.114 -6.949  1.00 0.00 ? 37 GLU A OE2  3  
ATOM 3404  H H    . GLU A 1 37 ? 107.345 -13.580 -10.719 1.00 0.00 ? 37 GLU A H    3  
ATOM 3405  H HA   . GLU A 1 37 ? 105.473 -13.932 -9.428  1.00 0.00 ? 37 GLU A HA   3  
ATOM 3406  H HB2  . GLU A 1 37 ? 105.510 -10.906 -9.495  1.00 0.00 ? 37 GLU A HB2  3  
ATOM 3407  H HB3  . GLU A 1 37 ? 104.558 -11.877 -8.372  1.00 0.00 ? 37 GLU A HB3  3  
ATOM 3408  H HG2  . GLU A 1 37 ? 106.648 -12.942 -7.553  1.00 0.00 ? 37 GLU A HG2  3  
ATOM 3409  H HG3  . GLU A 1 37 ? 107.579 -11.903 -8.631  1.00 0.00 ? 37 GLU A HG3  3  
ATOM 3410  N N    . VAL A 1 38 ? 103.575 -14.102 -11.038 1.00 0.00 ? 38 VAL A N    3  
ATOM 3411  C CA   . VAL A 1 38 ? 102.348 -14.176 -11.823 1.00 0.00 ? 38 VAL A CA   3  
ATOM 3412  C C    . VAL A 1 38 ? 101.189 -13.530 -11.071 1.00 0.00 ? 38 VAL A C    3  
ATOM 3413  O O    . VAL A 1 38 ? 100.249 -13.017 -11.678 1.00 0.00 ? 38 VAL A O    3  
ATOM 3414  C CB   . VAL A 1 38 ? 102.008 -15.637 -12.124 1.00 0.00 ? 38 VAL A CB   3  
ATOM 3415  C CG1  . VAL A 1 38 ? 100.720 -15.703 -12.945 1.00 0.00 ? 38 VAL A CG1  3  
ATOM 3416  C CG2  . VAL A 1 38 ? 103.152 -16.272 -12.919 1.00 0.00 ? 38 VAL A CG2  3  
ATOM 3417  H H    . VAL A 1 38 ? 103.965 -14.926 -10.678 1.00 0.00 ? 38 VAL A H    3  
ATOM 3418  H HA   . VAL A 1 38 ? 102.495 -13.653 -12.756 1.00 0.00 ? 38 VAL A HA   3  
ATOM 3419  H HB   . VAL A 1 38 ? 101.872 -16.172 -11.195 1.00 0.00 ? 38 VAL A HB   3  
ATOM 3420  H HG11 . VAL A 1 38 ? 99.879  -15.444 -12.318 1.00 0.00 ? 38 VAL A HG11 3  
ATOM 3421  H HG12 . VAL A 1 38 ? 100.588 -16.705 -13.328 1.00 0.00 ? 38 VAL A HG12 3  
ATOM 3422  H HG13 . VAL A 1 38 ? 100.782 -15.008 -13.769 1.00 0.00 ? 38 VAL A HG13 3  
ATOM 3423  H HG21 . VAL A 1 38 ? 103.031 -17.346 -12.928 1.00 0.00 ? 38 VAL A HG21 3  
ATOM 3424  H HG22 . VAL A 1 38 ? 104.096 -16.020 -12.457 1.00 0.00 ? 38 VAL A HG22 3  
ATOM 3425  H HG23 . VAL A 1 38 ? 103.137 -15.899 -13.932 1.00 0.00 ? 38 VAL A HG23 3  
ATOM 3426  N N    . LEU A 1 39 ? 101.260 -13.563 -9.745  1.00 0.00 ? 39 LEU A N    3  
ATOM 3427  C CA   . LEU A 1 39 ? 100.210 -12.984 -8.915  1.00 0.00 ? 39 LEU A CA   3  
ATOM 3428  C C    . LEU A 1 39 ? 100.123 -11.474 -9.134  1.00 0.00 ? 39 LEU A C    3  
ATOM 3429  O O    . LEU A 1 39 ? 99.048  -10.885 -9.025  1.00 0.00 ? 39 LEU A O    3  
ATOM 3430  C CB   . LEU A 1 39 ? 100.491 -13.278 -7.433  1.00 0.00 ? 39 LEU A CB   3  
ATOM 3431  C CG   . LEU A 1 39 ? 100.105 -14.728 -7.088  1.00 0.00 ? 39 LEU A CG   3  
ATOM 3432  C CD1  . LEU A 1 39 ? 98.573  -14.911 -7.110  1.00 0.00 ? 39 LEU A CD1  3  
ATOM 3433  C CD2  . LEU A 1 39 ? 100.755 -15.684 -8.097  1.00 0.00 ? 39 LEU A CD2  3  
ATOM 3434  H H    . LEU A 1 39 ? 102.033 -13.988 -9.317  1.00 0.00 ? 39 LEU A H    3  
ATOM 3435  H HA   . LEU A 1 39 ? 99.268  -13.426 -9.188  1.00 0.00 ? 39 LEU A HA   3  
ATOM 3436  H HB2  . LEU A 1 39 ? 101.544 -13.136 -7.239  1.00 0.00 ? 39 LEU A HB2  3  
ATOM 3437  H HB3  . LEU A 1 39 ? 99.922  -12.599 -6.814  1.00 0.00 ? 39 LEU A HB3  3  
ATOM 3438  H HG   . LEU A 1 39 ? 100.470 -14.959 -6.098  1.00 0.00 ? 39 LEU A HG   3  
ATOM 3439  H HD11 . LEU A 1 39 ? 98.244  -15.180 -8.103  1.00 0.00 ? 39 LEU A HD11 3  
ATOM 3440  H HD12 . LEU A 1 39 ? 98.087  -13.995 -6.808  1.00 0.00 ? 39 LEU A HD12 3  
ATOM 3441  H HD13 . LEU A 1 39 ? 98.302  -15.698 -6.421  1.00 0.00 ? 39 LEU A HD13 3  
ATOM 3442  H HD21 . LEU A 1 39 ? 100.702 -16.694 -7.719  1.00 0.00 ? 39 LEU A HD21 3  
ATOM 3443  H HD22 . LEU A 1 39 ? 101.789 -15.408 -8.239  1.00 0.00 ? 39 LEU A HD22 3  
ATOM 3444  H HD23 . LEU A 1 39 ? 100.233 -15.624 -9.039  1.00 0.00 ? 39 LEU A HD23 3  
ATOM 3445  N N    . GLY A 1 40 ? 101.258 -10.853 -9.437  1.00 0.00 ? 40 GLY A N    3  
ATOM 3446  C CA   . GLY A 1 40 ? 101.291 -9.412  -9.661  1.00 0.00 ? 40 GLY A CA   3  
ATOM 3447  C C    . GLY A 1 40 ? 100.425 -9.021  -10.856 1.00 0.00 ? 40 GLY A C    3  
ATOM 3448  O O    . GLY A 1 40 ? 99.591  -8.118  -10.763 1.00 0.00 ? 40 GLY A O    3  
ATOM 3449  H H    . GLY A 1 40 ? 102.087 -11.371 -9.507  1.00 0.00 ? 40 GLY A H    3  
ATOM 3450  H HA2  . GLY A 1 40 ? 100.927 -8.907  -8.779  1.00 0.00 ? 40 GLY A HA2  3  
ATOM 3451  H HA3  . GLY A 1 40 ? 102.309 -9.106  -9.851  1.00 0.00 ? 40 GLY A HA3  3  
ATOM 3452  N N    . ILE A 1 41 ? 100.628 -9.705  -11.977 1.00 0.00 ? 41 ILE A N    3  
ATOM 3453  C CA   . ILE A 1 41 ? 99.863  -9.420  -13.188 1.00 0.00 ? 41 ILE A CA   3  
ATOM 3454  C C    . ILE A 1 41 ? 98.369  -9.581  -12.925 1.00 0.00 ? 41 ILE A C    3  
ATOM 3455  O O    . ILE A 1 41 ? 97.557  -8.751  -13.338 1.00 0.00 ? 41 ILE A O    3  
ATOM 3456  C CB   . ILE A 1 41 ? 100.291 -10.371 -14.308 1.00 0.00 ? 41 ILE A CB   3  
ATOM 3457  C CG1  . ILE A 1 41 ? 101.758 -10.116 -14.662 1.00 0.00 ? 41 ILE A CG1  3  
ATOM 3458  C CG2  . ILE A 1 41 ? 99.423  -10.131 -15.544 1.00 0.00 ? 41 ILE A CG2  3  
ATOM 3459  C CD1  . ILE A 1 41 ? 102.276 -11.251 -15.548 1.00 0.00 ? 41 ILE A CD1  3  
ATOM 3460  H H    . ILE A 1 41 ? 101.308 -10.412 -11.992 1.00 0.00 ? 41 ILE A H    3  
ATOM 3461  H HA   . ILE A 1 41 ? 100.059 -8.405  -13.497 1.00 0.00 ? 41 ILE A HA   3  
ATOM 3462  H HB   . ILE A 1 41 ? 100.171 -11.394 -13.978 1.00 0.00 ? 41 ILE A HB   3  
ATOM 3463  H HG12 . ILE A 1 41 ? 101.841 -9.177  -15.192 1.00 0.00 ? 41 ILE A HG12 3  
ATOM 3464  H HG13 . ILE A 1 41 ? 102.345 -10.072 -13.757 1.00 0.00 ? 41 ILE A HG13 3  
ATOM 3465  H HG21 . ILE A 1 41 ? 99.360  -9.069  -15.738 1.00 0.00 ? 41 ILE A HG21 3  
ATOM 3466  H HG22 . ILE A 1 41 ? 98.432  -10.524 -15.371 1.00 0.00 ? 41 ILE A HG22 3  
ATOM 3467  H HG23 . ILE A 1 41 ? 99.864  -10.627 -16.396 1.00 0.00 ? 41 ILE A HG23 3  
ATOM 3468  H HD11 . ILE A 1 41 ? 102.086 -12.199 -15.067 1.00 0.00 ? 41 ILE A HD11 3  
ATOM 3469  H HD12 . ILE A 1 41 ? 103.338 -11.132 -15.701 1.00 0.00 ? 41 ILE A HD12 3  
ATOM 3470  H HD13 . ILE A 1 41 ? 101.769 -11.223 -16.502 1.00 0.00 ? 41 ILE A HD13 3  
ATOM 3471  N N    . ILE A 1 42 ? 98.012  -10.655 -12.234 1.00 0.00 ? 42 ILE A N    3  
ATOM 3472  C CA   . ILE A 1 42 ? 96.615  -10.915 -11.920 1.00 0.00 ? 42 ILE A CA   3  
ATOM 3473  C C    . ILE A 1 42 ? 96.054  -9.811  -11.028 1.00 0.00 ? 42 ILE A C    3  
ATOM 3474  O O    . ILE A 1 42 ? 94.905  -9.405  -11.179 1.00 0.00 ? 42 ILE A O    3  
ATOM 3475  C CB   . ILE A 1 42 ? 96.485  -12.268 -11.215 1.00 0.00 ? 42 ILE A CB   3  
ATOM 3476  C CG1  . ILE A 1 42 ? 96.881  -13.386 -12.184 1.00 0.00 ? 42 ILE A CG1  3  
ATOM 3477  C CG2  . ILE A 1 42 ? 95.038  -12.480 -10.764 1.00 0.00 ? 42 ILE A CG2  3  
ATOM 3478  C CD1  . ILE A 1 42 ? 97.049  -14.696 -11.413 1.00 0.00 ? 42 ILE A CD1  3  
ATOM 3479  H H    . ILE A 1 42 ? 98.700  -11.283 -11.930 1.00 0.00 ? 42 ILE A H    3  
ATOM 3480  H HA   . ILE A 1 42 ? 96.049  -10.945 -12.839 1.00 0.00 ? 42 ILE A HA   3  
ATOM 3481  H HB   . ILE A 1 42 ? 97.137  -12.289 -10.353 1.00 0.00 ? 42 ILE A HB   3  
ATOM 3482  H HG12 . ILE A 1 42 ? 96.111  -13.502 -12.932 1.00 0.00 ? 42 ILE A HG12 3  
ATOM 3483  H HG13 . ILE A 1 42 ? 97.814  -13.131 -12.664 1.00 0.00 ? 42 ILE A HG13 3  
ATOM 3484  H HG21 . ILE A 1 42 ? 94.832  -11.854 -9.909  1.00 0.00 ? 42 ILE A HG21 3  
ATOM 3485  H HG22 . ILE A 1 42 ? 94.892  -13.516 -10.496 1.00 0.00 ? 42 ILE A HG22 3  
ATOM 3486  H HG23 . ILE A 1 42 ? 94.369  -12.218 -11.570 1.00 0.00 ? 42 ILE A HG23 3  
ATOM 3487  H HD11 . ILE A 1 42 ? 97.868  -14.602 -10.716 1.00 0.00 ? 42 ILE A HD11 3  
ATOM 3488  H HD12 . ILE A 1 42 ? 97.256  -15.499 -12.106 1.00 0.00 ? 42 ILE A HD12 3  
ATOM 3489  H HD13 . ILE A 1 42 ? 96.139  -14.914 -10.872 1.00 0.00 ? 42 ILE A HD13 3  
ATOM 3490  N N    . SER A 1 43 ? 96.873  -9.341  -10.092 1.00 0.00 ? 43 SER A N    3  
ATOM 3491  C CA   . SER A 1 43 ? 96.451  -8.294  -9.166  1.00 0.00 ? 43 SER A CA   3  
ATOM 3492  C C    . SER A 1 43 ? 96.052  -7.014  -9.902  1.00 0.00 ? 43 SER A C    3  
ATOM 3493  O O    . SER A 1 43 ? 94.967  -6.476  -9.676  1.00 0.00 ? 43 SER A O    3  
ATOM 3494  C CB   . SER A 1 43 ? 97.584  -7.982  -8.189  1.00 0.00 ? 43 SER A CB   3  
ATOM 3495  O OG   . SER A 1 43 ? 98.023  -9.188  -7.578  1.00 0.00 ? 43 SER A OG   3  
ATOM 3496  H H    . SER A 1 43 ? 97.777  -9.711  -10.015 1.00 0.00 ? 43 SER A H    3  
ATOM 3497  H HA   . SER A 1 43 ? 95.601  -8.650  -8.603  1.00 0.00 ? 43 SER A HA   3  
ATOM 3498  H HB2  . SER A 1 43 ? 98.408  -7.534  -8.721  1.00 0.00 ? 43 SER A HB2  3  
ATOM 3499  H HB3  . SER A 1 43 ? 97.229  -7.292  -7.434  1.00 0.00 ? 43 SER A HB3  3  
ATOM 3500  H HG   . SER A 1 43 ? 98.980  -9.221  -7.639  1.00 0.00 ? 43 SER A HG   3  
ATOM 3501  N N    . ILE A 1 44 ? 96.929  -6.522  -10.773 1.00 0.00 ? 44 ILE A N    3  
ATOM 3502  C CA   . ILE A 1 44 ? 96.633  -5.296  -11.509 1.00 0.00 ? 44 ILE A CA   3  
ATOM 3503  C C    . ILE A 1 44 ? 95.400  -5.482  -12.392 1.00 0.00 ? 44 ILE A C    3  
ATOM 3504  O O    . ILE A 1 44 ? 94.537  -4.608  -12.463 1.00 0.00 ? 44 ILE A O    3  
ATOM 3505  C CB   . ILE A 1 44 ? 97.838  -4.871  -12.358 1.00 0.00 ? 44 ILE A CB   3  
ATOM 3506  C CG1  . ILE A 1 44 ? 98.349  -6.062  -13.173 1.00 0.00 ? 44 ILE A CG1  3  
ATOM 3507  C CG2  . ILE A 1 44 ? 98.961  -4.372  -11.442 1.00 0.00 ? 44 ILE A CG2  3  
ATOM 3508  C CD1  . ILE A 1 44 ? 99.578  -5.657  -14.000 1.00 0.00 ? 44 ILE A CD1  3  
ATOM 3509  H H    . ILE A 1 44 ? 97.786  -6.982  -10.913 1.00 0.00 ? 44 ILE A H    3  
ATOM 3510  H HA   . ILE A 1 44 ? 96.422  -4.514  -10.795 1.00 0.00 ? 44 ILE A HA   3  
ATOM 3511  H HB   . ILE A 1 44 ? 97.542  -4.075  -13.027 1.00 0.00 ? 44 ILE A HB   3  
ATOM 3512  H HG12 . ILE A 1 44 ? 98.621  -6.859  -12.499 1.00 0.00 ? 44 ILE A HG12 3  
ATOM 3513  H HG13 . ILE A 1 44 ? 97.569  -6.403  -13.836 1.00 0.00 ? 44 ILE A HG13 3  
ATOM 3514  H HG21 . ILE A 1 44 ? 99.753  -3.948  -12.042 1.00 0.00 ? 44 ILE A HG21 3  
ATOM 3515  H HG22 . ILE A 1 44 ? 99.350  -5.198  -10.867 1.00 0.00 ? 44 ILE A HG22 3  
ATOM 3516  H HG23 . ILE A 1 44 ? 98.574  -3.619  -10.774 1.00 0.00 ? 44 ILE A HG23 3  
ATOM 3517  H HD11 . ILE A 1 44 ? 99.592  -6.223  -14.920 1.00 0.00 ? 44 ILE A HD11 3  
ATOM 3518  H HD12 . ILE A 1 44 ? 100.475 -5.869  -13.437 1.00 0.00 ? 44 ILE A HD12 3  
ATOM 3519  H HD13 . ILE A 1 44 ? 99.542  -4.600  -14.230 1.00 0.00 ? 44 ILE A HD13 3  
ATOM 3520  N N    . VAL A 1 45 ? 95.305  -6.626  -13.057 1.00 0.00 ? 45 VAL A N    3  
ATOM 3521  C CA   . VAL A 1 45 ? 94.154  -6.889  -13.911 1.00 0.00 ? 45 VAL A CA   3  
ATOM 3522  C C    . VAL A 1 45 ? 92.869  -6.868  -13.079 1.00 0.00 ? 45 VAL A C    3  
ATOM 3523  O O    . VAL A 1 45 ? 91.813  -6.441  -13.554 1.00 0.00 ? 45 VAL A O    3  
ATOM 3524  C CB   . VAL A 1 45 ? 94.309  -8.253  -14.597 1.00 0.00 ? 45 VAL A CB   3  
ATOM 3525  C CG1  . VAL A 1 45 ? 93.001  -8.642  -15.294 1.00 0.00 ? 45 VAL A CG1  3  
ATOM 3526  C CG2  . VAL A 1 45 ? 95.426  -8.170  -15.640 1.00 0.00 ? 45 VAL A CG2  3  
ATOM 3527  H H    . VAL A 1 45 ? 96.011  -7.304  -12.965 1.00 0.00 ? 45 VAL A H    3  
ATOM 3528  H HA   . VAL A 1 45 ? 94.096  -6.122  -14.666 1.00 0.00 ? 45 VAL A HA   3  
ATOM 3529  H HB   . VAL A 1 45 ? 94.559  -9.001  -13.859 1.00 0.00 ? 45 VAL A HB   3  
ATOM 3530  H HG11 . VAL A 1 45 ? 92.274  -8.941  -14.554 1.00 0.00 ? 45 VAL A HG11 3  
ATOM 3531  H HG12 . VAL A 1 45 ? 93.183  -9.463  -15.973 1.00 0.00 ? 45 VAL A HG12 3  
ATOM 3532  H HG13 . VAL A 1 45 ? 92.623  -7.795  -15.848 1.00 0.00 ? 45 VAL A HG13 3  
ATOM 3533  H HG21 . VAL A 1 45 ? 96.350  -7.891  -15.157 1.00 0.00 ? 45 VAL A HG21 3  
ATOM 3534  H HG22 . VAL A 1 45 ? 95.170  -7.430  -16.381 1.00 0.00 ? 45 VAL A HG22 3  
ATOM 3535  H HG23 . VAL A 1 45 ? 95.545  -9.132  -16.117 1.00 0.00 ? 45 VAL A HG23 3  
ATOM 3536  N N    . LEU A 1 46 ? 92.969  -7.344  -11.841 1.00 0.00 ? 46 LEU A N    3  
ATOM 3537  C CA   . LEU A 1 46 ? 91.814  -7.396  -10.952 1.00 0.00 ? 46 LEU A CA   3  
ATOM 3538  C C    . LEU A 1 46 ? 91.374  -5.992  -10.518 1.00 0.00 ? 46 LEU A C    3  
ATOM 3539  O O    . LEU A 1 46 ? 90.177  -5.723  -10.417 1.00 0.00 ? 46 LEU A O    3  
ATOM 3540  C CB   . LEU A 1 46 ? 92.151  -8.267  -9.711  1.00 0.00 ? 46 LEU A CB   3  
ATOM 3541  C CG   . LEU A 1 46 ? 91.127  -9.403  -9.536  1.00 0.00 ? 46 LEU A CG   3  
ATOM 3542  C CD1  . LEU A 1 46 ? 91.617  -10.368 -8.455  1.00 0.00 ? 46 LEU A CD1  3  
ATOM 3543  C CD2  . LEU A 1 46 ? 89.772  -8.822  -9.119  1.00 0.00 ? 46 LEU A CD2  3  
ATOM 3544  H H    . LEU A 1 46 ? 93.834  -7.677  -11.525 1.00 0.00 ? 46 LEU A H    3  
ATOM 3545  H HA   . LEU A 1 46 ? 90.997  -7.849  -11.494 1.00 0.00 ? 46 LEU A HA   3  
ATOM 3546  H HB2  . LEU A 1 46 ? 93.130  -8.699  -9.843  1.00 0.00 ? 46 LEU A HB2  3  
ATOM 3547  H HB3  . LEU A 1 46 ? 92.159  -7.658  -8.817  1.00 0.00 ? 46 LEU A HB3  3  
ATOM 3548  H HG   . LEU A 1 46 ? 91.021  -9.939  -10.468 1.00 0.00 ? 46 LEU A HG   3  
ATOM 3549  H HD11 . LEU A 1 46 ? 91.585  -9.878  -7.493  1.00 0.00 ? 46 LEU A HD11 3  
ATOM 3550  H HD12 . LEU A 1 46 ? 92.632  -10.668 -8.672  1.00 0.00 ? 46 LEU A HD12 3  
ATOM 3551  H HD13 . LEU A 1 46 ? 90.981  -11.240 -8.435  1.00 0.00 ? 46 LEU A HD13 3  
ATOM 3552  H HD21 . LEU A 1 46 ? 89.137  -9.617  -8.754  1.00 0.00 ? 46 LEU A HD21 3  
ATOM 3553  H HD22 . LEU A 1 46 ? 89.305  -8.351  -9.968  1.00 0.00 ? 46 LEU A HD22 3  
ATOM 3554  H HD23 . LEU A 1 46 ? 89.916  -8.091  -8.336  1.00 0.00 ? 46 LEU A HD23 3  
ATOM 3555  N N    . VAL A 1 47 ? 92.332  -5.101  -10.252 1.00 0.00 ? 47 VAL A N    3  
ATOM 3556  C CA   . VAL A 1 47 ? 91.977  -3.755  -9.820  1.00 0.00 ? 47 VAL A CA   3  
ATOM 3557  C C    . VAL A 1 47 ? 91.324  -3.001  -10.976 1.00 0.00 ? 47 VAL A C    3  
ATOM 3558  O O    . VAL A 1 47 ? 90.481  -2.129  -10.770 1.00 0.00 ? 47 VAL A O    3  
ATOM 3559  C CB   . VAL A 1 47 ? 93.229  -3.009  -9.284  1.00 0.00 ? 47 VAL A CB   3  
ATOM 3560  C CG1  . VAL A 1 47 ? 93.906  -2.179  -10.387 1.00 0.00 ? 47 VAL A CG1  3  
ATOM 3561  C CG2  . VAL A 1 47 ? 92.829  -2.074  -8.131  1.00 0.00 ? 47 VAL A CG2  3  
ATOM 3562  H H    . VAL A 1 47 ? 93.277  -5.348  -10.344 1.00 0.00 ? 47 VAL A H    3  
ATOM 3563  H HA   . VAL A 1 47 ? 91.256  -3.843  -9.021  1.00 0.00 ? 47 VAL A HA   3  
ATOM 3564  H HB   . VAL A 1 47 ? 93.936  -3.739  -8.915  1.00 0.00 ? 47 VAL A HB   3  
ATOM 3565  H HG11 . VAL A 1 47 ? 93.889  -2.726  -11.313 1.00 0.00 ? 47 VAL A HG11 3  
ATOM 3566  H HG12 . VAL A 1 47 ? 94.929  -1.979  -10.108 1.00 0.00 ? 47 VAL A HG12 3  
ATOM 3567  H HG13 . VAL A 1 47 ? 93.379  -1.243  -10.514 1.00 0.00 ? 47 VAL A HG13 3  
ATOM 3568  H HG21 . VAL A 1 47 ? 93.663  -1.435  -7.880  1.00 0.00 ? 47 VAL A HG21 3  
ATOM 3569  H HG22 . VAL A 1 47 ? 92.554  -2.663  -7.269  1.00 0.00 ? 47 VAL A HG22 3  
ATOM 3570  H HG23 . VAL A 1 47 ? 91.989  -1.467  -8.435  1.00 0.00 ? 47 VAL A HG23 3  
ATOM 3571  N N    . ALA A 1 48 ? 91.732  -3.346  -12.193 1.00 0.00 ? 48 ALA A N    3  
ATOM 3572  C CA   . ALA A 1 48 ? 91.197  -2.698  -13.383 1.00 0.00 ? 48 ALA A CA   3  
ATOM 3573  C C    . ALA A 1 48 ? 89.743  -3.083  -13.638 1.00 0.00 ? 48 ALA A C    3  
ATOM 3574  O O    . ALA A 1 48 ? 88.890  -2.217  -13.834 1.00 0.00 ? 48 ALA A O    3  
ATOM 3575  C CB   . ALA A 1 48 ? 92.044  -3.083  -14.598 1.00 0.00 ? 48 ALA A CB   3  
ATOM 3576  H H    . ALA A 1 48 ? 92.416  -4.046  -12.291 1.00 0.00 ? 48 ALA A H    3  
ATOM 3577  H HA   . ALA A 1 48 ? 91.249  -1.634  -13.248 1.00 0.00 ? 48 ALA A HA   3  
ATOM 3578  H HB1  . ALA A 1 48 ? 93.086  -3.099  -14.319 1.00 0.00 ? 48 ALA A HB1  3  
ATOM 3579  H HB2  . ALA A 1 48 ? 91.892  -2.361  -15.387 1.00 0.00 ? 48 ALA A HB2  3  
ATOM 3580  H HB3  . ALA A 1 48 ? 91.751  -4.063  -14.947 1.00 0.00 ? 48 ALA A HB3  3  
ATOM 3581  N N    . THR A 1 49 ? 89.469  -4.381  -13.666 1.00 0.00 ? 49 THR A N    3  
ATOM 3582  C CA   . THR A 1 49 ? 88.113  -4.849  -13.936 1.00 0.00 ? 49 THR A CA   3  
ATOM 3583  C C    . THR A 1 49 ? 87.135  -4.419  -12.841 1.00 0.00 ? 49 THR A C    3  
ATOM 3584  O O    . THR A 1 49 ? 86.026  -3.972  -13.135 1.00 0.00 ? 49 THR A O    3  
ATOM 3585  C CB   . THR A 1 49 ? 88.102  -6.377  -14.072 1.00 0.00 ? 49 THR A CB   3  
ATOM 3586  O OG1  . THR A 1 49 ? 89.269  -6.794  -14.769 1.00 0.00 ? 49 THR A OG1  3  
ATOM 3587  C CG2  . THR A 1 49 ? 86.859  -6.820  -14.849 1.00 0.00 ? 49 THR A CG2  3  
ATOM 3588  H H    . THR A 1 49 ? 90.189  -5.033  -13.525 1.00 0.00 ? 49 THR A H    3  
ATOM 3589  H HA   . THR A 1 49 ? 87.788  -4.418  -14.872 1.00 0.00 ? 49 THR A HA   3  
ATOM 3590  H HB   . THR A 1 49 ? 88.089  -6.828  -13.091 1.00 0.00 ? 49 THR A HB   3  
ATOM 3591  H HG1  . THR A 1 49 ? 89.761  -7.386  -14.196 1.00 0.00 ? 49 THR A HG1  3  
ATOM 3592  H HG21 . THR A 1 49 ? 86.874  -7.892  -14.974 1.00 0.00 ? 49 THR A HG21 3  
ATOM 3593  H HG22 . THR A 1 49 ? 86.852  -6.344  -15.820 1.00 0.00 ? 49 THR A HG22 3  
ATOM 3594  H HG23 . THR A 1 49 ? 85.972  -6.533  -14.302 1.00 0.00 ? 49 THR A HG23 3  
ATOM 3595  N N    . VAL A 1 50 ? 87.537  -4.569  -11.582 1.00 0.00 ? 50 VAL A N    3  
ATOM 3596  C CA   . VAL A 1 50 ? 86.661  -4.203  -10.469 1.00 0.00 ? 50 VAL A CA   3  
ATOM 3597  C C    . VAL A 1 50 ? 86.446  -2.692  -10.397 1.00 0.00 ? 50 VAL A C    3  
ATOM 3598  O O    . VAL A 1 50 ? 85.339  -2.235  -10.124 1.00 0.00 ? 50 VAL A O    3  
ATOM 3599  C CB   . VAL A 1 50 ? 87.253  -4.687  -9.142  1.00 0.00 ? 50 VAL A CB   3  
ATOM 3600  C CG1  . VAL A 1 50 ? 87.528  -6.196  -9.213  1.00 0.00 ? 50 VAL A CG1  3  
ATOM 3601  C CG2  . VAL A 1 50 ? 88.554  -3.924  -8.855  1.00 0.00 ? 50 VAL A CG2  3  
ATOM 3602  H H    . VAL A 1 50 ? 88.427  -4.942  -11.397 1.00 0.00 ? 50 VAL A H    3  
ATOM 3603  H HA   . VAL A 1 50 ? 85.704  -4.681  -10.611 1.00 0.00 ? 50 VAL A HA   3  
ATOM 3604  H HB   . VAL A 1 50 ? 86.543  -4.496  -8.348  1.00 0.00 ? 50 VAL A HB   3  
ATOM 3605  H HG11 . VAL A 1 50 ? 86.601  -6.736  -9.085  1.00 0.00 ? 50 VAL A HG11 3  
ATOM 3606  H HG12 . VAL A 1 50 ? 88.215  -6.474  -8.428  1.00 0.00 ? 50 VAL A HG12 3  
ATOM 3607  H HG13 . VAL A 1 50 ? 87.958  -6.443  -10.170 1.00 0.00 ? 50 VAL A HG13 3  
ATOM 3608  H HG21 . VAL A 1 50 ? 89.087  -3.755  -9.780  1.00 0.00 ? 50 VAL A HG21 3  
ATOM 3609  H HG22 . VAL A 1 50 ? 89.174  -4.498  -8.181  1.00 0.00 ? 50 VAL A HG22 3  
ATOM 3610  H HG23 . VAL A 1 50 ? 88.318  -2.973  -8.400  1.00 0.00 ? 50 VAL A HG23 3  
ATOM 3611  N N    . LEU A 1 51 ? 87.501  -1.916  -10.631 1.00 0.00 ? 51 LEU A N    3  
ATOM 3612  C CA   . LEU A 1 51 ? 87.380  -0.462  -10.571 1.00 0.00 ? 51 LEU A CA   3  
ATOM 3613  C C    . LEU A 1 51 ? 86.424  0.035   -11.639 1.00 0.00 ? 51 LEU A C    3  
ATOM 3614  O O    . LEU A 1 51 ? 85.566  0.868   -11.366 1.00 0.00 ? 51 LEU A O    3  
ATOM 3615  C CB   . LEU A 1 51 ? 88.761  0.187   -10.755 1.00 0.00 ? 51 LEU A CB   3  
ATOM 3616  C CG   . LEU A 1 51 ? 88.667  1.720   -10.650 1.00 0.00 ? 51 LEU A CG   3  
ATOM 3617  C CD1  . LEU A 1 51 ? 88.292  2.137   -9.219  1.00 0.00 ? 51 LEU A CD1  3  
ATOM 3618  C CD2  . LEU A 1 51 ? 90.026  2.324   -11.018 1.00 0.00 ? 51 LEU A CD2  3  
ATOM 3619  H H    . LEU A 1 51 ? 88.371  -2.322  -10.840 1.00 0.00 ? 51 LEU A H    3  
ATOM 3620  H HA   . LEU A 1 51 ? 86.983  -0.183  -9.611  1.00 0.00 ? 51 LEU A HA   3  
ATOM 3621  H HB2  . LEU A 1 51 ? 89.430  -0.182  -9.992  1.00 0.00 ? 51 LEU A HB2  3  
ATOM 3622  H HB3  . LEU A 1 51 ? 89.149  -0.078  -11.727 1.00 0.00 ? 51 LEU A HB3  3  
ATOM 3623  H HG   . LEU A 1 51 ? 87.919  2.088   -11.336 1.00 0.00 ? 51 LEU A HG   3  
ATOM 3624  H HD11 . LEU A 1 51 ? 88.594  3.161   -9.048  1.00 0.00 ? 51 LEU A HD11 3  
ATOM 3625  H HD12 . LEU A 1 51 ? 88.790  1.495   -8.507  1.00 0.00 ? 51 LEU A HD12 3  
ATOM 3626  H HD13 . LEU A 1 51 ? 87.224  2.058   -9.088  1.00 0.00 ? 51 LEU A HD13 3  
ATOM 3627  H HD21 . LEU A 1 51 ? 90.004  3.391   -10.855 1.00 0.00 ? 51 LEU A HD21 3  
ATOM 3628  H HD22 . LEU A 1 51 ? 90.239  2.123   -12.059 1.00 0.00 ? 51 LEU A HD22 3  
ATOM 3629  H HD23 . LEU A 1 51 ? 90.796  1.881   -10.402 1.00 0.00 ? 51 LEU A HD23 3  
ATOM 3630  N N    . LYS A 1 52 ? 86.576  -0.469  -12.850 1.00 0.00 ? 52 LYS A N    3  
ATOM 3631  C CA   . LYS A 1 52 ? 85.715  -0.048  -13.942 1.00 0.00 ? 52 LYS A CA   3  
ATOM 3632  C C    . LYS A 1 52 ? 84.258  -0.403  -13.650 1.00 0.00 ? 52 LYS A C    3  
ATOM 3633  O O    . LYS A 1 52 ? 83.378  0.433   -13.780 1.00 0.00 ? 52 LYS A O    3  
ATOM 3634  C CB   . LYS A 1 52 ? 86.182  -0.715  -15.255 1.00 0.00 ? 52 LYS A CB   3  
ATOM 3635  C CG   . LYS A 1 52 ? 85.953  0.233   -16.448 1.00 0.00 ? 52 LYS A CG   3  
ATOM 3636  C CD   . LYS A 1 52 ? 87.128  1.227   -16.560 1.00 0.00 ? 52 LYS A CD   3  
ATOM 3637  C CE   . LYS A 1 52 ? 88.306  0.583   -17.316 1.00 0.00 ? 52 LYS A CE   3  
ATOM 3638  N NZ   . LYS A 1 52 ? 89.589  1.067   -16.731 1.00 0.00 ? 52 LYS A NZ   3  
ATOM 3639  H H    . LYS A 1 52 ? 87.282  -1.130  -13.016 1.00 0.00 ? 52 LYS A H    3  
ATOM 3640  H HA   . LYS A 1 52 ? 85.787  1.024   -14.044 1.00 0.00 ? 52 LYS A HA   3  
ATOM 3641  H HB2  . LYS A 1 52 ? 87.233  -0.949  -15.176 1.00 0.00 ? 52 LYS A HB2  3  
ATOM 3642  H HB3  . LYS A 1 52 ? 85.629  -1.630  -15.417 1.00 0.00 ? 52 LYS A HB3  3  
ATOM 3643  H HG2  . LYS A 1 52 ? 85.883  -0.347  -17.358 1.00 0.00 ? 52 LYS A HG2  3  
ATOM 3644  H HG3  . LYS A 1 52 ? 85.034  0.783   -16.303 1.00 0.00 ? 52 LYS A HG3  3  
ATOM 3645  H HD2  . LYS A 1 52 ? 86.798  2.109   -17.092 1.00 0.00 ? 52 LYS A HD2  3  
ATOM 3646  H HD3  . LYS A 1 52 ? 87.457  1.514   -15.572 1.00 0.00 ? 52 LYS A HD3  3  
ATOM 3647  H HE2  . LYS A 1 52 ? 88.262  -0.493  -17.231 1.00 0.00 ? 52 LYS A HE2  3  
ATOM 3648  H HE3  . LYS A 1 52 ? 88.262  0.861   -18.358 1.00 0.00 ? 52 LYS A HE3  3  
ATOM 3649  H HZ1  . LYS A 1 52 ? 89.420  1.949   -16.207 1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 3650  H HZ2  . LYS A 1 52 ? 90.273  1.242   -17.494 1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 3651  H HZ3  . LYS A 1 52 ? 89.967  0.348   -16.083 1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 3652  N N    . THR A 1 53 ? 84.012  -1.646  -13.271 1.00 0.00 ? 53 THR A N    3  
ATOM 3653  C CA   . THR A 1 53 ? 82.650  -2.090  -12.991 1.00 0.00 ? 53 THR A CA   3  
ATOM 3654  C C    . THR A 1 53 ? 82.014  -1.336  -11.818 1.00 0.00 ? 53 THR A C    3  
ATOM 3655  O O    . THR A 1 53 ? 80.863  -0.905  -11.902 1.00 0.00 ? 53 THR A O    3  
ATOM 3656  C CB   . THR A 1 53 ? 82.653  -3.588  -12.678 1.00 0.00 ? 53 THR A CB   3  
ATOM 3657  O OG1  . THR A 1 53 ? 83.638  -3.862  -11.692 1.00 0.00 ? 53 THR A OG1  3  
ATOM 3658  C CG2  . THR A 1 53 ? 82.969  -4.376  -13.950 1.00 0.00 ? 53 THR A CG2  3  
ATOM 3659  H H    . THR A 1 53 ? 84.754  -2.283  -13.191 1.00 0.00 ? 53 THR A H    3  
ATOM 3660  H HA   . THR A 1 53 ? 82.048  -1.929  -13.871 1.00 0.00 ? 53 THR A HA   3  
ATOM 3661  H HB   . THR A 1 53 ? 81.683  -3.882  -12.310 1.00 0.00 ? 53 THR A HB   3  
ATOM 3662  H HG1  . THR A 1 53 ? 84.319  -3.188  -11.758 1.00 0.00 ? 53 THR A HG1  3  
ATOM 3663  H HG21 . THR A 1 53 ? 83.225  -5.393  -13.689 1.00 0.00 ? 53 THR A HG21 3  
ATOM 3664  H HG22 . THR A 1 53 ? 83.801  -3.916  -14.462 1.00 0.00 ? 53 THR A HG22 3  
ATOM 3665  H HG23 . THR A 1 53 ? 82.105  -4.378  -14.597 1.00 0.00 ? 53 THR A HG23 3  
ATOM 3666  N N    . ILE A 1 54 ? 82.743  -1.213  -10.715 1.00 0.00 ? 54 ILE A N    3  
ATOM 3667  C CA   . ILE A 1 54 ? 82.202  -0.557  -9.526  1.00 0.00 ? 54 ILE A CA   3  
ATOM 3668  C C    . ILE A 1 54 ? 81.888  0.920   -9.747  1.00 0.00 ? 54 ILE A C    3  
ATOM 3669  O O    . ILE A 1 54 ? 80.833  1.389   -9.333  1.00 0.00 ? 54 ILE A O    3  
ATOM 3670  C CB   . ILE A 1 54 ? 83.181  -0.713  -8.357  1.00 0.00 ? 54 ILE A CB   3  
ATOM 3671  C CG1  . ILE A 1 54 ? 83.299  -2.193  -7.989  1.00 0.00 ? 54 ILE A CG1  3  
ATOM 3672  C CG2  . ILE A 1 54 ? 82.674  0.071   -7.143  1.00 0.00 ? 54 ILE A CG2  3  
ATOM 3673  C CD1  . ILE A 1 54 ? 84.516  -2.398  -7.086  1.00 0.00 ? 54 ILE A CD1  3  
ATOM 3674  H H    . ILE A 1 54 ? 83.647  -1.596  -10.686 1.00 0.00 ? 54 ILE A H    3  
ATOM 3675  H HA   . ILE A 1 54 ? 81.279  -1.050  -9.266  1.00 0.00 ? 54 ILE A HA   3  
ATOM 3676  H HB   . ILE A 1 54 ? 84.151  -0.336  -8.650  1.00 0.00 ? 54 ILE A HB   3  
ATOM 3677  H HG12 . ILE A 1 54 ? 82.405  -2.506  -7.467  1.00 0.00 ? 54 ILE A HG12 3  
ATOM 3678  H HG13 . ILE A 1 54 ? 83.415  -2.781  -8.886  1.00 0.00 ? 54 ILE A HG13 3  
ATOM 3679  H HG21 . ILE A 1 54 ? 83.224  -0.231  -6.264  1.00 0.00 ? 54 ILE A HG21 3  
ATOM 3680  H HG22 . ILE A 1 54 ? 81.623  -0.130  -6.997  1.00 0.00 ? 54 ILE A HG22 3  
ATOM 3681  H HG23 . ILE A 1 54 ? 82.818  1.128   -7.312  1.00 0.00 ? 54 ILE A HG23 3  
ATOM 3682  H HD11 . ILE A 1 54 ? 84.497  -1.675  -6.285  1.00 0.00 ? 54 ILE A HD11 3  
ATOM 3683  H HD12 . ILE A 1 54 ? 85.419  -2.269  -7.665  1.00 0.00 ? 54 ILE A HD12 3  
ATOM 3684  H HD13 . ILE A 1 54 ? 84.494  -3.395  -6.671  1.00 0.00 ? 54 ILE A HD13 3  
ATOM 3685  N N    . VAL A 1 55 ? 82.801  1.658   -10.363 1.00 0.00 ? 55 VAL A N    3  
ATOM 3686  C CA   . VAL A 1 55 ? 82.570  3.085   -10.586 1.00 0.00 ? 55 VAL A CA   3  
ATOM 3687  C C    . VAL A 1 55 ? 81.592  3.312   -11.739 1.00 0.00 ? 55 VAL A C    3  
ATOM 3688  O O    . VAL A 1 55 ? 80.813  4.261   -11.721 1.00 0.00 ? 55 VAL A O    3  
ATOM 3689  C CB   . VAL A 1 55 ? 83.896  3.798   -10.878 1.00 0.00 ? 55 VAL A CB   3  
ATOM 3690  C CG1  . VAL A 1 55 ? 84.917  3.450   -9.788  1.00 0.00 ? 55 VAL A CG1  3  
ATOM 3691  C CG2  . VAL A 1 55 ? 84.428  3.368   -12.256 1.00 0.00 ? 55 VAL A CG2  3  
ATOM 3692  H H    . VAL A 1 55 ? 83.640  1.249   -10.658 1.00 0.00 ? 55 VAL A H    3  
ATOM 3693  H HA   . VAL A 1 55 ? 82.145  3.509   -9.688  1.00 0.00 ? 55 VAL A HA   3  
ATOM 3694  H HB   . VAL A 1 55 ? 83.728  4.866   -10.875 1.00 0.00 ? 55 VAL A HB   3  
ATOM 3695  H HG11 . VAL A 1 55 ? 84.608  3.894   -8.852  1.00 0.00 ? 55 VAL A HG11 3  
ATOM 3696  H HG12 . VAL A 1 55 ? 85.885  3.837   -10.067 1.00 0.00 ? 55 VAL A HG12 3  
ATOM 3697  H HG13 . VAL A 1 55 ? 84.977  2.379   -9.675  1.00 0.00 ? 55 VAL A HG13 3  
ATOM 3698  H HG21 . VAL A 1 55 ? 85.504  3.474   -12.283 1.00 0.00 ? 55 VAL A HG21 3  
ATOM 3699  H HG22 . VAL A 1 55 ? 83.988  3.994   -13.018 1.00 0.00 ? 55 VAL A HG22 3  
ATOM 3700  H HG23 . VAL A 1 55 ? 84.165  2.338   -12.447 1.00 0.00 ? 55 VAL A HG23 3  
ATOM 3701  N N    . LEU A 1 56 ? 81.652  2.449   -12.747 1.00 0.00 ? 56 LEU A N    3  
ATOM 3702  C CA   . LEU A 1 56 ? 80.789  2.571   -13.919 1.00 0.00 ? 56 LEU A CA   3  
ATOM 3703  C C    . LEU A 1 56 ? 79.307  2.302   -13.621 1.00 0.00 ? 56 LEU A C    3  
ATOM 3704  O O    . LEU A 1 56 ? 78.441  2.915   -14.243 1.00 0.00 ? 56 LEU A O    3  
ATOM 3705  C CB   . LEU A 1 56 ? 81.280  1.609   -15.011 1.00 0.00 ? 56 LEU A CB   3  
ATOM 3706  C CG   . LEU A 1 56 ? 80.439  1.761   -16.308 1.00 0.00 ? 56 LEU A CG   3  
ATOM 3707  C CD1  . LEU A 1 56 ? 81.359  1.657   -17.532 1.00 0.00 ? 56 LEU A CD1  3  
ATOM 3708  C CD2  . LEU A 1 56 ? 79.378  0.651   -16.395 1.00 0.00 ? 56 LEU A CD2  3  
ATOM 3709  H H    . LEU A 1 56 ? 82.306  1.723   -12.714 1.00 0.00 ? 56 LEU A H    3  
ATOM 3710  H HA   . LEU A 1 56 ? 80.880  3.575   -14.302 1.00 0.00 ? 56 LEU A HA   3  
ATOM 3711  H HB2  . LEU A 1 56 ? 82.315  1.841   -15.224 1.00 0.00 ? 56 LEU A HB2  3  
ATOM 3712  H HB3  . LEU A 1 56 ? 81.212  0.594   -14.646 1.00 0.00 ? 56 LEU A HB3  3  
ATOM 3713  H HG   . LEU A 1 56 ? 79.951  2.728   -16.319 1.00 0.00 ? 56 LEU A HG   3  
ATOM 3714  H HD11 . LEU A 1 56 ? 81.843  0.692   -17.536 1.00 0.00 ? 56 LEU A HD11 3  
ATOM 3715  H HD12 . LEU A 1 56 ? 82.109  2.432   -17.484 1.00 0.00 ? 56 LEU A HD12 3  
ATOM 3716  H HD13 . LEU A 1 56 ? 80.775  1.772   -18.432 1.00 0.00 ? 56 LEU A HD13 3  
ATOM 3717  H HD21 . LEU A 1 56 ? 78.634  0.921   -17.129 1.00 0.00 ? 56 LEU A HD21 3  
ATOM 3718  H HD22 . LEU A 1 56 ? 78.903  0.524   -15.435 1.00 0.00 ? 56 LEU A HD22 3  
ATOM 3719  H HD23 . LEU A 1 56 ? 79.847  -0.277  -16.685 1.00 0.00 ? 56 LEU A HD23 3  
ATOM 3720  N N    . ILE A 1 57 ? 78.993  1.372   -12.713 1.00 0.00 ? 57 ILE A N    3  
ATOM 3721  C CA   . ILE A 1 57 ? 77.580  1.070   -12.447 1.00 0.00 ? 57 ILE A CA   3  
ATOM 3722  C C    . ILE A 1 57 ? 76.838  2.268   -11.818 1.00 0.00 ? 57 ILE A C    3  
ATOM 3723  O O    . ILE A 1 57 ? 75.788  2.666   -12.324 1.00 0.00 ? 57 ILE A O    3  
ATOM 3724  C CB   . ILE A 1 57 ? 77.445  -0.220  -11.575 1.00 0.00 ? 57 ILE A CB   3  
ATOM 3725  C CG1  . ILE A 1 57 ? 77.276  -1.471  -12.468 1.00 0.00 ? 57 ILE A CG1  3  
ATOM 3726  C CG2  . ILE A 1 57 ? 76.216  -0.141  -10.649 1.00 0.00 ? 57 ILE A CG2  3  
ATOM 3727  C CD1  . ILE A 1 57 ? 78.580  -1.793  -13.208 1.00 0.00 ? 57 ILE A CD1  3  
ATOM 3728  H H    . ILE A 1 57 ? 79.705  0.869   -12.243 1.00 0.00 ? 57 ILE A H    3  
ATOM 3729  H HA   . ILE A 1 57 ? 77.111  0.891   -13.403 1.00 0.00 ? 57 ILE A HA   3  
ATOM 3730  H HB   . ILE A 1 57 ? 78.334  -0.334  -10.973 1.00 0.00 ? 57 ILE A HB   3  
ATOM 3731  H HG12 . ILE A 1 57 ? 77.009  -2.314  -11.847 1.00 0.00 ? 57 ILE A HG12 3  
ATOM 3732  H HG13 . ILE A 1 57 ? 76.489  -1.301  -13.187 1.00 0.00 ? 57 ILE A HG13 3  
ATOM 3733  H HG21 . ILE A 1 57 ? 76.387  0.590   -9.875  1.00 0.00 ? 57 ILE A HG21 3  
ATOM 3734  H HG22 . ILE A 1 57 ? 76.044  -1.107  -10.197 1.00 0.00 ? 57 ILE A HG22 3  
ATOM 3735  H HG23 . ILE A 1 57 ? 75.350  0.144   -11.228 1.00 0.00 ? 57 ILE A HG23 3  
ATOM 3736  H HD11 . ILE A 1 57 ? 78.349  -2.333  -14.115 1.00 0.00 ? 57 ILE A HD11 3  
ATOM 3737  H HD12 . ILE A 1 57 ? 79.207  -2.405  -12.578 1.00 0.00 ? 57 ILE A HD12 3  
ATOM 3738  H HD13 . ILE A 1 57 ? 79.097  -0.880  -13.456 1.00 0.00 ? 57 ILE A HD13 3  
ATOM 3739  N N    . PRO A 1 58 ? 77.326  2.845   -10.746 1.00 0.00 ? 58 PRO A N    3  
ATOM 3740  C CA   . PRO A 1 58 ? 76.638  4.001   -10.098 1.00 0.00 ? 58 PRO A CA   3  
ATOM 3741  C C    . PRO A 1 58 ? 76.759  5.268   -10.942 1.00 0.00 ? 58 PRO A C    3  
ATOM 3742  O O    . PRO A 1 58 ? 75.886  6.135   -10.913 1.00 0.00 ? 58 PRO A O    3  
ATOM 3743  C CB   . PRO A 1 58 ? 77.356  4.144   -8.748  1.00 0.00 ? 58 PRO A CB   3  
ATOM 3744  C CG   . PRO A 1 58 ? 78.723  3.578   -8.976  1.00 0.00 ? 58 PRO A CG   3  
ATOM 3745  C CD   . PRO A 1 58 ? 78.567  2.487   -10.043 1.00 0.00 ? 58 PRO A CD   3  
ATOM 3746  H HA   . PRO A 1 58 ? 75.599  3.767   -9.933  1.00 0.00 ? 58 PRO A HA   3  
ATOM 3747  H HB2  . PRO A 1 58 ? 77.417  5.186   -8.457  1.00 0.00 ? 58 PRO A HB2  3  
ATOM 3748  H HB3  . PRO A 1 58 ? 76.842  3.573   -7.988  1.00 0.00 ? 58 PRO A HB3  3  
ATOM 3749  H HG2  . PRO A 1 58 ? 79.391  4.355   -9.326  1.00 0.00 ? 58 PRO A HG2  3  
ATOM 3750  H HG3  . PRO A 1 58 ? 79.107  3.145   -8.063  1.00 0.00 ? 58 PRO A HG3  3  
ATOM 3751  H HD2  . PRO A 1 58 ? 79.399  2.509   -10.720 1.00 0.00 ? 58 PRO A HD2  3  
ATOM 3752  H HD3  . PRO A 1 58 ? 78.473  1.516   -9.585  1.00 0.00 ? 58 PRO A HD3  3  
ATOM 3753  N N    . PHE A 1 59 ? 77.850  5.361   -11.690 1.00 0.00 ? 59 PHE A N    3  
ATOM 3754  C CA   . PHE A 1 59 ? 78.098  6.503   -12.538 1.00 0.00 ? 59 PHE A CA   3  
ATOM 3755  C C    . PHE A 1 59 ? 77.035  6.588   -13.635 1.00 0.00 ? 59 PHE A C    3  
ATOM 3756  O O    . PHE A 1 59 ? 76.455  7.648   -13.867 1.00 0.00 ? 59 PHE A O    3  
ATOM 3757  C CB   . PHE A 1 59 ? 79.493  6.368   -13.161 1.00 0.00 ? 59 PHE A CB   3  
ATOM 3758  C CG   . PHE A 1 59 ? 80.588  6.793   -12.188 1.00 0.00 ? 59 PHE A CG   3  
ATOM 3759  C CD1  . PHE A 1 59 ? 80.392  6.764   -10.789 1.00 0.00 ? 59 PHE A CD1  3  
ATOM 3760  C CD2  . PHE A 1 59 ? 81.823  7.212   -12.700 1.00 0.00 ? 59 PHE A CD2  3  
ATOM 3761  C CE1  . PHE A 1 59 ? 81.428  7.152   -9.930  1.00 0.00 ? 59 PHE A CE1  3  
ATOM 3762  C CE2  . PHE A 1 59 ? 82.853  7.600   -11.834 1.00 0.00 ? 59 PHE A CE2  3  
ATOM 3763  C CZ   . PHE A 1 59 ? 82.655  7.569   -10.451 1.00 0.00 ? 59 PHE A CZ   3  
ATOM 3764  H H    . PHE A 1 59 ? 78.508  4.645   -11.672 1.00 0.00 ? 59 PHE A H    3  
ATOM 3765  H HA   . PHE A 1 59 ? 78.061  7.404   -11.946 1.00 0.00 ? 59 PHE A HA   3  
ATOM 3766  H HB2  . PHE A 1 59 ? 79.662  5.349   -13.463 1.00 0.00 ? 59 PHE A HB2  3  
ATOM 3767  H HB3  . PHE A 1 59 ? 79.540  6.980   -14.024 1.00 0.00 ? 59 PHE A HB3  3  
ATOM 3768  H HD1  . PHE A 1 59 ? 79.455  6.443   -10.371 1.00 0.00 ? 59 PHE A HD1  3  
ATOM 3769  H HD2  . PHE A 1 59 ? 81.982  7.238   -13.768 1.00 0.00 ? 59 PHE A HD2  3  
ATOM 3770  H HE1  . PHE A 1 59 ? 81.276  7.129   -8.861  1.00 0.00 ? 59 PHE A HE1  3  
ATOM 3771  H HE2  . PHE A 1 59 ? 83.804  7.921   -12.234 1.00 0.00 ? 59 PHE A HE2  3  
ATOM 3772  H HZ   . PHE A 1 59 ? 83.450  7.868   -9.785  1.00 0.00 ? 59 PHE A HZ   3  
ATOM 3773  N N    . LEU A 1 60 ? 76.786  5.463   -14.307 1.00 0.00 ? 60 LEU A N    3  
ATOM 3774  C CA   . LEU A 1 60 ? 75.789  5.429   -15.377 1.00 0.00 ? 60 LEU A CA   3  
ATOM 3775  C C    . LEU A 1 60 ? 74.391  5.215   -14.797 1.00 0.00 ? 60 LEU A C    3  
ATOM 3776  O O    . LEU A 1 60 ? 73.505  4.691   -15.471 1.00 0.00 ? 60 LEU A O    3  
ATOM 3777  C CB   . LEU A 1 60 ? 76.127  4.301   -16.367 1.00 0.00 ? 60 LEU A CB   3  
ATOM 3778  C CG   . LEU A 1 60 ? 77.232  4.750   -17.344 1.00 0.00 ? 60 LEU A CG   3  
ATOM 3779  C CD1  . LEU A 1 60 ? 76.687  5.779   -18.357 1.00 0.00 ? 60 LEU A CD1  3  
ATOM 3780  C CD2  . LEU A 1 60 ? 78.397  5.366   -16.557 1.00 0.00 ? 60 LEU A CD2  3  
ATOM 3781  H H    . LEU A 1 60 ? 77.280  4.644   -14.081 1.00 0.00 ? 60 LEU A H    3  
ATOM 3782  H HA   . LEU A 1 60 ? 75.803  6.372   -15.900 1.00 0.00 ? 60 LEU A HA   3  
ATOM 3783  H HB2  . LEU A 1 60 ? 76.473  3.440   -15.814 1.00 0.00 ? 60 LEU A HB2  3  
ATOM 3784  H HB3  . LEU A 1 60 ? 75.242  4.030   -16.925 1.00 0.00 ? 60 LEU A HB3  3  
ATOM 3785  H HG   . LEU A 1 60 ? 77.589  3.886   -17.885 1.00 0.00 ? 60 LEU A HG   3  
ATOM 3786  H HD11 . LEU A 1 60 ? 77.265  5.719   -19.267 1.00 0.00 ? 60 LEU A HD11 3  
ATOM 3787  H HD12 . LEU A 1 60 ? 76.767  6.777   -17.951 1.00 0.00 ? 60 LEU A HD12 3  
ATOM 3788  H HD13 . LEU A 1 60 ? 75.652  5.566   -18.580 1.00 0.00 ? 60 LEU A HD13 3  
ATOM 3789  H HD21 . LEU A 1 60 ? 79.267  5.426   -17.192 1.00 0.00 ? 60 LEU A HD21 3  
ATOM 3790  H HD22 . LEU A 1 60 ? 78.619  4.748   -15.701 1.00 0.00 ? 60 LEU A HD22 3  
ATOM 3791  H HD23 . LEU A 1 60 ? 78.124  6.357   -16.226 1.00 0.00 ? 60 LEU A HD23 3  
ATOM 3792  N N    . GLU A 1 61 ? 74.202  5.628   -13.543 1.00 0.00 ? 61 GLU A N    3  
ATOM 3793  C CA   . GLU A 1 61 ? 72.905  5.484   -12.875 1.00 0.00 ? 61 GLU A CA   3  
ATOM 3794  C C    . GLU A 1 61 ? 72.595  6.726   -12.045 1.00 0.00 ? 61 GLU A C    3  
ATOM 3795  O O    . GLU A 1 61 ? 73.498  7.367   -11.508 1.00 0.00 ? 61 GLU A O    3  
ATOM 3796  C CB   . GLU A 1 61 ? 72.917  4.254   -11.961 1.00 0.00 ? 61 GLU A CB   3  
ATOM 3797  C CG   . GLU A 1 61 ? 72.904  2.979   -12.808 1.00 0.00 ? 61 GLU A CG   3  
ATOM 3798  C CD   . GLU A 1 61 ? 71.553  2.822   -13.498 1.00 0.00 ? 61 GLU A CD   3  
ATOM 3799  O OE1  . GLU A 1 61 ? 70.550  2.848   -12.806 1.00 0.00 ? 61 GLU A OE1  3  
ATOM 3800  O OE2  . GLU A 1 61 ? 71.542  2.680   -14.710 1.00 0.00 ? 61 GLU A OE2  3  
ATOM 3801  H H    . GLU A 1 61 ? 74.947  6.040   -13.058 1.00 0.00 ? 61 GLU A H    3  
ATOM 3802  H HA   . GLU A 1 61 ? 72.128  5.360   -13.616 1.00 0.00 ? 61 GLU A HA   3  
ATOM 3803  H HB2  . GLU A 1 61 ? 73.806  4.271   -11.350 1.00 0.00 ? 61 GLU A HB2  3  
ATOM 3804  H HB3  . GLU A 1 61 ? 72.044  4.270   -11.327 1.00 0.00 ? 61 GLU A HB3  3  
ATOM 3805  H HG2  . GLU A 1 61 ? 73.684  3.034   -13.553 1.00 0.00 ? 61 GLU A HG2  3  
ATOM 3806  H HG3  . GLU A 1 61 ? 73.079  2.125   -12.170 1.00 0.00 ? 61 GLU A HG3  3  
ATOM 3807  N N    . GLN A 1 62 ? 71.311  7.060   -11.945 1.00 0.00 ? 62 GLN A N    3  
ATOM 3808  C CA   . GLN A 1 62 ? 70.893  8.228   -11.178 1.00 0.00 ? 62 GLN A CA   3  
ATOM 3809  C C    . GLN A 1 62 ? 71.022  7.963   -9.681  1.00 0.00 ? 62 GLN A C    3  
ATOM 3810  O O    . GLN A 1 62 ? 70.782  6.849   -9.216  1.00 0.00 ? 62 GLN A O    3  
ATOM 3811  C CB   . GLN A 1 62 ? 69.442  8.580   -11.511 1.00 0.00 ? 62 GLN A CB   3  
ATOM 3812  C CG   . GLN A 1 62 ? 69.360  9.104   -12.947 1.00 0.00 ? 62 GLN A CG   3  
ATOM 3813  C CD   . GLN A 1 62 ? 70.014  10.479  -13.037 1.00 0.00 ? 62 GLN A CD   3  
ATOM 3814  O OE1  . GLN A 1 62 ? 69.457  11.466  -12.556 1.00 0.00 ? 62 GLN A OE1  3  
ATOM 3815  N NE2  . GLN A 1 62 ? 71.173  10.603  -13.626 1.00 0.00 ? 62 GLN A NE2  3  
ATOM 3816  H H    . GLN A 1 62 ? 70.636  6.512   -12.394 1.00 0.00 ? 62 GLN A H    3  
ATOM 3817  H HA   . GLN A 1 62 ? 71.523  9.064   -11.440 1.00 0.00 ? 62 GLN A HA   3  
ATOM 3818  H HB2  . GLN A 1 62 ? 68.827  7.696   -11.415 1.00 0.00 ? 62 GLN A HB2  3  
ATOM 3819  H HB3  . GLN A 1 62 ? 69.090  9.340   -10.832 1.00 0.00 ? 62 GLN A HB3  3  
ATOM 3820  H HG2  . GLN A 1 62 ? 69.871  8.420   -13.607 1.00 0.00 ? 62 GLN A HG2  3  
ATOM 3821  H HG3  . GLN A 1 62 ? 68.325  9.181   -13.241 1.00 0.00 ? 62 GLN A HG3  3  
ATOM 3822  H HE21 . GLN A 1 62 ? 71.616  9.816   -14.006 1.00 0.00 ? 62 GLN A HE21 3  
ATOM 3823  H HE22 . GLN A 1 62 ? 71.598  11.484  -13.688 1.00 0.00 ? 62 GLN A HE22 3  
ATOM 3824  N N    . ASN A 1 63 ? 71.404  8.995   -8.932  1.00 0.00 ? 63 ASN A N    3  
ATOM 3825  C CA   . ASN A 1 63 ? 71.562  8.866   -7.486  1.00 0.00 ? 63 ASN A CA   3  
ATOM 3826  C C    . ASN A 1 63 ? 72.253  7.552   -7.130  1.00 0.00 ? 63 ASN A C    3  
ATOM 3827  C CB   . ASN A 1 63 ? 70.195  8.926   -6.802  1.00 0.00 ? 63 ASN A CB   3  
ATOM 3828  C CG   . ASN A 1 63 ? 69.364  7.707   -7.185  1.00 0.00 ? 63 ASN A CG   3  
ATOM 3829  O OD1  . ASN A 1 63 ? 69.693  6.585   -6.802  1.00 0.00 ? 63 ASN A OD1  3  
ATOM 3830  N ND2  . ASN A 1 63 ? 68.298  7.860   -7.922  1.00 0.00 ? 63 ASN A ND2  3  
ATOM 3831  H H    . ASN A 1 63 ? 71.580  9.858   -9.360  1.00 0.00 ? 63 ASN A H    3  
ATOM 3832  H HA   . ASN A 1 63 ? 72.165  9.685   -7.128  1.00 0.00 ? 63 ASN A HA   3  
ATOM 3833  H HB2  . ASN A 1 63 ? 70.331  8.945   -5.730  1.00 0.00 ? 63 ASN A HB2  3  
ATOM 3834  H HB3  . ASN A 1 63 ? 69.678  9.823   -7.113  1.00 0.00 ? 63 ASN A HB3  3  
ATOM 3835  H HD21 . ASN A 1 63 ? 68.037  8.755   -8.227  1.00 0.00 ? 63 ASN A HD21 3  
ATOM 3836  H HD22 . ASN A 1 63 ? 67.758  7.082   -8.173  1.00 0.00 ? 63 ASN A HD22 3  
ATOM 3837  N N    . CYS B 2 1  ? 71.323  21.387  -14.808 1.00 0.00 ? 1  CYS B N    3  
ATOM 3838  C CA   . CYS B 2 1  ? 70.513  21.050  -13.605 1.00 0.00 ? 1  CYS B CA   3  
ATOM 3839  C C    . CYS B 2 1  ? 71.394  20.332  -12.587 1.00 0.00 ? 1  CYS B C    3  
ATOM 3840  O O    . CYS B 2 1  ? 71.190  20.454  -11.379 1.00 0.00 ? 1  CYS B O    3  
ATOM 3841  C CB   . CYS B 2 1  ? 69.347  20.148  -14.015 1.00 0.00 ? 1  CYS B CB   3  
ATOM 3842  S SG   . CYS B 2 1  ? 68.578  20.805  -15.517 1.00 0.00 ? 1  CYS B SG   3  
ATOM 3843  H HA   . CYS B 2 1  ? 70.127  21.958  -13.166 1.00 0.00 ? 1  CYS B HA   3  
ATOM 3844  H HB2  . CYS B 2 1  ? 69.712  19.149  -14.205 1.00 0.00 ? 1  CYS B HB2  3  
ATOM 3845  H HB3  . CYS B 2 1  ? 68.616  20.119  -13.220 1.00 0.00 ? 1  CYS B HB3  3  
ATOM 3846  N N    . SER B 2 2  ? 72.375  19.585  -13.084 1.00 0.00 ? 2  SER B N    3  
ATOM 3847  C CA   . SER B 2 2  ? 73.286  18.851  -12.211 1.00 0.00 ? 2  SER B CA   3  
ATOM 3848  C C    . SER B 2 2  ? 74.570  18.503  -12.956 1.00 0.00 ? 2  SER B C    3  
ATOM 3849  O O    . SER B 2 2  ? 75.656  18.503  -12.377 1.00 0.00 ? 2  SER B O    3  
ATOM 3850  C CB   . SER B 2 2  ? 72.615  17.570  -11.715 1.00 0.00 ? 2  SER B CB   3  
ATOM 3851  O OG   . SER B 2 2  ? 71.600  17.904  -10.778 1.00 0.00 ? 2  SER B OG   3  
ATOM 3852  H H    . SER B 2 2  ? 72.490  19.527  -14.055 1.00 0.00 ? 2  SER B H    3  
ATOM 3853  H HA   . SER B 2 2  ? 73.531  19.469  -11.360 1.00 0.00 ? 2  SER B HA   3  
ATOM 3854  H HB2  . SER B 2 2  ? 72.173  17.048  -12.547 1.00 0.00 ? 2  SER B HB2  3  
ATOM 3855  H HB3  . SER B 2 2  ? 73.357  16.935  -11.248 1.00 0.00 ? 2  SER B HB3  3  
ATOM 3856  H HG   . SER B 2 2  ? 70.848  18.245  -11.264 1.00 0.00 ? 2  SER B HG   3  
ATOM 3857  N N    . THR B 2 3  ? 74.436  18.214  -14.247 1.00 0.00 ? 3  THR B N    3  
ATOM 3858  C CA   . THR B 2 3  ? 75.589  17.872  -15.073 1.00 0.00 ? 3  THR B CA   3  
ATOM 3859  C C    . THR B 2 3  ? 76.492  16.868  -14.360 1.00 0.00 ? 3  THR B C    3  
ATOM 3860  O O    . THR B 2 3  ? 77.581  17.214  -13.905 1.00 0.00 ? 3  THR B O    3  
ATOM 3861  C CB   . THR B 2 3  ? 76.389  19.135  -15.398 1.00 0.00 ? 3  THR B CB   3  
ATOM 3862  O OG1  . THR B 2 3  ? 76.982  19.637  -14.208 1.00 0.00 ? 3  THR B OG1  3  
ATOM 3863  C CG2  . THR B 2 3  ? 75.457  20.193  -15.991 1.00 0.00 ? 3  THR B CG2  3  
ATOM 3864  H H    . THR B 2 3  ? 73.544  18.236  -14.653 1.00 0.00 ? 3  THR B H    3  
ATOM 3865  H HA   . THR B 2 3  ? 75.240  17.435  -15.995 1.00 0.00 ? 3  THR B HA   3  
ATOM 3866  H HB   . THR B 2 3  ? 77.160  18.899  -16.115 1.00 0.00 ? 3  THR B HB   3  
ATOM 3867  H HG1  . THR B 2 3  ? 77.509  18.935  -13.821 1.00 0.00 ? 3  THR B HG1  3  
ATOM 3868  H HG21 . THR B 2 3  ? 74.668  20.413  -15.286 1.00 0.00 ? 3  THR B HG21 3  
ATOM 3869  H HG22 . THR B 2 3  ? 75.026  19.820  -16.907 1.00 0.00 ? 3  THR B HG22 3  
ATOM 3870  H HG23 . THR B 2 3  ? 76.018  21.092  -16.196 1.00 0.00 ? 3  THR B HG23 3  
ATOM 3871  N N    . VAL B 2 4  ? 76.035  15.622  -14.274 1.00 0.00 ? 4  VAL B N    3  
ATOM 3872  C CA   . VAL B 2 4  ? 76.814  14.574  -13.622 1.00 0.00 ? 4  VAL B CA   3  
ATOM 3873  C C    . VAL B 2 4  ? 77.861  14.017  -14.581 1.00 0.00 ? 4  VAL B C    3  
ATOM 3874  O O    . VAL B 2 4  ? 79.012  13.800  -14.202 1.00 0.00 ? 4  VAL B O    3  
ATOM 3875  C CB   . VAL B 2 4  ? 75.892  13.445  -13.158 1.00 0.00 ? 4  VAL B CB   3  
ATOM 3876  C CG1  . VAL B 2 4  ? 74.850  14.003  -12.187 1.00 0.00 ? 4  VAL B CG1  3  
ATOM 3877  C CG2  . VAL B 2 4  ? 75.183  12.830  -14.370 1.00 0.00 ? 4  VAL B CG2  3  
ATOM 3878  H H    . VAL B 2 4  ? 75.160  15.402  -14.661 1.00 0.00 ? 4  VAL B H    3  
ATOM 3879  H HA   . VAL B 2 4  ? 77.315  14.991  -12.761 1.00 0.00 ? 4  VAL B HA   3  
ATOM 3880  H HB   . VAL B 2 4  ? 76.478  12.686  -12.658 1.00 0.00 ? 4  VAL B HB   3  
ATOM 3881  H HG11 . VAL B 2 4  ? 75.334  14.298  -11.269 1.00 0.00 ? 4  VAL B HG11 3  
ATOM 3882  H HG12 . VAL B 2 4  ? 74.110  13.244  -11.977 1.00 0.00 ? 4  VAL B HG12 3  
ATOM 3883  H HG13 . VAL B 2 4  ? 74.367  14.861  -12.631 1.00 0.00 ? 4  VAL B HG13 3  
ATOM 3884  H HG21 . VAL B 2 4  ? 74.823  13.618  -15.014 1.00 0.00 ? 4  VAL B HG21 3  
ATOM 3885  H HG22 . VAL B 2 4  ? 74.350  12.230  -14.034 1.00 0.00 ? 4  VAL B HG22 3  
ATOM 3886  H HG23 . VAL B 2 4  ? 75.878  12.208  -14.915 1.00 0.00 ? 4  VAL B HG23 3  
ATOM 3887  N N    . SER B 2 5  ? 77.452  13.787  -15.826 1.00 0.00 ? 5  SER B N    3  
ATOM 3888  C CA   . SER B 2 5  ? 78.354  13.253  -16.842 1.00 0.00 ? 5  SER B CA   3  
ATOM 3889  C C    . SER B 2 5  ? 79.763  13.848  -16.715 1.00 0.00 ? 5  SER B C    3  
ATOM 3890  O O    . SER B 2 5  ? 80.719  13.123  -16.438 1.00 0.00 ? 5  SER B O    3  
ATOM 3891  C CB   . SER B 2 5  ? 77.771  13.521  -18.239 1.00 0.00 ? 5  SER B CB   3  
ATOM 3892  O OG   . SER B 2 5  ? 77.111  12.349  -18.695 1.00 0.00 ? 5  SER B OG   3  
ATOM 3893  H H    . SER B 2 5  ? 76.520  13.977  -16.068 1.00 0.00 ? 5  SER B H    3  
ATOM 3894  H HA   . SER B 2 5  ? 78.422  12.187  -16.701 1.00 0.00 ? 5  SER B HA   3  
ATOM 3895  H HB2  . SER B 2 5  ? 77.058  14.325  -18.185 1.00 0.00 ? 5  SER B HB2  3  
ATOM 3896  H HB3  . SER B 2 5  ? 78.561  13.790  -18.932 1.00 0.00 ? 5  SER B HB3  3  
ATOM 3897  H HG   . SER B 2 5  ? 76.230  12.339  -18.316 1.00 0.00 ? 5  SER B HG   3  
ATOM 3898  N N    . PRO B 2 6  ? 79.917  15.136  -16.914 1.00 0.00 ? 6  PRO B N    3  
ATOM 3899  C CA   . PRO B 2 6  ? 81.253  15.807  -16.820 1.00 0.00 ? 6  PRO B CA   3  
ATOM 3900  C C    . PRO B 2 6  ? 81.892  15.638  -15.439 1.00 0.00 ? 6  PRO B C    3  
ATOM 3901  O O    . PRO B 2 6  ? 82.938  16.223  -15.156 1.00 0.00 ? 6  PRO B O    3  
ATOM 3902  C CB   . PRO B 2 6  ? 80.947  17.289  -17.131 1.00 0.00 ? 6  PRO B CB   3  
ATOM 3903  C CG   . PRO B 2 6  ? 79.478  17.444  -16.896 1.00 0.00 ? 6  PRO B CG   3  
ATOM 3904  C CD   . PRO B 2 6  ? 78.853  16.098  -17.250 1.00 0.00 ? 6  PRO B CD   3  
ATOM 3905  H HA   . PRO B 2 6  ? 81.913  15.410  -17.576 1.00 0.00 ? 6  PRO B HA   3  
ATOM 3906  H HB2  . PRO B 2 6  ? 81.509  17.942  -16.474 1.00 0.00 ? 6  PRO B HB2  3  
ATOM 3907  H HB3  . PRO B 2 6  ? 81.180  17.512  -18.163 1.00 0.00 ? 6  PRO B HB3  3  
ATOM 3908  H HG2  . PRO B 2 6  ? 79.289  17.684  -15.857 1.00 0.00 ? 6  PRO B HG2  3  
ATOM 3909  H HG3  . PRO B 2 6  ? 79.071  18.214  -17.536 1.00 0.00 ? 6  PRO B HG3  3  
ATOM 3910  H HD2  . PRO B 2 6  ? 77.969  15.926  -16.654 1.00 0.00 ? 6  PRO B HD2  3  
ATOM 3911  H HD3  . PRO B 2 6  ? 78.623  16.048  -18.302 1.00 0.00 ? 6  PRO B HD3  3  
ATOM 3912  N N    . GLY B 2 7  ? 81.257  14.835  -14.583 1.00 0.00 ? 7  GLY B N    3  
ATOM 3913  C CA   . GLY B 2 7  ? 81.769  14.589  -13.230 1.00 0.00 ? 7  GLY B CA   3  
ATOM 3914  C C    . GLY B 2 7  ? 82.109  13.114  -13.030 1.00 0.00 ? 7  GLY B C    3  
ATOM 3915  O O    . GLY B 2 7  ? 83.274  12.753  -12.859 1.00 0.00 ? 7  GLY B O    3  
ATOM 3916  H H    . GLY B 2 7  ? 80.430  14.398  -14.865 1.00 0.00 ? 7  GLY B H    3  
ATOM 3917  H HA2  . GLY B 2 7  ? 82.660  15.181  -13.062 1.00 0.00 ? 7  GLY B HA2  3  
ATOM 3918  H HA3  . GLY B 2 7  ? 81.015  14.873  -12.512 1.00 0.00 ? 7  GLY B HA3  3  
ATOM 3919  N N    . VAL B 2 8  ? 81.090  12.263  -13.051 1.00 0.00 ? 8  VAL B N    3  
ATOM 3920  C CA   . VAL B 2 8  ? 81.307  10.834  -12.867 1.00 0.00 ? 8  VAL B CA   3  
ATOM 3921  C C    . VAL B 2 8  ? 82.220  10.292  -13.975 1.00 0.00 ? 8  VAL B C    3  
ATOM 3922  O O    . VAL B 2 8  ? 83.240  9.650   -13.704 1.00 0.00 ? 8  VAL B O    3  
ATOM 3923  C CB   . VAL B 2 8  ? 79.949  10.098  -12.867 1.00 0.00 ? 8  VAL B CB   3  
ATOM 3924  C CG1  . VAL B 2 8  ? 79.390  10.024  -11.439 1.00 0.00 ? 8  VAL B CG1  3  
ATOM 3925  C CG2  . VAL B 2 8  ? 78.948  10.852  -13.754 1.00 0.00 ? 8  VAL B CG2  3  
ATOM 3926  H H    . VAL B 2 8  ? 80.180  12.599  -13.190 1.00 0.00 ? 8  VAL B H    3  
ATOM 3927  H HA   . VAL B 2 8  ? 81.797  10.677  -11.915 1.00 0.00 ? 8  VAL B HA   3  
ATOM 3928  H HB   . VAL B 2 8  ? 80.078  9.098   -13.246 1.00 0.00 ? 8  VAL B HB   3  
ATOM 3929  H HG11 . VAL B 2 8  ? 78.368  9.675   -11.469 1.00 0.00 ? 8  VAL B HG11 3  
ATOM 3930  H HG12 . VAL B 2 8  ? 79.419  11.007  -10.990 1.00 0.00 ? 8  VAL B HG12 3  
ATOM 3931  H HG13 . VAL B 2 8  ? 79.987  9.343   -10.853 1.00 0.00 ? 8  VAL B HG13 3  
ATOM 3932  H HG21 . VAL B 2 8  ? 78.133  10.193  -14.014 1.00 0.00 ? 8  VAL B HG21 3  
ATOM 3933  H HG22 . VAL B 2 8  ? 79.441  11.184  -14.653 1.00 0.00 ? 8  VAL B HG22 3  
ATOM 3934  H HG23 . VAL B 2 8  ? 78.563  11.709  -13.220 1.00 0.00 ? 8  VAL B HG23 3  
ATOM 3935  N N    . LEU B 2 9  ? 81.864  10.572  -15.220 1.00 0.00 ? 9  LEU B N    3  
ATOM 3936  C CA   . LEU B 2 9  ? 82.677  10.121  -16.337 1.00 0.00 ? 9  LEU B CA   3  
ATOM 3937  C C    . LEU B 2 9  ? 84.091  10.676  -16.171 1.00 0.00 ? 9  LEU B C    3  
ATOM 3938  O O    . LEU B 2 9  ? 85.084  9.985   -16.435 1.00 0.00 ? 9  LEU B O    3  
ATOM 3939  C CB   . LEU B 2 9  ? 82.045  10.577  -17.655 1.00 0.00 ? 9  LEU B CB   3  
ATOM 3940  C CG   . LEU B 2 9  ? 80.566  10.151  -17.680 1.00 0.00 ? 9  LEU B CG   3  
ATOM 3941  C CD1  . LEU B 2 9  ? 79.886  10.689  -18.947 1.00 0.00 ? 9  LEU B CD1  3  
ATOM 3942  C CD2  . LEU B 2 9  ? 80.460  8.615   -17.644 1.00 0.00 ? 9  LEU B CD2  3  
ATOM 3943  H H    . LEU B 2 9  ? 81.057  11.100  -15.389 1.00 0.00 ? 9  LEU B H    3  
ATOM 3944  H HA   . LEU B 2 9  ? 82.725  9.042   -16.322 1.00 0.00 ? 9  LEU B HA   3  
ATOM 3945  H HB2  . LEU B 2 9  ? 82.112  11.652  -17.733 1.00 0.00 ? 9  LEU B HB2  3  
ATOM 3946  H HB3  . LEU B 2 9  ? 82.563  10.119  -18.484 1.00 0.00 ? 9  LEU B HB3  3  
ATOM 3947  H HG   . LEU B 2 9  ? 80.069  10.560  -16.815 1.00 0.00 ? 9  LEU B HG   3  
ATOM 3948  H HD11 . LEU B 2 9  ? 78.816  10.701  -18.803 1.00 0.00 ? 9  LEU B HD11 3  
ATOM 3949  H HD12 . LEU B 2 9  ? 80.126  10.052  -19.786 1.00 0.00 ? 9  LEU B HD12 3  
ATOM 3950  H HD13 . LEU B 2 9  ? 80.231  11.694  -19.146 1.00 0.00 ? 9  LEU B HD13 3  
ATOM 3951  H HD21 . LEU B 2 9  ? 81.250  8.181   -18.240 1.00 0.00 ? 9  LEU B HD21 3  
ATOM 3952  H HD22 . LEU B 2 9  ? 79.502  8.306   -18.038 1.00 0.00 ? 9  LEU B HD22 3  
ATOM 3953  H HD23 . LEU B 2 9  ? 80.549  8.271   -16.623 1.00 0.00 ? 9  LEU B HD23 3  
ATOM 3954  N N    . ALA B 2 10 ? 84.176  11.911  -15.672 1.00 0.00 ? 10 ALA B N    3  
ATOM 3955  C CA   . ALA B 2 10 ? 85.471  12.523  -15.415 1.00 0.00 ? 10 ALA B CA   3  
ATOM 3956  C C    . ALA B 2 10 ? 86.235  11.608  -14.457 1.00 0.00 ? 10 ALA B C    3  
ATOM 3957  O O    . ALA B 2 10 ? 87.464  11.458  -14.521 1.00 0.00 ? 10 ALA B O    3  
ATOM 3958  C CB   . ALA B 2 10 ? 85.284  13.914  -14.788 1.00 0.00 ? 10 ALA B CB   3  
ATOM 3959  H H    . ALA B 2 10 ? 83.357  12.398  -15.440 1.00 0.00 ? 10 ALA B H    3  
ATOM 3960  H HA   . ALA B 2 10 ? 86.010  12.625  -16.343 1.00 0.00 ? 10 ALA B HA   3  
ATOM 3961  H HB1  . ALA B 2 10 ? 84.404  14.379  -15.208 1.00 0.00 ? 10 ALA B HB1  3  
ATOM 3962  H HB2  . ALA B 2 10 ? 86.148  14.524  -15.002 1.00 0.00 ? 10 ALA B HB2  3  
ATOM 3963  H HB3  . ALA B 2 10 ? 85.165  13.823  -13.718 1.00 0.00 ? 10 ALA B HB3  3  
ATOM 3964  N N    . GLY B 2 11 ? 85.467  10.988  -13.566 1.00 0.00 ? 11 GLY B N    3  
ATOM 3965  C CA   . GLY B 2 11 ? 86.023  10.074  -12.584 1.00 0.00 ? 11 GLY B CA   3  
ATOM 3966  C C    . GLY B 2 11 ? 86.589  8.824   -13.248 1.00 0.00 ? 11 GLY B C    3  
ATOM 3967  O O    . GLY B 2 11 ? 87.610  8.297   -12.807 1.00 0.00 ? 11 GLY B O    3  
ATOM 3968  H H    . GLY B 2 11 ? 84.499  11.149  -13.575 1.00 0.00 ? 11 GLY B H    3  
ATOM 3969  H HA2  . GLY B 2 11 ? 86.811  10.575  -12.040 1.00 0.00 ? 11 GLY B HA2  3  
ATOM 3970  H HA3  . GLY B 2 11 ? 85.246  9.783   -11.893 1.00 0.00 ? 11 GLY B HA3  3  
ATOM 3971  N N    . ILE B 2 12 ? 85.937  8.342   -14.309 1.00 0.00 ? 12 ILE B N    3  
ATOM 3972  C CA   . ILE B 2 12 ? 86.438  7.154   -14.977 1.00 0.00 ? 12 ILE B CA   3  
ATOM 3973  C C    . ILE B 2 12 ? 87.795  7.461   -15.608 1.00 0.00 ? 12 ILE B C    3  
ATOM 3974  O O    . ILE B 2 12 ? 88.716  6.649   -15.521 1.00 0.00 ? 12 ILE B O    3  
ATOM 3975  C CB   . ILE B 2 12 ? 85.406  6.642   -16.009 1.00 0.00 ? 12 ILE B CB   3  
ATOM 3976  C CG1  . ILE B 2 12 ? 84.382  5.756   -15.278 1.00 0.00 ? 12 ILE B CG1  3  
ATOM 3977  C CG2  . ILE B 2 12 ? 86.099  5.819   -17.108 1.00 0.00 ? 12 ILE B CG2  3  
ATOM 3978  C CD1  . ILE B 2 12 ? 83.197  5.438   -16.190 1.00 0.00 ? 12 ILE B CD1  3  
ATOM 3979  H H    . ILE B 2 12 ? 85.123  8.789   -14.645 1.00 0.00 ? 12 ILE B H    3  
ATOM 3980  H HA   . ILE B 2 12 ? 86.592  6.389   -14.228 1.00 0.00 ? 12 ILE B HA   3  
ATOM 3981  H HB   . ILE B 2 12 ? 84.899  7.484   -16.457 1.00 0.00 ? 12 ILE B HB   3  
ATOM 3982  H HG12 . ILE B 2 12 ? 84.861  4.835   -14.986 1.00 0.00 ? 12 ILE B HG12 3  
ATOM 3983  H HG13 . ILE B 2 12 ? 84.027  6.271   -14.397 1.00 0.00 ? 12 ILE B HG13 3  
ATOM 3984  H HG21 . ILE B 2 12 ? 86.511  6.486   -17.851 1.00 0.00 ? 12 ILE B HG21 3  
ATOM 3985  H HG22 . ILE B 2 12 ? 85.382  5.161   -17.577 1.00 0.00 ? 12 ILE B HG22 3  
ATOM 3986  H HG23 . ILE B 2 12 ? 86.893  5.231   -16.673 1.00 0.00 ? 12 ILE B HG23 3  
ATOM 3987  H HD11 . ILE B 2 12 ? 82.413  4.969   -15.607 1.00 0.00 ? 12 ILE B HD11 3  
ATOM 3988  H HD12 . ILE B 2 12 ? 83.515  4.762   -16.969 1.00 0.00 ? 12 ILE B HD12 3  
ATOM 3989  H HD13 . ILE B 2 12 ? 82.822  6.350   -16.630 1.00 0.00 ? 12 ILE B HD13 3  
ATOM 3990  N N    . VAL B 2 13 ? 87.932  8.637   -16.216 1.00 0.00 ? 13 VAL B N    3  
ATOM 3991  C CA   . VAL B 2 13 ? 89.221  9.003   -16.811 1.00 0.00 ? 13 VAL B CA   3  
ATOM 3992  C C    . VAL B 2 13 ? 90.296  8.956   -15.725 1.00 0.00 ? 13 VAL B C    3  
ATOM 3993  O O    . VAL B 2 13 ? 91.385  8.427   -15.944 1.00 0.00 ? 13 VAL B O    3  
ATOM 3994  C CB   . VAL B 2 13 ? 89.169  10.402  -17.509 1.00 0.00 ? 13 VAL B CB   3  
ATOM 3995  C CG1  . VAL B 2 13 ? 87.722  10.823  -17.696 1.00 0.00 ? 13 VAL B CG1  3  
ATOM 3996  C CG2  . VAL B 2 13 ? 89.885  11.493  -16.692 1.00 0.00 ? 13 VAL B CG2  3  
ATOM 3997  H H    . VAL B 2 13 ? 87.175  9.262   -16.247 1.00 0.00 ? 13 VAL B H    3  
ATOM 3998  H HA   . VAL B 2 13 ? 89.465  8.254   -17.553 1.00 0.00 ? 13 VAL B HA   3  
ATOM 3999  H HB   . VAL B 2 13 ? 89.637  10.329  -18.484 1.00 0.00 ? 13 VAL B HB   3  
ATOM 4000  H HG11 . VAL B 2 13 ? 87.239  10.849  -16.743 1.00 0.00 ? 13 VAL B HG11 3  
ATOM 4001  H HG12 . VAL B 2 13 ? 87.226  10.112  -18.327 1.00 0.00 ? 13 VAL B HG12 3  
ATOM 4002  H HG13 . VAL B 2 13 ? 87.682  11.803  -18.146 1.00 0.00 ? 13 VAL B HG13 3  
ATOM 4003  H HG21 . VAL B 2 13 ? 89.729  12.453  -17.165 1.00 0.00 ? 13 VAL B HG21 3  
ATOM 4004  H HG22 . VAL B 2 13 ? 90.944  11.284  -16.655 1.00 0.00 ? 13 VAL B HG22 3  
ATOM 4005  H HG23 . VAL B 2 13 ? 89.486  11.521  -15.692 1.00 0.00 ? 13 VAL B HG23 3  
ATOM 4006  N N    . VAL B 2 14 ? 89.983  9.502   -14.549 1.00 0.00 ? 14 VAL B N    3  
ATOM 4007  C CA   . VAL B 2 14 ? 90.949  9.490   -13.454 1.00 0.00 ? 14 VAL B CA   3  
ATOM 4008  C C    . VAL B 2 14 ? 91.416  8.057   -13.195 1.00 0.00 ? 14 VAL B C    3  
ATOM 4009  O O    . VAL B 2 14 ? 92.618  7.786   -13.143 1.00 0.00 ? 14 VAL B O    3  
ATOM 4010  C CB   . VAL B 2 14 ? 90.327  10.073  -12.181 1.00 0.00 ? 14 VAL B CB   3  
ATOM 4011  C CG1  . VAL B 2 14 ? 91.306  9.915   -11.015 1.00 0.00 ? 14 VAL B CG1  3  
ATOM 4012  C CG2  . VAL B 2 14 ? 90.031  11.560  -12.390 1.00 0.00 ? 14 VAL B CG2  3  
ATOM 4013  H H    . VAL B 2 14 ? 89.094  9.912   -14.417 1.00 0.00 ? 14 VAL B H    3  
ATOM 4014  H HA   . VAL B 2 14 ? 91.802  10.090  -13.735 1.00 0.00 ? 14 VAL B HA   3  
ATOM 4015  H HB   . VAL B 2 14 ? 89.411  9.548   -11.954 1.00 0.00 ? 14 VAL B HB   3  
ATOM 4016  H HG11 . VAL B 2 14 ? 90.976  10.518  -10.182 1.00 0.00 ? 14 VAL B HG11 3  
ATOM 4017  H HG12 . VAL B 2 14 ? 92.289  10.237  -11.325 1.00 0.00 ? 14 VAL B HG12 3  
ATOM 4018  H HG13 . VAL B 2 14 ? 91.345  8.877   -10.715 1.00 0.00 ? 14 VAL B HG13 3  
ATOM 4019  H HG21 . VAL B 2 14 ? 89.439  11.928  -11.565 1.00 0.00 ? 14 VAL B HG21 3  
ATOM 4020  H HG22 . VAL B 2 14 ? 89.485  11.692  -13.312 1.00 0.00 ? 14 VAL B HG22 3  
ATOM 4021  H HG23 . VAL B 2 14 ? 90.959  12.108  -12.439 1.00 0.00 ? 14 VAL B HG23 3  
ATOM 4022  N N    . GLY B 2 15 ? 90.453  7.146   -13.054 1.00 0.00 ? 15 GLY B N    3  
ATOM 4023  C CA   . GLY B 2 15 ? 90.762  5.736   -12.818 1.00 0.00 ? 15 GLY B CA   3  
ATOM 4024  C C    . GLY B 2 15 ? 91.624  5.178   -13.948 1.00 0.00 ? 15 GLY B C    3  
ATOM 4025  O O    . GLY B 2 15 ? 92.457  4.295   -13.735 1.00 0.00 ? 15 GLY B O    3  
ATOM 4026  H H    . GLY B 2 15 ? 89.515  7.425   -13.119 1.00 0.00 ? 15 GLY B H    3  
ATOM 4027  H HA2  . GLY B 2 15 ? 91.285  5.632   -11.875 1.00 0.00 ? 15 GLY B HA2  3  
ATOM 4028  H HA3  . GLY B 2 15 ? 89.840  5.176   -12.772 1.00 0.00 ? 15 GLY B HA3  3  
ATOM 4029  N N    . ASP B 2 16 ? 91.419  5.701   -15.153 1.00 0.00 ? 16 ASP B N    3  
ATOM 4030  C CA   . ASP B 2 16 ? 92.182  5.251   -16.310 1.00 0.00 ? 16 ASP B CA   3  
ATOM 4031  C C    . ASP B 2 16 ? 93.640  5.690   -16.203 1.00 0.00 ? 16 ASP B C    3  
ATOM 4032  O O    . ASP B 2 16 ? 94.552  4.930   -16.528 1.00 0.00 ? 16 ASP B O    3  
ATOM 4033  C CB   . ASP B 2 16 ? 91.568  5.821   -17.591 1.00 0.00 ? 16 ASP B CB   3  
ATOM 4034  C CG   . ASP B 2 16 ? 92.121  5.087   -18.808 1.00 0.00 ? 16 ASP B CG   3  
ATOM 4035  O OD1  . ASP B 2 16 ? 92.433  3.915   -18.676 1.00 0.00 ? 16 ASP B OD1  3  
ATOM 4036  O OD2  . ASP B 2 16 ? 92.222  5.706   -19.853 1.00 0.00 ? 16 ASP B OD2  3  
ATOM 4037  H H    . ASP B 2 16 ? 90.744  6.403   -15.264 1.00 0.00 ? 16 ASP B H    3  
ATOM 4038  H HA   . ASP B 2 16 ? 92.143  4.173   -16.355 1.00 0.00 ? 16 ASP B HA   3  
ATOM 4039  H HB2  . ASP B 2 16 ? 90.494  5.701   -17.557 1.00 0.00 ? 16 ASP B HB2  3  
ATOM 4040  H HB3  . ASP B 2 16 ? 91.809  6.870   -17.667 1.00 0.00 ? 16 ASP B HB3  3  
ATOM 4041  N N    . LEU B 2 17 ? 93.853  6.921   -15.747 1.00 0.00 ? 17 LEU B N    3  
ATOM 4042  C CA   . LEU B 2 17 ? 95.205  7.450   -15.603 1.00 0.00 ? 17 LEU B CA   3  
ATOM 4043  C C    . LEU B 2 17 ? 96.002  6.610   -14.608 1.00 0.00 ? 17 LEU B C    3  
ATOM 4044  O O    . LEU B 2 17 ? 97.105  6.144   -14.909 1.00 0.00 ? 17 LEU B O    3  
ATOM 4045  C CB   . LEU B 2 17 ? 95.136  8.907   -15.122 1.00 0.00 ? 17 LEU B CB   3  
ATOM 4046  C CG   . LEU B 2 17 ? 96.536  9.430   -14.770 1.00 0.00 ? 17 LEU B CG   3  
ATOM 4047  C CD1  . LEU B 2 17 ? 97.500  9.180   -15.936 1.00 0.00 ? 17 LEU B CD1  3  
ATOM 4048  C CD2  . LEU B 2 17 ? 96.449  10.935  -14.495 1.00 0.00 ? 17 LEU B CD2  3  
ATOM 4049  H H    . LEU B 2 17 ? 93.088  7.483   -15.504 1.00 0.00 ? 17 LEU B H    3  
ATOM 4050  H HA   . LEU B 2 17 ? 95.695  7.419   -16.564 1.00 0.00 ? 17 LEU B HA   3  
ATOM 4051  H HB2  . LEU B 2 17 ? 94.713  9.520   -15.905 1.00 0.00 ? 17 LEU B HB2  3  
ATOM 4052  H HB3  . LEU B 2 17 ? 94.506  8.962   -14.247 1.00 0.00 ? 17 LEU B HB3  3  
ATOM 4053  H HG   . LEU B 2 17 ? 96.900  8.925   -13.887 1.00 0.00 ? 17 LEU B HG   3  
ATOM 4054  H HD11 . LEU B 2 17 ? 98.366  9.821   -15.834 1.00 0.00 ? 17 LEU B HD11 3  
ATOM 4055  H HD12 . LEU B 2 17 ? 97.002  9.394   -16.870 1.00 0.00 ? 17 LEU B HD12 3  
ATOM 4056  H HD13 . LEU B 2 17 ? 97.817  8.148   -15.925 1.00 0.00 ? 17 LEU B HD13 3  
ATOM 4057  H HD21 . LEU B 2 17 ? 95.886  11.103  -13.588 1.00 0.00 ? 17 LEU B HD21 3  
ATOM 4058  H HD22 . LEU B 2 17 ? 95.956  11.425  -15.321 1.00 0.00 ? 17 LEU B HD22 3  
ATOM 4059  H HD23 . LEU B 2 17 ? 97.445  11.337  -14.380 1.00 0.00 ? 17 LEU B HD23 3  
ATOM 4060  N N    . VAL B 2 18 ? 95.434  6.416   -13.423 1.00 0.00 ? 18 VAL B N    3  
ATOM 4061  C CA   . VAL B 2 18 ? 96.100  5.625   -12.392 1.00 0.00 ? 18 VAL B CA   3  
ATOM 4062  C C    . VAL B 2 18 ? 96.378  4.215   -12.909 1.00 0.00 ? 18 VAL B C    3  
ATOM 4063  O O    . VAL B 2 18 ? 97.438  3.649   -12.637 1.00 0.00 ? 18 VAL B O    3  
ATOM 4064  C CB   . VAL B 2 18 ? 95.237  5.577   -11.123 1.00 0.00 ? 18 VAL B CB   3  
ATOM 4065  C CG1  . VAL B 2 18 ? 93.818  5.180   -11.484 1.00 0.00 ? 18 VAL B CG1  3  
ATOM 4066  C CG2  . VAL B 2 18 ? 95.784  4.549   -10.137 1.00 0.00 ? 18 VAL B CG2  3  
ATOM 4067  H H    . VAL B 2 18 ? 94.551  6.809   -13.240 1.00 0.00 ? 18 VAL B H    3  
ATOM 4068  H HA   . VAL B 2 18 ? 97.041  6.097   -12.152 1.00 0.00 ? 18 VAL B HA   3  
ATOM 4069  H HB   . VAL B 2 18 ? 95.229  6.552   -10.660 1.00 0.00 ? 18 VAL B HB   3  
ATOM 4070  H HG11 . VAL B 2 18 ? 93.806  4.156   -11.824 1.00 0.00 ? 18 VAL B HG11 3  
ATOM 4071  H HG12 . VAL B 2 18 ? 93.464  5.823   -12.262 1.00 0.00 ? 18 VAL B HG12 3  
ATOM 4072  H HG13 . VAL B 2 18 ? 93.187  5.279   -10.613 1.00 0.00 ? 18 VAL B HG13 3  
ATOM 4073  H HG21 . VAL B 2 18 ? 95.285  4.674   -9.188  1.00 0.00 ? 18 VAL B HG21 3  
ATOM 4074  H HG22 . VAL B 2 18 ? 96.846  4.696   -10.012 1.00 0.00 ? 18 VAL B HG22 3  
ATOM 4075  H HG23 . VAL B 2 18 ? 95.594  3.555   -10.513 1.00 0.00 ? 18 VAL B HG23 3  
ATOM 4076  N N    . LEU B 2 19 ? 95.436  3.651   -13.663 1.00 0.00 ? 19 LEU B N    3  
ATOM 4077  C CA   . LEU B 2 19 ? 95.633  2.310   -14.206 1.00 0.00 ? 19 LEU B CA   3  
ATOM 4078  C C    . LEU B 2 19 ? 96.859  2.301   -15.118 1.00 0.00 ? 19 LEU B C    3  
ATOM 4079  O O    . LEU B 2 19 ? 97.761  1.485   -14.952 1.00 0.00 ? 19 LEU B O    3  
ATOM 4080  C CB   . LEU B 2 19 ? 94.389  1.859   -15.011 1.00 0.00 ? 19 LEU B CB   3  
ATOM 4081  C CG   . LEU B 2 19 ? 93.427  1.030   -14.138 1.00 0.00 ? 19 LEU B CG   3  
ATOM 4082  C CD1  . LEU B 2 19 ? 92.035  1.028   -14.787 1.00 0.00 ? 19 LEU B CD1  3  
ATOM 4083  C CD2  . LEU B 2 19 ? 93.932  -0.423  -14.029 1.00 0.00 ? 19 LEU B CD2  3  
ATOM 4084  H H    . LEU B 2 19 ? 94.607  4.141   -13.862 1.00 0.00 ? 19 LEU B H    3  
ATOM 4085  H HA   . LEU B 2 19 ? 95.803  1.629   -13.388 1.00 0.00 ? 19 LEU B HA   3  
ATOM 4086  H HB2  . LEU B 2 19 ? 93.873  2.737   -15.372 1.00 0.00 ? 19 LEU B HB2  3  
ATOM 4087  H HB3  . LEU B 2 19 ? 94.694  1.260   -15.860 1.00 0.00 ? 19 LEU B HB3  3  
ATOM 4088  H HG   . LEU B 2 19 ? 93.366  1.469   -13.153 1.00 0.00 ? 19 LEU B HG   3  
ATOM 4089  H HD11 . LEU B 2 19 ? 91.344  0.487   -14.158 1.00 0.00 ? 19 LEU B HD11 3  
ATOM 4090  H HD12 . LEU B 2 19 ? 92.088  0.552   -15.760 1.00 0.00 ? 19 LEU B HD12 3  
ATOM 4091  H HD13 . LEU B 2 19 ? 91.691  2.045   -14.906 1.00 0.00 ? 19 LEU B HD13 3  
ATOM 4092  H HD21 . LEU B 2 19 ? 93.702  -0.951  -14.942 1.00 0.00 ? 19 LEU B HD21 3  
ATOM 4093  H HD22 . LEU B 2 19 ? 93.448  -0.915  -13.195 1.00 0.00 ? 19 LEU B HD22 3  
ATOM 4094  H HD23 . LEU B 2 19 ? 94.998  -0.431  -13.874 1.00 0.00 ? 19 LEU B HD23 3  
ATOM 4095  N N    . THR B 2 20 ? 96.877  3.217   -16.083 1.00 0.00 ? 20 THR B N    3  
ATOM 4096  C CA   . THR B 2 20 ? 97.990  3.300   -17.021 1.00 0.00 ? 20 THR B CA   3  
ATOM 4097  C C    . THR B 2 20 ? 99.318  3.277   -16.277 1.00 0.00 ? 20 THR B C    3  
ATOM 4098  O O    . THR B 2 20 ? 100.241 2.557   -16.657 1.00 0.00 ? 20 THR B O    3  
ATOM 4099  C CB   . THR B 2 20 ? 97.884  4.584   -17.850 1.00 0.00 ? 20 THR B CB   3  
ATOM 4100  O OG1  . THR B 2 20 ? 96.548  4.738   -18.310 1.00 0.00 ? 20 THR B OG1  3  
ATOM 4101  C CG2  . THR B 2 20 ? 98.831  4.499   -19.049 1.00 0.00 ? 20 THR B CG2  3  
ATOM 4102  H H    . THR B 2 20 ? 96.127  3.841   -16.169 1.00 0.00 ? 20 THR B H    3  
ATOM 4103  H HA   . THR B 2 20 ? 97.949  2.452   -17.688 1.00 0.00 ? 20 THR B HA   3  
ATOM 4104  H HB   . THR B 2 20 ? 98.156  5.430   -17.240 1.00 0.00 ? 20 THR B HB   3  
ATOM 4105  H HG1  . THR B 2 20 ? 96.212  5.571   -17.972 1.00 0.00 ? 20 THR B HG1  3  
ATOM 4106  H HG21 . THR B 2 20 ? 98.573  3.641   -19.651 1.00 0.00 ? 20 THR B HG21 3  
ATOM 4107  H HG22 . THR B 2 20 ? 99.847  4.400   -18.698 1.00 0.00 ? 20 THR B HG22 3  
ATOM 4108  H HG23 . THR B 2 20 ? 98.741  5.397   -19.643 1.00 0.00 ? 20 THR B HG23 3  
ATOM 4109  N N    . VAL B 2 21 ? 99.408  4.065   -15.213 1.00 0.00 ? 21 VAL B N    3  
ATOM 4110  C CA   . VAL B 2 21 ? 100.632 4.119   -14.423 1.00 0.00 ? 21 VAL B CA   3  
ATOM 4111  C C    . VAL B 2 21 ? 100.896 2.776   -13.742 1.00 0.00 ? 21 VAL B C    3  
ATOM 4112  O O    . VAL B 2 21 ? 102.047 2.379   -13.556 1.00 0.00 ? 21 VAL B O    3  
ATOM 4113  C CB   . VAL B 2 21 ? 100.519 5.220   -13.365 1.00 0.00 ? 21 VAL B CB   3  
ATOM 4114  C CG1  . VAL B 2 21 ? 101.758 5.198   -12.467 1.00 0.00 ? 21 VAL B CG1  3  
ATOM 4115  C CG2  . VAL B 2 21 ? 100.415 6.581   -14.055 1.00 0.00 ? 21 VAL B CG2  3  
ATOM 4116  H H    . VAL B 2 21 ? 98.638  4.619   -14.953 1.00 0.00 ? 21 VAL B H    3  
ATOM 4117  H HA   . VAL B 2 21 ? 101.460 4.348   -15.077 1.00 0.00 ? 21 VAL B HA   3  
ATOM 4118  H HB   . VAL B 2 21 ? 99.637  5.050   -12.764 1.00 0.00 ? 21 VAL B HB   3  
ATOM 4119  H HG11 . VAL B 2 21 ? 102.644 5.114   -13.078 1.00 0.00 ? 21 VAL B HG11 3  
ATOM 4120  H HG12 . VAL B 2 21 ? 101.702 4.352   -11.796 1.00 0.00 ? 21 VAL B HG12 3  
ATOM 4121  H HG13 . VAL B 2 21 ? 101.802 6.110   -11.891 1.00 0.00 ? 21 VAL B HG13 3  
ATOM 4122  H HG21 . VAL B 2 21 ? 99.501  6.625   -14.629 1.00 0.00 ? 21 VAL B HG21 3  
ATOM 4123  H HG22 . VAL B 2 21 ? 101.260 6.717   -14.714 1.00 0.00 ? 21 VAL B HG22 3  
ATOM 4124  H HG23 . VAL B 2 21 ? 100.411 7.364   -13.310 1.00 0.00 ? 21 VAL B HG23 3  
ATOM 4125  N N    . LEU B 2 22 ? 99.824  2.088   -13.358 1.00 0.00 ? 22 LEU B N    3  
ATOM 4126  C CA   . LEU B 2 22 ? 99.954  0.800   -12.682 1.00 0.00 ? 22 LEU B CA   3  
ATOM 4127  C C    . LEU B 2 22 ? 100.506 -0.273  -13.622 1.00 0.00 ? 22 LEU B C    3  
ATOM 4128  O O    . LEU B 2 22 ? 101.500 -0.930  -13.308 1.00 0.00 ? 22 LEU B O    3  
ATOM 4129  C CB   . LEU B 2 22 ? 98.586  0.365   -12.148 1.00 0.00 ? 22 LEU B CB   3  
ATOM 4130  C CG   . LEU B 2 22 ? 98.750  -0.723  -11.072 1.00 0.00 ? 22 LEU B CG   3  
ATOM 4131  C CD1  . LEU B 2 22 ? 99.404  -0.142  -9.799  1.00 0.00 ? 22 LEU B CD1  3  
ATOM 4132  C CD2  . LEU B 2 22 ? 97.367  -1.295  -10.732 1.00 0.00 ? 22 LEU B CD2  3  
ATOM 4133  H H    . LEU B 2 22 ? 98.931  2.457   -13.523 1.00 0.00 ? 22 LEU B H    3  
ATOM 4134  H HA   . LEU B 2 22 ? 100.630 0.915   -11.852 1.00 0.00 ? 22 LEU B HA   3  
ATOM 4135  H HB2  . LEU B 2 22 ? 98.079  1.219   -11.724 1.00 0.00 ? 22 LEU B HB2  3  
ATOM 4136  H HB3  . LEU B 2 22 ? 97.995  -0.029  -12.962 1.00 0.00 ? 22 LEU B HB3  3  
ATOM 4137  H HG   . LEU B 2 22 ? 99.376  -1.512  -11.462 1.00 0.00 ? 22 LEU B HG   3  
ATOM 4138  H HD11 . LEU B 2 22 ? 99.145  0.902   -9.692  1.00 0.00 ? 22 LEU B HD11 3  
ATOM 4139  H HD12 . LEU B 2 22 ? 100.476 -0.240  -9.870  1.00 0.00 ? 22 LEU B HD12 3  
ATOM 4140  H HD13 . LEU B 2 22 ? 99.060  -0.686  -8.929  1.00 0.00 ? 22 LEU B HD13 3  
ATOM 4141  H HD21 . LEU B 2 22 ? 97.051  -1.965  -11.519 1.00 0.00 ? 22 LEU B HD21 3  
ATOM 4142  H HD22 . LEU B 2 22 ? 96.653  -0.489  -10.639 1.00 0.00 ? 22 LEU B HD22 3  
ATOM 4143  H HD23 . LEU B 2 22 ? 97.419  -1.837  -9.799  1.00 0.00 ? 22 LEU B HD23 3  
ATOM 4144  N N    . ILE B 2 23 ? 99.864  -0.452  -14.774 1.00 0.00 ? 23 ILE B N    3  
ATOM 4145  C CA   . ILE B 2 23 ? 100.319 -1.454  -15.731 1.00 0.00 ? 23 ILE B CA   3  
ATOM 4146  C C    . ILE B 2 23 ? 101.739 -1.133  -16.184 1.00 0.00 ? 23 ILE B C    3  
ATOM 4147  O O    . ILE B 2 23 ? 102.606 -2.006  -16.204 1.00 0.00 ? 23 ILE B O    3  
ATOM 4148  C CB   . ILE B 2 23 ? 99.389  -1.499  -16.947 1.00 0.00 ? 23 ILE B CB   3  
ATOM 4149  C CG1  . ILE B 2 23 ? 97.924  -1.515  -16.491 1.00 0.00 ? 23 ILE B CG1  3  
ATOM 4150  C CG2  . ILE B 2 23 ? 99.678  -2.762  -17.763 1.00 0.00 ? 23 ILE B CG2  3  
ATOM 4151  C CD1  . ILE B 2 23 ? 97.701  -2.626  -15.459 1.00 0.00 ? 23 ILE B CD1  3  
ATOM 4152  H H    . ILE B 2 23 ? 99.077  0.092   -14.980 1.00 0.00 ? 23 ILE B H    3  
ATOM 4153  H HA   . ILE B 2 23 ? 100.318 -2.421  -15.251 1.00 0.00 ? 23 ILE B HA   3  
ATOM 4154  H HB   . ILE B 2 23 ? 99.565  -0.629  -17.563 1.00 0.00 ? 23 ILE B HB   3  
ATOM 4155  H HG12 . ILE B 2 23 ? 97.677  -0.564  -16.050 1.00 0.00 ? 23 ILE B HG12 3  
ATOM 4156  H HG13 . ILE B 2 23 ? 97.286  -1.690  -17.344 1.00 0.00 ? 23 ILE B HG13 3  
ATOM 4157  H HG21 . ILE B 2 23 ? 99.621  -3.628  -17.121 1.00 0.00 ? 23 ILE B HG21 3  
ATOM 4158  H HG22 . ILE B 2 23 ? 100.668 -2.697  -18.191 1.00 0.00 ? 23 ILE B HG22 3  
ATOM 4159  H HG23 . ILE B 2 23 ? 98.949  -2.853  -18.553 1.00 0.00 ? 23 ILE B HG23 3  
ATOM 4160  H HD11 . ILE B 2 23 ? 98.114  -2.323  -14.508 1.00 0.00 ? 23 ILE B HD11 3  
ATOM 4161  H HD12 . ILE B 2 23 ? 98.184  -3.531  -15.791 1.00 0.00 ? 23 ILE B HD12 3  
ATOM 4162  H HD13 . ILE B 2 23 ? 96.642  -2.804  -15.349 1.00 0.00 ? 23 ILE B HD13 3  
ATOM 4163  N N    . ALA B 2 24 ? 101.975 0.128   -16.537 1.00 0.00 ? 24 ALA B N    3  
ATOM 4164  C CA   . ALA B 2 24 ? 103.301 0.547   -16.974 1.00 0.00 ? 24 ALA B CA   3  
ATOM 4165  C C    . ALA B 2 24 ? 104.339 0.145   -15.934 1.00 0.00 ? 24 ALA B C    3  
ATOM 4166  O O    . ALA B 2 24 ? 105.398 -0.392  -16.267 1.00 0.00 ? 24 ALA B O    3  
ATOM 4167  C CB   . ALA B 2 24 ? 103.332 2.064   -17.174 1.00 0.00 ? 24 ALA B CB   3  
ATOM 4168  H H    . ALA B 2 24 ? 101.249 0.785   -16.494 1.00 0.00 ? 24 ALA B H    3  
ATOM 4169  H HA   . ALA B 2 24 ? 103.534 0.064   -17.910 1.00 0.00 ? 24 ALA B HA   3  
ATOM 4170  H HB1  . ALA B 2 24 ? 104.305 2.360   -17.536 1.00 0.00 ? 24 ALA B HB1  3  
ATOM 4171  H HB2  . ALA B 2 24 ? 103.133 2.556   -16.233 1.00 0.00 ? 24 ALA B HB2  3  
ATOM 4172  H HB3  . ALA B 2 24 ? 102.580 2.347   -17.895 1.00 0.00 ? 24 ALA B HB3  3  
ATOM 4173  N N    . LEU B 2 25 ? 104.023 0.394   -14.668 1.00 0.00 ? 25 LEU B N    3  
ATOM 4174  C CA   . LEU B 2 25 ? 104.930 0.037   -13.588 1.00 0.00 ? 25 LEU B CA   3  
ATOM 4175  C C    . LEU B 2 25 ? 105.191 -1.464  -13.625 1.00 0.00 ? 25 LEU B C    3  
ATOM 4176  O O    . LEU B 2 25 ? 106.311 -1.919  -13.393 1.00 0.00 ? 25 LEU B O    3  
ATOM 4177  C CB   . LEU B 2 25 ? 104.320 0.437   -12.238 1.00 0.00 ? 25 LEU B CB   3  
ATOM 4178  C CG   . LEU B 2 25 ? 105.189 -0.070  -11.079 1.00 0.00 ? 25 LEU B CG   3  
ATOM 4179  C CD1  . LEU B 2 25 ? 106.637 0.410   -11.254 1.00 0.00 ? 25 LEU B CD1  3  
ATOM 4180  C CD2  . LEU B 2 25 ? 104.627 0.471   -9.761  1.00 0.00 ? 25 LEU B CD2  3  
ATOM 4181  H H    . LEU B 2 25 ? 103.162 0.815   -14.458 1.00 0.00 ? 25 LEU B H    3  
ATOM 4182  H HA   . LEU B 2 25 ? 105.862 0.563   -13.727 1.00 0.00 ? 25 LEU B HA   3  
ATOM 4183  H HB2  . LEU B 2 25 ? 104.247 1.514   -12.186 1.00 0.00 ? 25 LEU B HB2  3  
ATOM 4184  H HB3  . LEU B 2 25 ? 103.331 0.010   -12.155 1.00 0.00 ? 25 LEU B HB3  3  
ATOM 4185  H HG   . LEU B 2 25 ? 105.169 -1.150  -11.058 1.00 0.00 ? 25 LEU B HG   3  
ATOM 4186  H HD11 . LEU B 2 25 ? 107.150 0.373   -10.302 1.00 0.00 ? 25 LEU B HD11 3  
ATOM 4187  H HD12 . LEU B 2 25 ? 106.641 1.424   -11.623 1.00 0.00 ? 25 LEU B HD12 3  
ATOM 4188  H HD13 . LEU B 2 25 ? 107.146 -0.233  -11.957 1.00 0.00 ? 25 LEU B HD13 3  
ATOM 4189  H HD21 . LEU B 2 25 ? 105.148 0.015   -8.933  1.00 0.00 ? 25 LEU B HD21 3  
ATOM 4190  H HD22 . LEU B 2 25 ? 103.574 0.239   -9.696  1.00 0.00 ? 25 LEU B HD22 3  
ATOM 4191  H HD23 . LEU B 2 25 ? 104.762 1.542   -9.725  1.00 0.00 ? 25 LEU B HD23 3  
ATOM 4192  N N    . ALA B 2 26 ? 104.143 -2.228  -13.928 1.00 0.00 ? 26 ALA B N    3  
ATOM 4193  C CA   . ALA B 2 26 ? 104.265 -3.678  -14.005 1.00 0.00 ? 26 ALA B CA   3  
ATOM 4194  C C    . ALA B 2 26 ? 105.229 -4.070  -15.123 1.00 0.00 ? 26 ALA B C    3  
ATOM 4195  O O    . ALA B 2 26 ? 106.008 -5.011  -14.980 1.00 0.00 ? 26 ALA B O    3  
ATOM 4196  C CB   . ALA B 2 26 ? 102.894 -4.308  -14.262 1.00 0.00 ? 26 ALA B CB   3  
ATOM 4197  H H    . ALA B 2 26 ? 103.276 -1.805  -14.108 1.00 0.00 ? 26 ALA B H    3  
ATOM 4198  H HA   . ALA B 2 26 ? 104.649 -4.047  -13.066 1.00 0.00 ? 26 ALA B HA   3  
ATOM 4199  H HB1  . ALA B 2 26 ? 102.155 -3.828  -13.638 1.00 0.00 ? 26 ALA B HB1  3  
ATOM 4200  H HB2  . ALA B 2 26 ? 102.933 -5.361  -14.027 1.00 0.00 ? 26 ALA B HB2  3  
ATOM 4201  H HB3  . ALA B 2 26 ? 102.627 -4.180  -15.300 1.00 0.00 ? 26 ALA B HB3  3  
ATOM 4202  N N    . VAL B 2 27 ? 105.173 -3.338  -16.234 1.00 0.00 ? 27 VAL B N    3  
ATOM 4203  C CA   . VAL B 2 27 ? 106.052 -3.621  -17.362 1.00 0.00 ? 27 VAL B CA   3  
ATOM 4204  C C    . VAL B 2 27 ? 107.508 -3.465  -16.941 1.00 0.00 ? 27 VAL B C    3  
ATOM 4205  O O    . VAL B 2 27 ? 108.340 -4.331  -17.211 1.00 0.00 ? 27 VAL B O    3  
ATOM 4206  C CB   . VAL B 2 27 ? 105.751 -2.671  -18.525 1.00 0.00 ? 27 VAL B CB   3  
ATOM 4207  C CG1  . VAL B 2 27 ? 106.742 -2.923  -19.662 1.00 0.00 ? 27 VAL B CG1  3  
ATOM 4208  C CG2  . VAL B 2 27 ? 104.324 -2.912  -19.027 1.00 0.00 ? 27 VAL B CG2  3  
ATOM 4209  H H    . VAL B 2 27 ? 104.535 -2.596  -16.293 1.00 0.00 ? 27 VAL B H    3  
ATOM 4210  H HA   . VAL B 2 27 ? 105.889 -4.637  -17.689 1.00 0.00 ? 27 VAL B HA   3  
ATOM 4211  H HB   . VAL B 2 27 ? 105.847 -1.650  -18.188 1.00 0.00 ? 27 VAL B HB   3  
ATOM 4212  H HG11 . VAL B 2 27 ? 107.713 -2.542  -19.386 1.00 0.00 ? 27 VAL B HG11 3  
ATOM 4213  H HG12 . VAL B 2 27 ? 106.399 -2.423  -20.556 1.00 0.00 ? 27 VAL B HG12 3  
ATOM 4214  H HG13 . VAL B 2 27 ? 106.813 -3.985  -19.849 1.00 0.00 ? 27 VAL B HG13 3  
ATOM 4215  H HG21 . VAL B 2 27 ? 104.296 -3.824  -19.606 1.00 0.00 ? 27 VAL B HG21 3  
ATOM 4216  H HG22 . VAL B 2 27 ? 104.016 -2.084  -19.646 1.00 0.00 ? 27 VAL B HG22 3  
ATOM 4217  H HG23 . VAL B 2 27 ? 103.655 -3.000  -18.184 1.00 0.00 ? 27 VAL B HG23 3  
ATOM 4218  N N    . TYR B 2 28 ? 107.807 -2.357  -16.270 1.00 0.00 ? 28 TYR B N    3  
ATOM 4219  C CA   . TYR B 2 28 ? 109.167 -2.104  -15.808 1.00 0.00 ? 28 TYR B CA   3  
ATOM 4220  C C    . TYR B 2 28 ? 109.595 -3.188  -14.823 1.00 0.00 ? 28 TYR B C    3  
ATOM 4221  O O    . TYR B 2 28 ? 110.731 -3.663  -14.861 1.00 0.00 ? 28 TYR B O    3  
ATOM 4222  C CB   . TYR B 2 28 ? 109.247 -0.734  -15.131 1.00 0.00 ? 28 TYR B CB   3  
ATOM 4223  C CG   . TYR B 2 28 ? 110.693 -0.390  -14.863 1.00 0.00 ? 28 TYR B CG   3  
ATOM 4224  C CD1  . TYR B 2 28 ? 111.472 0.189   -15.872 1.00 0.00 ? 28 TYR B CD1  3  
ATOM 4225  C CD2  . TYR B 2 28 ? 111.253 -0.648  -13.607 1.00 0.00 ? 28 TYR B CD2  3  
ATOM 4226  C CE1  . TYR B 2 28 ? 112.813 0.508   -15.625 1.00 0.00 ? 28 TYR B CE1  3  
ATOM 4227  C CE2  . TYR B 2 28 ? 112.593 -0.328  -13.359 1.00 0.00 ? 28 TYR B CE2  3  
ATOM 4228  C CZ   . TYR B 2 28 ? 113.373 0.251   -14.368 1.00 0.00 ? 28 TYR B CZ   3  
ATOM 4229  O OH   . TYR B 2 28 ? 114.694 0.565   -14.124 1.00 0.00 ? 28 TYR B OH   3  
ATOM 4230  H H    . TYR B 2 28 ? 107.101 -1.701  -16.078 1.00 0.00 ? 28 TYR B H    3  
ATOM 4231  H HA   . TYR B 2 28 ? 109.835 -2.115  -16.656 1.00 0.00 ? 28 TYR B HA   3  
ATOM 4232  H HB2  . TYR B 2 28 ? 108.811 0.014   -15.778 1.00 0.00 ? 28 TYR B HB2  3  
ATOM 4233  H HB3  . TYR B 2 28 ? 108.705 -0.762  -14.198 1.00 0.00 ? 28 TYR B HB3  3  
ATOM 4234  H HD1  . TYR B 2 28 ? 111.040 0.389   -16.841 1.00 0.00 ? 28 TYR B HD1  3  
ATOM 4235  H HD2  . TYR B 2 28 ? 110.652 -1.095  -12.828 1.00 0.00 ? 28 TYR B HD2  3  
ATOM 4236  H HE1  . TYR B 2 28 ? 113.413 0.955   -16.402 1.00 0.00 ? 28 TYR B HE1  3  
ATOM 4237  H HE2  . TYR B 2 28 ? 113.026 -0.528  -12.389 1.00 0.00 ? 28 TYR B HE2  3  
ATOM 4238  H HH   . TYR B 2 28 ? 114.744 0.996   -13.267 1.00 0.00 ? 28 TYR B HH   3  
ATOM 4239  N N    . PHE B 2 29 ? 108.674 -3.575  -13.948 1.00 0.00 ? 29 PHE B N    3  
ATOM 4240  C CA   . PHE B 2 29 ? 108.952 -4.606  -12.956 1.00 0.00 ? 29 PHE B CA   3  
ATOM 4241  C C    . PHE B 2 29 ? 109.397 -5.898  -13.638 1.00 0.00 ? 29 PHE B C    3  
ATOM 4242  O O    . PHE B 2 29 ? 110.400 -6.500  -13.253 1.00 0.00 ? 29 PHE B O    3  
ATOM 4243  C CB   . PHE B 2 29 ? 107.691 -4.858  -12.119 1.00 0.00 ? 29 PHE B CB   3  
ATOM 4244  C CG   . PHE B 2 29 ? 107.881 -6.076  -11.240 1.00 0.00 ? 29 PHE B CG   3  
ATOM 4245  C CD1  . PHE B 2 29 ? 108.909 -6.100  -10.289 1.00 0.00 ? 29 PHE B CD1  3  
ATOM 4246  C CD2  . PHE B 2 29 ? 107.030 -7.184  -11.375 1.00 0.00 ? 29 PHE B CD2  3  
ATOM 4247  C CE1  . PHE B 2 29 ? 109.086 -7.226  -9.475  1.00 0.00 ? 29 PHE B CE1  3  
ATOM 4248  C CE2  . PHE B 2 29 ? 107.207 -8.308  -10.561 1.00 0.00 ? 29 PHE B CE2  3  
ATOM 4249  C CZ   . PHE B 2 29 ? 108.234 -8.329  -9.611  1.00 0.00 ? 29 PHE B CZ   3  
ATOM 4250  H H    . PHE B 2 29 ? 107.786 -3.160  -13.970 1.00 0.00 ? 29 PHE B H    3  
ATOM 4251  H HA   . PHE B 2 29 ? 109.741 -4.262  -12.303 1.00 0.00 ? 29 PHE B HA   3  
ATOM 4252  H HB2  . PHE B 2 29 ? 107.500 -3.995  -11.499 1.00 0.00 ? 29 PHE B HB2  3  
ATOM 4253  H HB3  . PHE B 2 29 ? 106.852 -5.016  -12.780 1.00 0.00 ? 29 PHE B HB3  3  
ATOM 4254  H HD1  . PHE B 2 29 ? 109.565 -5.250  -10.182 1.00 0.00 ? 29 PHE B HD1  3  
ATOM 4255  H HD2  . PHE B 2 29 ? 106.236 -7.168  -12.108 1.00 0.00 ? 29 PHE B HD2  3  
ATOM 4256  H HE1  . PHE B 2 29 ? 109.878 -7.243  -8.742  1.00 0.00 ? 29 PHE B HE1  3  
ATOM 4257  H HE2  . PHE B 2 29 ? 106.550 -9.159  -10.668 1.00 0.00 ? 29 PHE B HE2  3  
ATOM 4258  H HZ   . PHE B 2 29 ? 108.372 -9.197  -8.984  1.00 0.00 ? 29 PHE B HZ   3  
ATOM 4259  N N    . LEU B 2 30 ? 108.645 -6.319  -14.649 1.00 0.00 ? 30 LEU B N    3  
ATOM 4260  C CA   . LEU B 2 30 ? 108.972 -7.540  -15.375 1.00 0.00 ? 30 LEU B CA   3  
ATOM 4261  C C    . LEU B 2 30 ? 110.335 -7.409  -16.049 1.00 0.00 ? 30 LEU B C    3  
ATOM 4262  O O    . LEU B 2 30 ? 111.144 -8.335  -16.021 1.00 0.00 ? 30 LEU B O    3  
ATOM 4263  C CB   . LEU B 2 30 ? 107.888 -7.825  -16.424 1.00 0.00 ? 30 LEU B CB   3  
ATOM 4264  C CG   . LEU B 2 30 ? 108.285 -9.019  -17.305 1.00 0.00 ? 30 LEU B CG   3  
ATOM 4265  C CD1  . LEU B 2 30 ? 108.621 -10.235 -16.430 1.00 0.00 ? 30 LEU B CD1  3  
ATOM 4266  C CD2  . LEU B 2 30 ? 107.113 -9.365  -18.229 1.00 0.00 ? 30 LEU B CD2  3  
ATOM 4267  H H    . LEU B 2 30 ? 107.857 -5.799  -14.911 1.00 0.00 ? 30 LEU B H    3  
ATOM 4268  H HA   . LEU B 2 30 ? 109.005 -8.360  -14.673 1.00 0.00 ? 30 LEU B HA   3  
ATOM 4269  H HB2  . LEU B 2 30 ? 106.957 -8.046  -15.923 1.00 0.00 ? 30 LEU B HB2  3  
ATOM 4270  H HB3  . LEU B 2 30 ? 107.759 -6.952  -17.047 1.00 0.00 ? 30 LEU B HB3  3  
ATOM 4271  H HG   . LEU B 2 30 ? 109.146 -8.758  -17.903 1.00 0.00 ? 30 LEU B HG   3  
ATOM 4272  H HD11 . LEU B 2 30 ? 107.923 -10.294 -15.607 1.00 0.00 ? 30 LEU B HD11 3  
ATOM 4273  H HD12 . LEU B 2 30 ? 109.625 -10.135 -16.045 1.00 0.00 ? 30 LEU B HD12 3  
ATOM 4274  H HD13 . LEU B 2 30 ? 108.556 -11.137 -17.022 1.00 0.00 ? 30 LEU B HD13 3  
ATOM 4275  H HD21 . LEU B 2 30 ? 106.734 -8.461  -18.683 1.00 0.00 ? 30 LEU B HD21 3  
ATOM 4276  H HD22 . LEU B 2 30 ? 106.329 -9.836  -17.655 1.00 0.00 ? 30 LEU B HD22 3  
ATOM 4277  H HD23 . LEU B 2 30 ? 107.450 -10.040 -19.001 1.00 0.00 ? 30 LEU B HD23 3  
ATOM 4278  N N    . GLY B 2 31 ? 110.580 -6.252  -16.656 1.00 0.00 ? 31 GLY B N    3  
ATOM 4279  C CA   . GLY B 2 31 ? 111.849 -6.013  -17.334 1.00 0.00 ? 31 GLY B CA   3  
ATOM 4280  C C    . GLY B 2 31 ? 112.042 -6.992  -18.487 1.00 0.00 ? 31 GLY B C    3  
ATOM 4281  O O    . GLY B 2 31 ? 112.058 -8.206  -18.287 1.00 0.00 ? 31 GLY B O    3  
ATOM 4282  H H    . GLY B 2 31 ? 109.899 -5.548  -16.646 1.00 0.00 ? 31 GLY B H    3  
ATOM 4283  H HA2  . GLY B 2 31 ? 111.860 -5.003  -17.720 1.00 0.00 ? 31 GLY B HA2  3  
ATOM 4284  H HA3  . GLY B 2 31 ? 112.657 -6.133  -16.630 1.00 0.00 ? 31 GLY B HA3  3  
ATOM 4285  N N    . ARG B 2 32 ? 112.188 -6.457  -19.694 1.00 0.00 ? 32 ARG B N    3  
ATOM 4286  C CA   . ARG B 2 32 ? 112.379 -7.294  -20.872 1.00 0.00 ? 32 ARG B CA   3  
ATOM 4287  C C    . ARG B 2 32 ? 113.804 -7.833  -20.921 1.00 0.00 ? 32 ARG B C    3  
ATOM 4288  O O    . ARG B 2 32 ? 114.020 -9.045  -20.903 1.00 0.00 ? 32 ARG B O    3  
ATOM 4289  C CB   . ARG B 2 32 ? 112.092 -6.485  -22.139 1.00 0.00 ? 32 ARG B CB   3  
ATOM 4290  C CG   . ARG B 2 32 ? 112.193 -7.400  -23.362 1.00 0.00 ? 32 ARG B CG   3  
ATOM 4291  C CD   . ARG B 2 32 ? 111.720 -6.644  -24.605 1.00 0.00 ? 32 ARG B CD   3  
ATOM 4292  N NE   . ARG B 2 32 ? 110.292 -6.362  -24.509 1.00 0.00 ? 32 ARG B NE   3  
ATOM 4293  C CZ   . ARG B 2 32 ? 109.655 -5.711  -25.476 1.00 0.00 ? 32 ARG B CZ   3  
ATOM 4294  N NH1  . ARG B 2 32 ? 110.306 -5.311  -26.534 1.00 0.00 ? 32 ARG B NH1  3  
ATOM 4295  N NH2  . ARG B 2 32 ? 108.376 -5.470  -25.367 1.00 0.00 ? 32 ARG B NH2  3  
ATOM 4296  H H    . ARG B 2 32 ? 112.166 -5.482  -19.794 1.00 0.00 ? 32 ARG B H    3  
ATOM 4297  H HA   . ARG B 2 32 ? 111.691 -8.125  -20.827 1.00 0.00 ? 32 ARG B HA   3  
ATOM 4298  H HB2  . ARG B 2 32 ? 111.098 -6.067  -22.083 1.00 0.00 ? 32 ARG B HB2  3  
ATOM 4299  H HB3  . ARG B 2 32 ? 112.815 -5.688  -22.228 1.00 0.00 ? 32 ARG B HB3  3  
ATOM 4300  H HG2  . ARG B 2 32 ? 113.221 -7.708  -23.496 1.00 0.00 ? 32 ARG B HG2  3  
ATOM 4301  H HG3  . ARG B 2 32 ? 111.572 -8.270  -23.214 1.00 0.00 ? 32 ARG B HG3  3  
ATOM 4302  H HD2  . ARG B 2 32 ? 112.262 -5.714  -24.686 1.00 0.00 ? 32 ARG B HD2  3  
ATOM 4303  H HD3  . ARG B 2 32 ? 111.911 -7.245  -25.482 1.00 0.00 ? 32 ARG B HD3  3  
ATOM 4304  H HE   . ARG B 2 32 ? 109.795 -6.659  -23.719 1.00 0.00 ? 32 ARG B HE   3  
ATOM 4305  H HH11 . ARG B 2 32 ? 111.286 -5.496  -26.617 1.00 0.00 ? 32 ARG B HH11 3  
ATOM 4306  H HH12 . ARG B 2 32 ? 109.826 -4.820  -27.262 1.00 0.00 ? 32 ARG B HH12 3  
ATOM 4307  H HH21 . ARG B 2 32 ? 107.878 -5.777  -24.557 1.00 0.00 ? 32 ARG B HH21 3  
ATOM 4308  H HH22 . ARG B 2 32 ? 107.896 -4.979  -26.095 1.00 0.00 ? 32 ARG B HH22 3  
ATOM 4309  N N    . CYS A 1 1  ? 68.476  19.762  -18.030 1.00 0.00 ? 1  CYS A N    4  
ATOM 4310  C CA   . CYS A 1 1  ? 69.053  18.427  -17.706 1.00 0.00 ? 1  CYS A CA   4  
ATOM 4311  C C    . CYS A 1 1  ? 69.603  17.793  -18.979 1.00 0.00 ? 1  CYS A C    4  
ATOM 4312  O O    . CYS A 1 1  ? 68.940  17.784  -20.016 1.00 0.00 ? 1  CYS A O    4  
ATOM 4313  C CB   . CYS A 1 1  ? 67.964  17.535  -17.106 1.00 0.00 ? 1  CYS A CB   4  
ATOM 4314  S SG   . CYS A 1 1  ? 67.026  18.476  -15.876 1.00 0.00 ? 1  CYS A SG   4  
ATOM 4315  H HA   . CYS A 1 1  ? 69.853  18.547  -16.991 1.00 0.00 ? 1  CYS A HA   4  
ATOM 4316  H HB2  . CYS A 1 1  ? 67.299  17.203  -17.889 1.00 0.00 ? 1  CYS A HB2  4  
ATOM 4317  H HB3  . CYS A 1 1  ? 68.420  16.679  -16.633 1.00 0.00 ? 1  CYS A HB3  4  
ATOM 4318  N N    . SER A 1 2  ? 70.819  17.262  -18.894 1.00 0.00 ? 2  SER A N    4  
ATOM 4319  C CA   . SER A 1 2  ? 71.447  16.627  -20.048 1.00 0.00 ? 2  SER A CA   4  
ATOM 4320  C C    . SER A 1 2  ? 72.577  15.702  -19.607 1.00 0.00 ? 2  SER A C    4  
ATOM 4321  O O    . SER A 1 2  ? 73.748  15.963  -19.877 1.00 0.00 ? 2  SER A O    4  
ATOM 4322  C CB   . SER A 1 2  ? 72.001  17.695  -20.991 1.00 0.00 ? 2  SER A CB   4  
ATOM 4323  O OG   . SER A 1 2  ? 70.961  18.597  -21.345 1.00 0.00 ? 2  SER A OG   4  
ATOM 4324  H H    . SER A 1 2  ? 71.302  17.298  -18.041 1.00 0.00 ? 2  SER A H    4  
ATOM 4325  H HA   . SER A 1 2  ? 70.705  16.047  -20.576 1.00 0.00 ? 2  SER A HA   4  
ATOM 4326  H HB2  . SER A 1 2  ? 72.790  18.240  -20.500 1.00 0.00 ? 2  SER A HB2  4  
ATOM 4327  H HB3  . SER A 1 2  ? 72.396  17.219  -21.880 1.00 0.00 ? 2  SER A HB3  4  
ATOM 4328  H HG   . SER A 1 2  ? 71.353  19.331  -21.822 1.00 0.00 ? 2  SER A HG   4  
ATOM 4329  N N    . THR A 1 3  ? 72.216  14.615  -18.930 1.00 0.00 ? 3  THR A N    4  
ATOM 4330  C CA   . THR A 1 3  ? 73.207  13.652  -18.459 1.00 0.00 ? 3  THR A CA   4  
ATOM 4331  C C    . THR A 1 3  ? 73.585  12.689  -19.581 1.00 0.00 ? 3  THR A C    4  
ATOM 4332  O O    . THR A 1 3  ? 72.849  12.545  -20.556 1.00 0.00 ? 3  THR A O    4  
ATOM 4333  C CB   . THR A 1 3  ? 72.644  12.864  -17.274 1.00 0.00 ? 3  THR A CB   4  
ATOM 4334  O OG1  . THR A 1 3  ? 71.486  12.153  -17.688 1.00 0.00 ? 3  THR A OG1  4  
ATOM 4335  C CG2  . THR A 1 3  ? 72.277  13.829  -16.145 1.00 0.00 ? 3  THR A CG2  4  
ATOM 4336  H H    . THR A 1 3  ? 71.266  14.457  -18.746 1.00 0.00 ? 3  THR A H    4  
ATOM 4337  H HA   . THR A 1 3  ? 74.091  14.182  -18.137 1.00 0.00 ? 3  THR A HA   4  
ATOM 4338  H HB   . THR A 1 3  ? 73.387  12.167  -16.919 1.00 0.00 ? 3  THR A HB   4  
ATOM 4339  H HG1  . THR A 1 3  ? 70.805  12.282  -17.022 1.00 0.00 ? 3  THR A HG1  4  
ATOM 4340  H HG21 . THR A 1 3  ? 71.504  14.503  -16.485 1.00 0.00 ? 3  THR A HG21 4  
ATOM 4341  H HG22 . THR A 1 3  ? 73.150  14.397  -15.860 1.00 0.00 ? 3  THR A HG22 4  
ATOM 4342  H HG23 . THR A 1 3  ? 71.919  13.268  -15.294 1.00 0.00 ? 3  THR A HG23 4  
ATOM 4343  N N    . VAL A 1 4  ? 74.739  12.033  -19.431 1.00 0.00 ? 4  VAL A N    4  
ATOM 4344  C CA   . VAL A 1 4  ? 75.224  11.077  -20.432 1.00 0.00 ? 4  VAL A CA   4  
ATOM 4345  C C    . VAL A 1 4  ? 74.850  11.515  -21.844 1.00 0.00 ? 4  VAL A C    4  
ATOM 4346  O O    . VAL A 1 4  ? 74.627  10.689  -22.729 1.00 0.00 ? 4  VAL A O    4  
ATOM 4347  C CB   . VAL A 1 4  ? 74.662  9.681   -20.143 1.00 0.00 ? 4  VAL A CB   4  
ATOM 4348  C CG1  . VAL A 1 4  ? 75.175  9.207   -18.781 1.00 0.00 ? 4  VAL A CG1  4  
ATOM 4349  C CG2  . VAL A 1 4  ? 73.130  9.722   -20.118 1.00 0.00 ? 4  VAL A CG2  4  
ATOM 4350  H H    . VAL A 1 4  ? 75.277  12.195  -18.628 1.00 0.00 ? 4  VAL A H    4  
ATOM 4351  H HA   . VAL A 1 4  ? 76.302  11.030  -20.371 1.00 0.00 ? 4  VAL A HA   4  
ATOM 4352  H HB   . VAL A 1 4  ? 74.995  8.995   -20.909 1.00 0.00 ? 4  VAL A HB   4  
ATOM 4353  H HG11 . VAL A 1 4  ? 76.253  9.143   -18.805 1.00 0.00 ? 4  VAL A HG11 4  
ATOM 4354  H HG12 . VAL A 1 4  ? 74.760  8.236   -18.558 1.00 0.00 ? 4  VAL A HG12 4  
ATOM 4355  H HG13 . VAL A 1 4  ? 74.873  9.912   -18.018 1.00 0.00 ? 4  VAL A HG13 4  
ATOM 4356  H HG21 . VAL A 1 4  ? 72.764  10.238  -20.993 1.00 0.00 ? 4  VAL A HG21 4  
ATOM 4357  H HG22 . VAL A 1 4  ? 72.797  10.237  -19.230 1.00 0.00 ? 4  VAL A HG22 4  
ATOM 4358  H HG23 . VAL A 1 4  ? 72.745  8.713   -20.111 1.00 0.00 ? 4  VAL A HG23 4  
ATOM 4359  N N    . SER A 1 5  ? 74.800  12.826  -22.040 1.00 0.00 ? 5  SER A N    4  
ATOM 4360  C CA   . SER A 1 5  ? 74.471  13.391  -23.343 1.00 0.00 ? 5  SER A CA   4  
ATOM 4361  C C    . SER A 1 5  ? 75.710  13.389  -24.246 1.00 0.00 ? 5  SER A C    4  
ATOM 4362  O O    . SER A 1 5  ? 75.636  12.989  -25.409 1.00 0.00 ? 5  SER A O    4  
ATOM 4363  C CB   . SER A 1 5  ? 73.922  14.818  -23.164 1.00 0.00 ? 5  SER A CB   4  
ATOM 4364  O OG   . SER A 1 5  ? 72.554  14.839  -23.554 1.00 0.00 ? 5  SER A OG   4  
ATOM 4365  H H    . SER A 1 5  ? 75.004  13.427  -21.292 1.00 0.00 ? 5  SER A H    4  
ATOM 4366  H HA   . SER A 1 5  ? 73.707  12.782  -23.803 1.00 0.00 ? 5  SER A HA   4  
ATOM 4367  H HB2  . SER A 1 5  ? 73.994  15.104  -22.128 1.00 0.00 ? 5  SER A HB2  4  
ATOM 4368  H HB3  . SER A 1 5  ? 74.487  15.521  -23.766 1.00 0.00 ? 5  SER A HB3  4  
ATOM 4369  H HG   . SER A 1 5  ? 72.476  15.399  -24.330 1.00 0.00 ? 5  SER A HG   4  
ATOM 4370  N N    . PRO A 1 6  ? 76.839  13.822  -23.736 1.00 0.00 ? 6  PRO A N    4  
ATOM 4371  C CA   . PRO A 1 6  ? 78.114  13.864  -24.512 1.00 0.00 ? 6  PRO A CA   4  
ATOM 4372  C C    . PRO A 1 6  ? 78.347  12.612  -25.338 1.00 0.00 ? 6  PRO A C    4  
ATOM 4373  O O    . PRO A 1 6  ? 78.752  12.700  -26.497 1.00 0.00 ? 6  PRO A O    4  
ATOM 4374  C CB   . PRO A 1 6  ? 79.167  14.034  -23.420 1.00 0.00 ? 6  PRO A CB   4  
ATOM 4375  C CG   . PRO A 1 6  ? 78.470  14.860  -22.394 1.00 0.00 ? 6  PRO A CG   4  
ATOM 4376  C CD   . PRO A 1 6  ? 77.039  14.325  -22.359 1.00 0.00 ? 6  PRO A CD   4  
ATOM 4377  H HA   . PRO A 1 6  ? 78.139  14.720  -25.150 1.00 0.00 ? 6  PRO A HA   4  
ATOM 4378  H HB2  . PRO A 1 6  ? 79.446  13.071  -23.012 1.00 0.00 ? 6  PRO A HB2  4  
ATOM 4379  H HB3  . PRO A 1 6  ? 80.033  14.556  -23.796 1.00 0.00 ? 6  PRO A HB3  4  
ATOM 4380  H HG2  . PRO A 1 6  ? 78.945  14.746  -21.431 1.00 0.00 ? 6  PRO A HG2  4  
ATOM 4381  H HG3  . PRO A 1 6  ? 78.464  15.897  -22.690 1.00 0.00 ? 6  PRO A HG3  4  
ATOM 4382  H HD2  . PRO A 1 6  ? 76.966  13.525  -21.637 1.00 0.00 ? 6  PRO A HD2  4  
ATOM 4383  H HD3  . PRO A 1 6  ? 76.336  15.113  -22.139 1.00 0.00 ? 6  PRO A HD3  4  
ATOM 4384  N N    . GLY A 1 7  ? 78.098  11.449  -24.752 1.00 0.00 ? 7  GLY A N    4  
ATOM 4385  C CA   . GLY A 1 7  ? 78.317  10.202  -25.485 1.00 0.00 ? 7  GLY A CA   4  
ATOM 4386  C C    . GLY A 1 7  ? 79.812  9.983   -25.650 1.00 0.00 ? 7  GLY A C    4  
ATOM 4387  O O    . GLY A 1 7  ? 80.332  8.899   -25.376 1.00 0.00 ? 7  GLY A O    4  
ATOM 4388  H H    . GLY A 1 7  ? 77.777  11.430  -23.819 1.00 0.00 ? 7  GLY A H    4  
ATOM 4389  H HA2  . GLY A 1 7  ? 77.884  9.369   -24.945 1.00 0.00 ? 7  GLY A HA2  4  
ATOM 4390  H HA3  . GLY A 1 7  ? 77.861  10.274  -26.460 1.00 0.00 ? 7  GLY A HA3  4  
ATOM 4391  N N    . VAL A 1 8  ? 80.512  11.037  -26.065 1.00 0.00 ? 8  VAL A N    4  
ATOM 4392  C CA   . VAL A 1 8  ? 81.950  10.956  -26.218 1.00 0.00 ? 8  VAL A CA   4  
ATOM 4393  C C    . VAL A 1 8  ? 82.534  10.503  -24.897 1.00 0.00 ? 8  VAL A C    4  
ATOM 4394  O O    . VAL A 1 8  ? 83.453  9.681   -24.857 1.00 0.00 ? 8  VAL A O    4  
ATOM 4395  C CB   . VAL A 1 8  ? 82.525  12.318  -26.613 1.00 0.00 ? 8  VAL A CB   4  
ATOM 4396  C CG1  . VAL A 1 8  ? 84.052  12.254  -26.597 1.00 0.00 ? 8  VAL A CG1  4  
ATOM 4397  C CG2  . VAL A 1 8  ? 82.047  12.678  -28.020 1.00 0.00 ? 8  VAL A CG2  4  
ATOM 4398  H H    . VAL A 1 8  ? 80.057  11.881  -26.242 1.00 0.00 ? 8  VAL A H    4  
ATOM 4399  H HA   . VAL A 1 8  ? 82.187  10.230  -26.982 1.00 0.00 ? 8  VAL A HA   4  
ATOM 4400  H HB   . VAL A 1 8  ? 82.187  13.068  -25.913 1.00 0.00 ? 8  VAL A HB   4  
ATOM 4401  H HG11 . VAL A 1 8  ? 84.382  11.375  -27.131 1.00 0.00 ? 8  VAL A HG11 4  
ATOM 4402  H HG12 . VAL A 1 8  ? 84.401  12.206  -25.574 1.00 0.00 ? 8  VAL A HG12 4  
ATOM 4403  H HG13 . VAL A 1 8  ? 84.455  13.136  -27.072 1.00 0.00 ? 8  VAL A HG13 4  
ATOM 4404  H HG21 . VAL A 1 8  ? 80.994  12.911  -27.994 1.00 0.00 ? 8  VAL A HG21 4  
ATOM 4405  H HG22 . VAL A 1 8  ? 82.214  11.839  -28.681 1.00 0.00 ? 8  VAL A HG22 4  
ATOM 4406  H HG23 . VAL A 1 8  ? 82.597  13.534  -28.380 1.00 0.00 ? 8  VAL A HG23 4  
ATOM 4407  N N    . LEU A 1 9  ? 81.968  11.010  -23.801 1.00 0.00 ? 9  LEU A N    4  
ATOM 4408  C CA   . LEU A 1 9  ? 82.444  10.590  -22.492 1.00 0.00 ? 9  LEU A CA   4  
ATOM 4409  C C    . LEU A 1 9  ? 82.350  9.064   -22.415 1.00 0.00 ? 9  LEU A C    4  
ATOM 4410  O O    . LEU A 1 9  ? 83.226  8.386   -21.861 1.00 0.00 ? 9  LEU A O    4  
ATOM 4411  C CB   . LEU A 1 9  ? 81.623  11.227  -21.367 1.00 0.00 ? 9  LEU A CB   4  
ATOM 4412  C CG   . LEU A 1 9  ? 81.886  12.740  -21.302 1.00 0.00 ? 9  LEU A CG   4  
ATOM 4413  C CD1  . LEU A 1 9  ? 80.977  13.351  -20.233 1.00 0.00 ? 9  LEU A CD1  4  
ATOM 4414  C CD2  . LEU A 1 9  ? 83.362  13.021  -20.940 1.00 0.00 ? 9  LEU A CD2  4  
ATOM 4415  H H    . LEU A 1 9  ? 81.208  11.649  -23.881 1.00 0.00 ? 9  LEU A H    4  
ATOM 4416  H HA   . LEU A 1 9  ? 83.472  10.885  -22.387 1.00 0.00 ? 9  LEU A HA   4  
ATOM 4417  H HB2  . LEU A 1 9  ? 80.572  11.052  -21.546 1.00 0.00 ? 9  LEU A HB2  4  
ATOM 4418  H HB3  . LEU A 1 9  ? 81.905  10.778  -20.428 1.00 0.00 ? 9  LEU A HB3  4  
ATOM 4419  H HG   . LEU A 1 9  ? 81.659  13.184  -22.260 1.00 0.00 ? 9  LEU A HG   4  
ATOM 4420  H HD11 . LEU A 1 9  ? 81.342  13.078  -19.255 1.00 0.00 ? 9  LEU A HD11 4  
ATOM 4421  H HD12 . LEU A 1 9  ? 79.971  12.977  -20.358 1.00 0.00 ? 9  LEU A HD12 4  
ATOM 4422  H HD13 . LEU A 1 9  ? 80.979  14.427  -20.330 1.00 0.00 ? 9  LEU A HD13 4  
ATOM 4423  H HD21 . LEU A 1 9  ? 83.742  12.232  -20.306 1.00 0.00 ? 9  LEU A HD21 4  
ATOM 4424  H HD22 . LEU A 1 9  ? 83.440  13.964  -20.418 1.00 0.00 ? 9  LEU A HD22 4  
ATOM 4425  H HD23 . LEU A 1 9  ? 83.949  13.071  -21.844 1.00 0.00 ? 9  LEU A HD23 4  
ATOM 4426  N N    . ALA A 1 10 ? 81.295  8.517   -23.021 1.00 0.00 ? 10 ALA A N    4  
ATOM 4427  C CA   . ALA A 1 10 ? 81.127  7.073   -23.054 1.00 0.00 ? 10 ALA A CA   4  
ATOM 4428  C C    . ALA A 1 10 ? 82.311  6.477   -23.801 1.00 0.00 ? 10 ALA A C    4  
ATOM 4429  O O    . ALA A 1 10 ? 82.841  5.429   -23.428 1.00 0.00 ? 10 ALA A O    4  
ATOM 4430  C CB   . ALA A 1 10 ? 79.808  6.702   -23.749 1.00 0.00 ? 10 ALA A CB   4  
ATOM 4431  H H    . ALA A 1 10 ? 80.644  9.092   -23.476 1.00 0.00 ? 10 ALA A H    4  
ATOM 4432  H HA   . ALA A 1 10 ? 81.116  6.694   -22.042 1.00 0.00 ? 10 ALA A HA   4  
ATOM 4433  H HB1  . ALA A 1 10 ? 79.956  6.655   -24.819 1.00 0.00 ? 10 ALA A HB1  4  
ATOM 4434  H HB2  . ALA A 1 10 ? 79.061  7.448   -23.523 1.00 0.00 ? 10 ALA A HB2  4  
ATOM 4435  H HB3  . ALA A 1 10 ? 79.471  5.738   -23.392 1.00 0.00 ? 10 ALA A HB3  4  
ATOM 4436  N N    . GLY A 1 11 ? 82.744  7.182   -24.844 1.00 0.00 ? 11 GLY A N    4  
ATOM 4437  C CA   . GLY A 1 11 ? 83.894  6.740   -25.618 1.00 0.00 ? 11 GLY A CA   4  
ATOM 4438  C C    . GLY A 1 11 ? 85.119  6.696   -24.715 1.00 0.00 ? 11 GLY A C    4  
ATOM 4439  O O    . GLY A 1 11 ? 86.026  5.891   -24.914 1.00 0.00 ? 11 GLY A O    4  
ATOM 4440  H H    . GLY A 1 11 ? 82.294  8.026   -25.081 1.00 0.00 ? 11 GLY A H    4  
ATOM 4441  H HA2  . GLY A 1 11 ? 83.701  5.755   -26.019 1.00 0.00 ? 11 GLY A HA2  4  
ATOM 4442  H HA3  . GLY A 1 11 ? 84.073  7.432   -26.428 1.00 0.00 ? 11 GLY A HA3  4  
ATOM 4443  N N    . ILE A 1 12 ? 85.118  7.564   -23.704 1.00 0.00 ? 12 ILE A N    4  
ATOM 4444  C CA   . ILE A 1 12 ? 86.220  7.617   -22.742 1.00 0.00 ? 12 ILE A CA   4  
ATOM 4445  C C    . ILE A 1 12 ? 86.237  6.308   -21.958 1.00 0.00 ? 12 ILE A C    4  
ATOM 4446  O O    . ILE A 1 12 ? 87.295  5.717   -21.740 1.00 0.00 ? 12 ILE A O    4  
ATOM 4447  C CB   . ILE A 1 12 ? 86.069  8.873   -21.811 1.00 0.00 ? 12 ILE A CB   4  
ATOM 4448  C CG1  . ILE A 1 12 ? 87.348  9.738   -21.837 1.00 0.00 ? 12 ILE A CG1  4  
ATOM 4449  C CG2  . ILE A 1 12 ? 85.765  8.489   -20.342 1.00 0.00 ? 12 ILE A CG2  4  
ATOM 4450  C CD1  . ILE A 1 12 ? 87.017  11.151  -21.346 1.00 0.00 ? 12 ILE A CD1  4  
ATOM 4451  H H    . ILE A 1 12 ? 84.354  8.166   -23.599 1.00 0.00 ? 12 ILE A H    4  
ATOM 4452  H HA   . ILE A 1 12 ? 87.144  7.682   -23.298 1.00 0.00 ? 12 ILE A HA   4  
ATOM 4453  H HB   . ILE A 1 12 ? 85.252  9.467   -22.179 1.00 0.00 ? 12 ILE A HB   4  
ATOM 4454  H HG12 . ILE A 1 12 ? 88.094  9.297   -21.193 1.00 0.00 ? 12 ILE A HG12 4  
ATOM 4455  H HG13 . ILE A 1 12 ? 87.730  9.800   -22.845 1.00 0.00 ? 12 ILE A HG13 4  
ATOM 4456  H HG21 . ILE A 1 12 ? 85.560  9.382   -19.768 1.00 0.00 ? 12 ILE A HG21 4  
ATOM 4457  H HG22 . ILE A 1 12 ? 86.614  7.978   -19.914 1.00 0.00 ? 12 ILE A HG22 4  
ATOM 4458  H HG23 . ILE A 1 12 ? 84.904  7.842   -20.305 1.00 0.00 ? 12 ILE A HG23 4  
ATOM 4459  H HD11 . ILE A 1 12 ? 86.466  11.676  -22.112 1.00 0.00 ? 12 ILE A HD11 4  
ATOM 4460  H HD12 . ILE A 1 12 ? 87.932  11.683  -21.136 1.00 0.00 ? 12 ILE A HD12 4  
ATOM 4461  H HD13 . ILE A 1 12 ? 86.416  11.092  -20.449 1.00 0.00 ? 12 ILE A HD13 4  
ATOM 4462  N N    . VAL A 1 13 ? 85.056  5.849   -21.561 1.00 0.00 ? 13 VAL A N    4  
ATOM 4463  C CA   . VAL A 1 13 ? 84.960  4.593   -20.828 1.00 0.00 ? 13 VAL A CA   4  
ATOM 4464  C C    . VAL A 1 13 ? 85.568  3.476   -21.665 1.00 0.00 ? 13 VAL A C    4  
ATOM 4465  O O    . VAL A 1 13 ? 86.435  2.727   -21.200 1.00 0.00 ? 13 VAL A O    4  
ATOM 4466  C CB   . VAL A 1 13 ? 83.500  4.264   -20.513 1.00 0.00 ? 13 VAL A CB   4  
ATOM 4467  C CG1  . VAL A 1 13 ? 83.427  2.923   -19.783 1.00 0.00 ? 13 VAL A CG1  4  
ATOM 4468  C CG2  . VAL A 1 13 ? 82.908  5.360   -19.624 1.00 0.00 ? 13 VAL A CG2  4  
ATOM 4469  H H    . VAL A 1 13 ? 84.241  6.357   -21.773 1.00 0.00 ? 13 VAL A H    4  
ATOM 4470  H HA   . VAL A 1 13 ? 85.509  4.680   -19.910 1.00 0.00 ? 13 VAL A HA   4  
ATOM 4471  H HB   . VAL A 1 13 ? 82.937  4.201   -21.434 1.00 0.00 ? 13 VAL A HB   4  
ATOM 4472  H HG11 . VAL A 1 13 ? 84.169  2.899   -19.000 1.00 0.00 ? 13 VAL A HG11 4  
ATOM 4473  H HG12 . VAL A 1 13 ? 83.615  2.122   -20.483 1.00 0.00 ? 13 VAL A HG12 4  
ATOM 4474  H HG13 . VAL A 1 13 ? 82.444  2.800   -19.352 1.00 0.00 ? 13 VAL A HG13 4  
ATOM 4475  H HG21 . VAL A 1 13 ? 83.329  5.285   -18.633 1.00 0.00 ? 13 VAL A HG21 4  
ATOM 4476  H HG22 . VAL A 1 13 ? 81.836  5.240   -19.570 1.00 0.00 ? 13 VAL A HG22 4  
ATOM 4477  H HG23 . VAL A 1 13 ? 83.140  6.327   -20.042 1.00 0.00 ? 13 VAL A HG23 4  
ATOM 4478  N N    . VAL A 1 14 ? 85.124  3.384   -22.912 1.00 0.00 ? 14 VAL A N    4  
ATOM 4479  C CA   . VAL A 1 14 ? 85.645  2.371   -23.816 1.00 0.00 ? 14 VAL A CA   4  
ATOM 4480  C C    . VAL A 1 14 ? 87.156  2.533   -23.964 1.00 0.00 ? 14 VAL A C    4  
ATOM 4481  O O    . VAL A 1 14 ? 87.874  1.559   -24.187 1.00 0.00 ? 14 VAL A O    4  
ATOM 4482  C CB   . VAL A 1 14 ? 84.978  2.500   -25.187 1.00 0.00 ? 14 VAL A CB   4  
ATOM 4483  C CG1  . VAL A 1 14 ? 85.571  1.466   -26.145 1.00 0.00 ? 14 VAL A CG1  4  
ATOM 4484  C CG2  . VAL A 1 14 ? 83.473  2.257   -25.047 1.00 0.00 ? 14 VAL A CG2  4  
ATOM 4485  H H    . VAL A 1 14 ? 84.440  4.017   -23.231 1.00 0.00 ? 14 VAL A H    4  
ATOM 4486  H HA   . VAL A 1 14 ? 85.432  1.393   -23.412 1.00 0.00 ? 14 VAL A HA   4  
ATOM 4487  H HB   . VAL A 1 14 ? 85.150  3.492   -25.577 1.00 0.00 ? 14 VAL A HB   4  
ATOM 4488  H HG11 . VAL A 1 14 ? 84.960  1.406   -27.033 1.00 0.00 ? 14 VAL A HG11 4  
ATOM 4489  H HG12 . VAL A 1 14 ? 85.599  0.501   -25.662 1.00 0.00 ? 14 VAL A HG12 4  
ATOM 4490  H HG13 . VAL A 1 14 ? 86.574  1.761   -26.417 1.00 0.00 ? 14 VAL A HG13 4  
ATOM 4491  H HG21 . VAL A 1 14 ? 82.988  2.460   -25.991 1.00 0.00 ? 14 VAL A HG21 4  
ATOM 4492  H HG22 . VAL A 1 14 ? 83.072  2.911   -24.288 1.00 0.00 ? 14 VAL A HG22 4  
ATOM 4493  H HG23 . VAL A 1 14 ? 83.299  1.229   -24.766 1.00 0.00 ? 14 VAL A HG23 4  
ATOM 4494  N N    . GLY A 1 15 ? 87.629  3.775   -23.839 1.00 0.00 ? 15 GLY A N    4  
ATOM 4495  C CA   . GLY A 1 15 ? 89.052  4.071   -23.959 1.00 0.00 ? 15 GLY A CA   4  
ATOM 4496  C C    . GLY A 1 15 ? 89.842  3.467   -22.799 1.00 0.00 ? 15 GLY A C    4  
ATOM 4497  O O    . GLY A 1 15 ? 90.955  2.976   -22.979 1.00 0.00 ? 15 GLY A O    4  
ATOM 4498  H H    . GLY A 1 15 ? 87.005  4.508   -23.663 1.00 0.00 ? 15 GLY A H    4  
ATOM 4499  H HA2  . GLY A 1 15 ? 89.419  3.668   -24.890 1.00 0.00 ? 15 GLY A HA2  4  
ATOM 4500  H HA3  . GLY A 1 15 ? 89.192  5.142   -23.958 1.00 0.00 ? 15 GLY A HA3  4  
ATOM 4501  N N    . ASP A 1 16 ? 89.262  3.510   -21.607 1.00 0.00 ? 16 ASP A N    4  
ATOM 4502  C CA   . ASP A 1 16 ? 89.930  2.962   -20.434 1.00 0.00 ? 16 ASP A CA   4  
ATOM 4503  C C    . ASP A 1 16 ? 90.024  1.444   -20.542 1.00 0.00 ? 16 ASP A C    4  
ATOM 4504  O O    . ASP A 1 16 ? 91.071  0.849   -20.264 1.00 0.00 ? 16 ASP A O    4  
ATOM 4505  C CB   . ASP A 1 16 ? 89.156  3.337   -19.169 1.00 0.00 ? 16 ASP A CB   4  
ATOM 4506  C CG   . ASP A 1 16 ? 89.996  3.038   -17.933 1.00 0.00 ? 16 ASP A CG   4  
ATOM 4507  O OD1  . ASP A 1 16 ? 90.917  2.244   -18.045 1.00 0.00 ? 16 ASP A OD1  4  
ATOM 4508  O OD2  . ASP A 1 16 ? 89.708  3.605   -16.893 1.00 0.00 ? 16 ASP A OD2  4  
ATOM 4509  H H    . ASP A 1 16 ? 88.374  3.916   -21.515 1.00 0.00 ? 16 ASP A H    4  
ATOM 4510  H HA   . ASP A 1 16 ? 90.925  3.373   -20.370 1.00 0.00 ? 16 ASP A HA   4  
ATOM 4511  H HB2  . ASP A 1 16 ? 88.918  4.392   -19.194 1.00 0.00 ? 16 ASP A HB2  4  
ATOM 4512  H HB3  . ASP A 1 16 ? 88.240  2.765   -19.126 1.00 0.00 ? 16 ASP A HB3  4  
ATOM 4513  N N    . LEU A 1 17 ? 88.921  0.821   -20.947 1.00 0.00 ? 17 LEU A N    4  
ATOM 4514  C CA   . LEU A 1 17 ? 88.883  -0.631  -21.085 1.00 0.00 ? 17 LEU A CA   4  
ATOM 4515  C C    . LEU A 1 17 ? 89.947  -1.114  -22.071 1.00 0.00 ? 17 LEU A C    4  
ATOM 4516  O O    . LEU A 1 17 ? 90.734  -2.014  -21.758 1.00 0.00 ? 17 LEU A O    4  
ATOM 4517  C CB   . LEU A 1 17 ? 87.494  -1.069  -21.568 1.00 0.00 ? 17 LEU A CB   4  
ATOM 4518  C CG   . LEU A 1 17 ? 87.360  -2.602  -21.506 1.00 0.00 ? 17 LEU A CG   4  
ATOM 4519  C CD1  . LEU A 1 17 ? 87.246  -3.080  -20.046 1.00 0.00 ? 17 LEU A CD1  4  
ATOM 4520  C CD2  . LEU A 1 17 ? 86.107  -3.021  -22.283 1.00 0.00 ? 17 LEU A CD2  4  
ATOM 4521  H H    . LEU A 1 17 ? 88.115  1.349   -21.152 1.00 0.00 ? 17 LEU A H    4  
ATOM 4522  H HA   . LEU A 1 17 ? 89.073  -1.074  -20.121 1.00 0.00 ? 17 LEU A HA   4  
ATOM 4523  H HB2  . LEU A 1 17 ? 86.739  -0.612  -20.947 1.00 0.00 ? 17 LEU A HB2  4  
ATOM 4524  H HB3  . LEU A 1 17 ? 87.356  -0.744  -22.589 1.00 0.00 ? 17 LEU A HB3  4  
ATOM 4525  H HG   . LEU A 1 17 ? 88.228  -3.056  -21.960 1.00 0.00 ? 17 LEU A HG   4  
ATOM 4526  H HD11 . LEU A 1 17 ? 86.662  -2.376  -19.472 1.00 0.00 ? 17 LEU A HD11 4  
ATOM 4527  H HD12 . LEU A 1 17 ? 88.231  -3.162  -19.615 1.00 0.00 ? 17 LEU A HD12 4  
ATOM 4528  H HD13 . LEU A 1 17 ? 86.766  -4.048  -20.017 1.00 0.00 ? 17 LEU A HD13 4  
ATOM 4529  H HD21 . LEU A 1 17 ? 85.969  -4.089  -22.195 1.00 0.00 ? 17 LEU A HD21 4  
ATOM 4530  H HD22 . LEU A 1 17 ? 86.225  -2.759  -23.324 1.00 0.00 ? 17 LEU A HD22 4  
ATOM 4531  H HD23 . LEU A 1 17 ? 85.244  -2.511  -21.878 1.00 0.00 ? 17 LEU A HD23 4  
ATOM 4532  N N    . VAL A 1 18 ? 89.975  -0.521  -23.263 1.00 0.00 ? 18 VAL A N    4  
ATOM 4533  C CA   . VAL A 1 18 ? 90.953  -0.928  -24.263 1.00 0.00 ? 18 VAL A CA   4  
ATOM 4534  C C    . VAL A 1 18 ? 92.368  -0.610  -23.794 1.00 0.00 ? 18 VAL A C    4  
ATOM 4535  O O    . VAL A 1 18 ? 93.305  -1.305  -24.161 1.00 0.00 ? 18 VAL A O    4  
ATOM 4536  C CB   . VAL A 1 18 ? 90.682  -0.247  -25.605 1.00 0.00 ? 18 VAL A CB   4  
ATOM 4537  C CG1  . VAL A 1 18 ? 89.292  -0.639  -26.108 1.00 0.00 ? 18 VAL A CG1  4  
ATOM 4538  C CG2  . VAL A 1 18 ? 90.747  1.264   -25.427 1.00 0.00 ? 18 VAL A CG2  4  
ATOM 4539  H H    . VAL A 1 18 ? 89.330  0.192   -23.470 1.00 0.00 ? 18 VAL A H    4  
ATOM 4540  H HA   . VAL A 1 18 ? 90.874  -1.996  -24.401 1.00 0.00 ? 18 VAL A HA   4  
ATOM 4541  H HB   . VAL A 1 18 ? 91.426  -0.559  -26.324 1.00 0.00 ? 18 VAL A HB   4  
ATOM 4542  H HG11 . VAL A 1 18 ? 89.063  -0.081  -27.004 1.00 0.00 ? 18 VAL A HG11 4  
ATOM 4543  H HG12 . VAL A 1 18 ? 88.558  -0.416  -25.347 1.00 0.00 ? 18 VAL A HG12 4  
ATOM 4544  H HG13 . VAL A 1 18 ? 89.273  -1.696  -26.327 1.00 0.00 ? 18 VAL A HG13 4  
ATOM 4545  H HG21 . VAL A 1 18 ? 91.772  1.569   -25.282 1.00 0.00 ? 18 VAL A HG21 4  
ATOM 4546  H HG22 . VAL A 1 18 ? 90.166  1.535   -24.565 1.00 0.00 ? 18 VAL A HG22 4  
ATOM 4547  H HG23 . VAL A 1 18 ? 90.344  1.750   -26.303 1.00 0.00 ? 18 VAL A HG23 4  
ATOM 4548  N N    . LEU A 1 19 ? 92.529  0.435   -22.978 1.00 0.00 ? 19 LEU A N    4  
ATOM 4549  C CA   . LEU A 1 19 ? 93.862  0.782   -22.487 1.00 0.00 ? 19 LEU A CA   4  
ATOM 4550  C C    . LEU A 1 19 ? 94.431  -0.392  -21.689 1.00 0.00 ? 19 LEU A C    4  
ATOM 4551  O O    . LEU A 1 19 ? 95.480  -0.949  -22.039 1.00 0.00 ? 19 LEU A O    4  
ATOM 4552  C CB   . LEU A 1 19 ? 93.785  2.039   -21.600 1.00 0.00 ? 19 LEU A CB   4  
ATOM 4553  C CG   . LEU A 1 19 ? 95.146  2.759   -21.526 1.00 0.00 ? 19 LEU A CG   4  
ATOM 4554  C CD1  . LEU A 1 19 ? 96.226  1.794   -21.029 1.00 0.00 ? 19 LEU A CD1  4  
ATOM 4555  C CD2  . LEU A 1 19 ? 95.544  3.323   -22.907 1.00 0.00 ? 19 LEU A CD2  4  
ATOM 4556  H H    . LEU A 1 19 ? 91.751  0.969   -22.704 1.00 0.00 ? 19 LEU A H    4  
ATOM 4557  H HA   . LEU A 1 19 ? 94.504  0.977   -23.330 1.00 0.00 ? 19 LEU A HA   4  
ATOM 4558  H HB2  . LEU A 1 19 ? 93.053  2.715   -22.011 1.00 0.00 ? 19 LEU A HB2  4  
ATOM 4559  H HB3  . LEU A 1 19 ? 93.481  1.755   -20.603 1.00 0.00 ? 19 LEU A HB3  4  
ATOM 4560  H HG   . LEU A 1 19 ? 95.065  3.577   -20.824 1.00 0.00 ? 19 LEU A HG   4  
ATOM 4561  H HD11 . LEU A 1 19 ? 96.527  1.143   -21.835 1.00 0.00 ? 19 LEU A HD11 4  
ATOM 4562  H HD12 . LEU A 1 19 ? 95.837  1.205   -20.212 1.00 0.00 ? 19 LEU A HD12 4  
ATOM 4563  H HD13 . LEU A 1 19 ? 97.079  2.360   -20.687 1.00 0.00 ? 19 LEU A HD13 4  
ATOM 4564  H HD21 . LEU A 1 19 ? 94.657  3.568   -23.475 1.00 0.00 ? 19 LEU A HD21 4  
ATOM 4565  H HD22 . LEU A 1 19 ? 96.128  2.596   -23.454 1.00 0.00 ? 19 LEU A HD22 4  
ATOM 4566  H HD23 . LEU A 1 19 ? 96.134  4.217   -22.767 1.00 0.00 ? 19 LEU A HD23 4  
ATOM 4567  N N    . THR A 1 20 ? 93.728  -0.778  -20.624 1.00 0.00 ? 20 THR A N    4  
ATOM 4568  C CA   . THR A 1 20 ? 94.169  -1.897  -19.800 1.00 0.00 ? 20 THR A CA   4  
ATOM 4569  C C    . THR A 1 20 ? 94.440  -3.133  -20.655 1.00 0.00 ? 20 THR A C    4  
ATOM 4570  O O    . THR A 1 20 ? 95.426  -3.838  -20.445 1.00 0.00 ? 20 THR A O    4  
ATOM 4571  C CB   . THR A 1 20 ? 93.088  -2.231  -18.771 1.00 0.00 ? 20 THR A CB   4  
ATOM 4572  O OG1  . THR A 1 20 ? 91.884  -2.563  -19.449 1.00 0.00 ? 20 THR A OG1  4  
ATOM 4573  C CG2  . THR A 1 20 ? 92.839  -1.026  -17.855 1.00 0.00 ? 20 THR A CG2  4  
ATOM 4574  H H    . THR A 1 20 ? 92.894  -0.304  -20.385 1.00 0.00 ? 20 THR A H    4  
ATOM 4575  H HA   . THR A 1 20 ? 95.073  -1.620  -19.280 1.00 0.00 ? 20 THR A HA   4  
ATOM 4576  H HB   . THR A 1 20 ? 93.407  -3.074  -18.176 1.00 0.00 ? 20 THR A HB   4  
ATOM 4577  H HG1  . THR A 1 20 ? 91.178  -2.029  -19.078 1.00 0.00 ? 20 THR A HG1  4  
ATOM 4578  H HG21 . THR A 1 20 ? 91.806  -1.024  -17.546 1.00 0.00 ? 20 THR A HG21 4  
ATOM 4579  H HG22 . THR A 1 20 ? 93.053  -0.107  -18.384 1.00 0.00 ? 20 THR A HG22 4  
ATOM 4580  H HG23 . THR A 1 20 ? 93.475  -1.096  -16.984 1.00 0.00 ? 20 THR A HG23 4  
ATOM 4581  N N    . VAL A 1 21 ? 93.547  -3.402  -21.603 1.00 0.00 ? 21 VAL A N    4  
ATOM 4582  C CA   . VAL A 1 21 ? 93.691  -4.574  -22.465 1.00 0.00 ? 21 VAL A CA   4  
ATOM 4583  C C    . VAL A 1 21 ? 94.902  -4.459  -23.397 1.00 0.00 ? 21 VAL A C    4  
ATOM 4584  O O    . VAL A 1 21 ? 95.488  -5.468  -23.782 1.00 0.00 ? 21 VAL A O    4  
ATOM 4585  C CB   . VAL A 1 21 ? 92.422  -4.758  -23.299 1.00 0.00 ? 21 VAL A CB   4  
ATOM 4586  C CG1  . VAL A 1 21 ? 92.594  -5.953  -24.241 1.00 0.00 ? 21 VAL A CG1  4  
ATOM 4587  C CG2  . VAL A 1 21 ? 91.236  -5.014  -22.366 1.00 0.00 ? 21 VAL A CG2  4  
ATOM 4588  H H    . VAL A 1 21 ? 92.767  -2.812  -21.714 1.00 0.00 ? 21 VAL A H    4  
ATOM 4589  H HA   . VAL A 1 21 ? 93.820  -5.446  -21.842 1.00 0.00 ? 21 VAL A HA   4  
ATOM 4590  H HB   . VAL A 1 21 ? 92.240  -3.866  -23.880 1.00 0.00 ? 21 VAL A HB   4  
ATOM 4591  H HG11 . VAL A 1 21 ? 92.996  -6.790  -23.690 1.00 0.00 ? 21 VAL A HG11 4  
ATOM 4592  H HG12 . VAL A 1 21 ? 93.271  -5.688  -25.039 1.00 0.00 ? 21 VAL A HG12 4  
ATOM 4593  H HG13 . VAL A 1 21 ? 91.634  -6.224  -24.657 1.00 0.00 ? 21 VAL A HG13 4  
ATOM 4594  H HG21 . VAL A 1 21 ? 91.257  -4.303  -21.554 1.00 0.00 ? 21 VAL A HG21 4  
ATOM 4595  H HG22 . VAL A 1 21 ? 91.301  -6.016  -21.968 1.00 0.00 ? 21 VAL A HG22 4  
ATOM 4596  H HG23 . VAL A 1 21 ? 90.314  -4.904  -22.917 1.00 0.00 ? 21 VAL A HG23 4  
ATOM 4597  N N    . LEU A 1 22 ? 95.258  -3.235  -23.774 1.00 0.00 ? 22 LEU A N    4  
ATOM 4598  C CA   . LEU A 1 22 ? 96.386  -3.028  -24.682 1.00 0.00 ? 22 LEU A CA   4  
ATOM 4599  C C    . LEU A 1 22 ? 97.714  -3.333  -23.991 1.00 0.00 ? 22 LEU A C    4  
ATOM 4600  O O    . LEU A 1 22 ? 98.502  -4.146  -24.477 1.00 0.00 ? 22 LEU A O    4  
ATOM 4601  C CB   . LEU A 1 22 ? 96.379  -1.574  -25.197 1.00 0.00 ? 22 LEU A CB   4  
ATOM 4602  C CG   . LEU A 1 22 ? 97.035  -1.468  -26.589 1.00 0.00 ? 22 LEU A CG   4  
ATOM 4603  C CD1  . LEU A 1 22 ? 98.444  -2.070  -26.553 1.00 0.00 ? 22 LEU A CD1  4  
ATOM 4604  C CD2  . LEU A 1 22 ? 96.181  -2.195  -27.653 1.00 0.00 ? 22 LEU A CD2  4  
ATOM 4605  H H    . LEU A 1 22 ? 94.749  -2.462  -23.454 1.00 0.00 ? 22 LEU A H    4  
ATOM 4606  H HA   . LEU A 1 22 ? 96.273  -3.696  -25.519 1.00 0.00 ? 22 LEU A HA   4  
ATOM 4607  H HB2  . LEU A 1 22 ? 95.360  -1.227  -25.260 1.00 0.00 ? 22 LEU A HB2  4  
ATOM 4608  H HB3  . LEU A 1 22 ? 96.919  -0.945  -24.503 1.00 0.00 ? 22 LEU A HB3  4  
ATOM 4609  H HG   . LEU A 1 22 ? 97.113  -0.423  -26.855 1.00 0.00 ? 22 LEU A HG   4  
ATOM 4610  H HD11 . LEU A 1 22 ? 99.003  -1.725  -27.410 1.00 0.00 ? 22 LEU A HD11 4  
ATOM 4611  H HD12 . LEU A 1 22 ? 98.376  -3.147  -26.579 1.00 0.00 ? 22 LEU A HD12 4  
ATOM 4612  H HD13 . LEU A 1 22 ? 98.947  -1.760  -25.649 1.00 0.00 ? 22 LEU A HD13 4  
ATOM 4613  H HD21 . LEU A 1 22 ? 95.138  -2.173  -27.369 1.00 0.00 ? 22 LEU A HD21 4  
ATOM 4614  H HD22 . LEU A 1 22 ? 96.503  -3.223  -27.752 1.00 0.00 ? 22 LEU A HD22 4  
ATOM 4615  H HD23 . LEU A 1 22 ? 96.299  -1.695  -28.602 1.00 0.00 ? 22 LEU A HD23 4  
ATOM 4616  N N    . ILE A 1 23 ? 97.967  -2.680  -22.861 1.00 0.00 ? 23 ILE A N    4  
ATOM 4617  C CA   . ILE A 1 23 ? 99.218  -2.907  -22.145 1.00 0.00 ? 23 ILE A CA   4  
ATOM 4618  C C    . ILE A 1 23 ? 99.243  -4.313  -21.553 1.00 0.00 ? 23 ILE A C    4  
ATOM 4619  O O    . ILE A 1 23 ? 100.265 -5.001  -21.597 1.00 0.00 ? 23 ILE A O    4  
ATOM 4620  C CB   . ILE A 1 23 ? 99.400  -1.859  -21.045 1.00 0.00 ? 23 ILE A CB   4  
ATOM 4621  C CG1  . ILE A 1 23 ? 99.250  -0.457  -21.648 1.00 0.00 ? 23 ILE A CG1  4  
ATOM 4622  C CG2  . ILE A 1 23 ? 100.798 -2.000  -20.435 1.00 0.00 ? 23 ILE A CG2  4  
ATOM 4623  C CD1  . ILE A 1 23 ? 99.212  0.585   -20.529 1.00 0.00 ? 23 ILE A CD1  4  
ATOM 4624  H H    . ILE A 1 23 ? 97.311  -2.038  -22.506 1.00 0.00 ? 23 ILE A H    4  
ATOM 4625  H HA   . ILE A 1 23 ? 100.034 -2.816  -22.847 1.00 0.00 ? 23 ILE A HA   4  
ATOM 4626  H HB   . ILE A 1 23 ? 98.654  -2.007  -20.277 1.00 0.00 ? 23 ILE A HB   4  
ATOM 4627  H HG12 . ILE A 1 23 ? 100.090 -0.256  -22.298 1.00 0.00 ? 23 ILE A HG12 4  
ATOM 4628  H HG13 . ILE A 1 23 ? 98.335  -0.404  -22.216 1.00 0.00 ? 23 ILE A HG13 4  
ATOM 4629  H HG21 . ILE A 1 23 ? 100.845 -2.905  -19.848 1.00 0.00 ? 23 ILE A HG21 4  
ATOM 4630  H HG22 . ILE A 1 23 ? 101.006 -1.148  -19.804 1.00 0.00 ? 23 ILE A HG22 4  
ATOM 4631  H HG23 . ILE A 1 23 ? 101.531 -2.047  -21.226 1.00 0.00 ? 23 ILE A HG23 4  
ATOM 4632  H HD11 . ILE A 1 23 ? 99.270  1.575   -20.958 1.00 0.00 ? 23 ILE A HD11 4  
ATOM 4633  H HD12 . ILE A 1 23 ? 100.049 0.432   -19.864 1.00 0.00 ? 23 ILE A HD12 4  
ATOM 4634  H HD13 . ILE A 1 23 ? 98.289  0.486   -19.976 1.00 0.00 ? 23 ILE A HD13 4  
ATOM 4635  N N    . ALA A 1 24 ? 98.107  -4.739  -21.010 1.00 0.00 ? 24 ALA A N    4  
ATOM 4636  C CA   . ALA A 1 24 ? 98.005  -6.070  -20.425 1.00 0.00 ? 24 ALA A CA   4  
ATOM 4637  C C    . ALA A 1 24 ? 98.294  -7.132  -21.482 1.00 0.00 ? 24 ALA A C    4  
ATOM 4638  O O    . ALA A 1 24 ? 99.006  -8.104  -21.228 1.00 0.00 ? 24 ALA A O    4  
ATOM 4639  C CB   . ALA A 1 24 ? 96.602  -6.282  -19.858 1.00 0.00 ? 24 ALA A CB   4  
ATOM 4640  H H    . ALA A 1 24 ? 97.323  -4.153  -21.013 1.00 0.00 ? 24 ALA A H    4  
ATOM 4641  H HA   . ALA A 1 24 ? 98.725  -6.161  -19.626 1.00 0.00 ? 24 ALA A HA   4  
ATOM 4642  H HB1  . ALA A 1 24 ? 95.873  -6.149  -20.644 1.00 0.00 ? 24 ALA A HB1  4  
ATOM 4643  H HB2  . ALA A 1 24 ? 96.421  -5.562  -19.073 1.00 0.00 ? 24 ALA A HB2  4  
ATOM 4644  H HB3  . ALA A 1 24 ? 96.523  -7.281  -19.457 1.00 0.00 ? 24 ALA A HB3  4  
ATOM 4645  N N    . LEU A 1 25 ? 97.743  -6.934  -22.673 1.00 0.00 ? 25 LEU A N    4  
ATOM 4646  C CA   . LEU A 1 25 ? 97.955  -7.874  -23.764 1.00 0.00 ? 25 LEU A CA   4  
ATOM 4647  C C    . LEU A 1 25 ? 99.412  -7.826  -24.209 1.00 0.00 ? 25 LEU A C    4  
ATOM 4648  O O    . LEU A 1 25 ? 99.977  -8.832  -24.637 1.00 0.00 ? 25 LEU A O    4  
ATOM 4649  C CB   . LEU A 1 25 ? 97.033  -7.528  -24.940 1.00 0.00 ? 25 LEU A CB   4  
ATOM 4650  C CG   . LEU A 1 25 ? 97.274  -8.484  -26.119 1.00 0.00 ? 25 LEU A CG   4  
ATOM 4651  C CD1  . LEU A 1 25 ? 97.040  -9.939  -25.683 1.00 0.00 ? 25 LEU A CD1  4  
ATOM 4652  C CD2  . LEU A 1 25 ? 96.306  -8.125  -27.254 1.00 0.00 ? 25 LEU A CD2  4  
ATOM 4653  H H    . LEU A 1 25 ? 97.189  -6.138  -22.823 1.00 0.00 ? 25 LEU A H    4  
ATOM 4654  H HA   . LEU A 1 25 ? 97.725  -8.868  -23.414 1.00 0.00 ? 25 LEU A HA   4  
ATOM 4655  H HB2  . LEU A 1 25 ? 96.004  -7.610  -24.621 1.00 0.00 ? 25 LEU A HB2  4  
ATOM 4656  H HB3  . LEU A 1 25 ? 97.227  -6.514  -25.258 1.00 0.00 ? 25 LEU A HB3  4  
ATOM 4657  H HG   . LEU A 1 25 ? 98.289  -8.375  -26.471 1.00 0.00 ? 25 LEU A HG   4  
ATOM 4658  H HD11 . LEU A 1 25 ? 96.809  -10.547 -26.546 1.00 0.00 ? 25 LEU A HD11 4  
ATOM 4659  H HD12 . LEU A 1 25 ? 96.215  -9.982  -24.986 1.00 0.00 ? 25 LEU A HD12 4  
ATOM 4660  H HD13 . LEU A 1 25 ? 97.932  -10.319 -25.208 1.00 0.00 ? 25 LEU A HD13 4  
ATOM 4661  H HD21 . LEU A 1 25 ? 96.473  -8.786  -28.091 1.00 0.00 ? 25 LEU A HD21 4  
ATOM 4662  H HD22 . LEU A 1 25 ? 96.474  -7.104  -27.562 1.00 0.00 ? 25 LEU A HD22 4  
ATOM 4663  H HD23 . LEU A 1 25 ? 95.289  -8.233  -26.907 1.00 0.00 ? 25 LEU A HD23 4  
ATOM 4664  N N    . ALA A 1 26 ? 100.015 -6.644  -24.104 1.00 0.00 ? 26 ALA A N    4  
ATOM 4665  C CA   . ALA A 1 26 ? 101.408 -6.469  -24.498 1.00 0.00 ? 26 ALA A CA   4  
ATOM 4666  C C    . ALA A 1 26 ? 102.319 -7.372  -23.670 1.00 0.00 ? 26 ALA A C    4  
ATOM 4667  O O    . ALA A 1 26 ? 103.138 -8.107  -24.220 1.00 0.00 ? 26 ALA A O    4  
ATOM 4668  C CB   . ALA A 1 26 ? 101.823 -5.010  -24.310 1.00 0.00 ? 26 ALA A CB   4  
ATOM 4669  H H    . ALA A 1 26 ? 99.512  -5.876  -23.757 1.00 0.00 ? 26 ALA A H    4  
ATOM 4670  H HA   . ALA A 1 26 ? 101.512 -6.730  -25.540 1.00 0.00 ? 26 ALA A HA   4  
ATOM 4671  H HB1  . ALA A 1 26 ? 102.745 -4.827  -24.843 1.00 0.00 ? 26 ALA A HB1  4  
ATOM 4672  H HB2  . ALA A 1 26 ? 101.969 -4.808  -23.259 1.00 0.00 ? 26 ALA A HB2  4  
ATOM 4673  H HB3  . ALA A 1 26 ? 101.049 -4.363  -24.696 1.00 0.00 ? 26 ALA A HB3  4  
ATOM 4674  N N    . VAL A 1 27 ? 102.174 -7.315  -22.348 1.00 0.00 ? 27 VAL A N    4  
ATOM 4675  C CA   . VAL A 1 27 ? 103.001 -8.141  -21.473 1.00 0.00 ? 27 VAL A CA   4  
ATOM 4676  C C    . VAL A 1 27 ? 102.670 -9.617  -21.666 1.00 0.00 ? 27 VAL A C    4  
ATOM 4677  O O    . VAL A 1 27 ? 103.555 -10.471 -21.621 1.00 0.00 ? 27 VAL A O    4  
ATOM 4678  C CB   . VAL A 1 27 ? 102.789 -7.757  -20.005 1.00 0.00 ? 27 VAL A CB   4  
ATOM 4679  C CG1  . VAL A 1 27 ? 103.411 -6.388  -19.732 1.00 0.00 ? 27 VAL A CG1  4  
ATOM 4680  C CG2  . VAL A 1 27 ? 101.293 -7.703  -19.693 1.00 0.00 ? 27 VAL A CG2  4  
ATOM 4681  H H    . VAL A 1 27 ? 101.505 -6.710  -21.959 1.00 0.00 ? 27 VAL A H    4  
ATOM 4682  H HA   . VAL A 1 27 ? 104.039 -7.984  -21.727 1.00 0.00 ? 27 VAL A HA   4  
ATOM 4683  H HB   . VAL A 1 27 ? 103.261 -8.496  -19.372 1.00 0.00 ? 27 VAL A HB   4  
ATOM 4684  H HG11 . VAL A 1 27 ? 103.380 -6.187  -18.671 1.00 0.00 ? 27 VAL A HG11 4  
ATOM 4685  H HG12 . VAL A 1 27 ? 102.855 -5.627  -20.260 1.00 0.00 ? 27 VAL A HG12 4  
ATOM 4686  H HG13 . VAL A 1 27 ? 104.438 -6.383  -20.068 1.00 0.00 ? 27 VAL A HG13 4  
ATOM 4687  H HG21 . VAL A 1 27 ? 100.825 -6.950  -20.311 1.00 0.00 ? 27 VAL A HG21 4  
ATOM 4688  H HG22 . VAL A 1 27 ? 101.151 -7.452  -18.652 1.00 0.00 ? 27 VAL A HG22 4  
ATOM 4689  H HG23 . VAL A 1 27 ? 100.848 -8.664  -19.895 1.00 0.00 ? 27 VAL A HG23 4  
ATOM 4690  N N    . TYR A 1 28 ? 101.391 -9.912  -21.881 1.00 0.00 ? 28 TYR A N    4  
ATOM 4691  C CA   . TYR A 1 28 ? 100.962 -11.291 -22.078 1.00 0.00 ? 28 TYR A CA   4  
ATOM 4692  C C    . TYR A 1 28 ? 101.653 -11.901 -23.295 1.00 0.00 ? 28 TYR A C    4  
ATOM 4693  O O    . TYR A 1 28 ? 102.143 -13.029 -23.240 1.00 0.00 ? 28 TYR A O    4  
ATOM 4694  C CB   . TYR A 1 28 ? 99.445  -11.346 -22.270 1.00 0.00 ? 28 TYR A CB   4  
ATOM 4695  C CG   . TYR A 1 28 ? 98.993  -12.787 -22.269 1.00 0.00 ? 28 TYR A CG   4  
ATOM 4696  C CD1  . TYR A 1 28 ? 98.813  -13.463 -21.057 1.00 0.00 ? 28 TYR A CD1  4  
ATOM 4697  C CD2  . TYR A 1 28 ? 98.754  -13.448 -23.480 1.00 0.00 ? 28 TYR A CD2  4  
ATOM 4698  C CE1  . TYR A 1 28 ? 98.395  -14.798 -21.055 1.00 0.00 ? 28 TYR A CE1  4  
ATOM 4699  C CE2  . TYR A 1 28 ? 98.336  -14.784 -23.478 1.00 0.00 ? 28 TYR A CE2  4  
ATOM 4700  C CZ   . TYR A 1 28 ? 98.157  -15.459 -22.266 1.00 0.00 ? 28 TYR A CZ   4  
ATOM 4701  O OH   . TYR A 1 28 ? 97.745  -16.777 -22.263 1.00 0.00 ? 28 TYR A OH   4  
ATOM 4702  H H    . TYR A 1 28 ? 100.726 -9.189  -21.905 1.00 0.00 ? 28 TYR A H    4  
ATOM 4703  H HA   . TYR A 1 28 ? 101.223 -11.866 -21.203 1.00 0.00 ? 28 TYR A HA   4  
ATOM 4704  H HB2  . TYR A 1 28 ? 98.962  -10.815 -21.463 1.00 0.00 ? 28 TYR A HB2  4  
ATOM 4705  H HB3  . TYR A 1 28 ? 99.185  -10.887 -23.212 1.00 0.00 ? 28 TYR A HB3  4  
ATOM 4706  H HD1  . TYR A 1 28 ? 98.997  -12.953 -20.122 1.00 0.00 ? 28 TYR A HD1  4  
ATOM 4707  H HD2  . TYR A 1 28 ? 98.893  -12.926 -24.416 1.00 0.00 ? 28 TYR A HD2  4  
ATOM 4708  H HE1  . TYR A 1 28 ? 98.257  -15.320 -20.119 1.00 0.00 ? 28 TYR A HE1  4  
ATOM 4709  H HE2  . TYR A 1 28 ? 98.152  -15.293 -24.413 1.00 0.00 ? 28 TYR A HE2  4  
ATOM 4710  H HH   . TYR A 1 28 ? 96.871  -16.815 -22.660 1.00 0.00 ? 28 TYR A HH   4  
ATOM 4711  N N    . PHE A 1 29 ? 101.686 -11.149 -24.391 1.00 0.00 ? 29 PHE A N    4  
ATOM 4712  C CA   . PHE A 1 29 ? 102.320 -11.629 -25.615 1.00 0.00 ? 29 PHE A CA   4  
ATOM 4713  C C    . PHE A 1 29 ? 103.818 -11.820 -25.408 1.00 0.00 ? 29 PHE A C    4  
ATOM 4714  O O    . PHE A 1 29 ? 104.400 -12.797 -25.881 1.00 0.00 ? 29 PHE A O    4  
ATOM 4715  C CB   . PHE A 1 29 ? 102.084 -10.631 -26.751 1.00 0.00 ? 29 PHE A CB   4  
ATOM 4716  C CG   . PHE A 1 29 ? 102.572 -11.224 -28.052 1.00 0.00 ? 29 PHE A CG   4  
ATOM 4717  C CD1  . PHE A 1 29 ? 101.832 -12.233 -28.681 1.00 0.00 ? 29 PHE A CD1  4  
ATOM 4718  C CD2  . PHE A 1 29 ? 103.765 -10.769 -28.629 1.00 0.00 ? 29 PHE A CD2  4  
ATOM 4719  C CE1  . PHE A 1 29 ? 102.283 -12.785 -29.887 1.00 0.00 ? 29 PHE A CE1  4  
ATOM 4720  C CE2  . PHE A 1 29 ? 104.216 -11.322 -29.834 1.00 0.00 ? 29 PHE A CE2  4  
ATOM 4721  C CZ   . PHE A 1 29 ? 103.475 -12.330 -30.463 1.00 0.00 ? 29 PHE A CZ   4  
ATOM 4722  H H    . PHE A 1 29 ? 101.280 -10.257 -24.377 1.00 0.00 ? 29 PHE A H    4  
ATOM 4723  H HA   . PHE A 1 29 ? 101.880 -12.576 -25.888 1.00 0.00 ? 29 PHE A HA   4  
ATOM 4724  H HB2  . PHE A 1 29 ? 101.027 -10.416 -26.827 1.00 0.00 ? 29 PHE A HB2  4  
ATOM 4725  H HB3  . PHE A 1 29 ? 102.623 -9.718  -26.545 1.00 0.00 ? 29 PHE A HB3  4  
ATOM 4726  H HD1  . PHE A 1 29 ? 100.913 -12.583 -28.237 1.00 0.00 ? 29 PHE A HD1  4  
ATOM 4727  H HD2  . PHE A 1 29 ? 104.338 -9.991  -28.145 1.00 0.00 ? 29 PHE A HD2  4  
ATOM 4728  H HE1  . PHE A 1 29 ? 101.711 -13.562 -30.370 1.00 0.00 ? 29 PHE A HE1  4  
ATOM 4729  H HE2  . PHE A 1 29 ? 105.135 -10.971 -30.279 1.00 0.00 ? 29 PHE A HE2  4  
ATOM 4730  H HZ   . PHE A 1 29 ? 103.822 -12.756 -31.392 1.00 0.00 ? 29 PHE A HZ   4  
ATOM 4731  N N    . LEU A 1 30 ? 104.438 -10.880 -24.702 1.00 0.00 ? 30 LEU A N    4  
ATOM 4732  C CA   . LEU A 1 30 ? 105.871 -10.952 -24.442 1.00 0.00 ? 30 LEU A CA   4  
ATOM 4733  C C    . LEU A 1 30 ? 106.217 -12.222 -23.671 1.00 0.00 ? 30 LEU A C    4  
ATOM 4734  O O    . LEU A 1 30 ? 107.219 -12.879 -23.954 1.00 0.00 ? 30 LEU A O    4  
ATOM 4735  C CB   . LEU A 1 30 ? 106.314 -9.725  -23.635 1.00 0.00 ? 30 LEU A CB   4  
ATOM 4736  C CG   . LEU A 1 30 ? 107.855 -9.629  -23.611 1.00 0.00 ? 30 LEU A CG   4  
ATOM 4737  C CD1  . LEU A 1 30 ? 108.365 -8.921  -24.873 1.00 0.00 ? 30 LEU A CD1  4  
ATOM 4738  C CD2  . LEU A 1 30 ? 108.301 -8.832  -22.380 1.00 0.00 ? 30 LEU A CD2  4  
ATOM 4739  H H    . LEU A 1 30 ? 103.923 -10.123 -24.353 1.00 0.00 ? 30 LEU A H    4  
ATOM 4740  H HA   . LEU A 1 30 ? 106.396 -10.960 -25.383 1.00 0.00 ? 30 LEU A HA   4  
ATOM 4741  H HB2  . LEU A 1 30 ? 105.899 -8.834  -24.082 1.00 0.00 ? 30 LEU A HB2  4  
ATOM 4742  H HB3  . LEU A 1 30 ? 105.945 -9.820  -22.624 1.00 0.00 ? 30 LEU A HB3  4  
ATOM 4743  H HG   . LEU A 1 30 ? 108.279 -10.624 -23.564 1.00 0.00 ? 30 LEU A HG   4  
ATOM 4744  H HD11 . LEU A 1 30 ? 108.179 -9.536  -25.739 1.00 0.00 ? 30 LEU A HD11 4  
ATOM 4745  H HD12 . LEU A 1 30 ? 109.427 -8.747  -24.780 1.00 0.00 ? 30 LEU A HD12 4  
ATOM 4746  H HD13 . LEU A 1 30 ? 107.857 -7.974  -24.988 1.00 0.00 ? 30 LEU A HD13 4  
ATOM 4747  H HD21 . LEU A 1 30 ? 109.379 -8.764  -22.367 1.00 0.00 ? 30 LEU A HD21 4  
ATOM 4748  H HD22 . LEU A 1 30 ? 107.960 -9.330  -21.485 1.00 0.00 ? 30 LEU A HD22 4  
ATOM 4749  H HD23 . LEU A 1 30 ? 107.879 -7.838  -22.423 1.00 0.00 ? 30 LEU A HD23 4  
ATOM 4750  N N    . GLY A 1 31 ? 105.381 -12.562 -22.694 1.00 0.00 ? 31 GLY A N    4  
ATOM 4751  C CA   . GLY A 1 31 ? 105.610 -13.754 -21.886 1.00 0.00 ? 31 GLY A CA   4  
ATOM 4752  C C    . GLY A 1 31 ? 105.914 -14.963 -22.764 1.00 0.00 ? 31 GLY A C    4  
ATOM 4753  O O    . GLY A 1 31 ? 105.401 -15.079 -23.877 1.00 0.00 ? 31 GLY A O    4  
ATOM 4754  H H    . GLY A 1 31 ? 104.600 -11.999 -22.511 1.00 0.00 ? 31 GLY A H    4  
ATOM 4755  H HA2  . GLY A 1 31 ? 106.446 -13.577 -21.223 1.00 0.00 ? 31 GLY A HA2  4  
ATOM 4756  H HA3  . GLY A 1 31 ? 104.728 -13.958 -21.298 1.00 0.00 ? 31 GLY A HA3  4  
ATOM 4757  N N    . ARG A 1 32 ? 106.750 -15.862 -22.254 1.00 0.00 ? 32 ARG A N    4  
ATOM 4758  C CA   . ARG A 1 32 ? 107.116 -17.064 -22.997 1.00 0.00 ? 32 ARG A CA   4  
ATOM 4759  C C    . ARG A 1 32 ? 107.917 -18.014 -22.112 1.00 0.00 ? 32 ARG A C    4  
ATOM 4760  O O    . ARG A 1 32 ? 109.123 -18.179 -22.294 1.00 0.00 ? 32 ARG A O    4  
ATOM 4761  C CB   . ARG A 1 32 ? 107.945 -16.688 -24.227 1.00 0.00 ? 32 ARG A CB   4  
ATOM 4762  C CG   . ARG A 1 32 ? 108.140 -17.922 -25.112 1.00 0.00 ? 32 ARG A CG   4  
ATOM 4763  C CD   . ARG A 1 32 ? 109.067 -17.574 -26.278 1.00 0.00 ? 32 ARG A CD   4  
ATOM 4764  N NE   . ARG A 1 32 ? 108.403 -16.656 -27.195 1.00 0.00 ? 32 ARG A NE   4  
ATOM 4765  C CZ   . ARG A 1 32 ? 109.024 -16.196 -28.277 1.00 0.00 ? 32 ARG A CZ   4  
ATOM 4766  N NH1  . ARG A 1 32 ? 110.249 -16.568 -28.533 1.00 0.00 ? 32 ARG A NH1  4  
ATOM 4767  N NH2  . ARG A 1 32 ? 108.409 -15.374 -29.083 1.00 0.00 ? 32 ARG A NH2  4  
ATOM 4768  H H    . ARG A 1 32 ? 107.126 -15.717 -21.361 1.00 0.00 ? 32 ARG A H    4  
ATOM 4769  H HA   . ARG A 1 32 ? 106.216 -17.563 -23.323 1.00 0.00 ? 32 ARG A HA   4  
ATOM 4770  H HB2  . ARG A 1 32 ? 107.430 -15.921 -24.787 1.00 0.00 ? 32 ARG A HB2  4  
ATOM 4771  H HB3  . ARG A 1 32 ? 108.909 -16.318 -23.912 1.00 0.00 ? 32 ARG A HB3  4  
ATOM 4772  H HG2  . ARG A 1 32 ? 108.579 -18.718 -24.529 1.00 0.00 ? 32 ARG A HG2  4  
ATOM 4773  H HG3  . ARG A 1 32 ? 107.185 -18.243 -25.498 1.00 0.00 ? 32 ARG A HG3  4  
ATOM 4774  H HD2  . ARG A 1 32 ? 109.963 -17.110 -25.897 1.00 0.00 ? 32 ARG A HD2  4  
ATOM 4775  H HD3  . ARG A 1 32 ? 109.331 -18.480 -26.806 1.00 0.00 ? 32 ARG A HD3  4  
ATOM 4776  H HE   . ARG A 1 32 ? 107.484 -16.372 -27.011 1.00 0.00 ? 32 ARG A HE   4  
ATOM 4777  H HH11 . ARG A 1 32 ? 110.719 -17.198 -27.916 1.00 0.00 ? 32 ARG A HH11 4  
ATOM 4778  H HH12 . ARG A 1 32 ? 110.716 -16.224 -29.348 1.00 0.00 ? 32 ARG A HH12 4  
ATOM 4779  H HH21 . ARG A 1 32 ? 107.470 -15.089 -28.887 1.00 0.00 ? 32 ARG A HH21 4  
ATOM 4780  H HH22 . ARG A 1 32 ? 108.876 -15.029 -29.897 1.00 0.00 ? 32 ARG A HH22 4  
ATOM 4781  N N    . LEU A 1 33 ? 107.238 -18.636 -21.153 1.00 0.00 ? 33 LEU A N    4  
ATOM 4782  C CA   . LEU A 1 33 ? 107.896 -19.568 -20.244 1.00 0.00 ? 33 LEU A CA   4  
ATOM 4783  C C    . LEU A 1 33 ? 109.140 -18.925 -19.634 1.00 0.00 ? 33 LEU A C    4  
ATOM 4784  O O    . LEU A 1 33 ? 110.259 -19.393 -19.847 1.00 0.00 ? 33 LEU A O    4  
ATOM 4785  C CB   . LEU A 1 33 ? 108.291 -20.844 -20.999 1.00 0.00 ? 33 LEU A CB   4  
ATOM 4786  C CG   . LEU A 1 33 ? 107.053 -21.720 -21.225 1.00 0.00 ? 33 LEU A CG   4  
ATOM 4787  C CD1  . LEU A 1 33 ? 105.965 -20.908 -21.936 1.00 0.00 ? 33 LEU A CD1  4  
ATOM 4788  C CD2  . LEU A 1 33 ? 107.441 -22.925 -22.086 1.00 0.00 ? 33 LEU A CD2  4  
ATOM 4789  H H    . LEU A 1 33 ? 106.277 -18.465 -21.054 1.00 0.00 ? 33 LEU A H    4  
ATOM 4790  H HA   . LEU A 1 33 ? 107.212 -19.827 -19.451 1.00 0.00 ? 33 LEU A HA   4  
ATOM 4791  H HB2  . LEU A 1 33 ? 108.721 -20.577 -21.953 1.00 0.00 ? 33 LEU A HB2  4  
ATOM 4792  H HB3  . LEU A 1 33 ? 109.016 -21.396 -20.420 1.00 0.00 ? 33 LEU A HB3  4  
ATOM 4793  H HG   . LEU A 1 33 ? 106.679 -22.062 -20.272 1.00 0.00 ? 33 LEU A HG   4  
ATOM 4794  H HD11 . LEU A 1 33 ? 105.238 -21.580 -22.371 1.00 0.00 ? 33 LEU A HD11 4  
ATOM 4795  H HD12 . LEU A 1 33 ? 106.411 -20.309 -22.717 1.00 0.00 ? 33 LEU A HD12 4  
ATOM 4796  H HD13 . LEU A 1 33 ? 105.474 -20.263 -21.224 1.00 0.00 ? 33 LEU A HD13 4  
ATOM 4797  H HD21 . LEU A 1 33 ? 107.648 -22.596 -23.093 1.00 0.00 ? 33 LEU A HD21 4  
ATOM 4798  H HD22 . LEU A 1 33 ? 106.625 -23.633 -22.100 1.00 0.00 ? 33 LEU A HD22 4  
ATOM 4799  H HD23 . LEU A 1 33 ? 108.320 -23.396 -21.672 1.00 0.00 ? 33 LEU A HD23 4  
ATOM 4800  N N    . GLY A 1 34 ? 108.936 -17.854 -18.876 1.00 0.00 ? 34 GLY A N    4  
ATOM 4801  C CA   . GLY A 1 34 ? 110.048 -17.156 -18.241 1.00 0.00 ? 34 GLY A CA   4  
ATOM 4802  C C    . GLY A 1 34 ? 109.543 -16.075 -17.293 1.00 0.00 ? 34 GLY A C    4  
ATOM 4803  O O    . GLY A 1 34 ? 110.332 -15.357 -16.678 1.00 0.00 ? 34 GLY A O    4  
ATOM 4804  H H    . GLY A 1 34 ? 108.021 -17.525 -18.743 1.00 0.00 ? 34 GLY A H    4  
ATOM 4805  H HA2  . GLY A 1 34 ? 110.641 -17.868 -17.686 1.00 0.00 ? 34 GLY A HA2  4  
ATOM 4806  H HA3  . GLY A 1 34 ? 110.661 -16.698 -19.002 1.00 0.00 ? 34 GLY A HA3  4  
ATOM 4807  N N    . THR A 1 35 ? 108.224 -15.965 -17.177 1.00 0.00 ? 35 THR A N    4  
ATOM 4808  C CA   . THR A 1 35 ? 107.624 -14.967 -16.298 1.00 0.00 ? 35 THR A CA   4  
ATOM 4809  C C    . THR A 1 35 ? 107.793 -15.371 -14.836 1.00 0.00 ? 35 THR A C    4  
ATOM 4810  O O    . THR A 1 35 ? 108.337 -16.432 -14.536 1.00 0.00 ? 35 THR A O    4  
ATOM 4811  C CB   . THR A 1 35 ? 106.136 -14.815 -16.619 1.00 0.00 ? 35 THR A CB   4  
ATOM 4812  O OG1  . THR A 1 35 ? 105.565 -13.838 -15.758 1.00 0.00 ? 35 THR A OG1  4  
ATOM 4813  C CG2  . THR A 1 35 ? 105.427 -16.154 -16.413 1.00 0.00 ? 35 THR A CG2  4  
ATOM 4814  H H    . THR A 1 35 ? 107.644 -16.565 -17.690 1.00 0.00 ? 35 THR A H    4  
ATOM 4815  H HA   . THR A 1 35 ? 108.115 -14.019 -16.458 1.00 0.00 ? 35 THR A HA   4  
ATOM 4816  H HB   . THR A 1 35 ? 106.018 -14.504 -17.645 1.00 0.00 ? 35 THR A HB   4  
ATOM 4817  H HG1  . THR A 1 35 ? 106.122 -13.057 -15.786 1.00 0.00 ? 35 THR A HG1  4  
ATOM 4818  H HG21 . THR A 1 35 ? 104.399 -16.071 -16.732 1.00 0.00 ? 35 THR A HG21 4  
ATOM 4819  H HG22 . THR A 1 35 ? 105.460 -16.423 -15.368 1.00 0.00 ? 35 THR A HG22 4  
ATOM 4820  H HG23 . THR A 1 35 ? 105.924 -16.916 -16.995 1.00 0.00 ? 35 THR A HG23 4  
ATOM 4821  N N    . ALA A 1 36 ? 107.322 -14.516 -13.933 1.00 0.00 ? 36 ALA A N    4  
ATOM 4822  C CA   . ALA A 1 36 ? 107.427 -14.795 -12.503 1.00 0.00 ? 36 ALA A CA   4  
ATOM 4823  C C    . ALA A 1 36 ? 106.390 -13.992 -11.723 1.00 0.00 ? 36 ALA A C    4  
ATOM 4824  O O    . ALA A 1 36 ? 106.216 -12.795 -11.953 1.00 0.00 ? 36 ALA A O    4  
ATOM 4825  C CB   . ALA A 1 36 ? 108.829 -14.442 -12.005 1.00 0.00 ? 36 ALA A CB   4  
ATOM 4826  H H    . ALA A 1 36 ? 106.898 -13.685 -14.231 1.00 0.00 ? 36 ALA A H    4  
ATOM 4827  H HA   . ALA A 1 36 ? 107.252 -15.847 -12.336 1.00 0.00 ? 36 ALA A HA   4  
ATOM 4828  H HB1  . ALA A 1 36 ? 108.885 -14.609 -10.939 1.00 0.00 ? 36 ALA A HB1  4  
ATOM 4829  H HB2  . ALA A 1 36 ? 109.036 -13.404 -12.217 1.00 0.00 ? 36 ALA A HB2  4  
ATOM 4830  H HB3  . ALA A 1 36 ? 109.556 -15.064 -12.505 1.00 0.00 ? 36 ALA A HB3  4  
ATOM 4831  N N    . GLU A 1 37 ? 105.707 -14.660 -10.799 1.00 0.00 ? 37 GLU A N    4  
ATOM 4832  C CA   . GLU A 1 37 ? 104.690 -14.000 -9.988  1.00 0.00 ? 37 GLU A CA   4  
ATOM 4833  C C    . GLU A 1 37 ? 103.642 -13.337 -10.878 1.00 0.00 ? 37 GLU A C    4  
ATOM 4834  O O    . GLU A 1 37 ? 103.507 -12.114 -10.893 1.00 0.00 ? 37 GLU A O    4  
ATOM 4835  C CB   . GLU A 1 37 ? 105.341 -12.948 -9.090  1.00 0.00 ? 37 GLU A CB   4  
ATOM 4836  C CG   . GLU A 1 37 ? 104.340 -12.489 -8.028  1.00 0.00 ? 37 GLU A CG   4  
ATOM 4837  C CD   . GLU A 1 37 ? 104.107 -13.605 -7.015  1.00 0.00 ? 37 GLU A CD   4  
ATOM 4838  O OE1  . GLU A 1 37 ? 104.941 -14.493 -6.939  1.00 0.00 ? 37 GLU A OE1  4  
ATOM 4839  O OE2  . GLU A 1 37 ? 103.098 -13.556 -6.332  1.00 0.00 ? 37 GLU A OE2  4  
ATOM 4840  H H    . GLU A 1 37 ? 105.889 -15.612 -10.661 1.00 0.00 ? 37 GLU A H    4  
ATOM 4841  H HA   . GLU A 1 37 ? 104.205 -14.737 -9.366  1.00 0.00 ? 37 GLU A HA   4  
ATOM 4842  H HB2  . GLU A 1 37 ? 106.210 -13.375 -8.607  1.00 0.00 ? 37 GLU A HB2  4  
ATOM 4843  H HB3  . GLU A 1 37 ? 105.643 -12.101 -9.688  1.00 0.00 ? 37 GLU A HB3  4  
ATOM 4844  H HG2  . GLU A 1 37 ? 104.730 -11.620 -7.521  1.00 0.00 ? 37 GLU A HG2  4  
ATOM 4845  H HG3  . GLU A 1 37 ? 103.404 -12.237 -8.503  1.00 0.00 ? 37 GLU A HG3  4  
ATOM 4846  N N    . VAL A 1 38 ? 102.900 -14.158 -11.616 1.00 0.00 ? 38 VAL A N    4  
ATOM 4847  C CA   . VAL A 1 38 ? 101.864 -13.649 -12.508 1.00 0.00 ? 38 VAL A CA   4  
ATOM 4848  C C    . VAL A 1 38 ? 100.710 -13.050 -11.709 1.00 0.00 ? 38 VAL A C    4  
ATOM 4849  O O    . VAL A 1 38 ? 99.988  -12.181 -12.198 1.00 0.00 ? 38 VAL A O    4  
ATOM 4850  C CB   . VAL A 1 38 ? 101.340 -14.780 -13.395 1.00 0.00 ? 38 VAL A CB   4  
ATOM 4851  C CG1  . VAL A 1 38 ? 102.443 -15.226 -14.357 1.00 0.00 ? 38 VAL A CG1  4  
ATOM 4852  C CG2  . VAL A 1 38 ? 100.920 -15.961 -12.519 1.00 0.00 ? 38 VAL A CG2  4  
ATOM 4853  H H    . VAL A 1 38 ? 103.055 -15.123 -11.561 1.00 0.00 ? 38 VAL A H    4  
ATOM 4854  H HA   . VAL A 1 38 ? 102.289 -12.882 -13.137 1.00 0.00 ? 38 VAL A HA   4  
ATOM 4855  H HB   . VAL A 1 38 ? 100.490 -14.427 -13.963 1.00 0.00 ? 38 VAL A HB   4  
ATOM 4856  H HG11 . VAL A 1 38 ? 102.761 -14.386 -14.955 1.00 0.00 ? 38 VAL A HG11 4  
ATOM 4857  H HG12 . VAL A 1 38 ? 102.064 -16.005 -15.002 1.00 0.00 ? 38 VAL A HG12 4  
ATOM 4858  H HG13 . VAL A 1 38 ? 103.281 -15.605 -13.792 1.00 0.00 ? 38 VAL A HG13 4  
ATOM 4859  H HG21 . VAL A 1 38 ? 100.229 -15.620 -11.762 1.00 0.00 ? 38 VAL A HG21 4  
ATOM 4860  H HG22 . VAL A 1 38 ? 101.792 -16.385 -12.045 1.00 0.00 ? 38 VAL A HG22 4  
ATOM 4861  H HG23 . VAL A 1 38 ? 100.441 -16.711 -13.131 1.00 0.00 ? 38 VAL A HG23 4  
ATOM 4862  N N    . LEU A 1 39 ? 100.539 -13.527 -10.480 1.00 0.00 ? 39 LEU A N    4  
ATOM 4863  C CA   . LEU A 1 39 ? 99.465  -13.038 -9.622  1.00 0.00 ? 39 LEU A CA   4  
ATOM 4864  C C    . LEU A 1 39 ? 99.408  -11.513 -9.647  1.00 0.00 ? 39 LEU A C    4  
ATOM 4865  O O    . LEU A 1 39 ? 98.340  -10.921 -9.487  1.00 0.00 ? 39 LEU A O    4  
ATOM 4866  C CB   . LEU A 1 39 ? 99.689  -13.532 -8.186  1.00 0.00 ? 39 LEU A CB   4  
ATOM 4867  C CG   . LEU A 1 39 ? 98.636  -12.941 -7.236  1.00 0.00 ? 39 LEU A CG   4  
ATOM 4868  C CD1  . LEU A 1 39 ? 97.222  -13.261 -7.743  1.00 0.00 ? 39 LEU A CD1  4  
ATOM 4869  C CD2  . LEU A 1 39 ? 98.829  -13.550 -5.842  1.00 0.00 ? 39 LEU A CD2  4  
ATOM 4870  H H    . LEU A 1 39 ? 101.142 -14.222 -10.146 1.00 0.00 ? 39 LEU A H    4  
ATOM 4871  H HA   . LEU A 1 39 ? 98.529  -13.430 -9.985  1.00 0.00 ? 39 LEU A HA   4  
ATOM 4872  H HB2  . LEU A 1 39 ? 99.620  -14.610 -8.168  1.00 0.00 ? 39 LEU A HB2  4  
ATOM 4873  H HB3  . LEU A 1 39 ? 100.673 -13.233 -7.857  1.00 0.00 ? 39 LEU A HB3  4  
ATOM 4874  H HG   . LEU A 1 39 ? 98.762  -11.870 -7.176  1.00 0.00 ? 39 LEU A HG   4  
ATOM 4875  H HD11 . LEU A 1 39 ? 96.516  -13.183 -6.927  1.00 0.00 ? 39 LEU A HD11 4  
ATOM 4876  H HD12 . LEU A 1 39 ? 97.198  -14.265 -8.141  1.00 0.00 ? 39 LEU A HD12 4  
ATOM 4877  H HD13 . LEU A 1 39 ? 96.951  -12.560 -8.517  1.00 0.00 ? 39 LEU A HD13 4  
ATOM 4878  H HD21 . LEU A 1 39 ? 98.505  -14.581 -5.852  1.00 0.00 ? 39 LEU A HD21 4  
ATOM 4879  H HD22 . LEU A 1 39 ? 98.243  -12.997 -5.124  1.00 0.00 ? 39 LEU A HD22 4  
ATOM 4880  H HD23 . LEU A 1 39 ? 99.873  -13.502 -5.571  1.00 0.00 ? 39 LEU A HD23 4  
ATOM 4881  N N    . GLY A 1 40 ? 100.559 -10.882 -9.851  1.00 0.00 ? 40 GLY A N    4  
ATOM 4882  C CA   . GLY A 1 40 ? 100.620 -9.425  -9.895  1.00 0.00 ? 40 GLY A CA   4  
ATOM 4883  C C    . GLY A 1 40 ? 99.834  -8.878  -11.081 1.00 0.00 ? 40 GLY A C    4  
ATOM 4884  O O    . GLY A 1 40 ? 99.011  -7.972  -10.932 1.00 0.00 ? 40 GLY A O    4  
ATOM 4885  H H    . GLY A 1 40 ? 101.380 -11.403 -9.974  1.00 0.00 ? 40 GLY A H    4  
ATOM 4886  H HA2  . GLY A 1 40 ? 100.207 -9.026  -8.979  1.00 0.00 ? 40 GLY A HA2  4  
ATOM 4887  H HA3  . GLY A 1 40 ? 101.651 -9.116  -9.983  1.00 0.00 ? 40 GLY A HA3  4  
ATOM 4888  N N    . ILE A 1 41 ? 100.093 -9.433  -12.262 1.00 0.00 ? 41 ILE A N    4  
ATOM 4889  C CA   . ILE A 1 41 ? 99.408  -8.993  -13.474 1.00 0.00 ? 41 ILE A CA   4  
ATOM 4890  C C    . ILE A 1 41 ? 97.898  -9.146  -13.320 1.00 0.00 ? 41 ILE A C    4  
ATOM 4891  O O    . ILE A 1 41 ? 97.129  -8.249  -13.673 1.00 0.00 ? 41 ILE A O    4  
ATOM 4892  C CB   . ILE A 1 41 ? 99.887  -9.822  -14.668 1.00 0.00 ? 41 ILE A CB   4  
ATOM 4893  C CG1  . ILE A 1 41 ? 101.418 -9.926  -14.650 1.00 0.00 ? 41 ILE A CG1  4  
ATOM 4894  C CG2  . ILE A 1 41 ? 99.435  -9.156  -15.969 1.00 0.00 ? 41 ILE A CG2  4  
ATOM 4895  C CD1  . ILE A 1 41 ? 102.040 -8.532  -14.513 1.00 0.00 ? 41 ILE A CD1  4  
ATOM 4896  H H    . ILE A 1 41 ? 100.760 -10.150 -12.319 1.00 0.00 ? 41 ILE A H    4  
ATOM 4897  H HA   . ILE A 1 41 ? 99.641  -7.955  -13.652 1.00 0.00 ? 41 ILE A HA   4  
ATOM 4898  H HB   . ILE A 1 41 ? 99.458  -10.813 -14.607 1.00 0.00 ? 41 ILE A HB   4  
ATOM 4899  H HG12 . ILE A 1 41 ? 101.724 -10.539 -13.815 1.00 0.00 ? 41 ILE A HG12 4  
ATOM 4900  H HG13 . ILE A 1 41 ? 101.756 -10.379 -15.569 1.00 0.00 ? 41 ILE A HG13 4  
ATOM 4901  H HG21 . ILE A 1 41 ? 99.940  -8.208  -16.083 1.00 0.00 ? 41 ILE A HG21 4  
ATOM 4902  H HG22 . ILE A 1 41 ? 98.367  -8.994  -15.938 1.00 0.00 ? 41 ILE A HG22 4  
ATOM 4903  H HG23 . ILE A 1 41 ? 99.677  -9.796  -16.804 1.00 0.00 ? 41 ILE A HG23 4  
ATOM 4904  H HD11 . ILE A 1 41 ? 101.518 -7.836  -15.151 1.00 0.00 ? 41 ILE A HD11 4  
ATOM 4905  H HD12 . ILE A 1 41 ? 103.079 -8.573  -14.801 1.00 0.00 ? 41 ILE A HD12 4  
ATOM 4906  H HD13 . ILE A 1 41 ? 101.966 -8.204  -13.485 1.00 0.00 ? 41 ILE A HD13 4  
ATOM 4907  N N    . ILE A 1 42 ? 97.478  -10.286 -12.791 1.00 0.00 ? 42 ILE A N    4  
ATOM 4908  C CA   . ILE A 1 42 ? 96.058  -10.544 -12.595 1.00 0.00 ? 42 ILE A CA   4  
ATOM 4909  C C    . ILE A 1 42 ? 95.465  -9.550  -11.603 1.00 0.00 ? 42 ILE A C    4  
ATOM 4910  O O    . ILE A 1 42 ? 94.325  -9.117  -11.753 1.00 0.00 ? 42 ILE A O    4  
ATOM 4911  C CB   . ILE A 1 42 ? 95.853  -11.968 -12.075 1.00 0.00 ? 42 ILE A CB   4  
ATOM 4912  C CG1  . ILE A 1 42 ? 96.503  -12.961 -13.040 1.00 0.00 ? 42 ILE A CG1  4  
ATOM 4913  C CG2  . ILE A 1 42 ? 94.354  -12.262 -11.974 1.00 0.00 ? 42 ILE A CG2  4  
ATOM 4914  C CD1  . ILE A 1 42 ? 96.478  -14.362 -12.425 1.00 0.00 ? 42 ILE A CD1  4  
ATOM 4915  H H    . ILE A 1 42 ? 98.133  -10.966 -12.527 1.00 0.00 ? 42 ILE A H    4  
ATOM 4916  H HA   . ILE A 1 42 ? 95.549  -10.442 -13.541 1.00 0.00 ? 42 ILE A HA   4  
ATOM 4917  H HB   . ILE A 1 42 ? 96.304  -12.063 -11.098 1.00 0.00 ? 42 ILE A HB   4  
ATOM 4918  H HG12 . ILE A 1 42 ? 95.957  -12.968 -13.972 1.00 0.00 ? 42 ILE A HG12 4  
ATOM 4919  H HG13 . ILE A 1 42 ? 97.526  -12.669 -13.223 1.00 0.00 ? 42 ILE A HG13 4  
ATOM 4920  H HG21 . ILE A 1 42 ? 93.888  -12.081 -12.931 1.00 0.00 ? 42 ILE A HG21 4  
ATOM 4921  H HG22 . ILE A 1 42 ? 93.911  -11.618 -11.229 1.00 0.00 ? 42 ILE A HG22 4  
ATOM 4922  H HG23 . ILE A 1 42 ? 94.209  -13.293 -11.692 1.00 0.00 ? 42 ILE A HG23 4  
ATOM 4923  H HD11 . ILE A 1 42 ? 96.985  -14.346 -11.472 1.00 0.00 ? 42 ILE A HD11 4  
ATOM 4924  H HD12 . ILE A 1 42 ? 96.977  -15.054 -13.086 1.00 0.00 ? 42 ILE A HD12 4  
ATOM 4925  H HD13 . ILE A 1 42 ? 95.454  -14.674 -12.282 1.00 0.00 ? 42 ILE A HD13 4  
ATOM 4926  N N    . SER A 1 43 ? 96.246  -9.198  -10.586 1.00 0.00 ? 43 SER A N    4  
ATOM 4927  C CA   . SER A 1 43 ? 95.784  -8.263  -9.565  1.00 0.00 ? 43 SER A CA   4  
ATOM 4928  C C    . SER A 1 43 ? 95.445  -6.900  -10.166 1.00 0.00 ? 43 SER A C    4  
ATOM 4929  O O    . SER A 1 43 ? 94.364  -6.365  -9.928  1.00 0.00 ? 43 SER A O    4  
ATOM 4930  C CB   . SER A 1 43 ? 96.858  -8.095  -8.491  1.00 0.00 ? 43 SER A CB   4  
ATOM 4931  O OG   . SER A 1 43 ? 97.099  -9.349  -7.867  1.00 0.00 ? 43 SER A OG   4  
ATOM 4932  H H    . SER A 1 43 ? 97.145  -9.582  -10.514 1.00 0.00 ? 43 SER A H    4  
ATOM 4933  H HA   . SER A 1 43 ? 94.896  -8.667  -9.103  1.00 0.00 ? 43 SER A HA   4  
ATOM 4934  H HB2  . SER A 1 43 ? 97.770  -7.741  -8.941  1.00 0.00 ? 43 SER A HB2  4  
ATOM 4935  H HB3  . SER A 1 43 ? 96.519  -7.375  -7.756  1.00 0.00 ? 43 SER A HB3  4  
ATOM 4936  H HG   . SER A 1 43 ? 96.269  -9.660  -7.494  1.00 0.00 ? 43 SER A HG   4  
ATOM 4937  N N    . ILE A 1 44 ? 96.372  -6.333  -10.933 1.00 0.00 ? 44 ILE A N    4  
ATOM 4938  C CA   . ILE A 1 44 ? 96.136  -5.021  -11.536 1.00 0.00 ? 44 ILE A CA   4  
ATOM 4939  C C    . ILE A 1 44 ? 94.952  -5.069  -12.503 1.00 0.00 ? 44 ILE A C    4  
ATOM 4940  O O    . ILE A 1 44 ? 94.103  -4.173  -12.501 1.00 0.00 ? 44 ILE A O    4  
ATOM 4941  C CB   . ILE A 1 44 ? 97.394  -4.525  -12.264 1.00 0.00 ? 44 ILE A CB   4  
ATOM 4942  C CG1  . ILE A 1 44 ? 97.949  -5.637  -13.159 1.00 0.00 ? 44 ILE A CG1  4  
ATOM 4943  C CG2  . ILE A 1 44 ? 98.461  -4.124  -11.240 1.00 0.00 ? 44 ILE A CG2  4  
ATOM 4944  C CD1  . ILE A 1 44 ? 99.220  -5.151  -13.863 1.00 0.00 ? 44 ILE A CD1  4  
ATOM 4945  H H    . ILE A 1 44 ? 97.223  -6.796  -11.088 1.00 0.00 ? 44 ILE A H    4  
ATOM 4946  H HA   . ILE A 1 44 ? 95.898  -4.324  -10.748 1.00 0.00 ? 44 ILE A HA   4  
ATOM 4947  H HB   . ILE A 1 44 ? 97.141  -3.666  -12.871 1.00 0.00 ? 44 ILE A HB   4  
ATOM 4948  H HG12 . ILE A 1 44 ? 98.184  -6.496  -12.553 1.00 0.00 ? 44 ILE A HG12 4  
ATOM 4949  H HG13 . ILE A 1 44 ? 97.212  -5.904  -13.898 1.00 0.00 ? 44 ILE A HG13 4  
ATOM 4950  H HG21 . ILE A 1 44 ? 98.033  -3.447  -10.516 1.00 0.00 ? 44 ILE A HG21 4  
ATOM 4951  H HG22 . ILE A 1 44 ? 99.280  -3.635  -11.745 1.00 0.00 ? 44 ILE A HG22 4  
ATOM 4952  H HG23 . ILE A 1 44 ? 98.825  -5.007  -10.736 1.00 0.00 ? 44 ILE A HG23 4  
ATOM 4953  H HD11 . ILE A 1 44 ? 99.428  -5.792  -14.708 1.00 0.00 ? 44 ILE A HD11 4  
ATOM 4954  H HD12 . ILE A 1 44 ? 100.050 -5.186  -13.172 1.00 0.00 ? 44 ILE A HD12 4  
ATOM 4955  H HD13 . ILE A 1 44 ? 99.081  -4.138  -14.206 1.00 0.00 ? 44 ILE A HD13 4  
ATOM 4956  N N    . VAL A 1 45 ? 94.887  -6.117  -13.321 1.00 0.00 ? 45 VAL A N    4  
ATOM 4957  C CA   . VAL A 1 45 ? 93.787  -6.253  -14.273 1.00 0.00 ? 45 VAL A CA   4  
ATOM 4958  C C    . VAL A 1 45 ? 92.449  -6.275  -13.535 1.00 0.00 ? 45 VAL A C    4  
ATOM 4959  O O    . VAL A 1 45 ? 91.481  -5.632  -13.953 1.00 0.00 ? 45 VAL A O    4  
ATOM 4960  C CB   . VAL A 1 45 ? 93.952  -7.546  -15.084 1.00 0.00 ? 45 VAL A CB   4  
ATOM 4961  C CG1  . VAL A 1 45 ? 92.690  -7.812  -15.912 1.00 0.00 ? 45 VAL A CG1  4  
ATOM 4962  C CG2  . VAL A 1 45 ? 95.148  -7.406  -16.026 1.00 0.00 ? 45 VAL A CG2  4  
ATOM 4963  H H    . VAL A 1 45 ? 95.583  -6.808  -13.280 1.00 0.00 ? 45 VAL A H    4  
ATOM 4964  H HA   . VAL A 1 45 ? 93.802  -5.412  -14.950 1.00 0.00 ? 45 VAL A HA   4  
ATOM 4965  H HB   . VAL A 1 45 ? 94.119  -8.374  -14.410 1.00 0.00 ? 45 VAL A HB   4  
ATOM 4966  H HG11 . VAL A 1 45 ? 91.897  -8.154  -15.263 1.00 0.00 ? 45 VAL A HG11 4  
ATOM 4967  H HG12 . VAL A 1 45 ? 92.898  -8.570  -16.654 1.00 0.00 ? 45 VAL A HG12 4  
ATOM 4968  H HG13 . VAL A 1 45 ? 92.384  -6.901  -16.405 1.00 0.00 ? 45 VAL A HG13 4  
ATOM 4969  H HG21 . VAL A 1 45 ? 94.957  -6.612  -16.732 1.00 0.00 ? 45 VAL A HG21 4  
ATOM 4970  H HG22 . VAL A 1 45 ? 95.296  -8.333  -16.558 1.00 0.00 ? 45 VAL A HG22 4  
ATOM 4971  H HG23 . VAL A 1 45 ? 96.032  -7.174  -15.454 1.00 0.00 ? 45 VAL A HG23 4  
ATOM 4972  N N    . LEU A 1 46 ? 92.401  -7.029  -12.442 1.00 0.00 ? 46 LEU A N    4  
ATOM 4973  C CA   . LEU A 1 46 ? 91.177  -7.144  -11.658 1.00 0.00 ? 46 LEU A CA   4  
ATOM 4974  C C    . LEU A 1 46 ? 90.800  -5.793  -11.041 1.00 0.00 ? 46 LEU A C    4  
ATOM 4975  O O    . LEU A 1 46 ? 89.617  -5.461  -10.938 1.00 0.00 ? 46 LEU A O    4  
ATOM 4976  C CB   . LEU A 1 46 ? 91.367  -8.213  -10.553 1.00 0.00 ? 46 LEU A CB   4  
ATOM 4977  C CG   . LEU A 1 46 ? 90.106  -9.091  -10.390 1.00 0.00 ? 46 LEU A CG   4  
ATOM 4978  C CD1  . LEU A 1 46 ? 88.869  -8.206  -10.161 1.00 0.00 ? 46 LEU A CD1  4  
ATOM 4979  C CD2  . LEU A 1 46 ? 89.896  -9.980  -11.638 1.00 0.00 ? 46 LEU A CD2  4  
ATOM 4980  H H    . LEU A 1 46 ? 93.201  -7.523  -12.163 1.00 0.00 ? 46 LEU A H    4  
ATOM 4981  H HA   . LEU A 1 46 ? 90.385  -7.451  -12.320 1.00 0.00 ? 46 LEU A HA   4  
ATOM 4982  H HB2  . LEU A 1 46 ? 92.202  -8.844  -10.814 1.00 0.00 ? 46 LEU A HB2  4  
ATOM 4983  H HB3  . LEU A 1 46 ? 91.582  -7.729  -9.610  1.00 0.00 ? 46 LEU A HB3  4  
ATOM 4984  H HG   . LEU A 1 46 ? 90.237  -9.727  -9.525  1.00 0.00 ? 46 LEU A HG   4  
ATOM 4985  H HD11 . LEU A 1 46 ? 89.146  -7.335  -9.584  1.00 0.00 ? 46 LEU A HD11 4  
ATOM 4986  H HD12 . LEU A 1 46 ? 88.122  -8.770  -9.621  1.00 0.00 ? 46 LEU A HD12 4  
ATOM 4987  H HD13 . LEU A 1 46 ? 88.461  -7.896  -11.111 1.00 0.00 ? 46 LEU A HD13 4  
ATOM 4988  H HD21 . LEU A 1 46 ? 89.406  -10.896 -11.342 1.00 0.00 ? 46 LEU A HD21 4  
ATOM 4989  H HD22 . LEU A 1 46 ? 90.849  -10.219 -12.087 1.00 0.00 ? 46 LEU A HD22 4  
ATOM 4990  H HD23 . LEU A 1 46 ? 89.279  -9.466  -12.361 1.00 0.00 ? 46 LEU A HD23 4  
ATOM 4991  N N    . VAL A 1 47 ? 91.806  -5.016  -10.637 1.00 0.00 ? 47 VAL A N    4  
ATOM 4992  C CA   . VAL A 1 47 ? 91.550  -3.713  -10.036 1.00 0.00 ? 47 VAL A CA   4  
ATOM 4993  C C    . VAL A 1 47 ? 90.929  -2.781  -11.068 1.00 0.00 ? 47 VAL A C    4  
ATOM 4994  O O    . VAL A 1 47 ? 90.104  -1.933  -10.741 1.00 0.00 ? 47 VAL A O    4  
ATOM 4995  C CB   . VAL A 1 47 ? 92.858  -3.113  -9.500  1.00 0.00 ? 47 VAL A CB   4  
ATOM 4996  C CG1  . VAL A 1 47 ? 92.633  -1.652  -9.092  1.00 0.00 ? 47 VAL A CG1  4  
ATOM 4997  C CG2  . VAL A 1 47 ? 93.322  -3.915  -8.276  1.00 0.00 ? 47 VAL A CG2  4  
ATOM 4998  H H    . VAL A 1 47 ? 92.731  -5.319  -10.751 1.00 0.00 ? 47 VAL A H    4  
ATOM 4999  H HA   . VAL A 1 47 ? 90.863  -3.836  -9.215  1.00 0.00 ? 47 VAL A HA   4  
ATOM 5000  H HB   . VAL A 1 47 ? 93.615  -3.158  -10.269 1.00 0.00 ? 47 VAL A HB   4  
ATOM 5001  H HG11 . VAL A 1 47 ? 91.719  -1.574  -8.522  1.00 0.00 ? 47 VAL A HG11 4  
ATOM 5002  H HG12 . VAL A 1 47 ? 92.559  -1.038  -9.977  1.00 0.00 ? 47 VAL A HG12 4  
ATOM 5003  H HG13 . VAL A 1 47 ? 93.463  -1.314  -8.489  1.00 0.00 ? 47 VAL A HG13 4  
ATOM 5004  H HG21 . VAL A 1 47 ? 92.739  -3.627  -7.413  1.00 0.00 ? 47 VAL A HG21 4  
ATOM 5005  H HG22 . VAL A 1 47 ? 94.366  -3.712  -8.090  1.00 0.00 ? 47 VAL A HG22 4  
ATOM 5006  H HG23 . VAL A 1 47 ? 93.189  -4.970  -8.463  1.00 0.00 ? 47 VAL A HG23 4  
ATOM 5007  N N    . ALA A 1 48 ? 91.342  -2.944  -12.316 1.00 0.00 ? 48 ALA A N    4  
ATOM 5008  C CA   . ALA A 1 48 ? 90.831  -2.108  -13.395 1.00 0.00 ? 48 ALA A CA   4  
ATOM 5009  C C    . ALA A 1 48 ? 89.357  -2.400  -13.676 1.00 0.00 ? 48 ALA A C    4  
ATOM 5010  O O    . ALA A 1 48 ? 88.521  -1.489  -13.686 1.00 0.00 ? 48 ALA A O    4  
ATOM 5011  C CB   . ALA A 1 48 ? 91.662  -2.365  -14.659 1.00 0.00 ? 48 ALA A CB   4  
ATOM 5012  H H    . ALA A 1 48 ? 92.010  -3.636  -12.517 1.00 0.00 ? 48 ALA A H    4  
ATOM 5013  H HA   . ALA A 1 48 ? 90.930  -1.073  -13.113 1.00 0.00 ? 48 ALA A HA   4  
ATOM 5014  H HB1  . ALA A 1 48 ? 91.259  -3.210  -15.198 1.00 0.00 ? 48 ALA A HB1  4  
ATOM 5015  H HB2  . ALA A 1 48 ? 92.682  -2.577  -14.378 1.00 0.00 ? 48 ALA A HB2  4  
ATOM 5016  H HB3  . ALA A 1 48 ? 91.640  -1.494  -15.290 1.00 0.00 ? 48 ALA A HB3  4  
ATOM 5017  N N    . THR A 1 49 ? 89.047  -3.667  -13.915 1.00 0.00 ? 49 THR A N    4  
ATOM 5018  C CA   . THR A 1 49 ? 87.675  -4.060  -14.213 1.00 0.00 ? 49 THR A CA   4  
ATOM 5019  C C    . THR A 1 49 ? 86.722  -3.606  -13.110 1.00 0.00 ? 49 THR A C    4  
ATOM 5020  O O    . THR A 1 49 ? 85.677  -3.013  -13.387 1.00 0.00 ? 49 THR A O    4  
ATOM 5021  C CB   . THR A 1 49 ? 87.589  -5.579  -14.371 1.00 0.00 ? 49 THR A CB   4  
ATOM 5022  O OG1  . THR A 1 49 ? 88.678  -6.032  -15.164 1.00 0.00 ? 49 THR A OG1  4  
ATOM 5023  C CG2  . THR A 1 49 ? 86.271  -5.952  -15.053 1.00 0.00 ? 49 THR A CG2  4  
ATOM 5024  H H    . THR A 1 49 ? 89.754  -4.350  -13.903 1.00 0.00 ? 49 THR A H    4  
ATOM 5025  H HA   . THR A 1 49 ? 87.377  -3.597  -15.142 1.00 0.00 ? 49 THR A HA   4  
ATOM 5026  H HB   . THR A 1 49 ? 87.632  -6.046  -13.400 1.00 0.00 ? 49 THR A HB   4  
ATOM 5027  H HG1  . THR A 1 49 ? 89.465  -6.037  -14.613 1.00 0.00 ? 49 THR A HG1  4  
ATOM 5028  H HG21 . THR A 1 49 ? 86.252  -5.534  -16.050 1.00 0.00 ? 49 THR A HG21 4  
ATOM 5029  H HG22 . THR A 1 49 ? 85.446  -5.557  -14.480 1.00 0.00 ? 49 THR A HG22 4  
ATOM 5030  H HG23 . THR A 1 49 ? 86.188  -7.027  -15.111 1.00 0.00 ? 49 THR A HG23 4  
ATOM 5031  N N    . VAL A 1 50 ? 87.077  -3.895  -11.864 1.00 0.00 ? 50 VAL A N    4  
ATOM 5032  C CA   . VAL A 1 50 ? 86.226  -3.518  -10.740 1.00 0.00 ? 50 VAL A CA   4  
ATOM 5033  C C    . VAL A 1 50 ? 86.225  -2.007  -10.517 1.00 0.00 ? 50 VAL A C    4  
ATOM 5034  O O    . VAL A 1 50 ? 85.267  -1.466  -9.970  1.00 0.00 ? 50 VAL A O    4  
ATOM 5035  C CB   . VAL A 1 50 ? 86.678  -4.226  -9.463  1.00 0.00 ? 50 VAL A CB   4  
ATOM 5036  C CG1  . VAL A 1 50 ? 86.756  -5.734  -9.714  1.00 0.00 ? 50 VAL A CG1  4  
ATOM 5037  C CG2  . VAL A 1 50 ? 88.052  -3.699  -9.043  1.00 0.00 ? 50 VAL A CG2  4  
ATOM 5038  H H    . VAL A 1 50 ? 87.917  -4.377  -11.696 1.00 0.00 ? 50 VAL A H    4  
ATOM 5039  H HA   . VAL A 1 50 ? 85.217  -3.829  -10.960 1.00 0.00 ? 50 VAL A HA   4  
ATOM 5040  H HB   . VAL A 1 50 ? 85.964  -4.034  -8.677  1.00 0.00 ? 50 VAL A HB   4  
ATOM 5041  H HG11 . VAL A 1 50 ? 87.219  -6.217  -8.865  1.00 0.00 ? 50 VAL A HG11 4  
ATOM 5042  H HG12 . VAL A 1 50 ? 87.342  -5.921  -10.599 1.00 0.00 ? 50 VAL A HG12 4  
ATOM 5043  H HG13 . VAL A 1 50 ? 85.760  -6.127  -9.852  1.00 0.00 ? 50 VAL A HG13 4  
ATOM 5044  H HG21 . VAL A 1 50 ? 87.936  -2.742  -8.555  1.00 0.00 ? 50 VAL A HG21 4  
ATOM 5045  H HG22 . VAL A 1 50 ? 88.673  -3.583  -9.915  1.00 0.00 ? 50 VAL A HG22 4  
ATOM 5046  H HG23 . VAL A 1 50 ? 88.517  -4.395  -8.358  1.00 0.00 ? 50 VAL A HG23 4  
ATOM 5047  N N    . LEU A 1 51 ? 87.293  -1.318  -10.915 1.00 0.00 ? 51 LEU A N    4  
ATOM 5048  C CA   . LEU A 1 51 ? 87.348  0.123   -10.712 1.00 0.00 ? 51 LEU A CA   4  
ATOM 5049  C C    . LEU A 1 51 ? 86.292  0.830   -11.552 1.00 0.00 ? 51 LEU A C    4  
ATOM 5050  O O    . LEU A 1 51 ? 85.462  1.561   -11.016 1.00 0.00 ? 51 LEU A O    4  
ATOM 5051  C CB   . LEU A 1 51 ? 88.746  0.646   -11.065 1.00 0.00 ? 51 LEU A CB   4  
ATOM 5052  C CG   . LEU A 1 51 ? 88.782  2.180   -11.025 1.00 0.00 ? 51 LEU A CG   4  
ATOM 5053  C CD1  . LEU A 1 51 ? 88.263  2.682   -9.673  1.00 0.00 ? 51 LEU A CD1  4  
ATOM 5054  C CD2  . LEU A 1 51 ? 90.226  2.651   -11.224 1.00 0.00 ? 51 LEU A CD2  4  
ATOM 5055  H H    . LEU A 1 51 ? 88.053  -1.780  -11.335 1.00 0.00 ? 51 LEU A H    4  
ATOM 5056  H HA   . LEU A 1 51 ? 87.144  0.329   -9.675  1.00 0.00 ? 51 LEU A HA   4  
ATOM 5057  H HB2  . LEU A 1 51 ? 89.456  0.258   -10.353 1.00 0.00 ? 51 LEU A HB2  4  
ATOM 5058  H HB3  . LEU A 1 51 ? 89.013  0.309   -12.055 1.00 0.00 ? 51 LEU A HB3  4  
ATOM 5059  H HG   . LEU A 1 51 ? 88.165  2.579   -11.818 1.00 0.00 ? 51 LEU A HG   4  
ATOM 5060  H HD11 . LEU A 1 51 ? 87.186  2.651   -9.670  1.00 0.00 ? 51 LEU A HD11 4  
ATOM 5061  H HD12 . LEU A 1 51 ? 88.593  3.699   -9.512  1.00 0.00 ? 51 LEU A HD12 4  
ATOM 5062  H HD13 . LEU A 1 51 ? 88.643  2.051   -8.882  1.00 0.00 ? 51 LEU A HD13 4  
ATOM 5063  H HD21 . LEU A 1 51 ? 90.874  2.124   -10.539 1.00 0.00 ? 51 LEU A HD21 4  
ATOM 5064  H HD22 . LEU A 1 51 ? 90.288  3.713   -11.032 1.00 0.00 ? 51 LEU A HD22 4  
ATOM 5065  H HD23 . LEU A 1 51 ? 90.534  2.450   -12.239 1.00 0.00 ? 51 LEU A HD23 4  
ATOM 5066  N N    . LYS A 1 52 ? 86.315  0.606   -12.861 1.00 0.00 ? 52 LYS A N    4  
ATOM 5067  C CA   . LYS A 1 52 ? 85.329  1.239   -13.738 1.00 0.00 ? 52 LYS A CA   4  
ATOM 5068  C C    . LYS A 1 52 ? 83.930  0.722   -13.419 1.00 0.00 ? 52 LYS A C    4  
ATOM 5069  O O    . LYS A 1 52 ? 82.976  1.489   -13.357 1.00 0.00 ? 52 LYS A O    4  
ATOM 5070  C CB   . LYS A 1 52 ? 85.655  0.943   -15.215 1.00 0.00 ? 52 LYS A CB   4  
ATOM 5071  C CG   . LYS A 1 52 ? 86.807  1.843   -15.722 1.00 0.00 ? 52 LYS A CG   4  
ATOM 5072  C CD   . LYS A 1 52 ? 88.168  1.190   -15.426 1.00 0.00 ? 52 LYS A CD   4  
ATOM 5073  C CE   . LYS A 1 52 ? 88.523  0.176   -16.528 1.00 0.00 ? 52 LYS A CE   4  
ATOM 5074  N NZ   . LYS A 1 52 ? 89.429  -0.864  -15.971 1.00 0.00 ? 52 LYS A NZ   4  
ATOM 5075  H H    . LYS A 1 52 ? 86.997  0.005   -13.242 1.00 0.00 ? 52 LYS A H    4  
ATOM 5076  H HA   . LYS A 1 52 ? 85.341  2.307   -13.578 1.00 0.00 ? 52 LYS A HA   4  
ATOM 5077  H HB2  . LYS A 1 52 ? 85.937  -0.096  -15.309 1.00 0.00 ? 52 LYS A HB2  4  
ATOM 5078  H HB3  . LYS A 1 52 ? 84.774  1.124   -15.816 1.00 0.00 ? 52 LYS A HB3  4  
ATOM 5079  H HG2  . LYS A 1 52 ? 86.703  1.983   -16.791 1.00 0.00 ? 52 LYS A HG2  4  
ATOM 5080  H HG3  . LYS A 1 52 ? 86.763  2.808   -15.240 1.00 0.00 ? 52 LYS A HG3  4  
ATOM 5081  H HD2  . LYS A 1 52 ? 88.931  1.955   -15.385 1.00 0.00 ? 52 LYS A HD2  4  
ATOM 5082  H HD3  . LYS A 1 52 ? 88.124  0.682   -14.474 1.00 0.00 ? 52 LYS A HD3  4  
ATOM 5083  H HE2  . LYS A 1 52 ? 87.624  -0.295  -16.899 1.00 0.00 ? 52 LYS A HE2  4  
ATOM 5084  H HE3  . LYS A 1 52 ? 89.020  0.687   -17.340 1.00 0.00 ? 52 LYS A HE3  4  
ATOM 5085  H HZ1  . LYS A 1 52 ? 88.864  -1.621  -15.537 1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 5086  H HZ2  . LYS A 1 52 ? 90.047  -0.435  -15.252 1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 5087  H HZ3  . LYS A 1 52 ? 90.010  -1.264  -16.735 1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 5088  N N    . THR A 1 53 ? 83.811  -0.582  -13.242 1.00 0.00 ? 53 THR A N    4  
ATOM 5089  C CA   . THR A 1 53 ? 82.516  -1.189  -12.963 1.00 0.00 ? 53 THR A CA   4  
ATOM 5090  C C    . THR A 1 53 ? 81.881  -0.667  -11.669 1.00 0.00 ? 53 THR A C    4  
ATOM 5091  O O    . THR A 1 53 ? 80.679  -0.396  -11.633 1.00 0.00 ? 53 THR A O    4  
ATOM 5092  C CB   . THR A 1 53 ? 82.679  -2.708  -12.870 1.00 0.00 ? 53 THR A CB   4  
ATOM 5093  O OG1  . THR A 1 53 ? 83.206  -3.203  -14.093 1.00 0.00 ? 53 THR A OG1  4  
ATOM 5094  C CG2  . THR A 1 53 ? 81.320  -3.355  -12.602 1.00 0.00 ? 53 THR A CG2  4  
ATOM 5095  H H    . THR A 1 53 ? 84.603  -1.156  -13.323 1.00 0.00 ? 53 THR A H    4  
ATOM 5096  H HA   . THR A 1 53 ? 81.851  -0.970  -13.784 1.00 0.00 ? 53 THR A HA   4  
ATOM 5097  H HB   . THR A 1 53 ? 83.351  -2.949  -12.063 1.00 0.00 ? 53 THR A HB   4  
ATOM 5098  H HG1  . THR A 1 53 ? 83.620  -4.050  -13.916 1.00 0.00 ? 53 THR A HG1  4  
ATOM 5099  H HG21 . THR A 1 53 ? 81.029  -3.170  -11.579 1.00 0.00 ? 53 THR A HG21 4  
ATOM 5100  H HG22 . THR A 1 53 ? 81.389  -4.420  -12.770 1.00 0.00 ? 53 THR A HG22 4  
ATOM 5101  H HG23 . THR A 1 53 ? 80.584  -2.932  -13.269 1.00 0.00 ? 53 THR A HG23 4  
ATOM 5102  N N    . ILE A 1 54 ? 82.667  -0.569  -10.598 1.00 0.00 ? 54 ILE A N    4  
ATOM 5103  C CA   . ILE A 1 54 ? 82.125  -0.130  -9.308  1.00 0.00 ? 54 ILE A CA   4  
ATOM 5104  C C    . ILE A 1 54 ? 81.826  1.365   -9.247  1.00 0.00 ? 54 ILE A C    4  
ATOM 5105  O O    . ILE A 1 54 ? 80.820  1.764   -8.674  1.00 0.00 ? 54 ILE A O    4  
ATOM 5106  C CB   . ILE A 1 54 ? 83.087  -0.508  -8.176  1.00 0.00 ? 54 ILE A CB   4  
ATOM 5107  C CG1  . ILE A 1 54 ? 83.183  -2.030  -8.074  1.00 0.00 ? 54 ILE A CG1  4  
ATOM 5108  C CG2  . ILE A 1 54 ? 82.574  0.050   -6.842  1.00 0.00 ? 54 ILE A CG2  4  
ATOM 5109  C CD1  . ILE A 1 54 ? 84.357  -2.403  -7.169  1.00 0.00 ? 54 ILE A CD1  4  
ATOM 5110  H H    . ILE A 1 54 ? 83.618  -0.824  -10.663 1.00 0.00 ? 54 ILE A H    4  
ATOM 5111  H HA   . ILE A 1 54 ? 81.195  -0.651  -9.151  1.00 0.00 ? 54 ILE A HA   4  
ATOM 5112  H HB   . ILE A 1 54 ? 84.065  -0.098  -8.383  1.00 0.00 ? 54 ILE A HB   4  
ATOM 5113  H HG12 . ILE A 1 54 ? 82.266  -2.421  -7.656  1.00 0.00 ? 54 ILE A HG12 4  
ATOM 5114  H HG13 . ILE A 1 54 ? 83.339  -2.450  -9.056  1.00 0.00 ? 54 ILE A HG13 4  
ATOM 5115  H HG21 . ILE A 1 54 ? 81.519  -0.162  -6.745  1.00 0.00 ? 54 ILE A HG21 4  
ATOM 5116  H HG22 . ILE A 1 54 ? 82.729  1.119   -6.815  1.00 0.00 ? 54 ILE A HG22 4  
ATOM 5117  H HG23 . ILE A 1 54 ? 83.111  -0.412  -6.027  1.00 0.00 ? 54 ILE A HG23 4  
ATOM 5118  H HD11 . ILE A 1 54 ? 85.280  -2.061  -7.617  1.00 0.00 ? 54 ILE A HD11 4  
ATOM 5119  H HD12 . ILE A 1 54 ? 84.390  -3.475  -7.045  1.00 0.00 ? 54 ILE A HD12 4  
ATOM 5120  H HD13 . ILE A 1 54 ? 84.231  -1.933  -6.205  1.00 0.00 ? 54 ILE A HD13 4  
ATOM 5121  N N    . VAL A 1 55 ? 82.700  2.197   -9.785  1.00 0.00 ? 55 VAL A N    4  
ATOM 5122  C CA   . VAL A 1 55 ? 82.467  3.638   -9.725  1.00 0.00 ? 55 VAL A CA   4  
ATOM 5123  C C    . VAL A 1 55 ? 81.424  4.074   -10.754 1.00 0.00 ? 55 VAL A C    4  
ATOM 5124  O O    . VAL A 1 55 ? 80.690  5.038   -10.537 1.00 0.00 ? 55 VAL A O    4  
ATOM 5125  C CB   . VAL A 1 55 ? 83.778  4.392   -9.964  1.00 0.00 ? 55 VAL A CB   4  
ATOM 5126  C CG1  . VAL A 1 55 ? 84.817  3.914   -8.944  1.00 0.00 ? 55 VAL A CG1  4  
ATOM 5127  C CG2  . VAL A 1 55 ? 84.285  4.135   -11.401 1.00 0.00 ? 55 VAL A CG2  4  
ATOM 5128  H H    . VAL A 1 55 ? 83.517  1.848   -10.205 1.00 0.00 ? 55 VAL A H    4  
ATOM 5129  H HA   . VAL A 1 55 ? 82.103  3.892   -8.740  1.00 0.00 ? 55 VAL A HA   4  
ATOM 5130  H HB   . VAL A 1 55 ? 83.608  5.451   -9.823  1.00 0.00 ? 55 VAL A HB   4  
ATOM 5131  H HG11 . VAL A 1 55 ? 85.756  4.415   -9.126  1.00 0.00 ? 55 VAL A HG11 4  
ATOM 5132  H HG12 . VAL A 1 55 ? 84.950  2.848   -9.040  1.00 0.00 ? 55 VAL A HG12 4  
ATOM 5133  H HG13 . VAL A 1 55 ? 84.474  4.145   -7.947  1.00 0.00 ? 55 VAL A HG13 4  
ATOM 5134  H HG21 . VAL A 1 55 ? 83.888  4.892   -12.061 1.00 0.00 ? 55 VAL A HG21 4  
ATOM 5135  H HG22 . VAL A 1 55 ? 83.958  3.163   -11.739 1.00 0.00 ? 55 VAL A HG22 4  
ATOM 5136  H HG23 . VAL A 1 55 ? 85.366  4.176   -11.423 1.00 0.00 ? 55 VAL A HG23 4  
ATOM 5137  N N    . LEU A 1 56 ? 81.394  3.383   -11.887 1.00 0.00 ? 56 LEU A N    4  
ATOM 5138  C CA   . LEU A 1 56 ? 80.475  3.723   -12.965 1.00 0.00 ? 56 LEU A CA   4  
ATOM 5139  C C    . LEU A 1 56 ? 79.037  3.240   -12.735 1.00 0.00 ? 56 LEU A C    4  
ATOM 5140  O O    . LEU A 1 56 ? 78.096  3.976   -13.022 1.00 0.00 ? 56 LEU A O    4  
ATOM 5141  C CB   . LEU A 1 56 ? 81.005  3.125   -14.272 1.00 0.00 ? 56 LEU A CB   4  
ATOM 5142  C CG   . LEU A 1 56 ? 80.248  3.712   -15.485 1.00 0.00 ? 56 LEU A CG   4  
ATOM 5143  C CD1  . LEU A 1 56 ? 80.909  5.021   -15.930 1.00 0.00 ? 56 LEU A CD1  4  
ATOM 5144  C CD2  . LEU A 1 56 ? 80.293  2.717   -16.651 1.00 0.00 ? 56 LEU A CD2  4  
ATOM 5145  H H    . LEU A 1 56 ? 82.021  2.641   -12.015 1.00 0.00 ? 56 LEU A H    4  
ATOM 5146  H HA   . LEU A 1 56 ? 80.460  4.794   -13.069 1.00 0.00 ? 56 LEU A HA   4  
ATOM 5147  H HB2  . LEU A 1 56 ? 82.059  3.353   -14.360 1.00 0.00 ? 56 LEU A HB2  4  
ATOM 5148  H HB3  . LEU A 1 56 ? 80.874  2.055   -14.244 1.00 0.00 ? 56 LEU A HB3  4  
ATOM 5149  H HG   . LEU A 1 56 ? 79.219  3.905   -15.218 1.00 0.00 ? 56 LEU A HG   4  
ATOM 5150  H HD11 . LEU A 1 56 ? 80.411  5.394   -16.812 1.00 0.00 ? 56 LEU A HD11 4  
ATOM 5151  H HD12 . LEU A 1 56 ? 81.948  4.836   -16.155 1.00 0.00 ? 56 LEU A HD12 4  
ATOM 5152  H HD13 . LEU A 1 56 ? 80.838  5.752   -15.140 1.00 0.00 ? 56 LEU A HD13 4  
ATOM 5153  H HD21 . LEU A 1 56 ? 79.838  3.163   -17.524 1.00 0.00 ? 56 LEU A HD21 4  
ATOM 5154  H HD22 . LEU A 1 56 ? 79.752  1.822   -16.382 1.00 0.00 ? 56 LEU A HD22 4  
ATOM 5155  H HD23 . LEU A 1 56 ? 81.320  2.465   -16.871 1.00 0.00 ? 56 LEU A HD23 4  
ATOM 5156  N N    . ILE A 1 57 ? 78.845  2.001   -12.276 1.00 0.00 ? 57 ILE A N    4  
ATOM 5157  C CA   . ILE A 1 57 ? 77.474  1.499   -12.115 1.00 0.00 ? 57 ILE A CA   4  
ATOM 5158  C C    . ILE A 1 57 ? 76.635  2.342   -11.140 1.00 0.00 ? 57 ILE A C    4  
ATOM 5159  O O    . ILE A 1 57 ? 75.621  2.911   -11.545 1.00 0.00 ? 57 ILE A O    4  
ATOM 5160  C CB   . ILE A 1 57 ? 77.495  0.006   -11.699 1.00 0.00 ? 57 ILE A CB   4  
ATOM 5161  C CG1  . ILE A 1 57 ? 77.785  -0.860  -12.934 1.00 0.00 ? 57 ILE A CG1  4  
ATOM 5162  C CG2  . ILE A 1 57 ? 76.140  -0.412  -11.104 1.00 0.00 ? 57 ILE A CG2  4  
ATOM 5163  C CD1  . ILE A 1 57 ? 78.024  -2.310  -12.505 1.00 0.00 ? 57 ILE A CD1  4  
ATOM 5164  H H    . ILE A 1 57 ? 79.616  1.412   -12.082 1.00 0.00 ? 57 ILE A H    4  
ATOM 5165  H HA   . ILE A 1 57 ? 76.995  1.571   -13.083 1.00 0.00 ? 57 ILE A HA   4  
ATOM 5166  H HB   . ILE A 1 57 ? 78.272  -0.155  -10.968 1.00 0.00 ? 57 ILE A HB   4  
ATOM 5167  H HG12 . ILE A 1 57 ? 76.941  -0.818  -13.607 1.00 0.00 ? 57 ILE A HG12 4  
ATOM 5168  H HG13 . ILE A 1 57 ? 78.664  -0.486  -13.436 1.00 0.00 ? 57 ILE A HG13 4  
ATOM 5169  H HG21 . ILE A 1 57 ? 75.345  -0.083  -11.757 1.00 0.00 ? 57 ILE A HG21 4  
ATOM 5170  H HG22 . ILE A 1 57 ? 76.016  0.041   -10.131 1.00 0.00 ? 57 ILE A HG22 4  
ATOM 5171  H HG23 . ILE A 1 57 ? 76.099  -1.485  -11.003 1.00 0.00 ? 57 ILE A HG23 4  
ATOM 5172  H HD11 . ILE A 1 57 ? 78.251  -2.910  -13.374 1.00 0.00 ? 57 ILE A HD11 4  
ATOM 5173  H HD12 . ILE A 1 57 ? 77.136  -2.694  -12.024 1.00 0.00 ? 57 ILE A HD12 4  
ATOM 5174  H HD13 . ILE A 1 57 ? 78.852  -2.348  -11.814 1.00 0.00 ? 57 ILE A HD13 4  
ATOM 5175  N N    . PRO A 1 58 ? 77.002  2.440   -9.892  1.00 0.00 ? 58 PRO A N    4  
ATOM 5176  C CA   . PRO A 1 58 ? 76.222  3.230   -8.895  1.00 0.00 ? 58 PRO A CA   4  
ATOM 5177  C C    . PRO A 1 58 ? 75.889  4.630   -9.401  1.00 0.00 ? 58 PRO A C    4  
ATOM 5178  O O    . PRO A 1 58 ? 74.896  5.226   -8.983  1.00 0.00 ? 58 PRO A O    4  
ATOM 5179  C CB   . PRO A 1 58 ? 77.132  3.268   -7.644  1.00 0.00 ? 58 PRO A CB   4  
ATOM 5180  C CG   . PRO A 1 58 ? 78.467  2.759   -8.105  1.00 0.00 ? 58 PRO A CG   4  
ATOM 5181  C CD   . PRO A 1 58 ? 78.177  1.827   -9.276  1.00 0.00 ? 58 PRO A CD   4  
ATOM 5182  H HA   . PRO A 1 58 ? 75.308  2.712   -8.665  1.00 0.00 ? 58 PRO A HA   4  
ATOM 5183  H HB2  . PRO A 1 58 ? 77.222  4.280   -7.265  1.00 0.00 ? 58 PRO A HB2  4  
ATOM 5184  H HB3  . PRO A 1 58 ? 76.736  2.619   -6.874  1.00 0.00 ? 58 PRO A HB3  4  
ATOM 5185  H HG2  . PRO A 1 58 ? 79.091  3.583   -8.429  1.00 0.00 ? 58 PRO A HG2  4  
ATOM 5186  H HG3  . PRO A 1 58 ? 78.956  2.208   -7.314  1.00 0.00 ? 58 PRO A HG3  4  
ATOM 5187  H HD2  . PRO A 1 58 ? 79.003  1.807   -9.963  1.00 0.00 ? 58 PRO A HD2  4  
ATOM 5188  H HD3  . PRO A 1 58 ? 77.939  0.836   -8.922  1.00 0.00 ? 58 PRO A HD3  4  
ATOM 5189  N N    . PHE A 1 59 ? 76.714  5.153   -10.300 1.00 0.00 ? 59 PHE A N    4  
ATOM 5190  C CA   . PHE A 1 59 ? 76.485  6.478   -10.847 1.00 0.00 ? 59 PHE A CA   4  
ATOM 5191  C C    . PHE A 1 59 ? 75.660  6.370   -12.133 1.00 0.00 ? 59 PHE A C    4  
ATOM 5192  O O    . PHE A 1 59 ? 74.523  6.839   -12.179 1.00 0.00 ? 59 PHE A O    4  
ATOM 5193  C CB   . PHE A 1 59 ? 77.842  7.175   -11.106 1.00 0.00 ? 59 PHE A CB   4  
ATOM 5194  C CG   . PHE A 1 59 ? 78.193  8.086   -9.940  1.00 0.00 ? 59 PHE A CG   4  
ATOM 5195  C CD1  . PHE A 1 59 ? 77.354  9.161   -9.617  1.00 0.00 ? 59 PHE A CD1  4  
ATOM 5196  C CD2  . PHE A 1 59 ? 79.352  7.854   -9.184  1.00 0.00 ? 59 PHE A CD2  4  
ATOM 5197  C CE1  . PHE A 1 59 ? 77.672  10.001  -8.545  1.00 0.00 ? 59 PHE A CE1  4  
ATOM 5198  C CE2  . PHE A 1 59 ? 79.668  8.695   -8.111  1.00 0.00 ? 59 PHE A CE2  4  
ATOM 5199  C CZ   . PHE A 1 59 ? 78.829  9.770   -7.791  1.00 0.00 ? 59 PHE A CZ   4  
ATOM 5200  H H    . PHE A 1 59 ? 77.483  4.640   -10.607 1.00 0.00 ? 59 PHE A H    4  
ATOM 5201  H HA   . PHE A 1 59 ? 75.916  7.060   -10.134 1.00 0.00 ? 59 PHE A HA   4  
ATOM 5202  H HB2  . PHE A 1 59 ? 78.623  6.440   -11.230 1.00 0.00 ? 59 PHE A HB2  4  
ATOM 5203  H HB3  . PHE A 1 59 ? 77.775  7.750   -11.998 1.00 0.00 ? 59 PHE A HB3  4  
ATOM 5204  H HD1  . PHE A 1 59 ? 76.462  9.342   -10.198 1.00 0.00 ? 59 PHE A HD1  4  
ATOM 5205  H HD2  . PHE A 1 59 ? 80.000  7.025   -9.429  1.00 0.00 ? 59 PHE A HD2  4  
ATOM 5206  H HE1  . PHE A 1 59 ? 77.025  10.831  -8.299  1.00 0.00 ? 59 PHE A HE1  4  
ATOM 5207  H HE2  . PHE A 1 59 ? 80.561  8.516   -7.529  1.00 0.00 ? 59 PHE A HE2  4  
ATOM 5208  H HZ   . PHE A 1 59 ? 79.074  10.419  -6.964  1.00 0.00 ? 59 PHE A HZ   4  
ATOM 5209  N N    . LEU A 1 60 ? 76.217  5.746   -13.170 1.00 0.00 ? 60 LEU A N    4  
ATOM 5210  C CA   . LEU A 1 60 ? 75.479  5.601   -14.420 1.00 0.00 ? 60 LEU A CA   4  
ATOM 5211  C C    . LEU A 1 60 ? 74.193  4.806   -14.185 1.00 0.00 ? 60 LEU A C    4  
ATOM 5212  O O    . LEU A 1 60 ? 73.328  4.751   -15.060 1.00 0.00 ? 60 LEU A O    4  
ATOM 5213  C CB   . LEU A 1 60 ? 76.342  4.893   -15.478 1.00 0.00 ? 60 LEU A CB   4  
ATOM 5214  C CG   . LEU A 1 60 ? 77.345  5.878   -16.107 1.00 0.00 ? 60 LEU A CG   4  
ATOM 5215  C CD1  . LEU A 1 60 ? 76.629  6.875   -17.039 1.00 0.00 ? 60 LEU A CD1  4  
ATOM 5216  C CD2  . LEU A 1 60 ? 78.078  6.645   -14.999 1.00 0.00 ? 60 LEU A CD2  4  
ATOM 5217  H H    . LEU A 1 60 ? 77.127  5.379   -13.096 1.00 0.00 ? 60 LEU A H    4  
ATOM 5218  H HA   . LEU A 1 60 ? 75.215  6.580   -14.781 1.00 0.00 ? 60 LEU A HA   4  
ATOM 5219  H HB2  . LEU A 1 60 ? 76.883  4.085   -15.011 1.00 0.00 ? 60 LEU A HB2  4  
ATOM 5220  H HB3  . LEU A 1 60 ? 75.706  4.487   -16.251 1.00 0.00 ? 60 LEU A HB3  4  
ATOM 5221  H HG   . LEU A 1 60 ? 78.067  5.318   -16.685 1.00 0.00 ? 60 LEU A HG   4  
ATOM 5222  H HD11 . LEU A 1 60 ? 76.273  7.725   -16.473 1.00 0.00 ? 60 LEU A HD11 4  
ATOM 5223  H HD12 . LEU A 1 60 ? 75.794  6.394   -17.525 1.00 0.00 ? 60 LEU A HD12 4  
ATOM 5224  H HD13 . LEU A 1 60 ? 77.325  7.217   -17.791 1.00 0.00 ? 60 LEU A HD13 4  
ATOM 5225  H HD21 . LEU A 1 60 ? 78.930  7.152   -15.421 1.00 0.00 ? 60 LEU A HD21 4  
ATOM 5226  H HD22 . LEU A 1 60 ? 78.411  5.954   -14.241 1.00 0.00 ? 60 LEU A HD22 4  
ATOM 5227  H HD23 . LEU A 1 60 ? 77.410  7.370   -14.558 1.00 0.00 ? 60 LEU A HD23 4  
ATOM 5228  N N    . GLU A 1 61 ? 74.062  4.195   -13.002 1.00 0.00 ? 61 GLU A N    4  
ATOM 5229  C CA   . GLU A 1 61 ? 72.863  3.414   -12.678 1.00 0.00 ? 61 GLU A CA   4  
ATOM 5230  C C    . GLU A 1 61 ? 72.374  3.743   -11.272 1.00 0.00 ? 61 GLU A C    4  
ATOM 5231  O O    . GLU A 1 61 ? 73.018  3.399   -10.282 1.00 0.00 ? 61 GLU A O    4  
ATOM 5232  C CB   . GLU A 1 61 ? 73.160  1.914   -12.774 1.00 0.00 ? 61 GLU A CB   4  
ATOM 5233  C CG   . GLU A 1 61 ? 73.963  1.625   -14.046 1.00 0.00 ? 61 GLU A CG   4  
ATOM 5234  C CD   . GLU A 1 61 ? 73.157  2.030   -15.275 1.00 0.00 ? 61 GLU A CD   4  
ATOM 5235  O OE1  . GLU A 1 61 ? 71.989  1.685   -15.334 1.00 0.00 ? 61 GLU A OE1  4  
ATOM 5236  O OE2  . GLU A 1 61 ? 73.721  2.680   -16.140 1.00 0.00 ? 61 GLU A OE2  4  
ATOM 5237  H H    . GLU A 1 61 ? 74.780  4.272   -12.333 1.00 0.00 ? 61 GLU A H    4  
ATOM 5238  H HA   . GLU A 1 61 ? 72.075  3.656   -13.381 1.00 0.00 ? 61 GLU A HA   4  
ATOM 5239  H HB2  . GLU A 1 61 ? 73.726  1.601   -11.910 1.00 0.00 ? 61 GLU A HB2  4  
ATOM 5240  H HB3  . GLU A 1 61 ? 72.230  1.367   -12.810 1.00 0.00 ? 61 GLU A HB3  4  
ATOM 5241  H HG2  . GLU A 1 61 ? 74.888  2.182   -14.021 1.00 0.00 ? 61 GLU A HG2  4  
ATOM 5242  H HG3  . GLU A 1 61 ? 74.183  0.569   -14.096 1.00 0.00 ? 61 GLU A HG3  4  
ATOM 5243  N N    . GLN A 1 62 ? 71.228  4.412   -11.196 1.00 0.00 ? 62 GLN A N    4  
ATOM 5244  C CA   . GLN A 1 62 ? 70.652  4.785   -9.909  1.00 0.00 ? 62 GLN A CA   4  
ATOM 5245  C C    . GLN A 1 62 ? 70.089  3.558   -9.201  1.00 0.00 ? 62 GLN A C    4  
ATOM 5246  O O    . GLN A 1 62 ? 70.178  3.439   -7.979  1.00 0.00 ? 62 GLN A O    4  
ATOM 5247  C CB   . GLN A 1 62 ? 69.538  5.812   -10.117 1.00 0.00 ? 62 GLN A CB   4  
ATOM 5248  C CG   . GLN A 1 62 ? 70.139  7.122   -10.629 1.00 0.00 ? 62 GLN A CG   4  
ATOM 5249  C CD   . GLN A 1 62 ? 69.028  8.122   -10.931 1.00 0.00 ? 62 GLN A CD   4  
ATOM 5250  O OE1  . GLN A 1 62 ? 67.856  7.846   -10.676 1.00 0.00 ? 62 GLN A OE1  4  
ATOM 5251  N NE2  . GLN A 1 62 ? 69.329  9.275   -11.465 1.00 0.00 ? 62 GLN A NE2  4  
ATOM 5252  H H    . GLN A 1 62 ? 70.759  4.658   -12.022 1.00 0.00 ? 62 GLN A H    4  
ATOM 5253  H HA   . GLN A 1 62 ? 71.422  5.226   -9.293  1.00 0.00 ? 62 GLN A HA   4  
ATOM 5254  H HB2  . GLN A 1 62 ? 68.829  5.433   -10.839 1.00 0.00 ? 62 GLN A HB2  4  
ATOM 5255  H HB3  . GLN A 1 62 ? 69.034  5.992   -9.179  1.00 0.00 ? 62 GLN A HB3  4  
ATOM 5256  H HG2  . GLN A 1 62 ? 70.795  7.532   -9.876  1.00 0.00 ? 62 GLN A HG2  4  
ATOM 5257  H HG3  . GLN A 1 62 ? 70.701  6.929   -11.530 1.00 0.00 ? 62 GLN A HG3  4  
ATOM 5258  H HE21 . GLN A 1 62 ? 70.263  9.493   -11.666 1.00 0.00 ? 62 GLN A HE21 4  
ATOM 5259  H HE22 . GLN A 1 62 ? 68.621  9.923   -11.662 1.00 0.00 ? 62 GLN A HE22 4  
ATOM 5260  N N    . ASN A 1 63 ? 69.509  2.650   -9.978  1.00 0.00 ? 63 ASN A N    4  
ATOM 5261  C CA   . ASN A 1 63 ? 68.933  1.433   -9.419  1.00 0.00 ? 63 ASN A CA   4  
ATOM 5262  C C    . ASN A 1 63 ? 67.919  1.772   -8.331  1.00 0.00 ? 63 ASN A C    4  
ATOM 5263  C CB   . ASN A 1 63 ? 70.037  0.551   -8.836  1.00 0.00 ? 63 ASN A CB   4  
ATOM 5264  C CG   . ASN A 1 63 ? 70.942  0.043   -9.952  1.00 0.00 ? 63 ASN A CG   4  
ATOM 5265  O OD1  . ASN A 1 63 ? 71.922  0.700   -10.307 1.00 0.00 ? 63 ASN A OD1  4  
ATOM 5266  N ND2  . ASN A 1 63 ? 70.672  -1.094  -10.533 1.00 0.00 ? 63 ASN A ND2  4  
ATOM 5267  H H    . ASN A 1 63 ? 69.468  2.801   -10.946 1.00 0.00 ? 63 ASN A H    4  
ATOM 5268  H HA   . ASN A 1 63 ? 68.433  0.890   -10.206 1.00 0.00 ? 63 ASN A HA   4  
ATOM 5269  H HB2  . ASN A 1 63 ? 70.622  1.127   -8.133  1.00 0.00 ? 63 ASN A HB2  4  
ATOM 5270  H HB3  . ASN A 1 63 ? 69.592  -0.291  -8.327  1.00 0.00 ? 63 ASN A HB3  4  
ATOM 5271  H HD21 . ASN A 1 63 ? 69.891  -1.614  -10.249 1.00 0.00 ? 63 ASN A HD21 4  
ATOM 5272  H HD22 . ASN A 1 63 ? 71.248  -1.427  -11.252 1.00 0.00 ? 63 ASN A HD22 4  
ATOM 5273  N N    . CYS B 2 1  ? 71.287  19.862  -14.283 1.00 0.00 ? 1  CYS B N    4  
ATOM 5274  C CA   . CYS B 2 1  ? 70.599  18.946  -13.330 1.00 0.00 ? 1  CYS B CA   4  
ATOM 5275  C C    . CYS B 2 1  ? 71.583  17.886  -12.848 1.00 0.00 ? 1  CYS B C    4  
ATOM 5276  O O    . CYS B 2 1  ? 71.617  16.774  -13.374 1.00 0.00 ? 1  CYS B O    4  
ATOM 5277  C CB   . CYS B 2 1  ? 69.415  18.280  -14.032 1.00 0.00 ? 1  CYS B CB   4  
ATOM 5278  S SG   . CYS B 2 1  ? 68.434  19.536  -14.888 1.00 0.00 ? 1  CYS B SG   4  
ATOM 5279  H HA   . CYS B 2 1  ? 70.241  19.514  -12.483 1.00 0.00 ? 1  CYS B HA   4  
ATOM 5280  H HB2  . CYS B 2 1  ? 69.782  17.559  -14.749 1.00 0.00 ? 1  CYS B HB2  4  
ATOM 5281  H HB3  . CYS B 2 1  ? 68.800  17.778  -13.302 1.00 0.00 ? 1  CYS B HB3  4  
ATOM 5282  N N    . SER B 2 2  ? 72.382  18.238  -11.846 1.00 0.00 ? 2  SER B N    4  
ATOM 5283  C CA   . SER B 2 2  ? 73.366  17.309  -11.300 1.00 0.00 ? 2  SER B CA   4  
ATOM 5284  C C    . SER B 2 2  ? 74.523  17.124  -12.276 1.00 0.00 ? 2  SER B C    4  
ATOM 5285  O O    . SER B 2 2  ? 75.688  17.292  -11.912 1.00 0.00 ? 2  SER B O    4  
ATOM 5286  C CB   . SER B 2 2  ? 72.708  15.953  -11.021 1.00 0.00 ? 2  SER B CB   4  
ATOM 5287  O OG   . SER B 2 2  ? 72.821  15.130  -12.174 1.00 0.00 ? 2  SER B OG   4  
ATOM 5288  H H    . SER B 2 2  ? 72.309  19.139  -11.467 1.00 0.00 ? 2  SER B H    4  
ATOM 5289  H HA   . SER B 2 2  ? 73.749  17.712  -10.373 1.00 0.00 ? 2  SER B HA   4  
ATOM 5290  H HB2  . SER B 2 2  ? 73.200  15.470  -10.192 1.00 0.00 ? 2  SER B HB2  4  
ATOM 5291  H HB3  . SER B 2 2  ? 71.664  16.106  -10.776 1.00 0.00 ? 2  SER B HB3  4  
ATOM 5292  H HG   . SER B 2 2  ? 73.081  14.252  -11.887 1.00 0.00 ? 2  SER B HG   4  
ATOM 5293  N N    . THR B 2 3  ? 74.195  16.779  -13.516 1.00 0.00 ? 3  THR B N    4  
ATOM 5294  C CA   . THR B 2 3  ? 75.215  16.576  -14.540 1.00 0.00 ? 3  THR B CA   4  
ATOM 5295  C C    . THR B 2 3  ? 76.369  15.741  -13.997 1.00 0.00 ? 3  THR B C    4  
ATOM 5296  O O    . THR B 2 3  ? 77.510  16.201  -13.947 1.00 0.00 ? 3  THR B O    4  
ATOM 5297  C CB   . THR B 2 3  ? 75.745  17.927  -15.024 1.00 0.00 ? 3  THR B CB   4  
ATOM 5298  O OG1  . THR B 2 3  ? 76.410  18.583  -13.954 1.00 0.00 ? 3  THR B OG1  4  
ATOM 5299  C CG2  . THR B 2 3  ? 74.581  18.791  -15.512 1.00 0.00 ? 3  THR B CG2  4  
ATOM 5300  H H    . THR B 2 3  ? 73.251  16.661  -13.748 1.00 0.00 ? 3  THR B H    4  
ATOM 5301  H HA   . THR B 2 3  ? 74.771  16.057  -15.377 1.00 0.00 ? 3  THR B HA   4  
ATOM 5302  H HB   . THR B 2 3  ? 76.437  17.772  -15.837 1.00 0.00 ? 3  THR B HB   4  
ATOM 5303  H HG1  . THR B 2 3  ? 76.495  19.512  -14.182 1.00 0.00 ? 3  THR B HG1  4  
ATOM 5304  H HG21 . THR B 2 3  ? 74.142  18.341  -16.389 1.00 0.00 ? 3  THR B HG21 4  
ATOM 5305  H HG22 . THR B 2 3  ? 74.943  19.778  -15.755 1.00 0.00 ? 3  THR B HG22 4  
ATOM 5306  H HG23 . THR B 2 3  ? 73.836  18.863  -14.733 1.00 0.00 ? 3  THR B HG23 4  
ATOM 5307  N N    . VAL B 2 4  ? 76.068  14.511  -13.593 1.00 0.00 ? 4  VAL B N    4  
ATOM 5308  C CA   . VAL B 2 4  ? 77.094  13.624  -13.059 1.00 0.00 ? 4  VAL B CA   4  
ATOM 5309  C C    . VAL B 2 4  ? 78.012  13.140  -14.179 1.00 0.00 ? 4  VAL B C    4  
ATOM 5310  O O    . VAL B 2 4  ? 79.219  12.995  -13.987 1.00 0.00 ? 4  VAL B O    4  
ATOM 5311  C CB   . VAL B 2 4  ? 76.443  12.422  -12.373 1.00 0.00 ? 4  VAL B CB   4  
ATOM 5312  C CG1  . VAL B 2 4  ? 75.500  12.912  -11.273 1.00 0.00 ? 4  VAL B CG1  4  
ATOM 5313  C CG2  . VAL B 2 4  ? 75.648  11.616  -13.403 1.00 0.00 ? 4  VAL B CG2  4  
ATOM 5314  H H    . VAL B 2 4  ? 75.143  14.196  -13.657 1.00 0.00 ? 4  VAL B H    4  
ATOM 5315  H HA   . VAL B 2 4  ? 77.683  14.164  -12.333 1.00 0.00 ? 4  VAL B HA   4  
ATOM 5316  H HB   . VAL B 2 4  ? 77.210  11.797  -11.938 1.00 0.00 ? 4  VAL B HB   4  
ATOM 5317  H HG11 . VAL B 2 4  ? 76.061  13.476  -10.543 1.00 0.00 ? 4  VAL B HG11 4  
ATOM 5318  H HG12 . VAL B 2 4  ? 75.036  12.063  -10.792 1.00 0.00 ? 4  VAL B HG12 4  
ATOM 5319  H HG13 . VAL B 2 4  ? 74.738  13.541  -11.706 1.00 0.00 ? 4  VAL B HG13 4  
ATOM 5320  H HG21 . VAL B 2 4  ? 75.016  12.282  -13.971 1.00 0.00 ? 4  VAL B HG21 4  
ATOM 5321  H HG22 . VAL B 2 4  ? 75.036  10.886  -12.894 1.00 0.00 ? 4  VAL B HG22 4  
ATOM 5322  H HG23 . VAL B 2 4  ? 76.330  11.111  -14.070 1.00 0.00 ? 4  VAL B HG23 4  
ATOM 5323  N N    . SER B 2 5  ? 77.428  12.893  -15.348 1.00 0.00 ? 5  SER B N    4  
ATOM 5324  C CA   . SER B 2 5  ? 78.194  12.425  -16.497 1.00 0.00 ? 5  SER B CA   4  
ATOM 5325  C C    . SER B 2 5  ? 79.529  13.174  -16.616 1.00 0.00 ? 5  SER B C    4  
ATOM 5326  O O    . SER B 2 5  ? 80.593  12.567  -16.481 1.00 0.00 ? 5  SER B O    4  
ATOM 5327  C CB   . SER B 2 5  ? 77.357  12.588  -17.776 1.00 0.00 ? 5  SER B CB   4  
ATOM 5328  O OG   . SER B 2 5  ? 76.743  11.345  -18.084 1.00 0.00 ? 5  SER B OG   4  
ATOM 5329  H H    . SER B 2 5  ? 76.460  13.024  -15.439 1.00 0.00 ? 5  SER B H    4  
ATOM 5330  H HA   . SER B 2 5  ? 78.404  11.376  -16.360 1.00 0.00 ? 5  SER B HA   4  
ATOM 5331  H HB2  . SER B 2 5  ? 76.588  13.325  -17.612 1.00 0.00 ? 5  SER B HB2  4  
ATOM 5332  H HB3  . SER B 2 5  ? 77.986  12.903  -18.601 1.00 0.00 ? 5  SER B HB3  4  
ATOM 5333  H HG   . SER B 2 5  ? 77.246  10.651  -17.651 1.00 0.00 ? 5  SER B HG   4  
ATOM 5334  N N    . PRO B 2 6  ? 79.503  14.462  -16.861 1.00 0.00 ? 6  PRO B N    4  
ATOM 5335  C CA   . PRO B 2 6  ? 80.753  15.276  -16.992 1.00 0.00 ? 6  PRO B CA   4  
ATOM 5336  C C    . PRO B 2 6  ? 81.594  15.242  -15.715 1.00 0.00 ? 6  PRO B C    4  
ATOM 5337  O O    . PRO B 2 6  ? 82.596  15.948  -15.602 1.00 0.00 ? 6  PRO B O    4  
ATOM 5338  C CB   . PRO B 2 6  ? 80.240  16.699  -17.297 1.00 0.00 ? 6  PRO B CB   4  
ATOM 5339  C CG   . PRO B 2 6  ? 78.820  16.709  -16.826 1.00 0.00 ? 6  PRO B CG   4  
ATOM 5340  C CD   . PRO B 2 6  ? 78.299  15.291  -17.041 1.00 0.00 ? 6  PRO B CD   4  
ATOM 5341  H HA   . PRO B 2 6  ? 81.340  14.918  -17.823 1.00 0.00 ? 6  PRO B HA   4  
ATOM 5342  H HB2  . PRO B 2 6  ? 80.823  17.441  -16.767 1.00 0.00 ? 6  PRO B HB2  4  
ATOM 5343  H HB3  . PRO B 2 6  ? 80.274  16.891  -18.362 1.00 0.00 ? 6  PRO B HB3  4  
ATOM 5344  H HG2  . PRO B 2 6  ? 78.780  16.969  -15.775 1.00 0.00 ? 6  PRO B HG2  4  
ATOM 5345  H HG3  . PRO B 2 6  ? 78.233  17.407  -17.405 1.00 0.00 ? 6  PRO B HG3  4  
ATOM 5346  H HD2  . PRO B 2 6  ? 77.545  15.051  -16.307 1.00 0.00 ? 6  PRO B HD2  4  
ATOM 5347  H HD3  . PRO B 2 6  ? 77.914  15.178  -18.042 1.00 0.00 ? 6  PRO B HD3  4  
ATOM 5348  N N    . GLY B 2 7  ? 81.177  14.417  -14.751 1.00 0.00 ? 7  GLY B N    4  
ATOM 5349  C CA   . GLY B 2 7  ? 81.894  14.294  -13.477 1.00 0.00 ? 7  GLY B CA   4  
ATOM 5350  C C    . GLY B 2 7  ? 82.393  12.870  -13.248 1.00 0.00 ? 7  GLY B C    4  
ATOM 5351  O O    . GLY B 2 7  ? 83.598  12.628  -13.192 1.00 0.00 ? 7  GLY B O    4  
ATOM 5352  H H    . GLY B 2 7  ? 80.371  13.883  -14.897 1.00 0.00 ? 7  GLY B H    4  
ATOM 5353  H HA2  . GLY B 2 7  ? 82.742  14.965  -13.469 1.00 0.00 ? 7  GLY B HA2  4  
ATOM 5354  H HA3  . GLY B 2 7  ? 81.226  14.563  -12.672 1.00 0.00 ? 7  GLY B HA3  4  
ATOM 5355  N N    . VAL B 2 8  ? 81.468  11.929  -13.099 1.00 0.00 ? 8  VAL B N    4  
ATOM 5356  C CA   . VAL B 2 8  ? 81.849  10.544  -12.860 1.00 0.00 ? 8  VAL B CA   4  
ATOM 5357  C C    . VAL B 2 8  ? 82.696  10.014  -14.019 1.00 0.00 ? 8  VAL B C    4  
ATOM 5358  O O    . VAL B 2 8  ? 83.800  9.501   -13.812 1.00 0.00 ? 8  VAL B O    4  
ATOM 5359  C CB   . VAL B 2 8  ? 80.594  9.677   -12.670 1.00 0.00 ? 8  VAL B CB   4  
ATOM 5360  C CG1  . VAL B 2 8  ? 79.710  10.265  -11.557 1.00 0.00 ? 8  VAL B CG1  4  
ATOM 5361  C CG2  . VAL B 2 8  ? 79.799  9.618   -13.980 1.00 0.00 ? 8  VAL B CG2  4  
ATOM 5362  H H    . VAL B 2 8  ? 80.519  12.170  -13.139 1.00 0.00 ? 8  VAL B H    4  
ATOM 5363  H HA   . VAL B 2 8  ? 82.438  10.500  -11.955 1.00 0.00 ? 8  VAL B HA   4  
ATOM 5364  H HB   . VAL B 2 8  ? 80.895  8.677   -12.390 1.00 0.00 ? 8  VAL B HB   4  
ATOM 5365  H HG11 . VAL B 2 8  ? 79.737  11.345  -11.594 1.00 0.00 ? 8  VAL B HG11 4  
ATOM 5366  H HG12 . VAL B 2 8  ? 80.071  9.932   -10.595 1.00 0.00 ? 8  VAL B HG12 4  
ATOM 5367  H HG13 . VAL B 2 8  ? 78.692  9.931   -11.691 1.00 0.00 ? 8  VAL B HG13 4  
ATOM 5368  H HG21 . VAL B 2 8  ? 78.783  9.314   -13.775 1.00 0.00 ? 8  VAL B HG21 4  
ATOM 5369  H HG22 . VAL B 2 8  ? 80.256  8.902   -14.638 1.00 0.00 ? 8  VAL B HG22 4  
ATOM 5370  H HG23 . VAL B 2 8  ? 79.794  10.592  -14.447 1.00 0.00 ? 8  VAL B HG23 4  
ATOM 5371  N N    . LEU B 2 9  ? 82.192  10.165  -15.242 1.00 0.00 ? 9  LEU B N    4  
ATOM 5372  C CA   . LEU B 2 9  ? 82.929  9.711   -16.413 1.00 0.00 ? 9  LEU B CA   4  
ATOM 5373  C C    . LEU B 2 9  ? 84.325  10.339  -16.393 1.00 0.00 ? 9  LEU B C    4  
ATOM 5374  O O    . LEU B 2 9  ? 85.337  9.676   -16.682 1.00 0.00 ? 9  LEU B O    4  
ATOM 5375  C CB   . LEU B 2 9  ? 82.160  10.076  -17.692 1.00 0.00 ? 9  LEU B CB   4  
ATOM 5376  C CG   . LEU B 2 9  ? 80.698  9.600   -17.567 1.00 0.00 ? 9  LEU B CG   4  
ATOM 5377  C CD1  . LEU B 2 9  ? 79.885  10.081  -18.773 1.00 0.00 ? 9  LEU B CD1  4  
ATOM 5378  C CD2  . LEU B 2 9  ? 80.644  8.063   -17.502 1.00 0.00 ? 9  LEU B CD2  4  
ATOM 5379  H H    . LEU B 2 9  ? 81.322  10.597  -15.356 1.00 0.00 ? 9  LEU B H    4  
ATOM 5380  H HA   . LEU B 2 9  ? 83.036  8.639   -16.365 1.00 0.00 ? 9  LEU B HA   4  
ATOM 5381  H HB2  . LEU B 2 9  ? 82.181  11.148  -17.831 1.00 0.00 ? 9  LEU B HB2  4  
ATOM 5382  H HB3  . LEU B 2 9  ? 82.622  9.594   -18.541 1.00 0.00 ? 9  LEU B HB3  4  
ATOM 5383  H HG   . LEU B 2 9  ? 80.267  10.012  -16.670 1.00 0.00 ? 9  LEU B HG   4  
ATOM 5384  H HD11 . LEU B 2 9  ? 78.830  9.981   -18.560 1.00 0.00 ? 9  LEU B HD11 4  
ATOM 5385  H HD12 . LEU B 2 9  ? 80.135  9.485   -19.638 1.00 0.00 ? 9  LEU B HD12 4  
ATOM 5386  H HD13 . LEU B 2 9  ? 80.112  11.117  -18.970 1.00 0.00 ? 9  LEU B HD13 4  
ATOM 5387  H HD21 . LEU B 2 9  ? 81.332  7.648   -18.223 1.00 0.00 ? 9  LEU B HD21 4  
ATOM 5388  H HD22 . LEU B 2 9  ? 79.641  7.725   -17.725 1.00 0.00 ? 9  LEU B HD22 4  
ATOM 5389  H HD23 . LEU B 2 9  ? 80.916  7.729   -16.512 1.00 0.00 ? 9  LEU B HD23 4  
ATOM 5390  N N    . ALA B 2 10 ? 84.388  11.606  -15.984 1.00 0.00 ? 10 ALA B N    4  
ATOM 5391  C CA   . ALA B 2 10 ? 85.672  12.273  -15.864 1.00 0.00 ? 10 ALA B CA   4  
ATOM 5392  C C    . ALA B 2 10 ? 86.524  11.445  -14.906 1.00 0.00 ? 10 ALA B C    4  
ATOM 5393  O O    . ALA B 2 10 ? 87.739  11.280  -15.076 1.00 0.00 ? 10 ALA B O    4  
ATOM 5394  C CB   . ALA B 2 10 ? 85.486  13.695  -15.317 1.00 0.00 ? 10 ALA B CB   4  
ATOM 5395  H H    . ALA B 2 10 ? 83.569  12.078  -15.719 1.00 0.00 ? 10 ALA B H    4  
ATOM 5396  H HA   . ALA B 2 10 ? 86.144  12.322  -16.831 1.00 0.00 ? 10 ALA B HA   4  
ATOM 5397  H HB1  . ALA B 2 10 ? 86.333  14.304  -15.600 1.00 0.00 ? 10 ALA B HB1  4  
ATOM 5398  H HB2  . ALA B 2 10 ? 85.407  13.668  -14.241 1.00 0.00 ? 10 ALA B HB2  4  
ATOM 5399  H HB3  . ALA B 2 10 ? 84.585  14.123  -15.731 1.00 0.00 ? 10 ALA B HB3  4  
ATOM 5400  N N    . GLY B 2 11 ? 85.842  10.905  -13.900 1.00 0.00 ? 11 GLY B N    4  
ATOM 5401  C CA   . GLY B 2 11 ? 86.480  10.071  -12.900 1.00 0.00 ? 11 GLY B CA   4  
ATOM 5402  C C    . GLY B 2 11 ? 87.083  8.828   -13.535 1.00 0.00 ? 11 GLY B C    4  
ATOM 5403  O O    . GLY B 2 11 ? 88.130  8.352   -13.097 1.00 0.00 ? 11 GLY B O    4  
ATOM 5404  H H    . GLY B 2 11 ? 84.877  11.067  -13.839 1.00 0.00 ? 11 GLY B H    4  
ATOM 5405  H HA2  . GLY B 2 11 ? 87.261  10.637  -12.412 1.00 0.00 ? 11 GLY B HA2  4  
ATOM 5406  H HA3  . GLY B 2 11 ? 85.747  9.771   -12.167 1.00 0.00 ? 11 GLY B HA3  4  
ATOM 5407  N N    . ILE B 2 12 ? 86.434  8.296   -14.573 1.00 0.00 ? 12 ILE B N    4  
ATOM 5408  C CA   . ILE B 2 12 ? 86.973  7.111   -15.222 1.00 0.00 ? 12 ILE B CA   4  
ATOM 5409  C C    . ILE B 2 12 ? 88.303  7.459   -15.883 1.00 0.00 ? 12 ILE B C    4  
ATOM 5410  O O    . ILE B 2 12 ? 89.278  6.733   -15.721 1.00 0.00 ? 12 ILE B O    4  
ATOM 5411  C CB   . ILE B 2 12 ? 85.969  6.526   -16.242 1.00 0.00 ? 12 ILE B CB   4  
ATOM 5412  C CG1  . ILE B 2 12 ? 84.963  5.623   -15.508 1.00 0.00 ? 12 ILE B CG1  4  
ATOM 5413  C CG2  . ILE B 2 12 ? 86.698  5.689   -17.313 1.00 0.00 ? 12 ILE B CG2  4  
ATOM 5414  C CD1  . ILE B 2 12 ? 84.291  6.395   -14.374 1.00 0.00 ? 12 ILE B CD1  4  
ATOM 5415  H H    . ILE B 2 12 ? 85.599  8.705   -14.907 1.00 0.00 ? 12 ILE B H    4  
ATOM 5416  H HA   . ILE B 2 12 ? 87.167  6.369   -14.458 1.00 0.00 ? 12 ILE B HA   4  
ATOM 5417  H HB   . ILE B 2 12 ? 85.437  7.334   -16.723 1.00 0.00 ? 12 ILE B HB   4  
ATOM 5418  H HG12 . ILE B 2 12 ? 84.216  5.284   -16.207 1.00 0.00 ? 12 ILE B HG12 4  
ATOM 5419  H HG13 . ILE B 2 12 ? 85.483  4.769   -15.099 1.00 0.00 ? 12 ILE B HG13 4  
ATOM 5420  H HG21 . ILE B 2 12 ? 87.040  6.337   -18.106 1.00 0.00 ? 12 ILE B HG21 4  
ATOM 5421  H HG22 . ILE B 2 12 ? 86.024  4.952   -17.720 1.00 0.00 ? 12 ILE B HG22 4  
ATOM 5422  H HG23 . ILE B 2 12 ? 87.545  5.186   -16.869 1.00 0.00 ? 12 ILE B HG23 4  
ATOM 5423  H HD11 . ILE B 2 12 ? 84.069  7.394   -14.705 1.00 0.00 ? 12 ILE B HD11 4  
ATOM 5424  H HD12 . ILE B 2 12 ? 84.953  6.435   -13.523 1.00 0.00 ? 12 ILE B HD12 4  
ATOM 5425  H HD13 . ILE B 2 12 ? 83.374  5.898   -14.097 1.00 0.00 ? 12 ILE B HD13 4  
ATOM 5426  N N    . VAL B 2 13 ? 88.356  8.569   -16.619 1.00 0.00 ? 13 VAL B N    4  
ATOM 5427  C CA   . VAL B 2 13 ? 89.625  8.938   -17.258 1.00 0.00 ? 13 VAL B CA   4  
ATOM 5428  C C    . VAL B 2 13 ? 90.724  8.977   -16.198 1.00 0.00 ? 13 VAL B C    4  
ATOM 5429  O O    . VAL B 2 13 ? 91.834  8.495   -16.426 1.00 0.00 ? 13 VAL B O    4  
ATOM 5430  C CB   . VAL B 2 13 ? 89.532  10.289  -18.031 1.00 0.00 ? 13 VAL B CB   4  
ATOM 5431  C CG1  . VAL B 2 13 ? 88.080  10.614  -18.322 1.00 0.00 ? 13 VAL B CG1  4  
ATOM 5432  C CG2  . VAL B 2 13 ? 90.150  11.457  -17.240 1.00 0.00 ? 13 VAL B CG2  4  
ATOM 5433  H H    . VAL B 2 13 ? 87.553  9.132   -16.726 1.00 0.00 ? 13 VAL B H    4  
ATOM 5434  H HA   . VAL B 2 13 ? 89.874  8.155   -17.962 1.00 0.00 ? 13 VAL B HA   4  
ATOM 5435  H HB   . VAL B 2 13 ? 90.057  10.191  -18.975 1.00 0.00 ? 13 VAL B HB   4  
ATOM 5436  H HG11 . VAL B 2 13 ? 87.532  10.661  -17.401 1.00 0.00 ? 13 VAL B HG11 4  
ATOM 5437  H HG12 . VAL B 2 13 ? 87.664  9.846   -18.951 1.00 0.00 ? 13 VAL B HG12 4  
ATOM 5438  H HG13 . VAL B 2 13 ? 88.020  11.567  -18.824 1.00 0.00 ? 13 VAL B HG13 4  
ATOM 5439  H HG21 . VAL B 2 13 ? 91.221  11.326  -17.181 1.00 0.00 ? 13 VAL B HG21 4  
ATOM 5440  H HG22 . VAL B 2 13 ? 89.735  11.485  -16.248 1.00 0.00 ? 13 VAL B HG22 4  
ATOM 5441  H HG23 . VAL B 2 13 ? 89.931  12.385  -17.748 1.00 0.00 ? 13 VAL B HG23 4  
ATOM 5442  N N    . VAL B 2 14 ? 90.409  9.544   -15.033 1.00 0.00 ? 14 VAL B N    4  
ATOM 5443  C CA   . VAL B 2 14 ? 91.394  9.616   -13.958 1.00 0.00 ? 14 VAL B CA   4  
ATOM 5444  C C    . VAL B 2 14 ? 91.875  8.209   -13.597 1.00 0.00 ? 14 VAL B C    4  
ATOM 5445  O O    . VAL B 2 14 ? 93.075  7.968   -13.436 1.00 0.00 ? 14 VAL B O    4  
ATOM 5446  C CB   . VAL B 2 14 ? 90.788  10.290  -12.723 1.00 0.00 ? 14 VAL B CB   4  
ATOM 5447  C CG1  . VAL B 2 14 ? 91.789  10.242  -11.567 1.00 0.00 ? 14 VAL B CG1  4  
ATOM 5448  C CG2  . VAL B 2 14 ? 90.464  11.751  -13.049 1.00 0.00 ? 14 VAL B CG2  4  
ATOM 5449  H H    . VAL B 2 14 ? 89.503  9.912   -14.897 1.00 0.00 ? 14 VAL B H    4  
ATOM 5450  H HA   . VAL B 2 14 ? 92.238  10.198  -14.295 1.00 0.00 ? 14 VAL B HA   4  
ATOM 5451  H HB   . VAL B 2 14 ? 89.883  9.775   -12.437 1.00 0.00 ? 14 VAL B HB   4  
ATOM 5452  H HG11 . VAL B 2 14 ? 92.764  10.544  -11.921 1.00 0.00 ? 14 VAL B HG11 4  
ATOM 5453  H HG12 . VAL B 2 14 ? 91.843  9.235   -11.180 1.00 0.00 ? 14 VAL B HG12 4  
ATOM 5454  H HG13 . VAL B 2 14 ? 91.467  10.912  -10.784 1.00 0.00 ? 14 VAL B HG13 4  
ATOM 5455  H HG21 . VAL B 2 14 ? 91.330  12.221  -13.491 1.00 0.00 ? 14 VAL B HG21 4  
ATOM 5456  H HG22 . VAL B 2 14 ? 90.196  12.270  -12.141 1.00 0.00 ? 14 VAL B HG22 4  
ATOM 5457  H HG23 . VAL B 2 14 ? 89.639  11.791  -13.744 1.00 0.00 ? 14 VAL B HG23 4  
ATOM 5458  N N    . GLY B 2 15 ? 90.929  7.280   -13.483 1.00 0.00 ? 15 GLY B N    4  
ATOM 5459  C CA   . GLY B 2 15 ? 91.264  5.899   -13.154 1.00 0.00 ? 15 GLY B CA   4  
ATOM 5460  C C    . GLY B 2 15 ? 92.159  5.290   -14.228 1.00 0.00 ? 15 GLY B C    4  
ATOM 5461  O O    . GLY B 2 15 ? 93.071  4.521   -13.927 1.00 0.00 ? 15 GLY B O    4  
ATOM 5462  H H    . GLY B 2 15 ? 89.992  7.527   -13.632 1.00 0.00 ? 15 GLY B H    4  
ATOM 5463  H HA2  . GLY B 2 15 ? 91.775  5.873   -12.203 1.00 0.00 ? 15 GLY B HA2  4  
ATOM 5464  H HA3  . GLY B 2 15 ? 90.355  5.320   -13.083 1.00 0.00 ? 15 GLY B HA3  4  
ATOM 5465  N N    . ASP B 2 16 ? 91.891  5.645   -15.481 1.00 0.00 ? 16 ASP B N    4  
ATOM 5466  C CA   . ASP B 2 16 ? 92.676  5.136   -16.598 1.00 0.00 ? 16 ASP B CA   4  
ATOM 5467  C C    . ASP B 2 16 ? 94.127  5.575   -16.462 1.00 0.00 ? 16 ASP B C    4  
ATOM 5468  O O    . ASP B 2 16 ? 95.048  4.792   -16.697 1.00 0.00 ? 16 ASP B O    4  
ATOM 5469  C CB   . ASP B 2 16 ? 92.104  5.654   -17.920 1.00 0.00 ? 16 ASP B CB   4  
ATOM 5470  C CG   . ASP B 2 16 ? 92.812  4.982   -19.091 1.00 0.00 ? 16 ASP B CG   4  
ATOM 5471  O OD1  . ASP B 2 16 ? 93.433  3.955   -18.872 1.00 0.00 ? 16 ASP B OD1  4  
ATOM 5472  O OD2  . ASP B 2 16 ? 92.722  5.502   -20.190 1.00 0.00 ? 16 ASP B OD2  4  
ATOM 5473  H H    . ASP B 2 16 ? 91.151  6.264   -15.657 1.00 0.00 ? 16 ASP B H    4  
ATOM 5474  H HA   . ASP B 2 16 ? 92.633  4.057   -16.597 1.00 0.00 ? 16 ASP B HA   4  
ATOM 5475  H HB2  . ASP B 2 16 ? 91.048  5.433   -17.964 1.00 0.00 ? 16 ASP B HB2  4  
ATOM 5476  H HB3  . ASP B 2 16 ? 92.252  6.722   -17.980 1.00 0.00 ? 16 ASP B HB3  4  
ATOM 5477  N N    . LEU B 2 17 ? 94.324  6.829   -16.072 1.00 0.00 ? 17 LEU B N    4  
ATOM 5478  C CA   . LEU B 2 17 ? 95.669  7.358   -15.895 1.00 0.00 ? 17 LEU B CA   4  
ATOM 5479  C C    . LEU B 2 17 ? 96.392  6.561   -14.816 1.00 0.00 ? 17 LEU B C    4  
ATOM 5480  O O    . LEU B 2 17 ? 97.554  6.178   -14.977 1.00 0.00 ? 17 LEU B O    4  
ATOM 5481  C CB   . LEU B 2 17 ? 95.593  8.839   -15.501 1.00 0.00 ? 17 LEU B CB   4  
ATOM 5482  C CG   . LEU B 2 17 ? 97.000  9.416   -15.281 1.00 0.00 ? 17 LEU B CG   4  
ATOM 5483  C CD1  . LEU B 2 17 ? 97.839  9.277   -16.562 1.00 0.00 ? 17 LEU B CD1  4  
ATOM 5484  C CD2  . LEU B 2 17 ? 96.873  10.897  -14.906 1.00 0.00 ? 17 LEU B CD2  4  
ATOM 5485  H H    . LEU B 2 17 ? 93.552  7.405   -15.892 1.00 0.00 ? 17 LEU B H    4  
ATOM 5486  H HA   . LEU B 2 17 ? 96.206  7.266   -16.826 1.00 0.00 ? 17 LEU B HA   4  
ATOM 5487  H HB2  . LEU B 2 17 ? 95.100  9.391   -16.287 1.00 0.00 ? 17 LEU B HB2  4  
ATOM 5488  H HB3  . LEU B 2 17 ? 95.023  8.935   -14.588 1.00 0.00 ? 17 LEU B HB3  4  
ATOM 5489  H HG   . LEU B 2 17 ? 97.485  8.884   -14.476 1.00 0.00 ? 17 LEU B HG   4  
ATOM 5490  H HD11 . LEU B 2 17 ? 98.274  8.289   -16.602 1.00 0.00 ? 17 LEU B HD11 4  
ATOM 5491  H HD12 . LEU B 2 17 ? 98.632  10.012  -16.561 1.00 0.00 ? 17 LEU B HD12 4  
ATOM 5492  H HD13 . LEU B 2 17 ? 97.211  9.429   -17.429 1.00 0.00 ? 17 LEU B HD13 4  
ATOM 5493  H HD21 . LEU B 2 17 ? 97.840  11.372  -14.986 1.00 0.00 ? 17 LEU B HD21 4  
ATOM 5494  H HD22 . LEU B 2 17 ? 96.513  10.982  -13.891 1.00 0.00 ? 17 LEU B HD22 4  
ATOM 5495  H HD23 . LEU B 2 17 ? 96.177  11.381  -15.576 1.00 0.00 ? 17 LEU B HD23 4  
ATOM 5496  N N    . VAL B 2 18 ? 95.687  6.299   -13.718 1.00 0.00 ? 18 VAL B N    4  
ATOM 5497  C CA   . VAL B 2 18 ? 96.266  5.532   -12.623 1.00 0.00 ? 18 VAL B CA   4  
ATOM 5498  C C    . VAL B 2 18 ? 96.664  4.143   -13.112 1.00 0.00 ? 18 VAL B C    4  
ATOM 5499  O O    . VAL B 2 18 ? 97.726  3.634   -12.761 1.00 0.00 ? 18 VAL B O    4  
ATOM 5500  C CB   . VAL B 2 18 ? 95.259  5.413   -11.475 1.00 0.00 ? 18 VAL B CB   4  
ATOM 5501  C CG1  . VAL B 2 18 ? 95.810  4.473   -10.399 1.00 0.00 ? 18 VAL B CG1  4  
ATOM 5502  C CG2  . VAL B 2 18 ? 95.024  6.797   -10.864 1.00 0.00 ? 18 VAL B CG2  4  
ATOM 5503  H H    . VAL B 2 18 ? 94.761  6.621   -13.649 1.00 0.00 ? 18 VAL B H    4  
ATOM 5504  H HA   . VAL B 2 18 ? 97.146  6.043   -12.264 1.00 0.00 ? 18 VAL B HA   4  
ATOM 5505  H HB   . VAL B 2 18 ? 94.326  5.021   -11.853 1.00 0.00 ? 18 VAL B HB   4  
ATOM 5506  H HG11 . VAL B 2 18 ? 96.838  4.731   -10.189 1.00 0.00 ? 18 VAL B HG11 4  
ATOM 5507  H HG12 . VAL B 2 18 ? 95.759  3.454   -10.751 1.00 0.00 ? 18 VAL B HG12 4  
ATOM 5508  H HG13 . VAL B 2 18 ? 95.222  4.573   -9.499  1.00 0.00 ? 18 VAL B HG13 4  
ATOM 5509  H HG21 . VAL B 2 18 ? 95.956  7.182   -10.478 1.00 0.00 ? 18 VAL B HG21 4  
ATOM 5510  H HG22 . VAL B 2 18 ? 94.306  6.718   -10.061 1.00 0.00 ? 18 VAL B HG22 4  
ATOM 5511  H HG23 . VAL B 2 18 ? 94.645  7.466   -11.623 1.00 0.00 ? 18 VAL B HG23 4  
ATOM 5512  N N    . LEU B 2 19 ? 95.807  3.537   -13.931 1.00 0.00 ? 19 LEU B N    4  
ATOM 5513  C CA   . LEU B 2 19 ? 96.091  2.209   -14.464 1.00 0.00 ? 19 LEU B CA   4  
ATOM 5514  C C    . LEU B 2 19 ? 97.322  2.259   -15.367 1.00 0.00 ? 19 LEU B C    4  
ATOM 5515  O O    . LEU B 2 19 ? 98.109  1.321   -15.406 1.00 0.00 ? 19 LEU B O    4  
ATOM 5516  C CB   . LEU B 2 19 ? 94.891  1.685   -15.267 1.00 0.00 ? 19 LEU B CB   4  
ATOM 5517  C CG   . LEU B 2 19 ? 93.763  1.229   -14.320 1.00 0.00 ? 19 LEU B CG   4  
ATOM 5518  C CD1  . LEU B 2 19 ? 92.424  1.251   -15.075 1.00 0.00 ? 19 LEU B CD1  4  
ATOM 5519  C CD2  . LEU B 2 19 ? 94.034  -0.201  -13.807 1.00 0.00 ? 19 LEU B CD2  4  
ATOM 5520  H H    . LEU B 2 19 ? 94.976  3.991   -14.183 1.00 0.00 ? 19 LEU B H    4  
ATOM 5521  H HA   . LEU B 2 19 ? 96.289  1.539   -13.645 1.00 0.00 ? 19 LEU B HA   4  
ATOM 5522  H HB2  . LEU B 2 19 ? 94.527  2.476   -15.908 1.00 0.00 ? 19 LEU B HB2  4  
ATOM 5523  H HB3  . LEU B 2 19 ? 95.204  0.852   -15.879 1.00 0.00 ? 19 LEU B HB3  4  
ATOM 5524  H HG   . LEU B 2 19 ? 93.705  1.908   -13.479 1.00 0.00 ? 19 LEU B HG   4  
ATOM 5525  H HD11 . LEU B 2 19 ? 92.554  0.820   -16.061 1.00 0.00 ? 19 LEU B HD11 4  
ATOM 5526  H HD12 . LEU B 2 19 ? 92.088  2.272   -15.175 1.00 0.00 ? 19 LEU B HD12 4  
ATOM 5527  H HD13 . LEU B 2 19 ? 91.689  0.683   -14.524 1.00 0.00 ? 19 LEU B HD13 4  
ATOM 5528  H HD21 . LEU B 2 19 ? 94.238  -0.854  -14.642 1.00 0.00 ? 19 LEU B HD21 4  
ATOM 5529  H HD22 . LEU B 2 19 ? 93.168  -0.564  -13.275 1.00 0.00 ? 19 LEU B HD22 4  
ATOM 5530  H HD23 . LEU B 2 19 ? 94.880  -0.198  -13.138 1.00 0.00 ? 19 LEU B HD23 4  
ATOM 5531  N N    . THR B 2 20 ? 97.482  3.357   -16.094 1.00 0.00 ? 20 THR B N    4  
ATOM 5532  C CA   . THR B 2 20 ? 98.624  3.499   -16.988 1.00 0.00 ? 20 THR B CA   4  
ATOM 5533  C C    . THR B 2 20 ? 99.931  3.461   -16.201 1.00 0.00 ? 20 THR B C    4  
ATOM 5534  O O    . THR B 2 20 ? 100.862 2.737   -16.559 1.00 0.00 ? 20 THR B O    4  
ATOM 5535  C CB   . THR B 2 20 ? 98.527  4.818   -17.758 1.00 0.00 ? 20 THR B CB   4  
ATOM 5536  O OG1  . THR B 2 20 ? 97.335  4.828   -18.529 1.00 0.00 ? 20 THR B OG1  4  
ATOM 5537  C CG2  . THR B 2 20 ? 99.737  4.961   -18.682 1.00 0.00 ? 20 THR B CG2  4  
ATOM 5538  H H    . THR B 2 20 ? 96.823  4.080   -16.030 1.00 0.00 ? 20 THR B H    4  
ATOM 5539  H HA   . THR B 2 20 ? 98.618  2.683   -17.696 1.00 0.00 ? 20 THR B HA   4  
ATOM 5540  H HB   . THR B 2 20 ? 98.513  5.642   -17.061 1.00 0.00 ? 20 THR B HB   4  
ATOM 5541  H HG1  . THR B 2 20 ? 97.535  4.452   -19.390 1.00 0.00 ? 20 THR B HG1  4  
ATOM 5542  H HG21 . THR B 2 20 ? 100.622 5.146   -18.091 1.00 0.00 ? 20 THR B HG21 4  
ATOM 5543  H HG22 . THR B 2 20 ? 99.577  5.787   -19.359 1.00 0.00 ? 20 THR B HG22 4  
ATOM 5544  H HG23 . THR B 2 20 ? 99.866  4.051   -19.248 1.00 0.00 ? 20 THR B HG23 4  
ATOM 5545  N N    . VAL B 2 21 ? 99.997  4.248   -15.133 1.00 0.00 ? 21 VAL B N    4  
ATOM 5546  C CA   . VAL B 2 21 ? 101.202 4.302   -14.310 1.00 0.00 ? 21 VAL B CA   4  
ATOM 5547  C C    . VAL B 2 21 ? 101.425 2.991   -13.555 1.00 0.00 ? 21 VAL B C    4  
ATOM 5548  O O    . VAL B 2 21 ? 102.536 2.458   -13.536 1.00 0.00 ? 21 VAL B O    4  
ATOM 5549  C CB   . VAL B 2 21 ? 101.095 5.452   -13.307 1.00 0.00 ? 21 VAL B CB   4  
ATOM 5550  C CG1  . VAL B 2 21 ? 102.361 5.504   -12.450 1.00 0.00 ? 21 VAL B CG1  4  
ATOM 5551  C CG2  . VAL B 2 21 ? 100.936 6.775   -14.061 1.00 0.00 ? 21 VAL B CG2  4  
ATOM 5552  H H    . VAL B 2 21 ? 99.225  4.809   -14.899 1.00 0.00 ? 21 VAL B H    4  
ATOM 5553  H HA   . VAL B 2 21 ? 102.052 4.483   -14.950 1.00 0.00 ? 21 VAL B HA   4  
ATOM 5554  H HB   . VAL B 2 21 ? 100.236 5.294   -12.669 1.00 0.00 ? 21 VAL B HB   4  
ATOM 5555  H HG11 . VAL B 2 21 ? 103.230 5.477   -13.092 1.00 0.00 ? 21 VAL B HG11 4  
ATOM 5556  H HG12 . VAL B 2 21 ? 102.380 4.655   -11.783 1.00 0.00 ? 21 VAL B HG12 4  
ATOM 5557  H HG13 . VAL B 2 21 ? 102.368 6.416   -11.872 1.00 0.00 ? 21 VAL B HG13 4  
ATOM 5558  H HG21 . VAL B 2 21 ? 100.085 6.711   -14.724 1.00 0.00 ? 21 VAL B HG21 4  
ATOM 5559  H HG22 . VAL B 2 21 ? 101.828 6.969   -14.639 1.00 0.00 ? 21 VAL B HG22 4  
ATOM 5560  H HG23 . VAL B 2 21 ? 100.783 7.577   -13.355 1.00 0.00 ? 21 VAL B HG23 4  
ATOM 5561  N N    . LEU B 2 22 ? 100.372 2.487   -12.918 1.00 0.00 ? 22 LEU B N    4  
ATOM 5562  C CA   . LEU B 2 22 ? 100.475 1.249   -12.146 1.00 0.00 ? 22 LEU B CA   4  
ATOM 5563  C C    . LEU B 2 22 ? 100.887 0.074   -13.033 1.00 0.00 ? 22 LEU B C    4  
ATOM 5564  O O    . LEU B 2 22 ? 101.842 -0.642  -12.724 1.00 0.00 ? 22 LEU B O    4  
ATOM 5565  C CB   . LEU B 2 22 ? 99.129  0.953   -11.469 1.00 0.00 ? 22 LEU B CB   4  
ATOM 5566  C CG   . LEU B 2 22 ? 99.164  -0.411  -10.760 1.00 0.00 ? 22 LEU B CG   4  
ATOM 5567  C CD1  . LEU B 2 22 ? 100.364 -0.481  -9.804  1.00 0.00 ? 22 LEU B CD1  4  
ATOM 5568  C CD2  . LEU B 2 22 ? 97.866  -0.592  -9.965  1.00 0.00 ? 22 LEU B CD2  4  
ATOM 5569  H H    . LEU B 2 22 ? 99.515  2.960   -12.956 1.00 0.00 ? 22 LEU B H    4  
ATOM 5570  H HA   . LEU B 2 22 ? 101.224 1.387   -11.382 1.00 0.00 ? 22 LEU B HA   4  
ATOM 5571  H HB2  . LEU B 2 22 ? 98.919  1.726   -10.746 1.00 0.00 ? 22 LEU B HB2  4  
ATOM 5572  H HB3  . LEU B 2 22 ? 98.350  0.944   -12.217 1.00 0.00 ? 22 LEU B HB3  4  
ATOM 5573  H HG   . LEU B 2 22 ? 99.245  -1.198  -11.495 1.00 0.00 ? 22 LEU B HG   4  
ATOM 5574  H HD11 . LEU B 2 22 ? 100.484 0.469   -9.304  1.00 0.00 ? 22 LEU B HD11 4  
ATOM 5575  H HD12 . LEU B 2 22 ? 101.258 -0.707  -10.366 1.00 0.00 ? 22 LEU B HD12 4  
ATOM 5576  H HD13 . LEU B 2 22 ? 100.198 -1.256  -9.070  1.00 0.00 ? 22 LEU B HD13 4  
ATOM 5577  H HD21 . LEU B 2 22 ? 97.047  -0.760  -10.647 1.00 0.00 ? 22 LEU B HD21 4  
ATOM 5578  H HD22 . LEU B 2 22 ? 97.673  0.295   -9.380  1.00 0.00 ? 22 LEU B HD22 4  
ATOM 5579  H HD23 . LEU B 2 22 ? 97.965  -1.441  -9.305  1.00 0.00 ? 22 LEU B HD23 4  
ATOM 5580  N N    . ILE B 2 23 ? 100.170 -0.121  -14.133 1.00 0.00 ? 23 ILE B N    4  
ATOM 5581  C CA   . ILE B 2 23 ? 100.483 -1.215  -15.044 1.00 0.00 ? 23 ILE B CA   4  
ATOM 5582  C C    . ILE B 2 23 ? 101.923 -1.089  -15.530 1.00 0.00 ? 23 ILE B C    4  
ATOM 5583  O O    . ILE B 2 23 ? 102.692 -2.044  -15.456 1.00 0.00 ? 23 ILE B O    4  
ATOM 5584  C CB   . ILE B 2 23 ? 99.518  -1.210  -16.237 1.00 0.00 ? 23 ILE B CB   4  
ATOM 5585  C CG1  . ILE B 2 23 ? 98.094  -1.496  -15.741 1.00 0.00 ? 23 ILE B CG1  4  
ATOM 5586  C CG2  . ILE B 2 23 ? 99.922  -2.296  -17.240 1.00 0.00 ? 23 ILE B CG2  4  
ATOM 5587  C CD1  . ILE B 2 23 ? 97.086  -1.103  -16.823 1.00 0.00 ? 23 ILE B CD1  4  
ATOM 5588  H H    . ILE B 2 23 ? 99.421  0.478   -14.336 1.00 0.00 ? 23 ILE B H    4  
ATOM 5589  H HA   . ILE B 2 23 ? 100.376 -2.149  -14.514 1.00 0.00 ? 23 ILE B HA   4  
ATOM 5590  H HB   . ILE B 2 23 ? 99.547  -0.244  -16.721 1.00 0.00 ? 23 ILE B HB   4  
ATOM 5591  H HG12 . ILE B 2 23 ? 97.993  -2.548  -15.523 1.00 0.00 ? 23 ILE B HG12 4  
ATOM 5592  H HG13 . ILE B 2 23 ? 97.900  -0.925  -14.846 1.00 0.00 ? 23 ILE B HG13 4  
ATOM 5593  H HG21 . ILE B 2 23 ? 100.878 -2.051  -17.675 1.00 0.00 ? 23 ILE B HG21 4  
ATOM 5594  H HG22 . ILE B 2 23 ? 99.178  -2.360  -18.023 1.00 0.00 ? 23 ILE B HG22 4  
ATOM 5595  H HG23 . ILE B 2 23 ? 99.992  -3.247  -16.733 1.00 0.00 ? 23 ILE B HG23 4  
ATOM 5596  H HD11 . ILE B 2 23 ? 97.230  -1.727  -17.693 1.00 0.00 ? 23 ILE B HD11 4  
ATOM 5597  H HD12 . ILE B 2 23 ? 97.232  -0.068  -17.094 1.00 0.00 ? 23 ILE B HD12 4  
ATOM 5598  H HD13 . ILE B 2 23 ? 96.084  -1.239  -16.446 1.00 0.00 ? 23 ILE B HD13 4  
ATOM 5599  N N    . ALA B 2 24 ? 102.289 0.095   -16.016 1.00 0.00 ? 24 ALA B N    4  
ATOM 5600  C CA   . ALA B 2 24 ? 103.651 0.317   -16.492 1.00 0.00 ? 24 ALA B CA   4  
ATOM 5601  C C    . ALA B 2 24 ? 104.652 -0.188  -15.458 1.00 0.00 ? 24 ALA B C    4  
ATOM 5602  O O    . ALA B 2 24 ? 105.611 -0.891  -15.791 1.00 0.00 ? 24 ALA B O    4  
ATOM 5603  C CB   . ALA B 2 24 ? 103.883 1.808   -16.745 1.00 0.00 ? 24 ALA B CB   4  
ATOM 5604  H H    . ALA B 2 24 ? 101.638 0.828   -16.047 1.00 0.00 ? 24 ALA B H    4  
ATOM 5605  H HA   . ALA B 2 24 ? 103.793 -0.222  -17.417 1.00 0.00 ? 24 ALA B HA   4  
ATOM 5606  H HB1  . ALA B 2 24 ? 103.063 2.208   -17.321 1.00 0.00 ? 24 ALA B HB1  4  
ATOM 5607  H HB2  . ALA B 2 24 ? 104.805 1.940   -17.291 1.00 0.00 ? 24 ALA B HB2  4  
ATOM 5608  H HB3  . ALA B 2 24 ? 103.947 2.326   -15.800 1.00 0.00 ? 24 ALA B HB3  4  
ATOM 5609  N N    . LEU B 2 25 ? 104.415 0.158   -14.198 1.00 0.00 ? 25 LEU B N    4  
ATOM 5610  C CA   . LEU B 2 25 ? 105.294 -0.284  -13.125 1.00 0.00 ? 25 LEU B CA   4  
ATOM 5611  C C    . LEU B 2 25 ? 105.358 -1.811  -13.135 1.00 0.00 ? 25 LEU B C    4  
ATOM 5612  O O    . LEU B 2 25 ? 106.422 -2.404  -12.965 1.00 0.00 ? 25 LEU B O    4  
ATOM 5613  C CB   . LEU B 2 25 ? 104.761 0.230   -11.772 1.00 0.00 ? 25 LEU B CB   4  
ATOM 5614  C CG   . LEU B 2 25 ? 105.907 0.436   -10.759 1.00 0.00 ? 25 LEU B CG   4  
ATOM 5615  C CD1  . LEU B 2 25 ? 106.761 -0.832  -10.665 1.00 0.00 ? 25 LEU B CD1  4  
ATOM 5616  C CD2  . LEU B 2 25 ? 106.793 1.631   -11.172 1.00 0.00 ? 25 LEU B CD2  4  
ATOM 5617  H H    . LEU B 2 25 ? 103.632 0.708   -13.985 1.00 0.00 ? 25 LEU B H    4  
ATOM 5618  H HA   . LEU B 2 25 ? 106.282 0.111   -13.299 1.00 0.00 ? 25 LEU B HA   4  
ATOM 5619  H HB2  . LEU B 2 25 ? 104.250 1.168   -11.928 1.00 0.00 ? 25 LEU B HB2  4  
ATOM 5620  H HB3  . LEU B 2 25 ? 104.057 -0.485  -11.366 1.00 0.00 ? 25 LEU B HB3  4  
ATOM 5621  H HG   . LEU B 2 25 ? 105.478 0.636   -9.787  1.00 0.00 ? 25 LEU B HG   4  
ATOM 5622  H HD11 . LEU B 2 25 ? 107.428 -0.882  -11.513 1.00 0.00 ? 25 LEU B HD11 4  
ATOM 5623  H HD12 . LEU B 2 25 ? 106.120 -1.701  -10.657 1.00 0.00 ? 25 LEU B HD12 4  
ATOM 5624  H HD13 . LEU B 2 25 ? 107.341 -0.807  -9.755  1.00 0.00 ? 25 LEU B HD13 4  
ATOM 5625  H HD21 . LEU B 2 25 ? 107.583 1.300   -11.831 1.00 0.00 ? 25 LEU B HD21 4  
ATOM 5626  H HD22 . LEU B 2 25 ? 107.233 2.067   -10.288 1.00 0.00 ? 25 LEU B HD22 4  
ATOM 5627  H HD23 . LEU B 2 25 ? 106.196 2.378   -11.676 1.00 0.00 ? 25 LEU B HD23 4  
ATOM 5628  N N    . ALA B 2 26 ? 104.205 -2.436  -13.354 1.00 0.00 ? 26 ALA B N    4  
ATOM 5629  C CA   . ALA B 2 26 ? 104.133 -3.891  -13.401 1.00 0.00 ? 26 ALA B CA   4  
ATOM 5630  C C    . ALA B 2 26 ? 104.993 -4.430  -14.542 1.00 0.00 ? 26 ALA B C    4  
ATOM 5631  O O    . ALA B 2 26 ? 105.633 -5.473  -14.409 1.00 0.00 ? 26 ALA B O    4  
ATOM 5632  C CB   . ALA B 2 26 ? 102.681 -4.342  -13.590 1.00 0.00 ? 26 ALA B CB   4  
ATOM 5633  H H    . ALA B 2 26 ? 103.390 -1.907  -13.492 1.00 0.00 ? 26 ALA B H    4  
ATOM 5634  H HA   . ALA B 2 26 ? 104.502 -4.290  -12.468 1.00 0.00 ? 26 ALA B HA   4  
ATOM 5635  H HB1  . ALA B 2 26 ? 102.035 -3.742  -12.966 1.00 0.00 ? 26 ALA B HB1  4  
ATOM 5636  H HB2  . ALA B 2 26 ? 102.588 -5.380  -13.310 1.00 0.00 ? 26 ALA B HB2  4  
ATOM 5637  H HB3  . ALA B 2 26 ? 102.396 -4.221  -14.624 1.00 0.00 ? 26 ALA B HB3  4  
ATOM 5638  N N    . VAL B 2 27 ? 105.011 -3.710  -15.663 1.00 0.00 ? 27 VAL B N    4  
ATOM 5639  C CA   . VAL B 2 27 ? 105.806 -4.132  -16.812 1.00 0.00 ? 27 VAL B CA   4  
ATOM 5640  C C    . VAL B 2 27 ? 107.276 -4.198  -16.421 1.00 0.00 ? 27 VAL B C    4  
ATOM 5641  O O    . VAL B 2 27 ? 107.967 -5.172  -16.719 1.00 0.00 ? 27 VAL B O    4  
ATOM 5642  C CB   . VAL B 2 27 ? 105.630 -3.153  -17.977 1.00 0.00 ? 27 VAL B CB   4  
ATOM 5643  C CG1  . VAL B 2 27 ? 106.413 -3.657  -19.190 1.00 0.00 ? 27 VAL B CG1  4  
ATOM 5644  C CG2  . VAL B 2 27 ? 104.146 -3.038  -18.338 1.00 0.00 ? 27 VAL B CG2  4  
ATOM 5645  H H    . VAL B 2 27 ? 104.487 -2.883  -15.715 1.00 0.00 ? 27 VAL B H    4  
ATOM 5646  H HA   . VAL B 2 27 ? 105.480 -5.113  -17.124 1.00 0.00 ? 27 VAL B HA   4  
ATOM 5647  H HB   . VAL B 2 27 ? 106.008 -2.184  -17.690 1.00 0.00 ? 27 VAL B HB   4  
ATOM 5648  H HG11 . VAL B 2 27 ? 107.472 -3.565  -18.999 1.00 0.00 ? 27 VAL B HG11 4  
ATOM 5649  H HG12 . VAL B 2 27 ? 106.150 -3.070  -20.056 1.00 0.00 ? 27 VAL B HG12 4  
ATOM 5650  H HG13 . VAL B 2 27 ? 106.169 -4.694  -19.370 1.00 0.00 ? 27 VAL B HG13 4  
ATOM 5651  H HG21 . VAL B 2 27 ? 103.558 -2.966  -17.436 1.00 0.00 ? 27 VAL B HG21 4  
ATOM 5652  H HG22 . VAL B 2 27 ? 103.840 -3.910  -18.896 1.00 0.00 ? 27 VAL B HG22 4  
ATOM 5653  H HG23 . VAL B 2 27 ? 103.990 -2.155  -18.940 1.00 0.00 ? 27 VAL B HG23 4  
ATOM 5654  N N    . TYR B 2 28 ? 107.743 -3.154  -15.744 1.00 0.00 ? 28 TYR B N    4  
ATOM 5655  C CA   . TYR B 2 28 ? 109.132 -3.106  -15.305 1.00 0.00 ? 28 TYR B CA   4  
ATOM 5656  C C    . TYR B 2 28 ? 109.422 -4.260  -14.347 1.00 0.00 ? 28 TYR B C    4  
ATOM 5657  O O    . TYR B 2 28 ? 110.478 -4.889  -14.417 1.00 0.00 ? 28 TYR B O    4  
ATOM 5658  C CB   . TYR B 2 28 ? 109.413 -1.775  -14.604 1.00 0.00 ? 28 TYR B CB   4  
ATOM 5659  C CG   . TYR B 2 28 ? 110.831 -1.765  -14.086 1.00 0.00 ? 28 TYR B CG   4  
ATOM 5660  C CD1  . TYR B 2 28 ? 111.873 -1.321  -14.908 1.00 0.00 ? 28 TYR B CD1  4  
ATOM 5661  C CD2  . TYR B 2 28 ? 111.103 -2.200  -12.783 1.00 0.00 ? 28 TYR B CD2  4  
ATOM 5662  C CE1  . TYR B 2 28 ? 113.188 -1.312  -14.427 1.00 0.00 ? 28 TYR B CE1  4  
ATOM 5663  C CE2  . TYR B 2 28 ? 112.419 -2.191  -12.303 1.00 0.00 ? 28 TYR B CE2  4  
ATOM 5664  C CZ   . TYR B 2 28 ? 113.461 -1.746  -13.125 1.00 0.00 ? 28 TYR B CZ   4  
ATOM 5665  O OH   . TYR B 2 28 ? 114.756 -1.737  -12.650 1.00 0.00 ? 28 TYR B OH   4  
ATOM 5666  H H    . TYR B 2 28 ? 107.141 -2.408  -15.529 1.00 0.00 ? 28 TYR B H    4  
ATOM 5667  H HA   . TYR B 2 28 ? 109.778 -3.192  -16.166 1.00 0.00 ? 28 TYR B HA   4  
ATOM 5668  H HB2  . TYR B 2 28 ? 109.280 -0.965  -15.306 1.00 0.00 ? 28 TYR B HB2  4  
ATOM 5669  H HB3  . TYR B 2 28 ? 108.728 -1.651  -13.779 1.00 0.00 ? 28 TYR B HB3  4  
ATOM 5670  H HD1  . TYR B 2 28 ? 111.663 -0.986  -15.913 1.00 0.00 ? 28 TYR B HD1  4  
ATOM 5671  H HD2  . TYR B 2 28 ? 110.299 -2.543  -12.149 1.00 0.00 ? 28 TYR B HD2  4  
ATOM 5672  H HE1  . TYR B 2 28 ? 113.993 -0.969  -15.061 1.00 0.00 ? 28 TYR B HE1  4  
ATOM 5673  H HE2  . TYR B 2 28 ? 112.628 -2.526  -11.298 1.00 0.00 ? 28 TYR B HE2  4  
ATOM 5674  H HH   . TYR B 2 28 ? 115.262 -1.115  -13.181 1.00 0.00 ? 28 TYR B HH   4  
ATOM 5675  N N    . PHE B 2 29 ? 108.473 -4.530  -13.457 1.00 0.00 ? 29 PHE B N    4  
ATOM 5676  C CA   . PHE B 2 29 ? 108.625 -5.608  -12.487 1.00 0.00 ? 29 PHE B CA   4  
ATOM 5677  C C    . PHE B 2 29 ? 108.819 -6.947  -13.197 1.00 0.00 ? 29 PHE B C    4  
ATOM 5678  O O    . PHE B 2 29 ? 109.679 -7.742  -12.819 1.00 0.00 ? 29 PHE B O    4  
ATOM 5679  C CB   . PHE B 2 29 ? 107.384 -5.670  -11.589 1.00 0.00 ? 29 PHE B CB   4  
ATOM 5680  C CG   . PHE B 2 29 ? 107.456 -6.889  -10.692 1.00 0.00 ? 29 PHE B CG   4  
ATOM 5681  C CD1  . PHE B 2 29 ? 108.500 -7.014  -9.767  1.00 0.00 ? 29 PHE B CD1  4  
ATOM 5682  C CD2  . PHE B 2 29 ? 106.481 -7.892  -10.785 1.00 0.00 ? 29 PHE B CD2  4  
ATOM 5683  C CE1  . PHE B 2 29 ? 108.570 -8.140  -8.938  1.00 0.00 ? 29 PHE B CE1  4  
ATOM 5684  C CE2  . PHE B 2 29 ? 106.550 -9.016  -9.956  1.00 0.00 ? 29 PHE B CE2  4  
ATOM 5685  C CZ   . PHE B 2 29 ? 107.596 -9.141  -9.032  1.00 0.00 ? 29 PHE B CZ   4  
ATOM 5686  H H    . PHE B 2 29 ? 107.653 -3.993  -13.453 1.00 0.00 ? 29 PHE B H    4  
ATOM 5687  H HA   . PHE B 2 29 ? 109.490 -5.408  -11.874 1.00 0.00 ? 29 PHE B HA   4  
ATOM 5688  H HB2  . PHE B 2 29 ? 107.340 -4.778  -10.980 1.00 0.00 ? 29 PHE B HB2  4  
ATOM 5689  H HB3  . PHE B 2 29 ? 106.499 -5.726  -12.205 1.00 0.00 ? 29 PHE B HB3  4  
ATOM 5690  H HD1  . PHE B 2 29 ? 109.252 -6.243  -9.694  1.00 0.00 ? 29 PHE B HD1  4  
ATOM 5691  H HD2  . PHE B 2 29 ? 105.674 -7.796  -11.498 1.00 0.00 ? 29 PHE B HD2  4  
ATOM 5692  H HE1  . PHE B 2 29 ? 109.376 -8.237  -8.226  1.00 0.00 ? 29 PHE B HE1  4  
ATOM 5693  H HE2  . PHE B 2 29 ? 105.798 -9.788  -10.029 1.00 0.00 ? 29 PHE B HE2  4  
ATOM 5694  H HZ   . PHE B 2 29 ? 107.650 -10.009 -8.392  1.00 0.00 ? 29 PHE B HZ   4  
ATOM 5695  N N    . LEU B 2 30 ? 108.012 -7.189  -14.225 1.00 0.00 ? 30 LEU B N    4  
ATOM 5696  C CA   . LEU B 2 30 ? 108.104 -8.436  -14.976 1.00 0.00 ? 30 LEU B CA   4  
ATOM 5697  C C    . LEU B 2 30 ? 109.522 -8.631  -15.506 1.00 0.00 ? 30 LEU B C    4  
ATOM 5698  O O    . LEU B 2 30 ? 110.065 -9.735  -15.463 1.00 0.00 ? 30 LEU B O    4  
ATOM 5699  C CB   . LEU B 2 30 ? 107.104 -8.414  -16.141 1.00 0.00 ? 30 LEU B CB   4  
ATOM 5700  C CG   . LEU B 2 30 ? 107.285 -9.649  -17.036 1.00 0.00 ? 30 LEU B CG   4  
ATOM 5701  C CD1  . LEU B 2 30 ? 107.210 -10.930 -16.194 1.00 0.00 ? 30 LEU B CD1  4  
ATOM 5702  C CD2  . LEU B 2 30 ? 106.172 -9.665  -18.090 1.00 0.00 ? 30 LEU B CD2  4  
ATOM 5703  H H    . LEU B 2 30 ? 107.343 -6.520  -14.481 1.00 0.00 ? 30 LEU B H    4  
ATOM 5704  H HA   . LEU B 2 30 ? 107.859 -9.255  -14.317 1.00 0.00 ? 30 LEU B HA   4  
ATOM 5705  H HB2  . LEU B 2 30 ? 106.099 -8.405  -15.745 1.00 0.00 ? 30 LEU B HB2  4  
ATOM 5706  H HB3  . LEU B 2 30 ? 107.263 -7.523  -16.729 1.00 0.00 ? 30 LEU B HB3  4  
ATOM 5707  H HG   . LEU B 2 30 ? 108.243 -9.599  -17.531 1.00 0.00 ? 30 LEU B HG   4  
ATOM 5708  H HD11 . LEU B 2 30 ? 106.984 -11.772 -16.833 1.00 0.00 ? 30 LEU B HD11 4  
ATOM 5709  H HD12 . LEU B 2 30 ? 106.436 -10.829 -15.449 1.00 0.00 ? 30 LEU B HD12 4  
ATOM 5710  H HD13 . LEU B 2 30 ? 108.159 -11.096 -15.708 1.00 0.00 ? 30 LEU B HD13 4  
ATOM 5711  H HD21 . LEU B 2 30 ? 106.193 -10.604 -18.622 1.00 0.00 ? 30 LEU B HD21 4  
ATOM 5712  H HD22 . LEU B 2 30 ? 106.324 -8.853  -18.787 1.00 0.00 ? 30 LEU B HD22 4  
ATOM 5713  H HD23 . LEU B 2 30 ? 105.215 -9.548  -17.603 1.00 0.00 ? 30 LEU B HD23 4  
ATOM 5714  N N    . GLY B 2 31 ? 110.118 -7.552  -16.003 1.00 0.00 ? 31 GLY B N    4  
ATOM 5715  C CA   . GLY B 2 31 ? 111.474 -7.616  -16.537 1.00 0.00 ? 31 GLY B CA   4  
ATOM 5716  C C    . GLY B 2 31 ? 111.480 -8.207  -17.942 1.00 0.00 ? 31 GLY B C    4  
ATOM 5717  O O    . GLY B 2 31 ? 110.525 -8.866  -18.354 1.00 0.00 ? 31 GLY B O    4  
ATOM 5718  H H    . GLY B 2 31 ? 109.637 -6.697  -16.011 1.00 0.00 ? 31 GLY B H    4  
ATOM 5719  H HA2  . GLY B 2 31 ? 111.891 -6.620  -16.566 1.00 0.00 ? 31 GLY B HA2  4  
ATOM 5720  H HA3  . GLY B 2 31 ? 112.079 -8.236  -15.892 1.00 0.00 ? 31 GLY B HA3  4  
ATOM 5721  N N    . ARG B 2 32 ? 112.564 -7.966  -18.675 1.00 0.00 ? 32 ARG B N    4  
ATOM 5722  C CA   . ARG B 2 32 ? 112.687 -8.479  -20.036 1.00 0.00 ? 32 ARG B CA   4  
ATOM 5723  C C    . ARG B 2 32 ? 113.174 -9.924  -20.022 1.00 0.00 ? 32 ARG B C    4  
ATOM 5724  O O    . ARG B 2 32 ? 114.316 -10.201 -19.652 1.00 0.00 ? 32 ARG B O    4  
ATOM 5725  C CB   . ARG B 2 32 ? 113.668 -7.616  -20.831 1.00 0.00 ? 32 ARG B CB   4  
ATOM 5726  C CG   . ARG B 2 32 ? 113.178 -6.166  -20.843 1.00 0.00 ? 32 ARG B CG   4  
ATOM 5727  C CD   . ARG B 2 32 ? 114.133 -5.310  -21.675 1.00 0.00 ? 32 ARG B CD   4  
ATOM 5728  N NE   . ARG B 2 32 ? 113.936 -5.571  -23.096 1.00 0.00 ? 32 ARG B NE   4  
ATOM 5729  C CZ   . ARG B 2 32 ? 112.904 -5.052  -23.753 1.00 0.00 ? 32 ARG B CZ   4  
ATOM 5730  N NH1  . ARG B 2 32 ? 112.046 -4.295  -23.126 1.00 0.00 ? 32 ARG B NH1  4  
ATOM 5731  N NH2  . ARG B 2 32 ? 112.747 -5.300  -25.025 1.00 0.00 ? 32 ARG B NH2  4  
ATOM 5732  H H    . ARG B 2 32 ? 113.294 -7.435  -18.294 1.00 0.00 ? 32 ARG B H    4  
ATOM 5733  H HA   . ARG B 2 32 ? 111.721 -8.439  -20.518 1.00 0.00 ? 32 ARG B HA   4  
ATOM 5734  H HB2  . ARG B 2 32 ? 114.644 -7.663  -20.370 1.00 0.00 ? 32 ARG B HB2  4  
ATOM 5735  H HB3  . ARG B 2 32 ? 113.730 -7.981  -21.845 1.00 0.00 ? 32 ARG B HB3  4  
ATOM 5736  H HG2  . ARG B 2 32 ? 112.188 -6.125  -21.274 1.00 0.00 ? 32 ARG B HG2  4  
ATOM 5737  H HG3  . ARG B 2 32 ? 113.147 -5.788  -19.832 1.00 0.00 ? 32 ARG B HG3  4  
ATOM 5738  H HD2  . ARG B 2 32 ? 113.944 -4.266  -21.476 1.00 0.00 ? 32 ARG B HD2  4  
ATOM 5739  H HD3  . ARG B 2 32 ? 115.153 -5.544  -21.404 1.00 0.00 ? 32 ARG B HD3  4  
ATOM 5740  H HE   . ARG B 2 32 ? 114.574 -6.140  -23.575 1.00 0.00 ? 32 ARG B HE   4  
ATOM 5741  H HH11 . ARG B 2 32 ? 112.165 -4.105  -22.151 1.00 0.00 ? 32 ARG B HH11 4  
ATOM 5742  H HH12 . ARG B 2 32 ? 111.269 -3.904  -23.620 1.00 0.00 ? 32 ARG B HH12 4  
ATOM 5743  H HH21 . ARG B 2 32 ? 113.404 -5.881  -25.505 1.00 0.00 ? 32 ARG B HH21 4  
ATOM 5744  H HH22 . ARG B 2 32 ? 111.971 -4.909  -25.519 1.00 0.00 ? 32 ARG B HH22 4  
ATOM 5745  N N    . CYS A 1 1  ? 70.766  20.701  -17.929 1.00 0.00 ? 1  CYS A N    5  
ATOM 5746  C CA   . CYS A 1 1  ? 71.463  19.753  -17.015 1.00 0.00 ? 1  CYS A CA   5  
ATOM 5747  C C    . CYS A 1 1  ? 71.270  18.328  -17.519 1.00 0.00 ? 1  CYS A C    5  
ATOM 5748  O O    . CYS A 1 1  ? 70.965  17.420  -16.745 1.00 0.00 ? 1  CYS A O    5  
ATOM 5749  C CB   . CYS A 1 1  ? 70.885  19.890  -15.605 1.00 0.00 ? 1  CYS A CB   5  
ATOM 5750  S SG   . CYS A 1 1  ? 70.955  21.622  -15.088 1.00 0.00 ? 1  CYS A SG   5  
ATOM 5751  H HA   . CYS A 1 1  ? 72.518  19.986  -16.994 1.00 0.00 ? 1  CYS A HA   5  
ATOM 5752  H HB2  . CYS A 1 1  ? 69.858  19.555  -15.604 1.00 0.00 ? 1  CYS A HB2  5  
ATOM 5753  H HB3  . CYS A 1 1  ? 71.461  19.286  -14.919 1.00 0.00 ? 1  CYS A HB3  5  
ATOM 5754  N N    . SER A 1 2  ? 71.447  18.137  -18.822 1.00 0.00 ? 2  SER A N    5  
ATOM 5755  C CA   . SER A 1 2  ? 71.286  16.816  -19.419 1.00 0.00 ? 2  SER A CA   5  
ATOM 5756  C C    . SER A 1 2  ? 72.499  15.940  -19.123 1.00 0.00 ? 2  SER A C    5  
ATOM 5757  O O    . SER A 1 2  ? 73.609  16.229  -19.569 1.00 0.00 ? 2  SER A O    5  
ATOM 5758  C CB   . SER A 1 2  ? 71.105  16.945  -20.932 1.00 0.00 ? 2  SER A CB   5  
ATOM 5759  O OG   . SER A 1 2  ? 70.955  15.650  -21.499 1.00 0.00 ? 2  SER A OG   5  
ATOM 5760  H H    . SER A 1 2  ? 71.687  18.897  -19.393 1.00 0.00 ? 2  SER A H    5  
ATOM 5761  H HA   . SER A 1 2  ? 70.407  16.348  -19.003 1.00 0.00 ? 2  SER A HA   5  
ATOM 5762  H HB2  . SER A 1 2  ? 70.225  17.529  -21.142 1.00 0.00 ? 2  SER A HB2  5  
ATOM 5763  H HB3  . SER A 1 2  ? 71.971  17.437  -21.356 1.00 0.00 ? 2  SER A HB3  5  
ATOM 5764  H HG   . SER A 1 2  ? 71.514  15.044  -21.005 1.00 0.00 ? 2  SER A HG   5  
ATOM 5765  N N    . THR A 1 3  ? 72.277  14.866  -18.369 1.00 0.00 ? 3  THR A N    5  
ATOM 5766  C CA   . THR A 1 3  ? 73.358  13.948  -18.020 1.00 0.00 ? 3  THR A CA   5  
ATOM 5767  C C    . THR A 1 3  ? 73.601  12.958  -19.154 1.00 0.00 ? 3  THR A C    5  
ATOM 5768  O O    . THR A 1 3  ? 72.808  12.878  -20.093 1.00 0.00 ? 3  THR A O    5  
ATOM 5769  C CB   . THR A 1 3  ? 73.001  13.185  -16.742 1.00 0.00 ? 3  THR A CB   5  
ATOM 5770  O OG1  . THR A 1 3  ? 73.847  12.051  -16.617 1.00 0.00 ? 3  THR A OG1  5  
ATOM 5771  C CG2  . THR A 1 3  ? 71.541  12.732  -16.807 1.00 0.00 ? 3  THR A CG2  5  
ATOM 5772  H H    . THR A 1 3  ? 71.371  14.686  -18.044 1.00 0.00 ? 3  THR A H    5  
ATOM 5773  H HA   . THR A 1 3  ? 74.262  14.514  -17.848 1.00 0.00 ? 3  THR A HA   5  
ATOM 5774  H HB   . THR A 1 3  ? 73.136  13.831  -15.888 1.00 0.00 ? 3  THR A HB   5  
ATOM 5775  H HG1  . THR A 1 3  ? 74.756  12.359  -16.593 1.00 0.00 ? 3  THR A HG1  5  
ATOM 5776  H HG21 . THR A 1 3  ? 71.362  11.991  -16.042 1.00 0.00 ? 3  THR A HG21 5  
ATOM 5777  H HG22 . THR A 1 3  ? 71.340  12.304  -17.777 1.00 0.00 ? 3  THR A HG22 5  
ATOM 5778  H HG23 . THR A 1 3  ? 70.894  13.581  -16.646 1.00 0.00 ? 3  THR A HG23 5  
ATOM 5779  N N    . VAL A 1 4  ? 74.698  12.203  -19.053 1.00 0.00 ? 4  VAL A N    5  
ATOM 5780  C CA   . VAL A 1 4  ? 75.050  11.205  -20.073 1.00 0.00 ? 4  VAL A CA   5  
ATOM 5781  C C    . VAL A 1 4  ? 74.617  11.649  -21.468 1.00 0.00 ? 4  VAL A C    5  
ATOM 5782  O O    . VAL A 1 4  ? 74.237  10.831  -22.306 1.00 0.00 ? 4  VAL A O    5  
ATOM 5783  C CB   . VAL A 1 4  ? 74.411  9.859   -19.722 1.00 0.00 ? 4  VAL A CB   5  
ATOM 5784  C CG1  . VAL A 1 4  ? 74.997  9.355   -18.400 1.00 0.00 ? 4  VAL A CG1  5  
ATOM 5785  C CG2  . VAL A 1 4  ? 72.894  10.024  -19.570 1.00 0.00 ? 4  VAL A CG2  5  
ATOM 5786  H H    . VAL A 1 4  ? 75.282  12.316  -18.270 1.00 0.00 ? 4  VAL A H    5  
ATOM 5787  H HA   . VAL A 1 4  ? 76.123  11.078  -20.084 1.00 0.00 ? 4  VAL A HA   5  
ATOM 5788  H HB   . VAL A 1 4  ? 74.621  9.145   -20.505 1.00 0.00 ? 4  VAL A HB   5  
ATOM 5789  H HG11 . VAL A 1 4  ? 74.391  8.547   -18.020 1.00 0.00 ? 4  VAL A HG11 5  
ATOM 5790  H HG12 . VAL A 1 4  ? 75.013  10.163  -17.681 1.00 0.00 ? 4  VAL A HG12 5  
ATOM 5791  H HG13 . VAL A 1 4  ? 76.005  9.003   -18.565 1.00 0.00 ? 4  VAL A HG13 5  
ATOM 5792  H HG21 . VAL A 1 4  ? 72.432  9.051   -19.518 1.00 0.00 ? 4  VAL A HG21 5  
ATOM 5793  H HG22 . VAL A 1 4  ? 72.502  10.564  -20.419 1.00 0.00 ? 4  VAL A HG22 5  
ATOM 5794  H HG23 . VAL A 1 4  ? 72.681  10.572  -18.664 1.00 0.00 ? 4  VAL A HG23 5  
ATOM 5795  N N    . SER A 1 5  ? 74.695  12.955  -21.708 1.00 0.00 ? 5  SER A N    5  
ATOM 5796  C CA   . SER A 1 5  ? 74.328  13.521  -23.003 1.00 0.00 ? 5  SER A CA   5  
ATOM 5797  C C    . SER A 1 5  ? 75.529  13.492  -23.956 1.00 0.00 ? 5  SER A C    5  
ATOM 5798  O O    . SER A 1 5  ? 75.381  13.172  -25.135 1.00 0.00 ? 5  SER A O    5  
ATOM 5799  C CB   . SER A 1 5  ? 73.829  14.966  -22.822 1.00 0.00 ? 5  SER A CB   5  
ATOM 5800  O OG   . SER A 1 5  ? 74.811  15.881  -23.297 1.00 0.00 ? 5  SER A OG   5  
ATOM 5801  H H    . SER A 1 5  ? 75.019  13.550  -20.999 1.00 0.00 ? 5  SER A H    5  
ATOM 5802  H HA   . SER A 1 5  ? 73.534  12.925  -23.432 1.00 0.00 ? 5  SER A HA   5  
ATOM 5803  H HB2  . SER A 1 5  ? 72.917  15.115  -23.378 1.00 0.00 ? 5  SER A HB2  5  
ATOM 5804  H HB3  . SER A 1 5  ? 73.636  15.146  -21.772 1.00 0.00 ? 5  SER A HB3  5  
ATOM 5805  H HG   . SER A 1 5  ? 74.726  15.937  -24.251 1.00 0.00 ? 5  SER A HG   5  
ATOM 5806  N N    . PRO A 1 6  ? 76.706  13.814  -23.471 1.00 0.00 ? 6  PRO A N    5  
ATOM 5807  C CA   . PRO A 1 6  ? 77.949  13.818  -24.304 1.00 0.00 ? 6  PRO A CA   5  
ATOM 5808  C C    . PRO A 1 6  ? 78.106  12.551  -25.130 1.00 0.00 ? 6  PRO A C    5  
ATOM 5809  O O    . PRO A 1 6  ? 78.438  12.619  -26.313 1.00 0.00 ? 6  PRO A O    5  
ATOM 5810  C CB   . PRO A 1 6  ? 79.063  13.966  -23.264 1.00 0.00 ? 6  PRO A CB   5  
ATOM 5811  C CG   . PRO A 1 6  ? 78.425  14.754  -22.175 1.00 0.00 ? 6  PRO A CG   5  
ATOM 5812  C CD   . PRO A 1 6  ? 77.002  14.212  -22.079 1.00 0.00 ? 6  PRO A CD   5  
ATOM 5813  H HA   . PRO A 1 6  ? 77.966  14.670  -24.952 1.00 0.00 ? 6  PRO A HA   5  
ATOM 5814  H HB2  . PRO A 1 6  ? 79.372  12.994  -22.901 1.00 0.00 ? 6  PRO A HB2  5  
ATOM 5815  H HB3  . PRO A 1 6  ? 79.904  14.506  -23.673 1.00 0.00 ? 6  PRO A HB3  5  
ATOM 5816  H HG2  . PRO A 1 6  ? 78.952  14.609  -21.245 1.00 0.00 ? 6  PRO A HG2  5  
ATOM 5817  H HG3  . PRO A 1 6  ? 78.398  15.800  -22.434 1.00 0.00 ? 6  PRO A HG3  5  
ATOM 5818  H HD2  . PRO A 1 6  ? 76.978  13.357  -21.417 1.00 0.00 ? 6  PRO A HD2  5  
ATOM 5819  H HD3  . PRO A 1 6  ? 76.318  14.977  -21.751 1.00 0.00 ? 6  PRO A HD3  5  
ATOM 5820  N N    . GLY A 1 7  ? 77.873  11.400  -24.512 1.00 0.00 ? 7  GLY A N    5  
ATOM 5821  C CA   . GLY A 1 7  ? 78.017  10.138  -25.238 1.00 0.00 ? 7  GLY A CA   5  
ATOM 5822  C C    . GLY A 1 7  ? 79.493  9.881   -25.505 1.00 0.00 ? 7  GLY A C    5  
ATOM 5823  O O    . GLY A 1 7  ? 80.014  8.802   -25.215 1.00 0.00 ? 7  GLY A O    5  
ATOM 5824  H H    . GLY A 1 7  ? 77.610  11.402  -23.560 1.00 0.00 ? 7  GLY A H    5  
ATOM 5825  H HA2  . GLY A 1 7  ? 77.607  9.321   -24.654 1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5826  H HA3  . GLY A 1 7  ? 77.495  10.203  -26.179 1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5827  N N    . VAL A 1 8  ? 80.175  10.894  -26.030 1.00 0.00 ? 8  VAL A N    5  
ATOM 5828  C CA   . VAL A 1 8  ? 81.596  10.775  -26.293 1.00 0.00 ? 8  VAL A CA   5  
ATOM 5829  C C    . VAL A 1 8  ? 82.282  10.366  -25.006 1.00 0.00 ? 8  VAL A C    5  
ATOM 5830  O O    . VAL A 1 8  ? 83.156  9.493   -24.997 1.00 0.00 ? 8  VAL A O    5  
ATOM 5831  C CB   . VAL A 1 8  ? 82.157  12.107  -26.793 1.00 0.00 ? 8  VAL A CB   5  
ATOM 5832  C CG1  . VAL A 1 8  ? 83.685  12.030  -26.869 1.00 0.00 ? 8  VAL A CG1  5  
ATOM 5833  C CG2  . VAL A 1 8  ? 81.595  12.395  -28.186 1.00 0.00 ? 8  VAL A CG2  5  
ATOM 5834  H H    . VAL A 1 8  ? 79.721  11.738  -26.218 1.00 0.00 ? 8  VAL A H    5  
ATOM 5835  H HA   . VAL A 1 8  ? 81.758  10.013  -27.042 1.00 0.00 ? 8  VAL A HA   5  
ATOM 5836  H HB   . VAL A 1 8  ? 81.870  12.897  -26.116 1.00 0.00 ? 8  VAL A HB   5  
ATOM 5837  H HG11 . VAL A 1 8  ? 84.096  12.051  -25.871 1.00 0.00 ? 8  VAL A HG11 5  
ATOM 5838  H HG12 . VAL A 1 8  ? 84.061  12.873  -27.431 1.00 0.00 ? 8  VAL A HG12 5  
ATOM 5839  H HG13 . VAL A 1 8  ? 83.976  11.113  -27.360 1.00 0.00 ? 8  VAL A HG13 5  
ATOM 5840  H HG21 . VAL A 1 8  ? 81.756  11.537  -28.823 1.00 0.00 ? 8  VAL A HG21 5  
ATOM 5841  H HG22 . VAL A 1 8  ? 82.096  13.255  -28.605 1.00 0.00 ? 8  VAL A HG22 5  
ATOM 5842  H HG23 . VAL A 1 8  ? 80.537  12.594  -28.111 1.00 0.00 ? 8  VAL A HG23 5  
ATOM 5843  N N    . LEU A 1 9  ? 81.858  10.973  -23.898 1.00 0.00 ? 9  LEU A N    5  
ATOM 5844  C CA   . LEU A 1 9  ? 82.439  10.605  -22.618 1.00 0.00 ? 9  LEU A CA   5  
ATOM 5845  C C    . LEU A 1 9  ? 82.280  9.089   -22.439 1.00 0.00 ? 9  LEU A C    5  
ATOM 5846  O O    . LEU A 1 9  ? 83.184  8.395   -21.958 1.00 0.00 ? 9  LEU A O    5  
ATOM 5847  C CB   . LEU A 1 9  ? 81.771  11.364  -21.467 1.00 0.00 ? 9  LEU A CB   5  
ATOM 5848  C CG   . LEU A 1 9  ? 82.077  12.873  -21.560 1.00 0.00 ? 9  LEU A CG   5  
ATOM 5849  C CD1  . LEU A 1 9  ? 81.435  13.585  -20.366 1.00 0.00 ? 9  LEU A CD1  5  
ATOM 5850  C CD2  . LEU A 1 9  ? 83.600  13.129  -21.543 1.00 0.00 ? 9  LEU A CD2  5  
ATOM 5851  H H    . LEU A 1 9  ? 81.132  11.652  -23.946 1.00 0.00 ? 9  LEU A H    5  
ATOM 5852  H HA   . LEU A 1 9  ? 83.487  10.844  -22.638 1.00 0.00 ? 9  LEU A HA   5  
ATOM 5853  H HB2  . LEU A 1 9  ? 80.703  11.214  -21.513 1.00 0.00 ? 9  LEU A HB2  5  
ATOM 5854  H HB3  . LEU A 1 9  ? 82.145  10.986  -20.527 1.00 0.00 ? 9  LEU A HB3  5  
ATOM 5855  H HG   . LEU A 1 9  ? 81.657  13.266  -22.475 1.00 0.00 ? 9  LEU A HG   5  
ATOM 5856  H HD11 . LEU A 1 9  ? 81.382  14.646  -20.562 1.00 0.00 ? 9  LEU A HD11 5  
ATOM 5857  H HD12 . LEU A 1 9  ? 82.030  13.411  -19.482 1.00 0.00 ? 9  LEU A HD12 5  
ATOM 5858  H HD13 . LEU A 1 9  ? 80.445  13.198  -20.209 1.00 0.00 ? 9  LEU A HD13 5  
ATOM 5859  H HD21 . LEU A 1 9  ? 83.980  13.098  -22.555 1.00 0.00 ? 9  LEU A HD21 5  
ATOM 5860  H HD22 . LEU A 1 9  ? 84.092  12.369  -20.953 1.00 0.00 ? 9  LEU A HD22 5  
ATOM 5861  H HD23 . LEU A 1 9  ? 83.807  14.102  -21.117 1.00 0.00 ? 9  LEU A HD23 5  
ATOM 5862  N N    . ALA A 1 10 ? 81.138  8.564   -22.885 1.00 0.00 ? 10 ALA A N    5  
ATOM 5863  C CA   . ALA A 1 10 ? 80.912  7.128   -22.815 1.00 0.00 ? 10 ALA A CA   5  
ATOM 5864  C C    . ALA A 1 10 ? 82.014  6.442   -23.613 1.00 0.00 ? 10 ALA A C    5  
ATOM 5865  O O    . ALA A 1 10 ? 82.527  5.388   -23.227 1.00 0.00 ? 10 ALA A O    5  
ATOM 5866  C CB   . ALA A 1 10 ? 79.529  6.774   -23.384 1.00 0.00 ? 10 ALA A CB   5  
ATOM 5867  H H    . ALA A 1 10 ? 80.464  9.142   -23.297 1.00 0.00 ? 10 ALA A H    5  
ATOM 5868  H HA   . ALA A 1 10 ? 80.969  6.807   -21.783 1.00 0.00 ? 10 ALA A HA   5  
ATOM 5869  H HB1  . ALA A 1 10 ? 78.839  7.577   -23.172 1.00 0.00 ? 10 ALA A HB1  5  
ATOM 5870  H HB2  . ALA A 1 10 ? 79.171  5.863   -22.924 1.00 0.00 ? 10 ALA A HB2  5  
ATOM 5871  H HB3  . ALA A 1 10 ? 79.595  6.631   -24.453 1.00 0.00 ? 10 ALA A HB3  5  
ATOM 5872  N N    . GLY A 1 11 ? 82.397  7.082   -24.718 1.00 0.00 ? 11 GLY A N    5  
ATOM 5873  C CA   . GLY A 1 11 ? 83.468  6.560   -25.552 1.00 0.00 ? 11 GLY A CA   5  
ATOM 5874  C C    . GLY A 1 11 ? 84.752  6.497   -24.736 1.00 0.00 ? 11 GLY A C    5  
ATOM 5875  O O    . GLY A 1 11 ? 85.613  5.653   -24.972 1.00 0.00 ? 11 GLY A O    5  
ATOM 5876  H H    . GLY A 1 11 ? 81.967  7.933   -24.959 1.00 0.00 ? 11 GLY A H    5  
ATOM 5877  H HA2  . GLY A 1 11 ? 83.207  5.569   -25.897 1.00 0.00 ? 11 GLY A HA2  5  
ATOM 5878  H HA3  . GLY A 1 11 ? 83.616  7.212   -26.399 1.00 0.00 ? 11 GLY A HA3  5  
ATOM 5879  N N    . ILE A 1 12 ? 84.857  7.398   -23.760 1.00 0.00 ? 12 ILE A N    5  
ATOM 5880  C CA   . ILE A 1 12 ? 86.031  7.442   -22.883 1.00 0.00 ? 12 ILE A CA   5  
ATOM 5881  C C    . ILE A 1 12 ? 86.054  6.174   -22.037 1.00 0.00 ? 12 ILE A C    5  
ATOM 5882  O O    . ILE A 1 12 ? 87.106  5.576   -21.825 1.00 0.00 ? 12 ILE A O    5  
ATOM 5883  C CB   . ILE A 1 12 ? 86.003  8.738   -21.996 1.00 0.00 ? 12 ILE A CB   5  
ATOM 5884  C CG1  . ILE A 1 12 ? 87.352  9.486   -22.068 1.00 0.00 ? 12 ILE A CG1  5  
ATOM 5885  C CG2  . ILE A 1 12 ? 85.694  8.433   -20.505 1.00 0.00 ? 12 ILE A CG2  5  
ATOM 5886  C CD1  . ILE A 1 12 ? 87.157  10.931  -21.598 1.00 0.00 ? 12 ILE A CD1  5  
ATOM 5887  H H    . ILE A 1 12 ? 84.127  8.034   -23.626 1.00 0.00 ? 12 ILE A H    5  
ATOM 5888  H HA   . ILE A 1 12 ? 86.913  7.442   -23.505 1.00 0.00 ? 12 ILE A HA   5  
ATOM 5889  H HB   . ILE A 1 12 ? 85.234  9.387   -22.375 1.00 0.00 ? 12 ILE A HB   5  
ATOM 5890  H HG12 . ILE A 1 12 ? 88.072  8.993   -21.431 1.00 0.00 ? 12 ILE A HG12 5  
ATOM 5891  H HG13 . ILE A 1 12 ? 87.716  9.496   -23.084 1.00 0.00 ? 12 ILE A HG13 5  
ATOM 5892  H HG21 . ILE A 1 12 ? 86.534  7.925   -20.055 1.00 0.00 ? 12 ILE A HG21 5  
ATOM 5893  H HG22 . ILE A 1 12 ? 84.820  7.812   -20.427 1.00 0.00 ? 12 ILE A HG22 5  
ATOM 5894  H HG23 . ILE A 1 12 ? 85.514  9.358   -19.975 1.00 0.00 ? 12 ILE A HG23 5  
ATOM 5895  H HD11 . ILE A 1 12 ? 86.514  10.948  -20.730 1.00 0.00 ? 12 ILE A HD11 5  
ATOM 5896  H HD12 . ILE A 1 12 ? 86.702  11.508  -22.390 1.00 0.00 ? 12 ILE A HD12 5  
ATOM 5897  H HD13 . ILE A 1 12 ? 88.115  11.360  -21.346 1.00 0.00 ? 12 ILE A HD13 5  
ATOM 5898  N N    . VAL A 1 13 ? 84.879  5.769   -21.566 1.00 0.00 ? 13 VAL A N    5  
ATOM 5899  C CA   . VAL A 1 13 ? 84.782  4.560   -20.756 1.00 0.00 ? 13 VAL A CA   5  
ATOM 5900  C C    . VAL A 1 13 ? 85.264  3.362   -21.562 1.00 0.00 ? 13 VAL A C    5  
ATOM 5901  O O    . VAL A 1 13 ? 86.116  2.589   -21.108 1.00 0.00 ? 13 VAL A O    5  
ATOM 5902  C CB   . VAL A 1 13 ? 83.337  4.336   -20.302 1.00 0.00 ? 13 VAL A CB   5  
ATOM 5903  C CG1  . VAL A 1 13 ? 83.253  3.037   -19.499 1.00 0.00 ? 13 VAL A CG1  5  
ATOM 5904  C CG2  . VAL A 1 13 ? 82.891  5.506   -19.424 1.00 0.00 ? 13 VAL A CG2  5  
ATOM 5905  H H    . VAL A 1 13 ? 84.071  6.290   -21.769 1.00 0.00 ? 13 VAL A H    5  
ATOM 5906  H HA   . VAL A 1 13 ? 85.409  4.671   -19.892 1.00 0.00 ? 13 VAL A HA   5  
ATOM 5907  H HB   . VAL A 1 13 ? 82.694  4.265   -21.167 1.00 0.00 ? 13 VAL A HB   5  
ATOM 5908  H HG11 . VAL A 1 13 ? 84.032  3.026   -18.751 1.00 0.00 ? 13 VAL A HG11 5  
ATOM 5909  H HG12 . VAL A 1 13 ? 83.377  2.194   -20.161 1.00 0.00 ? 13 VAL A HG12 5  
ATOM 5910  H HG13 . VAL A 1 13 ? 82.289  2.975   -19.015 1.00 0.00 ? 13 VAL A HG13 5  
ATOM 5911  H HG21 . VAL A 1 13 ? 83.518  5.556   -18.546 1.00 0.00 ? 13 VAL A HG21 5  
ATOM 5912  H HG22 . VAL A 1 13 ? 81.864  5.360   -19.125 1.00 0.00 ? 13 VAL A HG22 5  
ATOM 5913  H HG23 . VAL A 1 13 ? 82.977  6.428   -19.980 1.00 0.00 ? 13 VAL A HG23 5  
ATOM 5914  N N    . VAL A 1 14 ? 84.732  3.222   -22.770 1.00 0.00 ? 14 VAL A N    5  
ATOM 5915  C CA   . VAL A 1 14 ? 85.138  2.120   -23.636 1.00 0.00 ? 14 VAL A CA   5  
ATOM 5916  C C    . VAL A 1 14 ? 86.642  2.184   -23.879 1.00 0.00 ? 14 VAL A C    5  
ATOM 5917  O O    . VAL A 1 14 ? 87.341  1.171   -23.810 1.00 0.00 ? 14 VAL A O    5  
ATOM 5918  C CB   . VAL A 1 14 ? 84.398  2.199   -24.975 1.00 0.00 ? 14 VAL A CB   5  
ATOM 5919  C CG1  . VAL A 1 14 ? 84.920  1.109   -25.914 1.00 0.00 ? 14 VAL A CG1  5  
ATOM 5920  C CG2  . VAL A 1 14 ? 82.899  1.996   -24.741 1.00 0.00 ? 14 VAL A CG2  5  
ATOM 5921  H H    . VAL A 1 14 ? 84.067  3.877   -23.088 1.00 0.00 ? 14 VAL A H    5  
ATOM 5922  H HA   . VAL A 1 14 ? 84.897  1.184   -23.155 1.00 0.00 ? 14 VAL A HA   5  
ATOM 5923  H HB   . VAL A 1 14 ? 84.567  3.168   -25.422 1.00 0.00 ? 14 VAL A HB   5  
ATOM 5924  H HG11 . VAL A 1 14 ? 84.977  0.171   -25.382 1.00 0.00 ? 14 VAL A HG11 5  
ATOM 5925  H HG12 . VAL A 1 14 ? 85.901  1.381   -26.272 1.00 0.00 ? 14 VAL A HG12 5  
ATOM 5926  H HG13 . VAL A 1 14 ? 84.247  1.005   -26.753 1.00 0.00 ? 14 VAL A HG13 5  
ATOM 5927  H HG21 . VAL A 1 14 ? 82.522  2.787   -24.111 1.00 0.00 ? 14 VAL A HG21 5  
ATOM 5928  H HG22 . VAL A 1 14 ? 82.736  1.044   -24.261 1.00 0.00 ? 14 VAL A HG22 5  
ATOM 5929  H HG23 . VAL A 1 14 ? 82.381  2.015   -25.690 1.00 0.00 ? 14 VAL A HG23 5  
ATOM 5930  N N    . GLY A 1 15 ? 87.124  3.393   -24.158 1.00 0.00 ? 15 GLY A N    5  
ATOM 5931  C CA   . GLY A 1 15 ? 88.542  3.617   -24.413 1.00 0.00 ? 15 GLY A CA   5  
ATOM 5932  C C    . GLY A 1 15 ? 89.390  3.155   -23.233 1.00 0.00 ? 15 GLY A C    5  
ATOM 5933  O O    . GLY A 1 15 ? 90.489  2.636   -23.412 1.00 0.00 ? 15 GLY A O    5  
ATOM 5934  H H    . GLY A 1 15 ? 86.509  4.155   -24.193 1.00 0.00 ? 15 GLY A H    5  
ATOM 5935  H HA2  . GLY A 1 15 ? 88.832  3.078   -25.300 1.00 0.00 ? 15 GLY A HA2  5  
ATOM 5936  H HA3  . GLY A 1 15 ? 88.708  4.672   -24.571 1.00 0.00 ? 15 GLY A HA3  5  
ATOM 5937  N N    . ASP A 1 16 ? 88.872  3.355   -22.028 1.00 0.00 ? 16 ASP A N    5  
ATOM 5938  C CA   . ASP A 1 16 ? 89.588  2.964   -20.822 1.00 0.00 ? 16 ASP A CA   5  
ATOM 5939  C C    . ASP A 1 16 ? 89.745  1.448   -20.759 1.00 0.00 ? 16 ASP A C    5  
ATOM 5940  O O    . ASP A 1 16 ? 90.839  0.934   -20.512 1.00 0.00 ? 16 ASP A O    5  
ATOM 5941  C CB   . ASP A 1 16 ? 88.826  3.454   -19.590 1.00 0.00 ? 16 ASP A CB   5  
ATOM 5942  C CG   . ASP A 1 16 ? 89.696  3.315   -18.346 1.00 0.00 ? 16 ASP A CG   5  
ATOM 5943  O OD1  . ASP A 1 16 ? 90.598  2.494   -18.366 1.00 0.00 ? 16 ASP A OD1  5  
ATOM 5944  O OD2  . ASP A 1 16 ? 89.446  4.032   -17.393 1.00 0.00 ? 16 ASP A OD2  5  
ATOM 5945  H H    . ASP A 1 16 ? 87.992  3.780   -21.948 1.00 0.00 ? 16 ASP A H    5  
ATOM 5946  H HA   . ASP A 1 16 ? 90.567  3.419   -20.831 1.00 0.00 ? 16 ASP A HA   5  
ATOM 5947  H HB2  . ASP A 1 16 ? 88.558  4.492   -19.725 1.00 0.00 ? 16 ASP A HB2  5  
ATOM 5948  H HB3  . ASP A 1 16 ? 87.930  2.865   -19.466 1.00 0.00 ? 16 ASP A HB3  5  
ATOM 5949  N N    . LEU A 1 17 ? 88.643  0.736   -20.979 1.00 0.00 ? 17 LEU A N    5  
ATOM 5950  C CA   . LEU A 1 17 ? 88.675  -0.721  -20.937 1.00 0.00 ? 17 LEU A CA   5  
ATOM 5951  C C    . LEU A 1 17 ? 89.726  -1.267  -21.904 1.00 0.00 ? 17 LEU A C    5  
ATOM 5952  O O    . LEU A 1 17 ? 90.579  -2.079  -21.522 1.00 0.00 ? 17 LEU A O    5  
ATOM 5953  C CB   . LEU A 1 17 ? 87.296  -1.283  -21.304 1.00 0.00 ? 17 LEU A CB   5  
ATOM 5954  C CG   . LEU A 1 17 ? 87.261  -2.808  -21.093 1.00 0.00 ? 17 LEU A CG   5  
ATOM 5955  C CD1  . LEU A 1 17 ? 87.304  -3.148  -19.592 1.00 0.00 ? 17 LEU A CD1  5  
ATOM 5956  C CD2  . LEU A 1 17 ? 85.974  -3.365  -21.710 1.00 0.00 ? 17 LEU A CD2  5  
ATOM 5957  H H    . LEU A 1 17 ? 87.796  1.200   -21.168 1.00 0.00 ? 17 LEU A H    5  
ATOM 5958  H HA   . LEU A 1 17 ? 88.925  -1.033  -19.936 1.00 0.00 ? 17 LEU A HA   5  
ATOM 5959  H HB2  . LEU A 1 17 ? 86.543  -0.815  -20.687 1.00 0.00 ? 17 LEU A HB2  5  
ATOM 5960  H HB3  . LEU A 1 17 ? 87.089  -1.065  -22.341 1.00 0.00 ? 17 LEU A HB3  5  
ATOM 5961  H HG   . LEU A 1 17 ? 88.112  -3.258  -21.582 1.00 0.00 ? 17 LEU A HG   5  
ATOM 5962  H HD11 . LEU A 1 17 ? 86.873  -4.127  -19.429 1.00 0.00 ? 17 LEU A HD11 5  
ATOM 5963  H HD12 . LEU A 1 17 ? 86.744  -2.415  -19.032 1.00 0.00 ? 17 LEU A HD12 5  
ATOM 5964  H HD13 . LEU A 1 17 ? 88.330  -3.153  -19.253 1.00 0.00 ? 17 LEU A HD13 5  
ATOM 5965  H HD21 . LEU A 1 17 ? 86.035  -3.305  -22.787 1.00 0.00 ? 17 LEU A HD21 5  
ATOM 5966  H HD22 . LEU A 1 17 ? 85.129  -2.787  -21.365 1.00 0.00 ? 17 LEU A HD22 5  
ATOM 5967  H HD23 . LEU A 1 17 ? 85.850  -4.397  -21.414 1.00 0.00 ? 17 LEU A HD23 5  
ATOM 5968  N N    . VAL A 1 18 ? 89.669  -0.824  -23.157 1.00 0.00 ? 18 VAL A N    5  
ATOM 5969  C CA   . VAL A 1 18 ? 90.628  -1.297  -24.146 1.00 0.00 ? 18 VAL A CA   5  
ATOM 5970  C C    . VAL A 1 18 ? 92.042  -0.862  -23.780 1.00 0.00 ? 18 VAL A C    5  
ATOM 5971  O O    . VAL A 1 18 ? 92.997  -1.539  -24.125 1.00 0.00 ? 18 VAL A O    5  
ATOM 5972  C CB   . VAL A 1 18 ? 90.277  -0.782  -25.544 1.00 0.00 ? 18 VAL A CB   5  
ATOM 5973  C CG1  . VAL A 1 18 ? 88.955  -1.401  -26.000 1.00 0.00 ? 18 VAL A CG1  5  
ATOM 5974  C CG2  . VAL A 1 18 ? 90.138  0.733   -25.501 1.00 0.00 ? 18 VAL A CG2  5  
ATOM 5975  H H    . VAL A 1 18 ? 88.975  -0.176  -23.418 1.00 0.00 ? 18 VAL A H    5  
ATOM 5976  H HA   . VAL A 1 18 ? 90.597  -2.376  -24.163 1.00 0.00 ? 18 VAL A HA   5  
ATOM 5977  H HB   . VAL A 1 18 ? 91.062  -1.055  -26.236 1.00 0.00 ? 18 VAL A HB   5  
ATOM 5978  H HG11 . VAL A 1 18 ? 88.623  -0.913  -26.905 1.00 0.00 ? 18 VAL A HG11 5  
ATOM 5979  H HG12 . VAL A 1 18 ? 88.212  -1.274  -25.228 1.00 0.00 ? 18 VAL A HG12 5  
ATOM 5980  H HG13 . VAL A 1 18 ? 89.099  -2.454  -26.191 1.00 0.00 ? 18 VAL A HG13 5  
ATOM 5981  H HG21 . VAL A 1 18 ? 91.107  1.181   -25.337 1.00 0.00 ? 18 VAL A HG21 5  
ATOM 5982  H HG22 . VAL A 1 18 ? 89.479  0.996   -24.695 1.00 0.00 ? 18 VAL A HG22 5  
ATOM 5983  H HG23 . VAL A 1 18 ? 89.728  1.086   -26.435 1.00 0.00 ? 18 VAL A HG23 5  
ATOM 5984  N N    . LEU A 1 19 ? 92.175  0.267   -23.081 1.00 0.00 ? 19 LEU A N    5  
ATOM 5985  C CA   . LEU A 1 19 ? 93.505  0.744   -22.694 1.00 0.00 ? 19 LEU A CA   5  
ATOM 5986  C C    . LEU A 1 19 ? 94.189  -0.289  -21.794 1.00 0.00 ? 19 LEU A C    5  
ATOM 5987  O O    . LEU A 1 19 ? 95.283  -0.777  -22.106 1.00 0.00 ? 19 LEU A O    5  
ATOM 5988  C CB   . LEU A 1 19 ? 93.383  2.093   -21.957 1.00 0.00 ? 19 LEU A CB   5  
ATOM 5989  C CG   . LEU A 1 19 ? 94.652  2.944   -22.153 1.00 0.00 ? 19 LEU A CG   5  
ATOM 5990  C CD1  . LEU A 1 19 ? 95.883  2.134   -21.735 1.00 0.00 ? 19 LEU A CD1  5  
ATOM 5991  C CD2  . LEU A 1 19 ? 94.790  3.392   -23.627 1.00 0.00 ? 19 LEU A CD2  5  
ATOM 5992  H H    . LEU A 1 19 ? 91.379  0.781   -22.827 1.00 0.00 ? 19 LEU A H    5  
ATOM 5993  H HA   . LEU A 1 19 ? 94.096  0.874   -23.585 1.00 0.00 ? 19 LEU A HA   5  
ATOM 5994  H HB2  . LEU A 1 19 ? 92.535  2.633   -22.341 1.00 0.00 ? 19 LEU A HB2  5  
ATOM 5995  H HB3  . LEU A 1 19 ? 93.236  1.918   -20.900 1.00 0.00 ? 19 LEU A HB3  5  
ATOM 5996  H HG   . LEU A 1 19 ? 94.583  3.820   -21.523 1.00 0.00 ? 19 LEU A HG   5  
ATOM 5997  H HD11 . LEU A 1 19 ? 95.687  1.638   -20.796 1.00 0.00 ? 19 LEU A HD11 5  
ATOM 5998  H HD12 . LEU A 1 19 ? 96.724  2.801   -21.620 1.00 0.00 ? 19 LEU A HD12 5  
ATOM 5999  H HD13 . LEU A 1 19 ? 96.106  1.398   -22.492 1.00 0.00 ? 19 LEU A HD13 5  
ATOM 6000  H HD21 . LEU A 1 19 ? 93.814  3.464   -24.085 1.00 0.00 ? 19 LEU A HD21 5  
ATOM 6001  H HD22 . LEU A 1 19 ? 95.391  2.681   -24.178 1.00 0.00 ? 19 LEU A HD22 5  
ATOM 6002  H HD23 . LEU A 1 19 ? 95.269  4.359   -23.659 1.00 0.00 ? 19 LEU A HD23 5  
ATOM 6003  N N    . THR A 1 20 ? 93.532  -0.629  -20.685 1.00 0.00 ? 20 THR A N    5  
ATOM 6004  C CA   . THR A 1 20 ? 94.080  -1.612  -19.762 1.00 0.00 ? 20 THR A CA   5  
ATOM 6005  C C    . THR A 1 20 ? 94.387  -2.915  -20.493 1.00 0.00 ? 20 THR A C    5  
ATOM 6006  O O    . THR A 1 20 ? 95.420  -3.542  -20.258 1.00 0.00 ? 20 THR A O    5  
ATOM 6007  C CB   . THR A 1 20 ? 93.077  -1.885  -18.641 1.00 0.00 ? 20 THR A CB   5  
ATOM 6008  O OG1  . THR A 1 20 ? 92.637  -0.650  -18.095 1.00 0.00 ? 20 THR A OG1  5  
ATOM 6009  C CG2  . THR A 1 20 ? 93.740  -2.726  -17.548 1.00 0.00 ? 20 THR A CG2  5  
ATOM 6010  H H    . THR A 1 20 ? 92.662  -0.214  -20.483 1.00 0.00 ? 20 THR A H    5  
ATOM 6011  H HA   . THR A 1 20 ? 94.991  -1.225  -19.332 1.00 0.00 ? 20 THR A HA   5  
ATOM 6012  H HB   . THR A 1 20 ? 92.231  -2.423  -19.039 1.00 0.00 ? 20 THR A HB   5  
ATOM 6013  H HG1  . THR A 1 20 ? 91.721  -0.754  -17.826 1.00 0.00 ? 20 THR A HG1  5  
ATOM 6014  H HG21 . THR A 1 20 ? 93.019  -2.941  -16.772 1.00 0.00 ? 20 THR A HG21 5  
ATOM 6015  H HG22 . THR A 1 20 ? 94.571  -2.181  -17.126 1.00 0.00 ? 20 THR A HG22 5  
ATOM 6016  H HG23 . THR A 1 20 ? 94.096  -3.653  -17.975 1.00 0.00 ? 20 THR A HG23 5  
ATOM 6017  N N    . VAL A 1 21 ? 93.474  -3.325  -21.368 1.00 0.00 ? 21 VAL A N    5  
ATOM 6018  C CA   . VAL A 1 21 ? 93.653  -4.567  -22.116 1.00 0.00 ? 21 VAL A CA   5  
ATOM 6019  C C    . VAL A 1 21 ? 94.815  -4.471  -23.110 1.00 0.00 ? 21 VAL A C    5  
ATOM 6020  O O    . VAL A 1 21 ? 95.436  -5.481  -23.440 1.00 0.00 ? 21 VAL A O    5  
ATOM 6021  C CB   . VAL A 1 21 ? 92.367  -4.903  -22.870 1.00 0.00 ? 21 VAL A CB   5  
ATOM 6022  C CG1  . VAL A 1 21 ? 92.575  -6.170  -23.701 1.00 0.00 ? 21 VAL A CG1  5  
ATOM 6023  C CG2  . VAL A 1 21 ? 91.235  -5.133  -21.865 1.00 0.00 ? 21 VAL A CG2  5  
ATOM 6024  H H    . VAL A 1 21 ? 92.659  -2.789  -21.507 1.00 0.00 ? 21 VAL A H    5  
ATOM 6025  H HA   . VAL A 1 21 ? 93.859  -5.364  -21.418 1.00 0.00 ? 21 VAL A HA   5  
ATOM 6026  H HB   . VAL A 1 21 ? 92.108  -4.082  -23.524 1.00 0.00 ? 21 VAL A HB   5  
ATOM 6027  H HG11 . VAL A 1 21 ? 93.197  -5.942  -24.554 1.00 0.00 ? 21 VAL A HG11 5  
ATOM 6028  H HG12 . VAL A 1 21 ? 91.619  -6.539  -24.040 1.00 0.00 ? 21 VAL A HG12 5  
ATOM 6029  H HG13 . VAL A 1 21 ? 93.057  -6.922  -23.095 1.00 0.00 ? 21 VAL A HG13 5  
ATOM 6030  H HG21 . VAL A 1 21 ? 91.396  -6.069  -21.350 1.00 0.00 ? 21 VAL A HG21 5  
ATOM 6031  H HG22 . VAL A 1 21 ? 90.290  -5.166  -22.387 1.00 0.00 ? 21 VAL A HG22 5  
ATOM 6032  H HG23 . VAL A 1 21 ? 91.222  -4.325  -21.148 1.00 0.00 ? 21 VAL A HG23 5  
ATOM 6033  N N    . LEU A 1 22 ? 95.088  -3.267  -23.603 1.00 0.00 ? 22 LEU A N    5  
ATOM 6034  C CA   . LEU A 1 22 ? 96.160  -3.078  -24.578 1.00 0.00 ? 22 LEU A CA   5  
ATOM 6035  C C    . LEU A 1 22 ? 97.531  -3.261  -23.933 1.00 0.00 ? 22 LEU A C    5  
ATOM 6036  O O    . LEU A 1 22 ? 98.346  -4.050  -24.410 1.00 0.00 ? 22 LEU A O    5  
ATOM 6037  C CB   . LEU A 1 22 ? 96.057  -1.671  -25.206 1.00 0.00 ? 22 LEU A CB   5  
ATOM 6038  C CG   . LEU A 1 22 ? 96.622  -1.658  -26.643 1.00 0.00 ? 22 LEU A CG   5  
ATOM 6039  C CD1  . LEU A 1 22 ? 98.047  -2.218  -26.653 1.00 0.00 ? 22 LEU A CD1  5  
ATOM 6040  C CD2  . LEU A 1 22 ? 95.726  -2.488  -27.591 1.00 0.00 ? 22 LEU A CD2  5  
ATOM 6041  H H    . LEU A 1 22 ? 94.551  -2.498  -23.320 1.00 0.00 ? 22 LEU A H    5  
ATOM 6042  H HA   . LEU A 1 22 ? 96.046  -3.817  -25.354 1.00 0.00 ? 22 LEU A HA   5  
ATOM 6043  H HB2  . LEU A 1 22 ? 95.023  -1.372  -25.232 1.00 0.00 ? 22 LEU A HB2  5  
ATOM 6044  H HB3  . LEU A 1 22 ? 96.610  -0.966  -24.603 1.00 0.00 ? 22 LEU A HB3  5  
ATOM 6045  H HG   . LEU A 1 22 ? 96.651  -0.635  -26.992 1.00 0.00 ? 22 LEU A HG   5  
ATOM 6046  H HD11 . LEU A 1 22 ? 98.011  -3.295  -26.593 1.00 0.00 ? 22 LEU A HD11 5  
ATOM 6047  H HD12 . LEU A 1 22 ? 98.597  -1.826  -25.812 1.00 0.00 ? 22 LEU A HD12 5  
ATOM 6048  H HD13 . LEU A 1 22 ? 98.540  -1.927  -27.569 1.00 0.00 ? 22 LEU A HD13 5  
ATOM 6049  H HD21 . LEU A 1 22 ? 95.766  -2.058  -28.580 1.00 0.00 ? 22 LEU A HD21 5  
ATOM 6050  H HD22 . LEU A 1 22 ? 94.703  -2.475  -27.241 1.00 0.00 ? 22 LEU A HD22 5  
ATOM 6051  H HD23 . LEU A 1 22 ? 96.075  -3.510  -27.635 1.00 0.00 ? 22 LEU A HD23 5  
ATOM 6052  N N    . ILE A 1 23 ? 97.795  -2.530  -22.853 1.00 0.00 ? 23 ILE A N    5  
ATOM 6053  C CA   . ILE A 1 23 ? 99.089  -2.646  -22.193 1.00 0.00 ? 23 ILE A CA   5  
ATOM 6054  C C    . ILE A 1 23 ? 99.252  -4.035  -21.582 1.00 0.00 ? 23 ILE A C    5  
ATOM 6055  O O    . ILE A 1 23 ? 100.314 -4.649  -21.692 1.00 0.00 ? 23 ILE A O    5  
ATOM 6056  C CB   . ILE A 1 23 ? 99.239  -1.570  -21.114 1.00 0.00 ? 23 ILE A CB   5  
ATOM 6057  C CG1  . ILE A 1 23 ? 98.867  -0.204  -21.704 1.00 0.00 ? 23 ILE A CG1  5  
ATOM 6058  C CG2  . ILE A 1 23 ? 100.696 -1.531  -20.635 1.00 0.00 ? 23 ILE A CG2  5  
ATOM 6059  C CD1  . ILE A 1 23 ? 99.200  0.900   -20.696 1.00 0.00 ? 23 ILE A CD1  5  
ATOM 6060  H H    . ILE A 1 23 ? 97.119  -1.906  -22.502 1.00 0.00 ? 23 ILE A H    5  
ATOM 6061  H HA   . ILE A 1 23 ? 99.864  -2.502  -22.932 1.00 0.00 ? 23 ILE A HA   5  
ATOM 6062  H HB   . ILE A 1 23 ? 98.587  -1.797  -20.285 1.00 0.00 ? 23 ILE A HB   5  
ATOM 6063  H HG12 . ILE A 1 23 ? 99.425  -0.042  -22.614 1.00 0.00 ? 23 ILE A HG12 5  
ATOM 6064  H HG13 . ILE A 1 23 ? 97.810  -0.182  -21.922 1.00 0.00 ? 23 ILE A HG13 5  
ATOM 6065  H HG21 . ILE A 1 23 ? 101.049 -2.535  -20.460 1.00 0.00 ? 23 ILE A HG21 5  
ATOM 6066  H HG22 . ILE A 1 23 ? 100.758 -0.961  -19.719 1.00 0.00 ? 23 ILE A HG22 5  
ATOM 6067  H HG23 . ILE A 1 23 ? 101.309 -1.061  -21.391 1.00 0.00 ? 23 ILE A HG23 5  
ATOM 6068  H HD11 . ILE A 1 23 ? 98.832  0.621   -19.720 1.00 0.00 ? 23 ILE A HD11 5  
ATOM 6069  H HD12 . ILE A 1 23 ? 98.736  1.822   -21.006 1.00 0.00 ? 23 ILE A HD12 5  
ATOM 6070  H HD13 . ILE A 1 23 ? 100.271 1.037   -20.652 1.00 0.00 ? 23 ILE A HD13 5  
ATOM 6071  N N    . ALA A 1 24 ? 98.192  -4.528  -20.947 1.00 0.00 ? 24 ALA A N    5  
ATOM 6072  C CA   . ALA A 1 24 ? 98.232  -5.849  -20.329 1.00 0.00 ? 24 ALA A CA   5  
ATOM 6073  C C    . ALA A 1 24 ? 98.495  -6.922  -21.382 1.00 0.00 ? 24 ALA A C    5  
ATOM 6074  O O    . ALA A 1 24 ? 99.239  -7.874  -21.145 1.00 0.00 ? 24 ALA A O    5  
ATOM 6075  C CB   . ALA A 1 24 ? 96.905  -6.137  -19.627 1.00 0.00 ? 24 ALA A CB   5  
ATOM 6076  H H    . ALA A 1 24 ? 97.370  -3.997  -20.895 1.00 0.00 ? 24 ALA A H    5  
ATOM 6077  H HA   . ALA A 1 24 ? 99.024  -5.871  -19.598 1.00 0.00 ? 24 ALA A HA   5  
ATOM 6078  H HB1  . ALA A 1 24 ? 96.089  -5.969  -20.314 1.00 0.00 ? 24 ALA A HB1  5  
ATOM 6079  H HB2  . ALA A 1 24 ? 96.798  -5.481  -18.776 1.00 0.00 ? 24 ALA A HB2  5  
ATOM 6080  H HB3  . ALA A 1 24 ? 96.889  -7.164  -19.294 1.00 0.00 ? 24 ALA A HB3  5  
ATOM 6081  N N    . LEU A 1 25 ? 97.881  -6.758  -22.547 1.00 0.00 ? 25 LEU A N    5  
ATOM 6082  C CA   . LEU A 1 25 ? 98.058  -7.713  -23.633 1.00 0.00 ? 25 LEU A CA   5  
ATOM 6083  C C    . LEU A 1 25 ? 99.479  -7.625  -24.180 1.00 0.00 ? 25 LEU A C    5  
ATOM 6084  O O    . LEU A 1 25 ? 100.083 -8.636  -24.539 1.00 0.00 ? 25 LEU A O    5  
ATOM 6085  C CB   . LEU A 1 25 ? 97.045  -7.420  -24.749 1.00 0.00 ? 25 LEU A CB   5  
ATOM 6086  C CG   . LEU A 1 25 ? 97.306  -8.316  -25.969 1.00 0.00 ? 25 LEU A CG   5  
ATOM 6087  C CD1  . LEU A 1 25 ? 97.321  -9.793  -25.550 1.00 0.00 ? 25 LEU A CD1  5  
ATOM 6088  C CD2  . LEU A 1 25 ? 96.194  -8.089  -26.997 1.00 0.00 ? 25 LEU A CD2  5  
ATOM 6089  H H    . LEU A 1 25 ? 97.301  -5.979  -22.681 1.00 0.00 ? 25 LEU A H    5  
ATOM 6090  H HA   . LEU A 1 25 ? 97.886  -8.708  -23.253 1.00 0.00 ? 25 LEU A HA   5  
ATOM 6091  H HB2  . LEU A 1 25 ? 96.047  -7.604  -24.378 1.00 0.00 ? 25 LEU A HB2  5  
ATOM 6092  H HB3  . LEU A 1 25 ? 97.131  -6.385  -25.043 1.00 0.00 ? 25 LEU A HB3  5  
ATOM 6093  H HG   . LEU A 1 25 ? 98.258  -8.059  -26.410 1.00 0.00 ? 25 LEU A HG   5  
ATOM 6094  H HD11 . LEU A 1 25 ? 97.148  -10.418 -26.415 1.00 0.00 ? 25 LEU A HD11 5  
ATOM 6095  H HD12 . LEU A 1 25 ? 96.546  -9.971  -24.819 1.00 0.00 ? 25 LEU A HD12 5  
ATOM 6096  H HD13 . LEU A 1 25 ? 98.281  -10.036 -25.121 1.00 0.00 ? 25 LEU A HD13 5  
ATOM 6097  H HD21 . LEU A 1 25 ? 96.048  -7.029  -27.141 1.00 0.00 ? 25 LEU A HD21 5  
ATOM 6098  H HD22 . LEU A 1 25 ? 95.277  -8.534  -26.640 1.00 0.00 ? 25 LEU A HD22 5  
ATOM 6099  H HD23 . LEU A 1 25 ? 96.473  -8.544  -27.935 1.00 0.00 ? 25 LEU A HD23 5  
ATOM 6100  N N    . ALA A 1 26 ? 100.006 -6.407  -24.240 1.00 0.00 ? 26 ALA A N    5  
ATOM 6101  C CA   . ALA A 1 26 ? 101.355 -6.190  -24.747 1.00 0.00 ? 26 ALA A CA   5  
ATOM 6102  C C    . ALA A 1 26 ? 102.376 -6.975  -23.930 1.00 0.00 ? 26 ALA A C    5  
ATOM 6103  O O    . ALA A 1 26 ? 103.206 -7.694  -24.487 1.00 0.00 ? 26 ALA A O    5  
ATOM 6104  C CB   . ALA A 1 26 ? 101.698 -4.700  -24.697 1.00 0.00 ? 26 ALA A CB   5  
ATOM 6105  H H    . ALA A 1 26 ? 99.475  -5.639  -23.940 1.00 0.00 ? 26 ALA A H    5  
ATOM 6106  H HA   . ALA A 1 26 ? 101.400 -6.522  -25.773 1.00 0.00 ? 26 ALA A HA   5  
ATOM 6107  H HB1  . ALA A 1 26 ? 102.602 -4.520  -25.259 1.00 0.00 ? 26 ALA A HB1  5  
ATOM 6108  H HB2  . ALA A 1 26 ? 101.845 -4.398  -23.671 1.00 0.00 ? 26 ALA A HB2  5  
ATOM 6109  H HB3  . ALA A 1 26 ? 100.888 -4.129  -25.127 1.00 0.00 ? 26 ALA A HB3  5  
ATOM 6110  N N    . VAL A 1 27 ? 102.314 -6.836  -22.609 1.00 0.00 ? 27 VAL A N    5  
ATOM 6111  C CA   . VAL A 1 27 ? 103.249 -7.544  -21.741 1.00 0.00 ? 27 VAL A CA   5  
ATOM 6112  C C    . VAL A 1 27 ? 102.994 -9.048  -21.789 1.00 0.00 ? 27 VAL A C    5  
ATOM 6113  O O    . VAL A 1 27 ? 103.929 -9.845  -21.725 1.00 0.00 ? 27 VAL A O    5  
ATOM 6114  C CB   . VAL A 1 27 ? 103.119 -7.044  -20.301 1.00 0.00 ? 27 VAL A CB   5  
ATOM 6115  C CG1  . VAL A 1 27 ? 103.578 -5.588  -20.224 1.00 0.00 ? 27 VAL A CG1  5  
ATOM 6116  C CG2  . VAL A 1 27 ? 101.660 -7.136  -19.859 1.00 0.00 ? 27 VAL A CG2  5  
ATOM 6117  H H    . VAL A 1 27 ? 101.633 -6.248  -22.214 1.00 0.00 ? 27 VAL A H    5  
ATOM 6118  H HA   . VAL A 1 27 ? 104.254 -7.352  -22.084 1.00 0.00 ? 27 VAL A HA   5  
ATOM 6119  H HB   . VAL A 1 27 ? 103.734 -7.651  -19.652 1.00 0.00 ? 27 VAL A HB   5  
ATOM 6120  H HG11 . VAL A 1 27 ? 104.649 -5.542  -20.357 1.00 0.00 ? 27 VAL A HG11 5  
ATOM 6121  H HG12 . VAL A 1 27 ? 103.314 -5.179  -19.261 1.00 0.00 ? 27 VAL A HG12 5  
ATOM 6122  H HG13 . VAL A 1 27 ? 103.094 -5.017  -21.004 1.00 0.00 ? 27 VAL A HG13 5  
ATOM 6123  H HG21 . VAL A 1 27 ? 101.052 -6.542  -20.522 1.00 0.00 ? 27 VAL A HG21 5  
ATOM 6124  H HG22 . VAL A 1 27 ? 101.566 -6.762  -18.850 1.00 0.00 ? 27 VAL A HG22 5  
ATOM 6125  H HG23 . VAL A 1 27 ? 101.336 -8.165  -19.896 1.00 0.00 ? 27 VAL A HG23 5  
ATOM 6126  N N    . TYR A 1 28 ? 101.725 -9.430  -21.905 1.00 0.00 ? 28 TYR A N    5  
ATOM 6127  C CA   . TYR A 1 28 ? 101.371 -10.844 -21.963 1.00 0.00 ? 28 TYR A CA   5  
ATOM 6128  C C    . TYR A 1 28 ? 102.031 -11.512 -23.166 1.00 0.00 ? 28 TYR A C    5  
ATOM 6129  O O    . TYR A 1 28 ? 102.533 -12.630 -23.069 1.00 0.00 ? 28 TYR A O    5  
ATOM 6130  C CB   . TYR A 1 28 ? 99.851  -11.002 -22.059 1.00 0.00 ? 28 TYR A CB   5  
ATOM 6131  C CG   . TYR A 1 28 ? 99.505  -12.468 -22.169 1.00 0.00 ? 28 TYR A CG   5  
ATOM 6132  C CD1  . TYR A 1 28 ? 99.468  -13.087 -23.424 1.00 0.00 ? 28 TYR A CD1  5  
ATOM 6133  C CD2  . TYR A 1 28 ? 99.221  -13.209 -21.015 1.00 0.00 ? 28 TYR A CD2  5  
ATOM 6134  C CE1  . TYR A 1 28 ? 99.146  -14.445 -23.526 1.00 0.00 ? 28 TYR A CE1  5  
ATOM 6135  C CE2  . TYR A 1 28 ? 98.900  -14.568 -21.117 1.00 0.00 ? 28 TYR A CE2  5  
ATOM 6136  C CZ   . TYR A 1 28 ? 98.863  -15.186 -22.372 1.00 0.00 ? 28 TYR A CZ   5  
ATOM 6137  O OH   . TYR A 1 28 ? 98.547  -16.526 -22.473 1.00 0.00 ? 28 TYR A OH   5  
ATOM 6138  H H    . TYR A 1 28 ? 101.017 -8.751  -21.953 1.00 0.00 ? 28 TYR A H    5  
ATOM 6139  H HA   . TYR A 1 28 ? 101.715 -11.329 -21.061 1.00 0.00 ? 28 TYR A HA   5  
ATOM 6140  H HB2  . TYR A 1 28 ? 99.390  -10.588 -21.174 1.00 0.00 ? 28 TYR A HB2  5  
ATOM 6141  H HB3  . TYR A 1 28 ? 99.490  -10.480 -22.932 1.00 0.00 ? 28 TYR A HB3  5  
ATOM 6142  H HD1  . TYR A 1 28 ? 99.685  -12.515 -24.315 1.00 0.00 ? 28 TYR A HD1  5  
ATOM 6143  H HD2  . TYR A 1 28 ? 99.249  -12.732 -20.047 1.00 0.00 ? 28 TYR A HD2  5  
ATOM 6144  H HE1  . TYR A 1 28 ? 99.118  -14.923 -24.495 1.00 0.00 ? 28 TYR A HE1  5  
ATOM 6145  H HE2  . TYR A 1 28 ? 98.682  -15.140 -20.227 1.00 0.00 ? 28 TYR A HE2  5  
ATOM 6146  H HH   . TYR A 1 28 ? 98.257  -16.695 -23.373 1.00 0.00 ? 28 TYR A HH   5  
ATOM 6147  N N    . PHE A 1 29 ? 102.024 -10.816 -24.299 1.00 0.00 ? 29 PHE A N    5  
ATOM 6148  C CA   . PHE A 1 29 ? 102.626 -11.350 -25.516 1.00 0.00 ? 29 PHE A CA   5  
ATOM 6149  C C    . PHE A 1 29 ? 104.136 -11.494 -25.353 1.00 0.00 ? 29 PHE A C    5  
ATOM 6150  O O    . PHE A 1 29 ? 104.732 -12.460 -25.828 1.00 0.00 ? 29 PHE A O    5  
ATOM 6151  C CB   . PHE A 1 29 ? 102.329 -10.422 -26.695 1.00 0.00 ? 29 PHE A CB   5  
ATOM 6152  C CG   . PHE A 1 29 ? 102.775 -11.079 -27.981 1.00 0.00 ? 29 PHE A CG   5  
ATOM 6153  C CD1  . PHE A 1 29 ? 104.089 -10.912 -28.433 1.00 0.00 ? 29 PHE A CD1  5  
ATOM 6154  C CD2  . PHE A 1 29 ? 101.873 -11.854 -28.720 1.00 0.00 ? 29 PHE A CD2  5  
ATOM 6155  C CE1  . PHE A 1 29 ? 104.502 -11.521 -29.625 1.00 0.00 ? 29 PHE A CE1  5  
ATOM 6156  C CE2  . PHE A 1 29 ? 102.286 -12.463 -29.911 1.00 0.00 ? 29 PHE A CE2  5  
ATOM 6157  C CZ   . PHE A 1 29 ? 103.600 -12.296 -30.363 1.00 0.00 ? 29 PHE A CZ   5  
ATOM 6158  H H    . PHE A 1 29 ? 101.610 -9.928  -24.318 1.00 0.00 ? 29 PHE A H    5  
ATOM 6159  H HA   . PHE A 1 29 ? 102.201 -12.321 -25.722 1.00 0.00 ? 29 PHE A HA   5  
ATOM 6160  H HB2  . PHE A 1 29 ? 101.268 -10.226 -26.740 1.00 0.00 ? 29 PHE A HB2  5  
ATOM 6161  H HB3  . PHE A 1 29 ? 102.861 -9.492  -26.564 1.00 0.00 ? 29 PHE A HB3  5  
ATOM 6162  H HD1  . PHE A 1 29 ? 104.786 -10.314 -27.863 1.00 0.00 ? 29 PHE A HD1  5  
ATOM 6163  H HD2  . PHE A 1 29 ? 100.859 -11.983 -28.370 1.00 0.00 ? 29 PHE A HD2  5  
ATOM 6164  H HE1  . PHE A 1 29 ? 105.516 -11.392 -29.974 1.00 0.00 ? 29 PHE A HE1  5  
ATOM 6165  H HE2  . PHE A 1 29 ? 101.590 -13.061 -30.481 1.00 0.00 ? 29 PHE A HE2  5  
ATOM 6166  H HZ   . PHE A 1 29 ? 103.918 -12.766 -31.283 1.00 0.00 ? 29 PHE A HZ   5  
ATOM 6167  N N    . LEU A 1 30 ? 104.748 -10.524 -24.681 1.00 0.00 ? 30 LEU A N    5  
ATOM 6168  C CA   . LEU A 1 30 ? 106.191 -10.548 -24.466 1.00 0.00 ? 30 LEU A CA   5  
ATOM 6169  C C    . LEU A 1 30 ? 106.597 -11.802 -23.695 1.00 0.00 ? 30 LEU A C    5  
ATOM 6170  O O    . LEU A 1 30 ? 107.589 -12.452 -24.027 1.00 0.00 ? 30 LEU A O    5  
ATOM 6171  C CB   . LEU A 1 30 ? 106.616 -9.296  -23.688 1.00 0.00 ? 30 LEU A CB   5  
ATOM 6172  C CG   . LEU A 1 30 ? 108.144 -9.259  -23.518 1.00 0.00 ? 30 LEU A CG   5  
ATOM 6173  C CD1  . LEU A 1 30 ? 108.833 -9.166  -24.891 1.00 0.00 ? 30 LEU A CD1  5  
ATOM 6174  C CD2  . LEU A 1 30 ? 108.518 -8.037  -22.672 1.00 0.00 ? 30 LEU A CD2  5  
ATOM 6175  H H    . LEU A 1 30 ? 104.221 -9.777  -24.329 1.00 0.00 ? 30 LEU A H    5  
ATOM 6176  H HA   . LEU A 1 30 ? 106.683 -10.550 -25.424 1.00 0.00 ? 30 LEU A HA   5  
ATOM 6177  H HB2  . LEU A 1 30 ? 106.296 -8.416  -24.226 1.00 0.00 ? 30 LEU A HB2  5  
ATOM 6178  H HB3  . LEU A 1 30 ? 106.151 -9.307  -22.713 1.00 0.00 ? 30 LEU A HB3  5  
ATOM 6179  H HG   . LEU A 1 30 ? 108.472 -10.156 -23.014 1.00 0.00 ? 30 LEU A HG   5  
ATOM 6180  H HD11 . LEU A 1 30 ? 108.958 -10.158 -25.300 1.00 0.00 ? 30 LEU A HD11 5  
ATOM 6181  H HD12 . LEU A 1 30 ? 109.805 -8.705  -24.783 1.00 0.00 ? 30 LEU A HD12 5  
ATOM 6182  H HD13 . LEU A 1 30 ? 108.229 -8.573  -25.565 1.00 0.00 ? 30 LEU A HD13 5  
ATOM 6183  H HD21 . LEU A 1 30 ? 108.360 -7.137  -23.249 1.00 0.00 ? 30 LEU A HD21 5  
ATOM 6184  H HD22 . LEU A 1 30 ? 109.556 -8.102  -22.385 1.00 0.00 ? 30 LEU A HD22 5  
ATOM 6185  H HD23 . LEU A 1 30 ? 107.901 -8.009  -21.786 1.00 0.00 ? 30 LEU A HD23 5  
ATOM 6186  N N    . GLY A 1 31 ? 105.827 -12.136 -22.665 1.00 0.00 ? 31 GLY A N    5  
ATOM 6187  C CA   . GLY A 1 31 ? 106.119 -13.314 -21.855 1.00 0.00 ? 31 GLY A CA   5  
ATOM 6188  C C    . GLY A 1 31 ? 105.719 -14.592 -22.584 1.00 0.00 ? 31 GLY A C    5  
ATOM 6189  O O    . GLY A 1 31 ? 104.540 -14.821 -22.855 1.00 0.00 ? 31 GLY A O    5  
ATOM 6190  H H    . GLY A 1 31 ? 105.049 -11.582 -22.445 1.00 0.00 ? 31 GLY A H    5  
ATOM 6191  H HA2  . GLY A 1 31 ? 107.178 -13.342 -21.643 1.00 0.00 ? 31 GLY A HA2  5  
ATOM 6192  H HA3  . GLY A 1 31 ? 105.571 -13.252 -20.928 1.00 0.00 ? 31 GLY A HA3  5  
ATOM 6193  N N    . ARG A 1 32 ? 106.709 -15.422 -22.899 1.00 0.00 ? 32 ARG A N    5  
ATOM 6194  C CA   . ARG A 1 32 ? 106.451 -16.678 -23.598 1.00 0.00 ? 32 ARG A CA   5  
ATOM 6195  C C    . ARG A 1 32 ? 105.986 -17.750 -22.616 1.00 0.00 ? 32 ARG A C    5  
ATOM 6196  O O    . ARG A 1 32 ? 106.446 -18.891 -22.665 1.00 0.00 ? 32 ARG A O    5  
ATOM 6197  C CB   . ARG A 1 32 ? 107.722 -17.150 -24.310 1.00 0.00 ? 32 ARG A CB   5  
ATOM 6198  C CG   . ARG A 1 32 ? 108.411 -15.956 -24.976 1.00 0.00 ? 32 ARG A CG   5  
ATOM 6199  C CD   . ARG A 1 32 ? 107.442 -15.270 -25.939 1.00 0.00 ? 32 ARG A CD   5  
ATOM 6200  N NE   . ARG A 1 32 ? 108.167 -14.376 -26.833 1.00 0.00 ? 32 ARG A NE   5  
ATOM 6201  C CZ   . ARG A 1 32 ? 108.840 -14.846 -27.879 1.00 0.00 ? 32 ARG A CZ   5  
ATOM 6202  N NH1  . ARG A 1 32 ? 108.859 -16.130 -28.118 1.00 0.00 ? 32 ARG A NH1  5  
ATOM 6203  N NH2  . ARG A 1 32 ? 109.479 -14.026 -28.667 1.00 0.00 ? 32 ARG A NH2  5  
ATOM 6204  H H    . ARG A 1 32 ? 107.629 -15.188 -22.658 1.00 0.00 ? 32 ARG A H    5  
ATOM 6205  H HA   . ARG A 1 32 ? 105.677 -16.520 -24.335 1.00 0.00 ? 32 ARG A HA   5  
ATOM 6206  H HB2  . ARG A 1 32 ? 108.393 -17.598 -23.592 1.00 0.00 ? 32 ARG A HB2  5  
ATOM 6207  H HB3  . ARG A 1 32 ? 107.462 -17.879 -25.064 1.00 0.00 ? 32 ARG A HB3  5  
ATOM 6208  H HG2  . ARG A 1 32 ? 108.724 -15.253 -24.217 1.00 0.00 ? 32 ARG A HG2  5  
ATOM 6209  H HG3  . ARG A 1 32 ? 109.276 -16.301 -25.524 1.00 0.00 ? 32 ARG A HG3  5  
ATOM 6210  H HD2  . ARG A 1 32 ? 106.928 -16.018 -26.525 1.00 0.00 ? 32 ARG A HD2  5  
ATOM 6211  H HD3  . ARG A 1 32 ? 106.718 -14.701 -25.373 1.00 0.00 ? 32 ARG A HD3  5  
ATOM 6212  H HE   . ARG A 1 32 ? 108.159 -13.411 -26.661 1.00 0.00 ? 32 ARG A HE   5  
ATOM 6213  H HH11 . ARG A 1 32 ? 108.369 -16.758 -27.513 1.00 0.00 ? 32 ARG A HH11 5  
ATOM 6214  H HH12 . ARG A 1 32 ? 109.364 -16.484 -28.904 1.00 0.00 ? 32 ARG A HH12 5  
ATOM 6215  H HH21 . ARG A 1 32 ? 109.464 -13.044 -28.484 1.00 0.00 ? 32 ARG A HH21 5  
ATOM 6216  H HH22 . ARG A 1 32 ? 109.985 -14.380 -29.454 1.00 0.00 ? 32 ARG A HH22 5  
ATOM 6217  N N    . LEU A 1 33 ? 105.071 -17.376 -21.727 1.00 0.00 ? 33 LEU A N    5  
ATOM 6218  C CA   . LEU A 1 33 ? 104.553 -18.315 -20.739 1.00 0.00 ? 33 LEU A CA   5  
ATOM 6219  C C    . LEU A 1 33 ? 105.687 -18.864 -19.878 1.00 0.00 ? 33 LEU A C    5  
ATOM 6220  O O    . LEU A 1 33 ? 106.851 -18.836 -20.276 1.00 0.00 ? 33 LEU A O    5  
ATOM 6221  C CB   . LEU A 1 33 ? 103.834 -19.470 -21.440 1.00 0.00 ? 33 LEU A CB   5  
ATOM 6222  C CG   . LEU A 1 33 ? 102.956 -18.924 -22.567 1.00 0.00 ? 33 LEU A CG   5  
ATOM 6223  C CD1  . LEU A 1 33 ? 102.142 -20.068 -23.179 1.00 0.00 ? 33 LEU A CD1  5  
ATOM 6224  C CD2  . LEU A 1 33 ? 102.003 -17.861 -22.007 1.00 0.00 ? 33 LEU A CD2  5  
ATOM 6225  H H    . LEU A 1 33 ? 104.741 -16.454 -21.736 1.00 0.00 ? 33 LEU A H    5  
ATOM 6226  H HA   . LEU A 1 33 ? 103.849 -17.801 -20.102 1.00 0.00 ? 33 LEU A HA   5  
ATOM 6227  H HB2  . LEU A 1 33 ? 104.565 -20.152 -21.851 1.00 0.00 ? 33 LEU A HB2  5  
ATOM 6228  H HB3  . LEU A 1 33 ? 103.216 -19.994 -20.727 1.00 0.00 ? 33 LEU A HB3  5  
ATOM 6229  H HG   . LEU A 1 33 ? 103.582 -18.483 -23.328 1.00 0.00 ? 33 LEU A HG   5  
ATOM 6230  H HD11 . LEU A 1 33 ? 101.665 -20.630 -22.391 1.00 0.00 ? 33 LEU A HD11 5  
ATOM 6231  H HD12 . LEU A 1 33 ? 102.800 -20.717 -23.737 1.00 0.00 ? 33 LEU A HD12 5  
ATOM 6232  H HD13 . LEU A 1 33 ? 101.390 -19.662 -23.839 1.00 0.00 ? 33 LEU A HD13 5  
ATOM 6233  H HD21 . LEU A 1 33 ? 102.546 -16.944 -21.840 1.00 0.00 ? 33 LEU A HD21 5  
ATOM 6234  H HD22 . LEU A 1 33 ? 101.584 -18.208 -21.073 1.00 0.00 ? 33 LEU A HD22 5  
ATOM 6235  H HD23 . LEU A 1 33 ? 101.206 -17.683 -22.714 1.00 0.00 ? 33 LEU A HD23 5  
ATOM 6236  N N    . GLY A 1 34 ? 105.337 -19.362 -18.696 1.00 0.00 ? 34 GLY A N    5  
ATOM 6237  C CA   . GLY A 1 34 ? 106.335 -19.914 -17.787 1.00 0.00 ? 34 GLY A CA   5  
ATOM 6238  C C    . GLY A 1 34 ? 107.095 -18.802 -17.073 1.00 0.00 ? 34 GLY A C    5  
ATOM 6239  O O    . GLY A 1 34 ? 108.120 -19.047 -16.438 1.00 0.00 ? 34 GLY A O    5  
ATOM 6240  H H    . GLY A 1 34 ? 104.393 -19.357 -18.431 1.00 0.00 ? 34 GLY A H    5  
ATOM 6241  H HA2  . GLY A 1 34 ? 105.839 -20.534 -17.053 1.00 0.00 ? 34 GLY A HA2  5  
ATOM 6242  H HA3  . GLY A 1 34 ? 107.033 -20.515 -18.348 1.00 0.00 ? 34 GLY A HA3  5  
ATOM 6243  N N    . THR A 1 35 ? 106.585 -17.579 -17.183 1.00 0.00 ? 35 THR A N    5  
ATOM 6244  C CA   . THR A 1 35 ? 107.226 -16.434 -16.543 1.00 0.00 ? 35 THR A CA   5  
ATOM 6245  C C    . THR A 1 35 ? 106.897 -16.401 -15.055 1.00 0.00 ? 35 THR A C    5  
ATOM 6246  O O    . THR A 1 35 ? 107.504 -15.649 -14.292 1.00 0.00 ? 35 THR A O    5  
ATOM 6247  C CB   . THR A 1 35 ? 106.753 -15.137 -17.203 1.00 0.00 ? 35 THR A CB   5  
ATOM 6248  O OG1  . THR A 1 35 ? 105.333 -15.121 -17.250 1.00 0.00 ? 35 THR A OG1  5  
ATOM 6249  C CG2  . THR A 1 35 ? 107.313 -15.050 -18.624 1.00 0.00 ? 35 THR A CG2  5  
ATOM 6250  H H    . THR A 1 35 ? 105.765 -17.444 -17.702 1.00 0.00 ? 35 THR A H    5  
ATOM 6251  H HA   . THR A 1 35 ? 108.295 -16.517 -16.665 1.00 0.00 ? 35 THR A HA   5  
ATOM 6252  H HB   . THR A 1 35 ? 107.104 -14.293 -16.630 1.00 0.00 ? 35 THR A HB   5  
ATOM 6253  H HG1  . THR A 1 35 ? 105.030 -14.332 -16.796 1.00 0.00 ? 35 THR A HG1  5  
ATOM 6254  H HG21 . THR A 1 35 ? 108.386 -15.181 -18.596 1.00 0.00 ? 35 THR A HG21 5  
ATOM 6255  H HG22 . THR A 1 35 ? 107.081 -14.082 -19.043 1.00 0.00 ? 35 THR A HG22 5  
ATOM 6256  H HG23 . THR A 1 35 ? 106.871 -15.823 -19.233 1.00 0.00 ? 35 THR A HG23 5  
ATOM 6257  N N    . ALA A 1 36 ? 105.932 -17.220 -14.649 1.00 0.00 ? 36 ALA A N    5  
ATOM 6258  C CA   . ALA A 1 36 ? 105.530 -17.276 -13.248 1.00 0.00 ? 36 ALA A CA   5  
ATOM 6259  C C    . ALA A 1 36 ? 105.208 -15.878 -12.727 1.00 0.00 ? 36 ALA A C    5  
ATOM 6260  O O    . ALA A 1 36 ? 105.215 -14.907 -13.482 1.00 0.00 ? 36 ALA A O    5  
ATOM 6261  C CB   . ALA A 1 36 ? 106.650 -17.891 -12.408 1.00 0.00 ? 36 ALA A CB   5  
ATOM 6262  H H    . ALA A 1 36 ? 105.483 -17.797 -15.302 1.00 0.00 ? 36 ALA A H    5  
ATOM 6263  H HA   . ALA A 1 36 ? 104.649 -17.895 -13.161 1.00 0.00 ? 36 ALA A HA   5  
ATOM 6264  H HB1  . ALA A 1 36 ? 107.579 -17.381 -12.617 1.00 0.00 ? 36 ALA A HB1  5  
ATOM 6265  H HB2  . ALA A 1 36 ? 106.751 -18.938 -12.654 1.00 0.00 ? 36 ALA A HB2  5  
ATOM 6266  H HB3  . ALA A 1 36 ? 106.412 -17.789 -11.359 1.00 0.00 ? 36 ALA A HB3  5  
ATOM 6267  N N    . GLU A 1 37 ? 104.925 -15.786 -11.431 1.00 0.00 ? 37 GLU A N    5  
ATOM 6268  C CA   . GLU A 1 37 ? 104.601 -14.500 -10.821 1.00 0.00 ? 37 GLU A CA   5  
ATOM 6269  C C    . GLU A 1 37 ? 103.576 -13.753 -11.668 1.00 0.00 ? 37 GLU A C    5  
ATOM 6270  O O    . GLU A 1 37 ? 103.467 -12.529 -11.594 1.00 0.00 ? 37 GLU A O    5  
ATOM 6271  C CB   . GLU A 1 37 ? 105.868 -13.654 -10.681 1.00 0.00 ? 37 GLU A CB   5  
ATOM 6272  C CG   . GLU A 1 37 ? 106.831 -14.333 -9.706  1.00 0.00 ? 37 GLU A CG   5  
ATOM 6273  C CD   . GLU A 1 37 ? 106.258 -14.295 -8.294  1.00 0.00 ? 37 GLU A CD   5  
ATOM 6274  O OE1  . GLU A 1 37 ? 105.503 -13.381 -8.007  1.00 0.00 ? 37 GLU A OE1  5  
ATOM 6275  O OE2  . GLU A 1 37 ? 106.583 -15.180 -7.519  1.00 0.00 ? 37 GLU A OE2  5  
ATOM 6276  H H    . GLU A 1 37 ? 104.934 -16.593 -10.876 1.00 0.00 ? 37 GLU A H    5  
ATOM 6277  H HA   . GLU A 1 37 ? 104.187 -14.673 -9.839  1.00 0.00 ? 37 GLU A HA   5  
ATOM 6278  H HB2  . GLU A 1 37 ? 106.342 -13.554 -11.648 1.00 0.00 ? 37 GLU A HB2  5  
ATOM 6279  H HB3  . GLU A 1 37 ? 105.608 -12.677 -10.305 1.00 0.00 ? 37 GLU A HB3  5  
ATOM 6280  H HG2  . GLU A 1 37 ? 106.978 -15.362 -10.005 1.00 0.00 ? 37 GLU A HG2  5  
ATOM 6281  H HG3  . GLU A 1 37 ? 107.780 -13.817 -9.721  1.00 0.00 ? 37 GLU A HG3  5  
ATOM 6282  N N    . VAL A 1 38 ? 102.828 -14.500 -12.471 1.00 0.00 ? 38 VAL A N    5  
ATOM 6283  C CA   . VAL A 1 38 ? 101.812 -13.907 -13.332 1.00 0.00 ? 38 VAL A CA   5  
ATOM 6284  C C    . VAL A 1 38 ? 100.650 -13.365 -12.503 1.00 0.00 ? 38 VAL A C    5  
ATOM 6285  O O    . VAL A 1 38 ? 99.920  -12.478 -12.946 1.00 0.00 ? 38 VAL A O    5  
ATOM 6286  C CB   . VAL A 1 38 ? 101.294 -14.948 -14.327 1.00 0.00 ? 38 VAL A CB   5  
ATOM 6287  C CG1  . VAL A 1 38 ? 102.457 -15.460 -15.179 1.00 0.00 ? 38 VAL A CG1  5  
ATOM 6288  C CG2  . VAL A 1 38 ? 100.670 -16.117 -13.565 1.00 0.00 ? 38 VAL A CG2  5  
ATOM 6289  H H    . VAL A 1 38 ? 102.962 -15.471 -12.485 1.00 0.00 ? 38 VAL A H    5  
ATOM 6290  H HA   . VAL A 1 38 ? 102.256 -13.091 -13.883 1.00 0.00 ? 38 VAL A HA   5  
ATOM 6291  H HB   . VAL A 1 38 ? 100.551 -14.494 -14.968 1.00 0.00 ? 38 VAL A HB   5  
ATOM 6292  H HG11 . VAL A 1 38 ? 103.232 -15.848 -14.536 1.00 0.00 ? 38 VAL A HG11 5  
ATOM 6293  H HG12 . VAL A 1 38 ? 102.854 -14.650 -15.773 1.00 0.00 ? 38 VAL A HG12 5  
ATOM 6294  H HG13 . VAL A 1 38 ? 102.106 -16.246 -15.832 1.00 0.00 ? 38 VAL A HG13 5  
ATOM 6295  H HG21 . VAL A 1 38 ? 100.497 -16.939 -14.245 1.00 0.00 ? 38 VAL A HG21 5  
ATOM 6296  H HG22 . VAL A 1 38 ? 99.731  -15.805 -13.132 1.00 0.00 ? 38 VAL A HG22 5  
ATOM 6297  H HG23 . VAL A 1 38 ? 101.340 -16.435 -12.779 1.00 0.00 ? 38 VAL A HG23 5  
ATOM 6298  N N    . LEU A 1 39 ? 100.477 -13.911 -11.304 1.00 0.00 ? 39 LEU A N    5  
ATOM 6299  C CA   . LEU A 1 39 ? 99.393  -13.482 -10.426 1.00 0.00 ? 39 LEU A CA   5  
ATOM 6300  C C    . LEU A 1 39 ? 99.315  -11.956 -10.374 1.00 0.00 ? 39 LEU A C    5  
ATOM 6301  O O    . LEU A 1 39 ? 98.228  -11.385 -10.294 1.00 0.00 ? 39 LEU A O    5  
ATOM 6302  C CB   . LEU A 1 39 ? 99.613  -14.031 -9.010  1.00 0.00 ? 39 LEU A CB   5  
ATOM 6303  C CG   . LEU A 1 39 ? 99.254  -15.521 -8.959  1.00 0.00 ? 39 LEU A CG   5  
ATOM 6304  C CD1  . LEU A 1 39 ? 100.251 -16.331 -9.796  1.00 0.00 ? 39 LEU A CD1  5  
ATOM 6305  C CD2  . LEU A 1 39 ? 99.302  -16.000 -7.505  1.00 0.00 ? 39 LEU A CD2  5  
ATOM 6306  H H    . LEU A 1 39 ? 101.085 -14.620 -11.006 1.00 0.00 ? 39 LEU A H    5  
ATOM 6307  H HA   . LEU A 1 39 ? 98.459  -13.864 -10.810 1.00 0.00 ? 39 LEU A HA   5  
ATOM 6308  H HB2  . LEU A 1 39 ? 100.648 -13.901 -8.733  1.00 0.00 ? 39 LEU A HB2  5  
ATOM 6309  H HB3  . LEU A 1 39 ? 98.987  -13.493 -8.313  1.00 0.00 ? 39 LEU A HB3  5  
ATOM 6310  H HG   . LEU A 1 39 ? 98.257  -15.666 -9.350  1.00 0.00 ? 39 LEU A HG   5  
ATOM 6311  H HD11 . LEU A 1 39 ? 100.189 -17.375 -9.523  1.00 0.00 ? 39 LEU A HD11 5  
ATOM 6312  H HD12 . LEU A 1 39 ? 101.253 -15.972 -9.614  1.00 0.00 ? 39 LEU A HD12 5  
ATOM 6313  H HD13 . LEU A 1 39 ? 100.014 -16.220 -10.843 1.00 0.00 ? 39 LEU A HD13 5  
ATOM 6314  H HD21 . LEU A 1 39 ? 100.279 -15.796 -7.091  1.00 0.00 ? 39 LEU A HD21 5  
ATOM 6315  H HD22 . LEU A 1 39 ? 99.111  -17.063 -7.468  1.00 0.00 ? 39 LEU A HD22 5  
ATOM 6316  H HD23 . LEU A 1 39 ? 98.551  -15.479 -6.929  1.00 0.00 ? 39 LEU A HD23 5  
ATOM 6317  N N    . GLY A 1 40 ? 100.471 -11.301 -10.419 1.00 0.00 ? 40 GLY A N    5  
ATOM 6318  C CA   . GLY A 1 40 ? 100.511 -9.843  -10.374 1.00 0.00 ? 40 GLY A CA   5  
ATOM 6319  C C    . GLY A 1 40 ? 99.680  -9.239  -11.500 1.00 0.00 ? 40 GLY A C    5  
ATOM 6320  O O    . GLY A 1 40 ? 98.892  -8.318  -11.280 1.00 0.00 ? 40 GLY A O    5  
ATOM 6321  H H    . GLY A 1 40 ? 101.309 -11.805 -10.481 1.00 0.00 ? 40 GLY A H    5  
ATOM 6322  H HA2  . GLY A 1 40 ? 100.122 -9.507  -9.424  1.00 0.00 ? 40 GLY A HA2  5  
ATOM 6323  H HA3  . GLY A 1 40 ? 101.535 -9.514  -10.475 1.00 0.00 ? 40 GLY A HA3  5  
ATOM 6324  N N    . ILE A 1 41 ? 99.860  -9.765  -12.708 1.00 0.00 ? 41 ILE A N    5  
ATOM 6325  C CA   . ILE A 1 41 ? 99.122  -9.271  -13.867 1.00 0.00 ? 41 ILE A CA   5  
ATOM 6326  C C    . ILE A 1 41 ? 97.618  -9.414  -13.647 1.00 0.00 ? 41 ILE A C    5  
ATOM 6327  O O    . ILE A 1 41 ? 96.833  -8.549  -14.042 1.00 0.00 ? 41 ILE A O    5  
ATOM 6328  C CB   . ILE A 1 41 ? 99.532  -10.050 -15.118 1.00 0.00 ? 41 ILE A CB   5  
ATOM 6329  C CG1  . ILE A 1 41 ? 101.055 -10.003 -15.273 1.00 0.00 ? 41 ILE A CG1  5  
ATOM 6330  C CG2  . ILE A 1 41 ? 98.877  -9.422  -16.349 1.00 0.00 ? 41 ILE A CG2  5  
ATOM 6331  C CD1  . ILE A 1 41 ? 101.481 -10.925 -16.418 1.00 0.00 ? 41 ILE A CD1  5  
ATOM 6332  H H    . ILE A 1 41 ? 100.503 -10.496 -12.823 1.00 0.00 ? 41 ILE A H    5  
ATOM 6333  H HA   . ILE A 1 41 ? 99.357  -8.228  -14.014 1.00 0.00 ? 41 ILE A HA   5  
ATOM 6334  H HB   . ILE A 1 41 ? 99.209  -11.076 -15.023 1.00 0.00 ? 41 ILE A HB   5  
ATOM 6335  H HG12 . ILE A 1 41 ? 101.362 -8.991  -15.492 1.00 0.00 ? 41 ILE A HG12 5  
ATOM 6336  H HG13 . ILE A 1 41 ? 101.521 -10.331 -14.357 1.00 0.00 ? 41 ILE A HG13 5  
ATOM 6337  H HG21 . ILE A 1 41 ? 99.176  -8.387  -16.427 1.00 0.00 ? 41 ILE A HG21 5  
ATOM 6338  H HG22 . ILE A 1 41 ? 97.802  -9.480  -16.254 1.00 0.00 ? 41 ILE A HG22 5  
ATOM 6339  H HG23 . ILE A 1 41 ? 99.190  -9.955  -17.235 1.00 0.00 ? 41 ILE A HG23 5  
ATOM 6340  H HD11 . ILE A 1 41 ? 101.003 -11.887 -16.303 1.00 0.00 ? 41 ILE A HD11 5  
ATOM 6341  H HD12 . ILE A 1 41 ? 102.553 -11.052 -16.398 1.00 0.00 ? 41 ILE A HD12 5  
ATOM 6342  H HD13 . ILE A 1 41 ? 101.187 -10.488 -17.361 1.00 0.00 ? 41 ILE A HD13 5  
ATOM 6343  N N    . ILE A 1 42 ? 97.223  -10.513 -13.020 1.00 0.00 ? 42 ILE A N    5  
ATOM 6344  C CA   . ILE A 1 42 ? 95.813  -10.763 -12.754 1.00 0.00 ? 42 ILE A CA   5  
ATOM 6345  C C    . ILE A 1 42 ? 95.274  -9.757  -11.740 1.00 0.00 ? 42 ILE A C    5  
ATOM 6346  O O    . ILE A 1 42 ? 94.146  -9.284  -11.861 1.00 0.00 ? 42 ILE A O    5  
ATOM 6347  C CB   . ILE A 1 42 ? 95.629  -12.184 -12.215 1.00 0.00 ? 42 ILE A CB   5  
ATOM 6348  C CG1  . ILE A 1 42 ? 96.423  -13.174 -13.079 1.00 0.00 ? 42 ILE A CG1  5  
ATOM 6349  C CG2  . ILE A 1 42 ? 94.146  -12.558 -12.243 1.00 0.00 ? 42 ILE A CG2  5  
ATOM 6350  C CD1  . ILE A 1 42 ? 96.087  -12.971 -14.561 1.00 0.00 ? 42 ILE A CD1  5  
ATOM 6351  H H    . ILE A 1 42 ? 97.891  -11.169 -12.730 1.00 0.00 ? 42 ILE A H    5  
ATOM 6352  H HA   . ILE A 1 42 ? 95.258  -10.663 -13.674 1.00 0.00 ? 42 ILE A HA   5  
ATOM 6353  H HB   . ILE A 1 42 ? 95.989  -12.228 -11.196 1.00 0.00 ? 42 ILE A HB   5  
ATOM 6354  H HG12 . ILE A 1 42 ? 97.481  -13.012 -12.928 1.00 0.00 ? 42 ILE A HG12 5  
ATOM 6355  H HG13 . ILE A 1 42 ? 96.172  -14.183 -12.791 1.00 0.00 ? 42 ILE A HG13 5  
ATOM 6356  H HG21 . ILE A 1 42 ? 93.593  -11.884 -11.605 1.00 0.00 ? 42 ILE A HG21 5  
ATOM 6357  H HG22 . ILE A 1 42 ? 94.023  -13.570 -11.889 1.00 0.00 ? 42 ILE A HG22 5  
ATOM 6358  H HG23 . ILE A 1 42 ? 93.774  -12.482 -13.255 1.00 0.00 ? 42 ILE A HG23 5  
ATOM 6359  H HD11 . ILE A 1 42 ? 95.023  -12.825 -14.674 1.00 0.00 ? 42 ILE A HD11 5  
ATOM 6360  H HD12 . ILE A 1 42 ? 96.391  -13.843 -15.120 1.00 0.00 ? 42 ILE A HD12 5  
ATOM 6361  H HD13 . ILE A 1 42 ? 96.611  -12.104 -14.934 1.00 0.00 ? 42 ILE A HD13 5  
ATOM 6362  N N    . SER A 1 43 ? 96.088  -9.444  -10.737 1.00 0.00 ? 43 SER A N    5  
ATOM 6363  C CA   . SER A 1 43 ? 95.681  -8.503  -9.699  1.00 0.00 ? 43 SER A CA   5  
ATOM 6364  C C    . SER A 1 43 ? 95.389  -7.119  -10.277 1.00 0.00 ? 43 SER A C    5  
ATOM 6365  O O    . SER A 1 43 ? 94.328  -6.546  -10.029 1.00 0.00 ? 43 SER A O    5  
ATOM 6366  C CB   . SER A 1 43 ? 96.783  -8.387  -8.647  1.00 0.00 ? 43 SER A CB   5  
ATOM 6367  O OG   . SER A 1 43 ? 96.378  -7.468  -7.641  1.00 0.00 ? 43 SER A OG   5  
ATOM 6368  H H    . SER A 1 43 ? 96.974  -9.858  -10.690 1.00 0.00 ? 43 SER A H    5  
ATOM 6369  H HA   . SER A 1 43 ? 94.788  -8.875  -9.221  1.00 0.00 ? 43 SER A HA   5  
ATOM 6370  H HB2  . SER A 1 43 ? 96.959  -9.350  -8.198  1.00 0.00 ? 43 SER A HB2  5  
ATOM 6371  H HB3  . SER A 1 43 ? 97.695  -8.041  -9.118  1.00 0.00 ? 43 SER A HB3  5  
ATOM 6372  H HG   . SER A 1 43 ? 95.825  -7.940  -7.013  1.00 0.00 ? 43 SER A HG   5  
ATOM 6373  N N    . ILE A 1 44 ? 96.336  -6.580  -11.040 1.00 0.00 ? 44 ILE A N    5  
ATOM 6374  C CA   . ILE A 1 44 ? 96.155  -5.253  -11.626 1.00 0.00 ? 44 ILE A CA   5  
ATOM 6375  C C    . ILE A 1 44 ? 94.952  -5.233  -12.571 1.00 0.00 ? 44 ILE A C    5  
ATOM 6376  O O    . ILE A 1 44 ? 94.130  -4.312  -12.525 1.00 0.00 ? 44 ILE A O    5  
ATOM 6377  C CB   . ILE A 1 44 ? 97.429  -4.823  -12.367 1.00 0.00 ? 44 ILE A CB   5  
ATOM 6378  C CG1  . ILE A 1 44 ? 97.843  -5.915  -13.359 1.00 0.00 ? 44 ILE A CG1  5  
ATOM 6379  C CG2  . ILE A 1 44 ? 98.562  -4.606  -11.358 1.00 0.00 ? 44 ILE A CG2  5  
ATOM 6380  C CD1  . ILE A 1 44 ? 99.219  -5.596  -13.963 1.00 0.00 ? 44 ILE A CD1  5  
ATOM 6381  H H    . ILE A 1 44 ? 97.169  -7.074  -11.204 1.00 0.00 ? 44 ILE A H    5  
ATOM 6382  H HA   . ILE A 1 44 ? 95.969  -4.550  -10.828 1.00 0.00 ? 44 ILE A HA   5  
ATOM 6383  H HB   . ILE A 1 44 ? 97.241  -3.903  -12.901 1.00 0.00 ? 44 ILE A HB   5  
ATOM 6384  H HG12 . ILE A 1 44 ? 97.892  -6.860  -12.842 1.00 0.00 ? 44 ILE A HG12 5  
ATOM 6385  H HG13 . ILE A 1 44 ? 97.113  -5.975  -14.148 1.00 0.00 ? 44 ILE A HG13 5  
ATOM 6386  H HG21 . ILE A 1 44 ? 98.205  -4.017  -10.528 1.00 0.00 ? 44 ILE A HG21 5  
ATOM 6387  H HG22 . ILE A 1 44 ? 99.379  -4.088  -11.839 1.00 0.00 ? 44 ILE A HG22 5  
ATOM 6388  H HG23 . ILE A 1 44 ? 98.910  -5.564  -10.996 1.00 0.00 ? 44 ILE A HG23 5  
ATOM 6389  H HD11 . ILE A 1 44 ? 99.284  -6.030  -14.951 1.00 0.00 ? 44 ILE A HD11 5  
ATOM 6390  H HD12 . ILE A 1 44 ? 99.992  -6.015  -13.337 1.00 0.00 ? 44 ILE A HD12 5  
ATOM 6391  H HD13 . ILE A 1 44 ? 99.353  -4.525  -14.032 1.00 0.00 ? 44 ILE A HD13 5  
ATOM 6392  N N    . VAL A 1 45 ? 94.835  -6.255  -13.415 1.00 0.00 ? 45 VAL A N    5  
ATOM 6393  C CA   . VAL A 1 45 ? 93.709  -6.326  -14.342 1.00 0.00 ? 45 VAL A CA   5  
ATOM 6394  C C    . VAL A 1 45 ? 92.394  -6.275  -13.564 1.00 0.00 ? 45 VAL A C    5  
ATOM 6395  O O    . VAL A 1 45 ? 91.453  -5.581  -13.953 1.00 0.00 ? 45 VAL A O    5  
ATOM 6396  C CB   . VAL A 1 45 ? 93.783  -7.623  -15.161 1.00 0.00 ? 45 VAL A CB   5  
ATOM 6397  C CG1  . VAL A 1 45 ? 92.471  -7.838  -15.925 1.00 0.00 ? 45 VAL A CG1  5  
ATOM 6398  C CG2  . VAL A 1 45 ? 94.936  -7.529  -16.164 1.00 0.00 ? 45 VAL A CG2  5  
ATOM 6399  H H    . VAL A 1 45 ? 95.506  -6.973  -13.409 1.00 0.00 ? 45 VAL A H    5  
ATOM 6400  H HA   . VAL A 1 45 ? 93.753  -5.483  -15.015 1.00 0.00 ? 45 VAL A HA   5  
ATOM 6401  H HB   . VAL A 1 45 ? 93.951  -8.457  -14.496 1.00 0.00 ? 45 VAL A HB   5  
ATOM 6402  H HG11 . VAL A 1 45 ? 91.702  -8.156  -15.237 1.00 0.00 ? 45 VAL A HG11 5  
ATOM 6403  H HG12 . VAL A 1 45 ? 92.614  -8.598  -16.680 1.00 0.00 ? 45 VAL A HG12 5  
ATOM 6404  H HG13 . VAL A 1 45 ? 92.173  -6.913  -16.396 1.00 0.00 ? 45 VAL A HG13 5  
ATOM 6405  H HG21 . VAL A 1 45 ? 95.822  -7.175  -15.663 1.00 0.00 ? 45 VAL A HG21 5  
ATOM 6406  H HG22 . VAL A 1 45 ? 94.670  -6.841  -16.953 1.00 0.00 ? 45 VAL A HG22 5  
ATOM 6407  H HG23 . VAL A 1 45 ? 95.125  -8.504  -16.585 1.00 0.00 ? 45 VAL A HG23 5  
ATOM 6408  N N    . LEU A 1 46 ? 92.340  -7.021  -12.467 1.00 0.00 ? 46 LEU A N    5  
ATOM 6409  C CA   . LEU A 1 46 ? 91.140  -7.065  -11.642 1.00 0.00 ? 46 LEU A CA   5  
ATOM 6410  C C    . LEU A 1 46 ? 90.859  -5.707  -11.004 1.00 0.00 ? 46 LEU A C    5  
ATOM 6411  O O    . LEU A 1 46 ? 89.701  -5.344  -10.806 1.00 0.00 ? 46 LEU A O    5  
ATOM 6412  C CB   . LEU A 1 46 ? 91.292  -8.125  -10.547 1.00 0.00 ? 46 LEU A CB   5  
ATOM 6413  C CG   . LEU A 1 46 ? 91.200  -9.533  -11.157 1.00 0.00 ? 46 LEU A CG   5  
ATOM 6414  C CD1  . LEU A 1 46 ? 91.701  -10.555 -10.132 1.00 0.00 ? 46 LEU A CD1  5  
ATOM 6415  C CD2  . LEU A 1 46 ? 89.743  -9.866  -11.547 1.00 0.00 ? 46 LEU A CD2  5  
ATOM 6416  H H    . LEU A 1 46 ? 93.120  -7.555  -12.210 1.00 0.00 ? 46 LEU A H    5  
ATOM 6417  H HA   . LEU A 1 46 ? 90.302  -7.328  -12.264 1.00 0.00 ? 46 LEU A HA   5  
ATOM 6418  H HB2  . LEU A 1 46 ? 92.255  -8.006  -10.071 1.00 0.00 ? 46 LEU A HB2  5  
ATOM 6419  H HB3  . LEU A 1 46 ? 90.515  -7.998  -9.809  1.00 0.00 ? 46 LEU A HB3  5  
ATOM 6420  H HG   . LEU A 1 46 ? 91.826  -9.579  -12.038 1.00 0.00 ? 46 LEU A HG   5  
ATOM 6421  H HD11 . LEU A 1 46 ? 91.161  -10.430 -9.205  1.00 0.00 ? 46 LEU A HD11 5  
ATOM 6422  H HD12 . LEU A 1 46 ? 92.756  -10.401 -9.958  1.00 0.00 ? 46 LEU A HD12 5  
ATOM 6423  H HD13 . LEU A 1 46 ? 91.541  -11.554 -10.510 1.00 0.00 ? 46 LEU A HD13 5  
ATOM 6424  H HD21 . LEU A 1 46 ? 89.532  -9.470  -12.529 1.00 0.00 ? 46 LEU A HD21 5  
ATOM 6425  H HD22 . LEU A 1 46 ? 89.059  -9.433  -10.832 1.00 0.00 ? 46 LEU A HD22 5  
ATOM 6426  H HD23 . LEU A 1 46 ? 89.607  -10.939 -11.565 1.00 0.00 ? 46 LEU A HD23 5  
ATOM 6427  N N    . VAL A 1 47 ? 91.910  -4.953  -10.687 1.00 0.00 ? 47 VAL A N    5  
ATOM 6428  C CA   . VAL A 1 47 ? 91.722  -3.642  -10.079 1.00 0.00 ? 47 VAL A CA   5  
ATOM 6429  C C    . VAL A 1 47 ? 91.046  -2.707  -11.076 1.00 0.00 ? 47 VAL A C    5  
ATOM 6430  O O    . VAL A 1 47 ? 90.224  -1.869  -10.704 1.00 0.00 ? 47 VAL A O    5  
ATOM 6431  C CB   . VAL A 1 47 ? 93.073  -3.063  -9.633  1.00 0.00 ? 47 VAL A CB   5  
ATOM 6432  C CG1  . VAL A 1 47 ? 92.904  -1.590  -9.240  1.00 0.00 ? 47 VAL A CG1  5  
ATOM 6433  C CG2  . VAL A 1 47 ? 93.590  -3.853  -8.425  1.00 0.00 ? 47 VAL A CG2  5  
ATOM 6434  H H    . VAL A 1 47 ? 92.818  -5.277  -10.869 1.00 0.00 ? 47 VAL A H    5  
ATOM 6435  H HA   . VAL A 1 47 ? 91.087  -3.748  -9.212  1.00 0.00 ? 47 VAL A HA   5  
ATOM 6436  H HB   . VAL A 1 47 ? 93.781  -3.138  -10.446 1.00 0.00 ? 47 VAL A HB   5  
ATOM 6437  H HG11 . VAL A 1 47 ? 92.791  -0.990  -10.131 1.00 0.00 ? 47 VAL A HG11 5  
ATOM 6438  H HG12 . VAL A 1 47 ? 93.774  -1.261  -8.692  1.00 0.00 ? 47 VAL A HG12 5  
ATOM 6439  H HG13 . VAL A 1 47 ? 92.026  -1.482  -8.620  1.00 0.00 ? 47 VAL A HG13 5  
ATOM 6440  H HG21 . VAL A 1 47 ? 94.643  -3.655  -8.290  1.00 0.00 ? 47 VAL A HG21 5  
ATOM 6441  H HG22 . VAL A 1 47 ? 93.444  -4.910  -8.595  1.00 0.00 ? 47 VAL A HG22 5  
ATOM 6442  H HG23 . VAL A 1 47 ? 93.050  -3.554  -7.538  1.00 0.00 ? 47 VAL A HG23 5  
ATOM 6443  N N    . ALA A 1 48 ? 91.397  -2.857  -12.347 1.00 0.00 ? 48 ALA A N    5  
ATOM 6444  C CA   . ALA A 1 48 ? 90.814  -2.017  -13.388 1.00 0.00 ? 48 ALA A CA   5  
ATOM 6445  C C    . ALA A 1 48 ? 89.339  -2.344  -13.597 1.00 0.00 ? 48 ALA A C    5  
ATOM 6446  O O    . ALA A 1 48 ? 88.490  -1.453  -13.601 1.00 0.00 ? 48 ALA A O    5  
ATOM 6447  C CB   . ALA A 1 48 ? 91.567  -2.220  -14.704 1.00 0.00 ? 48 ALA A CB   5  
ATOM 6448  H H    . ALA A 1 48 ? 92.062  -3.541  -12.589 1.00 0.00 ? 48 ALA A H    5  
ATOM 6449  H HA   . ALA A 1 48 ? 90.897  -0.985  -13.092 1.00 0.00 ? 48 ALA A HA   5  
ATOM 6450  H HB1  . ALA A 1 48 ? 91.466  -3.248  -15.020 1.00 0.00 ? 48 ALA A HB1  5  
ATOM 6451  H HB2  . ALA A 1 48 ? 92.612  -1.990  -14.563 1.00 0.00 ? 48 ALA A HB2  5  
ATOM 6452  H HB3  . ALA A 1 48 ? 91.153  -1.570  -15.460 1.00 0.00 ? 48 ALA A HB3  5  
ATOM 6453  N N    . THR A 1 49 ? 89.039  -3.621  -13.784 1.00 0.00 ? 49 THR A N    5  
ATOM 6454  C CA   . THR A 1 49 ? 87.661  -4.039  -14.013 1.00 0.00 ? 49 THR A CA   5  
ATOM 6455  C C    . THR A 1 49 ? 86.744  -3.589  -12.876 1.00 0.00 ? 49 THR A C    5  
ATOM 6456  O O    . THR A 1 49 ? 85.669  -3.039  -13.118 1.00 0.00 ? 49 THR A O    5  
ATOM 6457  C CB   . THR A 1 49 ? 87.594  -5.561  -14.151 1.00 0.00 ? 49 THR A CB   5  
ATOM 6458  O OG1  . THR A 1 49 ? 88.599  -5.998  -15.056 1.00 0.00 ? 49 THR A OG1  5  
ATOM 6459  C CG2  . THR A 1 49 ? 86.217  -5.968  -14.680 1.00 0.00 ? 49 THR A CG2  5  
ATOM 6460  H H    . THR A 1 49 ? 89.756  -4.293  -13.781 1.00 0.00 ? 49 THR A H    5  
ATOM 6461  H HA   . THR A 1 49 ? 87.315  -3.595  -14.933 1.00 0.00 ? 49 THR A HA   5  
ATOM 6462  H HB   . THR A 1 49 ? 87.754  -6.019  -13.187 1.00 0.00 ? 49 THR A HB   5  
ATOM 6463  H HG1  . THR A 1 49 ? 89.401  -5.507  -14.867 1.00 0.00 ? 49 THR A HG1  5  
ATOM 6464  H HG21 . THR A 1 49 ? 86.209  -7.028  -14.883 1.00 0.00 ? 49 THR A HG21 5  
ATOM 6465  H HG22 . THR A 1 49 ? 86.006  -5.425  -15.589 1.00 0.00 ? 49 THR A HG22 5  
ATOM 6466  H HG23 . THR A 1 49 ? 85.465  -5.736  -13.941 1.00 0.00 ? 49 THR A HG23 5  
ATOM 6467  N N    . VAL A 1 50 ? 87.160  -3.841  -11.639 1.00 0.00 ? 50 VAL A N    5  
ATOM 6468  C CA   . VAL A 1 50 ? 86.345  -3.475  -10.484 1.00 0.00 ? 50 VAL A CA   5  
ATOM 6469  C C    . VAL A 1 50 ? 86.310  -1.964  -10.267 1.00 0.00 ? 50 VAL A C    5  
ATOM 6470  O O    . VAL A 1 50 ? 85.341  -1.442  -9.720  1.00 0.00 ? 50 VAL A O    5  
ATOM 6471  C CB   . VAL A 1 50 ? 86.865  -4.159  -9.216  1.00 0.00 ? 50 VAL A CB   5  
ATOM 6472  C CG1  . VAL A 1 50 ? 86.980  -5.670  -9.448  1.00 0.00 ? 50 VAL A CG1  5  
ATOM 6473  C CG2  . VAL A 1 50 ? 88.237  -3.585  -8.844  1.00 0.00 ? 50 VAL A CG2  5  
ATOM 6474  H H    . VAL A 1 50 ? 88.018  -4.295  -11.501 1.00 0.00 ? 50 VAL A H    5  
ATOM 6475  H HA   . VAL A 1 50 ? 85.336  -3.814  -10.661 1.00 0.00 ? 50 VAL A HA   5  
ATOM 6476  H HB   . VAL A 1 50 ? 86.172  -3.979  -8.407  1.00 0.00 ? 50 VAL A HB   5  
ATOM 6477  H HG11 . VAL A 1 50 ? 87.583  -6.109  -8.667  1.00 0.00 ? 50 VAL A HG11 5  
ATOM 6478  H HG12 . VAL A 1 50 ? 87.441  -5.858  -10.405 1.00 0.00 ? 50 VAL A HG12 5  
ATOM 6479  H HG13 . VAL A 1 50 ? 85.995  -6.111  -9.431  1.00 0.00 ? 50 VAL A HG13 5  
ATOM 6480  H HG21 . VAL A 1 50 ? 88.829  -3.463  -9.736  1.00 0.00 ? 50 VAL A HG21 5  
ATOM 6481  H HG22 . VAL A 1 50 ? 88.741  -4.258  -8.166  1.00 0.00 ? 50 VAL A HG22 5  
ATOM 6482  H HG23 . VAL A 1 50 ? 88.106  -2.626  -8.366  1.00 0.00 ? 50 VAL A HG23 5  
ATOM 6483  N N    . LEU A 1 51 ? 87.361  -1.253  -10.670 1.00 0.00 ? 51 LEU A N    5  
ATOM 6484  C CA   . LEU A 1 51 ? 87.381  0.194   -10.468 1.00 0.00 ? 51 LEU A CA   5  
ATOM 6485  C C    . LEU A 1 51 ? 86.336  0.876   -11.337 1.00 0.00 ? 51 LEU A C    5  
ATOM 6486  O O    . LEU A 1 51 ? 85.497  1.616   -10.833 1.00 0.00 ? 51 LEU A O    5  
ATOM 6487  C CB   . LEU A 1 51 ? 88.779  0.752   -10.778 1.00 0.00 ? 51 LEU A CB   5  
ATOM 6488  C CG   . LEU A 1 51 ? 88.818  2.275   -10.572 1.00 0.00 ? 51 LEU A CG   5  
ATOM 6489  C CD1  . LEU A 1 51 ? 88.526  2.622   -9.104  1.00 0.00 ? 51 LEU A CD1  5  
ATOM 6490  C CD2  . LEU A 1 51 ? 90.211  2.791   -10.952 1.00 0.00 ? 51 LEU A CD2  5  
ATOM 6491  H H    . LEU A 1 51 ? 88.130  -1.699  -11.092 1.00 0.00 ? 51 LEU A H    5  
ATOM 6492  H HA   . LEU A 1 51 ? 87.142  0.394   -9.438  1.00 0.00 ? 51 LEU A HA   5  
ATOM 6493  H HB2  . LEU A 1 51 ? 89.500  0.288   -10.123 1.00 0.00 ? 51 LEU A HB2  5  
ATOM 6494  H HB3  . LEU A 1 51 ? 89.032  0.526   -11.804 1.00 0.00 ? 51 LEU A HB3  5  
ATOM 6495  H HG   . LEU A 1 51 ? 88.080  2.749   -11.204 1.00 0.00 ? 51 LEU A HG   5  
ATOM 6496  H HD11 . LEU A 1 51 ? 87.461  2.619   -8.937  1.00 0.00 ? 51 LEU A HD11 5  
ATOM 6497  H HD12 . LEU A 1 51 ? 88.917  3.603   -8.876  1.00 0.00 ? 51 LEU A HD12 5  
ATOM 6498  H HD13 . LEU A 1 51 ? 88.993  1.891   -8.459  1.00 0.00 ? 51 LEU A HD13 5  
ATOM 6499  H HD21 . LEU A 1 51 ? 90.234  3.867   -10.860 1.00 0.00 ? 51 LEU A HD21 5  
ATOM 6500  H HD22 . LEU A 1 51 ? 90.431  2.512   -11.972 1.00 0.00 ? 51 LEU A HD22 5  
ATOM 6501  H HD23 . LEU A 1 51 ? 90.947  2.356   -10.292 1.00 0.00 ? 51 LEU A HD23 5  
ATOM 6502  N N    . LYS A 1 52 ? 86.385  0.628   -12.636 1.00 0.00 ? 52 LYS A N    5  
ATOM 6503  C CA   . LYS A 1 52 ? 85.425  1.238   -13.548 1.00 0.00 ? 52 LYS A CA   5  
ATOM 6504  C C    . LYS A 1 52 ? 84.017  0.729   -13.257 1.00 0.00 ? 52 LYS A C    5  
ATOM 6505  O O    . LYS A 1 52 ? 83.070  1.499   -13.214 1.00 0.00 ? 52 LYS A O    5  
ATOM 6506  C CB   . LYS A 1 52 ? 85.814  0.917   -14.996 1.00 0.00 ? 52 LYS A CB   5  
ATOM 6507  C CG   . LYS A 1 52 ? 86.958  1.840   -15.450 1.00 0.00 ? 52 LYS A CG   5  
ATOM 6508  C CD   . LYS A 1 52 ? 88.092  1.821   -14.413 1.00 0.00 ? 52 LYS A CD   5  
ATOM 6509  C CE   . LYS A 1 52 ? 89.338  2.501   -14.984 1.00 0.00 ? 52 LYS A CE   5  
ATOM 6510  N NZ   . LYS A 1 52 ? 89.133  3.976   -14.996 1.00 0.00 ? 52 LYS A NZ   5  
ATOM 6511  H H    . LYS A 1 52 ? 87.076  0.028   -12.990 1.00 0.00 ? 52 LYS A H    5  
ATOM 6512  H HA   . LYS A 1 52 ? 85.435  2.312   -13.413 1.00 0.00 ? 52 LYS A HA   5  
ATOM 6513  H HB2  . LYS A 1 52 ? 86.135  -0.113  -15.057 1.00 0.00 ? 52 LYS A HB2  5  
ATOM 6514  H HB3  . LYS A 1 52 ? 84.961  1.066   -15.641 1.00 0.00 ? 52 LYS A HB3  5  
ATOM 6515  H HG2  . LYS A 1 52 ? 87.334  1.497   -16.403 1.00 0.00 ? 52 LYS A HG2  5  
ATOM 6516  H HG3  . LYS A 1 52 ? 86.586  2.847   -15.553 1.00 0.00 ? 52 LYS A HG3  5  
ATOM 6517  H HD2  . LYS A 1 52 ? 87.776  2.353   -13.527 1.00 0.00 ? 52 LYS A HD2  5  
ATOM 6518  H HD3  . LYS A 1 52 ? 88.326  0.803   -14.156 1.00 0.00 ? 52 LYS A HD3  5  
ATOM 6519  H HE2  . LYS A 1 52 ? 90.191  2.262   -14.365 1.00 0.00 ? 52 LYS A HE2  5  
ATOM 6520  H HE3  . LYS A 1 52 ? 89.517  2.151   -15.989 1.00 0.00 ? 52 LYS A HE3  5  
ATOM 6521  H HZ1  . LYS A 1 52 ? 88.435  4.222   -15.723 1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 6522  H HZ2  . LYS A 1 52 ? 90.036  4.450   -15.206 1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 6523  H HZ3  . LYS A 1 52 ? 88.787  4.286   -14.066 1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 6524  N N    . THR A 1 53 ? 83.886  -0.572  -13.064 1.00 0.00 ? 53 THR A N    5  
ATOM 6525  C CA   . THR A 1 53 ? 82.577  -1.155  -12.793 1.00 0.00 ? 53 THR A CA   5  
ATOM 6526  C C    . THR A 1 53 ? 81.951  -0.601  -11.507 1.00 0.00 ? 53 THR A C    5  
ATOM 6527  O O    . THR A 1 53 ? 80.766  -0.257  -11.487 1.00 0.00 ? 53 THR A O    5  
ATOM 6528  C CB   . THR A 1 53 ? 82.708  -2.678  -12.679 1.00 0.00 ? 53 THR A CB   5  
ATOM 6529  O OG1  . THR A 1 53 ? 83.412  -3.176  -13.809 1.00 0.00 ? 53 THR A OG1  5  
ATOM 6530  C CG2  . THR A 1 53 ? 81.318  -3.316  -12.623 1.00 0.00 ? 53 THR A CG2  5  
ATOM 6531  H H    . THR A 1 53 ? 84.675  -1.152  -13.116 1.00 0.00 ? 53 THR A H    5  
ATOM 6532  H HA   . THR A 1 53 ? 81.922  -0.930  -13.620 1.00 0.00 ? 53 THR A HA   5  
ATOM 6533  H HB   . THR A 1 53 ? 83.249  -2.926  -11.780 1.00 0.00 ? 53 THR A HB   5  
ATOM 6534  H HG1  . THR A 1 53 ? 83.853  -2.436  -14.233 1.00 0.00 ? 53 THR A HG1  5  
ATOM 6535  H HG21 . THR A 1 53 ? 80.794  -3.119  -13.546 1.00 0.00 ? 53 THR A HG21 5  
ATOM 6536  H HG22 . THR A 1 53 ? 80.762  -2.898  -11.797 1.00 0.00 ? 53 THR A HG22 5  
ATOM 6537  H HG23 . THR A 1 53 ? 81.418  -4.382  -12.486 1.00 0.00 ? 53 THR A HG23 5  
ATOM 6538  N N    . ILE A 1 54 ? 82.728  -0.551  -10.427 1.00 0.00 ? 54 ILE A N    5  
ATOM 6539  C CA   . ILE A 1 54 ? 82.196  -0.086  -9.144  1.00 0.00 ? 54 ILE A CA   5  
ATOM 6540  C C    . ILE A 1 54 ? 81.912  1.414   -9.112  1.00 0.00 ? 54 ILE A C    5  
ATOM 6541  O O    . ILE A 1 54 ? 80.894  1.828   -8.568  1.00 0.00 ? 54 ILE A O    5  
ATOM 6542  C CB   . ILE A 1 54 ? 83.160  -0.457  -8.013  1.00 0.00 ? 54 ILE A CB   5  
ATOM 6543  C CG1  . ILE A 1 54 ? 83.237  -1.981  -7.888  1.00 0.00 ? 54 ILE A CG1  5  
ATOM 6544  C CG2  . ILE A 1 54 ? 82.660  0.128   -6.687  1.00 0.00 ? 54 ILE A CG2  5  
ATOM 6545  C CD1  . ILE A 1 54 ? 84.411  -2.358  -6.984  1.00 0.00 ? 54 ILE A CD1  5  
ATOM 6546  H H    . ILE A 1 54 ? 83.662  -0.857  -10.481 1.00 0.00 ? 54 ILE A H    5  
ATOM 6547  H HA   . ILE A 1 54 ? 81.261  -0.596  -8.973  1.00 0.00 ? 54 ILE A HA   5  
ATOM 6548  H HB   . ILE A 1 54 ? 84.141  -0.062  -8.232  1.00 0.00 ? 54 ILE A HB   5  
ATOM 6549  H HG12 . ILE A 1 54 ? 82.317  -2.352  -7.459  1.00 0.00 ? 54 ILE A HG12 5  
ATOM 6550  H HG13 . ILE A 1 54 ? 83.380  -2.417  -8.866  1.00 0.00 ? 54 ILE A HG13 5  
ATOM 6551  H HG21 . ILE A 1 54 ? 83.194  -0.329  -5.867  1.00 0.00 ? 54 ILE A HG21 5  
ATOM 6552  H HG22 . ILE A 1 54 ? 81.603  -0.070  -6.582  1.00 0.00 ? 54 ILE A HG22 5  
ATOM 6553  H HG23 . ILE A 1 54 ? 82.830  1.194   -6.677  1.00 0.00 ? 54 ILE A HG23 5  
ATOM 6554  H HD11 . ILE A 1 54 ? 84.271  -1.915  -6.009  1.00 0.00 ? 54 ILE A HD11 5  
ATOM 6555  H HD12 . ILE A 1 54 ? 85.330  -1.991  -7.417  1.00 0.00 ? 54 ILE A HD12 5  
ATOM 6556  H HD13 . ILE A 1 54 ? 84.462  -3.433  -6.889  1.00 0.00 ? 54 ILE A HD13 5  
ATOM 6557  N N    . VAL A 1 55 ? 82.806  2.230   -9.649  1.00 0.00 ? 55 VAL A N    5  
ATOM 6558  C CA   . VAL A 1 55 ? 82.589  3.677   -9.620  1.00 0.00 ? 55 VAL A CA   5  
ATOM 6559  C C    . VAL A 1 55 ? 81.545  4.107   -10.647 1.00 0.00 ? 55 VAL A C    5  
ATOM 6560  O O    . VAL A 1 55 ? 80.777  5.033   -10.408 1.00 0.00 ? 55 VAL A O    5  
ATOM 6561  C CB   . VAL A 1 55 ? 83.903  4.420   -9.890  1.00 0.00 ? 55 VAL A CB   5  
ATOM 6562  C CG1  . VAL A 1 55 ? 84.966  3.944   -8.895  1.00 0.00 ? 55 VAL A CG1  5  
ATOM 6563  C CG2  . VAL A 1 55 ? 84.374  4.162   -11.340 1.00 0.00 ? 55 VAL A CG2  5  
ATOM 6564  H H    . VAL A 1 55 ? 83.621  1.865   -10.053 1.00 0.00 ? 55 VAL A H    5  
ATOM 6565  H HA   . VAL A 1 55 ? 82.238  3.952   -8.637  1.00 0.00 ? 55 VAL A HA   5  
ATOM 6566  H HB   . VAL A 1 55 ? 83.741  5.481   -9.748  1.00 0.00 ? 55 VAL A HB   5  
ATOM 6567  H HG11 . VAL A 1 55 ? 84.706  4.282   -7.903  1.00 0.00 ? 55 VAL A HG11 5  
ATOM 6568  H HG12 . VAL A 1 55 ? 85.926  4.357   -9.173  1.00 0.00 ? 55 VAL A HG12 5  
ATOM 6569  H HG13 . VAL A 1 55 ? 85.018  2.867   -8.908  1.00 0.00 ? 55 VAL A HG13 5  
ATOM 6570  H HG21 . VAL A 1 55 ? 83.973  4.928   -11.992 1.00 0.00 ? 55 VAL A HG21 5  
ATOM 6571  H HG22 . VAL A 1 55 ? 84.026  3.196   -11.675 1.00 0.00 ? 55 VAL A HG22 5  
ATOM 6572  H HG23 . VAL A 1 55 ? 85.455  4.187   -11.387 1.00 0.00 ? 55 VAL A HG23 5  
ATOM 6573  N N    . LEU A 1 56 ? 81.549  3.450   -11.799 1.00 0.00 ? 56 LEU A N    5  
ATOM 6574  C CA   . LEU A 1 56 ? 80.632  3.789   -12.882 1.00 0.00 ? 56 LEU A CA   5  
ATOM 6575  C C    . LEU A 1 56 ? 79.180  3.386   -12.598 1.00 0.00 ? 56 LEU A C    5  
ATOM 6576  O O    . LEU A 1 56 ? 78.260  4.110   -12.971 1.00 0.00 ? 56 LEU A O    5  
ATOM 6577  C CB   . LEU A 1 56 ? 81.108  3.098   -14.166 1.00 0.00 ? 56 LEU A CB   5  
ATOM 6578  C CG   . LEU A 1 56 ? 80.336  3.626   -15.397 1.00 0.00 ? 56 LEU A CG   5  
ATOM 6579  C CD1  . LEU A 1 56 ? 81.061  4.845   -15.978 1.00 0.00 ? 56 LEU A CD1  5  
ATOM 6580  C CD2  . LEU A 1 56 ? 80.263  2.536   -16.474 1.00 0.00 ? 56 LEU A CD2  5  
ATOM 6581  H H    . LEU A 1 56 ? 82.205  2.735   -11.940 1.00 0.00 ? 56 LEU A H    5  
ATOM 6582  H HA   . LEU A 1 56 ? 80.666  4.855   -13.040 1.00 0.00 ? 56 LEU A HA   5  
ATOM 6583  H HB2  . LEU A 1 56 ? 82.163  3.291   -14.297 1.00 0.00 ? 56 LEU A HB2  5  
ATOM 6584  H HB3  . LEU A 1 56 ? 80.951  2.035   -14.066 1.00 0.00 ? 56 LEU A HB3  5  
ATOM 6585  H HG   . LEU A 1 56 ? 79.335  3.912   -15.111 1.00 0.00 ? 56 LEU A HG   5  
ATOM 6586  H HD11 . LEU A 1 56 ? 81.341  5.514   -15.178 1.00 0.00 ? 56 LEU A HD11 5  
ATOM 6587  H HD12 . LEU A 1 56 ? 80.410  5.358   -16.668 1.00 0.00 ? 56 LEU A HD12 5  
ATOM 6588  H HD13 . LEU A 1 56 ? 81.950  4.515   -16.496 1.00 0.00 ? 56 LEU A HD13 5  
ATOM 6589  H HD21 . LEU A 1 56 ? 81.255  2.161   -16.674 1.00 0.00 ? 56 LEU A HD21 5  
ATOM 6590  H HD22 . LEU A 1 56 ? 79.844  2.950   -17.378 1.00 0.00 ? 56 LEU A HD22 5  
ATOM 6591  H HD23 . LEU A 1 56 ? 79.637  1.727   -16.124 1.00 0.00 ? 56 LEU A HD23 5  
ATOM 6592  N N    . ILE A 1 57 ? 78.960  2.224   -11.986 1.00 0.00 ? 57 ILE A N    5  
ATOM 6593  C CA   . ILE A 1 57 ? 77.587  1.773   -11.742 1.00 0.00 ? 57 ILE A CA   5  
ATOM 6594  C C    . ILE A 1 57 ? 76.773  2.740   -10.853 1.00 0.00 ? 57 ILE A C    5  
ATOM 6595  O O    . ILE A 1 57 ? 75.649  3.084   -11.216 1.00 0.00 ? 57 ILE A O    5  
ATOM 6596  C CB   . ILE A 1 57 ? 77.592  0.319   -11.167 1.00 0.00 ? 57 ILE A CB   5  
ATOM 6597  C CG1  . ILE A 1 57 ? 77.376  -0.715  -12.294 1.00 0.00 ? 57 ILE A CG1  5  
ATOM 6598  C CG2  . ILE A 1 57 ? 76.473  0.119   -10.130 1.00 0.00 ? 57 ILE A CG2  5  
ATOM 6599  C CD1  . ILE A 1 57 ? 78.567  -0.728  -13.261 1.00 0.00 ? 57 ILE A CD1  5  
ATOM 6600  H H    . ILE A 1 57 ? 79.722  1.646   -11.723 1.00 0.00 ? 57 ILE A H    5  
ATOM 6601  H HA   . ILE A 1 57 ? 77.092  1.762   -12.702 1.00 0.00 ? 57 ILE A HA   5  
ATOM 6602  H HB   . ILE A 1 57 ? 78.546  0.131   -10.694 1.00 0.00 ? 57 ILE A HB   5  
ATOM 6603  H HG12 . ILE A 1 57 ? 77.266  -1.696  -11.855 1.00 0.00 ? 57 ILE A HG12 5  
ATOM 6604  H HG13 . ILE A 1 57 ? 76.476  -0.468  -12.838 1.00 0.00 ? 57 ILE A HG13 5  
ATOM 6605  H HG21 . ILE A 1 57 ? 76.404  -0.928  -9.874  1.00 0.00 ? 57 ILE A HG21 5  
ATOM 6606  H HG22 . ILE A 1 57 ? 75.534  0.448   -10.549 1.00 0.00 ? 57 ILE A HG22 5  
ATOM 6607  H HG23 . ILE A 1 57 ? 76.690  0.691   -9.243  1.00 0.00 ? 57 ILE A HG23 5  
ATOM 6608  H HD11 . ILE A 1 57 ? 79.313  -1.420  -12.902 1.00 0.00 ? 57 ILE A HD11 5  
ATOM 6609  H HD12 . ILE A 1 57 ? 78.995  0.260   -13.334 1.00 0.00 ? 57 ILE A HD12 5  
ATOM 6610  H HD13 . ILE A 1 57 ? 78.228  -1.044  -14.237 1.00 0.00 ? 57 ILE A HD13 5  
ATOM 6611  N N    . PRO A 1 58 ? 77.256  3.167   -9.710  1.00 0.00 ? 58 PRO A N    5  
ATOM 6612  C CA   . PRO A 1 58 ? 76.455  4.070   -8.834  1.00 0.00 ? 58 PRO A CA   5  
ATOM 6613  C C    . PRO A 1 58 ? 75.909  5.268   -9.609  1.00 0.00 ? 58 PRO A C    5  
ATOM 6614  O O    . PRO A 1 58 ? 74.742  5.629   -9.460  1.00 0.00 ? 58 PRO A O    5  
ATOM 6615  C CB   . PRO A 1 58 ? 77.422  4.486   -7.702  1.00 0.00 ? 58 PRO A CB   5  
ATOM 6616  C CG   . PRO A 1 58 ? 78.783  4.002   -8.116  1.00 0.00 ? 58 PRO A CG   5  
ATOM 6617  C CD   . PRO A 1 58 ? 78.571  2.871   -9.127  1.00 0.00 ? 58 PRO A CD   5  
ATOM 6618  H HA   . PRO A 1 58 ? 75.629  3.515   -8.417  1.00 0.00 ? 58 PRO A HA   5  
ATOM 6619  H HB2  . PRO A 1 58 ? 77.422  5.564   -7.580  1.00 0.00 ? 58 PRO A HB2  5  
ATOM 6620  H HB3  . PRO A 1 58 ? 77.132  4.014   -6.772  1.00 0.00 ? 58 PRO A HB3  5  
ATOM 6621  H HG2  . PRO A 1 58 ? 79.338  4.812   -8.575  1.00 0.00 ? 58 PRO A HG2  5  
ATOM 6622  H HG3  . PRO A 1 58 ? 79.327  3.627   -7.260  1.00 0.00 ? 58 PRO A HG3  5  
ATOM 6623  H HD2  . PRO A 1 58 ? 79.341  2.901   -9.877  1.00 0.00 ? 58 PRO A HD2  5  
ATOM 6624  H HD3  . PRO A 1 58 ? 78.555  1.914   -8.632  1.00 0.00 ? 58 PRO A HD3  5  
ATOM 6625  N N    . PHE A 1 59 ? 76.746  5.874   -10.442 1.00 0.00 ? 59 PHE A N    5  
ATOM 6626  C CA   . PHE A 1 59 ? 76.330  6.999   -11.227 1.00 0.00 ? 59 PHE A CA   5  
ATOM 6627  C C    . PHE A 1 59 ? 75.437  6.551   -12.378 1.00 0.00 ? 59 PHE A C    5  
ATOM 6628  O O    . PHE A 1 59 ? 74.244  6.851   -12.402 1.00 0.00 ? 59 PHE A O    5  
ATOM 6629  C CB   . PHE A 1 59 ? 77.566  7.679   -11.781 1.00 0.00 ? 59 PHE A CB   5  
ATOM 6630  C CG   . PHE A 1 59 ? 78.569  7.947   -10.672 1.00 0.00 ? 59 PHE A CG   5  
ATOM 6631  C CD1  . PHE A 1 59 ? 78.198  8.687   -9.537  1.00 0.00 ? 59 PHE A CD1  5  
ATOM 6632  C CD2  . PHE A 1 59 ? 79.878  7.457   -10.784 1.00 0.00 ? 59 PHE A CD2  5  
ATOM 6633  C CE1  . PHE A 1 59 ? 79.132  8.929   -8.521  1.00 0.00 ? 59 PHE A CE1  5  
ATOM 6634  C CE2  . PHE A 1 59 ? 80.809  7.702   -9.768  1.00 0.00 ? 59 PHE A CE2  5  
ATOM 6635  C CZ   . PHE A 1 59 ? 80.436  8.436   -8.637  1.00 0.00 ? 59 PHE A CZ   5  
ATOM 6636  H H    . PHE A 1 59 ? 77.661  5.560   -10.539 1.00 0.00 ? 59 PHE A H    5  
ATOM 6637  H HA   . PHE A 1 59 ? 75.788  7.692   -10.606 1.00 0.00 ? 59 PHE A HA   5  
ATOM 6638  H HB2  . PHE A 1 59 ? 78.013  7.045   -12.530 1.00 0.00 ? 59 PHE A HB2  5  
ATOM 6639  H HB3  . PHE A 1 59 ? 77.276  8.590   -12.224 1.00 0.00 ? 59 PHE A HB3  5  
ATOM 6640  H HD1  . PHE A 1 59 ? 77.194  9.071   -9.442  1.00 0.00 ? 59 PHE A HD1  5  
ATOM 6641  H HD2  . PHE A 1 59 ? 80.169  6.894   -11.657 1.00 0.00 ? 59 PHE A HD2  5  
ATOM 6642  H HE1  . PHE A 1 59 ? 78.845  9.498   -7.649  1.00 0.00 ? 59 PHE A HE1  5  
ATOM 6643  H HE2  . PHE A 1 59 ? 81.816  7.322   -9.856  1.00 0.00 ? 59 PHE A HE2  5  
ATOM 6644  H HZ   . PHE A 1 59 ? 81.155  8.624   -7.853  1.00 0.00 ? 59 PHE A HZ   5  
ATOM 6645  N N    . LEU A 1 60 ? 76.022  5.833   -13.334 1.00 0.00 ? 60 LEU A N    5  
ATOM 6646  C CA   . LEU A 1 60 ? 75.255  5.358   -14.481 1.00 0.00 ? 60 LEU A CA   5  
ATOM 6647  C C    . LEU A 1 60 ? 74.019  4.594   -14.012 1.00 0.00 ? 60 LEU A C    5  
ATOM 6648  O O    . LEU A 1 60 ? 73.039  4.474   -14.749 1.00 0.00 ? 60 LEU A O    5  
ATOM 6649  C CB   . LEU A 1 60 ? 76.129  4.455   -15.365 1.00 0.00 ? 60 LEU A CB   5  
ATOM 6650  C CG   . LEU A 1 60 ? 77.049  5.306   -16.263 1.00 0.00 ? 60 LEU A CG   5  
ATOM 6651  C CD1  . LEU A 1 60 ? 76.238  6.017   -17.367 1.00 0.00 ? 60 LEU A CD1  5  
ATOM 6652  C CD2  . LEU A 1 60 ? 77.784  6.348   -15.408 1.00 0.00 ? 60 LEU A CD2  5  
ATOM 6653  H H    . LEU A 1 60 ? 76.982  5.620   -13.267 1.00 0.00 ? 60 LEU A H    5  
ATOM 6654  H HA   . LEU A 1 60 ? 74.931  6.209   -15.058 1.00 0.00 ? 60 LEU A HA   5  
ATOM 6655  H HB2  . LEU A 1 60 ? 76.737  3.824   -14.734 1.00 0.00 ? 60 LEU A HB2  5  
ATOM 6656  H HB3  . LEU A 1 60 ? 75.500  3.833   -15.985 1.00 0.00 ? 60 LEU A HB3  5  
ATOM 6657  H HG   . LEU A 1 60 ? 77.776  4.658   -16.730 1.00 0.00 ? 60 LEU A HG   5  
ATOM 6658  H HD11 . LEU A 1 60 ? 76.873  6.174   -18.227 1.00 0.00 ? 60 LEU A HD11 5  
ATOM 6659  H HD12 . LEU A 1 60 ? 75.884  6.975   -17.009 1.00 0.00 ? 60 LEU A HD12 5  
ATOM 6660  H HD13 . LEU A 1 60 ? 75.393  5.410   -17.655 1.00 0.00 ? 60 LEU A HD13 5  
ATOM 6661  H HD21 . LEU A 1 60 ? 78.209  5.868   -14.541 1.00 0.00 ? 60 LEU A HD21 5  
ATOM 6662  H HD22 . LEU A 1 60 ? 77.090  7.113   -15.093 1.00 0.00 ? 60 LEU A HD22 5  
ATOM 6663  H HD23 . LEU A 1 60 ? 78.572  6.798   -15.991 1.00 0.00 ? 60 LEU A HD23 5  
ATOM 6664  N N    . GLU A 1 61 ? 74.064  4.083   -12.780 1.00 0.00 ? 61 GLU A N    5  
ATOM 6665  C CA   . GLU A 1 61 ? 72.933  3.337   -12.223 1.00 0.00 ? 61 GLU A CA   5  
ATOM 6666  C C    . GLU A 1 61 ? 72.794  3.624   -10.730 1.00 0.00 ? 61 GLU A C    5  
ATOM 6667  O O    . GLU A 1 61 ? 73.635  3.218   -9.928  1.00 0.00 ? 61 GLU A O    5  
ATOM 6668  C CB   . GLU A 1 61 ? 73.129  1.831   -12.440 1.00 0.00 ? 61 GLU A CB   5  
ATOM 6669  C CG   . GLU A 1 61 ? 72.875  1.474   -13.910 1.00 0.00 ? 61 GLU A CG   5  
ATOM 6670  C CD   . GLU A 1 61 ? 71.397  1.649   -14.247 1.00 0.00 ? 61 GLU A CD   5  
ATOM 6671  O OE1  . GLU A 1 61 ? 70.577  1.081   -13.544 1.00 0.00 ? 61 GLU A OE1  5  
ATOM 6672  O OE2  . GLU A 1 61 ? 71.107  2.349   -15.204 1.00 0.00 ? 61 GLU A OE2  5  
ATOM 6673  H H    . GLU A 1 61 ? 74.870  4.215   -12.234 1.00 0.00 ? 61 GLU A H    5  
ATOM 6674  H HA   . GLU A 1 61 ? 72.022  3.647   -12.717 1.00 0.00 ? 61 GLU A HA   5  
ATOM 6675  H HB2  . GLU A 1 61 ? 74.140  1.559   -12.175 1.00 0.00 ? 61 GLU A HB2  5  
ATOM 6676  H HB3  . GLU A 1 61 ? 72.437  1.284   -11.817 1.00 0.00 ? 61 GLU A HB3  5  
ATOM 6677  H HG2  . GLU A 1 61 ? 73.465  2.116   -14.544 1.00 0.00 ? 61 GLU A HG2  5  
ATOM 6678  H HG3  . GLU A 1 61 ? 73.159  0.446   -14.081 1.00 0.00 ? 61 GLU A HG3  5  
ATOM 6679  N N    . GLN A 1 62 ? 71.726  4.327   -10.367 1.00 0.00 ? 62 GLN A N    5  
ATOM 6680  C CA   . GLN A 1 62 ? 71.483  4.665   -8.969  1.00 0.00 ? 62 GLN A CA   5  
ATOM 6681  C C    . GLN A 1 62 ? 71.039  3.433   -8.186  1.00 0.00 ? 62 GLN A C    5  
ATOM 6682  O O    . GLN A 1 62 ? 71.315  3.311   -6.994  1.00 0.00 ? 62 GLN A O    5  
ATOM 6683  C CB   . GLN A 1 62 ? 70.403  5.745   -8.873  1.00 0.00 ? 62 GLN A CB   5  
ATOM 6684  C CG   . GLN A 1 62 ? 70.820  6.960   -9.703  1.00 0.00 ? 62 GLN A CG   5  
ATOM 6685  C CD   . GLN A 1 62 ? 72.064  7.603   -9.101  1.00 0.00 ? 62 GLN A CD   5  
ATOM 6686  O OE1  . GLN A 1 62 ? 72.153  7.765   -7.884  1.00 0.00 ? 62 GLN A OE1  5  
ATOM 6687  N NE2  . GLN A 1 62 ? 73.036  7.982   -9.885  1.00 0.00 ? 62 GLN A NE2  5  
ATOM 6688  H H    . GLN A 1 62 ? 71.090  4.624   -11.050 1.00 0.00 ? 62 GLN A H    5  
ATOM 6689  H HA   . GLN A 1 62 ? 72.395  5.046   -8.535  1.00 0.00 ? 62 GLN A HA   5  
ATOM 6690  H HB2  . GLN A 1 62 ? 69.469  5.353   -9.251  1.00 0.00 ? 62 GLN A HB2  5  
ATOM 6691  H HB3  . GLN A 1 62 ? 70.280  6.041   -7.843  1.00 0.00 ? 62 GLN A HB3  5  
ATOM 6692  H HG2  . GLN A 1 62 ? 71.033  6.646   -10.715 1.00 0.00 ? 62 GLN A HG2  5  
ATOM 6693  H HG3  . GLN A 1 62 ? 70.015  7.680   -9.715  1.00 0.00 ? 62 GLN A HG3  5  
ATOM 6694  H HE21 . GLN A 1 62 ? 72.963  7.851   -10.854 1.00 0.00 ? 62 GLN A HE21 5  
ATOM 6695  H HE22 . GLN A 1 62 ? 73.839  8.396   -9.505  1.00 0.00 ? 62 GLN A HE22 5  
ATOM 6696  N N    . ASN A 1 63 ? 70.346  2.524   -8.869  1.00 0.00 ? 63 ASN A N    5  
ATOM 6697  C CA   . ASN A 1 63 ? 69.863  1.302   -8.232  1.00 0.00 ? 63 ASN A CA   5  
ATOM 6698  C C    . ASN A 1 63 ? 69.279  1.603   -6.854  1.00 0.00 ? 63 ASN A C    5  
ATOM 6699  C CB   . ASN A 1 63 ? 71.007  0.294   -8.097  1.00 0.00 ? 63 ASN A CB   5  
ATOM 6700  C CG   . ASN A 1 63 ? 72.029  0.794   -7.082  1.00 0.00 ? 63 ASN A CG   5  
ATOM 6701  O OD1  . ASN A 1 63 ? 71.838  0.635   -5.877  1.00 0.00 ? 63 ASN A OD1  5  
ATOM 6702  N ND2  . ASN A 1 63 ? 73.110  1.394   -7.500  1.00 0.00 ? 63 ASN A ND2  5  
ATOM 6703  H H    . ASN A 1 63 ? 70.155  2.679   -9.818  1.00 0.00 ? 63 ASN A H    5  
ATOM 6704  H HA   . ASN A 1 63 ? 69.091  0.869   -8.850  1.00 0.00 ? 63 ASN A HA   5  
ATOM 6705  H HB2  . ASN A 1 63 ? 70.610  -0.656  -7.767  1.00 0.00 ? 63 ASN A HB2  5  
ATOM 6706  H HB3  . ASN A 1 63 ? 71.488  0.168   -9.055  1.00 0.00 ? 63 ASN A HB3  5  
ATOM 6707  H HD21 . ASN A 1 63 ? 73.259  1.520   -8.461  1.00 0.00 ? 63 ASN A HD21 5  
ATOM 6708  H HD22 . ASN A 1 63 ? 73.771  1.719   -6.854  1.00 0.00 ? 63 ASN A HD22 5  
ATOM 6709  N N    . CYS B 2 1  ? 73.621  22.401  -15.085 1.00 0.00 ? 1  CYS B N    5  
ATOM 6710  C CA   . CYS B 2 1  ? 73.893  22.285  -13.624 1.00 0.00 ? 1  CYS B CA   5  
ATOM 6711  C C    . CYS B 2 1  ? 74.234  20.836  -13.287 1.00 0.00 ? 1  CYS B C    5  
ATOM 6712  O O    . CYS B 2 1  ? 73.537  19.912  -13.703 1.00 0.00 ? 1  CYS B O    5  
ATOM 6713  C CB   . CYS B 2 1  ? 72.655  22.725  -12.842 1.00 0.00 ? 1  CYS B CB   5  
ATOM 6714  S SG   . CYS B 2 1  ? 71.318  21.533  -13.103 1.00 0.00 ? 1  CYS B SG   5  
ATOM 6715  H HA   . CYS B 2 1  ? 74.727  22.919  -13.363 1.00 0.00 ? 1  CYS B HA   5  
ATOM 6716  H HB2  . CYS B 2 1  ? 72.893  22.773  -11.789 1.00 0.00 ? 1  CYS B HB2  5  
ATOM 6717  H HB3  . CYS B 2 1  ? 72.340  23.700  -13.184 1.00 0.00 ? 1  CYS B HB3  5  
ATOM 6718  N N    . SER B 2 2  ? 75.311  20.648  -12.530 1.00 0.00 ? 2  SER B N    5  
ATOM 6719  C CA   . SER B 2 2  ? 75.738  19.307  -12.142 1.00 0.00 ? 2  SER B CA   5  
ATOM 6720  C C    . SER B 2 2  ? 76.053  18.464  -13.376 1.00 0.00 ? 2  SER B C    5  
ATOM 6721  O O    . SER B 2 2  ? 77.218  18.224  -13.689 1.00 0.00 ? 2  SER B O    5  
ATOM 6722  C CB   . SER B 2 2  ? 74.641  18.626  -11.322 1.00 0.00 ? 2  SER B CB   5  
ATOM 6723  O OG   . SER B 2 2  ? 75.185  17.489  -10.665 1.00 0.00 ? 2  SER B OG   5  
ATOM 6724  H H    . SER B 2 2  ? 75.829  21.423  -12.228 1.00 0.00 ? 2  SER B H    5  
ATOM 6725  H HA   . SER B 2 2  ? 76.629  19.384  -11.537 1.00 0.00 ? 2  SER B HA   5  
ATOM 6726  H HB2  . SER B 2 2  ? 74.262  19.313  -10.584 1.00 0.00 ? 2  SER B HB2  5  
ATOM 6727  H HB3  . SER B 2 2  ? 73.836  18.325  -11.978 1.00 0.00 ? 2  SER B HB3  5  
ATOM 6728  H HG   . SER B 2 2  ? 74.840  16.704  -11.097 1.00 0.00 ? 2  SER B HG   5  
ATOM 6729  N N    . THR B 2 3  ? 75.005  18.020  -14.067 1.00 0.00 ? 3  THR B N    5  
ATOM 6730  C CA   . THR B 2 3  ? 75.162  17.205  -15.270 1.00 0.00 ? 3  THR B CA   5  
ATOM 6731  C C    . THR B 2 3  ? 75.737  15.824  -14.941 1.00 0.00 ? 3  THR B C    5  
ATOM 6732  O O    . THR B 2 3  ? 75.437  14.850  -15.627 1.00 0.00 ? 3  THR B O    5  
ATOM 6733  C CB   . THR B 2 3  ? 76.063  17.920  -16.284 1.00 0.00 ? 3  THR B CB   5  
ATOM 6734  O OG1  . THR B 2 3  ? 75.691  19.288  -16.358 1.00 0.00 ? 3  THR B OG1  5  
ATOM 6735  C CG2  . THR B 2 3  ? 75.905  17.271  -17.661 1.00 0.00 ? 3  THR B CG2  5  
ATOM 6736  H H    . THR B 2 3  ? 74.101  18.248  -13.762 1.00 0.00 ? 3  THR B H    5  
ATOM 6737  H HA   . THR B 2 3  ? 74.188  17.068  -15.717 1.00 0.00 ? 3  THR B HA   5  
ATOM 6738  H HB   . THR B 2 3  ? 77.092  17.845  -15.973 1.00 0.00 ? 3  THR B HB   5  
ATOM 6739  H HG1  . THR B 2 3  ? 76.134  19.756  -15.646 1.00 0.00 ? 3  THR B HG1  5  
ATOM 6740  H HG21 . THR B 2 3  ? 75.964  16.197  -17.562 1.00 0.00 ? 3  THR B HG21 5  
ATOM 6741  H HG22 . THR B 2 3  ? 76.693  17.616  -18.313 1.00 0.00 ? 3  THR B HG22 5  
ATOM 6742  H HG23 . THR B 2 3  ? 74.946  17.542  -18.077 1.00 0.00 ? 3  THR B HG23 5  
ATOM 6743  N N    . VAL B 2 4  ? 76.557  15.748  -13.892 1.00 0.00 ? 4  VAL B N    5  
ATOM 6744  C CA   . VAL B 2 4  ? 77.160  14.477  -13.482 1.00 0.00 ? 4  VAL B CA   5  
ATOM 6745  C C    . VAL B 2 4  ? 78.102  13.944  -14.551 1.00 0.00 ? 4  VAL B C    5  
ATOM 6746  O O    . VAL B 2 4  ? 79.306  13.854  -14.330 1.00 0.00 ? 4  VAL B O    5  
ATOM 6747  C CB   . VAL B 2 4  ? 76.069  13.438  -13.205 1.00 0.00 ? 4  VAL B CB   5  
ATOM 6748  C CG1  . VAL B 2 4  ? 76.666  12.262  -12.433 1.00 0.00 ? 4  VAL B CG1  5  
ATOM 6749  C CG2  . VAL B 2 4  ? 74.948  14.076  -12.380 1.00 0.00 ? 4  VAL B CG2  5  
ATOM 6750  H H    . VAL B 2 4  ? 76.758  16.557  -13.381 1.00 0.00 ? 4  VAL B H    5  
ATOM 6751  H HA   . VAL B 2 4  ? 77.726  14.638  -12.579 1.00 0.00 ? 4  VAL B HA   5  
ATOM 6752  H HB   . VAL B 2 4  ? 75.668  13.077  -14.141 1.00 0.00 ? 4  VAL B HB   5  
ATOM 6753  H HG11 . VAL B 2 4  ? 75.882  11.564  -12.176 1.00 0.00 ? 4  VAL B HG11 5  
ATOM 6754  H HG12 . VAL B 2 4  ? 77.136  12.623  -11.530 1.00 0.00 ? 4  VAL B HG12 5  
ATOM 6755  H HG13 . VAL B 2 4  ? 77.401  11.764  -13.048 1.00 0.00 ? 4  VAL B HG13 5  
ATOM 6756  H HG21 . VAL B 2 4  ? 74.322  13.300  -11.963 1.00 0.00 ? 4  VAL B HG21 5  
ATOM 6757  H HG22 . VAL B 2 4  ? 74.353  14.714  -13.018 1.00 0.00 ? 4  VAL B HG22 5  
ATOM 6758  H HG23 . VAL B 2 4  ? 75.377  14.661  -11.582 1.00 0.00 ? 4  VAL B HG23 5  
ATOM 6759  N N    . SER B 2 5  ? 77.539  13.576  -15.696 1.00 0.00 ? 5  SER B N    5  
ATOM 6760  C CA   . SER B 2 5  ? 78.320  13.036  -16.807 1.00 0.00 ? 5  SER B CA   5  
ATOM 6761  C C    . SER B 2 5  ? 79.724  13.650  -16.888 1.00 0.00 ? 5  SER B C    5  
ATOM 6762  O O    . SER B 2 5  ? 80.718  12.933  -16.780 1.00 0.00 ? 5  SER B O    5  
ATOM 6763  C CB   . SER B 2 5  ? 77.556  13.277  -18.118 1.00 0.00 ? 5  SER B CB   5  
ATOM 6764  O OG   . SER B 2 5  ? 78.458  13.684  -19.136 1.00 0.00 ? 5  SER B OG   5  
ATOM 6765  H H    . SER B 2 5  ? 76.569  13.660  -15.797 1.00 0.00 ? 5  SER B H    5  
ATOM 6766  H HA   . SER B 2 5  ? 78.428  11.972  -16.657 1.00 0.00 ? 5  SER B HA   5  
ATOM 6767  H HB2  . SER B 2 5  ? 77.065  12.373  -18.427 1.00 0.00 ? 5  SER B HB2  5  
ATOM 6768  H HB3  . SER B 2 5  ? 76.811  14.045  -17.958 1.00 0.00 ? 5  SER B HB3  5  
ATOM 6769  H HG   . SER B 2 5  ? 78.611  12.933  -19.714 1.00 0.00 ? 5  SER B HG   5  
ATOM 6770  N N    . PRO B 2 6  ? 79.835  14.942  -17.084 1.00 0.00 ? 6  PRO B N    5  
ATOM 6771  C CA   . PRO B 2 6  ? 81.166  15.618  -17.188 1.00 0.00 ? 6  PRO B CA   5  
ATOM 6772  C C    . PRO B 2 6  ? 81.969  15.515  -15.891 1.00 0.00 ? 6  PRO B C    5  
ATOM 6773  O O    . PRO B 2 6  ? 83.006  16.161  -15.742 1.00 0.00 ? 6  PRO B O    5  
ATOM 6774  C CB   . PRO B 2 6  ? 80.811  17.080  -17.522 1.00 0.00 ? 6  PRO B CB   5  
ATOM 6775  C CG   . PRO B 2 6  ? 79.411  17.257  -17.033 1.00 0.00 ? 6  PRO B CG   5  
ATOM 6776  C CD   . PRO B 2 6  ? 78.727  15.904  -17.224 1.00 0.00 ? 6  PRO B CD   5  
ATOM 6777  H HA   . PRO B 2 6  ? 81.732  15.192  -18.001 1.00 0.00 ? 6  PRO B HA   5  
ATOM 6778  H HB2  . PRO B 2 6  ? 81.483  17.764  -17.016 1.00 0.00 ? 6  PRO B HB2  5  
ATOM 6779  H HB3  . PRO B 2 6  ? 80.851  17.242  -18.590 1.00 0.00 ? 6  PRO B HB3  5  
ATOM 6780  H HG2  . PRO B 2 6  ? 79.416  17.531  -15.984 1.00 0.00 ? 6  PRO B HG2  5  
ATOM 6781  H HG3  . PRO B 2 6  ? 78.899  18.011  -17.612 1.00 0.00 ? 6  PRO B HG3  5  
ATOM 6782  H HD2  . PRO B 2 6  ? 77.980  15.750  -16.462 1.00 0.00 ? 6  PRO B HD2  5  
ATOM 6783  H HD3  . PRO B 2 6  ? 78.293  15.834  -18.208 1.00 0.00 ? 6  PRO B HD3  5  
ATOM 6784  N N    . GLY B 2 7  ? 81.479  14.700  -14.954 1.00 0.00 ? 7  GLY B N    5  
ATOM 6785  C CA   . GLY B 2 7  ? 82.155  14.519  -13.664 1.00 0.00 ? 7  GLY B CA   5  
ATOM 6786  C C    . GLY B 2 7  ? 82.546  13.061  -13.423 1.00 0.00 ? 7  GLY B C    5  
ATOM 6787  O O    . GLY B 2 7  ? 83.729  12.744  -13.315 1.00 0.00 ? 7  GLY B O    5  
ATOM 6788  H H    . GLY B 2 7  ? 80.646  14.219  -15.128 1.00 0.00 ? 7  GLY B H    5  
ATOM 6789  H HA2  . GLY B 2 7  ? 83.052  15.123  -13.635 1.00 0.00 ? 7  GLY B HA2  5  
ATOM 6790  H HA3  . GLY B 2 7  ? 81.492  14.836  -12.874 1.00 0.00 ? 7  GLY B HA3  5  
ATOM 6791  N N    . VAL B 2 8  ? 81.560  12.175  -13.321 1.00 0.00 ? 8  VAL B N    5  
ATOM 6792  C CA   . VAL B 2 8  ? 81.859  10.769  -13.074 1.00 0.00 ? 8  VAL B CA   5  
ATOM 6793  C C    . VAL B 2 8  ? 82.694  10.187  -14.217 1.00 0.00 ? 8  VAL B C    5  
ATOM 6794  O O    . VAL B 2 8  ? 83.792  9.666   -13.991 1.00 0.00 ? 8  VAL B O    5  
ATOM 6795  C CB   . VAL B 2 8  ? 80.553  9.979   -12.894 1.00 0.00 ? 8  VAL B CB   5  
ATOM 6796  C CG1  . VAL B 2 8  ? 79.790  10.516  -11.670 1.00 0.00 ? 8  VAL B CG1  5  
ATOM 6797  C CG2  . VAL B 2 8  ? 79.680  10.113  -14.154 1.00 0.00 ? 8  VAL B CG2  5  
ATOM 6798  H H    . VAL B 2 8  ? 80.627  12.467  -13.403 1.00 0.00 ? 8  VAL B H    5  
ATOM 6799  H HA   . VAL B 2 8  ? 82.431  10.696  -12.161 1.00 0.00 ? 8  VAL B HA   5  
ATOM 6800  H HB   . VAL B 2 8  ? 80.792  8.936   -12.732 1.00 0.00 ? 8  VAL B HB   5  
ATOM 6801  H HG11 . VAL B 2 8  ? 80.173  10.049  -10.774 1.00 0.00 ? 8  VAL B HG11 5  
ATOM 6802  H HG12 . VAL B 2 8  ? 78.739  10.288  -11.768 1.00 0.00 ? 8  VAL B HG12 5  
ATOM 6803  H HG13 . VAL B 2 8  ? 79.917  11.587  -11.600 1.00 0.00 ? 8  VAL B HG13 5  
ATOM 6804  H HG21 . VAL B 2 8  ? 79.978  9.369   -14.871 1.00 0.00 ? 8  VAL B HG21 5  
ATOM 6805  H HG22 . VAL B 2 8  ? 79.800  11.098  -14.583 1.00 0.00 ? 8  VAL B HG22 5  
ATOM 6806  H HG23 . VAL B 2 8  ? 78.641  9.960   -13.895 1.00 0.00 ? 8  VAL B HG23 5  
ATOM 6807  N N    . LEU B 2 9  ? 82.197  10.301  -15.445 1.00 0.00 ? 9  LEU B N    5  
ATOM 6808  C CA   . LEU B 2 9  ? 82.946  9.796   -16.589 1.00 0.00 ? 9  LEU B CA   5  
ATOM 6809  C C    . LEU B 2 9  ? 84.353  10.398  -16.569 1.00 0.00 ? 9  LEU B C    5  
ATOM 6810  O O    . LEU B 2 9  ? 85.351  9.709   -16.846 1.00 0.00 ? 9  LEU B O    5  
ATOM 6811  C CB   . LEU B 2 9  ? 82.216  10.136  -17.895 1.00 0.00 ? 9  LEU B CB   5  
ATOM 6812  C CG   . LEU B 2 9  ? 80.740  9.712   -17.785 1.00 0.00 ? 9  LEU B CG   5  
ATOM 6813  C CD1  . LEU B 2 9  ? 80.004  10.060  -19.081 1.00 0.00 ? 9  LEU B CD1  5  
ATOM 6814  C CD2  . LEU B 2 9  ? 80.640  8.196   -17.537 1.00 0.00 ? 9  LEU B CD2  5  
ATOM 6815  H H    . LEU B 2 9  ? 81.334  10.743  -15.584 1.00 0.00 ? 9  LEU B H    5  
ATOM 6816  H HA   . LEU B 2 9  ? 83.030  8.724   -16.506 1.00 0.00 ? 9  LEU B HA   5  
ATOM 6817  H HB2  . LEU B 2 9  ? 82.276  11.199  -18.073 1.00 0.00 ? 9  LEU B HB2  5  
ATOM 6818  H HB3  . LEU B 2 9  ? 82.680  9.606   -18.712 1.00 0.00 ? 9  LEU B HB3  5  
ATOM 6819  H HG   . LEU B 2 9  ? 80.280  10.243  -16.969 1.00 0.00 ? 9  LEU B HG   5  
ATOM 6820  H HD11 . LEU B 2 9  ? 80.444  9.516   -19.904 1.00 0.00 ? 9  LEU B HD11 5  
ATOM 6821  H HD12 . LEU B 2 9  ? 80.082  11.119  -19.264 1.00 0.00 ? 9  LEU B HD12 5  
ATOM 6822  H HD13 . LEU B 2 9  ? 78.963  9.789   -18.987 1.00 0.00 ? 9  LEU B HD13 5  
ATOM 6823  H HD21 . LEU B 2 9  ? 81.359  7.682   -18.157 1.00 0.00 ? 9  LEU B HD21 5  
ATOM 6824  H HD22 . LEU B 2 9  ? 79.644  7.853   -17.782 1.00 0.00 ? 9  LEU B HD22 5  
ATOM 6825  H HD23 . LEU B 2 9  ? 80.841  7.980   -16.500 1.00 0.00 ? 9  LEU B HD23 5  
ATOM 6826  N N    . ALA B 2 10 ? 84.441  11.673  -16.181 1.00 0.00 ? 10 ALA B N    5  
ATOM 6827  C CA   . ALA B 2 10 ? 85.739  12.316  -16.073 1.00 0.00 ? 10 ALA B CA   5  
ATOM 6828  C C    . ALA B 2 10 ? 86.579  11.488  -15.102 1.00 0.00 ? 10 ALA B C    5  
ATOM 6829  O O    . ALA B 2 10 ? 87.790  11.304  -15.273 1.00 0.00 ? 10 ALA B O    5  
ATOM 6830  C CB   . ALA B 2 10 ? 85.588  13.752  -15.553 1.00 0.00 ? 10 ALA B CB   5  
ATOM 6831  H H    . ALA B 2 10 ? 83.630  12.168  -15.928 1.00 0.00 ? 10 ALA B H    5  
ATOM 6832  H HA   . ALA B 2 10 ? 86.208  12.337  -17.042 1.00 0.00 ? 10 ALA B HA   5  
ATOM 6833  H HB1  . ALA B 2 10 ? 85.491  13.744  -14.478 1.00 0.00 ? 10 ALA B HB1  5  
ATOM 6834  H HB2  . ALA B 2 10 ? 84.707  14.200  -15.988 1.00 0.00 ? 10 ALA B HB2  5  
ATOM 6835  H HB3  . ALA B 2 10 ? 86.458  14.328  -15.832 1.00 0.00 ? 10 ALA B HB3  5  
ATOM 6836  N N    . GLY B 2 11 ? 85.891  10.977  -14.085 1.00 0.00 ? 11 GLY B N    5  
ATOM 6837  C CA   . GLY B 2 11 ? 86.520  10.150  -13.072 1.00 0.00 ? 11 GLY B CA   5  
ATOM 6838  C C    . GLY B 2 11 ? 87.098  8.883   -13.685 1.00 0.00 ? 11 GLY B C    5  
ATOM 6839  O O    . GLY B 2 11 ? 88.151  8.410   -13.256 1.00 0.00 ? 11 GLY B O    5  
ATOM 6840  H H    . GLY B 2 11 ? 84.928  11.155  -14.025 1.00 0.00 ? 11 GLY B H    5  
ATOM 6841  H HA2  . GLY B 2 11 ? 87.313  10.711  -12.600 1.00 0.00 ? 11 GLY B HA2  5  
ATOM 6842  H HA3  . GLY B 2 11 ? 85.786  9.879   -12.330 1.00 0.00 ? 11 GLY B HA3  5  
ATOM 6843  N N    . ILE B 2 12 ? 86.422  8.328   -14.692 1.00 0.00 ? 12 ILE B N    5  
ATOM 6844  C CA   . ILE B 2 12 ? 86.931  7.120   -15.320 1.00 0.00 ? 12 ILE B CA   5  
ATOM 6845  C C    . ILE B 2 12 ? 88.258  7.424   -16.014 1.00 0.00 ? 12 ILE B C    5  
ATOM 6846  O O    . ILE B 2 12 ? 89.222  6.679   -15.854 1.00 0.00 ? 12 ILE B O    5  
ATOM 6847  C CB   . ILE B 2 12 ? 85.890  6.538   -16.300 1.00 0.00 ? 12 ILE B CB   5  
ATOM 6848  C CG1  . ILE B 2 12 ? 84.855  5.714   -15.513 1.00 0.00 ? 12 ILE B CG1  5  
ATOM 6849  C CG2  . ILE B 2 12 ? 86.568  5.624   -17.343 1.00 0.00 ? 12 ILE B CG2  5  
ATOM 6850  C CD1  . ILE B 2 12 ? 84.263  6.554   -14.384 1.00 0.00 ? 12 ILE B CD1  5  
ATOM 6851  H H    . ILE B 2 12 ? 85.581  8.735   -15.017 1.00 0.00 ? 12 ILE B H    5  
ATOM 6852  H HA   . ILE B 2 12 ? 87.125  6.391   -14.544 1.00 0.00 ? 12 ILE B HA   5  
ATOM 6853  H HB   . ILE B 2 12 ? 85.388  7.349   -16.807 1.00 0.00 ? 12 ILE B HB   5  
ATOM 6854  H HG12 . ILE B 2 12 ? 84.067  5.404   -16.181 1.00 0.00 ? 12 ILE B HG12 5  
ATOM 6855  H HG13 . ILE B 2 12 ? 85.334  4.841   -15.095 1.00 0.00 ? 12 ILE B HG13 5  
ATOM 6856  H HG21 . ILE B 2 12 ? 85.867  4.876   -17.681 1.00 0.00 ? 12 ILE B HG21 5  
ATOM 6857  H HG22 . ILE B 2 12 ? 87.421  5.133   -16.899 1.00 0.00 ? 12 ILE B HG22 5  
ATOM 6858  H HG23 . ILE B 2 12 ? 86.893  6.218   -18.186 1.00 0.00 ? 12 ILE B HG23 5  
ATOM 6859  H HD11 . ILE B 2 12 ? 85.003  6.692   -13.610 1.00 0.00 ? 12 ILE B HD11 5  
ATOM 6860  H HD12 . ILE B 2 12 ? 83.402  6.050   -13.973 1.00 0.00 ? 12 ILE B HD12 5  
ATOM 6861  H HD13 . ILE B 2 12 ? 83.967  7.510   -14.773 1.00 0.00 ? 12 ILE B HD13 5  
ATOM 6862  N N    . VAL B 2 13 ? 88.327  8.521   -16.770 1.00 0.00 ? 13 VAL B N    5  
ATOM 6863  C CA   . VAL B 2 13 ? 89.595  8.849   -17.433 1.00 0.00 ? 13 VAL B CA   5  
ATOM 6864  C C    . VAL B 2 13 ? 90.708  8.890   -16.386 1.00 0.00 ? 13 VAL B C    5  
ATOM 6865  O O    . VAL B 2 13 ? 91.795  8.349   -16.599 1.00 0.00 ? 13 VAL B O    5  
ATOM 6866  C CB   . VAL B 2 13 ? 89.514  10.184  -18.233 1.00 0.00 ? 13 VAL B CB   5  
ATOM 6867  C CG1  . VAL B 2 13 ? 88.059  10.538  -18.483 1.00 0.00 ? 13 VAL B CG1  5  
ATOM 6868  C CG2  . VAL B 2 13 ? 90.179  11.357  -17.486 1.00 0.00 ? 13 VAL B CG2  5  
ATOM 6869  H H    . VAL B 2 13 ? 87.538  9.102   -16.872 1.00 0.00 ? 13 VAL B H    5  
ATOM 6870  H HA   . VAL B 2 13 ? 89.822  8.046   -18.124 1.00 0.00 ? 13 VAL B HA   5  
ATOM 6871  H HB   . VAL B 2 13 ? 90.007  10.055  -19.189 1.00 0.00 ? 13 VAL B HB   5  
ATOM 6872  H HG11 . VAL B 2 13 ? 87.598  9.756   -19.059 1.00 0.00 ? 13 VAL B HG11 5  
ATOM 6873  H HG12 . VAL B 2 13 ? 88.003  11.471  -19.022 1.00 0.00 ? 13 VAL B HG12 5  
ATOM 6874  H HG13 . VAL B 2 13 ? 87.553  10.641  -17.544 1.00 0.00 ? 13 VAL B HG13 5  
ATOM 6875  H HG21 . VAL B 2 13 ? 89.990  12.275  -18.024 1.00 0.00 ? 13 VAL B HG21 5  
ATOM 6876  H HG22 . VAL B 2 13 ? 91.245  11.193  -17.426 1.00 0.00 ? 13 VAL B HG22 5  
ATOM 6877  H HG23 . VAL B 2 13 ? 89.769  11.435  -16.493 1.00 0.00 ? 13 VAL B HG23 5  
ATOM 6878  N N    . VAL B 2 14 ? 90.425  9.528   -15.250 1.00 0.00 ? 14 VAL B N    5  
ATOM 6879  C CA   . VAL B 2 14 ? 91.418  9.617   -14.182 1.00 0.00 ? 14 VAL B CA   5  
ATOM 6880  C C    . VAL B 2 14 ? 91.874  8.216   -13.782 1.00 0.00 ? 14 VAL B C    5  
ATOM 6881  O O    . VAL B 2 14 ? 93.069  7.964   -13.608 1.00 0.00 ? 14 VAL B O    5  
ATOM 6882  C CB   . VAL B 2 14 ? 90.827  10.340  -12.967 1.00 0.00 ? 14 VAL B CB   5  
ATOM 6883  C CG1  . VAL B 2 14 ? 91.832  10.308  -11.813 1.00 0.00 ? 14 VAL B CG1  5  
ATOM 6884  C CG2  . VAL B 2 14 ? 90.529  11.794  -13.338 1.00 0.00 ? 14 VAL B CG2  5  
ATOM 6885  H H    . VAL B 2 14 ? 89.539  9.940   -15.129 1.00 0.00 ? 14 VAL B H    5  
ATOM 6886  H HA   . VAL B 2 14 ? 92.270  10.174  -14.541 1.00 0.00 ? 14 VAL B HA   5  
ATOM 6887  H HB   . VAL B 2 14 ? 89.915  9.848   -12.664 1.00 0.00 ? 14 VAL B HB   5  
ATOM 6888  H HG11 . VAL B 2 14 ? 91.865  9.315   -11.392 1.00 0.00 ? 14 VAL B HG11 5  
ATOM 6889  H HG12 . VAL B 2 14 ? 91.529  11.012  -11.053 1.00 0.00 ? 14 VAL B HG12 5  
ATOM 6890  H HG13 . VAL B 2 14 ? 92.812  10.576  -12.181 1.00 0.00 ? 14 VAL B HG13 5  
ATOM 6891  H HG21 . VAL B 2 14 ? 89.813  11.820  -14.147 1.00 0.00 ? 14 VAL B HG21 5  
ATOM 6892  H HG22 . VAL B 2 14 ? 91.442  12.281  -13.648 1.00 0.00 ? 14 VAL B HG22 5  
ATOM 6893  H HG23 . VAL B 2 14 ? 90.121  12.307  -12.479 1.00 0.00 ? 14 VAL B HG23 5  
ATOM 6894  N N    . GLY B 2 15 ? 90.914  7.306   -13.650 1.00 0.00 ? 15 GLY B N    5  
ATOM 6895  C CA   . GLY B 2 15 ? 91.224  5.931   -13.282 1.00 0.00 ? 15 GLY B CA   5  
ATOM 6896  C C    . GLY B 2 15 ? 92.125  5.289   -14.331 1.00 0.00 ? 15 GLY B C    5  
ATOM 6897  O O    . GLY B 2 15 ? 93.017  4.507   -14.003 1.00 0.00 ? 15 GLY B O    5  
ATOM 6898  H H    . GLY B 2 15 ? 89.981  7.563   -13.810 1.00 0.00 ? 15 GLY B H    5  
ATOM 6899  H HA2  . GLY B 2 15 ? 91.724  5.920   -12.326 1.00 0.00 ? 15 GLY B HA2  5  
ATOM 6900  H HA3  . GLY B 2 15 ? 90.308  5.365   -13.211 1.00 0.00 ? 15 GLY B HA3  5  
ATOM 6901  N N    . ASP B 2 16 ? 91.889  5.632   -15.593 1.00 0.00 ? 16 ASP B N    5  
ATOM 6902  C CA   . ASP B 2 16 ? 92.689  5.089   -16.686 1.00 0.00 ? 16 ASP B CA   5  
ATOM 6903  C C    . ASP B 2 16 ? 94.150  5.477   -16.508 1.00 0.00 ? 16 ASP B C    5  
ATOM 6904  O O    . ASP B 2 16 ? 95.047  4.644   -16.642 1.00 0.00 ? 16 ASP B O    5  
ATOM 6905  C CB   . ASP B 2 16 ? 92.179  5.627   -18.023 1.00 0.00 ? 16 ASP B CB   5  
ATOM 6906  C CG   . ASP B 2 16 ? 92.765  4.810   -19.169 1.00 0.00 ? 16 ASP B CG   5  
ATOM 6907  O OD1  . ASP B 2 16 ? 93.554  3.921   -18.894 1.00 0.00 ? 16 ASP B OD1  5  
ATOM 6908  O OD2  . ASP B 2 16 ? 92.415  5.084   -20.306 1.00 0.00 ? 16 ASP B OD2  5  
ATOM 6909  H H    . ASP B 2 16 ? 91.168  6.263   -15.794 1.00 0.00 ? 16 ASP B H    5  
ATOM 6910  H HA   . ASP B 2 16 ? 92.604  4.013   -16.684 1.00 0.00 ? 16 ASP B HA   5  
ATOM 6911  H HB2  . ASP B 2 16 ? 91.103  5.561   -18.050 1.00 0.00 ? 16 ASP B HB2  5  
ATOM 6912  H HB3  . ASP B 2 16 ? 92.478  6.658   -18.132 1.00 0.00 ? 16 ASP B HB3  5  
ATOM 6913  N N    . LEU B 2 17 ? 94.379  6.749   -16.202 1.00 0.00 ? 17 LEU B N    5  
ATOM 6914  C CA   . LEU B 2 17 ? 95.735  7.245   -16.002 1.00 0.00 ? 17 LEU B CA   5  
ATOM 6915  C C    . LEU B 2 17 ? 96.411  6.454   -14.882 1.00 0.00 ? 17 LEU B C    5  
ATOM 6916  O O    . LEU B 2 17 ? 97.534  5.963   -15.036 1.00 0.00 ? 17 LEU B O    5  
ATOM 6917  C CB   . LEU B 2 17 ? 95.682  8.745   -15.646 1.00 0.00 ? 17 LEU B CB   5  
ATOM 6918  C CG   . LEU B 2 17 ? 96.966  9.471   -16.097 1.00 0.00 ? 17 LEU B CG   5  
ATOM 6919  C CD1  . LEU B 2 17 ? 98.201  8.731   -15.571 1.00 0.00 ? 17 LEU B CD1  5  
ATOM 6920  C CD2  . LEU B 2 17 ? 97.028  9.568   -17.637 1.00 0.00 ? 17 LEU B CD2  5  
ATOM 6921  H H    . LEU B 2 17 ? 93.622  7.366   -16.107 1.00 0.00 ? 17 LEU B H    5  
ATOM 6922  H HA   . LEU B 2 17 ? 96.291  7.111   -16.915 1.00 0.00 ? 17 LEU B HA   5  
ATOM 6923  H HB2  . LEU B 2 17 ? 94.829  9.192   -16.134 1.00 0.00 ? 17 LEU B HB2  5  
ATOM 6924  H HB3  . LEU B 2 17 ? 95.569  8.858   -14.578 1.00 0.00 ? 17 LEU B HB3  5  
ATOM 6925  H HG   . LEU B 2 17 ? 96.960  10.471  -15.682 1.00 0.00 ? 17 LEU B HG   5  
ATOM 6926  H HD11 . LEU B 2 17 ? 99.062  9.379   -15.639 1.00 0.00 ? 17 LEU B HD11 5  
ATOM 6927  H HD12 . LEU B 2 17 ? 98.372  7.845   -16.165 1.00 0.00 ? 17 LEU B HD12 5  
ATOM 6928  H HD13 . LEU B 2 17 ? 98.042  8.451   -14.541 1.00 0.00 ? 17 LEU B HD13 5  
ATOM 6929  H HD21 . LEU B 2 17 ? 97.518  8.693   -18.043 1.00 0.00 ? 17 LEU B HD21 5  
ATOM 6930  H HD22 . LEU B 2 17 ? 97.589  10.447  -17.914 1.00 0.00 ? 17 LEU B HD22 5  
ATOM 6931  H HD23 . LEU B 2 17 ? 96.031  9.642   -18.045 1.00 0.00 ? 17 LEU B HD23 5  
ATOM 6932  N N    . VAL B 2 18 ? 95.713  6.326   -13.757 1.00 0.00 ? 18 VAL B N    5  
ATOM 6933  C CA   . VAL B 2 18 ? 96.249  5.588   -12.622 1.00 0.00 ? 18 VAL B CA   5  
ATOM 6934  C C    . VAL B 2 18 ? 96.665  4.185   -13.057 1.00 0.00 ? 18 VAL B C    5  
ATOM 6935  O O    . VAL B 2 18 ? 97.747  3.712   -12.706 1.00 0.00 ? 18 VAL B O    5  
ATOM 6936  C CB   . VAL B 2 18 ? 95.201  5.500   -11.508 1.00 0.00 ? 18 VAL B CB   5  
ATOM 6937  C CG1  . VAL B 2 18 ? 95.711  4.591   -10.387 1.00 0.00 ? 18 VAL B CG1  5  
ATOM 6938  C CG2  . VAL B 2 18 ? 94.938  6.898   -10.944 1.00 0.00 ? 18 VAL B CG2  5  
ATOM 6939  H H    . VAL B 2 18 ? 94.819  6.732   -13.691 1.00 0.00 ? 18 VAL B H    5  
ATOM 6940  H HA   . VAL B 2 18 ? 97.117  6.109   -12.244 1.00 0.00 ? 18 VAL B HA   5  
ATOM 6941  H HB   . VAL B 2 18 ? 94.285  5.094   -11.910 1.00 0.00 ? 18 VAL B HB   5  
ATOM 6942  H HG11 . VAL B 2 18 ? 95.087  4.713   -9.514  1.00 0.00 ? 18 VAL B HG11 5  
ATOM 6943  H HG12 . VAL B 2 18 ? 96.729  4.858   -10.142 1.00 0.00 ? 18 VAL B HG12 5  
ATOM 6944  H HG13 . VAL B 2 18 ? 95.677  3.563   -10.713 1.00 0.00 ? 18 VAL B HG13 5  
ATOM 6945  H HG21 . VAL B 2 18 ? 94.589  7.547   -11.734 1.00 0.00 ? 18 VAL B HG21 5  
ATOM 6946  H HG22 . VAL B 2 18 ? 95.853  7.297   -10.530 1.00 0.00 ? 18 VAL B HG22 5  
ATOM 6947  H HG23 . VAL B 2 18 ? 94.189  6.838   -10.169 1.00 0.00 ? 18 VAL B HG23 5  
ATOM 6948  N N    . LEU B 2 19 ? 95.806  3.524   -13.828 1.00 0.00 ? 19 LEU B N    5  
ATOM 6949  C CA   . LEU B 2 19 ? 96.117  2.181   -14.301 1.00 0.00 ? 19 LEU B CA   5  
ATOM 6950  C C    . LEU B 2 19 ? 97.387  2.206   -15.137 1.00 0.00 ? 19 LEU B C    5  
ATOM 6951  O O    . LEU B 2 19 ? 98.302  1.431   -14.900 1.00 0.00 ? 19 LEU B O    5  
ATOM 6952  C CB   . LEU B 2 19 ? 94.972  1.619   -15.149 1.00 0.00 ? 19 LEU B CB   5  
ATOM 6953  C CG   . LEU B 2 19 ? 93.738  1.327   -14.283 1.00 0.00 ? 19 LEU B CG   5  
ATOM 6954  C CD1  . LEU B 2 19 ? 92.571  0.954   -15.208 1.00 0.00 ? 19 LEU B CD1  5  
ATOM 6955  C CD2  . LEU B 2 19 ? 94.023  0.159   -13.311 1.00 0.00 ? 19 LEU B CD2  5  
ATOM 6956  H H    . LEU B 2 19 ? 94.959  3.946   -14.085 1.00 0.00 ? 19 LEU B H    5  
ATOM 6957  H HA   . LEU B 2 19 ? 96.277  1.539   -13.453 1.00 0.00 ? 19 LEU B HA   5  
ATOM 6958  H HB2  . LEU B 2 19 ? 94.708  2.341   -15.909 1.00 0.00 ? 19 LEU B HB2  5  
ATOM 6959  H HB3  . LEU B 2 19 ? 95.297  0.707   -15.626 1.00 0.00 ? 19 LEU B HB3  5  
ATOM 6960  H HG   . LEU B 2 19 ? 93.481  2.213   -13.721 1.00 0.00 ? 19 LEU B HG   5  
ATOM 6961  H HD11 . LEU B 2 19 ? 92.905  0.234   -15.942 1.00 0.00 ? 19 LEU B HD11 5  
ATOM 6962  H HD12 . LEU B 2 19 ? 92.215  1.840   -15.714 1.00 0.00 ? 19 LEU B HD12 5  
ATOM 6963  H HD13 . LEU B 2 19 ? 91.770  0.528   -14.623 1.00 0.00 ? 19 LEU B HD13 5  
ATOM 6964  H HD21 . LEU B 2 19 ? 93.095  -0.313  -13.025 1.00 0.00 ? 19 LEU B HD21 5  
ATOM 6965  H HD22 . LEU B 2 19 ? 94.506  0.535   -12.423 1.00 0.00 ? 19 LEU B HD22 5  
ATOM 6966  H HD23 . LEU B 2 19 ? 94.662  -0.570  -13.787 1.00 0.00 ? 19 LEU B HD23 5  
ATOM 6967  N N    . THR B 2 20 ? 97.442  3.105   -16.116 1.00 0.00 ? 20 THR B N    5  
ATOM 6968  C CA   . THR B 2 20 ? 98.617  3.203   -16.976 1.00 0.00 ? 20 THR B CA   5  
ATOM 6969  C C    . THR B 2 20 ? 99.894  3.152   -16.143 1.00 0.00 ? 20 THR B C    5  
ATOM 6970  O O    . THR B 2 20 ? 100.810 2.378   -16.437 1.00 0.00 ? 20 THR B O    5  
ATOM 6971  C CB   . THR B 2 20 ? 98.575  4.509   -17.773 1.00 0.00 ? 20 THR B CB   5  
ATOM 6972  O OG1  . THR B 2 20 ? 97.294  4.656   -18.370 1.00 0.00 ? 20 THR B OG1  5  
ATOM 6973  C CG2  . THR B 2 20 ? 99.647  4.479   -18.863 1.00 0.00 ? 20 THR B CG2  5  
ATOM 6974  H H    . THR B 2 20 ? 96.683  3.707   -16.263 1.00 0.00 ? 20 THR B H    5  
ATOM 6975  H HA   . THR B 2 20 ? 98.617  2.373   -17.668 1.00 0.00 ? 20 THR B HA   5  
ATOM 6976  H HB   . THR B 2 20 ? 98.762  5.341   -17.113 1.00 0.00 ? 20 THR B HB   5  
ATOM 6977  H HG1  . THR B 2 20 ? 96.697  5.012   -17.709 1.00 0.00 ? 20 THR B HG1  5  
ATOM 6978  H HG21 . THR B 2 20 ? 99.475  3.634   -19.513 1.00 0.00 ? 20 THR B HG21 5  
ATOM 6979  H HG22 . THR B 2 20 ? 100.622 4.390   -18.407 1.00 0.00 ? 20 THR B HG22 5  
ATOM 6980  H HG23 . THR B 2 20 ? 99.601  5.391   -19.439 1.00 0.00 ? 20 THR B HG23 5  
ATOM 6981  N N    . VAL B 2 21 ? 99.946  3.968   -15.097 1.00 0.00 ? 21 VAL B N    5  
ATOM 6982  C CA   . VAL B 2 21 ? 101.117 3.992   -14.227 1.00 0.00 ? 21 VAL B CA   5  
ATOM 6983  C C    . VAL B 2 21 ? 101.305 2.638   -13.543 1.00 0.00 ? 21 VAL B C    5  
ATOM 6984  O O    . VAL B 2 21 ? 102.431 2.180   -13.346 1.00 0.00 ? 21 VAL B O    5  
ATOM 6985  C CB   . VAL B 2 21 ? 100.959 5.079   -13.162 1.00 0.00 ? 21 VAL B CB   5  
ATOM 6986  C CG1  . VAL B 2 21 ? 102.202 5.103   -12.271 1.00 0.00 ? 21 VAL B CG1  5  
ATOM 6987  C CG2  . VAL B 2 21 ? 100.794 6.441   -13.840 1.00 0.00 ? 21 VAL B CG2  5  
ATOM 6988  H H    . VAL B 2 21 ? 99.184  4.560   -14.904 1.00 0.00 ? 21 VAL B H    5  
ATOM 6989  H HA   . VAL B 2 21 ? 101.992 4.210   -14.821 1.00 0.00 ? 21 VAL B HA   5  
ATOM 6990  H HB   . VAL B 2 21 ? 100.089 4.868   -12.558 1.00 0.00 ? 21 VAL B HB   5  
ATOM 6991  H HG11 . VAL B 2 21 ? 102.197 6.000   -11.669 1.00 0.00 ? 21 VAL B HG11 5  
ATOM 6992  H HG12 . VAL B 2 21 ? 103.089 5.087   -12.887 1.00 0.00 ? 21 VAL B HG12 5  
ATOM 6993  H HG13 . VAL B 2 21 ? 102.199 4.238   -11.624 1.00 0.00 ? 21 VAL B HG13 5  
ATOM 6994  H HG21 . VAL B 2 21 ? 100.620 7.198   -13.089 1.00 0.00 ? 21 VAL B HG21 5  
ATOM 6995  H HG22 . VAL B 2 21 ? 99.954  6.406   -14.518 1.00 0.00 ? 21 VAL B HG22 5  
ATOM 6996  H HG23 . VAL B 2 21 ? 101.692 6.681   -14.391 1.00 0.00 ? 21 VAL B HG23 5  
ATOM 6997  N N    . LEU B 2 22 ? 100.192 2.011   -13.169 1.00 0.00 ? 22 LEU B N    5  
ATOM 6998  C CA   . LEU B 2 22 ? 100.238 0.718   -12.490 1.00 0.00 ? 22 LEU B CA   5  
ATOM 6999  C C    . LEU B 2 22 ? 100.841 -0.370  -13.386 1.00 0.00 ? 22 LEU B C    5  
ATOM 7000  O O    . LEU B 2 22 ? 101.748 -1.092  -12.968 1.00 0.00 ? 22 LEU B O    5  
ATOM 7001  C CB   . LEU B 2 22 ? 98.823  0.315   -12.062 1.00 0.00 ? 22 LEU B CB   5  
ATOM 7002  C CG   . LEU B 2 22 ? 98.873  -0.847  -11.054 1.00 0.00 ? 22 LEU B CG   5  
ATOM 7003  C CD1  . LEU B 2 22 ? 99.518  -0.388  -9.727  1.00 0.00 ? 22 LEU B CD1  5  
ATOM 7004  C CD2  . LEU B 2 22 ? 97.440  -1.340  -10.791 1.00 0.00 ? 22 LEU B CD2  5  
ATOM 7005  H H    . LEU B 2 22 ? 99.323  2.432   -13.342 1.00 0.00 ? 22 LEU B H    5  
ATOM 7006  H HA   . LEU B 2 22 ? 100.850 0.818   -11.611 1.00 0.00 ? 22 LEU B HA   5  
ATOM 7007  H HB2  . LEU B 2 22 ? 98.332  1.163   -11.609 1.00 0.00 ? 22 LEU B HB2  5  
ATOM 7008  H HB3  . LEU B 2 22 ? 98.263  0.004   -12.933 1.00 0.00 ? 22 LEU B HB3  5  
ATOM 7009  H HG   . LEU B 2 22 ? 99.458  -1.654  -11.472 1.00 0.00 ? 22 LEU B HG   5  
ATOM 7010  H HD11 . LEU B 2 22 ? 99.315  0.661   -9.560  1.00 0.00 ? 22 LEU B HD11 5  
ATOM 7011  H HD12 . LEU B 2 22 ? 100.586 -0.544  -9.773  1.00 0.00 ? 22 LEU B HD12 5  
ATOM 7012  H HD13 . LEU B 2 22 ? 99.116  -0.965  -8.905  1.00 0.00 ? 22 LEU B HD13 5  
ATOM 7013  H HD21 . LEU B 2 22 ? 97.418  -1.919  -9.880  1.00 0.00 ? 22 LEU B HD21 5  
ATOM 7014  H HD22 . LEU B 2 22 ? 97.115  -1.955  -11.615 1.00 0.00 ? 22 LEU B HD22 5  
ATOM 7015  H HD23 . LEU B 2 22 ? 96.776  -0.492  -10.693 1.00 0.00 ? 22 LEU B HD23 5  
ATOM 7016  N N    . ILE B 2 23 ? 100.340 -0.489  -14.614 1.00 0.00 ? 23 ILE B N    5  
ATOM 7017  C CA   . ILE B 2 23 ? 100.853 -1.501  -15.534 1.00 0.00 ? 23 ILE B CA   5  
ATOM 7018  C C    . ILE B 2 23 ? 102.345 -1.284  -15.756 1.00 0.00 ? 23 ILE B C    5  
ATOM 7019  O O    . ILE B 2 23 ? 103.135 -2.226  -15.693 1.00 0.00 ? 23 ILE B O    5  
ATOM 7020  C CB   . ILE B 2 23 ? 100.114 -1.436  -16.878 1.00 0.00 ? 23 ILE B CB   5  
ATOM 7021  C CG1  . ILE B 2 23 ? 98.595  -1.419  -16.647 1.00 0.00 ? 23 ILE B CG1  5  
ATOM 7022  C CG2  . ILE B 2 23 ? 100.480 -2.658  -17.733 1.00 0.00 ? 23 ILE B CG2  5  
ATOM 7023  C CD1  . ILE B 2 23 ? 98.180  -2.577  -15.735 1.00 0.00 ? 23 ILE B CD1  5  
ATOM 7024  H H    . ILE B 2 23 ? 99.618  0.105   -14.903 1.00 0.00 ? 23 ILE B H    5  
ATOM 7025  H HA   . ILE B 2 23 ? 100.705 -2.475  -15.094 1.00 0.00 ? 23 ILE B HA   5  
ATOM 7026  H HB   . ILE B 2 23 ? 100.407 -0.537  -17.402 1.00 0.00 ? 23 ILE B HB   5  
ATOM 7027  H HG12 . ILE B 2 23 ? 98.315  -0.487  -16.189 1.00 0.00 ? 23 ILE B HG12 5  
ATOM 7028  H HG13 . ILE B 2 23 ? 98.089  -1.515  -17.596 1.00 0.00 ? 23 ILE B HG13 5  
ATOM 7029  H HG21 . ILE B 2 23 ? 101.469 -2.526  -18.147 1.00 0.00 ? 23 ILE B HG21 5  
ATOM 7030  H HG22 . ILE B 2 23 ? 99.765  -2.763  -18.536 1.00 0.00 ? 23 ILE B HG22 5  
ATOM 7031  H HG23 . ILE B 2 23 ? 100.462 -3.548  -17.124 1.00 0.00 ? 23 ILE B HG23 5  
ATOM 7032  H HD11 . ILE B 2 23 ? 97.120  -2.751  -15.838 1.00 0.00 ? 23 ILE B HD11 5  
ATOM 7033  H HD12 . ILE B 2 23 ? 98.405  -2.325  -14.709 1.00 0.00 ? 23 ILE B HD12 5  
ATOM 7034  H HD13 . ILE B 2 23 ? 98.719  -3.469  -16.013 1.00 0.00 ? 23 ILE B HD13 5  
ATOM 7035  N N    . ALA B 2 24 ? 102.732 -0.034  -15.997 1.00 0.00 ? 24 ALA B N    5  
ATOM 7036  C CA   . ALA B 2 24 ? 104.143 0.279   -16.203 1.00 0.00 ? 24 ALA B CA   5  
ATOM 7037  C C    . ALA B 2 24 ? 104.967 -0.279  -15.046 1.00 0.00 ? 24 ALA B C    5  
ATOM 7038  O O    . ALA B 2 24 ? 105.979 -0.956  -15.252 1.00 0.00 ? 24 ALA B O    5  
ATOM 7039  C CB   . ALA B 2 24 ? 104.337 1.794   -16.288 1.00 0.00 ? 24 ALA B CB   5  
ATOM 7040  H H    . ALA B 2 24 ? 102.065 0.685   -16.026 1.00 0.00 ? 24 ALA B H    5  
ATOM 7041  H HA   . ALA B 2 24 ? 104.475 -0.172  -17.124 1.00 0.00 ? 24 ALA B HA   5  
ATOM 7042  H HB1  . ALA B 2 24 ? 103.772 2.183   -17.123 1.00 0.00 ? 24 ALA B HB1  5  
ATOM 7043  H HB2  . ALA B 2 24 ? 105.384 2.015   -16.429 1.00 0.00 ? 24 ALA B HB2  5  
ATOM 7044  H HB3  . ALA B 2 24 ? 103.991 2.253   -15.374 1.00 0.00 ? 24 ALA B HB3  5  
ATOM 7045  N N    . LEU B 2 25 ? 104.518 -0.003  -13.826 1.00 0.00 ? 25 LEU B N    5  
ATOM 7046  C CA   . LEU B 2 25 ? 105.214 -0.498  -12.648 1.00 0.00 ? 25 LEU B CA   5  
ATOM 7047  C C    . LEU B 2 25 ? 105.330 -2.015  -12.731 1.00 0.00 ? 25 LEU B C    5  
ATOM 7048  O O    . LEU B 2 25 ? 106.342 -2.595  -12.338 1.00 0.00 ? 25 LEU B O    5  
ATOM 7049  C CB   . LEU B 2 25 ? 104.453 -0.091  -11.379 1.00 0.00 ? 25 LEU B CB   5  
ATOM 7050  C CG   . LEU B 2 25 ? 105.090 -0.733  -10.138 1.00 0.00 ? 25 LEU B CG   5  
ATOM 7051  C CD1  . LEU B 2 25 ? 106.587 -0.395  -10.076 1.00 0.00 ? 25 LEU B CD1  5  
ATOM 7052  C CD2  . LEU B 2 25 ? 104.391 -0.193  -8.887  1.00 0.00 ? 25 LEU B CD2  5  
ATOM 7053  H H    . LEU B 2 25 ? 103.703 0.531   -13.717 1.00 0.00 ? 25 LEU B H    5  
ATOM 7054  H HA   . LEU B 2 25 ? 106.203 -0.067  -12.623 1.00 0.00 ? 25 LEU B HA   5  
ATOM 7055  H HB2  . LEU B 2 25 ? 104.478 0.983   -11.277 1.00 0.00 ? 25 LEU B HB2  5  
ATOM 7056  H HB3  . LEU B 2 25 ? 103.427 -0.418  -11.460 1.00 0.00 ? 25 LEU B HB3  5  
ATOM 7057  H HG   . LEU B 2 25 ? 104.966 -1.806  -10.181 1.00 0.00 ? 25 LEU B HG   5  
ATOM 7058  H HD11 . LEU B 2 25 ? 106.740 0.630   -10.381 1.00 0.00 ? 25 LEU B HD11 5  
ATOM 7059  H HD12 . LEU B 2 25 ? 107.131 -1.053  -10.735 1.00 0.00 ? 25 LEU B HD12 5  
ATOM 7060  H HD13 . LEU B 2 25 ? 106.947 -0.527  -9.065  1.00 0.00 ? 25 LEU B HD13 5  
ATOM 7061  H HD21 . LEU B 2 25 ? 104.688 -0.776  -8.028  1.00 0.00 ? 25 LEU B HD21 5  
ATOM 7062  H HD22 . LEU B 2 25 ? 103.320 -0.262  -9.015  1.00 0.00 ? 25 LEU B HD22 5  
ATOM 7063  H HD23 . LEU B 2 25 ? 104.671 0.839   -8.735  1.00 0.00 ? 25 LEU B HD23 5  
ATOM 7064  N N    . ALA B 2 26 ? 104.284 -2.650  -13.256 1.00 0.00 ? 26 ALA B N    5  
ATOM 7065  C CA   . ALA B 2 26 ? 104.280 -4.100  -13.400 1.00 0.00 ? 26 ALA B CA   5  
ATOM 7066  C C    . ALA B 2 26 ? 105.381 -4.538  -14.361 1.00 0.00 ? 26 ALA B C    5  
ATOM 7067  O O    . ALA B 2 26 ? 106.026 -5.565  -14.152 1.00 0.00 ? 26 ALA B O    5  
ATOM 7068  C CB   . ALA B 2 26 ? 102.917 -4.577  -13.914 1.00 0.00 ? 26 ALA B CB   5  
ATOM 7069  H H    . ALA B 2 26 ? 103.507 -2.132  -13.558 1.00 0.00 ? 26 ALA B H    5  
ATOM 7070  H HA   . ALA B 2 26 ? 104.462 -4.546  -12.433 1.00 0.00 ? 26 ALA B HA   5  
ATOM 7071  H HB1  . ALA B 2 26 ? 102.786 -5.621  -13.671 1.00 0.00 ? 26 ALA B HB1  5  
ATOM 7072  H HB2  . ALA B 2 26 ? 102.867 -4.448  -14.986 1.00 0.00 ? 26 ALA B HB2  5  
ATOM 7073  H HB3  . ALA B 2 26 ? 102.134 -3.998  -13.446 1.00 0.00 ? 26 ALA B HB3  5  
ATOM 7074  N N    . VAL B 2 27 ? 105.601 -3.747  -15.411 1.00 0.00 ? 27 VAL B N    5  
ATOM 7075  C CA   . VAL B 2 27 ? 106.639 -4.068  -16.382 1.00 0.00 ? 27 VAL B CA   5  
ATOM 7076  C C    . VAL B 2 27 ? 107.994 -4.098  -15.690 1.00 0.00 ? 27 VAL B C    5  
ATOM 7077  O O    . VAL B 2 27 ? 108.775 -5.032  -15.869 1.00 0.00 ? 27 VAL B O    5  
ATOM 7078  C CB   . VAL B 2 27 ? 106.664 -3.032  -17.508 1.00 0.00 ? 27 VAL B CB   5  
ATOM 7079  C CG1  . VAL B 2 27 ? 107.743 -3.413  -18.524 1.00 0.00 ? 27 VAL B CG1  5  
ATOM 7080  C CG2  . VAL B 2 27 ? 105.301 -2.993  -18.200 1.00 0.00 ? 27 VAL B CG2  5  
ATOM 7081  H H    . VAL B 2 27 ? 105.064 -2.935  -15.526 1.00 0.00 ? 27 VAL B H    5  
ATOM 7082  H HA   . VAL B 2 27 ? 106.438 -5.042  -16.804 1.00 0.00 ? 27 VAL B HA   5  
ATOM 7083  H HB   . VAL B 2 27 ? 106.890 -2.059  -17.096 1.00 0.00 ? 27 VAL B HB   5  
ATOM 7084  H HG11 . VAL B 2 27 ? 107.632 -2.806  -19.411 1.00 0.00 ? 27 VAL B HG11 5  
ATOM 7085  H HG12 . VAL B 2 27 ? 107.638 -4.455  -18.786 1.00 0.00 ? 27 VAL B HG12 5  
ATOM 7086  H HG13 . VAL B 2 27 ? 108.719 -3.246  -18.093 1.00 0.00 ? 27 VAL B HG13 5  
ATOM 7087  H HG21 . VAL B 2 27 ? 105.194 -3.861  -18.830 1.00 0.00 ? 27 VAL B HG21 5  
ATOM 7088  H HG22 . VAL B 2 27 ? 105.229 -2.100  -18.803 1.00 0.00 ? 27 VAL B HG22 5  
ATOM 7089  H HG23 . VAL B 2 27 ? 104.518 -2.988  -17.456 1.00 0.00 ? 27 VAL B HG23 5  
ATOM 7090  N N    . TYR B 2 28 ? 108.263 -3.069  -14.892 1.00 0.00 ? 28 TYR B N    5  
ATOM 7091  C CA   . TYR B 2 28 ? 109.528 -2.996  -14.168 1.00 0.00 ? 28 TYR B CA   5  
ATOM 7092  C C    . TYR B 2 28 ? 109.662 -4.183  -13.220 1.00 0.00 ? 28 TYR B C    5  
ATOM 7093  O O    . TYR B 2 28 ? 110.737 -4.768  -13.086 1.00 0.00 ? 28 TYR B O    5  
ATOM 7094  C CB   . TYR B 2 28 ? 109.605 -1.694  -13.370 1.00 0.00 ? 28 TYR B CB   5  
ATOM 7095  C CG   . TYR B 2 28 ? 110.936 -1.621  -12.660 1.00 0.00 ? 28 TYR B CG   5  
ATOM 7096  C CD1  . TYR B 2 28 ? 111.084 -2.187  -11.388 1.00 0.00 ? 28 TYR B CD1  5  
ATOM 7097  C CD2  . TYR B 2 28 ? 112.023 -0.990  -13.276 1.00 0.00 ? 28 TYR B CD2  5  
ATOM 7098  C CE1  . TYR B 2 28 ? 112.319 -2.121  -10.733 1.00 0.00 ? 28 TYR B CE1  5  
ATOM 7099  C CE2  . TYR B 2 28 ? 113.258 -0.925  -12.621 1.00 0.00 ? 28 TYR B CE2  5  
ATOM 7100  C CZ   . TYR B 2 28 ? 113.406 -1.490  -11.349 1.00 0.00 ? 28 TYR B CZ   5  
ATOM 7101  O OH   . TYR B 2 28 ? 114.624 -1.426  -10.702 1.00 0.00 ? 28 TYR B OH   5  
ATOM 7102  H H    . TYR B 2 28 ? 107.598 -2.351  -14.784 1.00 0.00 ? 28 TYR B H    5  
ATOM 7103  H HA   . TYR B 2 28 ? 110.341 -3.018  -14.879 1.00 0.00 ? 28 TYR B HA   5  
ATOM 7104  H HB2  . TYR B 2 28 ? 109.507 -0.852  -14.041 1.00 0.00 ? 28 TYR B HB2  5  
ATOM 7105  H HB3  . TYR B 2 28 ? 108.808 -1.670  -12.641 1.00 0.00 ? 28 TYR B HB3  5  
ATOM 7106  H HD1  . TYR B 2 28 ? 110.245 -2.674  -10.913 1.00 0.00 ? 28 TYR B HD1  5  
ATOM 7107  H HD2  . TYR B 2 28 ? 111.908 -0.552  -14.257 1.00 0.00 ? 28 TYR B HD2  5  
ATOM 7108  H HE1  . TYR B 2 28 ? 112.434 -2.559  -9.751  1.00 0.00 ? 28 TYR B HE1  5  
ATOM 7109  H HE2  . TYR B 2 28 ? 114.097 -0.437  -13.096 1.00 0.00 ? 28 TYR B HE2  5  
ATOM 7110  H HH   . TYR B 2 28 ? 115.012 -2.304  -10.714 1.00 0.00 ? 28 TYR B HH   5  
ATOM 7111  N N    . PHE B 2 29 ? 108.558 -4.532  -12.566 1.00 0.00 ? 29 PHE B N    5  
ATOM 7112  C CA   . PHE B 2 29 ? 108.547 -5.650  -11.630 1.00 0.00 ? 29 PHE B CA   5  
ATOM 7113  C C    . PHE B 2 29 ? 108.969 -6.941  -12.331 1.00 0.00 ? 29 PHE B C    5  
ATOM 7114  O O    . PHE B 2 29 ? 109.768 -7.714  -11.800 1.00 0.00 ? 29 PHE B O    5  
ATOM 7115  C CB   . PHE B 2 29 ? 107.139 -5.805  -11.042 1.00 0.00 ? 29 PHE B CB   5  
ATOM 7116  C CG   . PHE B 2 29 ? 107.046 -7.080  -10.227 1.00 0.00 ? 29 PHE B CG   5  
ATOM 7117  C CD1  . PHE B 2 29 ? 107.883 -7.266  -9.119  1.00 0.00 ? 29 PHE B CD1  5  
ATOM 7118  C CD2  . PHE B 2 29 ? 106.121 -8.074  -10.580 1.00 0.00 ? 29 PHE B CD2  5  
ATOM 7119  C CE1  . PHE B 2 29 ? 107.795 -8.443  -8.366  1.00 0.00 ? 29 PHE B CE1  5  
ATOM 7120  C CE2  . PHE B 2 29 ? 106.034 -9.250  -9.825  1.00 0.00 ? 29 PHE B CE2  5  
ATOM 7121  C CZ   . PHE B 2 29 ? 106.871 -9.435  -8.718  1.00 0.00 ? 29 PHE B CZ   5  
ATOM 7122  H H    . PHE B 2 29 ? 107.733 -4.027  -12.717 1.00 0.00 ? 29 PHE B H    5  
ATOM 7123  H HA   . PHE B 2 29 ? 109.240 -5.444  -10.829 1.00 0.00 ? 29 PHE B HA   5  
ATOM 7124  H HB2  . PHE B 2 29 ? 106.927 -4.958  -10.407 1.00 0.00 ? 29 PHE B HB2  5  
ATOM 7125  H HB3  . PHE B 2 29 ? 106.419 -5.836  -11.847 1.00 0.00 ? 29 PHE B HB3  5  
ATOM 7126  H HD1  . PHE B 2 29 ? 108.595 -6.503  -8.846  1.00 0.00 ? 29 PHE B HD1  5  
ATOM 7127  H HD2  . PHE B 2 29 ? 105.475 -7.932  -11.433 1.00 0.00 ? 29 PHE B HD2  5  
ATOM 7128  H HE1  . PHE B 2 29 ? 108.440 -8.586  -7.511  1.00 0.00 ? 29 PHE B HE1  5  
ATOM 7129  H HE2  . PHE B 2 29 ? 105.321 -10.014 -10.098 1.00 0.00 ? 29 PHE B HE2  5  
ATOM 7130  H HZ   . PHE B 2 29 ? 106.804 -10.342 -8.136  1.00 0.00 ? 29 PHE B HZ   5  
ATOM 7131  N N    . LEU B 2 30 ? 108.425 -7.170  -13.521 1.00 0.00 ? 30 LEU B N    5  
ATOM 7132  C CA   . LEU B 2 30 ? 108.750 -8.372  -14.281 1.00 0.00 ? 30 LEU B CA   5  
ATOM 7133  C C    . LEU B 2 30 ? 110.253 -8.448  -14.540 1.00 0.00 ? 30 LEU B C    5  
ATOM 7134  O O    . LEU B 2 30 ? 110.853 -9.519  -14.457 1.00 0.00 ? 30 LEU B O    5  
ATOM 7135  C CB   . LEU B 2 30 ? 107.986 -8.363  -15.612 1.00 0.00 ? 30 LEU B CB   5  
ATOM 7136  C CG   . LEU B 2 30 ? 108.414 -9.547  -16.492 1.00 0.00 ? 30 LEU B CG   5  
ATOM 7137  C CD1  . LEU B 2 30 ? 108.265 -10.866 -15.719 1.00 0.00 ? 30 LEU B CD1  5  
ATOM 7138  C CD2  . LEU B 2 30 ? 107.525 -9.586  -17.740 1.00 0.00 ? 30 LEU B CD2  5  
ATOM 7139  H H    . LEU B 2 30 ? 107.792 -6.521  -13.895 1.00 0.00 ? 30 LEU B H    5  
ATOM 7140  H HA   . LEU B 2 30 ? 108.448 -9.235  -13.709 1.00 0.00 ? 30 LEU B HA   5  
ATOM 7141  H HB2  . LEU B 2 30 ? 106.926 -8.433  -15.413 1.00 0.00 ? 30 LEU B HB2  5  
ATOM 7142  H HB3  . LEU B 2 30 ? 108.190 -7.440  -16.133 1.00 0.00 ? 30 LEU B HB3  5  
ATOM 7143  H HG   . LEU B 2 30 ? 109.444 -9.421  -16.793 1.00 0.00 ? 30 LEU B HG   5  
ATOM 7144  H HD11 . LEU B 2 30 ? 109.119 -11.000 -15.070 1.00 0.00 ? 30 LEU B HD11 5  
ATOM 7145  H HD12 . LEU B 2 30 ? 108.213 -11.692 -16.414 1.00 0.00 ? 30 LEU B HD12 5  
ATOM 7146  H HD13 . LEU B 2 30 ? 107.363 -10.838 -15.124 1.00 0.00 ? 30 LEU B HD13 5  
ATOM 7147  H HD21 . LEU B 2 30 ? 106.513 -9.831  -17.453 1.00 0.00 ? 30 LEU B HD21 5  
ATOM 7148  H HD22 . LEU B 2 30 ? 107.896 -10.334 -18.424 1.00 0.00 ? 30 LEU B HD22 5  
ATOM 7149  H HD23 . LEU B 2 30 ? 107.539 -8.619  -18.221 1.00 0.00 ? 30 LEU B HD23 5  
ATOM 7150  N N    . GLY B 2 31 ? 110.853 -7.304  -14.856 1.00 0.00 ? 31 GLY B N    5  
ATOM 7151  C CA   . GLY B 2 31 ? 112.286 -7.251  -15.124 1.00 0.00 ? 31 GLY B CA   5  
ATOM 7152  C C    . GLY B 2 31 ? 112.587 -7.675  -16.558 1.00 0.00 ? 31 GLY B C    5  
ATOM 7153  O O    . GLY B 2 31 ? 111.862 -8.480  -17.142 1.00 0.00 ? 31 GLY B O    5  
ATOM 7154  H H    . GLY B 2 31 ? 110.323 -6.481  -14.908 1.00 0.00 ? 31 GLY B H    5  
ATOM 7155  H HA2  . GLY B 2 31 ? 112.638 -6.241  -14.971 1.00 0.00 ? 31 GLY B HA2  5  
ATOM 7156  H HA3  . GLY B 2 31 ? 112.802 -7.914  -14.445 1.00 0.00 ? 31 GLY B HA3  5  
ATOM 7157  N N    . ARG B 2 32 ? 113.661 -7.128  -17.118 1.00 0.00 ? 32 ARG B N    5  
ATOM 7158  C CA   . ARG B 2 32 ? 114.049 -7.458  -18.485 1.00 0.00 ? 32 ARG B CA   5  
ATOM 7159  C C    . ARG B 2 32 ? 114.682 -8.845  -18.542 1.00 0.00 ? 32 ARG B C    5  
ATOM 7160  O O    . ARG B 2 32 ? 114.573 -9.546  -19.547 1.00 0.00 ? 32 ARG B O    5  
ATOM 7161  C CB   . ARG B 2 32 ? 115.040 -6.420  -19.013 1.00 0.00 ? 32 ARG B CB   5  
ATOM 7162  C CG   . ARG B 2 32 ? 114.382 -5.039  -19.016 1.00 0.00 ? 32 ARG B CG   5  
ATOM 7163  C CD   . ARG B 2 32 ? 115.360 -4.007  -19.581 1.00 0.00 ? 32 ARG B CD   5  
ATOM 7164  N NE   . ARG B 2 32 ? 115.567 -4.236  -21.007 1.00 0.00 ? 32 ARG B NE   5  
ATOM 7165  C CZ   . ARG B 2 32 ? 116.361 -3.445  -21.722 1.00 0.00 ? 32 ARG B CZ   5  
ATOM 7166  N NH1  . ARG B 2 32 ? 116.971 -2.443  -21.150 1.00 0.00 ? 32 ARG B NH1  5  
ATOM 7167  N NH2  . ARG B 2 32 ? 116.531 -3.671  -22.996 1.00 0.00 ? 32 ARG B NH2  5  
ATOM 7168  H H    . ARG B 2 32 ? 114.201 -6.492  -16.605 1.00 0.00 ? 32 ARG B H    5  
ATOM 7169  H HA   . ARG B 2 32 ? 113.169 -7.448  -19.111 1.00 0.00 ? 32 ARG B HA   5  
ATOM 7170  H HB2  . ARG B 2 32 ? 115.915 -6.402  -18.377 1.00 0.00 ? 32 ARG B HB2  5  
ATOM 7171  H HB3  . ARG B 2 32 ? 115.333 -6.679  -20.020 1.00 0.00 ? 32 ARG B HB3  5  
ATOM 7172  H HG2  . ARG B 2 32 ? 113.493 -5.066  -19.628 1.00 0.00 ? 32 ARG B HG2  5  
ATOM 7173  H HG3  . ARG B 2 32 ? 114.117 -4.765  -18.006 1.00 0.00 ? 32 ARG B HG3  5  
ATOM 7174  H HD2  . ARG B 2 32 ? 114.960 -3.016  -19.434 1.00 0.00 ? 32 ARG B HD2  5  
ATOM 7175  H HD3  . ARG B 2 32 ? 116.305 -4.090  -19.062 1.00 0.00 ? 32 ARG B HD3  5  
ATOM 7176  H HE   . ARG B 2 32 ? 115.113 -4.985  -21.445 1.00 0.00 ? 32 ARG B HE   5  
ATOM 7177  H HH11 . ARG B 2 32 ? 116.841 -2.270  -20.174 1.00 0.00 ? 32 ARG B HH11 5  
ATOM 7178  H HH12 . ARG B 2 32 ? 117.568 -1.848  -21.688 1.00 0.00 ? 32 ARG B HH12 5  
ATOM 7179  H HH21 . ARG B 2 32 ? 116.063 -4.438  -23.435 1.00 0.00 ? 32 ARG B HH21 5  
ATOM 7180  H HH22 . ARG B 2 32 ? 117.129 -3.076  -23.534 1.00 0.00 ? 32 ARG B HH22 5  
ATOM 7181  N N    . CYS A 1 1  ? 69.279  18.413  -20.745 1.00 0.00 ? 1  CYS A N    6  
ATOM 7182  C CA   . CYS A 1 1  ? 69.938  18.197  -19.425 1.00 0.00 ? 1  CYS A CA   6  
ATOM 7183  C C    . CYS A 1 1  ? 71.394  17.800  -19.644 1.00 0.00 ? 1  CYS A C    6  
ATOM 7184  O O    . CYS A 1 1  ? 71.704  17.000  -20.526 1.00 0.00 ? 1  CYS A O    6  
ATOM 7185  C CB   . CYS A 1 1  ? 69.199  17.092  -18.665 1.00 0.00 ? 1  CYS A CB   6  
ATOM 7186  S SG   . CYS A 1 1  ? 67.663  17.757  -17.978 1.00 0.00 ? 1  CYS A SG   6  
ATOM 7187  H HA   . CYS A 1 1  ? 69.899  19.112  -18.853 1.00 0.00 ? 1  CYS A HA   6  
ATOM 7188  H HB2  . CYS A 1 1  ? 68.970  16.281  -19.341 1.00 0.00 ? 1  CYS A HB2  6  
ATOM 7189  H HB3  . CYS A 1 1  ? 69.823  16.726  -17.863 1.00 0.00 ? 1  CYS A HB3  6  
ATOM 7190  N N    . SER A 1 2  ? 72.284  18.367  -18.834 1.00 0.00 ? 2  SER A N    6  
ATOM 7191  C CA   . SER A 1 2  ? 73.708  18.066  -18.945 1.00 0.00 ? 2  SER A CA   6  
ATOM 7192  C C    . SER A 1 2  ? 74.036  16.752  -18.245 1.00 0.00 ? 2  SER A C    6  
ATOM 7193  O O    . SER A 1 2  ? 74.679  16.741  -17.195 1.00 0.00 ? 2  SER A O    6  
ATOM 7194  C CB   . SER A 1 2  ? 74.527  19.197  -18.322 1.00 0.00 ? 2  SER A CB   6  
ATOM 7195  O OG   . SER A 1 2  ? 74.433  20.353  -19.143 1.00 0.00 ? 2  SER A OG   6  
ATOM 7196  H H    . SER A 1 2  ? 71.977  18.997  -18.150 1.00 0.00 ? 2  SER A H    6  
ATOM 7197  H HA   . SER A 1 2  ? 73.970  17.983  -19.990 1.00 0.00 ? 2  SER A HA   6  
ATOM 7198  H HB2  . SER A 1 2  ? 74.140  19.426  -17.342 1.00 0.00 ? 2  SER A HB2  6  
ATOM 7199  H HB3  . SER A 1 2  ? 75.559  18.886  -18.235 1.00 0.00 ? 2  SER A HB3  6  
ATOM 7200  H HG   . SER A 1 2  ? 74.698  21.112  -18.619 1.00 0.00 ? 2  SER A HG   6  
ATOM 7201  N N    . THR A 1 3  ? 73.591  15.644  -18.834 1.00 0.00 ? 3  THR A N    6  
ATOM 7202  C CA   . THR A 1 3  ? 73.840  14.321  -18.263 1.00 0.00 ? 3  THR A CA   6  
ATOM 7203  C C    . THR A 1 3  ? 73.949  13.277  -19.370 1.00 0.00 ? 3  THR A C    6  
ATOM 7204  O O    . THR A 1 3  ? 73.110  13.230  -20.269 1.00 0.00 ? 3  THR A O    6  
ATOM 7205  C CB   . THR A 1 3  ? 72.703  13.940  -17.313 1.00 0.00 ? 3  THR A CB   6  
ATOM 7206  O OG1  . THR A 1 3  ? 71.487  13.858  -18.044 1.00 0.00 ? 3  THR A OG1  6  
ATOM 7207  C CG2  . THR A 1 3  ? 72.571  15.000  -16.219 1.00 0.00 ? 3  THR A CG2  6  
ATOM 7208  H H    . THR A 1 3  ? 73.085  15.717  -19.670 1.00 0.00 ? 3  THR A H    6  
ATOM 7209  H HA   . THR A 1 3  ? 74.768  14.339  -17.707 1.00 0.00 ? 3  THR A HA   6  
ATOM 7210  H HB   . THR A 1 3  ? 72.916  12.985  -16.859 1.00 0.00 ? 3  THR A HB   6  
ATOM 7211  H HG1  . THR A 1 3  ? 71.611  13.225  -18.755 1.00 0.00 ? 3  THR A HG1  6  
ATOM 7212  H HG21 . THR A 1 3  ? 72.156  15.904  -16.641 1.00 0.00 ? 3  THR A HG21 6  
ATOM 7213  H HG22 . THR A 1 3  ? 73.545  15.212  -15.803 1.00 0.00 ? 3  THR A HG22 6  
ATOM 7214  H HG23 . THR A 1 3  ? 71.919  14.635  -15.440 1.00 0.00 ? 3  THR A HG23 6  
ATOM 7215  N N    . VAL A 1 4  ? 74.991  12.445  -19.294 1.00 0.00 ? 4  VAL A N    6  
ATOM 7216  C CA   . VAL A 1 4  ? 75.221  11.394  -20.294 1.00 0.00 ? 4  VAL A CA   6  
ATOM 7217  C C    . VAL A 1 4  ? 74.793  11.855  -21.681 1.00 0.00 ? 4  VAL A C    6  
ATOM 7218  O O    . VAL A 1 4  ? 74.399  11.052  -22.527 1.00 0.00 ? 4  VAL A O    6  
ATOM 7219  C CB   . VAL A 1 4  ? 74.470  10.117  -19.901 1.00 0.00 ? 4  VAL A CB   6  
ATOM 7220  C CG1  . VAL A 1 4  ? 75.028  9.593   -18.575 1.00 0.00 ? 4  VAL A CG1  6  
ATOM 7221  C CG2  . VAL A 1 4  ? 72.975  10.412  -19.737 1.00 0.00 ? 4  VAL A CG2  6  
ATOM 7222  H H    . VAL A 1 4  ? 75.622  12.539  -18.552 1.00 0.00 ? 4  VAL A H    6  
ATOM 7223  H HA   . VAL A 1 4  ? 76.280  11.175  -20.327 1.00 0.00 ? 4  VAL A HA   6  
ATOM 7224  H HB   . VAL A 1 4  ? 74.610  9.369   -20.669 1.00 0.00 ? 4  VAL A HB   6  
ATOM 7225  H HG11 . VAL A 1 4  ? 74.467  8.723   -18.268 1.00 0.00 ? 4  VAL A HG11 6  
ATOM 7226  H HG12 . VAL A 1 4  ? 74.944  10.362  -17.821 1.00 0.00 ? 4  VAL A HG12 6  
ATOM 7227  H HG13 . VAL A 1 4  ? 76.067  9.326   -18.703 1.00 0.00 ? 4  VAL A HG13 6  
ATOM 7228  H HG21 . VAL A 1 4  ? 72.615  10.959  -20.596 1.00 0.00 ? 4  VAL A HG21 6  
ATOM 7229  H HG22 . VAL A 1 4  ? 72.818  10.998  -18.843 1.00 0.00 ? 4  VAL A HG22 6  
ATOM 7230  H HG23 . VAL A 1 4  ? 72.434  9.481   -19.654 1.00 0.00 ? 4  VAL A HG23 6  
ATOM 7231  N N    . SER A 1 5  ? 74.897  13.160  -21.903 1.00 0.00 ? 5  SER A N    6  
ATOM 7232  C CA   . SER A 1 5  ? 74.545  13.754  -23.190 1.00 0.00 ? 5  SER A CA   6  
ATOM 7233  C C    . SER A 1 5  ? 75.777  13.813  -24.101 1.00 0.00 ? 5  SER A C    6  
ATOM 7234  O O    . SER A 1 5  ? 75.674  13.573  -25.304 1.00 0.00 ? 5  SER A O    6  
ATOM 7235  C CB   . SER A 1 5  ? 73.960  15.160  -22.985 1.00 0.00 ? 5  SER A CB   6  
ATOM 7236  O OG   . SER A 1 5  ? 72.944  15.384  -23.954 1.00 0.00 ? 5  SER A OG   6  
ATOM 7237  H H    . SER A 1 5  ? 75.238  13.736  -21.186 1.00 0.00 ? 5  SER A H    6  
ATOM 7238  H HA   . SER A 1 5  ? 73.795  13.137  -23.669 1.00 0.00 ? 5  SER A HA   6  
ATOM 7239  H HB2  . SER A 1 5  ? 73.528  15.229  -22.001 1.00 0.00 ? 5  SER A HB2  6  
ATOM 7240  H HB3  . SER A 1 5  ? 74.738  15.907  -23.086 1.00 0.00 ? 5  SER A HB3  6  
ATOM 7241  H HG   . SER A 1 5  ? 73.362  15.437  -24.815 1.00 0.00 ? 5  SER A HG   6  
ATOM 7242  N N    . PRO A 1 6  ? 76.937  14.115  -23.556 1.00 0.00 ? 6  PRO A N    6  
ATOM 7243  C CA   . PRO A 1 6  ? 78.200  14.189  -24.350 1.00 0.00 ? 6  PRO A CA   6  
ATOM 7244  C C    . PRO A 1 6  ? 78.395  12.981  -25.247 1.00 0.00 ? 6  PRO A C    6  
ATOM 7245  O O    . PRO A 1 6  ? 78.809  13.121  -26.397 1.00 0.00 ? 6  PRO A O    6  
ATOM 7246  C CB   . PRO A 1 6  ? 79.280  14.276  -23.269 1.00 0.00 ? 6  PRO A CB   6  
ATOM 7247  C CG   . PRO A 1 6  ? 78.604  14.994  -22.157 1.00 0.00 ? 6  PRO A CG   6  
ATOM 7248  C CD   . PRO A 1 6  ? 77.191  14.425  -22.132 1.00 0.00 ? 6  PRO A CD   6  
ATOM 7249  H HA   . PRO A 1 6  ? 78.226  15.080  -24.938 1.00 0.00 ? 6  PRO A HA   6  
ATOM 7250  H HB2  . PRO A 1 6  ? 79.579  13.284  -22.956 1.00 0.00 ? 6  PRO A HB2  6  
ATOM 7251  H HB3  . PRO A 1 6  ? 80.131  14.841  -23.618 1.00 0.00 ? 6  PRO A HB3  6  
ATOM 7252  H HG2  . PRO A 1 6  ? 79.109  14.805  -21.222 1.00 0.00 ? 6  PRO A HG2  6  
ATOM 7253  H HG3  . PRO A 1 6  ? 78.567  16.052  -22.359 1.00 0.00 ? 6  PRO A HG3  6  
ATOM 7254  H HD2  . PRO A 1 6  ? 77.167  13.528  -21.528 1.00 0.00 ? 6  PRO A HD2  6  
ATOM 7255  H HD3  . PRO A 1 6  ? 76.487  15.156  -21.769 1.00 0.00 ? 6  PRO A HD3  6  
ATOM 7256  N N    . GLY A 1 7  ? 78.105  11.795  -24.726 1.00 0.00 ? 7  GLY A N    6  
ATOM 7257  C CA   . GLY A 1 7  ? 78.287  10.584  -25.525 1.00 0.00 ? 7  GLY A CA   6  
ATOM 7258  C C    . GLY A 1 7  ? 79.776  10.325  -25.693 1.00 0.00 ? 7  GLY A C    6  
ATOM 7259  O O    . GLY A 1 7  ? 80.258  9.213   -25.472 1.00 0.00 ? 7  GLY A O    6  
ATOM 7260  H H    . GLY A 1 7  ? 77.780  11.735  -23.793 1.00 0.00 ? 7  GLY A H    6  
ATOM 7261  H HA2  . GLY A 1 7  ? 77.822  9.737   -25.032 1.00 0.00 ? 7  GLY A HA2  6  
ATOM 7262  H HA3  . GLY A 1 7  ? 77.840  10.724  -26.498 1.00 0.00 ? 7  GLY A HA3  6  
ATOM 7263  N N    . VAL A 1 8  ? 80.511  11.375  -26.050 1.00 0.00 ? 8  VAL A N    6  
ATOM 7264  C CA   . VAL A 1 8  ? 81.945  11.258  -26.200 1.00 0.00 ? 8  VAL A CA   6  
ATOM 7265  C C    . VAL A 1 8  ? 82.513  10.744  -24.893 1.00 0.00 ? 8  VAL A C    6  
ATOM 7266  O O    . VAL A 1 8  ? 83.387  9.872   -24.877 1.00 0.00 ? 8  VAL A O    6  
ATOM 7267  C CB   . VAL A 1 8  ? 82.559  12.615  -26.547 1.00 0.00 ? 8  VAL A CB   6  
ATOM 7268  C CG1  . VAL A 1 8  ? 84.086  12.515  -26.515 1.00 0.00 ? 8  VAL A CG1  6  
ATOM 7269  C CG2  . VAL A 1 8  ? 82.106  13.028  -27.948 1.00 0.00 ? 8  VAL A CG2  6  
ATOM 7270  H H    . VAL A 1 8  ? 80.084  12.242  -26.186 1.00 0.00 ? 8  VAL A H    6  
ATOM 7271  H HA   . VAL A 1 8  ? 82.166  10.551  -26.987 1.00 0.00 ? 8  VAL A HA   6  
ATOM 7272  H HB   . VAL A 1 8  ? 82.231  13.352  -25.829 1.00 0.00 ? 8  VAL A HB   6  
ATOM 7273  H HG11 . VAL A 1 8  ? 84.419  12.435  -25.491 1.00 0.00 ? 8  VAL A HG11 6  
ATOM 7274  H HG12 . VAL A 1 8  ? 84.515  13.399  -26.965 1.00 0.00 ? 8  VAL A HG12 6  
ATOM 7275  H HG13 . VAL A 1 8  ? 84.401  11.642  -27.066 1.00 0.00 ? 8  VAL A HG13 6  
ATOM 7276  H HG21 . VAL A 1 8  ? 81.053  13.266  -27.931 1.00 0.00 ? 8  VAL A HG21 6  
ATOM 7277  H HG22 . VAL A 1 8  ? 82.279  12.213  -28.636 1.00 0.00 ? 8  VAL A HG22 6  
ATOM 7278  H HG23 . VAL A 1 8  ? 82.666  13.895  -28.268 1.00 0.00 ? 8  VAL A HG23 6  
ATOM 7279  N N    . LEU A 1 9  ? 81.984  11.260  -23.783 1.00 0.00 ? 9  LEU A N    6  
ATOM 7280  C CA   . LEU A 1 9  ? 82.448  10.789  -22.487 1.00 0.00 ? 9  LEU A CA   6  
ATOM 7281  C C    . LEU A 1 9  ? 82.275  9.267   -22.438 1.00 0.00 ? 9  LEU A C    6  
ATOM 7282  O O    . LEU A 1 9  ? 83.106  8.537   -21.882 1.00 0.00 ? 9  LEU A O    6  
ATOM 7283  C CB   . LEU A 1 9  ? 81.671  11.448  -21.342 1.00 0.00 ? 9  LEU A CB   6  
ATOM 7284  C CG   . LEU A 1 9  ? 82.019  12.945  -21.225 1.00 0.00 ? 9  LEU A CG   6  
ATOM 7285  C CD1  . LEU A 1 9  ? 81.221  13.553  -20.061 1.00 0.00 ? 9  LEU A CD1  6  
ATOM 7286  C CD2  . LEU A 1 9  ? 83.531  13.138  -20.966 1.00 0.00 ? 9  LEU A CD2  6  
ATOM 7287  H H    . LEU A 1 9  ? 81.261  11.940  -23.843 1.00 0.00 ? 9  LEU A H    6  
ATOM 7288  H HA   . LEU A 1 9  ? 83.494  11.022  -22.390 1.00 0.00 ? 9  LEU A HA   6  
ATOM 7289  H HB2  . LEU A 1 9  ? 80.612  11.340  -21.523 1.00 0.00 ? 9  LEU A HB2  6  
ATOM 7290  H HB3  . LEU A 1 9  ? 81.925  10.956  -20.420 1.00 0.00 ? 9  LEU A HB3  6  
ATOM 7291  H HG   . LEU A 1 9  ? 81.746  13.448  -22.142 1.00 0.00 ? 9  LEU A HG   6  
ATOM 7292  H HD11 . LEU A 1 9  ? 80.216  13.160  -20.065 1.00 0.00 ? 9  LEU A HD11 6  
ATOM 7293  H HD12 . LEU A 1 9  ? 81.189  14.626  -20.167 1.00 0.00 ? 9  LEU A HD12 6  
ATOM 7294  H HD13 . LEU A 1 9  ? 81.700  13.300  -19.125 1.00 0.00 ? 9  LEU A HD13 6  
ATOM 7295  H HD21 . LEU A 1 9  ? 84.049  13.212  -21.910 1.00 0.00 ? 9  LEU A HD21 6  
ATOM 7296  H HD22 . LEU A 1 9  ? 83.917  12.296  -20.410 1.00 0.00 ? 9  LEU A HD22 6  
ATOM 7297  H HD23 . LEU A 1 9  ? 83.695  14.046  -20.400 1.00 0.00 ? 9  LEU A HD23 6  
ATOM 7298  N N    . ALA A 1 10 ? 81.204  8.787   -23.069 1.00 0.00 ? 10 ALA A N    6  
ATOM 7299  C CA   . ALA A 1 10 ? 80.960  7.354   -23.132 1.00 0.00 ? 10 ALA A CA   6  
ATOM 7300  C C    . ALA A 1 10 ? 82.112  6.713   -23.897 1.00 0.00 ? 10 ALA A C    6  
ATOM 7301  O O    . ALA A 1 10 ? 82.590  5.629   -23.550 1.00 0.00 ? 10 ALA A O    6  
ATOM 7302  C CB   . ALA A 1 10 ? 79.620  7.068   -23.828 1.00 0.00 ? 10 ALA A CB   6  
ATOM 7303  H H    . ALA A 1 10 ? 80.592  9.404   -23.524 1.00 0.00 ? 10 ALA A H    6  
ATOM 7304  H HA   . ALA A 1 10 ? 80.934  6.955   -22.128 1.00 0.00 ? 10 ALA A HA   6  
ATOM 7305  H HB1  . ALA A 1 10 ? 78.927  7.866   -23.609 1.00 0.00 ? 10 ALA A HB1  6  
ATOM 7306  H HB2  . ALA A 1 10 ? 79.216  6.134   -23.463 1.00 0.00 ? 10 ALA A HB2  6  
ATOM 7307  H HB3  . ALA A 1 10 ? 79.765  7.001   -24.896 1.00 0.00 ? 10 ALA A HB3  6  
ATOM 7308  N N    . GLY A 1 11 ? 82.574  7.420   -24.927 1.00 0.00 ? 11 GLY A N    6  
ATOM 7309  C CA   . GLY A 1 11 ? 83.696  6.943   -25.720 1.00 0.00 ? 11 GLY A CA   6  
ATOM 7310  C C    . GLY A 1 11 ? 84.921  6.813   -24.826 1.00 0.00 ? 11 GLY A C    6  
ATOM 7311  O O    . GLY A 1 11 ? 85.787  5.971   -25.055 1.00 0.00 ? 11 GLY A O    6  
ATOM 7312  H H    . GLY A 1 11 ? 82.167  8.290   -25.139 1.00 0.00 ? 11 GLY A H    6  
ATOM 7313  H HA2  . GLY A 1 11 ? 83.452  5.980   -26.145 1.00 0.00 ? 11 GLY A HA2  6  
ATOM 7314  H HA3  . GLY A 1 11 ? 83.906  7.646   -26.511 1.00 0.00 ? 11 GLY A HA3  6  
ATOM 7315  N N    . ILE A 1 12 ? 84.967  7.649   -23.792 1.00 0.00 ? 12 ILE A N    6  
ATOM 7316  C CA   . ILE A 1 12 ? 86.077  7.615   -22.837 1.00 0.00 ? 12 ILE A CA   6  
ATOM 7317  C C    . ILE A 1 12 ? 86.011  6.300   -22.063 1.00 0.00 ? 12 ILE A C    6  
ATOM 7318  O O    . ILE A 1 12 ? 87.029  5.646   -21.850 1.00 0.00 ? 12 ILE A O    6  
ATOM 7319  C CB   . ILE A 1 12 ? 86.018  8.869   -21.891 1.00 0.00 ? 12 ILE A CB   6  
ATOM 7320  C CG1  . ILE A 1 12 ? 87.312  9.701   -22.007 1.00 0.00 ? 12 ILE A CG1  6  
ATOM 7321  C CG2  . ILE A 1 12 ? 85.812  8.479   -20.410 1.00 0.00 ? 12 ILE A CG2  6  
ATOM 7322  C CD1  . ILE A 1 12 ? 87.069  11.107  -21.453 1.00 0.00 ? 12 ILE A CD1  6  
ATOM 7323  H H    . ILE A 1 12 ? 84.234  8.284   -23.662 1.00 0.00 ? 12 ILE A H    6  
ATOM 7324  H HA   . ILE A 1 12 ? 87.001  7.623   -23.397 1.00 0.00 ? 12 ILE A HA   6  
ATOM 7325  H HB   . ILE A 1 12 ? 85.191  9.485   -22.197 1.00 0.00 ? 12 ILE A HB   6  
ATOM 7326  H HG12 . ILE A 1 12 ? 88.100  9.223   -21.444 1.00 0.00 ? 12 ILE A HG12 6  
ATOM 7327  H HG13 . ILE A 1 12 ? 87.606  9.779   -23.044 1.00 0.00 ? 12 ILE A HG13 6  
ATOM 7328  H HG21 . ILE A 1 12 ? 85.706  9.372   -19.808 1.00 0.00 ? 12 ILE A HG21 6  
ATOM 7329  H HG22 . ILE A 1 12 ? 86.664  7.916   -20.061 1.00 0.00 ? 12 ILE A HG22 6  
ATOM 7330  H HG23 . ILE A 1 12 ? 84.921  7.879   -20.310 1.00 0.00 ? 12 ILE A HG23 6  
ATOM 7331  H HD11 . ILE A 1 12 ? 86.504  11.040  -20.535 1.00 0.00 ? 12 ILE A HD11 6  
ATOM 7332  H HD12 . ILE A 1 12 ? 86.511  11.685  -22.174 1.00 0.00 ? 12 ILE A HD12 6  
ATOM 7333  H HD13 . ILE A 1 12 ? 88.016  11.588  -21.262 1.00 0.00 ? 12 ILE A HD13 6  
ATOM 7334  N N    . VAL A 1 13 ? 84.804  5.913   -21.664 1.00 0.00 ? 13 VAL A N    6  
ATOM 7335  C CA   . VAL A 1 13 ? 84.623  4.659   -20.934 1.00 0.00 ? 13 VAL A CA   6  
ATOM 7336  C C    . VAL A 1 13 ? 85.168  3.495   -21.755 1.00 0.00 ? 13 VAL A C    6  
ATOM 7337  O O    . VAL A 1 13 ? 85.984  2.698   -21.272 1.00 0.00 ? 13 VAL A O    6  
ATOM 7338  C CB   . VAL A 1 13 ? 83.139  4.426   -20.637 1.00 0.00 ? 13 VAL A CB   6  
ATOM 7339  C CG1  . VAL A 1 13 ? 82.969  3.103   -19.889 1.00 0.00 ? 13 VAL A CG1  6  
ATOM 7340  C CG2  . VAL A 1 13 ? 82.607  5.571   -19.771 1.00 0.00 ? 13 VAL A CG2  6  
ATOM 7341  H H    . VAL A 1 13 ? 84.026  6.475   -21.867 1.00 0.00 ? 13 VAL A H    6  
ATOM 7342  H HA   . VAL A 1 13 ? 85.160  4.711   -20.010 1.00 0.00 ? 13 VAL A HA   6  
ATOM 7343  H HB   . VAL A 1 13 ? 82.588  4.387   -21.563 1.00 0.00 ? 13 VAL A HB   6  
ATOM 7344  H HG11 . VAL A 1 13 ? 83.650  3.070   -19.052 1.00 0.00 ? 13 VAL A HG11 6  
ATOM 7345  H HG12 . VAL A 1 13 ? 83.182  2.282   -20.558 1.00 0.00 ? 13 VAL A HG12 6  
ATOM 7346  H HG13 . VAL A 1 13 ? 81.953  3.020   -19.530 1.00 0.00 ? 13 VAL A HG13 6  
ATOM 7347  H HG21 . VAL A 1 13 ? 82.987  5.468   -18.764 1.00 0.00 ? 13 VAL A HG21 6  
ATOM 7348  H HG22 . VAL A 1 13 ? 81.528  5.537   -19.753 1.00 0.00 ? 13 VAL A HG22 6  
ATOM 7349  H HG23 . VAL A 1 13 ? 82.931  6.515   -20.183 1.00 0.00 ? 13 VAL A HG23 6  
ATOM 7350  N N    . VAL A 1 14 ? 84.725  3.410   -23.003 1.00 0.00 ? 14 VAL A N    6  
ATOM 7351  C CA   . VAL A 1 14 ? 85.185  2.347   -23.888 1.00 0.00 ? 14 VAL A CA   6  
ATOM 7352  C C    . VAL A 1 14 ? 86.701  2.419   -24.044 1.00 0.00 ? 14 VAL A C    6  
ATOM 7353  O O    . VAL A 1 14 ? 87.389  1.396   -24.009 1.00 0.00 ? 14 VAL A O    6  
ATOM 7354  C CB   . VAL A 1 14 ? 84.521  2.483   -25.260 1.00 0.00 ? 14 VAL A CB   6  
ATOM 7355  C CG1  . VAL A 1 14 ? 85.048  1.392   -26.195 1.00 0.00 ? 14 VAL A CG1  6  
ATOM 7356  C CG2  . VAL A 1 14 ? 83.005  2.334   -25.108 1.00 0.00 ? 14 VAL A CG2  6  
ATOM 7357  H H    . VAL A 1 14 ? 84.084  4.079   -23.337 1.00 0.00 ? 14 VAL A H    6  
ATOM 7358  H HA   . VAL A 1 14 ? 84.919  1.392   -23.462 1.00 0.00 ? 14 VAL A HA   6  
ATOM 7359  H HB   . VAL A 1 14 ? 84.750  3.454   -25.677 1.00 0.00 ? 14 VAL A HB   6  
ATOM 7360  H HG11 . VAL A 1 14 ? 84.422  1.337   -27.073 1.00 0.00 ? 14 VAL A HG11 6  
ATOM 7361  H HG12 . VAL A 1 14 ? 85.034  0.441   -25.683 1.00 0.00 ? 14 VAL A HG12 6  
ATOM 7362  H HG13 . VAL A 1 14 ? 86.060  1.628   -26.490 1.00 0.00 ? 14 VAL A HG13 6  
ATOM 7363  H HG21 . VAL A 1 14 ? 82.619  3.161   -24.530 1.00 0.00 ? 14 VAL A HG21 6  
ATOM 7364  H HG22 . VAL A 1 14 ? 82.784  1.407   -24.603 1.00 0.00 ? 14 VAL A HG22 6  
ATOM 7365  H HG23 . VAL A 1 14 ? 82.544  2.332   -26.085 1.00 0.00 ? 14 VAL A HG23 6  
ATOM 7366  N N    . GLY A 1 15 ? 87.207  3.637   -24.216 1.00 0.00 ? 15 GLY A N    6  
ATOM 7367  C CA   . GLY A 1 15 ? 88.640  3.859   -24.383 1.00 0.00 ? 15 GLY A CA   6  
ATOM 7368  C C    . GLY A 1 15 ? 89.428  3.346   -23.182 1.00 0.00 ? 15 GLY A C    6  
ATOM 7369  O O    . GLY A 1 15 ? 90.537  2.833   -23.329 1.00 0.00 ? 15 GLY A O    6  
ATOM 7370  H H    . GLY A 1 15 ? 86.602  4.407   -24.234 1.00 0.00 ? 15 GLY A H    6  
ATOM 7371  H HA2  . GLY A 1 15 ? 88.973  3.349   -25.274 1.00 0.00 ? 15 GLY A HA2  6  
ATOM 7372  H HA3  . GLY A 1 15 ? 88.820  4.917   -24.494 1.00 0.00 ? 15 GLY A HA3  6  
ATOM 7373  N N    . ASP A 1 16 ? 88.857  3.494   -21.995 1.00 0.00 ? 16 ASP A N    6  
ATOM 7374  C CA   . ASP A 1 16 ? 89.521  3.045   -20.780 1.00 0.00 ? 16 ASP A CA   6  
ATOM 7375  C C    . ASP A 1 16 ? 89.647  1.526   -20.770 1.00 0.00 ? 16 ASP A C    6  
ATOM 7376  O O    . ASP A 1 16 ? 90.728  0.982   -20.521 1.00 0.00 ? 16 ASP A O    6  
ATOM 7377  C CB   . ASP A 1 16 ? 88.728  3.505   -19.553 1.00 0.00 ? 16 ASP A CB   6  
ATOM 7378  C CG   . ASP A 1 16 ? 89.335  2.913   -18.284 1.00 0.00 ? 16 ASP A CG   6  
ATOM 7379  O OD1  . ASP A 1 16 ? 89.160  1.726   -18.066 1.00 0.00 ? 16 ASP A OD1  6  
ATOM 7380  O OD2  . ASP A 1 16 ? 89.966  3.655   -17.551 1.00 0.00 ? 16 ASP A OD2  6  
ATOM 7381  H H    . ASP A 1 16 ? 87.974  3.914   -21.936 1.00 0.00 ? 16 ASP A H    6  
ATOM 7382  H HA   . ASP A 1 16 ? 90.509  3.479   -20.739 1.00 0.00 ? 16 ASP A HA   6  
ATOM 7383  H HB2  . ASP A 1 16 ? 88.754  4.583   -19.493 1.00 0.00 ? 16 ASP A HB2  6  
ATOM 7384  H HB3  . ASP A 1 16 ? 87.704  3.176   -19.645 1.00 0.00 ? 16 ASP A HB3  6  
ATOM 7385  N N    . LEU A 1 17 ? 88.537  0.846   -21.034 1.00 0.00 ? 17 LEU A N    6  
ATOM 7386  C CA   . LEU A 1 17 ? 88.542  -0.613  -21.042 1.00 0.00 ? 17 LEU A CA   6  
ATOM 7387  C C    . LEU A 1 17 ? 89.612  -1.148  -21.995 1.00 0.00 ? 17 LEU A C    6  
ATOM 7388  O O    . LEU A 1 17 ? 90.428  -1.998  -21.617 1.00 0.00 ? 17 LEU A O    6  
ATOM 7389  C CB   . LEU A 1 17 ? 87.163  -1.138  -21.463 1.00 0.00 ? 17 LEU A CB   6  
ATOM 7390  C CG   . LEU A 1 17 ? 87.085  -2.662  -21.261 1.00 0.00 ? 17 LEU A CG   6  
ATOM 7391  C CD1  . LEU A 1 17 ? 87.025  -3.012  -19.761 1.00 0.00 ? 17 LEU A CD1  6  
ATOM 7392  C CD2  . LEU A 1 17 ? 85.830  -3.192  -21.964 1.00 0.00 ? 17 LEU A CD2  6  
ATOM 7393  H H    . LEU A 1 17 ? 87.700  1.332   -21.220 1.00 0.00 ? 17 LEU A H    6  
ATOM 7394  H HA   . LEU A 1 17 ? 88.757  -0.961  -20.046 1.00 0.00 ? 17 LEU A HA   6  
ATOM 7395  H HB2  . LEU A 1 17 ? 86.399  -0.654  -20.874 1.00 0.00 ? 17 LEU A HB2  6  
ATOM 7396  H HB3  . LEU A 1 17 ? 87.002  -0.912  -22.507 1.00 0.00 ? 17 LEU A HB3  6  
ATOM 7397  H HG   . LEU A 1 17 ? 87.958  -3.126  -21.698 1.00 0.00 ? 17 LEU A HG   6  
ATOM 7398  H HD11 . LEU A 1 17 ? 88.026  -3.038  -19.356 1.00 0.00 ? 17 LEU A HD11 6  
ATOM 7399  H HD12 . LEU A 1 17 ? 86.567  -3.984  -19.630 1.00 0.00 ? 17 LEU A HD12 6  
ATOM 7400  H HD13 . LEU A 1 17 ? 86.443  -2.272  -19.233 1.00 0.00 ? 17 LEU A HD13 6  
ATOM 7401  H HD21 . LEU A 1 17 ? 84.961  -2.677  -21.583 1.00 0.00 ? 17 LEU A HD21 6  
ATOM 7402  H HD22 . LEU A 1 17 ? 85.732  -4.251  -21.776 1.00 0.00 ? 17 LEU A HD22 6  
ATOM 7403  H HD23 . LEU A 1 17 ? 85.913  -3.021  -23.027 1.00 0.00 ? 17 LEU A HD23 6  
ATOM 7404  N N    . VAL A 1 18 ? 89.613  -0.655  -23.232 1.00 0.00 ? 18 VAL A N    6  
ATOM 7405  C CA   . VAL A 1 18 ? 90.596  -1.117  -24.205 1.00 0.00 ? 18 VAL A CA   6  
ATOM 7406  C C    . VAL A 1 18 ? 92.007  -0.721  -23.786 1.00 0.00 ? 18 VAL A C    6  
ATOM 7407  O O    . VAL A 1 18 ? 92.957  -1.411  -24.121 1.00 0.00 ? 18 VAL A O    6  
ATOM 7408  C CB   . VAL A 1 18 ? 90.295  -0.558  -25.597 1.00 0.00 ? 18 VAL A CB   6  
ATOM 7409  C CG1  . VAL A 1 18 ? 88.955  -1.104  -26.090 1.00 0.00 ? 18 VAL A CG1  6  
ATOM 7410  C CG2  . VAL A 1 18 ? 90.227  0.961   -25.525 1.00 0.00 ? 18 VAL A CG2  6  
ATOM 7411  H H    . VAL A 1 18 ? 88.948  0.023   -23.493 1.00 0.00 ? 18 VAL A H    6  
ATOM 7412  H HA   . VAL A 1 18 ? 90.545  -2.195  -24.254 1.00 0.00 ? 18 VAL A HA   6  
ATOM 7413  H HB   . VAL A 1 18 ? 91.078  -0.854  -26.281 1.00 0.00 ? 18 VAL A HB   6  
ATOM 7414  H HG11 . VAL A 1 18 ? 89.044  -2.165  -26.271 1.00 0.00 ? 18 VAL A HG11 6  
ATOM 7415  H HG12 . VAL A 1 18 ? 88.677  -0.605  -27.006 1.00 0.00 ? 18 VAL A HG12 6  
ATOM 7416  H HG13 . VAL A 1 18 ? 88.197  -0.930  -25.340 1.00 0.00 ? 18 VAL A HG13 6  
ATOM 7417  H HG21 . VAL A 1 18 ? 91.218  1.362   -25.372 1.00 0.00 ? 18 VAL A HG21 6  
ATOM 7418  H HG22 . VAL A 1 18 ? 89.595  1.239   -24.703 1.00 0.00 ? 18 VAL A HG22 6  
ATOM 7419  H HG23 . VAL A 1 18 ? 89.816  1.349   -26.445 1.00 0.00 ? 18 VAL A HG23 6  
ATOM 7420  N N    . LEU A 1 19 ? 92.148  0.387   -23.058 1.00 0.00 ? 19 LEU A N    6  
ATOM 7421  C CA   . LEU A 1 19 ? 93.478  0.823   -22.624 1.00 0.00 ? 19 LEU A CA   6  
ATOM 7422  C C    . LEU A 1 19 ? 94.115  -0.247  -21.733 1.00 0.00 ? 19 LEU A C    6  
ATOM 7423  O O    . LEU A 1 19 ? 95.192  -0.779  -22.046 1.00 0.00 ? 19 LEU A O    6  
ATOM 7424  C CB   . LEU A 1 19 ? 93.363  2.151   -21.850 1.00 0.00 ? 19 LEU A CB   6  
ATOM 7425  C CG   . LEU A 1 19 ? 94.701  2.917   -21.829 1.00 0.00 ? 19 LEU A CG   6  
ATOM 7426  C CD1  . LEU A 1 19 ? 95.796  2.058   -21.188 1.00 0.00 ? 19 LEU A CD1  6  
ATOM 7427  C CD2  . LEU A 1 19 ? 95.119  3.328   -23.257 1.00 0.00 ? 19 LEU A CD2  6  
ATOM 7428  H H    . LEU A 1 19 ? 91.357  0.916   -22.815 1.00 0.00 ? 19 LEU A H    6  
ATOM 7429  H HA   . LEU A 1 19 ? 94.095  0.969   -23.493 1.00 0.00 ? 19 LEU A HA   6  
ATOM 7430  H HB2  . LEU A 1 19 ? 92.618  2.769   -22.322 1.00 0.00 ? 19 LEU A HB2  6  
ATOM 7431  H HB3  . LEU A 1 19 ? 93.057  1.946   -20.834 1.00 0.00 ? 19 LEU A HB3  6  
ATOM 7432  H HG   . LEU A 1 19 ? 94.575  3.810   -21.233 1.00 0.00 ? 19 LEU A HG   6  
ATOM 7433  H HD11 . LEU A 1 19 ? 96.168  1.350   -21.911 1.00 0.00 ? 19 LEU A HD11 6  
ATOM 7434  H HD12 . LEU A 1 19 ? 95.391  1.528   -20.337 1.00 0.00 ? 19 LEU A HD12 6  
ATOM 7435  H HD13 . LEU A 1 19 ? 96.603  2.695   -20.860 1.00 0.00 ? 19 LEU A HD13 6  
ATOM 7436  H HD21 . LEU A 1 19 ? 95.748  2.564   -23.696 1.00 0.00 ? 19 LEU A HD21 6  
ATOM 7437  H HD22 . LEU A 1 19 ? 95.669  4.255   -23.212 1.00 0.00 ? 19 LEU A HD22 6  
ATOM 7438  H HD23 . LEU A 1 19 ? 94.239  3.466   -23.871 1.00 0.00 ? 19 LEU A HD23 6  
ATOM 7439  N N    . THR A 1 20 ? 93.442  -0.570  -20.629 1.00 0.00 ? 20 THR A N    6  
ATOM 7440  C CA   . THR A 1 20 ? 93.946  -1.582  -19.712 1.00 0.00 ? 20 THR A CA   6  
ATOM 7441  C C    . THR A 1 20 ? 94.210  -2.892  -20.450 1.00 0.00 ? 20 THR A C    6  
ATOM 7442  O O    . THR A 1 20 ? 95.200  -3.574  -20.186 1.00 0.00 ? 20 THR A O    6  
ATOM 7443  C CB   . THR A 1 20 ? 92.930  -1.820  -18.592 1.00 0.00 ? 20 THR A CB   6  
ATOM 7444  O OG1  . THR A 1 20 ? 92.497  -0.570  -18.076 1.00 0.00 ? 20 THR A OG1  6  
ATOM 7445  C CG2  . THR A 1 20 ? 93.577  -2.640  -17.475 1.00 0.00 ? 20 THR A CG2  6  
ATOM 7446  H H    . THR A 1 20 ? 92.588  -0.120  -20.425 1.00 0.00 ? 20 THR A H    6  
ATOM 7447  H HA   . THR A 1 20 ? 94.870  -1.231  -19.276 1.00 0.00 ? 20 THR A HA   6  
ATOM 7448  H HB   . THR A 1 20 ? 92.083  -2.361  -18.986 1.00 0.00 ? 20 THR A HB   6  
ATOM 7449  H HG1  . THR A 1 20 ? 93.227  -0.181  -17.590 1.00 0.00 ? 20 THR A HG1  6  
ATOM 7450  H HG21 . THR A 1 20 ? 94.119  -3.470  -17.903 1.00 0.00 ? 20 THR A HG21 6  
ATOM 7451  H HG22 . THR A 1 20 ? 92.809  -3.014  -16.814 1.00 0.00 ? 20 THR A HG22 6  
ATOM 7452  H HG23 . THR A 1 20 ? 94.258  -2.014  -16.917 1.00 0.00 ? 20 THR A HG23 6  
ATOM 7453  N N    . VAL A 1 21 ? 93.310  -3.245  -21.364 1.00 0.00 ? 21 VAL A N    6  
ATOM 7454  C CA   . VAL A 1 21 ? 93.452  -4.490  -22.119 1.00 0.00 ? 21 VAL A CA   6  
ATOM 7455  C C    . VAL A 1 21 ? 94.623  -4.438  -23.108 1.00 0.00 ? 21 VAL A C    6  
ATOM 7456  O O    . VAL A 1 21 ? 95.217  -5.469  -23.421 1.00 0.00 ? 21 VAL A O    6  
ATOM 7457  C CB   . VAL A 1 21 ? 92.157  -4.776  -22.882 1.00 0.00 ? 21 VAL A CB   6  
ATOM 7458  C CG1  . VAL A 1 21 ? 92.327  -6.039  -23.729 1.00 0.00 ? 21 VAL A CG1  6  
ATOM 7459  C CG2  . VAL A 1 21 ? 91.015  -4.983  -21.883 1.00 0.00 ? 21 VAL A CG2  6  
ATOM 7460  H H    . VAL A 1 21 ? 92.528  -2.667  -21.525 1.00 0.00 ? 21 VAL A H    6  
ATOM 7461  H HA   . VAL A 1 21 ? 93.623  -5.297  -21.423 1.00 0.00 ? 21 VAL A HA   6  
ATOM 7462  H HB   . VAL A 1 21 ? 91.927  -3.940  -23.527 1.00 0.00 ? 21 VAL A HB   6  
ATOM 7463  H HG11 . VAL A 1 21 ? 91.361  -6.370  -24.080 1.00 0.00 ? 21 VAL A HG11 6  
ATOM 7464  H HG12 . VAL A 1 21 ? 92.777  -6.816  -23.129 1.00 0.00 ? 21 VAL A HG12 6  
ATOM 7465  H HG13 . VAL A 1 21 ? 92.962  -5.823  -24.575 1.00 0.00 ? 21 VAL A HG13 6  
ATOM 7466  H HG21 . VAL A 1 21 ? 91.054  -4.214  -21.127 1.00 0.00 ? 21 VAL A HG21 6  
ATOM 7467  H HG22 . VAL A 1 21 ? 91.118  -5.951  -21.416 1.00 0.00 ? 21 VAL A HG22 6  
ATOM 7468  H HG23 . VAL A 1 21 ? 90.070  -4.931  -22.401 1.00 0.00 ? 21 VAL A HG23 6  
ATOM 7469  N N    . LEU A 1 22 ? 94.937  -3.250  -23.616 1.00 0.00 ? 22 LEU A N    6  
ATOM 7470  C CA   . LEU A 1 22 ? 96.019  -3.110  -24.590 1.00 0.00 ? 22 LEU A CA   6  
ATOM 7471  C C    . LEU A 1 22 ? 97.380  -3.336  -23.936 1.00 0.00 ? 22 LEU A C    6  
ATOM 7472  O O    . LEU A 1 22 ? 98.164  -4.166  -24.395 1.00 0.00 ? 22 LEU A O    6  
ATOM 7473  C CB   . LEU A 1 22 ? 95.971  -1.708  -25.234 1.00 0.00 ? 22 LEU A CB   6  
ATOM 7474  C CG   . LEU A 1 22 ? 96.564  -1.724  -26.659 1.00 0.00 ? 22 LEU A CG   6  
ATOM 7475  C CD1  . LEU A 1 22 ? 97.983  -2.301  -26.636 1.00 0.00 ? 22 LEU A CD1  6  
ATOM 7476  C CD2  . LEU A 1 22 ? 95.676  -2.555  -27.613 1.00 0.00 ? 22 LEU A CD2  6  
ATOM 7477  H H    . LEU A 1 22 ? 94.421  -2.459  -23.350 1.00 0.00 ? 22 LEU A H    6  
ATOM 7478  H HA   . LEU A 1 22 ? 95.881  -3.853  -25.357 1.00 0.00 ? 22 LEU A HA   6  
ATOM 7479  H HB2  . LEU A 1 22 ? 94.947  -1.379  -25.286 1.00 0.00 ? 22 LEU A HB2  6  
ATOM 7480  H HB3  . LEU A 1 22 ? 96.531  -1.011  -24.626 1.00 0.00 ? 22 LEU A HB3  6  
ATOM 7481  H HG   . LEU A 1 22 ? 96.613  -0.706  -27.023 1.00 0.00 ? 22 LEU A HG   6  
ATOM 7482  H HD11 . LEU A 1 22 ? 98.501  -2.016  -27.540 1.00 0.00 ? 22 LEU A HD11 6  
ATOM 7483  H HD12 . LEU A 1 22 ? 97.934  -3.377  -26.577 1.00 0.00 ? 22 LEU A HD12 6  
ATOM 7484  H HD13 . LEU A 1 22 ? 98.518  -1.915  -25.780 1.00 0.00 ? 22 LEU A HD13 6  
ATOM 7485  H HD21 . LEU A 1 22 ? 96.015  -3.583  -27.637 1.00 0.00 ? 22 LEU A HD21 6  
ATOM 7486  H HD22 . LEU A 1 22 ? 95.740  -2.140  -28.608 1.00 0.00 ? 22 LEU A HD22 6  
ATOM 7487  H HD23 . LEU A 1 22 ? 94.648  -2.524  -27.282 1.00 0.00 ? 22 LEU A HD23 6  
ATOM 7488  N N    . ILE A 1 23 ? 97.666  -2.596  -22.870 1.00 0.00 ? 23 ILE A N    6  
ATOM 7489  C CA   . ILE A 1 23 ? 98.954  -2.750  -22.204 1.00 0.00 ? 23 ILE A CA   6  
ATOM 7490  C C    . ILE A 1 23 ? 99.046  -4.114  -21.525 1.00 0.00 ? 23 ILE A C    6  
ATOM 7491  O O    . ILE A 1 23 ? 100.080 -4.782  -21.586 1.00 0.00 ? 23 ILE A O    6  
ATOM 7492  C CB   . ILE A 1 23 ? 99.165  -1.633  -21.184 1.00 0.00 ? 23 ILE A CB   6  
ATOM 7493  C CG1  . ILE A 1 23 ? 98.838  -0.289  -21.840 1.00 0.00 ? 23 ILE A CG1  6  
ATOM 7494  C CG2  . ILE A 1 23 ? 100.628 -1.628  -20.729 1.00 0.00 ? 23 ILE A CG2  6  
ATOM 7495  C CD1  . ILE A 1 23 ? 99.048  0.842   -20.832 1.00 0.00 ? 23 ILE A CD1  6  
ATOM 7496  H H    . ILE A 1 23 ? 97.013  -1.940  -22.534 1.00 0.00 ? 23 ILE A H    6  
ATOM 7497  H HA   . ILE A 1 23 ? 99.734  -2.687  -22.948 1.00 0.00 ? 23 ILE A HA   6  
ATOM 7498  H HB   . ILE A 1 23 ? 98.518  -1.789  -20.335 1.00 0.00 ? 23 ILE A HB   6  
ATOM 7499  H HG12 . ILE A 1 23 ? 99.487  -0.137  -22.692 1.00 0.00 ? 23 ILE A HG12 6  
ATOM 7500  H HG13 . ILE A 1 23 ? 97.810  -0.290  -22.169 1.00 0.00 ? 23 ILE A HG13 6  
ATOM 7501  H HG21 . ILE A 1 23 ? 100.949 -2.639  -20.526 1.00 0.00 ? 23 ILE A HG21 6  
ATOM 7502  H HG22 . ILE A 1 23 ? 100.724 -1.032  -19.834 1.00 0.00 ? 23 ILE A HG22 6  
ATOM 7503  H HG23 . ILE A 1 23 ? 101.247 -1.207  -21.509 1.00 0.00 ? 23 ILE A HG23 6  
ATOM 7504  H HD11 . ILE A 1 23 ? 100.096 0.916   -20.585 1.00 0.00 ? 23 ILE A HD11 6  
ATOM 7505  H HD12 . ILE A 1 23 ? 98.481  0.637   -19.936 1.00 0.00 ? 23 ILE A HD12 6  
ATOM 7506  H HD13 . ILE A 1 23 ? 98.714  1.774   -21.263 1.00 0.00 ? 23 ILE A HD13 6  
ATOM 7507  N N    . ALA A 1 24 ? 97.956  -4.530  -20.889 1.00 0.00 ? 24 ALA A N    6  
ATOM 7508  C CA   . ALA A 1 24 ? 97.928  -5.822  -20.217 1.00 0.00 ? 24 ALA A CA   6  
ATOM 7509  C C    . ALA A 1 24 ? 98.181  -6.942  -21.223 1.00 0.00 ? 24 ALA A C    6  
ATOM 7510  O O    . ALA A 1 24 ? 98.920  -7.889  -20.947 1.00 0.00 ? 24 ALA A O    6  
ATOM 7511  C CB   . ALA A 1 24 ? 96.571  -6.032  -19.547 1.00 0.00 ? 24 ALA A CB   6  
ATOM 7512  H H    . ALA A 1 24 ? 97.156  -3.963  -20.879 1.00 0.00 ? 24 ALA A H    6  
ATOM 7513  H HA   . ALA A 1 24 ? 98.699  -5.844  -19.462 1.00 0.00 ? 24 ALA A HA   6  
ATOM 7514  H HB1  . ALA A 1 24 ? 96.456  -5.326  -18.740 1.00 0.00 ? 24 ALA A HB1  6  
ATOM 7515  H HB2  . ALA A 1 24 ? 96.513  -7.037  -19.159 1.00 0.00 ? 24 ALA A HB2  6  
ATOM 7516  H HB3  . ALA A 1 24 ? 95.785  -5.881  -20.273 1.00 0.00 ? 24 ALA A HB3  6  
ATOM 7517  N N    . LEU A 1 25 ? 97.569  -6.822  -22.395 1.00 0.00 ? 25 LEU A N    6  
ATOM 7518  C CA   . LEU A 1 25 ? 97.740  -7.822  -23.440 1.00 0.00 ? 25 LEU A CA   6  
ATOM 7519  C C    . LEU A 1 25 ? 99.169  -7.780  -23.970 1.00 0.00 ? 25 LEU A C    6  
ATOM 7520  O O    . LEU A 1 25 ? 99.728  -8.803  -24.364 1.00 0.00 ? 25 LEU A O    6  
ATOM 7521  C CB   . LEU A 1 25 ? 96.747  -7.556  -24.580 1.00 0.00 ? 25 LEU A CB   6  
ATOM 7522  C CG   . LEU A 1 25 ? 96.996  -8.516  -25.753 1.00 0.00 ? 25 LEU A CG   6  
ATOM 7523  C CD1  . LEU A 1 25 ? 96.957  -9.972  -25.265 1.00 0.00 ? 25 LEU A CD1  6  
ATOM 7524  C CD2  . LEU A 1 25 ? 95.907  -8.302  -26.810 1.00 0.00 ? 25 LEU A CD2  6  
ATOM 7525  H H    . LEU A 1 25 ? 96.997  -6.044  -22.563 1.00 0.00 ? 25 LEU A H    6  
ATOM 7526  H HA   . LEU A 1 25 ? 97.546  -8.798  -23.023 1.00 0.00 ? 25 LEU A HA   6  
ATOM 7527  H HB2  . LEU A 1 25 ? 95.740  -7.695  -24.214 1.00 0.00 ? 25 LEU A HB2  6  
ATOM 7528  H HB3  . LEU A 1 25 ? 96.864  -6.539  -24.922 1.00 0.00 ? 25 LEU A HB3  6  
ATOM 7529  H HG   . LEU A 1 25 ? 97.962  -8.311  -26.190 1.00 0.00 ? 25 LEU A HG   6  
ATOM 7530  H HD11 . LEU A 1 25 ? 96.172  -10.089 -24.533 1.00 0.00 ? 25 LEU A HD11 6  
ATOM 7531  H HD12 . LEU A 1 25 ? 97.906  -10.228 -24.820 1.00 0.00 ? 25 LEU A HD12 6  
ATOM 7532  H HD13 . LEU A 1 25 ? 96.768  -10.631 -26.102 1.00 0.00 ? 25 LEU A HD13 6  
ATOM 7533  H HD21 . LEU A 1 25 ? 94.975  -8.717  -26.455 1.00 0.00 ? 25 LEU A HD21 6  
ATOM 7534  H HD22 . LEU A 1 25 ? 96.194  -8.795  -27.727 1.00 0.00 ? 25 LEU A HD22 6  
ATOM 7535  H HD23 . LEU A 1 25 ? 95.785  -7.245  -26.992 1.00 0.00 ? 25 LEU A HD23 6  
ATOM 7536  N N    . ALA A 1 26 ? 99.753  -6.586  -23.979 1.00 0.00 ? 26 ALA A N    6  
ATOM 7537  C CA   . ALA A 1 26 ? 101.116 -6.416  -24.465 1.00 0.00 ? 26 ALA A CA   6  
ATOM 7538  C C    . ALA A 1 26 ? 102.090 -7.243  -23.633 1.00 0.00 ? 26 ALA A C    6  
ATOM 7539  O O    . ALA A 1 26 ? 102.892 -8.002  -24.177 1.00 0.00 ? 26 ALA A O    6  
ATOM 7540  C CB   . ALA A 1 26 ? 101.514 -4.941  -24.402 1.00 0.00 ? 26 ALA A CB   6  
ATOM 7541  H H    . ALA A 1 26 ? 99.257  -5.805  -23.654 1.00 0.00 ? 26 ALA A H    6  
ATOM 7542  H HA   . ALA A 1 26 ? 101.165 -6.748  -25.491 1.00 0.00 ? 26 ALA A HA   6  
ATOM 7543  H HB1  . ALA A 1 26 ? 100.706 -4.333  -24.782 1.00 0.00 ? 26 ALA A HB1  6  
ATOM 7544  H HB2  . ALA A 1 26 ? 102.398 -4.781  -25.002 1.00 0.00 ? 26 ALA A HB2  6  
ATOM 7545  H HB3  . ALA A 1 26 ? 101.719 -4.667  -23.378 1.00 0.00 ? 26 ALA A HB3  6  
ATOM 7546  N N    . VAL A 1 27 ? 102.018 -7.095  -22.314 1.00 0.00 ? 27 VAL A N    6  
ATOM 7547  C CA   . VAL A 1 27 ? 102.907 -7.844  -21.432 1.00 0.00 ? 27 VAL A CA   6  
ATOM 7548  C C    . VAL A 1 27 ? 102.595 -9.335  -21.500 1.00 0.00 ? 27 VAL A C    6  
ATOM 7549  O O    . VAL A 1 27 ? 103.497 -10.168 -21.436 1.00 0.00 ? 27 VAL A O    6  
ATOM 7550  C CB   . VAL A 1 27 ? 102.768 -7.354  -19.989 1.00 0.00 ? 27 VAL A CB   6  
ATOM 7551  C CG1  . VAL A 1 27 ? 103.360 -5.950  -19.867 1.00 0.00 ? 27 VAL A CG1  6  
ATOM 7552  C CG2  . VAL A 1 27 ? 101.291 -7.314  -19.596 1.00 0.00 ? 27 VAL A CG2  6  
ATOM 7553  H H    . VAL A 1 27 ? 101.359 -6.475  -21.931 1.00 0.00 ? 27 VAL A H    6  
ATOM 7554  H HA   . VAL A 1 27 ? 103.925 -7.688  -21.754 1.00 0.00 ? 27 VAL A HA   6  
ATOM 7555  H HB   . VAL A 1 27 ? 103.299 -8.024  -19.330 1.00 0.00 ? 27 VAL A HB   6  
ATOM 7556  H HG11 . VAL A 1 27 ? 103.359 -5.648  -18.831 1.00 0.00 ? 27 VAL A HG11 6  
ATOM 7557  H HG12 . VAL A 1 27 ? 102.767 -5.257  -20.446 1.00 0.00 ? 27 VAL A HG12 6  
ATOM 7558  H HG13 . VAL A 1 27 ? 104.375 -5.954  -20.240 1.00 0.00 ? 27 VAL A HG13 6  
ATOM 7559  H HG21 . VAL A 1 27 ? 100.865 -8.300  -19.700 1.00 0.00 ? 27 VAL A HG21 6  
ATOM 7560  H HG22 . VAL A 1 27 ? 100.767 -6.624  -20.239 1.00 0.00 ? 27 VAL A HG22 6  
ATOM 7561  H HG23 . VAL A 1 27 ? 101.201 -6.990  -18.569 1.00 0.00 ? 27 VAL A HG23 6  
ATOM 7562  N N    . TYR A 1 28 ? 101.314 -9.665  -21.633 1.00 0.00 ? 28 TYR A N    6  
ATOM 7563  C CA   . TYR A 1 28 ? 100.907 -11.063 -21.710 1.00 0.00 ? 28 TYR A CA   6  
ATOM 7564  C C    . TYR A 1 28 ? 101.548 -11.741 -22.919 1.00 0.00 ? 28 TYR A C    6  
ATOM 7565  O O    . TYR A 1 28 ? 102.078 -12.848 -22.812 1.00 0.00 ? 28 TYR A O    6  
ATOM 7566  C CB   . TYR A 1 28 ? 99.383  -11.162 -21.817 1.00 0.00 ? 28 TYR A CB   6  
ATOM 7567  C CG   . TYR A 1 28 ? 98.969  -12.613 -21.749 1.00 0.00 ? 28 TYR A CG   6  
ATOM 7568  C CD1  . TYR A 1 28 ? 98.980  -13.399 -22.907 1.00 0.00 ? 28 TYR A CD1  6  
ATOM 7569  C CD2  . TYR A 1 28 ? 98.578  -13.171 -20.526 1.00 0.00 ? 28 TYR A CD2  6  
ATOM 7570  C CE1  . TYR A 1 28 ? 98.597  -14.745 -22.842 1.00 0.00 ? 28 TYR A CE1  6  
ATOM 7571  C CE2  . TYR A 1 28 ? 98.195  -14.516 -20.462 1.00 0.00 ? 28 TYR A CE2  6  
ATOM 7572  C CZ   . TYR A 1 28 ? 98.205  -15.303 -21.619 1.00 0.00 ? 28 TYR A CZ   6  
ATOM 7573  O OH   . TYR A 1 28 ? 97.828  -16.630 -21.555 1.00 0.00 ? 28 TYR A OH   6  
ATOM 7574  H H    . TYR A 1 28 ? 100.633 -8.960  -21.679 1.00 0.00 ? 28 TYR A H    6  
ATOM 7575  H HA   . TYR A 1 28 ? 101.227 -11.571 -20.813 1.00 0.00 ? 28 TYR A HA   6  
ATOM 7576  H HB2  . TYR A 1 28 ? 98.930  -10.618 -21.002 1.00 0.00 ? 28 TYR A HB2  6  
ATOM 7577  H HB3  . TYR A 1 28 ? 99.060  -10.740 -22.758 1.00 0.00 ? 28 TYR A HB3  6  
ATOM 7578  H HD1  . TYR A 1 28 ? 99.283  -12.969 -23.850 1.00 0.00 ? 28 TYR A HD1  6  
ATOM 7579  H HD2  . TYR A 1 28 ? 98.569  -12.563 -19.633 1.00 0.00 ? 28 TYR A HD2  6  
ATOM 7580  H HE1  . TYR A 1 28 ? 98.605  -15.352 -23.735 1.00 0.00 ? 28 TYR A HE1  6  
ATOM 7581  H HE2  . TYR A 1 28 ? 97.892  -14.947 -19.518 1.00 0.00 ? 28 TYR A HE2  6  
ATOM 7582  H HH   . TYR A 1 28 ? 98.489  -17.148 -22.020 1.00 0.00 ? 28 TYR A HH   6  
ATOM 7583  N N    . PHE A 1 29 ? 101.494 -11.072 -24.067 1.00 0.00 ? 29 PHE A N    6  
ATOM 7584  C CA   . PHE A 1 29 ? 102.073 -11.622 -25.288 1.00 0.00 ? 29 PHE A CA   6  
ATOM 7585  C C    . PHE A 1 29 ? 103.596 -11.657 -25.197 1.00 0.00 ? 29 PHE A C    6  
ATOM 7586  O O    . PHE A 1 29 ? 104.225 -12.657 -25.541 1.00 0.00 ? 29 PHE A O    6  
ATOM 7587  C CB   . PHE A 1 29 ? 101.654 -10.778 -26.493 1.00 0.00 ? 29 PHE A CB   6  
ATOM 7588  C CG   . PHE A 1 29 ? 102.155 -11.428 -27.762 1.00 0.00 ? 29 PHE A CG   6  
ATOM 7589  C CD1  . PHE A 1 29 ? 101.400 -12.433 -28.378 1.00 0.00 ? 29 PHE A CD1  6  
ATOM 7590  C CD2  . PHE A 1 29 ? 103.372 -11.024 -28.321 1.00 0.00 ? 29 PHE A CD2  6  
ATOM 7591  C CE1  . PHE A 1 29 ? 101.865 -13.035 -29.554 1.00 0.00 ? 29 PHE A CE1  6  
ATOM 7592  C CE2  . PHE A 1 29 ? 103.837 -11.625 -29.497 1.00 0.00 ? 29 PHE A CE2  6  
ATOM 7593  C CZ   . PHE A 1 29 ? 103.083 -12.631 -30.113 1.00 0.00 ? 29 PHE A CZ   6  
ATOM 7594  H H    . PHE A 1 29 ? 101.059 -10.193 -24.094 1.00 0.00 ? 29 PHE A H    6  
ATOM 7595  H HA   . PHE A 1 29 ? 101.708 -12.629 -25.426 1.00 0.00 ? 29 PHE A HA   6  
ATOM 7596  H HB2  . PHE A 1 29 ? 100.576 -10.707 -26.525 1.00 0.00 ? 29 PHE A HB2  6  
ATOM 7597  H HB3  . PHE A 1 29 ? 102.077 -9.789  -26.405 1.00 0.00 ? 29 PHE A HB3  6  
ATOM 7598  H HD1  . PHE A 1 29 ? 100.460 -12.745 -27.947 1.00 0.00 ? 29 PHE A HD1  6  
ATOM 7599  H HD2  . PHE A 1 29 ? 103.954 -10.248 -27.845 1.00 0.00 ? 29 PHE A HD2  6  
ATOM 7600  H HE1  . PHE A 1 29 ? 101.283 -13.811 -30.030 1.00 0.00 ? 29 PHE A HE1  6  
ATOM 7601  H HE2  . PHE A 1 29 ? 104.777 -11.315 -29.928 1.00 0.00 ? 29 PHE A HE2  6  
ATOM 7602  H HZ   . PHE A 1 29 ? 103.442 -13.096 -31.020 1.00 0.00 ? 29 PHE A HZ   6  
ATOM 7603  N N    . LEU A 1 30 ? 104.182 -10.555 -24.736 1.00 0.00 ? 30 LEU A N    6  
ATOM 7604  C CA   . LEU A 1 30 ? 105.632 -10.471 -24.609 1.00 0.00 ? 30 LEU A CA   6  
ATOM 7605  C C    . LEU A 1 30 ? 106.146 -11.526 -23.636 1.00 0.00 ? 30 LEU A C    6  
ATOM 7606  O O    . LEU A 1 30 ? 107.150 -12.189 -23.896 1.00 0.00 ? 30 LEU A O    6  
ATOM 7607  C CB   . LEU A 1 30 ? 106.030 -9.074  -24.114 1.00 0.00 ? 30 LEU A CB   6  
ATOM 7608  C CG   . LEU A 1 30 ? 107.556 -8.874  -24.239 1.00 0.00 ? 30 LEU A CG   6  
ATOM 7609  C CD1  . LEU A 1 30 ? 107.922 -8.436  -25.664 1.00 0.00 ? 30 LEU A CD1  6  
ATOM 7610  C CD2  . LEU A 1 30 ? 108.014 -7.791  -23.257 1.00 0.00 ? 30 LEU A CD2  6  
ATOM 7611  H H    . LEU A 1 30 ? 103.629 -9.788  -24.481 1.00 0.00 ? 30 LEU A H    6  
ATOM 7612  H HA   . LEU A 1 30 ? 106.077 -10.640 -25.576 1.00 0.00 ? 30 LEU A HA   6  
ATOM 7613  H HB2  . LEU A 1 30 ? 105.513 -8.327  -24.700 1.00 0.00 ? 30 LEU A HB2  6  
ATOM 7614  H HB3  . LEU A 1 30 ? 105.739 -8.975  -23.078 1.00 0.00 ? 30 LEU A HB3  6  
ATOM 7615  H HG   . LEU A 1 30 ? 108.062 -9.801  -24.010 1.00 0.00 ? 30 LEU A HG   6  
ATOM 7616  H HD11 . LEU A 1 30 ? 107.750 -9.250  -26.351 1.00 0.00 ? 30 LEU A HD11 6  
ATOM 7617  H HD12 . LEU A 1 30 ? 108.965 -8.158  -25.696 1.00 0.00 ? 30 LEU A HD12 6  
ATOM 7618  H HD13 . LEU A 1 30 ? 107.318 -7.588  -25.952 1.00 0.00 ? 30 LEU A HD13 6  
ATOM 7619  H HD21 . LEU A 1 30 ? 107.974 -8.178  -22.249 1.00 0.00 ? 30 LEU A HD21 6  
ATOM 7620  H HD22 . LEU A 1 30 ? 107.364 -6.933  -23.337 1.00 0.00 ? 30 LEU A HD22 6  
ATOM 7621  H HD23 . LEU A 1 30 ? 109.027 -7.498  -23.490 1.00 0.00 ? 30 LEU A HD23 6  
ATOM 7622  N N    . GLY A 1 31 ? 105.452 -11.677 -22.511 1.00 0.00 ? 31 GLY A N    6  
ATOM 7623  C CA   . GLY A 1 31 ? 105.848 -12.657 -21.505 1.00 0.00 ? 31 GLY A CA   6  
ATOM 7624  C C    . GLY A 1 31 ? 105.338 -14.047 -21.866 1.00 0.00 ? 31 GLY A C    6  
ATOM 7625  O O    . GLY A 1 31 ? 104.333 -14.511 -21.325 1.00 0.00 ? 31 GLY A O    6  
ATOM 7626  H H    . GLY A 1 31 ? 104.660 -11.122 -22.357 1.00 0.00 ? 31 GLY A H    6  
ATOM 7627  H HA2  . GLY A 1 31 ? 106.926 -12.679 -21.434 1.00 0.00 ? 31 GLY A HA2  6  
ATOM 7628  H HA3  . GLY A 1 31 ? 105.435 -12.368 -20.549 1.00 0.00 ? 31 GLY A HA3  6  
ATOM 7629  N N    . ARG A 1 32 ? 106.036 -14.711 -22.782 1.00 0.00 ? 32 ARG A N    6  
ATOM 7630  C CA   . ARG A 1 32 ? 105.643 -16.050 -23.205 1.00 0.00 ? 32 ARG A CA   6  
ATOM 7631  C C    . ARG A 1 32 ? 105.731 -17.026 -22.036 1.00 0.00 ? 32 ARG A C    6  
ATOM 7632  O O    . ARG A 1 32 ? 106.724 -17.737 -21.882 1.00 0.00 ? 32 ARG A O    6  
ATOM 7633  C CB   . ARG A 1 32 ? 106.551 -16.528 -24.339 1.00 0.00 ? 32 ARG A CB   6  
ATOM 7634  C CG   . ARG A 1 32 ? 106.247 -15.731 -25.610 1.00 0.00 ? 32 ARG A CG   6  
ATOM 7635  C CD   . ARG A 1 32 ? 107.171 -16.195 -26.736 1.00 0.00 ? 32 ARG A CD   6  
ATOM 7636  N NE   . ARG A 1 32 ? 106.856 -15.486 -27.972 1.00 0.00 ? 32 ARG A NE   6  
ATOM 7637  C CZ   . ARG A 1 32 ? 107.562 -15.689 -29.079 1.00 0.00 ? 32 ARG A CZ   6  
ATOM 7638  N NH1  . ARG A 1 32 ? 108.555 -16.536 -29.073 1.00 0.00 ? 32 ARG A NH1  6  
ATOM 7639  N NH2  . ARG A 1 32 ? 107.262 -15.043 -30.173 1.00 0.00 ? 32 ARG A NH2  6  
ATOM 7640  H H    . ARG A 1 32 ? 106.830 -14.293 -23.179 1.00 0.00 ? 32 ARG A H    6  
ATOM 7641  H HA   . ARG A 1 32 ? 104.626 -16.020 -23.562 1.00 0.00 ? 32 ARG A HA   6  
ATOM 7642  H HB2  . ARG A 1 32 ? 107.584 -16.381 -24.061 1.00 0.00 ? 32 ARG A HB2  6  
ATOM 7643  H HB3  . ARG A 1 32 ? 106.374 -17.577 -24.524 1.00 0.00 ? 32 ARG A HB3  6  
ATOM 7644  H HG2  . ARG A 1 32 ? 105.217 -15.893 -25.897 1.00 0.00 ? 32 ARG A HG2  6  
ATOM 7645  H HG3  . ARG A 1 32 ? 106.407 -14.681 -25.423 1.00 0.00 ? 32 ARG A HG3  6  
ATOM 7646  H HD2  . ARG A 1 32 ? 108.196 -15.995 -26.463 1.00 0.00 ? 32 ARG A HD2  6  
ATOM 7647  H HD3  . ARG A 1 32 ? 107.043 -17.257 -26.889 1.00 0.00 ? 32 ARG A HD3  6  
ATOM 7648  H HE   . ARG A 1 32 ? 106.112 -14.848 -27.985 1.00 0.00 ? 32 ARG A HE   6  
ATOM 7649  H HH11 . ARG A 1 32 ? 108.786 -17.032 -28.236 1.00 0.00 ? 32 ARG A HH11 6  
ATOM 7650  H HH12 . ARG A 1 32 ? 109.086 -16.689 -29.907 1.00 0.00 ? 32 ARG A HH12 6  
ATOM 7651  H HH21 . ARG A 1 32 ? 106.500 -14.395 -30.176 1.00 0.00 ? 32 ARG A HH21 6  
ATOM 7652  H HH22 . ARG A 1 32 ? 107.792 -15.196 -31.006 1.00 0.00 ? 32 ARG A HH22 6  
ATOM 7653  N N    . LEU A 1 33 ? 104.687 -17.051 -21.213 1.00 0.00 ? 33 LEU A N    6  
ATOM 7654  C CA   . LEU A 1 33 ? 104.657 -17.944 -20.058 1.00 0.00 ? 33 LEU A CA   6  
ATOM 7655  C C    . LEU A 1 33 ? 105.988 -17.893 -19.311 1.00 0.00 ? 33 LEU A C    6  
ATOM 7656  O O    . LEU A 1 33 ? 106.710 -18.888 -19.241 1.00 0.00 ? 33 LEU A O    6  
ATOM 7657  C CB   . LEU A 1 33 ? 104.373 -19.381 -20.514 1.00 0.00 ? 33 LEU A CB   6  
ATOM 7658  C CG   . LEU A 1 33 ? 102.882 -19.545 -20.829 1.00 0.00 ? 33 LEU A CG   6  
ATOM 7659  C CD1  . LEU A 1 33 ? 102.470 -18.552 -21.921 1.00 0.00 ? 33 LEU A CD1  6  
ATOM 7660  C CD2  . LEU A 1 33 ? 102.622 -20.974 -21.313 1.00 0.00 ? 33 LEU A CD2  6  
ATOM 7661  H H    . LEU A 1 33 ? 103.924 -16.461 -21.384 1.00 0.00 ? 33 LEU A H    6  
ATOM 7662  H HA   . LEU A 1 33 ? 103.869 -17.626 -19.390 1.00 0.00 ? 33 LEU A HA   6  
ATOM 7663  H HB2  . LEU A 1 33 ? 104.953 -19.597 -21.400 1.00 0.00 ? 33 LEU A HB2  6  
ATOM 7664  H HB3  . LEU A 1 33 ? 104.648 -20.072 -19.730 1.00 0.00 ? 33 LEU A HB3  6  
ATOM 7665  H HG   . LEU A 1 33 ? 102.304 -19.355 -19.937 1.00 0.00 ? 33 LEU A HG   6  
ATOM 7666  H HD11 . LEU A 1 33 ? 101.530 -18.861 -22.356 1.00 0.00 ? 33 LEU A HD11 6  
ATOM 7667  H HD12 . LEU A 1 33 ? 103.228 -18.524 -22.690 1.00 0.00 ? 33 LEU A HD12 6  
ATOM 7668  H HD13 . LEU A 1 33 ? 102.358 -17.568 -21.491 1.00 0.00 ? 33 LEU A HD13 6  
ATOM 7669  H HD21 . LEU A 1 33 ? 101.566 -21.107 -21.493 1.00 0.00 ? 33 LEU A HD21 6  
ATOM 7670  H HD22 . LEU A 1 33 ? 102.949 -21.674 -20.557 1.00 0.00 ? 33 LEU A HD22 6  
ATOM 7671  H HD23 . LEU A 1 33 ? 103.169 -21.151 -22.227 1.00 0.00 ? 33 LEU A HD23 6  
ATOM 7672  N N    . GLY A 1 34 ? 106.306 -16.727 -18.759 1.00 0.00 ? 34 GLY A N    6  
ATOM 7673  C CA   . GLY A 1 34 ? 107.553 -16.556 -18.022 1.00 0.00 ? 34 GLY A CA   6  
ATOM 7674  C C    . GLY A 1 34 ? 107.483 -17.247 -16.665 1.00 0.00 ? 34 GLY A C    6  
ATOM 7675  O O    . GLY A 1 34 ? 106.756 -18.225 -16.492 1.00 0.00 ? 34 GLY A O    6  
ATOM 7676  H H    . GLY A 1 34 ? 105.693 -15.968 -18.849 1.00 0.00 ? 34 GLY A H    6  
ATOM 7677  H HA2  . GLY A 1 34 ? 108.364 -16.981 -18.596 1.00 0.00 ? 34 GLY A HA2  6  
ATOM 7678  H HA3  . GLY A 1 34 ? 107.736 -15.503 -17.872 1.00 0.00 ? 34 GLY A HA3  6  
ATOM 7679  N N    . THR A 1 35 ? 108.244 -16.731 -15.705 1.00 0.00 ? 35 THR A N    6  
ATOM 7680  C CA   . THR A 1 35 ? 108.261 -17.306 -14.365 1.00 0.00 ? 35 THR A CA   6  
ATOM 7681  C C    . THR A 1 35 ? 106.962 -16.989 -13.630 1.00 0.00 ? 35 THR A C    6  
ATOM 7682  O O    . THR A 1 35 ? 106.092 -16.299 -14.159 1.00 0.00 ? 35 THR A O    6  
ATOM 7683  C CB   . THR A 1 35 ? 109.447 -16.752 -13.573 1.00 0.00 ? 35 THR A CB   6  
ATOM 7684  O OG1  . THR A 1 35 ? 109.502 -17.384 -12.301 1.00 0.00 ? 35 THR A OG1  6  
ATOM 7685  C CG2  . THR A 1 35 ? 109.280 -15.243 -13.388 1.00 0.00 ? 35 THR A CG2  6  
ATOM 7686  H H    . THR A 1 35 ? 108.803 -15.951 -15.901 1.00 0.00 ? 35 THR A H    6  
ATOM 7687  H HA   . THR A 1 35 ? 108.366 -18.378 -14.445 1.00 0.00 ? 35 THR A HA   6  
ATOM 7688  H HB   . THR A 1 35 ? 110.362 -16.946 -14.111 1.00 0.00 ? 35 THR A HB   6  
ATOM 7689  H HG1  . THR A 1 35 ? 109.852 -16.751 -11.670 1.00 0.00 ? 35 THR A HG1  6  
ATOM 7690  H HG21 . THR A 1 35 ? 109.020 -14.791 -14.334 1.00 0.00 ? 35 THR A HG21 6  
ATOM 7691  H HG22 . THR A 1 35 ? 110.207 -14.820 -13.030 1.00 0.00 ? 35 THR A HG22 6  
ATOM 7692  H HG23 . THR A 1 35 ? 108.496 -15.053 -12.671 1.00 0.00 ? 35 THR A HG23 6  
ATOM 7693  N N    . ALA A 1 36 ? 106.841 -17.498 -12.408 1.00 0.00 ? 36 ALA A N    6  
ATOM 7694  C CA   . ALA A 1 36 ? 105.643 -17.263 -11.609 1.00 0.00 ? 36 ALA A CA   6  
ATOM 7695  C C    . ALA A 1 36 ? 105.447 -15.768 -11.366 1.00 0.00 ? 36 ALA A C    6  
ATOM 7696  O O    . ALA A 1 36 ? 105.657 -14.952 -12.262 1.00 0.00 ? 36 ALA A O    6  
ATOM 7697  C CB   . ALA A 1 36 ? 105.758 -17.992 -10.269 1.00 0.00 ? 36 ALA A CB   6  
ATOM 7698  H H    . ALA A 1 36 ? 107.567 -18.042 -12.038 1.00 0.00 ? 36 ALA A H    6  
ATOM 7699  H HA   . ALA A 1 36 ? 104.786 -17.646 -12.142 1.00 0.00 ? 36 ALA A HA   6  
ATOM 7700  H HB1  . ALA A 1 36 ? 106.433 -17.451 -9.621  1.00 0.00 ? 36 ALA A HB1  6  
ATOM 7701  H HB2  . ALA A 1 36 ? 106.140 -18.989 -10.433 1.00 0.00 ? 36 ALA A HB2  6  
ATOM 7702  H HB3  . ALA A 1 36 ? 104.784 -18.050 -9.806  1.00 0.00 ? 36 ALA A HB3  6  
ATOM 7703  N N    . GLU A 1 37 ? 105.041 -15.418 -10.150 1.00 0.00 ? 37 GLU A N    6  
ATOM 7704  C CA   . GLU A 1 37 ? 104.820 -14.018 -9.804  1.00 0.00 ? 37 GLU A CA   6  
ATOM 7705  C C    . GLU A 1 37 ? 103.850 -13.371 -10.789 1.00 0.00 ? 37 GLU A C    6  
ATOM 7706  O O    . GLU A 1 37 ? 103.640 -12.158 -10.764 1.00 0.00 ? 37 GLU A O    6  
ATOM 7707  C CB   . GLU A 1 37 ? 106.148 -13.259 -9.821  1.00 0.00 ? 37 GLU A CB   6  
ATOM 7708  C CG   . GLU A 1 37 ? 107.054 -13.788 -8.707  1.00 0.00 ? 37 GLU A CG   6  
ATOM 7709  C CD   . GLU A 1 37 ? 108.417 -13.107 -8.776  1.00 0.00 ? 37 GLU A CD   6  
ATOM 7710  O OE1  . GLU A 1 37 ? 108.917 -12.937 -9.876  1.00 0.00 ? 37 GLU A OE1  6  
ATOM 7711  O OE2  . GLU A 1 37 ? 108.940 -12.765 -7.729  1.00 0.00 ? 37 GLU A OE2  6  
ATOM 7712  H H    . GLU A 1 37 ? 104.889 -16.111 -9.475  1.00 0.00 ? 37 GLU A H    6  
ATOM 7713  H HA   . GLU A 1 37 ? 104.399 -13.965 -8.811  1.00 0.00 ? 37 GLU A HA   6  
ATOM 7714  H HB2  . GLU A 1 37 ? 106.631 -13.400 -10.777 1.00 0.00 ? 37 GLU A HB2  6  
ATOM 7715  H HB3  . GLU A 1 37 ? 105.963 -12.208 -9.662  1.00 0.00 ? 37 GLU A HB3  6  
ATOM 7716  H HG2  . GLU A 1 37 ? 106.599 -13.585 -7.749  1.00 0.00 ? 37 GLU A HG2  6  
ATOM 7717  H HG3  . GLU A 1 37 ? 107.182 -14.854 -8.824  1.00 0.00 ? 37 GLU A HG3  6  
ATOM 7718  N N    . VAL A 1 38 ? 103.261 -14.191 -11.654 1.00 0.00 ? 38 VAL A N    6  
ATOM 7719  C CA   . VAL A 1 38 ? 102.313 -13.691 -12.644 1.00 0.00 ? 38 VAL A CA   6  
ATOM 7720  C C    . VAL A 1 38 ? 101.059 -13.148 -11.964 1.00 0.00 ? 38 VAL A C    6  
ATOM 7721  O O    . VAL A 1 38 ? 100.357 -12.304 -12.520 1.00 0.00 ? 38 VAL A O    6  
ATOM 7722  C CB   . VAL A 1 38 ? 101.932 -14.809 -13.617 1.00 0.00 ? 38 VAL A CB   6  
ATOM 7723  C CG1  . VAL A 1 38 ? 103.195 -15.362 -14.277 1.00 0.00 ? 38 VAL A CG1  6  
ATOM 7724  C CG2  . VAL A 1 38 ? 101.222 -15.932 -12.856 1.00 0.00 ? 38 VAL A CG2  6  
ATOM 7725  H H    . VAL A 1 38 ? 103.467 -15.148 -11.625 1.00 0.00 ? 38 VAL A H    6  
ATOM 7726  H HA   . VAL A 1 38 ? 102.780 -12.893 -13.200 1.00 0.00 ? 38 VAL A HA   6  
ATOM 7727  H HB   . VAL A 1 38 ? 101.273 -14.414 -14.376 1.00 0.00 ? 38 VAL A HB   6  
ATOM 7728  H HG11 . VAL A 1 38 ? 102.925 -16.129 -14.988 1.00 0.00 ? 38 VAL A HG11 6  
ATOM 7729  H HG12 . VAL A 1 38 ? 103.842 -15.785 -13.521 1.00 0.00 ? 38 VAL A HG12 6  
ATOM 7730  H HG13 . VAL A 1 38 ? 103.714 -14.565 -14.788 1.00 0.00 ? 38 VAL A HG13 6  
ATOM 7731  H HG21 . VAL A 1 38 ? 101.182 -16.816 -13.475 1.00 0.00 ? 38 VAL A HG21 6  
ATOM 7732  H HG22 . VAL A 1 38 ? 100.218 -15.619 -12.609 1.00 0.00 ? 38 VAL A HG22 6  
ATOM 7733  H HG23 . VAL A 1 38 ? 101.766 -16.151 -11.949 1.00 0.00 ? 38 VAL A HG23 6  
ATOM 7734  N N    . LEU A 1 39 ? 100.782 -13.641 -10.761 1.00 0.00 ? 39 LEU A N    6  
ATOM 7735  C CA   . LEU A 1 39 ? 99.607  -13.200 -10.015 1.00 0.00 ? 39 LEU A CA   6  
ATOM 7736  C C    . LEU A 1 39 ? 99.492  -11.677 -10.054 1.00 0.00 ? 39 LEU A C    6  
ATOM 7737  O O    . LEU A 1 39 ? 98.393  -11.127 -9.983  1.00 0.00 ? 39 LEU A O    6  
ATOM 7738  C CB   . LEU A 1 39 ? 99.707  -13.670 -8.555  1.00 0.00 ? 39 LEU A CB   6  
ATOM 7739  C CG   . LEU A 1 39 ? 99.332  -15.151 -8.452  1.00 0.00 ? 39 LEU A CG   6  
ATOM 7740  C CD1  . LEU A 1 39 ? 100.342 -15.996 -9.233  1.00 0.00 ? 39 LEU A CD1  6  
ATOM 7741  C CD2  . LEU A 1 39 ? 99.341  -15.573 -6.980  1.00 0.00 ? 39 LEU A CD2  6  
ATOM 7742  H H    . LEU A 1 39 ? 101.376 -14.314 -10.367 1.00 0.00 ? 39 LEU A H    6  
ATOM 7743  H HA   . LEU A 1 39 ? 98.723  -13.629 -10.463 1.00 0.00 ? 39 LEU A HA   6  
ATOM 7744  H HB2  . LEU A 1 39 ? 100.719 -13.531 -8.204  1.00 0.00 ? 39 LEU A HB2  6  
ATOM 7745  H HB3  . LEU A 1 39 ? 99.033  -13.089 -7.941  1.00 0.00 ? 39 LEU A HB3  6  
ATOM 7746  H HG   . LEU A 1 39 ? 98.344  -15.301 -8.865  1.00 0.00 ? 39 LEU A HG   6  
ATOM 7747  H HD11 . LEU A 1 39 ? 100.263 -17.029 -8.927  1.00 0.00 ? 39 LEU A HD11 6  
ATOM 7748  H HD12 . LEU A 1 39 ? 101.343 -15.638 -9.036  1.00 0.00 ? 39 LEU A HD12 6  
ATOM 7749  H HD13 . LEU A 1 39 ? 100.133 -15.918 -10.288 1.00 0.00 ? 39 LEU A HD13 6  
ATOM 7750  H HD21 . LEU A 1 39 ? 98.590  -15.014 -6.441  1.00 0.00 ? 39 LEU A HD21 6  
ATOM 7751  H HD22 . LEU A 1 39 ? 100.313 -15.373 -6.555  1.00 0.00 ? 39 LEU A HD22 6  
ATOM 7752  H HD23 . LEU A 1 39 ? 99.126  -16.628 -6.907  1.00 0.00 ? 39 LEU A HD23 6  
ATOM 7753  N N    . GLY A 1 40 ? 100.631 -11.003 -10.162 1.00 0.00 ? 40 GLY A N    6  
ATOM 7754  C CA   . GLY A 1 40 ? 100.644 -9.545  -10.206 1.00 0.00 ? 40 GLY A CA   6  
ATOM 7755  C C    . GLY A 1 40 ? 99.768  -9.020  -11.340 1.00 0.00 ? 40 GLY A C    6  
ATOM 7756  O O    . GLY A 1 40 ? 98.964  -8.109  -11.144 1.00 0.00 ? 40 GLY A O    6  
ATOM 7757  H H    . GLY A 1 40 ? 101.478 -11.493 -10.213 1.00 0.00 ? 40 GLY A H    6  
ATOM 7758  H HA2  . GLY A 1 40 ? 100.275 -9.161  -9.266  1.00 0.00 ? 40 GLY A HA2  6  
ATOM 7759  H HA3  . GLY A 1 40 ? 101.657 -9.204  -10.356 1.00 0.00 ? 40 GLY A HA3  6  
ATOM 7760  N N    . ILE A 1 41 ? 99.933  -9.596  -12.527 1.00 0.00 ? 41 ILE A N    6  
ATOM 7761  C CA   . ILE A 1 41 ? 99.153  -9.172  -13.688 1.00 0.00 ? 41 ILE A CA   6  
ATOM 7762  C C    . ILE A 1 41 ? 97.658  -9.328  -13.417 1.00 0.00 ? 41 ILE A C    6  
ATOM 7763  O O    . ILE A 1 41 ? 96.850  -8.491  -13.823 1.00 0.00 ? 41 ILE A O    6  
ATOM 7764  C CB   . ILE A 1 41 ? 99.544  -10.004 -14.913 1.00 0.00 ? 41 ILE A CB   6  
ATOM 7765  C CG1  . ILE A 1 41 ? 101.001 -9.713  -15.282 1.00 0.00 ? 41 ILE A CG1  6  
ATOM 7766  C CG2  . ILE A 1 41 ? 98.640  -9.639  -16.092 1.00 0.00 ? 41 ILE A CG2  6  
ATOM 7767  C CD1  . ILE A 1 41 ? 101.484 -10.743 -16.303 1.00 0.00 ? 41 ILE A CD1  6  
ATOM 7768  H H    . ILE A 1 41 ? 100.592 -10.315 -12.625 1.00 0.00 ? 41 ILE A H    6  
ATOM 7769  H HA   . ILE A 1 41 ? 99.365  -8.134  -13.890 1.00 0.00 ? 41 ILE A HA   6  
ATOM 7770  H HB   . ILE A 1 41 ? 99.432  -11.055 -14.685 1.00 0.00 ? 41 ILE A HB   6  
ATOM 7771  H HG12 . ILE A 1 41 ? 101.071 -8.721  -15.706 1.00 0.00 ? 41 ILE A HG12 6  
ATOM 7772  H HG13 . ILE A 1 41 ? 101.615 -9.771  -14.396 1.00 0.00 ? 41 ILE A HG13 6  
ATOM 7773  H HG21 . ILE A 1 41 ? 98.574  -8.564  -16.177 1.00 0.00 ? 41 ILE A HG21 6  
ATOM 7774  H HG22 . ILE A 1 41 ? 97.654  -10.048 -15.931 1.00 0.00 ? 41 ILE A HG22 6  
ATOM 7775  H HG23 . ILE A 1 41 ? 99.054  -10.047 -17.003 1.00 0.00 ? 41 ILE A HG23 6  
ATOM 7776  H HD11 . ILE A 1 41 ? 101.498 -11.722 -15.849 1.00 0.00 ? 41 ILE A HD11 6  
ATOM 7777  H HD12 . ILE A 1 41 ? 102.481 -10.485 -16.631 1.00 0.00 ? 41 ILE A HD12 6  
ATOM 7778  H HD13 . ILE A 1 41 ? 100.817 -10.749 -17.153 1.00 0.00 ? 41 ILE A HD13 6  
ATOM 7779  N N    . ILE A 1 42 ? 97.296  -10.402 -12.735 1.00 0.00 ? 42 ILE A N    6  
ATOM 7780  C CA   . ILE A 1 42 ? 95.896  -10.648 -12.420 1.00 0.00 ? 42 ILE A CA   6  
ATOM 7781  C C    . ILE A 1 42 ? 95.384  -9.595  -11.439 1.00 0.00 ? 42 ILE A C    6  
ATOM 7782  O O    . ILE A 1 42 ? 94.278  -9.084  -11.590 1.00 0.00 ? 42 ILE A O    6  
ATOM 7783  C CB   . ILE A 1 42 ? 95.734  -12.054 -11.822 1.00 0.00 ? 42 ILE A CB   6  
ATOM 7784  C CG1  . ILE A 1 42 ? 95.940  -13.107 -12.920 1.00 0.00 ? 42 ILE A CG1  6  
ATOM 7785  C CG2  . ILE A 1 42 ? 94.327  -12.217 -11.234 1.00 0.00 ? 42 ILE A CG2  6  
ATOM 7786  C CD1  . ILE A 1 42 ? 97.381  -13.055 -13.444 1.00 0.00 ? 42 ILE A CD1  6  
ATOM 7787  H H    . ILE A 1 42 ? 97.977  -11.039 -12.436 1.00 0.00 ? 42 ILE A H    6  
ATOM 7788  H HA   . ILE A 1 42 ? 95.318  -10.588 -13.329 1.00 0.00 ? 42 ILE A HA   6  
ATOM 7789  H HB   . ILE A 1 42 ? 96.465  -12.198 -11.041 1.00 0.00 ? 42 ILE A HB   6  
ATOM 7790  H HG12 . ILE A 1 42 ? 95.743  -14.088 -12.514 1.00 0.00 ? 42 ILE A HG12 6  
ATOM 7791  H HG13 . ILE A 1 42 ? 95.258  -12.913 -13.734 1.00 0.00 ? 42 ILE A HG13 6  
ATOM 7792  H HG21 . ILE A 1 42 ? 94.257  -11.662 -10.310 1.00 0.00 ? 42 ILE A HG21 6  
ATOM 7793  H HG22 . ILE A 1 42 ? 94.135  -13.263 -11.041 1.00 0.00 ? 42 ILE A HG22 6  
ATOM 7794  H HG23 . ILE A 1 42 ? 93.597  -11.840 -11.935 1.00 0.00 ? 42 ILE A HG23 6  
ATOM 7795  H HD11 . ILE A 1 42 ? 98.060  -12.833 -12.633 1.00 0.00 ? 42 ILE A HD11 6  
ATOM 7796  H HD12 . ILE A 1 42 ? 97.461  -12.289 -14.202 1.00 0.00 ? 42 ILE A HD12 6  
ATOM 7797  H HD13 . ILE A 1 42 ? 97.638  -14.011 -13.876 1.00 0.00 ? 42 ILE A HD13 6  
ATOM 7798  N N    . SER A 1 43 ? 96.196  -9.287  -10.432 1.00 0.00 ? 43 SER A N    6  
ATOM 7799  C CA   . SER A 1 43 ? 95.816  -8.306  -9.418  1.00 0.00 ? 43 SER A CA   6  
ATOM 7800  C C    . SER A 1 43 ? 95.513  -6.939  -10.033 1.00 0.00 ? 43 SER A C    6  
ATOM 7801  O O    . SER A 1 43 ? 94.466  -6.347  -9.757  1.00 0.00 ? 43 SER A O    6  
ATOM 7802  C CB   . SER A 1 43 ? 96.943  -8.163  -8.394  1.00 0.00 ? 43 SER A CB   6  
ATOM 7803  O OG   . SER A 1 43 ? 96.428  -7.557  -7.215  1.00 0.00 ? 43 SER A OG   6  
ATOM 7804  H H    . SER A 1 43 ? 97.065  -9.735  -10.363 1.00 0.00 ? 43 SER A H    6  
ATOM 7805  H HA   . SER A 1 43 ? 94.933  -8.660  -8.909  1.00 0.00 ? 43 SER A HA   6  
ATOM 7806  H HB2  . SER A 1 43 ? 97.336  -9.134  -8.150  1.00 0.00 ? 43 SER A HB2  6  
ATOM 7807  H HB3  . SER A 1 43 ? 97.732  -7.551  -8.810  1.00 0.00 ? 43 SER A HB3  6  
ATOM 7808  H HG   . SER A 1 43 ? 95.520  -7.297  -7.387  1.00 0.00 ? 43 SER A HG   6  
ATOM 7809  N N    . ILE A 1 44 ? 96.429  -6.429  -10.851 1.00 0.00 ? 44 ILE A N    6  
ATOM 7810  C CA   . ILE A 1 44 ? 96.228  -5.121  -11.468 1.00 0.00 ? 44 ILE A CA   6  
ATOM 7811  C C    . ILE A 1 44 ? 95.006  -5.136  -12.388 1.00 0.00 ? 44 ILE A C    6  
ATOM 7812  O O    . ILE A 1 44 ? 94.174  -4.228  -12.345 1.00 0.00 ? 44 ILE A O    6  
ATOM 7813  C CB   . ILE A 1 44 ? 97.485  -4.703  -12.242 1.00 0.00 ? 44 ILE A CB   6  
ATOM 7814  C CG1  . ILE A 1 44 ? 97.858  -5.796  -13.247 1.00 0.00 ? 44 ILE A CG1  6  
ATOM 7815  C CG2  . ILE A 1 44 ? 98.648  -4.505  -11.260 1.00 0.00 ? 44 ILE A CG2  6  
ATOM 7816  C CD1  . ILE A 1 44 ? 99.228  -5.502  -13.873 1.00 0.00 ? 44 ILE A CD1  6  
ATOM 7817  H H    . ILE A 1 44 ? 97.251  -6.932  -11.036 1.00 0.00 ? 44 ILE A H    6  
ATOM 7818  H HA   . ILE A 1 44 ? 96.051  -4.399  -10.685 1.00 0.00 ? 44 ILE A HA   6  
ATOM 7819  H HB   . ILE A 1 44 ? 97.294  -3.778  -12.765 1.00 0.00 ? 44 ILE A HB   6  
ATOM 7820  H HG12 . ILE A 1 44 ? 97.897  -6.744  -12.735 1.00 0.00 ? 44 ILE A HG12 6  
ATOM 7821  H HG13 . ILE A 1 44 ? 97.112  -5.837  -14.025 1.00 0.00 ? 44 ILE A HG13 6  
ATOM 7822  H HG21 . ILE A 1 44 ? 99.441  -3.960  -11.750 1.00 0.00 ? 44 ILE A HG21 6  
ATOM 7823  H HG22 . ILE A 1 44 ? 99.019  -5.468  -10.940 1.00 0.00 ? 44 ILE A HG22 6  
ATOM 7824  H HG23 . ILE A 1 44 ? 98.309  -3.949  -10.401 1.00 0.00 ? 44 ILE A HG23 6  
ATOM 7825  H HD11 . ILE A 1 44 ? 100.005 -5.908  -13.244 1.00 0.00 ? 44 ILE A HD11 6  
ATOM 7826  H HD12 . ILE A 1 44 ? 99.366  -4.434  -13.969 1.00 0.00 ? 44 ILE A HD12 6  
ATOM 7827  H HD13 . ILE A 1 44 ? 99.282  -5.960  -14.850 1.00 0.00 ? 44 ILE A HD13 6  
ATOM 7828  N N    . VAL A 1 45 ? 94.880  -6.174  -13.205 1.00 0.00 ? 45 VAL A N    6  
ATOM 7829  C CA   . VAL A 1 45 ? 93.732  -6.268  -14.098 1.00 0.00 ? 45 VAL A CA   6  
ATOM 7830  C C    . VAL A 1 45 ? 92.442  -6.232  -13.281 1.00 0.00 ? 45 VAL A C    6  
ATOM 7831  O O    . VAL A 1 45 ? 91.432  -5.666  -13.709 1.00 0.00 ? 45 VAL A O    6  
ATOM 7832  C CB   . VAL A 1 45 ? 93.803  -7.568  -14.913 1.00 0.00 ? 45 VAL A CB   6  
ATOM 7833  C CG1  . VAL A 1 45 ? 92.472  -7.810  -15.634 1.00 0.00 ? 45 VAL A CG1  6  
ATOM 7834  C CG2  . VAL A 1 45 ? 94.920  -7.456  -15.951 1.00 0.00 ? 45 VAL A CG2  6  
ATOM 7835  H H    . VAL A 1 45 ? 95.556  -6.887  -13.200 1.00 0.00 ? 45 VAL A H    6  
ATOM 7836  H HA   . VAL A 1 45 ? 93.743  -5.427  -14.776 1.00 0.00 ? 45 VAL A HA   6  
ATOM 7837  H HB   . VAL A 1 45 ? 94.008  -8.396  -14.250 1.00 0.00 ? 45 VAL A HB   6  
ATOM 7838  H HG11 . VAL A 1 45 ? 91.730  -8.138  -14.921 1.00 0.00 ? 45 VAL A HG11 6  
ATOM 7839  H HG12 . VAL A 1 45 ? 92.603  -8.571  -16.389 1.00 0.00 ? 45 VAL A HG12 6  
ATOM 7840  H HG13 . VAL A 1 45 ? 92.143  -6.894  -16.100 1.00 0.00 ? 45 VAL A HG13 6  
ATOM 7841  H HG21 . VAL A 1 45 ? 95.834  -7.151  -15.466 1.00 0.00 ? 45 VAL A HG21 6  
ATOM 7842  H HG22 . VAL A 1 45 ? 94.646  -6.724  -16.695 1.00 0.00 ? 45 VAL A HG22 6  
ATOM 7843  H HG23 . VAL A 1 45 ? 95.067  -8.415  -16.426 1.00 0.00 ? 45 VAL A HG23 6  
ATOM 7844  N N    . LEU A 1 46 ? 92.483  -6.851  -12.106 1.00 0.00 ? 46 LEU A N    6  
ATOM 7845  C CA   . LEU A 1 46 ? 91.315  -6.903  -11.237 1.00 0.00 ? 46 LEU A CA   6  
ATOM 7846  C C    . LEU A 1 46 ? 90.977  -5.517  -10.672 1.00 0.00 ? 46 LEU A C    6  
ATOM 7847  O O    . LEU A 1 46 ? 89.804  -5.173  -10.543 1.00 0.00 ? 46 LEU A O    6  
ATOM 7848  C CB   . LEU A 1 46 ? 91.565  -7.912  -10.085 1.00 0.00 ? 46 LEU A CB   6  
ATOM 7849  C CG   . LEU A 1 46 ? 90.348  -8.840  -9.865  1.00 0.00 ? 46 LEU A CG   6  
ATOM 7850  C CD1  . LEU A 1 46 ? 89.079  -8.007  -9.619  1.00 0.00 ? 46 LEU A CD1  6  
ATOM 7851  C CD2  . LEU A 1 46 ? 90.146  -9.770  -11.085 1.00 0.00 ? 46 LEU A CD2  6  
ATOM 7852  H H    . LEU A 1 46 ? 93.312  -7.290  -11.823 1.00 0.00 ? 46 LEU A H    6  
ATOM 7853  H HA   . LEU A 1 46 ? 90.480  -7.239  -11.827 1.00 0.00 ? 46 LEU A HA   6  
ATOM 7854  H HB2  . LEU A 1 46 ? 92.422  -8.514  -10.329 1.00 0.00 ? 46 LEU A HB2  6  
ATOM 7855  H HB3  . LEU A 1 46 ? 91.769  -7.378  -9.166  1.00 0.00 ? 46 LEU A HB3  6  
ATOM 7856  H HG   . LEU A 1 46 ? 90.534  -9.447  -8.990  1.00 0.00 ? 46 LEU A HG   6  
ATOM 7857  H HD11 . LEU A 1 46 ? 88.615  -7.755  -10.562 1.00 0.00 ? 46 LEU A HD11 6  
ATOM 7858  H HD12 . LEU A 1 46 ? 89.334  -7.100  -9.091  1.00 0.00 ? 46 LEU A HD12 6  
ATOM 7859  H HD13 . LEU A 1 46 ? 88.384  -8.583  -9.025  1.00 0.00 ? 46 LEU A HD13 6  
ATOM 7860  H HD21 . LEU A 1 46 ? 89.475  -9.310  -11.796 1.00 0.00 ? 46 LEU A HD21 6  
ATOM 7861  H HD22 . LEU A 1 46 ? 89.721  -10.704 -10.750 1.00 0.00 ? 46 LEU A HD22 6  
ATOM 7862  H HD23 . LEU A 1 46 ? 91.096  -9.964  -11.562 1.00 0.00 ? 46 LEU A HD23 6  
ATOM 7863  N N    . VAL A 1 47 ? 91.998  -4.729  -10.328 1.00 0.00 ? 47 VAL A N    6  
ATOM 7864  C CA   . VAL A 1 47 ? 91.746  -3.402  -9.771  1.00 0.00 ? 47 VAL A CA   6  
ATOM 7865  C C    . VAL A 1 47 ? 91.090  -2.515  -10.830 1.00 0.00 ? 47 VAL A C    6  
ATOM 7866  O O    . VAL A 1 47 ? 90.288  -1.633  -10.514 1.00 0.00 ? 47 VAL A O    6  
ATOM 7867  C CB   . VAL A 1 47 ? 93.067  -2.781  -9.232  1.00 0.00 ? 47 VAL A CB   6  
ATOM 7868  C CG1  . VAL A 1 47 ? 93.722  -1.847  -10.266 1.00 0.00 ? 47 VAL A CG1  6  
ATOM 7869  C CG2  . VAL A 1 47 ? 92.789  -1.980  -7.950  1.00 0.00 ? 47 VAL A CG2  6  
ATOM 7870  H H    . VAL A 1 47 ? 92.921  -5.039  -10.444 1.00 0.00 ? 47 VAL A H    6  
ATOM 7871  H HA   . VAL A 1 47 ? 91.053  -3.517  -8.949  1.00 0.00 ? 47 VAL A HA   6  
ATOM 7872  H HB   . VAL A 1 47 ? 93.757  -3.581  -9.001  1.00 0.00 ? 47 VAL A HB   6  
ATOM 7873  H HG11 . VAL A 1 47 ? 94.764  -1.710  -10.016 1.00 0.00 ? 47 VAL A HG11 6  
ATOM 7874  H HG12 . VAL A 1 47 ? 93.222  -0.889  -10.258 1.00 0.00 ? 47 VAL A HG12 6  
ATOM 7875  H HG13 . VAL A 1 47 ? 93.643  -2.280  -11.248 1.00 0.00 ? 47 VAL A HG13 6  
ATOM 7876  H HG21 . VAL A 1 47 ? 93.686  -1.460  -7.648  1.00 0.00 ? 47 VAL A HG21 6  
ATOM 7877  H HG22 . VAL A 1 47 ? 92.480  -2.654  -7.165  1.00 0.00 ? 47 VAL A HG22 6  
ATOM 7878  H HG23 . VAL A 1 47 ? 92.003  -1.263  -8.138  1.00 0.00 ? 47 VAL A HG23 6  
ATOM 7879  N N    . ALA A 1 48 ? 91.444  -2.757  -12.088 1.00 0.00 ? 48 ALA A N    6  
ATOM 7880  C CA   . ALA A 1 48 ? 90.891  -1.978  -13.189 1.00 0.00 ? 48 ALA A CA   6  
ATOM 7881  C C    . ALA A 1 48 ? 89.420  -2.303  -13.419 1.00 0.00 ? 48 ALA A C    6  
ATOM 7882  O O    . ALA A 1 48 ? 88.580  -1.405  -13.480 1.00 0.00 ? 48 ALA A O    6  
ATOM 7883  C CB   . ALA A 1 48 ? 91.675  -2.264  -14.473 1.00 0.00 ? 48 ALA A CB   6  
ATOM 7884  H H    . ALA A 1 48 ? 92.095  -3.473  -12.279 1.00 0.00 ? 48 ALA A H    6  
ATOM 7885  H HA   . ALA A 1 48 ? 90.978  -0.932  -12.955 1.00 0.00 ? 48 ALA A HA   6  
ATOM 7886  H HB1  . ALA A 1 48 ? 91.495  -3.283  -14.782 1.00 0.00 ? 48 ALA A HB1  6  
ATOM 7887  H HB2  . ALA A 1 48 ? 92.730  -2.126  -14.292 1.00 0.00 ? 48 ALA A HB2  6  
ATOM 7888  H HB3  . ALA A 1 48 ? 91.351  -1.590  -15.251 1.00 0.00 ? 48 ALA A HB3  6  
ATOM 7889  N N    . THR A 1 49 ? 89.110  -3.583  -13.566 1.00 0.00 ? 49 THR A N    6  
ATOM 7890  C CA   . THR A 1 49 ? 87.733  -3.987  -13.816 1.00 0.00 ? 49 THR A CA   6  
ATOM 7891  C C    . THR A 1 49 ? 86.801  -3.528  -12.693 1.00 0.00 ? 49 THR A C    6  
ATOM 7892  O O    . THR A 1 49 ? 85.711  -3.018  -12.956 1.00 0.00 ? 49 THR A O    6  
ATOM 7893  C CB   . THR A 1 49 ? 87.649  -5.509  -13.963 1.00 0.00 ? 49 THR A CB   6  
ATOM 7894  O OG1  . THR A 1 49 ? 88.736  -5.965  -14.758 1.00 0.00 ? 49 THR A OG1  6  
ATOM 7895  C CG2  . THR A 1 49 ? 86.331  -5.890  -14.640 1.00 0.00 ? 49 THR A CG2  6  
ATOM 7896  H H    . THR A 1 49 ? 89.818  -4.263  -13.523 1.00 0.00 ? 49 THR A H    6  
ATOM 7897  H HA   . THR A 1 49 ? 87.406  -3.534  -14.740 1.00 0.00 ? 49 THR A HA   6  
ATOM 7898  H HB   . THR A 1 49 ? 87.696  -5.970  -12.988 1.00 0.00 ? 49 THR A HB   6  
ATOM 7899  H HG1  . THR A 1 49 ? 89.528  -5.944  -14.217 1.00 0.00 ? 49 THR A HG1  6  
ATOM 7900  H HG21 . THR A 1 49 ? 86.188  -6.958  -14.577 1.00 0.00 ? 49 THR A HG21 6  
ATOM 7901  H HG22 . THR A 1 49 ? 86.360  -5.590  -15.678 1.00 0.00 ? 49 THR A HG22 6  
ATOM 7902  H HG23 . THR A 1 49 ? 85.513  -5.387  -14.144 1.00 0.00 ? 49 THR A HG23 6  
ATOM 7903  N N    . VAL A 1 50 ? 87.220  -3.723  -11.445 1.00 0.00 ? 50 VAL A N    6  
ATOM 7904  C CA   . VAL A 1 50 ? 86.387  -3.334  -10.308 1.00 0.00 ? 50 VAL A CA   6  
ATOM 7905  C C    . VAL A 1 50 ? 86.308  -1.817  -10.140 1.00 0.00 ? 50 VAL A C    6  
ATOM 7906  O O    . VAL A 1 50 ? 85.298  -1.304  -9.667  1.00 0.00 ? 50 VAL A O    6  
ATOM 7907  C CB   . VAL A 1 50 ? 86.917  -3.961  -9.017  1.00 0.00 ? 50 VAL A CB   6  
ATOM 7908  C CG1  . VAL A 1 50 ? 87.000  -5.479  -9.184  1.00 0.00 ? 50 VAL A CG1  6  
ATOM 7909  C CG2  . VAL A 1 50 ? 88.304  -3.389  -8.699  1.00 0.00 ? 50 VAL A CG2  6  
ATOM 7910  H H    . VAL A 1 50 ? 88.091  -4.145  -11.286 1.00 0.00 ? 50 VAL A H    6  
ATOM 7911  H HA   . VAL A 1 50 ? 85.389  -3.709  -10.477 1.00 0.00 ? 50 VAL A HA   6  
ATOM 7912  H HB   . VAL A 1 50 ? 86.239  -3.730  -8.207  1.00 0.00 ? 50 VAL A HB   6  
ATOM 7913  H HG11 . VAL A 1 50 ? 87.571  -5.713  -10.069 1.00 0.00 ? 50 VAL A HG11 6  
ATOM 7914  H HG12 . VAL A 1 50 ? 86.004  -5.885  -9.283  1.00 0.00 ? 50 VAL A HG12 6  
ATOM 7915  H HG13 . VAL A 1 50 ? 87.479  -5.910  -8.319  1.00 0.00 ? 50 VAL A HG13 6  
ATOM 7916  H HG21 . VAL A 1 50 ? 88.858  -3.254  -9.613  1.00 0.00 ? 50 VAL A HG21 6  
ATOM 7917  H HG22 . VAL A 1 50 ? 88.839  -4.067  -8.050  1.00 0.00 ? 50 VAL A HG22 6  
ATOM 7918  H HG23 . VAL A 1 50 ? 88.193  -2.434  -8.204  1.00 0.00 ? 50 VAL A HG23 6  
ATOM 7919  N N    . LEU A 1 51 ? 87.364  -1.091  -10.503 1.00 0.00 ? 51 LEU A N    6  
ATOM 7920  C CA   . LEU A 1 51 ? 87.337  0.361   -10.343 1.00 0.00 ? 51 LEU A CA   6  
ATOM 7921  C C    . LEU A 1 51 ? 86.334  0.995   -11.296 1.00 0.00 ? 51 LEU A C    6  
ATOM 7922  O O    . LEU A 1 51 ? 85.456  1.746   -10.872 1.00 0.00 ? 51 LEU A O    6  
ATOM 7923  C CB   . LEU A 1 51 ? 88.737  0.941   -10.583 1.00 0.00 ? 51 LEU A CB   6  
ATOM 7924  C CG   . LEU A 1 51 ? 88.733  2.469   -10.408 1.00 0.00 ? 51 LEU A CG   6  
ATOM 7925  C CD1  . LEU A 1 51 ? 88.273  2.844   -8.988  1.00 0.00 ? 51 LEU A CD1  6  
ATOM 7926  C CD2  . LEU A 1 51 ? 90.153  2.998   -10.644 1.00 0.00 ? 51 LEU A CD2  6  
ATOM 7927  H H    . LEU A 1 51 ? 88.169  -1.530  -10.869 1.00 0.00 ? 51 LEU A H    6  
ATOM 7928  H HA   . LEU A 1 51 ? 87.029  0.587   -9.336  1.00 0.00 ? 51 LEU A HA   6  
ATOM 7929  H HB2  . LEU A 1 51 ? 89.428  0.504   -9.876  1.00 0.00 ? 51 LEU A HB2  6  
ATOM 7930  H HB3  . LEU A 1 51 ? 89.054  0.699   -11.587 1.00 0.00 ? 51 LEU A HB3  6  
ATOM 7931  H HG   . LEU A 1 51 ? 88.063  2.913   -11.128 1.00 0.00 ? 51 LEU A HG   6  
ATOM 7932  H HD11 . LEU A 1 51 ? 87.195  2.867   -8.955  1.00 0.00 ? 51 LEU A HD11 6  
ATOM 7933  H HD12 . LEU A 1 51 ? 88.657  3.820   -8.724  1.00 0.00 ? 51 LEU A HD12 6  
ATOM 7934  H HD13 . LEU A 1 51 ? 88.639  2.113   -8.280  1.00 0.00 ? 51 LEU A HD13 6  
ATOM 7935  H HD21 . LEU A 1 51 ? 90.777  2.744   -9.800  1.00 0.00 ? 51 LEU A HD21 6  
ATOM 7936  H HD22 . LEU A 1 51 ? 90.123  4.071   -10.759 1.00 0.00 ? 51 LEU A HD22 6  
ATOM 7937  H HD23 . LEU A 1 51 ? 90.559  2.551   -11.539 1.00 0.00 ? 51 LEU A HD23 6  
ATOM 7938  N N    . LYS A 1 52 ? 86.462  0.688   -12.579 1.00 0.00 ? 52 LYS A N    6  
ATOM 7939  C CA   . LYS A 1 52 ? 85.553  1.240   -13.578 1.00 0.00 ? 52 LYS A CA   6  
ATOM 7940  C C    . LYS A 1 52 ? 84.124  0.764   -13.330 1.00 0.00 ? 52 LYS A C    6  
ATOM 7941  O O    . LYS A 1 52 ? 83.189  1.555   -13.365 1.00 0.00 ? 52 LYS A O    6  
ATOM 7942  C CB   . LYS A 1 52 ? 86.012  0.807   -14.980 1.00 0.00 ? 52 LYS A CB   6  
ATOM 7943  C CG   . LYS A 1 52 ? 87.151  1.709   -15.476 1.00 0.00 ? 52 LYS A CG   6  
ATOM 7944  C CD   . LYS A 1 52 ? 88.246  1.827   -14.409 1.00 0.00 ? 52 LYS A CD   6  
ATOM 7945  C CE   . LYS A 1 52 ? 89.457  2.549   -14.998 1.00 0.00 ? 52 LYS A CE   6  
ATOM 7946  N NZ   . LYS A 1 52 ? 90.502  2.701   -13.947 1.00 0.00 ? 52 LYS A NZ   6  
ATOM 7947  H H    . LYS A 1 52 ? 87.180  0.080   -12.861 1.00 0.00 ? 52 LYS A H    6  
ATOM 7948  H HA   . LYS A 1 52 ? 85.569  2.320   -13.522 1.00 0.00 ? 52 LYS A HA   6  
ATOM 7949  H HB2  . LYS A 1 52 ? 86.358  -0.216  -14.940 1.00 0.00 ? 52 LYS A HB2  6  
ATOM 7950  H HB3  . LYS A 1 52 ? 85.181  0.875   -15.670 1.00 0.00 ? 52 LYS A HB3  6  
ATOM 7951  H HG2  . LYS A 1 52 ? 87.574  1.285   -16.374 1.00 0.00 ? 52 LYS A HG2  6  
ATOM 7952  H HG3  . LYS A 1 52 ? 86.762  2.689   -15.697 1.00 0.00 ? 52 LYS A HG3  6  
ATOM 7953  H HD2  . LYS A 1 52 ? 87.876  2.387   -13.563 1.00 0.00 ? 52 LYS A HD2  6  
ATOM 7954  H HD3  . LYS A 1 52 ? 88.542  0.843   -14.086 1.00 0.00 ? 52 LYS A HD3  6  
ATOM 7955  H HE2  . LYS A 1 52 ? 89.854  1.975   -15.822 1.00 0.00 ? 52 LYS A HE2  6  
ATOM 7956  H HE3  . LYS A 1 52 ? 89.156  3.525   -15.350 1.00 0.00 ? 52 LYS A HE3  6  
ATOM 7957  H HZ1  . LYS A 1 52 ? 91.402  2.976   -14.388 1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 7958  H HZ2  . LYS A 1 52 ? 90.622  1.797   -13.445 1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 7959  H HZ3  . LYS A 1 52 ? 90.212  3.436   -13.271 1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 7960  N N    . THR A 1 53 ? 83.958  -0.528  -13.103 1.00 0.00 ? 53 THR A N    6  
ATOM 7961  C CA   . THR A 1 53 ? 82.626  -1.082  -12.887 1.00 0.00 ? 53 THR A CA   6  
ATOM 7962  C C    . THR A 1 53 ? 81.963  -0.566  -11.607 1.00 0.00 ? 53 THR A C    6  
ATOM 7963  O O    . THR A 1 53 ? 80.767  -0.297  -11.600 1.00 0.00 ? 53 THR A O    6  
ATOM 7964  C CB   . THR A 1 53 ? 82.701  -2.609  -12.833 1.00 0.00 ? 53 THR A CB   6  
ATOM 7965  O OG1  . THR A 1 53 ? 83.605  -3.002  -11.813 1.00 0.00 ? 53 THR A OG1  6  
ATOM 7966  C CG2  . THR A 1 53 ? 83.180  -3.149  -14.181 1.00 0.00 ? 53 THR A CG2  6  
ATOM 7967  H H    . THR A 1 53 ? 84.736  -1.125  -13.103 1.00 0.00 ? 53 THR A H    6  
ATOM 7968  H HA   . THR A 1 53 ? 82.004  -0.807  -13.726 1.00 0.00 ? 53 THR A HA   6  
ATOM 7969  H HB   . THR A 1 53 ? 81.721  -3.010  -12.619 1.00 0.00 ? 53 THR A HB   6  
ATOM 7970  H HG1  . THR A 1 53 ? 84.127  -2.235  -11.568 1.00 0.00 ? 53 THR A HG1  6  
ATOM 7971  H HG21 . THR A 1 53 ? 82.375  -3.092  -14.899 1.00 0.00 ? 53 THR A HG21 6  
ATOM 7972  H HG22 . THR A 1 53 ? 83.488  -4.178  -14.066 1.00 0.00 ? 53 THR A HG22 6  
ATOM 7973  H HG23 . THR A 1 53 ? 84.015  -2.561  -14.529 1.00 0.00 ? 53 THR A HG23 6  
ATOM 7974  N N    . ILE A 1 54 ? 82.708  -0.465  -10.513 1.00 0.00 ? 54 ILE A N    6  
ATOM 7975  C CA   . ILE A 1 54 ? 82.102  -0.027  -9.253  1.00 0.00 ? 54 ILE A CA   6  
ATOM 7976  C C    . ILE A 1 54 ? 81.738  1.454   -9.246  1.00 0.00 ? 54 ILE A C    6  
ATOM 7977  O O    . ILE A 1 54 ? 80.647  1.815   -8.808  1.00 0.00 ? 54 ILE A O    6  
ATOM 7978  C CB   . ILE A 1 54 ? 83.035  -0.344  -8.076  1.00 0.00 ? 54 ILE A CB   6  
ATOM 7979  C CG1  . ILE A 1 54 ? 83.149  -1.862  -7.916  1.00 0.00 ? 54 ILE A CG1  6  
ATOM 7980  C CG2  . ILE A 1 54 ? 82.470  0.253   -6.782  1.00 0.00 ? 54 ILE A CG2  6  
ATOM 7981  C CD1  . ILE A 1 54 ? 84.301  -2.190  -6.963  1.00 0.00 ? 54 ILE A CD1  6  
ATOM 7982  H H    . ILE A 1 54 ? 83.660  -0.714  -10.538 1.00 0.00 ? 54 ILE A H    6  
ATOM 7983  H HA   . ILE A 1 54 ? 81.188  -0.583  -9.121  1.00 0.00 ? 54 ILE A HA   6  
ATOM 7984  H HB   . ILE A 1 54 ? 84.012  0.076   -8.268  1.00 0.00 ? 54 ILE A HB   6  
ATOM 7985  H HG12 . ILE A 1 54 ? 82.226  -2.250  -7.511  1.00 0.00 ? 54 ILE A HG12 6  
ATOM 7986  H HG13 . ILE A 1 54 ? 83.338  -2.314  -8.877  1.00 0.00 ? 54 ILE A HG13 6  
ATOM 7987  H HG21 . ILE A 1 54 ? 82.610  1.324   -6.788  1.00 0.00 ? 54 ILE A HG21 6  
ATOM 7988  H HG22 . ILE A 1 54 ? 82.985  -0.172  -5.933  1.00 0.00 ? 54 ILE A HG22 6  
ATOM 7989  H HG23 . ILE A 1 54 ? 81.416  0.029   -6.712  1.00 0.00 ? 54 ILE A HG23 6  
ATOM 7990  H HD11 . ILE A 1 54 ? 85.223  -1.797  -7.364  1.00 0.00 ? 54 ILE A HD11 6  
ATOM 7991  H HD12 . ILE A 1 54 ? 84.383  -3.261  -6.852  1.00 0.00 ? 54 ILE A HD12 6  
ATOM 7992  H HD13 . ILE A 1 54 ? 84.108  -1.742  -5.999  1.00 0.00 ? 54 ILE A HD13 6  
ATOM 7993  N N    . VAL A 1 55 ? 82.641  2.314   -9.687  1.00 0.00 ? 55 VAL A N    6  
ATOM 7994  C CA   . VAL A 1 55 ? 82.356  3.746   -9.676  1.00 0.00 ? 55 VAL A CA   6  
ATOM 7995  C C    . VAL A 1 55 ? 81.381  4.136   -10.789 1.00 0.00 ? 55 VAL A C    6  
ATOM 7996  O O    . VAL A 1 55 ? 80.571  5.047   -10.621 1.00 0.00 ? 55 VAL A O    6  
ATOM 7997  C CB   . VAL A 1 55 ? 83.660  4.540   -9.818  1.00 0.00 ? 55 VAL A CB   6  
ATOM 7998  C CG1  . VAL A 1 55 ? 84.670  4.033   -8.784  1.00 0.00 ? 55 VAL A CG1  6  
ATOM 7999  C CG2  . VAL A 1 55 ? 84.234  4.372   -11.239 1.00 0.00 ? 55 VAL A CG2  6  
ATOM 8000  H H    . VAL A 1 55 ? 83.512  1.990   -10.005 1.00 0.00 ? 55 VAL A H    6  
ATOM 8001  H HA   . VAL A 1 55 ? 81.908  3.999   -8.726  1.00 0.00 ? 55 VAL A HA   6  
ATOM 8002  H HB   . VAL A 1 55 ? 83.458  5.586   -9.631  1.00 0.00 ? 55 VAL A HB   6  
ATOM 8003  H HG11 . VAL A 1 55 ? 84.843  2.978   -8.937  1.00 0.00 ? 55 VAL A HG11 6  
ATOM 8004  H HG12 . VAL A 1 55 ? 84.280  4.194   -7.790  1.00 0.00 ? 55 VAL A HG12 6  
ATOM 8005  H HG13 . VAL A 1 55 ? 85.599  4.572   -8.897  1.00 0.00 ? 55 VAL A HG13 6  
ATOM 8006  H HG21 . VAL A 1 55 ? 83.802  5.119   -11.889 1.00 0.00 ? 55 VAL A HG21 6  
ATOM 8007  H HG22 . VAL A 1 55 ? 83.997  3.389   -11.617 1.00 0.00 ? 55 VAL A HG22 6  
ATOM 8008  H HG23 . VAL A 1 55 ? 85.309  4.497   -11.218 1.00 0.00 ? 55 VAL A HG23 6  
ATOM 8009  N N    . LEU A 1 56 ? 81.484  3.466   -11.932 1.00 0.00 ? 56 LEU A N    6  
ATOM 8010  C CA   . LEU A 1 56 ? 80.632  3.773   -13.076 1.00 0.00 ? 56 LEU A CA   6  
ATOM 8011  C C    . LEU A 1 56 ? 79.213  3.197   -12.959 1.00 0.00 ? 56 LEU A C    6  
ATOM 8012  O O    . LEU A 1 56 ? 78.248  3.857   -13.345 1.00 0.00 ? 56 LEU A O    6  
ATOM 8013  C CB   . LEU A 1 56 ? 81.292  3.233   -14.345 1.00 0.00 ? 56 LEU A CB   6  
ATOM 8014  C CG   . LEU A 1 56 ? 80.643  3.855   -15.598 1.00 0.00 ? 56 LEU A CG   6  
ATOM 8015  C CD1  . LEU A 1 56 ? 81.305  5.199   -15.923 1.00 0.00 ? 56 LEU A CD1  6  
ATOM 8016  C CD2  . LEU A 1 56 ? 80.821  2.914   -16.795 1.00 0.00 ? 56 LEU A CD2  6  
ATOM 8017  H H    . LEU A 1 56 ? 82.161  2.763   -12.022 1.00 0.00 ? 56 LEU A H    6  
ATOM 8018  H HA   . LEU A 1 56 ? 80.556  4.843   -13.164 1.00 0.00 ? 56 LEU A HA   6  
ATOM 8019  H HB2  . LEU A 1 56 ? 82.345  3.473   -14.324 1.00 0.00 ? 56 LEU A HB2  6  
ATOM 8020  H HB3  . LEU A 1 56 ? 81.172  2.160   -14.365 1.00 0.00 ? 56 LEU A HB3  6  
ATOM 8021  H HG   . LEU A 1 56 ? 79.589  4.012   -15.420 1.00 0.00 ? 56 LEU A HG   6  
ATOM 8022  H HD11 . LEU A 1 56 ? 81.093  5.908   -15.138 1.00 0.00 ? 56 LEU A HD11 6  
ATOM 8023  H HD12 . LEU A 1 56 ? 80.917  5.574   -16.859 1.00 0.00 ? 56 LEU A HD12 6  
ATOM 8024  H HD13 . LEU A 1 56 ? 82.373  5.064   -16.007 1.00 0.00 ? 56 LEU A HD13 6  
ATOM 8025  H HD21 . LEU A 1 56 ? 81.872  2.717   -16.944 1.00 0.00 ? 56 LEU A HD21 6  
ATOM 8026  H HD22 . LEU A 1 56 ? 80.412  3.378   -17.682 1.00 0.00 ? 56 LEU A HD22 6  
ATOM 8027  H HD23 . LEU A 1 56 ? 80.304  1.985   -16.605 1.00 0.00 ? 56 LEU A HD23 6  
ATOM 8028  N N    . ILE A 1 57 ? 79.080  1.963   -12.470 1.00 0.00 ? 57 ILE A N    6  
ATOM 8029  C CA   . ILE A 1 57 ? 77.755  1.336   -12.378 1.00 0.00 ? 57 ILE A CA   6  
ATOM 8030  C C    . ILE A 1 57 ? 76.722  2.194   -11.622 1.00 0.00 ? 57 ILE A C    6  
ATOM 8031  O O    . ILE A 1 57 ? 75.627  2.415   -12.139 1.00 0.00 ? 57 ILE A O    6  
ATOM 8032  C CB   . ILE A 1 57 ? 77.874  -0.068  -11.738 1.00 0.00 ? 57 ILE A CB   6  
ATOM 8033  C CG1  . ILE A 1 57 ? 78.396  -1.067  -12.785 1.00 0.00 ? 57 ILE A CG1  6  
ATOM 8034  C CG2  . ILE A 1 57 ? 76.504  -0.555  -11.240 1.00 0.00 ? 57 ILE A CG2  6  
ATOM 8035  C CD1  . ILE A 1 57 ? 78.805  -2.376  -12.102 1.00 0.00 ? 57 ILE A CD1  6  
ATOM 8036  H H    . ILE A 1 57 ? 79.880  1.454   -12.191 1.00 0.00 ? 57 ILE A H    6  
ATOM 8037  H HA   . ILE A 1 57 ? 77.386  1.214   -13.386 1.00 0.00 ? 57 ILE A HA   6  
ATOM 8038  H HB   . ILE A 1 57 ? 78.558  -0.024  -10.906 1.00 0.00 ? 57 ILE A HB   6  
ATOM 8039  H HG12 . ILE A 1 57 ? 77.614  -1.269  -13.503 1.00 0.00 ? 57 ILE A HG12 6  
ATOM 8040  H HG13 . ILE A 1 57 ? 79.246  -0.646  -13.297 1.00 0.00 ? 57 ILE A HG13 6  
ATOM 8041  H HG21 . ILE A 1 57 ? 76.238  -0.022  -10.340 1.00 0.00 ? 57 ILE A HG21 6  
ATOM 8042  H HG22 . ILE A 1 57 ? 76.550  -1.613  -11.030 1.00 0.00 ? 57 ILE A HG22 6  
ATOM 8043  H HG23 . ILE A 1 57 ? 75.760  -0.371  -12.000 1.00 0.00 ? 57 ILE A HG23 6  
ATOM 8044  H HD11 . ILE A 1 57 ? 79.377  -2.977  -12.793 1.00 0.00 ? 57 ILE A HD11 6  
ATOM 8045  H HD12 . ILE A 1 57 ? 77.918  -2.918  -11.805 1.00 0.00 ? 57 ILE A HD12 6  
ATOM 8046  H HD13 . ILE A 1 57 ? 79.402  -2.163  -11.229 1.00 0.00 ? 57 ILE A HD13 6  
ATOM 8047  N N    . PRO A 1 58 ? 76.994  2.650   -10.420 1.00 0.00 ? 58 PRO A N    6  
ATOM 8048  C CA   . PRO A 1 58 ? 75.993  3.445   -9.649  1.00 0.00 ? 58 PRO A CA   6  
ATOM 8049  C C    . PRO A 1 58 ? 75.423  4.608   -10.461 1.00 0.00 ? 58 PRO A C    6  
ATOM 8050  O O    . PRO A 1 58 ? 74.214  4.840   -10.456 1.00 0.00 ? 58 PRO A O    6  
ATOM 8051  C CB   . PRO A 1 58 ? 76.757  3.926   -8.393  1.00 0.00 ? 58 PRO A CB   6  
ATOM 8052  C CG   . PRO A 1 58 ? 78.206  3.616   -8.644  1.00 0.00 ? 58 PRO A CG   6  
ATOM 8053  C CD   . PRO A 1 58 ? 78.245  2.480   -9.670  1.00 0.00 ? 58 PRO A CD   6  
ATOM 8054  H HA   . PRO A 1 58 ? 75.183  2.798   -9.350  1.00 0.00 ? 58 PRO A HA   6  
ATOM 8055  H HB2  . PRO A 1 58 ? 76.618  4.992   -8.247  1.00 0.00 ? 58 PRO A HB2  6  
ATOM 8056  H HB3  . PRO A 1 58 ? 76.413  3.389   -7.518  1.00 0.00 ? 58 PRO A HB3  6  
ATOM 8057  H HG2  . PRO A 1 58 ? 78.710  4.492   -9.038  1.00 0.00 ? 58 PRO A HG2  6  
ATOM 8058  H HG3  . PRO A 1 58 ? 78.688  3.297   -7.730  1.00 0.00 ? 58 PRO A HG3  6  
ATOM 8059  H HD2  . PRO A 1 58 ? 79.099  2.596   -10.312 1.00 0.00 ? 58 PRO A HD2  6  
ATOM 8060  H HD3  . PRO A 1 58 ? 78.261  1.520   -9.179  1.00 0.00 ? 58 PRO A HD3  6  
ATOM 8061  N N    . PHE A 1 59 ? 76.286  5.330   -11.161 1.00 0.00 ? 59 PHE A N    6  
ATOM 8062  C CA   . PHE A 1 59 ? 75.843  6.446   -11.964 1.00 0.00 ? 59 PHE A CA   6  
ATOM 8063  C C    . PHE A 1 59 ? 75.183  5.939   -13.246 1.00 0.00 ? 59 PHE A C    6  
ATOM 8064  O O    . PHE A 1 59 ? 74.023  6.250   -13.515 1.00 0.00 ? 59 PHE A O    6  
ATOM 8065  C CB   . PHE A 1 59 ? 77.036  7.350   -12.290 1.00 0.00 ? 59 PHE A CB   6  
ATOM 8066  C CG   . PHE A 1 59 ? 77.332  8.258   -11.110 1.00 0.00 ? 59 PHE A CG   6  
ATOM 8067  C CD1  . PHE A 1 59 ? 77.657  7.707   -9.862  1.00 0.00 ? 59 PHE A CD1  6  
ATOM 8068  C CD2  . PHE A 1 59 ? 77.278  9.648   -11.264 1.00 0.00 ? 59 PHE A CD2  6  
ATOM 8069  C CE1  . PHE A 1 59 ? 77.929  8.545   -8.774  1.00 0.00 ? 59 PHE A CE1  6  
ATOM 8070  C CE2  . PHE A 1 59 ? 77.551  10.487  -10.176 1.00 0.00 ? 59 PHE A CE2  6  
ATOM 8071  C CZ   . PHE A 1 59 ? 77.876  9.935   -8.931  1.00 0.00 ? 59 PHE A CZ   6  
ATOM 8072  H H    . PHE A 1 59 ? 77.232  5.112   -11.141 1.00 0.00 ? 59 PHE A H    6  
ATOM 8073  H HA   . PHE A 1 59 ? 75.112  7.014   -11.404 1.00 0.00 ? 59 PHE A HA   6  
ATOM 8074  H HB2  . PHE A 1 59 ? 77.910  6.755   -12.517 1.00 0.00 ? 59 PHE A HB2  6  
ATOM 8075  H HB3  . PHE A 1 59 ? 76.797  7.936   -13.138 1.00 0.00 ? 59 PHE A HB3  6  
ATOM 8076  H HD1  . PHE A 1 59 ? 77.700  6.636   -9.738  1.00 0.00 ? 59 PHE A HD1  6  
ATOM 8077  H HD2  . PHE A 1 59 ? 77.028  10.074  -12.224 1.00 0.00 ? 59 PHE A HD2  6  
ATOM 8078  H HE1  . PHE A 1 59 ? 78.181  8.121   -7.814  1.00 0.00 ? 59 PHE A HE1  6  
ATOM 8079  H HE2  . PHE A 1 59 ? 77.510  11.559  -10.295 1.00 0.00 ? 59 PHE A HE2  6  
ATOM 8080  H HZ   . PHE A 1 59 ? 78.088  10.582  -8.092  1.00 0.00 ? 59 PHE A HZ   6  
ATOM 8081  N N    . LEU A 1 60 ? 75.917  5.150   -14.029 1.00 0.00 ? 60 LEU A N    6  
ATOM 8082  C CA   . LEU A 1 60 ? 75.365  4.610   -15.268 1.00 0.00 ? 60 LEU A CA   6  
ATOM 8083  C C    . LEU A 1 60 ? 73.952  4.071   -15.021 1.00 0.00 ? 60 LEU A C    6  
ATOM 8084  O O    . LEU A 1 60 ? 73.065  4.219   -15.861 1.00 0.00 ? 60 LEU A O    6  
ATOM 8085  C CB   . LEU A 1 60 ? 76.280  3.487   -15.799 1.00 0.00 ? 60 LEU A CB   6  
ATOM 8086  C CG   . LEU A 1 60 ? 76.243  3.415   -17.341 1.00 0.00 ? 60 LEU A CG   6  
ATOM 8087  C CD1  . LEU A 1 60 ? 74.792  3.319   -17.830 1.00 0.00 ? 60 LEU A CD1  6  
ATOM 8088  C CD2  . LEU A 1 60 ? 76.923  4.656   -17.963 1.00 0.00 ? 60 LEU A CD2  6  
ATOM 8089  H H    . LEU A 1 60 ? 76.839  4.925   -13.772 1.00 0.00 ? 60 LEU A H    6  
ATOM 8090  H HA   . LEU A 1 60 ? 75.312  5.403   -15.996 1.00 0.00 ? 60 LEU A HA   6  
ATOM 8091  H HB2  . LEU A 1 60 ? 77.291  3.678   -15.479 1.00 0.00 ? 60 LEU A HB2  6  
ATOM 8092  H HB3  . LEU A 1 60 ? 75.961  2.536   -15.393 1.00 0.00 ? 60 LEU A HB3  6  
ATOM 8093  H HG   . LEU A 1 60 ? 76.773  2.527   -17.658 1.00 0.00 ? 60 LEU A HG   6  
ATOM 8094  H HD11 . LEU A 1 60 ? 74.235  2.656   -17.185 1.00 0.00 ? 60 LEU A HD11 6  
ATOM 8095  H HD12 . LEU A 1 60 ? 74.779  2.931   -18.839 1.00 0.00 ? 60 LEU A HD12 6  
ATOM 8096  H HD13 . LEU A 1 60 ? 74.342  4.299   -17.818 1.00 0.00 ? 60 LEU A HD13 6  
ATOM 8097  H HD21 . LEU A 1 60 ? 77.702  5.019   -17.310 1.00 0.00 ? 60 LEU A HD21 6  
ATOM 8098  H HD22 . LEU A 1 60 ? 76.195  5.440   -18.121 1.00 0.00 ? 60 LEU A HD22 6  
ATOM 8099  H HD23 . LEU A 1 60 ? 77.358  4.381   -18.912 1.00 0.00 ? 60 LEU A HD23 6  
ATOM 8100  N N    . GLU A 1 61 ? 73.751  3.449   -13.860 1.00 0.00 ? 61 GLU A N    6  
ATOM 8101  C CA   . GLU A 1 61 ? 72.441  2.899   -13.516 1.00 0.00 ? 61 GLU A CA   6  
ATOM 8102  C C    . GLU A 1 61 ? 71.526  3.994   -12.976 1.00 0.00 ? 61 GLU A C    6  
ATOM 8103  O O    . GLU A 1 61 ? 71.738  4.507   -11.877 1.00 0.00 ? 61 GLU A O    6  
ATOM 8104  C CB   . GLU A 1 61 ? 72.593  1.795   -12.466 1.00 0.00 ? 61 GLU A CB   6  
ATOM 8105  C CG   . GLU A 1 61 ? 73.184  0.542   -13.116 1.00 0.00 ? 61 GLU A CG   6  
ATOM 8106  C CD   . GLU A 1 61 ? 72.159  -0.096  -14.050 1.00 0.00 ? 61 GLU A CD   6  
ATOM 8107  O OE1  . GLU A 1 61 ? 71.068  -0.389  -13.589 1.00 0.00 ? 61 GLU A OE1  6  
ATOM 8108  O OE2  . GLU A 1 61 ? 72.482  -0.283  -15.210 1.00 0.00 ? 61 GLU A OE2  6  
ATOM 8109  H H    . GLU A 1 61 ? 74.492  3.362   -13.221 1.00 0.00 ? 61 GLU A H    6  
ATOM 8110  H HA   . GLU A 1 61 ? 71.993  2.478   -14.404 1.00 0.00 ? 61 GLU A HA   6  
ATOM 8111  H HB2  . GLU A 1 61 ? 73.250  2.136   -11.679 1.00 0.00 ? 61 GLU A HB2  6  
ATOM 8112  H HB3  . GLU A 1 61 ? 71.625  1.559   -12.049 1.00 0.00 ? 61 GLU A HB3  6  
ATOM 8113  H HG2  . GLU A 1 61 ? 74.064  0.811   -13.679 1.00 0.00 ? 61 GLU A HG2  6  
ATOM 8114  H HG3  . GLU A 1 61 ? 73.452  -0.167  -12.346 1.00 0.00 ? 61 GLU A HG3  6  
ATOM 8115  N N    . GLN A 1 62 ? 70.506  4.344   -13.754 1.00 0.00 ? 62 GLN A N    6  
ATOM 8116  C CA   . GLN A 1 62 ? 69.562  5.377   -13.342 1.00 0.00 ? 62 GLN A CA   6  
ATOM 8117  C C    . GLN A 1 62 ? 68.700  4.882   -12.184 1.00 0.00 ? 62 GLN A C    6  
ATOM 8118  O O    . GLN A 1 62 ? 68.165  5.677   -11.411 1.00 0.00 ? 62 GLN A O    6  
ATOM 8119  C CB   . GLN A 1 62 ? 68.664  5.762   -14.519 1.00 0.00 ? 62 GLN A CB   6  
ATOM 8120  C CG   . GLN A 1 62 ? 69.523  6.310   -15.660 1.00 0.00 ? 62 GLN A CG   6  
ATOM 8121  C CD   . GLN A 1 62 ? 70.166  7.628   -15.243 1.00 0.00 ? 62 GLN A CD   6  
ATOM 8122  O OE1  . GLN A 1 62 ? 69.500  8.492   -14.671 1.00 0.00 ? 62 GLN A OE1  6  
ATOM 8123  N NE2  . GLN A 1 62 ? 71.430  7.837   -15.495 1.00 0.00 ? 62 GLN A NE2  6  
ATOM 8124  H H    . GLN A 1 62 ? 70.386  3.899   -14.618 1.00 0.00 ? 62 GLN A H    6  
ATOM 8125  H HA   . GLN A 1 62 ? 70.112  6.248   -13.022 1.00 0.00 ? 62 GLN A HA   6  
ATOM 8126  H HB2  . GLN A 1 62 ? 68.124  4.891   -14.861 1.00 0.00 ? 62 GLN A HB2  6  
ATOM 8127  H HB3  . GLN A 1 62 ? 67.962  6.520   -14.204 1.00 0.00 ? 62 GLN A HB3  6  
ATOM 8128  H HG2  . GLN A 1 62 ? 70.296  5.595   -15.902 1.00 0.00 ? 62 GLN A HG2  6  
ATOM 8129  H HG3  . GLN A 1 62 ? 68.904  6.475   -16.529 1.00 0.00 ? 62 GLN A HG3  6  
ATOM 8130  H HE21 . GLN A 1 62 ? 71.958  7.150   -15.951 1.00 0.00 ? 62 GLN A HE21 6  
ATOM 8131  H HE22 . GLN A 1 62 ? 71.850  8.682   -15.228 1.00 0.00 ? 62 GLN A HE22 6  
ATOM 8132  N N    . ASN A 1 63 ? 68.570  3.564   -12.070 1.00 0.00 ? 63 ASN A N    6  
ATOM 8133  C CA   . ASN A 1 63 ? 67.770  2.974   -11.002 1.00 0.00 ? 63 ASN A CA   6  
ATOM 8134  C C    . ASN A 1 63 ? 68.169  3.558   -9.651  1.00 0.00 ? 63 ASN A C    6  
ATOM 8135  C CB   . ASN A 1 63 ? 67.964  1.456   -10.982 1.00 0.00 ? 63 ASN A CB   6  
ATOM 8136  C CG   . ASN A 1 63 ? 67.348  0.836   -12.232 1.00 0.00 ? 63 ASN A CG   6  
ATOM 8137  O OD1  . ASN A 1 63 ? 68.065  0.476   -13.165 1.00 0.00 ? 63 ASN A OD1  6  
ATOM 8138  N ND2  . ASN A 1 63 ? 66.053  0.688   -12.304 1.00 0.00 ? 63 ASN A ND2  6  
ATOM 8139  H H    . ASN A 1 63 ? 69.018  2.978   -12.715 1.00 0.00 ? 63 ASN A H    6  
ATOM 8140  H HA   . ASN A 1 63 ? 66.729  3.190   -11.183 1.00 0.00 ? 63 ASN A HA   6  
ATOM 8141  H HB2  . ASN A 1 63 ? 69.019  1.230   -10.952 1.00 0.00 ? 63 ASN A HB2  6  
ATOM 8142  H HB3  . ASN A 1 63 ? 67.484  1.046   -10.106 1.00 0.00 ? 63 ASN A HB3  6  
ATOM 8143  H HD21 . ASN A 1 63 ? 65.484  0.976   -11.560 1.00 0.00 ? 63 ASN A HD21 6  
ATOM 8144  H HD22 . ASN A 1 63 ? 65.649  0.291   -13.105 1.00 0.00 ? 63 ASN A HD22 6  
ATOM 8145  N N    . CYS B 2 1  ? 69.488  20.125  -14.109 1.00 0.00 ? 1  CYS B N    6  
ATOM 8146  C CA   . CYS B 2 1  ? 69.334  18.642  -14.090 1.00 0.00 ? 1  CYS B CA   6  
ATOM 8147  C C    . CYS B 2 1  ? 70.457  18.027  -13.263 1.00 0.00 ? 1  CYS B C    6  
ATOM 8148  O O    . CYS B 2 1  ? 70.652  16.811  -13.271 1.00 0.00 ? 1  CYS B O    6  
ATOM 8149  C CB   . CYS B 2 1  ? 69.391  18.108  -15.522 1.00 0.00 ? 1  CYS B CB   6  
ATOM 8150  S SG   . CYS B 2 1  ? 68.279  19.073  -16.575 1.00 0.00 ? 1  CYS B SG   6  
ATOM 8151  H HA   . CYS B 2 1  ? 68.382  18.386  -13.649 1.00 0.00 ? 1  CYS B HA   6  
ATOM 8152  H HB2  . CYS B 2 1  ? 70.400  18.188  -15.897 1.00 0.00 ? 1  CYS B HB2  6  
ATOM 8153  H HB3  . CYS B 2 1  ? 69.085  17.072  -15.532 1.00 0.00 ? 1  CYS B HB3  6  
ATOM 8154  N N    . SER B 2 2  ? 71.194  18.874  -12.552 1.00 0.00 ? 2  SER B N    6  
ATOM 8155  C CA   . SER B 2 2  ? 72.298  18.399  -11.724 1.00 0.00 ? 2  SER B CA   6  
ATOM 8156  C C    . SER B 2 2  ? 73.286  17.594  -12.562 1.00 0.00 ? 2  SER B C    6  
ATOM 8157  O O    . SER B 2 2  ? 72.991  16.477  -12.985 1.00 0.00 ? 2  SER B O    6  
ATOM 8158  C CB   . SER B 2 2  ? 71.761  17.527  -10.589 1.00 0.00 ? 2  SER B CB   6  
ATOM 8159  O OG   . SER B 2 2  ? 70.739  18.233  -9.898  1.00 0.00 ? 2  SER B OG   6  
ATOM 8160  H H    . SER B 2 2  ? 70.994  19.832  -12.585 1.00 0.00 ? 2  SER B H    6  
ATOM 8161  H HA   . SER B 2 2  ? 72.809  19.250  -11.299 1.00 0.00 ? 2  SER B HA   6  
ATOM 8162  H HB2  . SER B 2 2  ? 71.351  16.616  -10.995 1.00 0.00 ? 2  SER B HB2  6  
ATOM 8163  H HB3  . SER B 2 2  ? 72.569  17.284  -9.911  1.00 0.00 ? 2  SER B HB3  6  
ATOM 8164  H HG   . SER B 2 2  ? 69.953  18.230  -10.447 1.00 0.00 ? 2  SER B HG   6  
ATOM 8165  N N    . THR B 2 3  ? 74.459  18.170  -12.799 1.00 0.00 ? 3  THR B N    6  
ATOM 8166  C CA   . THR B 2 3  ? 75.483  17.496  -13.589 1.00 0.00 ? 3  THR B CA   6  
ATOM 8167  C C    . THR B 2 3  ? 76.035  16.294  -12.833 1.00 0.00 ? 3  THR B C    6  
ATOM 8168  O O    . THR B 2 3  ? 76.185  16.331  -11.611 1.00 0.00 ? 3  THR B O    6  
ATOM 8169  C CB   . THR B 2 3  ? 76.622  18.467  -13.909 1.00 0.00 ? 3  THR B CB   6  
ATOM 8170  O OG1  . THR B 2 3  ? 77.342  18.759  -12.720 1.00 0.00 ? 3  THR B OG1  6  
ATOM 8171  C CG2  . THR B 2 3  ? 76.045  19.758  -14.490 1.00 0.00 ? 3  THR B CG2  6  
ATOM 8172  H H    . THR B 2 3  ? 74.641  19.063  -12.438 1.00 0.00 ? 3  THR B H    6  
ATOM 8173  H HA   . THR B 2 3  ? 75.044  17.156  -14.515 1.00 0.00 ? 3  THR B HA   6  
ATOM 8174  H HB   . THR B 2 3  ? 77.286  18.017  -14.632 1.00 0.00 ? 3  THR B HB   6  
ATOM 8175  H HG1  . THR B 2 3  ? 76.758  18.607  -11.974 1.00 0.00 ? 3  THR B HG1  6  
ATOM 8176  H HG21 . THR B 2 3  ? 75.476  19.530  -15.381 1.00 0.00 ? 3  THR B HG21 6  
ATOM 8177  H HG22 . THR B 2 3  ? 76.852  20.432  -14.741 1.00 0.00 ? 3  THR B HG22 6  
ATOM 8178  H HG23 . THR B 2 3  ? 75.400  20.225  -13.761 1.00 0.00 ? 3  THR B HG23 6  
ATOM 8179  N N    . VAL B 2 4  ? 76.335  15.224  -13.567 1.00 0.00 ? 4  VAL B N    6  
ATOM 8180  C CA   . VAL B 2 4  ? 76.870  14.007  -12.960 1.00 0.00 ? 4  VAL B CA   6  
ATOM 8181  C C    . VAL B 2 4  ? 77.829  13.313  -13.922 1.00 0.00 ? 4  VAL B C    6  
ATOM 8182  O O    . VAL B 2 4  ? 78.925  12.909  -13.534 1.00 0.00 ? 4  VAL B O    6  
ATOM 8183  C CB   . VAL B 2 4  ? 75.724  13.063  -12.590 1.00 0.00 ? 4  VAL B CB   6  
ATOM 8184  C CG1  . VAL B 2 4  ? 74.735  13.795  -11.679 1.00 0.00 ? 4  VAL B CG1  6  
ATOM 8185  C CG2  . VAL B 2 4  ? 75.003  12.603  -13.861 1.00 0.00 ? 4  VAL B CG2  6  
ATOM 8186  H H    . VAL B 2 4  ? 76.193  15.254  -14.536 1.00 0.00 ? 4  VAL B H    6  
ATOM 8187  H HA   . VAL B 2 4  ? 77.412  14.266  -12.060 1.00 0.00 ? 4  VAL B HA   6  
ATOM 8188  H HB   . VAL B 2 4  ? 76.119  12.205  -12.069 1.00 0.00 ? 4  VAL B HB   6  
ATOM 8189  H HG11 . VAL B 2 4  ? 74.035  13.085  -11.264 1.00 0.00 ? 4  VAL B HG11 6  
ATOM 8190  H HG12 . VAL B 2 4  ? 74.198  14.536  -12.252 1.00 0.00 ? 4  VAL B HG12 6  
ATOM 8191  H HG13 . VAL B 2 4  ? 75.274  14.279  -10.878 1.00 0.00 ? 4  VAL B HG13 6  
ATOM 8192  H HG21 . VAL B 2 4  ? 74.040  12.187  -13.602 1.00 0.00 ? 4  VAL B HG21 6  
ATOM 8193  H HG22 . VAL B 2 4  ? 75.594  11.848  -14.357 1.00 0.00 ? 4  VAL B HG22 6  
ATOM 8194  H HG23 . VAL B 2 4  ? 74.864  13.445  -14.524 1.00 0.00 ? 4  VAL B HG23 6  
ATOM 8195  N N    . SER B 2 5  ? 77.414  13.185  -15.179 1.00 0.00 ? 5  SER B N    6  
ATOM 8196  C CA   . SER B 2 5  ? 78.252  12.547  -16.187 1.00 0.00 ? 5  SER B CA   6  
ATOM 8197  C C    . SER B 2 5  ? 79.690  13.073  -16.105 1.00 0.00 ? 5  SER B C    6  
ATOM 8198  O O    . SER B 2 5  ? 80.611  12.322  -15.790 1.00 0.00 ? 5  SER B O    6  
ATOM 8199  C CB   . SER B 2 5  ? 77.662  12.784  -17.587 1.00 0.00 ? 5  SER B CB   6  
ATOM 8200  O OG   . SER B 2 5  ? 76.919  11.636  -17.976 1.00 0.00 ? 5  SER B OG   6  
ATOM 8201  H H    . SER B 2 5  ? 76.533  13.530  -15.434 1.00 0.00 ? 5  SER B H    6  
ATOM 8202  H HA   . SER B 2 5  ? 78.267  11.484  -15.995 1.00 0.00 ? 5  SER B HA   6  
ATOM 8203  H HB2  . SER B 2 5  ? 77.003  13.635  -17.563 1.00 0.00 ? 5  SER B HB2  6  
ATOM 8204  H HB3  . SER B 2 5  ? 78.455  12.968  -18.303 1.00 0.00 ? 5  SER B HB3  6  
ATOM 8205  H HG   . SER B 2 5  ? 77.467  11.116  -18.567 1.00 0.00 ? 5  SER B HG   6  
ATOM 8206  N N    . PRO B 2 6  ? 79.909  14.335  -16.376 1.00 0.00 ? 6  PRO B N    6  
ATOM 8207  C CA   . PRO B 2 6  ? 81.279  14.926  -16.325 1.00 0.00 ? 6  PRO B CA   6  
ATOM 8208  C C    . PRO B 2 6  ? 81.979  14.657  -14.987 1.00 0.00 ? 6  PRO B C    6  
ATOM 8209  O O    . PRO B 2 6  ? 83.101  15.113  -14.767 1.00 0.00 ? 6  PRO B O    6  
ATOM 8210  C CB   . PRO B 2 6  ? 81.055  16.438  -16.568 1.00 0.00 ? 6  PRO B CB   6  
ATOM 8211  C CG   . PRO B 2 6  ? 79.579  16.661  -16.403 1.00 0.00 ? 6  PRO B CG   6  
ATOM 8212  C CD   . PRO B 2 6  ? 78.902  15.338  -16.752 1.00 0.00 ? 6  PRO B CD   6  
ATOM 8213  H HA   . PRO B 2 6  ? 81.876  14.519  -17.128 1.00 0.00 ? 6  PRO B HA   6  
ATOM 8214  H HB2  . PRO B 2 6  ? 81.611  17.027  -15.848 1.00 0.00 ? 6  PRO B HB2  6  
ATOM 8215  H HB3  . PRO B 2 6  ? 81.356  16.704  -17.573 1.00 0.00 ? 6  PRO B HB3  6  
ATOM 8216  H HG2  . PRO B 2 6  ? 79.356  16.937  -15.379 1.00 0.00 ? 6  PRO B HG2  6  
ATOM 8217  H HG3  . PRO B 2 6  ? 79.236  17.434  -17.076 1.00 0.00 ? 6  PRO B HG3  6  
ATOM 8218  H HD2  . PRO B 2 6  ? 77.998  15.220  -16.178 1.00 0.00 ? 6  PRO B HD2  6  
ATOM 8219  H HD3  . PRO B 2 6  ? 78.695  15.281  -17.810 1.00 0.00 ? 6  PRO B HD3  6  
ATOM 8220  N N    . GLY B 2 7  ? 81.313  13.918  -14.095 1.00 0.00 ? 7  GLY B N    6  
ATOM 8221  C CA   . GLY B 2 7  ? 81.890  13.601  -12.787 1.00 0.00 ? 7  GLY B CA   6  
ATOM 8222  C C    . GLY B 2 7  ? 82.479  12.196  -12.761 1.00 0.00 ? 7  GLY B C    6  
ATOM 8223  O O    . GLY B 2 7  ? 83.694  12.031  -12.674 1.00 0.00 ? 7  GLY B O    6  
ATOM 8224  H H    . GLY B 2 7  ? 80.422  13.582  -14.315 1.00 0.00 ? 7  GLY B H    6  
ATOM 8225  H HA2  . GLY B 2 7  ? 82.677  14.307  -12.564 1.00 0.00 ? 7  GLY B HA2  6  
ATOM 8226  H HA3  . GLY B 2 7  ? 81.121  13.675  -12.033 1.00 0.00 ? 7  GLY B HA3  6  
ATOM 8227  N N    . VAL B 2 8  ? 81.622  11.183  -12.828 1.00 0.00 ? 8  VAL B N    6  
ATOM 8228  C CA   . VAL B 2 8  ? 82.106  9.807   -12.806 1.00 0.00 ? 8  VAL B CA   6  
ATOM 8229  C C    . VAL B 2 8  ? 82.932  9.529   -14.058 1.00 0.00 ? 8  VAL B C    6  
ATOM 8230  O O    . VAL B 2 8  ? 84.050  9.026   -13.969 1.00 0.00 ? 8  VAL B O    6  
ATOM 8231  C CB   . VAL B 2 8  ? 80.924  8.816   -12.718 1.00 0.00 ? 8  VAL B CB   6  
ATOM 8232  C CG1  . VAL B 2 8  ? 80.556  8.539   -11.253 1.00 0.00 ? 8  VAL B CG1  6  
ATOM 8233  C CG2  . VAL B 2 8  ? 79.710  9.416   -13.430 1.00 0.00 ? 8  VAL B CG2  6  
ATOM 8234  H H    . VAL B 2 8  ? 80.661  11.361  -12.894 1.00 0.00 ? 8  VAL B H    6  
ATOM 8235  H HA   . VAL B 2 8  ? 82.745  9.681   -11.946 1.00 0.00 ? 8  VAL B HA   6  
ATOM 8236  H HB   . VAL B 2 8  ? 81.192  7.882   -13.195 1.00 0.00 ? 8  VAL B HB   6  
ATOM 8237  H HG11 . VAL B 2 8  ? 81.445  8.292   -10.691 1.00 0.00 ? 8  VAL B HG11 6  
ATOM 8238  H HG12 . VAL B 2 8  ? 79.871  7.708   -11.213 1.00 0.00 ? 8  VAL B HG12 6  
ATOM 8239  H HG13 . VAL B 2 8  ? 80.090  9.414   -10.827 1.00 0.00 ? 8  VAL B HG13 6  
ATOM 8240  H HG21 . VAL B 2 8  ? 78.972  8.646   -13.593 1.00 0.00 ? 8  VAL B HG21 6  
ATOM 8241  H HG22 . VAL B 2 8  ? 80.014  9.825   -14.376 1.00 0.00 ? 8  VAL B HG22 6  
ATOM 8242  H HG23 . VAL B 2 8  ? 79.285  10.198  -12.821 1.00 0.00 ? 8  VAL B HG23 6  
ATOM 8243  N N    . LEU B 2 9  ? 82.386  9.872   -15.220 1.00 0.00 ? 9  LEU B N    6  
ATOM 8244  C CA   . LEU B 2 9  ? 83.102  9.659   -16.467 1.00 0.00 ? 9  LEU B CA   6  
ATOM 8245  C C    . LEU B 2 9  ? 84.468  10.350  -16.389 1.00 0.00 ? 9  LEU B C    6  
ATOM 8246  O O    . LEU B 2 9  ? 85.499  9.791   -16.808 1.00 0.00 ? 9  LEU B O    6  
ATOM 8247  C CB   . LEU B 2 9  ? 82.266  10.182  -17.643 1.00 0.00 ? 9  LEU B CB   6  
ATOM 8248  C CG   . LEU B 2 9  ? 80.805  9.709   -17.486 1.00 0.00 ? 9  LEU B CG   6  
ATOM 8249  C CD1  . LEU B 2 9  ? 79.993  10.063  -18.739 1.00 0.00 ? 9  LEU B CD1  6  
ATOM 8250  C CD2  . LEU B 2 9  ? 80.767  8.190   -17.263 1.00 0.00 ? 9  LEU B CD2  6  
ATOM 8251  H H    . LEU B 2 9  ? 81.498  10.281  -15.236 1.00 0.00 ? 9  LEU B H    6  
ATOM 8252  H HA   . LEU B 2 9  ? 83.260  8.601   -16.602 1.00 0.00 ? 9  LEU B HA   6  
ATOM 8253  H HB2  . LEU B 2 9  ? 82.300  11.262  -17.659 1.00 0.00 ? 9  LEU B HB2  6  
ATOM 8254  H HB3  . LEU B 2 9  ? 82.669  9.794   -18.564 1.00 0.00 ? 9  LEU B HB3  6  
ATOM 8255  H HG   . LEU B 2 9  ? 80.364  10.200  -16.637 1.00 0.00 ? 9  LEU B HG   6  
ATOM 8256  H HD11 . LEU B 2 9  ? 78.948  9.852   -18.562 1.00 0.00 ? 9  LEU B HD11 6  
ATOM 8257  H HD12 . LEU B 2 9  ? 80.341  9.474   -19.574 1.00 0.00 ? 9  LEU B HD12 6  
ATOM 8258  H HD13 . LEU B 2 9  ? 80.111  11.112  -18.962 1.00 0.00 ? 9  LEU B HD13 6  
ATOM 8259  H HD21 . LEU B 2 9  ? 81.036  7.971   -16.241 1.00 0.00 ? 9  LEU B HD21 6  
ATOM 8260  H HD22 . LEU B 2 9  ? 81.466  7.709   -17.931 1.00 0.00 ? 9  LEU B HD22 6  
ATOM 8261  H HD23 . LEU B 2 9  ? 79.770  7.818   -17.457 1.00 0.00 ? 9  LEU B HD23 6  
ATOM 8262  N N    . ALA B 2 10 ? 84.489  11.546  -15.794 1.00 0.00 ? 10 ALA B N    6  
ATOM 8263  C CA   . ALA B 2 10 ? 85.744  12.256  -15.621 1.00 0.00 ? 10 ALA B CA   6  
ATOM 8264  C C    . ALA B 2 10 ? 86.655  11.398  -14.749 1.00 0.00 ? 10 ALA B C    6  
ATOM 8265  O O    . ALA B 2 10 ? 87.866  11.285  -14.977 1.00 0.00 ? 10 ALA B O    6  
ATOM 8266  C CB   . ALA B 2 10 ? 85.498  13.610  -14.948 1.00 0.00 ? 10 ALA B CB   6  
ATOM 8267  H H    . ALA B 2 10 ? 83.657  11.932  -15.434 1.00 0.00 ? 10 ALA B H    6  
ATOM 8268  H HA   . ALA B 2 10 ? 86.200  12.418  -16.584 1.00 0.00 ? 10 ALA B HA   6  
ATOM 8269  H HB1  . ALA B 2 10 ? 85.121  14.312  -15.677 1.00 0.00 ? 10 ALA B HB1  6  
ATOM 8270  H HB2  . ALA B 2 10 ? 86.426  13.984  -14.538 1.00 0.00 ? 10 ALA B HB2  6  
ATOM 8271  H HB3  . ALA B 2 10 ? 84.776  13.494  -14.154 1.00 0.00 ? 10 ALA B HB3  6  
ATOM 8272  N N    . GLY B 2 11 ? 86.037  10.774  -13.752 1.00 0.00 ? 11 GLY B N    6  
ATOM 8273  C CA   . GLY B 2 11 ? 86.750  9.907   -12.834 1.00 0.00 ? 11 GLY B CA   6  
ATOM 8274  C C    . GLY B 2 11 ? 87.354  8.716   -13.561 1.00 0.00 ? 11 GLY B C    6  
ATOM 8275  O O    . GLY B 2 11 ? 88.391  8.200   -13.148 1.00 0.00 ? 11 GLY B O    6  
ATOM 8276  H H    . GLY B 2 11 ? 85.072  10.897  -13.638 1.00 0.00 ? 11 GLY B H    6  
ATOM 8277  H HA2  . GLY B 2 11 ? 87.540  10.471  -12.357 1.00 0.00 ? 11 GLY B HA2  6  
ATOM 8278  H HA3  . GLY B 2 11 ? 86.065  9.548   -12.081 1.00 0.00 ? 11 GLY B HA3  6  
ATOM 8279  N N    . ILE B 2 12 ? 86.717  8.275   -14.650 1.00 0.00 ? 12 ILE B N    6  
ATOM 8280  C CA   . ILE B 2 12 ? 87.250  7.148   -15.384 1.00 0.00 ? 12 ILE B CA   6  
ATOM 8281  C C    . ILE B 2 12 ? 88.544  7.568   -16.064 1.00 0.00 ? 12 ILE B C    6  
ATOM 8282  O O    . ILE B 2 12 ? 89.539  6.863   -15.970 1.00 0.00 ? 12 ILE B O    6  
ATOM 8283  C CB   . ILE B 2 12 ? 86.218  6.615   -16.405 1.00 0.00 ? 12 ILE B CB   6  
ATOM 8284  C CG1  . ILE B 2 12 ? 85.299  5.574   -15.739 1.00 0.00 ? 12 ILE B CG1  6  
ATOM 8285  C CG2  . ILE B 2 12 ? 86.934  5.940   -17.583 1.00 0.00 ? 12 ILE B CG2  6  
ATOM 8286  C CD1  . ILE B 2 12 ? 84.450  6.229   -14.649 1.00 0.00 ? 12 ILE B CD1  6  
ATOM 8287  H H    . ILE B 2 12 ? 85.894  8.713   -14.961 1.00 0.00 ? 12 ILE B H    6  
ATOM 8288  H HA   . ILE B 2 12 ? 87.486  6.364   -14.677 1.00 0.00 ? 12 ILE B HA   6  
ATOM 8289  H HB   . ILE B 2 12 ? 85.622  7.437   -16.774 1.00 0.00 ? 12 ILE B HB   6  
ATOM 8290  H HG12 . ILE B 2 12 ? 84.652  5.141   -16.485 1.00 0.00 ? 12 ILE B HG12 6  
ATOM 8291  H HG13 . ILE B 2 12 ? 85.900  4.797   -15.297 1.00 0.00 ? 12 ILE B HG13 6  
ATOM 8292  H HG21 . ILE B 2 12 ? 86.226  5.361   -18.147 1.00 0.00 ? 12 ILE B HG21 6  
ATOM 8293  H HG22 . ILE B 2 12 ? 87.711  5.291   -17.208 1.00 0.00 ? 12 ILE B HG22 6  
ATOM 8294  H HG23 . ILE B 2 12 ? 87.371  6.692   -18.219 1.00 0.00 ? 12 ILE B HG23 6  
ATOM 8295  H HD11 . ILE B 2 12 ? 83.824  6.984   -15.088 1.00 0.00 ? 12 ILE B HD11 6  
ATOM 8296  H HD12 . ILE B 2 12 ? 85.092  6.677   -13.908 1.00 0.00 ? 12 ILE B HD12 6  
ATOM 8297  H HD13 . ILE B 2 12 ? 83.830  5.479   -14.183 1.00 0.00 ? 12 ILE B HD13 6  
ATOM 8298  N N    . VAL B 2 13 ? 88.549  8.715   -16.740 1.00 0.00 ? 13 VAL B N    6  
ATOM 8299  C CA   . VAL B 2 13 ? 89.791  9.142   -17.392 1.00 0.00 ? 13 VAL B CA   6  
ATOM 8300  C C    . VAL B 2 13 ? 90.915  9.154   -16.353 1.00 0.00 ? 13 VAL B C    6  
ATOM 8301  O O    . VAL B 2 13 ? 92.032  8.702   -16.620 1.00 0.00 ? 13 VAL B O    6  
ATOM 8302  C CB   . VAL B 2 13 ? 89.639  10.524  -18.087 1.00 0.00 ? 13 VAL B CB   6  
ATOM 8303  C CG1  . VAL B 2 13 ? 88.166  10.786  -18.355 1.00 0.00 ? 13 VAL B CG1  6  
ATOM 8304  C CG2  . VAL B 2 13 ? 90.200  11.671  -17.225 1.00 0.00 ? 13 VAL B CG2  6  
ATOM 8305  H H    . VAL B 2 13 ? 87.732  9.267   -16.796 1.00 0.00 ? 13 VAL B H    6  
ATOM 8306  H HA   . VAL B 2 13 ? 90.041  8.402   -18.143 1.00 0.00 ? 13 VAL B HA   6  
ATOM 8307  H HB   . VAL B 2 13 ? 90.165  10.505  -19.034 1.00 0.00 ? 13 VAL B HB   6  
ATOM 8308  H HG11 . VAL B 2 13 ? 88.059  11.691  -18.932 1.00 0.00 ? 13 VAL B HG11 6  
ATOM 8309  H HG12 . VAL B 2 13 ? 87.649  10.894  -17.417 1.00 0.00 ? 13 VAL B HG12 6  
ATOM 8310  H HG13 . VAL B 2 13 ? 87.752  9.955   -18.902 1.00 0.00 ? 13 VAL B HG13 6  
ATOM 8311  H HG21 . VAL B 2 13 ? 89.786  11.619  -16.233 1.00 0.00 ? 13 VAL B HG21 6  
ATOM 8312  H HG22 . VAL B 2 13 ? 89.935  12.617  -17.673 1.00 0.00 ? 13 VAL B HG22 6  
ATOM 8313  H HG23 . VAL B 2 13 ? 91.278  11.591  -17.172 1.00 0.00 ? 13 VAL B HG23 6  
ATOM 8314  N N    . VAL B 2 14 ? 90.602  9.656   -15.159 1.00 0.00 ? 14 VAL B N    6  
ATOM 8315  C CA   . VAL B 2 14 ? 91.591  9.697   -14.087 1.00 0.00 ? 14 VAL B CA   6  
ATOM 8316  C C    . VAL B 2 14 ? 92.055  8.281   -13.750 1.00 0.00 ? 14 VAL B C    6  
ATOM 8317  O O    . VAL B 2 14 ? 93.245  8.036   -13.545 1.00 0.00 ? 14 VAL B O    6  
ATOM 8318  C CB   . VAL B 2 14 ? 90.997  10.355  -12.839 1.00 0.00 ? 14 VAL B CB   6  
ATOM 8319  C CG1  . VAL B 2 14 ? 92.009  10.285  -11.693 1.00 0.00 ? 14 VAL B CG1  6  
ATOM 8320  C CG2  . VAL B 2 14 ? 90.672  11.821  -13.139 1.00 0.00 ? 14 VAL B CG2  6  
ATOM 8321  H H    . VAL B 2 14 ? 89.689  9.993   -14.994 1.00 0.00 ? 14 VAL B H    6  
ATOM 8322  H HA   . VAL B 2 14 ? 92.442  10.275  -14.417 1.00 0.00 ? 14 VAL B HA   6  
ATOM 8323  H HB   . VAL B 2 14 ? 90.094  9.835   -12.554 1.00 0.00 ? 14 VAL B HB   6  
ATOM 8324  H HG11 . VAL B 2 14 ? 91.701  10.949  -10.899 1.00 0.00 ? 14 VAL B HG11 6  
ATOM 8325  H HG12 . VAL B 2 14 ? 92.983  10.582  -12.054 1.00 0.00 ? 14 VAL B HG12 6  
ATOM 8326  H HG13 . VAL B 2 14 ? 92.057  9.274   -11.317 1.00 0.00 ? 14 VAL B HG13 6  
ATOM 8327  H HG21 . VAL B 2 14 ? 91.515  12.283  -13.632 1.00 0.00 ? 14 VAL B HG21 6  
ATOM 8328  H HG22 . VAL B 2 14 ? 90.466  12.340  -12.216 1.00 0.00 ? 14 VAL B HG22 6  
ATOM 8329  H HG23 . VAL B 2 14 ? 89.806  11.873  -13.782 1.00 0.00 ? 14 VAL B HG23 6  
ATOM 8330  N N    . GLY B 2 15 ? 91.102  7.353   -13.696 1.00 0.00 ? 15 GLY B N    6  
ATOM 8331  C CA   . GLY B 2 15 ? 91.411  5.960   -13.384 1.00 0.00 ? 15 GLY B CA   6  
ATOM 8332  C C    . GLY B 2 15 ? 92.299  5.337   -14.457 1.00 0.00 ? 15 GLY B C    6  
ATOM 8333  O O    . GLY B 2 15 ? 93.199  4.558   -14.151 1.00 0.00 ? 15 GLY B O    6  
ATOM 8334  H H    . GLY B 2 15 ? 90.173  7.610   -13.870 1.00 0.00 ? 15 GLY B H    6  
ATOM 8335  H HA2  . GLY B 2 15 ? 91.918  5.915   -12.433 1.00 0.00 ? 15 GLY B HA2  6  
ATOM 8336  H HA3  . GLY B 2 15 ? 90.490  5.400   -13.322 1.00 0.00 ? 15 GLY B HA3  6  
ATOM 8337  N N    . ASP B 2 16 ? 92.040  5.685   -15.713 1.00 0.00 ? 16 ASP B N    6  
ATOM 8338  C CA   . ASP B 2 16 ? 92.822  5.156   -16.821 1.00 0.00 ? 16 ASP B CA   6  
ATOM 8339  C C    . ASP B 2 16 ? 94.276  5.570   -16.670 1.00 0.00 ? 16 ASP B C    6  
ATOM 8340  O O    . ASP B 2 16 ? 95.186  4.769   -16.871 1.00 0.00 ? 16 ASP B O    6  
ATOM 8341  C CB   . ASP B 2 16 ? 92.274  5.681   -18.148 1.00 0.00 ? 16 ASP B CB   6  
ATOM 8342  C CG   . ASP B 2 16 ? 92.894  4.909   -19.306 1.00 0.00 ? 16 ASP B CG   6  
ATOM 8343  O OD1  . ASP B 2 16 ? 93.758  4.087   -19.047 1.00 0.00 ? 16 ASP B OD1  6  
ATOM 8344  O OD2  . ASP B 2 16 ? 92.497  5.150   -20.434 1.00 0.00 ? 16 ASP B OD2  6  
ATOM 8345  H H    . ASP B 2 16 ? 91.312  6.311   -15.897 1.00 0.00 ? 16 ASP B H    6  
ATOM 8346  H HA   . ASP B 2 16 ? 92.759  4.078   -16.815 1.00 0.00 ? 16 ASP B HA   6  
ATOM 8347  H HB2  . ASP B 2 16 ? 91.201  5.557   -18.167 1.00 0.00 ? 16 ASP B HB2  6  
ATOM 8348  H HB3  . ASP B 2 16 ? 92.516  6.728   -18.247 1.00 0.00 ? 16 ASP B HB3  6  
ATOM 8349  N N    . LEU B 2 17 ? 94.483  6.830   -16.306 1.00 0.00 ? 17 LEU B N    6  
ATOM 8350  C CA   . LEU B 2 17 ? 95.831  7.346   -16.117 1.00 0.00 ? 17 LEU B CA   6  
ATOM 8351  C C    . LEU B 2 17 ? 96.533  6.566   -15.007 1.00 0.00 ? 17 LEU B C    6  
ATOM 8352  O O    . LEU B 2 17 ? 97.680  6.129   -15.159 1.00 0.00 ? 17 LEU B O    6  
ATOM 8353  C CB   . LEU B 2 17 ? 95.752  8.834   -15.755 1.00 0.00 ? 17 LEU B CB   6  
ATOM 8354  C CG   . LEU B 2 17 ? 97.140  9.382   -15.398 1.00 0.00 ? 17 LEU B CG   6  
ATOM 8355  C CD1  . LEU B 2 17 ? 98.133  9.093   -16.532 1.00 0.00 ? 17 LEU B CD1  6  
ATOM 8356  C CD2  . LEU B 2 17 ? 97.031  10.896  -15.185 1.00 0.00 ? 17 LEU B CD2  6  
ATOM 8357  H H    . LEU B 2 17 ? 93.714  7.421   -16.155 1.00 0.00 ? 17 LEU B H    6  
ATOM 8358  H HA   . LEU B 2 17 ? 96.384  7.232   -17.036 1.00 0.00 ? 17 LEU B HA   6  
ATOM 8359  H HB2  . LEU B 2 17 ? 95.360  9.383   -16.599 1.00 0.00 ? 17 LEU B HB2  6  
ATOM 8360  H HB3  . LEU B 2 17 ? 95.093  8.960   -14.910 1.00 0.00 ? 17 LEU B HB3  6  
ATOM 8361  H HG   . LEU B 2 17 ? 97.489  8.917   -14.488 1.00 0.00 ? 17 LEU B HG   6  
ATOM 8362  H HD11 . LEU B 2 17 ? 97.647  9.239   -17.487 1.00 0.00 ? 17 LEU B HD11 6  
ATOM 8363  H HD12 . LEU B 2 17 ? 98.477  8.073   -16.455 1.00 0.00 ? 17 LEU B HD12 6  
ATOM 8364  H HD13 . LEU B 2 17 ? 98.979  9.761   -16.453 1.00 0.00 ? 17 LEU B HD13 6  
ATOM 8365  H HD21 . LEU B 2 17 ? 96.494  11.340  -16.010 1.00 0.00 ? 17 LEU B HD21 6  
ATOM 8366  H HD22 . LEU B 2 17 ? 98.021  11.324  -15.128 1.00 0.00 ? 17 LEU B HD22 6  
ATOM 8367  H HD23 . LEU B 2 17 ? 96.500  11.091  -14.264 1.00 0.00 ? 17 LEU B HD23 6  
ATOM 8368  N N    . VAL B 2 18 ? 95.827  6.384   -13.894 1.00 0.00 ? 18 VAL B N    6  
ATOM 8369  C CA   . VAL B 2 18 ? 96.378  5.648   -12.763 1.00 0.00 ? 18 VAL B CA   6  
ATOM 8370  C C    . VAL B 2 18 ? 96.759  4.233   -13.186 1.00 0.00 ? 18 VAL B C    6  
ATOM 8371  O O    . VAL B 2 18 ? 97.842  3.750   -12.855 1.00 0.00 ? 18 VAL B O    6  
ATOM 8372  C CB   . VAL B 2 18 ? 95.354  5.594   -11.624 1.00 0.00 ? 18 VAL B CB   6  
ATOM 8373  C CG1  . VAL B 2 18 ? 95.884  4.708   -10.495 1.00 0.00 ? 18 VAL B CG1  6  
ATOM 8374  C CG2  . VAL B 2 18 ? 95.117  7.009   -11.087 1.00 0.00 ? 18 VAL B CG2  6  
ATOM 8375  H H    . VAL B 2 18 ? 94.917  6.746   -13.836 1.00 0.00 ? 18 VAL B H    6  
ATOM 8376  H HA   . VAL B 2 18 ? 97.262  6.158   -12.412 1.00 0.00 ? 18 VAL B HA   6  
ATOM 8377  H HB   . VAL B 2 18 ? 94.425  5.187   -11.995 1.00 0.00 ? 18 VAL B HB   6  
ATOM 8378  H HG11 . VAL B 2 18 ? 95.281  4.852   -9.611  1.00 0.00 ? 18 VAL B HG11 6  
ATOM 8379  H HG12 . VAL B 2 18 ? 96.908  4.973   -10.279 1.00 0.00 ? 18 VAL B HG12 6  
ATOM 8380  H HG13 . VAL B 2 18 ? 95.837  3.673   -10.797 1.00 0.00 ? 18 VAL B HG13 6  
ATOM 8381  H HG21 . VAL B 2 18 ? 94.244  7.010   -10.452 1.00 0.00 ? 18 VAL B HG21 6  
ATOM 8382  H HG22 . VAL B 2 18 ? 94.963  7.687   -11.915 1.00 0.00 ? 18 VAL B HG22 6  
ATOM 8383  H HG23 . VAL B 2 18 ? 95.977  7.326   -10.517 1.00 0.00 ? 18 VAL B HG23 6  
ATOM 8384  N N    . LEU B 2 19 ? 95.870  3.571   -13.925 1.00 0.00 ? 19 LEU B N    6  
ATOM 8385  C CA   . LEU B 2 19 ? 96.150  2.216   -14.383 1.00 0.00 ? 19 LEU B CA   6  
ATOM 8386  C C    . LEU B 2 19 ? 97.390  2.214   -15.265 1.00 0.00 ? 19 LEU B C    6  
ATOM 8387  O O    . LEU B 2 19 ? 98.303  1.430   -15.051 1.00 0.00 ? 19 LEU B O    6  
ATOM 8388  C CB   . LEU B 2 19 ? 94.971  1.648   -15.184 1.00 0.00 ? 19 LEU B CB   6  
ATOM 8389  C CG   . LEU B 2 19 ? 93.767  1.368   -14.272 1.00 0.00 ? 19 LEU B CG   6  
ATOM 8390  C CD1  . LEU B 2 19 ? 92.567  0.982   -15.150 1.00 0.00 ? 19 LEU B CD1  6  
ATOM 8391  C CD2  . LEU B 2 19 ? 94.085  0.217   -13.290 1.00 0.00 ? 19 LEU B CD2  6  
ATOM 8392  H H    . LEU B 2 19 ? 95.023  4.001   -14.167 1.00 0.00 ? 19 LEU B H    6  
ATOM 8393  H HA   . LEU B 2 19 ? 96.333  1.588   -13.530 1.00 0.00 ? 19 LEU B HA   6  
ATOM 8394  H HB2  . LEU B 2 19 ? 94.681  2.362   -15.942 1.00 0.00 ? 19 LEU B HB2  6  
ATOM 8395  H HB3  . LEU B 2 19 ? 95.276  0.729   -15.663 1.00 0.00 ? 19 LEU B HB3  6  
ATOM 8396  H HG   . LEU B 2 19 ? 93.526  2.263   -13.714 1.00 0.00 ? 19 LEU B HG   6  
ATOM 8397  H HD11 . LEU B 2 19 ? 92.869  0.227   -15.865 1.00 0.00 ? 19 LEU B HD11 6  
ATOM 8398  H HD12 . LEU B 2 19 ? 92.214  1.854   -15.680 1.00 0.00 ? 19 LEU B HD12 6  
ATOM 8399  H HD13 . LEU B 2 19 ? 91.774  0.595   -14.527 1.00 0.00 ? 19 LEU B HD13 6  
ATOM 8400  H HD21 . LEU B 2 19 ? 94.592  0.612   -12.423 1.00 0.00 ? 19 LEU B HD21 6  
ATOM 8401  H HD22 . LEU B 2 19 ? 94.715  -0.515  -13.772 1.00 0.00 ? 19 LEU B HD22 6  
ATOM 8402  H HD23 . LEU B 2 19 ? 93.169  -0.258  -12.973 1.00 0.00 ? 19 LEU B HD23 6  
ATOM 8403  N N    . THR B 2 20 ? 97.421  3.102   -16.252 1.00 0.00 ? 20 THR B N    6  
ATOM 8404  C CA   . THR B 2 20 ? 98.563  3.179   -17.157 1.00 0.00 ? 20 THR B CA   6  
ATOM 8405  C C    . THR B 2 20 ? 99.869  3.138   -16.372 1.00 0.00 ? 20 THR B C    6  
ATOM 8406  O O    . THR B 2 20 ? 100.764 2.346   -16.677 1.00 0.00 ? 20 THR B O    6  
ATOM 8407  C CB   . THR B 2 20 ? 98.495  4.472   -17.973 1.00 0.00 ? 20 THR B CB   6  
ATOM 8408  O OG1  . THR B 2 20 ? 97.319  4.466   -18.771 1.00 0.00 ? 20 THR B OG1  6  
ATOM 8409  C CG2  . THR B 2 20 ? 99.726  4.571   -18.876 1.00 0.00 ? 20 THR B CG2  6  
ATOM 8410  H H    . THR B 2 20 ? 96.665  3.712   -16.376 1.00 0.00 ? 20 THR B H    6  
ATOM 8411  H HA   . THR B 2 20 ? 98.533  2.339   -17.832 1.00 0.00 ? 20 THR B HA   6  
ATOM 8412  H HB   . THR B 2 20 ? 98.475  5.320   -17.306 1.00 0.00 ? 20 THR B HB   6  
ATOM 8413  H HG1  . THR B 2 20 ? 97.156  5.365   -19.067 1.00 0.00 ? 20 THR B HG1  6  
ATOM 8414  H HG21 . THR B 2 20 ? 99.874  3.632   -19.388 1.00 0.00 ? 20 THR B HG21 6  
ATOM 8415  H HG22 . THR B 2 20 ? 100.596 4.796   -18.276 1.00 0.00 ? 20 THR B HG22 6  
ATOM 8416  H HG23 . THR B 2 20 ? 99.578  5.357   -19.603 1.00 0.00 ? 20 THR B HG23 6  
ATOM 8417  N N    . VAL B 2 21 ? 99.972  3.984   -15.353 1.00 0.00 ? 21 VAL B N    6  
ATOM 8418  C CA   . VAL B 2 21 ? 101.179 4.017   -14.532 1.00 0.00 ? 21 VAL B CA   6  
ATOM 8419  C C    . VAL B 2 21 ? 101.375 2.684   -13.809 1.00 0.00 ? 21 VAL B C    6  
ATOM 8420  O O    . VAL B 2 21 ? 102.504 2.222   -13.628 1.00 0.00 ? 21 VAL B O    6  
ATOM 8421  C CB   . VAL B 2 21 ? 101.079 5.147   -13.504 1.00 0.00 ? 21 VAL B CB   6  
ATOM 8422  C CG1  . VAL B 2 21 ? 102.299 5.110   -12.581 1.00 0.00 ? 21 VAL B CG1  6  
ATOM 8423  C CG2  . VAL B 2 21 ? 101.030 6.494   -14.228 1.00 0.00 ? 21 VAL B CG2  6  
ATOM 8424  H H    . VAL B 2 21 ? 99.226  4.590   -15.147 1.00 0.00 ? 21 VAL B H    6  
ATOM 8425  H HA   . VAL B 2 21 ? 102.030 4.199   -15.169 1.00 0.00 ? 21 VAL B HA   6  
ATOM 8426  H HB   . VAL B 2 21 ? 100.181 5.019   -12.916 1.00 0.00 ? 21 VAL B HB   6  
ATOM 8427  H HG11 . VAL B 2 21 ? 103.194 4.986   -13.173 1.00 0.00 ? 21 VAL B HG11 6  
ATOM 8428  H HG12 . VAL B 2 21 ? 102.206 4.281   -11.894 1.00 0.00 ? 21 VAL B HG12 6  
ATOM 8429  H HG13 . VAL B 2 21 ? 102.360 6.033   -12.025 1.00 0.00 ? 21 VAL B HG13 6  
ATOM 8430  H HG21 . VAL B 2 21 ? 100.329 6.438   -15.047 1.00 0.00 ? 21 VAL B HG21 6  
ATOM 8431  H HG22 . VAL B 2 21 ? 102.011 6.733   -14.611 1.00 0.00 ? 21 VAL B HG22 6  
ATOM 8432  H HG23 . VAL B 2 21 ? 100.716 7.263   -13.537 1.00 0.00 ? 21 VAL B HG23 6  
ATOM 8433  N N    . LEU B 2 22 ? 100.270 2.081   -13.382 1.00 0.00 ? 22 LEU B N    6  
ATOM 8434  C CA   . LEU B 2 22 ? 100.323 0.812   -12.659 1.00 0.00 ? 22 LEU B CA   6  
ATOM 8435  C C    . LEU B 2 22 ? 100.891 -0.311  -13.533 1.00 0.00 ? 22 LEU B C    6  
ATOM 8436  O O    . LEU B 2 22 ? 101.811 -1.018  -13.122 1.00 0.00 ? 22 LEU B O    6  
ATOM 8437  C CB   . LEU B 2 22 ? 98.915  0.444   -12.179 1.00 0.00 ? 22 LEU B CB   6  
ATOM 8438  C CG   . LEU B 2 22 ? 98.957  -0.783  -11.254 1.00 0.00 ? 22 LEU B CG   6  
ATOM 8439  C CD1  . LEU B 2 22 ? 99.765  -0.469  -9.978  1.00 0.00 ? 22 LEU B CD1  6  
ATOM 8440  C CD2  . LEU B 2 22 ? 97.517  -1.168  -10.876 1.00 0.00 ? 22 LEU B CD2  6  
ATOM 8441  H H    . LEU B 2 22 ? 99.401  2.503   -13.544 1.00 0.00 ? 22 LEU B H    6  
ATOM 8442  H HA   . LEU B 2 22 ? 100.961 0.939   -11.802 1.00 0.00 ? 22 LEU B HA   6  
ATOM 8443  H HB2  . LEU B 2 22 ? 98.495  1.280   -11.641 1.00 0.00 ? 22 LEU B HB2  6  
ATOM 8444  H HB3  . LEU B 2 22 ? 98.294  0.223   -13.033 1.00 0.00 ? 22 LEU B HB3  6  
ATOM 8445  H HG   . LEU B 2 22 ? 99.423  -1.606  -11.776 1.00 0.00 ? 22 LEU B HG   6  
ATOM 8446  H HD11 . LEU B 2 22 ? 100.810 -0.671  -10.156 1.00 0.00 ? 22 LEU B HD11 6  
ATOM 8447  H HD12 . LEU B 2 22 ? 99.419  -1.091  -9.164  1.00 0.00 ? 22 LEU B HD12 6  
ATOM 8448  H HD13 . LEU B 2 22 ? 99.638  0.571   -9.711  1.00 0.00 ? 22 LEU B HD13 6  
ATOM 8449  H HD21 . LEU B 2 22 ? 96.945  -0.276  -10.668 1.00 0.00 ? 22 LEU B HD21 6  
ATOM 8450  H HD22 . LEU B 2 22 ? 97.529  -1.796  -9.998  1.00 0.00 ? 22 LEU B HD22 6  
ATOM 8451  H HD23 . LEU B 2 22 ? 97.062  -1.704  -11.694 1.00 0.00 ? 22 LEU B HD23 6  
ATOM 8452  N N    . ILE B 2 23 ? 100.347 -0.469  -14.739 1.00 0.00 ? 23 ILE B N    6  
ATOM 8453  C CA   . ILE B 2 23 ? 100.822 -1.509  -15.644 1.00 0.00 ? 23 ILE B CA   6  
ATOM 8454  C C    . ILE B 2 23 ? 102.302 -1.296  -15.937 1.00 0.00 ? 23 ILE B C    6  
ATOM 8455  O O    . ILE B 2 23 ? 103.090 -2.240  -15.912 1.00 0.00 ? 23 ILE B O    6  
ATOM 8456  C CB   . ILE B 2 23 ? 100.028 -1.489  -16.959 1.00 0.00 ? 23 ILE B CB   6  
ATOM 8457  C CG1  . ILE B 2 23 ? 98.519  -1.499  -16.670 1.00 0.00 ? 23 ILE B CG1  6  
ATOM 8458  C CG2  . ILE B 2 23 ? 100.389 -2.716  -17.800 1.00 0.00 ? 23 ILE B CG2  6  
ATOM 8459  C CD1  . ILE B 2 23 ? 98.160  -2.654  -15.731 1.00 0.00 ? 23 ILE B CD1  6  
ATOM 8460  H H    . ILE B 2 23 ? 99.620  0.121   -15.021 1.00 0.00 ? 23 ILE B H    6  
ATOM 8461  H HA   . ILE B 2 23 ? 100.697 -2.471  -15.170 1.00 0.00 ? 23 ILE B HA   6  
ATOM 8462  H HB   . ILE B 2 23 ? 100.281 -0.594  -17.510 1.00 0.00 ? 23 ILE B HB   6  
ATOM 8463  H HG12 . ILE B 2 23 ? 98.237  -0.567  -16.211 1.00 0.00 ? 23 ILE B HG12 6  
ATOM 8464  H HG13 . ILE B 2 23 ? 97.981  -1.616  -17.599 1.00 0.00 ? 23 ILE B HG13 6  
ATOM 8465  H HG21 . ILE B 2 23 ? 101.375 -2.588  -18.221 1.00 0.00 ? 23 ILE B HG21 6  
ATOM 8466  H HG22 . ILE B 2 23 ? 99.668  -2.830  -18.597 1.00 0.00 ? 23 ILE B HG22 6  
ATOM 8467  H HG23 . ILE B 2 23 ? 100.376 -3.598  -17.179 1.00 0.00 ? 23 ILE B HG23 6  
ATOM 8468  H HD11 . ILE B 2 23 ? 98.707  -3.539  -16.017 1.00 0.00 ? 23 ILE B HD11 6  
ATOM 8469  H HD12 . ILE B 2 23 ? 97.101  -2.853  -15.796 1.00 0.00 ? 23 ILE B HD12 6  
ATOM 8470  H HD13 . ILE B 2 23 ? 98.411  -2.387  -14.716 1.00 0.00 ? 23 ILE B HD13 6  
ATOM 8471  N N    . ALA B 2 24 ? 102.679 -0.048  -16.199 1.00 0.00 ? 24 ALA B N    6  
ATOM 8472  C CA   . ALA B 2 24 ? 104.076 0.267   -16.476 1.00 0.00 ? 24 ALA B CA   6  
ATOM 8473  C C    . ALA B 2 24 ? 104.955 -0.269  -15.352 1.00 0.00 ? 24 ALA B C    6  
ATOM 8474  O O    . ALA B 2 24 ? 105.974 -0.921  -15.593 1.00 0.00 ? 24 ALA B O    6  
ATOM 8475  C CB   . ALA B 2 24 ? 104.257 1.782   -16.599 1.00 0.00 ? 24 ALA B CB   6  
ATOM 8476  H H    . ALA B 2 24 ? 102.011 0.672   -16.197 1.00 0.00 ? 24 ALA B H    6  
ATOM 8477  H HA   . ALA B 2 24 ? 104.365 -0.200  -17.407 1.00 0.00 ? 24 ALA B HA   6  
ATOM 8478  H HB1  . ALA B 2 24 ? 105.307 2.011   -16.703 1.00 0.00 ? 24 ALA B HB1  6  
ATOM 8479  H HB2  . ALA B 2 24 ? 103.868 2.263   -15.715 1.00 0.00 ? 24 ALA B HB2  6  
ATOM 8480  H HB3  . ALA B 2 24 ? 103.723 2.139   -17.467 1.00 0.00 ? 24 ALA B HB3  6  
ATOM 8481  N N    . LEU B 2 25 ? 104.545 -0.004  -14.117 1.00 0.00 ? 25 LEU B N    6  
ATOM 8482  C CA   . LEU B 2 25 ? 105.294 -0.480  -12.963 1.00 0.00 ? 25 LEU B CA   6  
ATOM 8483  C C    . LEU B 2 25 ? 105.403 -2.002  -13.033 1.00 0.00 ? 25 LEU B C    6  
ATOM 8484  O O    . LEU B 2 25 ? 106.443 -2.580  -12.718 1.00 0.00 ? 25 LEU B O    6  
ATOM 8485  C CB   . LEU B 2 25 ? 104.581 -0.042  -11.666 1.00 0.00 ? 25 LEU B CB   6  
ATOM 8486  C CG   . LEU B 2 25 ? 105.588 0.156   -10.512 1.00 0.00 ? 25 LEU B CG   6  
ATOM 8487  C CD1  . LEU B 2 25 ? 106.467 -1.090  -10.360 1.00 0.00 ? 25 LEU B CD1  6  
ATOM 8488  C CD2  . LEU B 2 25 ? 106.479 1.393   -10.768 1.00 0.00 ? 25 LEU B CD2  6  
ATOM 8489  H H    . LEU B 2 25 ? 103.720 0.509   -13.980 1.00 0.00 ? 25 LEU B H    6  
ATOM 8490  H HA   . LEU B 2 25 ? 106.283 -0.055  -12.993 1.00 0.00 ? 25 LEU B HA   6  
ATOM 8491  H HB2  . LEU B 2 25 ? 104.060 0.886   -11.847 1.00 0.00 ? 25 LEU B HB2  6  
ATOM 8492  H HB3  . LEU B 2 25 ? 103.859 -0.794  -11.379 1.00 0.00 ? 25 LEU B HB3  6  
ATOM 8493  H HG   . LEU B 2 25 ? 105.036 0.305   -9.594  1.00 0.00 ? 25 LEU B HG   6  
ATOM 8494  H HD11 . LEU B 2 25 ? 105.861 -1.976  -10.473 1.00 0.00 ? 25 LEU B HD11 6  
ATOM 8495  H HD12 . LEU B 2 25 ? 106.923 -1.089  -9.381  1.00 0.00 ? 25 LEU B HD12 6  
ATOM 8496  H HD13 . LEU B 2 25 ? 107.239 -1.080  -11.114 1.00 0.00 ? 25 LEU B HD13 6  
ATOM 8497  H HD21 . LEU B 2 25 ? 105.929 2.138   -11.322 1.00 0.00 ? 25 LEU B HD21 6  
ATOM 8498  H HD22 . LEU B 2 25 ? 107.359 1.109   -11.328 1.00 0.00 ? 25 LEU B HD22 6  
ATOM 8499  H HD23 . LEU B 2 25 ? 106.785 1.811   -9.820  1.00 0.00 ? 25 LEU B HD23 6  
ATOM 8500  N N    . ALA B 2 26 ? 104.320 -2.644  -13.466 1.00 0.00 ? 26 ALA B N    6  
ATOM 8501  C CA   . ALA B 2 26 ? 104.305 -4.096  -13.591 1.00 0.00 ? 26 ALA B CA   6  
ATOM 8502  C C    . ALA B 2 26 ? 105.361 -4.551  -14.595 1.00 0.00 ? 26 ALA B C    6  
ATOM 8503  O O    . ALA B 2 26 ? 106.026 -5.566  -14.391 1.00 0.00 ? 26 ALA B O    6  
ATOM 8504  C CB   . ALA B 2 26 ? 102.921 -4.574  -14.041 1.00 0.00 ? 26 ALA B CB   6  
ATOM 8505  H H    . ALA B 2 26 ? 103.522 -2.130  -13.714 1.00 0.00 ? 26 ALA B H    6  
ATOM 8506  H HA   . ALA B 2 26 ? 104.528 -4.532  -12.629 1.00 0.00 ? 26 ALA B HA   6  
ATOM 8507  H HB1  . ALA B 2 26 ? 102.810 -5.622  -13.808 1.00 0.00 ? 26 ALA B HB1  6  
ATOM 8508  H HB2  . ALA B 2 26 ? 102.815 -4.430  -15.106 1.00 0.00 ? 26 ALA B HB2  6  
ATOM 8509  H HB3  . ALA B 2 26 ? 102.160 -4.008  -13.523 1.00 0.00 ? 26 ALA B HB3  6  
ATOM 8510  N N    . VAL B 2 27 ? 105.519 -3.787  -15.676 1.00 0.00 ? 27 VAL B N    6  
ATOM 8511  C CA   . VAL B 2 27 ? 106.508 -4.127  -16.692 1.00 0.00 ? 27 VAL B CA   6  
ATOM 8512  C C    . VAL B 2 27 ? 107.898 -4.137  -16.069 1.00 0.00 ? 27 VAL B C    6  
ATOM 8513  O O    . VAL B 2 27 ? 108.671 -5.074  -16.262 1.00 0.00 ? 27 VAL B O    6  
ATOM 8514  C CB   . VAL B 2 27 ? 106.474 -3.114  -17.839 1.00 0.00 ? 27 VAL B CB   6  
ATOM 8515  C CG1  . VAL B 2 27 ? 107.533 -3.489  -18.879 1.00 0.00 ? 27 VAL B CG1  6  
ATOM 8516  C CG2  . VAL B 2 27 ? 105.090 -3.123  -18.493 1.00 0.00 ? 27 VAL B CG2  6  
ATOM 8517  H H    . VAL B 2 27 ? 104.967 -2.986  -15.787 1.00 0.00 ? 27 VAL B H    6  
ATOM 8518  H HA   . VAL B 2 27 ? 106.290 -5.110  -17.083 1.00 0.00 ? 27 VAL B HA   6  
ATOM 8519  H HB   . VAL B 2 27 ? 106.687 -2.129  -17.455 1.00 0.00 ? 27 VAL B HB   6  
ATOM 8520  H HG11 . VAL B 2 27 ? 107.449 -4.540  -19.115 1.00 0.00 ? 27 VAL B HG11 6  
ATOM 8521  H HG12 . VAL B 2 27 ? 108.516 -3.287  -18.481 1.00 0.00 ? 27 VAL B HG12 6  
ATOM 8522  H HG13 . VAL B 2 27 ? 107.379 -2.906  -19.775 1.00 0.00 ? 27 VAL B HG13 6  
ATOM 8523  H HG21 . VAL B 2 27 ? 104.991 -3.998  -19.116 1.00 0.00 ? 27 VAL B HG21 6  
ATOM 8524  H HG22 . VAL B 2 27 ? 104.973 -2.236  -19.098 1.00 0.00 ? 27 VAL B HG22 6  
ATOM 8525  H HG23 . VAL B 2 27 ? 104.329 -3.138  -17.727 1.00 0.00 ? 27 VAL B HG23 6  
ATOM 8526  N N    . TYR B 2 28 ? 108.201 -3.090  -15.308 1.00 0.00 ? 28 TYR B N    6  
ATOM 8527  C CA   . TYR B 2 28 ? 109.499 -2.992  -14.649 1.00 0.00 ? 28 TYR B CA   6  
ATOM 8528  C C    . TYR B 2 28 ? 109.688 -4.157  -13.682 1.00 0.00 ? 28 TYR B C    6  
ATOM 8529  O O    . TYR B 2 28 ? 110.772 -4.732  -13.589 1.00 0.00 ? 28 TYR B O    6  
ATOM 8530  C CB   . TYR B 2 28 ? 109.601 -1.671  -13.886 1.00 0.00 ? 28 TYR B CB   6  
ATOM 8531  C CG   . TYR B 2 28 ? 111.004 -1.508  -13.350 1.00 0.00 ? 28 TYR B CG   6  
ATOM 8532  C CD1  . TYR B 2 28 ? 111.381 -2.158  -12.168 1.00 0.00 ? 28 TYR B CD1  6  
ATOM 8533  C CD2  . TYR B 2 28 ? 111.927 -0.709  -14.036 1.00 0.00 ? 28 TYR B CD2  6  
ATOM 8534  C CE1  . TYR B 2 28 ? 112.682 -2.008  -11.672 1.00 0.00 ? 28 TYR B CE1  6  
ATOM 8535  C CE2  . TYR B 2 28 ? 113.227 -0.561  -13.539 1.00 0.00 ? 28 TYR B CE2  6  
ATOM 8536  C CZ   . TYR B 2 28 ? 113.605 -1.210  -12.357 1.00 0.00 ? 28 TYR B CZ   6  
ATOM 8537  O OH   . TYR B 2 28 ? 114.887 -1.063  -11.869 1.00 0.00 ? 28 TYR B OH   6  
ATOM 8538  H H    . TYR B 2 28 ? 107.539 -2.373  -15.185 1.00 0.00 ? 28 TYR B H    6  
ATOM 8539  H HA   . TYR B 2 28 ? 110.276 -3.026  -15.398 1.00 0.00 ? 28 TYR B HA   6  
ATOM 8540  H HB2  . TYR B 2 28 ? 109.372 -0.852  -14.552 1.00 0.00 ? 28 TYR B HB2  6  
ATOM 8541  H HB3  . TYR B 2 28 ? 108.901 -1.675  -13.064 1.00 0.00 ? 28 TYR B HB3  6  
ATOM 8542  H HD1  . TYR B 2 28 ? 110.669 -2.774  -11.640 1.00 0.00 ? 28 TYR B HD1  6  
ATOM 8543  H HD2  . TYR B 2 28 ? 111.636 -0.209  -14.947 1.00 0.00 ? 28 TYR B HD2  6  
ATOM 8544  H HE1  . TYR B 2 28 ? 112.972 -2.509  -10.761 1.00 0.00 ? 28 TYR B HE1  6  
ATOM 8545  H HE2  . TYR B 2 28 ? 113.940 0.055   -14.068 1.00 0.00 ? 28 TYR B HE2  6  
ATOM 8546  H HH   . TYR B 2 28 ? 114.837 -1.025  -10.911 1.00 0.00 ? 28 TYR B HH   6  
ATOM 8547  N N    . PHE B 2 29 ? 108.621 -4.495  -12.964 1.00 0.00 ? 29 PHE B N    6  
ATOM 8548  C CA   . PHE B 2 29 ? 108.665 -5.592  -12.003 1.00 0.00 ? 29 PHE B CA   6  
ATOM 8549  C C    . PHE B 2 29 ? 109.050 -6.900  -12.693 1.00 0.00 ? 29 PHE B C    6  
ATOM 8550  O O    . PHE B 2 29 ? 109.910 -7.636  -12.211 1.00 0.00 ? 29 PHE B O    6  
ATOM 8551  C CB   . PHE B 2 29 ? 107.293 -5.735  -11.333 1.00 0.00 ? 29 PHE B CB   6  
ATOM 8552  C CG   . PHE B 2 29 ? 107.255 -6.988  -10.481 1.00 0.00 ? 29 PHE B CG   6  
ATOM 8553  C CD1  . PHE B 2 29 ? 108.149 -7.138  -9.414  1.00 0.00 ? 29 PHE B CD1  6  
ATOM 8554  C CD2  . PHE B 2 29 ? 106.323 -8.000  -10.759 1.00 0.00 ? 29 PHE B CD2  6  
ATOM 8555  C CE1  . PHE B 2 29 ? 108.113 -8.295  -8.627  1.00 0.00 ? 29 PHE B CE1  6  
ATOM 8556  C CE2  . PHE B 2 29 ? 106.287 -9.156  -9.972  1.00 0.00 ? 29 PHE B CE2  6  
ATOM 8557  C CZ   . PHE B 2 29 ? 107.182 -9.305  -8.906  1.00 0.00 ? 29 PHE B CZ   6  
ATOM 8558  H H    . PHE B 2 29 ? 107.785 -3.999  -13.084 1.00 0.00 ? 29 PHE B H    6  
ATOM 8559  H HA   . PHE B 2 29 ? 109.401 -5.364  -11.247 1.00 0.00 ? 29 PHE B HA   6  
ATOM 8560  H HB2  . PHE B 2 29 ? 107.112 -4.872  -10.709 1.00 0.00 ? 29 PHE B HB2  6  
ATOM 8561  H HB3  . PHE B 2 29 ? 106.529 -5.791  -12.094 1.00 0.00 ? 29 PHE B HB3  6  
ATOM 8562  H HD1  . PHE B 2 29 ? 108.867 -6.361  -9.198  1.00 0.00 ? 29 PHE B HD1  6  
ATOM 8563  H HD2  . PHE B 2 29 ? 105.631 -7.887  -11.582 1.00 0.00 ? 29 PHE B HD2  6  
ATOM 8564  H HE1  . PHE B 2 29 ? 108.804 -8.411  -7.805  1.00 0.00 ? 29 PHE B HE1  6  
ATOM 8565  H HE2  . PHE B 2 29 ? 105.569 -9.934  -10.186 1.00 0.00 ? 29 PHE B HE2  6  
ATOM 8566  H HZ   . PHE B 2 29 ? 107.155 -10.197 -8.298  1.00 0.00 ? 29 PHE B HZ   6  
ATOM 8567  N N    . LEU B 2 30 ? 108.403 -7.183  -13.819 1.00 0.00 ? 30 LEU B N    6  
ATOM 8568  C CA   . LEU B 2 30 ? 108.686 -8.408  -14.560 1.00 0.00 ? 30 LEU B CA   6  
ATOM 8569  C C    . LEU B 2 30 ? 110.154 -8.453  -14.974 1.00 0.00 ? 30 LEU B C    6  
ATOM 8570  O O    . LEU B 2 30 ? 110.825 -9.470  -14.803 1.00 0.00 ? 30 LEU B O    6  
ATOM 8571  C CB   . LEU B 2 30 ? 107.785 -8.478  -15.800 1.00 0.00 ? 30 LEU B CB   6  
ATOM 8572  C CG   . LEU B 2 30 ? 108.174 -9.672  -16.687 1.00 0.00 ? 30 LEU B CG   6  
ATOM 8573  C CD1  . LEU B 2 30 ? 108.193 -10.963 -15.858 1.00 0.00 ? 30 LEU B CD1  6  
ATOM 8574  C CD2  . LEU B 2 30 ? 107.148 -9.807  -17.816 1.00 0.00 ? 30 LEU B CD2  6  
ATOM 8575  H H    . LEU B 2 30 ? 107.725 -6.562  -14.155 1.00 0.00 ? 30 LEU B H    6  
ATOM 8576  H HA   . LEU B 2 30 ? 108.474 -9.252  -13.925 1.00 0.00 ? 30 LEU B HA   6  
ATOM 8577  H HB2  . LEU B 2 30 ? 106.757 -8.588  -15.488 1.00 0.00 ? 30 LEU B HB2  6  
ATOM 8578  H HB3  . LEU B 2 30 ? 107.889 -7.565  -16.368 1.00 0.00 ? 30 LEU B HB3  6  
ATOM 8579  H HG   . LEU B 2 30 ? 109.153 -9.504  -17.112 1.00 0.00 ? 30 LEU B HG   6  
ATOM 8580  H HD11 . LEU B 2 30 ? 108.121 -11.819 -16.515 1.00 0.00 ? 30 LEU B HD11 6  
ATOM 8581  H HD12 . LEU B 2 30 ? 107.359 -10.966 -15.172 1.00 0.00 ? 30 LEU B HD12 6  
ATOM 8582  H HD13 . LEU B 2 30 ? 109.117 -11.019 -15.301 1.00 0.00 ? 30 LEU B HD13 6  
ATOM 8583  H HD21 . LEU B 2 30 ? 106.175 -10.016 -17.396 1.00 0.00 ? 30 LEU B HD21 6  
ATOM 8584  H HD22 . LEU B 2 30 ? 107.438 -10.616 -18.471 1.00 0.00 ? 30 LEU B HD22 6  
ATOM 8585  H HD23 . LEU B 2 30 ? 107.106 -8.887  -18.378 1.00 0.00 ? 30 LEU B HD23 6  
ATOM 8586  N N    . GLY B 2 31 ? 110.647 -7.343  -15.520 1.00 0.00 ? 31 GLY B N    6  
ATOM 8587  C CA   . GLY B 2 31 ? 112.040 -7.260  -15.958 1.00 0.00 ? 31 GLY B CA   6  
ATOM 8588  C C    . GLY B 2 31 ? 112.166 -6.377  -17.195 1.00 0.00 ? 31 GLY B C    6  
ATOM 8589  O O    . GLY B 2 31 ? 111.688 -6.732  -18.272 1.00 0.00 ? 31 GLY B O    6  
ATOM 8590  H H    . GLY B 2 31 ? 110.063 -6.563  -15.630 1.00 0.00 ? 31 GLY B H    6  
ATOM 8591  H HA2  . GLY B 2 31 ? 112.637 -6.841  -15.160 1.00 0.00 ? 31 GLY B HA2  6  
ATOM 8592  H HA3  . GLY B 2 31 ? 112.406 -8.249  -16.194 1.00 0.00 ? 31 GLY B HA3  6  
ATOM 8593  N N    . ARG B 2 32 ? 112.811 -5.228  -17.033 1.00 0.00 ? 32 ARG B N    6  
ATOM 8594  C CA   . ARG B 2 32 ? 112.993 -4.303  -18.147 1.00 0.00 ? 32 ARG B CA   6  
ATOM 8595  C C    . ARG B 2 32 ? 113.808 -4.958  -19.256 1.00 0.00 ? 32 ARG B C    6  
ATOM 8596  O O    . ARG B 2 32 ? 113.326 -5.857  -19.947 1.00 0.00 ? 32 ARG B O    6  
ATOM 8597  C CB   . ARG B 2 32 ? 113.706 -3.038  -17.665 1.00 0.00 ? 32 ARG B CB   6  
ATOM 8598  C CG   . ARG B 2 32 ? 113.795 -2.033  -18.816 1.00 0.00 ? 32 ARG B CG   6  
ATOM 8599  C CD   . ARG B 2 32 ? 114.410 -0.727  -18.308 1.00 0.00 ? 32 ARG B CD   6  
ATOM 8600  N NE   . ARG B 2 32 ? 114.540 0.226   -19.404 1.00 0.00 ? 32 ARG B NE   6  
ATOM 8601  C CZ   . ARG B 2 32 ? 113.498 0.936   -19.825 1.00 0.00 ? 32 ARG B CZ   6  
ATOM 8602  N NH1  . ARG B 2 32 ? 112.333 0.787   -19.254 1.00 0.00 ? 32 ARG B NH1  6  
ATOM 8603  N NH2  . ARG B 2 32 ? 113.638 1.782   -20.808 1.00 0.00 ? 32 ARG B NH2  6  
ATOM 8604  H H    . ARG B 2 32 ? 113.172 -4.996  -16.151 1.00 0.00 ? 32 ARG B H    6  
ATOM 8605  H HA   . ARG B 2 32 ? 112.025 -4.030  -18.537 1.00 0.00 ? 32 ARG B HA   6  
ATOM 8606  H HB2  . ARG B 2 32 ? 113.151 -2.601  -16.846 1.00 0.00 ? 32 ARG B HB2  6  
ATOM 8607  H HB3  . ARG B 2 32 ? 114.701 -3.290  -17.332 1.00 0.00 ? 32 ARG B HB3  6  
ATOM 8608  H HG2  . ARG B 2 32 ? 114.412 -2.441  -19.603 1.00 0.00 ? 32 ARG B HG2  6  
ATOM 8609  H HG3  . ARG B 2 32 ? 112.805 -1.836  -19.200 1.00 0.00 ? 32 ARG B HG3  6  
ATOM 8610  H HD2  . ARG B 2 32 ? 113.777 -0.306  -17.544 1.00 0.00 ? 32 ARG B HD2  6  
ATOM 8611  H HD3  . ARG B 2 32 ? 115.386 -0.932  -17.891 1.00 0.00 ? 32 ARG B HD3  6  
ATOM 8612  H HE   . ARG B 2 32 ? 115.411 0.346   -19.839 1.00 0.00 ? 32 ARG B HE   6  
ATOM 8613  H HH11 . ARG B 2 32 ? 112.226 0.139   -18.499 1.00 0.00 ? 32 ARG B HH11 6  
ATOM 8614  H HH12 . ARG B 2 32 ? 111.549 1.321   -19.569 1.00 0.00 ? 32 ARG B HH12 6  
ATOM 8615  H HH21 . ARG B 2 32 ? 114.530 1.896   -21.247 1.00 0.00 ? 32 ARG B HH21 6  
ATOM 8616  H HH22 . ARG B 2 32 ? 112.853 2.316   -21.125 1.00 0.00 ? 32 ARG B HH22 6  
ATOM 8617  N N    . CYS A 1 1  ? 68.327  19.896  -17.536 1.00 0.00 ? 1  CYS A N    7  
ATOM 8618  C CA   . CYS A 1 1  ? 68.982  18.787  -16.788 1.00 0.00 ? 1  CYS A CA   7  
ATOM 8619  C C    . CYS A 1 1  ? 69.572  17.787  -17.777 1.00 0.00 ? 1  CYS A C    7  
ATOM 8620  O O    . CYS A 1 1  ? 69.294  16.589  -17.704 1.00 0.00 ? 1  CYS A O    7  
ATOM 8621  C CB   . CYS A 1 1  ? 67.948  18.094  -15.899 1.00 0.00 ? 1  CYS A CB   7  
ATOM 8622  S SG   . CYS A 1 1  ? 68.786  16.947  -14.777 1.00 0.00 ? 1  CYS A SG   7  
ATOM 8623  H HA   . CYS A 1 1  ? 69.773  19.188  -16.171 1.00 0.00 ? 1  CYS A HA   7  
ATOM 8624  H HB2  . CYS A 1 1  ? 67.414  18.834  -15.323 1.00 0.00 ? 1  CYS A HB2  7  
ATOM 8625  H HB3  . CYS A 1 1  ? 67.250  17.547  -16.518 1.00 0.00 ? 1  CYS A HB3  7  
ATOM 8626  N N    . SER A 1 2  ? 70.385  18.286  -18.703 1.00 0.00 ? 2  SER A N    7  
ATOM 8627  C CA   . SER A 1 2  ? 71.007  17.425  -19.703 1.00 0.00 ? 2  SER A CA   7  
ATOM 8628  C C    . SER A 1 2  ? 72.116  16.587  -19.073 1.00 0.00 ? 2  SER A C    7  
ATOM 8629  O O    . SER A 1 2  ? 72.743  17.003  -18.098 1.00 0.00 ? 2  SER A O    7  
ATOM 8630  C CB   . SER A 1 2  ? 71.586  18.275  -20.834 1.00 0.00 ? 2  SER A CB   7  
ATOM 8631  O OG   . SER A 1 2  ? 72.632  19.089  -20.322 1.00 0.00 ? 2  SER A OG   7  
ATOM 8632  H H    . SER A 1 2  ? 70.570  19.248  -18.714 1.00 0.00 ? 2  SER A H    7  
ATOM 8633  H HA   . SER A 1 2  ? 70.257  16.764  -20.111 1.00 0.00 ? 2  SER A HA   7  
ATOM 8634  H HB2  . SER A 1 2  ? 71.980  17.632  -21.604 1.00 0.00 ? 2  SER A HB2  7  
ATOM 8635  H HB3  . SER A 1 2  ? 70.804  18.896  -21.253 1.00 0.00 ? 2  SER A HB3  7  
ATOM 8636  H HG   . SER A 1 2  ? 72.235  19.869  -19.929 1.00 0.00 ? 2  SER A HG   7  
ATOM 8637  N N    . THR A 1 3  ? 72.351  15.406  -19.635 1.00 0.00 ? 3  THR A N    7  
ATOM 8638  C CA   . THR A 1 3  ? 73.386  14.518  -19.118 1.00 0.00 ? 3  THR A CA   7  
ATOM 8639  C C    . THR A 1 3  ? 73.742  13.450  -20.149 1.00 0.00 ? 3  THR A C    7  
ATOM 8640  O O    . THR A 1 3  ? 73.009  13.242  -21.115 1.00 0.00 ? 3  THR A O    7  
ATOM 8641  C CB   . THR A 1 3  ? 72.903  13.851  -17.829 1.00 0.00 ? 3  THR A CB   7  
ATOM 8642  O OG1  . THR A 1 3  ? 73.759  12.762  -17.512 1.00 0.00 ? 3  THR A OG1  7  
ATOM 8643  C CG2  . THR A 1 3  ? 71.473  13.342  -18.021 1.00 0.00 ? 3  THR A CG2  7  
ATOM 8644  H H    . THR A 1 3  ? 71.819  15.127  -20.409 1.00 0.00 ? 3  THR A H    7  
ATOM 8645  H HA   . THR A 1 3  ? 74.268  15.100  -18.899 1.00 0.00 ? 3  THR A HA   7  
ATOM 8646  H HB   . THR A 1 3  ? 72.920  14.569  -17.024 1.00 0.00 ? 3  THR A HB   7  
ATOM 8647  H HG1  . THR A 1 3  ? 73.695  12.600  -16.567 1.00 0.00 ? 3  THR A HG1  7  
ATOM 8648  H HG21 . THR A 1 3  ? 70.799  14.183  -18.091 1.00 0.00 ? 3  THR A HG21 7  
ATOM 8649  H HG22 . THR A 1 3  ? 71.194  12.727  -17.178 1.00 0.00 ? 3  THR A HG22 7  
ATOM 8650  H HG23 . THR A 1 3  ? 71.417  12.758  -18.927 1.00 0.00 ? 3  THR A HG23 7  
ATOM 8651  N N    . VAL A 1 4  ? 74.874  12.778  -19.929 1.00 0.00 ? 4  VAL A N    7  
ATOM 8652  C CA   . VAL A 1 4  ? 75.344  11.724  -20.834 1.00 0.00 ? 4  VAL A CA   7  
ATOM 8653  C C    . VAL A 1 4  ? 74.996  12.044  -22.282 1.00 0.00 ? 4  VAL A C    7  
ATOM 8654  O O    . VAL A 1 4  ? 74.730  11.152  -23.086 1.00 0.00 ? 4  VAL A O    7  
ATOM 8655  C CB   . VAL A 1 4  ? 74.744  10.373  -20.433 1.00 0.00 ? 4  VAL A CB   7  
ATOM 8656  C CG1  . VAL A 1 4  ? 75.244  9.997   -19.036 1.00 0.00 ? 4  VAL A CG1  7  
ATOM 8657  C CG2  . VAL A 1 4  ? 73.215  10.459  -20.415 1.00 0.00 ? 4  VAL A CG2  7  
ATOM 8658  H H    . VAL A 1 4  ? 75.409  12.998  -19.139 1.00 0.00 ? 4  VAL A H    7  
ATOM 8659  H HA   . VAL A 1 4  ? 76.422  11.657  -20.757 1.00 0.00 ? 4  VAL A HA   7  
ATOM 8660  H HB   . VAL A 1 4  ? 75.058  9.618   -21.140 1.00 0.00 ? 4  VAL A HB   7  
ATOM 8661  H HG11 . VAL A 1 4  ? 74.727  9.114   -18.693 1.00 0.00 ? 4  VAL A HG11 7  
ATOM 8662  H HG12 . VAL A 1 4  ? 75.055  10.814  -18.354 1.00 0.00 ? 4  VAL A HG12 7  
ATOM 8663  H HG13 . VAL A 1 4  ? 76.305  9.801   -19.075 1.00 0.00 ? 4  VAL A HG13 7  
ATOM 8664  H HG21 . VAL A 1 4  ? 72.897  11.056  -19.575 1.00 0.00 ? 4  VAL A HG21 7  
ATOM 8665  H HG22 . VAL A 1 4  ? 72.802  9.465   -20.324 1.00 0.00 ? 4  VAL A HG22 7  
ATOM 8666  H HG23 . VAL A 1 4  ? 72.866  10.908  -21.332 1.00 0.00 ? 4  VAL A HG23 7  
ATOM 8667  N N    . SER A 1 5  ? 75.023  13.332  -22.604 1.00 0.00 ? 5  SER A N    7  
ATOM 8668  C CA   . SER A 1 5  ? 74.732  13.788  -23.958 1.00 0.00 ? 5  SER A CA   7  
ATOM 8669  C C    . SER A 1 5  ? 76.003  13.760  -24.815 1.00 0.00 ? 5  SER A C    7  
ATOM 8670  O O    . SER A 1 5  ? 75.947  13.419  -25.996 1.00 0.00 ? 5  SER A O    7  
ATOM 8671  C CB   . SER A 1 5  ? 74.140  15.208  -23.927 1.00 0.00 ? 5  SER A CB   7  
ATOM 8672  O OG   . SER A 1 5  ? 73.424  15.388  -22.713 1.00 0.00 ? 5  SER A OG   7  
ATOM 8673  H H    . SER A 1 5  ? 75.261  13.989  -21.915 1.00 0.00 ? 5  SER A H    7  
ATOM 8674  H HA   . SER A 1 5  ? 74.005  13.121  -24.403 1.00 0.00 ? 5  SER A HA   7  
ATOM 8675  H HB2  . SER A 1 5  ? 74.927  15.942  -23.984 1.00 0.00 ? 5  SER A HB2  7  
ATOM 8676  H HB3  . SER A 1 5  ? 73.473  15.340  -24.770 1.00 0.00 ? 5  SER A HB3  7  
ATOM 8677  H HG   . SER A 1 5  ? 73.954  15.941  -22.135 1.00 0.00 ? 5  SER A HG   7  
ATOM 8678  N N    . PRO A 1 6  ? 77.144  14.098  -24.250 1.00 0.00 ? 6  PRO A N    7  
ATOM 8679  C CA   . PRO A 1 6  ? 78.439  14.091  -24.996 1.00 0.00 ? 6  PRO A CA   7  
ATOM 8680  C C    . PRO A 1 6  ? 78.659  12.802  -25.766 1.00 0.00 ? 6  PRO A C    7  
ATOM 8681  O O    . PRO A 1 6  ? 79.133  12.831  -26.901 1.00 0.00 ? 6  PRO A O    7  
ATOM 8682  C CB   . PRO A 1 6  ? 79.480  14.285  -23.889 1.00 0.00 ? 6  PRO A CB   7  
ATOM 8683  C CG   . PRO A 1 6  ? 78.758  15.099  -22.874 1.00 0.00 ? 6  PRO A CG   7  
ATOM 8684  C CD   . PRO A 1 6  ? 77.346  14.527  -22.850 1.00 0.00 ? 6  PRO A CD   7  
ATOM 8685  H HA   . PRO A 1 6  ? 78.491  14.918  -25.667 1.00 0.00 ? 6  PRO A HA   7  
ATOM 8686  H HB2  . PRO A 1 6  ? 79.776  13.330  -23.474 1.00 0.00 ? 6  PRO A HB2  7  
ATOM 8687  H HB3  . PRO A 1 6  ? 80.338  14.825  -24.258 1.00 0.00 ? 6  PRO A HB3  7  
ATOM 8688  H HG2  . PRO A 1 6  ? 79.226  15.001  -21.908 1.00 0.00 ? 6  PRO A HG2  7  
ATOM 8689  H HG3  . PRO A 1 6  ? 78.726  16.134  -23.174 1.00 0.00 ? 6  PRO A HG3  7  
ATOM 8690  H HD2  . PRO A 1 6  ? 77.302  13.684  -22.174 1.00 0.00 ? 6  PRO A HD2  7  
ATOM 8691  H HD3  . PRO A 1 6  ? 76.629  15.282  -22.575 1.00 0.00 ? 6  PRO A HD3  7  
ATOM 8692  N N    . GLY A 1 7  ? 78.320  11.673  -25.156 1.00 0.00 ? 7  GLY A N    7  
ATOM 8693  C CA   . GLY A 1 7  ? 78.519  10.391  -25.833 1.00 0.00 ? 7  GLY A CA   7  
ATOM 8694  C C    . GLY A 1 7  ? 80.009  10.102  -25.906 1.00 0.00 ? 7  GLY A C    7  
ATOM 8695  O O    . GLY A 1 7  ? 80.465  9.010   -25.558 1.00 0.00 ? 7  GLY A O    7  
ATOM 8696  H H    . GLY A 1 7  ? 77.946  11.703  -24.242 1.00 0.00 ? 7  GLY A H    7  
ATOM 8697  H HA2  . GLY A 1 7  ? 78.019  9.598   -25.288 1.00 0.00 ? 7  GLY A HA2  7  
ATOM 8698  H HA3  . GLY A 1 7  ? 78.120  10.447  -26.834 1.00 0.00 ? 7  GLY A HA3  7  
ATOM 8699  N N    . VAL A 1 8  ? 80.774  11.107  -26.323 1.00 0.00 ? 8  VAL A N    7  
ATOM 8700  C CA   . VAL A 1 8  ? 82.213  10.963  -26.392 1.00 0.00 ? 8  VAL A CA   7  
ATOM 8701  C C    . VAL A 1 8  ? 82.702  10.532  -25.027 1.00 0.00 ? 8  VAL A C    7  
ATOM 8702  O O    . VAL A 1 8  ? 83.593  9.684   -24.907 1.00 0.00 ? 8  VAL A O    7  
ATOM 8703  C CB   . VAL A 1 8  ? 82.862  12.286  -26.800 1.00 0.00 ? 8  VAL A CB   7  
ATOM 8704  C CG1  . VAL A 1 8  ? 84.383  12.178  -26.670 1.00 0.00 ? 8  VAL A CG1  7  
ATOM 8705  C CG2  . VAL A 1 8  ? 82.496  12.594  -28.252 1.00 0.00 ? 8  VAL A CG2  7  
ATOM 8706  H H    . VAL A 1 8  ? 80.368  11.961  -26.559 1.00 0.00 ? 8  VAL A H    7  
ATOM 8707  H HA   . VAL A 1 8  ? 82.462  10.203  -27.119 1.00 0.00 ? 8  VAL A HA   7  
ATOM 8708  H HB   . VAL A 1 8  ? 82.500  13.078  -26.160 1.00 0.00 ? 8  VAL A HB   7  
ATOM 8709  H HG11 . VAL A 1 8  ? 84.721  11.267  -27.142 1.00 0.00 ? 8  VAL A HG11 7  
ATOM 8710  H HG12 . VAL A 1 8  ? 84.655  12.165  -25.624 1.00 0.00 ? 8  VAL A HG12 7  
ATOM 8711  H HG13 . VAL A 1 8  ? 84.847  13.026  -27.152 1.00 0.00 ? 8  VAL A HG13 7  
ATOM 8712  H HG21 . VAL A 1 8  ? 82.898  11.822  -28.893 1.00 0.00 ? 8  VAL A HG21 7  
ATOM 8713  H HG22 . VAL A 1 8  ? 82.910  13.550  -28.534 1.00 0.00 ? 8  VAL A HG22 7  
ATOM 8714  H HG23 . VAL A 1 8  ? 81.421  12.621  -28.354 1.00 0.00 ? 8  VAL A HG23 7  
ATOM 8715  N N    . LEU A 1 9  ? 82.086  11.089  -23.983 1.00 0.00 ? 9  LEU A N    7  
ATOM 8716  C CA   . LEU A 1 9  ? 82.472  10.693  -22.637 1.00 0.00 ? 9  LEU A CA   7  
ATOM 8717  C C    . LEU A 1 9  ? 82.338  9.170   -22.530 1.00 0.00 ? 9  LEU A C    7  
ATOM 8718  O O    . LEU A 1 9  ? 83.189  8.483   -21.954 1.00 0.00 ? 9  LEU A O    7  
ATOM 8719  C CB   . LEU A 1 9  ? 81.606  11.381  -21.577 1.00 0.00 ? 9  LEU A CB   7  
ATOM 8720  C CG   . LEU A 1 9  ? 81.981  12.871  -21.459 1.00 0.00 ? 9  LEU A CG   7  
ATOM 8721  C CD1  . LEU A 1 9  ? 81.026  13.547  -20.470 1.00 0.00 ? 9  LEU A CD1  7  
ATOM 8722  C CD2  . LEU A 1 9  ? 83.435  13.032  -20.957 1.00 0.00 ? 9  LEU A CD2  7  
ATOM 8723  H H    . LEU A 1 9  ? 81.353  11.748  -24.127 1.00 0.00 ? 9  LEU A H    7  
ATOM 8724  H HA   . LEU A 1 9  ? 83.501  10.967  -22.483 1.00 0.00 ? 9  LEU A HA   7  
ATOM 8725  H HB2  . LEU A 1 9  ? 80.565  11.294  -21.852 1.00 0.00 ? 9  LEU A HB2  7  
ATOM 8726  H HB3  . LEU A 1 9  ? 81.765  10.901  -20.623 1.00 0.00 ? 9  LEU A HB3  7  
ATOM 8727  H HG   . LEU A 1 9  ? 81.879  13.341  -22.428 1.00 0.00 ? 9  LEU A HG   7  
ATOM 8728  H HD11 . LEU A 1 9  ? 81.298  13.269  -19.464 1.00 0.00 ? 9  LEU A HD11 7  
ATOM 8729  H HD12 . LEU A 1 9  ? 80.015  13.229  -20.669 1.00 0.00 ? 9  LEU A HD12 7  
ATOM 8730  H HD13 . LEU A 1 9  ? 81.097  14.620  -20.577 1.00 0.00 ? 9  LEU A HD13 7  
ATOM 8731  H HD21 . LEU A 1 9  ? 83.529  13.943  -20.380 1.00 0.00 ? 9  LEU A HD21 7  
ATOM 8732  H HD22 . LEU A 1 9  ? 84.103  13.085  -21.804 1.00 0.00 ? 9  LEU A HD22 7  
ATOM 8733  H HD23 . LEU A 1 9  ? 83.706  12.187  -20.338 1.00 0.00 ? 9  LEU A HD23 7  
ATOM 8734  N N    . ALA A 1 10 ? 81.280  8.636   -23.138 1.00 0.00 ? 10 ALA A N    7  
ATOM 8735  C CA   . ALA A 1 10 ? 81.083  7.196   -23.140 1.00 0.00 ? 10 ALA A CA   7  
ATOM 8736  C C    . ALA A 1 10 ? 82.294  6.555   -23.801 1.00 0.00 ? 10 ALA A C    7  
ATOM 8737  O O    . ALA A 1 10 ? 82.789  5.512   -23.364 1.00 0.00 ? 10 ALA A O    7  
ATOM 8738  C CB   . ALA A 1 10 ? 79.802  6.830   -23.900 1.00 0.00 ? 10 ALA A CB   7  
ATOM 8739  H H    . ALA A 1 10 ? 80.649  9.212   -23.617 1.00 0.00 ? 10 ALA A H    7  
ATOM 8740  H HA   . ALA A 1 10 ? 81.006  6.847   -22.122 1.00 0.00 ? 10 ALA A HA   7  
ATOM 8741  H HB1  . ALA A 1 10 ? 80.003  6.790   -24.962 1.00 0.00 ? 10 ALA A HB1  7  
ATOM 8742  H HB2  . ALA A 1 10 ? 79.045  7.575   -23.706 1.00 0.00 ? 10 ALA A HB2  7  
ATOM 8743  H HB3  . ALA A 1 10 ? 79.449  5.865   -23.565 1.00 0.00 ? 10 ALA A HB3  7  
ATOM 8744  N N    . GLY A 1 11 ? 82.786  7.218   -24.847 1.00 0.00 ? 11 GLY A N    7  
ATOM 8745  C CA   . GLY A 1 11 ? 83.963  6.741   -25.555 1.00 0.00 ? 11 GLY A CA   7  
ATOM 8746  C C    . GLY A 1 11 ? 85.152  6.714   -24.607 1.00 0.00 ? 11 GLY A C    7  
ATOM 8747  O O    . GLY A 1 11 ? 86.082  5.929   -24.779 1.00 0.00 ? 11 GLY A O    7  
ATOM 8748  H H    . GLY A 1 11 ? 82.357  8.057   -25.132 1.00 0.00 ? 11 GLY A H    7  
ATOM 8749  H HA2  . GLY A 1 11 ? 83.776  5.745   -25.932 1.00 0.00 ? 11 GLY A HA2  7  
ATOM 8750  H HA3  . GLY A 1 11 ? 84.181  7.403   -26.380 1.00 0.00 ? 11 GLY A HA3  7  
ATOM 8751  N N    . ILE A 1 12 ? 85.104  7.579   -23.597 1.00 0.00 ? 12 ILE A N    7  
ATOM 8752  C CA   . ILE A 1 12 ? 86.176  7.649   -22.602 1.00 0.00 ? 12 ILE A CA   7  
ATOM 8753  C C    . ILE A 1 12 ? 86.164  6.369   -21.776 1.00 0.00 ? 12 ILE A C    7  
ATOM 8754  O O    . ILE A 1 12 ? 87.211  5.792   -21.487 1.00 0.00 ? 12 ILE A O    7  
ATOM 8755  C CB   . ILE A 1 12 ? 86.003  8.930   -21.712 1.00 0.00 ? 12 ILE A CB   7  
ATOM 8756  C CG1  . ILE A 1 12 ? 87.317  9.743   -21.649 1.00 0.00 ? 12 ILE A CG1  7  
ATOM 8757  C CG2  . ILE A 1 12 ? 85.560  8.591   -20.264 1.00 0.00 ? 12 ILE A CG2  7  
ATOM 8758  C CD1  . ILE A 1 12 ? 87.000  11.194  -21.273 1.00 0.00 ? 12 ILE A CD1  7  
ATOM 8759  H H    . ILE A 1 12 ? 84.329  8.171   -23.517 1.00 0.00 ? 12 ILE A H    7  
ATOM 8760  H HA   . ILE A 1 12 ? 87.117  7.692   -23.128 1.00 0.00 ? 12 ILE A HA   7  
ATOM 8761  H HB   . ILE A 1 12 ? 85.245  9.544   -22.160 1.00 0.00 ? 12 ILE A HB   7  
ATOM 8762  H HG12 . ILE A 1 12 ? 87.976  9.314   -20.909 1.00 0.00 ? 12 ILE A HG12 7  
ATOM 8763  H HG13 . ILE A 1 12 ? 87.805  9.734   -22.612 1.00 0.00 ? 12 ILE A HG13 7  
ATOM 8764  H HG21 . ILE A 1 12 ? 85.310  9.503   -19.737 1.00 0.00 ? 12 ILE A HG21 7  
ATOM 8765  H HG22 . ILE A 1 12 ? 86.361  8.088   -19.742 1.00 0.00 ? 12 ILE A HG22 7  
ATOM 8766  H HG23 . ILE A 1 12 ? 84.695  7.953   -20.284 1.00 0.00 ? 12 ILE A HG23 7  
ATOM 8767  H HD11 . ILE A 1 12 ? 86.314  11.210  -20.440 1.00 0.00 ? 12 ILE A HD11 7  
ATOM 8768  H HD12 . ILE A 1 12 ? 86.549  11.690  -22.120 1.00 0.00 ? 12 ILE A HD12 7  
ATOM 8769  H HD13 . ILE A 1 12 ? 87.912  11.703  -21.004 1.00 0.00 ? 12 ILE A HD13 7  
ATOM 8770  N N    . VAL A 1 13 ? 84.967  5.925   -21.413 1.00 0.00 ? 13 VAL A N    7  
ATOM 8771  C CA   . VAL A 1 13 ? 84.839  4.700   -20.634 1.00 0.00 ? 13 VAL A CA   7  
ATOM 8772  C C    . VAL A 1 13 ? 85.414  3.528   -21.420 1.00 0.00 ? 13 VAL A C    7  
ATOM 8773  O O    . VAL A 1 13 ? 86.297  2.804   -20.939 1.00 0.00 ? 13 VAL A O    7  
ATOM 8774  C CB   . VAL A 1 13 ? 83.366  4.441   -20.316 1.00 0.00 ? 13 VAL A CB   7  
ATOM 8775  C CG1  . VAL A 1 13 ? 83.233  3.173   -19.469 1.00 0.00 ? 13 VAL A CG1  7  
ATOM 8776  C CG2  . VAL A 1 13 ? 82.798  5.636   -19.544 1.00 0.00 ? 13 VAL A CG2  7  
ATOM 8777  H H    . VAL A 1 13 ? 84.160  6.427   -21.678 1.00 0.00 ? 13 VAL A H    7  
ATOM 8778  H HA   . VAL A 1 13 ? 85.386  4.809   -19.714 1.00 0.00 ? 13 VAL A HA   7  
ATOM 8779  H HB   . VAL A 1 13 ? 82.819  4.314   -21.238 1.00 0.00 ? 13 VAL A HB   7  
ATOM 8780  H HG11 . VAL A 1 13 ? 83.585  2.322   -20.032 1.00 0.00 ? 13 VAL A HG11 7  
ATOM 8781  H HG12 . VAL A 1 13 ? 82.197  3.025   -19.207 1.00 0.00 ? 13 VAL A HG12 7  
ATOM 8782  H HG13 . VAL A 1 13 ? 83.820  3.278   -18.569 1.00 0.00 ? 13 VAL A HG13 7  
ATOM 8783  H HG21 . VAL A 1 13 ? 81.860  5.359   -19.086 1.00 0.00 ? 13 VAL A HG21 7  
ATOM 8784  H HG22 . VAL A 1 13 ? 82.634  6.458   -20.225 1.00 0.00 ? 13 VAL A HG22 7  
ATOM 8785  H HG23 . VAL A 1 13 ? 83.497  5.940   -18.779 1.00 0.00 ? 13 VAL A HG23 7  
ATOM 8786  N N    . VAL A 1 14 ? 84.922  3.357   -22.641 1.00 0.00 ? 14 VAL A N    7  
ATOM 8787  C CA   . VAL A 1 14 ? 85.407  2.284   -23.493 1.00 0.00 ? 14 VAL A CA   7  
ATOM 8788  C C    . VAL A 1 14 ? 86.910  2.432   -23.705 1.00 0.00 ? 14 VAL A C    7  
ATOM 8789  O O    . VAL A 1 14 ? 87.620  1.445   -23.887 1.00 0.00 ? 14 VAL A O    7  
ATOM 8790  C CB   . VAL A 1 14 ? 84.693  2.323   -24.844 1.00 0.00 ? 14 VAL A CB   7  
ATOM 8791  C CG1  . VAL A 1 14 ? 85.275  1.244   -25.760 1.00 0.00 ? 14 VAL A CG1  7  
ATOM 8792  C CG2  . VAL A 1 14 ? 83.198  2.064   -24.641 1.00 0.00 ? 14 VAL A CG2  7  
ATOM 8793  H H    . VAL A 1 14 ? 84.228  3.970   -22.975 1.00 0.00 ? 14 VAL A H    7  
ATOM 8794  H HA   . VAL A 1 14 ? 85.208  1.335   -23.016 1.00 0.00 ? 14 VAL A HA   7  
ATOM 8795  H HB   . VAL A 1 14 ? 84.833  3.293   -25.299 1.00 0.00 ? 14 VAL A HB   7  
ATOM 8796  H HG11 . VAL A 1 14 ? 85.357  0.316   -25.214 1.00 0.00 ? 14 VAL A HG11 7  
ATOM 8797  H HG12 . VAL A 1 14 ? 86.253  1.551   -26.098 1.00 0.00 ? 14 VAL A HG12 7  
ATOM 8798  H HG13 . VAL A 1 14 ? 84.626  1.106   -26.612 1.00 0.00 ? 14 VAL A HG13 7  
ATOM 8799  H HG21 . VAL A 1 14 ? 82.690  2.119   -25.592 1.00 0.00 ? 14 VAL A HG21 7  
ATOM 8800  H HG22 . VAL A 1 14 ? 82.793  2.810   -23.973 1.00 0.00 ? 14 VAL A HG22 7  
ATOM 8801  H HG23 . VAL A 1 14 ? 83.058  1.083   -24.213 1.00 0.00 ? 14 VAL A HG23 7  
ATOM 8802  N N    . GLY A 1 15 ? 87.380  3.679   -23.680 1.00 0.00 ? 15 GLY A N    7  
ATOM 8803  C CA   . GLY A 1 15 ? 88.795  3.968   -23.870 1.00 0.00 ? 15 GLY A CA   7  
ATOM 8804  C C    . GLY A 1 15 ? 89.627  3.424   -22.716 1.00 0.00 ? 15 GLY A C    7  
ATOM 8805  O O    . GLY A 1 15 ? 90.728  2.919   -22.917 1.00 0.00 ? 15 GLY A O    7  
ATOM 8806  H H    . GLY A 1 15 ? 86.760  4.421   -23.531 1.00 0.00 ? 15 GLY A H    7  
ATOM 8807  H HA2  . GLY A 1 15 ? 89.127  3.519   -24.794 1.00 0.00 ? 15 GLY A HA2  7  
ATOM 8808  H HA3  . GLY A 1 15 ? 88.931  5.038   -23.928 1.00 0.00 ? 15 GLY A HA3  7  
ATOM 8809  N N    . ASP A 1 16 ? 89.097  3.533   -21.504 1.00 0.00 ? 16 ASP A N    7  
ATOM 8810  C CA   . ASP A 1 16 ? 89.813  3.044   -20.333 1.00 0.00 ? 16 ASP A CA   7  
ATOM 8811  C C    . ASP A 1 16 ? 89.911  1.522   -20.372 1.00 0.00 ? 16 ASP A C    7  
ATOM 8812  O O    . ASP A 1 16 ? 90.976  0.947   -20.123 1.00 0.00 ? 16 ASP A O    7  
ATOM 8813  C CB   . ASP A 1 16 ? 89.092  3.478   -19.057 1.00 0.00 ? 16 ASP A CB   7  
ATOM 8814  C CG   . ASP A 1 16 ? 89.988  3.243   -17.847 1.00 0.00 ? 16 ASP A CG   7  
ATOM 8815  O OD1  . ASP A 1 16 ? 90.901  2.442   -17.957 1.00 0.00 ? 16 ASP A OD1  7  
ATOM 8816  O OD2  . ASP A 1 16 ? 89.750  3.867   -16.826 1.00 0.00 ? 16 ASP A OD2  7  
ATOM 8817  H H    . ASP A 1 16 ? 88.216  3.946   -21.396 1.00 0.00 ? 16 ASP A H    7  
ATOM 8818  H HA   . ASP A 1 16 ? 90.810  3.459   -20.331 1.00 0.00 ? 16 ASP A HA   7  
ATOM 8819  H HB2  . ASP A 1 16 ? 88.846  4.528   -19.124 1.00 0.00 ? 16 ASP A HB2  7  
ATOM 8820  H HB3  . ASP A 1 16 ? 88.184  2.905   -18.945 1.00 0.00 ? 16 ASP A HB3  7  
ATOM 8821  N N    . LEU A 1 17 ? 88.791  0.874   -20.679 1.00 0.00 ? 17 LEU A N    7  
ATOM 8822  C CA   . LEU A 1 17 ? 88.765  -0.585  -20.738 1.00 0.00 ? 17 LEU A CA   7  
ATOM 8823  C C    . LEU A 1 17 ? 89.792  -1.112  -21.742 1.00 0.00 ? 17 LEU A C    7  
ATOM 8824  O O    . LEU A 1 17 ? 90.596  -1.990  -21.415 1.00 0.00 ? 17 LEU A O    7  
ATOM 8825  C CB   . LEU A 1 17 ? 87.361  -1.068  -21.127 1.00 0.00 ? 17 LEU A CB   7  
ATOM 8826  C CG   . LEU A 1 17 ? 87.260  -2.598  -20.987 1.00 0.00 ? 17 LEU A CG   7  
ATOM 8827  C CD1  . LEU A 1 17 ? 87.285  -3.014  -19.503 1.00 0.00 ? 17 LEU A CD1  7  
ATOM 8828  C CD2  . LEU A 1 17 ? 85.951  -3.069  -21.632 1.00 0.00 ? 17 LEU A CD2  7  
ATOM 8829  H H    . LEU A 1 17 ? 87.969  1.384   -20.865 1.00 0.00 ? 17 LEU A H    7  
ATOM 8830  H HA   . LEU A 1 17 ? 89.005  -0.970  -19.761 1.00 0.00 ? 17 LEU A HA   7  
ATOM 8831  H HB2  . LEU A 1 17 ? 86.630  -0.596  -20.487 1.00 0.00 ? 17 LEU A HB2  7  
ATOM 8832  H HB3  . LEU A 1 17 ? 87.163  -0.792  -22.152 1.00 0.00 ? 17 LEU A HB3  7  
ATOM 8833  H HG   . LEU A 1 17 ? 88.093  -3.059  -21.498 1.00 0.00 ? 17 LEU A HG   7  
ATOM 8834  H HD11 . LEU A 1 17 ? 88.308  -3.087  -19.167 1.00 0.00 ? 17 LEU A HD11 7  
ATOM 8835  H HD12 . LEU A 1 17 ? 86.805  -3.976  -19.385 1.00 0.00 ? 17 LEU A HD12 7  
ATOM 8836  H HD13 . LEU A 1 17 ? 86.762  -2.281  -18.906 1.00 0.00 ? 17 LEU A HD13 7  
ATOM 8837  H HD21 . LEU A 1 17 ? 85.912  -2.731  -22.658 1.00 0.00 ? 17 LEU A HD21 7  
ATOM 8838  H HD22 . LEU A 1 17 ? 85.113  -2.661  -21.086 1.00 0.00 ? 17 LEU A HD22 7  
ATOM 8839  H HD23 . LEU A 1 17 ? 85.905  -4.148  -21.607 1.00 0.00 ? 17 LEU A HD23 7  
ATOM 8840  N N    . VAL A 1 18 ? 89.769  -0.580  -22.964 1.00 0.00 ? 18 VAL A N    7  
ATOM 8841  C CA   . VAL A 1 18 ? 90.711  -1.033  -23.982 1.00 0.00 ? 18 VAL A CA   7  
ATOM 8842  C C    . VAL A 1 18 ? 92.140  -0.662  -23.600 1.00 0.00 ? 18 VAL A C    7  
ATOM 8843  O O    . VAL A 1 18 ? 93.078  -1.354  -23.980 1.00 0.00 ? 18 VAL A O    7  
ATOM 8844  C CB   . VAL A 1 18 ? 90.365  -0.441  -25.349 1.00 0.00 ? 18 VAL A CB   7  
ATOM 8845  C CG1  . VAL A 1 18 ? 90.418  1.079   -25.271 1.00 0.00 ? 18 VAL A CG1  7  
ATOM 8846  C CG2  . VAL A 1 18 ? 91.375  -0.931  -26.389 1.00 0.00 ? 18 VAL A CG2  7  
ATOM 8847  H H    . VAL A 1 18 ? 89.112  0.119   -23.183 1.00 0.00 ? 18 VAL A H    7  
ATOM 8848  H HA   . VAL A 1 18 ? 90.645  -2.109  -24.050 1.00 0.00 ? 18 VAL A HA   7  
ATOM 8849  H HB   . VAL A 1 18 ? 89.370  -0.752  -25.635 1.00 0.00 ? 18 VAL A HB   7  
ATOM 8850  H HG11 . VAL A 1 18 ? 89.960  1.504   -26.152 1.00 0.00 ? 18 VAL A HG11 7  
ATOM 8851  H HG12 . VAL A 1 18 ? 91.447  1.402   -25.205 1.00 0.00 ? 18 VAL A HG12 7  
ATOM 8852  H HG13 . VAL A 1 18 ? 89.883  1.399   -24.397 1.00 0.00 ? 18 VAL A HG13 7  
ATOM 8853  H HG21 . VAL A 1 18 ? 91.506  -1.999  -26.288 1.00 0.00 ? 18 VAL A HG21 7  
ATOM 8854  H HG22 . VAL A 1 18 ? 92.323  -0.436  -26.232 1.00 0.00 ? 18 VAL A HG22 7  
ATOM 8855  H HG23 . VAL A 1 18 ? 91.011  -0.705  -27.380 1.00 0.00 ? 18 VAL A HG23 7  
ATOM 8856  N N    . LEU A 1 19 ? 92.311  0.423   -22.846 1.00 0.00 ? 19 LEU A N    7  
ATOM 8857  C CA   . LEU A 1 19 ? 93.655  0.833   -22.436 1.00 0.00 ? 19 LEU A CA   7  
ATOM 8858  C C    . LEU A 1 19 ? 94.302  -0.283  -21.614 1.00 0.00 ? 19 LEU A C    7  
ATOM 8859  O O    . LEU A 1 19 ? 95.375  -0.787  -21.962 1.00 0.00 ? 19 LEU A O    7  
ATOM 8860  C CB   . LEU A 1 19 ? 93.574  2.123   -21.596 1.00 0.00 ? 19 LEU A CB   7  
ATOM 8861  C CG   . LEU A 1 19 ? 94.925  2.867   -21.552 1.00 0.00 ? 19 LEU A CG   7  
ATOM 8862  C CD1  . LEU A 1 19 ? 96.010  1.967   -20.949 1.00 0.00 ? 19 LEU A CD1  7  
ATOM 8863  C CD2  . LEU A 1 19 ? 95.340  3.326   -22.966 1.00 0.00 ? 19 LEU A CD2  7  
ATOM 8864  H H    . LEU A 1 19 ? 91.533  0.950   -22.563 1.00 0.00 ? 19 LEU A H    7  
ATOM 8865  H HA   . LEU A 1 19 ? 94.249  1.014   -23.316 1.00 0.00 ? 19 LEU A HA   7  
ATOM 8866  H HB2  . LEU A 1 19 ? 92.835  2.775   -22.024 1.00 0.00 ? 19 LEU A HB2  7  
ATOM 8867  H HB3  . LEU A 1 19 ? 93.278  1.871   -20.587 1.00 0.00 ? 19 LEU A HB3  7  
ATOM 8868  H HG   . LEU A 1 19 ? 94.815  3.737   -20.922 1.00 0.00 ? 19 LEU A HG   7  
ATOM 8869  H HD11 . LEU A 1 19 ? 96.385  1.296   -21.706 1.00 0.00 ? 19 LEU A HD11 7  
ATOM 8870  H HD12 . LEU A 1 19 ? 95.598  1.399   -20.129 1.00 0.00 ? 19 LEU A HD12 7  
ATOM 8871  H HD13 . LEU A 1 19 ? 96.819  2.584   -20.584 1.00 0.00 ? 19 LEU A HD13 7  
ATOM 8872  H HD21 . LEU A 1 19 ? 94.460  3.508   -23.566 1.00 0.00 ? 19 LEU A HD21 7  
ATOM 8873  H HD22 . LEU A 1 19 ? 95.947  2.567   -23.441 1.00 0.00 ? 19 LEU A HD22 7  
ATOM 8874  H HD23 . LEU A 1 19 ? 95.912  4.239   -22.889 1.00 0.00 ? 19 LEU A HD23 7  
ATOM 8875  N N    . THR A 1 20 ? 93.635  -0.674  -20.529 1.00 0.00 ? 20 THR A N    7  
ATOM 8876  C CA   . THR A 1 20 ? 94.153  -1.734  -19.673 1.00 0.00 ? 20 THR A CA   7  
ATOM 8877  C C    . THR A 1 20 ? 94.360  -3.027  -20.456 1.00 0.00 ? 20 THR A C    7  
ATOM 8878  O O    . THR A 1 20 ? 95.351  -3.727  -20.258 1.00 0.00 ? 20 THR A O    7  
ATOM 8879  C CB   . THR A 1 20 ? 93.179  -2.002  -18.524 1.00 0.00 ? 20 THR A CB   7  
ATOM 8880  O OG1  . THR A 1 20 ? 92.758  -0.765  -17.973 1.00 0.00 ? 20 THR A OG1  7  
ATOM 8881  C CG2  . THR A 1 20 ? 93.866  -2.844  -17.438 1.00 0.00 ? 20 THR A CG2  7  
ATOM 8882  H H    . THR A 1 20 ? 92.781  -0.241  -20.297 1.00 0.00 ? 20 THR A H    7  
ATOM 8883  H HA   . THR A 1 20 ? 95.099  -1.419  -19.260 1.00 0.00 ? 20 THR A HA   7  
ATOM 8884  H HB   . THR A 1 20 ? 92.321  -2.538  -18.902 1.00 0.00 ? 20 THR A HB   7  
ATOM 8885  H HG1  . THR A 1 20 ? 93.538  -0.232  -17.805 1.00 0.00 ? 20 THR A HG1  7  
ATOM 8886  H HG21 . THR A 1 20 ? 93.125  -3.429  -16.912 1.00 0.00 ? 20 THR A HG21 7  
ATOM 8887  H HG22 . THR A 1 20 ? 94.367  -2.191  -16.739 1.00 0.00 ? 20 THR A HG22 7  
ATOM 8888  H HG23 . THR A 1 20 ? 94.590  -3.510  -17.888 1.00 0.00 ? 20 THR A HG23 7  
ATOM 8889  N N    . VAL A 1 21 ? 93.409  -3.355  -21.325 1.00 0.00 ? 21 VAL A N    7  
ATOM 8890  C CA   . VAL A 1 21 ? 93.497  -4.588  -22.107 1.00 0.00 ? 21 VAL A CA   7  
ATOM 8891  C C    . VAL A 1 21 ? 94.675  -4.563  -23.086 1.00 0.00 ? 21 VAL A C    7  
ATOM 8892  O O    . VAL A 1 21 ? 95.304  -5.593  -23.331 1.00 0.00 ? 21 VAL A O    7  
ATOM 8893  C CB   . VAL A 1 21 ? 92.194  -4.801  -22.882 1.00 0.00 ? 21 VAL A CB   7  
ATOM 8894  C CG1  . VAL A 1 21 ? 92.320  -6.040  -23.771 1.00 0.00 ? 21 VAL A CG1  7  
ATOM 8895  C CG2  . VAL A 1 21 ? 91.041  -5.002  -21.894 1.00 0.00 ? 21 VAL A CG2  7  
ATOM 8896  H H    . VAL A 1 21 ? 92.626  -2.770  -21.430 1.00 0.00 ? 21 VAL A H    7  
ATOM 8897  H HA   . VAL A 1 21 ? 93.630  -5.417  -21.429 1.00 0.00 ? 21 VAL A HA   7  
ATOM 8898  H HB   . VAL A 1 21 ? 91.997  -3.937  -23.498 1.00 0.00 ? 21 VAL A HB   7  
ATOM 8899  H HG11 . VAL A 1 21 ? 92.755  -6.850  -23.201 1.00 0.00 ? 21 VAL A HG11 7  
ATOM 8900  H HG12 . VAL A 1 21 ? 92.954  -5.814  -24.615 1.00 0.00 ? 21 VAL A HG12 7  
ATOM 8901  H HG13 . VAL A 1 21 ? 91.342  -6.333  -24.123 1.00 0.00 ? 21 VAL A HG13 7  
ATOM 8902  H HG21 . VAL A 1 21 ? 91.102  -5.990  -21.464 1.00 0.00 ? 21 VAL A HG21 7  
ATOM 8903  H HG22 . VAL A 1 21 ? 90.100  -4.894  -22.413 1.00 0.00 ? 21 VAL A HG22 7  
ATOM 8904  H HG23 . VAL A 1 21 ? 91.105  -4.264  -21.109 1.00 0.00 ? 21 VAL A HG23 7  
ATOM 8905  N N    . LEU A 1 22 ? 94.953  -3.400  -23.665 1.00 0.00 ? 22 LEU A N    7  
ATOM 8906  C CA   . LEU A 1 22 ? 96.039  -3.282  -24.639 1.00 0.00 ? 22 LEU A CA   7  
ATOM 8907  C C    . LEU A 1 22 ? 97.403  -3.471  -23.974 1.00 0.00 ? 22 LEU A C    7  
ATOM 8908  O O    . LEU A 1 22 ? 98.191  -4.321  -24.391 1.00 0.00 ? 22 LEU A O    7  
ATOM 8909  C CB   . LEU A 1 22 ? 95.970  -1.902  -25.326 1.00 0.00 ? 22 LEU A CB   7  
ATOM 8910  C CG   . LEU A 1 22 ? 96.550  -1.961  -26.756 1.00 0.00 ? 22 LEU A CG   7  
ATOM 8911  C CD1  . LEU A 1 22 ? 97.963  -2.551  -26.723 1.00 0.00 ? 22 LEU A CD1  7  
ATOM 8912  C CD2  . LEU A 1 22 ? 95.647  -2.811  -27.678 1.00 0.00 ? 22 LEU A CD2  7  
ATOM 8913  H H    . LEU A 1 22 ? 94.409  -2.613  -23.452 1.00 0.00 ? 22 LEU A H    7  
ATOM 8914  H HA   . LEU A 1 22 ? 95.910  -4.050  -25.382 1.00 0.00 ? 22 LEU A HA   7  
ATOM 8915  H HB2  . LEU A 1 22 ? 94.941  -1.582  -25.375 1.00 0.00 ? 22 LEU A HB2  7  
ATOM 8916  H HB3  . LEU A 1 22 ? 96.532  -1.182  -24.747 1.00 0.00 ? 22 LEU A HB3  7  
ATOM 8917  H HG   . LEU A 1 22 ? 96.605  -0.954  -27.148 1.00 0.00 ? 22 LEU A HG   7  
ATOM 8918  H HD11 . LEU A 1 22 ? 98.515  -2.125  -25.898 1.00 0.00 ? 22 LEU A HD11 7  
ATOM 8919  H HD12 . LEU A 1 22 ? 98.469  -2.322  -27.649 1.00 0.00 ? 22 LEU A HD12 7  
ATOM 8920  H HD13 . LEU A 1 22 ? 97.903  -3.622  -26.604 1.00 0.00 ? 22 LEU A HD13 7  
ATOM 8921  H HD21 . LEU A 1 22 ? 95.712  -2.428  -28.686 1.00 0.00 ? 22 LEU A HD21 7  
ATOM 8922  H HD22 . LEU A 1 22 ? 94.621  -2.755  -27.344 1.00 0.00 ? 22 LEU A HD22 7  
ATOM 8923  H HD23 . LEU A 1 22 ? 95.971  -3.843  -27.669 1.00 0.00 ? 22 LEU A HD23 7  
ATOM 8924  N N    . ILE A 1 23 ? 97.686  -2.677  -22.946 1.00 0.00 ? 23 ILE A N    7  
ATOM 8925  C CA   . ILE A 1 23 ? 98.971  -2.784  -22.262 1.00 0.00 ? 23 ILE A CA   7  
ATOM 8926  C C    . ILE A 1 23 ? 99.090  -4.126  -21.542 1.00 0.00 ? 23 ILE A C    7  
ATOM 8927  O O    . ILE A 1 23 ? 100.125 -4.789  -21.615 1.00 0.00 ? 23 ILE A O    7  
ATOM 8928  C CB   . ILE A 1 23 ? 99.139  -1.627  -21.272 1.00 0.00 ? 23 ILE A CB   7  
ATOM 8929  C CG1  . ILE A 1 23 ? 98.902  -0.307  -22.009 1.00 0.00 ? 23 ILE A CG1  7  
ATOM 8930  C CG2  . ILE A 1 23 ? 100.561 -1.633  -20.697 1.00 0.00 ? 23 ILE A CG2  7  
ATOM 8931  C CD1  . ILE A 1 23 ? 99.008  0.863   -21.027 1.00 0.00 ? 23 ILE A CD1  7  
ATOM 8932  H H    . ILE A 1 23 ? 97.027  -2.011  -22.649 1.00 0.00 ? 23 ILE A H    7  
ATOM 8933  H HA   . ILE A 1 23 ? 99.759  -2.720  -22.999 1.00 0.00 ? 23 ILE A HA   7  
ATOM 8934  H HB   . ILE A 1 23 ? 98.421  -1.729  -20.472 1.00 0.00 ? 23 ILE A HB   7  
ATOM 8935  H HG12 . ILE A 1 23 ? 99.643  -0.192  -22.786 1.00 0.00 ? 23 ILE A HG12 7  
ATOM 8936  H HG13 . ILE A 1 23 ? 97.917  -0.314  -22.452 1.00 0.00 ? 23 ILE A HG13 7  
ATOM 8937  H HG21 . ILE A 1 23 ? 101.257 -1.313  -21.459 1.00 0.00 ? 23 ILE A HG21 7  
ATOM 8938  H HG22 . ILE A 1 23 ? 100.821 -2.628  -20.369 1.00 0.00 ? 23 ILE A HG22 7  
ATOM 8939  H HG23 . ILE A 1 23 ? 100.612 -0.954  -19.858 1.00 0.00 ? 23 ILE A HG23 7  
ATOM 8940  H HD11 . ILE A 1 23 ? 98.298  0.725   -20.224 1.00 0.00 ? 23 ILE A HD11 7  
ATOM 8941  H HD12 . ILE A 1 23 ? 98.792  1.786   -21.545 1.00 0.00 ? 23 ILE A HD12 7  
ATOM 8942  H HD13 . ILE A 1 23 ? 100.008 0.906   -20.622 1.00 0.00 ? 23 ILE A HD13 7  
ATOM 8943  N N    . ALA A 1 24 ? 98.026  -4.524  -20.855 1.00 0.00 ? 24 ALA A N    7  
ATOM 8944  C CA   . ALA A 1 24 ? 98.028  -5.795  -20.137 1.00 0.00 ? 24 ALA A CA   7  
ATOM 8945  C C    . ALA A 1 24 ? 98.302  -6.945  -21.101 1.00 0.00 ? 24 ALA A C    7  
ATOM 8946  O O    . ALA A 1 24 ? 99.090  -7.846  -20.810 1.00 0.00 ? 24 ALA A O    7  
ATOM 8947  C CB   . ALA A 1 24 ? 96.677  -6.011  -19.453 1.00 0.00 ? 24 ALA A CB   7  
ATOM 8948  H H    . ALA A 1 24 ? 97.225  -3.960  -20.833 1.00 0.00 ? 24 ALA A H    7  
ATOM 8949  H HA   . ALA A 1 24 ? 98.801  -5.773  -19.383 1.00 0.00 ? 24 ALA A HA   7  
ATOM 8950  H HB1  . ALA A 1 24 ? 96.689  -6.948  -18.917 1.00 0.00 ? 24 ALA A HB1  7  
ATOM 8951  H HB2  . ALA A 1 24 ? 95.896  -6.033  -20.199 1.00 0.00 ? 24 ALA A HB2  7  
ATOM 8952  H HB3  . ALA A 1 24 ? 96.490  -5.202  -18.761 1.00 0.00 ? 24 ALA A HB3  7  
ATOM 8953  N N    . LEU A 1 25 ? 97.648  -6.902  -22.255 1.00 0.00 ? 25 LEU A N    7  
ATOM 8954  C CA   . LEU A 1 25 ? 97.831  -7.939  -23.261 1.00 0.00 ? 25 LEU A CA   7  
ATOM 8955  C C    . LEU A 1 25 ? 99.248  -7.876  -23.821 1.00 0.00 ? 25 LEU A C    7  
ATOM 8956  O O    . LEU A 1 25 ? 99.816  -8.892  -24.218 1.00 0.00 ? 25 LEU A O    7  
ATOM 8957  C CB   . LEU A 1 25 ? 96.810  -7.751  -24.391 1.00 0.00 ? 25 LEU A CB   7  
ATOM 8958  C CG   . LEU A 1 25 ? 97.002  -8.819  -25.480 1.00 0.00 ? 25 LEU A CG   7  
ATOM 8959  C CD1  . LEU A 1 25 ? 96.850  -10.227 -24.882 1.00 0.00 ? 25 LEU A CD1  7  
ATOM 8960  C CD2  . LEU A 1 25 ? 95.946  -8.608  -26.572 1.00 0.00 ? 25 LEU A CD2  7  
ATOM 8961  H H    . LEU A 1 25 ? 97.037  -6.158  -22.435 1.00 0.00 ? 25 LEU A H    7  
ATOM 8962  H HA   . LEU A 1 25 ? 97.676  -8.901  -22.800 1.00 0.00 ? 25 LEU A HA   7  
ATOM 8963  H HB2  . LEU A 1 25 ? 95.813  -7.832  -23.986 1.00 0.00 ? 25 LEU A HB2  7  
ATOM 8964  H HB3  . LEU A 1 25 ? 96.937  -6.771  -24.827 1.00 0.00 ? 25 LEU A HB3  7  
ATOM 8965  H HG   . LEU A 1 25 ? 97.987  -8.719  -25.914 1.00 0.00 ? 25 LEU A HG   7  
ATOM 8966  H HD11 . LEU A 1 25 ? 97.787  -10.533 -24.442 1.00 0.00 ? 25 LEU A HD11 7  
ATOM 8967  H HD12 . LEU A 1 25 ? 96.578  -10.927 -25.659 1.00 0.00 ? 25 LEU A HD12 7  
ATOM 8968  H HD13 . LEU A 1 25 ? 96.081  -10.219 -24.123 1.00 0.00 ? 25 LEU A HD13 7  
ATOM 8969  H HD21 . LEU A 1 25 ? 94.978  -8.467  -26.114 1.00 0.00 ? 25 LEU A HD21 7  
ATOM 8970  H HD22 . LEU A 1 25 ? 95.917  -9.474  -27.216 1.00 0.00 ? 25 LEU A HD22 7  
ATOM 8971  H HD23 . LEU A 1 25 ? 96.199  -7.735  -27.155 1.00 0.00 ? 25 LEU A HD23 7  
ATOM 8972  N N    . ALA A 1 26 ? 99.809  -6.671  -23.854 1.00 0.00 ? 26 ALA A N    7  
ATOM 8973  C CA   . ALA A 1 26 ? 101.160 -6.482  -24.369 1.00 0.00 ? 26 ALA A CA   7  
ATOM 8974  C C    . ALA A 1 26 ? 102.175 -7.242  -23.522 1.00 0.00 ? 26 ALA A C    7  
ATOM 8975  O O    . ALA A 1 26 ? 102.992 -7.997  -24.050 1.00 0.00 ? 26 ALA A O    7  
ATOM 8976  C CB   . ALA A 1 26 ? 101.512 -4.994  -24.379 1.00 0.00 ? 26 ALA A CB   7  
ATOM 8977  H H    . ALA A 1 26 ? 99.306  -5.896  -23.525 1.00 0.00 ? 26 ALA A H    7  
ATOM 8978  H HA   . ALA A 1 26 ? 101.202 -6.855  -25.381 1.00 0.00 ? 26 ALA A HA   7  
ATOM 8979  H HB1  . ALA A 1 26 ? 102.388 -4.834  -24.991 1.00 0.00 ? 26 ALA A HB1  7  
ATOM 8980  H HB2  . ALA A 1 26 ? 101.713 -4.664  -23.370 1.00 0.00 ? 26 ALA A HB2  7  
ATOM 8981  H HB3  . ALA A 1 26 ? 100.684 -4.430  -24.782 1.00 0.00 ? 26 ALA A HB3  7  
ATOM 8982  N N    . VAL A 1 27 ? 102.124 -7.043  -22.208 1.00 0.00 ? 27 VAL A N    7  
ATOM 8983  C CA   . VAL A 1 27 ? 103.054 -7.727  -21.315 1.00 0.00 ? 27 VAL A CA   7  
ATOM 8984  C C    . VAL A 1 27 ? 102.795 -9.230  -21.329 1.00 0.00 ? 27 VAL A C    7  
ATOM 8985  O O    . VAL A 1 27 ? 103.728 -10.028 -21.248 1.00 0.00 ? 27 VAL A O    7  
ATOM 8986  C CB   . VAL A 1 27 ? 102.918 -7.193  -19.886 1.00 0.00 ? 27 VAL A CB   7  
ATOM 8987  C CG1  . VAL A 1 27 ? 103.459 -5.764  -19.821 1.00 0.00 ? 27 VAL A CG1  7  
ATOM 8988  C CG2  . VAL A 1 27 ? 101.448 -7.194  -19.470 1.00 0.00 ? 27 VAL A CG2  7  
ATOM 8989  H H    . VAL A 1 27 ? 101.453 -6.431  -21.835 1.00 0.00 ? 27 VAL A H    7  
ATOM 8990  H HA   . VAL A 1 27 ? 104.061 -7.544  -21.659 1.00 0.00 ? 27 VAL A HA   7  
ATOM 8991  H HB   . VAL A 1 27 ? 103.485 -7.821  -19.214 1.00 0.00 ? 27 VAL A HB   7  
ATOM 8992  H HG11 . VAL A 1 27 ? 102.991 -5.168  -20.589 1.00 0.00 ? 27 VAL A HG11 7  
ATOM 8993  H HG12 . VAL A 1 27 ? 104.528 -5.776  -19.975 1.00 0.00 ? 27 VAL A HG12 7  
ATOM 8994  H HG13 . VAL A 1 27 ? 103.238 -5.341  -18.852 1.00 0.00 ? 27 VAL A HG13 7  
ATOM 8995  H HG21 . VAL A 1 27 ? 100.894 -6.525  -20.110 1.00 0.00 ? 27 VAL A HG21 7  
ATOM 8996  H HG22 . VAL A 1 27 ? 101.364 -6.863  -18.445 1.00 0.00 ? 27 VAL A HG22 7  
ATOM 8997  H HG23 . VAL A 1 27 ? 101.049 -8.193  -19.558 1.00 0.00 ? 27 VAL A HG23 7  
ATOM 8998  N N    . TYR A 1 28 ? 101.526 -9.610  -21.436 1.00 0.00 ? 28 TYR A N    7  
ATOM 8999  C CA   . TYR A 1 28 ? 101.167 -11.023 -21.462 1.00 0.00 ? 28 TYR A CA   7  
ATOM 9000  C C    . TYR A 1 28 ? 101.794 -11.713 -22.671 1.00 0.00 ? 28 TYR A C    7  
ATOM 9001  O O    . TYR A 1 28 ? 102.405 -12.774 -22.542 1.00 0.00 ? 28 TYR A O    7  
ATOM 9002  C CB   . TYR A 1 28 ? 99.647  -11.178 -21.517 1.00 0.00 ? 28 TYR A CB   7  
ATOM 9003  C CG   . TYR A 1 28 ? 99.295  -12.646 -21.576 1.00 0.00 ? 28 TYR A CG   7  
ATOM 9004  C CD1  . TYR A 1 28 ? 99.261  -13.309 -22.808 1.00 0.00 ? 28 TYR A CD1  7  
ATOM 9005  C CD2  . TYR A 1 28 ? 99.007  -13.343 -20.397 1.00 0.00 ? 28 TYR A CD2  7  
ATOM 9006  C CE1  . TYR A 1 28 ? 98.937  -14.669 -22.862 1.00 0.00 ? 28 TYR A CE1  7  
ATOM 9007  C CE2  . TYR A 1 28 ? 98.682  -14.704 -20.451 1.00 0.00 ? 28 TYR A CE2  7  
ATOM 9008  C CZ   . TYR A 1 28 ? 98.648  -15.368 -21.683 1.00 0.00 ? 28 TYR A CZ   7  
ATOM 9009  O OH   . TYR A 1 28 ? 98.329  -16.709 -21.737 1.00 0.00 ? 28 TYR A OH   7  
ATOM 9010  H H    . TYR A 1 28 ? 100.820 -8.929  -21.498 1.00 0.00 ? 28 TYR A H    7  
ATOM 9011  H HA   . TYR A 1 28 ? 101.533 -11.493 -20.561 1.00 0.00 ? 28 TYR A HA   7  
ATOM 9012  H HB2  . TYR A 1 28 ? 99.208  -10.736 -20.634 1.00 0.00 ? 28 TYR A HB2  7  
ATOM 9013  H HB3  . TYR A 1 28 ? 99.265  -10.682 -22.397 1.00 0.00 ? 28 TYR A HB3  7  
ATOM 9014  H HD1  . TYR A 1 28 ? 99.484  -12.770 -23.718 1.00 0.00 ? 28 TYR A HD1  7  
ATOM 9015  H HD2  . TYR A 1 28 ? 99.033  -12.832 -19.447 1.00 0.00 ? 28 TYR A HD2  7  
ATOM 9016  H HE1  . TYR A 1 28 ? 98.910  -15.181 -23.813 1.00 0.00 ? 28 TYR A HE1  7  
ATOM 9017  H HE2  . TYR A 1 28 ? 98.460  -15.242 -19.541 1.00 0.00 ? 28 TYR A HE2  7  
ATOM 9018  H HH   . TYR A 1 28 ? 99.140  -17.211 -21.621 1.00 0.00 ? 28 TYR A HH   7  
ATOM 9019  N N    . PHE A 1 29 ? 101.638 -11.105 -23.843 1.00 0.00 ? 29 PHE A N    7  
ATOM 9020  C CA   . PHE A 1 29 ? 102.193 -11.675 -25.067 1.00 0.00 ? 29 PHE A CA   7  
ATOM 9021  C C    . PHE A 1 29 ? 103.716 -11.574 -25.066 1.00 0.00 ? 29 PHE A C    7  
ATOM 9022  O O    . PHE A 1 29 ? 104.412 -12.551 -25.345 1.00 0.00 ? 29 PHE A O    7  
ATOM 9023  C CB   . PHE A 1 29 ? 101.633 -10.941 -26.286 1.00 0.00 ? 29 PHE A CB   7  
ATOM 9024  C CG   . PHE A 1 29 ? 102.066 -11.653 -27.546 1.00 0.00 ? 29 PHE A CG   7  
ATOM 9025  C CD1  . PHE A 1 29 ? 101.326 -12.741 -28.025 1.00 0.00 ? 29 PHE A CD1  7  
ATOM 9026  C CD2  . PHE A 1 29 ? 103.208 -11.225 -28.233 1.00 0.00 ? 29 PHE A CD2  7  
ATOM 9027  C CE1  . PHE A 1 29 ? 101.728 -13.400 -29.193 1.00 0.00 ? 29 PHE A CE1  7  
ATOM 9028  C CE2  . PHE A 1 29 ? 103.610 -11.885 -29.400 1.00 0.00 ? 29 PHE A CE2  7  
ATOM 9029  C CZ   . PHE A 1 29 ? 102.870 -12.973 -29.881 1.00 0.00 ? 29 PHE A CZ   7  
ATOM 9030  H H    . PHE A 1 29 ? 101.142 -10.261 -23.887 1.00 0.00 ? 29 PHE A H    7  
ATOM 9031  H HA   . PHE A 1 29 ? 101.911 -12.715 -25.127 1.00 0.00 ? 29 PHE A HA   7  
ATOM 9032  H HB2  . PHE A 1 29 ? 100.554 -10.927 -26.234 1.00 0.00 ? 29 PHE A HB2  7  
ATOM 9033  H HB3  . PHE A 1 29 ? 102.005 -9.927  -26.300 1.00 0.00 ? 29 PHE A HB3  7  
ATOM 9034  H HD1  . PHE A 1 29 ? 100.446 -13.070 -27.494 1.00 0.00 ? 29 PHE A HD1  7  
ATOM 9035  H HD2  . PHE A 1 29 ? 103.780 -10.387 -27.864 1.00 0.00 ? 29 PHE A HD2  7  
ATOM 9036  H HE1  . PHE A 1 29 ? 101.158 -14.239 -29.563 1.00 0.00 ? 29 PHE A HE1  7  
ATOM 9037  H HE2  . PHE A 1 29 ? 104.492 -11.556 -29.931 1.00 0.00 ? 29 PHE A HE2  7  
ATOM 9038  H HZ   . PHE A 1 29 ? 103.181 -13.481 -30.781 1.00 0.00 ? 29 PHE A HZ   7  
ATOM 9039  N N    . LEU A 1 30 ? 104.226 -10.388 -24.753 1.00 0.00 ? 30 LEU A N    7  
ATOM 9040  C CA   . LEU A 1 30 ? 105.668 -10.170 -24.723 1.00 0.00 ? 30 LEU A CA   7  
ATOM 9041  C C    . LEU A 1 30 ? 106.320 -11.051 -23.661 1.00 0.00 ? 30 LEU A C    7  
ATOM 9042  O O    . LEU A 1 30 ? 107.372 -11.644 -23.893 1.00 0.00 ? 30 LEU A O    7  
ATOM 9043  C CB   . LEU A 1 30 ? 105.967 -8.696  -24.422 1.00 0.00 ? 30 LEU A CB   7  
ATOM 9044  C CG   . LEU A 1 30 ? 107.460 -8.391  -24.669 1.00 0.00 ? 30 LEU A CG   7  
ATOM 9045  C CD1  . LEU A 1 30 ? 107.706 -8.091  -26.154 1.00 0.00 ? 30 LEU A CD1  7  
ATOM 9046  C CD2  . LEU A 1 30 ? 107.879 -7.171  -23.843 1.00 0.00 ? 30 LEU A CD2  7  
ATOM 9047  H H    . LEU A 1 30 ? 103.622 -9.645  -24.542 1.00 0.00 ? 30 LEU A H    7  
ATOM 9048  H HA   . LEU A 1 30 ? 106.079 -10.423 -25.686 1.00 0.00 ? 30 LEU A HA   7  
ATOM 9049  H HB2  . LEU A 1 30 ? 105.355 -8.071  -25.058 1.00 0.00 ? 30 LEU A HB2  7  
ATOM 9050  H HB3  . LEU A 1 30 ? 105.725 -8.494  -23.388 1.00 0.00 ? 30 LEU A HB3  7  
ATOM 9051  H HG   . LEU A 1 30 ? 108.057 -9.243  -24.375 1.00 0.00 ? 30 LEU A HG   7  
ATOM 9052  H HD11 . LEU A 1 30 ? 107.551 -8.985  -26.738 1.00 0.00 ? 30 LEU A HD11 7  
ATOM 9053  H HD12 . LEU A 1 30 ? 108.722 -7.751  -26.286 1.00 0.00 ? 30 LEU A HD12 7  
ATOM 9054  H HD13 . LEU A 1 30 ? 107.026 -7.320  -26.485 1.00 0.00 ? 30 LEU A HD13 7  
ATOM 9055  H HD21 . LEU A 1 30 ? 108.856 -6.838  -24.162 1.00 0.00 ? 30 LEU A HD21 7  
ATOM 9056  H HD22 . LEU A 1 30 ? 107.914 -7.439  -22.797 1.00 0.00 ? 30 LEU A HD22 7  
ATOM 9057  H HD23 . LEU A 1 30 ? 107.163 -6.376  -23.985 1.00 0.00 ? 30 LEU A HD23 7  
ATOM 9058  N N    . GLY A 1 31 ? 105.687 -11.129 -22.494 1.00 0.00 ? 31 GLY A N    7  
ATOM 9059  C CA   . GLY A 1 31 ? 106.216 -11.939 -21.402 1.00 0.00 ? 31 GLY A CA   7  
ATOM 9060  C C    . GLY A 1 31 ? 106.242 -13.416 -21.779 1.00 0.00 ? 31 GLY A C    7  
ATOM 9061  O O    . GLY A 1 31 ? 105.195 -14.046 -21.935 1.00 0.00 ? 31 GLY A O    7  
ATOM 9062  H H    . GLY A 1 31 ? 104.852 -10.633 -22.365 1.00 0.00 ? 31 GLY A H    7  
ATOM 9063  H HA2  . GLY A 1 31 ? 107.221 -11.612 -21.174 1.00 0.00 ? 31 GLY A HA2  7  
ATOM 9064  H HA3  . GLY A 1 31 ? 105.594 -11.809 -20.530 1.00 0.00 ? 31 GLY A HA3  7  
ATOM 9065  N N    . ARG A 1 32 ? 107.444 -13.965 -21.921 1.00 0.00 ? 32 ARG A N    7  
ATOM 9066  C CA   . ARG A 1 32 ? 107.595 -15.371 -22.279 1.00 0.00 ? 32 ARG A CA   7  
ATOM 9067  C C    . ARG A 1 32 ? 107.233 -16.264 -21.095 1.00 0.00 ? 32 ARG A C    7  
ATOM 9068  O O    . ARG A 1 32 ? 107.414 -15.882 -19.939 1.00 0.00 ? 32 ARG A O    7  
ATOM 9069  C CB   . ARG A 1 32 ? 109.038 -15.646 -22.707 1.00 0.00 ? 32 ARG A CB   7  
ATOM 9070  C CG   . ARG A 1 32 ? 109.163 -17.092 -23.193 1.00 0.00 ? 32 ARG A CG   7  
ATOM 9071  C CD   . ARG A 1 32 ? 110.594 -17.349 -23.669 1.00 0.00 ? 32 ARG A CD   7  
ATOM 9072  N NE   . ARG A 1 32 ? 111.525 -17.229 -22.553 1.00 0.00 ? 32 ARG A NE   7  
ATOM 9073  C CZ   . ARG A 1 32 ? 112.839 -17.322 -22.739 1.00 0.00 ? 32 ARG A CZ   7  
ATOM 9074  N NH1  . ARG A 1 32 ? 113.314 -17.522 -23.938 1.00 0.00 ? 32 ARG A NH1  7  
ATOM 9075  N NH2  . ARG A 1 32 ? 113.650 -17.212 -21.725 1.00 0.00 ? 32 ARG A NH2  7  
ATOM 9076  H H    . ARG A 1 32 ? 108.243 -13.415 -21.782 1.00 0.00 ? 32 ARG A H    7  
ATOM 9077  H HA   . ARG A 1 32 ? 106.937 -15.597 -23.103 1.00 0.00 ? 32 ARG A HA   7  
ATOM 9078  H HB2  . ARG A 1 32 ? 109.309 -14.973 -23.508 1.00 0.00 ? 32 ARG A HB2  7  
ATOM 9079  H HB3  . ARG A 1 32 ? 109.700 -15.493 -21.868 1.00 0.00 ? 32 ARG A HB3  7  
ATOM 9080  H HG2  . ARG A 1 32 ? 108.927 -17.767 -22.383 1.00 0.00 ? 32 ARG A HG2  7  
ATOM 9081  H HG3  . ARG A 1 32 ? 108.479 -17.258 -24.012 1.00 0.00 ? 32 ARG A HG3  7  
ATOM 9082  H HD2  . ARG A 1 32 ? 110.661 -18.343 -24.083 1.00 0.00 ? 32 ARG A HD2  7  
ATOM 9083  H HD3  . ARG A 1 32 ? 110.851 -16.626 -24.431 1.00 0.00 ? 32 ARG A HD3  7  
ATOM 9084  H HE   . ARG A 1 32 ? 111.177 -17.077 -21.649 1.00 0.00 ? 32 ARG A HE   7  
ATOM 9085  H HH11 . ARG A 1 32 ? 112.693 -17.605 -24.716 1.00 0.00 ? 32 ARG A HH11 7  
ATOM 9086  H HH12 . ARG A 1 32 ? 114.302 -17.593 -24.078 1.00 0.00 ? 32 ARG A HH12 7  
ATOM 9087  H HH21 . ARG A 1 32 ? 113.286 -17.058 -20.806 1.00 0.00 ? 32 ARG A HH21 7  
ATOM 9088  H HH22 . ARG A 1 32 ? 114.638 -17.283 -21.864 1.00 0.00 ? 32 ARG A HH22 7  
ATOM 9089  N N    . LEU A 1 33 ? 106.723 -17.454 -21.392 1.00 0.00 ? 33 LEU A N    7  
ATOM 9090  C CA   . LEU A 1 33 ? 106.341 -18.391 -20.342 1.00 0.00 ? 33 LEU A CA   7  
ATOM 9091  C C    . LEU A 1 33 ? 107.585 -19.003 -19.703 1.00 0.00 ? 33 LEU A C    7  
ATOM 9092  O O    . LEU A 1 33 ? 108.287 -19.800 -20.325 1.00 0.00 ? 33 LEU A O    7  
ATOM 9093  C CB   . LEU A 1 33 ? 105.460 -19.506 -20.924 1.00 0.00 ? 33 LEU A CB   7  
ATOM 9094  C CG   . LEU A 1 33 ? 104.034 -18.989 -21.183 1.00 0.00 ? 33 LEU A CG   7  
ATOM 9095  C CD1  . LEU A 1 33 ? 103.291 -18.732 -19.855 1.00 0.00 ? 33 LEU A CD1  7  
ATOM 9096  C CD2  . LEU A 1 33 ? 104.095 -17.695 -22.001 1.00 0.00 ? 33 LEU A CD2  7  
ATOM 9097  H H    . LEU A 1 33 ? 106.602 -17.707 -22.331 1.00 0.00 ? 33 LEU A H    7  
ATOM 9098  H HA   . LEU A 1 33 ? 105.786 -17.862 -19.585 1.00 0.00 ? 33 LEU A HA   7  
ATOM 9099  H HB2  . LEU A 1 33 ? 105.889 -19.842 -21.856 1.00 0.00 ? 33 LEU A HB2  7  
ATOM 9100  H HB3  . LEU A 1 33 ? 105.422 -20.335 -20.232 1.00 0.00 ? 33 LEU A HB3  7  
ATOM 9101  H HG   . LEU A 1 33 ? 103.491 -19.736 -21.745 1.00 0.00 ? 33 LEU A HG   7  
ATOM 9102  H HD11 . LEU A 1 33 ? 102.229 -18.852 -20.015 1.00 0.00 ? 33 LEU A HD11 7  
ATOM 9103  H HD12 . LEU A 1 33 ? 103.486 -17.728 -19.510 1.00 0.00 ? 33 LEU A HD12 7  
ATOM 9104  H HD13 . LEU A 1 33 ? 103.618 -19.438 -19.107 1.00 0.00 ? 33 LEU A HD13 7  
ATOM 9105  H HD21 . LEU A 1 33 ? 104.812 -17.807 -22.802 1.00 0.00 ? 33 LEU A HD21 7  
ATOM 9106  H HD22 . LEU A 1 33 ? 104.393 -16.877 -21.362 1.00 0.00 ? 33 LEU A HD22 7  
ATOM 9107  H HD23 . LEU A 1 33 ? 103.120 -17.487 -22.418 1.00 0.00 ? 33 LEU A HD23 7  
ATOM 9108  N N    . GLY A 1 34 ? 107.851 -18.623 -18.458 1.00 0.00 ? 34 GLY A N    7  
ATOM 9109  C CA   . GLY A 1 34 ? 109.013 -19.141 -17.744 1.00 0.00 ? 34 GLY A CA   7  
ATOM 9110  C C    . GLY A 1 34 ? 109.373 -18.244 -16.565 1.00 0.00 ? 34 GLY A C    7  
ATOM 9111  O O    . GLY A 1 34 ? 110.545 -17.951 -16.331 1.00 0.00 ? 34 GLY A O    7  
ATOM 9112  H H    . GLY A 1 34 ? 107.257 -17.985 -18.011 1.00 0.00 ? 34 GLY A H    7  
ATOM 9113  H HA2  . GLY A 1 34 ? 108.792 -20.135 -17.382 1.00 0.00 ? 34 GLY A HA2  7  
ATOM 9114  H HA3  . GLY A 1 34 ? 109.853 -19.187 -18.420 1.00 0.00 ? 34 GLY A HA3  7  
ATOM 9115  N N    . THR A 1 35 ? 108.357 -17.811 -15.824 1.00 0.00 ? 35 THR A N    7  
ATOM 9116  C CA   . THR A 1 35 ? 108.580 -16.948 -14.670 1.00 0.00 ? 35 THR A CA   7  
ATOM 9117  C C    . THR A 1 35 ? 107.335 -16.895 -13.790 1.00 0.00 ? 35 THR A C    7  
ATOM 9118  O O    . THR A 1 35 ? 106.224 -16.693 -14.282 1.00 0.00 ? 35 THR A O    7  
ATOM 9119  C CB   . THR A 1 35 ? 108.937 -15.534 -15.136 1.00 0.00 ? 35 THR A CB   7  
ATOM 9120  O OG1  . THR A 1 35 ? 108.754 -14.623 -14.061 1.00 0.00 ? 35 THR A OG1  7  
ATOM 9121  C CG2  . THR A 1 35 ? 108.034 -15.137 -16.305 1.00 0.00 ? 35 THR A CG2  7  
ATOM 9122  H H    . THR A 1 35 ? 107.444 -18.078 -16.057 1.00 0.00 ? 35 THR A H    7  
ATOM 9123  H HA   . THR A 1 35 ? 109.402 -17.341 -14.090 1.00 0.00 ? 35 THR A HA   7  
ATOM 9124  H HB   . THR A 1 35 ? 109.966 -15.510 -15.458 1.00 0.00 ? 35 THR A HB   7  
ATOM 9125  H HG1  . THR A 1 35 ? 107.814 -14.439 -13.985 1.00 0.00 ? 35 THR A HG1  7  
ATOM 9126  H HG21 . THR A 1 35 ? 108.275 -15.742 -17.167 1.00 0.00 ? 35 THR A HG21 7  
ATOM 9127  H HG22 . THR A 1 35 ? 108.189 -14.095 -16.541 1.00 0.00 ? 35 THR A HG22 7  
ATOM 9128  H HG23 . THR A 1 35 ? 107.001 -15.295 -16.032 1.00 0.00 ? 35 THR A HG23 7  
ATOM 9129  N N    . ALA A 1 36 ? 107.528 -17.075 -12.488 1.00 0.00 ? 36 ALA A N    7  
ATOM 9130  C CA   . ALA A 1 36 ? 106.412 -17.043 -11.550 1.00 0.00 ? 36 ALA A CA   7  
ATOM 9131  C C    . ALA A 1 36 ? 105.918 -15.613 -11.358 1.00 0.00 ? 36 ALA A C    7  
ATOM 9132  O O    . ALA A 1 36 ? 105.849 -14.837 -12.311 1.00 0.00 ? 36 ALA A O    7  
ATOM 9133  C CB   . ALA A 1 36 ? 106.847 -17.622 -10.202 1.00 0.00 ? 36 ALA A CB   7  
ATOM 9134  H H    . ALA A 1 36 ? 108.436 -17.230 -12.152 1.00 0.00 ? 36 ALA A H    7  
ATOM 9135  H HA   . ALA A 1 36 ? 105.605 -17.643 -11.943 1.00 0.00 ? 36 ALA A HA   7  
ATOM 9136  H HB1  . ALA A 1 36 ? 107.422 -18.522 -10.365 1.00 0.00 ? 36 ALA A HB1  7  
ATOM 9137  H HB2  . ALA A 1 36 ? 105.973 -17.855 -9.611  1.00 0.00 ? 36 ALA A HB2  7  
ATOM 9138  H HB3  . ALA A 1 36 ? 107.453 -16.897 -9.677  1.00 0.00 ? 36 ALA A HB3  7  
ATOM 9139  N N    . GLU A 1 37 ? 105.575 -15.269 -10.121 1.00 0.00 ? 37 GLU A N    7  
ATOM 9140  C CA   . GLU A 1 37 ? 105.089 -13.927 -9.820  1.00 0.00 ? 37 GLU A CA   7  
ATOM 9141  C C    . GLU A 1 37 ? 104.025 -13.506 -10.829 1.00 0.00 ? 37 GLU A C    7  
ATOM 9142  O O    . GLU A 1 37 ? 103.735 -12.320 -10.981 1.00 0.00 ? 37 GLU A O    7  
ATOM 9143  C CB   . GLU A 1 37 ? 106.251 -12.934 -9.855  1.00 0.00 ? 37 GLU A CB   7  
ATOM 9144  C CG   . GLU A 1 37 ? 107.223 -13.245 -8.715  1.00 0.00 ? 37 GLU A CG   7  
ATOM 9145  C CD   . GLU A 1 37 ? 108.455 -12.354 -8.824  1.00 0.00 ? 37 GLU A CD   7  
ATOM 9146  O OE1  . GLU A 1 37 ? 108.765 -11.936 -9.927  1.00 0.00 ? 37 GLU A OE1  7  
ATOM 9147  O OE2  . GLU A 1 37 ? 109.071 -12.102 -7.801  1.00 0.00 ? 37 GLU A OE2  7  
ATOM 9148  H H    . GLU A 1 37 ? 105.650 -15.927 -9.400  1.00 0.00 ? 37 GLU A H    7  
ATOM 9149  H HA   . GLU A 1 37 ? 104.657 -13.924 -8.832  1.00 0.00 ? 37 GLU A HA   7  
ATOM 9150  H HB2  . GLU A 1 37 ? 106.767 -13.015 -10.802 1.00 0.00 ? 37 GLU A HB2  7  
ATOM 9151  H HB3  . GLU A 1 37 ? 105.871 -11.931 -9.737  1.00 0.00 ? 37 GLU A HB3  7  
ATOM 9152  H HG2  . GLU A 1 37 ? 106.733 -13.069 -7.769  1.00 0.00 ? 37 GLU A HG2  7  
ATOM 9153  H HG3  . GLU A 1 37 ? 107.525 -14.281 -8.774  1.00 0.00 ? 37 GLU A HG3  7  
ATOM 9154  N N    . VAL A 1 38 ? 103.448 -14.487 -11.515 1.00 0.00 ? 38 VAL A N    7  
ATOM 9155  C CA   . VAL A 1 38 ? 102.416 -14.212 -12.509 1.00 0.00 ? 38 VAL A CA   7  
ATOM 9156  C C    . VAL A 1 38 ? 101.195 -13.571 -11.855 1.00 0.00 ? 38 VAL A C    7  
ATOM 9157  O O    . VAL A 1 38 ? 100.451 -12.829 -12.498 1.00 0.00 ? 38 VAL A O    7  
ATOM 9158  C CB   . VAL A 1 38 ? 102.003 -15.511 -13.202 1.00 0.00 ? 38 VAL A CB   7  
ATOM 9159  C CG1  . VAL A 1 38 ? 103.166 -16.031 -14.049 1.00 0.00 ? 38 VAL A CG1  7  
ATOM 9160  C CG2  . VAL A 1 38 ? 101.636 -16.557 -12.145 1.00 0.00 ? 38 VAL A CG2  7  
ATOM 9161  H H    . VAL A 1 38 ? 103.721 -15.413 -11.349 1.00 0.00 ? 38 VAL A H    7  
ATOM 9162  H HA   . VAL A 1 38 ? 102.814 -13.535 -13.249 1.00 0.00 ? 38 VAL A HA   7  
ATOM 9163  H HB   . VAL A 1 38 ? 101.149 -15.324 -13.838 1.00 0.00 ? 38 VAL A HB   7  
ATOM 9164  H HG11 . VAL A 1 38 ? 103.444 -15.283 -14.776 1.00 0.00 ? 38 VAL A HG11 7  
ATOM 9165  H HG12 . VAL A 1 38 ? 102.863 -16.933 -14.559 1.00 0.00 ? 38 VAL A HG12 7  
ATOM 9166  H HG13 . VAL A 1 38 ? 104.010 -16.245 -13.410 1.00 0.00 ? 38 VAL A HG13 7  
ATOM 9167  H HG21 . VAL A 1 38 ? 100.837 -16.179 -11.526 1.00 0.00 ? 38 VAL A HG21 7  
ATOM 9168  H HG22 . VAL A 1 38 ? 102.500 -16.766 -11.532 1.00 0.00 ? 38 VAL A HG22 7  
ATOM 9169  H HG23 . VAL A 1 38 ? 101.314 -17.465 -12.634 1.00 0.00 ? 38 VAL A HG23 7  
ATOM 9170  N N    . LEU A 1 39 ? 100.994 -13.866 -10.575 1.00 0.00 ? 39 LEU A N    7  
ATOM 9171  C CA   . LEU A 1 39 ? 99.855  -13.322 -9.841  1.00 0.00 ? 39 LEU A CA   7  
ATOM 9172  C C    . LEU A 1 39 ? 99.741  -11.814 -10.051 1.00 0.00 ? 39 LEU A C    7  
ATOM 9173  O O    . LEU A 1 39 ? 98.646  -11.256 -10.000 1.00 0.00 ? 39 LEU A O    7  
ATOM 9174  C CB   . LEU A 1 39 ? 100.015 -13.628 -8.346  1.00 0.00 ? 39 LEU A CB   7  
ATOM 9175  C CG   . LEU A 1 39 ? 98.773  -13.167 -7.565  1.00 0.00 ? 39 LEU A CG   7  
ATOM 9176  C CD1  . LEU A 1 39 ? 97.536  -13.978 -7.996  1.00 0.00 ? 39 LEU A CD1  7  
ATOM 9177  C CD2  . LEU A 1 39 ? 99.028  -13.373 -6.067  1.00 0.00 ? 39 LEU A CD2  7  
ATOM 9178  H H    . LEU A 1 39 ? 101.618 -14.468 -10.118 1.00 0.00 ? 39 LEU A H    7  
ATOM 9179  H HA   . LEU A 1 39 ? 98.956  -13.796 -10.199 1.00 0.00 ? 39 LEU A HA   7  
ATOM 9180  H HB2  . LEU A 1 39 ? 100.149 -14.691 -8.211  1.00 0.00 ? 39 LEU A HB2  7  
ATOM 9181  H HB3  . LEU A 1 39 ? 100.884 -13.109 -7.968  1.00 0.00 ? 39 LEU A HB3  7  
ATOM 9182  H HG   . LEU A 1 39 ? 98.596  -12.120 -7.756  1.00 0.00 ? 39 LEU A HG   7  
ATOM 9183  H HD11 . LEU A 1 39 ? 97.093  -13.521 -8.868  1.00 0.00 ? 39 LEU A HD11 7  
ATOM 9184  H HD12 . LEU A 1 39 ? 96.810  -13.991 -7.195  1.00 0.00 ? 39 LEU A HD12 7  
ATOM 9185  H HD13 . LEU A 1 39 ? 97.827  -14.992 -8.231  1.00 0.00 ? 39 LEU A HD13 7  
ATOM 9186  H HD21 . LEU A 1 39 ? 98.166  -13.041 -5.507  1.00 0.00 ? 39 LEU A HD21 7  
ATOM 9187  H HD22 . LEU A 1 39 ? 99.894  -12.800 -5.767  1.00 0.00 ? 39 LEU A HD22 7  
ATOM 9188  H HD23 . LEU A 1 39 ? 99.203  -14.420 -5.871  1.00 0.00 ? 39 LEU A HD23 7  
ATOM 9189  N N    . GLY A 1 40 ? 100.874 -11.158 -10.281 1.00 0.00 ? 40 GLY A N    7  
ATOM 9190  C CA   . GLY A 1 40 ? 100.879 -9.712  -10.490 1.00 0.00 ? 40 GLY A CA   7  
ATOM 9191  C C    . GLY A 1 40 ? 99.970  -9.321  -11.653 1.00 0.00 ? 40 GLY A C    7  
ATOM 9192  O O    . GLY A 1 40 ? 99.154  -8.403  -11.539 1.00 0.00 ? 40 GLY A O    7  
ATOM 9193  H H    . GLY A 1 40 ? 101.720 -11.652 -10.307 1.00 0.00 ? 40 GLY A H    7  
ATOM 9194  H HA2  . GLY A 1 40 ? 100.535 -9.223  -9.590  1.00 0.00 ? 40 GLY A HA2  7  
ATOM 9195  H HA3  . GLY A 1 40 ? 101.885 -9.389  -10.707 1.00 0.00 ? 40 GLY A HA3  7  
ATOM 9196  N N    . ILE A 1 41 ? 100.114 -10.021 -12.772 1.00 0.00 ? 41 ILE A N    7  
ATOM 9197  C CA   . ILE A 1 41 ? 99.301  -9.737  -13.948 1.00 0.00 ? 41 ILE A CA   7  
ATOM 9198  C C    . ILE A 1 41 ? 97.815  -9.812  -13.590 1.00 0.00 ? 41 ILE A C    7  
ATOM 9199  O O    . ILE A 1 41 ? 97.030  -8.940  -13.963 1.00 0.00 ? 41 ILE A O    7  
ATOM 9200  C CB   . ILE A 1 41 ? 99.629  -10.740 -15.067 1.00 0.00 ? 41 ILE A CB   7  
ATOM 9201  C CG1  . ILE A 1 41 ? 101.011 -10.423 -15.655 1.00 0.00 ? 41 ILE A CG1  7  
ATOM 9202  C CG2  . ILE A 1 41 ? 98.582  -10.646 -16.182 1.00 0.00 ? 41 ILE A CG2  7  
ATOM 9203  C CD1  . ILE A 1 41 ? 102.105 -10.654 -14.607 1.00 0.00 ? 41 ILE A CD1  7  
ATOM 9204  H H    . ILE A 1 41 ? 100.780 -10.740 -12.807 1.00 0.00 ? 41 ILE A H    7  
ATOM 9205  H HA   . ILE A 1 41 ? 99.526  -8.741  -14.297 1.00 0.00 ? 41 ILE A HA   7  
ATOM 9206  H HB   . ILE A 1 41 ? 99.630  -11.741 -14.661 1.00 0.00 ? 41 ILE A HB   7  
ATOM 9207  H HG12 . ILE A 1 41 ? 101.192 -11.062 -16.506 1.00 0.00 ? 41 ILE A HG12 7  
ATOM 9208  H HG13 . ILE A 1 41 ? 101.036 -9.391  -15.973 1.00 0.00 ? 41 ILE A HG13 7  
ATOM 9209  H HG21 . ILE A 1 41 ? 98.404  -9.609  -16.423 1.00 0.00 ? 41 ILE A HG21 7  
ATOM 9210  H HG22 . ILE A 1 41 ? 97.661  -11.101 -15.851 1.00 0.00 ? 41 ILE A HG22 7  
ATOM 9211  H HG23 . ILE A 1 41 ? 98.942  -11.162 -17.060 1.00 0.00 ? 41 ILE A HG23 7  
ATOM 9212  H HD11 . ILE A 1 41 ? 102.178 -9.789  -13.965 1.00 0.00 ? 41 ILE A HD11 7  
ATOM 9213  H HD12 . ILE A 1 41 ? 103.051 -10.810 -15.106 1.00 0.00 ? 41 ILE A HD12 7  
ATOM 9214  H HD13 . ILE A 1 41 ? 101.866 -11.526 -14.015 1.00 0.00 ? 41 ILE A HD13 7  
ATOM 9215  N N    . ILE A 1 42 ? 97.441  -10.860 -12.865 1.00 0.00 ? 42 ILE A N    7  
ATOM 9216  C CA   . ILE A 1 42 ? 96.051  -11.042 -12.462 1.00 0.00 ? 42 ILE A CA   7  
ATOM 9217  C C    . ILE A 1 42 ? 95.622  -9.928  -11.508 1.00 0.00 ? 42 ILE A C    7  
ATOM 9218  O O    . ILE A 1 42 ? 94.449  -9.560  -11.458 1.00 0.00 ? 42 ILE A O    7  
ATOM 9219  C CB   . ILE A 1 42 ? 95.879  -12.412 -11.787 1.00 0.00 ? 42 ILE A CB   7  
ATOM 9220  C CG1  . ILE A 1 42 ? 95.996  -13.523 -12.841 1.00 0.00 ? 42 ILE A CG1  7  
ATOM 9221  C CG2  . ILE A 1 42 ? 94.501  -12.502 -11.120 1.00 0.00 ? 42 ILE A CG2  7  
ATOM 9222  C CD1  . ILE A 1 42 ? 97.413  -13.558 -13.426 1.00 0.00 ? 42 ILE A CD1  7  
ATOM 9223  H H    . ILE A 1 42 ? 98.110  -11.523 -12.596 1.00 0.00 ? 42 ILE A H    7  
ATOM 9224  H HA   . ILE A 1 42 ? 95.426  -11.007 -13.342 1.00 0.00 ? 42 ILE A HA   7  
ATOM 9225  H HB   . ILE A 1 42 ? 96.646  -12.541 -11.039 1.00 0.00 ? 42 ILE A HB   7  
ATOM 9226  H HG12 . ILE A 1 42 ? 95.776  -14.475 -12.380 1.00 0.00 ? 42 ILE A HG12 7  
ATOM 9227  H HG13 . ILE A 1 42 ? 95.287  -13.339 -13.634 1.00 0.00 ? 42 ILE A HG13 7  
ATOM 9228  H HG21 . ILE A 1 42 ? 93.747  -12.134 -11.801 1.00 0.00 ? 42 ILE A HG21 7  
ATOM 9229  H HG22 . ILE A 1 42 ? 94.497  -11.904 -10.221 1.00 0.00 ? 42 ILE A HG22 7  
ATOM 9230  H HG23 . ILE A 1 42 ? 94.288  -13.530 -10.869 1.00 0.00 ? 42 ILE A HG23 7  
ATOM 9231  H HD11 . ILE A 1 42 ? 97.613  -14.545 -13.819 1.00 0.00 ? 42 ILE A HD11 7  
ATOM 9232  H HD12 . ILE A 1 42 ? 98.135  -13.327 -12.657 1.00 0.00 ? 42 ILE A HD12 7  
ATOM 9233  H HD13 . ILE A 1 42 ? 97.491  -12.834 -14.224 1.00 0.00 ? 42 ILE A HD13 7  
ATOM 9234  N N    . SER A 1 43 ? 96.573  -9.400  -10.747 1.00 0.00 ? 43 SER A N    7  
ATOM 9235  C CA   . SER A 1 43 ? 96.270  -8.338  -9.795  1.00 0.00 ? 43 SER A CA   7  
ATOM 9236  C C    . SER A 1 43 ? 95.823  -7.067  -10.514 1.00 0.00 ? 43 SER A C    7  
ATOM 9237  O O    . SER A 1 43 ? 94.807  -6.467  -10.158 1.00 0.00 ? 43 SER A O    7  
ATOM 9238  C CB   . SER A 1 43 ? 97.503  -8.032  -8.942  1.00 0.00 ? 43 SER A CB   7  
ATOM 9239  O OG   . SER A 1 43 ? 98.031  -9.247  -8.427  1.00 0.00 ? 43 SER A OG   7  
ATOM 9240  H H    . SER A 1 43 ? 97.492  -9.735  -10.822 1.00 0.00 ? 43 SER A H    7  
ATOM 9241  H HA   . SER A 1 43 ? 95.475  -8.669  -9.146  1.00 0.00 ? 43 SER A HA   7  
ATOM 9242  H HB2  . SER A 1 43 ? 98.250  -7.547  -9.546  1.00 0.00 ? 43 SER A HB2  7  
ATOM 9243  H HB3  . SER A 1 43 ? 97.221  -7.377  -8.128  1.00 0.00 ? 43 SER A HB3  7  
ATOM 9244  H HG   . SER A 1 43 ? 97.600  -9.974  -8.882  1.00 0.00 ? 43 SER A HG   7  
ATOM 9245  N N    . ILE A 1 44 ? 96.592  -6.651  -11.517 1.00 0.00 ? 44 ILE A N    7  
ATOM 9246  C CA   . ILE A 1 44 ? 96.262  -5.436  -12.259 1.00 0.00 ? 44 ILE A CA   7  
ATOM 9247  C C    . ILE A 1 44 ? 94.995  -5.620  -13.102 1.00 0.00 ? 44 ILE A C    7  
ATOM 9248  O O    . ILE A 1 44 ? 94.167  -4.713  -13.197 1.00 0.00 ? 44 ILE A O    7  
ATOM 9249  C CB   . ILE A 1 44 ? 97.446  -5.022  -13.145 1.00 0.00 ? 44 ILE A CB   7  
ATOM 9250  C CG1  . ILE A 1 44 ? 97.911  -6.214  -13.994 1.00 0.00 ? 44 ILE A CG1  7  
ATOM 9251  C CG2  . ILE A 1 44 ? 98.607  -4.563  -12.259 1.00 0.00 ? 44 ILE A CG2  7  
ATOM 9252  C CD1  . ILE A 1 44 ? 98.973  -5.770  -15.016 1.00 0.00 ? 44 ILE A CD1  7  
ATOM 9253  H H    . ILE A 1 44 ? 97.398  -7.160  -11.752 1.00 0.00 ? 44 ILE A H    7  
ATOM 9254  H HA   . ILE A 1 44 ? 96.077  -4.646  -11.547 1.00 0.00 ? 44 ILE A HA   7  
ATOM 9255  H HB   . ILE A 1 44 ? 97.145  -4.211  -13.792 1.00 0.00 ? 44 ILE A HB   7  
ATOM 9256  H HG12 . ILE A 1 44 ? 98.332  -6.968  -13.346 1.00 0.00 ? 44 ILE A HG12 7  
ATOM 9257  H HG13 . ILE A 1 44 ? 97.067  -6.629  -14.520 1.00 0.00 ? 44 ILE A HG13 7  
ATOM 9258  H HG21 . ILE A 1 44 ? 99.370  -4.107  -12.873 1.00 0.00 ? 44 ILE A HG21 7  
ATOM 9259  H HG22 . ILE A 1 44 ? 99.023  -5.415  -11.743 1.00 0.00 ? 44 ILE A HG22 7  
ATOM 9260  H HG23 . ILE A 1 44 ? 98.253  -3.845  -11.537 1.00 0.00 ? 44 ILE A HG23 7  
ATOM 9261  H HD11 . ILE A 1 44 ? 99.469  -4.868  -14.680 1.00 0.00 ? 44 ILE A HD11 7  
ATOM 9262  H HD12 . ILE A 1 44 ? 98.498  -5.583  -15.967 1.00 0.00 ? 44 ILE A HD12 7  
ATOM 9263  H HD13 . ILE A 1 44 ? 99.705  -6.555  -15.133 1.00 0.00 ? 44 ILE A HD13 7  
ATOM 9264  N N    . VAL A 1 45 ? 94.835  -6.790  -13.706 1.00 0.00 ? 45 VAL A N    7  
ATOM 9265  C CA   . VAL A 1 45 ? 93.651  -7.044  -14.518 1.00 0.00 ? 45 VAL A CA   7  
ATOM 9266  C C    . VAL A 1 45 ? 92.392  -6.954  -13.655 1.00 0.00 ? 45 VAL A C    7  
ATOM 9267  O O    . VAL A 1 45 ? 91.378  -6.380  -14.063 1.00 0.00 ? 45 VAL A O    7  
ATOM 9268  C CB   . VAL A 1 45 ? 93.745  -8.434  -15.163 1.00 0.00 ? 45 VAL A CB   7  
ATOM 9269  C CG1  . VAL A 1 45 ? 92.413  -8.797  -15.824 1.00 0.00 ? 45 VAL A CG1  7  
ATOM 9270  C CG2  . VAL A 1 45 ? 94.847  -8.429  -16.225 1.00 0.00 ? 45 VAL A CG2  7  
ATOM 9271  H H    . VAL A 1 45 ? 95.513  -7.490  -13.601 1.00 0.00 ? 45 VAL A H    7  
ATOM 9272  H HA   . VAL A 1 45 ? 93.594  -6.300  -15.300 1.00 0.00 ? 45 VAL A HA   7  
ATOM 9273  H HB   . VAL A 1 45 ? 93.980  -9.166  -14.404 1.00 0.00 ? 45 VAL A HB   7  
ATOM 9274  H HG11 . VAL A 1 45 ? 91.685  -9.036  -15.062 1.00 0.00 ? 45 VAL A HG11 7  
ATOM 9275  H HG12 . VAL A 1 45 ? 92.551  -9.652  -16.469 1.00 0.00 ? 45 VAL A HG12 7  
ATOM 9276  H HG13 . VAL A 1 45 ? 92.061  -7.959  -16.408 1.00 0.00 ? 45 VAL A HG13 7  
ATOM 9277  H HG21 . VAL A 1 45 ? 95.777  -8.113  -15.779 1.00 0.00 ? 45 VAL A HG21 7  
ATOM 9278  H HG22 . VAL A 1 45 ? 94.578  -7.747  -17.019 1.00 0.00 ? 45 VAL A HG22 7  
ATOM 9279  H HG23 . VAL A 1 45 ? 94.962  -9.424  -16.630 1.00 0.00 ? 45 VAL A HG23 7  
ATOM 9280  N N    . LEU A 1 46 ? 92.467  -7.537  -12.463 1.00 0.00 ? 46 LEU A N    7  
ATOM 9281  C CA   . LEU A 1 46 ? 91.335  -7.540  -11.544 1.00 0.00 ? 46 LEU A CA   7  
ATOM 9282  C C    . LEU A 1 46 ? 91.049  -6.136  -10.996 1.00 0.00 ? 46 LEU A C    7  
ATOM 9283  O O    . LEU A 1 46 ? 89.890  -5.790  -10.782 1.00 0.00 ? 46 LEU A O    7  
ATOM 9284  C CB   . LEU A 1 46 ? 91.611  -8.521  -10.381 1.00 0.00 ? 46 LEU A CB   7  
ATOM 9285  C CG   . LEU A 1 46 ? 91.047  -9.931  -10.682 1.00 0.00 ? 46 LEU A CG   7  
ATOM 9286  C CD1  . LEU A 1 46 ? 89.519  -9.953  -10.501 1.00 0.00 ? 46 LEU A CD1  7  
ATOM 9287  C CD2  . LEU A 1 46 ? 91.406  -10.365 -12.118 1.00 0.00 ? 46 LEU A CD2  7  
ATOM 9288  H H    . LEU A 1 46 ? 93.299  -7.983  -12.200 1.00 0.00 ? 46 LEU A H    7  
ATOM 9289  H HA   . LEU A 1 46 ? 90.462  -7.868  -12.081 1.00 0.00 ? 46 LEU A HA   7  
ATOM 9290  H HB2  . LEU A 1 46 ? 92.678  -8.598  -10.238 1.00 0.00 ? 46 LEU A HB2  7  
ATOM 9291  H HB3  . LEU A 1 46 ? 91.165  -8.148  -9.469  1.00 0.00 ? 46 LEU A HB3  7  
ATOM 9292  H HG   . LEU A 1 46 ? 91.485  -10.633 -9.984  1.00 0.00 ? 46 LEU A HG   7  
ATOM 9293  H HD11 . LEU A 1 46 ? 89.191  -10.973 -10.358 1.00 0.00 ? 46 LEU A HD11 7  
ATOM 9294  H HD12 . LEU A 1 46 ? 89.041  -9.548  -11.381 1.00 0.00 ? 46 LEU A HD12 7  
ATOM 9295  H HD13 . LEU A 1 46 ? 89.241  -9.366  -9.639  1.00 0.00 ? 46 LEU A HD13 7  
ATOM 9296  H HD21 . LEU A 1 46 ? 91.488  -11.442 -12.152 1.00 0.00 ? 46 LEU A HD21 7  
ATOM 9297  H HD22 . LEU A 1 46 ? 92.349  -9.930  -12.408 1.00 0.00 ? 46 LEU A HD22 7  
ATOM 9298  H HD23 . LEU A 1 46 ? 90.637  -10.046 -12.807 1.00 0.00 ? 46 LEU A HD23 7  
ATOM 9299  N N    . VAL A 1 47 ? 92.087  -5.333  -10.755 1.00 0.00 ? 47 VAL A N    7  
ATOM 9300  C CA   . VAL A 1 47 ? 91.864  -3.995  -10.218 1.00 0.00 ? 47 VAL A CA   7  
ATOM 9301  C C    . VAL A 1 47 ? 91.158  -3.126  -11.259 1.00 0.00 ? 47 VAL A C    7  
ATOM 9302  O O    . VAL A 1 47 ? 90.363  -2.249  -10.919 1.00 0.00 ? 47 VAL A O    7  
ATOM 9303  C CB   . VAL A 1 47 ? 93.207  -3.362  -9.753  1.00 0.00 ? 47 VAL A CB   7  
ATOM 9304  C CG1  . VAL A 1 47 ? 93.816  -2.465  -10.844 1.00 0.00 ? 47 VAL A CG1  7  
ATOM 9305  C CG2  . VAL A 1 47 ? 92.982  -2.519  -8.489  1.00 0.00 ? 47 VAL A CG2  7  
ATOM 9306  H H    . VAL A 1 47 ? 93.002  -5.640  -10.933 1.00 0.00 ? 47 VAL A H    7  
ATOM 9307  H HA   . VAL A 1 47 ? 91.211  -4.091  -9.361  1.00 0.00 ? 47 VAL A HA   7  
ATOM 9308  H HB   . VAL A 1 47 ? 93.905  -4.155  -9.527  1.00 0.00 ? 47 VAL A HB   7  
ATOM 9309  H HG11 . VAL A 1 47 ? 93.306  -1.512  -10.857 1.00 0.00 ? 47 VAL A HG11 7  
ATOM 9310  H HG12 . VAL A 1 47 ? 93.707  -2.938  -11.803 1.00 0.00 ? 47 VAL A HG12 7  
ATOM 9311  H HG13 . VAL A 1 47 ? 94.863  -2.309  -10.637 1.00 0.00 ? 47 VAL A HG13 7  
ATOM 9312  H HG21 . VAL A 1 47 ? 93.904  -2.029  -8.215  1.00 0.00 ? 47 VAL A HG21 7  
ATOM 9313  H HG22 . VAL A 1 47 ? 92.661  -3.160  -7.682  1.00 0.00 ? 47 VAL A HG22 7  
ATOM 9314  H HG23 . VAL A 1 47 ? 92.222  -1.776  -8.683  1.00 0.00 ? 47 VAL A HG23 7  
ATOM 9315  N N    . ALA A 1 48 ? 91.457  -3.374  -12.528 1.00 0.00 ? 48 ALA A N    7  
ATOM 9316  C CA   . ALA A 1 48 ? 90.843  -2.605  -13.601 1.00 0.00 ? 48 ALA A CA   7  
ATOM 9317  C C    . ALA A 1 48 ? 89.374  -2.971  -13.780 1.00 0.00 ? 48 ALA A C    7  
ATOM 9318  O O    . ALA A 1 48 ? 88.513  -2.093  -13.848 1.00 0.00 ? 48 ALA A O    7  
ATOM 9319  C CB   . ALA A 1 48 ? 91.589  -2.846  -14.912 1.00 0.00 ? 48 ALA A CB   7  
ATOM 9320  H H    . ALA A 1 48 ? 92.103  -4.083  -12.746 1.00 0.00 ? 48 ALA A H    7  
ATOM 9321  H HA   . ALA A 1 48 ? 90.903  -1.559  -13.356 1.00 0.00 ? 48 ALA A HA   7  
ATOM 9322  H HB1  . ALA A 1 48 ? 91.554  -3.896  -15.158 1.00 0.00 ? 48 ALA A HB1  7  
ATOM 9323  H HB2  . ALA A 1 48 ? 92.618  -2.536  -14.803 1.00 0.00 ? 48 ALA A HB2  7  
ATOM 9324  H HB3  . ALA A 1 48 ? 91.123  -2.276  -15.702 1.00 0.00 ? 48 ALA A HB3  7  
ATOM 9325  N N    . THR A 1 49 ? 89.088  -4.264  -13.876 1.00 0.00 ? 49 THR A N    7  
ATOM 9326  C CA   . THR A 1 49 ? 87.711  -4.706  -14.070 1.00 0.00 ? 49 THR A CA   7  
ATOM 9327  C C    . THR A 1 49 ? 86.814  -4.242  -12.921 1.00 0.00 ? 49 THR A C    7  
ATOM 9328  O O    . THR A 1 49 ? 85.732  -3.693  -13.153 1.00 0.00 ? 49 THR A O    7  
ATOM 9329  C CB   . THR A 1 49 ? 87.663  -6.235  -14.189 1.00 0.00 ? 49 THR A CB   7  
ATOM 9330  O OG1  . THR A 1 49 ? 88.780  -6.682  -14.942 1.00 0.00 ? 49 THR A OG1  7  
ATOM 9331  C CG2  . THR A 1 49 ? 86.372  -6.657  -14.897 1.00 0.00 ? 49 THR A CG2  7  
ATOM 9332  H H    . THR A 1 49 ? 89.811  -4.927  -13.830 1.00 0.00 ? 49 THR A H    7  
ATOM 9333  H HA   . THR A 1 49 ? 87.343  -4.274  -14.990 1.00 0.00 ? 49 THR A HA   7  
ATOM 9334  H HB   . THR A 1 49 ? 87.690  -6.677  -13.205 1.00 0.00 ? 49 THR A HB   7  
ATOM 9335  H HG1  . THR A 1 49 ? 89.451  -5.995  -14.914 1.00 0.00 ? 49 THR A HG1  7  
ATOM 9336  H HG21 . THR A 1 49 ? 86.401  -6.328  -15.927 1.00 0.00 ? 49 THR A HG21 7  
ATOM 9337  H HG22 . THR A 1 49 ? 85.525  -6.209  -14.400 1.00 0.00 ? 49 THR A HG22 7  
ATOM 9338  H HG23 . THR A 1 49 ? 86.279  -7.733  -14.867 1.00 0.00 ? 49 THR A HG23 7  
ATOM 9339  N N    . VAL A 1 50 ? 87.256  -4.464  -11.686 1.00 0.00 ? 50 VAL A N    7  
ATOM 9340  C CA   . VAL A 1 50 ? 86.463  -4.060  -10.529 1.00 0.00 ? 50 VAL A CA   7  
ATOM 9341  C C    . VAL A 1 50 ? 86.316  -2.542  -10.474 1.00 0.00 ? 50 VAL A C    7  
ATOM 9342  O O    . VAL A 1 50 ? 85.262  -2.035  -10.108 1.00 0.00 ? 50 VAL A O    7  
ATOM 9343  C CB   . VAL A 1 50 ? 87.097  -4.563  -9.228  1.00 0.00 ? 50 VAL A CB   7  
ATOM 9344  C CG1  . VAL A 1 50 ? 87.291  -6.082  -9.298  1.00 0.00 ? 50 VAL A CG1  7  
ATOM 9345  C CG2  . VAL A 1 50 ? 88.450  -3.874  -9.016  1.00 0.00 ? 50 VAL A CG2  7  
ATOM 9346  H H    . VAL A 1 50 ? 88.121  -4.906  -11.552 1.00 0.00 ? 50 VAL A H    7  
ATOM 9347  H HA   . VAL A 1 50 ? 85.479  -4.496  -10.620 1.00 0.00 ? 50 VAL A HA   7  
ATOM 9348  H HB   . VAL A 1 50 ? 86.443  -4.328  -8.400  1.00 0.00 ? 50 VAL A HB   7  
ATOM 9349  H HG11 . VAL A 1 50 ? 87.668  -6.358  -10.272 1.00 0.00 ? 50 VAL A HG11 7  
ATOM 9350  H HG12 . VAL A 1 50 ? 86.343  -6.573  -9.129  1.00 0.00 ? 50 VAL A HG12 7  
ATOM 9351  H HG13 . VAL A 1 50 ? 87.996  -6.393  -8.539  1.00 0.00 ? 50 VAL A HG13 7  
ATOM 9352  H HG21 . VAL A 1 50 ? 88.288  -2.876  -8.637  1.00 0.00 ? 50 VAL A HG21 7  
ATOM 9353  H HG22 . VAL A 1 50 ? 88.973  -3.820  -9.955  1.00 0.00 ? 50 VAL A HG22 7  
ATOM 9354  H HG23 . VAL A 1 50 ? 89.038  -4.436  -8.307  1.00 0.00 ? 50 VAL A HG23 7  
ATOM 9355  N N    . LEU A 1 51 ? 87.371  -1.815  -10.839 1.00 0.00 ? 51 LEU A N    7  
ATOM 9356  C CA   . LEU A 1 51 ? 87.302  -0.357  -10.817 1.00 0.00 ? 51 LEU A CA   7  
ATOM 9357  C C    . LEU A 1 51 ? 86.253  0.136   -11.800 1.00 0.00 ? 51 LEU A C    7  
ATOM 9358  O O    . LEU A 1 51 ? 85.468  1.019   -11.479 1.00 0.00 ? 51 LEU A O    7  
ATOM 9359  C CB   . LEU A 1 51 ? 88.674  0.242   -11.165 1.00 0.00 ? 51 LEU A CB   7  
ATOM 9360  C CG   . LEU A 1 51 ? 88.648  1.776   -11.036 1.00 0.00 ? 51 LEU A CG   7  
ATOM 9361  C CD1  . LEU A 1 51 ? 88.527  2.191   -9.559  1.00 0.00 ? 51 LEU A CD1  7  
ATOM 9362  C CD2  . LEU A 1 51 ? 89.948  2.342   -11.620 1.00 0.00 ? 51 LEU A CD2  7  
ATOM 9363  H H    . LEU A 1 51 ? 88.201  -2.259  -11.128 1.00 0.00 ? 51 LEU A H    7  
ATOM 9364  H HA   . LEU A 1 51 ? 87.016  -0.034  -9.830  1.00 0.00 ? 51 LEU A HA   7  
ATOM 9365  H HB2  . LEU A 1 51 ? 89.418  -0.160  -10.496 1.00 0.00 ? 51 LEU A HB2  7  
ATOM 9366  H HB3  . LEU A 1 51 ? 88.929  -0.023  -12.179 1.00 0.00 ? 51 LEU A HB3  7  
ATOM 9367  H HG   . LEU A 1 51 ? 87.809  2.173   -11.586 1.00 0.00 ? 51 LEU A HG   7  
ATOM 9368  H HD11 . LEU A 1 51 ? 89.109  1.523   -8.942  1.00 0.00 ? 51 LEU A HD11 7  
ATOM 9369  H HD12 . LEU A 1 51 ? 87.493  2.149   -9.256  1.00 0.00 ? 51 LEU A HD12 7  
ATOM 9370  H HD13 . LEU A 1 51 ? 88.891  3.202   -9.435  1.00 0.00 ? 51 LEU A HD13 7  
ATOM 9371  H HD21 . LEU A 1 51 ? 89.921  3.420   -11.576 1.00 0.00 ? 51 LEU A HD21 7  
ATOM 9372  H HD22 . LEU A 1 51 ? 90.047  2.026   -12.648 1.00 0.00 ? 51 LEU A HD22 7  
ATOM 9373  H HD23 . LEU A 1 51 ? 90.789  1.978   -11.048 1.00 0.00 ? 51 LEU A HD23 7  
ATOM 9374  N N    . LYS A 1 52 ? 86.241  -0.438  -12.994 1.00 0.00 ? 52 LYS A N    7  
ATOM 9375  C CA   . LYS A 1 52 ? 85.275  -0.032  -14.009 1.00 0.00 ? 52 LYS A CA   7  
ATOM 9376  C C    . LYS A 1 52 ? 83.847  -0.251  -13.507 1.00 0.00 ? 52 LYS A C    7  
ATOM 9377  O O    . LYS A 1 52 ? 83.028  0.658   -13.551 1.00 0.00 ? 52 LYS A O    7  
ATOM 9378  C CB   . LYS A 1 52 ? 85.512  -0.844  -15.307 1.00 0.00 ? 52 LYS A CB   7  
ATOM 9379  C CG   . LYS A 1 52 ? 86.407  -0.066  -16.288 1.00 0.00 ? 52 LYS A CG   7  
ATOM 9380  C CD   . LYS A 1 52 ? 87.828  0.041   -15.725 1.00 0.00 ? 52 LYS A CD   7  
ATOM 9381  C CE   . LYS A 1 52 ? 88.586  1.151   -16.457 1.00 0.00 ? 52 LYS A CE   7  
ATOM 9382  N NZ   . LYS A 1 52 ? 87.879  2.447   -16.255 1.00 0.00 ? 52 LYS A NZ   7  
ATOM 9383  H H    . LYS A 1 52 ? 86.893  -1.141  -13.200 1.00 0.00 ? 52 LYS A H    7  
ATOM 9384  H HA   . LYS A 1 52 ? 85.404  1.019   -14.215 1.00 0.00 ? 52 LYS A HA   7  
ATOM 9385  H HB2  . LYS A 1 52 ? 85.993  -1.777  -15.057 1.00 0.00 ? 52 LYS A HB2  7  
ATOM 9386  H HB3  . LYS A 1 52 ? 84.566  -1.054  -15.789 1.00 0.00 ? 52 LYS A HB3  7  
ATOM 9387  H HG2  . LYS A 1 52 ? 86.436  -0.589  -17.233 1.00 0.00 ? 52 LYS A HG2  7  
ATOM 9388  H HG3  . LYS A 1 52 ? 86.003  0.924   -16.441 1.00 0.00 ? 52 LYS A HG3  7  
ATOM 9389  H HD2  . LYS A 1 52 ? 87.784  0.272   -14.672 1.00 0.00 ? 52 LYS A HD2  7  
ATOM 9390  H HD3  . LYS A 1 52 ? 88.343  -0.896  -15.869 1.00 0.00 ? 52 LYS A HD3  7  
ATOM 9391  H HE2  . LYS A 1 52 ? 89.589  1.222   -16.062 1.00 0.00 ? 52 LYS A HE2  7  
ATOM 9392  H HE3  . LYS A 1 52 ? 88.629  0.923   -17.511 1.00 0.00 ? 52 LYS A HE3  7  
ATOM 9393  H HZ1  . LYS A 1 52 ? 87.518  2.791   -17.167 1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 9394  H HZ2  . LYS A 1 52 ? 88.541  3.145   -15.858 1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 9395  H HZ3  . LYS A 1 52 ? 87.084  2.310   -15.600 1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 9396  N N    . THR A 1 53 ? 83.551  -1.459  -13.052 1.00 0.00 ? 53 THR A N    7  
ATOM 9397  C CA   . THR A 1 53 ? 82.203  -1.777  -12.580 1.00 0.00 ? 53 THR A CA   7  
ATOM 9398  C C    . THR A 1 53 ? 81.793  -0.966  -11.346 1.00 0.00 ? 53 THR A C    7  
ATOM 9399  O O    . THR A 1 53 ? 80.671  -0.459  -11.274 1.00 0.00 ? 53 THR A O    7  
ATOM 9400  C CB   . THR A 1 53 ? 82.117  -3.269  -12.251 1.00 0.00 ? 53 THR A CB   7  
ATOM 9401  O OG1  . THR A 1 53 ? 82.634  -4.023  -13.339 1.00 0.00 ? 53 THR A OG1  7  
ATOM 9402  C CG2  . THR A 1 53 ? 80.657  -3.656  -12.005 1.00 0.00 ? 53 THR A CG2  7  
ATOM 9403  H H    . THR A 1 53 ? 84.241  -2.157  -13.052 1.00 0.00 ? 53 THR A H    7  
ATOM 9404  H HA   . THR A 1 53 ? 81.505  -1.567  -13.374 1.00 0.00 ? 53 THR A HA   7  
ATOM 9405  H HB   . THR A 1 53 ? 82.693  -3.476  -11.362 1.00 0.00 ? 53 THR A HB   7  
ATOM 9406  H HG1  . THR A 1 53 ? 83.444  -3.601  -13.633 1.00 0.00 ? 53 THR A HG1  7  
ATOM 9407  H HG21 . THR A 1 53 ? 80.297  -3.159  -11.116 1.00 0.00 ? 53 THR A HG21 7  
ATOM 9408  H HG22 . THR A 1 53 ? 80.585  -4.726  -11.874 1.00 0.00 ? 53 THR A HG22 7  
ATOM 9409  H HG23 . THR A 1 53 ? 80.057  -3.356  -12.852 1.00 0.00 ? 53 THR A HG23 7  
ATOM 9410  N N    . ILE A 1 54 ? 82.680  -0.885  -10.362 1.00 0.00 ? 54 ILE A N    7  
ATOM 9411  C CA   . ILE A 1 54 ? 82.368  -0.181  -9.118  1.00 0.00 ? 54 ILE A CA   7  
ATOM 9412  C C    . ILE A 1 54 ? 82.099  1.306   -9.323  1.00 0.00 ? 54 ILE A C    7  
ATOM 9413  O O    . ILE A 1 54 ? 81.131  1.828   -8.780  1.00 0.00 ? 54 ILE A O    7  
ATOM 9414  C CB   . ILE A 1 54 ? 83.509  -0.372  -8.112  1.00 0.00 ? 54 ILE A CB   7  
ATOM 9415  C CG1  . ILE A 1 54 ? 83.593  -1.849  -7.715  1.00 0.00 ? 54 ILE A CG1  7  
ATOM 9416  C CG2  . ILE A 1 54 ? 83.251  0.474   -6.860  1.00 0.00 ? 54 ILE A CG2  7  
ATOM 9417  C CD1  . ILE A 1 54 ? 84.931  -2.116  -7.022  1.00 0.00 ? 54 ILE A CD1  7  
ATOM 9418  H H    . ILE A 1 54 ? 83.548  -1.332  -10.457 1.00 0.00 ? 54 ILE A H    7  
ATOM 9419  H HA   . ILE A 1 54 ? 81.474  -0.619  -8.706  1.00 0.00 ? 54 ILE A HA   7  
ATOM 9420  H HB   . ILE A 1 54 ? 84.441  -0.066  -8.565  1.00 0.00 ? 54 ILE A HB   7  
ATOM 9421  H HG12 . ILE A 1 54 ? 82.783  -2.087  -7.040  1.00 0.00 ? 54 ILE A HG12 7  
ATOM 9422  H HG13 . ILE A 1 54 ? 83.518  -2.466  -8.597  1.00 0.00 ? 54 ILE A HG13 7  
ATOM 9423  H HG21 . ILE A 1 54 ? 83.437  1.513   -7.083  1.00 0.00 ? 54 ILE A HG21 7  
ATOM 9424  H HG22 . ILE A 1 54 ? 83.911  0.152   -6.066  1.00 0.00 ? 54 ILE A HG22 7  
ATOM 9425  H HG23 . ILE A 1 54 ? 82.225  0.349   -6.547  1.00 0.00 ? 54 ILE A HG23 7  
ATOM 9426  H HD11 . ILE A 1 54 ? 85.126  -1.334  -6.302  1.00 0.00 ? 54 ILE A HD11 7  
ATOM 9427  H HD12 . ILE A 1 54 ? 85.720  -2.134  -7.757  1.00 0.00 ? 54 ILE A HD12 7  
ATOM 9428  H HD13 . ILE A 1 54 ? 84.889  -3.069  -6.515  1.00 0.00 ? 54 ILE A HD13 7  
ATOM 9429  N N    . VAL A 1 55 ? 82.954  1.995   -10.069 1.00 0.00 ? 55 VAL A N    7  
ATOM 9430  C CA   . VAL A 1 55 ? 82.758  3.428   -10.284 1.00 0.00 ? 55 VAL A CA   7  
ATOM 9431  C C    . VAL A 1 55 ? 81.646  3.683   -11.303 1.00 0.00 ? 55 VAL A C    7  
ATOM 9432  O O    . VAL A 1 55 ? 80.898  4.653   -11.188 1.00 0.00 ? 55 VAL A O    7  
ATOM 9433  C CB   . VAL A 1 55 ? 84.061  4.086   -10.756 1.00 0.00 ? 55 VAL A CB   7  
ATOM 9434  C CG1  . VAL A 1 55 ? 85.210  3.672   -9.831  1.00 0.00 ? 55 VAL A CG1  7  
ATOM 9435  C CG2  . VAL A 1 55 ? 84.370  3.657   -12.199 1.00 0.00 ? 55 VAL A CG2  7  
ATOM 9436  H H    . VAL A 1 55 ? 83.729  1.543   -10.465 1.00 0.00 ? 55 VAL A H    7  
ATOM 9437  H HA   . VAL A 1 55 ? 82.470  3.880   -9.345  1.00 0.00 ? 55 VAL A HA   7  
ATOM 9438  H HB   . VAL A 1 55 ? 83.947  5.160   -10.717 1.00 0.00 ? 55 VAL A HB   7  
ATOM 9439  H HG11 . VAL A 1 55 ? 85.252  2.597   -9.763  1.00 0.00 ? 55 VAL A HG11 7  
ATOM 9440  H HG12 . VAL A 1 55 ? 85.046  4.087   -8.847  1.00 0.00 ? 55 VAL A HG12 7  
ATOM 9441  H HG13 . VAL A 1 55 ? 86.142  4.046   -10.227 1.00 0.00 ? 55 VAL A HG13 7  
ATOM 9442  H HG21 . VAL A 1 55 ? 83.816  4.282   -12.881 1.00 0.00 ? 55 VAL A HG21 7  
ATOM 9443  H HG22 . VAL A 1 55 ? 84.082  2.627   -12.343 1.00 0.00 ? 55 VAL A HG22 7  
ATOM 9444  H HG23 . VAL A 1 55 ? 85.429  3.764   -12.393 1.00 0.00 ? 55 VAL A HG23 7  
ATOM 9445  N N    . LEU A 1 56 ? 81.557  2.817   -12.307 1.00 0.00 ? 56 LEU A N    7  
ATOM 9446  C CA   . LEU A 1 56 ? 80.554  2.961   -13.358 1.00 0.00 ? 56 LEU A CA   7  
ATOM 9447  C C    . LEU A 1 56 ? 79.118  2.800   -12.845 1.00 0.00 ? 56 LEU A C    7  
ATOM 9448  O O    . LEU A 1 56 ? 78.203  3.416   -13.388 1.00 0.00 ? 56 LEU A O    7  
ATOM 9449  C CB   . LEU A 1 56 ? 80.821  1.933   -14.464 1.00 0.00 ? 56 LEU A CB   7  
ATOM 9450  C CG   . LEU A 1 56 ? 79.789  2.084   -15.616 1.00 0.00 ? 56 LEU A CG   7  
ATOM 9451  C CD1  . LEU A 1 56 ? 80.497  1.924   -16.968 1.00 0.00 ? 56 LEU A CD1  7  
ATOM 9452  C CD2  . LEU A 1 56 ? 78.692  1.013   -15.497 1.00 0.00 ? 56 LEU A CD2  7  
ATOM 9453  H H    . LEU A 1 56 ? 82.192  2.075   -12.357 1.00 0.00 ? 56 LEU A H    7  
ATOM 9454  H HA   . LEU A 1 56 ? 80.656  3.942   -13.790 1.00 0.00 ? 56 LEU A HA   7  
ATOM 9455  H HB2  . LEU A 1 56 ? 81.819  2.098   -14.846 1.00 0.00 ? 56 LEU A HB2  7  
ATOM 9456  H HB3  . LEU A 1 56 ? 80.761  0.938   -14.045 1.00 0.00 ? 56 LEU A HB3  7  
ATOM 9457  H HG   . LEU A 1 56 ? 79.336  3.067   -15.576 1.00 0.00 ? 56 LEU A HG   7  
ATOM 9458  H HD11 . LEU A 1 56 ? 79.766  1.756   -17.745 1.00 0.00 ? 56 LEU A HD11 7  
ATOM 9459  H HD12 . LEU A 1 56 ? 81.176  1.083   -16.921 1.00 0.00 ? 56 LEU A HD12 7  
ATOM 9460  H HD13 . LEU A 1 56 ? 81.056  2.822   -17.186 1.00 0.00 ? 56 LEU A HD13 7  
ATOM 9461  H HD21 . LEU A 1 56 ? 77.847  1.293   -16.108 1.00 0.00 ? 56 LEU A HD21 7  
ATOM 9462  H HD22 . LEU A 1 56 ? 78.377  0.928   -14.468 1.00 0.00 ? 56 LEU A HD22 7  
ATOM 9463  H HD23 . LEU A 1 56 ? 79.077  0.061   -15.832 1.00 0.00 ? 56 LEU A HD23 7  
ATOM 9464  N N    . ILE A 1 57 ? 78.896  1.954   -11.837 1.00 0.00 ? 57 ILE A N    7  
ATOM 9465  C CA   . ILE A 1 57 ? 77.525  1.747   -11.354 1.00 0.00 ? 57 ILE A CA   7  
ATOM 9466  C C    . ILE A 1 57 ? 76.932  3.007   -10.686 1.00 0.00 ? 57 ILE A C    7  
ATOM 9467  O O    . ILE A 1 57 ? 75.863  3.460   -11.091 1.00 0.00 ? 57 ILE A O    7  
ATOM 9468  C CB   . ILE A 1 57 ? 77.474  0.511   -10.418 1.00 0.00 ? 57 ILE A CB   7  
ATOM 9469  C CG1  . ILE A 1 57 ? 77.298  -0.764  -11.255 1.00 0.00 ? 57 ILE A CG1  7  
ATOM 9470  C CG2  . ILE A 1 57 ? 76.305  0.615   -9.428  1.00 0.00 ? 57 ILE A CG2  7  
ATOM 9471  C CD1  . ILE A 1 57 ? 77.554  -1.993  -10.382 1.00 0.00 ? 57 ILE A CD1  7  
ATOM 9472  H H    . ILE A 1 57 ? 79.645  1.445   -11.435 1.00 0.00 ? 57 ILE A H    7  
ATOM 9473  H HA   . ILE A 1 57 ? 76.911  1.544   -12.221 1.00 0.00 ? 57 ILE A HA   7  
ATOM 9474  H HB   . ILE A 1 57 ? 78.401  0.441   -9.869  1.00 0.00 ? 57 ILE A HB   7  
ATOM 9475  H HG12 . ILE A 1 57 ? 76.291  -0.802  -11.644 1.00 0.00 ? 57 ILE A HG12 7  
ATOM 9476  H HG13 . ILE A 1 57 ? 78.000  -0.756  -12.076 1.00 0.00 ? 57 ILE A HG13 7  
ATOM 9477  H HG21 . ILE A 1 57 ? 76.162  -0.335  -8.935  1.00 0.00 ? 57 ILE A HG21 7  
ATOM 9478  H HG22 . ILE A 1 57 ? 75.405  0.883   -9.962  1.00 0.00 ? 57 ILE A HG22 7  
ATOM 9479  H HG23 . ILE A 1 57 ? 76.524  1.373   -8.690  1.00 0.00 ? 57 ILE A HG23 7  
ATOM 9480  H HD11 . ILE A 1 57 ? 78.549  -1.941  -9.968  1.00 0.00 ? 57 ILE A HD11 7  
ATOM 9481  H HD12 . ILE A 1 57 ? 77.459  -2.887  -10.982 1.00 0.00 ? 57 ILE A HD12 7  
ATOM 9482  H HD13 . ILE A 1 57 ? 76.831  -2.021  -9.579  1.00 0.00 ? 57 ILE A HD13 7  
ATOM 9483  N N    . PRO A 1 58 ? 77.567  3.588   -9.697  1.00 0.00 ? 58 PRO A N    7  
ATOM 9484  C CA   . PRO A 1 58 ? 77.027  4.811   -9.026  1.00 0.00 ? 58 PRO A CA   7  
ATOM 9485  C C    . PRO A 1 58 ? 77.103  6.023   -9.952  1.00 0.00 ? 58 PRO A C    7  
ATOM 9486  O O    . PRO A 1 58 ? 76.300  6.951   -9.854  1.00 0.00 ? 58 PRO A O    7  
ATOM 9487  C CB   . PRO A 1 58 ? 77.929  4.981   -7.795  1.00 0.00 ? 58 PRO A CB   7  
ATOM 9488  C CG   . PRO A 1 58 ? 79.217  4.320   -8.170  1.00 0.00 ? 58 PRO A CG   7  
ATOM 9489  C CD   . PRO A 1 58 ? 78.847  3.169   -9.110  1.00 0.00 ? 58 PRO A CD   7  
ATOM 9490  H HA   . PRO A 1 58 ? 76.008  4.644   -8.713  1.00 0.00 ? 58 PRO A HA   7  
ATOM 9491  H HB2  . PRO A 1 58 ? 78.086  6.031   -7.578  1.00 0.00 ? 58 PRO A HB2  7  
ATOM 9492  H HB3  . PRO A 1 58 ? 77.495  4.484   -6.939  1.00 0.00 ? 58 PRO A HB3  7  
ATOM 9493  H HG2  . PRO A 1 58 ? 79.863  5.027   -8.677  1.00 0.00 ? 58 PRO A HG2  7  
ATOM 9494  H HG3  . PRO A 1 58 ? 79.712  3.931   -7.291  1.00 0.00 ? 58 PRO A HG3  7  
ATOM 9495  H HD2  . PRO A 1 58 ? 79.590  3.057   -9.878  1.00 0.00 ? 58 PRO A HD2  7  
ATOM 9496  H HD3  . PRO A 1 58 ? 78.723  2.256   -8.555  1.00 0.00 ? 58 PRO A HD3  7  
ATOM 9497  N N    . PHE A 1 59 ? 78.080  5.996   -10.847 1.00 0.00 ? 59 PHE A N    7  
ATOM 9498  C CA   . PHE A 1 59 ? 78.286  7.070   -11.794 1.00 0.00 ? 59 PHE A CA   7  
ATOM 9499  C C    . PHE A 1 59 ? 77.078  7.205   -12.723 1.00 0.00 ? 59 PHE A C    7  
ATOM 9500  O O    . PHE A 1 59 ? 76.528  8.296   -12.881 1.00 0.00 ? 59 PHE A O    7  
ATOM 9501  C CB   . PHE A 1 59 ? 79.548  6.769   -12.612 1.00 0.00 ? 59 PHE A CB   7  
ATOM 9502  C CG   . PHE A 1 59 ? 80.814  7.172   -11.864 1.00 0.00 ? 59 PHE A CG   7  
ATOM 9503  C CD1  . PHE A 1 59 ? 80.850  7.247   -10.457 1.00 0.00 ? 59 PHE A CD1  7  
ATOM 9504  C CD2  . PHE A 1 59 ? 81.969  7.469   -12.600 1.00 0.00 ? 59 PHE A CD2  7  
ATOM 9505  C CE1  . PHE A 1 59 ? 82.033  7.617   -9.805  1.00 0.00 ? 59 PHE A CE1  7  
ATOM 9506  C CE2  . PHE A 1 59 ? 83.150  7.837   -11.942 1.00 0.00 ? 59 PHE A CE2  7  
ATOM 9507  C CZ   . PHE A 1 59 ? 83.181  7.912   -10.547 1.00 0.00 ? 59 PHE A CZ   7  
ATOM 9508  H H    . PHE A 1 59 ? 78.684  5.236   -10.872 1.00 0.00 ? 59 PHE A H    7  
ATOM 9509  H HA   . PHE A 1 59 ? 78.422  7.996   -11.260 1.00 0.00 ? 59 PHE A HA   7  
ATOM 9510  H HB2  . PHE A 1 59 ? 79.592  5.720   -12.841 1.00 0.00 ? 59 PHE A HB2  7  
ATOM 9511  H HB3  . PHE A 1 59 ? 79.500  7.304   -13.525 1.00 0.00 ? 59 PHE A HB3  7  
ATOM 9512  H HD1  . PHE A 1 59 ? 79.976  7.021   -9.871  1.00 0.00 ? 59 PHE A HD1  7  
ATOM 9513  H HD2  . PHE A 1 59 ? 81.950  7.413   -13.678 1.00 0.00 ? 59 PHE A HD2  7  
ATOM 9514  H HE1  . PHE A 1 59 ? 82.059  7.675   -8.727  1.00 0.00 ? 59 PHE A HE1  7  
ATOM 9515  H HE2  . PHE A 1 59 ? 84.037  8.064   -12.514 1.00 0.00 ? 59 PHE A HE2  7  
ATOM 9516  H HZ   . PHE A 1 59 ? 84.092  8.197   -10.042 1.00 0.00 ? 59 PHE A HZ   7  
ATOM 9517  N N    . LEU A 1 60 ? 76.673  6.097   -13.339 1.00 0.00 ? 60 LEU A N    7  
ATOM 9518  C CA   . LEU A 1 60 ? 75.534  6.121   -14.253 1.00 0.00 ? 60 LEU A CA   7  
ATOM 9519  C C    . LEU A 1 60 ? 74.219  6.113   -13.471 1.00 0.00 ? 60 LEU A C    7  
ATOM 9520  O O    . LEU A 1 60 ? 73.140  6.191   -14.056 1.00 0.00 ? 60 LEU A O    7  
ATOM 9521  C CB   . LEU A 1 60 ? 75.592  4.905   -15.195 1.00 0.00 ? 60 LEU A CB   7  
ATOM 9522  C CG   . LEU A 1 60 ? 76.556  5.172   -16.370 1.00 0.00 ? 60 LEU A CG   7  
ATOM 9523  C CD1  . LEU A 1 60 ? 75.946  6.182   -17.364 1.00 0.00 ? 60 LEU A CD1  7  
ATOM 9524  C CD2  . LEU A 1 60 ? 77.889  5.714   -15.835 1.00 0.00 ? 60 LEU A CD2  7  
ATOM 9525  H H    . LEU A 1 60 ? 77.151  5.251   -13.182 1.00 0.00 ? 60 LEU A H    7  
ATOM 9526  H HA   . LEU A 1 60 ? 75.575  7.023   -14.840 1.00 0.00 ? 60 LEU A HA   7  
ATOM 9527  H HB2  . LEU A 1 60 ? 75.944  4.047   -14.640 1.00 0.00 ? 60 LEU A HB2  7  
ATOM 9528  H HB3  . LEU A 1 60 ? 74.606  4.694   -15.581 1.00 0.00 ? 60 LEU A HB3  7  
ATOM 9529  H HG   . LEU A 1 60 ? 76.737  4.241   -16.889 1.00 0.00 ? 60 LEU A HG   7  
ATOM 9530  H HD11 . LEU A 1 60 ? 74.874  6.058   -17.407 1.00 0.00 ? 60 LEU A HD11 7  
ATOM 9531  H HD12 . LEU A 1 60 ? 76.360  6.008   -18.345 1.00 0.00 ? 60 LEU A HD12 7  
ATOM 9532  H HD13 . LEU A 1 60 ? 76.178  7.192   -17.056 1.00 0.00 ? 60 LEU A HD13 7  
ATOM 9533  H HD21 . LEU A 1 60 ? 77.776  6.756   -15.572 1.00 0.00 ? 60 LEU A HD21 7  
ATOM 9534  H HD22 . LEU A 1 60 ? 78.648  5.616   -16.597 1.00 0.00 ? 60 LEU A HD22 7  
ATOM 9535  H HD23 . LEU A 1 60 ? 78.182  5.152   -14.962 1.00 0.00 ? 60 LEU A HD23 7  
ATOM 9536  N N    . GLU A 1 61 ? 74.320  6.024   -12.145 1.00 0.00 ? 61 GLU A N    7  
ATOM 9537  C CA   . GLU A 1 61 ? 73.131  6.010   -11.288 1.00 0.00 ? 61 GLU A CA   7  
ATOM 9538  C C    . GLU A 1 61 ? 73.415  6.739   -9.977  1.00 0.00 ? 61 GLU A C    7  
ATOM 9539  O O    . GLU A 1 61 ? 74.160  6.247   -9.130  1.00 0.00 ? 61 GLU A O    7  
ATOM 9540  C CB   . GLU A 1 61 ? 72.707  4.565   -10.984 1.00 0.00 ? 61 GLU A CB   7  
ATOM 9541  C CG   . GLU A 1 61 ? 72.069  3.916   -12.222 1.00 0.00 ? 61 GLU A CG   7  
ATOM 9542  C CD   . GLU A 1 61 ? 73.146  3.468   -13.206 1.00 0.00 ? 61 GLU A CD   7  
ATOM 9543  O OE1  . GLU A 1 61 ? 74.313  3.567   -12.868 1.00 0.00 ? 61 GLU A OE1  7  
ATOM 9544  O OE2  . GLU A 1 61 ? 72.786  3.029   -14.286 1.00 0.00 ? 61 GLU A OE2  7  
ATOM 9545  H H    . GLU A 1 61 ? 75.208  5.968   -11.735 1.00 0.00 ? 61 GLU A H    7  
ATOM 9546  H HA   . GLU A 1 61 ? 72.321  6.518   -11.792 1.00 0.00 ? 61 GLU A HA   7  
ATOM 9547  H HB2  . GLU A 1 61 ? 73.574  3.994   -10.685 1.00 0.00 ? 61 GLU A HB2  7  
ATOM 9548  H HB3  . GLU A 1 61 ? 71.989  4.568   -10.176 1.00 0.00 ? 61 GLU A HB3  7  
ATOM 9549  H HG2  . GLU A 1 61 ? 71.494  3.056   -11.913 1.00 0.00 ? 61 GLU A HG2  7  
ATOM 9550  H HG3  . GLU A 1 61 ? 71.414  4.623   -12.708 1.00 0.00 ? 61 GLU A HG3  7  
ATOM 9551  N N    . GLN A 1 62 ? 72.812  7.913   -9.817  1.00 0.00 ? 62 GLN A N    7  
ATOM 9552  C CA   . GLN A 1 62 ? 73.003  8.703   -8.604  1.00 0.00 ? 62 GLN A CA   7  
ATOM 9553  C C    . GLN A 1 62 ? 72.474  7.951   -7.386  1.00 0.00 ? 62 GLN A C    7  
ATOM 9554  O O    . GLN A 1 62 ? 73.099  7.949   -6.326  1.00 0.00 ? 62 GLN A O    7  
ATOM 9555  C CB   . GLN A 1 62 ? 72.273  10.041  -8.734  1.00 0.00 ? 62 GLN A CB   7  
ATOM 9556  C CG   . GLN A 1 62 ? 72.827  10.812  -9.933  1.00 0.00 ? 62 GLN A CG   7  
ATOM 9557  C CD   . GLN A 1 62 ? 74.280  11.197  -9.680  1.00 0.00 ? 62 GLN A CD   7  
ATOM 9558  O OE1  . GLN A 1 62 ? 74.658  11.487  -8.545  1.00 0.00 ? 62 GLN A OE1  7  
ATOM 9559  N NE2  . GLN A 1 62 ? 75.122  11.219  -10.676 1.00 0.00 ? 62 GLN A NE2  7  
ATOM 9560  H H    . GLN A 1 62 ? 72.227  8.254   -10.526 1.00 0.00 ? 62 GLN A H    7  
ATOM 9561  H HA   . GLN A 1 62 ? 74.057  8.890   -8.471  1.00 0.00 ? 62 GLN A HA   7  
ATOM 9562  H HB2  . GLN A 1 62 ? 71.217  9.863   -8.876  1.00 0.00 ? 62 GLN A HB2  7  
ATOM 9563  H HB3  . GLN A 1 62 ? 72.423  10.621  -7.835  1.00 0.00 ? 62 GLN A HB3  7  
ATOM 9564  H HG2  . GLN A 1 62 ? 72.769  10.192  -10.815 1.00 0.00 ? 62 GLN A HG2  7  
ATOM 9565  H HG3  . GLN A 1 62 ? 72.242  11.708  -10.085 1.00 0.00 ? 62 GLN A HG3  7  
ATOM 9566  H HE21 . GLN A 1 62 ? 74.819  10.990  -11.580 1.00 0.00 ? 62 GLN A HE21 7  
ATOM 9567  H HE22 . GLN A 1 62 ? 76.059  11.466  -10.522 1.00 0.00 ? 62 GLN A HE22 7  
ATOM 9568  N N    . ASN A 1 63 ? 71.318  7.314   -7.546  1.00 0.00 ? 63 ASN A N    7  
ATOM 9569  C CA   . ASN A 1 63 ? 70.712  6.562   -6.453  1.00 0.00 ? 63 ASN A CA   7  
ATOM 9570  C C    . ASN A 1 63 ? 69.701  5.555   -6.990  1.00 0.00 ? 63 ASN A C    7  
ATOM 9571  C CB   . ASN A 1 63 ? 70.016  7.520   -5.484  1.00 0.00 ? 63 ASN A CB   7  
ATOM 9572  C CG   . ASN A 1 63 ? 68.835  8.194   -6.174  1.00 0.00 ? 63 ASN A CG   7  
ATOM 9573  O OD1  . ASN A 1 63 ? 68.751  8.194   -7.402  1.00 0.00 ? 63 ASN A OD1  7  
ATOM 9574  N ND2  . ASN A 1 63 ? 67.912  8.771   -5.454  1.00 0.00 ? 63 ASN A ND2  7  
ATOM 9575  H H    . ASN A 1 63 ? 70.863  7.350   -8.414  1.00 0.00 ? 63 ASN A H    7  
ATOM 9576  H HA   . ASN A 1 63 ? 71.487  6.031   -5.920  1.00 0.00 ? 63 ASN A HA   7  
ATOM 9577  H HB2  . ASN A 1 63 ? 69.661  6.967   -4.626  1.00 0.00 ? 63 ASN A HB2  7  
ATOM 9578  H HB3  . ASN A 1 63 ? 70.717  8.274   -5.158  1.00 0.00 ? 63 ASN A HB3  7  
ATOM 9579  H HD21 . ASN A 1 63 ? 67.981  8.770   -4.476  1.00 0.00 ? 63 ASN A HD21 7  
ATOM 9580  H HD22 . ASN A 1 63 ? 67.150  9.206   -5.891  1.00 0.00 ? 63 ASN A HD22 7  
ATOM 9581  N N    . CYS B 2 1  ? 71.061  19.594  -11.202 1.00 0.00 ? 1  CYS B N    7  
ATOM 9582  C CA   . CYS B 2 1  ? 71.702  18.573  -12.078 1.00 0.00 ? 1  CYS B CA   7  
ATOM 9583  C C    . CYS B 2 1  ? 73.170  18.934  -12.285 1.00 0.00 ? 1  CYS B C    7  
ATOM 9584  O O    . CYS B 2 1  ? 74.060  18.124  -12.027 1.00 0.00 ? 1  CYS B O    7  
ATOM 9585  C CB   . CYS B 2 1  ? 70.979  18.535  -13.425 1.00 0.00 ? 1  CYS B CB   7  
ATOM 9586  S SG   . CYS B 2 1  ? 69.247  18.078  -13.168 1.00 0.00 ? 1  CYS B SG   7  
ATOM 9587  H HA   . CYS B 2 1  ? 71.635  17.603  -11.607 1.00 0.00 ? 1  CYS B HA   7  
ATOM 9588  H HB2  . CYS B 2 1  ? 71.029  19.509  -13.889 1.00 0.00 ? 1  CYS B HB2  7  
ATOM 9589  H HB3  . CYS B 2 1  ? 71.452  17.807  -14.068 1.00 0.00 ? 1  CYS B HB3  7  
ATOM 9590  N N    . SER B 2 2  ? 73.414  20.154  -12.753 1.00 0.00 ? 2  SER B N    7  
ATOM 9591  C CA   . SER B 2 2  ? 74.778  20.612  -12.990 1.00 0.00 ? 2  SER B CA   7  
ATOM 9592  C C    . SER B 2 2  ? 75.523  19.634  -13.894 1.00 0.00 ? 2  SER B C    7  
ATOM 9593  O O    . SER B 2 2  ? 76.752  19.644  -13.958 1.00 0.00 ? 2  SER B O    7  
ATOM 9594  C CB   . SER B 2 2  ? 75.521  20.751  -11.662 1.00 0.00 ? 2  SER B CB   7  
ATOM 9595  O OG   . SER B 2 2  ? 74.685  21.416  -10.724 1.00 0.00 ? 2  SER B OG   7  
ATOM 9596  H H    . SER B 2 2  ? 72.664  20.756  -12.940 1.00 0.00 ? 2  SER B H    7  
ATOM 9597  H HA   . SER B 2 2  ? 74.744  21.577  -13.473 1.00 0.00 ? 2  SER B HA   7  
ATOM 9598  H HB2  . SER B 2 2  ? 75.771  19.774  -11.283 1.00 0.00 ? 2  SER B HB2  7  
ATOM 9599  H HB3  . SER B 2 2  ? 76.429  21.318  -11.817 1.00 0.00 ? 2  SER B HB3  7  
ATOM 9600  H HG   . SER B 2 2  ? 74.585  22.327  -11.010 1.00 0.00 ? 2  SER B HG   7  
ATOM 9601  N N    . THR B 2 3  ? 74.768  18.793  -14.594 1.00 0.00 ? 3  THR B N    7  
ATOM 9602  C CA   . THR B 2 3  ? 75.363  17.813  -15.497 1.00 0.00 ? 3  THR B CA   7  
ATOM 9603  C C    . THR B 2 3  ? 76.421  16.982  -14.775 1.00 0.00 ? 3  THR B C    7  
ATOM 9604  O O    . THR B 2 3  ? 77.581  17.383  -14.683 1.00 0.00 ? 3  THR B O    7  
ATOM 9605  C CB   . THR B 2 3  ? 76.000  18.525  -16.692 1.00 0.00 ? 3  THR B CB   7  
ATOM 9606  O OG1  . THR B 2 3  ? 77.168  19.212  -16.265 1.00 0.00 ? 3  THR B OG1  7  
ATOM 9607  C CG2  . THR B 2 3  ? 75.005  19.526  -17.282 1.00 0.00 ? 3  THR B CG2  7  
ATOM 9608  H H    . THR B 2 3  ? 73.792  18.833  -14.504 1.00 0.00 ? 3  THR B H    7  
ATOM 9609  H HA   . THR B 2 3  ? 74.588  17.154  -15.858 1.00 0.00 ? 3  THR B HA   7  
ATOM 9610  H HB   . THR B 2 3  ? 76.264  17.799  -17.446 1.00 0.00 ? 3  THR B HB   7  
ATOM 9611  H HG1  . THR B 2 3  ? 77.601  19.573  -17.042 1.00 0.00 ? 3  THR B HG1  7  
ATOM 9612  H HG21 . THR B 2 3  ? 74.918  20.378  -16.625 1.00 0.00 ? 3  THR B HG21 7  
ATOM 9613  H HG22 . THR B 2 3  ? 74.039  19.053  -17.388 1.00 0.00 ? 3  THR B HG22 7  
ATOM 9614  H HG23 . THR B 2 3  ? 75.353  19.851  -18.251 1.00 0.00 ? 3  THR B HG23 7  
ATOM 9615  N N    . VAL B 2 4  ? 76.014  15.822  -14.270 1.00 0.00 ? 4  VAL B N    7  
ATOM 9616  C CA   . VAL B 2 4  ? 76.937  14.940  -13.565 1.00 0.00 ? 4  VAL B CA   7  
ATOM 9617  C C    . VAL B 2 4  ? 77.866  14.242  -14.553 1.00 0.00 ? 4  VAL B C    7  
ATOM 9618  O O    . VAL B 2 4  ? 79.053  14.062  -14.286 1.00 0.00 ? 4  VAL B O    7  
ATOM 9619  C CB   . VAL B 2 4  ? 76.156  13.893  -12.769 1.00 0.00 ? 4  VAL B CB   7  
ATOM 9620  C CG1  . VAL B 2 4  ? 75.228  14.595  -11.776 1.00 0.00 ? 4  VAL B CG1  7  
ATOM 9621  C CG2  . VAL B 2 4  ? 75.324  13.042  -13.730 1.00 0.00 ? 4  VAL B CG2  7  
ATOM 9622  H H    . VAL B 2 4  ? 75.077  15.553  -14.377 1.00 0.00 ? 4  VAL B H    7  
ATOM 9623  H HA   . VAL B 2 4  ? 77.532  15.528  -12.880 1.00 0.00 ? 4  VAL B HA   7  
ATOM 9624  H HB   . VAL B 2 4  ? 76.847  13.261  -12.232 1.00 0.00 ? 4  VAL B HB   7  
ATOM 9625  H HG11 . VAL B 2 4  ? 75.819  15.135  -11.052 1.00 0.00 ? 4  VAL B HG11 7  
ATOM 9626  H HG12 . VAL B 2 4  ? 74.622  13.859  -11.269 1.00 0.00 ? 4  VAL B HG12 7  
ATOM 9627  H HG13 . VAL B 2 4  ? 74.588  15.284  -12.306 1.00 0.00 ? 4  VAL B HG13 7  
ATOM 9628  H HG21 . VAL B 2 4  ? 74.616  12.452  -13.168 1.00 0.00 ? 4  VAL B HG21 7  
ATOM 9629  H HG22 . VAL B 2 4  ? 75.976  12.386  -14.289 1.00 0.00 ? 4  VAL B HG22 7  
ATOM 9630  H HG23 . VAL B 2 4  ? 74.790  13.688  -14.414 1.00 0.00 ? 4  VAL B HG23 7  
ATOM 9631  N N    . SER B 2 5  ? 77.311  13.852  -15.698 1.00 0.00 ? 5  SER B N    7  
ATOM 9632  C CA   . SER B 2 5  ? 78.087  13.173  -16.732 1.00 0.00 ? 5  SER B CA   7  
ATOM 9633  C C    . SER B 2 5  ? 79.497  13.764  -16.856 1.00 0.00 ? 5  SER B C    7  
ATOM 9634  O O    . SER B 2 5  ? 80.483  13.065  -16.621 1.00 0.00 ? 5  SER B O    7  
ATOM 9635  C CB   . SER B 2 5  ? 77.348  13.266  -18.076 1.00 0.00 ? 5  SER B CB   7  
ATOM 9636  O OG   . SER B 2 5  ? 78.281  13.502  -19.122 1.00 0.00 ? 5  SER B OG   7  
ATOM 9637  H H    . SER B 2 5  ? 76.359  14.024  -15.852 1.00 0.00 ? 5  SER B H    7  
ATOM 9638  H HA   . SER B 2 5  ? 78.179  12.132  -16.457 1.00 0.00 ? 5  SER B HA   7  
ATOM 9639  H HB2  . SER B 2 5  ? 76.827  12.343  -18.274 1.00 0.00 ? 5  SER B HB2  7  
ATOM 9640  H HB3  . SER B 2 5  ? 76.630  14.074  -18.033 1.00 0.00 ? 5  SER B HB3  7  
ATOM 9641  H HG   . SER B 2 5  ? 77.986  14.270  -19.616 1.00 0.00 ? 5  SER B HG   7  
ATOM 9642  N N    . PRO B 2 6  ? 79.622  15.021  -17.221 1.00 0.00 ? 6  PRO B N    7  
ATOM 9643  C CA   . PRO B 2 6  ? 80.959  15.679  -17.372 1.00 0.00 ? 6  PRO B CA   7  
ATOM 9644  C C    . PRO B 2 6  ? 81.759  15.673  -16.065 1.00 0.00 ? 6  PRO B C    7  
ATOM 9645  O O    . PRO B 2 6  ? 82.827  16.279  -15.979 1.00 0.00 ? 6  PRO B O    7  
ATOM 9646  C CB   . PRO B 2 6  ? 80.619  17.114  -17.827 1.00 0.00 ? 6  PRO B CB   7  
ATOM 9647  C CG   . PRO B 2 6  ? 79.189  17.324  -17.437 1.00 0.00 ? 6  PRO B CG   7  
ATOM 9648  C CD   . PRO B 2 6  ? 78.523  15.952  -17.530 1.00 0.00 ? 6  PRO B CD   7  
ATOM 9649  H HA   . PRO B 2 6  ? 81.525  15.184  -18.144 1.00 0.00 ? 6  PRO B HA   7  
ATOM 9650  H HB2  . PRO B 2 6  ? 81.258  17.836  -17.331 1.00 0.00 ? 6  PRO B HB2  7  
ATOM 9651  H HB3  . PRO B 2 6  ? 80.723  17.203  -18.900 1.00 0.00 ? 6  PRO B HB3  7  
ATOM 9652  H HG2  . PRO B 2 6  ? 79.133  17.700  -16.423 1.00 0.00 ? 6  PRO B HG2  7  
ATOM 9653  H HG3  . PRO B 2 6  ? 78.707  18.011  -18.116 1.00 0.00 ? 6  PRO B HG3  7  
ATOM 9654  H HD2  . PRO B 2 6  ? 77.727  15.874  -16.807 1.00 0.00 ? 6  PRO B HD2  7  
ATOM 9655  H HD3  . PRO B 2 6  ? 78.153  15.777  -18.528 1.00 0.00 ? 6  PRO B HD3  7  
ATOM 9656  N N    . GLY B 2 7  ? 81.236  14.978  -15.054 1.00 0.00 ? 7  GLY B N    7  
ATOM 9657  C CA   . GLY B 2 7  ? 81.902  14.885  -13.751 1.00 0.00 ? 7  GLY B CA   7  
ATOM 9658  C C    . GLY B 2 7  ? 82.289  13.441  -13.438 1.00 0.00 ? 7  GLY B C    7  
ATOM 9659  O O    . GLY B 2 7  ? 83.470  13.105  -13.366 1.00 0.00 ? 7  GLY B O    7  
ATOM 9660  H H    . GLY B 2 7  ? 80.384  14.517  -15.186 1.00 0.00 ? 7  GLY B H    7  
ATOM 9661  H HA2  . GLY B 2 7  ? 82.796  15.498  -13.751 1.00 0.00 ? 7  GLY B HA2  7  
ATOM 9662  H HA3  . GLY B 2 7  ? 81.231  15.241  -12.985 1.00 0.00 ? 7  GLY B HA3  7  
ATOM 9663  N N    . VAL B 2 8  ? 81.286  12.591  -13.250 1.00 0.00 ? 8  VAL B N    7  
ATOM 9664  C CA   . VAL B 2 8  ? 81.536  11.187  -12.943 1.00 0.00 ? 8  VAL B CA   7  
ATOM 9665  C C    . VAL B 2 8  ? 82.373  10.539  -14.056 1.00 0.00 ? 8  VAL B C    7  
ATOM 9666  O O    . VAL B 2 8  ? 83.418  9.929   -13.795 1.00 0.00 ? 8  VAL B O    7  
ATOM 9667  C CB   . VAL B 2 8  ? 80.188  10.449  -12.774 1.00 0.00 ? 8  VAL B CB   7  
ATOM 9668  C CG1  . VAL B 2 8  ? 79.732  10.508  -11.306 1.00 0.00 ? 8  VAL B CG1  7  
ATOM 9669  C CG2  . VAL B 2 8  ? 79.120  11.112  -13.660 1.00 0.00 ? 8  VAL B CG2  7  
ATOM 9670  H H    . VAL B 2 8  ? 80.362  12.912  -13.316 1.00 0.00 ? 8  VAL B H    7  
ATOM 9671  H HA   . VAL B 2 8  ? 82.093  11.127  -12.018 1.00 0.00 ? 8  VAL B HA   7  
ATOM 9672  H HB   . VAL B 2 8  ? 80.301  9.418   -13.065 1.00 0.00 ? 8  VAL B HB   7  
ATOM 9673  H HG11 . VAL B 2 8  ? 79.936  11.489  -10.904 1.00 0.00 ? 8  VAL B HG11 7  
ATOM 9674  H HG12 . VAL B 2 8  ? 80.268  9.768   -10.734 1.00 0.00 ? 8  VAL B HG12 7  
ATOM 9675  H HG13 . VAL B 2 8  ? 78.671  10.309  -11.245 1.00 0.00 ? 8  VAL B HG13 7  
ATOM 9676  H HG21 . VAL B 2 8  ? 79.550  11.371  -14.614 1.00 0.00 ? 8  VAL B HG21 7  
ATOM 9677  H HG22 . VAL B 2 8  ? 78.752  12.006  -13.179 1.00 0.00 ? 8  VAL B HG22 7  
ATOM 9678  H HG23 . VAL B 2 8  ? 78.302  10.424  -13.811 1.00 0.00 ? 8  VAL B HG23 7  
ATOM 9679  N N    . LEU B 2 9  ? 81.928  10.688  -15.297 1.00 0.00 ? 9  LEU B N    7  
ATOM 9680  C CA   . LEU B 2 9  ? 82.664  10.125  -16.419 1.00 0.00 ? 9  LEU B CA   7  
ATOM 9681  C C    . LEU B 2 9  ? 84.091  10.679  -16.402 1.00 0.00 ? 9  LEU B C    7  
ATOM 9682  O O    . LEU B 2 9  ? 85.069  9.950   -16.642 1.00 0.00 ? 9  LEU B O    7  
ATOM 9683  C CB   . LEU B 2 9  ? 81.942  10.461  -17.730 1.00 0.00 ? 9  LEU B CB   7  
ATOM 9684  C CG   . LEU B 2 9  ? 80.448  10.114  -17.587 1.00 0.00 ? 9  LEU B CG   7  
ATOM 9685  C CD1  . LEU B 2 9  ? 79.715  10.388  -18.907 1.00 0.00 ? 9  LEU B CD1  7  
ATOM 9686  C CD2  . LEU B 2 9  ? 80.289  8.631   -17.210 1.00 0.00 ? 9  LEU B CD2  7  
ATOM 9687  H H    . LEU B 2 9  ? 81.105  11.192  -15.460 1.00 0.00 ? 9  LEU B H    7  
ATOM 9688  H HA   . LEU B 2 9  ? 82.707  9.051   -16.306 1.00 0.00 ? 9  LEU B HA   7  
ATOM 9689  H HB2  . LEU B 2 9  ? 82.051  11.516  -17.941 1.00 0.00 ? 9  LEU B HB2  7  
ATOM 9690  H HB3  . LEU B 2 9  ? 82.368  9.884   -18.536 1.00 0.00 ? 9  LEU B HB3  7  
ATOM 9691  H HG   . LEU B 2 9  ? 80.016  10.727  -16.812 1.00 0.00 ? 9  LEU B HG   7  
ATOM 9692  H HD11 . LEU B 2 9  ? 78.649  10.296  -18.753 1.00 0.00 ? 9  LEU B HD11 7  
ATOM 9693  H HD12 . LEU B 2 9  ? 80.033  9.675   -19.653 1.00 0.00 ? 9  LEU B HD12 7  
ATOM 9694  H HD13 . LEU B 2 9  ? 79.940  11.387  -19.245 1.00 0.00 ? 9  LEU B HD13 7  
ATOM 9695  H HD21 . LEU B 2 9  ? 79.291  8.295   -17.458 1.00 0.00 ? 9  LEU B HD21 7  
ATOM 9696  H HD22 . LEU B 2 9  ? 80.447  8.510   -16.147 1.00 0.00 ? 9  LEU B HD22 7  
ATOM 9697  H HD23 . LEU B 2 9  ? 81.012  8.038   -17.751 1.00 0.00 ? 9  LEU B HD23 7  
ATOM 9698  N N    . ALA B 2 10 ? 84.211  11.961  -16.054 1.00 0.00 ? 10 ALA B N    7  
ATOM 9699  C CA   . ALA B 2 10 ? 85.521  12.579  -15.941 1.00 0.00 ? 10 ALA B CA   7  
ATOM 9700  C C    . ALA B 2 10 ? 86.331  11.757  -14.937 1.00 0.00 ? 10 ALA B C    7  
ATOM 9701  O O    . ALA B 2 10 ? 87.552  11.580  -15.056 1.00 0.00 ? 10 ALA B O    7  
ATOM 9702  C CB   . ALA B 2 10 ? 85.383  14.032  -15.458 1.00 0.00 ? 10 ALA B CB   7  
ATOM 9703  H H    . ALA B 2 10 ? 83.409  12.479  -15.830 1.00 0.00 ? 10 ALA B H    7  
ATOM 9704  H HA   . ALA B 2 10 ? 86.003  12.571  -16.905 1.00 0.00 ? 10 ALA B HA   7  
ATOM 9705  H HB1  . ALA B 2 10 ? 85.345  14.060  -14.378 1.00 0.00 ? 10 ALA B HB1  7  
ATOM 9706  H HB2  . ALA B 2 10 ? 84.476  14.458  -15.858 1.00 0.00 ? 10 ALA B HB2  7  
ATOM 9707  H HB3  . ALA B 2 10 ? 86.230  14.609  -15.801 1.00 0.00 ? 10 ALA B HB3  7  
ATOM 9708  N N    . GLY B 2 11 ? 85.608  11.242  -13.947 1.00 0.00 ? 11 GLY B N    7  
ATOM 9709  C CA   . GLY B 2 11 ? 86.207  10.423  -12.909 1.00 0.00 ? 11 GLY B CA   7  
ATOM 9710  C C    . GLY B 2 11 ? 86.749  9.124   -13.488 1.00 0.00 ? 11 GLY B C    7  
ATOM 9711  O O    . GLY B 2 11 ? 87.796  8.639   -13.056 1.00 0.00 ? 11 GLY B O    7  
ATOM 9712  H H    . GLY B 2 11 ? 84.642  11.415  -13.921 1.00 0.00 ? 11 GLY B H    7  
ATOM 9713  H HA2  . GLY B 2 11 ? 87.013  10.971  -12.445 1.00 0.00 ? 11 GLY B HA2  7  
ATOM 9714  H HA3  . GLY B 2 11 ? 85.460  10.191  -12.165 1.00 0.00 ? 11 GLY B HA3  7  
ATOM 9715  N N    . ILE B 2 12 ? 86.047  8.554   -14.470 1.00 0.00 ? 12 ILE B N    7  
ATOM 9716  C CA   . ILE B 2 12 ? 86.521  7.315   -15.062 1.00 0.00 ? 12 ILE B CA   7  
ATOM 9717  C C    . ILE B 2 12 ? 87.861  7.559   -15.756 1.00 0.00 ? 12 ILE B C    7  
ATOM 9718  O O    . ILE B 2 12 ? 88.783  6.756   -15.614 1.00 0.00 ? 12 ILE B O    7  
ATOM 9719  C CB   . ILE B 2 12 ? 85.459  6.728   -16.019 1.00 0.00 ? 12 ILE B CB   7  
ATOM 9720  C CG1  . ILE B 2 12 ? 84.414  5.971   -15.179 1.00 0.00 ? 12 ILE B CG1  7  
ATOM 9721  C CG2  . ILE B 2 12 ? 86.113  5.756   -17.014 1.00 0.00 ? 12 ILE B CG2  7  
ATOM 9722  C CD1  . ILE B 2 12 ? 83.221  5.557   -16.043 1.00 0.00 ? 12 ILE B CD1  7  
ATOM 9723  H H    . ILE B 2 12 ? 85.214  8.968   -14.799 1.00 0.00 ? 12 ILE B H    7  
ATOM 9724  H HA   . ILE B 2 12 ? 86.693  6.609   -14.260 1.00 0.00 ? 12 ILE B HA   7  
ATOM 9725  H HB   . ILE B 2 12 ? 84.977  7.529   -16.560 1.00 0.00 ? 12 ILE B HB   7  
ATOM 9726  H HG12 . ILE B 2 12 ? 84.873  5.088   -14.764 1.00 0.00 ? 12 ILE B HG12 7  
ATOM 9727  H HG13 . ILE B 2 12 ? 84.069  6.606   -14.377 1.00 0.00 ? 12 ILE B HG13 7  
ATOM 9728  H HG21 . ILE B 2 12 ? 86.567  6.318   -17.817 1.00 0.00 ? 12 ILE B HG21 7  
ATOM 9729  H HG22 . ILE B 2 12 ? 85.367  5.091   -17.419 1.00 0.00 ? 12 ILE B HG22 7  
ATOM 9730  H HG23 . ILE B 2 12 ? 86.872  5.178   -16.508 1.00 0.00 ? 12 ILE B HG23 7  
ATOM 9731  H HD11 . ILE B 2 12 ? 83.532  4.799   -16.747 1.00 0.00 ? 12 ILE B HD11 7  
ATOM 9732  H HD12 . ILE B 2 12 ? 82.846  6.416   -16.578 1.00 0.00 ? 12 ILE B HD12 7  
ATOM 9733  H HD13 . ILE B 2 12 ? 82.441  5.156   -15.408 1.00 0.00 ? 12 ILE B HD13 7  
ATOM 9734  N N    . VAL B 2 13 ? 87.991  8.672   -16.479 1.00 0.00 ? 13 VAL B N    7  
ATOM 9735  C CA   . VAL B 2 13 ? 89.277  8.953   -17.130 1.00 0.00 ? 13 VAL B CA   7  
ATOM 9736  C C    . VAL B 2 13 ? 90.375  8.969   -16.067 1.00 0.00 ? 13 VAL B C    7  
ATOM 9737  O O    . VAL B 2 13 ? 91.434  8.368   -16.251 1.00 0.00 ? 13 VAL B O    7  
ATOM 9738  C CB   . VAL B 2 13 ? 89.255  10.288  -17.943 1.00 0.00 ? 13 VAL B CB   7  
ATOM 9739  C CG1  . VAL B 2 13 ? 87.818  10.715  -18.179 1.00 0.00 ? 13 VAL B CG1  7  
ATOM 9740  C CG2  . VAL B 2 13 ? 89.987  11.435  -17.216 1.00 0.00 ? 13 VAL B CG2  7  
ATOM 9741  H H    . VAL B 2 13 ? 87.237  9.302   -16.560 1.00 0.00 ? 13 VAL B H    7  
ATOM 9742  H HA   . VAL B 2 13 ? 89.486  8.137   -17.811 1.00 0.00 ? 13 VAL B HA   7  
ATOM 9743  H HB   . VAL B 2 13 ? 89.728  10.124  -18.904 1.00 0.00 ? 13 VAL B HB   7  
ATOM 9744  H HG11 . VAL B 2 13 ? 87.803  11.658  -18.701 1.00 0.00 ? 13 VAL B HG11 7  
ATOM 9745  H HG12 . VAL B 2 13 ? 87.320  10.820  -17.238 1.00 0.00 ? 13 VAL B HG12 7  
ATOM 9746  H HG13 . VAL B 2 13 ? 87.322  9.967   -18.766 1.00 0.00 ? 13 VAL B HG13 7  
ATOM 9747  H HG21 . VAL B 2 13 ? 89.578  11.562  -16.228 1.00 0.00 ? 13 VAL B HG21 7  
ATOM 9748  H HG22 . VAL B 2 13 ? 89.857  12.351  -17.775 1.00 0.00 ? 13 VAL B HG22 7  
ATOM 9749  H HG23 . VAL B 2 13 ? 91.042  11.209  -17.147 1.00 0.00 ? 13 VAL B HG23 7  
ATOM 9750  N N    . VAL B 2 14 ? 90.116  9.653   -14.950 1.00 0.00 ? 14 VAL B N    7  
ATOM 9751  C CA   . VAL B 2 14 ? 91.109  9.711   -13.880 1.00 0.00 ? 14 VAL B CA   7  
ATOM 9752  C C    . VAL B 2 14 ? 91.546  8.295   -13.514 1.00 0.00 ? 14 VAL B C    7  
ATOM 9753  O O    . VAL B 2 14 ? 92.740  8.015   -13.368 1.00 0.00 ? 14 VAL B O    7  
ATOM 9754  C CB   . VAL B 2 14 ? 90.538  10.414  -12.645 1.00 0.00 ? 14 VAL B CB   7  
ATOM 9755  C CG1  . VAL B 2 14 ? 91.560  10.347  -11.506 1.00 0.00 ? 14 VAL B CG1  7  
ATOM 9756  C CG2  . VAL B 2 14 ? 90.249  11.879  -12.977 1.00 0.00 ? 14 VAL B CG2  7  
ATOM 9757  H H    . VAL B 2 14 ? 89.251  10.117  -14.845 1.00 0.00 ? 14 VAL B H    7  
ATOM 9758  H HA   . VAL B 2 14 ? 91.969  10.262  -14.232 1.00 0.00 ? 14 VAL B HA   7  
ATOM 9759  H HB   . VAL B 2 14 ? 89.627  9.923   -12.339 1.00 0.00 ? 14 VAL B HB   7  
ATOM 9760  H HG11 . VAL B 2 14 ? 91.598  9.341   -11.116 1.00 0.00 ? 14 VAL B HG11 7  
ATOM 9761  H HG12 . VAL B 2 14 ? 91.268  11.028  -10.720 1.00 0.00 ? 14 VAL B HG12 7  
ATOM 9762  H HG13 . VAL B 2 14 ? 92.534  10.626  -11.880 1.00 0.00 ? 14 VAL B HG13 7  
ATOM 9763  H HG21 . VAL B 2 14 ? 89.991  12.410  -12.072 1.00 0.00 ? 14 VAL B HG21 7  
ATOM 9764  H HG22 . VAL B 2 14 ? 89.426  11.936  -13.674 1.00 0.00 ? 14 VAL B HG22 7  
ATOM 9765  H HG23 . VAL B 2 14 ? 91.126  12.329  -13.419 1.00 0.00 ? 14 VAL B HG23 7  
ATOM 9766  N N    . GLY B 2 15 ? 90.568  7.402   -13.382 1.00 0.00 ? 15 GLY B N    7  
ATOM 9767  C CA   . GLY B 2 15 ? 90.857  6.014   -13.048 1.00 0.00 ? 15 GLY B CA   7  
ATOM 9768  C C    . GLY B 2 15 ? 91.761  5.387   -14.104 1.00 0.00 ? 15 GLY B C    7  
ATOM 9769  O O    . GLY B 2 15 ? 92.648  4.595   -13.786 1.00 0.00 ? 15 GLY B O    7  
ATOM 9770  H H    . GLY B 2 15 ? 89.638  7.683   -13.520 1.00 0.00 ? 15 GLY B H    7  
ATOM 9771  H HA2  . GLY B 2 15 ? 91.347  5.973   -12.087 1.00 0.00 ? 15 GLY B HA2  7  
ATOM 9772  H HA3  . GLY B 2 15 ? 89.932  5.459   -13.003 1.00 0.00 ? 15 GLY B HA3  7  
ATOM 9773  N N    . ASP B 2 16 ? 91.533  5.753   -15.362 1.00 0.00 ? 16 ASP B N    7  
ATOM 9774  C CA   . ASP B 2 16 ? 92.335  5.226   -16.460 1.00 0.00 ? 16 ASP B CA   7  
ATOM 9775  C C    . ASP B 2 16 ? 93.799  5.602   -16.269 1.00 0.00 ? 16 ASP B C    7  
ATOM 9776  O O    . ASP B 2 16 ? 94.692  4.766   -16.400 1.00 0.00 ? 16 ASP B O    7  
ATOM 9777  C CB   . ASP B 2 16 ? 91.837  5.791   -17.792 1.00 0.00 ? 16 ASP B CB   7  
ATOM 9778  C CG   . ASP B 2 16 ? 92.416  4.985   -18.949 1.00 0.00 ? 16 ASP B CG   7  
ATOM 9779  O OD1  . ASP B 2 16 ? 93.080  3.997   -18.684 1.00 0.00 ? 16 ASP B OD1  7  
ATOM 9780  O OD2  . ASP B 2 16 ? 92.187  5.369   -20.085 1.00 0.00 ? 16 ASP B OD2  7  
ATOM 9781  H H    . ASP B 2 16 ? 90.814  6.391   -15.554 1.00 0.00 ? 16 ASP B H    7  
ATOM 9782  H HA   . ASP B 2 16 ? 92.247  4.151   -16.479 1.00 0.00 ? 16 ASP B HA   7  
ATOM 9783  H HB2  . ASP B 2 16 ? 90.758  5.739   -17.822 1.00 0.00 ? 16 ASP B HB2  7  
ATOM 9784  H HB3  . ASP B 2 16 ? 92.149  6.821   -17.883 1.00 0.00 ? 16 ASP B HB3  7  
ATOM 9785  N N    . LEU B 2 17 ? 94.032  6.871   -15.955 1.00 0.00 ? 17 LEU B N    7  
ATOM 9786  C CA   . LEU B 2 17 ? 95.385  7.365   -15.741 1.00 0.00 ? 17 LEU B CA   7  
ATOM 9787  C C    . LEU B 2 17 ? 96.075  6.552   -14.650 1.00 0.00 ? 17 LEU B C    7  
ATOM 9788  O O    . LEU B 2 17 ? 97.217  6.112   -14.811 1.00 0.00 ? 17 LEU B O    7  
ATOM 9789  C CB   . LEU B 2 17 ? 95.324  8.846   -15.343 1.00 0.00 ? 17 LEU B CB   7  
ATOM 9790  C CG   . LEU B 2 17 ? 96.711  9.361   -14.940 1.00 0.00 ? 17 LEU B CG   7  
ATOM 9791  C CD1  . LEU B 2 17 ? 97.728  9.062   -16.049 1.00 0.00 ? 17 LEU B CD1  7  
ATOM 9792  C CD2  . LEU B 2 17 ? 96.629  10.874  -14.714 1.00 0.00 ? 17 LEU B CD2  7  
ATOM 9793  H H    . LEU B 2 17 ? 93.277  7.489   -15.863 1.00 0.00 ? 17 LEU B H    7  
ATOM 9794  H HA   . LEU B 2 17 ? 95.942  7.270   -16.661 1.00 0.00 ? 17 LEU B HA   7  
ATOM 9795  H HB2  . LEU B 2 17 ? 94.959  9.422   -16.180 1.00 0.00 ? 17 LEU B HB2  7  
ATOM 9796  H HB3  . LEU B 2 17 ? 94.646  8.961   -14.510 1.00 0.00 ? 17 LEU B HB3  7  
ATOM 9797  H HG   . LEU B 2 17 ? 97.024  8.879   -14.026 1.00 0.00 ? 17 LEU B HG   7  
ATOM 9798  H HD11 . LEU B 2 17 ? 98.590  9.704   -15.933 1.00 0.00 ? 17 LEU B HD11 7  
ATOM 9799  H HD12 . LEU B 2 17 ? 97.277  9.240   -17.013 1.00 0.00 ? 17 LEU B HD12 7  
ATOM 9800  H HD13 . LEU B 2 17 ? 98.040  8.030   -15.982 1.00 0.00 ? 17 LEU B HD13 7  
ATOM 9801  H HD21 . LEU B 2 17 ? 97.626  11.276  -14.602 1.00 0.00 ? 17 LEU B HD21 7  
ATOM 9802  H HD22 . LEU B 2 17 ? 96.058  11.074  -13.820 1.00 0.00 ? 17 LEU B HD22 7  
ATOM 9803  H HD23 . LEU B 2 17 ? 96.146  11.340  -15.561 1.00 0.00 ? 17 LEU B HD23 7  
ATOM 9804  N N    . VAL B 2 18 ? 95.370  6.348   -13.541 1.00 0.00 ? 18 VAL B N    7  
ATOM 9805  C CA   . VAL B 2 18 ? 95.925  5.579   -12.435 1.00 0.00 ? 18 VAL B CA   7  
ATOM 9806  C C    . VAL B 2 18 ? 96.347  4.193   -12.914 1.00 0.00 ? 18 VAL B C    7  
ATOM 9807  O O    . VAL B 2 18 ? 97.440  3.722   -12.595 1.00 0.00 ? 18 VAL B O    7  
ATOM 9808  C CB   . VAL B 2 18 ? 94.891  5.452   -11.313 1.00 0.00 ? 18 VAL B CB   7  
ATOM 9809  C CG1  . VAL B 2 18 ? 95.430  4.528   -10.218 1.00 0.00 ? 18 VAL B CG1  7  
ATOM 9810  C CG2  . VAL B 2 18 ? 94.619  6.835   -10.716 1.00 0.00 ? 18 VAL B CG2  7  
ATOM 9811  H H    . VAL B 2 18 ? 94.462  6.716   -13.470 1.00 0.00 ? 18 VAL B H    7  
ATOM 9812  H HA   . VAL B 2 18 ? 96.792  6.096   -12.052 1.00 0.00 ? 18 VAL B HA   7  
ATOM 9813  H HB   . VAL B 2 18 ? 93.975  5.042   -11.711 1.00 0.00 ? 18 VAL B HB   7  
ATOM 9814  H HG11 . VAL B 2 18 ? 96.446  4.805   -9.981  1.00 0.00 ? 18 VAL B HG11 7  
ATOM 9815  H HG12 . VAL B 2 18 ? 95.407  3.506   -10.565 1.00 0.00 ? 18 VAL B HG12 7  
ATOM 9816  H HG13 . VAL B 2 18 ? 94.815  4.621   -9.335  1.00 0.00 ? 18 VAL B HG13 7  
ATOM 9817  H HG21 . VAL B 2 18 ? 95.534  7.234   -10.303 1.00 0.00 ? 18 VAL B HG21 7  
ATOM 9818  H HG22 . VAL B 2 18 ? 93.878  6.752   -9.936  1.00 0.00 ? 18 VAL B HG22 7  
ATOM 9819  H HG23 . VAL B 2 18 ? 94.255  7.495   -11.490 1.00 0.00 ? 18 VAL B HG23 7  
ATOM 9820  N N    . LEU B 2 19 ? 95.484  3.543   -13.691 1.00 0.00 ? 19 LEU B N    7  
ATOM 9821  C CA   . LEU B 2 19 ? 95.802  2.217   -14.205 1.00 0.00 ? 19 LEU B CA   7  
ATOM 9822  C C    . LEU B 2 19 ? 97.069  2.276   -15.049 1.00 0.00 ? 19 LEU B C    7  
ATOM 9823  O O    . LEU B 2 19 ? 98.008  1.523   -14.818 1.00 0.00 ? 19 LEU B O    7  
ATOM 9824  C CB   . LEU B 2 19 ? 94.644  1.679   -15.064 1.00 0.00 ? 19 LEU B CB   7  
ATOM 9825  C CG   . LEU B 2 19 ? 93.524  1.112   -14.176 1.00 0.00 ? 19 LEU B CG   7  
ATOM 9826  C CD1  . LEU B 2 19 ? 92.276  0.898   -15.042 1.00 0.00 ? 19 LEU B CD1  7  
ATOM 9827  C CD2  . LEU B 2 19 ? 93.955  -0.233  -13.543 1.00 0.00 ? 19 LEU B CD2  7  
ATOM 9828  H H    . LEU B 2 19 ? 94.629  3.962   -13.924 1.00 0.00 ? 19 LEU B H    7  
ATOM 9829  H HA   . LEU B 2 19 ? 95.969  1.552   -13.376 1.00 0.00 ? 19 LEU B HA   7  
ATOM 9830  H HB2  . LEU B 2 19 ? 94.247  2.486   -15.662 1.00 0.00 ? 19 LEU B HB2  7  
ATOM 9831  H HB3  . LEU B 2 19 ? 95.008  0.901   -15.721 1.00 0.00 ? 19 LEU B HB3  7  
ATOM 9832  H HG   . LEU B 2 19 ? 93.297  1.823   -13.394 1.00 0.00 ? 19 LEU B HG   7  
ATOM 9833  H HD11 . LEU B 2 19 ? 91.527  0.374   -14.470 1.00 0.00 ? 19 LEU B HD11 7  
ATOM 9834  H HD12 . LEU B 2 19 ? 92.537  0.318   -15.917 1.00 0.00 ? 19 LEU B HD12 7  
ATOM 9835  H HD13 . LEU B 2 19 ? 91.886  1.856   -15.352 1.00 0.00 ? 19 LEU B HD13 7  
ATOM 9836  H HD21 . LEU B 2 19 ? 93.081  -0.814  -13.291 1.00 0.00 ? 19 LEU B HD21 7  
ATOM 9837  H HD22 . LEU B 2 19 ? 94.518  -0.046  -12.643 1.00 0.00 ? 19 LEU B HD22 7  
ATOM 9838  H HD23 . LEU B 2 19 ? 94.564  -0.792  -14.238 1.00 0.00 ? 19 LEU B HD23 7  
ATOM 9839  N N    . THR B 2 20 ? 97.089  3.179   -16.024 1.00 0.00 ? 20 THR B N    7  
ATOM 9840  C CA   . THR B 2 20 ? 98.250  3.316   -16.897 1.00 0.00 ? 20 THR B CA   7  
ATOM 9841  C C    . THR B 2 20 ? 99.538  3.291   -16.083 1.00 0.00 ? 20 THR B C    7  
ATOM 9842  O O    . THR B 2 20 ? 100.483 2.575   -16.419 1.00 0.00 ? 20 THR B O    7  
ATOM 9843  C CB   . THR B 2 20 ? 98.162  4.627   -17.682 1.00 0.00 ? 20 THR B CB   7  
ATOM 9844  O OG1  . THR B 2 20 ? 96.875  4.738   -18.273 1.00 0.00 ? 20 THR B OG1  7  
ATOM 9845  C CG2  . THR B 2 20 ? 99.232  4.645   -18.775 1.00 0.00 ? 20 THR B CG2  7  
ATOM 9846  H H    . THR B 2 20 ? 96.310  3.758   -16.162 1.00 0.00 ? 20 THR B H    7  
ATOM 9847  H HA   . THR B 2 20 ? 98.261  2.492   -17.596 1.00 0.00 ? 20 THR B HA   7  
ATOM 9848  H HB   . THR B 2 20 ? 98.325  5.458   -17.013 1.00 0.00 ? 20 THR B HB   7  
ATOM 9849  H HG1  . THR B 2 20 ? 96.375  5.389   -17.776 1.00 0.00 ? 20 THR B HG1  7  
ATOM 9850  H HG21 . THR B 2 20 ? 99.168  5.570   -19.327 1.00 0.00 ? 20 THR B HG21 7  
ATOM 9851  H HG22 . THR B 2 20 ? 99.074  3.813   -19.447 1.00 0.00 ? 20 THR B HG22 7  
ATOM 9852  H HG23 . THR B 2 20 ? 100.210 4.563   -18.324 1.00 0.00 ? 20 THR B HG23 7  
ATOM 9853  N N    . VAL B 2 21 ? 99.568  4.066   -15.007 1.00 0.00 ? 21 VAL B N    7  
ATOM 9854  C CA   . VAL B 2 21 ? 100.749 4.110   -14.153 1.00 0.00 ? 21 VAL B CA   7  
ATOM 9855  C C    . VAL B 2 21 ? 101.000 2.744   -13.517 1.00 0.00 ? 21 VAL B C    7  
ATOM 9856  O O    . VAL B 2 21 ? 102.148 2.320   -13.363 1.00 0.00 ? 21 VAL B O    7  
ATOM 9857  C CB   . VAL B 2 21 ? 100.563 5.158   -13.055 1.00 0.00 ? 21 VAL B CB   7  
ATOM 9858  C CG1  . VAL B 2 21 ? 101.816 5.206   -12.179 1.00 0.00 ? 21 VAL B CG1  7  
ATOM 9859  C CG2  . VAL B 2 21 ? 100.334 6.531   -13.692 1.00 0.00 ? 21 VAL B CG2  7  
ATOM 9860  H H    . VAL B 2 21 ? 98.783  4.614   -14.780 1.00 0.00 ? 21 VAL B H    7  
ATOM 9861  H HA   . VAL B 2 21 ? 101.605 4.381   -14.752 1.00 0.00 ? 21 VAL B HA   7  
ATOM 9862  H HB   . VAL B 2 21 ? 99.710  4.894   -12.447 1.00 0.00 ? 21 VAL B HB   7  
ATOM 9863  H HG11 . VAL B 2 21 ? 102.691 5.279   -12.807 1.00 0.00 ? 21 VAL B HG11 7  
ATOM 9864  H HG12 . VAL B 2 21 ? 101.874 4.306   -11.584 1.00 0.00 ? 21 VAL B HG12 7  
ATOM 9865  H HG13 . VAL B 2 21 ? 101.768 6.067   -11.528 1.00 0.00 ? 21 VAL B HG13 7  
ATOM 9866  H HG21 . VAL B 2 21 ? 99.521  6.469   -14.399 1.00 0.00 ? 21 VAL B HG21 7  
ATOM 9867  H HG22 . VAL B 2 21 ? 101.232 6.846   -14.202 1.00 0.00 ? 21 VAL B HG22 7  
ATOM 9868  H HG23 . VAL B 2 21 ? 100.087 7.248   -12.922 1.00 0.00 ? 21 VAL B HG23 7  
ATOM 9869  N N    . LEU B 2 22 ? 99.920  2.067   -13.134 1.00 0.00 ? 22 LEU B N    7  
ATOM 9870  C CA   . LEU B 2 22 ? 100.035 0.757   -12.496 1.00 0.00 ? 22 LEU B CA   7  
ATOM 9871  C C    . LEU B 2 22 ? 100.634 -0.284  -13.446 1.00 0.00 ? 22 LEU B C    7  
ATOM 9872  O O    . LEU B 2 22 ? 101.630 -0.929  -13.114 1.00 0.00 ? 22 LEU B O    7  
ATOM 9873  C CB   . LEU B 2 22 ? 98.652  0.297   -12.022 1.00 0.00 ? 22 LEU B CB   7  
ATOM 9874  C CG   . LEU B 2 22 ? 98.766  -1.001  -11.207 1.00 0.00 ? 22 LEU B CG   7  
ATOM 9875  C CD1  . LEU B 2 22 ? 99.568  -0.758  -9.914  1.00 0.00 ? 22 LEU B CD1  7  
ATOM 9876  C CD2  . LEU B 2 22 ? 97.354  -1.491  -10.855 1.00 0.00 ? 22 LEU B CD2  7  
ATOM 9877  H H    . LEU B 2 22 ? 99.031  2.459   -13.271 1.00 0.00 ? 22 LEU B H    7  
ATOM 9878  H HA   . LEU B 2 22 ? 100.679 0.854   -11.638 1.00 0.00 ? 22 LEU B HA   7  
ATOM 9879  H HB2  . LEU B 2 22 ? 98.211  1.067   -11.407 1.00 0.00 ? 22 LEU B HB2  7  
ATOM 9880  H HB3  . LEU B 2 22 ? 98.022  0.123   -12.882 1.00 0.00 ? 22 LEU B HB3  7  
ATOM 9881  H HG   . LEU B 2 22 ? 99.266  -1.754  -11.799 1.00 0.00 ? 22 LEU B HG   7  
ATOM 9882  H HD11 . LEU B 2 22 ? 99.383  0.243   -9.551  1.00 0.00 ? 22 LEU B HD11 7  
ATOM 9883  H HD12 . LEU B 2 22 ? 100.621 -0.877  -10.117 1.00 0.00 ? 22 LEU B HD12 7  
ATOM 9884  H HD13 . LEU B 2 22 ? 99.272  -1.473  -9.159  1.00 0.00 ? 22 LEU B HD13 7  
ATOM 9885  H HD21 . LEU B 2 22 ? 96.756  -0.656  -10.520 1.00 0.00 ? 22 LEU B HD21 7  
ATOM 9886  H HD22 . LEU B 2 22 ? 97.415  -2.228  -10.070 1.00 0.00 ? 22 LEU B HD22 7  
ATOM 9887  H HD23 . LEU B 2 22 ? 96.899  -1.931  -11.730 1.00 0.00 ? 22 LEU B HD23 7  
ATOM 9888  N N    . ILE B 2 23 ? 100.032 -0.454  -14.622 1.00 0.00 ? 23 ILE B N    7  
ATOM 9889  C CA   . ILE B 2 23 ? 100.542 -1.429  -15.579 1.00 0.00 ? 23 ILE B CA   7  
ATOM 9890  C C    . ILE B 2 23 ? 102.011 -1.151  -15.869 1.00 0.00 ? 23 ILE B C    7  
ATOM 9891  O O    . ILE B 2 23 ? 102.842 -2.058  -15.840 1.00 0.00 ? 23 ILE B O    7  
ATOM 9892  C CB   . ILE B 2 23 ? 99.742  -1.378  -16.891 1.00 0.00 ? 23 ILE B CB   7  
ATOM 9893  C CG1  . ILE B 2 23 ? 98.239  -1.274  -16.601 1.00 0.00 ? 23 ILE B CG1  7  
ATOM 9894  C CG2  . ILE B 2 23 ? 100.006 -2.651  -17.702 1.00 0.00 ? 23 ILE B CG2  7  
ATOM 9895  C CD1  . ILE B 2 23 ? 97.825  -2.320  -15.566 1.00 0.00 ? 23 ILE B CD1  7  
ATOM 9896  H H    . ILE B 2 23 ? 99.240  0.073   -14.845 1.00 0.00 ? 23 ILE B H    7  
ATOM 9897  H HA   . ILE B 2 23 ? 100.452 -2.415  -15.149 1.00 0.00 ? 23 ILE B HA   7  
ATOM 9898  H HB   . ILE B 2 23 ? 100.056 -0.519  -17.468 1.00 0.00 ? 23 ILE B HB   7  
ATOM 9899  H HG12 . ILE B 2 23 ? 98.014  -0.291  -16.228 1.00 0.00 ? 23 ILE B HG12 7  
ATOM 9900  H HG13 . ILE B 2 23 ? 97.688  -1.443  -17.514 1.00 0.00 ? 23 ILE B HG13 7  
ATOM 9901  H HG21 . ILE B 2 23 ? 99.822  -3.518  -17.086 1.00 0.00 ? 23 ILE B HG21 7  
ATOM 9902  H HG22 . ILE B 2 23 ? 101.033 -2.657  -18.037 1.00 0.00 ? 23 ILE B HG22 7  
ATOM 9903  H HG23 . ILE B 2 23 ? 99.349  -2.674  -18.557 1.00 0.00 ? 23 ILE B HG23 7  
ATOM 9904  H HD11 . ILE B 2 23 ? 98.204  -2.037  -14.595 1.00 0.00 ? 23 ILE B HD11 7  
ATOM 9905  H HD12 . ILE B 2 23 ? 98.230  -3.278  -15.844 1.00 0.00 ? 23 ILE B HD12 7  
ATOM 9906  H HD13 . ILE B 2 23 ? 96.748  -2.382  -15.527 1.00 0.00 ? 23 ILE B HD13 7  
ATOM 9907  N N    . ALA B 2 24 ? 102.332 0.112   -16.137 1.00 0.00 ? 24 ALA B N    7  
ATOM 9908  C CA   . ALA B 2 24 ? 103.713 0.488   -16.414 1.00 0.00 ? 24 ALA B CA   7  
ATOM 9909  C C    . ALA B 2 24 ? 104.624 -0.050  -15.317 1.00 0.00 ? 24 ALA B C    7  
ATOM 9910  O O    . ALA B 2 24 ? 105.645 -0.686  -15.591 1.00 0.00 ? 24 ALA B O    7  
ATOM 9911  C CB   . ALA B 2 24 ? 103.838 2.011   -16.487 1.00 0.00 ? 24 ALA B CB   7  
ATOM 9912  H H    . ALA B 2 24 ? 101.633 0.800   -16.140 1.00 0.00 ? 24 ALA B H    7  
ATOM 9913  H HA   . ALA B 2 24 ? 104.011 0.064   -17.361 1.00 0.00 ? 24 ALA B HA   7  
ATOM 9914  H HB1  . ALA B 2 24 ? 104.831 2.275   -16.819 1.00 0.00 ? 24 ALA B HB1  7  
ATOM 9915  H HB2  . ALA B 2 24 ? 103.660 2.434   -15.510 1.00 0.00 ? 24 ALA B HB2  7  
ATOM 9916  H HB3  . ALA B 2 24 ? 103.111 2.398   -17.186 1.00 0.00 ? 24 ALA B HB3  7  
ATOM 9917  N N    . LEU B 2 25 ? 104.239 0.195   -14.069 1.00 0.00 ? 25 LEU B N    7  
ATOM 9918  C CA   . LEU B 2 25 ? 105.021 -0.286  -12.941 1.00 0.00 ? 25 LEU B CA   7  
ATOM 9919  C C    . LEU B 2 25 ? 105.196 -1.795  -13.052 1.00 0.00 ? 25 LEU B C    7  
ATOM 9920  O O    . LEU B 2 25 ? 106.249 -2.337  -12.717 1.00 0.00 ? 25 LEU B O    7  
ATOM 9921  C CB   . LEU B 2 25 ? 104.315 0.069   -11.627 1.00 0.00 ? 25 LEU B CB   7  
ATOM 9922  C CG   . LEU B 2 25 ? 105.151 -0.396  -10.424 1.00 0.00 ? 25 LEU B CG   7  
ATOM 9923  C CD1  . LEU B 2 25 ? 106.506 0.334   -10.400 1.00 0.00 ? 25 LEU B CD1  7  
ATOM 9924  C CD2  . LEU B 2 25 ? 104.376 -0.088  -9.136  1.00 0.00 ? 25 LEU B CD2  7  
ATOM 9925  H H    . LEU B 2 25 ? 103.412 0.698   -13.907 1.00 0.00 ? 25 LEU B H    7  
ATOM 9926  H HA   . LEU B 2 25 ? 105.990 0.187   -12.963 1.00 0.00 ? 25 LEU B HA   7  
ATOM 9927  H HB2  . LEU B 2 25 ? 104.179 1.139   -11.573 1.00 0.00 ? 25 LEU B HB2  7  
ATOM 9928  H HB3  . LEU B 2 25 ? 103.351 -0.415  -11.597 1.00 0.00 ? 25 LEU B HB3  7  
ATOM 9929  H HG   . LEU B 2 25 ? 105.321 -1.460  -10.492 1.00 0.00 ? 25 LEU B HG   7  
ATOM 9930  H HD11 . LEU B 2 25 ? 107.206 -0.187  -11.035 1.00 0.00 ? 25 LEU B HD11 7  
ATOM 9931  H HD12 . LEU B 2 25 ? 106.893 0.354   -9.390  1.00 0.00 ? 25 LEU B HD12 7  
ATOM 9932  H HD13 . LEU B 2 25 ? 106.382 1.346   -10.756 1.00 0.00 ? 25 LEU B HD13 7  
ATOM 9933  H HD21 . LEU B 2 25 ? 103.539 -0.764  -9.051  1.00 0.00 ? 25 LEU B HD21 7  
ATOM 9934  H HD22 . LEU B 2 25 ? 104.017 0.930   -9.167  1.00 0.00 ? 25 LEU B HD22 7  
ATOM 9935  H HD23 . LEU B 2 25 ? 105.029 -0.214  -8.285  1.00 0.00 ? 25 LEU B HD23 7  
ATOM 9936  N N    . ALA B 2 26 ? 104.155 -2.468  -13.538 1.00 0.00 ? 26 ALA B N    7  
ATOM 9937  C CA   . ALA B 2 26 ? 104.204 -3.914  -13.702 1.00 0.00 ? 26 ALA B CA   7  
ATOM 9938  C C    . ALA B 2 26 ? 105.255 -4.291  -14.744 1.00 0.00 ? 26 ALA B C    7  
ATOM 9939  O O    . ALA B 2 26 ? 105.960 -5.288  -14.593 1.00 0.00 ? 26 ALA B O    7  
ATOM 9940  C CB   . ALA B 2 26 ? 102.830 -4.444  -14.128 1.00 0.00 ? 26 ALA B CB   7  
ATOM 9941  H H    . ALA B 2 26 ? 103.344 -1.980  -13.795 1.00 0.00 ? 26 ALA B H    7  
ATOM 9942  H HA   . ALA B 2 26 ? 104.474 -4.364  -12.757 1.00 0.00 ? 26 ALA B HA   7  
ATOM 9943  H HB1  . ALA B 2 26 ? 102.058 -3.902  -13.603 1.00 0.00 ? 26 ALA B HB1  7  
ATOM 9944  H HB2  . ALA B 2 26 ? 102.759 -5.495  -13.885 1.00 0.00 ? 26 ALA B HB2  7  
ATOM 9945  H HB3  . ALA B 2 26 ? 102.702 -4.312  -15.193 1.00 0.00 ? 26 ALA B HB3  7  
ATOM 9946  N N    . VAL B 2 27 ? 105.361 -3.481  -15.796 1.00 0.00 ? 27 VAL B N    7  
ATOM 9947  C CA   . VAL B 2 27 ? 106.339 -3.743  -16.845 1.00 0.00 ? 27 VAL B CA   7  
ATOM 9948  C C    . VAL B 2 27 ? 107.743 -3.722  -16.259 1.00 0.00 ? 27 VAL B C    7  
ATOM 9949  O O    . VAL B 2 27 ? 108.544 -4.624  -16.505 1.00 0.00 ? 27 VAL B O    7  
ATOM 9950  C CB   . VAL B 2 27 ? 106.234 -2.689  -17.951 1.00 0.00 ? 27 VAL B CB   7  
ATOM 9951  C CG1  . VAL B 2 27 ? 107.261 -2.994  -19.044 1.00 0.00 ? 27 VAL B CG1  7  
ATOM 9952  C CG2  . VAL B 2 27 ? 104.826 -2.710  -18.552 1.00 0.00 ? 27 VAL B CG2  7  
ATOM 9953  H H    . VAL B 2 27 ? 104.777 -2.696  -15.862 1.00 0.00 ? 27 VAL B H    7  
ATOM 9954  H HA   . VAL B 2 27 ? 106.148 -4.717  -17.269 1.00 0.00 ? 27 VAL B HA   7  
ATOM 9955  H HB   . VAL B 2 27 ? 106.435 -1.712  -17.537 1.00 0.00 ? 27 VAL B HB   7  
ATOM 9956  H HG11 . VAL B 2 27 ? 107.037 -2.408  -19.923 1.00 0.00 ? 27 VAL B HG11 7  
ATOM 9957  H HG12 . VAL B 2 27 ? 107.220 -4.045  -19.293 1.00 0.00 ? 27 VAL B HG12 7  
ATOM 9958  H HG13 . VAL B 2 27 ? 108.249 -2.748  -18.689 1.00 0.00 ? 27 VAL B HG13 7  
ATOM 9959  H HG21 . VAL B 2 27 ? 104.095 -2.773  -17.758 1.00 0.00 ? 27 VAL B HG21 7  
ATOM 9960  H HG22 . VAL B 2 27 ? 104.724 -3.566  -19.203 1.00 0.00 ? 27 VAL B HG22 7  
ATOM 9961  H HG23 . VAL B 2 27 ? 104.663 -1.806  -19.120 1.00 0.00 ? 27 VAL B HG23 7  
ATOM 9962  N N    . TYR B 2 28 ? 108.031 -2.690  -15.472 1.00 0.00 ? 28 TYR B N    7  
ATOM 9963  C CA   . TYR B 2 28 ? 109.342 -2.567  -14.845 1.00 0.00 ? 28 TYR B CA   7  
ATOM 9964  C C    . TYR B 2 28 ? 109.583 -3.742  -13.901 1.00 0.00 ? 28 TYR B C    7  
ATOM 9965  O O    . TYR B 2 28 ? 110.686 -4.284  -13.833 1.00 0.00 ? 28 TYR B O    7  
ATOM 9966  C CB   . TYR B 2 28 ? 109.432 -1.254  -14.064 1.00 0.00 ? 28 TYR B CB   7  
ATOM 9967  C CG   . TYR B 2 28 ? 110.859 -1.027  -13.627 1.00 0.00 ? 28 TYR B CG   7  
ATOM 9968  C CD1  . TYR B 2 28 ? 111.773 -0.431  -14.504 1.00 0.00 ? 28 TYR B CD1  7  
ATOM 9969  C CD2  . TYR B 2 28 ? 111.269 -1.412  -12.344 1.00 0.00 ? 28 TYR B CD2  7  
ATOM 9970  C CE1  . TYR B 2 28 ? 113.097 -0.221  -14.099 1.00 0.00 ? 28 TYR B CE1  7  
ATOM 9971  C CE2  . TYR B 2 28 ? 112.592 -1.200  -11.939 1.00 0.00 ? 28 TYR B CE2  7  
ATOM 9972  C CZ   . TYR B 2 28 ? 113.506 -0.605  -12.817 1.00 0.00 ? 28 TYR B CZ   7  
ATOM 9973  O OH   . TYR B 2 28 ? 114.810 -0.398  -12.418 1.00 0.00 ? 28 TYR B OH   7  
ATOM 9974  H H    . TYR B 2 28 ? 107.348 -2.002  -15.306 1.00 0.00 ? 28 TYR B H    7  
ATOM 9975  H HA   . TYR B 2 28 ? 110.101 -2.571  -15.612 1.00 0.00 ? 28 TYR B HA   7  
ATOM 9976  H HB2  . TYR B 2 28 ? 109.113 -0.438  -14.695 1.00 0.00 ? 28 TYR B HB2  7  
ATOM 9977  H HB3  . TYR B 2 28 ? 108.793 -1.309  -13.195 1.00 0.00 ? 28 TYR B HB3  7  
ATOM 9978  H HD1  . TYR B 2 28 ? 111.457 -0.135  -15.493 1.00 0.00 ? 28 TYR B HD1  7  
ATOM 9979  H HD2  . TYR B 2 28 ? 110.563 -1.871  -11.666 1.00 0.00 ? 28 TYR B HD2  7  
ATOM 9980  H HE1  . TYR B 2 28 ? 113.802 0.238   -14.776 1.00 0.00 ? 28 TYR B HE1  7  
ATOM 9981  H HE2  . TYR B 2 28 ? 112.909 -1.497  -10.950 1.00 0.00 ? 28 TYR B HE2  7  
ATOM 9982  H HH   . TYR B 2 28 ? 115.345 -1.116  -12.762 1.00 0.00 ? 28 TYR B HH   7  
ATOM 9983  N N    . PHE B 2 29 ? 108.537 -4.128  -13.177 1.00 0.00 ? 29 PHE B N    7  
ATOM 9984  C CA   . PHE B 2 29 ? 108.628 -5.240  -12.238 1.00 0.00 ? 29 PHE B CA   7  
ATOM 9985  C C    . PHE B 2 29 ? 109.038 -6.521  -12.962 1.00 0.00 ? 29 PHE B C    7  
ATOM 9986  O O    . PHE B 2 29 ? 109.885 -7.274  -12.479 1.00 0.00 ? 29 PHE B O    7  
ATOM 9987  C CB   . PHE B 2 29 ? 107.271 -5.436  -11.551 1.00 0.00 ? 29 PHE B CB   7  
ATOM 9988  C CG   . PHE B 2 29 ? 107.283 -6.703  -10.720 1.00 0.00 ? 29 PHE B CG   7  
ATOM 9989  C CD1  . PHE B 2 29 ? 108.196 -6.841  -9.666  1.00 0.00 ? 29 PHE B CD1  7  
ATOM 9990  C CD2  . PHE B 2 29 ? 106.379 -7.738  -10.999 1.00 0.00 ? 29 PHE B CD2  7  
ATOM 9991  C CE1  . PHE B 2 29 ? 108.206 -8.011  -8.897  1.00 0.00 ? 29 PHE B CE1  7  
ATOM 9992  C CE2  . PHE B 2 29 ? 106.389 -8.906  -10.230 1.00 0.00 ? 29 PHE B CE2  7  
ATOM 9993  C CZ   . PHE B 2 29 ? 107.304 -9.043  -9.178  1.00 0.00 ? 29 PHE B CZ   7  
ATOM 9994  H H    . PHE B 2 29 ? 107.684 -3.657  -13.278 1.00 0.00 ? 29 PHE B H    7  
ATOM 9995  H HA   . PHE B 2 29 ? 109.369 -5.007  -11.489 1.00 0.00 ? 29 PHE B HA   7  
ATOM 9996  H HB2  . PHE B 2 29 ? 107.072 -4.588  -10.911 1.00 0.00 ? 29 PHE B HB2  7  
ATOM 9997  H HB3  . PHE B 2 29 ? 106.498 -5.504  -12.302 1.00 0.00 ? 29 PHE B HB3  7  
ATOM 9998  H HD1  . PHE B 2 29 ? 108.893 -6.045  -9.447  1.00 0.00 ? 29 PHE B HD1  7  
ATOM 9999  H HD2  . PHE B 2 29 ? 105.673 -7.634  -11.811 1.00 0.00 ? 29 PHE B HD2  7  
ATOM 10000 H HE1  . PHE B 2 29 ? 108.911 -8.116  -8.086  1.00 0.00 ? 29 PHE B HE1  7  
ATOM 10001 H HE2  . PHE B 2 29 ? 105.692 -9.702  -10.447 1.00 0.00 ? 29 PHE B HE2  7  
ATOM 10002 H HZ   . PHE B 2 29 ? 107.311 -9.944  -8.583  1.00 0.00 ? 29 PHE B HZ   7  
ATOM 10003 N N    . LEU B 2 30 ? 108.431 -6.762  -14.119 1.00 0.00 ? 30 LEU B N    7  
ATOM 10004 C CA   . LEU B 2 30 ? 108.740 -7.955  -14.899 1.00 0.00 ? 30 LEU B CA   7  
ATOM 10005 C C    . LEU B 2 30 ? 110.218 -7.976  -15.279 1.00 0.00 ? 30 LEU B C    7  
ATOM 10006 O O    . LEU B 2 30 ? 110.875 -9.014  -15.197 1.00 0.00 ? 30 LEU B O    7  
ATOM 10007 C CB   . LEU B 2 30 ? 107.871 -7.983  -16.163 1.00 0.00 ? 30 LEU B CB   7  
ATOM 10008 C CG   . LEU B 2 30 ? 108.280 -9.147  -17.079 1.00 0.00 ? 30 LEU B CG   7  
ATOM 10009 C CD1  . LEU B 2 30 ? 108.262 -10.469 -16.299 1.00 0.00 ? 30 LEU B CD1  7  
ATOM 10010 C CD2  . LEU B 2 30 ? 107.292 -9.231  -18.247 1.00 0.00 ? 30 LEU B CD2  7  
ATOM 10011 H H    . LEU B 2 30 ? 107.764 -6.128  -14.454 1.00 0.00 ? 30 LEU B H    7  
ATOM 10012 H HA   . LEU B 2 30 ? 108.517 -8.827  -14.302 1.00 0.00 ? 30 LEU B HA   7  
ATOM 10013 H HB2  . LEU B 2 30 ? 106.835 -8.101  -15.881 1.00 0.00 ? 30 LEU B HB2  7  
ATOM 10014 H HB3  . LEU B 2 30 ? 107.991 -7.053  -16.697 1.00 0.00 ? 30 LEU B HB3  7  
ATOM 10015 H HG   . LEU B 2 30 ? 109.274 -8.972  -17.465 1.00 0.00 ? 30 LEU B HG   7  
ATOM 10016 H HD11 . LEU B 2 30 ? 107.407 -10.488 -15.638 1.00 0.00 ? 30 LEU B HD11 7  
ATOM 10017 H HD12 . LEU B 2 30 ? 109.167 -10.556 -15.717 1.00 0.00 ? 30 LEU B HD12 7  
ATOM 10018 H HD13 . LEU B 2 30 ? 108.201 -11.298 -16.990 1.00 0.00 ? 30 LEU B HD13 7  
ATOM 10019 H HD21 . LEU B 2 30 ? 107.193 -8.259  -18.706 1.00 0.00 ? 30 LEU B HD21 7  
ATOM 10020 H HD22 . LEU B 2 30 ? 106.329 -9.557  -17.882 1.00 0.00 ? 30 LEU B HD22 7  
ATOM 10021 H HD23 . LEU B 2 30 ? 107.658 -9.938  -18.978 1.00 0.00 ? 30 LEU B HD23 7  
ATOM 10022 N N    . GLY B 2 31 ? 110.734 -6.825  -15.695 1.00 0.00 ? 31 GLY B N    7  
ATOM 10023 C CA   . GLY B 2 31 ? 112.135 -6.724  -16.085 1.00 0.00 ? 31 GLY B CA   7  
ATOM 10024 C C    . GLY B 2 31 ? 112.367 -7.361  -17.450 1.00 0.00 ? 31 GLY B C    7  
ATOM 10025 O O    . GLY B 2 31 ? 111.765 -8.382  -17.779 1.00 0.00 ? 31 GLY B O    7  
ATOM 10026 H H    . GLY B 2 31 ? 110.162 -6.030  -15.740 1.00 0.00 ? 31 GLY B H    7  
ATOM 10027 H HA2  . GLY B 2 31 ? 112.417 -5.681  -16.127 1.00 0.00 ? 31 GLY B HA2  7  
ATOM 10028 H HA3  . GLY B 2 31 ? 112.746 -7.228  -15.352 1.00 0.00 ? 31 GLY B HA3  7  
ATOM 10029 N N    . ARG B 2 32 ? 113.243 -6.752  -18.242 1.00 0.00 ? 32 ARG B N    7  
ATOM 10030 C CA   . ARG B 2 32 ? 113.545 -7.269  -19.572 1.00 0.00 ? 32 ARG B CA   7  
ATOM 10031 C C    . ARG B 2 32 ? 114.367 -8.551  -19.474 1.00 0.00 ? 32 ARG B C    7  
ATOM 10032 O O    . ARG B 2 32 ? 115.105 -8.754  -18.510 1.00 0.00 ? 32 ARG B O    7  
ATOM 10033 C CB   . ARG B 2 32 ? 114.319 -6.224  -20.377 1.00 0.00 ? 32 ARG B CB   7  
ATOM 10034 C CG   . ARG B 2 32 ? 114.388 -6.657  -21.843 1.00 0.00 ? 32 ARG B CG   7  
ATOM 10035 C CD   . ARG B 2 32 ? 115.322 -5.721  -22.613 1.00 0.00 ? 32 ARG B CD   7  
ATOM 10036 N NE   . ARG B 2 32 ? 114.713 -4.400  -22.757 1.00 0.00 ? 32 ARG B NE   7  
ATOM 10037 C CZ   . ARG B 2 32 ? 114.878 -3.451  -21.836 1.00 0.00 ? 32 ARG B CZ   7  
ATOM 10038 N NH1  . ARG B 2 32 ? 115.589 -3.692  -20.768 1.00 0.00 ? 32 ARG B NH1  7  
ATOM 10039 N NH2  . ARG B 2 32 ? 114.326 -2.281  -22.002 1.00 0.00 ? 32 ARG B NH2  7  
ATOM 10040 H H    . ARG B 2 32 ? 113.693 -5.939  -17.928 1.00 0.00 ? 32 ARG B H    7  
ATOM 10041 H HA   . ARG B 2 32 ? 112.618 -7.485  -20.082 1.00 0.00 ? 32 ARG B HA   7  
ATOM 10042 H HB2  . ARG B 2 32 ? 113.815 -5.271  -20.304 1.00 0.00 ? 32 ARG B HB2  7  
ATOM 10043 H HB3  . ARG B 2 32 ? 115.320 -6.134  -19.983 1.00 0.00 ? 32 ARG B HB3  7  
ATOM 10044 H HG2  . ARG B 2 32 ? 114.762 -7.668  -21.901 1.00 0.00 ? 32 ARG B HG2  7  
ATOM 10045 H HG3  . ARG B 2 32 ? 113.401 -6.613  -22.278 1.00 0.00 ? 32 ARG B HG3  7  
ATOM 10046 H HD2  . ARG B 2 32 ? 116.257 -5.631  -22.081 1.00 0.00 ? 32 ARG B HD2  7  
ATOM 10047 H HD3  . ARG B 2 32 ? 115.512 -6.137  -23.592 1.00 0.00 ? 32 ARG B HD3  7  
ATOM 10048 H HE   . ARG B 2 32 ? 114.173 -4.207  -23.552 1.00 0.00 ? 32 ARG B HE   7  
ATOM 10049 H HH11 . ARG B 2 32 ? 116.011 -4.588  -20.638 1.00 0.00 ? 32 ARG B HH11 7  
ATOM 10050 H HH12 . ARG B 2 32 ? 115.712 -2.977  -20.079 1.00 0.00 ? 32 ARG B HH12 7  
ATOM 10051 H HH21 . ARG B 2 32 ? 113.779 -2.097  -22.819 1.00 0.00 ? 32 ARG B HH21 7  
ATOM 10052 H HH22 . ARG B 2 32 ? 114.449 -1.568  -21.311 1.00 0.00 ? 32 ARG B HH22 7  
ATOM 10053 N N    . CYS A 1 1  ? 73.591  22.099  -17.674 1.00 0.00 ? 1  CYS A N    8  
ATOM 10054 C CA   . CYS A 1 1  ? 73.151  20.678  -17.570 1.00 0.00 ? 1  CYS A CA   8  
ATOM 10055 C C    . CYS A 1 1  ? 73.864  19.849  -18.632 1.00 0.00 ? 1  CYS A C    8  
ATOM 10056 O O    . CYS A 1 1  ? 75.018  19.456  -18.458 1.00 0.00 ? 1  CYS A O    8  
ATOM 10057 C CB   . CYS A 1 1  ? 71.638  20.600  -17.775 1.00 0.00 ? 1  CYS A CB   8  
ATOM 10058 S SG   . CYS A 1 1  ? 71.130  18.864  -17.857 1.00 0.00 ? 1  CYS A SG   8  
ATOM 10059 H HA   . CYS A 1 1  ? 73.401  20.297  -16.591 1.00 0.00 ? 1  CYS A HA   8  
ATOM 10060 H HB2  . CYS A 1 1  ? 71.137  21.082  -16.949 1.00 0.00 ? 1  CYS A HB2  8  
ATOM 10061 H HB3  . CYS A 1 1  ? 71.373  21.097  -18.697 1.00 0.00 ? 1  CYS A HB3  8  
ATOM 10062 N N    . SER A 1 2  ? 73.169  19.586  -19.735 1.00 0.00 ? 2  SER A N    8  
ATOM 10063 C CA   . SER A 1 2  ? 73.746  18.801  -20.820 1.00 0.00 ? 2  SER A CA   8  
ATOM 10064 C C    . SER A 1 2  ? 74.319  17.491  -20.289 1.00 0.00 ? 2  SER A C    8  
ATOM 10065 O O    . SER A 1 2  ? 75.491  17.181  -20.506 1.00 0.00 ? 2  SER A O    8  
ATOM 10066 C CB   . SER A 1 2  ? 74.850  19.600  -21.512 1.00 0.00 ? 2  SER A CB   8  
ATOM 10067 O OG   . SER A 1 2  ? 74.314  20.829  -21.985 1.00 0.00 ? 2  SER A OG   8  
ATOM 10068 H H    . SER A 1 2  ? 72.254  19.924  -19.819 1.00 0.00 ? 2  SER A H    8  
ATOM 10069 H HA   . SER A 1 2  ? 72.973  18.579  -21.541 1.00 0.00 ? 2  SER A HA   8  
ATOM 10070 H HB2  . SER A 1 2  ? 75.641  19.806  -20.811 1.00 0.00 ? 2  SER A HB2  8  
ATOM 10071 H HB3  . SER A 1 2  ? 75.245  19.026  -22.339 1.00 0.00 ? 2  SER A HB3  8  
ATOM 10072 H HG   . SER A 1 2  ? 74.826  21.544  -21.602 1.00 0.00 ? 2  SER A HG   8  
ATOM 10073 N N    . THR A 1 3  ? 73.485  16.724  -19.594 1.00 0.00 ? 3  THR A N    8  
ATOM 10074 C CA   . THR A 1 3  ? 73.918  15.448  -19.035 1.00 0.00 ? 3  THR A CA   8  
ATOM 10075 C C    . THR A 1 3  ? 74.214  14.450  -20.151 1.00 0.00 ? 3  THR A C    8  
ATOM 10076 O O    . THR A 1 3  ? 73.552  14.455  -21.188 1.00 0.00 ? 3  THR A O    8  
ATOM 10077 C CB   . THR A 1 3  ? 72.833  14.886  -18.115 1.00 0.00 ? 3  THR A CB   8  
ATOM 10078 O OG1  . THR A 1 3  ? 73.105  13.517  -17.849 1.00 0.00 ? 3  THR A OG1  8  
ATOM 10079 C CG2  . THR A 1 3  ? 71.469  15.017  -18.792 1.00 0.00 ? 3  THR A CG2  8  
ATOM 10080 H H    . THR A 1 3  ? 72.561  17.022  -19.453 1.00 0.00 ? 3  THR A H    8  
ATOM 10081 H HA   . THR A 1 3  ? 74.817  15.606  -18.459 1.00 0.00 ? 3  THR A HA   8  
ATOM 10082 H HB   . THR A 1 3  ? 72.825  15.438  -17.189 1.00 0.00 ? 3  THR A HB   8  
ATOM 10083 H HG1  . THR A 1 3  ? 73.275  13.425  -16.908 1.00 0.00 ? 3  THR A HG1  8  
ATOM 10084 H HG21 . THR A 1 3  ? 71.538  14.671  -19.813 1.00 0.00 ? 3  THR A HG21 8  
ATOM 10085 H HG22 . THR A 1 3  ? 71.159  16.052  -18.783 1.00 0.00 ? 3  THR A HG22 8  
ATOM 10086 H HG23 . THR A 1 3  ? 70.743  14.419  -18.259 1.00 0.00 ? 3  THR A HG23 8  
ATOM 10087 N N    . VAL A 1 4  ? 75.214  13.596  -19.921 1.00 0.00 ? 4  VAL A N    8  
ATOM 10088 C CA   . VAL A 1 4  ? 75.615  12.577  -20.902 1.00 0.00 ? 4  VAL A CA   8  
ATOM 10089 C C    . VAL A 1 4  ? 75.400  13.061  -22.333 1.00 0.00 ? 4  VAL A C    8  
ATOM 10090 O O    . VAL A 1 4  ? 75.073  12.277  -23.224 1.00 0.00 ? 4  VAL A O    8  
ATOM 10091 C CB   . VAL A 1 4  ? 74.827  11.286  -20.667 1.00 0.00 ? 4  VAL A CB   8  
ATOM 10092 C CG1  . VAL A 1 4  ? 75.222  10.691  -19.313 1.00 0.00 ? 4  VAL A CG1  8  
ATOM 10093 C CG2  . VAL A 1 4  ? 73.326  11.587  -20.671 1.00 0.00 ? 4  VAL A CG2  8  
ATOM 10094 H H    . VAL A 1 4  ? 75.695  13.649  -19.068 1.00 0.00 ? 4  VAL A H    8  
ATOM 10095 H HA   . VAL A 1 4  ? 76.667  12.365  -20.774 1.00 0.00 ? 4  VAL A HA   8  
ATOM 10096 H HB   . VAL A 1 4  ? 75.057  10.577  -21.450 1.00 0.00 ? 4  VAL A HB   8  
ATOM 10097 H HG11 . VAL A 1 4  ? 74.506  9.934   -19.029 1.00 0.00 ? 4  VAL A HG11 8  
ATOM 10098 H HG12 . VAL A 1 4  ? 75.237  11.472  -18.567 1.00 0.00 ? 4  VAL A HG12 8  
ATOM 10099 H HG13 . VAL A 1 4  ? 76.205  10.247  -19.388 1.00 0.00 ? 4  VAL A HG13 8  
ATOM 10100 H HG21 . VAL A 1 4  ? 73.077  12.174  -21.542 1.00 0.00 ? 4  VAL A HG21 8  
ATOM 10101 H HG22 . VAL A 1 4  ? 73.067  12.138  -19.779 1.00 0.00 ? 4  VAL A HG22 8  
ATOM 10102 H HG23 . VAL A 1 4  ? 72.774  10.660  -20.693 1.00 0.00 ? 4  VAL A HG23 8  
ATOM 10103 N N    . SER A 1 5  ? 75.601  14.358  -22.542 1.00 0.00 ? 5  SER A N    8  
ATOM 10104 C CA   . SER A 1 5  ? 75.444  14.950  -23.867 1.00 0.00 ? 5  SER A CA   8  
ATOM 10105 C C    . SER A 1 5  ? 76.739  14.807  -24.674 1.00 0.00 ? 5  SER A C    8  
ATOM 10106 O O    . SER A 1 5  ? 76.698  14.514  -25.869 1.00 0.00 ? 5  SER A O    8  
ATOM 10107 C CB   . SER A 1 5  ? 75.041  16.429  -23.741 1.00 0.00 ? 5  SER A CB   8  
ATOM 10108 O OG   . SER A 1 5  ? 74.052  16.726  -24.718 1.00 0.00 ? 5  SER A OG   8  
ATOM 10109 H H    . SER A 1 5  ? 75.872  14.926  -21.790 1.00 0.00 ? 5  SER A H    8  
ATOM 10110 H HA   . SER A 1 5  ? 74.655  14.427  -24.391 1.00 0.00 ? 5  SER A HA   8  
ATOM 10111 H HB2  . SER A 1 5  ? 74.631  16.607  -22.761 1.00 0.00 ? 5  SER A HB2  8  
ATOM 10112 H HB3  . SER A 1 5  ? 75.905  17.068  -23.885 1.00 0.00 ? 5  SER A HB3  8  
ATOM 10113 H HG   . SER A 1 5  ? 73.214  16.846  -24.265 1.00 0.00 ? 5  SER A HG   8  
ATOM 10114 N N    . PRO A 1 6  ? 77.878  15.004  -24.053 1.00 0.00 ? 6  PRO A N    8  
ATOM 10115 C CA   . PRO A 1 6  ? 79.202  14.888  -24.738 1.00 0.00 ? 6  PRO A CA   8  
ATOM 10116 C C    . PRO A 1 6  ? 79.327  13.621  -25.567 1.00 0.00 ? 6  PRO A C    8  
ATOM 10117 O O    . PRO A 1 6  ? 79.831  13.664  -26.688 1.00 0.00 ? 6  PRO A O    8  
ATOM 10118 C CB   . PRO A 1 6  ? 80.197  14.918  -23.575 1.00 0.00 ? 6  PRO A CB   8  
ATOM 10119 C CG   . PRO A 1 6  ? 79.518  15.772  -22.562 1.00 0.00 ? 6  PRO A CG   8  
ATOM 10120 C CD   . PRO A 1 6  ? 78.052  15.363  -22.629 1.00 0.00 ? 6  PRO A CD   8  
ATOM 10121 H HA   . PRO A 1 6  ? 79.377  15.737  -25.363 1.00 0.00 ? 6  PRO A HA   8  
ATOM 10122 H HB2  . PRO A 1 6  ? 80.359  13.919  -23.189 1.00 0.00 ? 6  PRO A HB2  8  
ATOM 10123 H HB3  . PRO A 1 6  ? 81.131  15.367  -23.877 1.00 0.00 ? 6  PRO A HB3  8  
ATOM 10124 H HG2  . PRO A 1 6  ? 79.922  15.591  -21.580 1.00 0.00 ? 6  PRO A HG2  8  
ATOM 10125 H HG3  . PRO A 1 6  ? 79.617  16.814  -22.824 1.00 0.00 ? 6  PRO A HG3  8  
ATOM 10126 H HD2  . PRO A 1 6  ? 77.877  14.509  -21.989 1.00 0.00 ? 6  PRO A HD2  8  
ATOM 10127 H HD3  . PRO A 1 6  ? 77.410  16.186  -22.363 1.00 0.00 ? 6  PRO A HD3  8  
ATOM 10128 N N    . GLY A 1 7  ? 78.874  12.496  -25.027 1.00 0.00 ? 7  GLY A N    8  
ATOM 10129 C CA   . GLY A 1 7  ? 78.975  11.238  -25.770 1.00 0.00 ? 7  GLY A CA   8  
ATOM 10130 C C    . GLY A 1 7  ? 80.437  10.823  -25.849 1.00 0.00 ? 7  GLY A C    8  
ATOM 10131 O O    . GLY A 1 7  ? 80.806  9.708   -25.472 1.00 0.00 ? 7  GLY A O    8  
ATOM 10132 H H    . GLY A 1 7  ? 78.475  12.512  -24.122 1.00 0.00 ? 7  GLY A H    8  
ATOM 10133 H HA2  . GLY A 1 7  ? 78.404  10.462  -25.273 1.00 0.00 ? 7  GLY A HA2  8  
ATOM 10134 H HA3  . GLY A 1 7  ? 78.593  11.379  -26.770 1.00 0.00 ? 7  GLY A HA3  8  
ATOM 10135 N N    . VAL A 1 8  ? 81.283  11.747  -26.306 1.00 0.00 ? 8  VAL A N    8  
ATOM 10136 C CA   . VAL A 1 8  ? 82.706  11.475  -26.382 1.00 0.00 ? 8  VAL A CA   8  
ATOM 10137 C C    . VAL A 1 8  ? 83.149  10.944  -25.033 1.00 0.00 ? 8  VAL A C    8  
ATOM 10138 O O    . VAL A 1 8  ? 83.983  10.037  -24.944 1.00 0.00 ? 8  VAL A O    8  
ATOM 10139 C CB   . VAL A 1 8  ? 83.477  12.752  -26.731 1.00 0.00 ? 8  VAL A CB   8  
ATOM 10140 C CG1  . VAL A 1 8  ? 84.981  12.502  -26.594 1.00 0.00 ? 8  VAL A CG1  8  
ATOM 10141 C CG2  . VAL A 1 8  ? 83.160  13.150  -28.172 1.00 0.00 ? 8  VAL A CG2  8  
ATOM 10142 H H    . VAL A 1 8  ? 80.947  12.624  -26.566 1.00 0.00 ? 8  VAL A H    8  
ATOM 10143 H HA   . VAL A 1 8  ? 82.888  10.726  -27.138 1.00 0.00 ? 8  VAL A HA   8  
ATOM 10144 H HB   . VAL A 1 8  ? 83.181  13.546  -26.061 1.00 0.00 ? 8  VAL A HB   8  
ATOM 10145 H HG11 . VAL A 1 8  ? 85.238  11.575  -27.085 1.00 0.00 ? 8  VAL A HG11 8  
ATOM 10146 H HG12 . VAL A 1 8  ? 85.241  12.439  -25.548 1.00 0.00 ? 8  VAL A HG12 8  
ATOM 10147 H HG13 . VAL A 1 8  ? 85.523  13.314  -27.053 1.00 0.00 ? 8  VAL A HG13 8  
ATOM 10148 H HG21 . VAL A 1 8  ? 83.316  12.301  -28.822 1.00 0.00 ? 8  VAL A HG21 8  
ATOM 10149 H HG22 . VAL A 1 8  ? 83.810  13.959  -28.474 1.00 0.00 ? 8  VAL A HG22 8  
ATOM 10150 H HG23 . VAL A 1 8  ? 82.132  13.471  -28.239 1.00 0.00 ? 8  VAL A HG23 8  
ATOM 10151 N N    . LEU A 1 9  ? 82.546  11.485  -23.974 1.00 0.00 ? 9  LEU A N    8  
ATOM 10152 C CA   . LEU A 1 9  ? 82.876  10.999  -22.645 1.00 0.00 ? 9  LEU A CA   8  
ATOM 10153 C C    . LEU A 1 9  ? 82.641  9.485   -22.627 1.00 0.00 ? 9  LEU A C    8  
ATOM 10154 O O    . LEU A 1 9  ? 83.449  8.712   -22.102 1.00 0.00 ? 9  LEU A O    8  
ATOM 10155 C CB   . LEU A 1 9  ? 82.027  11.691  -21.572 1.00 0.00 ? 9  LEU A CB   8  
ATOM 10156 C CG   . LEU A 1 9  ? 82.589  13.097  -21.272 1.00 0.00 ? 9  LEU A CG   8  
ATOM 10157 C CD1  . LEU A 1 9  ? 81.628  13.838  -20.332 1.00 0.00 ? 9  LEU A CD1  8  
ATOM 10158 C CD2  . LEU A 1 9  ? 83.985  12.999  -20.608 1.00 0.00 ? 9  LEU A CD2  8  
ATOM 10159 H H    . LEU A 1 9  ? 81.857  12.191  -24.096 1.00 0.00 ? 9  LEU A H    8  
ATOM 10160 H HA   . LEU A 1 9  ? 83.914  11.199  -22.457 1.00 0.00 ? 9  LEU A HA   8  
ATOM 10161 H HB2  . LEU A 1 9  ? 81.010  11.777  -21.925 1.00 0.00 ? 9  LEU A HB2  8  
ATOM 10162 H HB3  . LEU A 1 9  ? 82.043  11.100  -20.670 1.00 0.00 ? 9  LEU A HB3  8  
ATOM 10163 H HG   . LEU A 1 9  ? 82.671  13.649  -22.197 1.00 0.00 ? 9  LEU A HG   8  
ATOM 10164 H HD11 . LEU A 1 9  ? 80.610  13.634  -20.620 1.00 0.00 ? 9  LEU A HD11 8  
ATOM 10165 H HD12 . LEU A 1 9  ? 81.814  14.899  -20.393 1.00 0.00 ? 9  LEU A HD12 8  
ATOM 10166 H HD13 . LEU A 1 9  ? 81.787  13.506  -19.316 1.00 0.00 ? 9  LEU A HD13 8  
ATOM 10167 H HD21 . LEU A 1 9  ? 84.749  13.043  -21.372 1.00 0.00 ? 9  LEU A HD21 8  
ATOM 10168 H HD22 . LEU A 1 9  ? 84.074  12.068  -20.067 1.00 0.00 ? 9  LEU A HD22 8  
ATOM 10169 H HD23 . LEU A 1 9  ? 84.128  13.823  -19.921 1.00 0.00 ? 9  LEU A HD23 8  
ATOM 10170 N N    . ALA A 1 10 ? 81.546  9.057   -23.261 1.00 0.00 ? 10 ALA A N    8  
ATOM 10171 C CA   . ALA A 1 10 ? 81.255  7.635   -23.354 1.00 0.00 ? 10 ALA A CA   8  
ATOM 10172 C C    . ALA A 1 10 ? 82.451  6.954   -23.999 1.00 0.00 ? 10 ALA A C    8  
ATOM 10173 O O    . ALA A 1 10 ? 82.864  5.863   -23.597 1.00 0.00 ? 10 ALA A O    8  
ATOM 10174 C CB   . ALA A 1 10 ? 79.993  7.399   -24.193 1.00 0.00 ? 10 ALA A CB   8  
ATOM 10175 H H    . ALA A 1 10 ? 80.955  9.701   -23.701 1.00 0.00 ? 10 ALA A H    8  
ATOM 10176 H HA   . ALA A 1 10 ? 81.105  7.233   -22.363 1.00 0.00 ? 10 ALA A HA   8  
ATOM 10177 H HB1  . ALA A 1 10 ? 79.584  6.426   -23.961 1.00 0.00 ? 10 ALA A HB1  8  
ATOM 10178 H HB2  . ALA A 1 10 ? 80.239  7.443   -25.244 1.00 0.00 ? 10 ALA A HB2  8  
ATOM 10179 H HB3  . ALA A 1 10 ? 79.262  8.159   -23.964 1.00 0.00 ? 10 ALA A HB3  8  
ATOM 10180 N N    . GLY A 1 11 ? 83.020  7.636   -24.989 1.00 0.00 ? 11 GLY A N    8  
ATOM 10181 C CA   . GLY A 1 11 ? 84.197  7.124   -25.677 1.00 0.00 ? 11 GLY A CA   8  
ATOM 10182 C C    . GLY A 1 11 ? 85.340  6.963   -24.684 1.00 0.00 ? 11 GLY A C    8  
ATOM 10183 O O    . GLY A 1 11 ? 86.218  6.123   -24.858 1.00 0.00 ? 11 GLY A O    8  
ATOM 10184 H H    . GLY A 1 11 ? 82.651  8.513   -25.248 1.00 0.00 ? 11 GLY A H    8  
ATOM 10185 H HA2  . GLY A 1 11 ? 83.965  6.165   -26.120 1.00 0.00 ? 11 GLY A HA2  8  
ATOM 10186 H HA3  . GLY A 1 11 ? 84.492  7.816   -26.450 1.00 0.00 ? 11 GLY A HA3  8  
ATOM 10187 N N    . ILE A 1 12 ? 85.308  7.779   -23.632 1.00 0.00 ? 12 ILE A N    8  
ATOM 10188 C CA   . ILE A 1 12 ? 86.339  7.722   -22.593 1.00 0.00 ? 12 ILE A CA   8  
ATOM 10189 C C    . ILE A 1 12 ? 86.190  6.419   -21.819 1.00 0.00 ? 12 ILE A C    8  
ATOM 10190 O O    . ILE A 1 12 ? 87.176  5.802   -21.426 1.00 0.00 ? 12 ILE A O    8  
ATOM 10191 C CB   . ILE A 1 12 ? 86.234  8.981   -21.660 1.00 0.00 ? 12 ILE A CB   8  
ATOM 10192 C CG1  . ILE A 1 12 ? 87.619  9.644   -21.465 1.00 0.00 ? 12 ILE A CG1  8  
ATOM 10193 C CG2  . ILE A 1 12 ? 85.648  8.642   -20.261 1.00 0.00 ? 12 ILE A CG2  8  
ATOM 10194 C CD1  . ILE A 1 12 ? 87.438  11.110  -21.050 1.00 0.00 ? 12 ILE A CD1  8  
ATOM 10195 H H    . ILE A 1 12 ? 84.574  8.421   -23.555 1.00 0.00 ? 12 ILE A H    8  
ATOM 10196 H HA   . ILE A 1 12 ? 87.299  7.708   -23.082 1.00 0.00 ? 12 ILE A HA   8  
ATOM 10197 H HB   . ILE A 1 12 ? 85.581  9.691   -22.136 1.00 0.00 ? 12 ILE A HB   8  
ATOM 10198 H HG12 . ILE A 1 12 ? 88.168  9.119   -20.697 1.00 0.00 ? 12 ILE A HG12 8  
ATOM 10199 H HG13 . ILE A 1 12 ? 88.178  9.614   -22.388 1.00 0.00 ? 12 ILE A HG13 8  
ATOM 10200 H HG21 . ILE A 1 12 ? 86.396  8.142   -19.661 1.00 0.00 ? 12 ILE A HG21 8  
ATOM 10201 H HG22 . ILE A 1 12 ? 84.787  8.005   -20.361 1.00 0.00 ? 12 ILE A HG22 8  
ATOM 10202 H HG23 . ILE A 1 12 ? 85.349  9.554   -19.766 1.00 0.00 ? 12 ILE A HG23 8  
ATOM 10203 H HD11 . ILE A 1 12 ? 88.338  11.459  -20.566 1.00 0.00 ? 12 ILE A HD11 8  
ATOM 10204 H HD12 . ILE A 1 12 ? 86.603  11.196  -20.370 1.00 0.00 ? 12 ILE A HD12 8  
ATOM 10205 H HD13 . ILE A 1 12 ? 87.248  11.709  -21.927 1.00 0.00 ? 12 ILE A HD13 8  
ATOM 10206 N N    . VAL A 1 13 ? 84.946  6.010   -21.611 1.00 0.00 ? 13 VAL A N    8  
ATOM 10207 C CA   . VAL A 1 13 ? 84.677  4.771   -20.891 1.00 0.00 ? 13 VAL A CA   8  
ATOM 10208 C C    . VAL A 1 13 ? 85.190  3.575   -21.689 1.00 0.00 ? 13 VAL A C    8  
ATOM 10209 O O    . VAL A 1 13 ? 85.956  2.745   -21.180 1.00 0.00 ? 13 VAL A O    8  
ATOM 10210 C CB   . VAL A 1 13 ? 83.171  4.631   -20.652 1.00 0.00 ? 13 VAL A CB   8  
ATOM 10211 C CG1  . VAL A 1 13 ? 82.884  3.325   -19.909 1.00 0.00 ? 13 VAL A CG1  8  
ATOM 10212 C CG2  . VAL A 1 13 ? 82.680  5.812   -19.812 1.00 0.00 ? 13 VAL A CG2  8  
ATOM 10213 H H    . VAL A 1 13 ? 84.197  6.553   -21.948 1.00 0.00 ? 13 VAL A H    8  
ATOM 10214 H HA   . VAL A 1 13 ? 85.181  4.800   -19.941 1.00 0.00 ? 13 VAL A HA   8  
ATOM 10215 H HB   . VAL A 1 13 ? 82.657  4.624   -21.602 1.00 0.00 ? 13 VAL A HB   8  
ATOM 10216 H HG11 . VAL A 1 13 ? 81.837  3.286   -19.646 1.00 0.00 ? 13 VAL A HG11 8  
ATOM 10217 H HG12 . VAL A 1 13 ? 83.482  3.284   -19.013 1.00 0.00 ? 13 VAL A HG12 8  
ATOM 10218 H HG13 . VAL A 1 13 ? 83.126  2.486   -20.544 1.00 0.00 ? 13 VAL A HG13 8  
ATOM 10219 H HG21 . VAL A 1 13 ? 82.640  6.699   -20.426 1.00 0.00 ? 13 VAL A HG21 8  
ATOM 10220 H HG22 . VAL A 1 13 ? 83.359  5.977   -18.989 1.00 0.00 ? 13 VAL A HG22 8  
ATOM 10221 H HG23 . VAL A 1 13 ? 81.693  5.597   -19.427 1.00 0.00 ? 13 VAL A HG23 8  
ATOM 10222 N N    . VAL A 1 14 ? 84.774  3.500   -22.949 1.00 0.00 ? 14 VAL A N    8  
ATOM 10223 C CA   . VAL A 1 14 ? 85.203  2.410   -23.818 1.00 0.00 ? 14 VAL A CA   8  
ATOM 10224 C C    . VAL A 1 14 ? 86.721  2.413   -23.953 1.00 0.00 ? 14 VAL A C    8  
ATOM 10225 O O    . VAL A 1 14 ? 87.364  1.364   -23.910 1.00 0.00 ? 14 VAL A O    8  
ATOM 10226 C CB   . VAL A 1 14 ? 84.568  2.561   -25.200 1.00 0.00 ? 14 VAL A CB   8  
ATOM 10227 C CG1  . VAL A 1 14 ? 85.028  1.413   -26.100 1.00 0.00 ? 14 VAL A CG1  8  
ATOM 10228 C CG2  . VAL A 1 14 ? 83.044  2.528   -25.070 1.00 0.00 ? 14 VAL A CG2  8  
ATOM 10229 H H    . VAL A 1 14 ? 84.173  4.192   -23.301 1.00 0.00 ? 14 VAL A H    8  
ATOM 10230 H HA   . VAL A 1 14 ? 84.888  1.470   -23.388 1.00 0.00 ? 14 VAL A HA   8  
ATOM 10231 H HB   . VAL A 1 14 ? 84.874  3.503   -25.635 1.00 0.00 ? 14 VAL A HB   8  
ATOM 10232 H HG11 . VAL A 1 14 ? 86.073  1.540   -26.340 1.00 0.00 ? 14 VAL A HG11 8  
ATOM 10233 H HG12 . VAL A 1 14 ? 84.447  1.413   -27.010 1.00 0.00 ? 14 VAL A HG12 8  
ATOM 10234 H HG13 . VAL A 1 14 ? 84.889  0.474   -25.585 1.00 0.00 ? 14 VAL A HG13 8  
ATOM 10235 H HG21 . VAL A 1 14 ? 82.599  2.496   -26.054 1.00 0.00 ? 14 VAL A HG21 8  
ATOM 10236 H HG22 . VAL A 1 14 ? 82.707  3.414   -24.553 1.00 0.00 ? 14 VAL A HG22 8  
ATOM 10237 H HG23 . VAL A 1 14 ? 82.748  1.651   -24.514 1.00 0.00 ? 14 VAL A HG23 8  
ATOM 10238 N N    . GLY A 1 15 ? 87.283  3.604   -24.117 1.00 0.00 ? 15 GLY A N    8  
ATOM 10239 C CA   . GLY A 1 15 ? 88.724  3.755   -24.262 1.00 0.00 ? 15 GLY A CA   8  
ATOM 10240 C C    . GLY A 1 15 ? 89.453  3.375   -22.980 1.00 0.00 ? 15 GLY A C    8  
ATOM 10241 O O    . GLY A 1 15 ? 90.606  2.965   -23.020 1.00 0.00 ? 15 GLY A O    8  
ATOM 10242 H H    . GLY A 1 15 ? 86.714  4.401   -24.144 1.00 0.00 ? 15 GLY A H    8  
ATOM 10243 H HA2  . GLY A 1 15 ? 89.066  3.120   -25.067 1.00 0.00 ? 15 GLY A HA2  8  
ATOM 10244 H HA3  . GLY A 1 15 ? 88.949  4.783   -24.502 1.00 0.00 ? 15 GLY A HA3  8  
ATOM 10245 N N    . ASP A 1 16 ? 88.782  3.522   -21.842 1.00 0.00 ? 16 ASP A N    8  
ATOM 10246 C CA   . ASP A 1 16 ? 89.399  3.195   -20.559 1.00 0.00 ? 16 ASP A CA   8  
ATOM 10247 C C    . ASP A 1 16 ? 89.585  1.687   -20.425 1.00 0.00 ? 16 ASP A C    8  
ATOM 10248 O O    . ASP A 1 16 ? 90.695  1.207   -20.170 1.00 0.00 ? 16 ASP A O    8  
ATOM 10249 C CB   . ASP A 1 16 ? 88.524  3.707   -19.412 1.00 0.00 ? 16 ASP A CB   8  
ATOM 10250 C CG   . ASP A 1 16 ? 89.100  3.256   -18.074 1.00 0.00 ? 16 ASP A CG   8  
ATOM 10251 O OD1  . ASP A 1 16 ? 90.238  2.818   -18.058 1.00 0.00 ? 16 ASP A OD1  8  
ATOM 10252 O OD2  . ASP A 1 16 ? 88.393  3.352   -17.084 1.00 0.00 ? 16 ASP A OD2  8  
ATOM 10253 H H    . ASP A 1 16 ? 87.864  3.864   -21.863 1.00 0.00 ? 16 ASP A H    8  
ATOM 10254 H HA   . ASP A 1 16 ? 90.363  3.674   -20.502 1.00 0.00 ? 16 ASP A HA   8  
ATOM 10255 H HB2  . ASP A 1 16 ? 88.489  4.786   -19.443 1.00 0.00 ? 16 ASP A HB2  8  
ATOM 10256 H HB3  . ASP A 1 16 ? 87.524  3.314   -19.521 1.00 0.00 ? 16 ASP A HB3  8  
ATOM 10257 N N    . LEU A 1 17 ? 88.498  0.943   -20.604 1.00 0.00 ? 17 LEU A N    8  
ATOM 10258 C CA   . LEU A 1 17 ? 88.571  -0.511  -20.503 1.00 0.00 ? 17 LEU A CA   8  
ATOM 10259 C C    . LEU A 1 17 ? 89.528  -1.055  -21.558 1.00 0.00 ? 17 LEU A C    8  
ATOM 10260 O O    . LEU A 1 17 ? 90.312  -1.970  -21.298 1.00 0.00 ? 17 LEU A O    8  
ATOM 10261 C CB   . LEU A 1 17 ? 87.179  -1.124  -20.701 1.00 0.00 ? 17 LEU A CB   8  
ATOM 10262 C CG   . LEU A 1 17 ? 87.226  -2.650  -20.508 1.00 0.00 ? 17 LEU A CG   8  
ATOM 10263 C CD1  . LEU A 1 17 ? 87.601  -2.997  -19.056 1.00 0.00 ? 17 LEU A CD1  8  
ATOM 10264 C CD2  . LEU A 1 17 ? 85.846  -3.232  -20.838 1.00 0.00 ? 17 LEU A CD2  8  
ATOM 10265 H H    . LEU A 1 17 ? 87.638  1.376   -20.811 1.00 0.00 ? 17 LEU A H    8  
ATOM 10266 H HA   . LEU A 1 17 ? 88.938  -0.775  -19.523 1.00 0.00 ? 17 LEU A HA   8  
ATOM 10267 H HB2  . LEU A 1 17 ? 86.496  -0.696  -19.984 1.00 0.00 ? 17 LEU A HB2  8  
ATOM 10268 H HB3  . LEU A 1 17 ? 86.831  -0.903  -21.698 1.00 0.00 ? 17 LEU A HB3  8  
ATOM 10269 H HG   . LEU A 1 17 ? 87.960  -3.074  -21.177 1.00 0.00 ? 17 LEU A HG   8  
ATOM 10270 H HD11 . LEU A 1 17 ? 88.675  -2.999  -18.952 1.00 0.00 ? 17 LEU A HD11 8  
ATOM 10271 H HD12 . LEU A 1 17 ? 87.222  -3.979  -18.804 1.00 0.00 ? 17 LEU A HD12 8  
ATOM 10272 H HD13 . LEU A 1 17 ? 87.175  -2.267  -18.383 1.00 0.00 ? 17 LEU A HD13 8  
ATOM 10273 H HD21 . LEU A 1 17 ? 85.093  -2.732  -20.247 1.00 0.00 ? 17 LEU A HD21 8  
ATOM 10274 H HD22 . LEU A 1 17 ? 85.838  -4.289  -20.611 1.00 0.00 ? 17 LEU A HD22 8  
ATOM 10275 H HD23 . LEU A 1 17 ? 85.635  -3.089  -21.886 1.00 0.00 ? 17 LEU A HD23 8  
ATOM 10276 N N    . VAL A 1 18 ? 89.452  -0.480  -22.751 1.00 0.00 ? 18 VAL A N    8  
ATOM 10277 C CA   . VAL A 1 18 ? 90.302  -0.904  -23.854 1.00 0.00 ? 18 VAL A CA   8  
ATOM 10278 C C    . VAL A 1 18 ? 91.760  -0.525  -23.607 1.00 0.00 ? 18 VAL A C    8  
ATOM 10279 O O    . VAL A 1 18 ? 92.665  -1.175  -24.121 1.00 0.00 ? 18 VAL A O    8  
ATOM 10280 C CB   . VAL A 1 18 ? 89.811  -0.261  -25.156 1.00 0.00 ? 18 VAL A CB   8  
ATOM 10281 C CG1  . VAL A 1 18 ? 90.785  -0.584  -26.294 1.00 0.00 ? 18 VAL A CG1  8  
ATOM 10282 C CG2  . VAL A 1 18 ? 88.423  -0.808  -25.504 1.00 0.00 ? 18 VAL A CG2  8  
ATOM 10283 H H    . VAL A 1 18 ? 88.804  0.242   -22.894 1.00 0.00 ? 18 VAL A H    8  
ATOM 10284 H HA   . VAL A 1 18 ? 90.234  -1.976  -23.951 1.00 0.00 ? 18 VAL A HA   8  
ATOM 10285 H HB   . VAL A 1 18 ? 89.755  0.811   -25.026 1.00 0.00 ? 18 VAL A HB   8  
ATOM 10286 H HG11 . VAL A 1 18 ? 91.687  -0.005  -26.170 1.00 0.00 ? 18 VAL A HG11 8  
ATOM 10287 H HG12 . VAL A 1 18 ? 90.326  -0.337  -27.240 1.00 0.00 ? 18 VAL A HG12 8  
ATOM 10288 H HG13 . VAL A 1 18 ? 91.026  -1.636  -26.273 1.00 0.00 ? 18 VAL A HG13 8  
ATOM 10289 H HG21 . VAL A 1 18 ? 88.518  -1.807  -25.905 1.00 0.00 ? 18 VAL A HG21 8  
ATOM 10290 H HG22 . VAL A 1 18 ? 87.958  -0.168  -26.240 1.00 0.00 ? 18 VAL A HG22 8  
ATOM 10291 H HG23 . VAL A 1 18 ? 87.811  -0.836  -24.614 1.00 0.00 ? 18 VAL A HG23 8  
ATOM 10292 N N    . LEU A 1 19 ? 91.991  0.536   -22.840 1.00 0.00 ? 19 LEU A N    8  
ATOM 10293 C CA   . LEU A 1 19 ? 93.358  0.969   -22.574 1.00 0.00 ? 19 LEU A CA   8  
ATOM 10294 C C    . LEU A 1 19 ? 94.058  0.001   -21.625 1.00 0.00 ? 19 LEU A C    8  
ATOM 10295 O O    . LEU A 1 19 ? 95.121  -0.526  -21.947 1.00 0.00 ? 19 LEU A O    8  
ATOM 10296 C CB   . LEU A 1 19 ? 93.365  2.384   -21.976 1.00 0.00 ? 19 LEU A CB   8  
ATOM 10297 C CG   . LEU A 1 19 ? 94.806  2.849   -21.698 1.00 0.00 ? 19 LEU A CG   8  
ATOM 10298 C CD1  . LEU A 1 19 ? 95.625  2.857   -23.001 1.00 0.00 ? 19 LEU A CD1  8  
ATOM 10299 C CD2  . LEU A 1 19 ? 94.765  4.264   -21.109 1.00 0.00 ? 19 LEU A CD2  8  
ATOM 10300 H H    . LEU A 1 19 ? 91.238  1.036   -22.461 1.00 0.00 ? 19 LEU A H    8  
ATOM 10301 H HA   . LEU A 1 19 ? 93.895  0.985   -23.508 1.00 0.00 ? 19 LEU A HA   8  
ATOM 10302 H HB2  . LEU A 1 19 ? 92.904  3.066   -22.673 1.00 0.00 ? 19 LEU A HB2  8  
ATOM 10303 H HB3  . LEU A 1 19 ? 92.806  2.385   -21.053 1.00 0.00 ? 19 LEU A HB3  8  
ATOM 10304 H HG   . LEU A 1 19 ? 95.271  2.182   -20.987 1.00 0.00 ? 19 LEU A HG   8  
ATOM 10305 H HD11 . LEU A 1 19 ? 96.006  1.866   -23.193 1.00 0.00 ? 19 LEU A HD11 8  
ATOM 10306 H HD12 . LEU A 1 19 ? 96.456  3.543   -22.905 1.00 0.00 ? 19 LEU A HD12 8  
ATOM 10307 H HD13 . LEU A 1 19 ? 94.998  3.169   -23.824 1.00 0.00 ? 19 LEU A HD13 8  
ATOM 10308 H HD21 . LEU A 1 19 ? 94.086  4.876   -21.685 1.00 0.00 ? 19 LEU A HD21 8  
ATOM 10309 H HD22 . LEU A 1 19 ? 95.755  4.697   -21.144 1.00 0.00 ? 19 LEU A HD22 8  
ATOM 10310 H HD23 . LEU A 1 19 ? 94.430  4.219   -20.084 1.00 0.00 ? 19 LEU A HD23 8  
ATOM 10311 N N    . THR A 1 20 ? 93.471  -0.232  -20.453 1.00 0.00 ? 20 THR A N    8  
ATOM 10312 C CA   . THR A 1 20 ? 94.085  -1.137  -19.493 1.00 0.00 ? 20 THR A CA   8  
ATOM 10313 C C    . THR A 1 20 ? 94.181  -2.553  -20.060 1.00 0.00 ? 20 THR A C    8  
ATOM 10314 O O    . THR A 1 20 ? 95.172  -3.250  -19.839 1.00 0.00 ? 20 THR A O    8  
ATOM 10315 C CB   . THR A 1 20 ? 93.265  -1.146  -18.204 1.00 0.00 ? 20 THR A CB   8  
ATOM 10316 O OG1  . THR A 1 20 ? 92.884  0.185   -17.896 1.00 0.00 ? 20 THR A OG1  8  
ATOM 10317 C CG2  . THR A 1 20 ? 94.106  -1.720  -17.059 1.00 0.00 ? 20 THR A CG2  8  
ATOM 10318 H H    . THR A 1 20 ? 92.622  0.217   -20.221 1.00 0.00 ? 20 THR A H    8  
ATOM 10319 H HA   . THR A 1 20 ? 95.080  -0.782  -19.272 1.00 0.00 ? 20 THR A HA   8  
ATOM 10320 H HB   . THR A 1 20 ? 92.384  -1.754  -18.340 1.00 0.00 ? 20 THR A HB   8  
ATOM 10321 H HG1  . THR A 1 20 ? 92.960  0.708   -18.698 1.00 0.00 ? 20 THR A HG1  8  
ATOM 10322 H HG21 . THR A 1 20 ? 95.019  -1.153  -16.963 1.00 0.00 ? 20 THR A HG21 8  
ATOM 10323 H HG22 . THR A 1 20 ? 94.343  -2.752  -17.270 1.00 0.00 ? 20 THR A HG22 8  
ATOM 10324 H HG23 . THR A 1 20 ? 93.547  -1.660  -16.138 1.00 0.00 ? 20 THR A HG23 8  
ATOM 10325 N N    . VAL A 1 21 ? 93.148  -2.978  -20.782 1.00 0.00 ? 21 VAL A N    8  
ATOM 10326 C CA   . VAL A 1 21 ? 93.133  -4.319  -21.361 1.00 0.00 ? 21 VAL A CA   8  
ATOM 10327 C C    . VAL A 1 21 ? 94.132  -4.444  -22.514 1.00 0.00 ? 21 VAL A C    8  
ATOM 10328 O O    . VAL A 1 21 ? 94.781  -5.478  -22.668 1.00 0.00 ? 21 VAL A O    8  
ATOM 10329 C CB   . VAL A 1 21 ? 91.724  -4.651  -21.859 1.00 0.00 ? 21 VAL A CB   8  
ATOM 10330 C CG1  . VAL A 1 21 ? 91.732  -6.012  -22.558 1.00 0.00 ? 21 VAL A CG1  8  
ATOM 10331 C CG2  . VAL A 1 21 ? 90.763  -4.698  -20.667 1.00 0.00 ? 21 VAL A CG2  8  
ATOM 10332 H H    . VAL A 1 21 ? 92.378  -2.383  -20.923 1.00 0.00 ? 21 VAL A H    8  
ATOM 10333 H HA   . VAL A 1 21 ? 93.402  -5.029  -20.593 1.00 0.00 ? 21 VAL A HA   8  
ATOM 10334 H HB   . VAL A 1 21 ? 91.401  -3.891  -22.555 1.00 0.00 ? 21 VAL A HB   8  
ATOM 10335 H HG11 . VAL A 1 21 ? 90.716  -6.351  -22.698 1.00 0.00 ? 21 VAL A HG11 8  
ATOM 10336 H HG12 . VAL A 1 21 ? 92.269  -6.726  -21.950 1.00 0.00 ? 21 VAL A HG12 8  
ATOM 10337 H HG13 . VAL A 1 21 ? 92.217  -5.921  -23.519 1.00 0.00 ? 21 VAL A HG13 8  
ATOM 10338 H HG21 . VAL A 1 21 ? 90.923  -5.609  -20.111 1.00 0.00 ? 21 VAL A HG21 8  
ATOM 10339 H HG22 . VAL A 1 21 ? 89.745  -4.669  -21.026 1.00 0.00 ? 21 VAL A HG22 8  
ATOM 10340 H HG23 . VAL A 1 21 ? 90.943  -3.848  -20.025 1.00 0.00 ? 21 VAL A HG23 8  
ATOM 10341 N N    . LEU A 1 22 ? 94.236  -3.402  -23.332 1.00 0.00 ? 22 LEU A N    8  
ATOM 10342 C CA   . LEU A 1 22 ? 95.145  -3.429  -24.477 1.00 0.00 ? 22 LEU A CA   8  
ATOM 10343 C C    . LEU A 1 22 ? 96.603  -3.530  -24.029 1.00 0.00 ? 22 LEU A C    8  
ATOM 10344 O O    . LEU A 1 22 ? 97.336  -4.406  -24.485 1.00 0.00 ? 22 LEU A O    8  
ATOM 10345 C CB   . LEU A 1 22 ? 94.943  -2.167  -25.330 1.00 0.00 ? 22 LEU A CB   8  
ATOM 10346 C CG   . LEU A 1 22 ? 96.005  -2.082  -26.439 1.00 0.00 ? 22 LEU A CG   8  
ATOM 10347 C CD1  . LEU A 1 22 ? 96.031  -3.389  -27.244 1.00 0.00 ? 22 LEU A CD1  8  
ATOM 10348 C CD2  . LEU A 1 22 ? 95.660  -0.917  -27.371 1.00 0.00 ? 22 LEU A CD2  8  
ATOM 10349 H H    . LEU A 1 22 ? 93.684  -2.608  -23.174 1.00 0.00 ? 22 LEU A H    8  
ATOM 10350 H HA   . LEU A 1 22 ? 94.908  -4.292  -25.080 1.00 0.00 ? 22 LEU A HA   8  
ATOM 10351 H HB2  . LEU A 1 22 ? 93.963  -2.196  -25.781 1.00 0.00 ? 22 LEU A HB2  8  
ATOM 10352 H HB3  . LEU A 1 22 ? 95.020  -1.293  -24.699 1.00 0.00 ? 22 LEU A HB3  8  
ATOM 10353 H HG   . LEU A 1 22 ? 96.977  -1.912  -26.000 1.00 0.00 ? 22 LEU A HG   8  
ATOM 10354 H HD11 . LEU A 1 22 ? 96.509  -3.218  -28.198 1.00 0.00 ? 22 LEU A HD11 8  
ATOM 10355 H HD12 . LEU A 1 22 ? 95.021  -3.736  -27.406 1.00 0.00 ? 22 LEU A HD12 8  
ATOM 10356 H HD13 . LEU A 1 22 ? 96.584  -4.137  -26.696 1.00 0.00 ? 22 LEU A HD13 8  
ATOM 10357 H HD21 . LEU A 1 22 ? 94.634  -1.007  -27.697 1.00 0.00 ? 22 LEU A HD21 8  
ATOM 10358 H HD22 . LEU A 1 22 ? 96.314  -0.937  -28.231 1.00 0.00 ? 22 LEU A HD22 8  
ATOM 10359 H HD23 . LEU A 1 22 ? 95.790  0.017   -26.844 1.00 0.00 ? 22 LEU A HD23 8  
ATOM 10360 N N    . ILE A 1 23 ? 97.024  -2.631  -23.143 1.00 0.00 ? 23 ILE A N    8  
ATOM 10361 C CA   . ILE A 1 23 ? 98.404  -2.648  -22.665 1.00 0.00 ? 23 ILE A CA   8  
ATOM 10362 C C    . ILE A 1 23 ? 98.672  -3.918  -21.860 1.00 0.00 ? 23 ILE A C    8  
ATOM 10363 O O    . ILE A 1 23 ? 99.711  -4.557  -22.025 1.00 0.00 ? 23 ILE A O    8  
ATOM 10364 C CB   . ILE A 1 23 ? 98.686  -1.409  -21.806 1.00 0.00 ? 23 ILE A CB   8  
ATOM 10365 C CG1  . ILE A 1 23 ? 98.272  -0.152  -22.579 1.00 0.00 ? 23 ILE A CG1  8  
ATOM 10366 C CG2  . ILE A 1 23 ? 100.184 -1.325  -21.480 1.00 0.00 ? 23 ILE A CG2  8  
ATOM 10367 C CD1  . ILE A 1 23 ? 98.423  1.077   -21.679 1.00 0.00 ? 23 ILE A CD1  8  
ATOM 10368 H H    . ILE A 1 23 ? 96.404  -1.949  -22.813 1.00 0.00 ? 23 ILE A H    8  
ATOM 10369 H HA   . ILE A 1 23 ? 99.066  -2.635  -23.518 1.00 0.00 ? 23 ILE A HA   8  
ATOM 10370 H HB   . ILE A 1 23 ? 98.119  -1.470  -20.888 1.00 0.00 ? 23 ILE A HB   8  
ATOM 10371 H HG12 . ILE A 1 23 ? 98.905  -0.041  -23.447 1.00 0.00 ? 23 ILE A HG12 8  
ATOM 10372 H HG13 . ILE A 1 23 ? 97.245  -0.243  -22.892 1.00 0.00 ? 23 ILE A HG13 8  
ATOM 10373 H HG21 . ILE A 1 23 ? 100.554 -2.297  -21.194 1.00 0.00 ? 23 ILE A HG21 8  
ATOM 10374 H HG22 . ILE A 1 23 ? 100.337 -0.631  -20.666 1.00 0.00 ? 23 ILE A HG22 8  
ATOM 10375 H HG23 . ILE A 1 23 ? 100.724 -0.979  -22.351 1.00 0.00 ? 23 ILE A HG23 8  
ATOM 10376 H HD11 . ILE A 1 23 ? 99.453  1.173   -21.368 1.00 0.00 ? 23 ILE A HD11 8  
ATOM 10377 H HD12 . ILE A 1 23 ? 97.793  0.965   -20.808 1.00 0.00 ? 23 ILE A HD12 8  
ATOM 10378 H HD13 . ILE A 1 23 ? 98.129  1.962   -22.223 1.00 0.00 ? 23 ILE A HD13 8  
ATOM 10379 N N    . ALA A 1 24 ? 97.733  -4.281  -20.992 1.00 0.00 ? 24 ALA A N    8  
ATOM 10380 C CA   . ALA A 1 24 ? 97.889  -5.479  -20.175 1.00 0.00 ? 24 ALA A CA   8  
ATOM 10381 C C    . ALA A 1 24 ? 98.069  -6.707  -21.061 1.00 0.00 ? 24 ALA A C    8  
ATOM 10382 O O    . ALA A 1 24 ? 98.877  -7.589  -20.767 1.00 0.00 ? 24 ALA A O    8  
ATOM 10383 C CB   . ALA A 1 24 ? 96.663  -5.667  -19.276 1.00 0.00 ? 24 ALA A CB   8  
ATOM 10384 H H    . ALA A 1 24 ? 96.922  -3.736  -20.901 1.00 0.00 ? 24 ALA A H    8  
ATOM 10385 H HA   . ALA A 1 24 ? 98.764  -5.366  -19.554 1.00 0.00 ? 24 ALA A HA   8  
ATOM 10386 H HB1  . ALA A 1 24 ? 95.784  -5.804  -19.888 1.00 0.00 ? 24 ALA A HB1  8  
ATOM 10387 H HB2  . ALA A 1 24 ? 96.536  -4.794  -18.654 1.00 0.00 ? 24 ALA A HB2  8  
ATOM 10388 H HB3  . ALA A 1 24 ? 96.805  -6.537  -18.652 1.00 0.00 ? 24 ALA A HB3  8  
ATOM 10389 N N    . LEU A 1 25 ? 97.310  -6.755  -22.150 1.00 0.00 ? 25 LEU A N    8  
ATOM 10390 C CA   . LEU A 1 25 ? 97.392  -7.876  -23.079 1.00 0.00 ? 25 LEU A CA   8  
ATOM 10391 C C    . LEU A 1 25 ? 98.709  -7.829  -23.849 1.00 0.00 ? 25 LEU A C    8  
ATOM 10392 O O    . LEU A 1 25 ? 99.298  -8.865  -24.156 1.00 0.00 ? 25 LEU A O    8  
ATOM 10393 C CB   . LEU A 1 25 ? 96.209  -7.822  -24.055 1.00 0.00 ? 25 LEU A CB   8  
ATOM 10394 C CG   . LEU A 1 25 ? 96.339  -8.915  -25.127 1.00 0.00 ? 25 LEU A CG   8  
ATOM 10395 C CD1  . LEU A 1 25 ? 96.501  -10.292 -24.465 1.00 0.00 ? 25 LEU A CD1  8  
ATOM 10396 C CD2  . LEU A 1 25 ? 95.074  -8.912  -25.992 1.00 0.00 ? 25 LEU A CD2  8  
ATOM 10397 H H    . LEU A 1 25 ? 96.686  -6.023  -22.334 1.00 0.00 ? 25 LEU A H    8  
ATOM 10398 H HA   . LEU A 1 25 ? 97.343  -8.795  -22.517 1.00 0.00 ? 25 LEU A HA   8  
ATOM 10399 H HB2  . LEU A 1 25 ? 95.289  -7.967  -23.507 1.00 0.00 ? 25 LEU A HB2  8  
ATOM 10400 H HB3  . LEU A 1 25 ? 96.188  -6.855  -24.535 1.00 0.00 ? 25 LEU A HB3  8  
ATOM 10401 H HG   . LEU A 1 25 ? 97.197  -8.712  -25.749 1.00 0.00 ? 25 LEU A HG   8  
ATOM 10402 H HD11 . LEU A 1 25 ? 97.530  -10.427 -24.166 1.00 0.00 ? 25 LEU A HD11 8  
ATOM 10403 H HD12 . LEU A 1 25 ? 96.230  -11.067 -25.165 1.00 0.00 ? 25 LEU A HD12 8  
ATOM 10404 H HD13 . LEU A 1 25 ? 95.863  -10.354 -23.595 1.00 0.00 ? 25 LEU A HD13 8  
ATOM 10405 H HD21 . LEU A 1 25 ? 95.124  -9.722  -26.705 1.00 0.00 ? 25 LEU A HD21 8  
ATOM 10406 H HD22 . LEU A 1 25 ? 95.002  -7.973  -26.520 1.00 0.00 ? 25 LEU A HD22 8  
ATOM 10407 H HD23 . LEU A 1 25 ? 94.206  -9.039  -25.362 1.00 0.00 ? 25 LEU A HD23 8  
ATOM 10408 N N    . ALA A 1 26 ? 99.160  -6.619  -24.162 1.00 0.00 ? 26 ALA A N    8  
ATOM 10409 C CA   . ALA A 1 26 ? 100.403 -6.441  -24.904 1.00 0.00 ? 26 ALA A CA   8  
ATOM 10410 C C    . ALA A 1 26 ? 101.595 -6.957  -24.105 1.00 0.00 ? 26 ALA A C    8  
ATOM 10411 O O    . ALA A 1 26 ? 102.408 -7.727  -24.617 1.00 0.00 ? 26 ALA A O    8  
ATOM 10412 C CB   . ALA A 1 26 ? 100.608 -4.961  -25.231 1.00 0.00 ? 26 ALA A CB   8  
ATOM 10413 H H    . ALA A 1 26 ? 98.643  -5.829  -23.895 1.00 0.00 ? 26 ALA A H    8  
ATOM 10414 H HA   . ALA A 1 26 ? 100.339 -6.994  -25.830 1.00 0.00 ? 26 ALA A HA   8  
ATOM 10415 H HB1  . ALA A 1 26 ? 101.506 -4.843  -25.820 1.00 0.00 ? 26 ALA A HB1  8  
ATOM 10416 H HB2  . ALA A 1 26 ? 100.705 -4.399  -24.313 1.00 0.00 ? 26 ALA A HB2  8  
ATOM 10417 H HB3  . ALA A 1 26 ? 99.760  -4.593  -25.789 1.00 0.00 ? 26 ALA A HB3  8  
ATOM 10418 N N    . VAL A 1 27 ? 101.700 -6.531  -22.849 1.00 0.00 ? 27 VAL A N    8  
ATOM 10419 C CA   . VAL A 1 27 ? 102.806 -6.966  -22.005 1.00 0.00 ? 27 VAL A CA   8  
ATOM 10420 C C    . VAL A 1 27 ? 102.665 -8.446  -21.667 1.00 0.00 ? 27 VAL A C    8  
ATOM 10421 O O    . VAL A 1 27 ? 103.658 -9.162  -21.540 1.00 0.00 ? 27 VAL A O    8  
ATOM 10422 C CB   . VAL A 1 27 ? 102.845 -6.142  -20.716 1.00 0.00 ? 27 VAL A CB   8  
ATOM 10423 C CG1  . VAL A 1 27 ? 103.003 -4.660  -21.063 1.00 0.00 ? 27 VAL A CG1  8  
ATOM 10424 C CG2  . VAL A 1 27 ? 101.542 -6.347  -19.942 1.00 0.00 ? 27 VAL A CG2  8  
ATOM 10425 H H    . VAL A 1 27 ? 101.025 -5.917  -22.486 1.00 0.00 ? 27 VAL A H    8  
ATOM 10426 H HA   . VAL A 1 27 ? 103.732 -6.818  -22.539 1.00 0.00 ? 27 VAL A HA   8  
ATOM 10427 H HB   . VAL A 1 27 ? 103.681 -6.461  -20.111 1.00 0.00 ? 27 VAL A HB   8  
ATOM 10428 H HG11 . VAL A 1 27 ? 102.310 -4.398  -21.849 1.00 0.00 ? 27 VAL A HG11 8  
ATOM 10429 H HG12 . VAL A 1 27 ? 104.013 -4.474  -21.396 1.00 0.00 ? 27 VAL A HG12 8  
ATOM 10430 H HG13 . VAL A 1 27 ? 102.797 -4.062  -20.187 1.00 0.00 ? 27 VAL A HG13 8  
ATOM 10431 H HG21 . VAL A 1 27 ? 100.707 -6.138  -20.590 1.00 0.00 ? 27 VAL A HG21 8  
ATOM 10432 H HG22 . VAL A 1 27 ? 101.518 -5.679  -19.095 1.00 0.00 ? 27 VAL A HG22 8  
ATOM 10433 H HG23 . VAL A 1 27 ? 101.484 -7.369  -19.598 1.00 0.00 ? 27 VAL A HG23 8  
ATOM 10434 N N    . TYR A 1 28 ? 101.423 -8.899  -21.526 1.00 0.00 ? 28 TYR A N    8  
ATOM 10435 C CA   . TYR A 1 28 ? 101.164 -10.298 -21.208 1.00 0.00 ? 28 TYR A CA   8  
ATOM 10436 C C    . TYR A 1 28 ? 101.658 -11.201 -22.334 1.00 0.00 ? 28 TYR A C    8  
ATOM 10437 O O    . TYR A 1 28 ? 102.302 -12.221 -22.088 1.00 0.00 ? 28 TYR A O    8  
ATOM 10438 C CB   . TYR A 1 28 ? 99.665  -10.518 -20.995 1.00 0.00 ? 28 TYR A CB   8  
ATOM 10439 C CG   . TYR A 1 28 ? 99.406  -11.980 -20.721 1.00 0.00 ? 28 TYR A CG   8  
ATOM 10440 C CD1  . TYR A 1 28 ? 99.267  -12.878 -21.785 1.00 0.00 ? 28 TYR A CD1  8  
ATOM 10441 C CD2  . TYR A 1 28 ? 99.305  -12.437 -19.401 1.00 0.00 ? 28 TYR A CD2  8  
ATOM 10442 C CE1  . TYR A 1 28 ? 99.027  -14.234 -21.531 1.00 0.00 ? 28 TYR A CE1  8  
ATOM 10443 C CE2  . TYR A 1 28 ? 99.065  -13.793 -19.147 1.00 0.00 ? 28 TYR A CE2  8  
ATOM 10444 C CZ   . TYR A 1 28 ? 98.927  -14.691 -20.211 1.00 0.00 ? 28 TYR A CZ   8  
ATOM 10445 O OH   . TYR A 1 28 ? 98.690  -16.028 -19.961 1.00 0.00 ? 28 TYR A OH   8  
ATOM 10446 H H    . TYR A 1 28 ? 100.669 -8.283  -21.641 1.00 0.00 ? 28 TYR A H    8  
ATOM 10447 H HA   . TYR A 1 28 ? 101.687 -10.554 -20.299 1.00 0.00 ? 28 TYR A HA   8  
ATOM 10448 H HB2  . TYR A 1 28 ? 99.331  -9.929  -20.154 1.00 0.00 ? 28 TYR A HB2  8  
ATOM 10449 H HB3  . TYR A 1 28 ? 99.127  -10.219 -21.881 1.00 0.00 ? 28 TYR A HB3  8  
ATOM 10450 H HD1  . TYR A 1 28 ? 99.345  -12.525 -22.803 1.00 0.00 ? 28 TYR A HD1  8  
ATOM 10451 H HD2  . TYR A 1 28 ? 99.412  -11.744 -18.579 1.00 0.00 ? 28 TYR A HD2  8  
ATOM 10452 H HE1  . TYR A 1 28 ? 98.920  -14.927 -22.351 1.00 0.00 ? 28 TYR A HE1  8  
ATOM 10453 H HE2  . TYR A 1 28 ? 98.987  -14.145 -18.128 1.00 0.00 ? 28 TYR A HE2  8  
ATOM 10454 H HH   . TYR A 1 28 ? 97.905  -16.093 -19.412 1.00 0.00 ? 28 TYR A HH   8  
ATOM 10455 N N    . PHE A 1 29 ? 101.352 -10.820 -23.571 1.00 0.00 ? 29 PHE A N    8  
ATOM 10456 C CA   . PHE A 1 29 ? 101.770 -11.606 -24.727 1.00 0.00 ? 29 PHE A CA   8  
ATOM 10457 C C    . PHE A 1 29 ? 103.292 -11.691 -24.791 1.00 0.00 ? 29 PHE A C    8  
ATOM 10458 O O    . PHE A 1 29 ? 103.859 -12.778 -24.909 1.00 0.00 ? 29 PHE A O    8  
ATOM 10459 C CB   . PHE A 1 29 ? 101.238 -10.968 -26.012 1.00 0.00 ? 29 PHE A CB   8  
ATOM 10460 C CG   . PHE A 1 29 ? 101.714 -11.763 -27.205 1.00 0.00 ? 29 PHE A CG   8  
ATOM 10461 C CD1  . PHE A 1 29 ? 101.105 -12.982 -27.522 1.00 0.00 ? 29 PHE A CD1  8  
ATOM 10462 C CD2  . PHE A 1 29 ? 102.766 -11.280 -27.995 1.00 0.00 ? 29 PHE A CD2  8  
ATOM 10463 C CE1  . PHE A 1 29 ? 101.545 -13.719 -28.629 1.00 0.00 ? 29 PHE A CE1  8  
ATOM 10464 C CE2  . PHE A 1 29 ? 103.207 -12.017 -29.101 1.00 0.00 ? 29 PHE A CE2  8  
ATOM 10465 C CZ   . PHE A 1 29 ? 102.596 -13.236 -29.418 1.00 0.00 ? 29 PHE A CZ   8  
ATOM 10466 H H    . PHE A 1 29 ? 100.836 -9.998  -23.710 1.00 0.00 ? 29 PHE A H    8  
ATOM 10467 H HA   . PHE A 1 29 ? 101.366 -12.603 -24.639 1.00 0.00 ? 29 PHE A HA   8  
ATOM 10468 H HB2  . PHE A 1 29 ? 100.157 -10.966 -25.990 1.00 0.00 ? 29 PHE A HB2  8  
ATOM 10469 H HB3  . PHE A 1 29 ? 101.597 -9.953  -26.086 1.00 0.00 ? 29 PHE A HB3  8  
ATOM 10470 H HD1  . PHE A 1 29 ? 100.294 -13.355 -26.914 1.00 0.00 ? 29 PHE A HD1  8  
ATOM 10471 H HD2  . PHE A 1 29 ? 103.236 -10.339 -27.751 1.00 0.00 ? 29 PHE A HD2  8  
ATOM 10472 H HE1  . PHE A 1 29 ? 101.074 -14.659 -28.872 1.00 0.00 ? 29 PHE A HE1  8  
ATOM 10473 H HE2  . PHE A 1 29 ? 104.017 -11.645 -29.710 1.00 0.00 ? 29 PHE A HE2  8  
ATOM 10474 H HZ   . PHE A 1 29 ? 102.936 -13.805 -30.270 1.00 0.00 ? 29 PHE A HZ   8  
ATOM 10475 N N    . LEU A 1 30 ? 103.948 -10.538 -24.705 1.00 0.00 ? 30 LEU A N    8  
ATOM 10476 C CA   . LEU A 1 30 ? 105.405 -10.494 -24.749 1.00 0.00 ? 30 LEU A CA   8  
ATOM 10477 C C    . LEU A 1 30 ? 105.990 -11.089 -23.472 1.00 0.00 ? 30 LEU A C    8  
ATOM 10478 O O    . LEU A 1 30 ? 107.042 -11.726 -23.497 1.00 0.00 ? 30 LEU A O    8  
ATOM 10479 C CB   . LEU A 1 30 ? 105.887 -9.048  -24.907 1.00 0.00 ? 30 LEU A CB   8  
ATOM 10480 C CG   . LEU A 1 30 ? 105.244 -8.411  -26.148 1.00 0.00 ? 30 LEU A CG   8  
ATOM 10481 C CD1  . LEU A 1 30 ? 105.436 -6.893  -26.093 1.00 0.00 ? 30 LEU A CD1  8  
ATOM 10482 C CD2  . LEU A 1 30 ? 105.896 -8.954  -27.427 1.00 0.00 ? 30 LEU A CD2  8  
ATOM 10483 H H    . LEU A 1 30 ? 103.444 -9.703  -24.608 1.00 0.00 ? 30 LEU A H    8  
ATOM 10484 H HA   . LEU A 1 30 ? 105.750 -11.073 -25.591 1.00 0.00 ? 30 LEU A HA   8  
ATOM 10485 H HB2  . LEU A 1 30 ? 105.608 -8.484  -24.030 1.00 0.00 ? 30 LEU A HB2  8  
ATOM 10486 H HB3  . LEU A 1 30 ? 106.961 -9.036  -25.011 1.00 0.00 ? 30 LEU A HB3  8  
ATOM 10487 H HG   . LEU A 1 30 ? 104.187 -8.635  -26.158 1.00 0.00 ? 30 LEU A HG   8  
ATOM 10488 H HD11 . LEU A 1 30 ? 106.486 -6.667  -25.984 1.00 0.00 ? 30 LEU A HD11 8  
ATOM 10489 H HD12 . LEU A 1 30 ? 104.892 -6.492  -25.249 1.00 0.00 ? 30 LEU A HD12 8  
ATOM 10490 H HD13 . LEU A 1 30 ? 105.064 -6.450  -27.004 1.00 0.00 ? 30 LEU A HD13 8  
ATOM 10491 H HD21 . LEU A 1 30 ? 106.971 -8.960  -27.315 1.00 0.00 ? 30 LEU A HD21 8  
ATOM 10492 H HD22 . LEU A 1 30 ? 105.629 -8.324  -28.262 1.00 0.00 ? 30 LEU A HD22 8  
ATOM 10493 H HD23 . LEU A 1 30 ? 105.548 -9.958  -27.613 1.00 0.00 ? 30 LEU A HD23 8  
ATOM 10494 N N    . GLY A 1 31 ? 105.299 -10.873 -22.358 1.00 0.00 ? 31 GLY A N    8  
ATOM 10495 C CA   . GLY A 1 31 ? 105.756 -11.391 -21.073 1.00 0.00 ? 31 GLY A CA   8  
ATOM 10496 C C    . GLY A 1 31 ? 105.953 -12.901 -21.135 1.00 0.00 ? 31 GLY A C    8  
ATOM 10497 O O    . GLY A 1 31 ? 106.092 -13.475 -22.215 1.00 0.00 ? 31 GLY A O    8  
ATOM 10498 H H    . GLY A 1 31 ? 104.467 -10.357 -22.399 1.00 0.00 ? 31 GLY A H    8  
ATOM 10499 H HA2  . GLY A 1 31 ? 106.693 -10.919 -20.814 1.00 0.00 ? 31 GLY A HA2  8  
ATOM 10500 H HA3  . GLY A 1 31 ? 105.022 -11.162 -20.315 1.00 0.00 ? 31 GLY A HA3  8  
ATOM 10501 N N    . ARG A 1 32 ? 105.967 -13.541 -19.969 1.00 0.00 ? 32 ARG A N    8  
ATOM 10502 C CA   . ARG A 1 32 ? 106.151 -14.986 -19.906 1.00 0.00 ? 32 ARG A CA   8  
ATOM 10503 C C    . ARG A 1 32 ? 105.646 -15.537 -18.576 1.00 0.00 ? 32 ARG A C    8  
ATOM 10504 O O    . ARG A 1 32 ? 106.037 -15.065 -17.508 1.00 0.00 ? 32 ARG A O    8  
ATOM 10505 C CB   . ARG A 1 32 ? 107.631 -15.331 -20.073 1.00 0.00 ? 32 ARG A CB   8  
ATOM 10506 C CG   . ARG A 1 32 ? 107.804 -16.850 -20.105 1.00 0.00 ? 32 ARG A CG   8  
ATOM 10507 C CD   . ARG A 1 32 ? 109.266 -17.192 -20.398 1.00 0.00 ? 32 ARG A CD   8  
ATOM 10508 N NE   . ARG A 1 32 ? 109.446 -18.637 -20.439 1.00 0.00 ? 32 ARG A NE   8  
ATOM 10509 C CZ   . ARG A 1 32 ? 109.087 -19.344 -21.506 1.00 0.00 ? 32 ARG A CZ   8  
ATOM 10510 N NH1  . ARG A 1 32 ? 108.559 -18.743 -22.538 1.00 0.00 ? 32 ARG A NH1  8  
ATOM 10511 N NH2  . ARG A 1 32 ? 109.260 -20.637 -21.522 1.00 0.00 ? 32 ARG A NH2  8  
ATOM 10512 H H    . ARG A 1 32 ? 105.853 -13.033 -19.138 1.00 0.00 ? 32 ARG A H    8  
ATOM 10513 H HA   . ARG A 1 32 ? 105.593 -15.448 -20.708 1.00 0.00 ? 32 ARG A HA   8  
ATOM 10514 H HB2  . ARG A 1 32 ? 107.997 -14.906 -20.998 1.00 0.00 ? 32 ARG A HB2  8  
ATOM 10515 H HB3  . ARG A 1 32 ? 108.192 -14.925 -19.245 1.00 0.00 ? 32 ARG A HB3  8  
ATOM 10516 H HG2  . ARG A 1 32 ? 107.521 -17.265 -19.149 1.00 0.00 ? 32 ARG A HG2  8  
ATOM 10517 H HG3  . ARG A 1 32 ? 107.177 -17.268 -20.880 1.00 0.00 ? 32 ARG A HG3  8  
ATOM 10518 H HD2  . ARG A 1 32 ? 109.548 -16.770 -21.350 1.00 0.00 ? 32 ARG A HD2  8  
ATOM 10519 H HD3  . ARG A 1 32 ? 109.891 -16.772 -19.623 1.00 0.00 ? 32 ARG A HD3  8  
ATOM 10520 H HE   . ARG A 1 32 ? 109.841 -19.097 -19.669 1.00 0.00 ? 32 ARG A HE   8  
ATOM 10521 H HH11 . ARG A 1 32 ? 108.424 -17.752 -22.525 1.00 0.00 ? 32 ARG A HH11 8  
ATOM 10522 H HH12 . ARG A 1 32 ? 108.288 -19.274 -23.341 1.00 0.00 ? 32 ARG A HH12 8  
ATOM 10523 H HH21 . ARG A 1 32 ? 109.664 -21.097 -20.730 1.00 0.00 ? 32 ARG A HH21 8  
ATOM 10524 H HH22 . ARG A 1 32 ? 108.990 -21.168 -22.325 1.00 0.00 ? 32 ARG A HH22 8  
ATOM 10525 N N    . LEU A 1 33 ? 104.776 -16.540 -18.649 1.00 0.00 ? 33 LEU A N    8  
ATOM 10526 C CA   . LEU A 1 33 ? 104.220 -17.155 -17.447 1.00 0.00 ? 33 LEU A CA   8  
ATOM 10527 C C    . LEU A 1 33 ? 105.175 -18.221 -16.912 1.00 0.00 ? 33 LEU A C    8  
ATOM 10528 O O    . LEU A 1 33 ? 106.260 -18.427 -17.458 1.00 0.00 ? 33 LEU A O    8  
ATOM 10529 C CB   . LEU A 1 33 ? 102.849 -17.787 -17.762 1.00 0.00 ? 33 LEU A CB   8  
ATOM 10530 C CG   . LEU A 1 33 ? 102.862 -18.418 -19.176 1.00 0.00 ? 33 LEU A CG   8  
ATOM 10531 C CD1  . LEU A 1 33 ? 101.926 -19.633 -19.217 1.00 0.00 ? 33 LEU A CD1  8  
ATOM 10532 C CD2  . LEU A 1 33 ? 102.392 -17.388 -20.219 1.00 0.00 ? 33 LEU A CD2  8  
ATOM 10533 H H    . LEU A 1 33 ? 104.503 -16.875 -19.529 1.00 0.00 ? 33 LEU A H    8  
ATOM 10534 H HA   . LEU A 1 33 ? 104.088 -16.395 -16.690 1.00 0.00 ? 33 LEU A HA   8  
ATOM 10535 H HB2  . LEU A 1 33 ? 102.630 -18.548 -17.022 1.00 0.00 ? 33 LEU A HB2  8  
ATOM 10536 H HB3  . LEU A 1 33 ? 102.086 -17.023 -17.713 1.00 0.00 ? 33 LEU A HB3  8  
ATOM 10537 H HG   . LEU A 1 33 ? 103.866 -18.743 -19.421 1.00 0.00 ? 33 LEU A HG   8  
ATOM 10538 H HD11 . LEU A 1 33 ? 102.379 -20.456 -18.684 1.00 0.00 ? 33 LEU A HD11 8  
ATOM 10539 H HD12 . LEU A 1 33 ? 101.753 -19.922 -20.244 1.00 0.00 ? 33 LEU A HD12 8  
ATOM 10540 H HD13 . LEU A 1 33 ? 100.985 -19.379 -18.751 1.00 0.00 ? 33 LEU A HD13 8  
ATOM 10541 H HD21 . LEU A 1 33 ? 102.812 -16.422 -19.990 1.00 0.00 ? 33 LEU A HD21 8  
ATOM 10542 H HD22 . LEU A 1 33 ? 101.313 -17.321 -20.204 1.00 0.00 ? 33 LEU A HD22 8  
ATOM 10543 H HD23 . LEU A 1 33 ? 102.718 -17.697 -21.201 1.00 0.00 ? 33 LEU A HD23 8  
ATOM 10544 N N    . GLY A 1 34 ? 104.764 -18.895 -15.843 1.00 0.00 ? 34 GLY A N    8  
ATOM 10545 C CA   . GLY A 1 34 ? 105.592 -19.937 -15.245 1.00 0.00 ? 34 GLY A CA   8  
ATOM 10546 C C    . GLY A 1 34 ? 106.754 -19.329 -14.468 1.00 0.00 ? 34 GLY A C    8  
ATOM 10547 O O    . GLY A 1 34 ? 107.394 -20.003 -13.661 1.00 0.00 ? 34 GLY A O    8  
ATOM 10548 H H    . GLY A 1 34 ? 103.891 -18.689 -15.450 1.00 0.00 ? 34 GLY A H    8  
ATOM 10549 H HA2  . GLY A 1 34 ? 104.986 -20.530 -14.574 1.00 0.00 ? 34 GLY A HA2  8  
ATOM 10550 H HA3  . GLY A 1 34 ? 105.983 -20.572 -16.025 1.00 0.00 ? 34 GLY A HA3  8  
ATOM 10551 N N    . THR A 1 35 ? 107.023 -18.052 -14.719 1.00 0.00 ? 35 THR A N    8  
ATOM 10552 C CA   . THR A 1 35 ? 108.112 -17.360 -14.038 1.00 0.00 ? 35 THR A CA   8  
ATOM 10553 C C    . THR A 1 35 ? 107.676 -16.917 -12.646 1.00 0.00 ? 35 THR A C    8  
ATOM 10554 O O    . THR A 1 35 ? 108.234 -15.978 -12.080 1.00 0.00 ? 35 THR A O    8  
ATOM 10555 C CB   . THR A 1 35 ? 108.544 -16.138 -14.851 1.00 0.00 ? 35 THR A CB   8  
ATOM 10556 O OG1  . THR A 1 35 ? 109.675 -15.538 -14.236 1.00 0.00 ? 35 THR A OG1  8  
ATOM 10557 C CG2  . THR A 1 35 ? 107.395 -15.129 -14.908 1.00 0.00 ? 35 THR A CG2  8  
ATOM 10558 H H    . THR A 1 35 ? 106.479 -17.566 -15.374 1.00 0.00 ? 35 THR A H    8  
ATOM 10559 H HA   . THR A 1 35 ? 108.953 -18.032 -13.946 1.00 0.00 ? 35 THR A HA   8  
ATOM 10560 H HB   . THR A 1 35 ? 108.799 -16.443 -15.855 1.00 0.00 ? 35 THR A HB   8  
ATOM 10561 H HG1  . THR A 1 35 ? 110.325 -16.224 -14.076 1.00 0.00 ? 35 THR A HG1  8  
ATOM 10562 H HG21 . THR A 1 35 ? 106.481 -15.639 -15.171 1.00 0.00 ? 35 THR A HG21 8  
ATOM 10563 H HG22 . THR A 1 35 ? 107.614 -14.375 -15.650 1.00 0.00 ? 35 THR A HG22 8  
ATOM 10564 H HG23 . THR A 1 35 ? 107.281 -14.661 -13.942 1.00 0.00 ? 35 THR A HG23 8  
ATOM 10565 N N    . ALA A 1 36 ? 106.673 -17.599 -12.101 1.00 0.00 ? 36 ALA A N    8  
ATOM 10566 C CA   . ALA A 1 36 ? 106.169 -17.264 -10.775 1.00 0.00 ? 36 ALA A CA   8  
ATOM 10567 C C    . ALA A 1 36 ? 105.858 -15.773 -10.683 1.00 0.00 ? 36 ALA A C    8  
ATOM 10568 O O    . ALA A 1 36 ? 105.891 -15.060 -11.686 1.00 0.00 ? 36 ALA A O    8  
ATOM 10569 C CB   . ALA A 1 36 ? 107.203 -17.639 -9.713  1.00 0.00 ? 36 ALA A CB   8  
ATOM 10570 H H    . ALA A 1 36 ? 106.265 -18.337 -12.600 1.00 0.00 ? 36 ALA A H    8  
ATOM 10571 H HA   . ALA A 1 36 ? 105.263 -17.823 -10.593 1.00 0.00 ? 36 ALA A HA   8  
ATOM 10572 H HB1  . ALA A 1 36 ? 107.313 -18.713 -9.680  1.00 0.00 ? 36 ALA A HB1  8  
ATOM 10573 H HB2  . ALA A 1 36 ? 106.875 -17.282 -8.748  1.00 0.00 ? 36 ALA A HB2  8  
ATOM 10574 H HB3  . ALA A 1 36 ? 108.153 -17.188 -9.959  1.00 0.00 ? 36 ALA A HB3  8  
ATOM 10575 N N    . GLU A 1 37 ? 105.556 -15.309 -9.476  1.00 0.00 ? 37 GLU A N    8  
ATOM 10576 C CA   . GLU A 1 37 ? 105.241 -13.900 -9.267  1.00 0.00 ? 37 GLU A CA   8  
ATOM 10577 C C    . GLU A 1 37 ? 104.050 -13.493 -10.135 1.00 0.00 ? 37 GLU A C    8  
ATOM 10578 O O    . GLU A 1 37 ? 103.697 -12.317 -10.215 1.00 0.00 ? 37 GLU A O    8  
ATOM 10579 C CB   . GLU A 1 37 ? 106.467 -13.039 -9.613  1.00 0.00 ? 37 GLU A CB   8  
ATOM 10580 C CG   . GLU A 1 37 ? 106.391 -11.696 -8.879  1.00 0.00 ? 37 GLU A CG   8  
ATOM 10581 C CD   . GLU A 1 37 ? 106.643 -11.902 -7.390  1.00 0.00 ? 37 GLU A CD   8  
ATOM 10582 O OE1  . GLU A 1 37 ? 107.229 -12.914 -7.042  1.00 0.00 ? 37 GLU A OE1  8  
ATOM 10583 O OE2  . GLU A 1 37 ? 106.247 -11.045 -6.618  1.00 0.00 ? 37 GLU A OE2  8  
ATOM 10584 H H    . GLU A 1 37 ? 105.544 -15.924 -8.712  1.00 0.00 ? 37 GLU A H    8  
ATOM 10585 H HA   . GLU A 1 37 ? 104.985 -13.752 -8.229  1.00 0.00 ? 37 GLU A HA   8  
ATOM 10586 H HB2  . GLU A 1 37 ? 107.364 -13.560 -9.310  1.00 0.00 ? 37 GLU A HB2  8  
ATOM 10587 H HB3  . GLU A 1 37 ? 106.499 -12.863 -10.678 1.00 0.00 ? 37 GLU A HB3  8  
ATOM 10588 H HG2  . GLU A 1 37 ? 107.140 -11.026 -9.279  1.00 0.00 ? 37 GLU A HG2  8  
ATOM 10589 H HG3  . GLU A 1 37 ? 105.413 -11.262 -9.019  1.00 0.00 ? 37 GLU A HG3  8  
ATOM 10590 N N    . VAL A 1 38 ? 103.435 -14.478 -10.780 1.00 0.00 ? 38 VAL A N    8  
ATOM 10591 C CA   . VAL A 1 38 ? 102.285 -14.219 -11.639 1.00 0.00 ? 38 VAL A CA   8  
ATOM 10592 C C    . VAL A 1 38 ? 101.182 -13.511 -10.858 1.00 0.00 ? 38 VAL A C    8  
ATOM 10593 O O    . VAL A 1 38 ? 100.368 -12.787 -11.431 1.00 0.00 ? 38 VAL A O    8  
ATOM 10594 C CB   . VAL A 1 38 ? 101.747 -15.536 -12.202 1.00 0.00 ? 38 VAL A CB   8  
ATOM 10595 C CG1  . VAL A 1 38 ? 102.812 -16.184 -13.089 1.00 0.00 ? 38 VAL A CG1  8  
ATOM 10596 C CG2  . VAL A 1 38 ? 101.404 -16.481 -11.047 1.00 0.00 ? 38 VAL A CG2  8  
ATOM 10597 H H    . VAL A 1 38 ? 103.760 -15.397 -10.677 1.00 0.00 ? 38 VAL A H    8  
ATOM 10598 H HA   . VAL A 1 38 ? 102.593 -13.590 -12.459 1.00 0.00 ? 38 VAL A HA   8  
ATOM 10599 H HB   . VAL A 1 38 ? 100.860 -15.342 -12.787 1.00 0.00 ? 38 VAL A HB   8  
ATOM 10600 H HG11 . VAL A 1 38 ? 103.663 -16.463 -12.487 1.00 0.00 ? 38 VAL A HG11 8  
ATOM 10601 H HG12 . VAL A 1 38 ? 103.122 -15.483 -13.850 1.00 0.00 ? 38 VAL A HG12 8  
ATOM 10602 H HG13 . VAL A 1 38 ? 102.400 -17.066 -13.559 1.00 0.00 ? 38 VAL A HG13 8  
ATOM 10603 H HG21 . VAL A 1 38 ? 102.288 -16.660 -10.454 1.00 0.00 ? 38 VAL A HG21 8  
ATOM 10604 H HG22 . VAL A 1 38 ? 101.041 -17.417 -11.445 1.00 0.00 ? 38 VAL A HG22 8  
ATOM 10605 H HG23 . VAL A 1 38 ? 100.640 -16.031 -10.430 1.00 0.00 ? 38 VAL A HG23 8  
ATOM 10606 N N    . LEU A 1 39 ? 101.162 -13.729 -9.548  1.00 0.00 ? 39 LEU A N    8  
ATOM 10607 C CA   . LEU A 1 39 ? 100.155 -13.113 -8.690  1.00 0.00 ? 39 LEU A CA   8  
ATOM 10608 C C    . LEU A 1 39 ? 100.032 -11.621 -8.990  1.00 0.00 ? 39 LEU A C    8  
ATOM 10609 O O    . LEU A 1 39 ? 98.951  -11.041 -8.872  1.00 0.00 ? 39 LEU A O    8  
ATOM 10610 C CB   . LEU A 1 39 ? 100.538 -13.324 -7.219  1.00 0.00 ? 39 LEU A CB   8  
ATOM 10611 C CG   . LEU A 1 39 ? 99.561  -12.587 -6.290  1.00 0.00 ? 39 LEU A CG   8  
ATOM 10612 C CD1  . LEU A 1 39 ? 98.117  -13.019 -6.587  1.00 0.00 ? 39 LEU A CD1  8  
ATOM 10613 C CD2  . LEU A 1 39 ? 99.907  -12.928 -4.837  1.00 0.00 ? 39 LEU A CD2  8  
ATOM 10614 H H    . LEU A 1 39 ? 101.836 -14.319 -9.149  1.00 0.00 ? 39 LEU A H    8  
ATOM 10615 H HA   . LEU A 1 39 ? 99.205  -13.589 -8.877  1.00 0.00 ? 39 LEU A HA   8  
ATOM 10616 H HB2  . LEU A 1 39 ? 100.516 -14.379 -6.993  1.00 0.00 ? 39 LEU A HB2  8  
ATOM 10617 H HB3  . LEU A 1 39 ? 101.536 -12.946 -7.054  1.00 0.00 ? 39 LEU A HB3  8  
ATOM 10618 H HG   . LEU A 1 39 ? 99.654  -11.521 -6.438  1.00 0.00 ? 39 LEU A HG   8  
ATOM 10619 H HD11 . LEU A 1 39 ? 98.091  -14.080 -6.792  1.00 0.00 ? 39 LEU A HD11 8  
ATOM 10620 H HD12 . LEU A 1 39 ? 97.749  -12.478 -7.445  1.00 0.00 ? 39 LEU A HD12 8  
ATOM 10621 H HD13 . LEU A 1 39 ? 97.489  -12.803 -5.734  1.00 0.00 ? 39 LEU A HD13 8  
ATOM 10622 H HD21 . LEU A 1 39 ? 99.306  -12.324 -4.173  1.00 0.00 ? 39 LEU A HD21 8  
ATOM 10623 H HD22 . LEU A 1 39 ? 100.953 -12.725 -4.659  1.00 0.00 ? 39 LEU A HD22 8  
ATOM 10624 H HD23 . LEU A 1 39 ? 99.707  -13.973 -4.655  1.00 0.00 ? 39 LEU A HD23 8  
ATOM 10625 N N    . GLY A 1 40 ? 101.144 -11.002 -9.372  1.00 0.00 ? 40 GLY A N    8  
ATOM 10626 C CA   . GLY A 1 40 ? 101.142 -9.575  -9.676  1.00 0.00 ? 40 GLY A CA   8  
ATOM 10627 C C    . GLY A 1 40 ? 100.239 -9.261  -10.866 1.00 0.00 ? 40 GLY A C    8  
ATOM 10628 O O    . GLY A 1 40 ? 99.359  -8.408  -10.776 1.00 0.00 ? 40 GLY A O    8  
ATOM 10629 H H    . GLY A 1 40 ? 101.979 -11.510 -9.446  1.00 0.00 ? 40 GLY A H    8  
ATOM 10630 H HA2  . GLY A 1 40 ? 100.792 -9.030  -8.811  1.00 0.00 ? 40 GLY A HA2  8  
ATOM 10631 H HA3  . GLY A 1 40 ? 102.149 -9.262  -9.907  1.00 0.00 ? 40 GLY A HA3  8  
ATOM 10632 N N    . ILE A 1 41 ? 100.460 -9.956  -11.978 1.00 0.00 ? 41 ILE A N    8  
ATOM 10633 C CA   . ILE A 1 41 ? 99.658  -9.733  -13.178 1.00 0.00 ? 41 ILE A CA   8  
ATOM 10634 C C    . ILE A 1 41 ? 98.175  -9.924  -12.871 1.00 0.00 ? 41 ILE A C    8  
ATOM 10635 O O    . ILE A 1 41 ? 97.332  -9.105  -13.259 1.00 0.00 ? 41 ILE A O    8  
ATOM 10636 C CB   . ILE A 1 41 ? 100.081 -10.712 -14.276 1.00 0.00 ? 41 ILE A CB   8  
ATOM 10637 C CG1  . ILE A 1 41 ? 101.611 -10.735 -14.393 1.00 0.00 ? 41 ILE A CG1  8  
ATOM 10638 C CG2  . ILE A 1 41 ? 99.474  -10.276 -15.612 1.00 0.00 ? 41 ILE A CG2  8  
ATOM 10639 C CD1  . ILE A 1 41 ? 102.154 -9.308  -14.519 1.00 0.00 ? 41 ILE A CD1  8  
ATOM 10640 H H    . ILE A 1 41 ? 101.176 -10.624 -11.993 1.00 0.00 ? 41 ILE A H    8  
ATOM 10641 H HA   . ILE A 1 41 ? 99.816  -8.724  -13.526 1.00 0.00 ? 41 ILE A HA   8  
ATOM 10642 H HB   . ILE A 1 41 ? 99.724  -11.701 -14.029 1.00 0.00 ? 41 ILE A HB   8  
ATOM 10643 H HG12 . ILE A 1 41 ? 102.029 -11.200 -13.511 1.00 0.00 ? 41 ILE A HG12 8  
ATOM 10644 H HG13 . ILE A 1 41 ? 101.895 -11.304 -15.265 1.00 0.00 ? 41 ILE A HG13 8  
ATOM 10645 H HG21 . ILE A 1 41 ? 99.849  -9.299  -15.878 1.00 0.00 ? 41 ILE A HG21 8  
ATOM 10646 H HG22 . ILE A 1 41 ? 98.398  -10.237 -15.524 1.00 0.00 ? 41 ILE A HG22 8  
ATOM 10647 H HG23 . ILE A 1 41 ? 99.745  -10.986 -16.380 1.00 0.00 ? 41 ILE A HG23 8  
ATOM 10648 H HD11 . ILE A 1 41 ? 101.529 -8.740  -15.194 1.00 0.00 ? 41 ILE A HD11 8  
ATOM 10649 H HD12 . ILE A 1 41 ? 103.161 -9.340  -14.906 1.00 0.00 ? 41 ILE A HD12 8  
ATOM 10650 H HD13 . ILE A 1 41 ? 102.157 -8.836  -13.548 1.00 0.00 ? 41 ILE A HD13 8  
ATOM 10651 N N    . ILE A 1 42 ? 97.862  -11.008 -12.171 1.00 0.00 ? 42 ILE A N    8  
ATOM 10652 C CA   . ILE A 1 42 ? 96.482  -11.297 -11.817 1.00 0.00 ? 42 ILE A CA   8  
ATOM 10653 C C    . ILE A 1 42 ? 95.869  -10.111 -11.077 1.00 0.00 ? 42 ILE A C    8  
ATOM 10654 O O    . ILE A 1 42 ? 94.748  -9.703  -11.368 1.00 0.00 ? 42 ILE A O    8  
ATOM 10655 C CB   . ILE A 1 42 ? 96.418  -12.553 -10.942 1.00 0.00 ? 42 ILE A CB   8  
ATOM 10656 C CG1  . ILE A 1 42 ? 96.819  -13.772 -11.778 1.00 0.00 ? 42 ILE A CG1  8  
ATOM 10657 C CG2  . ILE A 1 42 ? 94.992  -12.747 -10.418 1.00 0.00 ? 42 ILE A CG2  8  
ATOM 10658 C CD1  . ILE A 1 42 ? 97.026  -14.984 -10.866 1.00 0.00 ? 42 ILE A CD1  8  
ATOM 10659 H H    . ILE A 1 42 ? 98.571  -11.622 -11.889 1.00 0.00 ? 42 ILE A H    8  
ATOM 10660 H HA   . ILE A 1 42 ? 95.920  -11.475 -12.720 1.00 0.00 ? 42 ILE A HA   8  
ATOM 10661 H HB   . ILE A 1 42 ? 97.097  -12.445 -10.108 1.00 0.00 ? 42 ILE A HB   8  
ATOM 10662 H HG12 . ILE A 1 42 ? 96.039  -13.989 -12.494 1.00 0.00 ? 42 ILE A HG12 8  
ATOM 10663 H HG13 . ILE A 1 42 ? 97.739  -13.560 -12.303 1.00 0.00 ? 42 ILE A HG13 8  
ATOM 10664 H HG21 . ILE A 1 42 ? 94.792  -12.023 -9.642  1.00 0.00 ? 42 ILE A HG21 8  
ATOM 10665 H HG22 . ILE A 1 42 ? 94.889  -13.744 -10.014 1.00 0.00 ? 42 ILE A HG22 8  
ATOM 10666 H HG23 . ILE A 1 42 ? 94.290  -12.611 -11.227 1.00 0.00 ? 42 ILE A HG23 8  
ATOM 10667 H HD11 . ILE A 1 42 ? 97.982  -14.905 -10.373 1.00 0.00 ? 42 ILE A HD11 8  
ATOM 10668 H HD12 . ILE A 1 42 ? 97.000  -15.887 -11.457 1.00 0.00 ? 42 ILE A HD12 8  
ATOM 10669 H HD13 . ILE A 1 42 ? 96.240  -15.019 -10.125 1.00 0.00 ? 42 ILE A HD13 8  
ATOM 10670 N N    . SER A 1 43 ? 96.614  -9.564  -10.124 1.00 0.00 ? 43 SER A N    8  
ATOM 10671 C CA   . SER A 1 43 ? 96.131  -8.425  -9.349  1.00 0.00 ? 43 SER A CA   8  
ATOM 10672 C C    . SER A 1 43 ? 95.835  -7.231  -10.255 1.00 0.00 ? 43 SER A C    8  
ATOM 10673 O O    . SER A 1 43 ? 94.840  -6.532  -10.066 1.00 0.00 ? 43 SER A O    8  
ATOM 10674 C CB   . SER A 1 43 ? 97.173  -8.026  -8.305  1.00 0.00 ? 43 SER A CB   8  
ATOM 10675 O OG   . SER A 1 43 ? 96.674  -6.940  -7.536  1.00 0.00 ? 43 SER A OG   8  
ATOM 10676 H H    . SER A 1 43 ? 97.503  -9.932  -9.935  1.00 0.00 ? 43 SER A H    8  
ATOM 10677 H HA   . SER A 1 43 ? 95.222  -8.710  -8.840  1.00 0.00 ? 43 SER A HA   8  
ATOM 10678 H HB2  . SER A 1 43 ? 97.370  -8.861  -7.652  1.00 0.00 ? 43 SER A HB2  8  
ATOM 10679 H HB3  . SER A 1 43 ? 98.089  -7.738  -8.803  1.00 0.00 ? 43 SER A HB3  8  
ATOM 10680 H HG   . SER A 1 43 ? 95.836  -7.207  -7.152  1.00 0.00 ? 43 SER A HG   8  
ATOM 10681 N N    . ILE A 1 44 ? 96.707  -6.996  -11.231 1.00 0.00 ? 44 ILE A N    8  
ATOM 10682 C CA   . ILE A 1 44 ? 96.529  -5.874  -12.150 1.00 0.00 ? 44 ILE A CA   8  
ATOM 10683 C C    . ILE A 1 44 ? 95.181  -5.958  -12.868 1.00 0.00 ? 44 ILE A C    8  
ATOM 10684 O O    . ILE A 1 44 ? 94.380  -5.010  -12.848 1.00 0.00 ? 44 ILE A O    8  
ATOM 10685 C CB   . ILE A 1 44 ? 97.658  -5.875  -13.186 1.00 0.00 ? 44 ILE A CB   8  
ATOM 10686 C CG1  . ILE A 1 44 ? 99.026  -5.709  -12.480 1.00 0.00 ? 44 ILE A CG1  8  
ATOM 10687 C CG2  . ILE A 1 44 ? 97.437  -4.742  -14.194 1.00 0.00 ? 44 ILE A CG2  8  
ATOM 10688 C CD1  . ILE A 1 44 ? 99.349  -4.228  -12.223 1.00 0.00 ? 44 ILE A CD1  8  
ATOM 10689 H H    . ILE A 1 44 ? 97.487  -7.583  -11.331 1.00 0.00 ? 44 ILE A H    8  
ATOM 10690 H HA   . ILE A 1 44 ? 96.571  -4.956  -11.590 1.00 0.00 ? 44 ILE A HA   8  
ATOM 10691 H HB   . ILE A 1 44 ? 97.644  -6.817  -13.715 1.00 0.00 ? 44 ILE A HB   8  
ATOM 10692 H HG12 . ILE A 1 44 ? 99.009  -6.233  -11.538 1.00 0.00 ? 44 ILE A HG12 8  
ATOM 10693 H HG13 . ILE A 1 44 ? 99.799  -6.134  -13.106 1.00 0.00 ? 44 ILE A HG13 8  
ATOM 10694 H HG21 . ILE A 1 44 ? 98.357  -4.553  -14.722 1.00 0.00 ? 44 ILE A HG21 8  
ATOM 10695 H HG22 . ILE A 1 44 ? 97.129  -3.847  -13.672 1.00 0.00 ? 44 ILE A HG22 8  
ATOM 10696 H HG23 . ILE A 1 44 ? 96.669  -5.030  -14.898 1.00 0.00 ? 44 ILE A HG23 8  
ATOM 10697 H HD11 . ILE A 1 44 ? 98.440  -3.683  -12.029 1.00 0.00 ? 44 ILE A HD11 8  
ATOM 10698 H HD12 . ILE A 1 44 ? 99.837  -3.811  -13.091 1.00 0.00 ? 44 ILE A HD12 8  
ATOM 10699 H HD13 . ILE A 1 44 ? 100.005 -4.147  -11.369 1.00 0.00 ? 44 ILE A HD13 8  
ATOM 10700 N N    . VAL A 1 45 ? 94.922  -7.094  -13.503 1.00 0.00 ? 45 VAL A N    8  
ATOM 10701 C CA   . VAL A 1 45 ? 93.662  -7.264  -14.217 1.00 0.00 ? 45 VAL A CA   8  
ATOM 10702 C C    . VAL A 1 45 ? 92.490  -7.236  -13.237 1.00 0.00 ? 45 VAL A C    8  
ATOM 10703 O O    . VAL A 1 45 ? 91.372  -6.864  -13.598 1.00 0.00 ? 45 VAL A O    8  
ATOM 10704 C CB   . VAL A 1 45 ? 93.671  -8.578  -15.002 1.00 0.00 ? 45 VAL A CB   8  
ATOM 10705 C CG1  . VAL A 1 45 ? 94.013  -9.729  -14.064 1.00 0.00 ? 45 VAL A CG1  8  
ATOM 10706 C CG2  . VAL A 1 45 ? 92.294  -8.815  -15.627 1.00 0.00 ? 45 VAL A CG2  8  
ATOM 10707 H H    . VAL A 1 45 ? 95.582  -7.825  -13.492 1.00 0.00 ? 45 VAL A H    8  
ATOM 10708 H HA   . VAL A 1 45 ? 93.550  -6.449  -14.914 1.00 0.00 ? 45 VAL A HA   8  
ATOM 10709 H HB   . VAL A 1 45 ? 94.416  -8.521  -15.782 1.00 0.00 ? 45 VAL A HB   8  
ATOM 10710 H HG11 . VAL A 1 45 ? 93.318  -9.742  -13.239 1.00 0.00 ? 45 VAL A HG11 8  
ATOM 10711 H HG12 . VAL A 1 45 ? 95.016  -9.592  -13.692 1.00 0.00 ? 45 VAL A HG12 8  
ATOM 10712 H HG13 . VAL A 1 45 ? 93.953  -10.663 -14.603 1.00 0.00 ? 45 VAL A HG13 8  
ATOM 10713 H HG21 . VAL A 1 45 ? 91.587  -9.080  -14.855 1.00 0.00 ? 45 VAL A HG21 8  
ATOM 10714 H HG22 . VAL A 1 45 ? 92.360  -9.617  -16.347 1.00 0.00 ? 45 VAL A HG22 8  
ATOM 10715 H HG23 . VAL A 1 45 ? 91.966  -7.913  -16.123 1.00 0.00 ? 45 VAL A HG23 8  
ATOM 10716 N N    . LEU A 1 46 ? 92.754  -7.636  -11.995 1.00 0.00 ? 46 LEU A N    8  
ATOM 10717 C CA   . LEU A 1 46 ? 91.716  -7.659  -10.969 1.00 0.00 ? 46 LEU A CA   8  
ATOM 10718 C C    . LEU A 1 46 ? 91.250  -6.241  -10.617 1.00 0.00 ? 46 LEU A C    8  
ATOM 10719 O O    . LEU A 1 46 ? 90.048  -5.983  -10.526 1.00 0.00 ? 46 LEU A O    8  
ATOM 10720 C CB   . LEU A 1 46 ? 92.251  -8.369  -9.704  1.00 0.00 ? 46 LEU A CB   8  
ATOM 10721 C CG   . LEU A 1 46 ? 91.123  -9.103  -8.951  1.00 0.00 ? 46 LEU A CG   8  
ATOM 10722 C CD1  . LEU A 1 46 ? 89.965  -8.140  -8.675  1.00 0.00 ? 46 LEU A CD1  8  
ATOM 10723 C CD2  . LEU A 1 46 ? 90.613  -10.312 -9.770  1.00 0.00 ? 46 LEU A CD2  8  
ATOM 10724 H H    . LEU A 1 46 ? 93.663  -7.925  -11.766 1.00 0.00 ? 46 LEU A H    8  
ATOM 10725 H HA   . LEU A 1 46 ? 90.874  -8.211  -11.352 1.00 0.00 ? 46 LEU A HA   8  
ATOM 10726 H HB2  . LEU A 1 46 ? 93.003  -9.083  -9.993  1.00 0.00 ? 46 LEU A HB2  8  
ATOM 10727 H HB3  . LEU A 1 46 ? 92.700  -7.640  -9.043  1.00 0.00 ? 46 LEU A HB3  8  
ATOM 10728 H HG   . LEU A 1 46 ? 91.511  -9.457  -8.006  1.00 0.00 ? 46 LEU A HG   8  
ATOM 10729 H HD11 . LEU A 1 46 ? 89.379  -8.018  -9.570  1.00 0.00 ? 46 LEU A HD11 8  
ATOM 10730 H HD12 . LEU A 1 46 ? 90.355  -7.182  -8.365  1.00 0.00 ? 46 LEU A HD12 8  
ATOM 10731 H HD13 . LEU A 1 46 ? 89.341  -8.543  -7.891  1.00 0.00 ? 46 LEU A HD13 8  
ATOM 10732 H HD21 . LEU A 1 46 ? 89.794  -10.011 -10.409 1.00 0.00 ? 46 LEU A HD21 8  
ATOM 10733 H HD22 . LEU A 1 46 ? 90.269  -11.078 -9.092  1.00 0.00 ? 46 LEU A HD22 8  
ATOM 10734 H HD23 . LEU A 1 46 ? 91.412  -10.712 -10.377 1.00 0.00 ? 46 LEU A HD23 8  
ATOM 10735 N N    . VAL A 1 47 ? 92.199  -5.322  -10.410 1.00 0.00 ? 47 VAL A N    8  
ATOM 10736 C CA   . VAL A 1 47 ? 91.840  -3.955  -10.057 1.00 0.00 ? 47 VAL A CA   8  
ATOM 10737 C C    . VAL A 1 47 ? 91.149  -3.263  -11.225 1.00 0.00 ? 47 VAL A C    8  
ATOM 10738 O O    . VAL A 1 47 ? 90.270  -2.427  -11.024 1.00 0.00 ? 47 VAL A O    8  
ATOM 10739 C CB   . VAL A 1 47 ? 93.080  -3.163  -9.621  1.00 0.00 ? 47 VAL A CB   8  
ATOM 10740 C CG1  . VAL A 1 47 ? 94.172  -3.274  -10.679 1.00 0.00 ? 47 VAL A CG1  8  
ATOM 10741 C CG2  . VAL A 1 47 ? 92.708  -1.689  -9.426  1.00 0.00 ? 47 VAL A CG2  8  
ATOM 10742 H H    . VAL A 1 47 ? 93.143  -5.566  -10.493 1.00 0.00 ? 47 VAL A H    8  
ATOM 10743 H HA   . VAL A 1 47 ? 91.157  -3.990  -9.223  1.00 0.00 ? 47 VAL A HA   8  
ATOM 10744 H HB   . VAL A 1 47 ? 93.449  -3.564  -8.689  1.00 0.00 ? 47 VAL A HB   8  
ATOM 10745 H HG11 . VAL A 1 47 ? 94.947  -2.551  -10.474 1.00 0.00 ? 47 VAL A HG11 8  
ATOM 10746 H HG12 . VAL A 1 47 ? 93.751  -3.084  -11.655 1.00 0.00 ? 47 VAL A HG12 8  
ATOM 10747 H HG13 . VAL A 1 47 ? 94.588  -4.266  -10.650 1.00 0.00 ? 47 VAL A HG13 8  
ATOM 10748 H HG21 . VAL A 1 47 ? 92.561  -1.225  -10.390 1.00 0.00 ? 47 VAL A HG21 8  
ATOM 10749 H HG22 . VAL A 1 47 ? 93.505  -1.183  -8.901  1.00 0.00 ? 47 VAL A HG22 8  
ATOM 10750 H HG23 . VAL A 1 47 ? 91.797  -1.621  -8.850  1.00 0.00 ? 47 VAL A HG23 8  
ATOM 10751 N N    . ALA A 1 48 ? 91.548  -3.605  -12.449 1.00 0.00 ? 48 ALA A N    8  
ATOM 10752 C CA   . ALA A 1 48 ? 90.938  -2.983  -13.623 1.00 0.00 ? 48 ALA A CA   8  
ATOM 10753 C C    . ALA A 1 48 ? 89.474  -3.397  -13.784 1.00 0.00 ? 48 ALA A C    8  
ATOM 10754 O O    . ALA A 1 48 ? 88.617  -2.561  -14.071 1.00 0.00 ? 48 ALA A O    8  
ATOM 10755 C CB   . ALA A 1 48 ? 91.715  -3.358  -14.885 1.00 0.00 ? 48 ALA A CB   8  
ATOM 10756 H H    . ALA A 1 48 ? 92.263  -4.276  -12.563 1.00 0.00 ? 48 ALA A H    8  
ATOM 10757 H HA   . ALA A 1 48 ? 90.973  -1.914  -13.503 1.00 0.00 ? 48 ALA A HA   8  
ATOM 10758 H HB1  . ALA A 1 48 ? 91.479  -2.658  -15.673 1.00 0.00 ? 48 ALA A HB1  8  
ATOM 10759 H HB2  . ALA A 1 48 ? 91.439  -4.354  -15.196 1.00 0.00 ? 48 ALA A HB2  8  
ATOM 10760 H HB3  . ALA A 1 48 ? 92.774  -3.323  -14.678 1.00 0.00 ? 48 ALA A HB3  8  
ATOM 10761 N N    . THR A 1 49 ? 89.195  -4.685  -13.619 1.00 0.00 ? 49 THR A N    8  
ATOM 10762 C CA   . THR A 1 49 ? 87.829  -5.182  -13.774 1.00 0.00 ? 49 THR A CA   8  
ATOM 10763 C C    . THR A 1 49 ? 86.900  -4.642  -12.685 1.00 0.00 ? 49 THR A C    8  
ATOM 10764 O O    . THR A 1 49 ? 85.832  -4.106  -12.983 1.00 0.00 ? 49 THR A O    8  
ATOM 10765 C CB   . THR A 1 49 ? 87.828  -6.713  -13.736 1.00 0.00 ? 49 THR A CB   8  
ATOM 10766 O OG1  . THR A 1 49 ? 88.595  -7.157  -12.626 1.00 0.00 ? 49 THR A OG1  8  
ATOM 10767 C CG2  . THR A 1 49 ? 88.434  -7.260  -15.031 1.00 0.00 ? 49 THR A CG2  8  
ATOM 10768 H H    . THR A 1 49 ? 89.918  -5.314  -13.406 1.00 0.00 ? 49 THR A H    8  
ATOM 10769 H HA   . THR A 1 49 ? 87.454  -4.862  -14.735 1.00 0.00 ? 49 THR A HA   8  
ATOM 10770 H HB   . THR A 1 49 ? 86.814  -7.070  -13.640 1.00 0.00 ? 49 THR A HB   8  
ATOM 10771 H HG1  . THR A 1 49 ? 89.418  -6.663  -12.618 1.00 0.00 ? 49 THR A HG1  8  
ATOM 10772 H HG21 . THR A 1 49 ? 88.360  -8.337  -15.034 1.00 0.00 ? 49 THR A HG21 8  
ATOM 10773 H HG22 . THR A 1 49 ? 89.471  -6.969  -15.093 1.00 0.00 ? 49 THR A HG22 8  
ATOM 10774 H HG23 . THR A 1 49 ? 87.896  -6.859  -15.878 1.00 0.00 ? 49 THR A HG23 8  
ATOM 10775 N N    . VAL A 1 50 ? 87.300  -4.796  -11.426 1.00 0.00 ? 50 VAL A N    8  
ATOM 10776 C CA   . VAL A 1 50 ? 86.471  -4.327  -10.315 1.00 0.00 ? 50 VAL A CA   8  
ATOM 10777 C C    . VAL A 1 50 ? 86.339  -2.808  -10.327 1.00 0.00 ? 50 VAL A C    8  
ATOM 10778 O O    . VAL A 1 50 ? 85.283  -2.272  -10.006 1.00 0.00 ? 50 VAL A O    8  
ATOM 10779 C CB   . VAL A 1 50 ? 87.078  -4.768  -8.981  1.00 0.00 ? 50 VAL A CB   8  
ATOM 10780 C CG1  . VAL A 1 50 ? 87.208  -6.297  -8.953  1.00 0.00 ? 50 VAL A CG1  8  
ATOM 10781 C CG2  . VAL A 1 50 ? 88.458  -4.114  -8.814  1.00 0.00 ? 50 VAL A CG2  8  
ATOM 10782 H H    . VAL A 1 50 ? 88.157  -5.238  -11.239 1.00 0.00 ? 50 VAL A H    8  
ATOM 10783 H HA   . VAL A 1 50 ? 85.488  -4.763  -10.407 1.00 0.00 ? 50 VAL A HA   8  
ATOM 10784 H HB   . VAL A 1 50 ? 86.430  -4.452  -8.175  1.00 0.00 ? 50 VAL A HB   8  
ATOM 10785 H HG11 . VAL A 1 50 ? 86.248  -6.733  -8.716  1.00 0.00 ? 50 VAL A HG11 8  
ATOM 10786 H HG12 . VAL A 1 50 ? 87.927  -6.585  -8.200  1.00 0.00 ? 50 VAL A HG12 8  
ATOM 10787 H HG13 . VAL A 1 50 ? 87.535  -6.652  -9.919  1.00 0.00 ? 50 VAL A HG13 8  
ATOM 10788 H HG21 . VAL A 1 50 ? 88.949  -4.057  -9.774  1.00 0.00 ? 50 VAL A HG21 8  
ATOM 10789 H HG22 . VAL A 1 50 ? 89.062  -4.701  -8.136  1.00 0.00 ? 50 VAL A HG22 8  
ATOM 10790 H HG23 . VAL A 1 50 ? 88.338  -3.118  -8.414  1.00 0.00 ? 50 VAL A HG23 8  
ATOM 10791 N N    . LEU A 1 51 ? 87.412  -2.115  -10.688 1.00 0.00 ? 51 LEU A N    8  
ATOM 10792 C CA   . LEU A 1 51 ? 87.379  -0.659  -10.721 1.00 0.00 ? 51 LEU A CA   8  
ATOM 10793 C C    . LEU A 1 51 ? 86.412  -0.171  -11.784 1.00 0.00 ? 51 LEU A C    8  
ATOM 10794 O O    . LEU A 1 51 ? 85.657  0.769   -11.555 1.00 0.00 ? 51 LEU A O    8  
ATOM 10795 C CB   . LEU A 1 51 ? 88.787  -0.107  -10.994 1.00 0.00 ? 51 LEU A CB   8  
ATOM 10796 C CG   . LEU A 1 51 ? 88.754  1.444   -11.116 1.00 0.00 ? 51 LEU A CG   8  
ATOM 10797 C CD1  . LEU A 1 51 ? 89.987  2.053   -10.433 1.00 0.00 ? 51 LEU A CD1  8  
ATOM 10798 C CD2  . LEU A 1 51 ? 88.753  1.865   -12.597 1.00 0.00 ? 51 LEU A CD2  8  
ATOM 10799 H H    . LEU A 1 51 ? 88.237  -2.588  -10.931 1.00 0.00 ? 51 LEU A H    8  
ATOM 10800 H HA   . LEU A 1 51 ? 87.041  -0.294  -9.764  1.00 0.00 ? 51 LEU A HA   8  
ATOM 10801 H HB2  . LEU A 1 51 ? 89.435  -0.398  -10.177 1.00 0.00 ? 51 LEU A HB2  8  
ATOM 10802 H HB3  . LEU A 1 51 ? 89.165  -0.538  -11.910 1.00 0.00 ? 51 LEU A HB3  8  
ATOM 10803 H HG   . LEU A 1 51 ? 87.865  1.831   -10.635 1.00 0.00 ? 51 LEU A HG   8  
ATOM 10804 H HD11 . LEU A 1 51 ? 89.896  1.945   -9.363  1.00 0.00 ? 51 LEU A HD11 8  
ATOM 10805 H HD12 . LEU A 1 51 ? 90.057  3.100   -10.685 1.00 0.00 ? 51 LEU A HD12 8  
ATOM 10806 H HD13 . LEU A 1 51 ? 90.876  1.542   -10.773 1.00 0.00 ? 51 LEU A HD13 8  
ATOM 10807 H HD21 . LEU A 1 51 ? 88.082  1.233   -13.155 1.00 0.00 ? 51 LEU A HD21 8  
ATOM 10808 H HD22 . LEU A 1 51 ? 89.751  1.771   -13.001 1.00 0.00 ? 51 LEU A HD22 8  
ATOM 10809 H HD23 . LEU A 1 51 ? 88.430  2.893   -12.678 1.00 0.00 ? 51 LEU A HD23 8  
ATOM 10810 N N    . LYS A 1 52 ? 86.435  -0.810  -12.942 1.00 0.00 ? 52 LYS A N    8  
ATOM 10811 C CA   . LYS A 1 52 ? 85.550  -0.418  -14.027 1.00 0.00 ? 52 LYS A CA   8  
ATOM 10812 C C    . LYS A 1 52 ? 84.088  -0.610  -13.633 1.00 0.00 ? 52 LYS A C    8  
ATOM 10813 O O    . LYS A 1 52 ? 83.283  0.302   -13.768 1.00 0.00 ? 52 LYS A O    8  
ATOM 10814 C CB   . LYS A 1 52 ? 85.860  -1.254  -15.275 1.00 0.00 ? 52 LYS A CB   8  
ATOM 10815 C CG   . LYS A 1 52 ? 85.113  -0.691  -16.502 1.00 0.00 ? 52 LYS A CG   8  
ATOM 10816 C CD   . LYS A 1 52 ? 85.949  0.407   -17.175 1.00 0.00 ? 52 LYS A CD   8  
ATOM 10817 C CE   . LYS A 1 52 ? 85.056  1.231   -18.104 1.00 0.00 ? 52 LYS A CE   8  
ATOM 10818 N NZ   . LYS A 1 52 ? 84.494  0.350   -19.167 1.00 0.00 ? 52 LYS A NZ   8  
ATOM 10819 H H    . LYS A 1 52 ? 87.060  -1.555  -13.072 1.00 0.00 ? 52 LYS A H    8  
ATOM 10820 H HA   . LYS A 1 52 ? 85.712  0.623   -14.255 1.00 0.00 ? 52 LYS A HA   8  
ATOM 10821 H HB2  . LYS A 1 52 ? 86.926  -1.240  -15.459 1.00 0.00 ? 52 LYS A HB2  8  
ATOM 10822 H HB3  . LYS A 1 52 ? 85.544  -2.274  -15.103 1.00 0.00 ? 52 LYS A HB3  8  
ATOM 10823 H HG2  . LYS A 1 52 ? 84.941  -1.488  -17.211 1.00 0.00 ? 52 LYS A HG2  8  
ATOM 10824 H HG3  . LYS A 1 52 ? 84.163  -0.279  -16.195 1.00 0.00 ? 52 LYS A HG3  8  
ATOM 10825 H HD2  . LYS A 1 52 ? 86.377  1.052   -16.423 1.00 0.00 ? 52 LYS A HD2  8  
ATOM 10826 H HD3  . LYS A 1 52 ? 86.742  -0.047  -17.751 1.00 0.00 ? 52 LYS A HD3  8  
ATOM 10827 H HE2  . LYS A 1 52 ? 84.249  1.664   -17.532 1.00 0.00 ? 52 LYS A HE2  8  
ATOM 10828 H HE3  . LYS A 1 52 ? 85.638  2.019   -18.559 1.00 0.00 ? 52 LYS A HE3  8  
ATOM 10829 H HZ1  . LYS A 1 52 ? 83.464  0.279   -19.051 1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 10830 H HZ2  . LYS A 1 52 ? 84.920  -0.598  -19.091 1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 10831 H HZ3  . LYS A 1 52 ? 84.709  0.753   -20.101 1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 10832 N N    . THR A 1 53 ? 83.747  -1.802  -13.168 1.00 0.00 ? 53 THR A N    8  
ATOM 10833 C CA   . THR A 1 53 ? 82.366  -2.098  -12.792 1.00 0.00 ? 53 THR A CA   8  
ATOM 10834 C C    . THR A 1 53 ? 81.892  -1.284  -11.584 1.00 0.00 ? 53 THR A C    8  
ATOM 10835 O O    . THR A 1 53 ? 80.763  -0.788  -11.568 1.00 0.00 ? 53 THR A O    8  
ATOM 10836 C CB   . THR A 1 53 ? 82.231  -3.588  -12.474 1.00 0.00 ? 53 THR A CB   8  
ATOM 10837 O OG1  . THR A 1 53 ? 83.127  -3.930  -11.425 1.00 0.00 ? 53 THR A OG1  8  
ATOM 10838 C CG2  . THR A 1 53 ? 82.565  -4.410  -13.719 1.00 0.00 ? 53 THR A CG2  8  
ATOM 10839 H H    . THR A 1 53 ? 84.430  -2.504  -13.093 1.00 0.00 ? 53 THR A H    8  
ATOM 10840 H HA   . THR A 1 53 ? 81.726  -1.872  -13.630 1.00 0.00 ? 53 THR A HA   8  
ATOM 10841 H HB   . THR A 1 53 ? 81.218  -3.802  -12.168 1.00 0.00 ? 53 THR A HB   8  
ATOM 10842 H HG1  . THR A 1 53 ? 83.807  -4.500  -11.790 1.00 0.00 ? 53 THR A HG1  8  
ATOM 10843 H HG21 . THR A 1 53 ? 81.798  -4.261  -14.466 1.00 0.00 ? 53 THR A HG21 8  
ATOM 10844 H HG22 . THR A 1 53 ? 82.611  -5.458  -13.457 1.00 0.00 ? 53 THR A HG22 8  
ATOM 10845 H HG23 . THR A 1 53 ? 83.519  -4.095  -14.114 1.00 0.00 ? 53 THR A HG23 8  
ATOM 10846 N N    . ILE A 1 54 ? 82.733  -1.181  -10.560 1.00 0.00 ? 54 ILE A N    8  
ATOM 10847 C CA   . ILE A 1 54 ? 82.352  -0.467  -9.342  1.00 0.00 ? 54 ILE A CA   8  
ATOM 10848 C C    . ILE A 1 54 ? 82.128  1.022   -9.575  1.00 0.00 ? 54 ILE A C    8  
ATOM 10849 O O    . ILE A 1 54 ? 81.152  1.574   -9.079  1.00 0.00 ? 54 ILE A O    8  
ATOM 10850 C CB   . ILE A 1 54 ? 83.418  -0.678  -8.260  1.00 0.00 ? 54 ILE A CB   8  
ATOM 10851 C CG1  . ILE A 1 54 ? 83.424  -2.149  -7.835  1.00 0.00 ? 54 ILE A CG1  8  
ATOM 10852 C CG2  . ILE A 1 54 ? 83.108  0.197   -7.040  1.00 0.00 ? 54 ILE A CG2  8  
ATOM 10853 C CD1  . ILE A 1 54 ? 84.697  -2.445  -7.039  1.00 0.00 ? 54 ILE A CD1  8  
ATOM 10854 H H    . ILE A 1 54 ? 83.611  -1.617  -10.610 1.00 0.00 ? 54 ILE A H    8  
ATOM 10855 H HA   . ILE A 1 54 ? 81.423  -0.885  -8.992  1.00 0.00 ? 54 ILE A HA   8  
ATOM 10856 H HB   . ILE A 1 54 ? 84.388  -0.413  -8.654  1.00 0.00 ? 54 ILE A HB   8  
ATOM 10857 H HG12 . ILE A 1 54 ? 82.559  -2.349  -7.219  1.00 0.00 ? 54 ILE A HG12 8  
ATOM 10858 H HG13 . ILE A 1 54 ? 83.394  -2.779  -8.711  1.00 0.00 ? 54 ILE A HG13 8  
ATOM 10859 H HG21 . ILE A 1 54 ? 83.339  1.227   -7.268  1.00 0.00 ? 54 ILE A HG21 8  
ATOM 10860 H HG22 . ILE A 1 54 ? 83.706  -0.129  -6.202  1.00 0.00 ? 54 ILE A HG22 8  
ATOM 10861 H HG23 . ILE A 1 54 ? 82.061  0.109   -6.790  1.00 0.00 ? 54 ILE A HG23 8  
ATOM 10862 H HD11 . ILE A 1 54 ? 84.697  -1.861  -6.131  1.00 0.00 ? 54 ILE A HD11 8  
ATOM 10863 H HD12 . ILE A 1 54 ? 85.560  -2.187  -7.634  1.00 0.00 ? 54 ILE A HD12 8  
ATOM 10864 H HD13 . ILE A 1 54 ? 84.731  -3.495  -6.792  1.00 0.00 ? 54 ILE A HD13 8  
ATOM 10865 N N    . VAL A 1 55 ? 83.030  1.681   -10.292 1.00 0.00 ? 55 VAL A N    8  
ATOM 10866 C CA   . VAL A 1 55 ? 82.877  3.116   -10.535 1.00 0.00 ? 55 VAL A CA   8  
ATOM 10867 C C    . VAL A 1 55 ? 81.838  3.383   -11.625 1.00 0.00 ? 55 VAL A C    8  
ATOM 10868 O O    . VAL A 1 55 ? 81.103  4.366   -11.563 1.00 0.00 ? 55 VAL A O    8  
ATOM 10869 C CB   . VAL A 1 55 ? 84.220  3.744   -10.933 1.00 0.00 ? 55 VAL A CB   8  
ATOM 10870 C CG1  . VAL A 1 55 ? 85.298  3.335   -9.922  1.00 0.00 ? 55 VAL A CG1  8  
ATOM 10871 C CG2  . VAL A 1 55 ? 84.616  3.287   -12.352 1.00 0.00 ? 55 VAL A CG2  8  
ATOM 10872 H H    . VAL A 1 55 ? 83.809  1.205   -10.651 1.00 0.00 ? 55 VAL A H    8  
ATOM 10873 H HA   . VAL A 1 55 ? 82.540  3.585   -9.621  1.00 0.00 ? 55 VAL A HA   8  
ATOM 10874 H HB   . VAL A 1 55 ? 84.119  4.821   -10.919 1.00 0.00 ? 55 VAL A HB   8  
ATOM 10875 H HG11 . VAL A 1 55 ? 86.267  3.648   -10.286 1.00 0.00 ? 55 VAL A HG11 8  
ATOM 10876 H HG12 . VAL A 1 55 ? 85.291  2.264   -9.794  1.00 0.00 ? 55 VAL A HG12 8  
ATOM 10877 H HG13 . VAL A 1 55 ? 85.101  3.812   -8.974  1.00 0.00 ? 55 VAL A HG13 8  
ATOM 10878 H HG21 . VAL A 1 55 ? 84.236  2.294   -12.539 1.00 0.00 ? 55 VAL A HG21 8  
ATOM 10879 H HG22 . VAL A 1 55 ? 85.694  3.281   -12.448 1.00 0.00 ? 55 VAL A HG22 8  
ATOM 10880 H HG23 . VAL A 1 55 ? 84.198  3.971   -13.076 1.00 0.00 ? 55 VAL A HG23 8  
ATOM 10881 N N    . LEU A 1 56 ? 81.796  2.516   -12.631 1.00 0.00 ? 56 LEU A N    8  
ATOM 10882 C CA   . LEU A 1 56 ? 80.866  2.678   -13.744 1.00 0.00 ? 56 LEU A CA   8  
ATOM 10883 C C    . LEU A 1 56 ? 79.402  2.499   -13.331 1.00 0.00 ? 56 LEU A C    8  
ATOM 10884 O O    . LEU A 1 56 ? 78.517  3.105   -13.932 1.00 0.00 ? 56 LEU A O    8  
ATOM 10885 C CB   . LEU A 1 56 ? 81.214  1.675   -14.851 1.00 0.00 ? 56 LEU A CB   8  
ATOM 10886 C CG   . LEU A 1 56 ? 80.305  1.885   -16.096 1.00 0.00 ? 56 LEU A CG   8  
ATOM 10887 C CD1  . LEU A 1 56 ? 81.132  1.715   -17.376 1.00 0.00 ? 56 LEU A CD1  8  
ATOM 10888 C CD2  . LEU A 1 56 ? 79.166  0.851   -16.111 1.00 0.00 ? 56 LEU A CD2  8  
ATOM 10889 H H    . LEU A 1 56 ? 82.417  1.760   -12.639 1.00 0.00 ? 56 LEU A H    8  
ATOM 10890 H HA   . LEU A 1 56 ? 80.989  3.670   -14.146 1.00 0.00 ? 56 LEU A HA   8  
ATOM 10891 H HB2  . LEU A 1 56 ? 82.247  1.823   -15.132 1.00 0.00 ? 56 LEU A HB2  8  
ATOM 10892 H HB3  . LEU A 1 56 ? 81.088  0.671   -14.473 1.00 0.00 ? 56 LEU A HB3  8  
ATOM 10893 H HG   . LEU A 1 56 ? 79.884  2.883   -16.080 1.00 0.00 ? 56 LEU A HG   8  
ATOM 10894 H HD11 . LEU A 1 56 ? 80.480  1.759   -18.235 1.00 0.00 ? 56 LEU A HD11 8  
ATOM 10895 H HD12 . LEU A 1 56 ? 81.637  0.761   -17.354 1.00 0.00 ? 56 LEU A HD12 8  
ATOM 10896 H HD13 . LEU A 1 56 ? 81.864  2.507   -17.438 1.00 0.00 ? 56 LEU A HD13 8  
ATOM 10897 H HD21 . LEU A 1 56 ? 79.586  -0.142  -16.189 1.00 0.00 ? 56 LEU A HD21 8  
ATOM 10898 H HD22 . LEU A 1 56 ? 78.525  1.037   -16.960 1.00 0.00 ? 56 LEU A HD22 8  
ATOM 10899 H HD23 . LEU A 1 56 ? 78.590  0.928   -15.204 1.00 0.00 ? 56 LEU A HD23 8  
ATOM 10900 N N    . ILE A 1 57 ? 79.125  1.646   -12.341 1.00 0.00 ? 57 ILE A N    8  
ATOM 10901 C CA   . ILE A 1 57 ? 77.730  1.417   -11.949 1.00 0.00 ? 57 ILE A CA   8  
ATOM 10902 C C    . ILE A 1 57 ? 77.084  2.658   -11.296 1.00 0.00 ? 57 ILE A C    8  
ATOM 10903 O O    . ILE A 1 57 ? 76.030  3.102   -11.754 1.00 0.00 ? 57 ILE A O    8  
ATOM 10904 C CB   . ILE A 1 57 ? 77.642  0.166   -11.034 1.00 0.00 ? 57 ILE A CB   8  
ATOM 10905 C CG1  . ILE A 1 57 ? 77.528  -1.116  -11.891 1.00 0.00 ? 57 ILE A CG1  8  
ATOM 10906 C CG2  . ILE A 1 57 ? 76.438  0.245   -10.080 1.00 0.00 ? 57 ILE A CG2  8  
ATOM 10907 C CD1  . ILE A 1 57 ? 76.197  -1.172  -12.674 1.00 0.00 ? 57 ILE A CD1  8  
ATOM 10908 H H    . ILE A 1 57 ? 79.852  1.147   -11.892 1.00 0.00 ? 57 ILE A H    8  
ATOM 10909 H HA   . ILE A 1 57 ? 77.176  1.223   -12.854 1.00 0.00 ? 57 ILE A HA   8  
ATOM 10910 H HB   . ILE A 1 57 ? 78.545  0.102   -10.448 1.00 0.00 ? 57 ILE A HB   8  
ATOM 10911 H HG12 . ILE A 1 57 ? 78.348  -1.142  -12.594 1.00 0.00 ? 57 ILE A HG12 8  
ATOM 10912 H HG13 . ILE A 1 57 ? 77.594  -1.978  -11.245 1.00 0.00 ? 57 ILE A HG13 8  
ATOM 10913 H HG21 . ILE A 1 57 ? 75.554  0.513   -10.639 1.00 0.00 ? 57 ILE A HG21 8  
ATOM 10914 H HG22 . ILE A 1 57 ? 76.626  0.993   -9.325  1.00 0.00 ? 57 ILE A HG22 8  
ATOM 10915 H HG23 . ILE A 1 57 ? 76.289  -0.715  -9.608  1.00 0.00 ? 57 ILE A HG23 8  
ATOM 10916 H HD11 . ILE A 1 57 ? 75.548  -0.355  -12.391 1.00 0.00 ? 57 ILE A HD11 8  
ATOM 10917 H HD12 . ILE A 1 57 ? 75.700  -2.107  -12.462 1.00 0.00 ? 57 ILE A HD12 8  
ATOM 10918 H HD13 . ILE A 1 57 ? 76.405  -1.113  -13.733 1.00 0.00 ? 57 ILE A HD13 8  
ATOM 10919 N N    . PRO A 1 58 ? 77.658  3.232   -10.265 1.00 0.00 ? 58 PRO A N    8  
ATOM 10920 C CA   . PRO A 1 58 ? 77.067  4.435   -9.606  1.00 0.00 ? 58 PRO A CA   8  
ATOM 10921 C C    . PRO A 1 58 ? 77.163  5.659   -10.514 1.00 0.00 ? 58 PRO A C    8  
ATOM 10922 O O    . PRO A 1 58 ? 76.349  6.578   -10.433 1.00 0.00 ? 58 PRO A O    8  
ATOM 10923 C CB   . PRO A 1 58 ? 77.905  4.605   -8.330  1.00 0.00 ? 58 PRO A CB   8  
ATOM 10924 C CG   . PRO A 1 58 ? 79.218  3.963   -8.645  1.00 0.00 ? 58 PRO A CG   8  
ATOM 10925 C CD   . PRO A 1 58 ? 78.912  2.822   -9.620  1.00 0.00 ? 58 PRO A CD   8  
ATOM 10926 H HA   . PRO A 1 58 ? 76.037  4.247   -9.343  1.00 0.00 ? 58 PRO A HA   8  
ATOM 10927 H HB2  . PRO A 1 58 ? 78.037  5.655   -8.097  1.00 0.00 ? 58 PRO A HB2  8  
ATOM 10928 H HB3  . PRO A 1 58 ? 77.435  4.096   -7.501  1.00 0.00 ? 58 PRO A HB3  8  
ATOM 10929 H HG2  . PRO A 1 58 ? 79.883  4.683   -9.105  1.00 0.00 ? 58 PRO A HG2  8  
ATOM 10930 H HG3  . PRO A 1 58 ? 79.668  3.566   -7.747  1.00 0.00 ? 58 PRO A HG3  8  
ATOM 10931 H HD2  . PRO A 1 58 ? 79.695  2.734   -10.352 1.00 0.00 ? 58 PRO A HD2  8  
ATOM 10932 H HD3  . PRO A 1 58 ? 78.775  1.898   -9.087  1.00 0.00 ? 58 PRO A HD3  8  
ATOM 10933 N N    . PHE A 1 59 ? 78.175  5.654   -11.372 1.00 0.00 ? 59 PHE A N    8  
ATOM 10934 C CA   . PHE A 1 59 ? 78.404  6.742   -12.297 1.00 0.00 ? 59 PHE A CA   8  
ATOM 10935 C C    . PHE A 1 59 ? 77.231  6.879   -13.267 1.00 0.00 ? 59 PHE A C    8  
ATOM 10936 O O    . PHE A 1 59 ? 76.646  7.954   -13.397 1.00 0.00 ? 59 PHE A O    8  
ATOM 10937 C CB   . PHE A 1 59 ? 79.700  6.465   -13.073 1.00 0.00 ? 59 PHE A CB   8  
ATOM 10938 C CG   . PHE A 1 59 ? 80.934  6.862   -12.271 1.00 0.00 ? 59 PHE A CG   8  
ATOM 10939 C CD1  . PHE A 1 59 ? 80.918  6.902   -10.861 1.00 0.00 ? 59 PHE A CD1  8  
ATOM 10940 C CD2  . PHE A 1 59 ? 82.115  7.175   -12.956 1.00 0.00 ? 59 PHE A CD2  8  
ATOM 10941 C CE1  . PHE A 1 59 ? 82.077  7.254   -10.158 1.00 0.00 ? 59 PHE A CE1  8  
ATOM 10942 C CE2  . PHE A 1 59 ? 83.271  7.527   -12.245 1.00 0.00 ? 59 PHE A CE2  8  
ATOM 10943 C CZ   . PHE A 1 59 ? 83.250  7.566   -10.848 1.00 0.00 ? 59 PHE A CZ   8  
ATOM 10944 H H    . PHE A 1 59 ? 78.787  4.899   -11.385 1.00 0.00 ? 59 PHE A H    8  
ATOM 10945 H HA   . PHE A 1 59 ? 78.513  7.659   -11.747 1.00 0.00 ? 59 PHE A HA   8  
ATOM 10946 H HB2  . PHE A 1 59 ? 79.759  5.419   -13.320 1.00 0.00 ? 59 PHE A HB2  8  
ATOM 10947 H HB3  . PHE A 1 59 ? 79.680  7.014   -13.979 1.00 0.00 ? 59 PHE A HB3  8  
ATOM 10948 H HD1  . PHE A 1 59 ? 80.024  6.664   -10.315 1.00 0.00 ? 59 PHE A HD1  8  
ATOM 10949 H HD2  . PHE A 1 59 ? 82.133  7.148   -14.034 1.00 0.00 ? 59 PHE A HD2  8  
ATOM 10950 H HE1  . PHE A 1 59 ? 82.063  7.285   -9.078  1.00 0.00 ? 59 PHE A HE1  8  
ATOM 10951 H HE2  . PHE A 1 59 ? 84.181  7.764   -12.775 1.00 0.00 ? 59 PHE A HE2  8  
ATOM 10952 H HZ   . PHE A 1 59 ? 84.142  7.837   -10.302 1.00 0.00 ? 59 PHE A HZ   8  
ATOM 10953 N N    . LEU A 1 60 ? 76.898  5.787   -13.949 1.00 0.00 ? 60 LEU A N    8  
ATOM 10954 C CA   . LEU A 1 60 ? 75.797  5.810   -14.907 1.00 0.00 ? 60 LEU A CA   8  
ATOM 10955 C C    . LEU A 1 60 ? 74.454  5.784   -14.180 1.00 0.00 ? 60 LEU A C    8  
ATOM 10956 O O    . LEU A 1 60 ? 73.429  6.178   -14.739 1.00 0.00 ? 60 LEU A O    8  
ATOM 10957 C CB   . LEU A 1 60 ? 75.906  4.605   -15.857 1.00 0.00 ? 60 LEU A CB   8  
ATOM 10958 C CG   . LEU A 1 60 ? 76.925  4.887   -16.981 1.00 0.00 ? 60 LEU A CG   8  
ATOM 10959 C CD1  . LEU A 1 60 ? 76.361  5.907   -17.991 1.00 0.00 ? 60 LEU A CD1  8  
ATOM 10960 C CD2  . LEU A 1 60 ? 78.228  5.427   -16.375 1.00 0.00 ? 60 LEU A CD2  8  
ATOM 10961 H H    . LEU A 1 60 ? 77.403  4.954   -13.808 1.00 0.00 ? 60 LEU A H    8  
ATOM 10962 H HA   . LEU A 1 60 ? 75.856  6.719   -15.483 1.00 0.00 ? 60 LEU A HA   8  
ATOM 10963 H HB2  . LEU A 1 60 ? 76.233  3.743   -15.294 1.00 0.00 ? 60 LEU A HB2  8  
ATOM 10964 H HB3  . LEU A 1 60 ? 74.940  4.396   -16.293 1.00 0.00 ? 60 LEU A HB3  8  
ATOM 10965 H HG   . LEU A 1 60 ? 77.134  3.963   -17.501 1.00 0.00 ? 60 LEU A HG   8  
ATOM 10966 H HD11 . LEU A 1 60 ? 76.825  5.747   -18.953 1.00 0.00 ? 60 LEU A HD11 8  
ATOM 10967 H HD12 . LEU A 1 60 ? 76.572  6.913   -17.659 1.00 0.00 ? 60 LEU A HD12 8  
ATOM 10968 H HD13 . LEU A 1 60 ? 75.293  5.780   -18.088 1.00 0.00 ? 60 LEU A HD13 8  
ATOM 10969 H HD21 . LEU A 1 60 ? 78.484  4.851   -15.500 1.00 0.00 ? 60 LEU A HD21 8  
ATOM 10970 H HD22 . LEU A 1 60 ? 78.096  6.462   -16.100 1.00 0.00 ? 60 LEU A HD22 8  
ATOM 10971 H HD23 . LEU A 1 60 ? 79.021  5.348   -17.103 1.00 0.00 ? 60 LEU A HD23 8  
ATOM 10972 N N    . GLU A 1 61 ? 74.466  5.321   -12.932 1.00 0.00 ? 61 GLU A N    8  
ATOM 10973 C CA   . GLU A 1 61 ? 73.241  5.250   -12.130 1.00 0.00 ? 61 GLU A CA   8  
ATOM 10974 C C    . GLU A 1 61 ? 73.160  6.435   -11.175 1.00 0.00 ? 61 GLU A C    8  
ATOM 10975 O O    . GLU A 1 61 ? 73.985  6.575   -10.272 1.00 0.00 ? 61 GLU A O    8  
ATOM 10976 C CB   . GLU A 1 61 ? 73.217  3.948   -11.327 1.00 0.00 ? 61 GLU A CB   8  
ATOM 10977 C CG   . GLU A 1 61 ? 73.208  2.755   -12.285 1.00 0.00 ? 61 GLU A CG   8  
ATOM 10978 C CD   . GLU A 1 61 ? 71.897  2.719   -13.063 1.00 0.00 ? 61 GLU A CD   8  
ATOM 10979 O OE1  . GLU A 1 61 ? 70.855  2.742   -12.430 1.00 0.00 ? 61 GLU A OE1  8  
ATOM 10980 O OE2  . GLU A 1 61 ? 71.955  2.670   -14.280 1.00 0.00 ? 61 GLU A OE2  8  
ATOM 10981 H H    . GLU A 1 61 ? 75.314  5.026   -12.541 1.00 0.00 ? 61 GLU A H    8  
ATOM 10982 H HA   . GLU A 1 61 ? 72.379  5.269   -12.784 1.00 0.00 ? 61 GLU A HA   8  
ATOM 10983 H HB2  . GLU A 1 61 ? 74.092  3.899   -10.696 1.00 0.00 ? 61 GLU A HB2  8  
ATOM 10984 H HB3  . GLU A 1 61 ? 72.329  3.921   -10.714 1.00 0.00 ? 61 GLU A HB3  8  
ATOM 10985 H HG2  . GLU A 1 61 ? 74.033  2.845   -12.977 1.00 0.00 ? 61 GLU A HG2  8  
ATOM 10986 H HG3  . GLU A 1 61 ? 73.312  1.841   -11.720 1.00 0.00 ? 61 GLU A HG3  8  
ATOM 10987 N N    . GLN A 1 62 ? 72.161  7.286   -11.380 1.00 0.00 ? 62 GLN A N    8  
ATOM 10988 C CA   . GLN A 1 62 ? 71.982  8.457   -10.530 1.00 0.00 ? 62 GLN A CA   8  
ATOM 10989 C C    . GLN A 1 62 ? 71.600  8.038   -9.114  1.00 0.00 ? 62 GLN A C    8  
ATOM 10990 O O    . GLN A 1 62 ? 72.371  8.224   -8.172  1.00 0.00 ? 62 GLN A O    8  
ATOM 10991 C CB   . GLN A 1 62 ? 70.891  9.361   -11.109 1.00 0.00 ? 62 GLN A CB   8  
ATOM 10992 C CG   . GLN A 1 62 ? 71.254  9.743   -12.545 1.00 0.00 ? 62 GLN A CG   8  
ATOM 10993 C CD   . GLN A 1 62 ? 72.541  10.561  -12.559 1.00 0.00 ? 62 GLN A CD   8  
ATOM 10994 O OE1  . GLN A 1 62 ? 72.624  11.601  -11.906 1.00 0.00 ? 62 GLN A OE1  8  
ATOM 10995 N NE2  . GLN A 1 62 ? 73.557  10.149  -13.267 1.00 0.00 ? 62 GLN A NE2  8  
ATOM 10996 H H    . GLN A 1 62 ? 71.533  7.124   -12.115 1.00 0.00 ? 62 GLN A H    8  
ATOM 10997 H HA   . GLN A 1 62 ? 72.909  9.009   -10.493 1.00 0.00 ? 62 GLN A HA   8  
ATOM 10998 H HB2  . GLN A 1 62 ? 69.948  8.833   -11.104 1.00 0.00 ? 62 GLN A HB2  8  
ATOM 10999 H HB3  . GLN A 1 62 ? 70.807  10.255  -10.511 1.00 0.00 ? 62 GLN A HB3  8  
ATOM 11000 H HG2  . GLN A 1 62 ? 71.393  8.846   -13.131 1.00 0.00 ? 62 GLN A HG2  8  
ATOM 11001 H HG3  . GLN A 1 62 ? 70.454  10.330  -12.972 1.00 0.00 ? 62 GLN A HG3  8  
ATOM 11002 H HE21 . GLN A 1 62 ? 73.489  9.321   -13.785 1.00 0.00 ? 62 GLN A HE21 8  
ATOM 11003 H HE22 . GLN A 1 62 ? 74.388  10.668  -13.279 1.00 0.00 ? 62 GLN A HE22 8  
ATOM 11004 N N    . ASN A 1 63 ? 70.407  7.470   -8.972  1.00 0.00 ? 63 ASN A N    8  
ATOM 11005 C CA   . ASN A 1 63 ? 69.932  7.027   -7.665  1.00 0.00 ? 63 ASN A CA   8  
ATOM 11006 C C    . ASN A 1 63 ? 70.549  5.681   -7.300  1.00 0.00 ? 63 ASN A C    8  
ATOM 11007 C CB   . ASN A 1 63 ? 68.408  6.904   -7.678  1.00 0.00 ? 63 ASN A CB   8  
ATOM 11008 C CG   . ASN A 1 63 ? 67.974  5.905   -8.745  1.00 0.00 ? 63 ASN A CG   8  
ATOM 11009 O OD1  . ASN A 1 63 ? 68.190  4.703   -8.594  1.00 0.00 ? 63 ASN A OD1  8  
ATOM 11010 N ND2  . ASN A 1 63 ? 67.373  6.333   -9.822  1.00 0.00 ? 63 ASN A ND2  8  
ATOM 11011 H H    . ASN A 1 63 ? 69.835  7.347   -9.758  1.00 0.00 ? 63 ASN A H    8  
ATOM 11012 H HA   . ASN A 1 63 ? 70.216  7.756   -6.921  1.00 0.00 ? 63 ASN A HA   8  
ATOM 11013 H HB2  . ASN A 1 63 ? 68.067  6.567   -6.710  1.00 0.00 ? 63 ASN A HB2  8  
ATOM 11014 H HB3  . ASN A 1 63 ? 67.973  7.869   -7.894  1.00 0.00 ? 63 ASN A HB3  8  
ATOM 11015 H HD21 . ASN A 1 63 ? 67.204  7.291   -9.939  1.00 0.00 ? 63 ASN A HD21 8  
ATOM 11016 H HD22 . ASN A 1 63 ? 67.092  5.696   -10.511 1.00 0.00 ? 63 ASN A HD22 8  
ATOM 11017 N N    . CYS B 2 1  ? 68.700  18.351  -13.700 1.00 0.00 ? 1  CYS B N    8  
ATOM 11018 C CA   . CYS B 2 1  ? 70.070  17.816  -13.941 1.00 0.00 ? 1  CYS B CA   8  
ATOM 11019 C C    . CYS B 2 1  ? 71.098  18.901  -13.641 1.00 0.00 ? 1  CYS B C    8  
ATOM 11020 O O    . CYS B 2 1  ? 70.774  20.089  -13.623 1.00 0.00 ? 1  CYS B O    8  
ATOM 11021 C CB   . CYS B 2 1  ? 70.190  17.371  -15.401 1.00 0.00 ? 1  CYS B CB   8  
ATOM 11022 S SG   . CYS B 2 1  ? 69.653  18.715  -16.487 1.00 0.00 ? 1  CYS B SG   8  
ATOM 11023 H HA   . CYS B 2 1  ? 70.242  16.970  -13.294 1.00 0.00 ? 1  CYS B HA   8  
ATOM 11024 H HB2  . CYS B 2 1  ? 71.219  17.123  -15.617 1.00 0.00 ? 1  CYS B HB2  8  
ATOM 11025 H HB3  . CYS B 2 1  ? 69.569  16.504  -15.566 1.00 0.00 ? 1  CYS B HB3  8  
ATOM 11026 N N    . SER B 2 2  ? 72.338  18.485  -13.407 1.00 0.00 ? 2  SER B N    8  
ATOM 11027 C CA   . SER B 2 2  ? 73.408  19.430  -13.110 1.00 0.00 ? 2  SER B CA   8  
ATOM 11028 C C    . SER B 2 2  ? 74.769  18.765  -13.288 1.00 0.00 ? 2  SER B C    8  
ATOM 11029 O O    . SER B 2 2  ? 75.206  17.994  -12.436 1.00 0.00 ? 2  SER B O    8  
ATOM 11030 C CB   . SER B 2 2  ? 73.270  19.940  -11.674 1.00 0.00 ? 2  SER B CB   8  
ATOM 11031 O OG   . SER B 2 2  ? 73.737  18.942  -10.775 1.00 0.00 ? 2  SER B OG   8  
ATOM 11032 H H    . SER B 2 2  ? 72.536  17.526  -13.435 1.00 0.00 ? 2  SER B H    8  
ATOM 11033 H HA   . SER B 2 2  ? 73.335  20.267  -13.786 1.00 0.00 ? 2  SER B HA   8  
ATOM 11034 H HB2  . SER B 2 2  ? 73.859  20.833  -11.550 1.00 0.00 ? 2  SER B HB2  8  
ATOM 11035 H HB3  . SER B 2 2  ? 72.232  20.164  -11.472 1.00 0.00 ? 2  SER B HB3  8  
ATOM 11036 H HG   . SER B 2 2  ? 74.670  19.098  -10.618 1.00 0.00 ? 2  SER B HG   8  
ATOM 11037 N N    . THR B 2 3  ? 75.427  19.071  -14.404 1.00 0.00 ? 3  THR B N    8  
ATOM 11038 C CA   . THR B 2 3  ? 76.740  18.502  -14.704 1.00 0.00 ? 3  THR B CA   8  
ATOM 11039 C C    . THR B 2 3  ? 76.682  16.974  -14.714 1.00 0.00 ? 3  THR B C    8  
ATOM 11040 O O    . THR B 2 3  ? 76.226  16.374  -15.685 1.00 0.00 ? 3  THR B O    8  
ATOM 11041 C CB   . THR B 2 3  ? 77.778  18.988  -13.682 1.00 0.00 ? 3  THR B CB   8  
ATOM 11042 O OG1  . THR B 2 3  ? 77.479  18.463  -12.398 1.00 0.00 ? 3  THR B OG1  8  
ATOM 11043 C CG2  . THR B 2 3  ? 77.762  20.515  -13.625 1.00 0.00 ? 3  THR B CG2  8  
ATOM 11044 H H    . THR B 2 3  ? 75.020  19.691  -15.043 1.00 0.00 ? 3  THR B H    8  
ATOM 11045 H HA   . THR B 2 3  ? 77.042  18.839  -15.685 1.00 0.00 ? 3  THR B HA   8  
ATOM 11046 H HB   . THR B 2 3  ? 78.760  18.657  -13.984 1.00 0.00 ? 3  THR B HB   8  
ATOM 11047 H HG1  . THR B 2 3  ? 76.896  19.081  -11.953 1.00 0.00 ? 3  THR B HG1  8  
ATOM 11048 H HG21 . THR B 2 3  ? 76.784  20.854  -13.316 1.00 0.00 ? 3  THR B HG21 8  
ATOM 11049 H HG22 . THR B 2 3  ? 77.987  20.915  -14.603 1.00 0.00 ? 3  THR B HG22 8  
ATOM 11050 H HG23 . THR B 2 3  ? 78.501  20.858  -12.917 1.00 0.00 ? 3  THR B HG23 8  
ATOM 11051 N N    . VAL B 2 4  ? 77.153  16.356  -13.633 1.00 0.00 ? 4  VAL B N    8  
ATOM 11052 C CA   . VAL B 2 4  ? 77.159  14.896  -13.518 1.00 0.00 ? 4  VAL B CA   8  
ATOM 11053 C C    . VAL B 2 4  ? 78.111  14.265  -14.531 1.00 0.00 ? 4  VAL B C    8  
ATOM 11054 O O    . VAL B 2 4  ? 79.227  13.878  -14.189 1.00 0.00 ? 4  VAL B O    8  
ATOM 11055 C CB   . VAL B 2 4  ? 75.747  14.326  -13.721 1.00 0.00 ? 4  VAL B CB   8  
ATOM 11056 C CG1  . VAL B 2 4  ? 75.723  12.863  -13.274 1.00 0.00 ? 4  VAL B CG1  8  
ATOM 11057 C CG2  . VAL B 2 4  ? 74.731  15.135  -12.901 1.00 0.00 ? 4  VAL B CG2  8  
ATOM 11058 H H    . VAL B 2 4  ? 77.507  16.892  -12.894 1.00 0.00 ? 4  VAL B H    8  
ATOM 11059 H HA   . VAL B 2 4  ? 77.496  14.634  -12.528 1.00 0.00 ? 4  VAL B HA   8  
ATOM 11060 H HB   . VAL B 2 4  ? 75.483  14.376  -14.766 1.00 0.00 ? 4  VAL B HB   8  
ATOM 11061 H HG11 . VAL B 2 4  ? 74.712  12.487  -13.329 1.00 0.00 ? 4  VAL B HG11 8  
ATOM 11062 H HG12 . VAL B 2 4  ? 76.079  12.789  -12.257 1.00 0.00 ? 4  VAL B HG12 8  
ATOM 11063 H HG13 . VAL B 2 4  ? 76.359  12.278  -13.923 1.00 0.00 ? 4  VAL B HG13 8  
ATOM 11064 H HG21 . VAL B 2 4  ? 75.164  15.408  -11.949 1.00 0.00 ? 4  VAL B HG21 8  
ATOM 11065 H HG22 . VAL B 2 4  ? 73.843  14.542  -12.735 1.00 0.00 ? 4  VAL B HG22 8  
ATOM 11066 H HG23 . VAL B 2 4  ? 74.466  16.028  -13.446 1.00 0.00 ? 4  VAL B HG23 8  
ATOM 11067 N N    . SER B 2 5  ? 77.656  14.148  -15.775 1.00 0.00 ? 5  SER B N    8  
ATOM 11068 C CA   . SER B 2 5  ? 78.466  13.543  -16.826 1.00 0.00 ? 5  SER B CA   8  
ATOM 11069 C C    . SER B 2 5  ? 79.936  13.969  -16.728 1.00 0.00 ? 5  SER B C    8  
ATOM 11070 O O    . SER B 2 5  ? 80.809  13.130  -16.506 1.00 0.00 ? 5  SER B O    8  
ATOM 11071 C CB   . SER B 2 5  ? 77.888  13.909  -18.202 1.00 0.00 ? 5  SER B CB   8  
ATOM 11072 O OG   . SER B 2 5  ? 78.945  14.181  -19.109 1.00 0.00 ? 5  SER B OG   8  
ATOM 11073 H H    . SER B 2 5  ? 76.755  14.463  -15.989 1.00 0.00 ? 5  SER B H    8  
ATOM 11074 H HA   . SER B 2 5  ? 78.421  12.470  -16.707 1.00 0.00 ? 5  SER B HA   8  
ATOM 11075 H HB2  . SER B 2 5  ? 77.301  13.090  -18.584 1.00 0.00 ? 5  SER B HB2  8  
ATOM 11076 H HB3  . SER B 2 5  ? 77.254  14.781  -18.101 1.00 0.00 ? 5  SER B HB3  8  
ATOM 11077 H HG   . SER B 2 5  ? 79.460  13.377  -19.214 1.00 0.00 ? 5  SER B HG   8  
ATOM 11078 N N    . PRO B 2 6  ? 80.234  15.234  -16.897 1.00 0.00 ? 6  PRO B N    8  
ATOM 11079 C CA   . PRO B 2 6  ? 81.642  15.735  -16.829 1.00 0.00 ? 6  PRO B CA   8  
ATOM 11080 C C    . PRO B 2 6  ? 82.271  15.494  -15.455 1.00 0.00 ? 6  PRO B C    8  
ATOM 11081 O O    . PRO B 2 6  ? 83.423  15.857  -15.220 1.00 0.00 ? 6  PRO B O    8  
ATOM 11082 C CB   . PRO B 2 6  ? 81.516  17.239  -17.140 1.00 0.00 ? 6  PRO B CB   8  
ATOM 11083 C CG   . PRO B 2 6  ? 80.094  17.581  -16.834 1.00 0.00 ? 6  PRO B CG   8  
ATOM 11084 C CD   . PRO B 2 6  ? 79.284  16.329  -17.164 1.00 0.00 ? 6  PRO B CD   8  
ATOM 11085 H HA   . PRO B 2 6  ? 82.237  15.257  -17.592 1.00 0.00 ? 6  PRO B HA   8  
ATOM 11086 H HB2  . PRO B 2 6  ? 82.190  17.818  -16.520 1.00 0.00 ? 6  PRO B HB2  8  
ATOM 11087 H HB3  . PRO B 2 6  ? 81.722  17.426  -18.185 1.00 0.00 ? 6  PRO B HB3  8  
ATOM 11088 H HG2  . PRO B 2 6  ? 79.990  17.827  -15.785 1.00 0.00 ? 6  PRO B HG2  8  
ATOM 11089 H HG3  . PRO B 2 6  ? 79.759  18.404  -17.446 1.00 0.00 ? 6  PRO B HG3  8  
ATOM 11090 H HD2  . PRO B 2 6  ? 78.419  16.260  -16.524 1.00 0.00 ? 6  PRO B HD2  8  
ATOM 11091 H HD3  . PRO B 2 6  ? 78.995  16.329  -18.203 1.00 0.00 ? 6  PRO B HD3  8  
ATOM 11092 N N    . GLY B 2 7  ? 81.508  14.880  -14.551 1.00 0.00 ? 7  GLY B N    8  
ATOM 11093 C CA   . GLY B 2 7  ? 82.001  14.593  -13.200 1.00 0.00 ? 7  GLY B CA   8  
ATOM 11094 C C    . GLY B 2 7  ? 82.280  13.105  -13.019 1.00 0.00 ? 7  GLY B C    8  
ATOM 11095 O O    . GLY B 2 7  ? 83.422  12.696  -12.805 1.00 0.00 ? 7  GLY B O    8  
ATOM 11096 H H    . GLY B 2 7  ? 80.596  14.614  -14.794 1.00 0.00 ? 7  GLY B H    8  
ATOM 11097 H HA2  . GLY B 2 7  ? 82.915  15.144  -13.022 1.00 0.00 ? 7  GLY B HA2  8  
ATOM 11098 H HA3  . GLY B 2 7  ? 81.257  14.900  -12.480 1.00 0.00 ? 7  GLY B HA3  8  
ATOM 11099 N N    . VAL B 2 8  ? 81.236  12.293  -13.104 1.00 0.00 ? 8  VAL B N    8  
ATOM 11100 C CA   . VAL B 2 8  ? 81.402  10.855  -12.945 1.00 0.00 ? 8  VAL B CA   8  
ATOM 11101 C C    . VAL B 2 8  ? 82.276  10.303  -14.078 1.00 0.00 ? 8  VAL B C    8  
ATOM 11102 O O    . VAL B 2 8  ? 83.272  9.612   -13.837 1.00 0.00 ? 8  VAL B O    8  
ATOM 11103 C CB   . VAL B 2 8  ? 80.018  10.170  -12.927 1.00 0.00 ? 8  VAL B CB   8  
ATOM 11104 C CG1  . VAL B 2 8  ? 79.472  10.125  -11.489 1.00 0.00 ? 8  VAL B CG1  8  
ATOM 11105 C CG2  . VAL B 2 8  ? 79.036  10.955  -13.814 1.00 0.00 ? 8  VAL B CG2  8  
ATOM 11106 H H    . VAL B 2 8  ? 80.344  12.662  -13.277 1.00 0.00 ? 8  VAL B H    8  
ATOM 11107 H HA   . VAL B 2 8  ? 81.903  10.668  -12.006 1.00 0.00 ? 8  VAL B HA   8  
ATOM 11108 H HB   . VAL B 2 8  ? 80.111  9.164   -13.299 1.00 0.00 ? 8  VAL B HB   8  
ATOM 11109 H HG11 . VAL B 2 8  ? 78.403  9.959   -11.511 1.00 0.00 ? 8  VAL B HG11 8  
ATOM 11110 H HG12 . VAL B 2 8  ? 79.678  11.062  -10.996 1.00 0.00 ? 8  VAL B HG12 8  
ATOM 11111 H HG13 . VAL B 2 8  ? 79.949  9.322   -10.949 1.00 0.00 ? 8  VAL B HG13 8  
ATOM 11112 H HG21 . VAL B 2 8  ? 78.643  11.799  -13.265 1.00 0.00 ? 8  VAL B HG21 8  
ATOM 11113 H HG22 . VAL B 2 8  ? 78.222  10.308  -14.106 1.00 0.00 ? 8  VAL B HG22 8  
ATOM 11114 H HG23 . VAL B 2 8  ? 79.545  11.307  -14.695 1.00 0.00 ? 8  VAL B HG23 8  
ATOM 11115 N N    . LEU B 2 9  ? 81.925  10.633  -15.313 1.00 0.00 ? 9  LEU B N    8  
ATOM 11116 C CA   . LEU B 2 9  ? 82.710  10.175  -16.447 1.00 0.00 ? 9  LEU B CA   8  
ATOM 11117 C C    . LEU B 2 9  ? 84.140  10.692  -16.305 1.00 0.00 ? 9  LEU B C    8  
ATOM 11118 O O    . LEU B 2 9  ? 85.110  9.966   -16.569 1.00 0.00 ? 9  LEU B O    8  
ATOM 11119 C CB   . LEU B 2 9  ? 82.068  10.655  -17.753 1.00 0.00 ? 9  LEU B CB   8  
ATOM 11120 C CG   . LEU B 2 9  ? 80.563  10.336  -17.715 1.00 0.00 ? 9  LEU B CG   8  
ATOM 11121 C CD1  . LEU B 2 9  ? 79.902  10.762  -19.031 1.00 0.00 ? 9  LEU B CD1  8  
ATOM 11122 C CD2  . LEU B 2 9  ? 80.353  8.828   -17.494 1.00 0.00 ? 9  LEU B CD2  8  
ATOM 11123 H H    . LEU B 2 9  ? 81.143  11.203  -15.461 1.00 0.00 ? 9  LEU B H    8  
ATOM 11124 H HA   . LEU B 2 9  ? 82.732  9.095   -16.443 1.00 0.00 ? 9  LEU B HA   8  
ATOM 11125 H HB2  . LEU B 2 9  ? 82.212  11.720  -17.857 1.00 0.00 ? 9  LEU B HB2  8  
ATOM 11126 H HB3  . LEU B 2 9  ? 82.521  10.145  -18.588 1.00 0.00 ? 9  LEU B HB3  8  
ATOM 11127 H HG   . LEU B 2 9  ? 80.111  10.880  -16.904 1.00 0.00 ? 9  LEU B HG   8  
ATOM 11128 H HD11 . LEU B 2 9  ? 80.149  10.052  -19.806 1.00 0.00 ? 9  LEU B HD11 8  
ATOM 11129 H HD12 . LEU B 2 9  ? 80.256  11.741  -19.312 1.00 0.00 ? 9  LEU B HD12 8  
ATOM 11130 H HD13 . LEU B 2 9  ? 78.830  10.794  -18.901 1.00 0.00 ? 9  LEU B HD13 8  
ATOM 11131 H HD21 . LEU B 2 9  ? 81.087  8.272   -18.059 1.00 0.00 ? 9  LEU B HD21 8  
ATOM 11132 H HD22 . LEU B 2 9  ? 79.361  8.546   -17.820 1.00 0.00 ? 9  LEU B HD22 8  
ATOM 11133 H HD23 . LEU B 2 9  ? 80.459  8.599   -16.443 1.00 0.00 ? 9  LEU B HD23 8  
ATOM 11134 N N    . ALA B 2 10 ? 84.272  11.936  -15.831 1.00 0.00 ? 10 ALA B N    8  
ATOM 11135 C CA   . ALA B 2 10 ? 85.592  12.502  -15.604 1.00 0.00 ? 10 ALA B CA   8  
ATOM 11136 C C    . ALA B 2 10 ? 86.335  11.576  -14.638 1.00 0.00 ? 10 ALA B C    8  
ATOM 11137 O O    . ALA B 2 10 ? 87.560  11.400  -14.705 1.00 0.00 ? 10 ALA B O    8  
ATOM 11138 C CB   . ALA B 2 10 ? 85.472  13.912  -15.005 1.00 0.00 ? 10 ALA B CB   8  
ATOM 11139 H H    . ALA B 2 10 ? 83.473  12.456  -15.596 1.00 0.00 ? 10 ALA B H    8  
ATOM 11140 H HA   . ALA B 2 10 ? 86.119  12.562  -16.540 1.00 0.00 ? 10 ALA B HA   8  
ATOM 11141 H HB1  . ALA B 2 10 ? 84.618  13.954  -14.350 1.00 0.00 ? 10 ALA B HB1  8  
ATOM 11142 H HB2  . ALA B 2 10 ? 85.346  14.631  -15.801 1.00 0.00 ? 10 ALA B HB2  8  
ATOM 11143 H HB3  . ALA B 2 10 ? 86.366  14.150  -14.447 1.00 0.00 ? 10 ALA B HB3  8  
ATOM 11144 N N    . GLY B 2 11 ? 85.555  10.972  -13.744 1.00 0.00 ? 11 GLY B N    8  
ATOM 11145 C CA   . GLY B 2 11 ? 86.091  10.049  -12.755 1.00 0.00 ? 11 GLY B CA   8  
ATOM 11146 C C    . GLY B 2 11 ? 86.647  8.787   -13.407 1.00 0.00 ? 11 GLY B C    8  
ATOM 11147 O O    . GLY B 2 11 ? 87.674  8.265   -12.971 1.00 0.00 ? 11 GLY B O    8  
ATOM 11148 H H    . GLY B 2 11 ? 84.590  11.153  -13.755 1.00 0.00 ? 11 GLY B H    8  
ATOM 11149 H HA2  . GLY B 2 11 ? 86.881  10.542  -12.208 1.00 0.00 ? 11 GLY B HA2  8  
ATOM 11150 H HA3  . GLY B 2 11 ? 85.305  9.772   -12.068 1.00 0.00 ? 11 GLY B HA3  8  
ATOM 11151 N N    . ILE B 2 12 ? 85.981  8.283   -14.450 1.00 0.00 ? 12 ILE B N    8  
ATOM 11152 C CA   . ILE B 2 12 ? 86.475  7.080   -15.104 1.00 0.00 ? 12 ILE B CA   8  
ATOM 11153 C C    . ILE B 2 12 ? 87.820  7.373   -15.769 1.00 0.00 ? 12 ILE B C    8  
ATOM 11154 O O    . ILE B 2 12 ? 88.748  6.572   -15.666 1.00 0.00 ? 12 ILE B O    8  
ATOM 11155 C CB   . ILE B 2 12 ? 85.424  6.541   -16.108 1.00 0.00 ? 12 ILE B CB   8  
ATOM 11156 C CG1  . ILE B 2 12 ? 84.438  5.629   -15.351 1.00 0.00 ? 12 ILE B CG1  8  
ATOM 11157 C CG2  . ILE B 2 12 ? 86.098  5.732   -17.229 1.00 0.00 ? 12 ILE B CG2  8  
ATOM 11158 C CD1  . ILE B 2 12 ? 83.179  5.388   -16.185 1.00 0.00 ? 12 ILE B CD1  8  
ATOM 11159 H H    . ILE B 2 12 ? 85.161  8.722   -14.781 1.00 0.00 ? 12 ILE B H    8  
ATOM 11160 H HA   . ILE B 2 12 ? 86.645  6.331   -14.342 1.00 0.00 ? 12 ILE B HA   8  
ATOM 11161 H HB   . ILE B 2 12 ? 84.887  7.372   -16.540 1.00 0.00 ? 12 ILE B HB   8  
ATOM 11162 H HG12 . ILE B 2 12 ? 84.917  4.682   -15.154 1.00 0.00 ? 12 ILE B HG12 8  
ATOM 11163 H HG13 . ILE B 2 12 ? 84.165  6.092   -14.417 1.00 0.00 ? 12 ILE B HG13 8  
ATOM 11164 H HG21 . ILE B 2 12 ? 86.924  5.168   -16.822 1.00 0.00 ? 12 ILE B HG21 8  
ATOM 11165 H HG22 . ILE B 2 12 ? 86.463  6.406   -17.991 1.00 0.00 ? 12 ILE B HG22 8  
ATOM 11166 H HG23 . ILE B 2 12 ? 85.382  5.053   -17.667 1.00 0.00 ? 12 ILE B HG23 8  
ATOM 11167 H HD11 . ILE B 2 12 ? 82.427  4.917   -15.568 1.00 0.00 ? 12 ILE B HD11 8  
ATOM 11168 H HD12 . ILE B 2 12 ? 83.418  4.741   -17.015 1.00 0.00 ? 12 ILE B HD12 8  
ATOM 11169 H HD13 . ILE B 2 12 ? 82.803  6.330   -16.557 1.00 0.00 ? 12 ILE B HD13 8  
ATOM 11170 N N    . VAL B 2 13 ? 87.940  8.525   -16.422 1.00 0.00 ? 13 VAL B N    8  
ATOM 11171 C CA   . VAL B 2 13 ? 89.219  8.869   -17.052 1.00 0.00 ? 13 VAL B CA   8  
ATOM 11172 C C    . VAL B 2 13 ? 90.316  8.816   -15.990 1.00 0.00 ? 13 VAL B C    8  
ATOM 11173 O O    . VAL B 2 13 ? 91.385  8.254   -16.220 1.00 0.00 ? 13 VAL B O    8  
ATOM 11174 C CB   . VAL B 2 13 ? 89.166  10.261  -17.759 1.00 0.00 ? 13 VAL B CB   8  
ATOM 11175 C CG1  . VAL B 2 13 ? 87.721  10.703  -17.891 1.00 0.00 ? 13 VAL B CG1  8  
ATOM 11176 C CG2  . VAL B 2 13 ? 89.928  11.349  -16.978 1.00 0.00 ? 13 VAL B CG2  8  
ATOM 11177 H H    . VAL B 2 13 ? 87.178  9.144   -16.469 1.00 0.00 ? 13 VAL B H    8  
ATOM 11178 H HA   . VAL B 2 13 ? 89.436  8.110   -17.794 1.00 0.00 ? 13 VAL B HA   8  
ATOM 11179 H HB   . VAL B 2 13 ? 89.594  10.175  -18.751 1.00 0.00 ? 13 VAL B HB   8  
ATOM 11180 H HG11 . VAL B 2 13 ? 87.188  9.989   -18.489 1.00 0.00 ? 13 VAL B HG11 8  
ATOM 11181 H HG12 . VAL B 2 13 ? 87.678  11.676  -18.355 1.00 0.00 ? 13 VAL B HG12 8  
ATOM 11182 H HG13 . VAL B 2 13 ? 87.282  10.753  -16.919 1.00 0.00 ? 13 VAL B HG13 8  
ATOM 11183 H HG21 . VAL B 2 13 ? 89.787  12.302  -17.467 1.00 0.00 ? 13 VAL B HG21 8  
ATOM 11184 H HG22 . VAL B 2 13 ? 90.981  11.113  -16.956 1.00 0.00 ? 13 VAL B HG22 8  
ATOM 11185 H HG23 . VAL B 2 13 ? 89.547  11.406  -15.972 1.00 0.00 ? 13 VAL B HG23 8  
ATOM 11186 N N    . VAL B 2 14 ? 90.040  9.397   -14.820 1.00 0.00 ? 14 VAL B N    8  
ATOM 11187 C CA   . VAL B 2 14 ? 91.026  9.384   -13.744 1.00 0.00 ? 14 VAL B CA   8  
ATOM 11188 C C    . VAL B 2 14 ? 91.470  7.949   -13.471 1.00 0.00 ? 14 VAL B C    8  
ATOM 11189 O O    . VAL B 2 14 ? 92.667  7.658   -13.431 1.00 0.00 ? 14 VAL B O    8  
ATOM 11190 C CB   . VAL B 2 14 ? 90.438  10.001  -12.471 1.00 0.00 ? 14 VAL B CB   8  
ATOM 11191 C CG1  . VAL B 2 14 ? 91.435  9.850   -11.319 1.00 0.00 ? 14 VAL B CG1  8  
ATOM 11192 C CG2  . VAL B 2 14 ? 90.161  11.487  -12.706 1.00 0.00 ? 14 VAL B CG2  8  
ATOM 11193 H H    . VAL B 2 14 ? 89.165  9.832   -14.681 1.00 0.00 ? 14 VAL B H    8  
ATOM 11194 H HA   . VAL B 2 14 ? 91.884  9.964   -14.050 1.00 0.00 ? 14 VAL B HA   8  
ATOM 11195 H HB   . VAL B 2 14 ? 89.518  9.496   -12.218 1.00 0.00 ? 14 VAL B HB   8  
ATOM 11196 H HG11 . VAL B 2 14 ? 92.418  10.150  -11.652 1.00 0.00 ? 14 VAL B HG11 8  
ATOM 11197 H HG12 . VAL B 2 14 ? 91.463  8.818   -10.999 1.00 0.00 ? 14 VAL B HG12 8  
ATOM 11198 H HG13 . VAL B 2 14 ? 91.128  10.475  -10.494 1.00 0.00 ? 14 VAL B HG13 8  
ATOM 11199 H HG21 . VAL B 2 14 ? 89.641  11.612  -13.642 1.00 0.00 ? 14 VAL B HG21 8  
ATOM 11200 H HG22 . VAL B 2 14 ? 91.096  12.026  -12.738 1.00 0.00 ? 14 VAL B HG22 8  
ATOM 11201 H HG23 . VAL B 2 14 ? 89.551  11.870  -11.901 1.00 0.00 ? 14 VAL B HG23 8  
ATOM 11202 N N    . GLY B 2 15 ? 90.493  7.057   -13.300 1.00 0.00 ? 15 GLY B N    8  
ATOM 11203 C CA   . GLY B 2 15 ? 90.783  5.646   -13.047 1.00 0.00 ? 15 GLY B CA   8  
ATOM 11204 C C    . GLY B 2 15 ? 91.632  5.059   -14.173 1.00 0.00 ? 15 GLY B C    8  
ATOM 11205 O O    . GLY B 2 15 ? 92.443  4.159   -13.951 1.00 0.00 ? 15 GLY B O    8  
ATOM 11206 H H    . GLY B 2 15 ? 89.559  7.353   -13.356 1.00 0.00 ? 15 GLY B H    8  
ATOM 11207 H HA2  . GLY B 2 15 ? 91.310  5.547   -12.105 1.00 0.00 ? 15 GLY B HA2  8  
ATOM 11208 H HA3  . GLY B 2 15 ? 89.852  5.100   -12.989 1.00 0.00 ? 15 GLY B HA3  8  
ATOM 11209 N N    . ASP B 2 16 ? 91.442  5.577   -15.381 1.00 0.00 ? 16 ASP B N    8  
ATOM 11210 C CA   . ASP B 2 16 ? 92.198  5.100   -16.534 1.00 0.00 ? 16 ASP B CA   8  
ATOM 11211 C C    . ASP B 2 16 ? 93.658  5.541   -16.442 1.00 0.00 ? 16 ASP B C    8  
ATOM 11212 O O    . ASP B 2 16 ? 94.567  4.778   -16.766 1.00 0.00 ? 16 ASP B O    8  
ATOM 11213 C CB   . ASP B 2 16 ? 91.580  5.641   -17.825 1.00 0.00 ? 16 ASP B CB   8  
ATOM 11214 C CG   . ASP B 2 16 ? 92.140  4.888   -19.027 1.00 0.00 ? 16 ASP B CG   8  
ATOM 11215 O OD1  . ASP B 2 16 ? 92.463  3.721   -18.873 1.00 0.00 ? 16 ASP B OD1  8  
ATOM 11216 O OD2  . ASP B 2 16 ? 92.238  5.489   -20.084 1.00 0.00 ? 16 ASP B OD2  8  
ATOM 11217 H H    . ASP B 2 16 ? 90.786  6.294   -15.501 1.00 0.00 ? 16 ASP B H    8  
ATOM 11218 H HA   . ASP B 2 16 ? 92.159  4.021   -16.555 1.00 0.00 ? 16 ASP B HA   8  
ATOM 11219 H HB2  . ASP B 2 16 ? 90.508  5.512   -17.790 1.00 0.00 ? 16 ASP B HB2  8  
ATOM 11220 H HB3  . ASP B 2 16 ? 91.812  6.690   -17.923 1.00 0.00 ? 16 ASP B HB3  8  
ATOM 11221 N N    . LEU B 2 17 ? 93.873  6.777   -16.000 1.00 0.00 ? 17 LEU B N    8  
ATOM 11222 C CA   . LEU B 2 17 ? 95.227  7.308   -15.871 1.00 0.00 ? 17 LEU B CA   8  
ATOM 11223 C C    . LEU B 2 17 ? 96.031  6.480   -14.873 1.00 0.00 ? 17 LEU B C    8  
ATOM 11224 O O    . LEU B 2 17 ? 97.139  6.029   -15.172 1.00 0.00 ? 17 LEU B O    8  
ATOM 11225 C CB   . LEU B 2 17 ? 95.165  8.771   -15.409 1.00 0.00 ? 17 LEU B CB   8  
ATOM 11226 C CG   . LEU B 2 17 ? 96.571  9.300   -15.089 1.00 0.00 ? 17 LEU B CG   8  
ATOM 11227 C CD1  . LEU B 2 17 ? 97.513  9.049   -16.274 1.00 0.00 ? 17 LEU B CD1  8  
ATOM 11228 C CD2  . LEU B 2 17 ? 96.486  10.805  -14.815 1.00 0.00 ? 17 LEU B CD2  8  
ATOM 11229 H H    . LEU B 2 17 ? 93.110  7.342   -15.758 1.00 0.00 ? 17 LEU B H    8  
ATOM 11230 H HA   . LEU B 2 17 ? 95.709  7.265   -16.836 1.00 0.00 ? 17 LEU B HA   8  
ATOM 11231 H HB2  . LEU B 2 17 ? 94.727  9.372   -16.192 1.00 0.00 ? 17 LEU B HB2  8  
ATOM 11232 H HB3  . LEU B 2 17 ? 94.550  8.837   -14.524 1.00 0.00 ? 17 LEU B HB3  8  
ATOM 11233 H HG   . LEU B 2 17 ? 96.956  8.799   -14.212 1.00 0.00 ? 17 LEU B HG   8  
ATOM 11234 H HD11 . LEU B 2 17 ? 98.374  9.698   -16.198 1.00 0.00 ? 17 LEU B HD11 8  
ATOM 11235 H HD12 . LEU B 2 17 ? 96.992  9.251   -17.199 1.00 0.00 ? 17 LEU B HD12 8  
ATOM 11236 H HD13 . LEU B 2 17 ? 97.838  8.019   -16.263 1.00 0.00 ? 17 LEU B HD13 8  
ATOM 11237 H HD21 . LEU B 2 17 ? 95.953  11.289  -15.620 1.00 0.00 ? 17 LEU B HD21 8  
ATOM 11238 H HD22 . LEU B 2 17 ? 97.484  11.215  -14.747 1.00 0.00 ? 17 LEU B HD22 8  
ATOM 11239 H HD23 . LEU B 2 17 ? 95.964  10.973  -13.885 1.00 0.00 ? 17 LEU B HD23 8  
ATOM 11240 N N    . VAL B 2 18 ? 95.463  6.281   -13.688 1.00 0.00 ? 18 VAL B N    8  
ATOM 11241 C CA   . VAL B 2 18 ? 96.134  5.501   -12.651 1.00 0.00 ? 18 VAL B CA   8  
ATOM 11242 C C    . VAL B 2 18 ? 96.420  4.085   -13.152 1.00 0.00 ? 18 VAL B C    8  
ATOM 11243 O O    . VAL B 2 18 ? 97.518  3.565   -12.954 1.00 0.00 ? 18 VAL B O    8  
ATOM 11244 C CB   . VAL B 2 18 ? 95.269  5.461   -11.380 1.00 0.00 ? 18 VAL B CB   8  
ATOM 11245 C CG1  . VAL B 2 18 ? 93.848  5.065   -11.735 1.00 0.00 ? 18 VAL B CG1  8  
ATOM 11246 C CG2  . VAL B 2 18 ? 95.812  4.439   -10.385 1.00 0.00 ? 18 VAL B CG2  8  
ATOM 11247 H H    . VAL B 2 18 ? 94.576  6.664   -13.510 1.00 0.00 ? 18 VAL B H    8  
ATOM 11248 H HA   . VAL B 2 18 ? 97.073  5.979   -12.415 1.00 0.00 ? 18 VAL B HA   8  
ATOM 11249 H HB   . VAL B 2 18 ? 95.263  6.439   -10.922 1.00 0.00 ? 18 VAL B HB   8  
ATOM 11250 H HG11 . VAL B 2 18 ? 93.495  5.701   -12.519 1.00 0.00 ? 18 VAL B HG11 8  
ATOM 11251 H HG12 . VAL B 2 18 ? 93.220  5.173   -10.865 1.00 0.00 ? 18 VAL B HG12 8  
ATOM 11252 H HG13 . VAL B 2 18 ? 93.833  4.037   -12.066 1.00 0.00 ? 18 VAL B HG13 8  
ATOM 11253 H HG21 . VAL B 2 18 ? 96.870  4.591   -10.248 1.00 0.00 ? 18 VAL B HG21 8  
ATOM 11254 H HG22 . VAL B 2 18 ? 95.631  3.443   -10.760 1.00 0.00 ? 18 VAL B HG22 8  
ATOM 11255 H HG23 . VAL B 2 18 ? 95.301  4.562   -9.442  1.00 0.00 ? 18 VAL B HG23 8  
ATOM 11256 N N    . LEU B 2 19 ? 95.438  3.465   -13.807 1.00 0.00 ? 19 LEU B N    8  
ATOM 11257 C CA   . LEU B 2 19 ? 95.639  2.114   -14.325 1.00 0.00 ? 19 LEU B CA   8  
ATOM 11258 C C    . LEU B 2 19 ? 96.820  2.098   -15.292 1.00 0.00 ? 19 LEU B C    8  
ATOM 11259 O O    . LEU B 2 19 ? 97.733  1.291   -15.150 1.00 0.00 ? 19 LEU B O    8  
ATOM 11260 C CB   . LEU B 2 19 ? 94.377  1.614   -15.052 1.00 0.00 ? 19 LEU B CB   8  
ATOM 11261 C CG   . LEU B 2 19 ? 93.335  1.086   -14.051 1.00 0.00 ? 19 LEU B CG   8  
ATOM 11262 C CD1  . LEU B 2 19 ? 92.028  0.822   -14.810 1.00 0.00 ? 19 LEU B CD1  8  
ATOM 11263 C CD2  . LEU B 2 19 ? 93.828  -0.224  -13.383 1.00 0.00 ? 19 LEU B CD2  8  
ATOM 11264 H H    . LEU B 2 19 ? 94.579  3.920   -13.947 1.00 0.00 ? 19 LEU B H    8  
ATOM 11265 H HA   . LEU B 2 19 ? 95.857  1.455   -13.502 1.00 0.00 ? 19 LEU B HA   8  
ATOM 11266 H HB2  . LEU B 2 19 ? 93.944  2.433   -15.609 1.00 0.00 ? 19 LEU B HB2  8  
ATOM 11267 H HB3  . LEU B 2 19 ? 94.642  0.823   -15.739 1.00 0.00 ? 19 LEU B HB3  8  
ATOM 11268 H HG   . LEU B 2 19 ? 93.159  1.835   -13.291 1.00 0.00 ? 19 LEU B HG   8  
ATOM 11269 H HD11 . LEU B 2 19 ? 91.338  0.295   -14.167 1.00 0.00 ? 19 LEU B HD11 8  
ATOM 11270 H HD12 . LEU B 2 19 ? 92.233  0.222   -15.688 1.00 0.00 ? 19 LEU B HD12 8  
ATOM 11271 H HD13 . LEU B 2 19 ? 91.593  1.761   -15.115 1.00 0.00 ? 19 LEU B HD13 8  
ATOM 11272 H HD21 . LEU B 2 19 ? 94.451  -0.778  -14.069 1.00 0.00 ? 19 LEU B HD21 8  
ATOM 11273 H HD22 . LEU B 2 19 ? 92.982  -0.836  -13.102 1.00 0.00 ? 19 LEU B HD22 8  
ATOM 11274 H HD23 . LEU B 2 19 ? 94.394  0.012   -12.496 1.00 0.00 ? 19 LEU B HD23 8  
ATOM 11275 N N    . THR B 2 20 ? 96.796  2.997   -16.270 1.00 0.00 ? 20 THR B N    8  
ATOM 11276 C CA   . THR B 2 20 ? 97.875  3.067   -17.251 1.00 0.00 ? 20 THR B CA   8  
ATOM 11277 C C    . THR B 2 20 ? 99.230  3.056   -16.554 1.00 0.00 ? 20 THR B C    8  
ATOM 11278 O O    . THR B 2 20 ? 100.110 2.261   -16.894 1.00 0.00 ? 20 THR B O    8  
ATOM 11279 C CB   . THR B 2 20 ? 97.740  4.342   -18.087 1.00 0.00 ? 20 THR B CB   8  
ATOM 11280 O OG1  . THR B 2 20 ? 96.423  4.421   -18.616 1.00 0.00 ? 20 THR B OG1  8  
ATOM 11281 C CG2  . THR B 2 20 ? 98.751  4.313   -19.233 1.00 0.00 ? 20 THR B CG2  8  
ATOM 11282 H H    . THR B 2 20 ? 96.043  3.620   -16.336 1.00 0.00 ? 20 THR B H    8  
ATOM 11283 H HA   . THR B 2 20 ? 97.810  2.211   -17.906 1.00 0.00 ? 20 THR B HA   8  
ATOM 11284 H HB   . THR B 2 20 ? 97.931  5.202   -17.465 1.00 0.00 ? 20 THR B HB   8  
ATOM 11285 H HG1  . THR B 2 20 ? 95.828  4.647   -17.897 1.00 0.00 ? 20 THR B HG1  8  
ATOM 11286 H HG21 . THR B 2 20 ? 98.566  5.144   -19.898 1.00 0.00 ? 20 THR B HG21 8  
ATOM 11287 H HG22 . THR B 2 20 ? 98.652  3.387   -19.779 1.00 0.00 ? 20 THR B HG22 8  
ATOM 11288 H HG23 . THR B 2 20 ? 99.752  4.390   -18.833 1.00 0.00 ? 20 THR B HG23 8  
ATOM 11289 N N    . VAL B 2 21 ? 99.390  3.934   -15.571 1.00 0.00 ? 21 VAL B N    8  
ATOM 11290 C CA   . VAL B 2 21 ? 100.641 4.007   -14.830 1.00 0.00 ? 21 VAL B CA   8  
ATOM 11291 C C    . VAL B 2 21 ? 100.917 2.678   -14.133 1.00 0.00 ? 21 VAL B C    8  
ATOM 11292 O O    . VAL B 2 21 ? 102.070 2.291   -13.948 1.00 0.00 ? 21 VAL B O    8  
ATOM 11293 C CB   . VAL B 2 21 ? 100.569 5.128   -13.791 1.00 0.00 ? 21 VAL B CB   8  
ATOM 11294 C CG1  . VAL B 2 21 ? 101.846 5.128   -12.948 1.00 0.00 ? 21 VAL B CG1  8  
ATOM 11295 C CG2  . VAL B 2 21 ? 100.430 6.475   -14.504 1.00 0.00 ? 21 VAL B CG2  8  
ATOM 11296 H H    . VAL B 2 21 ? 98.652  4.540   -15.339 1.00 0.00 ? 21 VAL B H    8  
ATOM 11297 H HA   . VAL B 2 21 ? 101.446 4.218   -15.518 1.00 0.00 ? 21 VAL B HA   8  
ATOM 11298 H HB   . VAL B 2 21 ? 99.715  4.969   -13.149 1.00 0.00 ? 21 VAL B HB   8  
ATOM 11299 H HG11 . VAL B 2 21 ? 101.902 6.045   -12.381 1.00 0.00 ? 21 VAL B HG11 8  
ATOM 11300 H HG12 . VAL B 2 21 ? 102.706 5.053   -13.597 1.00 0.00 ? 21 VAL B HG12 8  
ATOM 11301 H HG13 . VAL B 2 21 ? 101.831 4.286   -12.272 1.00 0.00 ? 21 VAL B HG13 8  
ATOM 11302 H HG21 . VAL B 2 21 ? 100.398 7.268   -13.772 1.00 0.00 ? 21 VAL B HG21 8  
ATOM 11303 H HG22 . VAL B 2 21 ? 99.520  6.483   -15.085 1.00 0.00 ? 21 VAL B HG22 8  
ATOM 11304 H HG23 . VAL B 2 21 ? 101.277 6.624   -15.159 1.00 0.00 ? 21 VAL B HG23 8  
ATOM 11305 N N    . LEU B 2 22 ? 99.848  1.986   -13.748 1.00 0.00 ? 22 LEU B N    8  
ATOM 11306 C CA   . LEU B 2 22 ? 99.986  0.702   -13.069 1.00 0.00 ? 22 LEU B CA   8  
ATOM 11307 C C    . LEU B 2 22 ? 100.554 -0.357  -14.015 1.00 0.00 ? 22 LEU B C    8  
ATOM 11308 O O    . LEU B 2 22 ? 101.448 -1.116  -13.639 1.00 0.00 ? 22 LEU B O    8  
ATOM 11309 C CB   . LEU B 2 22 ? 98.624  0.247   -12.531 1.00 0.00 ? 22 LEU B CB   8  
ATOM 11310 C CG   . LEU B 2 22 ? 98.809  -0.822  -11.441 1.00 0.00 ? 22 LEU B CG   8  
ATOM 11311 C CD1  . LEU B 2 22 ? 99.411  -0.203  -10.159 1.00 0.00 ? 22 LEU B CD1  8  
ATOM 11312 C CD2  . LEU B 2 22 ? 97.441  -1.441  -11.124 1.00 0.00 ? 22 LEU B CD2  8  
ATOM 11313 H H    . LEU B 2 22 ? 98.953  2.346   -13.920 1.00 0.00 ? 22 LEU B H    8  
ATOM 11314 H HA   . LEU B 2 22 ? 100.664 0.825   -12.240 1.00 0.00 ? 22 LEU B HA   8  
ATOM 11315 H HB2  . LEU B 2 22 ? 98.098  1.097   -12.122 1.00 0.00 ? 22 LEU B HB2  8  
ATOM 11316 H HB3  . LEU B 2 22 ? 98.044  -0.171  -13.340 1.00 0.00 ? 22 LEU B HB3  8  
ATOM 11317 H HG   . LEU B 2 22 ? 99.472  -1.590  -11.808 1.00 0.00 ? 22 LEU B HG   8  
ATOM 11318 H HD11 . LEU B 2 22 ? 100.489 -0.243  -10.213 1.00 0.00 ? 22 LEU B HD11 8  
ATOM 11319 H HD12 . LEU B 2 22 ? 99.083  -0.763  -9.294  1.00 0.00 ? 22 LEU B HD12 8  
ATOM 11320 H HD13 . LEU B 2 22 ? 99.094  0.825   -10.058 1.00 0.00 ? 22 LEU B HD13 8  
ATOM 11321 H HD21 . LEU B 2 22 ? 97.566  -2.241  -10.409 1.00 0.00 ? 22 LEU B HD21 8  
ATOM 11322 H HD22 . LEU B 2 22 ? 97.004  -1.832  -12.031 1.00 0.00 ? 22 LEU B HD22 8  
ATOM 11323 H HD23 . LEU B 2 22 ? 96.792  -0.685  -10.709 1.00 0.00 ? 22 LEU B HD23 8  
ATOM 11324 N N    . ILE B 2 23 ? 100.035 -0.408  -15.241 1.00 0.00 ? 23 ILE B N    8  
ATOM 11325 C CA   . ILE B 2 23 ? 100.515 -1.387  -16.213 1.00 0.00 ? 23 ILE B CA   8  
ATOM 11326 C C    . ILE B 2 23 ? 101.994 -1.156  -16.500 1.00 0.00 ? 23 ILE B C    8  
ATOM 11327 O O    . ILE B 2 23 ? 102.803 -2.080  -16.418 1.00 0.00 ? 23 ILE B O    8  
ATOM 11328 C CB   . ILE B 2 23 ? 99.724  -1.281  -17.524 1.00 0.00 ? 23 ILE B CB   8  
ATOM 11329 C CG1  . ILE B 2 23 ? 98.215  -1.307  -17.240 1.00 0.00 ? 23 ILE B CG1  8  
ATOM 11330 C CG2  . ILE B 2 23 ? 100.092 -2.450  -18.445 1.00 0.00 ? 23 ILE B CG2  8  
ATOM 11331 C CD1  . ILE B 2 23 ? 97.854  -2.522  -16.381 1.00 0.00 ? 23 ILE B CD1  8  
ATOM 11332 H H    . ILE B 2 23 ? 99.325  0.218   -15.493 1.00 0.00 ? 23 ILE B H    8  
ATOM 11333 H HA   . ILE B 2 23 ? 100.389 -2.376  -15.803 1.00 0.00 ? 23 ILE B HA   8  
ATOM 11334 H HB   . ILE B 2 23 ? 99.978  -0.353  -18.015 1.00 0.00 ? 23 ILE B HB   8  
ATOM 11335 H HG12 . ILE B 2 23 ? 97.933  -0.407  -16.719 1.00 0.00 ? 23 ILE B HG12 8  
ATOM 11336 H HG13 . ILE B 2 23 ? 97.677  -1.361  -18.173 1.00 0.00 ? 23 ILE B HG13 8  
ATOM 11337 H HG21 . ILE B 2 23 ? 100.128 -3.366  -17.874 1.00 0.00 ? 23 ILE B HG21 8  
ATOM 11338 H HG22 . ILE B 2 23 ? 101.057 -2.268  -18.892 1.00 0.00 ? 23 ILE B HG22 8  
ATOM 11339 H HG23 . ILE B 2 23 ? 99.348  -2.544  -19.222 1.00 0.00 ? 23 ILE B HG23 8  
ATOM 11340 H HD11 . ILE B 2 23 ? 96.795  -2.717  -16.462 1.00 0.00 ? 23 ILE B HD11 8  
ATOM 11341 H HD12 . ILE B 2 23 ? 98.102  -2.320  -15.349 1.00 0.00 ? 23 ILE B HD12 8  
ATOM 11342 H HD13 . ILE B 2 23 ? 98.404  -3.385  -16.723 1.00 0.00 ? 23 ILE B HD13 8  
ATOM 11343 N N    . ALA B 2 24 ? 102.343 0.085   -16.826 1.00 0.00 ? 24 ALA B N    8  
ATOM 11344 C CA   . ALA B 2 24 ? 103.733 0.419   -17.110 1.00 0.00 ? 24 ALA B CA   8  
ATOM 11345 C C    . ALA B 2 24 ? 104.614 0.026   -15.928 1.00 0.00 ? 24 ALA B C    8  
ATOM 11346 O O    . ALA B 2 24 ? 105.702 -0.527  -16.100 1.00 0.00 ? 24 ALA B O    8  
ATOM 11347 C CB   . ALA B 2 24 ? 103.869 1.919   -17.378 1.00 0.00 ? 24 ALA B CB   8  
ATOM 11348 H H    . ALA B 2 24 ? 101.657 0.785   -16.871 1.00 0.00 ? 24 ALA B H    8  
ATOM 11349 H HA   . ALA B 2 24 ? 104.056 -0.126  -17.985 1.00 0.00 ? 24 ALA B HA   8  
ATOM 11350 H HB1  . ALA B 2 24 ? 104.898 2.152   -17.607 1.00 0.00 ? 24 ALA B HB1  8  
ATOM 11351 H HB2  . ALA B 2 24 ? 103.562 2.471   -16.502 1.00 0.00 ? 24 ALA B HB2  8  
ATOM 11352 H HB3  . ALA B 2 24 ? 103.243 2.193   -18.215 1.00 0.00 ? 24 ALA B HB3  8  
ATOM 11353 N N    . LEU B 2 25 ? 104.124 0.308   -14.724 1.00 0.00 ? 25 LEU B N    8  
ATOM 11354 C CA   . LEU B 2 25 ? 104.862 -0.026  -13.514 1.00 0.00 ? 25 LEU B CA   8  
ATOM 11355 C C    . LEU B 2 25 ? 105.093 -1.530  -13.452 1.00 0.00 ? 25 LEU B C    8  
ATOM 11356 O O    . LEU B 2 25 ? 106.150 -1.991  -13.021 1.00 0.00 ? 25 LEU B O    8  
ATOM 11357 C CB   . LEU B 2 25 ? 104.074 0.439   -12.282 1.00 0.00 ? 25 LEU B CB   8  
ATOM 11358 C CG   . LEU B 2 25 ? 104.787 0.010   -10.989 1.00 0.00 ? 25 LEU B CG   8  
ATOM 11359 C CD1  . LEU B 2 25 ? 106.227 0.548   -10.970 1.00 0.00 ? 25 LEU B CD1  8  
ATOM 11360 C CD2  . LEU B 2 25 ? 104.016 0.571   -9.789  1.00 0.00 ? 25 LEU B CD2  8  
ATOM 11361 H H    . LEU B 2 25 ? 103.249 0.743   -14.650 1.00 0.00 ? 25 LEU B H    8  
ATOM 11362 H HA   . LEU B 2 25 ? 105.815 0.479   -13.537 1.00 0.00 ? 25 LEU B HA   8  
ATOM 11363 H HB2  . LEU B 2 25 ? 103.988 1.515   -12.300 1.00 0.00 ? 25 LEU B HB2  8  
ATOM 11364 H HB3  . LEU B 2 25 ? 103.088 0.002   -12.304 1.00 0.00 ? 25 LEU B HB3  8  
ATOM 11365 H HG   . LEU B 2 25 ? 104.807 -1.068  -10.927 1.00 0.00 ? 25 LEU B HG   8  
ATOM 11366 H HD11 . LEU B 2 25 ? 106.862 -0.107  -11.548 1.00 0.00 ? 25 LEU B HD11 8  
ATOM 11367 H HD12 . LEU B 2 25 ? 106.589 0.585   -9.952  1.00 0.00 ? 25 LEU B HD12 8  
ATOM 11368 H HD13 . LEU B 2 25 ? 106.250 1.540   -11.397 1.00 0.00 ? 25 LEU B HD13 8  
ATOM 11369 H HD21 . LEU B 2 25 ? 104.557 0.354   -8.880  1.00 0.00 ? 25 LEU B HD21 8  
ATOM 11370 H HD22 . LEU B 2 25 ? 103.038 0.114   -9.745  1.00 0.00 ? 25 LEU B HD22 8  
ATOM 11371 H HD23 . LEU B 2 25 ? 103.909 1.641   -9.898  1.00 0.00 ? 25 LEU B HD23 8  
ATOM 11372 N N    . ALA B 2 26 ? 104.096 -2.291  -13.894 1.00 0.00 ? 26 ALA B N    8  
ATOM 11373 C CA   . ALA B 2 26 ? 104.200 -3.745  -13.895 1.00 0.00 ? 26 ALA B CA   8  
ATOM 11374 C C    . ALA B 2 26 ? 105.304 -4.193  -14.845 1.00 0.00 ? 26 ALA B C    8  
ATOM 11375 O O    . ALA B 2 26 ? 106.058 -5.118  -14.544 1.00 0.00 ? 26 ALA B O    8  
ATOM 11376 C CB   . ALA B 2 26 ? 102.870 -4.365  -14.327 1.00 0.00 ? 26 ALA B CB   8  
ATOM 11377 H H    . ALA B 2 26 ? 103.280 -1.867  -14.232 1.00 0.00 ? 26 ALA B H    8  
ATOM 11378 H HA   . ALA B 2 26 ? 104.436 -4.082  -12.896 1.00 0.00 ? 26 ALA B HA   8  
ATOM 11379 H HB1  . ALA B 2 26 ? 102.744 -4.240  -15.392 1.00 0.00 ? 26 ALA B HB1  8  
ATOM 11380 H HB2  . ALA B 2 26 ? 102.061 -3.874  -13.807 1.00 0.00 ? 26 ALA B HB2  8  
ATOM 11381 H HB3  . ALA B 2 26 ? 102.867 -5.417  -14.085 1.00 0.00 ? 26 ALA B HB3  8  
ATOM 11382 N N    . VAL B 2 27 ? 105.397 -3.526  -15.991 1.00 0.00 ? 27 VAL B N    8  
ATOM 11383 C CA   . VAL B 2 27 ? 106.418 -3.862  -16.974 1.00 0.00 ? 27 VAL B CA   8  
ATOM 11384 C C    . VAL B 2 27 ? 107.805 -3.692  -16.366 1.00 0.00 ? 27 VAL B C    8  
ATOM 11385 O O    . VAL B 2 27 ? 108.655 -4.576  -16.476 1.00 0.00 ? 27 VAL B O    8  
ATOM 11386 C CB   . VAL B 2 27 ? 106.278 -2.963  -18.205 1.00 0.00 ? 27 VAL B CB   8  
ATOM 11387 C CG1  . VAL B 2 27 ? 107.427 -3.240  -19.177 1.00 0.00 ? 27 VAL B CG1  8  
ATOM 11388 C CG2  . VAL B 2 27 ? 104.946 -3.254  -18.899 1.00 0.00 ? 27 VAL B CG2  8  
ATOM 11389 H H    . VAL B 2 27 ? 104.770 -2.795  -16.176 1.00 0.00 ? 27 VAL B H    8  
ATOM 11390 H HA   . VAL B 2 27 ? 106.290 -4.891  -17.277 1.00 0.00 ? 27 VAL B HA   8  
ATOM 11391 H HB   . VAL B 2 27 ? 106.309 -1.927  -17.898 1.00 0.00 ? 27 VAL B HB   8  
ATOM 11392 H HG11 . VAL B 2 27 ? 107.534 -4.306  -19.313 1.00 0.00 ? 27 VAL B HG11 8  
ATOM 11393 H HG12 . VAL B 2 27 ? 108.345 -2.835  -18.776 1.00 0.00 ? 27 VAL B HG12 8  
ATOM 11394 H HG13 . VAL B 2 27 ? 107.214 -2.776  -20.128 1.00 0.00 ? 27 VAL B HG13 8  
ATOM 11395 H HG21 . VAL B 2 27 ? 104.826 -2.588  -19.740 1.00 0.00 ? 27 VAL B HG21 8  
ATOM 11396 H HG22 . VAL B 2 27 ? 104.136 -3.103  -18.202 1.00 0.00 ? 27 VAL B HG22 8  
ATOM 11397 H HG23 . VAL B 2 27 ? 104.938 -4.277  -19.246 1.00 0.00 ? 27 VAL B HG23 8  
ATOM 11398 N N    . TYR B 2 28 ? 108.025 -2.553  -15.716 1.00 0.00 ? 28 TYR B N    8  
ATOM 11399 C CA   . TYR B 2 28 ? 109.313 -2.287  -15.086 1.00 0.00 ? 28 TYR B CA   8  
ATOM 11400 C C    . TYR B 2 28 ? 109.572 -3.294  -13.970 1.00 0.00 ? 28 TYR B C    8  
ATOM 11401 O O    . TYR B 2 28 ? 110.697 -3.758  -13.784 1.00 0.00 ? 28 TYR B O    8  
ATOM 11402 C CB   . TYR B 2 28 ? 109.337 -0.868  -14.514 1.00 0.00 ? 28 TYR B CB   8  
ATOM 11403 C CG   . TYR B 2 28 ? 110.685 -0.603  -13.886 1.00 0.00 ? 28 TYR B CG   8  
ATOM 11404 C CD1  . TYR B 2 28 ? 110.916 -0.951  -12.550 1.00 0.00 ? 28 TYR B CD1  8  
ATOM 11405 C CD2  . TYR B 2 28 ? 111.705 -0.011  -14.641 1.00 0.00 ? 28 TYR B CD2  8  
ATOM 11406 C CE1  . TYR B 2 28 ? 112.166 -0.707  -11.969 1.00 0.00 ? 28 TYR B CE1  8  
ATOM 11407 C CE2  . TYR B 2 28 ? 112.954 0.233   -14.060 1.00 0.00 ? 28 TYR B CE2  8  
ATOM 11408 C CZ   . TYR B 2 28 ? 113.185 -0.114  -12.724 1.00 0.00 ? 28 TYR B CZ   8  
ATOM 11409 O OH   . TYR B 2 28 ? 114.418 0.127   -12.151 1.00 0.00 ? 28 TYR B OH   8  
ATOM 11410 H H    . TYR B 2 28 ? 107.308 -1.885  -15.654 1.00 0.00 ? 28 TYR B H    8  
ATOM 11411 H HA   . TYR B 2 28 ? 110.092 -2.377  -15.828 1.00 0.00 ? 28 TYR B HA   8  
ATOM 11412 H HB2  . TYR B 2 28 ? 109.162 -0.157  -15.307 1.00 0.00 ? 28 TYR B HB2  8  
ATOM 11413 H HB3  . TYR B 2 28 ? 108.567 -0.769  -13.764 1.00 0.00 ? 28 TYR B HB3  8  
ATOM 11414 H HD1  . TYR B 2 28 ? 110.130 -1.408  -11.967 1.00 0.00 ? 28 TYR B HD1  8  
ATOM 11415 H HD2  . TYR B 2 28 ? 111.527 0.257   -15.673 1.00 0.00 ? 28 TYR B HD2  8  
ATOM 11416 H HE1  . TYR B 2 28 ? 112.344 -0.975  -10.938 1.00 0.00 ? 28 TYR B HE1  8  
ATOM 11417 H HE2  . TYR B 2 28 ? 113.741 0.690   -14.643 1.00 0.00 ? 28 TYR B HE2  8  
ATOM 11418 H HH   . TYR B 2 28 ? 114.289 0.723   -11.410 1.00 0.00 ? 28 TYR B HH   8  
ATOM 11419 N N    . PHE B 2 29 ? 108.518 -3.626  -13.230 1.00 0.00 ? 29 PHE B N    8  
ATOM 11420 C CA   . PHE B 2 29 ? 108.630 -4.580  -12.133 1.00 0.00 ? 29 PHE B CA   8  
ATOM 11421 C C    . PHE B 2 29 ? 109.154 -5.920  -12.644 1.00 0.00 ? 29 PHE B C    8  
ATOM 11422 O O    . PHE B 2 29 ? 110.064 -6.505  -12.057 1.00 0.00 ? 29 PHE B O    8  
ATOM 11423 C CB   . PHE B 2 29 ? 107.257 -4.770  -11.479 1.00 0.00 ? 29 PHE B CB   8  
ATOM 11424 C CG   . PHE B 2 29 ? 107.320 -5.886  -10.457 1.00 0.00 ? 29 PHE B CG   8  
ATOM 11425 C CD1  . PHE B 2 29 ? 108.166 -5.770  -9.348  1.00 0.00 ? 29 PHE B CD1  8  
ATOM 11426 C CD2  . PHE B 2 29 ? 106.532 -7.035  -10.617 1.00 0.00 ? 29 PHE B CD2  8  
ATOM 11427 C CE1  . PHE B 2 29 ? 108.225 -6.800  -8.400  1.00 0.00 ? 29 PHE B CE1  8  
ATOM 11428 C CE2  . PHE B 2 29 ? 106.592 -8.064  -9.670  1.00 0.00 ? 29 PHE B CE2  8  
ATOM 11429 C CZ   . PHE B 2 29 ? 107.438 -7.947  -8.562  1.00 0.00 ? 29 PHE B CZ   8  
ATOM 11430 H H    . PHE B 2 29 ? 107.647 -3.224  -13.428 1.00 0.00 ? 29 PHE B H    8  
ATOM 11431 H HA   . PHE B 2 29 ? 109.317 -4.191  -11.397 1.00 0.00 ? 29 PHE B HA   8  
ATOM 11432 H HB2  . PHE B 2 29 ? 106.965 -3.853  -10.990 1.00 0.00 ? 29 PHE B HB2  8  
ATOM 11433 H HB3  . PHE B 2 29 ? 106.530 -5.017  -12.239 1.00 0.00 ? 29 PHE B HB3  8  
ATOM 11434 H HD1  . PHE B 2 29 ? 108.773 -4.887  -9.222  1.00 0.00 ? 29 PHE B HD1  8  
ATOM 11435 H HD2  . PHE B 2 29 ? 105.878 -7.127  -11.473 1.00 0.00 ? 29 PHE B HD2  8  
ATOM 11436 H HE1  . PHE B 2 29 ? 108.879 -6.710  -7.545  1.00 0.00 ? 29 PHE B HE1  8  
ATOM 11437 H HE2  . PHE B 2 29 ? 105.983 -8.949  -9.795  1.00 0.00 ? 29 PHE B HE2  8  
ATOM 11438 H HZ   . PHE B 2 29 ? 107.485 -8.741  -7.832  1.00 0.00 ? 29 PHE B HZ   8  
ATOM 11439 N N    . LEU B 2 30 ? 108.576 -6.398  -13.741 1.00 0.00 ? 30 LEU B N    8  
ATOM 11440 C CA   . LEU B 2 30 ? 108.995 -7.669  -14.320 1.00 0.00 ? 30 LEU B CA   8  
ATOM 11441 C C    . LEU B 2 30 ? 110.451 -7.590  -14.768 1.00 0.00 ? 30 LEU B C    8  
ATOM 11442 O O    . LEU B 2 30 ? 111.218 -8.536  -14.591 1.00 0.00 ? 30 LEU B O    8  
ATOM 11443 C CB   . LEU B 2 30 ? 108.094 -8.018  -15.514 1.00 0.00 ? 30 LEU B CB   8  
ATOM 11444 C CG   . LEU B 2 30 ? 108.604 -9.280  -16.226 1.00 0.00 ? 30 LEU B CG   8  
ATOM 11445 C CD1  . LEU B 2 30 ? 108.753 -10.433 -15.223 1.00 0.00 ? 30 LEU B CD1  8  
ATOM 11446 C CD2  . LEU B 2 30 ? 107.599 -9.677  -17.312 1.00 0.00 ? 30 LEU B CD2  8  
ATOM 11447 H H    . LEU B 2 30 ? 107.856 -5.888  -14.167 1.00 0.00 ? 30 LEU B H    8  
ATOM 11448 H HA   . LEU B 2 30 ? 108.899 -8.438  -13.570 1.00 0.00 ? 30 LEU B HA   8  
ATOM 11449 H HB2  . LEU B 2 30 ? 107.089 -8.188  -15.162 1.00 0.00 ? 30 LEU B HB2  8  
ATOM 11450 H HB3  . LEU B 2 30 ? 108.093 -7.192  -16.210 1.00 0.00 ? 30 LEU B HB3  8  
ATOM 11451 H HG   . LEU B 2 30 ? 109.562 -9.076  -16.684 1.00 0.00 ? 30 LEU B HG   8  
ATOM 11452 H HD11 . LEU B 2 30 ? 109.683 -10.324 -14.686 1.00 0.00 ? 30 LEU B HD11 8  
ATOM 11453 H HD12 . LEU B 2 30 ? 108.755 -11.377 -15.750 1.00 0.00 ? 30 LEU B HD12 8  
ATOM 11454 H HD13 . LEU B 2 30 ? 107.930 -10.414 -14.523 1.00 0.00 ? 30 LEU B HD13 8  
ATOM 11455 H HD21 . LEU B 2 30 ? 108.022 -10.458 -17.927 1.00 0.00 ? 30 LEU B HD21 8  
ATOM 11456 H HD22 . LEU B 2 30 ? 107.375 -8.817  -17.927 1.00 0.00 ? 30 LEU B HD22 8  
ATOM 11457 H HD23 . LEU B 2 30 ? 106.691 -10.034 -16.850 1.00 0.00 ? 30 LEU B HD23 8  
ATOM 11458 N N    . GLY B 2 31 ? 110.825 -6.454  -15.350 1.00 0.00 ? 31 GLY B N    8  
ATOM 11459 C CA   . GLY B 2 31 ? 112.192 -6.258  -15.822 1.00 0.00 ? 31 GLY B CA   8  
ATOM 11460 C C    . GLY B 2 31 ? 112.372 -6.834  -17.221 1.00 0.00 ? 31 GLY B C    8  
ATOM 11461 O O    . GLY B 2 31 ? 111.451 -7.426  -17.783 1.00 0.00 ? 31 GLY B O    8  
ATOM 11462 H H    . GLY B 2 31 ? 110.169 -5.734  -15.464 1.00 0.00 ? 31 GLY B H    8  
ATOM 11463 H HA2  . GLY B 2 31 ? 112.411 -5.199  -15.843 1.00 0.00 ? 31 GLY B HA2  8  
ATOM 11464 H HA3  . GLY B 2 31 ? 112.878 -6.748  -15.148 1.00 0.00 ? 31 GLY B HA3  8  
ATOM 11465 N N    . ARG B 2 32 ? 113.565 -6.657  -17.779 1.00 0.00 ? 32 ARG B N    8  
ATOM 11466 C CA   . ARG B 2 32 ? 113.856 -7.163  -19.115 1.00 0.00 ? 32 ARG B CA   8  
ATOM 11467 C C    . ARG B 2 32 ? 113.958 -8.685  -19.102 1.00 0.00 ? 32 ARG B C    8  
ATOM 11468 O O    . ARG B 2 32 ? 115.037 -9.242  -18.898 1.00 0.00 ? 32 ARG B O    8  
ATOM 11469 C CB   . ARG B 2 32 ? 115.169 -6.566  -19.625 1.00 0.00 ? 32 ARG B CB   8  
ATOM 11470 C CG   . ARG B 2 32 ? 115.033 -5.044  -19.720 1.00 0.00 ? 32 ARG B CG   8  
ATOM 11471 C CD   . ARG B 2 32 ? 116.350 -4.445  -20.216 1.00 0.00 ? 32 ARG B CD   8  
ATOM 11472 N NE   . ARG B 2 32 ? 116.259 -2.989  -20.254 1.00 0.00 ? 32 ARG B NE   8  
ATOM 11473 C CZ   . ARG B 2 32 ? 116.461 -2.256  -19.163 1.00 0.00 ? 32 ARG B CZ   8  
ATOM 11474 N NH1  . ARG B 2 32 ? 116.750 -2.837  -18.031 1.00 0.00 ? 32 ARG B NH1  8  
ATOM 11475 N NH2  . ARG B 2 32 ? 116.372 -0.956  -19.225 1.00 0.00 ? 32 ARG B NH2  8  
ATOM 11476 H H    . ARG B 2 32 ? 114.261 -6.177  -17.284 1.00 0.00 ? 32 ARG B H    8  
ATOM 11477 H HA   . ARG B 2 32 ? 113.058 -6.871  -19.782 1.00 0.00 ? 32 ARG B HA   8  
ATOM 11478 H HB2  . ARG B 2 32 ? 115.967 -6.816  -18.941 1.00 0.00 ? 32 ARG B HB2  8  
ATOM 11479 H HB3  . ARG B 2 32 ? 115.392 -6.967  -20.602 1.00 0.00 ? 32 ARG B HB3  8  
ATOM 11480 H HG2  . ARG B 2 32 ? 114.241 -4.797  -20.412 1.00 0.00 ? 32 ARG B HG2  8  
ATOM 11481 H HG3  . ARG B 2 32 ? 114.801 -4.642  -18.746 1.00 0.00 ? 32 ARG B HG3  8  
ATOM 11482 H HD2  . ARG B 2 32 ? 117.150 -4.736  -19.550 1.00 0.00 ? 32 ARG B HD2  8  
ATOM 11483 H HD3  . ARG B 2 32 ? 116.560 -4.819  -21.208 1.00 0.00 ? 32 ARG B HD3  8  
ATOM 11484 H HE   . ARG B 2 32 ? 116.044 -2.543  -21.100 1.00 0.00 ? 32 ARG B HE   8  
ATOM 11485 H HH11 . ARG B 2 32 ? 116.819 -3.834  -17.984 1.00 0.00 ? 32 ARG B HH11 8  
ATOM 11486 H HH12 . ARG B 2 32 ? 116.902 -2.287  -17.211 1.00 0.00 ? 32 ARG B HH12 8  
ATOM 11487 H HH21 . ARG B 2 32 ? 116.152 -0.510  -20.093 1.00 0.00 ? 32 ARG B HH21 8  
ATOM 11488 H HH22 . ARG B 2 32 ? 116.524 -0.405  -18.404 1.00 0.00 ? 32 ARG B HH22 8  
ATOM 11489 N N    . CYS A 1 1  ? 74.222  22.381  -19.918 1.00 0.00 ? 1  CYS A N    9  
ATOM 11490 C CA   . CYS A 1 1  ? 73.124  21.704  -19.174 1.00 0.00 ? 1  CYS A CA   9  
ATOM 11491 C C    . CYS A 1 1  ? 72.962  20.280  -19.697 1.00 0.00 ? 1  CYS A C    9  
ATOM 11492 O O    . CYS A 1 1  ? 72.852  19.332  -18.919 1.00 0.00 ? 1  CYS A O    9  
ATOM 11493 C CB   . CYS A 1 1  ? 71.821  22.484  -19.372 1.00 0.00 ? 1  CYS A CB   9  
ATOM 11494 S SG   . CYS A 1 1  ? 70.488  21.677  -18.453 1.00 0.00 ? 1  CYS A SG   9  
ATOM 11495 H HA   . CYS A 1 1  ? 73.367  21.674  -18.122 1.00 0.00 ? 1  CYS A HA   9  
ATOM 11496 H HB2  . CYS A 1 1  ? 71.949  23.494  -19.009 1.00 0.00 ? 1  CYS A HB2  9  
ATOM 11497 H HB3  . CYS A 1 1  ? 71.572  22.508  -20.423 1.00 0.00 ? 1  CYS A HB3  9  
ATOM 11498 N N    . SER A 1 2  ? 72.948  20.138  -21.018 1.00 0.00 ? 2  SER A N    9  
ATOM 11499 C CA   . SER A 1 2  ? 72.799  18.824  -21.632 1.00 0.00 ? 2  SER A CA   9  
ATOM 11500 C C    . SER A 1 2  ? 73.833  17.851  -21.074 1.00 0.00 ? 2  SER A C    9  
ATOM 11501 O O    . SER A 1 2  ? 75.032  18.005  -21.304 1.00 0.00 ? 2  SER A O    9  
ATOM 11502 C CB   . SER A 1 2  ? 72.967  18.934  -23.148 1.00 0.00 ? 2  SER A CB   9  
ATOM 11503 O OG   . SER A 1 2  ? 74.351  18.963  -23.467 1.00 0.00 ? 2  SER A OG   9  
ATOM 11504 H H    . SER A 1 2  ? 73.039  20.929  -21.588 1.00 0.00 ? 2  SER A H    9  
ATOM 11505 H HA   . SER A 1 2  ? 71.811  18.447  -21.417 1.00 0.00 ? 2  SER A HA   9  
ATOM 11506 H HB2  . SER A 1 2  ? 72.510  18.084  -23.626 1.00 0.00 ? 2  SER A HB2  9  
ATOM 11507 H HB3  . SER A 1 2  ? 72.488  19.840  -23.497 1.00 0.00 ? 2  SER A HB3  9  
ATOM 11508 H HG   . SER A 1 2  ? 74.530  18.247  -24.081 1.00 0.00 ? 2  SER A HG   9  
ATOM 11509 N N    . THR A 1 3  ? 73.359  16.846  -20.340 1.00 0.00 ? 3  THR A N    9  
ATOM 11510 C CA   . THR A 1 3  ? 74.249  15.846  -19.753 1.00 0.00 ? 3  THR A CA   9  
ATOM 11511 C C    . THR A 1 3  ? 74.502  14.714  -20.743 1.00 0.00 ? 3  THR A C    9  
ATOM 11512 O O    . THR A 1 3  ? 73.815  14.604  -21.757 1.00 0.00 ? 3  THR A O    9  
ATOM 11513 C CB   . THR A 1 3  ? 73.623  15.280  -18.476 1.00 0.00 ? 3  THR A CB   9  
ATOM 11514 O OG1  . THR A 1 3  ? 74.221  14.026  -18.175 1.00 0.00 ? 3  THR A OG1  9  
ATOM 11515 C CG2  . THR A 1 3  ? 72.120  15.095  -18.680 1.00 0.00 ? 3  THR A CG2  9  
ATOM 11516 H H    . THR A 1 3  ? 72.393  16.774  -20.192 1.00 0.00 ? 3  THR A H    9  
ATOM 11517 H HA   . THR A 1 3  ? 75.192  16.312  -19.503 1.00 0.00 ? 3  THR A HA   9  
ATOM 11518 H HB   . THR A 1 3  ? 73.789  15.964  -17.658 1.00 0.00 ? 3  THR A HB   9  
ATOM 11519 H HG1  . THR A 1 3  ? 74.449  14.022  -17.243 1.00 0.00 ? 3  THR A HG1  9  
ATOM 11520 H HG21 . THR A 1 3  ? 71.632  16.059  -18.660 1.00 0.00 ? 3  THR A HG21 9  
ATOM 11521 H HG22 . THR A 1 3  ? 71.723  14.474  -17.891 1.00 0.00 ? 3  THR A HG22 9  
ATOM 11522 H HG23 . THR A 1 3  ? 71.942  14.622  -19.634 1.00 0.00 ? 3  THR A HG23 9  
ATOM 11523 N N    . VAL A 1 4  ? 75.495  13.876  -20.435 1.00 0.00 ? 4  VAL A N    9  
ATOM 11524 C CA   . VAL A 1 4  ? 75.852  12.742  -21.296 1.00 0.00 ? 4  VAL A CA   9  
ATOM 11525 C C    . VAL A 1 4  ? 75.658  13.086  -22.768 1.00 0.00 ? 4  VAL A C    9  
ATOM 11526 O O    . VAL A 1 4  ? 75.352  12.221  -23.588 1.00 0.00 ? 4  VAL A O    9  
ATOM 11527 C CB   . VAL A 1 4  ? 75.015  11.512  -20.925 1.00 0.00 ? 4  VAL A CB   9  
ATOM 11528 C CG1  . VAL A 1 4  ? 75.349  11.087  -19.494 1.00 0.00 ? 4  VAL A CG1  9  
ATOM 11529 C CG2  . VAL A 1 4  ? 73.521  11.841  -21.019 1.00 0.00 ? 4  VAL A CG2  9  
ATOM 11530 H H    . VAL A 1 4  ? 76.001  14.025  -19.610 1.00 0.00 ? 4  VAL A H    9  
ATOM 11531 H HA   . VAL A 1 4  ? 76.896  12.506  -21.141 1.00 0.00 ? 4  VAL A HA   9  
ATOM 11532 H HB   . VAL A 1 4  ? 75.249  10.703  -21.603 1.00 0.00 ? 4  VAL A HB   9  
ATOM 11533 H HG11 . VAL A 1 4  ? 74.760  10.222  -19.229 1.00 0.00 ? 4  VAL A HG11 9  
ATOM 11534 H HG12 . VAL A 1 4  ? 75.125  11.898  -18.816 1.00 0.00 ? 4  VAL A HG12 9  
ATOM 11535 H HG13 . VAL A 1 4  ? 76.398  10.842  -19.427 1.00 0.00 ? 4  VAL A HG13 9  
ATOM 11536 H HG21 . VAL A 1 4  ? 72.947  10.929  -20.946 1.00 0.00 ? 4  VAL A HG21 9  
ATOM 11537 H HG22 . VAL A 1 4  ? 73.312  12.319  -21.964 1.00 0.00 ? 4  VAL A HG22 9  
ATOM 11538 H HG23 . VAL A 1 4  ? 73.245  12.502  -20.210 1.00 0.00 ? 4  VAL A HG23 9  
ATOM 11539 N N    . SER A 1 5  ? 75.858  14.358  -23.091 1.00 0.00 ? 5  SER A N    9  
ATOM 11540 C CA   . SER A 1 5  ? 75.726  14.828  -24.466 1.00 0.00 ? 5  SER A CA   9  
ATOM 11541 C C    . SER A 1 5  ? 77.039  14.625  -25.229 1.00 0.00 ? 5  SER A C    9  
ATOM 11542 O O    . SER A 1 5  ? 77.023  14.263  -26.406 1.00 0.00 ? 5  SER A O    9  
ATOM 11543 C CB   . SER A 1 5  ? 75.321  16.315  -24.485 1.00 0.00 ? 5  SER A CB   9  
ATOM 11544 O OG   . SER A 1 5  ? 74.603  16.615  -23.295 1.00 0.00 ? 5  SER A OG   9  
ATOM 11545 H H    . SER A 1 5  ? 76.116  14.992  -22.387 1.00 0.00 ? 5  SER A H    9  
ATOM 11546 H HA   . SER A 1 5  ? 74.952  14.252  -24.956 1.00 0.00 ? 5  SER A HA   9  
ATOM 11547 H HB2  . SER A 1 5  ? 76.196  16.942  -24.536 1.00 0.00 ? 5  SER A HB2  9  
ATOM 11548 H HB3  . SER A 1 5  ? 74.696  16.508  -25.349 1.00 0.00 ? 5  SER A HB3  9  
ATOM 11549 H HG   . SER A 1 5  ? 75.195  17.085  -22.703 1.00 0.00 ? 5  SER A HG   9  
ATOM 11550 N N    . PRO A 1 6  ? 78.169  14.839  -24.591 1.00 0.00 ? 6  PRO A N    9  
ATOM 11551 C CA   . PRO A 1 6  ? 79.503  14.660  -25.242 1.00 0.00 ? 6  PRO A CA   9  
ATOM 11552 C C    . PRO A 1 6  ? 79.619  13.338  -25.979 1.00 0.00 ? 6  PRO A C    9  
ATOM 11553 O O    . PRO A 1 6  ? 80.153  13.291  -27.086 1.00 0.00 ? 6  PRO A O    9  
ATOM 11554 C CB   . PRO A 1 6  ? 80.480  14.753  -24.066 1.00 0.00 ? 6  PRO A CB   9  
ATOM 11555 C CG   . PRO A 1 6  ? 79.793  15.669  -23.116 1.00 0.00 ? 6  PRO A CG   9  
ATOM 11556 C CD   . PRO A 1 6  ? 78.324  15.273  -23.187 1.00 0.00 ? 6  PRO A CD   9  
ATOM 11557 H HA   . PRO A 1 6  ? 79.700  15.462  -25.919 1.00 0.00 ? 6  PRO A HA   9  
ATOM 11558 H HB2  . PRO A 1 6  ? 80.628  13.778  -23.619 1.00 0.00 ? 6  PRO A HB2  9  
ATOM 11559 H HB3  . PRO A 1 6  ? 81.422  15.178  -24.379 1.00 0.00 ? 6  PRO A HB3  9  
ATOM 11560 H HG2  . PRO A 1 6  ? 80.175  15.537  -22.118 1.00 0.00 ? 6  PRO A HG2  9  
ATOM 11561 H HG3  . PRO A 1 6  ? 79.908  16.694  -23.432 1.00 0.00 ? 6  PRO A HG3  9  
ATOM 11562 H HD2  . PRO A 1 6  ? 78.128  14.458  -22.503 1.00 0.00 ? 6  PRO A HD2  9  
ATOM 11563 H HD3  . PRO A 1 6  ? 77.686  16.115  -22.977 1.00 0.00 ? 6  PRO A HD3  9  
ATOM 11564 N N    . GLY A 1 7  ? 79.126  12.266  -25.372 1.00 0.00 ? 7  GLY A N    9  
ATOM 11565 C CA   . GLY A 1 7  ? 79.217  10.957  -26.019 1.00 0.00 ? 7  GLY A CA   9  
ATOM 11566 C C    . GLY A 1 7  ? 80.670  10.510  -26.017 1.00 0.00 ? 7  GLY A C    9  
ATOM 11567 O O    . GLY A 1 7  ? 80.994  9.392   -25.612 1.00 0.00 ? 7  GLY A O    9  
ATOM 11568 H H    . GLY A 1 7  ? 78.707  12.356  -24.481 1.00 0.00 ? 7  GLY A H    9  
ATOM 11569 H HA2  . GLY A 1 7  ? 78.614  10.231  -25.484 1.00 0.00 ? 7  GLY A HA2  9  
ATOM 11570 H HA3  . GLY A 1 7  ? 78.872  11.033  -27.037 1.00 0.00 ? 7  GLY A HA3  9  
ATOM 11571 N N    . VAL A 1 8  ? 81.555  11.414  -26.437 1.00 0.00 ? 8  VAL A N    9  
ATOM 11572 C CA   . VAL A 1 8  ? 82.972  11.120  -26.438 1.00 0.00 ? 8  VAL A CA   9  
ATOM 11573 C C    . VAL A 1 8  ? 83.352  10.665  -25.046 1.00 0.00 ? 8  VAL A C    9  
ATOM 11574 O O    . VAL A 1 8  ? 84.177  9.767   -24.872 1.00 0.00 ? 8  VAL A O    9  
ATOM 11575 C CB   . VAL A 1 8  ? 83.777  12.360  -26.826 1.00 0.00 ? 8  VAL A CB   9  
ATOM 11576 C CG1  . VAL A 1 8  ? 85.271  12.077  -26.646 1.00 0.00 ? 8  VAL A CG1  9  
ATOM 11577 C CG2  . VAL A 1 8  ? 83.498  12.703  -28.289 1.00 0.00 ? 8  VAL A CG2  9  
ATOM 11578 H H    . VAL A 1 8  ? 81.249  12.295  -26.719 1.00 0.00 ? 8  VAL A H    9  
ATOM 11579 H HA   . VAL A 1 8  ? 83.172  10.325  -27.143 1.00 0.00 ? 8  VAL A HA   9  
ATOM 11580 H HB   . VAL A 1 8  ? 83.489  13.189  -26.197 1.00 0.00 ? 8  VAL A HB   9  
ATOM 11581 H HG11 . VAL A 1 8  ? 85.510  12.066  -25.593 1.00 0.00 ? 8  VAL A HG11 9  
ATOM 11582 H HG12 . VAL A 1 8  ? 85.845  12.849  -27.137 1.00 0.00 ? 8  VAL A HG12 9  
ATOM 11583 H HG13 . VAL A 1 8  ? 85.510  11.119  -27.081 1.00 0.00 ? 8  VAL A HG13 9  
ATOM 11584 H HG21 . VAL A 1 8  ? 82.471  13.017  -28.396 1.00 0.00 ? 8  VAL A HG21 9  
ATOM 11585 H HG22 . VAL A 1 8  ? 83.674  11.831  -28.902 1.00 0.00 ? 8  VAL A HG22 9  
ATOM 11586 H HG23 . VAL A 1 8  ? 84.154  13.502  -28.604 1.00 0.00 ? 8  VAL A HG23 9  
ATOM 11587 N N    . LEU A 1 9  ? 82.714  11.272  -24.044 1.00 0.00 ? 9  LEU A N    9  
ATOM 11588 C CA   . LEU A 1 9  ? 82.988  10.869  -22.675 1.00 0.00 ? 9  LEU A CA   9  
ATOM 11589 C C    . LEU A 1 9  ? 82.757  9.355   -22.565 1.00 0.00 ? 9  LEU A C    9  
ATOM 11590 O O    . LEU A 1 9  ? 83.561  8.620   -21.972 1.00 0.00 ? 9  LEU A O    9  
ATOM 11591 C CB   . LEU A 1 9  ? 82.094  11.634  -21.686 1.00 0.00 ? 9  LEU A CB   9  
ATOM 11592 C CG   . LEU A 1 9  ? 82.648  13.057  -21.450 1.00 0.00 ? 9  LEU A CG   9  
ATOM 11593 C CD1  . LEU A 1 9  ? 81.666  13.849  -20.574 1.00 0.00 ? 9  LEU A CD1  9  
ATOM 11594 C CD2  . LEU A 1 9  ? 84.029  12.999  -20.750 1.00 0.00 ? 9  LEU A CD2  9  
ATOM 11595 H H    . LEU A 1 9  ? 82.037  11.977  -24.238 1.00 0.00 ? 9  LEU A H    9  
ATOM 11596 H HA   . LEU A 1 9  ? 84.021  11.081  -22.457 1.00 0.00 ? 9  LEU A HA   9  
ATOM 11597 H HB2  . LEU A 1 9  ? 81.095  11.701  -22.087 1.00 0.00 ? 9  LEU A HB2  9  
ATOM 11598 H HB3  . LEU A 1 9  ? 82.068  11.104  -20.749 1.00 0.00 ? 9  LEU A HB3  9  
ATOM 11599 H HG   . LEU A 1 9  ? 82.752  13.556  -22.404 1.00 0.00 ? 9  LEU A HG   9  
ATOM 11600 H HD11 . LEU A 1 9  ? 81.789  13.558  -19.542 1.00 0.00 ? 9  LEU A HD11 9  
ATOM 11601 H HD12 . LEU A 1 9  ? 80.654  13.649  -20.888 1.00 0.00 ? 9  LEU A HD12 9  
ATOM 11602 H HD13 . LEU A 1 9  ? 81.872  14.905  -20.673 1.00 0.00 ? 9  LEU A HD13 9  
ATOM 11603 H HD21 . LEU A 1 9  ? 84.112  12.088  -20.175 1.00 0.00 ? 9  LEU A HD21 9  
ATOM 11604 H HD22 . LEU A 1 9  ? 84.146  13.848  -20.091 1.00 0.00 ? 9  LEU A HD22 9  
ATOM 11605 H HD23 . LEU A 1 9  ? 84.809  13.025  -21.496 1.00 0.00 ? 9  LEU A HD23 9  
ATOM 11606 N N    . ALA A 1 10 ? 81.682  8.878   -23.195 1.00 0.00 ? 10 ALA A N    9  
ATOM 11607 C CA   . ALA A 1 10 ? 81.401  7.450   -23.203 1.00 0.00 ? 10 ALA A CA   9  
ATOM 11608 C C    . ALA A 1 10 ? 82.593  6.744   -23.832 1.00 0.00 ? 10 ALA A C    9  
ATOM 11609 O O    . ALA A 1 10 ? 83.017  5.672   -23.390 1.00 0.00 ? 10 ALA A O    9  
ATOM 11610 C CB   . ALA A 1 10 ? 80.129  7.159   -24.008 1.00 0.00 ? 10 ALA A CB   9  
ATOM 11611 H H    . ALA A 1 10 ? 81.098  9.488   -23.690 1.00 0.00 ? 10 ALA A H    9  
ATOM 11612 H HA   . ALA A 1 10 ? 81.270  7.101   -22.188 1.00 0.00 ? 10 ALA A HA   9  
ATOM 11613 H HB1  . ALA A 1 10 ? 79.377  7.898   -23.771 1.00 0.00 ? 10 ALA A HB1  9  
ATOM 11614 H HB2  . ALA A 1 10 ? 79.760  6.177   -23.754 1.00 0.00 ? 10 ALA A HB2  9  
ATOM 11615 H HB3  . ALA A 1 10 ? 80.351  7.198   -25.065 1.00 0.00 ? 10 ALA A HB3  9  
ATOM 11616 N N    . GLY A 1 11 ? 83.151  7.388   -24.855 1.00 0.00 ? 11 GLY A N    9  
ATOM 11617 C CA   . GLY A 1 11 ? 84.320  6.857   -25.531 1.00 0.00 ? 11 GLY A CA   9  
ATOM 11618 C C    . GLY A 1 11 ? 85.469  6.742   -24.539 1.00 0.00 ? 11 GLY A C    9  
ATOM 11619 O O    . GLY A 1 11 ? 86.368  5.921   -24.704 1.00 0.00 ? 11 GLY A O    9  
ATOM 11620 H H    . GLY A 1 11 ? 82.777  8.253   -25.142 1.00 0.00 ? 11 GLY A H    9  
ATOM 11621 H HA2  . GLY A 1 11 ? 84.091  5.879   -25.933 1.00 0.00 ? 11 GLY A HA2  9  
ATOM 11622 H HA3  . GLY A 1 11 ? 84.606  7.519   -26.335 1.00 0.00 ? 11 GLY A HA3  9  
ATOM 11623 N N    . ILE A 1 12 ? 85.423  7.578   -23.502 1.00 0.00 ? 12 ILE A N    9  
ATOM 11624 C CA   . ILE A 1 12 ? 86.457  7.566   -22.468 1.00 0.00 ? 12 ILE A CA   9  
ATOM 11625 C C    . ILE A 1 12 ? 86.308  6.294   -21.639 1.00 0.00 ? 12 ILE A C    9  
ATOM 11626 O O    . ILE A 1 12 ? 87.298  5.672   -21.253 1.00 0.00 ? 12 ILE A O    9  
ATOM 11627 C CB   . ILE A 1 12 ? 86.365  8.871   -21.598 1.00 0.00 ? 12 ILE A CB   9  
ATOM 11628 C CG1  . ILE A 1 12 ? 87.756  9.529   -21.446 1.00 0.00 ? 12 ILE A CG1  9  
ATOM 11629 C CG2  . ILE A 1 12 ? 85.788  8.611   -20.178 1.00 0.00 ? 12 ILE A CG2  9  
ATOM 11630 C CD1  . ILE A 1 12 ? 87.605  11.010  -21.062 1.00 0.00 ? 12 ILE A CD1  9  
ATOM 11631 H H    . ILE A 1 12 ? 84.676  8.207   -23.432 1.00 0.00 ? 12 ILE A H    9  
ATOM 11632 H HA   . ILE A 1 12 ? 87.415  7.524   -22.963 1.00 0.00 ? 12 ILE A HA   9  
ATOM 11633 H HB   . ILE A 1 12 ? 85.714  9.565   -22.104 1.00 0.00 ? 12 ILE A HB   9  
ATOM 11634 H HG12 . ILE A 1 12 ? 88.315  9.014   -20.679 1.00 0.00 ? 12 ILE A HG12 9  
ATOM 11635 H HG13 . ILE A 1 12 ? 88.296  9.468   -22.380 1.00 0.00 ? 12 ILE A HG13 9  
ATOM 11636 H HG21 . ILE A 1 12 ? 85.478  9.550   -19.740 1.00 0.00 ? 12 ILE A HG21 9  
ATOM 11637 H HG22 . ILE A 1 12 ? 86.544  8.161   -19.550 1.00 0.00 ? 12 ILE A HG22 9  
ATOM 11638 H HG23 . ILE A 1 12 ? 84.937  7.956   -20.235 1.00 0.00 ? 12 ILE A HG23 9  
ATOM 11639 H HD11 . ILE A 1 12 ? 86.689  11.159  -20.508 1.00 0.00 ? 12 ILE A HD11 9  
ATOM 11640 H HD12 . ILE A 1 12 ? 87.582  11.612  -21.959 1.00 0.00 ? 12 ILE A HD12 9  
ATOM 11641 H HD13 . ILE A 1 12 ? 88.447  11.308  -20.457 1.00 0.00 ? 12 ILE A HD13 9  
ATOM 11642 N N    . VAL A 1 13 ? 85.062  5.907   -21.387 1.00 0.00 ? 13 VAL A N    9  
ATOM 11643 C CA   . VAL A 1 13 ? 84.804  4.691   -20.623 1.00 0.00 ? 13 VAL A CA   9  
ATOM 11644 C C    . VAL A 1 13 ? 85.382  3.492   -21.364 1.00 0.00 ? 13 VAL A C    9  
ATOM 11645 O O    . VAL A 1 13 ? 86.189  2.726   -20.820 1.00 0.00 ? 13 VAL A O    9  
ATOM 11646 C CB   . VAL A 1 13 ? 83.297  4.489   -20.435 1.00 0.00 ? 13 VAL A CB   9  
ATOM 11647 C CG1  . VAL A 1 13 ? 83.043  3.188   -19.671 1.00 0.00 ? 13 VAL A CG1  9  
ATOM 11648 C CG2  . VAL A 1 13 ? 82.716  5.665   -19.648 1.00 0.00 ? 13 VAL A CG2  9  
ATOM 11649 H H    . VAL A 1 13 ? 84.311  6.445   -21.730 1.00 0.00 ? 13 VAL A H    9  
ATOM 11650 H HA   . VAL A 1 13 ? 85.277  4.772   -19.658 1.00 0.00 ? 13 VAL A HA   9  
ATOM 11651 H HB   . VAL A 1 13 ? 82.821  4.433   -21.403 1.00 0.00 ? 13 VAL A HB   9  
ATOM 11652 H HG11 . VAL A 1 13 ? 83.646  3.172   -18.774 1.00 0.00 ? 13 VAL A HG11 9  
ATOM 11653 H HG12 . VAL A 1 13 ? 83.304  2.345   -20.295 1.00 0.00 ? 13 VAL A HG12 9  
ATOM 11654 H HG13 . VAL A 1 13 ? 81.999  3.125   -19.404 1.00 0.00 ? 13 VAL A HG13 9  
ATOM 11655 H HG21 . VAL A 1 13 ? 81.639  5.593   -19.636 1.00 0.00 ? 13 VAL A HG21 9  
ATOM 11656 H HG22 . VAL A 1 13 ? 83.010  6.593   -20.117 1.00 0.00 ? 13 VAL A HG22 9  
ATOM 11657 H HG23 . VAL A 1 13 ? 83.088  5.640   -18.637 1.00 0.00 ? 13 VAL A HG23 9  
ATOM 11658 N N    . VAL A 1 14 ? 84.976  3.344   -22.620 1.00 0.00 ? 14 VAL A N    9  
ATOM 11659 C CA   . VAL A 1 14 ? 85.469  2.243   -23.437 1.00 0.00 ? 14 VAL A CA   9  
ATOM 11660 C C    . VAL A 1 14 ? 86.984  2.331   -23.584 1.00 0.00 ? 14 VAL A C    9  
ATOM 11661 O O    . VAL A 1 14 ? 87.674  1.312   -23.613 1.00 0.00 ? 14 VAL A O    9  
ATOM 11662 C CB   . VAL A 1 14 ? 84.817  2.280   -24.819 1.00 0.00 ? 14 VAL A CB   9  
ATOM 11663 C CG1  . VAL A 1 14 ? 85.135  0.985   -25.569 1.00 0.00 ? 14 VAL A CG1  9  
ATOM 11664 C CG2  . VAL A 1 14 ? 83.300  2.419   -24.665 1.00 0.00 ? 14 VAL A CG2  9  
ATOM 11665 H H    . VAL A 1 14 ? 84.338  3.991   -23.004 1.00 0.00 ? 14 VAL A H    9  
ATOM 11666 H HA   . VAL A 1 14 ? 85.215  1.310   -22.956 1.00 0.00 ? 14 VAL A HA   9  
ATOM 11667 H HB   . VAL A 1 14 ? 85.202  3.122   -25.377 1.00 0.00 ? 14 VAL A HB   9  
ATOM 11668 H HG11 . VAL A 1 14 ? 84.673  0.152   -25.060 1.00 0.00 ? 14 VAL A HG11 9  
ATOM 11669 H HG12 . VAL A 1 14 ? 86.204  0.840   -25.601 1.00 0.00 ? 14 VAL A HG12 9  
ATOM 11670 H HG13 . VAL A 1 14 ? 84.751  1.048   -26.577 1.00 0.00 ? 14 VAL A HG13 9  
ATOM 11671 H HG21 . VAL A 1 14 ? 82.934  1.647   -24.003 1.00 0.00 ? 14 VAL A HG21 9  
ATOM 11672 H HG22 . VAL A 1 14 ? 82.829  2.319   -25.631 1.00 0.00 ? 14 VAL A HG22 9  
ATOM 11673 H HG23 . VAL A 1 14 ? 83.067  3.388   -24.250 1.00 0.00 ? 14 VAL A HG23 9  
ATOM 11674 N N    . GLY A 1 15 ? 87.490  3.556   -23.679 1.00 0.00 ? 15 GLY A N    9  
ATOM 11675 C CA   . GLY A 1 15 ? 88.921  3.783   -23.828 1.00 0.00 ? 15 GLY A CA   9  
ATOM 11676 C C    . GLY A 1 15 ? 89.692  3.237   -22.633 1.00 0.00 ? 15 GLY A C    9  
ATOM 11677 O O    . GLY A 1 15 ? 90.780  2.684   -22.783 1.00 0.00 ? 15 GLY A O    9  
ATOM 11678 H H    . GLY A 1 15 ? 86.888  4.326   -23.653 1.00 0.00 ? 15 GLY A H    9  
ATOM 11679 H HA2  . GLY A 1 15 ? 89.263  3.295   -24.726 1.00 0.00 ? 15 GLY A HA2  9  
ATOM 11680 H HA3  . GLY A 1 15 ? 89.104  4.844   -23.911 1.00 0.00 ? 15 GLY A HA3  9  
ATOM 11681 N N    . ASP A 1 16 ? 89.126  3.399   -21.445 1.00 0.00 ? 16 ASP A N    9  
ATOM 11682 C CA   . ASP A 1 16 ? 89.779  2.917   -20.236 1.00 0.00 ? 16 ASP A CA   9  
ATOM 11683 C C    . ASP A 1 16 ? 89.814  1.392   -20.223 1.00 0.00 ? 16 ASP A C    9  
ATOM 11684 O O    . ASP A 1 16 ? 90.856  0.783   -19.952 1.00 0.00 ? 16 ASP A O    9  
ATOM 11685 C CB   . ASP A 1 16 ? 89.029  3.425   -19.003 1.00 0.00 ? 16 ASP A CB   9  
ATOM 11686 C CG   . ASP A 1 16 ? 89.769  3.015   -17.734 1.00 0.00 ? 16 ASP A CG   9  
ATOM 11687 O OD1  . ASP A 1 16 ? 90.521  2.056   -17.792 1.00 0.00 ? 16 ASP A OD1  9  
ATOM 11688 O OD2  . ASP A 1 16 ? 89.573  3.668   -16.722 1.00 0.00 ? 16 ASP A OD2  9  
ATOM 11689 H H    . ASP A 1 16 ? 88.259  3.851   -21.380 1.00 0.00 ? 16 ASP A H    9  
ATOM 11690 H HA   . ASP A 1 16 ? 90.790  3.294   -20.208 1.00 0.00 ? 16 ASP A HA   9  
ATOM 11691 H HB2  . ASP A 1 16 ? 88.960  4.503   -19.045 1.00 0.00 ? 16 ASP A HB2  9  
ATOM 11692 H HB3  . ASP A 1 16 ? 88.037  3.004   -18.989 1.00 0.00 ? 16 ASP A HB3  9  
ATOM 11693 N N    . LEU A 1 17 ? 88.670  0.777   -20.511 1.00 0.00 ? 17 LEU A N    9  
ATOM 11694 C CA   . LEU A 1 17 ? 88.583  -0.680  -20.517 1.00 0.00 ? 17 LEU A CA   9  
ATOM 11695 C C    . LEU A 1 17 ? 89.568  -1.285  -21.519 1.00 0.00 ? 17 LEU A C    9  
ATOM 11696 O O    . LEU A 1 17 ? 90.337  -2.191  -21.179 1.00 0.00 ? 17 LEU A O    9  
ATOM 11697 C CB   . LEU A 1 17 ? 87.156  -1.118  -20.866 1.00 0.00 ? 17 LEU A CB   9  
ATOM 11698 C CG   . LEU A 1 17 ? 86.990  -2.633  -20.647 1.00 0.00 ? 17 LEU A CG   9  
ATOM 11699 C CD1  . LEU A 1 17 ? 86.999  -2.972  -19.143 1.00 0.00 ? 17 LEU A CD1  9  
ATOM 11700 C CD2  . LEU A 1 17 ? 85.659  -3.077  -21.267 1.00 0.00 ? 17 LEU A CD2  9  
ATOM 11701 H H    . LEU A 1 17 ? 87.869  1.314   -20.714 1.00 0.00 ? 17 LEU A H    9  
ATOM 11702 H HA   . LEU A 1 17 ? 88.826  -1.042  -19.531 1.00 0.00 ? 17 LEU A HA   9  
ATOM 11703 H HB2  . LEU A 1 17 ? 86.454  -0.583  -20.245 1.00 0.00 ? 17 LEU A HB2  9  
ATOM 11704 H HB3  . LEU A 1 17 ? 86.960  -0.888  -21.903 1.00 0.00 ? 17 LEU A HB3  9  
ATOM 11705 H HG   . LEU A 1 17 ? 87.801  -3.155  -21.133 1.00 0.00 ? 17 LEU A HG   9  
ATOM 11706 H HD11 . LEU A 1 17 ? 86.475  -3.905  -18.975 1.00 0.00 ? 17 LEU A HD11 9  
ATOM 11707 H HD12 . LEU A 1 17 ? 86.513  -2.186  -18.585 1.00 0.00 ? 17 LEU A HD12 9  
ATOM 11708 H HD13 . LEU A 1 17 ? 88.018  -3.075  -18.803 1.00 0.00 ? 17 LEU A HD13 9  
ATOM 11709 H HD21 . LEU A 1 17 ? 85.505  -4.128  -21.073 1.00 0.00 ? 17 LEU A HD21 9  
ATOM 11710 H HD22 . LEU A 1 17 ? 85.685  -2.908  -22.333 1.00 0.00 ? 17 LEU A HD22 9  
ATOM 11711 H HD23 . LEU A 1 17 ? 84.852  -2.507  -20.831 1.00 0.00 ? 17 LEU A HD23 9  
ATOM 11712 N N    . VAL A 1 18 ? 89.546  -0.790  -22.754 1.00 0.00 ? 18 VAL A N    9  
ATOM 11713 C CA   . VAL A 1 18 ? 90.446  -1.314  -23.775 1.00 0.00 ? 18 VAL A CA   9  
ATOM 11714 C C    . VAL A 1 18 ? 91.891  -0.949  -23.460 1.00 0.00 ? 18 VAL A C    9  
ATOM 11715 O O    . VAL A 1 18 ? 92.807  -1.647  -23.873 1.00 0.00 ? 18 VAL A O    9  
ATOM 11716 C CB   . VAL A 1 18 ? 90.070  -0.780  -25.159 1.00 0.00 ? 18 VAL A CB   9  
ATOM 11717 C CG1  . VAL A 1 18 ? 88.600  -1.092  -25.448 1.00 0.00 ? 18 VAL A CG1  9  
ATOM 11718 C CG2  . VAL A 1 18 ? 90.290  0.730   -25.194 1.00 0.00 ? 18 VAL A CG2  9  
ATOM 11719 H H    . VAL A 1 18 ? 88.919  -0.067  -22.983 1.00 0.00 ? 18 VAL A H    9  
ATOM 11720 H HA   . VAL A 1 18 ? 90.359  -2.391  -23.789 1.00 0.00 ? 18 VAL A HA   9  
ATOM 11721 H HB   . VAL A 1 18 ? 90.691  -1.253  -25.907 1.00 0.00 ? 18 VAL A HB   9  
ATOM 11722 H HG11 . VAL A 1 18 ? 88.484  -2.152  -25.621 1.00 0.00 ? 18 VAL A HG11 9  
ATOM 11723 H HG12 . VAL A 1 18 ? 88.281  -0.546  -26.323 1.00 0.00 ? 18 VAL A HG12 9  
ATOM 11724 H HG13 . VAL A 1 18 ? 87.996  -0.799  -24.602 1.00 0.00 ? 18 VAL A HG13 9  
ATOM 11725 H HG21 . VAL A 1 18 ? 89.912  1.161   -24.284 1.00 0.00 ? 18 VAL A HG21 9  
ATOM 11726 H HG22 . VAL A 1 18 ? 89.767  1.155   -26.039 1.00 0.00 ? 18 VAL A HG22 9  
ATOM 11727 H HG23 . VAL A 1 18 ? 91.345  0.939   -25.280 1.00 0.00 ? 18 VAL A HG23 9  
ATOM 11728 N N    . LEU A 1 19 ? 92.102  0.145   -22.731 1.00 0.00 ? 19 LEU A N    9  
ATOM 11729 C CA   . LEU A 1 19 ? 93.465  0.544   -22.394 1.00 0.00 ? 19 LEU A CA   9  
ATOM 11730 C C    . LEU A 1 19 ? 94.116  -0.541  -21.533 1.00 0.00 ? 19 LEU A C    9  
ATOM 11731 O O    . LEU A 1 19 ? 95.183  -1.053  -21.873 1.00 0.00 ? 19 LEU A O    9  
ATOM 11732 C CB   . LEU A 1 19 ? 93.466  1.900   -21.641 1.00 0.00 ? 19 LEU A CB   9  
ATOM 11733 C CG   . LEU A 1 19 ? 93.716  3.069   -22.617 1.00 0.00 ? 19 LEU A CG   9  
ATOM 11734 C CD1  . LEU A 1 19 ? 93.214  4.380   -21.993 1.00 0.00 ? 19 LEU A CD1  9  
ATOM 11735 C CD2  . LEU A 1 19 ? 95.223  3.199   -22.904 1.00 0.00 ? 19 LEU A CD2  9  
ATOM 11736 H H    . LEU A 1 19 ? 91.343  0.681   -22.419 1.00 0.00 ? 19 LEU A H    9  
ATOM 11737 H HA   . LEU A 1 19 ? 94.028  0.639   -23.309 1.00 0.00 ? 19 LEU A HA   9  
ATOM 11738 H HB2  . LEU A 1 19 ? 92.507  2.034   -21.164 1.00 0.00 ? 19 LEU A HB2  9  
ATOM 11739 H HB3  . LEU A 1 19 ? 94.240  1.901   -20.884 1.00 0.00 ? 19 LEU A HB3  9  
ATOM 11740 H HG   . LEU A 1 19 ? 93.186  2.887   -23.541 1.00 0.00 ? 19 LEU A HG   9  
ATOM 11741 H HD11 . LEU A 1 19 ? 92.137  4.406   -22.020 1.00 0.00 ? 19 LEU A HD11 9  
ATOM 11742 H HD12 . LEU A 1 19 ? 93.607  5.218   -22.549 1.00 0.00 ? 19 LEU A HD12 9  
ATOM 11743 H HD13 . LEU A 1 19 ? 93.550  4.441   -20.968 1.00 0.00 ? 19 LEU A HD13 9  
ATOM 11744 H HD21 . LEU A 1 19 ? 95.655  2.221   -23.041 1.00 0.00 ? 19 LEU A HD21 9  
ATOM 11745 H HD22 . LEU A 1 19 ? 95.710  3.690   -22.074 1.00 0.00 ? 19 LEU A HD22 9  
ATOM 11746 H HD23 . LEU A 1 19 ? 95.368  3.783   -23.800 1.00 0.00 ? 19 LEU A HD23 9  
ATOM 11747 N N    . THR A 1 20 ? 93.469  -0.893  -20.423 1.00 0.00 ? 20 THR A N    9  
ATOM 11748 C CA   . THR A 1 20 ? 94.009  -1.919  -19.542 1.00 0.00 ? 20 THR A CA   9  
ATOM 11749 C C    . THR A 1 20 ? 94.152  -3.256  -20.269 1.00 0.00 ? 20 THR A C    9  
ATOM 11750 O O    . THR A 1 20 ? 95.157  -3.950  -20.117 1.00 0.00 ? 20 THR A O    9  
ATOM 11751 C CB   . THR A 1 20 ? 93.084  -2.104  -18.339 1.00 0.00 ? 20 THR A CB   9  
ATOM 11752 O OG1  . THR A 1 20 ? 92.711  -0.830  -17.841 1.00 0.00 ? 20 THR A OG1  9  
ATOM 11753 C CG2  . THR A 1 20 ? 93.807  -2.895  -17.243 1.00 0.00 ? 20 THR A CG2  9  
ATOM 11754 H H    . THR A 1 20 ? 92.617  -0.452  -20.188 1.00 0.00 ? 20 THR A H    9  
ATOM 11755 H HA   . THR A 1 20 ? 94.980  -1.605  -19.189 1.00 0.00 ? 20 THR A HA   9  
ATOM 11756 H HB   . THR A 1 20 ? 92.201  -2.645  -18.644 1.00 0.00 ? 20 THR A HB   9  
ATOM 11757 H HG1  . THR A 1 20 ? 93.513  -0.348  -17.627 1.00 0.00 ? 20 THR A HG1  9  
ATOM 11758 H HG21 . THR A 1 20 ? 93.079  -3.347  -16.588 1.00 0.00 ? 20 THR A HG21 9  
ATOM 11759 H HG22 . THR A 1 20 ? 94.436  -2.227  -16.673 1.00 0.00 ? 20 THR A HG22 9  
ATOM 11760 H HG23 . THR A 1 20 ? 94.416  -3.668  -17.690 1.00 0.00 ? 20 THR A HG23 9  
ATOM 11761 N N    . VAL A 1 21 ? 93.130  -3.624  -21.036 1.00 0.00 ? 21 VAL A N    9  
ATOM 11762 C CA   . VAL A 1 21 ? 93.145  -4.899  -21.754 1.00 0.00 ? 21 VAL A CA   9  
ATOM 11763 C C    . VAL A 1 21 ? 94.277  -4.976  -22.785 1.00 0.00 ? 21 VAL A C    9  
ATOM 11764 O O    . VAL A 1 21 ? 95.001  -5.969  -22.842 1.00 0.00 ? 21 VAL A O    9  
ATOM 11765 C CB   . VAL A 1 21 ? 91.801  -5.105  -22.458 1.00 0.00 ? 21 VAL A CB   9  
ATOM 11766 C CG1  . VAL A 1 21 ? 91.845  -6.393  -23.283 1.00 0.00 ? 21 VAL A CG1  9  
ATOM 11767 C CG2  . VAL A 1 21 ? 90.689  -5.210  -21.410 1.00 0.00 ? 21 VAL A CG2  9  
ATOM 11768 H H    . VAL A 1 21 ? 92.341  -3.040  -21.104 1.00 0.00 ? 21 VAL A H    9  
ATOM 11769 H HA   . VAL A 1 21 ? 93.278  -5.695  -21.038 1.00 0.00 ? 21 VAL A HA   9  
ATOM 11770 H HB   . VAL A 1 21 ? 91.606  -4.266  -23.110 1.00 0.00 ? 21 VAL A HB   9  
ATOM 11771 H HG11 . VAL A 1 21 ? 92.452  -6.237  -24.163 1.00 0.00 ? 21 VAL A HG11 9  
ATOM 11772 H HG12 . VAL A 1 21 ? 90.842  -6.664  -23.582 1.00 0.00 ? 21 VAL A HG12 9  
ATOM 11773 H HG13 . VAL A 1 21 ? 92.271  -7.188  -22.689 1.00 0.00 ? 21 VAL A HG13 9  
ATOM 11774 H HG21 . VAL A 1 21 ? 90.732  -6.178  -20.934 1.00 0.00 ? 21 VAL A HG21 9  
ATOM 11775 H HG22 . VAL A 1 21 ? 89.729  -5.089  -21.892 1.00 0.00 ? 21 VAL A HG22 9  
ATOM 11776 H HG23 . VAL A 1 21 ? 90.818  -4.437  -20.668 1.00 0.00 ? 21 VAL A HG23 9  
ATOM 11777 N N    . LEU A 1 22 ? 94.401  -3.950  -23.618 1.00 0.00 ? 22 LEU A N    9  
ATOM 11778 C CA   . LEU A 1 22 ? 95.423  -3.940  -24.667 1.00 0.00 ? 22 LEU A CA   9  
ATOM 11779 C C    . LEU A 1 22 ? 96.838  -3.984  -24.083 1.00 0.00 ? 22 LEU A C    9  
ATOM 11780 O O    . LEU A 1 22 ? 97.639  -4.839  -24.460 1.00 0.00 ? 22 LEU A O    9  
ATOM 11781 C CB   . LEU A 1 22 ? 95.248  -2.681  -25.543 1.00 0.00 ? 22 LEU A CB   9  
ATOM 11782 C CG   . LEU A 1 22 ? 95.740  -2.925  -26.985 1.00 0.00 ? 22 LEU A CG   9  
ATOM 11783 C CD1  . LEU A 1 22 ? 97.184  -3.435  -26.970 1.00 0.00 ? 22 LEU A CD1  9  
ATOM 11784 C CD2  . LEU A 1 22 ? 94.832  -3.948  -27.706 1.00 0.00 ? 22 LEU A CD2  9  
ATOM 11785 H H    . LEU A 1 22 ? 93.781  -3.198  -23.547 1.00 0.00 ? 22 LEU A H    9  
ATOM 11786 H HA   . LEU A 1 22 ? 95.281  -4.813  -25.282 1.00 0.00 ? 22 LEU A HA   9  
ATOM 11787 H HB2  . LEU A 1 22 ? 94.204  -2.414  -25.569 1.00 0.00 ? 22 LEU A HB2  9  
ATOM 11788 H HB3  . LEU A 1 22 ? 95.808  -1.863  -25.113 1.00 0.00 ? 22 LEU A HB3  9  
ATOM 11789 H HG   . LEU A 1 22 ? 95.709  -1.988  -27.522 1.00 0.00 ? 22 LEU A HG   9  
ATOM 11790 H HD11 . LEU A 1 22 ? 97.194  -4.484  -26.718 1.00 0.00 ? 22 LEU A HD11 9  
ATOM 11791 H HD12 . LEU A 1 22 ? 97.757  -2.880  -26.241 1.00 0.00 ? 22 LEU A HD12 9  
ATOM 11792 H HD13 . LEU A 1 22 ? 97.622  -3.298  -27.948 1.00 0.00 ? 22 LEU A HD13 9  
ATOM 11793 H HD21 . LEU A 1 22 ? 93.828  -3.898  -27.307 1.00 0.00 ? 22 LEU A HD21 9  
ATOM 11794 H HD22 . LEU A 1 22 ? 95.218  -4.949  -27.575 1.00 0.00 ? 22 LEU A HD22 9  
ATOM 11795 H HD23 . LEU A 1 22 ? 94.806  -3.715  -28.761 1.00 0.00 ? 22 LEU A HD23 9  
ATOM 11796 N N    . ILE A 1 23 ? 97.151  -3.066  -23.175 1.00 0.00 ? 23 ILE A N    9  
ATOM 11797 C CA   . ILE A 1 23 ? 98.484  -3.038  -22.583 1.00 0.00 ? 23 ILE A CA   9  
ATOM 11798 C C    . ILE A 1 23 ? 98.780  -4.366  -21.890 1.00 0.00 ? 23 ILE A C    9  
ATOM 11799 O O    . ILE A 1 23 ? 99.869  -4.924  -22.037 1.00 0.00 ? 23 ILE A O    9  
ATOM 11800 C CB   . ILE A 1 23 ? 98.599  -1.876  -21.589 1.00 0.00 ? 23 ILE A CB   9  
ATOM 11801 C CG1  . ILE A 1 23 ? 98.214  -0.568  -22.288 1.00 0.00 ? 23 ILE A CG1  9  
ATOM 11802 C CG2  . ILE A 1 23 ? 100.043 -1.757  -21.084 1.00 0.00 ? 23 ILE A CG2  9  
ATOM 11803 C CD1  . ILE A 1 23 ? 98.032  0.531   -21.241 1.00 0.00 ? 23 ILE A CD1  9  
ATOM 11804 H H    . ILE A 1 23 ? 96.485  -2.399  -22.902 1.00 0.00 ? 23 ILE A H    9  
ATOM 11805 H HA   . ILE A 1 23 ? 99.207  -2.892  -23.372 1.00 0.00 ? 23 ILE A HA   9  
ATOM 11806 H HB   . ILE A 1 23 ? 97.936  -2.048  -20.755 1.00 0.00 ? 23 ILE A HB   9  
ATOM 11807 H HG12 . ILE A 1 23 ? 98.999  -0.284  -22.975 1.00 0.00 ? 23 ILE A HG12 9  
ATOM 11808 H HG13 . ILE A 1 23 ? 97.293  -0.702  -22.830 1.00 0.00 ? 23 ILE A HG13 9  
ATOM 11809 H HG21 . ILE A 1 23 ? 100.406 -2.724  -20.774 1.00 0.00 ? 23 ILE A HG21 9  
ATOM 11810 H HG22 . ILE A 1 23 ? 100.076 -1.076  -20.244 1.00 0.00 ? 23 ILE A HG22 9  
ATOM 11811 H HG23 . ILE A 1 23 ? 100.670 -1.376  -21.877 1.00 0.00 ? 23 ILE A HG23 9  
ATOM 11812 H HD11 . ILE A 1 23 ? 97.658  1.425   -21.719 1.00 0.00 ? 23 ILE A HD11 9  
ATOM 11813 H HD12 . ILE A 1 23 ? 98.982  0.745   -20.773 1.00 0.00 ? 23 ILE A HD12 9  
ATOM 11814 H HD13 . ILE A 1 23 ? 97.327  0.202   -20.492 1.00 0.00 ? 23 ILE A HD13 9  
ATOM 11815 N N    . ALA A 1 24 ? 97.807  -4.871  -21.141 1.00 0.00 ? 24 ALA A N    9  
ATOM 11816 C CA   . ALA A 1 24 ? 97.980  -6.138  -20.440 1.00 0.00 ? 24 ALA A CA   9  
ATOM 11817 C C    . ALA A 1 24 ? 98.258  -7.260  -21.436 1.00 0.00 ? 24 ALA A C    9  
ATOM 11818 O O    . ALA A 1 24 ? 99.066  -8.150  -21.174 1.00 0.00 ? 24 ALA A O    9  
ATOM 11819 C CB   . ALA A 1 24 ? 96.723  -6.466  -19.635 1.00 0.00 ? 24 ALA A CB   9  
ATOM 11820 H H    . ALA A 1 24 ? 96.958  -4.388  -21.063 1.00 0.00 ? 24 ALA A H    9  
ATOM 11821 H HA   . ALA A 1 24 ? 98.816  -6.052  -19.763 1.00 0.00 ? 24 ALA A HA   9  
ATOM 11822 H HB1  . ALA A 1 24 ? 96.601  -5.738  -18.846 1.00 0.00 ? 24 ALA A HB1  9  
ATOM 11823 H HB2  . ALA A 1 24 ? 96.818  -7.451  -19.205 1.00 0.00 ? 24 ALA A HB2  9  
ATOM 11824 H HB3  . ALA A 1 24 ? 95.861  -6.4