data_2L6W
# 
_entry.id   2L6W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L6W         
RCSB  RCSB102032   
WWPDB D_1000102032 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L6W 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-11-29 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Muhle-Goll, C.' 1 
'Hoffmann, S.'   2 
'Ulrich, A.S.'   3 
# 
_citation.id                        primary 
_citation.title                     
;Hydrophobic matching controls the tilt and stability of the dimeric platelet-derived growth factor receptor (PDGFR) beta transmembrane segment.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                26178 
_citation.page_last                 26186 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22619173 
_citation.pdbx_database_id_DOI      10.1074/jbc.M111.325555 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Muhle-Goll, C.'  1 
primary 'Hoffmann, S.'    2 
primary 'Afonin, S.'      3 
primary 'Grage, S.L.'     4 
primary 'Polyansky, A.A.' 5 
primary 'Windisch, D.'    6 
primary 'Zeitler, M.'     7 
primary 'Burck, J.'       8 
primary 'Ulrich, A.S.'    9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Beta-type platelet-derived growth factor receptor' 
_entity.formula_weight             4421.528 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    2.7.10.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 526-563' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PDGF-R-beta, CD140 antigen-like family member B' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE 
_entity_poly.pdbx_seq_one_letter_code_can   GHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  HIS n 
1 3  SER n 
1 4  LEU n 
1 5  PRO n 
1 6  PHE n 
1 7  LYS n 
1 8  VAL n 
1 9  VAL n 
1 10 VAL n 
1 11 ILE n 
1 12 SER n 
1 13 ALA n 
1 14 ILE n 
1 15 LEU n 
1 16 ALA n 
1 17 LEU n 
1 18 VAL n 
1 19 VAL n 
1 20 LEU n 
1 21 THR n 
1 22 ILE n 
1 23 ILE n 
1 24 SER n 
1 25 LEU n 
1 26 ILE n 
1 27 ILE n 
1 28 LEU n 
1 29 ILE n 
1 30 MET n 
1 31 LEU n 
1 32 TRP n 
1 33 GLN n 
1 34 LYS n 
1 35 LYS n 
1 36 PRO n 
1 37 ARG n 
1 38 TYR n 
1 39 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PDGFRB 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL 21' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pMMHb 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGFRB_HUMAN 
_struct_ref.pdbx_db_accession          P09619 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   HSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE 
_struct_ref.pdbx_align_begin           526 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2L6W A 2 ? 39 ? P09619 526 ? 563 ? 2 39 
2 1 2L6W B 2 ? 39 ? P09619 526 ? 563 ? 2 39 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2L6W GLY A 1 ? UNP P09619 ? ? 'EXPRESSION TAG' 1 1 
2 2L6W GLY B 1 ? UNP P09619 ? ? 'EXPRESSION TAG' 1 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '3D 1H-15N TOCSY'                  
1 2  1 '3D 1H-15N NOESY'                  
2 3  1 '3D 1H-15N NOESY'                  
1 4  2 '3D HNCACB'                        
1 5  2 '3D HNCA'                          
1 6  2 '3D CBCA(CO)NH'                    
1 7  2 '3D C(CO)NH'                       
1 8  4 '3D 1H-13C NOESY'                  
2 9  4 '3D 1H-13C NOESY'                  
2 10 3 '3D 13C-filtered 13C-edited NOESY' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 120 6.8 ambient ? 323 K 
2 120 6.8 ambient ? 310 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-100% 15N] PDGFR-TM, 200 mM [U-2H] DPC, 90% H2O/10% D2O'                     1 '90% H2O/10% D2O' 
'1 mM [U-100% 13C; U-100% 15N] PDGFR-TM, 200 mM [U-2H] DPC, 90% H2O/10% D2O'         2 '90% H2O/10% D2O' 
'1 mM [U-100% 13C; U-100% 15N] and natural abundance PDGFR-TM, 200 mM DPC, 100% D2O' 3 '100% D2O'        
'1 mM [U-100% 13C; U-100% 15N] PDGFR-TM, 200 mM [U-2H] DPC, 100% D2O'                4 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker Avance 1 'Bruker Avance' 
900 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2L6W 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L6W 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L6W 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing           NMRPipe ?   1 
'Johnson, One Moon Scientific'                      'data analysis'      NMRView ?   2 
;Linge, O'Donoghue and Nilges
;
'structure solution' ARIA    1.2 3 
;Linge, O'Donoghue and Nilges
;
refinement           ARIA    1.2 4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'transmembrane helix of the platelet derived growth factor receptor beta' 
_exptl.entry_id                   2L6W 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L6W 
_struct.title                     'PDGFR beta-TM' 
_struct.pdbx_descriptor           'Beta-type platelet-derived growth factor receptor (E.C.2.7.10.1)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L6W 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'transmembrane helix, receptor tyrosine kinase, heptad repeat, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 5 ? GLN A 33 ? PRO A 5 GLN A 33 1 ? 29 
HELX_P HELX_P2 2 PRO B 5 ? LYS B 34 ? PRO B 5 LYS B 34 1 ? 30 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2L6W 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 2.317   -27.384 1.102   1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 2.510   -27.857 -0.297  1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 3.757   -28.704 -0.461  1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 3.681   -29.856 -0.888  1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 2.248   -28.195 1.752   1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? 1.441   -26.828 1.171   1.00 0.00 ? 1  GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? 3.115   -26.784 1.395   1.00 0.00 ? 1  GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? 1.650   -28.442 -0.589  1.00 0.00 ? 1  GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? 2.584   -26.998 -0.948  1.00 0.00 ? 1  GLY A HA3  1  
ATOM 10    N N    . HIS A 1 2  ? 4.907   -28.129 -0.122  1.00 0.00 ? 2  HIS A N    1  
ATOM 11    C CA   . HIS A 1 2  ? 6.180   -28.836 -0.236  1.00 0.00 ? 2  HIS A CA   1  
ATOM 12    C C    . HIS A 1 2  ? 6.980   -28.734 1.057   1.00 0.00 ? 2  HIS A C    1  
ATOM 13    O O    . HIS A 1 2  ? 7.654   -29.684 1.457   1.00 0.00 ? 2  HIS A O    1  
ATOM 14    C CB   . HIS A 1 2  ? 6.997   -28.272 -1.401  1.00 0.00 ? 2  HIS A CB   1  
ATOM 15    C CG   . HIS A 1 2  ? 8.363   -28.872 -1.525  1.00 0.00 ? 2  HIS A CG   1  
ATOM 16    N ND1  . HIS A 1 2  ? 9.524   -28.136 -1.395  1.00 0.00 ? 2  HIS A ND1  1  
ATOM 17    C CD2  . HIS A 1 2  ? 8.755   -30.144 -1.774  1.00 0.00 ? 2  HIS A CD2  1  
ATOM 18    C CE1  . HIS A 1 2  ? 10.568  -28.929 -1.560  1.00 0.00 ? 2  HIS A CE1  1  
ATOM 19    N NE2  . HIS A 1 2  ? 10.127  -30.151 -1.790  1.00 0.00 ? 2  HIS A NE2  1  
ATOM 20    H H    . HIS A 1 2  ? 4.901   -27.202 0.199   1.00 0.00 ? 2  HIS A H    1  
ATOM 21    H HA   . HIS A 1 2  ? 5.992   -29.885 -0.426  1.00 0.00 ? 2  HIS A HA   1  
ATOM 22    H HB2  . HIS A 1 2  ? 6.469   -28.459 -2.324  1.00 0.00 ? 2  HIS A HB2  1  
ATOM 23    H HB3  . HIS A 1 2  ? 7.110   -27.206 -1.268  1.00 0.00 ? 2  HIS A HB3  1  
ATOM 24    H HD1  . HIS A 1 2  ? 9.574   -27.175 -1.210  1.00 0.00 ? 2  HIS A HD1  1  
ATOM 25    H HD2  . HIS A 1 2  ? 8.107   -30.995 -1.931  1.00 0.00 ? 2  HIS A HD2  1  
ATOM 26    H HE1  . HIS A 1 2  ? 11.604  -28.629 -1.513  1.00 0.00 ? 2  HIS A HE1  1  
ATOM 27    H HE2  . HIS A 1 2  ? 10.691  -30.947 -1.881  1.00 0.00 ? 2  HIS A HE2  1  
ATOM 28    N N    . SER A 1 3  ? 6.903   -27.579 1.708   1.00 0.00 ? 3  SER A N    1  
ATOM 29    C CA   . SER A 1 3  ? 7.627   -27.356 2.953   1.00 0.00 ? 3  SER A CA   1  
ATOM 30    C C    . SER A 1 3  ? 6.735   -26.689 3.995   1.00 0.00 ? 3  SER A C    1  
ATOM 31    O O    . SER A 1 3  ? 6.265   -27.341 4.929   1.00 0.00 ? 3  SER A O    1  
ATOM 32    C CB   . SER A 1 3  ? 8.867   -26.496 2.696   1.00 0.00 ? 3  SER A CB   1  
ATOM 33    O OG   . SER A 1 3  ? 9.583   -26.261 3.896   1.00 0.00 ? 3  SER A OG   1  
ATOM 34    H H    . SER A 1 3  ? 6.365   -26.842 1.351   1.00 0.00 ? 3  SER A H    1  
ATOM 35    H HA   . SER A 1 3  ? 7.948   -28.309 3.356   1.00 0.00 ? 3  SER A HA   1  
ATOM 36    H HB2  . SER A 1 3  ? 9.517   -27.015 2.006   1.00 0.00 ? 3  SER A HB2  1  
ATOM 37    H HB3  . SER A 1 3  ? 8.581   -25.551 2.266   1.00 0.00 ? 3  SER A HB3  1  
ATOM 38    H HG   . SER A 1 3  ? 10.120  -27.029 4.108   1.00 0.00 ? 3  SER A HG   1  
ATOM 39    N N    . LEU A 1 4  ? 6.507   -25.390 3.830   1.00 0.00 ? 4  LEU A N    1  
ATOM 40    C CA   . LEU A 1 4  ? 5.671   -24.638 4.759   1.00 0.00 ? 4  LEU A CA   1  
ATOM 41    C C    . LEU A 1 4  ? 4.201   -24.707 4.342   1.00 0.00 ? 4  LEU A C    1  
ATOM 42    O O    . LEU A 1 4  ? 3.888   -24.673 3.152   1.00 0.00 ? 4  LEU A O    1  
ATOM 43    C CB   . LEU A 1 4  ? 6.127   -23.180 4.822   1.00 0.00 ? 4  LEU A CB   1  
ATOM 44    C CG   . LEU A 1 4  ? 7.584   -22.970 5.238   1.00 0.00 ? 4  LEU A CG   1  
ATOM 45    C CD1  . LEU A 1 4  ? 7.970   -21.505 5.105   1.00 0.00 ? 4  LEU A CD1  1  
ATOM 46    C CD2  . LEU A 1 4  ? 7.810   -23.451 6.666   1.00 0.00 ? 4  LEU A CD2  1  
ATOM 47    H H    . LEU A 1 4  ? 6.890   -24.913 3.062   1.00 0.00 ? 4  LEU A H    1  
ATOM 48    H HA   . LEU A 1 4  ? 5.790   -25.076 5.739   1.00 0.00 ? 4  LEU A HA   1  
ATOM 49    H HB2  . LEU A 1 4  ? 5.988   -22.745 3.838   1.00 0.00 ? 4  LEU A HB2  1  
ATOM 50    H HB3  . LEU A 1 4  ? 5.493   -22.650 5.522   1.00 0.00 ? 4  LEU A HB3  1  
ATOM 51    H HG   . LEU A 1 4  ? 8.225   -23.545 4.585   1.00 0.00 ? 4  LEU A HG   1  
ATOM 52    H HD11 . LEU A 1 4  ? 7.830   -21.185 4.082   1.00 0.00 ? 4  LEU A HD11 1  
ATOM 53    H HD12 . LEU A 1 4  ? 9.009   -21.377 5.377   1.00 0.00 ? 4  LEU A HD12 1  
ATOM 54    H HD13 . LEU A 1 4  ? 7.351   -20.903 5.757   1.00 0.00 ? 4  LEU A HD13 1  
ATOM 55    H HD21 . LEU A 1 4  ? 7.153   -22.918 7.340   1.00 0.00 ? 4  LEU A HD21 1  
ATOM 56    H HD22 . LEU A 1 4  ? 8.838   -23.271 6.952   1.00 0.00 ? 4  LEU A HD22 1  
ATOM 57    H HD23 . LEU A 1 4  ? 7.608   -24.509 6.730   1.00 0.00 ? 4  LEU A HD23 1  
ATOM 58    N N    . PRO A 1 5  ? 3.278   -24.801 5.319   1.00 0.00 ? 5  PRO A N    1  
ATOM 59    C CA   . PRO A 1 5  ? 1.840   -24.875 5.040   1.00 0.00 ? 5  PRO A CA   1  
ATOM 60    C C    . PRO A 1 5  ? 1.292   -23.577 4.454   1.00 0.00 ? 5  PRO A C    1  
ATOM 61    O O    . PRO A 1 5  ? 1.771   -22.489 4.775   1.00 0.00 ? 5  PRO A O    1  
ATOM 62    C CB   . PRO A 1 5  ? 1.220   -25.141 6.415   1.00 0.00 ? 5  PRO A CB   1  
ATOM 63    C CG   . PRO A 1 5  ? 2.212   -24.610 7.390   1.00 0.00 ? 5  PRO A CG   1  
ATOM 64    C CD   . PRO A 1 5  ? 3.561   -24.839 6.768   1.00 0.00 ? 5  PRO A CD   1  
ATOM 65    H HA   . PRO A 1 5  ? 1.613   -25.699 4.377   1.00 0.00 ? 5  PRO A HA   1  
ATOM 66    H HB2  . PRO A 1 5  ? 0.265   -24.642 6.511   1.00 0.00 ? 5  PRO A HB2  1  
ATOM 67    H HB3  . PRO A 1 5  ? 1.083   -26.204 6.544   1.00 0.00 ? 5  PRO A HB3  1  
ATOM 68    H HG2  . PRO A 1 5  ? 2.045   -23.554 7.547   1.00 0.00 ? 5  PRO A HG2  1  
ATOM 69    H HG3  . PRO A 1 5  ? 2.134   -25.147 8.324   1.00 0.00 ? 5  PRO A HG3  1  
ATOM 70    H HD2  . PRO A 1 5  ? 4.244   -24.051 7.050   1.00 0.00 ? 5  PRO A HD2  1  
ATOM 71    H HD3  . PRO A 1 5  ? 3.953   -25.802 7.059   1.00 0.00 ? 5  PRO A HD3  1  
ATOM 72    N N    . PHE A 1 6  ? 0.283   -23.701 3.596   1.00 0.00 ? 6  PHE A N    1  
ATOM 73    C CA   . PHE A 1 6  ? -0.338  -22.541 2.964   1.00 0.00 ? 6  PHE A CA   1  
ATOM 74    C C    . PHE A 1 6  ? -0.973  -21.629 4.011   1.00 0.00 ? 6  PHE A C    1  
ATOM 75    O O    . PHE A 1 6  ? -1.304  -20.479 3.726   1.00 0.00 ? 6  PHE A O    1  
ATOM 76    C CB   . PHE A 1 6  ? -1.389  -22.978 1.940   1.00 0.00 ? 6  PHE A CB   1  
ATOM 77    C CG   . PHE A 1 6  ? -2.544  -23.735 2.536   1.00 0.00 ? 6  PHE A CG   1  
ATOM 78    C CD1  . PHE A 1 6  ? -2.441  -25.092 2.791   1.00 0.00 ? 6  PHE A CD1  1  
ATOM 79    C CD2  . PHE A 1 6  ? -3.733  -23.087 2.836   1.00 0.00 ? 6  PHE A CD2  1  
ATOM 80    C CE1  . PHE A 1 6  ? -3.502  -25.791 3.336   1.00 0.00 ? 6  PHE A CE1  1  
ATOM 81    C CE2  . PHE A 1 6  ? -4.797  -23.781 3.381   1.00 0.00 ? 6  PHE A CE2  1  
ATOM 82    C CZ   . PHE A 1 6  ? -4.680  -25.134 3.632   1.00 0.00 ? 6  PHE A CZ   1  
ATOM 83    H H    . PHE A 1 6  ? -0.038  -24.596 3.385   1.00 0.00 ? 6  PHE A H    1  
ATOM 84    H HA   . PHE A 1 6  ? 0.430   -21.993 2.446   1.00 0.00 ? 6  PHE A HA   1  
ATOM 85    H HB2  . PHE A 1 6  ? -1.775  -22.100 1.435   1.00 0.00 ? 6  PHE A HB2  1  
ATOM 86    H HB3  . PHE A 1 6  ? -0.911  -23.614 1.205   1.00 0.00 ? 6  PHE A HB3  1  
ATOM 87    H HD1  . PHE A 1 6  ? -1.527  -25.616 2.556   1.00 0.00 ? 6  PHE A HD1  1  
ATOM 88    H HD2  . PHE A 1 6  ? -3.829  -22.027 2.641   1.00 0.00 ? 6  PHE A HD2  1  
ATOM 89    H HE1  . PHE A 1 6  ? -3.410  -26.849 3.530   1.00 0.00 ? 6  PHE A HE1  1  
ATOM 90    H HE2  . PHE A 1 6  ? -5.718  -23.266 3.612   1.00 0.00 ? 6  PHE A HE2  1  
ATOM 91    H HZ   . PHE A 1 6  ? -5.510  -25.678 4.058   1.00 0.00 ? 6  PHE A HZ   1  
ATOM 92    N N    . LYS A 1 7  ? -1.141  -22.153 5.220   1.00 0.00 ? 7  LYS A N    1  
ATOM 93    C CA   . LYS A 1 7  ? -1.746  -21.396 6.312   1.00 0.00 ? 7  LYS A CA   1  
ATOM 94    C C    . LYS A 1 7  ? -0.987  -20.097 6.571   1.00 0.00 ? 7  LYS A C    1  
ATOM 95    O O    . LYS A 1 7  ? -1.582  -19.020 6.605   1.00 0.00 ? 7  LYS A O    1  
ATOM 96    C CB   . LYS A 1 7  ? -1.761  -22.244 7.586   1.00 0.00 ? 7  LYS A CB   1  
ATOM 97    C CG   . LYS A 1 7  ? -2.337  -23.640 7.387   1.00 0.00 ? 7  LYS A CG   1  
ATOM 98    C CD   . LYS A 1 7  ? -3.834  -23.600 7.123   1.00 0.00 ? 7  LYS A CD   1  
ATOM 99    C CE   . LYS A 1 7  ? -4.609  -23.172 8.362   1.00 0.00 ? 7  LYS A CE   1  
ATOM 100   N NZ   . LYS A 1 7  ? -6.080  -23.194 8.132   1.00 0.00 ? 7  LYS A NZ   1  
ATOM 101   H H    . LYS A 1 7  ? -0.869  -23.067 5.385   1.00 0.00 ? 7  LYS A H    1  
ATOM 102   H HA   . LYS A 1 7  ? -2.762  -21.158 6.036   1.00 0.00 ? 7  LYS A HA   1  
ATOM 103   H HB2  . LYS A 1 7  ? -0.741  -22.362 7.935   1.00 0.00 ? 7  LYS A HB2  1  
ATOM 104   H HB3  . LYS A 1 7  ? -2.325  -21.731 8.347   1.00 0.00 ? 7  LYS A HB3  1  
ATOM 105   H HG2  . LYS A 1 7  ? -1.854  -24.130 6.562   1.00 0.00 ? 7  LYS A HG2  1  
ATOM 106   H HG3  . LYS A 1 7  ? -2.157  -24.215 8.286   1.00 0.00 ? 7  LYS A HG3  1  
ATOM 107   H HD2  . LYS A 1 7  ? -4.044  -22.909 6.319   1.00 0.00 ? 7  LYS A HD2  1  
ATOM 108   H HD3  . LYS A 1 7  ? -4.159  -24.589 6.836   1.00 0.00 ? 7  LYS A HD3  1  
ATOM 109   H HE2  . LYS A 1 7  ? -4.375  -23.845 9.175   1.00 0.00 ? 7  LYS A HE2  1  
ATOM 110   H HE3  . LYS A 1 7  ? -4.319  -22.169 8.632   1.00 0.00 ? 7  LYS A HE3  1  
ATOM 111   H HZ1  . LYS A 1 7  ? -6.578  -22.898 8.996   1.00 0.00 ? 7  LYS A HZ1  1  
ATOM 112   H HZ2  . LYS A 1 7  ? -6.393  -24.154 7.880   1.00 0.00 ? 7  LYS A HZ2  1  
ATOM 113   H HZ3  . LYS A 1 7  ? -6.336  -22.543 7.360   1.00 0.00 ? 7  LYS A HZ3  1  
ATOM 114   N N    . VAL A 1 8  ? 0.325   -20.205 6.749   1.00 0.00 ? 8  VAL A N    1  
ATOM 115   C CA   . VAL A 1 8  ? 1.159   -19.037 7.009   1.00 0.00 ? 8  VAL A CA   1  
ATOM 116   C C    . VAL A 1 8  ? 1.318   -18.171 5.762   1.00 0.00 ? 8  VAL A C    1  
ATOM 117   O O    . VAL A 1 8  ? 1.375   -16.944 5.852   1.00 0.00 ? 8  VAL A O    1  
ATOM 118   C CB   . VAL A 1 8  ? 2.557   -19.448 7.518   1.00 0.00 ? 8  VAL A CB   1  
ATOM 119   C CG1  . VAL A 1 8  ? 3.392   -18.218 7.842   1.00 0.00 ? 8  VAL A CG1  1  
ATOM 120   C CG2  . VAL A 1 8  ? 2.439   -20.354 8.734   1.00 0.00 ? 8  VAL A CG2  1  
ATOM 121   H H    . VAL A 1 8  ? 0.744   -21.096 6.700   1.00 0.00 ? 8  VAL A H    1  
ATOM 122   H HA   . VAL A 1 8  ? 0.681   -18.445 7.783   1.00 0.00 ? 8  VAL A HA   1  
ATOM 123   H HB   . VAL A 1 8  ? 3.060   -20.001 6.736   1.00 0.00 ? 8  VAL A HB   1  
ATOM 124   H HG11 . VAL A 1 8  ? 3.619   -17.677 6.936   1.00 0.00 ? 8  VAL A HG11 1  
ATOM 125   H HG12 . VAL A 1 8  ? 4.321   -18.521 8.309   1.00 0.00 ? 8  VAL A HG12 1  
ATOM 126   H HG13 . VAL A 1 8  ? 2.848   -17.573 8.519   1.00 0.00 ? 8  VAL A HG13 1  
ATOM 127   H HG21 . VAL A 1 8  ? 3.427   -20.612 9.092   1.00 0.00 ? 8  VAL A HG21 1  
ATOM 128   H HG22 . VAL A 1 8  ? 1.915   -21.259 8.469   1.00 0.00 ? 8  VAL A HG22 1  
ATOM 129   H HG23 . VAL A 1 8  ? 1.898   -19.842 9.518   1.00 0.00 ? 8  VAL A HG23 1  
ATOM 130   N N    . VAL A 1 9  ? 1.388   -18.812 4.599   1.00 0.00 ? 9  VAL A N    1  
ATOM 131   C CA   . VAL A 1 9  ? 1.552   -18.095 3.338   1.00 0.00 ? 9  VAL A CA   1  
ATOM 132   C C    . VAL A 1 9  ? 0.402   -17.123 3.093   1.00 0.00 ? 9  VAL A C    1  
ATOM 133   O O    . VAL A 1 9  ? 0.622   -15.946 2.807   1.00 0.00 ? 9  VAL A O    1  
ATOM 134   C CB   . VAL A 1 9  ? 1.640   -19.058 2.140   1.00 0.00 ? 9  VAL A CB   1  
ATOM 135   C CG1  . VAL A 1 9  ? 2.171   -18.335 0.913   1.00 0.00 ? 9  VAL A CG1  1  
ATOM 136   C CG2  . VAL A 1 9  ? 2.507   -20.260 2.470   1.00 0.00 ? 9  VAL A CG2  1  
ATOM 137   H H    . VAL A 1 9  ? 1.325   -19.787 4.598   1.00 0.00 ? 9  VAL A H    1  
ATOM 138   H HA   . VAL A 1 9  ? 2.478   -17.533 3.397   1.00 0.00 ? 9  VAL A HA   1  
ATOM 139   H HB   . VAL A 1 9  ? 0.646   -19.423 1.909   1.00 0.00 ? 9  VAL A HB   1  
ATOM 140   H HG11 . VAL A 1 9  ? 1.508   -17.524 0.650   1.00 0.00 ? 9  VAL A HG11 1  
ATOM 141   H HG12 . VAL A 1 9  ? 2.231   -19.025 0.082   1.00 0.00 ? 9  VAL A HG12 1  
ATOM 142   H HG13 . VAL A 1 9  ? 3.156   -17.940 1.121   1.00 0.00 ? 9  VAL A HG13 1  
ATOM 143   H HG21 . VAL A 1 9  ? 3.464   -19.929 2.850   1.00 0.00 ? 9  VAL A HG21 1  
ATOM 144   H HG22 . VAL A 1 9  ? 2.665   -20.853 1.578   1.00 0.00 ? 9  VAL A HG22 1  
ATOM 145   H HG23 . VAL A 1 9  ? 2.024   -20.865 3.202   1.00 0.00 ? 9  VAL A HG23 1  
ATOM 146   N N    . VAL A 1 10 ? -0.824  -17.626 3.204   1.00 0.00 ? 10 VAL A N    1  
ATOM 147   C CA   . VAL A 1 10 ? -2.014  -16.809 2.982   1.00 0.00 ? 10 VAL A CA   1  
ATOM 148   C C    . VAL A 1 10 ? -2.085  -15.639 3.959   1.00 0.00 ? 10 VAL A C    1  
ATOM 149   O O    . VAL A 1 10 ? -2.132  -14.482 3.545   1.00 0.00 ? 10 VAL A O    1  
ATOM 150   C CB   . VAL A 1 10 ? -3.301  -17.650 3.105   1.00 0.00 ? 10 VAL A CB   1  
ATOM 151   C CG1  . VAL A 1 10 ? -4.534  -16.779 2.911   1.00 0.00 ? 10 VAL A CG1  1  
ATOM 152   C CG2  . VAL A 1 10 ? -3.291  -18.792 2.102   1.00 0.00 ? 10 VAL A CG2  1  
ATOM 153   H H    . VAL A 1 10 ? -0.929  -18.577 3.441   1.00 0.00 ? 10 VAL A H    1  
ATOM 154   H HA   . VAL A 1 10 ? -1.965  -16.413 1.974   1.00 0.00 ? 10 VAL A HA   1  
ATOM 155   H HB   . VAL A 1 10 ? -3.340  -18.075 4.099   1.00 0.00 ? 10 VAL A HB   1  
ATOM 156   H HG11 . VAL A 1 10 ? -4.432  -16.191 2.009   1.00 0.00 ? 10 VAL A HG11 1  
ATOM 157   H HG12 . VAL A 1 10 ? -4.656  -16.121 3.758   1.00 0.00 ? 10 VAL A HG12 1  
ATOM 158   H HG13 . VAL A 1 10 ? -5.414  -17.404 2.829   1.00 0.00 ? 10 VAL A HG13 1  
ATOM 159   H HG21 . VAL A 1 10 ? -4.094  -19.474 2.334   1.00 0.00 ? 10 VAL A HG21 1  
ATOM 160   H HG22 . VAL A 1 10 ? -2.359  -19.322 2.131   1.00 0.00 ? 10 VAL A HG22 1  
ATOM 161   H HG23 . VAL A 1 10 ? -3.439  -18.401 1.104   1.00 0.00 ? 10 VAL A HG23 1  
ATOM 162   N N    . ILE A 1 11 ? -2.096  -15.946 5.252   1.00 0.00 ? 11 ILE A N    1  
ATOM 163   C CA   . ILE A 1 11 ? -2.173  -14.917 6.284   1.00 0.00 ? 11 ILE A CA   1  
ATOM 164   C C    . ILE A 1 11 ? -1.118  -13.831 6.076   1.00 0.00 ? 11 ILE A C    1  
ATOM 165   O O    . ILE A 1 11 ? -1.375  -12.650 6.315   1.00 0.00 ? 11 ILE A O    1  
ATOM 166   C CB   . ILE A 1 11 ? -2.007  -15.522 7.692   1.00 0.00 ? 11 ILE A CB   1  
ATOM 167   C CG1  . ILE A 1 11 ? -3.057  -16.614 7.923   1.00 0.00 ? 11 ILE A CG1  1  
ATOM 168   C CG2  . ILE A 1 11 ? -2.119  -14.436 8.755   1.00 0.00 ? 11 ILE A CG2  1  
ATOM 169   C CD1  . ILE A 1 11 ? -2.858  -17.387 9.209   1.00 0.00 ? 11 ILE A CD1  1  
ATOM 170   H H    . ILE A 1 11 ? -2.048  -16.893 5.509   1.00 0.00 ? 11 ILE A H    1  
ATOM 171   H HA   . ILE A 1 11 ? -3.153  -14.462 6.222   1.00 0.00 ? 11 ILE A HA   1  
ATOM 172   H HB   . ILE A 1 11 ? -1.020  -15.961 7.761   1.00 0.00 ? 11 ILE A HB   1  
ATOM 173   H HG12 . ILE A 1 11 ? -4.036  -16.159 7.968   1.00 0.00 ? 11 ILE A HG12 1  
ATOM 174   H HG13 . ILE A 1 11 ? -3.048  -17.322 7.119   1.00 0.00 ? 11 ILE A HG13 1  
ATOM 175   H HG21 . ILE A 1 11 ? -3.073  -13.936 8.664   1.00 0.00 ? 11 ILE A HG21 1  
ATOM 176   H HG22 . ILE A 1 11 ? -1.324  -13.716 8.636   1.00 0.00 ? 11 ILE A HG22 1  
ATOM 177   H HG23 . ILE A 1 11 ? -2.040  -14.873 9.739   1.00 0.00 ? 11 ILE A HG23 1  
ATOM 178   H HD11 . ILE A 1 11 ? -1.833  -17.726 9.278   1.00 0.00 ? 11 ILE A HD11 1  
ATOM 179   H HD12 . ILE A 1 11 ? -3.518  -18.242 9.218   1.00 0.00 ? 11 ILE A HD12 1  
ATOM 180   H HD13 . ILE A 1 11 ? -3.085  -16.752 10.052  1.00 0.00 ? 11 ILE A HD13 1  
ATOM 181   N N    . SER A 1 12 ? 0.066   -14.236 5.627   1.00 0.00 ? 12 SER A N    1  
ATOM 182   C CA   . SER A 1 12 ? 1.157   -13.294 5.394   1.00 0.00 ? 12 SER A CA   1  
ATOM 183   C C    . SER A 1 12 ? 0.892   -12.430 4.162   1.00 0.00 ? 12 SER A C    1  
ATOM 184   O O    . SER A 1 12 ? 1.133   -11.223 4.176   1.00 0.00 ? 12 SER A O    1  
ATOM 185   C CB   . SER A 1 12 ? 2.479   -14.044 5.227   1.00 0.00 ? 12 SER A CB   1  
ATOM 186   O OG   . SER A 1 12 ? 3.552   -13.145 5.006   1.00 0.00 ? 12 SER A OG   1  
ATOM 187   H H    . SER A 1 12 ? 0.220   -15.194 5.450   1.00 0.00 ? 12 SER A H    1  
ATOM 188   H HA   . SER A 1 12 ? 1.237   -12.646 6.258   1.00 0.00 ? 12 SER A HA   1  
ATOM 189   H HB2  . SER A 1 12 ? 2.682   -14.614 6.122   1.00 0.00 ? 12 SER A HB2  1  
ATOM 190   H HB3  . SER A 1 12 ? 2.408   -14.716 4.383   1.00 0.00 ? 12 SER A HB3  1  
ATOM 191   H HG   . SER A 1 12 ? 3.839   -12.772 5.844   1.00 0.00 ? 12 SER A HG   1  
ATOM 192   N N    . ALA A 1 13 ? 0.394   -13.056 3.100   1.00 0.00 ? 13 ALA A N    1  
ATOM 193   C CA   . ALA A 1 13 ? 0.104   -12.346 1.858   1.00 0.00 ? 13 ALA A CA   1  
ATOM 194   C C    . ALA A 1 13 ? -1.009  -11.319 2.050   1.00 0.00 ? 13 ALA A C    1  
ATOM 195   O O    . ALA A 1 13 ? -0.849  -10.147 1.709   1.00 0.00 ? 13 ALA A O    1  
ATOM 196   C CB   . ALA A 1 13 ? -0.270  -13.334 0.763   1.00 0.00 ? 13 ALA A CB   1  
ATOM 197   H H    . ALA A 1 13 ? 0.221   -14.027 3.146   1.00 0.00 ? 13 ALA A H    1  
ATOM 198   H HA   . ALA A 1 13 ? 1.003   -11.830 1.545   1.00 0.00 ? 13 ALA A HA   1  
ATOM 199   H HB1  . ALA A 1 13 ? -0.421  -12.806 -0.168  1.00 0.00 ? 13 ALA A HB1  1  
ATOM 200   H HB2  . ALA A 1 13 ? -1.179  -13.852 1.035   1.00 0.00 ? 13 ALA A HB2  1  
ATOM 201   H HB3  . ALA A 1 13 ? 0.528   -14.052 0.642   1.00 0.00 ? 13 ALA A HB3  1  
ATOM 202   N N    . ILE A 1 14 ? -2.133  -11.770 2.598   1.00 0.00 ? 14 ILE A N    1  
ATOM 203   C CA   . ILE A 1 14 ? -3.276  -10.896 2.840   1.00 0.00 ? 14 ILE A CA   1  
ATOM 204   C C    . ILE A 1 14 ? -2.873  -9.683  3.672   1.00 0.00 ? 14 ILE A C    1  
ATOM 205   O O    . ILE A 1 14 ? -3.145  -8.542  3.296   1.00 0.00 ? 14 ILE A O    1  
ATOM 206   C CB   . ILE A 1 14 ? -4.411  -11.646 3.570   1.00 0.00 ? 14 ILE A CB   1  
ATOM 207   C CG1  . ILE A 1 14 ? -4.802  -12.915 2.805   1.00 0.00 ? 14 ILE A CG1  1  
ATOM 208   C CG2  . ILE A 1 14 ? -5.617  -10.737 3.759   1.00 0.00 ? 14 ILE A CG2  1  
ATOM 209   C CD1  . ILE A 1 14 ? -5.359  -12.652 1.422   1.00 0.00 ? 14 ILE A CD1  1  
ATOM 210   H H    . ILE A 1 14 ? -2.181  -12.717 2.854   1.00 0.00 ? 14 ILE A H    1  
ATOM 211   H HA   . ILE A 1 14 ? -3.646  -10.554 1.884   1.00 0.00 ? 14 ILE A HA   1  
ATOM 212   H HB   . ILE A 1 14 ? -4.054  -11.931 4.551   1.00 0.00 ? 14 ILE A HB   1  
ATOM 213   H HG12 . ILE A 1 14 ? -3.958  -13.557 2.692   1.00 0.00 ? 14 ILE A HG12 1  
ATOM 214   H HG13 . ILE A 1 14 ? -5.563  -13.440 3.365   1.00 0.00 ? 14 ILE A HG13 1  
ATOM 215   H HG21 . ILE A 1 14 ? -5.898  -10.296 2.812   1.00 0.00 ? 14 ILE A HG21 1  
ATOM 216   H HG22 . ILE A 1 14 ? -5.380  -9.954  4.463   1.00 0.00 ? 14 ILE A HG22 1  
ATOM 217   H HG23 . ILE A 1 14 ? -6.450  -11.311 4.144   1.00 0.00 ? 14 ILE A HG23 1  
ATOM 218   H HD11 . ILE A 1 14 ? -5.621  -13.593 0.961   1.00 0.00 ? 14 ILE A HD11 1  
ATOM 219   H HD12 . ILE A 1 14 ? -4.617  -12.156 0.816   1.00 0.00 ? 14 ILE A HD12 1  
ATOM 220   H HD13 . ILE A 1 14 ? -6.241  -12.034 1.491   1.00 0.00 ? 14 ILE A HD13 1  
ATOM 221   N N    . LEU A 1 15 ? -2.219  -9.937  4.802   1.00 0.00 ? 15 LEU A N    1  
ATOM 222   C CA   . LEU A 1 15 ? -1.782  -8.868  5.696   1.00 0.00 ? 15 LEU A CA   1  
ATOM 223   C C    . LEU A 1 15 ? -0.913  -7.855  4.959   1.00 0.00 ? 15 LEU A C    1  
ATOM 224   O O    . LEU A 1 15 ? -1.148  -6.648  5.041   1.00 0.00 ? 15 LEU A O    1  
ATOM 225   C CB   . LEU A 1 15 ? -1.010  -9.451  6.883   1.00 0.00 ? 15 LEU A CB   1  
ATOM 226   C CG   . LEU A 1 15 ? -0.459  -8.418  7.869   1.00 0.00 ? 15 LEU A CG   1  
ATOM 227   C CD1  . LEU A 1 15 ? -1.595  -7.660  8.543   1.00 0.00 ? 15 LEU A CD1  1  
ATOM 228   C CD2  . LEU A 1 15 ? 0.423   -9.091  8.909   1.00 0.00 ? 15 LEU A CD2  1  
ATOM 229   H H    . LEU A 1 15 ? -2.029  -10.875 5.046   1.00 0.00 ? 15 LEU A H    1  
ATOM 230   H HA   . LEU A 1 15 ? -2.663  -8.365  6.066   1.00 0.00 ? 15 LEU A HA   1  
ATOM 231   H HB2  . LEU A 1 15 ? -1.668  -10.125 7.417   1.00 0.00 ? 15 LEU A HB2  1  
ATOM 232   H HB3  . LEU A 1 15 ? -0.181  -10.026 6.490   1.00 0.00 ? 15 LEU A HB3  1  
ATOM 233   H HG   . LEU A 1 15 ? 0.150   -7.700  7.341   1.00 0.00 ? 15 LEU A HG   1  
ATOM 234   H HD11 . LEU A 1 15 ? -1.188  -6.946  9.247   1.00 0.00 ? 15 LEU A HD11 1  
ATOM 235   H HD12 . LEU A 1 15 ? -2.236  -8.354  9.069   1.00 0.00 ? 15 LEU A HD12 1  
ATOM 236   H HD13 . LEU A 1 15 ? -2.172  -7.132  7.798   1.00 0.00 ? 15 LEU A HD13 1  
ATOM 237   H HD21 . LEU A 1 15 ? 0.825   -8.346  9.581   1.00 0.00 ? 15 LEU A HD21 1  
ATOM 238   H HD22 . LEU A 1 15 ? 1.239   -9.601  8.416   1.00 0.00 ? 15 LEU A HD22 1  
ATOM 239   H HD23 . LEU A 1 15 ? -0.159  -9.807  9.474   1.00 0.00 ? 15 LEU A HD23 1  
ATOM 240   N N    . ALA A 1 16 ? 0.089   -8.352  4.242   1.00 0.00 ? 16 ALA A N    1  
ATOM 241   C CA   . ALA A 1 16 ? 0.995   -7.490  3.491   1.00 0.00 ? 16 ALA A CA   1  
ATOM 242   C C    . ALA A 1 16 ? 0.226   -6.626  2.497   1.00 0.00 ? 16 ALA A C    1  
ATOM 243   O O    . ALA A 1 16 ? 0.627   -5.501  2.196   1.00 0.00 ? 16 ALA A O    1  
ATOM 244   C CB   . ALA A 1 16 ? 2.039   -8.329  2.773   1.00 0.00 ? 16 ALA A CB   1  
ATOM 245   H H    . ALA A 1 16 ? 0.226   -9.330  4.218   1.00 0.00 ? 16 ALA A H    1  
ATOM 246   H HA   . ALA A 1 16 ? 1.510   -6.852  4.193   1.00 0.00 ? 16 ALA A HA   1  
ATOM 247   H HB1  . ALA A 1 16 ? 1.555   -8.975  2.054   1.00 0.00 ? 16 ALA A HB1  1  
ATOM 248   H HB2  . ALA A 1 16 ? 2.571   -8.932  3.494   1.00 0.00 ? 16 ALA A HB2  1  
ATOM 249   H HB3  . ALA A 1 16 ? 2.739   -7.682  2.263   1.00 0.00 ? 16 ALA A HB3  1  
ATOM 250   N N    . LEU A 1 17 ? -0.871  -7.163  1.981   1.00 0.00 ? 17 LEU A N    1  
ATOM 251   C CA   . LEU A 1 17 ? -1.700  -6.442  1.027   1.00 0.00 ? 17 LEU A CA   1  
ATOM 252   C C    . LEU A 1 17 ? -2.489  -5.340  1.728   1.00 0.00 ? 17 LEU A C    1  
ATOM 253   O O    . LEU A 1 17 ? -2.776  -4.296  1.142   1.00 0.00 ? 17 LEU A O    1  
ATOM 254   C CB   . LEU A 1 17 ? -2.652  -7.407  0.315   1.00 0.00 ? 17 LEU A CB   1  
ATOM 255   C CG   . LEU A 1 17 ? -3.350  -6.845  -0.925  1.00 0.00 ? 17 LEU A CG   1  
ATOM 256   C CD1  . LEU A 1 17 ? -2.331  -6.431  -1.976  1.00 0.00 ? 17 LEU A CD1  1  
ATOM 257   C CD2  . LEU A 1 17 ? -4.315  -7.872  -1.495  1.00 0.00 ? 17 LEU A CD2  1  
ATOM 258   H H    . LEU A 1 17 ? -1.141  -8.073  2.242   1.00 0.00 ? 17 LEU A H    1  
ATOM 259   H HA   . LEU A 1 17 ? -1.043  -5.986  0.302   1.00 0.00 ? 17 LEU A HA   1  
ATOM 260   H HB2  . LEU A 1 17 ? -2.083  -8.281  0.019   1.00 0.00 ? 17 LEU A HB2  1  
ATOM 261   H HB3  . LEU A 1 17 ? -3.411  -7.723  1.019   1.00 0.00 ? 17 LEU A HB3  1  
ATOM 262   H HG   . LEU A 1 17 ? -3.918  -5.969  -0.646  1.00 0.00 ? 17 LEU A HG   1  
ATOM 263   H HD11 . LEU A 1 17 ? -2.844  -6.118  -2.877  1.00 0.00 ? 17 LEU A HD11 1  
ATOM 264   H HD12 . LEU A 1 17 ? -1.683  -7.265  -2.207  1.00 0.00 ? 17 LEU A HD12 1  
ATOM 265   H HD13 . LEU A 1 17 ? -1.741  -5.608  -1.606  1.00 0.00 ? 17 LEU A HD13 1  
ATOM 266   H HD21 . LEU A 1 17 ? -3.772  -8.759  -1.794  1.00 0.00 ? 17 LEU A HD21 1  
ATOM 267   H HD22 . LEU A 1 17 ? -4.822  -7.456  -2.355  1.00 0.00 ? 17 LEU A HD22 1  
ATOM 268   H HD23 . LEU A 1 17 ? -5.048  -8.136  -0.745  1.00 0.00 ? 17 LEU A HD23 1  
ATOM 269   N N    . VAL A 1 18 ? -2.837  -5.585  2.988   1.00 0.00 ? 18 VAL A N    1  
ATOM 270   C CA   . VAL A 1 18 ? -3.595  -4.621  3.777   1.00 0.00 ? 18 VAL A CA   1  
ATOM 271   C C    . VAL A 1 18 ? -2.735  -3.424  4.174   1.00 0.00 ? 18 VAL A C    1  
ATOM 272   O O    . VAL A 1 18 ? -3.173  -2.278  4.084   1.00 0.00 ? 18 VAL A O    1  
ATOM 273   C CB   . VAL A 1 18 ? -4.171  -5.272  5.053   1.00 0.00 ? 18 VAL A CB   1  
ATOM 274   C CG1  . VAL A 1 18 ? -4.921  -4.248  5.892   1.00 0.00 ? 18 VAL A CG1  1  
ATOM 275   C CG2  . VAL A 1 18 ? -5.080  -6.436  4.693   1.00 0.00 ? 18 VAL A CG2  1  
ATOM 276   H H    . VAL A 1 18 ? -2.589  -6.437  3.405   1.00 0.00 ? 18 VAL A H    1  
ATOM 277   H HA   . VAL A 1 18 ? -4.426  -4.265  3.176   1.00 0.00 ? 18 VAL A HA   1  
ATOM 278   H HB   . VAL A 1 18 ? -3.351  -5.656  5.643   1.00 0.00 ? 18 VAL A HB   1  
ATOM 279   H HG11 . VAL A 1 18 ? -4.224  -3.551  6.332   1.00 0.00 ? 18 VAL A HG11 1  
ATOM 280   H HG12 . VAL A 1 18 ? -5.458  -4.750  6.687   1.00 0.00 ? 18 VAL A HG12 1  
ATOM 281   H HG13 . VAL A 1 18 ? -5.626  -3.709  5.273   1.00 0.00 ? 18 VAL A HG13 1  
ATOM 282   H HG21 . VAL A 1 18 ? -5.929  -6.072  4.130   1.00 0.00 ? 18 VAL A HG21 1  
ATOM 283   H HG22 . VAL A 1 18 ? -5.429  -6.915  5.596   1.00 0.00 ? 18 VAL A HG22 1  
ATOM 284   H HG23 . VAL A 1 18 ? -4.547  -7.148  4.104   1.00 0.00 ? 18 VAL A HG23 1  
ATOM 285   N N    . VAL A 1 19 ? -1.507  -3.697  4.613   1.00 0.00 ? 19 VAL A N    1  
ATOM 286   C CA   . VAL A 1 19 ? -0.596  -2.638  5.033   1.00 0.00 ? 19 VAL A CA   1  
ATOM 287   C C    . VAL A 1 19 ? -0.228  -1.715  3.874   1.00 0.00 ? 19 VAL A C    1  
ATOM 288   O O    . VAL A 1 19 ? 0.061   -0.539  4.082   1.00 0.00 ? 19 VAL A O    1  
ATOM 289   C CB   . VAL A 1 19 ? 0.693   -3.207  5.657   1.00 0.00 ? 19 VAL A CB   1  
ATOM 290   C CG1  . VAL A 1 19 ? 0.376   -3.985  6.927   1.00 0.00 ? 19 VAL A CG1  1  
ATOM 291   C CG2  . VAL A 1 19 ? 1.433   -4.084  4.661   1.00 0.00 ? 19 VAL A CG2  1  
ATOM 292   H H    . VAL A 1 19 ? -1.216  -4.635  4.669   1.00 0.00 ? 19 VAL A H    1  
ATOM 293   H HA   . VAL A 1 19 ? -1.099  -2.045  5.789   1.00 0.00 ? 19 VAL A HA   1  
ATOM 294   H HB   . VAL A 1 19 ? 1.341   -2.383  5.929   1.00 0.00 ? 19 VAL A HB   1  
ATOM 295   H HG11 . VAL A 1 19 ? -0.122  -3.336  7.634   1.00 0.00 ? 19 VAL A HG11 1  
ATOM 296   H HG12 . VAL A 1 19 ? 1.293   -4.352  7.367   1.00 0.00 ? 19 VAL A HG12 1  
ATOM 297   H HG13 . VAL A 1 19 ? -0.269  -4.820  6.691   1.00 0.00 ? 19 VAL A HG13 1  
ATOM 298   H HG21 . VAL A 1 19 ? 0.820   -4.918  4.416   1.00 0.00 ? 19 VAL A HG21 1  
ATOM 299   H HG22 . VAL A 1 19 ? 2.351   -4.439  5.109   1.00 0.00 ? 19 VAL A HG22 1  
ATOM 300   H HG23 . VAL A 1 19 ? 1.672   -3.530  3.768   1.00 0.00 ? 19 VAL A HG23 1  
ATOM 301   N N    . LEU A 1 20 ? -0.231  -2.249  2.653   1.00 0.00 ? 20 LEU A N    1  
ATOM 302   C CA   . LEU A 1 20 ? 0.098   -1.448  1.480   1.00 0.00 ? 20 LEU A CA   1  
ATOM 303   C C    . LEU A 1 20 ? -0.954  -0.361  1.282   1.00 0.00 ? 20 LEU A C    1  
ATOM 304   O O    . LEU A 1 20 ? -0.643  0.754   0.865   1.00 0.00 ? 20 LEU A O    1  
ATOM 305   C CB   . LEU A 1 20 ? 0.195   -2.333  0.230   1.00 0.00 ? 20 LEU A CB   1  
ATOM 306   C CG   . LEU A 1 20 ? 1.077   -1.794  -0.910  1.00 0.00 ? 20 LEU A CG   1  
ATOM 307   C CD1  . LEU A 1 20 ? 0.431   -0.592  -1.580  1.00 0.00 ? 20 LEU A CD1  1  
ATOM 308   C CD2  . LEU A 1 20 ? 2.466   -1.432  -0.399  1.00 0.00 ? 20 LEU A CD2  1  
ATOM 309   H H    . LEU A 1 20 ? -0.461  -3.199  2.532   1.00 0.00 ? 20 LEU A H    1  
ATOM 310   H HA   . LEU A 1 20 ? 1.045   -0.975  1.672   1.00 0.00 ? 20 LEU A HA   1  
ATOM 311   H HB2  . LEU A 1 20 ? 0.607   -3.288  0.531   1.00 0.00 ? 20 LEU A HB2  1  
ATOM 312   H HB3  . LEU A 1 20 ? -0.800  -2.511  -0.160  1.00 0.00 ? 20 LEU A HB3  1  
ATOM 313   H HG   . LEU A 1 20 ? 1.190   -2.566  -1.658  1.00 0.00 ? 20 LEU A HG   1  
ATOM 314   H HD11 . LEU A 1 20 ? 0.634   0.306   -1.017  1.00 0.00 ? 20 LEU A HD11 1  
ATOM 315   H HD12 . LEU A 1 20 ? -0.639  -0.735  -1.655  1.00 0.00 ? 20 LEU A HD12 1  
ATOM 316   H HD13 . LEU A 1 20 ? 0.840   -0.484  -2.574  1.00 0.00 ? 20 LEU A HD13 1  
ATOM 317   H HD21 . LEU A 1 20 ? 2.871   -2.252  0.179   1.00 0.00 ? 20 LEU A HD21 1  
ATOM 318   H HD22 . LEU A 1 20 ? 2.419   -0.546  0.218   1.00 0.00 ? 20 LEU A HD22 1  
ATOM 319   H HD23 . LEU A 1 20 ? 3.114   -1.241  -1.242  1.00 0.00 ? 20 LEU A HD23 1  
ATOM 320   N N    . THR A 1 21 ? -2.204  -0.694  1.592   1.00 0.00 ? 21 THR A N    1  
ATOM 321   C CA   . THR A 1 21 ? -3.301  0.256   1.465   1.00 0.00 ? 21 THR A CA   1  
ATOM 322   C C    . THR A 1 21 ? -3.250  1.278   2.594   1.00 0.00 ? 21 THR A C    1  
ATOM 323   O O    . THR A 1 21 ? -3.599  2.444   2.411   1.00 0.00 ? 21 THR A O    1  
ATOM 324   C CB   . THR A 1 21 ? -4.670  -0.453  1.486   1.00 0.00 ? 21 THR A CB   1  
ATOM 325   O OG1  . THR A 1 21 ? -4.729  -1.433  0.444   1.00 0.00 ? 21 THR A OG1  1  
ATOM 326   C CG2  . THR A 1 21 ? -5.802  0.545   1.309   1.00 0.00 ? 21 THR A CG2  1  
ATOM 327   H H    . THR A 1 21 ? -2.402  -1.600  1.924   1.00 0.00 ? 21 THR A H    1  
ATOM 328   H HA   . THR A 1 21 ? -3.201  0.774   0.517   1.00 0.00 ? 21 THR A HA   1  
ATOM 329   H HB   . THR A 1 21 ? -4.793  -0.950  2.439   1.00 0.00 ? 21 THR A HB   1  
ATOM 330   H HG1  . THR A 1 21 ? -4.600  -1.026  -0.423  1.00 0.00 ? 21 THR A HG1  1  
ATOM 331   H HG21 . THR A 1 21 ? -5.927  1.119   2.215   1.00 0.00 ? 21 THR A HG21 1  
ATOM 332   H HG22 . THR A 1 21 ? -6.716  0.010   1.099   1.00 0.00 ? 21 THR A HG22 1  
ATOM 333   H HG23 . THR A 1 21 ? -5.584  1.212   0.485   1.00 0.00 ? 21 THR A HG23 1  
ATOM 334   N N    . ILE A 1 22 ? -2.811  0.826   3.766   1.00 0.00 ? 22 ILE A N    1  
ATOM 335   C CA   . ILE A 1 22 ? -2.698  1.694   4.931   1.00 0.00 ? 22 ILE A CA   1  
ATOM 336   C C    . ILE A 1 22 ? -1.602  2.732   4.721   1.00 0.00 ? 22 ILE A C    1  
ATOM 337   O O    . ILE A 1 22 ? -1.821  3.928   4.911   1.00 0.00 ? 22 ILE A O    1  
ATOM 338   C CB   . ILE A 1 22 ? -2.393  0.883   6.209   1.00 0.00 ? 22 ILE A CB   1  
ATOM 339   C CG1  . ILE A 1 22 ? -3.547  -0.076  6.526   1.00 0.00 ? 22 ILE A CG1  1  
ATOM 340   C CG2  . ILE A 1 22 ? -2.126  1.812   7.386   1.00 0.00 ? 22 ILE A CG2  1  
ATOM 341   C CD1  . ILE A 1 22 ? -4.866  0.618   6.807   1.00 0.00 ? 22 ILE A CD1  1  
ATOM 342   H H    . ILE A 1 22 ? -2.549  -0.119  3.859   1.00 0.00 ? 22 ILE A H    1  
ATOM 343   H HA   . ILE A 1 22 ? -3.634  2.218   5.064   1.00 0.00 ? 22 ILE A HA   1  
ATOM 344   H HB   . ILE A 1 22 ? -1.498  0.305   6.034   1.00 0.00 ? 22 ILE A HB   1  
ATOM 345   H HG12 . ILE A 1 22 ? -3.701  -0.732  5.692   1.00 0.00 ? 22 ILE A HG12 1  
ATOM 346   H HG13 . ILE A 1 22 ? -3.292  -0.665  7.396   1.00 0.00 ? 22 ILE A HG13 1  
ATOM 347   H HG21 . ILE A 1 22 ? -2.891  2.576   7.436   1.00 0.00 ? 22 ILE A HG21 1  
ATOM 348   H HG22 . ILE A 1 22 ? -1.159  2.279   7.272   1.00 0.00 ? 22 ILE A HG22 1  
ATOM 349   H HG23 . ILE A 1 22 ? -2.130  1.245   8.308   1.00 0.00 ? 22 ILE A HG23 1  
ATOM 350   H HD11 . ILE A 1 22 ? -5.222  1.100   5.910   1.00 0.00 ? 22 ILE A HD11 1  
ATOM 351   H HD12 . ILE A 1 22 ? -4.742  1.353   7.587   1.00 0.00 ? 22 ILE A HD12 1  
ATOM 352   H HD13 . ILE A 1 22 ? -5.591  -0.116  7.125   1.00 0.00 ? 22 ILE A HD13 1  
ATOM 353   N N    . ILE A 1 23 ? -0.421  2.264   4.326   1.00 0.00 ? 23 ILE A N    1  
ATOM 354   C CA   . ILE A 1 23 ? 0.709   3.152   4.087   1.00 0.00 ? 23 ILE A CA   1  
ATOM 355   C C    . ILE A 1 23 ? 0.382   4.150   2.979   1.00 0.00 ? 23 ILE A C    1  
ATOM 356   O O    . ILE A 1 23 ? 0.833   5.296   3.006   1.00 0.00 ? 23 ILE A O    1  
ATOM 357   C CB   . ILE A 1 23 ? 1.982   2.361   3.718   1.00 0.00 ? 23 ILE A CB   1  
ATOM 358   C CG1  . ILE A 1 23 ? 3.203   3.282   3.748   1.00 0.00 ? 23 ILE A CG1  1  
ATOM 359   C CG2  . ILE A 1 23 ? 1.831   1.709   2.352   1.00 0.00 ? 23 ILE A CG2  1  
ATOM 360   C CD1  . ILE A 1 23 ? 4.519   2.552   3.595   1.00 0.00 ? 23 ILE A CD1  1  
ATOM 361   H H    . ILE A 1 23 ? -0.305  1.293   4.189   1.00 0.00 ? 23 ILE A H    1  
ATOM 362   H HA   . ILE A 1 23 ? 0.899   3.700   5.004   1.00 0.00 ? 23 ILE A HA   1  
ATOM 363   H HB   . ILE A 1 23 ? 2.111   1.577   4.450   1.00 0.00 ? 23 ILE A HB   1  
ATOM 364   H HG12 . ILE A 1 23 ? 3.133   4.005   2.948   1.00 0.00 ? 23 ILE A HG12 1  
ATOM 365   H HG13 . ILE A 1 23 ? 3.232   3.807   4.695   1.00 0.00 ? 23 ILE A HG13 1  
ATOM 366   H HG21 . ILE A 1 23 ? 1.787   2.455   1.572   1.00 0.00 ? 23 ILE A HG21 1  
ATOM 367   H HG22 . ILE A 1 23 ? 0.941   1.124   2.348   1.00 0.00 ? 23 ILE A HG22 1  
ATOM 368   H HG23 . ILE A 1 23 ? 2.676   1.060   2.174   1.00 0.00 ? 23 ILE A HG23 1  
ATOM 369   H HD11 . ILE A 1 23 ? 4.568   2.097   2.617   1.00 0.00 ? 23 ILE A HD11 1  
ATOM 370   H HD12 . ILE A 1 23 ? 4.599   1.786   4.353   1.00 0.00 ? 23 ILE A HD12 1  
ATOM 371   H HD13 . ILE A 1 23 ? 5.333   3.253   3.706   1.00 0.00 ? 23 ILE A HD13 1  
ATOM 372   N N    . SER A 1 24 ? -0.408  3.702   2.006   1.00 0.00 ? 24 SER A N    1  
ATOM 373   C CA   . SER A 1 24 ? -0.810  4.546   0.885   1.00 0.00 ? 24 SER A CA   1  
ATOM 374   C C    . SER A 1 24 ? -1.848  5.576   1.323   1.00 0.00 ? 24 SER A C    1  
ATOM 375   O O    . SER A 1 24 ? -1.862  6.706   0.835   1.00 0.00 ? 24 SER A O    1  
ATOM 376   C CB   . SER A 1 24 ? -1.376  3.687   -0.248  1.00 0.00 ? 24 SER A CB   1  
ATOM 377   O OG   . SER A 1 24 ? -1.803  4.490   -1.336  1.00 0.00 ? 24 SER A OG   1  
ATOM 378   H H    . SER A 1 24 ? -0.738  2.774   2.035   1.00 0.00 ? 24 SER A H    1  
ATOM 379   H HA   . SER A 1 24 ? 0.065   5.069   0.519   1.00 0.00 ? 24 SER A HA   1  
ATOM 380   H HB2  . SER A 1 24 ? -0.610  3.010   -0.598  1.00 0.00 ? 24 SER A HB2  1  
ATOM 381   H HB3  . SER A 1 24 ? -2.218  3.116   0.119   1.00 0.00 ? 24 SER A HB3  1  
ATOM 382   H HG   . SER A 1 24 ? -2.706  4.783   -1.188  1.00 0.00 ? 24 SER A HG   1  
ATOM 383   N N    . LEU A 1 25 ? -2.717  5.172   2.245   1.00 0.00 ? 25 LEU A N    1  
ATOM 384   C CA   . LEU A 1 25 ? -3.763  6.051   2.757   1.00 0.00 ? 25 LEU A CA   1  
ATOM 385   C C    . LEU A 1 25 ? -3.161  7.300   3.391   1.00 0.00 ? 25 LEU A C    1  
ATOM 386   O O    . LEU A 1 25 ? -3.666  8.407   3.208   1.00 0.00 ? 25 LEU A O    1  
ATOM 387   C CB   . LEU A 1 25 ? -4.621  5.308   3.784   1.00 0.00 ? 25 LEU A CB   1  
ATOM 388   C CG   . LEU A 1 25 ? -5.800  6.105   4.348   1.00 0.00 ? 25 LEU A CG   1  
ATOM 389   C CD1  . LEU A 1 25 ? -6.832  6.372   3.262   1.00 0.00 ? 25 LEU A CD1  1  
ATOM 390   C CD2  . LEU A 1 25 ? -6.430  5.365   5.517   1.00 0.00 ? 25 LEU A CD2  1  
ATOM 391   H H    . LEU A 1 25 ? -2.662  4.252   2.595   1.00 0.00 ? 25 LEU A H    1  
ATOM 392   H HA   . LEU A 1 25 ? -4.387  6.347   1.926   1.00 0.00 ? 25 LEU A HA   1  
ATOM 393   H HB2  . LEU A 1 25 ? -5.002  4.408   3.319   1.00 0.00 ? 25 LEU A HB2  1  
ATOM 394   H HB3  . LEU A 1 25 ? -3.981  5.018   4.606   1.00 0.00 ? 25 LEU A HB3  1  
ATOM 395   H HG   . LEU A 1 25 ? -5.451  7.059   4.713   1.00 0.00 ? 25 LEU A HG   1  
ATOM 396   H HD11 . LEU A 1 25 ? -7.662  6.927   3.679   1.00 0.00 ? 25 LEU A HD11 1  
ATOM 397   H HD12 . LEU A 1 25 ? -7.194  5.435   2.863   1.00 0.00 ? 25 LEU A HD12 1  
ATOM 398   H HD13 . LEU A 1 25 ? -6.383  6.950   2.468   1.00 0.00 ? 25 LEU A HD13 1  
ATOM 399   H HD21 . LEU A 1 25 ? -5.689  5.208   6.288   1.00 0.00 ? 25 LEU A HD21 1  
ATOM 400   H HD22 . LEU A 1 25 ? -6.808  4.408   5.183   1.00 0.00 ? 25 LEU A HD22 1  
ATOM 401   H HD23 . LEU A 1 25 ? -7.244  5.951   5.921   1.00 0.00 ? 25 LEU A HD23 1  
ATOM 402   N N    . ILE A 1 26 ? -2.079  7.110   4.139   1.00 0.00 ? 26 ILE A N    1  
ATOM 403   C CA   . ILE A 1 26 ? -1.407  8.217   4.807   1.00 0.00 ? 26 ILE A CA   1  
ATOM 404   C C    . ILE A 1 26 ? -0.871  9.224   3.794   1.00 0.00 ? 26 ILE A C    1  
ATOM 405   O O    . ILE A 1 26 ? -0.957  10.434  4.004   1.00 0.00 ? 26 ILE A O    1  
ATOM 406   C CB   . ILE A 1 26 ? -0.244  7.717   5.689   1.00 0.00 ? 26 ILE A CB   1  
ATOM 407   C CG1  . ILE A 1 26 ? -0.742  6.664   6.687   1.00 0.00 ? 26 ILE A CG1  1  
ATOM 408   C CG2  . ILE A 1 26 ? 0.414   8.881   6.419   1.00 0.00 ? 26 ILE A CG2  1  
ATOM 409   C CD1  . ILE A 1 26 ? -1.811  7.170   7.634   1.00 0.00 ? 26 ILE A CD1  1  
ATOM 410   H H    . ILE A 1 26 ? -1.722  6.200   4.241   1.00 0.00 ? 26 ILE A H    1  
ATOM 411   H HA   . ILE A 1 26 ? -2.128  8.719   5.439   1.00 0.00 ? 26 ILE A HA   1  
ATOM 412   H HB   . ILE A 1 26 ? 0.500   7.263   5.048   1.00 0.00 ? 26 ILE A HB   1  
ATOM 413   H HG12 . ILE A 1 26 ? -1.145  5.824   6.158   1.00 0.00 ? 26 ILE A HG12 1  
ATOM 414   H HG13 . ILE A 1 26 ? 0.092   6.326   7.288   1.00 0.00 ? 26 ILE A HG13 1  
ATOM 415   H HG21 . ILE A 1 26 ? 1.130   8.503   7.138   1.00 0.00 ? 26 ILE A HG21 1  
ATOM 416   H HG22 . ILE A 1 26 ? -0.335  9.464   6.936   1.00 0.00 ? 26 ILE A HG22 1  
ATOM 417   H HG23 . ILE A 1 26 ? 0.928   9.508   5.712   1.00 0.00 ? 26 ILE A HG23 1  
ATOM 418   H HD11 . ILE A 1 26 ? -2.701  7.423   7.079   1.00 0.00 ? 26 ILE A HD11 1  
ATOM 419   H HD12 . ILE A 1 26 ? -1.455  8.040   8.163   1.00 0.00 ? 26 ILE A HD12 1  
ATOM 420   H HD13 . ILE A 1 26 ? -2.048  6.394   8.347   1.00 0.00 ? 26 ILE A HD13 1  
ATOM 421   N N    . ILE A 1 27 ? -0.322  8.718   2.693   1.00 0.00 ? 27 ILE A N    1  
ATOM 422   C CA   . ILE A 1 27 ? 0.227   9.574   1.647   1.00 0.00 ? 27 ILE A CA   1  
ATOM 423   C C    . ILE A 1 27 ? -0.874  10.347  0.933   1.00 0.00 ? 27 ILE A C    1  
ATOM 424   O O    . ILE A 1 27 ? -0.702  11.514  0.587   1.00 0.00 ? 27 ILE A O    1  
ATOM 425   C CB   . ILE A 1 27 ? 1.007   8.758   0.600   1.00 0.00 ? 27 ILE A CB   1  
ATOM 426   C CG1  . ILE A 1 27 ? 2.017   7.836   1.283   1.00 0.00 ? 27 ILE A CG1  1  
ATOM 427   C CG2  . ILE A 1 27 ? 1.707   9.687   -0.384  1.00 0.00 ? 27 ILE A CG2  1  
ATOM 428   C CD1  . ILE A 1 27 ? 2.716   6.894   0.328   1.00 0.00 ? 27 ILE A CD1  1  
ATOM 429   H H    . ILE A 1 27 ? -0.297  7.742   2.577   1.00 0.00 ? 27 ILE A H    1  
ATOM 430   H HA   . ILE A 1 27 ? 0.910   10.279  2.109   1.00 0.00 ? 27 ILE A HA   1  
ATOM 431   H HB   . ILE A 1 27 ? 0.303   8.151   0.043   1.00 0.00 ? 27 ILE A HB   1  
ATOM 432   H HG12 . ILE A 1 27 ? 2.776   8.432   1.768   1.00 0.00 ? 27 ILE A HG12 1  
ATOM 433   H HG13 . ILE A 1 27 ? 1.529   7.235   2.020   1.00 0.00 ? 27 ILE A HG13 1  
ATOM 434   H HG21 . ILE A 1 27 ? 2.407   10.317  0.147   1.00 0.00 ? 27 ILE A HG21 1  
ATOM 435   H HG22 . ILE A 1 27 ? 0.982   10.306  -0.891  1.00 0.00 ? 27 ILE A HG22 1  
ATOM 436   H HG23 . ILE A 1 27 ? 2.240   9.108   -1.122  1.00 0.00 ? 27 ILE A HG23 1  
ATOM 437   H HD11 . ILE A 1 27 ? 1.985   6.381   -0.282  1.00 0.00 ? 27 ILE A HD11 1  
ATOM 438   H HD12 . ILE A 1 27 ? 3.282   6.168   0.893   1.00 0.00 ? 27 ILE A HD12 1  
ATOM 439   H HD13 . ILE A 1 27 ? 3.386   7.454   -0.307  1.00 0.00 ? 27 ILE A HD13 1  
ATOM 440   N N    . LEU A 1 28 ? -2.003  9.683   0.709   1.00 0.00 ? 28 LEU A N    1  
ATOM 441   C CA   . LEU A 1 28 ? -3.133  10.303  0.027   1.00 0.00 ? 28 LEU A CA   1  
ATOM 442   C C    . LEU A 1 28 ? -3.596  11.557  0.758   1.00 0.00 ? 28 LEU A C    1  
ATOM 443   O O    . LEU A 1 28 ? -3.676  12.633  0.169   1.00 0.00 ? 28 LEU A O    1  
ATOM 444   C CB   . LEU A 1 28 ? -4.293  9.312   -0.093  1.00 0.00 ? 28 LEU A CB   1  
ATOM 445   C CG   . LEU A 1 28 ? -5.493  9.815   -0.899  1.00 0.00 ? 28 LEU A CG   1  
ATOM 446   C CD1  . LEU A 1 28 ? -5.090  10.090  -2.339  1.00 0.00 ? 28 LEU A CD1  1  
ATOM 447   C CD2  . LEU A 1 28 ? -6.633  8.808   -0.845  1.00 0.00 ? 28 LEU A CD2  1  
ATOM 448   H H    . LEU A 1 28 ? -2.082  8.744   1.000   1.00 0.00 ? 28 LEU A H    1  
ATOM 449   H HA   . LEU A 1 28 ? -2.803  10.581  -0.962  1.00 0.00 ? 28 LEU A HA   1  
ATOM 450   H HB2  . LEU A 1 28 ? -3.917  8.409   -0.559  1.00 0.00 ? 28 LEU A HB2  1  
ATOM 451   H HB3  . LEU A 1 28 ? -4.630  9.063   0.906   1.00 0.00 ? 28 LEU A HB3  1  
ATOM 452   H HG   . LEU A 1 28 ? -5.850  10.741  -0.472  1.00 0.00 ? 28 LEU A HG   1  
ATOM 453   H HD11 . LEU A 1 28 ? -5.959  10.393  -2.908  1.00 0.00 ? 28 LEU A HD11 1  
ATOM 454   H HD12 . LEU A 1 28 ? -4.671  9.196   -2.779  1.00 0.00 ? 28 LEU A HD12 1  
ATOM 455   H HD13 . LEU A 1 28 ? -4.358  10.882  -2.368  1.00 0.00 ? 28 LEU A HD13 1  
ATOM 456   H HD21 . LEU A 1 28 ? -6.924  8.645   0.184   1.00 0.00 ? 28 LEU A HD21 1  
ATOM 457   H HD22 . LEU A 1 28 ? -6.314  7.871   -1.280  1.00 0.00 ? 28 LEU A HD22 1  
ATOM 458   H HD23 . LEU A 1 28 ? -7.481  9.190   -1.397  1.00 0.00 ? 28 LEU A HD23 1  
ATOM 459   N N    . ILE A 1 29 ? -3.899  11.410  2.043   1.00 0.00 ? 29 ILE A N    1  
ATOM 460   C CA   . ILE A 1 29 ? -4.360  12.531  2.852   1.00 0.00 ? 29 ILE A CA   1  
ATOM 461   C C    . ILE A 1 29 ? -3.247  13.551  3.071   1.00 0.00 ? 29 ILE A C    1  
ATOM 462   O O    . ILE A 1 29 ? -3.491  14.757  3.077   1.00 0.00 ? 29 ILE A O    1  
ATOM 463   C CB   . ILE A 1 29 ? -4.889  12.053  4.220   1.00 0.00 ? 29 ILE A CB   1  
ATOM 464   C CG1  . ILE A 1 29 ? -5.945  10.958  4.031   1.00 0.00 ? 29 ILE A CG1  1  
ATOM 465   C CG2  . ILE A 1 29 ? -5.459  13.224  5.010   1.00 0.00 ? 29 ILE A CG2  1  
ATOM 466   C CD1  . ILE A 1 29 ? -7.140  11.393  3.207   1.00 0.00 ? 29 ILE A CD1  1  
ATOM 467   H H    . ILE A 1 29 ? -3.801  10.521  2.456   1.00 0.00 ? 29 ILE A H    1  
ATOM 468   H HA   . ILE A 1 29 ? -5.170  13.015  2.325   1.00 0.00 ? 29 ILE A HA   1  
ATOM 469   H HB   . ILE A 1 29 ? -4.061  11.643  4.783   1.00 0.00 ? 29 ILE A HB   1  
ATOM 470   H HG12 . ILE A 1 29 ? -5.503  10.105  3.545   1.00 0.00 ? 29 ILE A HG12 1  
ATOM 471   H HG13 . ILE A 1 29 ? -6.312  10.651  5.001   1.00 0.00 ? 29 ILE A HG13 1  
ATOM 472   H HG21 . ILE A 1 29 ? -6.211  13.727  4.427   1.00 0.00 ? 29 ILE A HG21 1  
ATOM 473   H HG22 . ILE A 1 29 ? -4.672  13.919  5.258   1.00 0.00 ? 29 ILE A HG22 1  
ATOM 474   H HG23 . ILE A 1 29 ? -5.904  12.860  5.926   1.00 0.00 ? 29 ILE A HG23 1  
ATOM 475   H HD11 . ILE A 1 29 ? -7.866  10.593  3.189   1.00 0.00 ? 29 ILE A HD11 1  
ATOM 476   H HD12 . ILE A 1 29 ? -6.830  11.610  2.197   1.00 0.00 ? 29 ILE A HD12 1  
ATOM 477   H HD13 . ILE A 1 29 ? -7.592  12.270  3.643   1.00 0.00 ? 29 ILE A HD13 1  
ATOM 478   N N    . MET A 1 30 ? -2.026  13.057  3.254   1.00 0.00 ? 30 MET A N    1  
ATOM 479   C CA   . MET A 1 30 ? -0.873  13.926  3.471   1.00 0.00 ? 30 MET A CA   1  
ATOM 480   C C    . MET A 1 30 ? -0.716  14.915  2.321   1.00 0.00 ? 30 MET A C    1  
ATOM 481   O O    . MET A 1 30 ? -0.613  16.123  2.534   1.00 0.00 ? 30 MET A O    1  
ATOM 482   C CB   . MET A 1 30 ? 0.400   13.089  3.620   1.00 0.00 ? 30 MET A CB   1  
ATOM 483   C CG   . MET A 1 30 ? 1.644   13.914  3.906   1.00 0.00 ? 30 MET A CG   1  
ATOM 484   S SD   . MET A 1 30 ? 3.136   12.906  4.027   1.00 0.00 ? 30 MET A SD   1  
ATOM 485   C CE   . MET A 1 30 ? 2.739   11.870  5.435   1.00 0.00 ? 30 MET A CE   1  
ATOM 486   H H    . MET A 1 30 ? -1.889  12.080  3.247   1.00 0.00 ? 30 MET A H    1  
ATOM 487   H HA   . MET A 1 30 ? -1.037  14.479  4.386   1.00 0.00 ? 30 MET A HA   1  
ATOM 488   H HB2  . MET A 1 30 ? 0.259   12.405  4.441   1.00 0.00 ? 30 MET A HB2  1  
ATOM 489   H HB3  . MET A 1 30 ? 0.559   12.524  2.711   1.00 0.00 ? 30 MET A HB3  1  
ATOM 490   H HG2  . MET A 1 30 ? 1.787   14.626  3.109   1.00 0.00 ? 30 MET A HG2  1  
ATOM 491   H HG3  . MET A 1 30 ? 1.506   14.440  4.839   1.00 0.00 ? 30 MET A HG3  1  
ATOM 492   H HE1  . MET A 1 30 ? 1.966   12.332  6.032   1.00 0.00 ? 30 MET A HE1  1  
ATOM 493   H HE2  . MET A 1 30 ? 3.624   11.734  6.039   1.00 0.00 ? 30 MET A HE2  1  
ATOM 494   H HE3  . MET A 1 30 ? 2.397   10.911  5.083   1.00 0.00 ? 30 MET A HE3  1  
ATOM 495   N N    . LEU A 1 31 ? -0.698  14.390  1.099   1.00 0.00 ? 31 LEU A N    1  
ATOM 496   C CA   . LEU A 1 31 ? -0.558  15.218  -0.093  1.00 0.00 ? 31 LEU A CA   1  
ATOM 497   C C    . LEU A 1 31 ? -1.853  15.969  -0.381  1.00 0.00 ? 31 LEU A C    1  
ATOM 498   O O    . LEU A 1 31 ? -1.849  17.011  -1.036  1.00 0.00 ? 31 LEU A O    1  
ATOM 499   C CB   . LEU A 1 31 ? -0.174  14.355  -1.299  1.00 0.00 ? 31 LEU A CB   1  
ATOM 500   C CG   . LEU A 1 31 ? 0.090   15.121  -2.597  1.00 0.00 ? 31 LEU A CG   1  
ATOM 501   C CD1  . LEU A 1 31 ? 1.263   16.078  -2.429  1.00 0.00 ? 31 LEU A CD1  1  
ATOM 502   C CD2  . LEU A 1 31 ? 0.352   14.154  -3.743  1.00 0.00 ? 31 LEU A CD2  1  
ATOM 503   H H    . LEU A 1 31 ? -0.787  13.412  0.994   1.00 0.00 ? 31 LEU A H    1  
ATOM 504   H HA   . LEU A 1 31 ? 0.228   15.938  0.089   1.00 0.00 ? 31 LEU A HA   1  
ATOM 505   H HB2  . LEU A 1 31 ? 0.718   13.798  -1.041  1.00 0.00 ? 31 LEU A HB2  1  
ATOM 506   H HB3  . LEU A 1 31 ? -0.975  13.648  -1.475  1.00 0.00 ? 31 LEU A HB3  1  
ATOM 507   H HG   . LEU A 1 31 ? -0.781  15.705  -2.852  1.00 0.00 ? 31 LEU A HG   1  
ATOM 508   H HD11 . LEU A 1 31 ? 2.142   15.529  -2.120  1.00 0.00 ? 31 LEU A HD11 1  
ATOM 509   H HD12 . LEU A 1 31 ? 1.023   16.819  -1.687  1.00 0.00 ? 31 LEU A HD12 1  
ATOM 510   H HD13 . LEU A 1 31 ? 1.465   16.574  -3.369  1.00 0.00 ? 31 LEU A HD13 1  
ATOM 511   H HD21 . LEU A 1 31 ? 1.230   13.561  -3.527  1.00 0.00 ? 31 LEU A HD21 1  
ATOM 512   H HD22 . LEU A 1 31 ? 0.510   14.709  -4.658  1.00 0.00 ? 31 LEU A HD22 1  
ATOM 513   H HD23 . LEU A 1 31 ? -0.500  13.500  -3.867  1.00 0.00 ? 31 LEU A HD23 1  
ATOM 514   N N    . TRP A 1 32 ? -2.963  15.428  0.114   1.00 0.00 ? 32 TRP A N    1  
ATOM 515   C CA   . TRP A 1 32 ? -4.272  16.042  -0.085  1.00 0.00 ? 32 TRP A CA   1  
ATOM 516   C C    . TRP A 1 32 ? -4.342  17.397  0.612   1.00 0.00 ? 32 TRP A C    1  
ATOM 517   O O    . TRP A 1 32 ? -5.131  18.262  0.230   1.00 0.00 ? 32 TRP A O    1  
ATOM 518   C CB   . TRP A 1 32 ? -5.374  15.121  0.445   1.00 0.00 ? 32 TRP A CB   1  
ATOM 519   C CG   . TRP A 1 32 ? -6.757  15.675  0.267   1.00 0.00 ? 32 TRP A CG   1  
ATOM 520   C CD1  . TRP A 1 32 ? -7.331  16.083  -0.901  1.00 0.00 ? 32 TRP A CD1  1  
ATOM 521   C CD2  . TRP A 1 32 ? -7.738  15.874  1.291   1.00 0.00 ? 32 TRP A CD2  1  
ATOM 522   N NE1  . TRP A 1 32 ? -8.610  16.528  -0.668  1.00 0.00 ? 32 TRP A NE1  1  
ATOM 523   C CE2  . TRP A 1 32 ? -8.884  16.411  0.670   1.00 0.00 ? 32 TRP A CE2  1  
ATOM 524   C CE3  . TRP A 1 32 ? -7.761  15.655  2.671   1.00 0.00 ? 32 TRP A CE3  1  
ATOM 525   C CZ2  . TRP A 1 32 ? -10.037 16.728  1.382   1.00 0.00 ? 32 TRP A CZ2  1  
ATOM 526   C CZ3  . TRP A 1 32 ? -8.908  15.969  3.377   1.00 0.00 ? 32 TRP A CZ3  1  
ATOM 527   C CH2  . TRP A 1 32 ? -10.031 16.500  2.732   1.00 0.00 ? 32 TRP A CH2  1  
ATOM 528   H H    . TRP A 1 32 ? -2.913  14.591  0.621   1.00 0.00 ? 32 TRP A H    1  
ATOM 529   H HA   . TRP A 1 32 ? -4.421  16.188  -1.147  1.00 0.00 ? 32 TRP A HA   1  
ATOM 530   H HB2  . TRP A 1 32 ? -5.336  14.187  -0.085  1.00 0.00 ? 32 TRP A HB2  1  
ATOM 531   H HB3  . TRP A 1 32 ? -5.216  14.945  1.493   1.00 0.00 ? 32 TRP A HB3  1  
ATOM 532   H HD1  . TRP A 1 32 ? -6.839  16.056  -1.862  1.00 0.00 ? 32 TRP A HD1  1  
ATOM 533   H HE1  . TRP A 1 32 ? -9.223  16.878  -1.338  1.00 0.00 ? 32 TRP A HE1  1  
ATOM 534   H HE3  . TRP A 1 32 ? -6.905  15.251  3.183   1.00 0.00 ? 32 TRP A HE3  1  
ATOM 535   H HZ2  . TRP A 1 32 ? -10.912 17.138  0.900   1.00 0.00 ? 32 TRP A HZ2  1  
ATOM 536   H HZ3  . TRP A 1 32 ? -8.944  15.805  4.444   1.00 0.00 ? 32 TRP A HZ3  1  
ATOM 537   H HH2  . TRP A 1 32 ? -10.905 16.731  3.323   1.00 0.00 ? 32 TRP A HH2  1  
ATOM 538   N N    . GLN A 1 33 ? -3.511  17.574  1.634   1.00 0.00 ? 33 GLN A N    1  
ATOM 539   C CA   . GLN A 1 33 ? -3.479  18.821  2.387   1.00 0.00 ? 33 GLN A CA   1  
ATOM 540   C C    . GLN A 1 33 ? -2.257  19.655  2.016   1.00 0.00 ? 33 GLN A C    1  
ATOM 541   O O    . GLN A 1 33 ? -1.949  20.650  2.671   1.00 0.00 ? 33 GLN A O    1  
ATOM 542   C CB   . GLN A 1 33 ? -3.482  18.534  3.890   1.00 0.00 ? 33 GLN A CB   1  
ATOM 543   C CG   . GLN A 1 33 ? -4.757  17.865  4.375   1.00 0.00 ? 33 GLN A CG   1  
ATOM 544   C CD   . GLN A 1 33 ? -5.990  18.715  4.137   1.00 0.00 ? 33 GLN A CD   1  
ATOM 545   O OE1  . GLN A 1 33 ? -6.384  19.509  4.989   1.00 0.00 ? 33 GLN A OE1  1  
ATOM 546   N NE2  . GLN A 1 33 ? -6.605  18.552  2.971   1.00 0.00 ? 33 GLN A NE2  1  
ATOM 547   H H    . GLN A 1 33 ? -2.901  16.856  1.911   1.00 0.00 ? 33 GLN A H    1  
ATOM 548   H HA   . GLN A 1 33 ? -4.354  19.408  2.144   1.00 0.00 ? 33 GLN A HA   1  
ATOM 549   H HB2  . GLN A 1 33 ? -2.651  17.884  4.121   1.00 0.00 ? 33 GLN A HB2  1  
ATOM 550   H HB3  . GLN A 1 33 ? -3.362  19.464  4.433   1.00 0.00 ? 33 GLN A HB3  1  
ATOM 551   H HG2  . GLN A 1 33 ? -4.875  16.923  3.858   1.00 0.00 ? 33 GLN A HG2  1  
ATOM 552   H HG3  . GLN A 1 33 ? -4.666  17.680  5.436   1.00 0.00 ? 33 GLN A HG3  1  
ATOM 553   H HE21 . GLN A 1 33 ? -6.248  17.909  2.333   1.00 0.00 ? 33 GLN A HE21 1  
ATOM 554   H HE22 . GLN A 1 33 ? -7.404  19.092  2.798   1.00 0.00 ? 33 GLN A HE22 1  
ATOM 555   N N    . LYS A 1 34 ? -1.562  19.241  0.961   1.00 0.00 ? 34 LYS A N    1  
ATOM 556   C CA   . LYS A 1 34 ? -0.377  19.952  0.498   1.00 0.00 ? 34 LYS A CA   1  
ATOM 557   C C    . LYS A 1 34 ? -0.599  20.518  -0.901  1.00 0.00 ? 34 LYS A C    1  
ATOM 558   O O    . LYS A 1 34 ? -0.653  21.734  -1.087  1.00 0.00 ? 34 LYS A O    1  
ATOM 559   C CB   . LYS A 1 34 ? 0.836   19.023  0.500   1.00 0.00 ? 34 LYS A CB   1  
ATOM 560   C CG   . LYS A 1 34 ? 1.261   18.590  1.892   1.00 0.00 ? 34 LYS A CG   1  
ATOM 561   C CD   . LYS A 1 34 ? 2.456   17.651  1.844   1.00 0.00 ? 34 LYS A CD   1  
ATOM 562   C CE   . LYS A 1 34 ? 2.895   17.246  3.241   1.00 0.00 ? 34 LYS A CE   1  
ATOM 563   N NZ   . LYS A 1 34 ? 3.210   18.431  4.087   1.00 0.00 ? 34 LYS A NZ   1  
ATOM 564   H H    . LYS A 1 34 ? -1.838  18.454  0.464   1.00 0.00 ? 34 LYS A H    1  
ATOM 565   H HA   . LYS A 1 34 ? -0.173  20.784  1.162   1.00 0.00 ? 34 LYS A HA   1  
ATOM 566   H HB2  . LYS A 1 34 ? 0.595   18.140  -0.068  1.00 0.00 ? 34 LYS A HB2  1  
ATOM 567   H HB3  . LYS A 1 34 ? 1.674   19.527  0.033   1.00 0.00 ? 34 LYS A HB3  1  
ATOM 568   H HG2  . LYS A 1 34 ? 1.531   19.474  2.451   1.00 0.00 ? 34 LYS A HG2  1  
ATOM 569   H HG3  . LYS A 1 34 ? 0.437   18.102  2.376   1.00 0.00 ? 34 LYS A HG3  1  
ATOM 570   H HD2  . LYS A 1 34 ? 2.186   16.762  1.292   1.00 0.00 ? 34 LYS A HD2  1  
ATOM 571   H HD3  . LYS A 1 34 ? 3.279   18.149  1.350   1.00 0.00 ? 34 LYS A HD3  1  
ATOM 572   H HE2  . LYS A 1 34 ? 2.099   16.686  3.708   1.00 0.00 ? 34 LYS A HE2  1  
ATOM 573   H HE3  . LYS A 1 34 ? 3.775   16.625  3.163   1.00 0.00 ? 34 LYS A HE3  1  
ATOM 574   H HZ1  . LYS A 1 34 ? 3.732   18.128  4.934   1.00 0.00 ? 34 LYS A HZ1  1  
ATOM 575   H HZ2  . LYS A 1 34 ? 2.334   18.901  4.391   1.00 0.00 ? 34 LYS A HZ2  1  
ATOM 576   H HZ3  . LYS A 1 34 ? 3.797   19.116  3.563   1.00 0.00 ? 34 LYS A HZ3  1  
ATOM 577   N N    . LYS A 1 35 ? -0.726  19.627  -1.877  1.00 0.00 ? 35 LYS A N    1  
ATOM 578   C CA   . LYS A 1 35 ? -0.947  20.034  -3.260  1.00 0.00 ? 35 LYS A CA   1  
ATOM 579   C C    . LYS A 1 35 ? -2.392  19.759  -3.679  1.00 0.00 ? 35 LYS A C    1  
ATOM 580   O O    . LYS A 1 35 ? -2.827  18.607  -3.687  1.00 0.00 ? 35 LYS A O    1  
ATOM 581   C CB   . LYS A 1 35 ? 0.011   19.292  -4.192  1.00 0.00 ? 35 LYS A CB   1  
ATOM 582   C CG   . LYS A 1 35 ? -0.183  19.638  -5.660  1.00 0.00 ? 35 LYS A CG   1  
ATOM 583   C CD   . LYS A 1 35 ? 0.746   18.831  -6.552  1.00 0.00 ? 35 LYS A CD   1  
ATOM 584   C CE   . LYS A 1 35 ? 0.437   19.056  -8.023  1.00 0.00 ? 35 LYS A CE   1  
ATOM 585   N NZ   . LYS A 1 35 ? 0.603   20.482  -8.416  1.00 0.00 ? 35 LYS A NZ   1  
ATOM 586   H H    . LYS A 1 35 ? -0.685  18.664  -1.675  1.00 0.00 ? 35 LYS A H    1  
ATOM 587   H HA   . LYS A 1 35 ? -0.729  21.086  -3.348  1.00 0.00 ? 35 LYS A HA   1  
ATOM 588   H HB2  . LYS A 1 35 ? 1.026   19.541  -3.914  1.00 0.00 ? 35 LYS A HB2  1  
ATOM 589   H HB3  . LYS A 1 35 ? -0.137  18.227  -4.066  1.00 0.00 ? 35 LYS A HB3  1  
ATOM 590   H HG2  . LYS A 1 35 ? -1.203  19.427  -5.946  1.00 0.00 ? 35 LYS A HG2  1  
ATOM 591   H HG3  . LYS A 1 35 ? 0.022   20.689  -5.800  1.00 0.00 ? 35 LYS A HG3  1  
ATOM 592   H HD2  . LYS A 1 35 ? 1.765   19.131  -6.360  1.00 0.00 ? 35 LYS A HD2  1  
ATOM 593   H HD3  . LYS A 1 35 ? 0.630   17.778  -6.330  1.00 0.00 ? 35 LYS A HD3  1  
ATOM 594   H HE2  . LYS A 1 35 ? 1.109   18.451  -8.613  1.00 0.00 ? 35 LYS A HE2  1  
ATOM 595   H HE3  . LYS A 1 35 ? -0.582  18.752  -8.219  1.00 0.00 ? 35 LYS A HE3  1  
ATOM 596   H HZ1  . LYS A 1 35 ? 1.540   20.836  -8.127  1.00 0.00 ? 35 LYS A HZ1  1  
ATOM 597   H HZ2  . LYS A 1 35 ? -0.130  21.069  -7.971  1.00 0.00 ? 35 LYS A HZ2  1  
ATOM 598   H HZ3  . LYS A 1 35 ? 0.518   20.575  -9.449  1.00 0.00 ? 35 LYS A HZ3  1  
ATOM 599   N N    . PRO A 1 36 ? -3.159  20.811  -4.032  1.00 0.00 ? 36 PRO A N    1  
ATOM 600   C CA   . PRO A 1 36 ? -4.557  20.658  -4.454  1.00 0.00 ? 36 PRO A CA   1  
ATOM 601   C C    . PRO A 1 36 ? -4.719  19.629  -5.571  1.00 0.00 ? 36 PRO A C    1  
ATOM 602   O O    . PRO A 1 36 ? -3.821  19.447  -6.393  1.00 0.00 ? 36 PRO A O    1  
ATOM 603   C CB   . PRO A 1 36 ? -4.933  22.055  -4.957  1.00 0.00 ? 36 PRO A CB   1  
ATOM 604   C CG   . PRO A 1 36 ? -4.020  22.977  -4.227  1.00 0.00 ? 36 PRO A CG   1  
ATOM 605   C CD   . PRO A 1 36 ? -2.732  22.225  -4.044  1.00 0.00 ? 36 PRO A CD   1  
ATOM 606   H HA   . PRO A 1 36 ? -5.191  20.392  -3.619  1.00 0.00 ? 36 PRO A HA   1  
ATOM 607   H HB2  . PRO A 1 36 ? -4.785  22.130  -6.028  1.00 0.00 ? 36 PRO A HB2  1  
ATOM 608   H HB3  . PRO A 1 36 ? -5.966  22.259  -4.718  1.00 0.00 ? 36 PRO A HB3  1  
ATOM 609   H HG2  . PRO A 1 36 ? -3.854  23.869  -4.813  1.00 0.00 ? 36 PRO A HG2  1  
ATOM 610   H HG3  . PRO A 1 36 ? -4.445  23.231  -3.267  1.00 0.00 ? 36 PRO A HG3  1  
ATOM 611   H HD2  . PRO A 1 36 ? -2.060  22.420  -4.867  1.00 0.00 ? 36 PRO A HD2  1  
ATOM 612   H HD3  . PRO A 1 36 ? -2.274  22.498  -3.105  1.00 0.00 ? 36 PRO A HD3  1  
ATOM 613   N N    . ARG A 1 37 ? -5.868  18.958  -5.592  1.00 0.00 ? 37 ARG A N    1  
ATOM 614   C CA   . ARG A 1 37 ? -6.146  17.945  -6.607  1.00 0.00 ? 37 ARG A CA   1  
ATOM 615   C C    . ARG A 1 37 ? -7.143  18.465  -7.641  1.00 0.00 ? 37 ARG A C    1  
ATOM 616   O O    . ARG A 1 37 ? -8.066  19.208  -7.308  1.00 0.00 ? 37 ARG A O    1  
ATOM 617   C CB   . ARG A 1 37 ? -6.687  16.673  -5.950  1.00 0.00 ? 37 ARG A CB   1  
ATOM 618   C CG   . ARG A 1 37 ? -7.918  16.906  -5.089  1.00 0.00 ? 37 ARG A CG   1  
ATOM 619   C CD   . ARG A 1 37 ? -8.382  15.623  -4.419  1.00 0.00 ? 37 ARG A CD   1  
ATOM 620   N NE   . ARG A 1 37 ? -9.537  15.848  -3.551  1.00 0.00 ? 37 ARG A NE   1  
ATOM 621   C CZ   . ARG A 1 37 ? -10.248 14.869  -2.998  1.00 0.00 ? 37 ARG A CZ   1  
ATOM 622   N NH1  . ARG A 1 37 ? -9.923  13.603  -3.217  1.00 0.00 ? 37 ARG A NH1  1  
ATOM 623   N NH2  . ARG A 1 37 ? -11.284 15.159  -2.224  1.00 0.00 ? 37 ARG A NH2  1  
ATOM 624   H H    . ARG A 1 37 ? -6.548  19.159  -4.913  1.00 0.00 ? 37 ARG A H    1  
ATOM 625   H HA   . ARG A 1 37 ? -5.222  17.692  -7.116  1.00 0.00 ? 37 ARG A HA   1  
ATOM 626   H HB2  . ARG A 1 37 ? -6.936  15.953  -6.720  1.00 0.00 ? 37 ARG A HB2  1  
ATOM 627   H HB3  . ARG A 1 37 ? -5.909  16.257  -5.324  1.00 0.00 ? 37 ARG A HB3  1  
ATOM 628   H HG2  . ARG A 1 37 ? -7.686  17.623  -4.320  1.00 0.00 ? 37 ARG A HG2  1  
ATOM 629   H HG3  . ARG A 1 37 ? -8.717  17.284  -5.709  1.00 0.00 ? 37 ARG A HG3  1  
ATOM 630   H HD2  . ARG A 1 37 ? -8.651  14.913  -5.189  1.00 0.00 ? 37 ARG A HD2  1  
ATOM 631   H HD3  . ARG A 1 37 ? -7.571  15.222  -3.826  1.00 0.00 ? 37 ARG A HD3  1  
ATOM 632   H HE   . ARG A 1 37 ? -9.804  16.780  -3.374  1.00 0.00 ? 37 ARG A HE   1  
ATOM 633   H HH11 . ARG A 1 37 ? -9.146  13.357  -3.793  1.00 0.00 ? 37 ARG A HH11 1  
ATOM 634   H HH12 . ARG A 1 37 ? -10.466 12.873  -2.797  1.00 0.00 ? 37 ARG A HH12 1  
ATOM 635   H HH21 . ARG A 1 37 ? -11.534 16.114  -2.054  1.00 0.00 ? 37 ARG A HH21 1  
ATOM 636   H HH22 . ARG A 1 37 ? -11.822 14.424  -1.806  1.00 0.00 ? 37 ARG A HH22 1  
ATOM 637   N N    . TYR A 1 38 ? -6.949  18.068  -8.897  1.00 0.00 ? 38 TYR A N    1  
ATOM 638   C CA   . TYR A 1 38 ? -7.829  18.499  -9.980  1.00 0.00 ? 38 TYR A CA   1  
ATOM 639   C C    . TYR A 1 38 ? -8.868  17.430  -10.300 1.00 0.00 ? 38 TYR A C    1  
ATOM 640   O O    . TYR A 1 38 ? -8.529  16.274  -10.553 1.00 0.00 ? 38 TYR A O    1  
ATOM 641   C CB   . TYR A 1 38 ? -7.014  18.821  -11.235 1.00 0.00 ? 38 TYR A CB   1  
ATOM 642   C CG   . TYR A 1 38 ? -5.959  19.882  -11.016 1.00 0.00 ? 38 TYR A CG   1  
ATOM 643   C CD1  . TYR A 1 38 ? -4.679  19.539  -10.600 1.00 0.00 ? 38 TYR A CD1  1  
ATOM 644   C CD2  . TYR A 1 38 ? -6.245  21.225  -11.223 1.00 0.00 ? 38 TYR A CD2  1  
ATOM 645   C CE1  . TYR A 1 38 ? -3.712  20.506  -10.396 1.00 0.00 ? 38 TYR A CE1  1  
ATOM 646   C CE2  . TYR A 1 38 ? -5.283  22.198  -11.023 1.00 0.00 ? 38 TYR A CE2  1  
ATOM 647   C CZ   . TYR A 1 38 ? -4.019  21.833  -10.609 1.00 0.00 ? 38 TYR A CZ   1  
ATOM 648   O OH   . TYR A 1 38 ? -3.057  22.798  -10.408 1.00 0.00 ? 38 TYR A OH   1  
ATOM 649   H H    . TYR A 1 38 ? -6.194  17.468  -9.107  1.00 0.00 ? 38 TYR A H    1  
ATOM 650   H HA   . TYR A 1 38 ? -8.339  19.407  -9.673  1.00 0.00 ? 38 TYR A HA   1  
ATOM 651   H HB2  . TYR A 1 38 ? -6.520  17.919  -11.577 1.00 0.00 ? 38 TYR A HB2  1  
ATOM 652   H HB3  . TYR A 1 38 ? -7.685  19.166  -12.014 1.00 0.00 ? 38 TYR A HB3  1  
ATOM 653   H HD1  . TYR A 1 38 ? -4.438  18.498  -10.434 1.00 0.00 ? 38 TYR A HD1  1  
ATOM 654   H HD2  . TYR A 1 38 ? -7.236  21.512  -11.547 1.00 0.00 ? 38 TYR A HD2  1  
ATOM 655   H HE1  . TYR A 1 38 ? -2.722  20.220  -10.072 1.00 0.00 ? 38 TYR A HE1  1  
ATOM 656   H HE2  . TYR A 1 38 ? -5.524  23.238  -11.189 1.00 0.00 ? 38 TYR A HE2  1  
ATOM 657   H HH   . TYR A 1 38 ? -3.122  23.134  -9.511  1.00 0.00 ? 38 TYR A HH   1  
ATOM 658   N N    . GLU A 1 39 ? -10.137 17.827  -10.290 1.00 0.00 ? 39 GLU A N    1  
ATOM 659   C CA   . GLU A 1 39 ? -11.230 16.907  -10.582 1.00 0.00 ? 39 GLU A CA   1  
ATOM 660   C C    . GLU A 1 39 ? -11.653 17.013  -12.043 1.00 0.00 ? 39 GLU A C    1  
ATOM 661   O O    . GLU A 1 39 ? -11.390 18.017  -12.704 1.00 0.00 ? 39 GLU A O    1  
ATOM 662   C CB   . GLU A 1 39 ? -12.423 17.199  -9.671  1.00 0.00 ? 39 GLU A CB   1  
ATOM 663   C CG   . GLU A 1 39 ? -12.123 16.993  -8.194  1.00 0.00 ? 39 GLU A CG   1  
ATOM 664   C CD   . GLU A 1 39 ? -11.803 15.549  -7.859  1.00 0.00 ? 39 GLU A CD   1  
ATOM 665   O OE1  . GLU A 1 39 ? -12.751 14.760  -7.663  1.00 0.00 ? 39 GLU A OE1  1  
ATOM 666   O OE2  . GLU A 1 39 ? -10.602 15.208  -7.794  1.00 0.00 ? 39 GLU A OE2  1  
ATOM 667   O OXT  . GLU A 1 39 ? -12.271 16.041  -12.525 1.00 0.00 ? 39 GLU A OXT  1  
ATOM 668   H H    . GLU A 1 39 ? -10.352 18.769  -10.087 1.00 0.00 ? 39 GLU A H    1  
ATOM 669   H HA   . GLU A 1 39 ? -10.898 15.892  -10.401 1.00 0.00 ? 39 GLU A HA   1  
ATOM 670   H HB2  . GLU A 1 39 ? -12.725 18.227  -9.812  1.00 0.00 ? 39 GLU A HB2  1  
ATOM 671   H HB3  . GLU A 1 39 ? -13.248 16.551  -9.942  1.00 0.00 ? 39 GLU A HB3  1  
ATOM 672   H HG2  . GLU A 1 39 ? -11.277 17.607  -7.919  1.00 0.00 ? 39 GLU A HG2  1  
ATOM 673   H HG3  . GLU A 1 39 ? -12.987 17.297  -7.620  1.00 0.00 ? 39 GLU A HG3  1  
ATOM 674   N N    . GLY B 1 1  ? -6.614  -21.124 -0.323  1.00 0.00 ? 1  GLY B N    1  
ATOM 675   C CA   . GLY B 1 1  ? -5.700  -22.012 -1.019  1.00 0.00 ? 1  GLY B CA   1  
ATOM 676   C C    . GLY B 1 1  ? -6.359  -23.309 -1.444  1.00 0.00 ? 1  GLY B C    1  
ATOM 677   O O    . GLY B 1 1  ? -5.678  -24.295 -1.725  1.00 0.00 ? 1  GLY B O    1  
ATOM 678   H H1   . GLY B 1 1  ? -7.288  -20.702 -0.992  1.00 0.00 ? 1  GLY B H1   1  
ATOM 679   H H2   . GLY B 1 1  ? -6.077  -20.356 0.128   1.00 0.00 ? 1  GLY B H2   1  
ATOM 680   H H3   . GLY B 1 1  ? -7.142  -21.634 0.418   1.00 0.00 ? 1  GLY B H3   1  
ATOM 681   H HA2  . GLY B 1 1  ? -5.326  -21.509 -1.898  1.00 0.00 ? 1  GLY B HA2  1  
ATOM 682   H HA3  . GLY B 1 1  ? -4.870  -22.239 -0.366  1.00 0.00 ? 1  GLY B HA3  1  
ATOM 683   N N    . HIS B 1 2  ? -7.687  -23.308 -1.492  1.00 0.00 ? 2  HIS B N    1  
ATOM 684   C CA   . HIS B 1 2  ? -8.435  -24.495 -1.887  1.00 0.00 ? 2  HIS B CA   1  
ATOM 685   C C    . HIS B 1 2  ? -8.819  -24.430 -3.362  1.00 0.00 ? 2  HIS B C    1  
ATOM 686   O O    . HIS B 1 2  ? -9.535  -25.297 -3.866  1.00 0.00 ? 2  HIS B O    1  
ATOM 687   C CB   . HIS B 1 2  ? -9.690  -24.646 -1.024  1.00 0.00 ? 2  HIS B CB   1  
ATOM 688   C CG   . HIS B 1 2  ? -10.675 -23.530 -1.195  1.00 0.00 ? 2  HIS B CG   1  
ATOM 689   N ND1  . HIS B 1 2  ? -11.828 -23.654 -1.941  1.00 0.00 ? 2  HIS B ND1  1  
ATOM 690   C CD2  . HIS B 1 2  ? -10.679 -22.267 -0.709  1.00 0.00 ? 2  HIS B CD2  1  
ATOM 691   C CE1  . HIS B 1 2  ? -12.498 -22.516 -1.906  1.00 0.00 ? 2  HIS B CE1  1  
ATOM 692   N NE2  . HIS B 1 2  ? -11.822 -21.659 -1.163  1.00 0.00 ? 2  HIS B NE2  1  
ATOM 693   H H    . HIS B 1 2  ? -8.180  -22.500 -1.275  1.00 0.00 ? 2  HIS B H    1  
ATOM 694   H HA   . HIS B 1 2  ? -7.815  -25.371 -1.736  1.00 0.00 ? 2  HIS B HA   1  
ATOM 695   H HB2  . HIS B 1 2  ? -10.188 -25.571 -1.277  1.00 0.00 ? 2  HIS B HB2  1  
ATOM 696   H HB3  . HIS B 1 2  ? -9.399  -24.675 0.016   1.00 0.00 ? 2  HIS B HB3  1  
ATOM 697   H HD1  . HIS B 1 2  ? -12.113 -24.457 -2.425  1.00 0.00 ? 2  HIS B HD1  1  
ATOM 698   H HD2  . HIS B 1 2  ? -9.923  -21.821 -0.079  1.00 0.00 ? 2  HIS B HD2  1  
ATOM 699   H HE1  . HIS B 1 2  ? -13.439 -22.321 -2.399  1.00 0.00 ? 2  HIS B HE1  1  
ATOM 700   H HE2  . HIS B 1 2  ? -12.137 -20.770 -0.898  1.00 0.00 ? 2  HIS B HE2  1  
ATOM 701   N N    . SER B 1 3  ? -8.337  -23.399 -4.047  1.00 0.00 ? 3  SER B N    1  
ATOM 702   C CA   . SER B 1 3  ? -8.630  -23.221 -5.464  1.00 0.00 ? 3  SER B CA   1  
ATOM 703   C C    . SER B 1 3  ? -7.374  -22.828 -6.234  1.00 0.00 ? 3  SER B C    1  
ATOM 704   O O    . SER B 1 3  ? -6.809  -23.636 -6.971  1.00 0.00 ? 3  SER B O    1  
ATOM 705   C CB   . SER B 1 3  ? -9.714  -22.158 -5.652  1.00 0.00 ? 3  SER B CB   1  
ATOM 706   O OG   . SER B 1 3  ? -10.914 -22.534 -4.999  1.00 0.00 ? 3  SER B OG   1  
ATOM 707   H H    . SER B 1 3  ? -7.775  -22.727 -3.612  1.00 0.00 ? 3  SER B H    1  
ATOM 708   H HA   . SER B 1 3  ? -8.990  -24.156 -5.875  1.00 0.00 ? 3  SER B HA   1  
ATOM 709   H HB2  . SER B 1 3  ? -9.385  -21.221 -5.233  1.00 0.00 ? 3  SER B HB2  1  
ATOM 710   H HB3  . SER B 1 3  ? -9.920  -22.030 -6.706  1.00 0.00 ? 3  SER B HB3  1  
ATOM 711   H HG   . SER B 1 3  ? -11.397 -23.160 -5.545  1.00 0.00 ? 3  SER B HG   1  
ATOM 712   N N    . LEU B 1 4  ? -6.943  -21.583 -6.059  1.00 0.00 ? 4  LEU B N    1  
ATOM 713   C CA   . LEU B 1 4  ? -5.752  -21.085 -6.738  1.00 0.00 ? 4  LEU B CA   1  
ATOM 714   C C    . LEU B 1 4  ? -4.493  -21.740 -6.171  1.00 0.00 ? 4  LEU B C    1  
ATOM 715   O O    . LEU B 1 4  ? -4.485  -22.181 -5.022  1.00 0.00 ? 4  LEU B O    1  
ATOM 716   C CB   . LEU B 1 4  ? -5.660  -19.562 -6.600  1.00 0.00 ? 4  LEU B CB   1  
ATOM 717   C CG   . LEU B 1 4  ? -6.879  -18.788 -7.109  1.00 0.00 ? 4  LEU B CG   1  
ATOM 718   C CD1  . LEU B 1 4  ? -6.726  -17.304 -6.820  1.00 0.00 ? 4  LEU B CD1  1  
ATOM 719   C CD2  . LEU B 1 4  ? -7.078  -19.022 -8.600  1.00 0.00 ? 4  LEU B CD2  1  
ATOM 720   H H    . LEU B 1 4  ? -7.420  -20.979 -5.449  1.00 0.00 ? 4  LEU B H    1  
ATOM 721   H HA   . LEU B 1 4  ? -5.842  -21.337 -7.785  1.00 0.00 ? 4  LEU B HA   1  
ATOM 722   H HB2  . LEU B 1 4  ? -5.530  -19.331 -5.548  1.00 0.00 ? 4  LEU B HB2  1  
ATOM 723   H HB3  . LEU B 1 4  ? -4.788  -19.213 -7.132  1.00 0.00 ? 4  LEU B HB3  1  
ATOM 724   H HG   . LEU B 1 4  ? -7.762  -19.138 -6.594  1.00 0.00 ? 4  LEU B HG   1  
ATOM 725   H HD11 . LEU B 1 4  ? -5.854  -16.919 -7.332  1.00 0.00 ? 4  LEU B HD11 1  
ATOM 726   H HD12 . LEU B 1 4  ? -6.612  -17.152 -5.755  1.00 0.00 ? 4  LEU B HD12 1  
ATOM 727   H HD13 . LEU B 1 4  ? -7.605  -16.775 -7.162  1.00 0.00 ? 4  LEU B HD13 1  
ATOM 728   H HD21 . LEU B 1 4  ? -6.189  -18.724 -9.139  1.00 0.00 ? 4  LEU B HD21 1  
ATOM 729   H HD22 . LEU B 1 4  ? -7.920  -18.439 -8.950  1.00 0.00 ? 4  LEU B HD22 1  
ATOM 730   H HD23 . LEU B 1 4  ? -7.275  -20.067 -8.782  1.00 0.00 ? 4  LEU B HD23 1  
ATOM 731   N N    . PRO B 1 5  ? -3.412  -21.816 -6.969  1.00 0.00 ? 5  PRO B N    1  
ATOM 732   C CA   . PRO B 1 5  ? -2.152  -22.425 -6.528  1.00 0.00 ? 5  PRO B CA   1  
ATOM 733   C C    . PRO B 1 5  ? -1.503  -21.644 -5.389  1.00 0.00 ? 5  PRO B C    1  
ATOM 734   O O    . PRO B 1 5  ? -1.739  -20.449 -5.233  1.00 0.00 ? 5  PRO B O    1  
ATOM 735   C CB   . PRO B 1 5  ? -1.267  -22.380 -7.778  1.00 0.00 ? 5  PRO B CB   1  
ATOM 736   C CG   . PRO B 1 5  ? -1.847  -21.298 -8.620  1.00 0.00 ? 5  PRO B CG   1  
ATOM 737   C CD   . PRO B 1 5  ? -3.325  -21.315 -8.354  1.00 0.00 ? 5  PRO B CD   1  
ATOM 738   H HA   . PRO B 1 5  ? -2.299  -23.453 -6.225  1.00 0.00 ? 5  PRO B HA   1  
ATOM 739   H HB2  . PRO B 1 5  ? -0.237  -22.169 -7.516  1.00 0.00 ? 5  PRO B HB2  1  
ATOM 740   H HB3  . PRO B 1 5  ? -1.319  -23.332 -8.284  1.00 0.00 ? 5  PRO B HB3  1  
ATOM 741   H HG2  . PRO B 1 5  ? -1.429  -20.353 -8.333  1.00 0.00 ? 5  PRO B HG2  1  
ATOM 742   H HG3  . PRO B 1 5  ? -1.651  -21.497 -9.663  1.00 0.00 ? 5  PRO B HG3  1  
ATOM 743   H HD2  . PRO B 1 5  ? -3.728  -20.322 -8.441  1.00 0.00 ? 5  PRO B HD2  1  
ATOM 744   H HD3  . PRO B 1 5  ? -3.823  -21.986 -9.038  1.00 0.00 ? 5  PRO B HD3  1  
ATOM 745   N N    . PHE B 1 6  ? -0.696  -22.331 -4.589  1.00 0.00 ? 6  PHE B N    1  
ATOM 746   C CA   . PHE B 1 6  ? -0.012  -21.699 -3.466  1.00 0.00 ? 6  PHE B CA   1  
ATOM 747   C C    . PHE B 1 6  ? 1.098   -20.773 -3.956  1.00 0.00 ? 6  PHE B C    1  
ATOM 748   O O    . PHE B 1 6  ? 1.582   -19.919 -3.214  1.00 0.00 ? 6  PHE B O    1  
ATOM 749   C CB   . PHE B 1 6  ? 0.570   -22.767 -2.533  1.00 0.00 ? 6  PHE B CB   1  
ATOM 750   C CG   . PHE B 1 6  ? 1.827   -23.412 -3.055  1.00 0.00 ? 6  PHE B CG   1  
ATOM 751   C CD1  . PHE B 1 6  ? 1.828   -24.093 -4.262  1.00 0.00 ? 6  PHE B CD1  1  
ATOM 752   C CD2  . PHE B 1 6  ? 3.008   -23.335 -2.333  1.00 0.00 ? 6  PHE B CD2  1  
ATOM 753   C CE1  . PHE B 1 6  ? 2.983   -24.684 -4.739  1.00 0.00 ? 6  PHE B CE1  1  
ATOM 754   C CE2  . PHE B 1 6  ? 4.165   -23.926 -2.805  1.00 0.00 ? 6  PHE B CE2  1  
ATOM 755   C CZ   . PHE B 1 6  ? 4.152   -24.600 -4.010  1.00 0.00 ? 6  PHE B CZ   1  
ATOM 756   H H    . PHE B 1 6  ? -0.577  -23.284 -4.757  1.00 0.00 ? 6  PHE B H    1  
ATOM 757   H HA   . PHE B 1 6  ? -0.735  -21.119 -2.911  1.00 0.00 ? 6  PHE B HA   1  
ATOM 758   H HB2  . PHE B 1 6  ? 0.784   -22.311 -1.576  1.00 0.00 ? 6  PHE B HB2  1  
ATOM 759   H HB3  . PHE B 1 6  ? -0.167  -23.546 -2.389  1.00 0.00 ? 6  PHE B HB3  1  
ATOM 760   H HD1  . PHE B 1 6  ? 0.931   -24.178 -4.838  1.00 0.00 ? 6  PHE B HD1  1  
ATOM 761   H HD2  . PHE B 1 6  ? 3.024   -22.808 -1.388  1.00 0.00 ? 6  PHE B HD2  1  
ATOM 762   H HE1  . PHE B 1 6  ? 2.970   -25.212 -5.681  1.00 0.00 ? 6  PHE B HE1  1  
ATOM 763   H HE2  . PHE B 1 6  ? 5.079   -23.859 -2.233  1.00 0.00 ? 6  PHE B HE2  1  
ATOM 764   H HZ   . PHE B 1 6  ? 5.055   -25.061 -4.381  1.00 0.00 ? 6  PHE B HZ   1  
ATOM 765   N N    . LYS B 1 7  ? 1.493   -20.955 -5.209  1.00 0.00 ? 7  LYS B N    1  
ATOM 766   C CA   . LYS B 1 7  ? 2.556   -20.156 -5.807  1.00 0.00 ? 7  LYS B CA   1  
ATOM 767   C C    . LYS B 1 7  ? 2.196   -18.672 -5.846  1.00 0.00 ? 7  LYS B C    1  
ATOM 768   O O    . LYS B 1 7  ? 3.010   -17.822 -5.486  1.00 0.00 ? 7  LYS B O    1  
ATOM 769   C CB   . LYS B 1 7  ? 2.863   -20.665 -7.215  1.00 0.00 ? 7  LYS B CB   1  
ATOM 770   C CG   . LYS B 1 7  ? 4.035   -19.960 -7.879  1.00 0.00 ? 7  LYS B CG   1  
ATOM 771   C CD   . LYS B 1 7  ? 4.629   -20.796 -9.003  1.00 0.00 ? 7  LYS B CD   1  
ATOM 772   C CE   . LYS B 1 7  ? 3.622   -21.040 -10.118 1.00 0.00 ? 7  LYS B CE   1  
ATOM 773   N NZ   . LYS B 1 7  ? 4.186   -21.900 -11.194 1.00 0.00 ? 7  LYS B NZ   1  
ATOM 774   H H    . LYS B 1 7  ? 1.085   -21.659 -5.757  1.00 0.00 ? 7  LYS B H    1  
ATOM 775   H HA   . LYS B 1 7  ? 3.443   -20.277 -5.198  1.00 0.00 ? 7  LYS B HA   1  
ATOM 776   H HB2  . LYS B 1 7  ? 3.082   -21.723 -7.149  1.00 0.00 ? 7  LYS B HB2  1  
ATOM 777   H HB3  . LYS B 1 7  ? 1.988   -20.530 -7.837  1.00 0.00 ? 7  LYS B HB3  1  
ATOM 778   H HG2  . LYS B 1 7  ? 3.693   -19.019 -8.283  1.00 0.00 ? 7  LYS B HG2  1  
ATOM 779   H HG3  . LYS B 1 7  ? 4.807   -19.775 -7.142  1.00 0.00 ? 7  LYS B HG3  1  
ATOM 780   H HD2  . LYS B 1 7  ? 5.480   -20.273 -9.413  1.00 0.00 ? 7  LYS B HD2  1  
ATOM 781   H HD3  . LYS B 1 7  ? 4.951   -21.748 -8.605  1.00 0.00 ? 7  LYS B HD3  1  
ATOM 782   H HE2  . LYS B 1 7  ? 2.749   -21.530 -9.714  1.00 0.00 ? 7  LYS B HE2  1  
ATOM 783   H HE3  . LYS B 1 7  ? 3.336   -20.089 -10.545 1.00 0.00 ? 7  LYS B HE3  1  
ATOM 784   H HZ1  . LYS B 1 7  ? 3.475   -22.048 -11.938 1.00 0.00 ? 7  LYS B HZ1  1  
ATOM 785   H HZ2  . LYS B 1 7  ? 4.463   -22.827 -10.810 1.00 0.00 ? 7  LYS B HZ2  1  
ATOM 786   H HZ3  . LYS B 1 7  ? 5.023   -21.448 -11.618 1.00 0.00 ? 7  LYS B HZ3  1  
ATOM 787   N N    . VAL B 1 8  ? 0.979   -18.360 -6.282  1.00 0.00 ? 8  VAL B N    1  
ATOM 788   C CA   . VAL B 1 8  ? 0.539   -16.971 -6.363  1.00 0.00 ? 8  VAL B CA   1  
ATOM 789   C C    . VAL B 1 8  ? 0.575   -16.297 -4.993  1.00 0.00 ? 8  VAL B C    1  
ATOM 790   O O    . VAL B 1 8  ? 0.876   -15.109 -4.886  1.00 0.00 ? 8  VAL B O    1  
ATOM 791   C CB   . VAL B 1 8  ? -0.878  -16.843 -6.959  1.00 0.00 ? 8  VAL B CB   1  
ATOM 792   C CG1  . VAL B 1 8  ? -0.937  -17.475 -8.340  1.00 0.00 ? 8  VAL B CG1  1  
ATOM 793   C CG2  . VAL B 1 8  ? -1.916  -17.465 -6.038  1.00 0.00 ? 8  VAL B CG2  1  
ATOM 794   H H    . VAL B 1 8  ? 0.365   -19.080 -6.553  1.00 0.00 ? 8  VAL B H    1  
ATOM 795   H HA   . VAL B 1 8  ? 1.224   -16.444 -7.018  1.00 0.00 ? 8  VAL B HA   1  
ATOM 796   H HB   . VAL B 1 8  ? -1.110  -15.792 -7.067  1.00 0.00 ? 8  VAL B HB   1  
ATOM 797   H HG11 . VAL B 1 8  ? -1.941  -17.396 -8.735  1.00 0.00 ? 8  VAL B HG11 1  
ATOM 798   H HG12 . VAL B 1 8  ? -0.656  -18.509 -8.284  1.00 0.00 ? 8  VAL B HG12 1  
ATOM 799   H HG13 . VAL B 1 8  ? -0.257  -16.956 -9.000  1.00 0.00 ? 8  VAL B HG13 1  
ATOM 800   H HG21 . VAL B 1 8  ? -1.548  -18.392 -5.652  1.00 0.00 ? 8  VAL B HG21 1  
ATOM 801   H HG22 . VAL B 1 8  ? -2.839  -17.640 -6.576  1.00 0.00 ? 8  VAL B HG22 1  
ATOM 802   H HG23 . VAL B 1 8  ? -2.112  -16.792 -5.217  1.00 0.00 ? 8  VAL B HG23 1  
ATOM 803   N N    . VAL B 1 9  ? 0.267   -17.063 -3.949  1.00 0.00 ? 9  VAL B N    1  
ATOM 804   C CA   . VAL B 1 9  ? 0.266   -16.534 -2.587  1.00 0.00 ? 9  VAL B CA   1  
ATOM 805   C C    . VAL B 1 9  ? 1.667   -16.100 -2.168  1.00 0.00 ? 9  VAL B C    1  
ATOM 806   O O    . VAL B 1 9  ? 1.864   -14.977 -1.705  1.00 0.00 ? 9  VAL B O    1  
ATOM 807   C CB   . VAL B 1 9  ? -0.251  -17.571 -1.568  1.00 0.00 ? 9  VAL B CB   1  
ATOM 808   C CG1  . VAL B 1 9  ? -0.714  -16.879 -0.296  1.00 0.00 ? 9  VAL B CG1  1  
ATOM 809   C CG2  . VAL B 1 9  ? -1.368  -18.410 -2.165  1.00 0.00 ? 9  VAL B CG2  1  
ATOM 810   H H    . VAL B 1 9  ? 0.050   -18.002 -4.105  1.00 0.00 ? 9  VAL B H    1  
ATOM 811   H HA   . VAL B 1 9  ? -0.390  -15.670 -2.567  1.00 0.00 ? 9  VAL B HA   1  
ATOM 812   H HB   . VAL B 1 9  ? 0.559   -18.243 -1.306  1.00 0.00 ? 9  VAL B HB   1  
ATOM 813   H HG11 . VAL B 1 9  ? -1.045  -17.619 0.420   1.00 0.00 ? 9  VAL B HG11 1  
ATOM 814   H HG12 . VAL B 1 9  ? -1.532  -16.209 -0.522  1.00 0.00 ? 9  VAL B HG12 1  
ATOM 815   H HG13 . VAL B 1 9  ? 0.105   -16.315 0.128   1.00 0.00 ? 9  VAL B HG13 1  
ATOM 816   H HG21 . VAL B 1 9  ? -2.117  -17.766 -2.606  1.00 0.00 ? 9  VAL B HG21 1  
ATOM 817   H HG22 . VAL B 1 9  ? -1.828  -19.011 -1.391  1.00 0.00 ? 9  VAL B HG22 1  
ATOM 818   H HG23 . VAL B 1 9  ? -0.971  -19.064 -2.918  1.00 0.00 ? 9  VAL B HG23 1  
ATOM 819   N N    . VAL B 1 10 ? 2.632   -16.999 -2.332  1.00 0.00 ? 10 VAL B N    1  
ATOM 820   C CA   . VAL B 1 10 ? 4.016   -16.715 -1.967  1.00 0.00 ? 10 VAL B CA   1  
ATOM 821   C C    . VAL B 1 10 ? 4.553   -15.503 -2.723  1.00 0.00 ? 10 VAL B C    1  
ATOM 822   O O    . VAL B 1 10 ? 5.085   -14.571 -2.120  1.00 0.00 ? 10 VAL B O    1  
ATOM 823   C CB   . VAL B 1 10 ? 4.930   -17.923 -2.253  1.00 0.00 ? 10 VAL B CB   1  
ATOM 824   C CG1  . VAL B 1 10 ? 6.345   -17.655 -1.759  1.00 0.00 ? 10 VAL B CG1  1  
ATOM 825   C CG2  . VAL B 1 10 ? 4.365   -19.183 -1.617  1.00 0.00 ? 10 VAL B CG2  1  
ATOM 826   H H    . VAL B 1 10 ? 2.399   -17.872 -2.717  1.00 0.00 ? 10 VAL B H    1  
ATOM 827   H HA   . VAL B 1 10 ? 4.046   -16.508 -0.904  1.00 0.00 ? 10 VAL B HA   1  
ATOM 828   H HB   . VAL B 1 10 ? 4.971   -18.080 -3.324  1.00 0.00 ? 10 VAL B HB   1  
ATOM 829   H HG11 . VAL B 1 10 ? 6.786   -16.849 -2.324  1.00 0.00 ? 10 VAL B HG11 1  
ATOM 830   H HG12 . VAL B 1 10 ? 6.949   -18.543 -1.888  1.00 0.00 ? 10 VAL B HG12 1  
ATOM 831   H HG13 . VAL B 1 10 ? 6.322   -17.389 -0.711  1.00 0.00 ? 10 VAL B HG13 1  
ATOM 832   H HG21 . VAL B 1 10 ? 4.236   -19.027 -0.554  1.00 0.00 ? 10 VAL B HG21 1  
ATOM 833   H HG22 . VAL B 1 10 ? 5.049   -20.006 -1.775  1.00 0.00 ? 10 VAL B HG22 1  
ATOM 834   H HG23 . VAL B 1 10 ? 3.426   -19.428 -2.056  1.00 0.00 ? 10 VAL B HG23 1  
ATOM 835   N N    . ILE B 1 11 ? 4.412   -15.525 -4.045  1.00 0.00 ? 11 ILE B N    1  
ATOM 836   C CA   . ILE B 1 11 ? 4.888   -14.433 -4.886  1.00 0.00 ? 11 ILE B CA   1  
ATOM 837   C C    . ILE B 1 11 ? 4.229   -13.109 -4.505  1.00 0.00 ? 11 ILE B C    1  
ATOM 838   O O    . ILE B 1 11 ? 4.874   -12.062 -4.506  1.00 0.00 ? 11 ILE B O    1  
ATOM 839   C CB   . ILE B 1 11 ? 4.624   -14.719 -6.378  1.00 0.00 ? 11 ILE B CB   1  
ATOM 840   C CG1  . ILE B 1 11 ? 5.283   -16.041 -6.789  1.00 0.00 ? 11 ILE B CG1  1  
ATOM 841   C CG2  . ILE B 1 11 ? 5.141   -13.575 -7.240  1.00 0.00 ? 11 ILE B CG2  1  
ATOM 842   C CD1  . ILE B 1 11 ? 4.919   -16.493 -8.187  1.00 0.00 ? 11 ILE B CD1  1  
ATOM 843   H H    . ILE B 1 11 ? 3.968   -16.300 -4.460  1.00 0.00 ? 11 ILE B H    1  
ATOM 844   H HA   . ILE B 1 11 ? 5.958   -14.342 -4.742  1.00 0.00 ? 11 ILE B HA   1  
ATOM 845   H HB   . ILE B 1 11 ? 3.555   -14.796 -6.527  1.00 0.00 ? 11 ILE B HB   1  
ATOM 846   H HG12 . ILE B 1 11 ? 6.357   -15.927 -6.755  1.00 0.00 ? 11 ILE B HG12 1  
ATOM 847   H HG13 . ILE B 1 11 ? 5.003   -16.827 -6.115  1.00 0.00 ? 11 ILE B HG13 1  
ATOM 848   H HG21 . ILE B 1 11 ? 4.983   -13.800 -8.285  1.00 0.00 ? 11 ILE B HG21 1  
ATOM 849   H HG22 . ILE B 1 11 ? 6.198   -13.435 -7.064  1.00 0.00 ? 11 ILE B HG22 1  
ATOM 850   H HG23 . ILE B 1 11 ? 4.616   -12.663 -7.000  1.00 0.00 ? 11 ILE B HG23 1  
ATOM 851   H HD11 . ILE B 1 11 ? 5.365   -15.828 -8.910  1.00 0.00 ? 11 ILE B HD11 1  
ATOM 852   H HD12 . ILE B 1 11 ? 3.844   -16.487 -8.305  1.00 0.00 ? 11 ILE B HD12 1  
ATOM 853   H HD13 . ILE B 1 11 ? 5.291   -17.494 -8.346  1.00 0.00 ? 11 ILE B HD13 1  
ATOM 854   N N    . SER B 1 12 ? 2.941   -13.164 -4.179  1.00 0.00 ? 12 SER B N    1  
ATOM 855   C CA   . SER B 1 12 ? 2.197   -11.966 -3.800  1.00 0.00 ? 12 SER B CA   1  
ATOM 856   C C    . SER B 1 12 ? 2.681   -11.425 -2.459  1.00 0.00 ? 12 SER B C    1  
ATOM 857   O O    . SER B 1 12 ? 2.777   -10.213 -2.265  1.00 0.00 ? 12 SER B O    1  
ATOM 858   C CB   . SER B 1 12 ? 0.699   -12.269 -3.730  1.00 0.00 ? 12 SER B CB   1  
ATOM 859   O OG   . SER B 1 12 ? -0.038  -11.115 -3.364  1.00 0.00 ? 12 SER B OG   1  
ATOM 860   H H    . SER B 1 12 ? 2.470   -14.031 -4.196  1.00 0.00 ? 12 SER B H    1  
ATOM 861   H HA   . SER B 1 12 ? 2.361   -11.210 -4.558  1.00 0.00 ? 12 SER B HA   1  
ATOM 862   H HB2  . SER B 1 12 ? 0.358   -12.608 -4.697  1.00 0.00 ? 12 SER B HB2  1  
ATOM 863   H HB3  . SER B 1 12 ? 0.522   -13.043 -2.997  1.00 0.00 ? 12 SER B HB3  1  
ATOM 864   H HG   . SER B 1 12 ? -0.161  -10.552 -4.133  1.00 0.00 ? 12 SER B HG   1  
ATOM 865   N N    . ALA B 1 13 ? 2.985   -12.331 -1.536  1.00 0.00 ? 13 ALA B N    1  
ATOM 866   C CA   . ALA B 1 13 ? 3.453   -11.946 -0.210  1.00 0.00 ? 13 ALA B CA   1  
ATOM 867   C C    . ALA B 1 13 ? 4.821   -11.278 -0.276  1.00 0.00 ? 13 ALA B C    1  
ATOM 868   O O    . ALA B 1 13 ? 4.991   -10.147 0.176   1.00 0.00 ? 13 ALA B O    1  
ATOM 869   C CB   . ALA B 1 13 ? 3.502   -13.161 0.705   1.00 0.00 ? 13 ALA B CB   1  
ATOM 870   H H    . ALA B 1 13 ? 2.887   -13.290 -1.744  1.00 0.00 ? 13 ALA B H    1  
ATOM 871   H HA   . ALA B 1 13 ? 2.743   -11.244 0.211   1.00 0.00 ? 13 ALA B HA   1  
ATOM 872   H HB1  . ALA B 1 13 ? 4.220   -13.874 0.325   1.00 0.00 ? 13 ALA B HB1  1  
ATOM 873   H HB2  . ALA B 1 13 ? 2.526   -13.621 0.740   1.00 0.00 ? 13 ALA B HB2  1  
ATOM 874   H HB3  . ALA B 1 13 ? 3.789   -12.855 1.702   1.00 0.00 ? 13 ALA B HB3  1  
ATOM 875   N N    . ILE B 1 14 ? 5.796   -11.985 -0.843  1.00 0.00 ? 14 ILE B N    1  
ATOM 876   C CA   . ILE B 1 14 ? 7.150   -11.460 -0.962  1.00 0.00 ? 14 ILE B CA   1  
ATOM 877   C C    . ILE B 1 14 ? 7.167   -10.135 -1.720  1.00 0.00 ? 14 ILE B C    1  
ATOM 878   O O    . ILE B 1 14 ? 7.904   -9.217  -1.362  1.00 0.00 ? 14 ILE B O    1  
ATOM 879   C CB   . ILE B 1 14 ? 8.086   -12.466 -1.668  1.00 0.00 ? 14 ILE B CB   1  
ATOM 880   C CG1  . ILE B 1 14 ? 9.518   -11.930 -1.709  1.00 0.00 ? 14 ILE B CG1  1  
ATOM 881   C CG2  . ILE B 1 14 ? 7.588   -12.765 -3.077  1.00 0.00 ? 14 ILE B CG2  1  
ATOM 882   C CD1  . ILE B 1 14 ? 10.136  -11.739 -0.339  1.00 0.00 ? 14 ILE B CD1  1  
ATOM 883   H H    . ILE B 1 14 ? 5.597   -12.889 -1.182  1.00 0.00 ? 14 ILE B H    1  
ATOM 884   H HA   . ILE B 1 14 ? 7.519   -11.292 0.040   1.00 0.00 ? 14 ILE B HA   1  
ATOM 885   H HB   . ILE B 1 14 ? 8.070   -13.390 -1.108  1.00 0.00 ? 14 ILE B HB   1  
ATOM 886   H HG12 . ILE B 1 14 ? 10.141  -12.637 -2.240  1.00 0.00 ? 14 ILE B HG12 1  
ATOM 887   H HG13 . ILE B 1 14 ? 9.550   -10.984 -2.227  1.00 0.00 ? 14 ILE B HG13 1  
ATOM 888   H HG21 . ILE B 1 14 ? 8.138   -13.607 -3.471  1.00 0.00 ? 14 ILE B HG21 1  
ATOM 889   H HG22 . ILE B 1 14 ? 7.747   -11.912 -3.720  1.00 0.00 ? 14 ILE B HG22 1  
ATOM 890   H HG23 . ILE B 1 14 ? 6.546   -13.006 -3.061  1.00 0.00 ? 14 ILE B HG23 1  
ATOM 891   H HD11 . ILE B 1 14 ? 10.009  -12.638 0.248   1.00 0.00 ? 14 ILE B HD11 1  
ATOM 892   H HD12 . ILE B 1 14 ? 9.657   -10.911 0.161   1.00 0.00 ? 14 ILE B HD12 1  
ATOM 893   H HD13 . ILE B 1 14 ? 11.190  -11.529 -0.449  1.00 0.00 ? 14 ILE B HD13 1  
ATOM 894   N N    . LEU B 1 15 ? 6.348   -10.042 -2.763  1.00 0.00 ? 15 LEU B N    1  
ATOM 895   C CA   . LEU B 1 15 ? 6.272   -8.829  -3.567  1.00 0.00 ? 15 LEU B CA   1  
ATOM 896   C C    . LEU B 1 15 ? 5.642   -7.688  -2.776  1.00 0.00 ? 15 LEU B C    1  
ATOM 897   O O    . LEU B 1 15 ? 6.007   -6.524  -2.948  1.00 0.00 ? 15 LEU B O    1  
ATOM 898   C CB   . LEU B 1 15 ? 5.464   -9.085  -4.843  1.00 0.00 ? 15 LEU B CB   1  
ATOM 899   C CG   . LEU B 1 15 ? 5.313   -7.878  -5.771  1.00 0.00 ? 15 LEU B CG   1  
ATOM 900   C CD1  . LEU B 1 15 ? 6.658   -7.481  -6.359  1.00 0.00 ? 15 LEU B CD1  1  
ATOM 901   C CD2  . LEU B 1 15 ? 4.313   -8.180  -6.877  1.00 0.00 ? 15 LEU B CD2  1  
ATOM 902   H H    . LEU B 1 15 ? 5.771   -10.804 -3.003  1.00 0.00 ? 15 LEU B H    1  
ATOM 903   H HA   . LEU B 1 15 ? 7.278   -8.544  -3.845  1.00 0.00 ? 15 LEU B HA   1  
ATOM 904   H HB2  . LEU B 1 15 ? 5.942   -9.887  -5.391  1.00 0.00 ? 15 LEU B HB2  1  
ATOM 905   H HB3  . LEU B 1 15 ? 4.476   -9.418  -4.548  1.00 0.00 ? 15 LEU B HB3  1  
ATOM 906   H HG   . LEU B 1 15 ? 4.936   -7.035  -5.213  1.00 0.00 ? 15 LEU B HG   1  
ATOM 907   H HD11 . LEU B 1 15 ? 7.339   -7.217  -5.563  1.00 0.00 ? 15 LEU B HD11 1  
ATOM 908   H HD12 . LEU B 1 15 ? 6.531   -6.629  -7.013  1.00 0.00 ? 15 LEU B HD12 1  
ATOM 909   H HD13 . LEU B 1 15 ? 7.069   -8.307  -6.923  1.00 0.00 ? 15 LEU B HD13 1  
ATOM 910   H HD21 . LEU B 1 15 ? 4.667   -9.011  -7.473  1.00 0.00 ? 15 LEU B HD21 1  
ATOM 911   H HD22 . LEU B 1 15 ? 4.196   -7.310  -7.508  1.00 0.00 ? 15 LEU B HD22 1  
ATOM 912   H HD23 . LEU B 1 15 ? 3.356   -8.433  -6.441  1.00 0.00 ? 15 LEU B HD23 1  
ATOM 913   N N    . ALA B 1 16 ? 4.692   -8.027  -1.912  1.00 0.00 ? 16 ALA B N    1  
ATOM 914   C CA   . ALA B 1 16 ? 4.008   -7.034  -1.095  1.00 0.00 ? 16 ALA B CA   1  
ATOM 915   C C    . ALA B 1 16 ? 4.958   -6.393  -0.088  1.00 0.00 ? 16 ALA B C    1  
ATOM 916   O O    . ALA B 1 16 ? 4.863   -5.199  0.194   1.00 0.00 ? 16 ALA B O    1  
ATOM 917   C CB   . ALA B 1 16 ? 2.821   -7.665  -0.387  1.00 0.00 ? 16 ALA B CB   1  
ATOM 918   H H    . ALA B 1 16 ? 4.434   -8.974  -1.818  1.00 0.00 ? 16 ALA B H    1  
ATOM 919   H HA   . ALA B 1 16 ? 3.622   -6.268  -1.751  1.00 0.00 ? 16 ALA B HA   1  
ATOM 920   H HB1  . ALA B 1 16 ? 2.154   -8.094  -1.120  1.00 0.00 ? 16 ALA B HB1  1  
ATOM 921   H HB2  . ALA B 1 16 ? 2.292   -6.912  0.180   1.00 0.00 ? 16 ALA B HB2  1  
ATOM 922   H HB3  . ALA B 1 16 ? 3.167   -8.442  0.280   1.00 0.00 ? 16 ALA B HB3  1  
ATOM 923   N N    . LEU B 1 17 ? 5.870   -7.193  0.457   1.00 0.00 ? 17 LEU B N    1  
ATOM 924   C CA   . LEU B 1 17 ? 6.841   -6.697  1.428   1.00 0.00 ? 17 LEU B CA   1  
ATOM 925   C C    . LEU B 1 17 ? 7.862   -5.785  0.753   1.00 0.00 ? 17 LEU B C    1  
ATOM 926   O O    . LEU B 1 17 ? 8.341   -4.824  1.354   1.00 0.00 ? 17 LEU B O    1  
ATOM 927   C CB   . LEU B 1 17 ? 7.558   -7.862  2.117   1.00 0.00 ? 17 LEU B CB   1  
ATOM 928   C CG   . LEU B 1 17 ? 6.861   -8.425  3.362   1.00 0.00 ? 17 LEU B CG   1  
ATOM 929   C CD1  . LEU B 1 17 ? 6.764   -7.364  4.449   1.00 0.00 ? 17 LEU B CD1  1  
ATOM 930   C CD2  . LEU B 1 17 ? 5.480   -8.958  3.012   1.00 0.00 ? 17 LEU B CD2  1  
ATOM 931   H H    . LEU B 1 17 ? 5.899   -8.145  0.201   1.00 0.00 ? 17 LEU B H    1  
ATOM 932   H HA   . LEU B 1 17 ? 6.308   -6.111  2.160   1.00 0.00 ? 17 LEU B HA   1  
ATOM 933   H HB2  . LEU B 1 17 ? 7.673   -8.666  1.402   1.00 0.00 ? 17 LEU B HB2  1  
ATOM 934   H HB3  . LEU B 1 17 ? 8.550   -7.540  2.416   1.00 0.00 ? 17 LEU B HB3  1  
ATOM 935   H HG   . LEU B 1 17 ? 7.447   -9.245  3.751   1.00 0.00 ? 17 LEU B HG   1  
ATOM 936   H HD11 . LEU B 1 17 ? 7.743   -6.946  4.640   1.00 0.00 ? 17 LEU B HD11 1  
ATOM 937   H HD12 . LEU B 1 17 ? 6.391   -7.817  5.356   1.00 0.00 ? 17 LEU B HD12 1  
ATOM 938   H HD13 . LEU B 1 17 ? 6.091   -6.577  4.144   1.00 0.00 ? 17 LEU B HD13 1  
ATOM 939   H HD21 . LEU B 1 17 ? 5.581   -9.764  2.310   1.00 0.00 ? 17 LEU B HD21 1  
ATOM 940   H HD22 . LEU B 1 17 ? 4.872   -8.175  2.586   1.00 0.00 ? 17 LEU B HD22 1  
ATOM 941   H HD23 . LEU B 1 17 ? 5.000   -9.332  3.907   1.00 0.00 ? 17 LEU B HD23 1  
ATOM 942   N N    . VAL B 1 18 ? 8.189   -6.096  -0.498  1.00 0.00 ? 18 VAL B N    1  
ATOM 943   C CA   . VAL B 1 18 ? 9.149   -5.305  -1.256  1.00 0.00 ? 18 VAL B CA   1  
ATOM 944   C C    . VAL B 1 18 ? 8.582   -3.932  -1.598  1.00 0.00 ? 18 VAL B C    1  
ATOM 945   O O    . VAL B 1 18 ? 9.257   -2.915  -1.441  1.00 0.00 ? 18 VAL B O    1  
ATOM 946   C CB   . VAL B 1 18 ? 9.566   -6.017  -2.558  1.00 0.00 ? 18 VAL B CB   1  
ATOM 947   C CG1  . VAL B 1 18 ? 10.464  -5.124  -3.402  1.00 0.00 ? 18 VAL B CG1  1  
ATOM 948   C CG2  . VAL B 1 18 ? 10.265  -7.333  -2.246  1.00 0.00 ? 18 VAL B CG2  1  
ATOM 949   H H    . VAL B 1 18 ? 7.778   -6.880  -0.931  1.00 0.00 ? 18 VAL B H    1  
ATOM 950   H HA   . VAL B 1 18 ? 10.036  -5.168  -0.647  1.00 0.00 ? 18 VAL B HA   1  
ATOM 951   H HB   . VAL B 1 18 ? 8.675   -6.236  -3.128  1.00 0.00 ? 18 VAL B HB   1  
ATOM 952   H HG11 . VAL B 1 18 ? 11.247  -4.700  -2.787  1.00 0.00 ? 18 VAL B HG11 1  
ATOM 953   H HG12 . VAL B 1 18 ? 9.881   -4.329  -3.842  1.00 0.00 ? 18 VAL B HG12 1  
ATOM 954   H HG13 . VAL B 1 18 ? 10.914  -5.704  -4.198  1.00 0.00 ? 18 VAL B HG13 1  
ATOM 955   H HG21 . VAL B 1 18 ? 9.709   -7.886  -1.512  1.00 0.00 ? 18 VAL B HG21 1  
ATOM 956   H HG22 . VAL B 1 18 ? 11.257  -7.139  -1.860  1.00 0.00 ? 18 VAL B HG22 1  
ATOM 957   H HG23 . VAL B 1 18 ? 10.343  -7.918  -3.150  1.00 0.00 ? 18 VAL B HG23 1  
ATOM 958   N N    . VAL B 1 19 ? 7.336   -3.909  -2.061  1.00 0.00 ? 19 VAL B N    1  
ATOM 959   C CA   . VAL B 1 19 ? 6.683   -2.659  -2.428  1.00 0.00 ? 19 VAL B CA   1  
ATOM 960   C C    . VAL B 1 19 ? 6.371   -1.811  -1.200  1.00 0.00 ? 19 VAL B C    1  
ATOM 961   O O    . VAL B 1 19 ? 6.403   -0.585  -1.266  1.00 0.00 ? 19 VAL B O    1  
ATOM 962   C CB   . VAL B 1 19 ? 5.382   -2.904  -3.217  1.00 0.00 ? 19 VAL B CB   1  
ATOM 963   C CG1  . VAL B 1 19 ? 5.680   -3.619  -4.526  1.00 0.00 ? 19 VAL B CG1  1  
ATOM 964   C CG2  . VAL B 1 19 ? 4.388   -3.695  -2.382  1.00 0.00 ? 19 VAL B CG2  1  
ATOM 965   H H    . VAL B 1 19 ? 6.850   -4.757  -2.166  1.00 0.00 ? 19 VAL B H    1  
ATOM 966   H HA   . VAL B 1 19 ? 7.359   -2.098  -3.064  1.00 0.00 ? 19 VAL B HA   1  
ATOM 967   H HB   . VAL B 1 19 ? 4.936   -1.947  -3.458  1.00 0.00 ? 19 VAL B HB   1  
ATOM 968   H HG11 . VAL B 1 19 ? 6.166   -4.560  -4.327  1.00 0.00 ? 19 VAL B HG11 1  
ATOM 969   H HG12 . VAL B 1 19 ? 6.329   -3.003  -5.132  1.00 0.00 ? 19 VAL B HG12 1  
ATOM 970   H HG13 . VAL B 1 19 ? 4.758   -3.797  -5.063  1.00 0.00 ? 19 VAL B HG13 1  
ATOM 971   H HG21 . VAL B 1 19 ? 3.503   -3.896  -2.971  1.00 0.00 ? 19 VAL B HG21 1  
ATOM 972   H HG22 . VAL B 1 19 ? 4.102   -3.134  -1.508  1.00 0.00 ? 19 VAL B HG22 1  
ATOM 973   H HG23 . VAL B 1 19 ? 4.828   -4.617  -2.090  1.00 0.00 ? 19 VAL B HG23 1  
ATOM 974   N N    . LEU B 1 20 ? 6.073   -2.467  -0.081  1.00 0.00 ? 20 LEU B N    1  
ATOM 975   C CA   . LEU B 1 20 ? 5.755   -1.754  1.153   1.00 0.00 ? 20 LEU B CA   1  
ATOM 976   C C    . LEU B 1 20 ? 6.903   -0.833  1.551   1.00 0.00 ? 20 LEU B C    1  
ATOM 977   O O    . LEU B 1 20 ? 6.682   0.314   1.940   1.00 0.00 ? 20 LEU B O    1  
ATOM 978   C CB   . LEU B 1 20 ? 5.452   -2.740  2.286   1.00 0.00 ? 20 LEU B CB   1  
ATOM 979   C CG   . LEU B 1 20 ? 5.130   -2.097  3.640   1.00 0.00 ? 20 LEU B CG   1  
ATOM 980   C CD1  . LEU B 1 20 ? 3.845   -1.281  3.559   1.00 0.00 ? 20 LEU B CD1  1  
ATOM 981   C CD2  . LEU B 1 20 ? 5.020   -3.160  4.722   1.00 0.00 ? 20 LEU B CD2  1  
ATOM 982   H H    . LEU B 1 20 ? 6.058   -3.452  -0.079  1.00 0.00 ? 20 LEU B H    1  
ATOM 983   H HA   . LEU B 1 20 ? 4.876   -1.152  0.970   1.00 0.00 ? 20 LEU B HA   1  
ATOM 984   H HB2  . LEU B 1 20 ? 4.613   -3.354  1.985   1.00 0.00 ? 20 LEU B HB2  1  
ATOM 985   H HB3  . LEU B 1 20 ? 6.316   -3.381  2.408   1.00 0.00 ? 20 LEU B HB3  1  
ATOM 986   H HG   . LEU B 1 20 ? 5.929   -1.427  3.921   1.00 0.00 ? 20 LEU B HG   1  
ATOM 987   H HD11 . LEU B 1 20 ? 3.962   -0.490  2.833   1.00 0.00 ? 20 LEU B HD11 1  
ATOM 988   H HD12 . LEU B 1 20 ? 3.630   -0.845  4.525   1.00 0.00 ? 20 LEU B HD12 1  
ATOM 989   H HD13 . LEU B 1 20 ? 3.025   -1.921  3.265   1.00 0.00 ? 20 LEU B HD13 1  
ATOM 990   H HD21 . LEU B 1 20 ? 4.215   -3.842  4.484   1.00 0.00 ? 20 LEU B HD21 1  
ATOM 991   H HD22 . LEU B 1 20 ? 4.821   -2.689  5.675   1.00 0.00 ? 20 LEU B HD22 1  
ATOM 992   H HD23 . LEU B 1 20 ? 5.949   -3.710  4.786   1.00 0.00 ? 20 LEU B HD23 1  
ATOM 993   N N    . THR B 1 21 ? 8.128   -1.339  1.451   1.00 0.00 ? 21 THR B N    1  
ATOM 994   C CA   . THR B 1 21 ? 9.303   -0.548  1.787   1.00 0.00 ? 21 THR B CA   1  
ATOM 995   C C    . THR B 1 21 ? 9.472   0.596   0.795   1.00 0.00 ? 21 THR B C    1  
ATOM 996   O O    . THR B 1 21 ? 9.852   1.704   1.169   1.00 0.00 ? 21 THR B O    1  
ATOM 997   C CB   . THR B 1 21 ? 10.584  -1.407  1.795   1.00 0.00 ? 21 THR B CB   1  
ATOM 998   O OG1  . THR B 1 21 ? 10.440  -2.493  2.717   1.00 0.00 ? 21 THR B OG1  1  
ATOM 999   C CG2  . THR B 1 21 ? 11.796  -0.571  2.177   1.00 0.00 ? 21 THR B CG2  1  
ATOM 1000  H H    . THR B 1 21 ? 8.250   -2.265  1.134   1.00 0.00 ? 21 THR B H    1  
ATOM 1001  H HA   . THR B 1 21 ? 9.164   -0.135  2.780   1.00 0.00 ? 21 THR B HA   1  
ATOM 1002  H HB   . THR B 1 21 ? 10.741  -1.810  0.803   1.00 0.00 ? 21 THR B HB   1  
ATOM 1003  H HG1  . THR B 1 21 ? 10.276  -2.168  3.613   1.00 0.00 ? 21 THR B HG1  1  
ATOM 1004  H HG21 . THR B 1 21 ? 12.622  -1.228  2.404   1.00 0.00 ? 21 THR B HG21 1  
ATOM 1005  H HG22 . THR B 1 21 ? 11.573  0.032   3.048   1.00 0.00 ? 21 THR B HG22 1  
ATOM 1006  H HG23 . THR B 1 21 ? 12.070  0.072   1.354   1.00 0.00 ? 21 THR B HG23 1  
ATOM 1007  N N    . ILE B 1 22 ? 9.180   0.316   -0.472  1.00 0.00 ? 22 ILE B N    1  
ATOM 1008  C CA   . ILE B 1 22 ? 9.293   1.321   -1.523  1.00 0.00 ? 22 ILE B CA   1  
ATOM 1009  C C    . ILE B 1 22 ? 8.318   2.469   -1.281  1.00 0.00 ? 22 ILE B C    1  
ATOM 1010  O O    . ILE B 1 22 ? 8.668   3.636   -1.458  1.00 0.00 ? 22 ILE B O    1  
ATOM 1011  C CB   . ILE B 1 22 ? 9.032   0.715   -2.916  1.00 0.00 ? 22 ILE B CB   1  
ATOM 1012  C CG1  . ILE B 1 22 ? 10.079  -0.357  -3.230  1.00 0.00 ? 22 ILE B CG1  1  
ATOM 1013  C CG2  . ILE B 1 22 ? 9.045   1.805   -3.982  1.00 0.00 ? 22 ILE B CG2  1  
ATOM 1014  C CD1  . ILE B 1 22 ? 9.819   -1.101  -4.523  1.00 0.00 ? 22 ILE B CD1  1  
ATOM 1015  H H    . ILE B 1 22 ? 8.878   -0.590  -0.714  1.00 0.00 ? 22 ILE B H    1  
ATOM 1016  H HA   . ILE B 1 22 ? 10.301  1.717   -1.508  1.00 0.00 ? 22 ILE B HA   1  
ATOM 1017  H HB   . ILE B 1 22 ? 8.052   0.262   -2.911  1.00 0.00 ? 22 ILE B HB   1  
ATOM 1018  H HG12 . ILE B 1 22 ? 11.051  0.109   -3.311  1.00 0.00 ? 22 ILE B HG12 1  
ATOM 1019  H HG13 . ILE B 1 22 ? 10.108  -1.078  -2.437  1.00 0.00 ? 22 ILE B HG13 1  
ATOM 1020  H HG21 . ILE B 1 22 ? 8.228   2.490   -3.822  1.00 0.00 ? 22 ILE B HG21 1  
ATOM 1021  H HG22 . ILE B 1 22 ? 8.934   1.367   -4.963  1.00 0.00 ? 22 ILE B HG22 1  
ATOM 1022  H HG23 . ILE B 1 22 ? 9.980   2.347   -3.939  1.00 0.00 ? 22 ILE B HG23 1  
ATOM 1023  H HD11 . ILE B 1 22 ? 10.055  -0.462  -5.360  1.00 0.00 ? 22 ILE B HD11 1  
ATOM 1024  H HD12 . ILE B 1 22 ? 8.781   -1.396  -4.577  1.00 0.00 ? 22 ILE B HD12 1  
ATOM 1025  H HD13 . ILE B 1 22 ? 10.443  -1.982  -4.560  1.00 0.00 ? 22 ILE B HD13 1  
ATOM 1026  N N    . ILE B 1 23 ? 7.096   2.131   -0.877  1.00 0.00 ? 23 ILE B N    1  
ATOM 1027  C CA   . ILE B 1 23 ? 6.081   3.140   -0.606  1.00 0.00 ? 23 ILE B CA   1  
ATOM 1028  C C    . ILE B 1 23 ? 6.552   4.084   0.496   1.00 0.00 ? 23 ILE B C    1  
ATOM 1029  O O    . ILE B 1 23 ? 6.319   5.292   0.438   1.00 0.00 ? 23 ILE B O    1  
ATOM 1030  C CB   . ILE B 1 23 ? 4.738   2.506   -0.186  1.00 0.00 ? 23 ILE B CB   1  
ATOM 1031  C CG1  . ILE B 1 23 ? 4.184   1.620   -1.307  1.00 0.00 ? 23 ILE B CG1  1  
ATOM 1032  C CG2  . ILE B 1 23 ? 3.732   3.590   0.180   1.00 0.00 ? 23 ILE B CG2  1  
ATOM 1033  C CD1  . ILE B 1 23 ? 3.869   2.369   -2.584  1.00 0.00 ? 23 ILE B CD1  1  
ATOM 1034  H H    . ILE B 1 23 ? 6.870   1.180   -0.753  1.00 0.00 ? 23 ILE B H    1  
ATOM 1035  H HA   . ILE B 1 23 ? 5.928   3.721   -1.505  1.00 0.00 ? 23 ILE B HA   1  
ATOM 1036  H HB   . ILE B 1 23 ? 4.908   1.897   0.691   1.00 0.00 ? 23 ILE B HB   1  
ATOM 1037  H HG12 . ILE B 1 23 ? 4.893   0.862   -1.550  1.00 0.00 ? 23 ILE B HG12 1  
ATOM 1038  H HG13 . ILE B 1 23 ? 3.271   1.150   -0.969  1.00 0.00 ? 23 ILE B HG13 1  
ATOM 1039  H HG21 . ILE B 1 23 ? 2.744   3.156   0.271   1.00 0.00 ? 23 ILE B HG21 1  
ATOM 1040  H HG22 . ILE B 1 23 ? 3.714   4.353   -0.586  1.00 0.00 ? 23 ILE B HG22 1  
ATOM 1041  H HG23 . ILE B 1 23 ? 4.003   4.037   1.125   1.00 0.00 ? 23 ILE B HG23 1  
ATOM 1042  H HD11 . ILE B 1 23 ? 3.179   3.173   -2.383  1.00 0.00 ? 23 ILE B HD11 1  
ATOM 1043  H HD12 . ILE B 1 23 ? 3.421   1.687   -3.292  1.00 0.00 ? 23 ILE B HD12 1  
ATOM 1044  H HD13 . ILE B 1 23 ? 4.777   2.769   -3.006  1.00 0.00 ? 23 ILE B HD13 1  
ATOM 1045  N N    . SER B 1 24 ? 7.227   3.519   1.493   1.00 0.00 ? 24 SER B N    1  
ATOM 1046  C CA   . SER B 1 24 ? 7.736   4.294   2.620   1.00 0.00 ? 24 SER B CA   1  
ATOM 1047  C C    . SER B 1 24 ? 8.930   5.150   2.209   1.00 0.00 ? 24 SER B C    1  
ATOM 1048  O O    . SER B 1 24 ? 9.104   6.264   2.702   1.00 0.00 ? 24 SER B O    1  
ATOM 1049  C CB   . SER B 1 24 ? 8.137   3.357   3.761   1.00 0.00 ? 24 SER B CB   1  
ATOM 1050  O OG   . SER B 1 24 ? 8.744   4.072   4.822   1.00 0.00 ? 24 SER B OG   1  
ATOM 1051  H H    . SER B 1 24 ? 7.388   2.546   1.481   1.00 0.00 ? 24 SER B H    1  
ATOM 1052  H HA   . SER B 1 24 ? 6.946   4.946   2.971   1.00 0.00 ? 24 SER B HA   1  
ATOM 1053  H HB2  . SER B 1 24 ? 7.258   2.857   4.139   1.00 0.00 ? 24 SER B HB2  1  
ATOM 1054  H HB3  . SER B 1 24 ? 8.837   2.623   3.391   1.00 0.00 ? 24 SER B HB3  1  
ATOM 1055  H HG   . SER B 1 24 ? 9.093   3.453   5.468   1.00 0.00 ? 24 SER B HG   1  
ATOM 1056  N N    . LEU B 1 25 ? 9.748   4.622   1.307   1.00 0.00 ? 25 LEU B N    1  
ATOM 1057  C CA   . LEU B 1 25 ? 10.928  5.338   0.835   1.00 0.00 ? 25 LEU B CA   1  
ATOM 1058  C C    . LEU B 1 25 ? 10.536  6.590   0.056   1.00 0.00 ? 25 LEU B C    1  
ATOM 1059  O O    . LEU B 1 25 ? 11.237  7.601   0.099   1.00 0.00 ? 25 LEU B O    1  
ATOM 1060  C CB   . LEU B 1 25 ? 11.791  4.424   -0.038  1.00 0.00 ? 25 LEU B CB   1  
ATOM 1061  C CG   . LEU B 1 25 ? 12.492  3.285   0.707   1.00 0.00 ? 25 LEU B CG   1  
ATOM 1062  C CD1  . LEU B 1 25 ? 13.155  2.334   -0.276  1.00 0.00 ? 25 LEU B CD1  1  
ATOM 1063  C CD2  . LEU B 1 25 ? 13.517  3.837   1.688   1.00 0.00 ? 25 LEU B CD2  1  
ATOM 1064  H H    . LEU B 1 25 ? 9.564   3.723   0.947   1.00 0.00 ? 25 LEU B H    1  
ATOM 1065  H HA   . LEU B 1 25 ? 11.499  5.648   1.697   1.00 0.00 ? 25 LEU B HA   1  
ATOM 1066  H HB2  . LEU B 1 25 ? 11.149  3.995   -0.798  1.00 0.00 ? 25 LEU B HB2  1  
ATOM 1067  H HB3  . LEU B 1 25 ? 12.549  5.022   -0.532  1.00 0.00 ? 25 LEU B HB3  1  
ATOM 1068  H HG   . LEU B 1 25 ? 11.770  2.730   1.271   1.00 0.00 ? 25 LEU B HG   1  
ATOM 1069  H HD11 . LEU B 1 25 ? 12.412  1.932   -0.949  1.00 0.00 ? 25 LEU B HD11 1  
ATOM 1070  H HD12 . LEU B 1 25 ? 13.621  1.521   0.264   1.00 0.00 ? 25 LEU B HD12 1  
ATOM 1071  H HD13 . LEU B 1 25 ? 13.906  2.863   -0.847  1.00 0.00 ? 25 LEU B HD13 1  
ATOM 1072  H HD21 . LEU B 1 25 ? 13.020  4.435   2.435   1.00 0.00 ? 25 LEU B HD21 1  
ATOM 1073  H HD22 . LEU B 1 25 ? 14.238  4.446   1.160   1.00 0.00 ? 25 LEU B HD22 1  
ATOM 1074  H HD23 . LEU B 1 25 ? 14.031  3.019   2.176   1.00 0.00 ? 25 LEU B HD23 1  
ATOM 1075  N N    . ILE B 1 26 ? 9.415   6.518   -0.657  1.00 0.00 ? 26 ILE B N    1  
ATOM 1076  C CA   . ILE B 1 26 ? 8.939   7.652   -1.440  1.00 0.00 ? 26 ILE B CA   1  
ATOM 1077  C C    . ILE B 1 26 ? 8.529   8.807   -0.531  1.00 0.00 ? 26 ILE B C    1  
ATOM 1078  O O    . ILE B 1 26 ? 8.809   9.968   -0.828  1.00 0.00 ? 26 ILE B O    1  
ATOM 1079  C CB   . ILE B 1 26 ? 7.748   7.264   -2.342  1.00 0.00 ? 26 ILE B CB   1  
ATOM 1080  C CG1  . ILE B 1 26 ? 8.167   6.179   -3.336  1.00 0.00 ? 26 ILE B CG1  1  
ATOM 1081  C CG2  . ILE B 1 26 ? 7.217   8.489   -3.080  1.00 0.00 ? 26 ILE B CG2  1  
ATOM 1082  C CD1  . ILE B 1 26 ? 7.020   5.634   -4.160  1.00 0.00 ? 26 ILE B CD1  1  
ATOM 1083  H H    . ILE B 1 26 ? 8.890   5.685   -0.662  1.00 0.00 ? 26 ILE B H    1  
ATOM 1084  H HA   . ILE B 1 26 ? 9.750   7.988   -2.077  1.00 0.00 ? 26 ILE B HA   1  
ATOM 1085  H HB   . ILE B 1 26 ? 6.957   6.882   -1.712  1.00 0.00 ? 26 ILE B HB   1  
ATOM 1086  H HG12 . ILE B 1 26 ? 8.896   6.587   -4.022  1.00 0.00 ? 26 ILE B HG12 1  
ATOM 1087  H HG13 . ILE B 1 26 ? 8.610   5.358   -2.812  1.00 0.00 ? 26 ILE B HG13 1  
ATOM 1088  H HG21 . ILE B 1 26 ? 6.828   9.207   -2.376  1.00 0.00 ? 26 ILE B HG21 1  
ATOM 1089  H HG22 . ILE B 1 26 ? 6.420   8.202   -3.749  1.00 0.00 ? 26 ILE B HG22 1  
ATOM 1090  H HG23 . ILE B 1 26 ? 8.014   8.944   -3.651  1.00 0.00 ? 26 ILE B HG23 1  
ATOM 1091  H HD11 . ILE B 1 26 ? 6.706   6.376   -4.878  1.00 0.00 ? 26 ILE B HD11 1  
ATOM 1092  H HD12 . ILE B 1 26 ? 6.190   5.383   -3.514  1.00 0.00 ? 26 ILE B HD12 1  
ATOM 1093  H HD13 . ILE B 1 26 ? 7.346   4.747   -4.683  1.00 0.00 ? 26 ILE B HD13 1  
ATOM 1094  N N    . ILE B 1 27 ? 7.868   8.482   0.576   1.00 0.00 ? 27 ILE B N    1  
ATOM 1095  C CA   . ILE B 1 27 ? 7.425   9.497   1.527   1.00 0.00 ? 27 ILE B CA   1  
ATOM 1096  C C    . ILE B 1 27 ? 8.613   10.142  2.225   1.00 0.00 ? 27 ILE B C    1  
ATOM 1097  O O    . ILE B 1 27 ? 8.640   11.353  2.442   1.00 0.00 ? 27 ILE B O    1  
ATOM 1098  C CB   . ILE B 1 27 ? 6.500   8.899   2.605   1.00 0.00 ? 27 ILE B CB   1  
ATOM 1099  C CG1  . ILE B 1 27 ? 5.524   7.899   1.988   1.00 0.00 ? 27 ILE B CG1  1  
ATOM 1100  C CG2  . ILE B 1 27 ? 5.746   10.007  3.323   1.00 0.00 ? 27 ILE B CG2  1  
ATOM 1101  C CD1  . ILE B 1 27 ? 4.809   7.046   3.013   1.00 0.00 ? 27 ILE B CD1  1  
ATOM 1102  H H    . ILE B 1 27 ? 7.697   7.535   0.760   1.00 0.00 ? 27 ILE B H    1  
ATOM 1103  H HA   . ILE B 1 27 ? 6.879   10.256  0.981   1.00 0.00 ? 27 ILE B HA   1  
ATOM 1104  H HB   . ILE B 1 27 ? 7.111   8.383   3.339   1.00 0.00 ? 27 ILE B HB   1  
ATOM 1105  H HG12 . ILE B 1 27 ? 4.772   8.427   1.420   1.00 0.00 ? 27 ILE B HG12 1  
ATOM 1106  H HG13 . ILE B 1 27 ? 6.035   7.232   1.338   1.00 0.00 ? 27 ILE B HG13 1  
ATOM 1107  H HG21 . ILE B 1 27 ? 5.117   9.580   4.092   1.00 0.00 ? 27 ILE B HG21 1  
ATOM 1108  H HG22 . ILE B 1 27 ? 5.130   10.547  2.617   1.00 0.00 ? 27 ILE B HG22 1  
ATOM 1109  H HG23 . ILE B 1 27 ? 6.447   10.691  3.781   1.00 0.00 ? 27 ILE B HG23 1  
ATOM 1110  H HD11 . ILE B 1 27 ? 4.171   7.670   3.621   1.00 0.00 ? 27 ILE B HD11 1  
ATOM 1111  H HD12 . ILE B 1 27 ? 5.534   6.549   3.642   1.00 0.00 ? 27 ILE B HD12 1  
ATOM 1112  H HD13 . ILE B 1 27 ? 4.208   6.306   2.506   1.00 0.00 ? 27 ILE B HD13 1  
ATOM 1113  N N    . LEU B 1 28 ? 9.593   9.318   2.579   1.00 0.00 ? 28 LEU B N    1  
ATOM 1114  C CA   . LEU B 1 28 ? 10.791  9.788   3.262   1.00 0.00 ? 28 LEU B CA   1  
ATOM 1115  C C    . LEU B 1 28 ? 11.527  10.835  2.432   1.00 0.00 ? 28 LEU B C    1  
ATOM 1116  O O    . LEU B 1 28 ? 11.798  11.939  2.908   1.00 0.00 ? 28 LEU B O    1  
ATOM 1117  C CB   . LEU B 1 28 ? 11.719  8.609   3.565   1.00 0.00 ? 28 LEU B CB   1  
ATOM 1118  C CG   . LEU B 1 28 ? 12.984  8.954   4.354   1.00 0.00 ? 28 LEU B CG   1  
ATOM 1119  C CD1  . LEU B 1 28 ? 12.627  9.538   5.714   1.00 0.00 ? 28 LEU B CD1  1  
ATOM 1120  C CD2  . LEU B 1 28 ? 13.863  7.723   4.512   1.00 0.00 ? 28 LEU B CD2  1  
ATOM 1121  H H    . LEU B 1 28 ? 9.509   8.354   2.384   1.00 0.00 ? 28 LEU B H    1  
ATOM 1122  H HA   . LEU B 1 28 ? 10.481  10.239  4.192   1.00 0.00 ? 28 LEU B HA   1  
ATOM 1123  H HB2  . LEU B 1 28 ? 11.154  7.875   4.125   1.00 0.00 ? 28 LEU B HB2  1  
ATOM 1124  H HB3  . LEU B 1 28 ? 12.014  8.163   2.623   1.00 0.00 ? 28 LEU B HB3  1  
ATOM 1125  H HG   . LEU B 1 28 ? 13.551  9.697   3.813   1.00 0.00 ? 28 LEU B HG   1  
ATOM 1126  H HD11 . LEU B 1 28 ? 12.010  8.839   6.261   1.00 0.00 ? 28 LEU B HD11 1  
ATOM 1127  H HD12 . LEU B 1 28 ? 12.091  10.465  5.583   1.00 0.00 ? 28 LEU B HD12 1  
ATOM 1128  H HD13 . LEU B 1 28 ? 13.531  9.731   6.276   1.00 0.00 ? 28 LEU B HD13 1  
ATOM 1129  H HD21 . LEU B 1 28 ? 13.329  6.961   5.064   1.00 0.00 ? 28 LEU B HD21 1  
ATOM 1130  H HD22 . LEU B 1 28 ? 14.765  7.988   5.047   1.00 0.00 ? 28 LEU B HD22 1  
ATOM 1131  H HD23 . LEU B 1 28 ? 14.129  7.339   3.537   1.00 0.00 ? 28 LEU B HD23 1  
ATOM 1132  N N    . ILE B 1 29 ? 11.847  10.487  1.189   1.00 0.00 ? 29 ILE B N    1  
ATOM 1133  C CA   . ILE B 1 29 ? 12.559  11.396  0.299   1.00 0.00 ? 29 ILE B CA   1  
ATOM 1134  C C    . ILE B 1 29 ? 11.694  12.595  -0.083  1.00 0.00 ? 29 ILE B C    1  
ATOM 1135  O O    . ILE B 1 29 ? 12.193  13.713  -0.212  1.00 0.00 ? 29 ILE B O    1  
ATOM 1136  C CB   . ILE B 1 29 ? 13.025  10.676  -0.984  1.00 0.00 ? 29 ILE B CB   1  
ATOM 1137  C CG1  . ILE B 1 29 ? 13.866  9.447   -0.620  1.00 0.00 ? 29 ILE B CG1  1  
ATOM 1138  C CG2  . ILE B 1 29 ? 13.816  11.628  -1.870  1.00 0.00 ? 29 ILE B CG2  1  
ATOM 1139  C CD1  . ILE B 1 29 ? 14.292  8.626   -1.819  1.00 0.00 ? 29 ILE B CD1  1  
ATOM 1140  H H    . ILE B 1 29 ? 11.590  9.593   0.863   1.00 0.00 ? 29 ILE B H    1  
ATOM 1141  H HA   . ILE B 1 29 ? 13.439  11.756  0.821   1.00 0.00 ? 29 ILE B HA   1  
ATOM 1142  H HB   . ILE B 1 29 ? 12.151  10.353  -1.533  1.00 0.00 ? 29 ILE B HB   1  
ATOM 1143  H HG12 . ILE B 1 29 ? 14.763  9.768   -0.110  1.00 0.00 ? 29 ILE B HG12 1  
ATOM 1144  H HG13 . ILE B 1 29 ? 13.310  8.797   0.032   1.00 0.00 ? 29 ILE B HG13 1  
ATOM 1145  H HG21 . ILE B 1 29 ? 13.200  12.463  -2.163  1.00 0.00 ? 29 ILE B HG21 1  
ATOM 1146  H HG22 . ILE B 1 29 ? 14.143  11.116  -2.762  1.00 0.00 ? 29 ILE B HG22 1  
ATOM 1147  H HG23 . ILE B 1 29 ? 14.680  11.993  -1.331  1.00 0.00 ? 29 ILE B HG23 1  
ATOM 1148  H HD11 . ILE B 1 29 ? 15.034  9.169   -2.384  1.00 0.00 ? 29 ILE B HD11 1  
ATOM 1149  H HD12 . ILE B 1 29 ? 13.436  8.424   -2.448  1.00 0.00 ? 29 ILE B HD12 1  
ATOM 1150  H HD13 . ILE B 1 29 ? 14.715  7.692   -1.480  1.00 0.00 ? 29 ILE B HD13 1  
ATOM 1151  N N    . MET B 1 30 ? 10.396  12.359  -0.262  1.00 0.00 ? 30 MET B N    1  
ATOM 1152  C CA   . MET B 1 30 ? 9.468   13.424  -0.630  1.00 0.00 ? 30 MET B CA   1  
ATOM 1153  C C    . MET B 1 30 ? 9.449   14.521  0.430   1.00 0.00 ? 30 MET B C    1  
ATOM 1154  O O    . MET B 1 30 ? 9.485   15.708  0.108   1.00 0.00 ? 30 MET B O    1  
ATOM 1155  C CB   . MET B 1 30 ? 8.056   12.863  -0.823  1.00 0.00 ? 30 MET B CB   1  
ATOM 1156  C CG   . MET B 1 30 ? 7.051   13.900  -1.295  1.00 0.00 ? 30 MET B CG   1  
ATOM 1157  S SD   . MET B 1 30 ? 5.390   13.223  -1.478  1.00 0.00 ? 30 MET B SD   1  
ATOM 1158  C CE   . MET B 1 30 ? 5.020   12.776  0.216   1.00 0.00 ? 30 MET B CE   1  
ATOM 1159  H H    . MET B 1 30 ? 10.047  11.444  -0.149  1.00 0.00 ? 30 MET B H    1  
ATOM 1160  H HA   . MET B 1 30 ? 9.803   13.852  -1.566  1.00 0.00 ? 30 MET B HA   1  
ATOM 1161  H HB2  . MET B 1 30 ? 8.099   12.083  -1.567  1.00 0.00 ? 30 MET B HB2  1  
ATOM 1162  H HB3  . MET B 1 30 ? 7.715   12.443  0.112   1.00 0.00 ? 30 MET B HB3  1  
ATOM 1163  H HG2  . MET B 1 30 ? 7.008   14.707  -0.579  1.00 0.00 ? 30 MET B HG2  1  
ATOM 1164  H HG3  . MET B 1 30 ? 7.374   14.285  -2.251  1.00 0.00 ? 30 MET B HG3  1  
ATOM 1165  H HE1  . MET B 1 30 ? 5.393   13.540  0.882   1.00 0.00 ? 30 MET B HE1  1  
ATOM 1166  H HE2  . MET B 1 30 ? 5.490   11.834  0.450   1.00 0.00 ? 30 MET B HE2  1  
ATOM 1167  H HE3  . MET B 1 30 ? 3.951   12.684  0.338   1.00 0.00 ? 30 MET B HE3  1  
ATOM 1168  N N    . LEU B 1 31 ? 9.392   14.114  1.693   1.00 0.00 ? 31 LEU B N    1  
ATOM 1169  C CA   . LEU B 1 31 ? 9.372   15.060  2.802   1.00 0.00 ? 31 LEU B CA   1  
ATOM 1170  C C    . LEU B 1 31 ? 10.770  15.613  3.062   1.00 0.00 ? 31 LEU B C    1  
ATOM 1171  O O    . LEU B 1 31 ? 10.927  16.698  3.623   1.00 0.00 ? 31 LEU B O    1  
ATOM 1172  C CB   . LEU B 1 31 ? 8.832   14.385  4.065   1.00 0.00 ? 31 LEU B CB   1  
ATOM 1173  C CG   . LEU B 1 31 ? 8.697   15.298  5.288   1.00 0.00 ? 31 LEU B CG   1  
ATOM 1174  C CD1  . LEU B 1 31 ? 7.617   16.344  5.057   1.00 0.00 ? 31 LEU B CD1  1  
ATOM 1175  C CD2  . LEU B 1 31 ? 8.389   14.479  6.531   1.00 0.00 ? 31 LEU B CD2  1  
ATOM 1176  H H    . LEU B 1 31 ? 9.365   13.147  1.891   1.00 0.00 ? 31 LEU B H    1  
ATOM 1177  H HA   . LEU B 1 31 ? 8.717   15.881  2.539   1.00 0.00 ? 31 LEU B HA   1  
ATOM 1178  H HB2  . LEU B 1 31 ? 7.860   13.967  3.835   1.00 0.00 ? 31 LEU B HB2  1  
ATOM 1179  H HB3  . LEU B 1 31 ? 9.498   13.569  4.317   1.00 0.00 ? 31 LEU B HB3  1  
ATOM 1180  H HG   . LEU B 1 31 ? 9.627   15.815  5.462   1.00 0.00 ? 31 LEU B HG   1  
ATOM 1181  H HD11 . LEU B 1 31 ? 7.528   16.973  5.933   1.00 0.00 ? 31 LEU B HD11 1  
ATOM 1182  H HD12 . LEU B 1 31 ? 6.670   15.857  4.869   1.00 0.00 ? 31 LEU B HD12 1  
ATOM 1183  H HD13 . LEU B 1 31 ? 7.880   16.956  4.207   1.00 0.00 ? 31 LEU B HD13 1  
ATOM 1184  H HD21 . LEU B 1 31 ? 9.179   13.759  6.695   1.00 0.00 ? 31 LEU B HD21 1  
ATOM 1185  H HD22 . LEU B 1 31 ? 7.450   13.958  6.403   1.00 0.00 ? 31 LEU B HD22 1  
ATOM 1186  H HD23 . LEU B 1 31 ? 8.322   15.133  7.389   1.00 0.00 ? 31 LEU B HD23 1  
ATOM 1187  N N    . TRP B 1 32 ? 11.780  14.853  2.652   1.00 0.00 ? 32 TRP B N    1  
ATOM 1188  C CA   . TRP B 1 32 ? 13.170  15.257  2.833   1.00 0.00 ? 32 TRP B CA   1  
ATOM 1189  C C    . TRP B 1 32 ? 13.509  16.459  1.955   1.00 0.00 ? 32 TRP B C    1  
ATOM 1190  O O    . TRP B 1 32 ? 14.333  17.297  2.325   1.00 0.00 ? 32 TRP B O    1  
ATOM 1191  C CB   . TRP B 1 32 ? 14.100  14.085  2.508   1.00 0.00 ? 32 TRP B CB   1  
ATOM 1192  C CG   . TRP B 1 32 ? 15.553  14.398  2.696   1.00 0.00 ? 32 TRP B CG   1  
ATOM 1193  C CD1  . TRP B 1 32 ? 16.176  14.727  3.865   1.00 0.00 ? 32 TRP B CD1  1  
ATOM 1194  C CD2  . TRP B 1 32 ? 16.567  14.401  1.684   1.00 0.00 ? 32 TRP B CD2  1  
ATOM 1195  N NE1  . TRP B 1 32 ? 17.516  14.938  3.642   1.00 0.00 ? 32 TRP B NE1  1  
ATOM 1196  C CE2  . TRP B 1 32 ? 17.781  14.744  2.311   1.00 0.00 ? 32 TRP B CE2  1  
ATOM 1197  C CE3  . TRP B 1 32 ? 16.569  14.147  0.311   1.00 0.00 ? 32 TRP B CE3  1  
ATOM 1198  C CZ2  . TRP B 1 32 ? 18.980  14.839  1.611   1.00 0.00 ? 32 TRP B CZ2  1  
ATOM 1199  C CZ3  . TRP B 1 32 ? 17.760  14.242  -0.384  1.00 0.00 ? 32 TRP B CZ3  1  
ATOM 1200  C CH2  . TRP B 1 32 ? 18.951  14.585  0.267   1.00 0.00 ? 32 TRP B CH2  1  
ATOM 1201  H H    . TRP B 1 32 ? 11.598  13.993  2.220   1.00 0.00 ? 32 TRP B H    1  
ATOM 1202  H HA   . TRP B 1 32 ? 13.311  15.534  3.870   1.00 0.00 ? 32 TRP B HA   1  
ATOM 1203  H HB2  . TRP B 1 32 ? 13.858  13.257  3.157   1.00 0.00 ? 32 TRP B HB2  1  
ATOM 1204  H HB3  . TRP B 1 32 ? 13.948  13.785  1.482   1.00 0.00 ? 32 TRP B HB3  1  
ATOM 1205  H HD1  . TRP B 1 32 ? 15.676  14.808  4.819   1.00 0.00 ? 32 TRP B HD1  1  
ATOM 1206  H HE1  . TRP B 1 32 ? 18.174  15.186  4.324   1.00 0.00 ? 32 TRP B HE1  1  
ATOM 1207  H HE3  . TRP B 1 32 ? 15.662  13.877  -0.207  1.00 0.00 ? 32 TRP B HE3  1  
ATOM 1208  H HZ2  . TRP B 1 32 ? 19.907  15.102  2.098   1.00 0.00 ? 32 TRP B HZ2  1  
ATOM 1209  H HZ3  . TRP B 1 32 ? 17.779  14.050  -1.447  1.00 0.00 ? 32 TRP B HZ3  1  
ATOM 1210  H HH2  . TRP B 1 32 ? 19.858  14.648  -0.315  1.00 0.00 ? 32 TRP B HH2  1  
ATOM 1211  N N    . GLN B 1 33 ? 12.869  16.538  0.791   1.00 0.00 ? 33 GLN B N    1  
ATOM 1212  C CA   . GLN B 1 33 ? 13.102  17.640  -0.138  1.00 0.00 ? 33 GLN B CA   1  
ATOM 1213  C C    . GLN B 1 33 ? 11.942  18.633  -0.111  1.00 0.00 ? 33 GLN B C    1  
ATOM 1214  O O    . GLN B 1 33 ? 12.023  19.710  -0.701  1.00 0.00 ? 33 GLN B O    1  
ATOM 1215  C CB   . GLN B 1 33 ? 13.297  17.109  -1.561  1.00 0.00 ? 33 GLN B CB   1  
ATOM 1216  C CG   . GLN B 1 33 ? 14.490  16.177  -1.706  1.00 0.00 ? 33 GLN B CG   1  
ATOM 1217  C CD   . GLN B 1 33 ? 14.716  15.729  -3.138  1.00 0.00 ? 33 GLN B CD   1  
ATOM 1218  O OE1  . GLN B 1 33 ? 15.850  15.479  -3.548  1.00 0.00 ? 33 GLN B OE1  1  
ATOM 1219  N NE2  . GLN B 1 33 ? 13.638  15.620  -3.907  1.00 0.00 ? 33 GLN B NE2  1  
ATOM 1220  H H    . GLN B 1 33 ? 12.222  15.841  0.535   1.00 0.00 ? 33 GLN B H    1  
ATOM 1221  H HA   . GLN B 1 33 ? 14.003  18.168  0.152   1.00 0.00 ? 33 GLN B HA   1  
ATOM 1222  H HB2  . GLN B 1 33 ? 12.406  16.568  -1.839  1.00 0.00 ? 33 GLN B HB2  1  
ATOM 1223  H HB3  . GLN B 1 33 ? 13.431  17.945  -2.237  1.00 0.00 ? 33 GLN B HB3  1  
ATOM 1224  H HG2  . GLN B 1 33 ? 15.378  16.688  -1.362  1.00 0.00 ? 33 GLN B HG2  1  
ATOM 1225  H HG3  . GLN B 1 33 ? 14.319  15.305  -1.096  1.00 0.00 ? 33 GLN B HG3  1  
ATOM 1226  H HE21 . GLN B 1 33 ? 12.750  15.812  -3.553  1.00 0.00 ? 33 GLN B HE21 1  
ATOM 1227  H HE22 . GLN B 1 33 ? 13.782  15.339  -4.835  1.00 0.00 ? 33 GLN B HE22 1  
ATOM 1228  N N    . LYS B 1 34 ? 10.865  18.258  0.575   1.00 0.00 ? 34 LYS B N    1  
ATOM 1229  C CA   . LYS B 1 34 ? 9.679   19.105  0.687   1.00 0.00 ? 34 LYS B CA   1  
ATOM 1230  C C    . LYS B 1 34 ? 9.100   19.437  -0.686  1.00 0.00 ? 34 LYS B C    1  
ATOM 1231  O O    . LYS B 1 34 ? 8.190   18.759  -1.163  1.00 0.00 ? 34 LYS B O    1  
ATOM 1232  C CB   . LYS B 1 34 ? 10.007  20.395  1.445   1.00 0.00 ? 34 LYS B CB   1  
ATOM 1233  C CG   . LYS B 1 34 ? 10.534  20.159  2.851   1.00 0.00 ? 34 LYS B CG   1  
ATOM 1234  C CD   . LYS B 1 34 ? 10.646  21.459  3.633   1.00 0.00 ? 34 LYS B CD   1  
ATOM 1235  C CE   . LYS B 1 34 ? 11.682  22.395  3.028   1.00 0.00 ? 34 LYS B CE   1  
ATOM 1236  N NZ   . LYS B 1 34 ? 11.826  23.649  3.819   1.00 0.00 ? 34 LYS B NZ   1  
ATOM 1237  H H    . LYS B 1 34 ? 10.839  17.394  1.023   1.00 0.00 ? 34 LYS B H    1  
ATOM 1238  H HA   . LYS B 1 34 ? 8.937   18.554  1.246   1.00 0.00 ? 34 LYS B HA   1  
ATOM 1239  H HB2  . LYS B 1 34 ? 10.760  20.943  0.909   1.00 0.00 ? 34 LYS B HB2  1  
ATOM 1240  H HB3  . LYS B 1 34 ? 9.110   20.998  1.514   1.00 0.00 ? 34 LYS B HB3  1  
ATOM 1241  H HG2  . LYS B 1 34 ? 9.856   19.500  3.375   1.00 0.00 ? 34 LYS B HG2  1  
ATOM 1242  H HG3  . LYS B 1 34 ? 11.509  19.696  2.788   1.00 0.00 ? 34 LYS B HG3  1  
ATOM 1243  H HD2  . LYS B 1 34 ? 9.686   21.956  3.639   1.00 0.00 ? 34 LYS B HD2  1  
ATOM 1244  H HD3  . LYS B 1 34 ? 10.936  21.228  4.648   1.00 0.00 ? 34 LYS B HD3  1  
ATOM 1245  H HE2  . LYS B 1 34 ? 12.638  21.892  2.998   1.00 0.00 ? 34 LYS B HE2  1  
ATOM 1246  H HE3  . LYS B 1 34 ? 11.382  22.656  2.025   1.00 0.00 ? 34 LYS B HE3  1  
ATOM 1247  H HZ1  . LYS B 1 34 ? 10.920  24.161  3.854   1.00 0.00 ? 34 LYS B HZ1  1  
ATOM 1248  H HZ2  . LYS B 1 34 ? 12.539  24.265  3.380   1.00 0.00 ? 34 LYS B HZ2  1  
ATOM 1249  H HZ3  . LYS B 1 34 ? 12.128  23.431  4.792   1.00 0.00 ? 34 LYS B HZ3  1  
ATOM 1250  N N    . LYS B 1 35 ? 9.628   20.486  -1.315  1.00 0.00 ? 35 LYS B N    1  
ATOM 1251  C CA   . LYS B 1 35 ? 9.159   20.904  -2.632  1.00 0.00 ? 35 LYS B CA   1  
ATOM 1252  C C    . LYS B 1 35 ? 9.640   19.939  -3.713  1.00 0.00 ? 35 LYS B C    1  
ATOM 1253  O O    . LYS B 1 35 ? 10.756  19.422  -3.637  1.00 0.00 ? 35 LYS B O    1  
ATOM 1254  C CB   . LYS B 1 35 ? 9.652   22.319  -2.949  1.00 0.00 ? 35 LYS B CB   1  
ATOM 1255  C CG   . LYS B 1 35 ? 9.131   23.380  -1.993  1.00 0.00 ? 35 LYS B CG   1  
ATOM 1256  C CD   . LYS B 1 35 ? 9.670   24.757  -2.344  1.00 0.00 ? 35 LYS B CD   1  
ATOM 1257  C CE   . LYS B 1 35 ? 9.146   25.822  -1.395  1.00 0.00 ? 35 LYS B CE   1  
ATOM 1258  N NZ   . LYS B 1 35 ? 9.674   27.174  -1.729  1.00 0.00 ? 35 LYS B NZ   1  
ATOM 1259  H H    . LYS B 1 35 ? 10.359  20.993  -0.907  1.00 0.00 ? 35 LYS B H    1  
ATOM 1260  H HA   . LYS B 1 35 ? 8.083   20.917  -2.594  1.00 0.00 ? 35 LYS B HA   1  
ATOM 1261  H HB2  . LYS B 1 35 ? 10.733  22.326  -2.908  1.00 0.00 ? 35 LYS B HB2  1  
ATOM 1262  H HB3  . LYS B 1 35 ? 9.337   22.585  -3.951  1.00 0.00 ? 35 LYS B HB3  1  
ATOM 1263  H HG2  . LYS B 1 35 ? 8.052   23.398  -2.048  1.00 0.00 ? 35 LYS B HG2  1  
ATOM 1264  H HG3  . LYS B 1 35 ? 9.438   23.125  -0.988  1.00 0.00 ? 35 LYS B HG3  1  
ATOM 1265  H HD2  . LYS B 1 35 ? 10.749  24.740  -2.284  1.00 0.00 ? 35 LYS B HD2  1  
ATOM 1266  H HD3  . LYS B 1 35 ? 9.368   25.009  -3.351  1.00 0.00 ? 35 LYS B HD3  1  
ATOM 1267  H HE2  . LYS B 1 35 ? 8.067   25.845  -1.456  1.00 0.00 ? 35 LYS B HE2  1  
ATOM 1268  H HE3  . LYS B 1 35 ? 9.444   25.570  -0.386  1.00 0.00 ? 35 LYS B HE3  1  
ATOM 1269  H HZ1  . LYS B 1 35 ? 10.714  27.182  -1.668  1.00 0.00 ? 35 LYS B HZ1  1  
ATOM 1270  H HZ2  . LYS B 1 35 ? 9.297   27.877  -1.062  1.00 0.00 ? 35 LYS B HZ2  1  
ATOM 1271  H HZ3  . LYS B 1 35 ? 9.391   27.445  -2.694  1.00 0.00 ? 35 LYS B HZ3  1  
ATOM 1272  N N    . PRO B 1 36 ? 8.806   19.681  -4.741  1.00 0.00 ? 36 PRO B N    1  
ATOM 1273  C CA   . PRO B 1 36 ? 9.166   18.775  -5.837  1.00 0.00 ? 36 PRO B CA   1  
ATOM 1274  C C    . PRO B 1 36 ? 10.420  19.237  -6.571  1.00 0.00 ? 36 PRO B C    1  
ATOM 1275  O O    . PRO B 1 36 ? 10.881  20.363  -6.382  1.00 0.00 ? 36 PRO B O    1  
ATOM 1276  C CB   . PRO B 1 36 ? 7.951   18.828  -6.771  1.00 0.00 ? 36 PRO B CB   1  
ATOM 1277  C CG   . PRO B 1 36 ? 6.831   19.316  -5.919  1.00 0.00 ? 36 PRO B CG   1  
ATOM 1278  C CD   . PRO B 1 36 ? 7.454   20.241  -4.916  1.00 0.00 ? 36 PRO B CD   1  
ATOM 1279  H HA   . PRO B 1 36 ? 9.309   17.764  -5.483  1.00 0.00 ? 36 PRO B HA   1  
ATOM 1280  H HB2  . PRO B 1 36 ? 8.131   19.505  -7.598  1.00 0.00 ? 36 PRO B HB2  1  
ATOM 1281  H HB3  . PRO B 1 36 ? 7.747   17.839  -7.151  1.00 0.00 ? 36 PRO B HB3  1  
ATOM 1282  H HG2  . PRO B 1 36 ? 6.112   19.848  -6.525  1.00 0.00 ? 36 PRO B HG2  1  
ATOM 1283  H HG3  . PRO B 1 36 ? 6.359   18.483  -5.419  1.00 0.00 ? 36 PRO B HG3  1  
ATOM 1284  H HD2  . PRO B 1 36 ? 7.496   21.249  -5.304  1.00 0.00 ? 36 PRO B HD2  1  
ATOM 1285  H HD3  . PRO B 1 36 ? 6.893   20.209  -3.997  1.00 0.00 ? 36 PRO B HD3  1  
ATOM 1286  N N    . ARG B 1 37 ? 10.966  18.363  -7.408  1.00 0.00 ? 37 ARG B N    1  
ATOM 1287  C CA   . ARG B 1 37 ? 12.168  18.685  -8.165  1.00 0.00 ? 37 ARG B CA   1  
ATOM 1288  C C    . ARG B 1 37 ? 11.882  18.726  -9.661  1.00 0.00 ? 37 ARG B C    1  
ATOM 1289  O O    . ARG B 1 37 ? 11.184  17.863  -10.195 1.00 0.00 ? 37 ARG B O    1  
ATOM 1290  C CB   . ARG B 1 37 ? 13.268  17.664  -7.871  1.00 0.00 ? 37 ARG B CB   1  
ATOM 1291  C CG   . ARG B 1 37 ? 13.754  17.692  -6.430  1.00 0.00 ? 37 ARG B CG   1  
ATOM 1292  C CD   . ARG B 1 37 ? 14.443  19.007  -6.102  1.00 0.00 ? 37 ARG B CD   1  
ATOM 1293  N NE   . ARG B 1 37 ? 15.568  19.267  -6.996  1.00 0.00 ? 37 ARG B NE   1  
ATOM 1294  C CZ   . ARG B 1 37 ? 16.445  20.250  -6.816  1.00 0.00 ? 37 ARG B CZ   1  
ATOM 1295  N NH1  . ARG B 1 37 ? 16.331  21.065  -5.776  1.00 0.00 ? 37 ARG B NH1  1  
ATOM 1296  N NH2  . ARG B 1 37 ? 17.440  20.417  -7.677  1.00 0.00 ? 37 ARG B NH2  1  
ATOM 1297  H H    . ARG B 1 37 ? 10.557  17.475  -7.526  1.00 0.00 ? 37 ARG B H    1  
ATOM 1298  H HA   . ARG B 1 37 ? 12.519  19.664  -7.869  1.00 0.00 ? 37 ARG B HA   1  
ATOM 1299  H HB2  . ARG B 1 37 ? 12.873  16.677  -8.067  1.00 0.00 ? 37 ARG B HB2  1  
ATOM 1300  H HB3  . ARG B 1 37 ? 14.106  17.834  -8.529  1.00 0.00 ? 37 ARG B HB3  1  
ATOM 1301  H HG2  . ARG B 1 37 ? 12.910  17.564  -5.768  1.00 0.00 ? 37 ARG B HG2  1  
ATOM 1302  H HG3  . ARG B 1 37 ? 14.455  16.883  -6.282  1.00 0.00 ? 37 ARG B HG3  1  
ATOM 1303  H HD2  . ARG B 1 37 ? 13.731  19.813  -6.180  1.00 0.00 ? 37 ARG B HD2  1  
ATOM 1304  H HD3  . ARG B 1 37 ? 14.807  18.950  -5.085  1.00 0.00 ? 37 ARG B HD3  1  
ATOM 1305  H HE   . ARG B 1 37 ? 15.698  18.679  -7.770  1.00 0.00 ? 37 ARG B HE   1  
ATOM 1306  H HH11 . ARG B 1 37 ? 15.592  20.962  -5.112  1.00 0.00 ? 37 ARG B HH11 1  
ATOM 1307  H HH12 . ARG B 1 37 ? 16.999  21.802  -5.649  1.00 0.00 ? 37 ARG B HH12 1  
ATOM 1308  H HH21 . ARG B 1 37 ? 17.533  19.804  -8.464  1.00 0.00 ? 37 ARG B HH21 1  
ATOM 1309  H HH22 . ARG B 1 37 ? 18.103  21.157  -7.544  1.00 0.00 ? 37 ARG B HH22 1  
ATOM 1310  N N    . TYR B 1 38 ? 12.426  19.734  -10.334 1.00 0.00 ? 38 TYR B N    1  
ATOM 1311  C CA   . TYR B 1 38 ? 12.235  19.891  -11.770 1.00 0.00 ? 38 TYR B CA   1  
ATOM 1312  C C    . TYR B 1 38 ? 13.575  20.074  -12.474 1.00 0.00 ? 38 TYR B C    1  
ATOM 1313  O O    . TYR B 1 38 ? 14.522  20.605  -11.893 1.00 0.00 ? 38 TYR B O    1  
ATOM 1314  C CB   . TYR B 1 38 ? 11.319  21.084  -12.058 1.00 0.00 ? 38 TYR B CB   1  
ATOM 1315  C CG   . TYR B 1 38 ? 11.836  22.398  -11.514 1.00 0.00 ? 38 TYR B CG   1  
ATOM 1316  C CD1  . TYR B 1 38 ? 12.678  23.203  -12.269 1.00 0.00 ? 38 TYR B CD1  1  
ATOM 1317  C CD2  . TYR B 1 38 ? 11.479  22.833  -10.243 1.00 0.00 ? 38 TYR B CD2  1  
ATOM 1318  C CE1  . TYR B 1 38 ? 13.151  24.404  -11.775 1.00 0.00 ? 38 TYR B CE1  1  
ATOM 1319  C CE2  . TYR B 1 38 ? 11.947  24.033  -9.742  1.00 0.00 ? 38 TYR B CE2  1  
ATOM 1320  C CZ   . TYR B 1 38 ? 12.783  24.814  -10.512 1.00 0.00 ? 38 TYR B CZ   1  
ATOM 1321  O OH   . TYR B 1 38 ? 13.251  26.010  -10.016 1.00 0.00 ? 38 TYR B OH   1  
ATOM 1322  H H    . TYR B 1 38 ? 12.975  20.399  -9.857  1.00 0.00 ? 38 TYR B H    1  
ATOM 1323  H HA   . TYR B 1 38 ? 11.766  18.997  -12.166 1.00 0.00 ? 38 TYR B HA   1  
ATOM 1324  H HB2  . TYR B 1 38 ? 11.192  21.184  -13.130 1.00 0.00 ? 38 TYR B HB2  1  
ATOM 1325  H HB3  . TYR B 1 38 ? 10.351  20.890  -11.614 1.00 0.00 ? 38 TYR B HB3  1  
ATOM 1326  H HD1  . TYR B 1 38 ? 12.967  22.883  -13.261 1.00 0.00 ? 38 TYR B HD1  1  
ATOM 1327  H HD2  . TYR B 1 38 ? 10.824  22.221  -9.639  1.00 0.00 ? 38 TYR B HD2  1  
ATOM 1328  H HE1  . TYR B 1 38 ? 13.806  25.015  -12.378 1.00 0.00 ? 38 TYR B HE1  1  
ATOM 1329  H HE2  . TYR B 1 38 ? 11.659  24.354  -8.752  1.00 0.00 ? 38 TYR B HE2  1  
ATOM 1330  H HH   . TYR B 1 38 ? 12.620  26.707  -10.211 1.00 0.00 ? 38 TYR B HH   1  
ATOM 1331  N N    . GLU B 1 39 ? 13.645  19.634  -13.728 1.00 0.00 ? 39 GLU B N    1  
ATOM 1332  C CA   . GLU B 1 39 ? 14.870  19.746  -14.516 1.00 0.00 ? 39 GLU B CA   1  
ATOM 1333  C C    . GLU B 1 39 ? 16.045  19.087  -13.798 1.00 0.00 ? 39 GLU B C    1  
ATOM 1334  O O    . GLU B 1 39 ? 17.216  19.448  -14.075 1.00 0.00 ? 39 GLU B O    1  
ATOM 1335  C CB   . GLU B 1 39 ? 15.187  21.216  -14.802 1.00 0.00 ? 39 GLU B CB   1  
ATOM 1336  C CG   . GLU B 1 39 ? 14.181  21.887  -15.724 1.00 0.00 ? 39 GLU B CG   1  
ATOM 1337  C CD   . GLU B 1 39 ? 14.496  23.350  -15.966 1.00 0.00 ? 39 GLU B CD   1  
ATOM 1338  O OE1  . GLU B 1 39 ? 15.396  23.635  -16.785 1.00 0.00 ? 39 GLU B OE1  1  
ATOM 1339  O OE2  . GLU B 1 39 ? 13.847  24.209  -15.337 1.00 0.00 ? 39 GLU B OE2  1  
ATOM 1340  O OXT  . GLU B 1 39 ? 15.809  18.170  -12.975 1.00 0.00 ? 39 GLU B OXT  1  
ATOM 1341  H H    . GLU B 1 39 ? 12.856  19.219  -14.145 1.00 0.00 ? 39 GLU B H    1  
ATOM 1342  H HA   . GLU B 1 39 ? 14.708  19.231  -15.452 1.00 0.00 ? 39 GLU B HA   1  
ATOM 1343  H HB2  . GLU B 1 39 ? 15.215  21.762  -13.873 1.00 0.00 ? 39 GLU B HB2  1  
ATOM 1344  H HB3  . GLU B 1 39 ? 16.160  21.284  -15.275 1.00 0.00 ? 39 GLU B HB3  1  
ATOM 1345  H HG2  . GLU B 1 39 ? 14.184  21.373  -16.674 1.00 0.00 ? 39 GLU B HG2  1  
ATOM 1346  H HG3  . GLU B 1 39 ? 13.198  21.813  -15.280 1.00 0.00 ? 39 GLU B HG3  1  
ATOM 1347  N N    . GLY A 1 1  ? 15.376  -29.231 3.444   1.00 0.00 ? 1  GLY A N    2  
ATOM 1348  C CA   . GLY A 1 1  ? 14.039  -28.952 2.849   1.00 0.00 ? 1  GLY A CA   2  
ATOM 1349  C C    . GLY A 1 1  ? 13.078  -28.328 3.842   1.00 0.00 ? 1  GLY A C    2  
ATOM 1350  O O    . GLY A 1 1  ? 13.310  -27.221 4.328   1.00 0.00 ? 1  GLY A O    2  
ATOM 1351  H H1   . GLY A 1 1  ? 15.812  -28.348 3.784   1.00 0.00 ? 1  GLY A H1   2  
ATOM 1352  H H2   . GLY A 1 1  ? 16.001  -29.657 2.730   1.00 0.00 ? 1  GLY A H2   2  
ATOM 1353  H H3   . GLY A 1 1  ? 15.285  -29.892 4.244   1.00 0.00 ? 1  GLY A H3   2  
ATOM 1354  H HA2  . GLY A 1 1  ? 14.167  -28.273 2.018   1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1355  H HA3  . GLY A 1 1  ? 13.626  -29.879 2.476   1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1356  N N    . HIS A 1 2  ? 11.997  -29.046 4.145   1.00 0.00 ? 2  HIS A N    2  
ATOM 1357  C CA   . HIS A 1 2  ? 10.983  -28.564 5.081   1.00 0.00 ? 2  HIS A CA   2  
ATOM 1358  C C    . HIS A 1 2  ? 10.376  -27.250 4.600   1.00 0.00 ? 2  HIS A C    2  
ATOM 1359  O O    . HIS A 1 2  ? 10.951  -26.178 4.796   1.00 0.00 ? 2  HIS A O    2  
ATOM 1360  C CB   . HIS A 1 2  ? 11.578  -28.386 6.481   1.00 0.00 ? 2  HIS A CB   2  
ATOM 1361  C CG   . HIS A 1 2  ? 12.170  -29.641 7.044   1.00 0.00 ? 2  HIS A CG   2  
ATOM 1362  N ND1  . HIS A 1 2  ? 11.505  -30.457 7.937   1.00 0.00 ? 2  HIS A ND1  2  
ATOM 1363  C CD2  . HIS A 1 2  ? 13.376  -30.221 6.839   1.00 0.00 ? 2  HIS A CD2  2  
ATOM 1364  C CE1  . HIS A 1 2  ? 12.277  -31.480 8.256   1.00 0.00 ? 2  HIS A CE1  2  
ATOM 1365  N NE2  . HIS A 1 2  ? 13.418  -31.360 7.604   1.00 0.00 ? 2  HIS A NE2  2  
ATOM 1366  H H    . HIS A 1 2  ? 11.863  -29.927 3.729   1.00 0.00 ? 2  HIS A H    2  
ATOM 1367  H HA   . HIS A 1 2  ? 10.205  -29.315 5.130   1.00 0.00 ? 2  HIS A HA   2  
ATOM 1368  H HB2  . HIS A 1 2  ? 12.354  -27.639 6.456   1.00 0.00 ? 2  HIS A HB2  2  
ATOM 1369  H HB3  . HIS A 1 2  ? 10.799  -28.061 7.158   1.00 0.00 ? 2  HIS A HB3  2  
ATOM 1370  H HD1  . HIS A 1 2  ? 10.601  -30.307 8.285   1.00 0.00 ? 2  HIS A HD1  2  
ATOM 1371  H HD2  . HIS A 1 2  ? 14.161  -29.855 6.192   1.00 0.00 ? 2  HIS A HD2  2  
ATOM 1372  H HE1  . HIS A 1 2  ? 12.018  -32.280 8.934   1.00 0.00 ? 2  HIS A HE1  2  
ATOM 1373  H HE2  . HIS A 1 2  ? 14.204  -31.932 7.731   1.00 0.00 ? 2  HIS A HE2  2  
ATOM 1374  N N    . SER A 1 3  ? 9.211   -27.341 3.970   1.00 0.00 ? 3  SER A N    2  
ATOM 1375  C CA   . SER A 1 3  ? 8.522   -26.164 3.456   1.00 0.00 ? 3  SER A CA   2  
ATOM 1376  C C    . SER A 1 3  ? 7.396   -25.741 4.395   1.00 0.00 ? 3  SER A C    2  
ATOM 1377  O O    . SER A 1 3  ? 6.746   -26.582 5.017   1.00 0.00 ? 3  SER A O    2  
ATOM 1378  C CB   . SER A 1 3  ? 7.962   -26.447 2.060   1.00 0.00 ? 3  SER A CB   2  
ATOM 1379  O OG   . SER A 1 3  ? 7.043   -27.525 2.087   1.00 0.00 ? 3  SER A OG   2  
ATOM 1380  H H    . SER A 1 3  ? 8.794   -28.226 3.844   1.00 0.00 ? 3  SER A H    2  
ATOM 1381  H HA   . SER A 1 3  ? 9.232   -25.347 3.375   1.00 0.00 ? 3  SER A HA   2  
ATOM 1382  H HB2  . SER A 1 3  ? 7.457   -25.568 1.684   1.00 0.00 ? 3  SER A HB2  2  
ATOM 1383  H HB3  . SER A 1 3  ? 8.775   -26.703 1.397   1.00 0.00 ? 3  SER A HB3  2  
ATOM 1384  H HG   . SER A 1 3  ? 6.853   -27.806 1.189   1.00 0.00 ? 3  SER A HG   2  
ATOM 1385  N N    . LEU A 1 4  ? 7.173   -24.434 4.492   1.00 0.00 ? 4  LEU A N    2  
ATOM 1386  C CA   . LEU A 1 4  ? 6.127   -23.900 5.359   1.00 0.00 ? 4  LEU A CA   2  
ATOM 1387  C C    . LEU A 1 4  ? 4.746   -24.092 4.730   1.00 0.00 ? 4  LEU A C    2  
ATOM 1388  O O    . LEU A 1 4  ? 4.601   -24.024 3.509   1.00 0.00 ? 4  LEU A O    2  
ATOM 1389  C CB   . LEU A 1 4  ? 6.367   -22.411 5.639   1.00 0.00 ? 4  LEU A CB   2  
ATOM 1390  C CG   . LEU A 1 4  ? 7.566   -22.086 6.538   1.00 0.00 ? 4  LEU A CG   2  
ATOM 1391  C CD1  . LEU A 1 4  ? 7.451   -22.806 7.875   1.00 0.00 ? 4  LEU A CD1  2  
ATOM 1392  C CD2  . LEU A 1 4  ? 8.875   -22.442 5.848   1.00 0.00 ? 4  LEU A CD2  2  
ATOM 1393  H H    . LEU A 1 4  ? 7.720   -23.813 3.955   1.00 0.00 ? 4  LEU A H    2  
ATOM 1394  H HA   . LEU A 1 4  ? 6.168   -24.447 6.285   1.00 0.00 ? 4  LEU A HA   2  
ATOM 1395  H HB2  . LEU A 1 4  ? 6.502   -21.907 4.692   1.00 0.00 ? 4  LEU A HB2  2  
ATOM 1396  H HB3  . LEU A 1 4  ? 5.483   -22.002 6.114   1.00 0.00 ? 4  LEU A HB3  2  
ATOM 1397  H HG   . LEU A 1 4  ? 7.574   -21.024 6.737   1.00 0.00 ? 4  LEU A HG   2  
ATOM 1398  H HD11 . LEU A 1 4  ? 8.226   -22.451 8.538   1.00 0.00 ? 4  LEU A HD11 2  
ATOM 1399  H HD12 . LEU A 1 4  ? 7.565   -23.871 7.734   1.00 0.00 ? 4  LEU A HD12 2  
ATOM 1400  H HD13 . LEU A 1 4  ? 6.485   -22.603 8.319   1.00 0.00 ? 4  LEU A HD13 2  
ATOM 1401  H HD21 . LEU A 1 4  ? 9.690   -21.967 6.374   1.00 0.00 ? 4  LEU A HD21 2  
ATOM 1402  H HD22 . LEU A 1 4  ? 8.863   -22.090 4.825   1.00 0.00 ? 4  LEU A HD22 2  
ATOM 1403  H HD23 . LEU A 1 4  ? 9.026   -23.512 5.858   1.00 0.00 ? 4  LEU A HD23 2  
ATOM 1404  N N    . PRO A 1 5  ? 3.710   -24.336 5.557   1.00 0.00 ? 5  PRO A N    2  
ATOM 1405  C CA   . PRO A 1 5  ? 2.341   -24.536 5.069   1.00 0.00 ? 5  PRO A CA   2  
ATOM 1406  C C    . PRO A 1 5  ? 1.747   -23.266 4.466   1.00 0.00 ? 5  PRO A C    2  
ATOM 1407  O O    . PRO A 1 5  ? 2.139   -22.154 4.821   1.00 0.00 ? 5  PRO A O    2  
ATOM 1408  C CB   . PRO A 1 5  ? 1.564   -24.945 6.324   1.00 0.00 ? 5  PRO A CB   2  
ATOM 1409  C CG   . PRO A 1 5  ? 2.355   -24.401 7.463   1.00 0.00 ? 5  PRO A CG   2  
ATOM 1410  C CD   . PRO A 1 5  ? 3.793   -24.437 7.029   1.00 0.00 ? 5  PRO A CD   2  
ATOM 1411  H HA   . PRO A 1 5  ? 2.298   -25.336 4.342   1.00 0.00 ? 5  PRO A HA   2  
ATOM 1412  H HB2  . PRO A 1 5  ? 0.561   -24.537 6.308   1.00 0.00 ? 5  PRO A HB2  2  
ATOM 1413  H HB3  . PRO A 1 5  ? 1.510   -26.022 6.372   1.00 0.00 ? 5  PRO A HB3  2  
ATOM 1414  H HG2  . PRO A 1 5  ? 2.051   -23.385 7.668   1.00 0.00 ? 5  PRO A HG2  2  
ATOM 1415  H HG3  . PRO A 1 5  ? 2.212   -25.019 8.337   1.00 0.00 ? 5  PRO A HG3  2  
ATOM 1416  H HD2  . PRO A 1 5  ? 4.332   -23.598 7.444   1.00 0.00 ? 5  PRO A HD2  2  
ATOM 1417  H HD3  . PRO A 1 5  ? 4.254   -25.368 7.326   1.00 0.00 ? 5  PRO A HD3  2  
ATOM 1418  N N    . PHE A 1 6  ? 0.796   -23.442 3.551   1.00 0.00 ? 6  PHE A N    2  
ATOM 1419  C CA   . PHE A 1 6  ? 0.142   -22.315 2.896   1.00 0.00 ? 6  PHE A CA   2  
ATOM 1420  C C    . PHE A 1 6  ? -0.625  -21.468 3.906   1.00 0.00 ? 6  PHE A C    2  
ATOM 1421  O O    . PHE A 1 6  ? -1.011  -20.337 3.617   1.00 0.00 ? 6  PHE A O    2  
ATOM 1422  C CB   . PHE A 1 6  ? -0.807  -22.808 1.797   1.00 0.00 ? 6  PHE A CB   2  
ATOM 1423  C CG   . PHE A 1 6  ? -1.985  -23.586 2.312   1.00 0.00 ? 6  PHE A CG   2  
ATOM 1424  C CD1  . PHE A 1 6  ? -1.862  -24.929 2.629   1.00 0.00 ? 6  PHE A CD1  2  
ATOM 1425  C CD2  . PHE A 1 6  ? -3.217  -22.973 2.476   1.00 0.00 ? 6  PHE A CD2  2  
ATOM 1426  C CE1  . PHE A 1 6  ? -2.945  -25.647 3.099   1.00 0.00 ? 6  PHE A CE1  2  
ATOM 1427  C CE2  . PHE A 1 6  ? -4.304  -23.686 2.946   1.00 0.00 ? 6  PHE A CE2  2  
ATOM 1428  C CZ   . PHE A 1 6  ? -4.168  -25.024 3.258   1.00 0.00 ? 6  PHE A CZ   2  
ATOM 1429  H H    . PHE A 1 6  ? 0.543   -24.353 3.314   1.00 0.00 ? 6  PHE A H    2  
ATOM 1430  H HA   . PHE A 1 6  ? 0.908   -21.701 2.441   1.00 0.00 ? 6  PHE A HA   2  
ATOM 1431  H HB2  . PHE A 1 6  ? -1.174  -21.953 1.243   1.00 0.00 ? 6  PHE A HB2  2  
ATOM 1432  H HB3  . PHE A 1 6  ? -0.251  -23.444 1.120   1.00 0.00 ? 6  PHE A HB3  2  
ATOM 1433  H HD1  . PHE A 1 6  ? -0.914  -25.427 2.500   1.00 0.00 ? 6  PHE A HD1  2  
ATOM 1434  H HD2  . PHE A 1 6  ? -3.330  -21.925 2.233   1.00 0.00 ? 6  PHE A HD2  2  
ATOM 1435  H HE1  . PHE A 1 6  ? -2.836  -26.694 3.342   1.00 0.00 ? 6  PHE A HE1  2  
ATOM 1436  H HE2  . PHE A 1 6  ? -5.259  -23.197 3.069   1.00 0.00 ? 6  PHE A HE2  2  
ATOM 1437  H HZ   . PHE A 1 6  ? -5.016  -25.583 3.625   1.00 0.00 ? 6  PHE A HZ   2  
ATOM 1438  N N    . LYS A 1 7  ? -0.844  -22.026 5.092   1.00 0.00 ? 7  LYS A N    2  
ATOM 1439  C CA   . LYS A 1 7  ? -1.572  -21.329 6.145   1.00 0.00 ? 7  LYS A CA   2  
ATOM 1440  C C    . LYS A 1 7  ? -0.913  -19.992 6.480   1.00 0.00 ? 7  LYS A C    2  
ATOM 1441  O O    . LYS A 1 7  ? -1.565  -18.948 6.462   1.00 0.00 ? 7  LYS A O    2  
ATOM 1442  C CB   . LYS A 1 7  ? -1.632  -22.200 7.401   1.00 0.00 ? 7  LYS A CB   2  
ATOM 1443  C CG   . LYS A 1 7  ? -2.165  -23.602 7.149   1.00 0.00 ? 7  LYS A CG   2  
ATOM 1444  C CD   . LYS A 1 7  ? -3.677  -23.609 6.992   1.00 0.00 ? 7  LYS A CD   2  
ATOM 1445  C CE   . LYS A 1 7  ? -4.376  -23.335 8.313   1.00 0.00 ? 7  LYS A CE   2  
ATOM 1446  N NZ   . LYS A 1 7  ? -5.857  -23.414 8.187   1.00 0.00 ? 7  LYS A NZ   2  
ATOM 1447  H H    . LYS A 1 7  ? -0.525  -22.925 5.266   1.00 0.00 ? 7  LYS A H    2  
ATOM 1448  H HA   . LYS A 1 7  ? -2.579  -21.147 5.796   1.00 0.00 ? 7  LYS A HA   2  
ATOM 1449  H HB2  . LYS A 1 7  ? -0.627  -22.302 7.796   1.00 0.00 ? 7  LYS A HB2  2  
ATOM 1450  H HB3  . LYS A 1 7  ? -2.241  -21.710 8.142   1.00 0.00 ? 7  LYS A HB3  2  
ATOM 1451  H HG2  . LYS A 1 7  ? -1.726  -24.021 6.260   1.00 0.00 ? 7  LYS A HG2  2  
ATOM 1452  H HG3  . LYS A 1 7  ? -1.899  -24.225 7.993   1.00 0.00 ? 7  LYS A HG3  2  
ATOM 1453  H HD2  . LYS A 1 7  ? -3.970  -22.854 6.275   1.00 0.00 ? 7  LYS A HD2  2  
ATOM 1454  H HD3  . LYS A 1 7  ? -3.983  -24.581 6.632   1.00 0.00 ? 7  LYS A HD3  2  
ATOM 1455  H HE2  . LYS A 1 7  ? -4.052  -24.065 9.042   1.00 0.00 ? 7  LYS A HE2  2  
ATOM 1456  H HE3  . LYS A 1 7  ? -4.113  -22.347 8.654   1.00 0.00 ? 7  LYS A HE3  2  
ATOM 1457  H HZ1  . LYS A 1 7  ? -6.143  -24.364 7.871   1.00 0.00 ? 7  LYS A HZ1  2  
ATOM 1458  H HZ2  . LYS A 1 7  ? -6.200  -22.713 7.498   1.00 0.00 ? 7  LYS A HZ2  2  
ATOM 1459  H HZ3  . LYS A 1 7  ? -6.302  -23.221 9.107   1.00 0.00 ? 7  LYS A HZ3  2  
ATOM 1460  N N    . VAL A 1 8  ? 0.381   -20.032 6.780   1.00 0.00 ? 8  VAL A N    2  
ATOM 1461  C CA   . VAL A 1 8  ? 1.127   -18.825 7.126   1.00 0.00 ? 8  VAL A CA   2  
ATOM 1462  C C    . VAL A 1 8  ? 1.366   -17.944 5.902   1.00 0.00 ? 8  VAL A C    2  
ATOM 1463  O O    . VAL A 1 8  ? 1.354   -16.718 5.999   1.00 0.00 ? 8  VAL A O    2  
ATOM 1464  C CB   . VAL A 1 8  ? 2.483   -19.172 7.770   1.00 0.00 ? 8  VAL A CB   2  
ATOM 1465  C CG1  . VAL A 1 8  ? 3.229   -17.908 8.171   1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1466  C CG2  . VAL A 1 8  ? 2.282   -20.083 8.971   1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1467  H H    . VAL A 1 8  ? 0.850   -20.900 6.766   1.00 0.00 ? 8  VAL A H    2  
ATOM 1468  H HA   . VAL A 1 8  ? 0.545   -18.262 7.849   1.00 0.00 ? 8  VAL A HA   2  
ATOM 1469  H HB   . VAL A 1 8  ? 3.084   -19.703 7.044   1.00 0.00 ? 8  VAL A HB   2  
ATOM 1470  H HG11 . VAL A 1 8  ? 3.523   -17.359 7.290   1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1471  H HG12 . VAL A 1 8  ? 4.118   -18.171 8.730   1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1472  H HG13 . VAL A 1 8  ? 2.593   -17.286 8.787   1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1473  H HG21 . VAL A 1 8  ? 1.826   -21.010 8.658   1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1474  H HG22 . VAL A 1 8  ? 1.644   -19.596 9.695   1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1475  H HG23 . VAL A 1 8  ? 3.239   -20.298 9.427   1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1476  N N    . VAL A 1 9  ? 1.585   -18.578 4.754   1.00 0.00 ? 9  VAL A N    2  
ATOM 1477  C CA   . VAL A 1 9  ? 1.837   -17.851 3.514   1.00 0.00 ? 9  VAL A CA   2  
ATOM 1478  C C    . VAL A 1 9  ? 0.672   -16.935 3.148   1.00 0.00 ? 9  VAL A C    2  
ATOM 1479  O O    . VAL A 1 9  ? 0.866   -15.756 2.852   1.00 0.00 ? 9  VAL A O    2  
ATOM 1480  C CB   . VAL A 1 9  ? 2.100   -18.816 2.342   1.00 0.00 ? 9  VAL A CB   2  
ATOM 1481  C CG1  . VAL A 1 9  ? 2.464   -18.044 1.084   1.00 0.00 ? 9  VAL A CG1  2  
ATOM 1482  C CG2  . VAL A 1 9  ? 3.196   -19.807 2.703   1.00 0.00 ? 9  VAL A CG2  2  
ATOM 1483  H H    . VAL A 1 9  ? 1.575   -19.559 4.743   1.00 0.00 ? 9  VAL A H    2  
ATOM 1484  H HA   . VAL A 1 9  ? 2.724   -17.245 3.659   1.00 0.00 ? 9  VAL A HA   2  
ATOM 1485  H HB   . VAL A 1 9  ? 1.195   -19.376 2.144   1.00 0.00 ? 9  VAL A HB   2  
ATOM 1486  H HG11 . VAL A 1 9  ? 3.296   -17.384 1.287   1.00 0.00 ? 9  VAL A HG11 2  
ATOM 1487  H HG12 . VAL A 1 9  ? 1.618   -17.463 0.750   1.00 0.00 ? 9  VAL A HG12 2  
ATOM 1488  H HG13 . VAL A 1 9  ? 2.743   -18.736 0.300   1.00 0.00 ? 9  VAL A HG13 2  
ATOM 1489  H HG21 . VAL A 1 9  ? 4.104   -19.271 2.946   1.00 0.00 ? 9  VAL A HG21 2  
ATOM 1490  H HG22 . VAL A 1 9  ? 3.384   -20.461 1.862   1.00 0.00 ? 9  VAL A HG22 2  
ATOM 1491  H HG23 . VAL A 1 9  ? 2.899   -20.399 3.541   1.00 0.00 ? 9  VAL A HG23 2  
ATOM 1492  N N    . VAL A 1 10 ? -0.539  -17.485 3.167   1.00 0.00 ? 10 VAL A N    2  
ATOM 1493  C CA   . VAL A 1 10 ? -1.735  -16.720 2.826   1.00 0.00 ? 10 VAL A CA   2  
ATOM 1494  C C    . VAL A 1 10 ? -1.979  -15.586 3.817   1.00 0.00 ? 10 VAL A C    2  
ATOM 1495  O O    . VAL A 1 10 ? -2.146  -14.432 3.420   1.00 0.00 ? 10 VAL A O    2  
ATOM 1496  C CB   . VAL A 1 10 ? -2.983  -17.624 2.775   1.00 0.00 ? 10 VAL A CB   2  
ATOM 1497  C CG1  . VAL A 1 10 ? -4.230  -16.806 2.470   1.00 0.00 ? 10 VAL A CG1  2  
ATOM 1498  C CG2  . VAL A 1 10 ? -2.800  -18.727 1.744   1.00 0.00 ? 10 VAL A CG2  2  
ATOM 1499  H H    . VAL A 1 10 ? -0.630  -18.435 3.416   1.00 0.00 ? 10 VAL A H    2  
ATOM 1500  H HA   . VAL A 1 10 ? -1.590  -16.290 1.841   1.00 0.00 ? 10 VAL A HA   2  
ATOM 1501  H HB   . VAL A 1 10 ? -3.111  -18.087 3.744   1.00 0.00 ? 10 VAL A HB   2  
ATOM 1502  H HG11 . VAL A 1 10 ? -4.056  -16.175 1.609   1.00 0.00 ? 10 VAL A HG11 2  
ATOM 1503  H HG12 . VAL A 1 10 ? -4.484  -16.192 3.321   1.00 0.00 ? 10 VAL A HG12 2  
ATOM 1504  H HG13 . VAL A 1 10 ? -5.060  -17.469 2.261   1.00 0.00 ? 10 VAL A HG13 2  
ATOM 1505  H HG21 . VAL A 1 10 ? -3.578  -19.464 1.871   1.00 0.00 ? 10 VAL A HG21 2  
ATOM 1506  H HG22 . VAL A 1 10 ? -1.843  -19.201 1.854   1.00 0.00 ? 10 VAL A HG22 2  
ATOM 1507  H HG23 . VAL A 1 10 ? -2.870  -18.310 0.748   1.00 0.00 ? 10 VAL A HG23 2  
ATOM 1508  N N    . ILE A 1 11 ? -2.003  -15.919 5.104   1.00 0.00 ? 11 ILE A N    2  
ATOM 1509  C CA   . ILE A 1 11 ? -2.231  -14.924 6.146   1.00 0.00 ? 11 ILE A CA   2  
ATOM 1510  C C    . ILE A 1 11 ? -1.214  -13.789 6.061   1.00 0.00 ? 11 ILE A C    2  
ATOM 1511  O O    . ILE A 1 11 ? -1.542  -12.628 6.310   1.00 0.00 ? 11 ILE A O    2  
ATOM 1512  C CB   . ILE A 1 11 ? -2.168  -15.558 7.550   1.00 0.00 ? 11 ILE A CB   2  
ATOM 1513  C CG1  . ILE A 1 11 ? -3.224  -16.660 7.679   1.00 0.00 ? 11 ILE A CG1  2  
ATOM 1514  C CG2  . ILE A 1 11 ? -2.364  -14.495 8.624   1.00 0.00 ? 11 ILE A CG2  2  
ATOM 1515  C CD1  . ILE A 1 11 ? -3.125  -17.448 8.969   1.00 0.00 ? 11 ILE A CD1  2  
ATOM 1516  H H    . ILE A 1 11 ? -1.857  -16.860 5.354   1.00 0.00 ? 11 ILE A H    2  
ATOM 1517  H HA   . ILE A 1 11 ? -3.222  -14.511 6.003   1.00 0.00 ? 11 ILE A HA   2  
ATOM 1518  H HB   . ILE A 1 11 ? -1.186  -15.992 7.682   1.00 0.00 ? 11 ILE A HB   2  
ATOM 1519  H HG12 . ILE A 1 11 ? -4.207  -16.212 7.649   1.00 0.00 ? 11 ILE A HG12 2  
ATOM 1520  H HG13 . ILE A 1 11 ? -3.142  -17.355 6.866   1.00 0.00 ? 11 ILE A HG13 2  
ATOM 1521  H HG21 . ILE A 1 11 ? -1.559  -13.778 8.589   1.00 0.00 ? 11 ILE A HG21 2  
ATOM 1522  H HG22 . ILE A 1 11 ? -2.370  -14.954 9.602   1.00 0.00 ? 11 ILE A HG22 2  
ATOM 1523  H HG23 . ILE A 1 11 ? -3.304  -13.986 8.464   1.00 0.00 ? 11 ILE A HG23 2  
ATOM 1524  H HD11 . ILE A 1 11 ? -2.104  -17.767 9.126   1.00 0.00 ? 11 ILE A HD11 2  
ATOM 1525  H HD12 . ILE A 1 11 ? -3.765  -18.316 8.907   1.00 0.00 ? 11 ILE A HD12 2  
ATOM 1526  H HD13 . ILE A 1 11 ? -3.441  -16.830 9.796   1.00 0.00 ? 11 ILE A HD13 2  
ATOM 1527  N N    . SER A 1 12 ? 0.021   -14.131 5.705   1.00 0.00 ? 12 SER A N    2  
ATOM 1528  C CA   . SER A 1 12 ? 1.085   -13.139 5.590   1.00 0.00 ? 12 SER A CA   2  
ATOM 1529  C C    . SER A 1 12 ? 0.882   -12.259 4.360   1.00 0.00 ? 12 SER A C    2  
ATOM 1530  O O    . SER A 1 12 ? 1.110   -11.050 4.407   1.00 0.00 ? 12 SER A O    2  
ATOM 1531  C CB   . SER A 1 12 ? 2.448   -13.831 5.519   1.00 0.00 ? 12 SER A CB   2  
ATOM 1532  O OG   . SER A 1 12 ? 3.495   -12.884 5.407   1.00 0.00 ? 12 SER A OG   2  
ATOM 1533  H H    . SER A 1 12 ? 0.231   -15.076 5.516   1.00 0.00 ? 12 SER A H    2  
ATOM 1534  H HA   . SER A 1 12 ? 1.063   -12.511 6.472   1.00 0.00 ? 12 SER A HA   2  
ATOM 1535  H HB2  . SER A 1 12 ? 2.601   -14.411 6.417   1.00 0.00 ? 12 SER A HB2  2  
ATOM 1536  H HB3  . SER A 1 12 ? 2.476   -14.486 4.659   1.00 0.00 ? 12 SER A HB3  2  
ATOM 1537  H HG   . SER A 1 12 ? 4.310   -13.334 5.174   1.00 0.00 ? 12 SER A HG   2  
ATOM 1538  N N    . ALA A 1 13 ? 0.453   -12.873 3.262   1.00 0.00 ? 13 ALA A N    2  
ATOM 1539  C CA   . ALA A 1 13 ? 0.221   -12.147 2.017   1.00 0.00 ? 13 ALA A CA   2  
ATOM 1540  C C    . ALA A 1 13 ? -0.893  -11.119 2.178   1.00 0.00 ? 13 ALA A C    2  
ATOM 1541  O O    . ALA A 1 13 ? -0.707  -9.938  1.886   1.00 0.00 ? 13 ALA A O    2  
ATOM 1542  C CB   . ALA A 1 13 ? -0.118  -13.119 0.897   1.00 0.00 ? 13 ALA A CB   2  
ATOM 1543  H H    . ALA A 1 13 ? 0.290   -13.846 3.282   1.00 0.00 ? 13 ALA A H    2  
ATOM 1544  H HA   . ALA A 1 13 ? 1.135   -11.634 1.747   1.00 0.00 ? 13 ALA A HA   2  
ATOM 1545  H HB1  . ALA A 1 13 ? -0.231  -12.579 -0.033  1.00 0.00 ? 13 ALA A HB1  2  
ATOM 1546  H HB2  . ALA A 1 13 ? -1.039  -13.636 1.129   1.00 0.00 ? 13 ALA A HB2  2  
ATOM 1547  H HB3  . ALA A 1 13 ? 0.680   -13.840 0.796   1.00 0.00 ? 13 ALA A HB3  2  
ATOM 1548  N N    . ILE A 1 14 ? -2.051  -11.579 2.641   1.00 0.00 ? 14 ILE A N    2  
ATOM 1549  C CA   . ILE A 1 14 ? -3.202  -10.706 2.839   1.00 0.00 ? 14 ILE A CA   2  
ATOM 1550  C C    . ILE A 1 14 ? -2.855  -9.536  3.755   1.00 0.00 ? 14 ILE A C    2  
ATOM 1551  O O    . ILE A 1 14 ? -3.139  -8.382  3.435   1.00 0.00 ? 14 ILE A O    2  
ATOM 1552  C CB   . ILE A 1 14 ? -4.393  -11.481 3.435   1.00 0.00 ? 14 ILE A CB   2  
ATOM 1553  C CG1  . ILE A 1 14 ? -4.777  -12.644 2.517   1.00 0.00 ? 14 ILE A CG1  2  
ATOM 1554  C CG2  . ILE A 1 14 ? -5.581  -10.552 3.649   1.00 0.00 ? 14 ILE A CG2  2  
ATOM 1555  C CD1  . ILE A 1 14 ? -5.840  -13.552 3.097   1.00 0.00 ? 14 ILE A CD1  2  
ATOM 1556  H H    . ILE A 1 14 ? -2.124  -12.536 2.860   1.00 0.00 ? 14 ILE A H    2  
ATOM 1557  H HA   . ILE A 1 14 ? -3.497  -10.316 1.873   1.00 0.00 ? 14 ILE A HA   2  
ATOM 1558  H HB   . ILE A 1 14 ? -4.096  -11.875 4.398   1.00 0.00 ? 14 ILE A HB   2  
ATOM 1559  H HG12 . ILE A 1 14 ? -5.157  -12.252 1.585   1.00 0.00 ? 14 ILE A HG12 2  
ATOM 1560  H HG13 . ILE A 1 14 ? -3.917  -13.254 2.308   1.00 0.00 ? 14 ILE A HG13 2  
ATOM 1561  H HG21 . ILE A 1 14 ? -5.858  -10.094 2.710   1.00 0.00 ? 14 ILE A HG21 2  
ATOM 1562  H HG22 . ILE A 1 14 ? -5.328  -9.783  4.362   1.00 0.00 ? 14 ILE A HG22 2  
ATOM 1563  H HG23 . ILE A 1 14 ? -6.422  -11.109 4.033   1.00 0.00 ? 14 ILE A HG23 2  
ATOM 1564  H HD11 . ILE A 1 14 ? -6.789  -13.038 3.107   1.00 0.00 ? 14 ILE A HD11 2  
ATOM 1565  H HD12 . ILE A 1 14 ? -5.571  -13.834 4.106   1.00 0.00 ? 14 ILE A HD12 2  
ATOM 1566  H HD13 . ILE A 1 14 ? -5.922  -14.440 2.488   1.00 0.00 ? 14 ILE A HD13 2  
ATOM 1567  N N    . LEU A 1 15 ? -2.239  -9.842  4.892   1.00 0.00 ? 15 LEU A N    2  
ATOM 1568  C CA   . LEU A 1 15 ? -1.853  -8.816  5.856   1.00 0.00 ? 15 LEU A CA   2  
ATOM 1569  C C    . LEU A 1 15 ? -0.992  -7.746  5.195   1.00 0.00 ? 15 LEU A C    2  
ATOM 1570  O O    . LEU A 1 15 ? -1.246  -6.551  5.345   1.00 0.00 ? 15 LEU A O    2  
ATOM 1571  C CB   . LEU A 1 15 ? -1.093  -9.445  7.025   1.00 0.00 ? 15 LEU A CB   2  
ATOM 1572  C CG   . LEU A 1 15 ? -0.753  -8.485  8.167   1.00 0.00 ? 15 LEU A CG   2  
ATOM 1573  C CD1  . LEU A 1 15 ? -2.015  -8.064  8.904   1.00 0.00 ? 15 LEU A CD1  2  
ATOM 1574  C CD2  . LEU A 1 15 ? 0.240   -9.126  9.125   1.00 0.00 ? 15 LEU A CD2  2  
ATOM 1575  H H    . LEU A 1 15 ? -2.038  -10.788 5.093   1.00 0.00 ? 15 LEU A H    2  
ATOM 1576  H HA   . LEU A 1 15 ? -2.755  -8.356  6.229   1.00 0.00 ? 15 LEU A HA   2  
ATOM 1577  H HB2  . LEU A 1 15 ? -1.692  -10.257 7.419   1.00 0.00 ? 15 LEU A HB2  2  
ATOM 1578  H HB3  . LEU A 1 15 ? -0.171  -9.863  6.639   1.00 0.00 ? 15 LEU A HB3  2  
ATOM 1579  H HG   . LEU A 1 15 ? -0.293  -7.594  7.766   1.00 0.00 ? 15 LEU A HG   2  
ATOM 1580  H HD11 . LEU A 1 15 ? -1.756  -7.392  9.712   1.00 0.00 ? 15 LEU A HD11 2  
ATOM 1581  H HD12 . LEU A 1 15 ? -2.510  -8.936  9.309   1.00 0.00 ? 15 LEU A HD12 2  
ATOM 1582  H HD13 . LEU A 1 15 ? -2.682  -7.557  8.223   1.00 0.00 ? 15 LEU A HD13 2  
ATOM 1583  H HD21 . LEU A 1 15 ? 0.490   -8.426  9.911   1.00 0.00 ? 15 LEU A HD21 2  
ATOM 1584  H HD22 . LEU A 1 15 ? 1.140   -9.393  8.589   1.00 0.00 ? 15 LEU A HD22 2  
ATOM 1585  H HD23 . LEU A 1 15 ? -0.195  -10.015 9.561   1.00 0.00 ? 15 LEU A HD23 2  
ATOM 1586  N N    . ALA A 1 16 ? 0.028   -8.185  4.466   1.00 0.00 ? 16 ALA A N    2  
ATOM 1587  C CA   . ALA A 1 16 ? 0.928   -7.267  3.778   1.00 0.00 ? 16 ALA A CA   2  
ATOM 1588  C C    . ALA A 1 16 ? 0.178   -6.444  2.737   1.00 0.00 ? 16 ALA A C    2  
ATOM 1589  O O    . ALA A 1 16 ? 0.542   -5.304  2.450   1.00 0.00 ? 16 ALA A O    2  
ATOM 1590  C CB   . ALA A 1 16 ? 2.072   -8.032  3.131   1.00 0.00 ? 16 ALA A CB   2  
ATOM 1591  H H    . ALA A 1 16 ? 0.182   -9.157  4.386   1.00 0.00 ? 16 ALA A H    2  
ATOM 1592  H HA   . ALA A 1 16 ? 1.356   -6.606  4.514   1.00 0.00 ? 16 ALA A HA   2  
ATOM 1593  H HB1  . ALA A 1 16 ? 2.763   -7.337  2.675   1.00 0.00 ? 16 ALA A HB1  2  
ATOM 1594  H HB2  . ALA A 1 16 ? 1.682   -8.700  2.376   1.00 0.00 ? 16 ALA A HB2  2  
ATOM 1595  H HB3  . ALA A 1 16 ? 2.589   -8.607  3.885   1.00 0.00 ? 16 ALA A HB3  2  
ATOM 1596  N N    . LEU A 1 17 ? -0.866  -7.035  2.169   1.00 0.00 ? 17 LEU A N    2  
ATOM 1597  C CA   . LEU A 1 17 ? -1.671  -6.360  1.159   1.00 0.00 ? 17 LEU A CA   2  
ATOM 1598  C C    . LEU A 1 17 ? -2.539  -5.279  1.796   1.00 0.00 ? 17 LEU A C    2  
ATOM 1599  O O    . LEU A 1 17 ? -2.824  -4.253  1.176   1.00 0.00 ? 17 LEU A O    2  
ATOM 1600  C CB   . LEU A 1 17 ? -2.546  -7.375  0.423   1.00 0.00 ? 17 LEU A CB   2  
ATOM 1601  C CG   . LEU A 1 17 ? -3.258  -6.845  -0.823  1.00 0.00 ? 17 LEU A CG   2  
ATOM 1602  C CD1  . LEU A 1 17 ? -2.252  -6.347  -1.850  1.00 0.00 ? 17 LEU A CD1  2  
ATOM 1603  C CD2  . LEU A 1 17 ? -4.140  -7.927  -1.425  1.00 0.00 ? 17 LEU A CD2  2  
ATOM 1604  H H    . LEU A 1 17 ? -1.107  -7.951  2.425   1.00 0.00 ? 17 LEU A H    2  
ATOM 1605  H HA   . LEU A 1 17 ? -0.997  -5.894  0.457   1.00 0.00 ? 17 LEU A HA   2  
ATOM 1606  H HB2  . LEU A 1 17 ? -1.917  -8.207  0.129   1.00 0.00 ? 17 LEU A HB2  2  
ATOM 1607  H HB3  . LEU A 1 17 ? -3.295  -7.745  1.110   1.00 0.00 ? 17 LEU A HB3  2  
ATOM 1608  H HG   . LEU A 1 17 ? -3.890  -6.014  -0.544  1.00 0.00 ? 17 LEU A HG   2  
ATOM 1609  H HD11 . LEU A 1 17 ? -2.770  -6.052  -2.754  1.00 0.00 ? 17 LEU A HD11 2  
ATOM 1610  H HD12 . LEU A 1 17 ? -1.547  -7.133  -2.084  1.00 0.00 ? 17 LEU A HD12 2  
ATOM 1611  H HD13 . LEU A 1 17 ? -1.722  -5.494  -1.456  1.00 0.00 ? 17 LEU A HD13 2  
ATOM 1612  H HD21 . LEU A 1 17 ? -3.532  -8.770  -1.725  1.00 0.00 ? 17 LEU A HD21 2  
ATOM 1613  H HD22 . LEU A 1 17 ? -4.659  -7.534  -2.289  1.00 0.00 ? 17 LEU A HD22 2  
ATOM 1614  H HD23 . LEU A 1 17 ? -4.867  -8.252  -0.693  1.00 0.00 ? 17 LEU A HD23 2  
ATOM 1615  N N    . VAL A 1 18 ? -2.956  -5.515  3.036   1.00 0.00 ? 18 VAL A N    2  
ATOM 1616  C CA   . VAL A 1 18 ? -3.787  -4.560  3.760   1.00 0.00 ? 18 VAL A CA   2  
ATOM 1617  C C    . VAL A 1 18 ? -2.979  -3.339  4.183   1.00 0.00 ? 18 VAL A C    2  
ATOM 1618  O O    . VAL A 1 18 ? -3.396  -2.201  3.965   1.00 0.00 ? 18 VAL A O    2  
ATOM 1619  C CB   . VAL A 1 18 ? -4.423  -5.202  5.013   1.00 0.00 ? 18 VAL A CB   2  
ATOM 1620  C CG1  . VAL A 1 18 ? -5.194  -4.166  5.819   1.00 0.00 ? 18 VAL A CG1  2  
ATOM 1621  C CG2  . VAL A 1 18 ? -5.331  -6.359  4.622   1.00 0.00 ? 18 VAL A CG2  2  
ATOM 1622  H H    . VAL A 1 18 ? -2.702  -6.353  3.487   1.00 0.00 ? 18 VAL A H    2  
ATOM 1623  H HA   . VAL A 1 18 ? -4.588  -4.234  3.105   1.00 0.00 ? 18 VAL A HA   2  
ATOM 1624  H HB   . VAL A 1 18 ? -3.630  -5.592  5.636   1.00 0.00 ? 18 VAL A HB   2  
ATOM 1625  H HG11 . VAL A 1 18 ? -5.796  -4.661  6.572   1.00 0.00 ? 18 VAL A HG11 2  
ATOM 1626  H HG12 . VAL A 1 18 ? -5.842  -3.597  5.167   1.00 0.00 ? 18 VAL A HG12 2  
ATOM 1627  H HG13 . VAL A 1 18 ? -4.504  -3.497  6.312   1.00 0.00 ? 18 VAL A HG13 2  
ATOM 1628  H HG21 . VAL A 1 18 ? -6.183  -5.982  4.071   1.00 0.00 ? 18 VAL A HG21 2  
ATOM 1629  H HG22 . VAL A 1 18 ? -5.677  -6.862  5.513   1.00 0.00 ? 18 VAL A HG22 2  
ATOM 1630  H HG23 . VAL A 1 18 ? -4.796  -7.056  4.010   1.00 0.00 ? 18 VAL A HG23 2  
ATOM 1631  N N    . VAL A 1 19 ? -1.817  -3.582  4.782   1.00 0.00 ? 19 VAL A N    2  
ATOM 1632  C CA   . VAL A 1 19 ? -0.953  -2.503  5.246   1.00 0.00 ? 19 VAL A CA   2  
ATOM 1633  C C    . VAL A 1 19 ? -0.518  -1.597  4.094   1.00 0.00 ? 19 VAL A C    2  
ATOM 1634  O O    . VAL A 1 19 ? -0.359  -0.391  4.278   1.00 0.00 ? 19 VAL A O    2  
ATOM 1635  C CB   . VAL A 1 19 ? 0.295   -3.050  5.968   1.00 0.00 ? 19 VAL A CB   2  
ATOM 1636  C CG1  . VAL A 1 19 ? 1.094   -3.960  5.051   1.00 0.00 ? 19 VAL A CG1  2  
ATOM 1637  C CG2  . VAL A 1 19 ? 1.161   -1.911  6.482   1.00 0.00 ? 19 VAL A CG2  2  
ATOM 1638  H H    . VAL A 1 19 ? -1.545  -4.516  4.929   1.00 0.00 ? 19 VAL A H    2  
ATOM 1639  H HA   . VAL A 1 19 ? -1.517  -1.910  5.956   1.00 0.00 ? 19 VAL A HA   2  
ATOM 1640  H HB   . VAL A 1 19 ? -0.033  -3.633  6.816   1.00 0.00 ? 19 VAL A HB   2  
ATOM 1641  H HG11 . VAL A 1 19 ? 1.452   -3.415  4.192   1.00 0.00 ? 19 VAL A HG11 2  
ATOM 1642  H HG12 . VAL A 1 19 ? 0.471   -4.762  4.737   1.00 0.00 ? 19 VAL A HG12 2  
ATOM 1643  H HG13 . VAL A 1 19 ? 1.939   -4.363  5.593   1.00 0.00 ? 19 VAL A HG13 2  
ATOM 1644  H HG21 . VAL A 1 19 ? 1.934   -2.315  7.120   1.00 0.00 ? 19 VAL A HG21 2  
ATOM 1645  H HG22 . VAL A 1 19 ? 0.557   -1.220  7.054   1.00 0.00 ? 19 VAL A HG22 2  
ATOM 1646  H HG23 . VAL A 1 19 ? 1.622   -1.386  5.657   1.00 0.00 ? 19 VAL A HG23 2  
ATOM 1647  N N    . LEU A 1 20 ? -0.328  -2.176  2.910   1.00 0.00 ? 20 LEU A N    2  
ATOM 1648  C CA   . LEU A 1 20 ? 0.083   -1.400  1.743   1.00 0.00 ? 20 LEU A CA   2  
ATOM 1649  C C    . LEU A 1 20 ? -0.932  -0.292  1.473   1.00 0.00 ? 20 LEU A C    2  
ATOM 1650  O O    . LEU A 1 20 ? -0.562  0.850   1.200   1.00 0.00 ? 20 LEU A O    2  
ATOM 1651  C CB   . LEU A 1 20 ? 0.223   -2.309  0.512   1.00 0.00 ? 20 LEU A CB   2  
ATOM 1652  C CG   . LEU A 1 20 ? 1.144   -1.792  -0.606  1.00 0.00 ? 20 LEU A CG   2  
ATOM 1653  C CD1  . LEU A 1 20 ? 0.530   -0.591  -1.311  1.00 0.00 ? 20 LEU A CD1  2  
ATOM 1654  C CD2  . LEU A 1 20 ? 2.521   -1.433  -0.060  1.00 0.00 ? 20 LEU A CD2  2  
ATOM 1655  H H    . LEU A 1 20 ? -0.465  -3.147  2.813   1.00 0.00 ? 20 LEU A H    2  
ATOM 1656  H HA   . LEU A 1 20 ? 1.030   -0.947  1.980   1.00 0.00 ? 20 LEU A HA   2  
ATOM 1657  H HB2  . LEU A 1 20 ? 0.623   -3.258  0.846   1.00 0.00 ? 20 LEU A HB2  2  
ATOM 1658  H HB3  . LEU A 1 20 ? -0.759  -2.492  0.091   1.00 0.00 ? 20 LEU A HB3  2  
ATOM 1659  H HG   . LEU A 1 20 ? 1.273   -2.574  -1.341  1.00 0.00 ? 20 LEU A HG   2  
ATOM 1660  H HD11 . LEU A 1 20 ? -0.525  -0.761  -1.485  1.00 0.00 ? 20 LEU A HD11 2  
ATOM 1661  H HD12 . LEU A 1 20 ? 1.024   -0.451  -2.261  1.00 0.00 ? 20 LEU A HD12 2  
ATOM 1662  H HD13 . LEU A 1 20 ? 0.657   0.299   -0.715  1.00 0.00 ? 20 LEU A HD13 2  
ATOM 1663  H HD21 . LEU A 1 20 ? 2.460   -0.545  0.553   1.00 0.00 ? 20 LEU A HD21 2  
ATOM 1664  H HD22 . LEU A 1 20 ? 3.192   -1.247  -0.886  1.00 0.00 ? 20 LEU A HD22 2  
ATOM 1665  H HD23 . LEU A 1 20 ? 2.907   -2.253  0.531   1.00 0.00 ? 20 LEU A HD23 2  
ATOM 1666  N N    . THR A 1 21 ? -2.213  -0.638  1.564   1.00 0.00 ? 21 THR A N    2  
ATOM 1667  C CA   . THR A 1 21 ? -3.284  0.327   1.346   1.00 0.00 ? 21 THR A CA   2  
ATOM 1668  C C    . THR A 1 21 ? -3.305  1.361   2.467   1.00 0.00 ? 21 THR A C    2  
ATOM 1669  O O    . THR A 1 21 ? -3.656  2.522   2.251   1.00 0.00 ? 21 THR A O    2  
ATOM 1670  C CB   . THR A 1 21 ? -4.660  -0.361  1.269   1.00 0.00 ? 21 THR A CB   2  
ATOM 1671  O OG1  . THR A 1 21 ? -4.651  -1.362  0.246   1.00 0.00 ? 21 THR A OG1  2  
ATOM 1672  C CG2  . THR A 1 21 ? -5.760  0.651   0.979   1.00 0.00 ? 21 THR A CG2  2  
ATOM 1673  H H    . THR A 1 21 ? -2.452  -1.567  1.792   1.00 0.00 ? 21 THR A H    2  
ATOM 1674  H HA   . THR A 1 21 ? -3.102  0.832   0.404   1.00 0.00 ? 21 THR A HA   2  
ATOM 1675  H HB   . THR A 1 21 ? -4.869  -0.836  2.219   1.00 0.00 ? 21 THR A HB   2  
ATOM 1676  H HG1  . THR A 1 21 ? -4.446  -0.975  -0.616  1.00 0.00 ? 21 THR A HG1  2  
ATOM 1677  H HG21 . THR A 1 21 ? -5.468  1.291   0.156   1.00 0.00 ? 21 THR A HG21 2  
ATOM 1678  H HG22 . THR A 1 21 ? -5.943  1.253   1.857   1.00 0.00 ? 21 THR A HG22 2  
ATOM 1679  H HG23 . THR A 1 21 ? -6.665  0.124   0.715   1.00 0.00 ? 21 THR A HG23 2  
ATOM 1680  N N    . ILE A 1 22 ? -2.927  0.926   3.665   1.00 0.00 ? 22 ILE A N    2  
ATOM 1681  C CA   . ILE A 1 22 ? -2.891  1.810   4.823   1.00 0.00 ? 22 ILE A CA   2  
ATOM 1682  C C    . ILE A 1 22 ? -1.798  2.859   4.667   1.00 0.00 ? 22 ILE A C    2  
ATOM 1683  O O    . ILE A 1 22 ? -1.983  4.021   5.029   1.00 0.00 ? 22 ILE A O    2  
ATOM 1684  C CB   . ILE A 1 22 ? -2.650  1.023   6.128   1.00 0.00 ? 22 ILE A CB   2  
ATOM 1685  C CG1  . ILE A 1 22 ? -3.753  -0.021  6.340   1.00 0.00 ? 22 ILE A CG1  2  
ATOM 1686  C CG2  . ILE A 1 22 ? -2.573  1.971   7.317   1.00 0.00 ? 22 ILE A CG2  2  
ATOM 1687  C CD1  . ILE A 1 22 ? -5.138  0.573   6.495   1.00 0.00 ? 22 ILE A CD1  2  
ATOM 1688  H H    . ILE A 1 22 ? -2.664  -0.011  3.782   1.00 0.00 ? 22 ILE A H    2  
ATOM 1689  H HA   . ILE A 1 22 ? -3.842  2.320   4.896   1.00 0.00 ? 22 ILE A HA   2  
ATOM 1690  H HB   . ILE A 1 22 ? -1.702  0.516   6.052   1.00 0.00 ? 22 ILE A HB   2  
ATOM 1691  H HG12 . ILE A 1 22 ? -3.780  -0.686  5.505   1.00 0.00 ? 22 ILE A HG12 2  
ATOM 1692  H HG13 . ILE A 1 22 ? -3.537  -0.589  7.234   1.00 0.00 ? 22 ILE A HG13 2  
ATOM 1693  H HG21 . ILE A 1 22 ? -1.653  2.535   7.278   1.00 0.00 ? 22 ILE A HG21 2  
ATOM 1694  H HG22 . ILE A 1 22 ? -2.593  1.404   8.239   1.00 0.00 ? 22 ILE A HG22 2  
ATOM 1695  H HG23 . ILE A 1 22 ? -3.413  2.653   7.302   1.00 0.00 ? 22 ILE A HG23 2  
ATOM 1696  H HD11 . ILE A 1 22 ? -5.841  -0.219  6.707   1.00 0.00 ? 22 ILE A HD11 2  
ATOM 1697  H HD12 . ILE A 1 22 ? -5.428  1.066   5.581   1.00 0.00 ? 22 ILE A HD12 2  
ATOM 1698  H HD13 . ILE A 1 22 ? -5.149  1.282   7.308   1.00 0.00 ? 22 ILE A HD13 2  
ATOM 1699  N N    . ILE A 1 23 ? -0.661  2.440   4.122   1.00 0.00 ? 23 ILE A N    2  
ATOM 1700  C CA   . ILE A 1 23 ? 0.463   3.343   3.917   1.00 0.00 ? 23 ILE A CA   2  
ATOM 1701  C C    . ILE A 1 23 ? 0.111   4.434   2.910   1.00 0.00 ? 23 ILE A C    2  
ATOM 1702  O O    . ILE A 1 23 ? 0.333   5.620   3.162   1.00 0.00 ? 23 ILE A O    2  
ATOM 1703  C CB   . ILE A 1 23 ? 1.717   2.592   3.427   1.00 0.00 ? 23 ILE A CB   2  
ATOM 1704  C CG1  . ILE A 1 23 ? 2.155   1.551   4.460   1.00 0.00 ? 23 ILE A CG1  2  
ATOM 1705  C CG2  . ILE A 1 23 ? 2.846   3.574   3.146   1.00 0.00 ? 23 ILE A CG2  2  
ATOM 1706  C CD1  . ILE A 1 23 ? 2.561   2.141   5.797   1.00 0.00 ? 23 ILE A CD1  2  
ATOM 1707  H H    . ILE A 1 23 ? -0.568  1.498   3.849   1.00 0.00 ? 23 ILE A H    2  
ATOM 1708  H HA   . ILE A 1 23 ? 0.690   3.819   4.861   1.00 0.00 ? 23 ILE A HA   2  
ATOM 1709  H HB   . ILE A 1 23 ? 1.473   2.088   2.503   1.00 0.00 ? 23 ILE A HB   2  
ATOM 1710  H HG12 . ILE A 1 23 ? 1.355   0.867   4.641   1.00 0.00 ? 23 ILE A HG12 2  
ATOM 1711  H HG13 . ILE A 1 23 ? 3.002   1.003   4.071   1.00 0.00 ? 23 ILE A HG13 2  
ATOM 1712  H HG21 . ILE A 1 23 ? 3.781   3.038   3.041   1.00 0.00 ? 23 ILE A HG21 2  
ATOM 1713  H HG22 . ILE A 1 23 ? 2.935   4.285   3.956   1.00 0.00 ? 23 ILE A HG22 2  
ATOM 1714  H HG23 . ILE A 1 23 ? 2.646   4.104   2.226   1.00 0.00 ? 23 ILE A HG23 2  
ATOM 1715  H HD11 . ILE A 1 23 ? 3.581   1.855   6.014   1.00 0.00 ? 23 ILE A HD11 2  
ATOM 1716  H HD12 . ILE A 1 23 ? 1.915   1.749   6.568   1.00 0.00 ? 23 ILE A HD12 2  
ATOM 1717  H HD13 . ILE A 1 23 ? 2.489   3.219   5.794   1.00 0.00 ? 23 ILE A HD13 2  
ATOM 1718  N N    . SER A 1 24 ? -0.444  4.026   1.771   1.00 0.00 ? 24 SER A N    2  
ATOM 1719  C CA   . SER A 1 24 ? -0.822  4.964   0.718   1.00 0.00 ? 24 SER A CA   2  
ATOM 1720  C C    . SER A 1 24 ? -2.010  5.825   1.142   1.00 0.00 ? 24 SER A C    2  
ATOM 1721  O O    . SER A 1 24 ? -2.212  6.918   0.615   1.00 0.00 ? 24 SER A O    2  
ATOM 1722  C CB   . SER A 1 24 ? -1.160  4.213   -0.571  1.00 0.00 ? 24 SER A CB   2  
ATOM 1723  O OG   . SER A 1 24 ? -2.301  3.389   -0.400  1.00 0.00 ? 24 SER A OG   2  
ATOM 1724  H H    . SER A 1 24 ? -0.601  3.061   1.630   1.00 0.00 ? 24 SER A H    2  
ATOM 1725  H HA   . SER A 1 24 ? 0.023   5.614   0.525   1.00 0.00 ? 24 SER A HA   2  
ATOM 1726  H HB2  . SER A 1 24 ? -1.358  4.922   -1.362  1.00 0.00 ? 24 SER A HB2  2  
ATOM 1727  H HB3  . SER A 1 24 ? -0.322  3.591   -0.850  1.00 0.00 ? 24 SER A HB3  2  
ATOM 1728  H HG   . SER A 1 24 ? -2.581  3.049   -1.253  1.00 0.00 ? 24 SER A HG   2  
ATOM 1729  N N    . LEU A 1 25 ? -2.797  5.324   2.088   1.00 0.00 ? 25 LEU A N    2  
ATOM 1730  C CA   . LEU A 1 25 ? -3.961  6.054   2.577   1.00 0.00 ? 25 LEU A CA   2  
ATOM 1731  C C    . LEU A 1 25 ? -3.538  7.318   3.314   1.00 0.00 ? 25 LEU A C    2  
ATOM 1732  O O    . LEU A 1 25 ? -4.073  8.400   3.072   1.00 0.00 ? 25 LEU A O    2  
ATOM 1733  C CB   . LEU A 1 25 ? -4.803  5.167   3.498   1.00 0.00 ? 25 LEU A CB   2  
ATOM 1734  C CG   . LEU A 1 25 ? -6.063  5.829   4.066   1.00 0.00 ? 25 LEU A CG   2  
ATOM 1735  C CD1  . LEU A 1 25 ? -7.011  6.230   2.946   1.00 0.00 ? 25 LEU A CD1  2  
ATOM 1736  C CD2  . LEU A 1 25 ? -6.757  4.896   5.047   1.00 0.00 ? 25 LEU A CD2  2  
ATOM 1737  H H    . LEU A 1 25 ? -2.602  4.440   2.473   1.00 0.00 ? 25 LEU A H    2  
ATOM 1738  H HA   . LEU A 1 25 ? -4.559  6.336   1.722   1.00 0.00 ? 25 LEU A HA   2  
ATOM 1739  H HB2  . LEU A 1 25 ? -5.102  4.292   2.940   1.00 0.00 ? 25 LEU A HB2  2  
ATOM 1740  H HB3  . LEU A 1 25 ? -4.181  4.851   4.323   1.00 0.00 ? 25 LEU A HB3  2  
ATOM 1741  H HG   . LEU A 1 25 ? -5.789  6.724   4.604   1.00 0.00 ? 25 LEU A HG   2  
ATOM 1742  H HD11 . LEU A 1 25 ? -7.272  5.360   2.359   1.00 0.00 ? 25 LEU A HD11 2  
ATOM 1743  H HD12 . LEU A 1 25 ? -6.536  6.963   2.311   1.00 0.00 ? 25 LEU A HD12 2  
ATOM 1744  H HD13 . LEU A 1 25 ? -7.910  6.659   3.367   1.00 0.00 ? 25 LEU A HD13 2  
ATOM 1745  H HD21 . LEU A 1 25 ? -6.078  4.644   5.850   1.00 0.00 ? 25 LEU A HD21 2  
ATOM 1746  H HD22 . LEU A 1 25 ? -7.062  3.992   4.538   1.00 0.00 ? 25 LEU A HD22 2  
ATOM 1747  H HD23 . LEU A 1 25 ? -7.628  5.386   5.460   1.00 0.00 ? 25 LEU A HD23 2  
ATOM 1748  N N    . ILE A 1 26 ? -2.571  7.174   4.217   1.00 0.00 ? 26 ILE A N    2  
ATOM 1749  C CA   . ILE A 1 26 ? -2.072  8.305   4.991   1.00 0.00 ? 26 ILE A CA   2  
ATOM 1750  C C    . ILE A 1 26 ? -1.466  9.366   4.078   1.00 0.00 ? 26 ILE A C    2  
ATOM 1751  O O    . ILE A 1 26 ? -1.646  10.564  4.297   1.00 0.00 ? 26 ILE A O    2  
ATOM 1752  C CB   . ILE A 1 26 ? -1.012  7.859   6.021   1.00 0.00 ? 26 ILE A CB   2  
ATOM 1753  C CG1  . ILE A 1 26 ? -1.594  6.802   6.969   1.00 0.00 ? 26 ILE A CG1  2  
ATOM 1754  C CG2  . ILE A 1 26 ? -0.488  9.054   6.805   1.00 0.00 ? 26 ILE A CG2  2  
ATOM 1755  C CD1  . ILE A 1 26 ? -2.739  7.308   7.823   1.00 0.00 ? 26 ILE A CD1  2  
ATOM 1756  H H    . ILE A 1 26 ? -2.179  6.282   4.360   1.00 0.00 ? 26 ILE A H    2  
ATOM 1757  H HA   . ILE A 1 26 ? -2.904  8.748   5.521   1.00 0.00 ? 26 ILE A HA   2  
ATOM 1758  H HB   . ILE A 1 26 ? -0.180  7.423   5.484   1.00 0.00 ? 26 ILE A HB   2  
ATOM 1759  H HG12 . ILE A 1 26 ? -1.955  5.964   6.404   1.00 0.00 ? 26 ILE A HG12 2  
ATOM 1760  H HG13 . ILE A 1 26 ? -0.815  6.462   7.636   1.00 0.00 ? 26 ILE A HG13 2  
ATOM 1761  H HG21 . ILE A 1 26 ? 0.117   9.677   6.164   1.00 0.00 ? 26 ILE A HG21 2  
ATOM 1762  H HG22 . ILE A 1 26 ? 0.121   8.710   7.631   1.00 0.00 ? 26 ILE A HG22 2  
ATOM 1763  H HG23 . ILE A 1 26 ? -1.316  9.633   7.192   1.00 0.00 ? 26 ILE A HG23 2  
ATOM 1764  H HD11 . ILE A 1 26 ? -2.415  8.150   8.415   1.00 0.00 ? 26 ILE A HD11 2  
ATOM 1765  H HD12 . ILE A 1 26 ? -3.065  6.517   8.482   1.00 0.00 ? 26 ILE A HD12 2  
ATOM 1766  H HD13 . ILE A 1 26 ? -3.562  7.605   7.193   1.00 0.00 ? 26 ILE A HD13 2  
ATOM 1767  N N    . ILE A 1 27 ? -0.749  8.918   3.052   1.00 0.00 ? 27 ILE A N    2  
ATOM 1768  C CA   . ILE A 1 27 ? -0.111  9.825   2.107   1.00 0.00 ? 27 ILE A CA   2  
ATOM 1769  C C    . ILE A 1 27 ? -1.142  10.526  1.230   1.00 0.00 ? 27 ILE A C    2  
ATOM 1770  O O    . ILE A 1 27 ? -0.982  11.696  0.882   1.00 0.00 ? 27 ILE A O    2  
ATOM 1771  C CB   . ILE A 1 27 ? 0.889   9.081   1.200   1.00 0.00 ? 27 ILE A CB   2  
ATOM 1772  C CG1  . ILE A 1 27 ? 1.851   8.233   2.040   1.00 0.00 ? 27 ILE A CG1  2  
ATOM 1773  C CG2  . ILE A 1 27 ? 1.659   10.070  0.335   1.00 0.00 ? 27 ILE A CG2  2  
ATOM 1774  C CD1  . ILE A 1 27 ? 2.623   9.022   3.077   1.00 0.00 ? 27 ILE A CD1  2  
ATOM 1775  H H    . ILE A 1 27 ? -0.651  7.948   2.924   1.00 0.00 ? 27 ILE A H    2  
ATOM 1776  H HA   . ILE A 1 27 ? 0.429   10.576  2.670   1.00 0.00 ? 27 ILE A HA   2  
ATOM 1777  H HB   . ILE A 1 27 ? 0.334   8.424   0.542   1.00 0.00 ? 27 ILE A HB   2  
ATOM 1778  H HG12 . ILE A 1 27 ? 1.304   7.477   2.554   1.00 0.00 ? 27 ILE A HG12 2  
ATOM 1779  H HG13 . ILE A 1 27 ? 2.571   7.758   1.387   1.00 0.00 ? 27 ILE A HG13 2  
ATOM 1780  H HG21 . ILE A 1 27 ? 2.440   9.551   -0.205  1.00 0.00 ? 27 ILE A HG21 2  
ATOM 1781  H HG22 . ILE A 1 27 ? 2.104   10.835  0.955   1.00 0.00 ? 27 ILE A HG22 2  
ATOM 1782  H HG23 . ILE A 1 27 ? 0.990   10.531  -0.376  1.00 0.00 ? 27 ILE A HG23 2  
ATOM 1783  H HD11 . ILE A 1 27 ? 3.359   8.378   3.536   1.00 0.00 ? 27 ILE A HD11 2  
ATOM 1784  H HD12 . ILE A 1 27 ? 1.946   9.383   3.836   1.00 0.00 ? 27 ILE A HD12 2  
ATOM 1785  H HD13 . ILE A 1 27 ? 3.123   9.857   2.612   1.00 0.00 ? 27 ILE A HD13 2  
ATOM 1786  N N    . LEU A 1 28 ? -2.196  9.800   0.869   1.00 0.00 ? 28 LEU A N    2  
ATOM 1787  C CA   . LEU A 1 28 ? -3.251  10.348  0.026   1.00 0.00 ? 28 LEU A CA   2  
ATOM 1788  C C    . LEU A 1 28 ? -3.863  11.601  0.647   1.00 0.00 ? 28 LEU A C    2  
ATOM 1789  O O    . LEU A 1 28 ? -3.986  12.634  -0.010  1.00 0.00 ? 28 LEU A O    2  
ATOM 1790  C CB   . LEU A 1 28 ? -4.342  9.301   -0.207  1.00 0.00 ? 28 LEU A CB   2  
ATOM 1791  C CG   . LEU A 1 28 ? -5.492  9.753   -1.107  1.00 0.00 ? 28 LEU A CG   2  
ATOM 1792  C CD1  . LEU A 1 28 ? -5.000  9.991   -2.527  1.00 0.00 ? 28 LEU A CD1  2  
ATOM 1793  C CD2  . LEU A 1 28 ? -6.614  8.725   -1.093  1.00 0.00 ? 28 LEU A CD2  2  
ATOM 1794  H H    . LEU A 1 28 ? -2.268  8.863   1.168   1.00 0.00 ? 28 LEU A H    2  
ATOM 1795  H HA   . LEU A 1 28 ? -2.812  10.611  -0.925  1.00 0.00 ? 28 LEU A HA   2  
ATOM 1796  H HB2  . LEU A 1 28 ? -3.882  8.424   -0.645  1.00 0.00 ? 28 LEU A HB2  2  
ATOM 1797  H HB3  . LEU A 1 28 ? -4.749  9.024   0.757   1.00 0.00 ? 28 LEU A HB3  2  
ATOM 1798  H HG   . LEU A 1 28 ? -5.898  10.683  -0.739  1.00 0.00 ? 28 LEU A HG   2  
ATOM 1799  H HD11 . LEU A 1 28 ? -5.828  10.298  -3.152  1.00 0.00 ? 28 LEU A HD11 2  
ATOM 1800  H HD12 . LEU A 1 28 ? -4.572  9.080   -2.923  1.00 0.00 ? 28 LEU A HD12 2  
ATOM 1801  H HD13 . LEU A 1 28 ? -4.251  10.769  -2.527  1.00 0.00 ? 28 LEU A HD13 2  
ATOM 1802  H HD21 . LEU A 1 28 ? -6.969  8.589   -0.080  1.00 0.00 ? 28 LEU A HD21 2  
ATOM 1803  H HD22 . LEU A 1 28 ? -6.250  7.781   -1.475  1.00 0.00 ? 28 LEU A HD22 2  
ATOM 1804  H HD23 . LEU A 1 28 ? -7.431  9.071   -1.712  1.00 0.00 ? 28 LEU A HD23 2  
ATOM 1805  N N    . ILE A 1 29 ? -4.248  11.501  1.916   1.00 0.00 ? 29 ILE A N    2  
ATOM 1806  C CA   . ILE A 1 29 ? -4.855  12.623  2.622   1.00 0.00 ? 29 ILE A CA   2  
ATOM 1807  C C    . ILE A 1 29 ? -3.815  13.685  2.971   1.00 0.00 ? 29 ILE A C    2  
ATOM 1808  O O    . ILE A 1 29 ? -4.090  14.883  2.888   1.00 0.00 ? 29 ILE A O    2  
ATOM 1809  C CB   . ILE A 1 29 ? -5.577  12.158  3.910   1.00 0.00 ? 29 ILE A CB   2  
ATOM 1810  C CG1  . ILE A 1 29 ? -6.871  11.413  3.568   1.00 0.00 ? 29 ILE A CG1  2  
ATOM 1811  C CG2  . ILE A 1 29 ? -5.879  13.344  4.817   1.00 0.00 ? 29 ILE A CG2  2  
ATOM 1812  C CD1  . ILE A 1 29 ? -6.652  10.064  2.916   1.00 0.00 ? 29 ILE A CD1  2  
ATOM 1813  H H    . ILE A 1 29 ? -4.115  10.649  2.393   1.00 0.00 ? 29 ILE A H    2  
ATOM 1814  H HA   . ILE A 1 29 ? -5.593  13.071  1.968   1.00 0.00 ? 29 ILE A HA   2  
ATOM 1815  H HB   . ILE A 1 29 ? -4.915  11.493  4.446   1.00 0.00 ? 29 ILE A HB   2  
ATOM 1816  H HG12 . ILE A 1 29 ? -7.435  11.239  4.475   1.00 0.00 ? 29 ILE A HG12 2  
ATOM 1817  H HG13 . ILE A 1 29 ? -7.466  12.015  2.894   1.00 0.00 ? 29 ILE A HG13 2  
ATOM 1818  H HG21 . ILE A 1 29 ? -6.238  14.179  4.234   1.00 0.00 ? 29 ILE A HG21 2  
ATOM 1819  H HG22 . ILE A 1 29 ? -4.982  13.634  5.345   1.00 0.00 ? 29 ILE A HG22 2  
ATOM 1820  H HG23 . ILE A 1 29 ? -6.633  13.070  5.545   1.00 0.00 ? 29 ILE A HG23 2  
ATOM 1821  H HD11 . ILE A 1 29 ? -5.968  9.489   3.511   1.00 0.00 ? 29 ILE A HD11 2  
ATOM 1822  H HD12 . ILE A 1 29 ? -6.262  10.190  1.921   1.00 0.00 ? 29 ILE A HD12 2  
ATOM 1823  H HD13 . ILE A 1 29 ? -7.596  9.542   2.860   1.00 0.00 ? 29 ILE A HD13 2  
ATOM 1824  N N    . MET A 1 30 ? -2.622  13.245  3.363   1.00 0.00 ? 30 MET A N    2  
ATOM 1825  C CA   . MET A 1 30 ? -1.550  14.168  3.723   1.00 0.00 ? 30 MET A CA   2  
ATOM 1826  C C    . MET A 1 30 ? -1.230  15.104  2.561   1.00 0.00 ? 30 MET A C    2  
ATOM 1827  O O    . MET A 1 30 ? -1.025  16.302  2.757   1.00 0.00 ? 30 MET A O    2  
ATOM 1828  C CB   . MET A 1 30 ? -0.296  13.400  4.141   1.00 0.00 ? 30 MET A CB   2  
ATOM 1829  C CG   . MET A 1 30 ? 0.843   14.299  4.598   1.00 0.00 ? 30 MET A CG   2  
ATOM 1830  S SD   . MET A 1 30 ? 2.140   13.396  5.470   1.00 0.00 ? 30 MET A SD   2  
ATOM 1831  C CE   . MET A 1 30 ? 2.662   12.241  4.207   1.00 0.00 ? 30 MET A CE   2  
ATOM 1832  H H    . MET A 1 30 ? -2.454  12.275  3.418   1.00 0.00 ? 30 MET A H    2  
ATOM 1833  H HA   . MET A 1 30 ? -1.890  14.762  4.561   1.00 0.00 ? 30 MET A HA   2  
ATOM 1834  H HB2  . MET A 1 30 ? -0.564  12.736  4.952   1.00 0.00 ? 30 MET A HB2  2  
ATOM 1835  H HB3  . MET A 1 30 ? 0.051   12.808  3.305   1.00 0.00 ? 30 MET A HB3  2  
ATOM 1836  H HG2  . MET A 1 30 ? 1.278   14.773  3.731   1.00 0.00 ? 30 MET A HG2  2  
ATOM 1837  H HG3  . MET A 1 30 ? 0.450   15.058  5.262   1.00 0.00 ? 30 MET A HG3  2  
ATOM 1838  H HE1  . MET A 1 30 ? 1.850   11.571  3.978   1.00 0.00 ? 30 MET A HE1  2  
ATOM 1839  H HE2  . MET A 1 30 ? 3.507   11.672  4.566   1.00 0.00 ? 30 MET A HE2  2  
ATOM 1840  H HE3  . MET A 1 30 ? 2.944   12.784  3.317   1.00 0.00 ? 30 MET A HE3  2  
ATOM 1841  N N    . LEU A 1 31 ? -1.190  14.549  1.355   1.00 0.00 ? 31 LEU A N    2  
ATOM 1842  C CA   . LEU A 1 31 ? -0.906  15.339  0.163   1.00 0.00 ? 31 LEU A CA   2  
ATOM 1843  C C    . LEU A 1 31 ? -2.159  16.084  -0.280  1.00 0.00 ? 31 LEU A C    2  
ATOM 1844  O O    . LEU A 1 31 ? -2.081  17.122  -0.939  1.00 0.00 ? 31 LEU A O    2  
ATOM 1845  C CB   . LEU A 1 31 ? -0.400  14.442  -0.970  1.00 0.00 ? 31 LEU A CB   2  
ATOM 1846  C CG   . LEU A 1 31 ? 0.003   15.176  -2.252  1.00 0.00 ? 31 LEU A CG   2  
ATOM 1847  C CD1  . LEU A 1 31 ? 1.225   16.050  -2.010  1.00 0.00 ? 31 LEU A CD1  2  
ATOM 1848  C CD2  . LEU A 1 31 ? 0.269   14.182  -3.373  1.00 0.00 ? 31 LEU A CD2  2  
ATOM 1849  H H    . LEU A 1 31 ? -1.362  13.583  1.255   1.00 0.00 ? 31 LEU A H    2  
ATOM 1850  H HA   . LEU A 1 31 ? -0.138  16.062  0.406   1.00 0.00 ? 31 LEU A HA   2  
ATOM 1851  H HB2  . LEU A 1 31 ? 0.455   13.887  -0.605  1.00 0.00 ? 31 LEU A HB2  2  
ATOM 1852  H HB3  . LEU A 1 31 ? -1.184  13.734  -1.211  1.00 0.00 ? 31 LEU A HB3  2  
ATOM 1853  H HG   . LEU A 1 31 ? -0.804  15.818  -2.570  1.00 0.00 ? 31 LEU A HG   2  
ATOM 1854  H HD11 . LEU A 1 31 ? 0.998   16.792  -1.260  1.00 0.00 ? 31 LEU A HD11 2  
ATOM 1855  H HD12 . LEU A 1 31 ? 1.502   16.550  -2.929  1.00 0.00 ? 31 LEU A HD12 2  
ATOM 1856  H HD13 . LEU A 1 31 ? 2.051   15.438  -1.673  1.00 0.00 ? 31 LEU A HD13 2  
ATOM 1857  H HD21 . LEU A 1 31 ? 0.525   14.716  -4.278  1.00 0.00 ? 31 LEU A HD21 2  
ATOM 1858  H HD22 . LEU A 1 31 ? -0.618  13.589  -3.550  1.00 0.00 ? 31 LEU A HD22 2  
ATOM 1859  H HD23 . LEU A 1 31 ? 1.087   13.530  -3.097  1.00 0.00 ? 31 LEU A HD23 2  
ATOM 1860  N N    . TRP A 1 32 ? -3.315  15.543  0.090   1.00 0.00 ? 32 TRP A N    2  
ATOM 1861  C CA   . TRP A 1 32 ? -4.594  16.150  -0.256  1.00 0.00 ? 32 TRP A CA   2  
ATOM 1862  C C    . TRP A 1 32 ? -4.756  17.493  0.446   1.00 0.00 ? 32 TRP A C    2  
ATOM 1863  O O    . TRP A 1 32 ? -5.463  18.379  -0.035  1.00 0.00 ? 32 TRP A O    2  
ATOM 1864  C CB   . TRP A 1 32 ? -5.740  15.209  0.127   1.00 0.00 ? 32 TRP A CB   2  
ATOM 1865  C CG   . TRP A 1 32 ? -7.101  15.795  -0.098  1.00 0.00 ? 32 TRP A CG   2  
ATOM 1866  C CD1  . TRP A 1 32 ? -7.593  16.308  -1.263  1.00 0.00 ? 32 TRP A CD1  2  
ATOM 1867  C CD2  . TRP A 1 32 ? -8.147  15.924  0.872   1.00 0.00 ? 32 TRP A CD2  2  
ATOM 1868  N NE1  . TRP A 1 32 ? -8.879  16.754  -1.076  1.00 0.00 ? 32 TRP A NE1  2  
ATOM 1869  C CE2  . TRP A 1 32 ? -9.242  16.529  0.225   1.00 0.00 ? 32 TRP A CE2  2  
ATOM 1870  C CE3  . TRP A 1 32 ? -8.264  15.590  2.223   1.00 0.00 ? 32 TRP A CE3  2  
ATOM 1871  C CZ2  . TRP A 1 32 ? -10.437 16.805  0.885   1.00 0.00 ? 32 TRP A CZ2  2  
ATOM 1872  C CZ3  . TRP A 1 32 ? -9.452  15.863  2.877   1.00 0.00 ? 32 TRP A CZ3  2  
ATOM 1873  C CH2  . TRP A 1 32 ? -10.524 16.465  2.207   1.00 0.00 ? 32 TRP A CH2  2  
ATOM 1874  H H    . TRP A 1 32 ? -3.319  14.712  0.604   1.00 0.00 ? 32 TRP A H    2  
ATOM 1875  H HA   . TRP A 1 32 ? -4.617  16.310  -1.326  1.00 0.00 ? 32 TRP A HA   2  
ATOM 1876  H HB2  . TRP A 1 32 ? -5.670  14.310  -0.462  1.00 0.00 ? 32 TRP A HB2  2  
ATOM 1877  H HB3  . TRP A 1 32 ? -5.654  14.960  1.166   1.00 0.00 ? 32 TRP A HB3  2  
ATOM 1878  H HD1  . TRP A 1 32 ? -7.039  16.354  -2.189  1.00 0.00 ? 32 TRP A HD1  2  
ATOM 1879  H HE1  . TRP A 1 32 ? -9.444  17.165  -1.763  1.00 0.00 ? 32 TRP A HE1  2  
ATOM 1880  H HE3  . TRP A 1 32 ? -7.450  15.127  2.754   1.00 0.00 ? 32 TRP A HE3  2  
ATOM 1881  H HZ2  . TRP A 1 32 ? -11.273 17.268  0.383   1.00 0.00 ? 32 TRP A HZ2  2  
ATOM 1882  H HZ3  . TRP A 1 32 ? -9.561  15.611  3.921   1.00 0.00 ? 32 TRP A HZ3  2  
ATOM 1883  H HH2  . TRP A 1 32 ? -11.433 16.660  2.757   1.00 0.00 ? 32 TRP A HH2  2  
ATOM 1884  N N    . GLN A 1 33 ? -4.090  17.638  1.588   1.00 0.00 ? 33 GLN A N    2  
ATOM 1885  C CA   . GLN A 1 33 ? -4.152  18.870  2.362   1.00 0.00 ? 33 GLN A CA   2  
ATOM 1886  C C    . GLN A 1 33 ? -2.879  19.689  2.177   1.00 0.00 ? 33 GLN A C    2  
ATOM 1887  O O    . GLN A 1 33 ? -2.654  20.674  2.880   1.00 0.00 ? 33 GLN A O    2  
ATOM 1888  C CB   . GLN A 1 33 ? -4.367  18.556  3.843   1.00 0.00 ? 33 GLN A CB   2  
ATOM 1889  C CG   . GLN A 1 33 ? -5.707  17.902  4.136   1.00 0.00 ? 33 GLN A CG   2  
ATOM 1890  C CD   . GLN A 1 33 ? -6.880  18.766  3.712   1.00 0.00 ? 33 GLN A CD   2  
ATOM 1891  O OE1  . GLN A 1 33 ? -7.386  19.572  4.494   1.00 0.00 ? 33 GLN A OE1  2  
ATOM 1892  N NE2  . GLN A 1 33 ? -7.316  18.603  2.469   1.00 0.00 ? 33 GLN A NE2  2  
ATOM 1893  H H    . GLN A 1 33 ? -3.537  16.903  1.936   1.00 0.00 ? 33 GLN A H    2  
ATOM 1894  H HA   . GLN A 1 33 ? -4.976  19.474  2.009   1.00 0.00 ? 33 GLN A HA   2  
ATOM 1895  H HB2  . GLN A 1 33 ? -3.586  17.887  4.174   1.00 0.00 ? 33 GLN A HB2  2  
ATOM 1896  H HB3  . GLN A 1 33 ? -4.309  19.473  4.416   1.00 0.00 ? 33 GLN A HB3  2  
ATOM 1897  H HG2  . GLN A 1 33 ? -5.757  16.959  3.610   1.00 0.00 ? 33 GLN A HG2  2  
ATOM 1898  H HG3  . GLN A 1 33 ? -5.778  17.722  5.199   1.00 0.00 ? 33 GLN A HG3  2  
ATOM 1899  H HE21 . GLN A 1 33 ? -6.873  17.956  1.897   1.00 0.00 ? 33 GLN A HE21 2  
ATOM 1900  H HE22 . GLN A 1 33 ? -8.076  19.148  2.176   1.00 0.00 ? 33 GLN A HE22 2  
ATOM 1901  N N    . LYS A 1 34 ? -2.047  19.273  1.226   1.00 0.00 ? 34 LYS A N    2  
ATOM 1902  C CA   . LYS A 1 34 ? -0.798  19.971  0.940   1.00 0.00 ? 34 LYS A CA   2  
ATOM 1903  C C    . LYS A 1 34 ? -0.835  20.583  -0.457  1.00 0.00 ? 34 LYS A C    2  
ATOM 1904  O O    . LYS A 1 34 ? -1.397  20.000  -1.385  1.00 0.00 ? 34 LYS A O    2  
ATOM 1905  C CB   . LYS A 1 34 ? 0.390   19.013  1.060   1.00 0.00 ? 34 LYS A CB   2  
ATOM 1906  C CG   . LYS A 1 34 ? 1.737   19.687  0.851   1.00 0.00 ? 34 LYS A CG   2  
ATOM 1907  C CD   . LYS A 1 34 ? 2.062   20.653  1.979   1.00 0.00 ? 34 LYS A CD   2  
ATOM 1908  C CE   . LYS A 1 34 ? 3.303   21.476  1.669   1.00 0.00 ? 34 LYS A CE   2  
ATOM 1909  N NZ   . LYS A 1 34 ? 4.490   20.614  1.414   1.00 0.00 ? 34 LYS A NZ   2  
ATOM 1910  H H    . LYS A 1 34 ? -2.260  18.496  0.688   1.00 0.00 ? 34 LYS A H    2  
ATOM 1911  H HA   . LYS A 1 34 ? -0.673  20.768  1.660   1.00 0.00 ? 34 LYS A HA   2  
ATOM 1912  H HB2  . LYS A 1 34 ? 0.377   18.562  2.043   1.00 0.00 ? 34 LYS A HB2  2  
ATOM 1913  H HB3  . LYS A 1 34 ? 0.286   18.231  0.320   1.00 0.00 ? 34 LYS A HB3  2  
ATOM 1914  H HG2  . LYS A 1 34 ? 2.499   18.922  0.828   1.00 0.00 ? 34 LYS A HG2  2  
ATOM 1915  H HG3  . LYS A 1 34 ? 1.740   20.215  -0.090  1.00 0.00 ? 34 LYS A HG3  2  
ATOM 1916  H HD2  . LYS A 1 34 ? 1.239   21.333  2.129   1.00 0.00 ? 34 LYS A HD2  2  
ATOM 1917  H HD3  . LYS A 1 34 ? 2.235   20.089  2.883   1.00 0.00 ? 34 LYS A HD3  2  
ATOM 1918  H HE2  . LYS A 1 34 ? 3.113   22.080  0.794   1.00 0.00 ? 34 LYS A HE2  2  
ATOM 1919  H HE3  . LYS A 1 34 ? 3.511   22.120  2.511   1.00 0.00 ? 34 LYS A HE3  2  
ATOM 1920  H HZ1  . LYS A 1 34 ? 4.610   19.917  2.180   1.00 0.00 ? 34 LYS A HZ1  2  
ATOM 1921  H HZ2  . LYS A 1 34 ? 5.347   21.201  1.365   1.00 0.00 ? 34 LYS A HZ2  2  
ATOM 1922  H HZ3  . LYS A 1 34 ? 4.384   20.109  0.511   1.00 0.00 ? 34 LYS A HZ3  2  
ATOM 1923  N N    . LYS A 1 35 ? -0.233  21.760  -0.599  1.00 0.00 ? 35 LYS A N    2  
ATOM 1924  C CA   . LYS A 1 35 ? -0.198  22.453  -1.883  1.00 0.00 ? 35 LYS A CA   2  
ATOM 1925  C C    . LYS A 1 35 ? 0.591   21.647  -2.919  1.00 0.00 ? 35 LYS A C    2  
ATOM 1926  O O    . LYS A 1 35 ? 1.801   21.472  -2.781  1.00 0.00 ? 35 LYS A O    2  
ATOM 1927  C CB   . LYS A 1 35 ? 0.432   23.839  -1.718  1.00 0.00 ? 35 LYS A CB   2  
ATOM 1928  C CG   . LYS A 1 35 ? 0.324   24.713  -2.959  1.00 0.00 ? 35 LYS A CG   2  
ATOM 1929  C CD   . LYS A 1 35 ? -1.121  25.085  -3.255  1.00 0.00 ? 35 LYS A CD   2  
ATOM 1930  C CE   . LYS A 1 35 ? -1.227  25.973  -4.487  1.00 0.00 ? 35 LYS A CE   2  
ATOM 1931  N NZ   . LYS A 1 35 ? -2.636  26.362  -4.770  1.00 0.00 ? 35 LYS A NZ   2  
ATOM 1932  H H    . LYS A 1 35 ? 0.202   22.176  0.184   1.00 0.00 ? 35 LYS A H    2  
ATOM 1933  H HA   . LYS A 1 35 ? -1.217  22.580  -2.197  1.00 0.00 ? 35 LYS A HA   2  
ATOM 1934  H HB2  . LYS A 1 35 ? -0.057  24.347  -0.897  1.00 0.00 ? 35 LYS A HB2  2  
ATOM 1935  H HB3  . LYS A 1 35 ? 1.481   23.725  -1.475  1.00 0.00 ? 35 LYS A HB3  2  
ATOM 1936  H HG2  . LYS A 1 35 ? 0.890   25.619  -2.791  1.00 0.00 ? 35 LYS A HG2  2  
ATOM 1937  H HG3  . LYS A 1 35 ? 0.737   24.186  -3.808  1.00 0.00 ? 35 LYS A HG3  2  
ATOM 1938  H HD2  . LYS A 1 35 ? -1.692  24.188  -3.433  1.00 0.00 ? 35 LYS A HD2  2  
ATOM 1939  H HD3  . LYS A 1 35 ? -1.532  25.615  -2.407  1.00 0.00 ? 35 LYS A HD3  2  
ATOM 1940  H HE2  . LYS A 1 35 ? -0.645  26.869  -4.326  1.00 0.00 ? 35 LYS A HE2  2  
ATOM 1941  H HE3  . LYS A 1 35 ? -0.834  25.437  -5.340  1.00 0.00 ? 35 LYS A HE3  2  
ATOM 1942  H HZ1  . LYS A 1 35 ? -2.673  26.968  -5.615  1.00 0.00 ? 35 LYS A HZ1  2  
ATOM 1943  H HZ2  . LYS A 1 35 ? -3.035  26.889  -3.966  1.00 0.00 ? 35 LYS A HZ2  2  
ATOM 1944  H HZ3  . LYS A 1 35 ? -3.218  25.515  -4.940  1.00 0.00 ? 35 LYS A HZ3  2  
ATOM 1945  N N    . PRO A 1 36 ? -0.083  21.139  -3.974  1.00 0.00 ? 36 PRO A N    2  
ATOM 1946  C CA   . PRO A 1 36 ? 0.580   20.355  -5.024  1.00 0.00 ? 36 PRO A CA   2  
ATOM 1947  C C    . PRO A 1 36 ? 1.705   21.132  -5.697  1.00 0.00 ? 36 PRO A C    2  
ATOM 1948  O O    . PRO A 1 36 ? 1.736   22.362  -5.654  1.00 0.00 ? 36 PRO A O    2  
ATOM 1949  C CB   . PRO A 1 36 ? -0.541  20.066  -6.028  1.00 0.00 ? 36 PRO A CB   2  
ATOM 1950  C CG   . PRO A 1 36 ? -1.800  20.209  -5.247  1.00 0.00 ? 36 PRO A CG   2  
ATOM 1951  C CD   . PRO A 1 36 ? -1.528  21.278  -4.226  1.00 0.00 ? 36 PRO A CD   2  
ATOM 1952  H HA   . PRO A 1 36 ? 0.966   19.424  -4.633  1.00 0.00 ? 36 PRO A HA   2  
ATOM 1953  H HB2  . PRO A 1 36 ? -0.513  20.772  -6.850  1.00 0.00 ? 36 PRO A HB2  2  
ATOM 1954  H HB3  . PRO A 1 36 ? -0.432  19.062  -6.409  1.00 0.00 ? 36 PRO A HB3  2  
ATOM 1955  H HG2  . PRO A 1 36 ? -2.606  20.509  -5.900  1.00 0.00 ? 36 PRO A HG2  2  
ATOM 1956  H HG3  . PRO A 1 36 ? -2.038  19.276  -4.758  1.00 0.00 ? 36 PRO A HG3  2  
ATOM 1957  H HD2  . PRO A 1 36 ? -1.758  22.253  -4.632  1.00 0.00 ? 36 PRO A HD2  2  
ATOM 1958  H HD3  . PRO A 1 36 ? -2.104  21.093  -3.338  1.00 0.00 ? 36 PRO A HD3  2  
ATOM 1959  N N    . ARG A 1 37 ? 2.628   20.405  -6.317  1.00 0.00 ? 37 ARG A N    2  
ATOM 1960  C CA   . ARG A 1 37 ? 3.756   21.023  -7.002  1.00 0.00 ? 37 ARG A CA   2  
ATOM 1961  C C    . ARG A 1 37 ? 3.910   20.461  -8.412  1.00 0.00 ? 37 ARG A C    2  
ATOM 1962  O O    . ARG A 1 37 ? 4.063   19.254  -8.598  1.00 0.00 ? 37 ARG A O    2  
ATOM 1963  C CB   . ARG A 1 37 ? 5.044   20.803  -6.205  1.00 0.00 ? 37 ARG A CB   2  
ATOM 1964  C CG   . ARG A 1 37 ? 5.053   21.505  -4.856  1.00 0.00 ? 37 ARG A CG   2  
ATOM 1965  C CD   . ARG A 1 37 ? 6.332   21.218  -4.086  1.00 0.00 ? 37 ARG A CD   2  
ATOM 1966  N NE   . ARG A 1 37 ? 6.424   19.820  -3.672  1.00 0.00 ? 37 ARG A NE   2  
ATOM 1967  C CZ   . ARG A 1 37 ? 7.460   19.311  -3.012  1.00 0.00 ? 37 ARG A CZ   2  
ATOM 1968  N NH1  . ARG A 1 37 ? 8.496   20.080  -2.700  1.00 0.00 ? 37 ARG A NH1  2  
ATOM 1969  N NH2  . ARG A 1 37 ? 7.459   18.032  -2.664  1.00 0.00 ? 37 ARG A NH2  2  
ATOM 1970  H H    . ARG A 1 37 ? 2.556   19.422  -6.317  1.00 0.00 ? 37 ARG A H    2  
ATOM 1971  H HA   . ARG A 1 37 ? 3.581   22.092  -7.076  1.00 0.00 ? 37 ARG A HA   2  
ATOM 1972  H HB2  . ARG A 1 37 ? 5.170   19.742  -6.040  1.00 0.00 ? 37 ARG A HB2  2  
ATOM 1973  H HB3  . ARG A 1 37 ? 5.885   21.171  -6.781  1.00 0.00 ? 37 ARG A HB3  2  
ATOM 1974  H HG2  . ARG A 1 37 ? 4.972   22.570  -5.015  1.00 0.00 ? 37 ARG A HG2  2  
ATOM 1975  H HG3  . ARG A 1 37 ? 4.209   21.161  -4.275  1.00 0.00 ? 37 ARG A HG3  2  
ATOM 1976  H HD2  . ARG A 1 37 ? 7.183   21.460  -4.709  1.00 0.00 ? 37 ARG A HD2  2  
ATOM 1977  H HD3  . ARG A 1 37 ? 6.349   21.843  -3.205  1.00 0.00 ? 37 ARG A HD3  2  
ATOM 1978  H HE   . ARG A 1 37 ? 5.671   19.224  -3.893  1.00 0.00 ? 37 ARG A HE   2  
ATOM 1979  H HH11 . ARG A 1 37 ? 8.519   21.047  -2.952  1.00 0.00 ? 37 ARG A HH11 2  
ATOM 1980  H HH12 . ARG A 1 37 ? 9.273   19.688  -2.202  1.00 0.00 ? 37 ARG A HH12 2  
ATOM 1981  H HH21 . ARG A 1 37 ? 6.679   17.447  -2.897  1.00 0.00 ? 37 ARG A HH21 2  
ATOM 1982  H HH22 . ARG A 1 37 ? 8.238   17.644  -2.167  1.00 0.00 ? 37 ARG A HH22 2  
ATOM 1983  N N    . TYR A 1 38 ? 3.871   21.347  -9.403  1.00 0.00 ? 38 TYR A N    2  
ATOM 1984  C CA   . TYR A 1 38 ? 4.006   20.943  -10.799 1.00 0.00 ? 38 TYR A CA   2  
ATOM 1985  C C    . TYR A 1 38 ? 5.467   20.675  -11.148 1.00 0.00 ? 38 TYR A C    2  
ATOM 1986  O O    . TYR A 1 38 ? 6.376   21.213  -10.514 1.00 0.00 ? 38 TYR A O    2  
ATOM 1987  C CB   . TYR A 1 38 ? 3.442   22.026  -11.720 1.00 0.00 ? 38 TYR A CB   2  
ATOM 1988  C CG   . TYR A 1 38 ? 1.989   22.355  -11.456 1.00 0.00 ? 38 TYR A CG   2  
ATOM 1989  C CD1  . TYR A 1 38 ? 1.636   23.339  -10.539 1.00 0.00 ? 38 TYR A CD1  2  
ATOM 1990  C CD2  . TYR A 1 38 ? 0.971   21.685  -12.124 1.00 0.00 ? 38 TYR A CD2  2  
ATOM 1991  C CE1  . TYR A 1 38 ? 0.309   23.642  -10.295 1.00 0.00 ? 38 TYR A CE1  2  
ATOM 1992  C CE2  . TYR A 1 38 ? -0.357  21.985  -11.885 1.00 0.00 ? 38 TYR A CE2  2  
ATOM 1993  C CZ   . TYR A 1 38 ? -0.682  22.964  -10.971 1.00 0.00 ? 38 TYR A CZ   2  
ATOM 1994  O OH   . TYR A 1 38 ? -2.003  23.263  -10.729 1.00 0.00 ? 38 TYR A OH   2  
ATOM 1995  H H    . TYR A 1 38 ? 3.756   22.303  -9.191  1.00 0.00 ? 38 TYR A H    2  
ATOM 1996  H HA   . TYR A 1 38 ? 3.437   20.032  -10.949 1.00 0.00 ? 38 TYR A HA   2  
ATOM 1997  H HB2  . TYR A 1 38 ? 4.021   22.933  -11.594 1.00 0.00 ? 38 TYR A HB2  2  
ATOM 1998  H HB3  . TYR A 1 38 ? 3.532   21.697  -12.749 1.00 0.00 ? 38 TYR A HB3  2  
ATOM 1999  H HD1  . TYR A 1 38 ? 2.413   23.872  -10.009 1.00 0.00 ? 38 TYR A HD1  2  
ATOM 2000  H HD2  . TYR A 1 38 ? 1.225   20.916  -12.841 1.00 0.00 ? 38 TYR A HD2  2  
ATOM 2001  H HE1  . TYR A 1 38 ? 0.054   24.410  -9.579  1.00 0.00 ? 38 TYR A HE1  2  
ATOM 2002  H HE2  . TYR A 1 38 ? -1.134  21.454  -12.415 1.00 0.00 ? 38 TYR A HE2  2  
ATOM 2003  H HH   . TYR A 1 38 ? -2.301  23.926  -11.355 1.00 0.00 ? 38 TYR A HH   2  
ATOM 2004  N N    . GLU A 1 39 ? 5.686   19.839  -12.157 1.00 0.00 ? 39 GLU A N    2  
ATOM 2005  C CA   . GLU A 1 39 ? 7.037   19.500  -12.592 1.00 0.00 ? 39 GLU A CA   2  
ATOM 2006  C C    . GLU A 1 39 ? 7.092   19.321  -14.106 1.00 0.00 ? 39 GLU A C    2  
ATOM 2007  O O    . GLU A 1 39 ? 6.058   19.204  -14.766 1.00 0.00 ? 39 GLU A O    2  
ATOM 2008  C CB   . GLU A 1 39 ? 7.519   18.224  -11.895 1.00 0.00 ? 39 GLU A CB   2  
ATOM 2009  C CG   . GLU A 1 39 ? 6.729   16.979  -12.268 1.00 0.00 ? 39 GLU A CG   2  
ATOM 2010  C CD   . GLU A 1 39 ? 5.294   17.023  -11.779 1.00 0.00 ? 39 GLU A CD   2  
ATOM 2011  O OE1  . GLU A 1 39 ? 5.063   16.732  -10.587 1.00 0.00 ? 39 GLU A OE1  2  
ATOM 2012  O OE2  . GLU A 1 39 ? 4.401   17.347  -12.589 1.00 0.00 ? 39 GLU A OE2  2  
ATOM 2013  O OXT  . GLU A 1 39 ? 8.224   19.307  -14.636 1.00 0.00 ? 39 GLU A OXT  2  
ATOM 2014  H H    . GLU A 1 39 ? 4.917   19.445  -12.632 1.00 0.00 ? 39 GLU A H    2  
ATOM 2015  H HA   . GLU A 1 39 ? 7.705   20.311  -12.329 1.00 0.00 ? 39 GLU A HA   2  
ATOM 2016  H HB2  . GLU A 1 39 ? 8.555   18.055  -12.156 1.00 0.00 ? 39 GLU A HB2  2  
ATOM 2017  H HB3  . GLU A 1 39 ? 7.450   18.365  -10.825 1.00 0.00 ? 39 GLU A HB3  2  
ATOM 2018  H HG2  . GLU A 1 39 ? 6.727   16.855  -13.339 1.00 0.00 ? 39 GLU A HG2  2  
ATOM 2019  H HG3  . GLU A 1 39 ? 7.213   16.124  -11.818 1.00 0.00 ? 39 GLU A HG3  2  
ATOM 2020  N N    . GLY B 1 1  ? -8.723  -20.750 -0.979  1.00 0.00 ? 1  GLY B N    2  
ATOM 2021  C CA   . GLY B 1 1  ? -8.439  -21.856 -0.085  1.00 0.00 ? 1  GLY B CA   2  
ATOM 2022  C C    . GLY B 1 1  ? -7.382  -22.793 -0.640  1.00 0.00 ? 1  GLY B C    2  
ATOM 2023  O O    . GLY B 1 1  ? -6.198  -22.454 -0.671  1.00 0.00 ? 1  GLY B O    2  
ATOM 2024  H H1   . GLY B 1 1  ? -7.864  -20.184 -1.143  1.00 0.00 ? 1  GLY B H1   2  
ATOM 2025  H H2   . GLY B 1 1  ? -9.450  -20.135 -0.560  1.00 0.00 ? 1  GLY B H2   2  
ATOM 2026  H H3   . GLY B 1 1  ? -9.073  -21.102 -1.895  1.00 0.00 ? 1  GLY B H3   2  
ATOM 2027  H HA2  . GLY B 1 1  ? -8.088  -21.458 0.856   1.00 0.00 ? 1  GLY B HA2  2  
ATOM 2028  H HA3  . GLY B 1 1  ? -9.354  -22.405 0.092   1.00 0.00 ? 1  GLY B HA3  2  
ATOM 2029  N N    . HIS B 1 2  ? -7.811  -23.972 -1.078  1.00 0.00 ? 2  HIS B N    2  
ATOM 2030  C CA   . HIS B 1 2  ? -6.893  -24.959 -1.636  1.00 0.00 ? 2  HIS B CA   2  
ATOM 2031  C C    . HIS B 1 2  ? -6.934  -24.934 -3.160  1.00 0.00 ? 2  HIS B C    2  
ATOM 2032  O O    . HIS B 1 2  ? -5.936  -25.221 -3.822  1.00 0.00 ? 2  HIS B O    2  
ATOM 2033  C CB   . HIS B 1 2  ? -7.242  -26.358 -1.126  1.00 0.00 ? 2  HIS B CB   2  
ATOM 2034  C CG   . HIS B 1 2  ? -6.271  -27.413 -1.557  1.00 0.00 ? 2  HIS B CG   2  
ATOM 2035  N ND1  . HIS B 1 2  ? -6.406  -28.127 -2.729  1.00 0.00 ? 2  HIS B ND1  2  
ATOM 2036  C CD2  . HIS B 1 2  ? -5.143  -27.876 -0.966  1.00 0.00 ? 2  HIS B CD2  2  
ATOM 2037  C CE1  . HIS B 1 2  ? -5.406  -28.983 -2.840  1.00 0.00 ? 2  HIS B CE1  2  
ATOM 2038  N NE2  . HIS B 1 2  ? -4.626  -28.848 -1.784  1.00 0.00 ? 2  HIS B NE2  2  
ATOM 2039  H H    . HIS B 1 2  ? -8.772  -24.190 -1.027  1.00 0.00 ? 2  HIS B H    2  
ATOM 2040  H HA   . HIS B 1 2  ? -5.883  -24.722 -1.319  1.00 0.00 ? 2  HIS B HA   2  
ATOM 2041  H HB2  . HIS B 1 2  ? -7.256  -26.343 -0.046  1.00 0.00 ? 2  HIS B HB2  2  
ATOM 2042  H HB3  . HIS B 1 2  ? -8.223  -26.638 -1.487  1.00 0.00 ? 2  HIS B HB3  2  
ATOM 2043  H HD1  . HIS B 1 2  ? -7.129  -28.022 -3.383  1.00 0.00 ? 2  HIS B HD1  2  
ATOM 2044  H HD2  . HIS B 1 2  ? -4.728  -27.541 -0.025  1.00 0.00 ? 2  HIS B HD2  2  
ATOM 2045  H HE1  . HIS B 1 2  ? -5.252  -29.674 -3.656  1.00 0.00 ? 2  HIS B HE1  2  
ATOM 2046  H HE2  . HIS B 1 2  ? -3.772  -29.310 -1.650  1.00 0.00 ? 2  HIS B HE2  2  
ATOM 2047  N N    . SER B 1 3  ? -8.094  -24.588 -3.709  1.00 0.00 ? 3  SER B N    2  
ATOM 2048  C CA   . SER B 1 3  ? -8.270  -24.523 -5.156  1.00 0.00 ? 3  SER B CA   2  
ATOM 2049  C C    . SER B 1 3  ? -7.328  -23.497 -5.775  1.00 0.00 ? 3  SER B C    2  
ATOM 2050  O O    . SER B 1 3  ? -6.977  -23.589 -6.951  1.00 0.00 ? 3  SER B O    2  
ATOM 2051  C CB   . SER B 1 3  ? -9.720  -24.173 -5.499  1.00 0.00 ? 3  SER B CB   2  
ATOM 2052  O OG   . SER B 1 3  ? -10.618 -25.122 -4.950  1.00 0.00 ? 3  SER B OG   2  
ATOM 2053  H H    . SER B 1 3  ? -8.863  -24.372 -3.135  1.00 0.00 ? 3  SER B H    2  
ATOM 2054  H HA   . SER B 1 3  ? -8.041  -25.497 -5.567  1.00 0.00 ? 3  SER B HA   2  
ATOM 2055  H HB2  . SER B 1 3  ? -9.961  -23.199 -5.096  1.00 0.00 ? 3  SER B HB2  2  
ATOM 2056  H HB3  . SER B 1 3  ? -9.845  -24.159 -6.574  1.00 0.00 ? 3  SER B HB3  2  
ATOM 2057  H HG   . SER B 1 3  ? -10.645 -25.903 -5.509  1.00 0.00 ? 3  SER B HG   2  
ATOM 2058  N N    . LEU B 1 4  ? -6.922  -22.517 -4.974  1.00 0.00 ? 4  LEU B N    2  
ATOM 2059  C CA   . LEU B 1 4  ? -6.020  -21.470 -5.438  1.00 0.00 ? 4  LEU B CA   2  
ATOM 2060  C C    . LEU B 1 4  ? -4.562  -21.923 -5.335  1.00 0.00 ? 4  LEU B C    2  
ATOM 2061  O O    . LEU B 1 4  ? -4.106  -22.309 -4.258  1.00 0.00 ? 4  LEU B O    2  
ATOM 2062  C CB   . LEU B 1 4  ? -6.224  -20.193 -4.620  1.00 0.00 ? 4  LEU B CB   2  
ATOM 2063  C CG   . LEU B 1 4  ? -5.276  -19.043 -4.959  1.00 0.00 ? 4  LEU B CG   2  
ATOM 2064  C CD1  . LEU B 1 4  ? -5.602  -18.463 -6.327  1.00 0.00 ? 4  LEU B CD1  2  
ATOM 2065  C CD2  . LEU B 1 4  ? -5.348  -17.964 -3.887  1.00 0.00 ? 4  LEU B CD2  2  
ATOM 2066  H H    . LEU B 1 4  ? -7.236  -22.476 -4.044  1.00 0.00 ? 4  LEU B H    2  
ATOM 2067  H HA   . LEU B 1 4  ? -6.277  -21.250 -6.460  1.00 0.00 ? 4  LEU B HA   2  
ATOM 2068  H HB2  . LEU B 1 4  ? -7.245  -19.859 -4.761  1.00 0.00 ? 4  LEU B HB2  2  
ATOM 2069  H HB3  . LEU B 1 4  ? -6.094  -20.450 -3.576  1.00 0.00 ? 4  LEU B HB3  2  
ATOM 2070  H HG   . LEU B 1 4  ? -4.258  -19.400 -4.988  1.00 0.00 ? 4  LEU B HG   2  
ATOM 2071  H HD11 . LEU B 1 4  ? -5.681  -19.246 -7.057  1.00 0.00 ? 4  LEU B HD11 2  
ATOM 2072  H HD12 . LEU B 1 4  ? -4.826  -17.779 -6.621  1.00 0.00 ? 4  LEU B HD12 2  
ATOM 2073  H HD13 . LEU B 1 4  ? -6.544  -17.931 -6.280  1.00 0.00 ? 4  LEU B HD13 2  
ATOM 2074  H HD21 . LEU B 1 4  ? -6.351  -17.561 -3.840  1.00 0.00 ? 4  LEU B HD21 2  
ATOM 2075  H HD22 . LEU B 1 4  ? -4.653  -17.170 -4.125  1.00 0.00 ? 4  LEU B HD22 2  
ATOM 2076  H HD23 . LEU B 1 4  ? -5.087  -18.388 -2.927  1.00 0.00 ? 4  LEU B HD23 2  
ATOM 2077  N N    . PRO B 1 5  ? -3.808  -21.886 -6.454  1.00 0.00 ? 5  PRO B N    2  
ATOM 2078  C CA   . PRO B 1 5  ? -2.398  -22.290 -6.461  1.00 0.00 ? 5  PRO B CA   2  
ATOM 2079  C C    . PRO B 1 5  ? -1.586  -21.553 -5.403  1.00 0.00 ? 5  PRO B C    2  
ATOM 2080  O O    . PRO B 1 5  ? -1.704  -20.338 -5.248  1.00 0.00 ? 5  PRO B O    2  
ATOM 2081  C CB   . PRO B 1 5  ? -1.922  -21.910 -7.865  1.00 0.00 ? 5  PRO B CB   2  
ATOM 2082  C CG   . PRO B 1 5  ? -3.157  -21.925 -8.696  1.00 0.00 ? 5  PRO B CG   2  
ATOM 2083  C CD   . PRO B 1 5  ? -4.263  -21.458 -7.791  1.00 0.00 ? 5  PRO B CD   2  
ATOM 2084  H HA   . PRO B 1 5  ? -2.300  -23.359 -6.325  1.00 0.00 ? 5  PRO B HA   2  
ATOM 2085  H HB2  . PRO B 1 5  ? -1.467  -20.926 -7.863  1.00 0.00 ? 5  PRO B HB2  2  
ATOM 2086  H HB3  . PRO B 1 5  ? -1.208  -22.640 -8.214  1.00 0.00 ? 5  PRO B HB3  2  
ATOM 2087  H HG2  . PRO B 1 5  ? -3.046  -21.251 -9.533  1.00 0.00 ? 5  PRO B HG2  2  
ATOM 2088  H HG3  . PRO B 1 5  ? -3.355  -22.928 -9.043  1.00 0.00 ? 5  PRO B HG3  2  
ATOM 2089  H HD2  . PRO B 1 5  ? -4.351  -20.390 -7.848  1.00 0.00 ? 5  PRO B HD2  2  
ATOM 2090  H HD3  . PRO B 1 5  ? -5.191  -21.937 -8.061  1.00 0.00 ? 5  PRO B HD3  2  
ATOM 2091  N N    . PHE B 1 6  ? -0.771  -22.298 -4.669  1.00 0.00 ? 6  PHE B N    2  
ATOM 2092  C CA   . PHE B 1 6  ? 0.060   -21.723 -3.618  1.00 0.00 ? 6  PHE B CA   2  
ATOM 2093  C C    . PHE B 1 6  ? 1.200   -20.889 -4.206  1.00 0.00 ? 6  PHE B C    2  
ATOM 2094  O O    . PHE B 1 6  ? 1.830   -20.103 -3.506  1.00 0.00 ? 6  PHE B O    2  
ATOM 2095  C CB   . PHE B 1 6  ? 0.617   -22.833 -2.722  1.00 0.00 ? 6  PHE B CB   2  
ATOM 2096  C CG   . PHE B 1 6  ? 1.807   -23.550 -3.299  1.00 0.00 ? 6  PHE B CG   2  
ATOM 2097  C CD1  . PHE B 1 6  ? 1.714   -24.219 -4.510  1.00 0.00 ? 6  PHE B CD1  2  
ATOM 2098  C CD2  . PHE B 1 6  ? 3.017   -23.558 -2.624  1.00 0.00 ? 6  PHE B CD2  2  
ATOM 2099  C CE1  . PHE B 1 6  ? 2.808   -24.881 -5.036  1.00 0.00 ? 6  PHE B CE1  2  
ATOM 2100  C CE2  . PHE B 1 6  ? 4.112   -24.218 -3.145  1.00 0.00 ? 6  PHE B CE2  2  
ATOM 2101  C CZ   . PHE B 1 6  ? 4.008   -24.881 -4.353  1.00 0.00 ? 6  PHE B CZ   2  
ATOM 2102  H H    . PHE B 1 6  ? -0.744  -23.262 -4.831  1.00 0.00 ? 6  PHE B H    2  
ATOM 2103  H HA   . PHE B 1 6  ? -0.563  -21.078 -3.013  1.00 0.00 ? 6  PHE B HA   2  
ATOM 2104  H HB2  . PHE B 1 6  ? 0.901   -22.399 -1.772  1.00 0.00 ? 6  PHE B HB2  2  
ATOM 2105  H HB3  . PHE B 1 6  ? -0.159  -23.567 -2.548  1.00 0.00 ? 6  PHE B HB3  2  
ATOM 2106  H HD1  . PHE B 1 6  ? 0.789   -24.235 -5.051  1.00 0.00 ? 6  PHE B HD1  2  
ATOM 2107  H HD2  . PHE B 1 6  ? 3.105   -23.041 -1.678  1.00 0.00 ? 6  PHE B HD2  2  
ATOM 2108  H HE1  . PHE B 1 6  ? 2.724   -25.399 -5.980  1.00 0.00 ? 6  PHE B HE1  2  
ATOM 2109  H HE2  . PHE B 1 6  ? 5.049   -24.216 -2.609  1.00 0.00 ? 6  PHE B HE2  2  
ATOM 2110  H HZ   . PHE B 1 6  ? 4.864   -25.398 -4.762  1.00 0.00 ? 6  PHE B HZ   2  
ATOM 2111  N N    . LYS B 1 7  ? 1.462   -21.075 -5.495  1.00 0.00 ? 7  LYS B N    2  
ATOM 2112  C CA   . LYS B 1 7  ? 2.535   -20.349 -6.172  1.00 0.00 ? 7  LYS B CA   2  
ATOM 2113  C C    . LYS B 1 7  ? 2.249   -18.849 -6.261  1.00 0.00 ? 7  LYS B C    2  
ATOM 2114  O O    . LYS B 1 7  ? 3.149   -18.030 -6.073  1.00 0.00 ? 7  LYS B O    2  
ATOM 2115  C CB   . LYS B 1 7  ? 2.751   -20.920 -7.575  1.00 0.00 ? 7  LYS B CB   2  
ATOM 2116  C CG   . LYS B 1 7  ? 3.919   -20.289 -8.316  1.00 0.00 ? 7  LYS B CG   2  
ATOM 2117  C CD   . LYS B 1 7  ? 4.105   -20.903 -9.696  1.00 0.00 ? 7  LYS B CD   2  
ATOM 2118  C CE   . LYS B 1 7  ? 4.523   -22.362 -9.608  1.00 0.00 ? 7  LYS B CE   2  
ATOM 2119  N NZ   . LYS B 1 7  ? 4.759   -22.956 -10.953 1.00 0.00 ? 7  LYS B NZ   2  
ATOM 2120  H H    . LYS B 1 7  ? 0.945   -21.725 -6.016  1.00 0.00 ? 7  LYS B H    2  
ATOM 2121  H HA   . LYS B 1 7  ? 3.445   -20.491 -5.602  1.00 0.00 ? 7  LYS B HA   2  
ATOM 2122  H HB2  . LYS B 1 7  ? 2.931   -21.978 -7.475  1.00 0.00 ? 7  LYS B HB2  2  
ATOM 2123  H HB3  . LYS B 1 7  ? 1.851   -20.771 -8.158  1.00 0.00 ? 7  LYS B HB3  2  
ATOM 2124  H HG2  . LYS B 1 7  ? 3.733   -19.233 -8.438  1.00 0.00 ? 7  LYS B HG2  2  
ATOM 2125  H HG3  . LYS B 1 7  ? 4.822   -20.431 -7.738  1.00 0.00 ? 7  LYS B HG3  2  
ATOM 2126  H HD2  . LYS B 1 7  ? 3.177   -20.836 -10.246 1.00 0.00 ? 7  LYS B HD2  2  
ATOM 2127  H HD3  . LYS B 1 7  ? 4.872   -20.352 -10.220 1.00 0.00 ? 7  LYS B HD3  2  
ATOM 2128  H HE2  . LYS B 1 7  ? 5.435   -22.434 -9.033  1.00 0.00 ? 7  LYS B HE2  2  
ATOM 2129  H HE3  . LYS B 1 7  ? 3.745   -22.927 -9.119  1.00 0.00 ? 7  LYS B HE3  2  
ATOM 2130  H HZ1  . LYS B 1 7  ? 3.890   -22.912 -11.526 1.00 0.00 ? 7  LYS B HZ1  2  
ATOM 2131  H HZ2  . LYS B 1 7  ? 5.043   -23.952 -10.856 1.00 0.00 ? 7  LYS B HZ2  2  
ATOM 2132  H HZ3  . LYS B 1 7  ? 5.517   -22.441 -11.448 1.00 0.00 ? 7  LYS B HZ3  2  
ATOM 2133  N N    . VAL B 1 8  ? 1.001   -18.489 -6.547  1.00 0.00 ? 8  VAL B N    2  
ATOM 2134  C CA   . VAL B 1 8  ? 0.621   -17.082 -6.678  1.00 0.00 ? 8  VAL B CA   2  
ATOM 2135  C C    . VAL B 1 8  ? 0.595   -16.359 -5.334  1.00 0.00 ? 8  VAL B C    2  
ATOM 2136  O O    . VAL B 1 8  ? 0.942   -15.179 -5.253  1.00 0.00 ? 8  VAL B O    2  
ATOM 2137  C CB   . VAL B 1 8  ? -0.752  -16.920 -7.361  1.00 0.00 ? 8  VAL B CB   2  
ATOM 2138  C CG1  . VAL B 1 8  ? -0.739  -17.551 -8.744  1.00 0.00 ? 8  VAL B CG1  2  
ATOM 2139  C CG2  . VAL B 1 8  ? -1.858  -17.519 -6.505  1.00 0.00 ? 8  VAL B CG2  2  
ATOM 2140  H H    . VAL B 1 8  ? 0.321   -19.185 -6.692  1.00 0.00 ? 8  VAL B H    2  
ATOM 2141  H HA   . VAL B 1 8  ? 1.359   -16.594 -7.306  1.00 0.00 ? 8  VAL B HA   2  
ATOM 2142  H HB   . VAL B 1 8  ? -0.954  -15.864 -7.483  1.00 0.00 ? 8  VAL B HB   2  
ATOM 2143  H HG11 . VAL B 1 8  ? 0.032   -17.090 -9.345  1.00 0.00 ? 8  VAL B HG11 2  
ATOM 2144  H HG12 . VAL B 1 8  ? -1.698  -17.401 -9.221  1.00 0.00 ? 8  VAL B HG12 2  
ATOM 2145  H HG13 . VAL B 1 8  ? -0.541  -18.611 -8.659  1.00 0.00 ? 8  VAL B HG13 2  
ATOM 2146  H HG21 . VAL B 1 8  ? -1.992  -16.932 -5.610  1.00 0.00 ? 8  VAL B HG21 2  
ATOM 2147  H HG22 . VAL B 1 8  ? -1.609  -18.521 -6.244  1.00 0.00 ? 8  VAL B HG22 2  
ATOM 2148  H HG23 . VAL B 1 8  ? -2.782  -17.519 -7.063  1.00 0.00 ? 8  VAL B HG23 2  
ATOM 2149  N N    . VAL B 1 9  ? 0.181   -17.056 -4.279  1.00 0.00 ? 9  VAL B N    2  
ATOM 2150  C CA   . VAL B 1 9  ? 0.102   -16.448 -2.955  1.00 0.00 ? 9  VAL B CA   2  
ATOM 2151  C C    . VAL B 1 9  ? 1.491   -16.151 -2.387  1.00 0.00 ? 9  VAL B C    2  
ATOM 2152  O O    . VAL B 1 9  ? 1.689   -15.137 -1.718  1.00 0.00 ? 9  VAL B O    2  
ATOM 2153  C CB   . VAL B 1 9  ? -0.687  -17.331 -1.965  1.00 0.00 ? 9  VAL B CB   2  
ATOM 2154  C CG1  . VAL B 1 9  ? 0.055   -18.621 -1.663  1.00 0.00 ? 9  VAL B CG1  2  
ATOM 2155  C CG2  . VAL B 1 9  ? -0.974  -16.562 -0.685  1.00 0.00 ? 9  VAL B CG2  2  
ATOM 2156  H H    . VAL B 1 9  ? -0.093  -17.995 -4.391  1.00 0.00 ? 9  VAL B H    2  
ATOM 2157  H HA   . VAL B 1 9  ? -0.431  -15.507 -3.059  1.00 0.00 ? 9  VAL B HA   2  
ATOM 2158  H HB   . VAL B 1 9  ? -1.632  -17.587 -2.421  1.00 0.00 ? 9  VAL B HB   2  
ATOM 2159  H HG11 . VAL B 1 9  ? -0.566  -19.251 -1.042  1.00 0.00 ? 9  VAL B HG11 2  
ATOM 2160  H HG12 . VAL B 1 9  ? 0.980   -18.421 -1.146  1.00 0.00 ? 9  VAL B HG12 2  
ATOM 2161  H HG13 . VAL B 1 9  ? 0.249   -19.122 -2.574  1.00 0.00 ? 9  VAL B HG13 2  
ATOM 2162  H HG21 . VAL B 1 9  ? -1.486  -15.639 -0.921  1.00 0.00 ? 9  VAL B HG21 2  
ATOM 2163  H HG22 . VAL B 1 9  ? -0.050  -16.338 -0.172  1.00 0.00 ? 9  VAL B HG22 2  
ATOM 2164  H HG23 . VAL B 1 9  ? -1.603  -17.160 -0.041  1.00 0.00 ? 9  VAL B HG23 2  
ATOM 2165  N N    . VAL B 1 10 ? 2.450   -17.035 -2.656  1.00 0.00 ? 10 VAL B N    2  
ATOM 2166  C CA   . VAL B 1 10 ? 3.814   -16.846 -2.170  1.00 0.00 ? 10 VAL B CA   2  
ATOM 2167  C C    . VAL B 1 10 ? 4.467   -15.648 -2.850  1.00 0.00 ? 10 VAL B C    2  
ATOM 2168  O O    . VAL B 1 10 ? 5.142   -14.846 -2.204  1.00 0.00 ? 10 VAL B O    2  
ATOM 2169  C CB   . VAL B 1 10 ? 4.683   -18.100 -2.412  1.00 0.00 ? 10 VAL B CB   2  
ATOM 2170  C CG1  . VAL B 1 10 ? 6.121   -17.850 -1.979  1.00 0.00 ? 10 VAL B CG1  2  
ATOM 2171  C CG2  . VAL B 1 10 ? 4.105   -19.299 -1.680  1.00 0.00 ? 10 VAL B CG2  2  
ATOM 2172  H H    . VAL B 1 10 ? 2.243   -17.833 -3.196  1.00 0.00 ? 10 VAL B H    2  
ATOM 2173  H HA   . VAL B 1 10 ? 3.775   -16.660 -1.102  1.00 0.00 ? 10 VAL B HA   2  
ATOM 2174  H HB   . VAL B 1 10 ? 4.682   -18.318 -3.471  1.00 0.00 ? 10 VAL B HB   2  
ATOM 2175  H HG11 . VAL B 1 10 ? 6.598   -17.167 -2.665  1.00 0.00 ? 10 VAL B HG11 2  
ATOM 2176  H HG12 . VAL B 1 10 ? 6.671   -18.783 -1.980  1.00 0.00 ? 10 VAL B HG12 2  
ATOM 2177  H HG13 . VAL B 1 10 ? 6.139   -17.430 -0.982  1.00 0.00 ? 10 VAL B HG13 2  
ATOM 2178  H HG21 . VAL B 1 10 ? 4.389   -19.265 -0.635  1.00 0.00 ? 10 VAL B HG21 2  
ATOM 2179  H HG22 . VAL B 1 10 ? 4.491   -20.205 -2.121  1.00 0.00 ? 10 VAL B HG22 2  
ATOM 2180  H HG23 . VAL B 1 10 ? 3.031   -19.304 -1.748  1.00 0.00 ? 10 VAL B HG23 2  
ATOM 2181  N N    . ILE B 1 11 ? 4.257   -15.534 -4.156  1.00 0.00 ? 11 ILE B N    2  
ATOM 2182  C CA   . ILE B 1 11 ? 4.820   -14.437 -4.931  1.00 0.00 ? 11 ILE B CA   2  
ATOM 2183  C C    . ILE B 1 11 ? 4.203   -13.103 -4.523  1.00 0.00 ? 11 ILE B C    2  
ATOM 2184  O O    . ILE B 1 11 ? 4.883   -12.078 -4.494  1.00 0.00 ? 11 ILE B O    2  
ATOM 2185  C CB   . ILE B 1 11 ? 4.612   -14.658 -6.441  1.00 0.00 ? 11 ILE B CB   2  
ATOM 2186  C CG1  . ILE B 1 11 ? 5.297   -15.953 -6.883  1.00 0.00 ? 11 ILE B CG1  2  
ATOM 2187  C CG2  . ILE B 1 11 ? 5.143   -13.471 -7.234  1.00 0.00 ? 11 ILE B CG2  2  
ATOM 2188  C CD1  . ILE B 1 11 ? 4.996   -16.348 -8.314  1.00 0.00 ? 11 ILE B CD1  2  
ATOM 2189  H H    . ILE B 1 11 ? 3.704   -16.207 -4.619  1.00 0.00 ? 11 ILE B H    2  
ATOM 2190  H HA   . ILE B 1 11 ? 5.887   -14.398 -4.739  1.00 0.00 ? 11 ILE B HA   2  
ATOM 2191  H HB   . ILE B 1 11 ? 3.550   -14.739 -6.628  1.00 0.00 ? 11 ILE B HB   2  
ATOM 2192  H HG12 . ILE B 1 11 ? 6.368   -15.832 -6.800  1.00 0.00 ? 11 ILE B HG12 2  
ATOM 2193  H HG13 . ILE B 1 11 ? 4.996   -16.765 -6.249  1.00 0.00 ? 11 ILE B HG13 2  
ATOM 2194  H HG21 . ILE B 1 11 ? 5.054   -13.664 -8.293  1.00 0.00 ? 11 ILE B HG21 2  
ATOM 2195  H HG22 . ILE B 1 11 ? 6.183   -13.306 -6.992  1.00 0.00 ? 11 ILE B HG22 2  
ATOM 2196  H HG23 . ILE B 1 11 ? 4.576   -12.584 -6.997  1.00 0.00 ? 11 ILE B HG23 2  
ATOM 2197  H HD11 . ILE B 1 11 ? 5.349   -17.354 -8.489  1.00 0.00 ? 11 ILE B HD11 2  
ATOM 2198  H HD12 . ILE B 1 11 ? 5.498   -15.672 -8.989  1.00 0.00 ? 11 ILE B HD12 2  
ATOM 2199  H HD13 . ILE B 1 11 ? 3.930   -16.308 -8.489  1.00 0.00 ? 11 ILE B HD13 2  
ATOM 2200  N N    . SER B 1 12 ? 2.912   -13.123 -4.207  1.00 0.00 ? 12 SER B N    2  
ATOM 2201  C CA   . SER B 1 12 ? 2.210   -11.913 -3.797  1.00 0.00 ? 12 SER B CA   2  
ATOM 2202  C C    . SER B 1 12 ? 2.690   -11.447 -2.427  1.00 0.00 ? 12 SER B C    2  
ATOM 2203  O O    . SER B 1 12 ? 2.838   -10.249 -2.185  1.00 0.00 ? 12 SER B O    2  
ATOM 2204  C CB   . SER B 1 12 ? 0.700   -12.158 -3.765  1.00 0.00 ? 12 SER B CB   2  
ATOM 2205  O OG   . SER B 1 12 ? 0.201   -12.438 -5.061  1.00 0.00 ? 12 SER B OG   2  
ATOM 2206  H H    . SER B 1 12 ? 2.411   -13.972 -4.248  1.00 0.00 ? 12 SER B H    2  
ATOM 2207  H HA   . SER B 1 12 ? 2.419   -11.135 -4.521  1.00 0.00 ? 12 SER B HA   2  
ATOM 2208  H HB2  . SER B 1 12 ? 0.488   -13.000 -3.124  1.00 0.00 ? 12 SER B HB2  2  
ATOM 2209  H HB3  . SER B 1 12 ? 0.195   -11.279 -3.383  1.00 0.00 ? 12 SER B HB3  2  
ATOM 2210  H HG   . SER B 1 12 ? 0.084   -11.617 -5.547  1.00 0.00 ? 12 SER B HG   2  
ATOM 2211  N N    . ALA B 1 13 ? 2.933   -12.404 -1.537  1.00 0.00 ? 13 ALA B N    2  
ATOM 2212  C CA   . ALA B 1 13 ? 3.397   -12.100 -0.189  1.00 0.00 ? 13 ALA B CA   2  
ATOM 2213  C C    . ALA B 1 13 ? 4.791   -11.482 -0.205  1.00 0.00 ? 13 ALA B C    2  
ATOM 2214  O O    . ALA B 1 13 ? 5.007   -10.404 0.347   1.00 0.00 ? 13 ALA B O    2  
ATOM 2215  C CB   . ALA B 1 13 ? 3.387   -13.357 0.666   1.00 0.00 ? 13 ALA B CB   2  
ATOM 2216  H H    . ALA B 1 13 ? 2.795   -13.348 -1.788  1.00 0.00 ? 13 ALA B H    2  
ATOM 2217  H HA   . ALA B 1 13 ? 2.708   -11.393 0.256   1.00 0.00 ? 13 ALA B HA   2  
ATOM 2218  H HB1  . ALA B 1 13 ? 3.671   -13.110 1.680   1.00 0.00 ? 13 ALA B HB1  2  
ATOM 2219  H HB2  . ALA B 1 13 ? 4.083   -14.078 0.262   1.00 0.00 ? 13 ALA B HB2  2  
ATOM 2220  H HB3  . ALA B 1 13 ? 2.394   -13.781 0.666   1.00 0.00 ? 13 ALA B HB3  2  
ATOM 2221  N N    . ILE B 1 14 ? 5.735   -12.171 -0.843  1.00 0.00 ? 14 ILE B N    2  
ATOM 2222  C CA   . ILE B 1 14 ? 7.111   -11.693 -0.923  1.00 0.00 ? 14 ILE B CA   2  
ATOM 2223  C C    . ILE B 1 14 ? 7.182   -10.329 -1.607  1.00 0.00 ? 14 ILE B C    2  
ATOM 2224  O O    . ILE B 1 14 ? 7.909   -9.440  -1.164  1.00 0.00 ? 14 ILE B O    2  
ATOM 2225  C CB   . ILE B 1 14 ? 8.018   -12.694 -1.672  1.00 0.00 ? 14 ILE B CB   2  
ATOM 2226  C CG1  . ILE B 1 14 ? 9.479   -12.236 -1.623  1.00 0.00 ? 14 ILE B CG1  2  
ATOM 2227  C CG2  . ILE B 1 14 ? 7.559   -12.864 -3.113  1.00 0.00 ? 14 ILE B CG2  2  
ATOM 2228  C CD1  . ILE B 1 14 ? 10.076  -12.263 -0.233  1.00 0.00 ? 14 ILE B CD1  2  
ATOM 2229  H H    . ILE B 1 14 ? 5.499   -13.031 -1.264  1.00 0.00 ? 14 ILE B H    2  
ATOM 2230  H HA   . ILE B 1 14 ? 7.476   -11.591 0.090   1.00 0.00 ? 14 ILE B HA   2  
ATOM 2231  H HB   . ILE B 1 14 ? 7.932   -13.654 -1.184  1.00 0.00 ? 14 ILE B HB   2  
ATOM 2232  H HG12 . ILE B 1 14 ? 10.076  -12.900 -2.235  1.00 0.00 ? 14 ILE B HG12 2  
ATOM 2233  H HG13 . ILE B 1 14 ? 9.573   -11.233 -2.009  1.00 0.00 ? 14 ILE B HG13 2  
ATOM 2234  H HG21 . ILE B 1 14 ? 6.508   -13.057 -3.137  1.00 0.00 ? 14 ILE B HG21 2  
ATOM 2235  H HG22 . ILE B 1 14 ? 8.078   -13.704 -3.549  1.00 0.00 ? 14 ILE B HG22 2  
ATOM 2236  H HG23 . ILE B 1 14 ? 7.782   -11.978 -3.690  1.00 0.00 ? 14 ILE B HG23 2  
ATOM 2237  H HD11 . ILE B 1 14 ? 9.895   -13.226 0.225   1.00 0.00 ? 14 ILE B HD11 2  
ATOM 2238  H HD12 . ILE B 1 14 ? 9.627   -11.488 0.369   1.00 0.00 ? 14 ILE B HD12 2  
ATOM 2239  H HD13 . ILE B 1 14 ? 11.141  -12.093 -0.298  1.00 0.00 ? 14 ILE B HD13 2  
ATOM 2240  N N    . LEU B 1 15 ? 6.420   -10.171 -2.685  1.00 0.00 ? 15 LEU B N    2  
ATOM 2241  C CA   . LEU B 1 15 ? 6.400   -8.916  -3.426  1.00 0.00 ? 15 LEU B CA   2  
ATOM 2242  C C    . LEU B 1 15 ? 5.726   -7.813  -2.617  1.00 0.00 ? 15 LEU B C    2  
ATOM 2243  O O    . LEU B 1 15 ? 6.027   -6.631  -2.789  1.00 0.00 ? 15 LEU B O    2  
ATOM 2244  C CB   . LEU B 1 15 ? 5.681   -9.101  -4.766  1.00 0.00 ? 15 LEU B CB   2  
ATOM 2245  C CG   . LEU B 1 15 ? 5.606   -7.851  -5.646  1.00 0.00 ? 15 LEU B CG   2  
ATOM 2246  C CD1  . LEU B 1 15 ? 7.002   -7.370  -6.013  1.00 0.00 ? 15 LEU B CD1  2  
ATOM 2247  C CD2  . LEU B 1 15 ? 4.791   -8.133  -6.898  1.00 0.00 ? 15 LEU B CD2  2  
ATOM 2248  H H    . LEU B 1 15 ? 5.845   -10.909 -2.992  1.00 0.00 ? 15 LEU B H    2  
ATOM 2249  H HA   . LEU B 1 15 ? 7.424   -8.627  -3.618  1.00 0.00 ? 15 LEU B HA   2  
ATOM 2250  H HB2  . LEU B 1 15 ? 6.192   -9.881  -5.316  1.00 0.00 ? 15 LEU B HB2  2  
ATOM 2251  H HB3  . LEU B 1 15 ? 4.672   -9.436  -4.560  1.00 0.00 ? 15 LEU B HB3  2  
ATOM 2252  H HG   . LEU B 1 15 ? 5.113   -7.057  -5.104  1.00 0.00 ? 15 LEU B HG   2  
ATOM 2253  H HD11 . LEU B 1 15 ? 7.536   -7.084  -5.120  1.00 0.00 ? 15 LEU B HD11 2  
ATOM 2254  H HD12 . LEU B 1 15 ? 6.930   -6.512  -6.669  1.00 0.00 ? 15 LEU B HD12 2  
ATOM 2255  H HD13 . LEU B 1 15 ? 7.540   -8.161  -6.517  1.00 0.00 ? 15 LEU B HD13 2  
ATOM 2256  H HD21 . LEU B 1 15 ? 5.266   -8.915  -7.475  1.00 0.00 ? 15 LEU B HD21 2  
ATOM 2257  H HD22 . LEU B 1 15 ? 4.724   -7.235  -7.497  1.00 0.00 ? 15 LEU B HD22 2  
ATOM 2258  H HD23 . LEU B 1 15 ? 3.795   -8.448  -6.619  1.00 0.00 ? 15 LEU B HD23 2  
ATOM 2259  N N    . ALA B 1 16 ? 4.814   -8.205  -1.733  1.00 0.00 ? 16 ALA B N    2  
ATOM 2260  C CA   . ALA B 1 16 ? 4.099   -7.247  -0.898  1.00 0.00 ? 16 ALA B CA   2  
ATOM 2261  C C    . ALA B 1 16 ? 5.054   -6.521  0.045   1.00 0.00 ? 16 ALA B C    2  
ATOM 2262  O O    . ALA B 1 16 ? 4.901   -5.328  0.297   1.00 0.00 ? 16 ALA B O    2  
ATOM 2263  C CB   . ALA B 1 16 ? 2.999   -7.943  -0.112  1.00 0.00 ? 16 ALA B CB   2  
ATOM 2264  H H    . ALA B 1 16 ? 4.606   -9.160  -1.636  1.00 0.00 ? 16 ALA B H    2  
ATOM 2265  H HA   . ALA B 1 16 ? 3.630   -6.518  -1.547  1.00 0.00 ? 16 ALA B HA   2  
ATOM 2266  H HB1  . ALA B 1 16 ? 2.467   -7.215  0.486   1.00 0.00 ? 16 ALA B HB1  2  
ATOM 2267  H HB2  . ALA B 1 16 ? 3.425   -8.689  0.535   1.00 0.00 ? 16 ALA B HB2  2  
ATOM 2268  H HB3  . ALA B 1 16 ? 2.308   -8.408  -0.794  1.00 0.00 ? 16 ALA B HB3  2  
ATOM 2269  N N    . LEU B 1 17 ? 6.039   -7.249  0.567   1.00 0.00 ? 17 LEU B N    2  
ATOM 2270  C CA   . LEU B 1 17 ? 7.018   -6.659  1.474   1.00 0.00 ? 17 LEU B CA   2  
ATOM 2271  C C    . LEU B 1 17 ? 7.980   -5.759  0.711   1.00 0.00 ? 17 LEU B C    2  
ATOM 2272  O O    . LEU B 1 17 ? 8.422   -4.729  1.223   1.00 0.00 ? 17 LEU B O    2  
ATOM 2273  C CB   . LEU B 1 17 ? 7.799   -7.749  2.219   1.00 0.00 ? 17 LEU B CB   2  
ATOM 2274  C CG   . LEU B 1 17 ? 7.085   -8.368  3.428   1.00 0.00 ? 17 LEU B CG   2  
ATOM 2275  C CD1  . LEU B 1 17 ? 6.761   -7.304  4.467   1.00 0.00 ? 17 LEU B CD1  2  
ATOM 2276  C CD2  . LEU B 1 17 ? 5.820   -9.091  2.991   1.00 0.00 ? 17 LEU B CD2  2  
ATOM 2277  H H    . LEU B 1 17 ? 6.118   -8.205  0.337   1.00 0.00 ? 17 LEU B H    2  
ATOM 2278  H HA   . LEU B 1 17 ? 6.489   -6.043  2.183   1.00 0.00 ? 17 LEU B HA   2  
ATOM 2279  H HB2  . LEU B 1 17 ? 8.032   -8.540  1.519   1.00 0.00 ? 17 LEU B HB2  2  
ATOM 2280  H HB3  . LEU B 1 17 ? 8.735   -7.331  2.572   1.00 0.00 ? 17 LEU B HB3  2  
ATOM 2281  H HG   . LEU B 1 17 ? 7.741   -9.092  3.890   1.00 0.00 ? 17 LEU B HG   2  
ATOM 2282  H HD11 . LEU B 1 17 ? 7.653   -6.740  4.705   1.00 0.00 ? 17 LEU B HD11 2  
ATOM 2283  H HD12 . LEU B 1 17 ? 6.397   -7.783  5.364   1.00 0.00 ? 17 LEU B HD12 2  
ATOM 2284  H HD13 . LEU B 1 17 ? 6.002   -6.634  4.091   1.00 0.00 ? 17 LEU B HD13 2  
ATOM 2285  H HD21 . LEU B 1 17 ? 6.078   -9.853  2.277   1.00 0.00 ? 17 LEU B HD21 2  
ATOM 2286  H HD22 . LEU B 1 17 ? 5.126   -8.395  2.549   1.00 0.00 ? 17 LEU B HD22 2  
ATOM 2287  H HD23 . LEU B 1 17 ? 5.357   -9.557  3.851   1.00 0.00 ? 17 LEU B HD23 2  
ATOM 2288  N N    . VAL B 1 18 ? 8.301   -6.152  -0.518  1.00 0.00 ? 18 VAL B N    2  
ATOM 2289  C CA   . VAL B 1 18 ? 9.210   -5.378  -1.356  1.00 0.00 ? 18 VAL B CA   2  
ATOM 2290  C C    . VAL B 1 18 ? 8.611   -4.019  -1.702  1.00 0.00 ? 18 VAL B C    2  
ATOM 2291  O O    . VAL B 1 18 ? 9.309   -3.005  -1.688  1.00 0.00 ? 18 VAL B O    2  
ATOM 2292  C CB   . VAL B 1 18 ? 9.552   -6.124  -2.661  1.00 0.00 ? 18 VAL B CB   2  
ATOM 2293  C CG1  . VAL B 1 18 ? 10.472  -5.286  -3.537  1.00 0.00 ? 18 VAL B CG1  2  
ATOM 2294  C CG2  . VAL B 1 18 ? 10.185  -7.473  -2.353  1.00 0.00 ? 18 VAL B CG2  2  
ATOM 2295  H H    . VAL B 1 18 ? 7.916   -6.983  -0.879  1.00 0.00 ? 18 VAL B H    2  
ATOM 2296  H HA   . VAL B 1 18 ? 10.130  -5.221  -0.804  1.00 0.00 ? 18 VAL B HA   2  
ATOM 2297  H HB   . VAL B 1 18 ? 8.635   -6.300  -3.206  1.00 0.00 ? 18 VAL B HB   2  
ATOM 2298  H HG11 . VAL B 1 18 ? 10.834  -5.885  -4.364  1.00 0.00 ? 18 VAL B HG11 2  
ATOM 2299  H HG12 . VAL B 1 18 ? 11.316  -4.937  -2.958  1.00 0.00 ? 18 VAL B HG12 2  
ATOM 2300  H HG13 . VAL B 1 18 ? 9.932   -4.438  -3.932  1.00 0.00 ? 18 VAL B HG13 2  
ATOM 2301  H HG21 . VAL B 1 18 ? 9.549   -8.043  -1.710  1.00 0.00 ? 18 VAL B HG21 2  
ATOM 2302  H HG22 . VAL B 1 18 ? 11.137  -7.323  -1.864  1.00 0.00 ? 18 VAL B HG22 2  
ATOM 2303  H HG23 . VAL B 1 18 ? 10.339  -8.017  -3.275  1.00 0.00 ? 18 VAL B HG23 2  
ATOM 2304  N N    . VAL B 1 19 ? 7.317   -4.001  -2.007  1.00 0.00 ? 19 VAL B N    2  
ATOM 2305  C CA   . VAL B 1 19 ? 6.637   -2.761  -2.358  1.00 0.00 ? 19 VAL B CA   2  
ATOM 2306  C C    . VAL B 1 19 ? 6.371   -1.907  -1.124  1.00 0.00 ? 19 VAL B C    2  
ATOM 2307  O O    . VAL B 1 19 ? 6.497   -0.688  -1.172  1.00 0.00 ? 19 VAL B O    2  
ATOM 2308  C CB   . VAL B 1 19 ? 5.308   -3.019  -3.096  1.00 0.00 ? 19 VAL B CB   2  
ATOM 2309  C CG1  . VAL B 1 19 ? 5.549   -3.828  -4.360  1.00 0.00 ? 19 VAL B CG1  2  
ATOM 2310  C CG2  . VAL B 1 19 ? 4.306   -3.721  -2.188  1.00 0.00 ? 19 VAL B CG2  2  
ATOM 2311  H H    . VAL B 1 19 ? 6.807   -4.842  -2.002  1.00 0.00 ? 19 VAL B H    2  
ATOM 2312  H HA   . VAL B 1 19 ? 7.282   -2.198  -3.026  1.00 0.00 ? 19 VAL B HA   2  
ATOM 2313  H HB   . VAL B 1 19 ? 4.888   -2.066  -3.389  1.00 0.00 ? 19 VAL B HB   2  
ATOM 2314  H HG11 . VAL B 1 19 ? 4.606   -4.032  -4.849  1.00 0.00 ? 19 VAL B HG11 2  
ATOM 2315  H HG12 . VAL B 1 19 ? 6.033   -4.756  -4.119  1.00 0.00 ? 19 VAL B HG12 2  
ATOM 2316  H HG13 . VAL B 1 19 ? 6.179   -3.262  -5.031  1.00 0.00 ? 19 VAL B HG13 2  
ATOM 2317  H HG21 . VAL B 1 19 ? 4.051   -3.099  -1.348  1.00 0.00 ? 19 VAL B HG21 2  
ATOM 2318  H HG22 . VAL B 1 19 ? 4.720   -4.644  -1.849  1.00 0.00 ? 19 VAL B HG22 2  
ATOM 2319  H HG23 . VAL B 1 19 ? 3.404   -3.930  -2.749  1.00 0.00 ? 19 VAL B HG23 2  
ATOM 2320  N N    . LEU B 1 20 ? 6.011   -2.552  -0.016  1.00 0.00 ? 20 LEU B N    2  
ATOM 2321  C CA   . LEU B 1 20 ? 5.729   -1.834  1.223   1.00 0.00 ? 20 LEU B CA   2  
ATOM 2322  C C    . LEU B 1 20 ? 6.948   -1.033  1.669   1.00 0.00 ? 20 LEU B C    2  
ATOM 2323  O O    . LEU B 1 20 ? 6.816   0.012   2.306   1.00 0.00 ? 20 LEU B O    2  
ATOM 2324  C CB   . LEU B 1 20 ? 5.304   -2.806  2.325   1.00 0.00 ? 20 LEU B CB   2  
ATOM 2325  C CG   . LEU B 1 20 ? 4.846   -2.148  3.630   1.00 0.00 ? 20 LEU B CG   2  
ATOM 2326  C CD1  . LEU B 1 20 ? 3.585   -1.323  3.406   1.00 0.00 ? 20 LEU B CD1  2  
ATOM 2327  C CD2  . LEU B 1 20 ? 4.610   -3.202  4.701   1.00 0.00 ? 20 LEU B CD2  2  
ATOM 2328  H H    . LEU B 1 20 ? 5.930   -3.534  -0.025  1.00 0.00 ? 20 LEU B H    2  
ATOM 2329  H HA   . LEU B 1 20 ? 4.919   -1.148  1.026   1.00 0.00 ? 20 LEU B HA   2  
ATOM 2330  H HB2  . LEU B 1 20 ? 4.494   -3.415  1.942   1.00 0.00 ? 20 LEU B HB2  2  
ATOM 2331  H HB3  . LEU B 1 20 ? 6.143   -3.456  2.543   1.00 0.00 ? 20 LEU B HB3  2  
ATOM 2332  H HG   . LEU B 1 20 ? 5.619   -1.482  3.986   1.00 0.00 ? 20 LEU B HG   2  
ATOM 2333  H HD11 . LEU B 1 20 ? 3.258   -0.896  4.345   1.00 0.00 ? 20 LEU B HD11 2  
ATOM 2334  H HD12 . LEU B 1 20 ? 2.802   -1.953  3.009   1.00 0.00 ? 20 LEU B HD12 2  
ATOM 2335  H HD13 . LEU B 1 20 ? 3.792   -0.525  2.709   1.00 0.00 ? 20 LEU B HD13 2  
ATOM 2336  H HD21 . LEU B 1 20 ? 4.314   -2.722  5.624   1.00 0.00 ? 20 LEU B HD21 2  
ATOM 2337  H HD22 . LEU B 1 20 ? 5.521   -3.760  4.868   1.00 0.00 ? 20 LEU B HD22 2  
ATOM 2338  H HD23 . LEU B 1 20 ? 3.829   -3.879  4.382   1.00 0.00 ? 20 LEU B HD23 2  
ATOM 2339  N N    . THR B 1 21 ? 8.134   -1.531  1.330   1.00 0.00 ? 21 THR B N    2  
ATOM 2340  C CA   . THR B 1 21 ? 9.373   -0.854  1.689   1.00 0.00 ? 21 THR B CA   2  
ATOM 2341  C C    . THR B 1 21 ? 9.632   0.318   0.750   1.00 0.00 ? 21 THR B C    2  
ATOM 2342  O O    . THR B 1 21 ? 10.067  1.387   1.179   1.00 0.00 ? 21 THR B O    2  
ATOM 2343  C CB   . THR B 1 21 ? 10.578  -1.814  1.640   1.00 0.00 ? 21 THR B CB   2  
ATOM 2344  O OG1  . THR B 1 21 ? 10.333  -2.953  2.472   1.00 0.00 ? 21 THR B OG1  2  
ATOM 2345  C CG2  . THR B 1 21 ? 11.848  -1.110  2.100   1.00 0.00 ? 21 THR B CG2  2  
ATOM 2346  H H    . THR B 1 21 ? 8.191   -2.374  0.826   1.00 0.00 ? 21 THR B H    2  
ATOM 2347  H HA   . THR B 1 21 ? 9.279   -0.478  2.703   1.00 0.00 ? 21 THR B HA   2  
ATOM 2348  H HB   . THR B 1 21 ? 10.719  -2.149  0.620   1.00 0.00 ? 21 THR B HB   2  
ATOM 2349  H HG1  . THR B 1 21 ? 10.859  -3.697  2.166   1.00 0.00 ? 21 THR B HG1  2  
ATOM 2350  H HG21 . THR B 1 21 ? 12.623  -1.845  2.259   1.00 0.00 ? 21 THR B HG21 2  
ATOM 2351  H HG22 . THR B 1 21 ? 11.665  -0.582  3.027   1.00 0.00 ? 21 THR B HG22 2  
ATOM 2352  H HG23 . THR B 1 21 ? 12.172  -0.411  1.344   1.00 0.00 ? 21 THR B HG23 2  
ATOM 2353  N N    . ILE B 1 22 ? 9.357   0.110   -0.534  1.00 0.00 ? 22 ILE B N    2  
ATOM 2354  C CA   . ILE B 1 22 ? 9.556   1.147   -1.537  1.00 0.00 ? 22 ILE B CA   2  
ATOM 2355  C C    . ILE B 1 22 ? 8.565   2.289   -1.341  1.00 0.00 ? 22 ILE B C    2  
ATOM 2356  O O    . ILE B 1 22 ? 8.906   3.456   -1.527  1.00 0.00 ? 22 ILE B O    2  
ATOM 2357  C CB   . ILE B 1 22 ? 9.416   0.580   -2.965  1.00 0.00 ? 22 ILE B CB   2  
ATOM 2358  C CG1  . ILE B 1 22 ? 10.494  -0.476  -3.218  1.00 0.00 ? 22 ILE B CG1  2  
ATOM 2359  C CG2  . ILE B 1 22 ? 9.508   1.697   -3.998  1.00 0.00 ? 22 ILE B CG2  2  
ATOM 2360  C CD1  . ILE B 1 22 ? 10.311  -1.234  -4.514  1.00 0.00 ? 22 ILE B CD1  2  
ATOM 2361  H H    . ILE B 1 22 ? 9.010   -0.767  -0.823  1.00 0.00 ? 22 ILE B H    2  
ATOM 2362  H HA   . ILE B 1 22 ? 10.558  1.542   -1.427  1.00 0.00 ? 22 ILE B HA   2  
ATOM 2363  H HB   . ILE B 1 22 ? 8.441   0.121   -3.052  1.00 0.00 ? 22 ILE B HB   2  
ATOM 2364  H HG12 . ILE B 1 22 ? 11.462  0.004   -3.255  1.00 0.00 ? 22 ILE B HG12 2  
ATOM 2365  H HG13 . ILE B 1 22 ? 10.497  -1.193  -2.417  1.00 0.00 ? 22 ILE B HG13 2  
ATOM 2366  H HG21 . ILE B 1 22 ? 8.666   2.363   -3.899  1.00 0.00 ? 22 ILE B HG21 2  
ATOM 2367  H HG22 . ILE B 1 22 ? 9.499   1.282   -4.995  1.00 0.00 ? 22 ILE B HG22 2  
ATOM 2368  H HG23 . ILE B 1 22 ? 10.424  2.254   -3.853  1.00 0.00 ? 22 ILE B HG23 2  
ATOM 2369  H HD11 . ILE B 1 22 ? 10.982  -2.080  -4.530  1.00 0.00 ? 22 ILE B HD11 2  
ATOM 2370  H HD12 . ILE B 1 22 ? 10.535  -0.586  -5.347  1.00 0.00 ? 22 ILE B HD12 2  
ATOM 2371  H HD13 . ILE B 1 22 ? 9.291   -1.585  -4.593  1.00 0.00 ? 22 ILE B HD13 2  
ATOM 2372  N N    . ILE B 1 23 ? 7.337   1.945   -0.962  1.00 0.00 ? 23 ILE B N    2  
ATOM 2373  C CA   . ILE B 1 23 ? 6.304   2.947   -0.735  1.00 0.00 ? 23 ILE B CA   2  
ATOM 2374  C C    . ILE B 1 23 ? 6.745   3.930   0.345   1.00 0.00 ? 23 ILE B C    2  
ATOM 2375  O O    . ILE B 1 23 ? 6.564   5.139   0.209   1.00 0.00 ? 23 ILE B O    2  
ATOM 2376  C CB   . ILE B 1 23 ? 4.962   2.305   -0.320  1.00 0.00 ? 23 ILE B CB   2  
ATOM 2377  C CG1  . ILE B 1 23 ? 4.384   1.476   -1.471  1.00 0.00 ? 23 ILE B CG1  2  
ATOM 2378  C CG2  . ILE B 1 23 ? 3.972   3.380   0.110   1.00 0.00 ? 23 ILE B CG2  2  
ATOM 2379  C CD1  . ILE B 1 23 ? 3.971   2.301   -2.671  1.00 0.00 ? 23 ILE B CD1  2  
ATOM 2380  H H    . ILE B 1 23 ? 7.114   0.996   -0.828  1.00 0.00 ? 23 ILE B H    2  
ATOM 2381  H HA   . ILE B 1 23 ? 6.163   3.498   -1.653  1.00 0.00 ? 23 ILE B HA   2  
ATOM 2382  H HB   . ILE B 1 23 ? 5.143   1.658   0.525   1.00 0.00 ? 23 ILE B HB   2  
ATOM 2383  H HG12 . ILE B 1 23 ? 5.113   0.769   -1.809  1.00 0.00 ? 23 ILE B HG12 2  
ATOM 2384  H HG13 . ILE B 1 23 ? 3.512   0.944   -1.120  1.00 0.00 ? 23 ILE B HG13 2  
ATOM 2385  H HG21 . ILE B 1 23 ? 2.973   2.964   0.150   1.00 0.00 ? 23 ILE B HG21 2  
ATOM 2386  H HG22 . ILE B 1 23 ? 3.983   4.201   -0.594  1.00 0.00 ? 23 ILE B HG22 2  
ATOM 2387  H HG23 . ILE B 1 23 ? 4.234   3.745   1.093   1.00 0.00 ? 23 ILE B HG23 2  
ATOM 2388  H HD11 . ILE B 1 23 ? 2.893   2.306   -2.741  1.00 0.00 ? 23 ILE B HD11 2  
ATOM 2389  H HD12 . ILE B 1 23 ? 4.379   1.855   -3.566  1.00 0.00 ? 23 ILE B HD12 2  
ATOM 2390  H HD13 . ILE B 1 23 ? 4.325   3.319   -2.593  1.00 0.00 ? 23 ILE B HD13 2  
ATOM 2391  N N    . SER B 1 24 ? 7.335   3.398   1.414   1.00 0.00 ? 24 SER B N    2  
ATOM 2392  C CA   . SER B 1 24 ? 7.802   4.221   2.524   1.00 0.00 ? 24 SER B CA   2  
ATOM 2393  C C    . SER B 1 24 ? 9.057   5.001   2.146   1.00 0.00 ? 24 SER B C    2  
ATOM 2394  O O    . SER B 1 24 ? 9.255   6.130   2.597   1.00 0.00 ? 24 SER B O    2  
ATOM 2395  C CB   . SER B 1 24 ? 8.082   3.348   3.750   1.00 0.00 ? 24 SER B CB   2  
ATOM 2396  O OG   . SER B 1 24 ? 9.068   2.370   3.466   1.00 0.00 ? 24 SER B OG   2  
ATOM 2397  H H    . SER B 1 24 ? 7.459   2.420   1.464   1.00 0.00 ? 24 SER B H    2  
ATOM 2398  H HA   . SER B 1 24 ? 7.020   4.927   2.777   1.00 0.00 ? 24 SER B HA   2  
ATOM 2399  H HB2  . SER B 1 24 ? 8.428   3.966   4.568   1.00 0.00 ? 24 SER B HB2  2  
ATOM 2400  H HB3  . SER B 1 24 ? 7.172   2.846   4.043   1.00 0.00 ? 24 SER B HB3  2  
ATOM 2401  H HG   . SER B 1 24 ? 9.289   1.895   4.270   1.00 0.00 ? 24 SER B HG   2  
ATOM 2402  N N    . LEU B 1 25 ? 9.906   4.394   1.321   1.00 0.00 ? 25 LEU B N    2  
ATOM 2403  C CA   . LEU B 1 25 ? 11.140  5.041   0.887   1.00 0.00 ? 25 LEU B CA   2  
ATOM 2404  C C    . LEU B 1 25 ? 10.841  6.295   0.071   1.00 0.00 ? 25 LEU B C    2  
ATOM 2405  O O    . LEU B 1 25 ? 11.515  7.316   0.217   1.00 0.00 ? 25 LEU B O    2  
ATOM 2406  C CB   . LEU B 1 25 ? 11.991  4.070   0.064   1.00 0.00 ? 25 LEU B CB   2  
ATOM 2407  C CG   . LEU B 1 25 ? 12.702  2.979   0.870   1.00 0.00 ? 25 LEU B CG   2  
ATOM 2408  C CD1  . LEU B 1 25 ? 13.338  1.960   -0.060  1.00 0.00 ? 25 LEU B CD1  2  
ATOM 2409  C CD2  . LEU B 1 25 ? 13.752  3.590   1.787   1.00 0.00 ? 25 LEU B CD2  2  
ATOM 2410  H H    . LEU B 1 25 ? 9.705   3.486   0.993   1.00 0.00 ? 25 LEU B H    2  
ATOM 2411  H HA   . LEU B 1 25 ? 11.687  5.340   1.767   1.00 0.00 ? 25 LEU B HA   2  
ATOM 2412  H HB2  . LEU B 1 25 ? 11.340  3.594   -0.660  1.00 0.00 ? 25 LEU B HB2  2  
ATOM 2413  H HB3  . LEU B 1 25 ? 12.744  4.632   -0.478  1.00 0.00 ? 25 LEU B HB3  2  
ATOM 2414  H HG   . LEU B 1 25 ? 11.988  2.469   1.488   1.00 0.00 ? 25 LEU B HG   2  
ATOM 2415  H HD11 . LEU B 1 25 ? 14.073  2.446   -0.687  1.00 0.00 ? 25 LEU B HD11 2  
ATOM 2416  H HD12 . LEU B 1 25 ? 12.578  1.511   -0.682  1.00 0.00 ? 25 LEU B HD12 2  
ATOM 2417  H HD13 . LEU B 1 25 ? 13.820  1.187   0.523   1.00 0.00 ? 25 LEU B HD13 2  
ATOM 2418  H HD21 . LEU B 1 25 ? 13.276  4.241   2.503   1.00 0.00 ? 25 LEU B HD21 2  
ATOM 2419  H HD22 . LEU B 1 25 ? 14.463  4.157   1.202   1.00 0.00 ? 25 LEU B HD22 2  
ATOM 2420  H HD23 . LEU B 1 25 ? 14.273  2.804   2.317   1.00 0.00 ? 25 LEU B HD23 2  
ATOM 2421  N N    . ILE B 1 26 ? 9.828   6.211   -0.785  1.00 0.00 ? 26 ILE B N    2  
ATOM 2422  C CA   . ILE B 1 26 ? 9.437   7.341   -1.621  1.00 0.00 ? 26 ILE B CA   2  
ATOM 2423  C C    . ILE B 1 26 ? 8.969   8.514   -0.768  1.00 0.00 ? 26 ILE B C    2  
ATOM 2424  O O    . ILE B 1 26 ? 9.334   9.662   -1.021  1.00 0.00 ? 26 ILE B O    2  
ATOM 2425  C CB   . ILE B 1 26 ? 8.317   6.949   -2.609  1.00 0.00 ? 26 ILE B CB   2  
ATOM 2426  C CG1  . ILE B 1 26 ? 8.806   5.846   -3.551  1.00 0.00 ? 26 ILE B CG1  2  
ATOM 2427  C CG2  . ILE B 1 26 ? 7.854   8.164   -3.402  1.00 0.00 ? 26 ILE B CG2  2  
ATOM 2428  C CD1  . ILE B 1 26 ? 7.707   5.239   -4.398  1.00 0.00 ? 26 ILE B CD1  2  
ATOM 2429  H H    . ILE B 1 26 ? 9.323   5.368   -0.859  1.00 0.00 ? 26 ILE B H    2  
ATOM 2430  H HA   . ILE B 1 26 ? 10.302  7.655   -2.194  1.00 0.00 ? 26 ILE B HA   2  
ATOM 2431  H HB   . ILE B 1 26 ? 7.476   6.581   -2.037  1.00 0.00 ? 26 ILE B HB   2  
ATOM 2432  H HG12 . ILE B 1 26 ? 9.546   6.256   -4.225  1.00 0.00 ? 26 ILE B HG12 2  
ATOM 2433  H HG13 . ILE B 1 26 ? 9.259   5.054   -2.990  1.00 0.00 ? 26 ILE B HG13 2  
ATOM 2434  H HG21 . ILE B 1 26 ? 7.377   8.874   -2.746  1.00 0.00 ? 26 ILE B HG21 2  
ATOM 2435  H HG22 . ILE B 1 26 ? 7.141   7.865   -4.157  1.00 0.00 ? 26 ILE B HG22 2  
ATOM 2436  H HG23 . ILE B 1 26 ? 8.703   8.633   -3.881  1.00 0.00 ? 26 ILE B HG23 2  
ATOM 2437  H HD11 . ILE B 1 26 ? 6.868   4.970   -3.772  1.00 0.00 ? 26 ILE B HD11 2  
ATOM 2438  H HD12 . ILE B 1 26 ? 8.083   4.354   -4.890  1.00 0.00 ? 26 ILE B HD12 2  
ATOM 2439  H HD13 . ILE B 1 26 ? 7.387   5.953   -5.142  1.00 0.00 ? 26 ILE B HD13 2  
ATOM 2440  N N    . ILE B 1 27 ? 8.162   8.218   0.246   1.00 0.00 ? 27 ILE B N    2  
ATOM 2441  C CA   . ILE B 1 27 ? 7.645   9.249   1.140   1.00 0.00 ? 27 ILE B CA   2  
ATOM 2442  C C    . ILE B 1 27 ? 8.762   9.857   1.981   1.00 0.00 ? 27 ILE B C    2  
ATOM 2443  O O    . ILE B 1 27 ? 8.769   11.060  2.249   1.00 0.00 ? 27 ILE B O    2  
ATOM 2444  C CB   . ILE B 1 27 ? 6.562   8.688   2.082   1.00 0.00 ? 27 ILE B CB   2  
ATOM 2445  C CG1  . ILE B 1 27 ? 5.480   7.951   1.283   1.00 0.00 ? 27 ILE B CG1  2  
ATOM 2446  C CG2  . ILE B 1 27 ? 5.951   9.806   2.915   1.00 0.00 ? 27 ILE B CG2  2  
ATOM 2447  C CD1  . ILE B 1 27 ? 4.789   8.810   0.246   1.00 0.00 ? 27 ILE B CD1  2  
ATOM 2448  H H    . ILE B 1 27 ? 7.916   7.278   0.403   1.00 0.00 ? 27 ILE B H    2  
ATOM 2449  H HA   . ILE B 1 27 ? 7.205   10.030  0.535   1.00 0.00 ? 27 ILE B HA   2  
ATOM 2450  H HB   . ILE B 1 27 ? 7.028   7.985   2.761   1.00 0.00 ? 27 ILE B HB   2  
ATOM 2451  H HG12 . ILE B 1 27 ? 5.913   7.122   0.775   1.00 0.00 ? 27 ILE B HG12 2  
ATOM 2452  H HG13 . ILE B 1 27 ? 4.723   7.586   1.963   1.00 0.00 ? 27 ILE B HG13 2  
ATOM 2453  H HG21 . ILE B 1 27 ? 6.685   10.191  3.606   1.00 0.00 ? 27 ILE B HG21 2  
ATOM 2454  H HG22 . ILE B 1 27 ? 5.109   9.423   3.477   1.00 0.00 ? 27 ILE B HG22 2  
ATOM 2455  H HG23 . ILE B 1 27 ? 5.613   10.605  2.269   1.00 0.00 ? 27 ILE B HG23 2  
ATOM 2456  H HD11 . ILE B 1 27 ? 5.496   9.106   -0.514  1.00 0.00 ? 27 ILE B HD11 2  
ATOM 2457  H HD12 . ILE B 1 27 ? 4.372   9.689   0.713   1.00 0.00 ? 27 ILE B HD12 2  
ATOM 2458  H HD13 . ILE B 1 27 ? 3.994   8.241   -0.213  1.00 0.00 ? 27 ILE B HD13 2  
ATOM 2459  N N    . LEU B 1 28 ? 9.704   9.015   2.394   1.00 0.00 ? 28 LEU B N    2  
ATOM 2460  C CA   . LEU B 1 28 ? 10.830  9.460   3.208   1.00 0.00 ? 28 LEU B CA   2  
ATOM 2461  C C    . LEU B 1 28 ? 11.638  10.534  2.486   1.00 0.00 ? 28 LEU B C    2  
ATOM 2462  O O    . LEU B 1 28 ? 11.869  11.618  3.022   1.00 0.00 ? 28 LEU B O    2  
ATOM 2463  C CB   . LEU B 1 28 ? 11.732  8.271   3.555   1.00 0.00 ? 28 LEU B CB   2  
ATOM 2464  C CG   . LEU B 1 28 ? 12.944  8.601   4.430   1.00 0.00 ? 28 LEU B CG   2  
ATOM 2465  C CD1  . LEU B 1 28 ? 12.500  9.085   5.801   1.00 0.00 ? 28 LEU B CD1  2  
ATOM 2466  C CD2  . LEU B 1 28 ? 13.851  7.386   4.562   1.00 0.00 ? 28 LEU B CD2  2  
ATOM 2467  H H    . LEU B 1 28 ? 9.643   8.061   2.152   1.00 0.00 ? 28 LEU B H    2  
ATOM 2468  H HA   . LEU B 1 28 ? 10.435  9.878   4.123   1.00 0.00 ? 28 LEU B HA   2  
ATOM 2469  H HB2  . LEU B 1 28 ? 11.130  7.529   4.064   1.00 0.00 ? 28 LEU B HB2  2  
ATOM 2470  H HB3  . LEU B 1 28 ? 12.086  7.841   2.627   1.00 0.00 ? 28 LEU B HB3  2  
ATOM 2471  H HG   . LEU B 1 28 ? 13.519  9.391   3.970   1.00 0.00 ? 28 LEU B HG   2  
ATOM 2472  H HD11 . LEU B 1 28 ? 13.369  9.296   6.411   1.00 0.00 ? 28 LEU B HD11 2  
ATOM 2473  H HD12 . LEU B 1 28 ? 11.902  8.323   6.282   1.00 0.00 ? 28 LEU B HD12 2  
ATOM 2474  H HD13 . LEU B 1 28 ? 11.915  9.987   5.696   1.00 0.00 ? 28 LEU B HD13 2  
ATOM 2475  H HD21 . LEU B 1 28 ? 13.312  6.577   5.037   1.00 0.00 ? 28 LEU B HD21 2  
ATOM 2476  H HD22 . LEU B 1 28 ? 14.715  7.641   5.160   1.00 0.00 ? 28 LEU B HD22 2  
ATOM 2477  H HD23 . LEU B 1 28 ? 14.179  7.071   3.581   1.00 0.00 ? 28 LEU B HD23 2  
ATOM 2478  N N    . ILE B 1 29 ? 12.062  10.227  1.265   1.00 0.00 ? 29 ILE B N    2  
ATOM 2479  C CA   . ILE B 1 29 ? 12.848  11.161  0.465   1.00 0.00 ? 29 ILE B CA   2  
ATOM 2480  C C    . ILE B 1 29 ? 12.010  12.361  0.035   1.00 0.00 ? 29 ILE B C    2  
ATOM 2481  O O    . ILE B 1 29 ? 12.517  13.478  -0.070  1.00 0.00 ? 29 ILE B O    2  
ATOM 2482  C CB   . ILE B 1 29 ? 13.426  10.474  -0.787  1.00 0.00 ? 29 ILE B CB   2  
ATOM 2483  C CG1  . ILE B 1 29 ? 14.239  9.240   -0.382  1.00 0.00 ? 29 ILE B CG1  2  
ATOM 2484  C CG2  . ILE B 1 29 ? 14.287  11.447  -1.580  1.00 0.00 ? 29 ILE B CG2  2  
ATOM 2485  C CD1  . ILE B 1 29 ? 14.703  8.405   -1.556  1.00 0.00 ? 29 ILE B CD1  2  
ATOM 2486  H H    . ILE B 1 29 ? 11.830  9.346   0.889   1.00 0.00 ? 29 ILE B H    2  
ATOM 2487  H HA   . ILE B 1 29 ? 13.675  11.511  1.071   1.00 0.00 ? 29 ILE B HA   2  
ATOM 2488  H HB   . ILE B 1 29 ? 12.603  10.162  -1.417  1.00 0.00 ? 29 ILE B HB   2  
ATOM 2489  H HG12 . ILE B 1 29 ? 15.116  9.552   0.165   1.00 0.00 ? 29 ILE B HG12 2  
ATOM 2490  H HG13 . ILE B 1 29 ? 13.646  8.596   0.249   1.00 0.00 ? 29 ILE B HG13 2  
ATOM 2491  H HG21 . ILE B 1 29 ? 13.691  12.274  -1.907  1.00 0.00 ? 29 ILE B HG21 2  
ATOM 2492  H HG22 . ILE B 1 29 ? 14.697  10.953  -2.449  1.00 0.00 ? 29 ILE B HG22 2  
ATOM 2493  H HG23 . ILE B 1 29 ? 15.094  11.807  -0.961  1.00 0.00 ? 29 ILE B HG23 2  
ATOM 2494  H HD11 . ILE B 1 29 ? 15.458  8.944   -2.107  1.00 0.00 ? 29 ILE B HD11 2  
ATOM 2495  H HD12 . ILE B 1 29 ? 13.866  8.190   -2.206  1.00 0.00 ? 29 ILE B HD12 2  
ATOM 2496  H HD13 . ILE B 1 29 ? 15.120  7.478   -1.192  1.00 0.00 ? 29 ILE B HD13 2  
ATOM 2497  N N    . MET B 1 30 ? 10.725  12.125  -0.214  1.00 0.00 ? 30 MET B N    2  
ATOM 2498  C CA   . MET B 1 30 ? 9.818   13.187  -0.630  1.00 0.00 ? 30 MET B CA   2  
ATOM 2499  C C    . MET B 1 30 ? 9.763   14.296  0.416   1.00 0.00 ? 30 MET B C    2  
ATOM 2500  O O    . MET B 1 30 ? 9.746   15.480  0.081   1.00 0.00 ? 30 MET B O    2  
ATOM 2501  C CB   . MET B 1 30 ? 8.415   12.623  -0.870  1.00 0.00 ? 30 MET B CB   2  
ATOM 2502  C CG   . MET B 1 30 ? 7.435   13.644  -1.427  1.00 0.00 ? 30 MET B CG   2  
ATOM 2503  S SD   . MET B 1 30 ? 5.799   12.945  -1.723  1.00 0.00 ? 30 MET B SD   2  
ATOM 2504  C CE   . MET B 1 30 ? 5.325   12.471  -0.063  1.00 0.00 ? 30 MET B CE   2  
ATOM 2505  H H    . MET B 1 30 ? 10.370  11.210  -0.120  1.00 0.00 ? 30 MET B H    2  
ATOM 2506  H HA   . MET B 1 30 ? 10.191  13.602  -1.557  1.00 0.00 ? 30 MET B HA   2  
ATOM 2507  H HB2  . MET B 1 30 ? 8.492   11.814  -1.580  1.00 0.00 ? 30 MET B HB2  2  
ATOM 2508  H HB3  . MET B 1 30 ? 8.027   12.239  0.063   1.00 0.00 ? 30 MET B HB3  2  
ATOM 2509  H HG2  . MET B 1 30 ? 7.334   14.457  -0.724  1.00 0.00 ? 30 MET B HG2  2  
ATOM 2510  H HG3  . MET B 1 30 ? 7.822   14.023  -2.361  1.00 0.00 ? 30 MET B HG3  2  
ATOM 2511  H HE1  . MET B 1 30 ? 5.757   13.156  0.652   1.00 0.00 ? 30 MET B HE1  2  
ATOM 2512  H HE2  . MET B 1 30 ? 5.674   11.472  0.139   1.00 0.00 ? 30 MET B HE2  2  
ATOM 2513  H HE3  . MET B 1 30 ? 4.249   12.497  0.023   1.00 0.00 ? 30 MET B HE3  2  
ATOM 2514  N N    . LEU B 1 31 ? 9.735   13.901  1.685   1.00 0.00 ? 31 LEU B N    2  
ATOM 2515  C CA   . LEU B 1 31 ? 9.684   14.858  2.785   1.00 0.00 ? 31 LEU B CA   2  
ATOM 2516  C C    . LEU B 1 31 ? 11.078  15.390  3.108   1.00 0.00 ? 31 LEU B C    2  
ATOM 2517  O O    . LEU B 1 31 ? 11.225  16.484  3.651   1.00 0.00 ? 31 LEU B O    2  
ATOM 2518  C CB   . LEU B 1 31 ? 9.072   14.205  4.028   1.00 0.00 ? 31 LEU B CB   2  
ATOM 2519  C CG   . LEU B 1 31 ? 8.924   15.123  5.242   1.00 0.00 ? 31 LEU B CG   2  
ATOM 2520  C CD1  . LEU B 1 31 ? 7.898   16.213  4.969   1.00 0.00 ? 31 LEU B CD1  2  
ATOM 2521  C CD2  . LEU B 1 31 ? 8.536   14.320  6.475   1.00 0.00 ? 31 LEU B CD2  2  
ATOM 2522  H H    . LEU B 1 31 ? 9.750   12.938  1.897   1.00 0.00 ? 31 LEU B H    2  
ATOM 2523  H HA   . LEU B 1 31 ? 9.058   15.689  2.487   1.00 0.00 ? 31 LEU B HA   2  
ATOM 2524  H HB2  . LEU B 1 31 ? 8.095   13.821  3.762   1.00 0.00 ? 31 LEU B HB2  2  
ATOM 2525  H HB3  . LEU B 1 31 ? 9.699   13.367  4.305   1.00 0.00 ? 31 LEU B HB3  2  
ATOM 2526  H HG   . LEU B 1 31 ? 9.866   15.603  5.453   1.00 0.00 ? 31 LEU B HG   2  
ATOM 2527  H HD11 . LEU B 1 31 ? 8.214   16.795  4.120   1.00 0.00 ? 31 LEU B HD11 2  
ATOM 2528  H HD12 . LEU B 1 31 ? 7.815   16.859  5.832   1.00 0.00 ? 31 LEU B HD12 2  
ATOM 2529  H HD13 . LEU B 1 31 ? 6.935   15.766  4.760   1.00 0.00 ? 31 LEU B HD13 2  
ATOM 2530  H HD21 . LEU B 1 31 ? 9.289   13.569  6.670   1.00 0.00 ? 31 LEU B HD21 2  
ATOM 2531  H HD22 . LEU B 1 31 ? 7.582   13.837  6.311   1.00 0.00 ? 31 LEU B HD22 2  
ATOM 2532  H HD23 . LEU B 1 31 ? 8.462   14.979  7.329   1.00 0.00 ? 31 LEU B HD23 2  
ATOM 2533  N N    . TRP B 1 32 ? 12.097  14.605  2.769   1.00 0.00 ? 32 TRP B N    2  
ATOM 2534  C CA   . TRP B 1 32 ? 13.479  14.993  3.023   1.00 0.00 ? 32 TRP B CA   2  
ATOM 2535  C C    . TRP B 1 32 ? 13.886  16.173  2.146   1.00 0.00 ? 32 TRP B C    2  
ATOM 2536  O O    . TRP B 1 32 ? 14.680  17.020  2.558   1.00 0.00 ? 32 TRP B O    2  
ATOM 2537  C CB   . TRP B 1 32 ? 14.415  13.805  2.773   1.00 0.00 ? 32 TRP B CB   2  
ATOM 2538  C CG   . TRP B 1 32 ? 15.863  14.127  2.995   1.00 0.00 ? 32 TRP B CG   2  
ATOM 2539  C CD1  . TRP B 1 32 ? 16.439  14.559  4.155   1.00 0.00 ? 32 TRP B CD1  2  
ATOM 2540  C CD2  . TRP B 1 32 ? 16.919  14.037  2.030   1.00 0.00 ? 32 TRP B CD2  2  
ATOM 2541  N NE1  . TRP B 1 32 ? 17.787  14.746  3.970   1.00 0.00 ? 32 TRP B NE1  2  
ATOM 2542  C CE2  . TRP B 1 32 ? 18.107  14.432  2.675   1.00 0.00 ? 32 TRP B CE2  2  
ATOM 2543  C CE3  . TRP B 1 32 ? 16.977  13.661  0.684   1.00 0.00 ? 32 TRP B CE3  2  
ATOM 2544  C CZ2  . TRP B 1 32 ? 19.336  14.462  2.021   1.00 0.00 ? 32 TRP B CZ2  2  
ATOM 2545  C CZ3  . TRP B 1 32 ? 18.198  13.690  0.036   1.00 0.00 ? 32 TRP B CZ3  2  
ATOM 2546  C CH2  . TRP B 1 32 ? 19.363  14.089  0.705   1.00 0.00 ? 32 TRP B CH2  2  
ATOM 2547  H H    . TRP B 1 32 ? 11.925  13.738  2.345   1.00 0.00 ? 32 TRP B H    2  
ATOM 2548  H HA   . TRP B 1 32 ? 13.564  15.287  4.061   1.00 0.00 ? 32 TRP B HA   2  
ATOM 2549  H HB2  . TRP B 1 32 ? 14.148  13.000  3.442   1.00 0.00 ? 32 TRP B HB2  2  
ATOM 2550  H HB3  . TRP B 1 32 ? 14.294  13.472  1.752   1.00 0.00 ? 32 TRP B HB3  2  
ATOM 2551  H HD1  . TRP B 1 32 ? 15.900  14.728  5.076   1.00 0.00 ? 32 TRP B HD1  2  
ATOM 2552  H HE1  . TRP B 1 32 ? 18.418  15.053  4.654   1.00 0.00 ? 32 TRP B HE1  2  
ATOM 2553  H HE3  . TRP B 1 32 ? 16.091  13.353  0.153   1.00 0.00 ? 32 TRP B HE3  2  
ATOM 2554  H HZ2  . TRP B 1 32 ? 20.243  14.766  2.522   1.00 0.00 ? 32 TRP B HZ2  2  
ATOM 2555  H HZ3  . TRP B 1 32 ? 18.262  13.404  -1.003  1.00 0.00 ? 32 TRP B HZ3  2  
ATOM 2556  H HH2  . TRP B 1 32 ? 20.295  14.097  0.159   1.00 0.00 ? 32 TRP B HH2  2  
ATOM 2557  N N    . GLN B 1 33 ? 13.336  16.227  0.936   1.00 0.00 ? 33 GLN B N    2  
ATOM 2558  C CA   . GLN B 1 33 ? 13.645  17.306  0.003   1.00 0.00 ? 33 GLN B CA   2  
ATOM 2559  C C    . GLN B 1 33 ? 12.543  18.363  0.006   1.00 0.00 ? 33 GLN B C    2  
ATOM 2560  O O    . GLN B 1 33 ? 12.522  19.249  -0.849  1.00 0.00 ? 33 GLN B O    2  
ATOM 2561  C CB   . GLN B 1 33 ? 13.836  16.751  -1.410  1.00 0.00 ? 33 GLN B CB   2  
ATOM 2562  C CG   . GLN B 1 33 ? 14.901  15.669  -1.500  1.00 0.00 ? 33 GLN B CG   2  
ATOM 2563  C CD   . GLN B 1 33 ? 15.222  15.281  -2.931  1.00 0.00 ? 33 GLN B CD   2  
ATOM 2564  O OE1  . GLN B 1 33 ? 16.119  15.849  -3.553  1.00 0.00 ? 33 GLN B OE1  2  
ATOM 2565  N NE2  . GLN B 1 33 ? 14.487  14.311  -3.461  1.00 0.00 ? 33 GLN B NE2  2  
ATOM 2566  H H    . GLN B 1 33 ? 12.704  15.528  0.649   1.00 0.00 ? 33 GLN B H    2  
ATOM 2567  H HA   . GLN B 1 33 ? 14.570  17.782  0.305   1.00 0.00 ? 33 GLN B HA   2  
ATOM 2568  H HB2  . GLN B 1 33 ? 12.900  16.330  -1.754  1.00 0.00 ? 33 GLN B HB2  2  
ATOM 2569  H HB3  . GLN B 1 33 ? 14.119  17.564  -2.067  1.00 0.00 ? 33 GLN B HB3  2  
ATOM 2570  H HG2  . GLN B 1 33 ? 15.808  16.032  -1.036  1.00 0.00 ? 33 GLN B HG2  2  
ATOM 2571  H HG3  . GLN B 1 33 ? 14.553  14.794  -0.969  1.00 0.00 ? 33 GLN B HG3  2  
ATOM 2572  H HE21 . GLN B 1 33 ? 13.779  13.904  -2.924  1.00 0.00 ? 33 GLN B HE21 2  
ATOM 2573  H HE22 . GLN B 1 33 ? 14.686  14.039  -4.381  1.00 0.00 ? 33 GLN B HE22 2  
ATOM 2574  N N    . LYS B 1 34 ? 11.631  18.262  0.969   1.00 0.00 ? 34 LYS B N    2  
ATOM 2575  C CA   . LYS B 1 34 ? 10.527  19.211  1.085   1.00 0.00 ? 34 LYS B CA   2  
ATOM 2576  C C    . LYS B 1 34 ? 11.048  20.642  1.202   1.00 0.00 ? 34 LYS B C    2  
ATOM 2577  O O    . LYS B 1 34 ? 10.475  21.568  0.630   1.00 0.00 ? 34 LYS B O    2  
ATOM 2578  C CB   . LYS B 1 34 ? 9.659   18.873  2.301   1.00 0.00 ? 34 LYS B CB   2  
ATOM 2579  C CG   . LYS B 1 34 ? 8.524   19.859  2.535   1.00 0.00 ? 34 LYS B CG   2  
ATOM 2580  C CD   . LYS B 1 34 ? 7.807   19.581  3.847   1.00 0.00 ? 34 LYS B CD   2  
ATOM 2581  C CE   . LYS B 1 34 ? 6.742   20.629  4.132   1.00 0.00 ? 34 LYS B CE   2  
ATOM 2582  N NZ   . LYS B 1 34 ? 7.314   22.002  4.190   1.00 0.00 ? 34 LYS B NZ   2  
ATOM 2583  H H    . LYS B 1 34 ? 11.688  17.545  1.624   1.00 0.00 ? 34 LYS B H    2  
ATOM 2584  H HA   . LYS B 1 34 ? 9.923   19.132  0.192   1.00 0.00 ? 34 LYS B HA   2  
ATOM 2585  H HB2  . LYS B 1 34 ? 9.231   17.891  2.160   1.00 0.00 ? 34 LYS B HB2  2  
ATOM 2586  H HB3  . LYS B 1 34 ? 10.290  18.858  3.180   1.00 0.00 ? 34 LYS B HB3  2  
ATOM 2587  H HG2  . LYS B 1 34 ? 8.922   20.860  2.566   1.00 0.00 ? 34 LYS B HG2  2  
ATOM 2588  H HG3  . LYS B 1 34 ? 7.816   19.776  1.724   1.00 0.00 ? 34 LYS B HG3  2  
ATOM 2589  H HD2  . LYS B 1 34 ? 7.327   18.621  3.782   1.00 0.00 ? 34 LYS B HD2  2  
ATOM 2590  H HD3  . LYS B 1 34 ? 8.524   19.579  4.657   1.00 0.00 ? 34 LYS B HD3  2  
ATOM 2591  H HE2  . LYS B 1 34 ? 5.996   20.592  3.351   1.00 0.00 ? 34 LYS B HE2  2  
ATOM 2592  H HE3  . LYS B 1 34 ? 6.278   20.402  5.081   1.00 0.00 ? 34 LYS B HE3  2  
ATOM 2593  H HZ1  . LYS B 1 34 ? 6.626   22.651  4.623   1.00 0.00 ? 34 LYS B HZ1  2  
ATOM 2594  H HZ2  . LYS B 1 34 ? 7.530   22.343  3.233   1.00 0.00 ? 34 LYS B HZ2  2  
ATOM 2595  H HZ3  . LYS B 1 34 ? 8.188   22.017  4.759   1.00 0.00 ? 34 LYS B HZ3  2  
ATOM 2596  N N    . LYS B 1 35 ? 12.136  20.812  1.948   1.00 0.00 ? 35 LYS B N    2  
ATOM 2597  C CA   . LYS B 1 35 ? 12.731  22.128  2.142   1.00 0.00 ? 35 LYS B CA   2  
ATOM 2598  C C    . LYS B 1 35 ? 13.370  22.638  0.849   1.00 0.00 ? 35 LYS B C    2  
ATOM 2599  O O    . LYS B 1 35 ? 14.298  22.019  0.327   1.00 0.00 ? 35 LYS B O    2  
ATOM 2600  C CB   . LYS B 1 35 ? 13.780  22.077  3.256   1.00 0.00 ? 35 LYS B CB   2  
ATOM 2601  C CG   . LYS B 1 35 ? 13.192  21.784  4.629   1.00 0.00 ? 35 LYS B CG   2  
ATOM 2602  C CD   . LYS B 1 35 ? 12.236  22.880  5.073   1.00 0.00 ? 35 LYS B CD   2  
ATOM 2603  C CE   . LYS B 1 35 ? 11.646  22.583  6.442   1.00 0.00 ? 35 LYS B CE   2  
ATOM 2604  N NZ   . LYS B 1 35 ? 12.700  22.475  7.487   1.00 0.00 ? 35 LYS B NZ   2  
ATOM 2605  H H    . LYS B 1 35 ? 12.553  20.033  2.387   1.00 0.00 ? 35 LYS B H    2  
ATOM 2606  H HA   . LYS B 1 35 ? 11.947  22.790  2.443   1.00 0.00 ? 35 LYS B HA   2  
ATOM 2607  H HB2  . LYS B 1 35 ? 14.494  21.301  3.023   1.00 0.00 ? 35 LYS B HB2  2  
ATOM 2608  H HB3  . LYS B 1 35 ? 14.299  23.027  3.306   1.00 0.00 ? 35 LYS B HB3  2  
ATOM 2609  H HG2  . LYS B 1 35 ? 12.659  20.844  4.588   1.00 0.00 ? 35 LYS B HG2  2  
ATOM 2610  H HG3  . LYS B 1 35 ? 14.002  21.710  5.340   1.00 0.00 ? 35 LYS B HG3  2  
ATOM 2611  H HD2  . LYS B 1 35 ? 12.769  23.818  5.122   1.00 0.00 ? 35 LYS B HD2  2  
ATOM 2612  H HD3  . LYS B 1 35 ? 11.425  22.962  4.368   1.00 0.00 ? 35 LYS B HD3  2  
ATOM 2613  H HE2  . LYS B 1 35 ? 10.970  23.382  6.708   1.00 0.00 ? 35 LYS B HE2  2  
ATOM 2614  H HE3  . LYS B 1 35 ? 11.099  21.652  6.395   1.00 0.00 ? 35 LYS B HE3  2  
ATOM 2615  H HZ1  . LYS B 1 35 ? 12.261  22.468  8.430   1.00 0.00 ? 35 LYS B HZ1  2  
ATOM 2616  H HZ2  . LYS B 1 35 ? 13.357  23.282  7.435   1.00 0.00 ? 35 LYS B HZ2  2  
ATOM 2617  H HZ3  . LYS B 1 35 ? 13.239  21.594  7.367   1.00 0.00 ? 35 LYS B HZ3  2  
ATOM 2618  N N    . PRO B 1 36 ? 12.883  23.774  0.311   1.00 0.00 ? 36 PRO B N    2  
ATOM 2619  C CA   . PRO B 1 36 ? 13.421  24.351  -0.925  1.00 0.00 ? 36 PRO B CA   2  
ATOM 2620  C C    . PRO B 1 36 ? 14.886  24.746  -0.782  1.00 0.00 ? 36 PRO B C    2  
ATOM 2621  O O    . PRO B 1 36 ? 15.292  25.302  0.239   1.00 0.00 ? 36 PRO B O    2  
ATOM 2622  C CB   . PRO B 1 36 ? 12.557  25.596  -1.160  1.00 0.00 ? 36 PRO B CB   2  
ATOM 2623  C CG   . PRO B 1 36 ? 11.337  25.388  -0.331  1.00 0.00 ? 36 PRO B CG   2  
ATOM 2624  C CD   . PRO B 1 36 ? 11.779  24.582  0.855   1.00 0.00 ? 36 PRO B CD   2  
ATOM 2625  H HA   . PRO B 1 36 ? 13.304  23.668  -1.756  1.00 0.00 ? 36 PRO B HA   2  
ATOM 2626  H HB2  . PRO B 1 36 ? 13.083  26.493  -0.854  1.00 0.00 ? 36 PRO B HB2  2  
ATOM 2627  H HB3  . PRO B 1 36 ? 12.306  25.665  -2.208  1.00 0.00 ? 36 PRO B HB3  2  
ATOM 2628  H HG2  . PRO B 1 36 ? 10.943  26.341  -0.011  1.00 0.00 ? 36 PRO B HG2  2  
ATOM 2629  H HG3  . PRO B 1 36 ? 10.595  24.845  -0.898  1.00 0.00 ? 36 PRO B HG3  2  
ATOM 2630  H HD2  . PRO B 1 36 ? 12.122  25.230  1.649   1.00 0.00 ? 36 PRO B HD2  2  
ATOM 2631  H HD3  . PRO B 1 36 ? 10.964  23.961  1.192   1.00 0.00 ? 36 PRO B HD3  2  
ATOM 2632  N N    . ARG B 1 37 ? 15.676  24.454  -1.810  1.00 0.00 ? 37 ARG B N    2  
ATOM 2633  C CA   . ARG B 1 37 ? 17.097  24.784  -1.797  1.00 0.00 ? 37 ARG B CA   2  
ATOM 2634  C C    . ARG B 1 37 ? 17.489  25.530  -3.066  1.00 0.00 ? 37 ARG B C    2  
ATOM 2635  O O    . ARG B 1 37 ? 17.022  25.208  -4.158  1.00 0.00 ? 37 ARG B O    2  
ATOM 2636  C CB   . ARG B 1 37 ? 17.936  23.515  -1.653  1.00 0.00 ? 37 ARG B CB   2  
ATOM 2637  C CG   . ARG B 1 37 ? 17.618  22.720  -0.399  1.00 0.00 ? 37 ARG B CG   2  
ATOM 2638  C CD   . ARG B 1 37 ? 18.501  21.491  -0.281  1.00 0.00 ? 37 ARG B CD   2  
ATOM 2639  N NE   . ARG B 1 37 ? 18.380  20.616  -1.445  1.00 0.00 ? 37 ARG B NE   2  
ATOM 2640  C CZ   . ARG B 1 37 ? 19.165  19.568  -1.663  1.00 0.00 ? 37 ARG B CZ   2  
ATOM 2641  N NH1  . ARG B 1 37 ? 20.123  19.260  -0.798  1.00 0.00 ? 37 ARG B NH1  2  
ATOM 2642  N NH2  . ARG B 1 37 ? 18.996  18.823  -2.749  1.00 0.00 ? 37 ARG B NH2  2  
ATOM 2643  H H    . ARG B 1 37 ? 15.302  24.004  -2.603  1.00 0.00 ? 37 ARG B H    2  
ATOM 2644  H HA   . ARG B 1 37 ? 17.303  25.426  -0.947  1.00 0.00 ? 37 ARG B HA   2  
ATOM 2645  H HB2  . ARG B 1 37 ? 17.760  22.886  -2.514  1.00 0.00 ? 37 ARG B HB2  2  
ATOM 2646  H HB3  . ARG B 1 37 ? 18.984  23.790  -1.625  1.00 0.00 ? 37 ARG B HB3  2  
ATOM 2647  H HG2  . ARG B 1 37 ? 17.775  23.347  0.466   1.00 0.00 ? 37 ARG B HG2  2  
ATOM 2648  H HG3  . ARG B 1 37 ? 16.587  22.408  -0.437  1.00 0.00 ? 37 ARG B HG3  2  
ATOM 2649  H HD2  . ARG B 1 37 ? 19.528  21.815  -0.183  1.00 0.00 ? 37 ARG B HD2  2  
ATOM 2650  H HD3  . ARG B 1 37 ? 18.213  20.941  0.603   1.00 0.00 ? 37 ARG B HD3  2  
ATOM 2651  H HE   . ARG B 1 37 ? 17.670  20.810  -2.099  1.00 0.00 ? 37 ARG B HE   2  
ATOM 2652  H HH11 . ARG B 1 37 ? 20.273  19.801  0.027   1.00 0.00 ? 37 ARG B HH11 2  
ATOM 2653  H HH12 . ARG B 1 37 ? 20.711  18.467  -0.972  1.00 0.00 ? 37 ARG B HH12 2  
ATOM 2654  H HH21 . ARG B 1 37 ? 18.275  19.049  -3.408  1.00 0.00 ? 37 ARG B HH21 2  
ATOM 2655  H HH22 . ARG B 1 37 ? 19.588  18.032  -2.915  1.00 0.00 ? 37 ARG B HH22 2  
ATOM 2656  N N    . TYR B 1 38 ? 18.350  26.528  -2.914  1.00 0.00 ? 38 TYR B N    2  
ATOM 2657  C CA   . TYR B 1 38 ? 18.804  27.326  -4.046  1.00 0.00 ? 38 TYR B CA   2  
ATOM 2658  C C    . TYR B 1 38 ? 20.300  27.140  -4.277  1.00 0.00 ? 38 TYR B C    2  
ATOM 2659  O O    . TYR B 1 38 ? 21.087  27.121  -3.331  1.00 0.00 ? 38 TYR B O    2  
ATOM 2660  C CB   . TYR B 1 38 ? 18.490  28.803  -3.810  1.00 0.00 ? 38 TYR B CB   2  
ATOM 2661  C CG   . TYR B 1 38 ? 17.021  29.083  -3.579  1.00 0.00 ? 38 TYR B CG   2  
ATOM 2662  C CD1  . TYR B 1 38 ? 16.441  28.876  -2.333  1.00 0.00 ? 38 TYR B CD1  2  
ATOM 2663  C CD2  . TYR B 1 38 ? 16.213  29.555  -4.607  1.00 0.00 ? 38 TYR B CD2  2  
ATOM 2664  C CE1  . TYR B 1 38 ? 15.100  29.131  -2.119  1.00 0.00 ? 38 TYR B CE1  2  
ATOM 2665  C CE2  . TYR B 1 38 ? 14.872  29.813  -4.400  1.00 0.00 ? 38 TYR B CE2  2  
ATOM 2666  C CZ   . TYR B 1 38 ? 14.319  29.599  -3.155  1.00 0.00 ? 38 TYR B CZ   2  
ATOM 2667  O OH   . TYR B 1 38 ? 12.984  29.854  -2.945  1.00 0.00 ? 38 TYR B OH   2  
ATOM 2668  H H    . TYR B 1 38 ? 18.696  26.744  -2.017  1.00 0.00 ? 38 TYR B H    2  
ATOM 2669  H HA   . TYR B 1 38 ? 18.275  27.009  -4.938  1.00 0.00 ? 38 TYR B HA   2  
ATOM 2670  H HB2  . TYR B 1 38 ? 19.036  29.145  -2.939  1.00 0.00 ? 38 TYR B HB2  2  
ATOM 2671  H HB3  . TYR B 1 38 ? 18.815  29.376  -4.671  1.00 0.00 ? 38 TYR B HB3  2  
ATOM 2672  H HD1  . TYR B 1 38 ? 17.052  28.509  -1.520  1.00 0.00 ? 38 TYR B HD1  2  
ATOM 2673  H HD2  . TYR B 1 38 ? 16.645  29.723  -5.584  1.00 0.00 ? 38 TYR B HD2  2  
ATOM 2674  H HE1  . TYR B 1 38 ? 14.668  28.964  -1.143  1.00 0.00 ? 38 TYR B HE1  2  
ATOM 2675  H HE2  . TYR B 1 38 ? 14.262  30.179  -5.212  1.00 0.00 ? 38 TYR B HE2  2  
ATOM 2676  H HH   . TYR B 1 38 ? 12.866  30.781  -2.725  1.00 0.00 ? 38 TYR B HH   2  
ATOM 2677  N N    . GLU B 1 39 ? 20.685  26.999  -5.541  1.00 0.00 ? 39 GLU B N    2  
ATOM 2678  C CA   . GLU B 1 39 ? 22.086  26.815  -5.898  1.00 0.00 ? 39 GLU B CA   2  
ATOM 2679  C C    . GLU B 1 39 ? 22.767  28.159  -6.136  1.00 0.00 ? 39 GLU B C    2  
ATOM 2680  O O    . GLU B 1 39 ? 23.836  28.396  -5.533  1.00 0.00 ? 39 GLU B O    2  
ATOM 2681  C CB   . GLU B 1 39 ? 22.205  25.938  -7.144  1.00 0.00 ? 39 GLU B CB   2  
ATOM 2682  C CG   . GLU B 1 39 ? 21.598  24.555  -6.972  1.00 0.00 ? 39 GLU B CG   2  
ATOM 2683  C CD   . GLU B 1 39 ? 22.248  23.770  -5.849  1.00 0.00 ? 39 GLU B CD   2  
ATOM 2684  O OE1  . GLU B 1 39 ? 23.281  23.115  -6.103  1.00 0.00 ? 39 GLU B OE1  2  
ATOM 2685  O OE2  . GLU B 1 39 ? 21.723  23.811  -4.716  1.00 0.00 ? 39 GLU B OE2  2  
ATOM 2686  O OXT  . GLU B 1 39 ? 22.229  28.967  -6.925  1.00 0.00 ? 39 GLU B OXT  2  
ATOM 2687  H H    . GLU B 1 39 ? 20.009  27.024  -6.260  1.00 0.00 ? 39 GLU B H    2  
ATOM 2688  H HA   . GLU B 1 39 ? 22.593  26.320  -5.078  1.00 0.00 ? 39 GLU B HA   2  
ATOM 2689  H HB2  . GLU B 1 39 ? 21.700  26.426  -7.966  1.00 0.00 ? 39 GLU B HB2  2  
ATOM 2690  H HB3  . GLU B 1 39 ? 23.251  25.818  -7.396  1.00 0.00 ? 39 GLU B HB3  2  
ATOM 2691  H HG2  . GLU B 1 39 ? 20.546  24.662  -6.754  1.00 0.00 ? 39 GLU B HG2  2  
ATOM 2692  H HG3  . GLU B 1 39 ? 21.720  24.005  -7.894  1.00 0.00 ? 39 GLU B HG3  2  
ATOM 2693  N N    . GLY A 1 1  ? 11.925  -24.640 8.226   1.00 0.00 ? 1  GLY A N    3  
ATOM 2694  C CA   . GLY A 1 1  ? 11.905  -26.029 8.761   1.00 0.00 ? 1  GLY A CA   3  
ATOM 2695  C C    . GLY A 1 1  ? 11.829  -27.073 7.665   1.00 0.00 ? 1  GLY A C    3  
ATOM 2696  O O    . GLY A 1 1  ? 12.741  -27.191 6.846   1.00 0.00 ? 1  GLY A O    3  
ATOM 2697  H H1   . GLY A 1 1  ? 11.977  -23.959 9.010   1.00 0.00 ? 1  GLY A H1   3  
ATOM 2698  H H2   . GLY A 1 1  ? 11.061  -24.451 7.677   1.00 0.00 ? 1  GLY A H2   3  
ATOM 2699  H H3   . GLY A 1 1  ? 12.752  -24.502 7.609   1.00 0.00 ? 1  GLY A H3   3  
ATOM 2700  H HA2  . GLY A 1 1  ? 12.808  -26.191 9.332   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2701  H HA3  . GLY A 1 1  ? 11.056  -26.133 9.423   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2702  N N    . HIS A 1 2  ? 10.739  -27.833 7.650   1.00 0.00 ? 2  HIS A N    3  
ATOM 2703  C CA   . HIS A 1 2  ? 10.547  -28.876 6.648   1.00 0.00 ? 2  HIS A CA   3  
ATOM 2704  C C    . HIS A 1 2  ? 9.731   -28.351 5.471   1.00 0.00 ? 2  HIS A C    3  
ATOM 2705  O O    . HIS A 1 2  ? 10.252  -28.180 4.368   1.00 0.00 ? 2  HIS A O    3  
ATOM 2706  C CB   . HIS A 1 2  ? 9.847   -30.087 7.268   1.00 0.00 ? 2  HIS A CB   3  
ATOM 2707  C CG   . HIS A 1 2  ? 10.553  -30.637 8.469   1.00 0.00 ? 2  HIS A CG   3  
ATOM 2708  N ND1  . HIS A 1 2  ? 10.018  -30.597 9.739   1.00 0.00 ? 2  HIS A ND1  3  
ATOM 2709  C CD2  . HIS A 1 2  ? 11.757  -31.245 8.589   1.00 0.00 ? 2  HIS A CD2  3  
ATOM 2710  C CE1  . HIS A 1 2  ? 10.862  -31.156 10.589  1.00 0.00 ? 2  HIS A CE1  3  
ATOM 2711  N NE2  . HIS A 1 2  ? 11.924  -31.558 9.916   1.00 0.00 ? 2  HIS A NE2  3  
ATOM 2712  H H    . HIS A 1 2  ? 10.037  -27.692 8.329   1.00 0.00 ? 2  HIS A H    3  
ATOM 2713  H HA   . HIS A 1 2  ? 11.515  -29.195 6.279   1.00 0.00 ? 2  HIS A HA   3  
ATOM 2714  H HB2  . HIS A 1 2  ? 8.850   -29.817 7.579   1.00 0.00 ? 2  HIS A HB2  3  
ATOM 2715  H HB3  . HIS A 1 2  ? 9.787   -30.877 6.532   1.00 0.00 ? 2  HIS A HB3  3  
ATOM 2716  H HD1  . HIS A 1 2  ? 9.149   -30.215 9.982   1.00 0.00 ? 2  HIS A HD1  3  
ATOM 2717  H HD2  . HIS A 1 2  ? 12.456  -31.446 7.789   1.00 0.00 ? 2  HIS A HD2  3  
ATOM 2718  H HE1  . HIS A 1 2  ? 10.708  -31.266 11.652  1.00 0.00 ? 2  HIS A HE1  3  
ATOM 2719  H HE2  . HIS A 1 2  ? 12.739  -31.929 10.315  1.00 0.00 ? 2  HIS A HE2  3  
ATOM 2720  N N    . SER A 1 3  ? 8.449   -28.097 5.715   1.00 0.00 ? 3  SER A N    3  
ATOM 2721  C CA   . SER A 1 3  ? 7.556   -27.591 4.680   1.00 0.00 ? 3  SER A CA   3  
ATOM 2722  C C    . SER A 1 3  ? 6.802   -26.361 5.171   1.00 0.00 ? 3  SER A C    3  
ATOM 2723  O O    . SER A 1 3  ? 6.411   -26.285 6.336   1.00 0.00 ? 3  SER A O    3  
ATOM 2724  C CB   . SER A 1 3  ? 6.564   -28.676 4.259   1.00 0.00 ? 3  SER A CB   3  
ATOM 2725  O OG   . SER A 1 3  ? 7.238   -29.809 3.738   1.00 0.00 ? 3  SER A OG   3  
ATOM 2726  H H    . SER A 1 3  ? 8.078   -28.241 6.613   1.00 0.00 ? 3  SER A H    3  
ATOM 2727  H HA   . SER A 1 3  ? 8.142   -27.308 3.812   1.00 0.00 ? 3  SER A HA   3  
ATOM 2728  H HB2  . SER A 1 3  ? 5.980   -28.983 5.115   1.00 0.00 ? 3  SER A HB2  3  
ATOM 2729  H HB3  . SER A 1 3  ? 5.904   -28.287 3.495   1.00 0.00 ? 3  SER A HB3  3  
ATOM 2730  H HG   . SER A 1 3  ? 7.565   -30.352 4.461   1.00 0.00 ? 3  SER A HG   3  
ATOM 2731  N N    . LEU A 1 4  ? 6.600   -25.400 4.275   1.00 0.00 ? 4  LEU A N    3  
ATOM 2732  C CA   . LEU A 1 4  ? 5.890   -24.173 4.619   1.00 0.00 ? 4  LEU A CA   3  
ATOM 2733  C C    . LEU A 1 4  ? 4.418   -24.263 4.209   1.00 0.00 ? 4  LEU A C    3  
ATOM 2734  O O    . LEU A 1 4  ? 4.096   -24.192 3.022   1.00 0.00 ? 4  LEU A O    3  
ATOM 2735  C CB   . LEU A 1 4  ? 6.546   -22.969 3.938   1.00 0.00 ? 4  LEU A CB   3  
ATOM 2736  C CG   . LEU A 1 4  ? 5.911   -21.615 4.262   1.00 0.00 ? 4  LEU A CG   3  
ATOM 2737  C CD1  . LEU A 1 4  ? 6.039   -21.303 5.745   1.00 0.00 ? 4  LEU A CD1  3  
ATOM 2738  C CD2  . LEU A 1 4  ? 6.549   -20.515 3.427   1.00 0.00 ? 4  LEU A CD2  3  
ATOM 2739  H H    . LEU A 1 4  ? 6.931   -25.516 3.353   1.00 0.00 ? 4  LEU A H    3  
ATOM 2740  H HA   . LEU A 1 4  ? 5.975   -24.029 5.680   1.00 0.00 ? 4  LEU A HA   3  
ATOM 2741  H HB2  . LEU A 1 4  ? 7.588   -22.942 4.232   1.00 0.00 ? 4  LEU A HB2  3  
ATOM 2742  H HB3  . LEU A 1 4  ? 6.499   -23.123 2.867   1.00 0.00 ? 4  LEU A HB3  3  
ATOM 2743  H HG   . LEU A 1 4  ? 4.859   -21.643 4.019   1.00 0.00 ? 4  LEU A HG   3  
ATOM 2744  H HD11 . LEU A 1 4  ? 5.624   -20.324 5.947   1.00 0.00 ? 4  LEU A HD11 3  
ATOM 2745  H HD12 . LEU A 1 4  ? 7.081   -21.314 6.032   1.00 0.00 ? 4  LEU A HD12 3  
ATOM 2746  H HD13 . LEU A 1 4  ? 5.502   -22.037 6.319   1.00 0.00 ? 4  LEU A HD13 3  
ATOM 2747  H HD21 . LEU A 1 4  ? 6.072   -19.570 3.647   1.00 0.00 ? 4  LEU A HD21 3  
ATOM 2748  H HD22 . LEU A 1 4  ? 6.425   -20.739 2.376   1.00 0.00 ? 4  LEU A HD22 3  
ATOM 2749  H HD23 . LEU A 1 4  ? 7.604   -20.447 3.657   1.00 0.00 ? 4  LEU A HD23 3  
ATOM 2750  N N    . PRO A 1 5  ? 3.500   -24.423 5.184   1.00 0.00 ? 5  PRO A N    3  
ATOM 2751  C CA   . PRO A 1 5  ? 2.062   -24.522 4.904   1.00 0.00 ? 5  PRO A CA   3  
ATOM 2752  C C    . PRO A 1 5  ? 1.502   -23.235 4.310   1.00 0.00 ? 5  PRO A C    3  
ATOM 2753  O O    . PRO A 1 5  ? 1.976   -22.141 4.617   1.00 0.00 ? 5  PRO A O    3  
ATOM 2754  C CB   . PRO A 1 5  ? 1.442   -24.788 6.280   1.00 0.00 ? 5  PRO A CB   3  
ATOM 2755  C CG   . PRO A 1 5  ? 2.442   -24.273 7.255   1.00 0.00 ? 5  PRO A CG   3  
ATOM 2756  C CD   . PRO A 1 5  ? 3.785   -24.519 6.628   1.00 0.00 ? 5  PRO A CD   3  
ATOM 2757  H HA   . PRO A 1 5  ? 1.848   -25.352 4.244   1.00 0.00 ? 5  PRO A HA   3  
ATOM 2758  H HB2  . PRO A 1 5  ? 0.491   -24.279 6.381   1.00 0.00 ? 5  PRO A HB2  3  
ATOM 2759  H HB3  . PRO A 1 5  ? 1.294   -25.850 6.404   1.00 0.00 ? 5  PRO A HB3  3  
ATOM 2760  H HG2  . PRO A 1 5  ? 2.289   -23.216 7.415   1.00 0.00 ? 5  PRO A HG2  3  
ATOM 2761  H HG3  . PRO A 1 5  ? 2.359   -24.812 8.187   1.00 0.00 ? 5  PRO A HG3  3  
ATOM 2762  H HD2  . PRO A 1 5  ? 4.478   -23.762 6.948   1.00 0.00 ? 5  PRO A HD2  3  
ATOM 2763  H HD3  . PRO A 1 5  ? 4.147   -25.502 6.887   1.00 0.00 ? 5  PRO A HD3  3  
ATOM 2764  N N    . PHE A 1 6  ? 0.489   -23.373 3.458   1.00 0.00 ? 6  PHE A N    3  
ATOM 2765  C CA   . PHE A 1 6  ? -0.138  -22.223 2.818   1.00 0.00 ? 6  PHE A CA   3  
ATOM 2766  C C    . PHE A 1 6  ? -0.814  -21.322 3.849   1.00 0.00 ? 6  PHE A C    3  
ATOM 2767  O O    . PHE A 1 6  ? -1.143  -20.173 3.560   1.00 0.00 ? 6  PHE A O    3  
ATOM 2768  C CB   . PHE A 1 6  ? -1.157  -22.680 1.770   1.00 0.00 ? 6  PHE A CB   3  
ATOM 2769  C CG   . PHE A 1 6  ? -2.333  -23.421 2.347   1.00 0.00 ? 6  PHE A CG   3  
ATOM 2770  C CD1  . PHE A 1 6  ? -2.229  -24.763 2.677   1.00 0.00 ? 6  PHE A CD1  3  
ATOM 2771  C CD2  . PHE A 1 6  ? -3.540  -22.774 2.553   1.00 0.00 ? 6  PHE A CD2  3  
ATOM 2772  C CE1  . PHE A 1 6  ? -3.309  -25.445 3.204   1.00 0.00 ? 6  PHE A CE1  3  
ATOM 2773  C CE2  . PHE A 1 6  ? -4.623  -23.451 3.080   1.00 0.00 ? 6  PHE A CE2  3  
ATOM 2774  C CZ   . PHE A 1 6  ? -4.508  -24.789 3.405   1.00 0.00 ? 6  PHE A CZ   3  
ATOM 2775  H H    . PHE A 1 6  ? 0.174   -24.271 3.257   1.00 0.00 ? 6  PHE A H    3  
ATOM 2776  H HA   . PHE A 1 6  ? 0.627   -21.662 2.314   1.00 0.00 ? 6  PHE A HA   3  
ATOM 2777  H HB2  . PHE A 1 6  ? -1.523  -21.812 1.235   1.00 0.00 ? 6  PHE A HB2  3  
ATOM 2778  H HB3  . PHE A 1 6  ? -0.659  -23.333 1.065   1.00 0.00 ? 6  PHE A HB3  3  
ATOM 2779  H HD1  . PHE A 1 6  ? -1.301  -25.288 2.514   1.00 0.00 ? 6  PHE A HD1  3  
ATOM 2780  H HD2  . PHE A 1 6  ? -3.635  -21.727 2.300   1.00 0.00 ? 6  PHE A HD2  3  
ATOM 2781  H HE1  . PHE A 1 6  ? -3.216  -26.491 3.457   1.00 0.00 ? 6  PHE A HE1  3  
ATOM 2782  H HE2  . PHE A 1 6  ? -5.559  -22.935 3.236   1.00 0.00 ? 6  PHE A HE2  3  
ATOM 2783  H HZ   . PHE A 1 6  ? -5.353  -25.320 3.817   1.00 0.00 ? 6  PHE A HZ   3  
ATOM 2784  N N    . LYS A 1 7  ? -1.022  -21.855 5.049   1.00 0.00 ? 7  LYS A N    3  
ATOM 2785  C CA   . LYS A 1 7  ? -1.661  -21.101 6.121   1.00 0.00 ? 7  LYS A CA   3  
ATOM 2786  C C    . LYS A 1 7  ? -0.895  -19.816 6.425   1.00 0.00 ? 7  LYS A C    3  
ATOM 2787  O O    . LYS A 1 7  ? -1.477  -18.733 6.471   1.00 0.00 ? 7  LYS A O    3  
ATOM 2788  C CB   . LYS A 1 7  ? -1.754  -21.953 7.389   1.00 0.00 ? 7  LYS A CB   3  
ATOM 2789  C CG   . LYS A 1 7  ? -2.661  -23.166 7.252   1.00 0.00 ? 7  LYS A CG   3  
ATOM 2790  C CD   . LYS A 1 7  ? -4.103  -22.757 7.000   1.00 0.00 ? 7  LYS A CD   3  
ATOM 2791  C CE   . LYS A 1 7  ? -5.051  -23.933 7.169   1.00 0.00 ? 7  LYS A CE   3  
ATOM 2792  N NZ   . LYS A 1 7  ? -5.021  -24.472 8.558   1.00 0.00 ? 7  LYS A NZ   3  
ATOM 2793  H H    . LYS A 1 7  ? -0.764  -22.780 5.231   1.00 0.00 ? 7  LYS A H    3  
ATOM 2794  H HA   . LYS A 1 7  ? -2.656  -20.834 5.797   1.00 0.00 ? 7  LYS A HA   3  
ATOM 2795  H HB2  . LYS A 1 7  ? -0.764  -22.304 7.642   1.00 0.00 ? 7  LYS A HB2  3  
ATOM 2796  H HB3  . LYS A 1 7  ? -2.127  -21.344 8.205   1.00 0.00 ? 7  LYS A HB3  3  
ATOM 2797  H HG2  . LYS A 1 7  ? -2.318  -23.772 6.426   1.00 0.00 ? 7  LYS A HG2  3  
ATOM 2798  H HG3  . LYS A 1 7  ? -2.598  -23.734 8.167   1.00 0.00 ? 7  LYS A HG3  3  
ATOM 2799  H HD2  . LYS A 1 7  ? -4.387  -21.983 7.701   1.00 0.00 ? 7  LYS A HD2  3  
ATOM 2800  H HD3  . LYS A 1 7  ? -4.190  -22.382 5.991   1.00 0.00 ? 7  LYS A HD3  3  
ATOM 2801  H HE2  . LYS A 1 7  ? -6.054  -23.603 6.944   1.00 0.00 ? 7  LYS A HE2  3  
ATOM 2802  H HE3  . LYS A 1 7  ? -4.769  -24.717 6.480   1.00 0.00 ? 7  LYS A HE3  3  
ATOM 2803  H HZ1  . LYS A 1 7  ? -5.043  -23.699 9.258   1.00 0.00 ? 7  LYS A HZ1  3  
ATOM 2804  H HZ2  . LYS A 1 7  ? -4.162  -25.037 8.707   1.00 0.00 ? 7  LYS A HZ2  3  
ATOM 2805  H HZ3  . LYS A 1 7  ? -5.848  -25.084 8.715   1.00 0.00 ? 7  LYS A HZ3  3  
ATOM 2806  N N    . VAL A 1 8  ? 0.412   -19.946 6.629   1.00 0.00 ? 8  VAL A N    3  
ATOM 2807  C CA   . VAL A 1 8  ? 1.254   -18.798 6.939   1.00 0.00 ? 8  VAL A CA   3  
ATOM 2808  C C    . VAL A 1 8  ? 1.458   -17.900 5.721   1.00 0.00 ? 8  VAL A C    3  
ATOM 2809  O O    . VAL A 1 8  ? 1.519   -16.677 5.849   1.00 0.00 ? 8  VAL A O    3  
ATOM 2810  C CB   . VAL A 1 8  ? 2.632   -19.245 7.468   1.00 0.00 ? 8  VAL A CB   3  
ATOM 2811  C CG1  . VAL A 1 8  ? 3.473   -18.041 7.865   1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2812  C CG2  . VAL A 1 8  ? 2.470   -20.200 8.641   1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2813  H H    . VAL A 1 8  ? 0.820   -20.841 6.567   1.00 0.00 ? 8  VAL A H    3  
ATOM 2814  H HA   . VAL A 1 8  ? 0.767   -18.221 7.718   1.00 0.00 ? 8  VAL A HA   3  
ATOM 2815  H HB   . VAL A 1 8  ? 3.151   -19.772 6.678   1.00 0.00 ? 8  VAL A HB   3  
ATOM 2816  H HG11 . VAL A 1 8  ? 3.723   -17.461 6.990   1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2817  H HG12 . VAL A 1 8  ? 4.389   -18.376 8.334   1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2818  H HG13 . VAL A 1 8  ? 2.922   -17.423 8.561   1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2819  H HG21 . VAL A 1 8  ? 3.444   -20.475 9.022   1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2820  H HG22 . VAL A 1 8  ? 1.954   -21.092 8.322   1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2821  H HG23 . VAL A 1 8  ? 1.904   -19.719 9.426   1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2822  N N    . VAL A 1 9  ? 1.559   -18.509 4.544   1.00 0.00 ? 9  VAL A N    3  
ATOM 2823  C CA   . VAL A 1 9  ? 1.767   -17.754 3.310   1.00 0.00 ? 9  VAL A CA   3  
ATOM 2824  C C    . VAL A 1 9  ? 0.603   -16.809 3.027   1.00 0.00 ? 9  VAL A C    3  
ATOM 2825  O O    . VAL A 1 9  ? 0.803   -15.616 2.801   1.00 0.00 ? 9  VAL A O    3  
ATOM 2826  C CB   . VAL A 1 9  ? 1.947   -18.683 2.093   1.00 0.00 ? 9  VAL A CB   3  
ATOM 2827  C CG1  . VAL A 1 9  ? 2.660   -17.953 0.968   1.00 0.00 ? 9  VAL A CG1  3  
ATOM 2828  C CG2  . VAL A 1 9  ? 2.703   -19.945 2.474   1.00 0.00 ? 9  VAL A CG2  3  
ATOM 2829  H H    . VAL A 1 9  ? 1.488   -19.482 4.514   1.00 0.00 ? 9  VAL A H    3  
ATOM 2830  H HA   . VAL A 1 9  ? 2.671   -17.166 3.433   1.00 0.00 ? 9  VAL A HA   3  
ATOM 2831  H HB   . VAL A 1 9  ? 0.971   -18.984 1.729   1.00 0.00 ? 9  VAL A HB   3  
ATOM 2832  H HG11 . VAL A 1 9  ? 2.092   -17.077 0.687   1.00 0.00 ? 9  VAL A HG11 3  
ATOM 2833  H HG12 . VAL A 1 9  ? 2.751   -18.606 0.111   1.00 0.00 ? 9  VAL A HG12 3  
ATOM 2834  H HG13 . VAL A 1 9  ? 3.645   -17.651 1.296   1.00 0.00 ? 9  VAL A HG13 3  
ATOM 2835  H HG21 . VAL A 1 9  ? 3.603   -19.687 3.017   1.00 0.00 ? 9  VAL A HG21 3  
ATOM 2836  H HG22 . VAL A 1 9  ? 2.971   -20.497 1.582   1.00 0.00 ? 9  VAL A HG22 3  
ATOM 2837  H HG23 . VAL A 1 9  ? 2.085   -20.559 3.082   1.00 0.00 ? 9  VAL A HG23 3  
ATOM 2838  N N    . VAL A 1 10 ? -0.612  -17.351 3.040   1.00 0.00 ? 10 VAL A N    3  
ATOM 2839  C CA   . VAL A 1 10 ? -1.811  -16.562 2.774   1.00 0.00 ? 10 VAL A CA   3  
ATOM 2840  C C    . VAL A 1 10 ? -1.948  -15.395 3.749   1.00 0.00 ? 10 VAL A C    3  
ATOM 2841  O O    . VAL A 1 10 ? -2.055  -14.242 3.334   1.00 0.00 ? 10 VAL A O    3  
ATOM 2842  C CB   . VAL A 1 10 ? -3.084  -17.432 2.844   1.00 0.00 ? 10 VAL A CB   3  
ATOM 2843  C CG1  . VAL A 1 10 ? -4.333  -16.579 2.682   1.00 0.00 ? 10 VAL A CG1  3  
ATOM 2844  C CG2  . VAL A 1 10 ? -3.046  -18.524 1.786   1.00 0.00 ? 10 VAL A CG2  3  
ATOM 2845  H H    . VAL A 1 10 ? -0.703  -18.314 3.232   1.00 0.00 ? 10 VAL A H    3  
ATOM 2846  H HA   . VAL A 1 10 ? -1.731  -16.161 1.771   1.00 0.00 ? 10 VAL A HA   3  
ATOM 2847  H HB   . VAL A 1 10 ? -3.121  -17.904 3.815   1.00 0.00 ? 10 VAL A HB   3  
ATOM 2848  H HG11 . VAL A 1 10 ? -4.222  -15.919 1.831   1.00 0.00 ? 10 VAL A HG11 3  
ATOM 2849  H HG12 . VAL A 1 10 ? -4.495  -15.993 3.574   1.00 0.00 ? 10 VAL A HG12 3  
ATOM 2850  H HG13 . VAL A 1 10 ? -5.195  -17.216 2.526   1.00 0.00 ? 10 VAL A HG13 3  
ATOM 2851  H HG21 . VAL A 1 10 ? -3.849  -19.223 1.967   1.00 0.00 ? 10 VAL A HG21 3  
ATOM 2852  H HG22 . VAL A 1 10 ? -2.107  -19.047 1.814   1.00 0.00 ? 10 VAL A HG22 3  
ATOM 2853  H HG23 . VAL A 1 10 ? -3.173  -18.086 0.805   1.00 0.00 ? 10 VAL A HG23 3  
ATOM 2854  N N    . ILE A 1 11 ? -1.946  -15.699 5.043   1.00 0.00 ? 11 ILE A N    3  
ATOM 2855  C CA   . ILE A 1 11 ? -2.080  -14.671 6.071   1.00 0.00 ? 11 ILE A CA   3  
ATOM 2856  C C    . ILE A 1 11 ? -1.016  -13.585 5.925   1.00 0.00 ? 11 ILE A C    3  
ATOM 2857  O O    . ILE A 1 11 ? -1.280  -12.410 6.182   1.00 0.00 ? 11 ILE A O    3  
ATOM 2858  C CB   . ILE A 1 11 ? -1.997  -15.278 7.486   1.00 0.00 ? 11 ILE A CB   3  
ATOM 2859  C CG1  . ILE A 1 11 ? -3.091  -16.334 7.672   1.00 0.00 ? 11 ILE A CG1  3  
ATOM 2860  C CG2  . ILE A 1 11 ? -2.120  -14.188 8.542   1.00 0.00 ? 11 ILE A CG2  3  
ATOM 2861  C CD1  . ILE A 1 11 ? -2.996  -17.085 8.985   1.00 0.00 ? 11 ILE A CD1  3  
ATOM 2862  H H    . ILE A 1 11 ? -1.849  -16.642 5.307   1.00 0.00 ? 11 ILE A H    3  
ATOM 2863  H HA   . ILE A 1 11 ? -3.055  -14.213 5.956   1.00 0.00 ? 11 ILE A HA   3  
ATOM 2864  H HB   . ILE A 1 11 ? -1.030  -15.748 7.599   1.00 0.00 ? 11 ILE A HB   3  
ATOM 2865  H HG12 . ILE A 1 11 ? -4.057  -15.851 7.644   1.00 0.00 ? 11 ILE A HG12 3  
ATOM 2866  H HG13 . ILE A 1 11 ? -3.048  -17.059 6.881   1.00 0.00 ? 11 ILE A HG13 3  
ATOM 2867  H HG21 . ILE A 1 11 ? -3.051  -13.655 8.408   1.00 0.00 ? 11 ILE A HG21 3  
ATOM 2868  H HG22 . ILE A 1 11 ? -1.296  -13.496 8.460   1.00 0.00 ? 11 ILE A HG22 3  
ATOM 2869  H HG23 . ILE A 1 11 ? -2.101  -14.625 9.529   1.00 0.00 ? 11 ILE A HG23 3  
ATOM 2870  H HD11 . ILE A 1 11 ? -1.984  -17.435 9.135   1.00 0.00 ? 11 ILE A HD11 3  
ATOM 2871  H HD12 . ILE A 1 11 ? -3.667  -17.931 8.962   1.00 0.00 ? 11 ILE A HD12 3  
ATOM 2872  H HD13 . ILE A 1 11 ? -3.275  -16.431 9.797   1.00 0.00 ? 11 ILE A HD13 3  
ATOM 2873  N N    . SER A 1 12 ? 0.184   -13.979 5.513   1.00 0.00 ? 12 SER A N    3  
ATOM 2874  C CA   . SER A 1 12 ? 1.280   -13.028 5.338   1.00 0.00 ? 12 SER A CA   3  
ATOM 2875  C C    . SER A 1 12 ? 1.041   -12.128 4.130   1.00 0.00 ? 12 SER A C    3  
ATOM 2876  O O    . SER A 1 12 ? 1.262   -10.919 4.192   1.00 0.00 ? 12 SER A O    3  
ATOM 2877  C CB   . SER A 1 12 ? 2.610   -13.768 5.181   1.00 0.00 ? 12 SER A CB   3  
ATOM 2878  O OG   . SER A 1 12 ? 2.989   -14.400 6.391   1.00 0.00 ? 12 SER A OG   3  
ATOM 2879  H H    . SER A 1 12 ? 0.347   -14.932 5.322   1.00 0.00 ? 12 SER A H    3  
ATOM 2880  H HA   . SER A 1 12 ? 1.335   -12.407 6.224   1.00 0.00 ? 12 SER A HA   3  
ATOM 2881  H HB2  . SER A 1 12 ? 2.511   -14.522 4.415   1.00 0.00 ? 12 SER A HB2  3  
ATOM 2882  H HB3  . SER A 1 12 ? 3.389   -13.070 4.899   1.00 0.00 ? 12 SER A HB3  3  
ATOM 2883  H HG   . SER A 1 12 ? 3.386   -13.755 6.982   1.00 0.00 ? 12 SER A HG   3  
ATOM 2884  N N    . ALA A 1 13 ? 0.590   -12.727 3.032   1.00 0.00 ? 13 ALA A N    3  
ATOM 2885  C CA   . ALA A 1 13 ? 0.325   -11.983 1.806   1.00 0.00 ? 13 ALA A CA   3  
ATOM 2886  C C    . ALA A 1 13 ? -0.794  -10.969 2.004   1.00 0.00 ? 13 ALA A C    3  
ATOM 2887  O O    . ALA A 1 13 ? -0.637  -9.787  1.698   1.00 0.00 ? 13 ALA A O    3  
ATOM 2888  C CB   . ALA A 1 13 ? -0.026  -12.940 0.677   1.00 0.00 ? 13 ALA A CB   3  
ATOM 2889  H H    . ALA A 1 13 ? 0.434   -13.702 3.041   1.00 0.00 ? 13 ALA A H    3  
ATOM 2890  H HA   . ALA A 1 13 ? 1.228   -11.456 1.526   1.00 0.00 ? 13 ALA A HA   3  
ATOM 2891  H HB1  . ALA A 1 13 ? -0.162  -12.386 -0.242  1.00 0.00 ? 13 ALA A HB1  3  
ATOM 2892  H HB2  . ALA A 1 13 ? -0.938  -13.469 0.917   1.00 0.00 ? 13 ALA A HB2  3  
ATOM 2893  H HB3  . ALA A 1 13 ? 0.776   -13.652 0.550   1.00 0.00 ? 13 ALA A HB3  3  
ATOM 2894  N N    . ILE A 1 14 ? -1.926  -11.441 2.517   1.00 0.00 ? 14 ILE A N    3  
ATOM 2895  C CA   . ILE A 1 14 ? -3.078  -10.583 2.755   1.00 0.00 ? 14 ILE A CA   3  
ATOM 2896  C C    . ILE A 1 14 ? -2.720  -9.424  3.680   1.00 0.00 ? 14 ILE A C    3  
ATOM 2897  O O    . ILE A 1 14 ? -3.018  -8.268  3.381   1.00 0.00 ? 14 ILE A O    3  
ATOM 2898  C CB   . ILE A 1 14 ? -4.251  -11.373 3.367   1.00 0.00 ? 14 ILE A CB   3  
ATOM 2899  C CG1  . ILE A 1 14 ? -4.672  -12.505 2.426   1.00 0.00 ? 14 ILE A CG1  3  
ATOM 2900  C CG2  . ILE A 1 14 ? -5.425  -10.447 3.651   1.00 0.00 ? 14 ILE A CG2  3  
ATOM 2901  C CD1  . ILE A 1 14 ? -5.717  -13.430 3.013   1.00 0.00 ? 14 ILE A CD1  3  
ATOM 2902  H H    . ILE A 1 14 ? -1.980  -12.398 2.745   1.00 0.00 ? 14 ILE A H    3  
ATOM 2903  H HA   . ILE A 1 14 ? -3.399  -10.179 1.802   1.00 0.00 ? 14 ILE A HA   3  
ATOM 2904  H HB   . ILE A 1 14 ? -3.923  -11.798 4.306   1.00 0.00 ? 14 ILE A HB   3  
ATOM 2905  H HG12 . ILE A 1 14 ? -5.084  -12.082 1.521   1.00 0.00 ? 14 ILE A HG12 3  
ATOM 2906  H HG13 . ILE A 1 14 ? -3.820  -13.109 2.167   1.00 0.00 ? 14 ILE A HG13 3  
ATOM 2907  H HG21 . ILE A 1 14 ? -5.728  -9.953  2.738   1.00 0.00 ? 14 ILE A HG21 3  
ATOM 2908  H HG22 . ILE A 1 14 ? -5.146  -9.706  4.384   1.00 0.00 ? 14 ILE A HG22 3  
ATOM 2909  H HG23 . ILE A 1 14 ? -6.257  -11.013 4.040   1.00 0.00 ? 14 ILE A HG23 3  
ATOM 2910  H HD11 . ILE A 1 14 ? -6.656  -12.906 3.101   1.00 0.00 ? 14 ILE A HD11 3  
ATOM 2911  H HD12 . ILE A 1 14 ? -5.399  -13.768 3.989   1.00 0.00 ? 14 ILE A HD12 3  
ATOM 2912  H HD13 . ILE A 1 14 ? -5.844  -14.283 2.363   1.00 0.00 ? 14 ILE A HD13 3  
ATOM 2913  N N    . LEU A 1 15 ? -2.081  -9.742  4.803   1.00 0.00 ? 15 LEU A N    3  
ATOM 2914  C CA   . LEU A 1 15 ? -1.683  -8.728  5.772   1.00 0.00 ? 15 LEU A CA   3  
ATOM 2915  C C    . LEU A 1 15 ? -0.866  -7.628  5.103   1.00 0.00 ? 15 LEU A C    3  
ATOM 2916  O O    . LEU A 1 15 ? -1.178  -6.443  5.234   1.00 0.00 ? 15 LEU A O    3  
ATOM 2917  C CB   . LEU A 1 15 ? -0.873  -9.361  6.906   1.00 0.00 ? 15 LEU A CB   3  
ATOM 2918  C CG   . LEU A 1 15 ? -0.317  -8.375  7.937   1.00 0.00 ? 15 LEU A CG   3  
ATOM 2919  C CD1  . LEU A 1 15 ? -1.448  -7.676  8.678   1.00 0.00 ? 15 LEU A CD1  3  
ATOM 2920  C CD2  . LEU A 1 15 ? 0.605   -9.091  8.915   1.00 0.00 ? 15 LEU A CD2  3  
ATOM 2921  H H    . LEU A 1 15 ? -1.872  -10.689 4.987   1.00 0.00 ? 15 LEU A H    3  
ATOM 2922  H HA   . LEU A 1 15 ? -2.581  -8.292  6.184   1.00 0.00 ? 15 LEU A HA   3  
ATOM 2923  H HB2  . LEU A 1 15 ? -1.505  -10.077 7.416   1.00 0.00 ? 15 LEU A HB2  3  
ATOM 2924  H HB3  . LEU A 1 15 ? -0.044  -9.895  6.461   1.00 0.00 ? 15 LEU A HB3  3  
ATOM 2925  H HG   . LEU A 1 15 ? 0.267   -7.617  7.437   1.00 0.00 ? 15 LEU A HG   3  
ATOM 2926  H HD11 . LEU A 1 15 ? -1.036  -6.989  9.405   1.00 0.00 ? 15 LEU A HD11 3  
ATOM 2927  H HD12 . LEU A 1 15 ? -2.059  -8.409  9.186   1.00 0.00 ? 15 LEU A HD12 3  
ATOM 2928  H HD13 . LEU A 1 15 ? -2.057  -7.125  7.976   1.00 0.00 ? 15 LEU A HD13 3  
ATOM 2929  H HD21 . LEU A 1 15 ? 1.011   -8.378  9.619   1.00 0.00 ? 15 LEU A HD21 3  
ATOM 2930  H HD22 . LEU A 1 15 ? 1.417   -9.557  8.373   1.00 0.00 ? 15 LEU A HD22 3  
ATOM 2931  H HD23 . LEU A 1 15 ? 0.050   -9.849  9.452   1.00 0.00 ? 15 LEU A HD23 3  
ATOM 2932  N N    . ALA A 1 16 ? 0.178   -8.028  4.385   1.00 0.00 ? 16 ALA A N    3  
ATOM 2933  C CA   . ALA A 1 16 ? 1.039   -7.079  3.692   1.00 0.00 ? 16 ALA A CA   3  
ATOM 2934  C C    . ALA A 1 16 ? 0.249   -6.273  2.669   1.00 0.00 ? 16 ALA A C    3  
ATOM 2935  O O    . ALA A 1 16 ? 0.573   -5.121  2.382   1.00 0.00 ? 16 ALA A O    3  
ATOM 2936  C CB   . ALA A 1 16 ? 2.191   -7.808  3.022   1.00 0.00 ? 16 ALA A CB   3  
ATOM 2937  H H    . ALA A 1 16 ? 0.374   -8.994  4.317   1.00 0.00 ? 16 ALA A H    3  
ATOM 2938  H HA   . ALA A 1 16 ? 1.459   -6.410  4.427   1.00 0.00 ? 16 ALA A HA   3  
ATOM 2939  H HB1  . ALA A 1 16 ? 1.807   -8.484  2.270   1.00 0.00 ? 16 ALA A HB1  3  
ATOM 2940  H HB2  . ALA A 1 16 ? 2.737   -8.372  3.764   1.00 0.00 ? 16 ALA A HB2  3  
ATOM 2941  H HB3  . ALA A 1 16 ? 2.855   -7.092  2.558   1.00 0.00 ? 16 ALA A HB3  3  
ATOM 2942  N N    . LEU A 1 17 ? -0.788  -6.891  2.113   1.00 0.00 ? 17 LEU A N    3  
ATOM 2943  C CA   . LEU A 1 17 ? -1.630  -6.232  1.125   1.00 0.00 ? 17 LEU A CA   3  
ATOM 2944  C C    . LEU A 1 17 ? -2.504  -5.169  1.786   1.00 0.00 ? 17 LEU A C    3  
ATOM 2945  O O    . LEU A 1 17 ? -2.834  -4.151  1.176   1.00 0.00 ? 17 LEU A O    3  
ATOM 2946  C CB   . LEU A 1 17 ? -2.504  -7.263  0.407   1.00 0.00 ? 17 LEU A CB   3  
ATOM 2947  C CG   . LEU A 1 17 ? -3.249  -6.746  -0.826  1.00 0.00 ? 17 LEU A CG   3  
ATOM 2948  C CD1  . LEU A 1 17 ? -2.266  -6.291  -1.895  1.00 0.00 ? 17 LEU A CD1  3  
ATOM 2949  C CD2  . LEU A 1 17 ? -4.172  -7.822  -1.374  1.00 0.00 ? 17 LEU A CD2  3  
ATOM 2950  H H    . LEU A 1 17 ? -0.997  -7.816  2.365   1.00 0.00 ? 17 LEU A H    3  
ATOM 2951  H HA   . LEU A 1 17 ? -0.983  -5.751  0.407   1.00 0.00 ? 17 LEU A HA   3  
ATOM 2952  H HB2  . LEU A 1 17 ? -1.870  -8.087  0.103   1.00 0.00 ? 17 LEU A HB2  3  
ATOM 2953  H HB3  . LEU A 1 17 ? -3.234  -7.641  1.108   1.00 0.00 ? 17 LEU A HB3  3  
ATOM 2954  H HG   . LEU A 1 17 ? -3.854  -5.896  -0.544  1.00 0.00 ? 17 LEU A HG   3  
ATOM 2955  H HD11 . LEU A 1 17 ? -2.808  -5.986  -2.781  1.00 0.00 ? 17 LEU A HD11 3  
ATOM 2956  H HD12 . LEU A 1 17 ? -1.599  -7.103  -2.148  1.00 0.00 ? 17 LEU A HD12 3  
ATOM 2957  H HD13 . LEU A 1 17 ? -1.692  -5.455  -1.529  1.00 0.00 ? 17 LEU A HD13 3  
ATOM 2958  H HD21 . LEU A 1 17 ? -3.592  -8.684  -1.675  1.00 0.00 ? 17 LEU A HD21 3  
ATOM 2959  H HD22 . LEU A 1 17 ? -4.711  -7.437  -2.229  1.00 0.00 ? 17 LEU A HD22 3  
ATOM 2960  H HD23 . LEU A 1 17 ? -4.880  -8.115  -0.611  1.00 0.00 ? 17 LEU A HD23 3  
ATOM 2961  N N    . VAL A 1 18 ? -2.876  -5.414  3.041   1.00 0.00 ? 18 VAL A N    3  
ATOM 2962  C CA   . VAL A 1 18 ? -3.708  -4.480  3.791   1.00 0.00 ? 18 VAL A CA   3  
ATOM 2963  C C    . VAL A 1 18 ? -2.917  -3.241  4.200   1.00 0.00 ? 18 VAL A C    3  
ATOM 2964  O O    . VAL A 1 18 ? -3.392  -2.115  4.048   1.00 0.00 ? 18 VAL A O    3  
ATOM 2965  C CB   . VAL A 1 18 ? -4.301  -5.142  5.053   1.00 0.00 ? 18 VAL A CB   3  
ATOM 2966  C CG1  . VAL A 1 18 ? -5.062  -4.123  5.890   1.00 0.00 ? 18 VAL A CG1  3  
ATOM 2967  C CG2  . VAL A 1 18 ? -5.205  -6.302  4.671   1.00 0.00 ? 18 VAL A CG2  3  
ATOM 2968  H H    . VAL A 1 18 ? -2.590  -6.244  3.483   1.00 0.00 ? 18 VAL A H    3  
ATOM 2969  H HA   . VAL A 1 18 ? -4.531  -4.167  3.156   1.00 0.00 ? 18 VAL A HA   3  
ATOM 2970  H HB   . VAL A 1 18 ? -3.488  -5.529  5.650   1.00 0.00 ? 18 VAL A HB   3  
ATOM 2971  H HG11 . VAL A 1 18 ? -4.367  -3.454  6.375   1.00 0.00 ? 18 VAL A HG11 3  
ATOM 2972  H HG12 . VAL A 1 18 ? -5.641  -4.632  6.651   1.00 0.00 ? 18 VAL A HG12 3  
ATOM 2973  H HG13 . VAL A 1 18 ? -5.731  -3.552  5.260   1.00 0.00 ? 18 VAL A HG13 3  
ATOM 2974  H HG21 . VAL A 1 18 ? -6.068  -5.928  4.135   1.00 0.00 ? 18 VAL A HG21 3  
ATOM 2975  H HG22 . VAL A 1 18 ? -5.533  -6.813  5.564   1.00 0.00 ? 18 VAL A HG22 3  
ATOM 2976  H HG23 . VAL A 1 18 ? -4.675  -6.991  4.047   1.00 0.00 ? 18 VAL A HG23 3  
ATOM 2977  N N    . VAL A 1 19 ? -1.709  -3.454  4.718   1.00 0.00 ? 19 VAL A N    3  
ATOM 2978  C CA   . VAL A 1 19 ? -0.862  -2.349  5.151   1.00 0.00 ? 19 VAL A CA   3  
ATOM 2979  C C    . VAL A 1 19 ? -0.468  -1.461  3.975   1.00 0.00 ? 19 VAL A C    3  
ATOM 2980  O O    . VAL A 1 19 ? -0.271  -0.258  4.141   1.00 0.00 ? 19 VAL A O    3  
ATOM 2981  C CB   . VAL A 1 19 ? 0.413   -2.850  5.859   1.00 0.00 ? 19 VAL A CB   3  
ATOM 2982  C CG1  . VAL A 1 19 ? 0.057   -3.612  7.125   1.00 0.00 ? 19 VAL A CG1  3  
ATOM 2983  C CG2  . VAL A 1 19 ? 1.246   -3.713  4.923   1.00 0.00 ? 19 VAL A CG2  3  
ATOM 2984  H H    . VAL A 1 19 ? -1.387  -4.378  4.820   1.00 0.00 ? 19 VAL A H    3  
ATOM 2985  H HA   . VAL A 1 19 ? -1.425  -1.749  5.856   1.00 0.00 ? 19 VAL A HA   3  
ATOM 2986  H HB   . VAL A 1 19 ? 1.008   -1.993  6.147   1.00 0.00 ? 19 VAL A HB   3  
ATOM 2987  H HG11 . VAL A 1 19 ? -0.507  -2.970  7.787   1.00 0.00 ? 19 VAL A HG11 3  
ATOM 2988  H HG12 . VAL A 1 19 ? 0.962   -3.930  7.624   1.00 0.00 ? 19 VAL A HG12 3  
ATOM 2989  H HG13 . VAL A 1 19 ? -0.538  -4.479  6.873   1.00 0.00 ? 19 VAL A HG13 3  
ATOM 2990  H HG21 . VAL A 1 19 ? 0.664   -4.549  4.621   1.00 0.00 ? 19 VAL A HG21 3  
ATOM 2991  H HG22 . VAL A 1 19 ? 2.127   -4.063  5.444   1.00 0.00 ? 19 VAL A HG22 3  
ATOM 2992  H HG23 . VAL A 1 19 ? 1.553   -3.148  4.059   1.00 0.00 ? 19 VAL A HG23 3  
ATOM 2993  N N    . LEU A 1 20 ? -0.353  -2.055  2.788   1.00 0.00 ? 20 LEU A N    3  
ATOM 2994  C CA   . LEU A 1 20 ? 0.010   -1.302  1.591   1.00 0.00 ? 20 LEU A CA   3  
ATOM 2995  C C    . LEU A 1 20 ? -1.009  -0.193  1.348   1.00 0.00 ? 20 LEU A C    3  
ATOM 2996  O O    . LEU A 1 20 ? -0.652  0.927   0.979   1.00 0.00 ? 20 LEU A O    3  
ATOM 2997  C CB   . LEU A 1 20 ? 0.090   -2.233  0.374   1.00 0.00 ? 20 LEU A CB   3  
ATOM 2998  C CG   . LEU A 1 20 ? 0.994   -1.763  -0.779  1.00 0.00 ? 20 LEU A CG   3  
ATOM 2999  C CD1  . LEU A 1 20 ? 0.393   -0.562  -1.490  1.00 0.00 ? 20 LEU A CD1  3  
ATOM 3000  C CD2  . LEU A 1 20 ? 2.394   -1.435  -0.274  1.00 0.00 ? 20 LEU A CD2  3  
ATOM 3001  H H    . LEU A 1 20 ? -0.516  -3.023  2.707   1.00 0.00 ? 20 LEU A H    3  
ATOM 3002  H HA   . LEU A 1 20 ? 0.969   -0.851  1.778   1.00 0.00 ? 20 LEU A HA   3  
ATOM 3003  H HB2  . LEU A 1 20 ? 0.472   -3.188  0.712   1.00 0.00 ? 20 LEU A HB2  3  
ATOM 3004  H HB3  . LEU A 1 20 ? -0.908  -2.396  -0.017  1.00 0.00 ? 20 LEU A HB3  3  
ATOM 3005  H HG   . LEU A 1 20 ? 1.081   -2.562  -1.501  1.00 0.00 ? 20 LEU A HG   3  
ATOM 3006  H HD11 . LEU A 1 20 ? 0.552   0.334   -0.911  1.00 0.00 ? 20 LEU A HD11 3  
ATOM 3007  H HD12 . LEU A 1 20 ? -0.669  -0.710  -1.639  1.00 0.00 ? 20 LEU A HD12 3  
ATOM 3008  H HD13 . LEU A 1 20 ? 0.870   -0.449  -2.453  1.00 0.00 ? 20 LEU A HD13 3  
ATOM 3009  H HD21 . LEU A 1 20 ? 2.376   -0.532  0.319   1.00 0.00 ? 20 LEU A HD21 3  
ATOM 3010  H HD22 . LEU A 1 20 ? 3.049   -1.288  -1.120  1.00 0.00 ? 20 LEU A HD22 3  
ATOM 3011  H HD23 . LEU A 1 20 ? 2.769   -2.253  0.326   1.00 0.00 ? 20 LEU A HD23 3  
ATOM 3012  N N    . THR A 1 21 ? -2.281  -0.514  1.567   1.00 0.00 ? 21 THR A N    3  
ATOM 3013  C CA   . THR A 1 21 ? -3.358  0.450   1.388   1.00 0.00 ? 21 THR A CA   3  
ATOM 3014  C C    . THR A 1 21 ? -3.315  1.514   2.480   1.00 0.00 ? 21 THR A C    3  
ATOM 3015  O O    . THR A 1 21 ? -3.653  2.675   2.248   1.00 0.00 ? 21 THR A O    3  
ATOM 3016  C CB   . THR A 1 21 ? -4.739  -0.239  1.408   1.00 0.00 ? 21 THR A CB   3  
ATOM 3017  O OG1  . THR A 1 21 ? -4.794  -1.255  0.398   1.00 0.00 ? 21 THR A OG1  3  
ATOM 3018  C CG2  . THR A 1 21 ? -5.855  0.769   1.179   1.00 0.00 ? 21 THR A CG2  3  
ATOM 3019  H H    . THR A 1 21 ? -2.510  -1.426  1.865   1.00 0.00 ? 21 THR A H    3  
ATOM 3020  H HA   . THR A 1 21 ? -3.232  0.930   0.424   1.00 0.00 ? 21 THR A HA   3  
ATOM 3021  H HB   . THR A 1 21 ? -4.885  -0.702  2.375   1.00 0.00 ? 21 THR A HB   3  
ATOM 3022  H HG1  . THR A 1 21 ? -4.646  -0.879  -0.480  1.00 0.00 ? 21 THR A HG1  3  
ATOM 3023  H HG21 . THR A 1 21 ? -5.990  1.372   2.065   1.00 0.00 ? 21 THR A HG21 3  
ATOM 3024  H HG22 . THR A 1 21 ? -6.772  0.240   0.967   1.00 0.00 ? 21 THR A HG22 3  
ATOM 3025  H HG23 . THR A 1 21 ? -5.612  1.408   0.340   1.00 0.00 ? 21 THR A HG23 3  
ATOM 3026  N N    . ILE A 1 22 ? -2.892  1.106   3.674   1.00 0.00 ? 22 ILE A N    3  
ATOM 3027  C CA   . ILE A 1 22 ? -2.796  2.019   4.804   1.00 0.00 ? 22 ILE A CA   3  
ATOM 3028  C C    . ILE A 1 22 ? -1.654  3.011   4.606   1.00 0.00 ? 22 ILE A C    3  
ATOM 3029  O O    . ILE A 1 22 ? -1.763  4.178   4.980   1.00 0.00 ? 22 ILE A O    3  
ATOM 3030  C CB   . ILE A 1 22 ? -2.583  1.253   6.126   1.00 0.00 ? 22 ILE A CB   3  
ATOM 3031  C CG1  . ILE A 1 22 ? -3.728  0.262   6.350   1.00 0.00 ? 22 ILE A CG1  3  
ATOM 3032  C CG2  . ILE A 1 22 ? -2.476  2.228   7.294   1.00 0.00 ? 22 ILE A CG2  3  
ATOM 3033  C CD1  . ILE A 1 22 ? -3.557  -0.600  7.582   1.00 0.00 ? 22 ILE A CD1  3  
ATOM 3034  H H    . ILE A 1 22 ? -2.635  0.168   3.804   1.00 0.00 ? 22 ILE A H    3  
ATOM 3035  H HA   . ILE A 1 22 ? -3.727  2.571   4.878   1.00 0.00 ? 22 ILE A HA   3  
ATOM 3036  H HB   . ILE A 1 22 ? -1.653  0.706   6.058   1.00 0.00 ? 22 ILE A HB   3  
ATOM 3037  H HG12 . ILE A 1 22 ? -4.654  0.807   6.460   1.00 0.00 ? 22 ILE A HG12 3  
ATOM 3038  H HG13 . ILE A 1 22 ? -3.811  -0.394  5.506   1.00 0.00 ? 22 ILE A HG13 3  
ATOM 3039  H HG21 . ILE A 1 22 ? -3.375  2.826   7.352   1.00 0.00 ? 22 ILE A HG21 3  
ATOM 3040  H HG22 . ILE A 1 22 ? -1.623  2.876   7.161   1.00 0.00 ? 22 ILE A HG22 3  
ATOM 3041  H HG23 . ILE A 1 22 ? -2.351  1.685   8.219   1.00 0.00 ? 22 ILE A HG23 3  
ATOM 3042  H HD11 . ILE A 1 22 ? -3.714  -0.001  8.466   1.00 0.00 ? 22 ILE A HD11 3  
ATOM 3043  H HD12 . ILE A 1 22 ? -2.561  -1.019  7.602   1.00 0.00 ? 22 ILE A HD12 3  
ATOM 3044  H HD13 . ILE A 1 22 ? -4.281  -1.401  7.561   1.00 0.00 ? 22 ILE A HD13 3  
ATOM 3045  N N    . ILE A 1 23 ? -0.559  2.539   4.014   1.00 0.00 ? 23 ILE A N    3  
ATOM 3046  C CA   . ILE A 1 23 ? 0.596   3.391   3.762   1.00 0.00 ? 23 ILE A CA   3  
ATOM 3047  C C    . ILE A 1 23 ? 0.238   4.507   2.785   1.00 0.00 ? 23 ILE A C    3  
ATOM 3048  O O    . ILE A 1 23 ? 0.575   5.672   3.001   1.00 0.00 ? 23 ILE A O    3  
ATOM 3049  C CB   . ILE A 1 23 ? 1.785   2.591   3.197   1.00 0.00 ? 23 ILE A CB   3  
ATOM 3050  C CG1  . ILE A 1 23 ? 2.301   1.593   4.240   1.00 0.00 ? 23 ILE A CG1  3  
ATOM 3051  C CG2  . ILE A 1 23 ? 2.901   3.533   2.760   1.00 0.00 ? 23 ILE A CG2  3  
ATOM 3052  C CD1  . ILE A 1 23 ? 2.858   2.243   5.490   1.00 0.00 ? 23 ILE A CD1  3  
ATOM 3053  H H    . ILE A 1 23 ? -0.521  1.594   3.735   1.00 0.00 ? 23 ILE A H    3  
ATOM 3054  H HA   . ILE A 1 23 ? 0.890   3.847   4.697   1.00 0.00 ? 23 ILE A HA   3  
ATOM 3055  H HB   . ILE A 1 23 ? 1.445   2.048   2.328   1.00 0.00 ? 23 ILE A HB   3  
ATOM 3056  H HG12 . ILE A 1 23 ? 1.503   0.947   4.543   1.00 0.00 ? 23 ILE A HG12 3  
ATOM 3057  H HG13 . ILE A 1 23 ? 3.087   0.996   3.799   1.00 0.00 ? 23 ILE A HG13 3  
ATOM 3058  H HG21 . ILE A 1 23 ? 3.822   2.978   2.633   1.00 0.00 ? 23 ILE A HG21 3  
ATOM 3059  H HG22 . ILE A 1 23 ? 3.053   4.304   3.503   1.00 0.00 ? 23 ILE A HG22 3  
ATOM 3060  H HG23 . ILE A 1 23 ? 2.641   3.991   1.816   1.00 0.00 ? 23 ILE A HG23 3  
ATOM 3061  H HD11 . ILE A 1 23 ? 3.893   1.955   5.606   1.00 0.00 ? 23 ILE A HD11 3  
ATOM 3062  H HD12 . ILE A 1 23 ? 2.300   1.899   6.348   1.00 0.00 ? 23 ILE A HD12 3  
ATOM 3063  H HD13 . ILE A 1 23 ? 2.794   3.320   5.439   1.00 0.00 ? 23 ILE A HD13 3  
ATOM 3064  N N    . SER A 1 24 ? -0.448  4.137   1.708   1.00 0.00 ? 24 SER A N    3  
ATOM 3065  C CA   . SER A 1 24 ? -0.856  5.095   0.686   1.00 0.00 ? 24 SER A CA   3  
ATOM 3066  C C    . SER A 1 24 ? -2.005  5.971   1.175   1.00 0.00 ? 24 SER A C    3  
ATOM 3067  O O    . SER A 1 24 ? -2.182  7.094   0.707   1.00 0.00 ? 24 SER A O    3  
ATOM 3068  C CB   . SER A 1 24 ? -1.270  4.362   -0.592  1.00 0.00 ? 24 SER A CB   3  
ATOM 3069  O OG   . SER A 1 24 ? -1.707  5.273   -1.585  1.00 0.00 ? 24 SER A OG   3  
ATOM 3070  H H    . SER A 1 24 ? -0.688  3.187   1.590   1.00 0.00 ? 24 SER A H    3  
ATOM 3071  H HA   . SER A 1 24 ? -0.010  5.731   0.458   1.00 0.00 ? 24 SER A HA   3  
ATOM 3072  H HB2  . SER A 1 24 ? -0.426  3.810   -0.976  1.00 0.00 ? 24 SER A HB2  3  
ATOM 3073  H HB3  . SER A 1 24 ? -2.075  3.677   -0.369  1.00 0.00 ? 24 SER A HB3  3  
ATOM 3074  H HG   . SER A 1 24 ? -1.783  4.817   -2.427  1.00 0.00 ? 24 SER A HG   3  
ATOM 3075  N N    . LEU A 1 25 ? -2.785  5.449   2.118   1.00 0.00 ? 25 LEU A N    3  
ATOM 3076  C CA   . LEU A 1 25 ? -3.921  6.184   2.664   1.00 0.00 ? 25 LEU A CA   3  
ATOM 3077  C C    . LEU A 1 25 ? -3.463  7.436   3.411   1.00 0.00 ? 25 LEU A C    3  
ATOM 3078  O O    . LEU A 1 25 ? -4.023  8.518   3.226   1.00 0.00 ? 25 LEU A O    3  
ATOM 3079  C CB   . LEU A 1 25 ? -4.731  5.286   3.603   1.00 0.00 ? 25 LEU A CB   3  
ATOM 3080  C CG   . LEU A 1 25 ? -5.953  5.950   4.241   1.00 0.00 ? 25 LEU A CG   3  
ATOM 3081  C CD1  . LEU A 1 25 ? -6.940  6.397   3.172   1.00 0.00 ? 25 LEU A CD1  3  
ATOM 3082  C CD2  . LEU A 1 25 ? -6.624  5.000   5.223   1.00 0.00 ? 25 LEU A CD2  3  
ATOM 3083  H H    . LEU A 1 25 ? -2.605  4.542   2.457   1.00 0.00 ? 25 LEU A H    3  
ATOM 3084  H HA   . LEU A 1 25 ? -4.550  6.483   1.838   1.00 0.00 ? 25 LEU A HA   3  
ATOM 3085  H HB2  . LEU A 1 25 ? -5.066  4.427   3.039   1.00 0.00 ? 25 LEU A HB2  3  
ATOM 3086  H HB3  . LEU A 1 25 ? -4.074  4.944   4.392   1.00 0.00 ? 25 LEU A HB3  3  
ATOM 3087  H HG   . LEU A 1 25 ? -5.643  6.825   4.792   1.00 0.00 ? 25 LEU A HG   3  
ATOM 3088  H HD11 . LEU A 1 25 ? -7.816  6.824   3.642   1.00 0.00 ? 25 LEU A HD11 3  
ATOM 3089  H HD12 . LEU A 1 25 ? -7.236  5.549   2.570   1.00 0.00 ? 25 LEU A HD12 3  
ATOM 3090  H HD13 . LEU A 1 25 ? -6.481  7.143   2.541   1.00 0.00 ? 25 LEU A HD13 3  
ATOM 3091  H HD21 . LEU A 1 25 ? -5.918  4.714   5.990   1.00 0.00 ? 25 LEU A HD21 3  
ATOM 3092  H HD22 . LEU A 1 25 ? -6.965  4.116   4.702   1.00 0.00 ? 25 LEU A HD22 3  
ATOM 3093  H HD23 . LEU A 1 25 ? -7.469  5.492   5.684   1.00 0.00 ? 25 LEU A HD23 3  
ATOM 3094  N N    . ILE A 1 26 ? -2.450  7.278   4.253   1.00 0.00 ? 26 ILE A N    3  
ATOM 3095  C CA   . ILE A 1 26 ? -1.918  8.393   5.031   1.00 0.00 ? 26 ILE A CA   3  
ATOM 3096  C C    . ILE A 1 26 ? -1.341  9.473   4.123   1.00 0.00 ? 26 ILE A C    3  
ATOM 3097  O O    . ILE A 1 26 ? -1.502  10.666  4.379   1.00 0.00 ? 26 ILE A O    3  
ATOM 3098  C CB   . ILE A 1 26 ? -0.828  7.919   6.012   1.00 0.00 ? 26 ILE A CB   3  
ATOM 3099  C CG1  . ILE A 1 26 ? -1.369  6.806   6.917   1.00 0.00 ? 26 ILE A CG1  3  
ATOM 3100  C CG2  . ILE A 1 26 ? -0.313  9.085   6.845   1.00 0.00 ? 26 ILE A CG2  3  
ATOM 3101  C CD1  . ILE A 1 26 ? -2.529  7.237   7.791   1.00 0.00 ? 26 ILE A CD1  3  
ATOM 3102  H H    . ILE A 1 26 ? -2.045  6.386   4.349   1.00 0.00 ? 26 ILE A H    3  
ATOM 3103  H HA   . ILE A 1 26 ? -2.731  8.825   5.599   1.00 0.00 ? 26 ILE A HA   3  
ATOM 3104  H HB   . ILE A 1 26 ? 0.001   7.528   5.438   1.00 0.00 ? 26 ILE A HB   3  
ATOM 3105  H HG12 . ILE A 1 26 ? -1.699  5.982   6.323   1.00 0.00 ? 26 ILE A HG12 3  
ATOM 3106  H HG13 . ILE A 1 26 ? -0.576  6.468   7.570   1.00 0.00 ? 26 ILE A HG13 3  
ATOM 3107  H HG21 . ILE A 1 26 ? 0.313   8.714   7.647   1.00 0.00 ? 26 ILE A HG21 3  
ATOM 3108  H HG22 . ILE A 1 26 ? -1.141  9.636   7.268   1.00 0.00 ? 26 ILE A HG22 3  
ATOM 3109  H HG23 . ILE A 1 26 ? 0.274   9.745   6.223   1.00 0.00 ? 26 ILE A HG23 3  
ATOM 3110  H HD11 . ILE A 1 26 ? -2.767  8.281   7.650   1.00 0.00 ? 26 ILE A HD11 3  
ATOM 3111  H HD12 . ILE A 1 26 ? -2.272  7.073   8.827   1.00 0.00 ? 26 ILE A HD12 3  
ATOM 3112  H HD13 . ILE A 1 26 ? -3.397  6.640   7.546   1.00 0.00 ? 26 ILE A HD13 3  
ATOM 3113  N N    . ILE A 1 27 ? -0.668  9.044   3.061   1.00 0.00 ? 27 ILE A N    3  
ATOM 3114  C CA   . ILE A 1 27 ? -0.058  9.970   2.112   1.00 0.00 ? 27 ILE A CA   3  
ATOM 3115  C C    . ILE A 1 27 ? -1.111  10.669  1.260   1.00 0.00 ? 27 ILE A C    3  
ATOM 3116  O O    . ILE A 1 27 ? -0.967  11.844  0.924   1.00 0.00 ? 27 ILE A O    3  
ATOM 3117  C CB   . ILE A 1 27 ? 0.943   9.249   1.190   1.00 0.00 ? 27 ILE A CB   3  
ATOM 3118  C CG1  . ILE A 1 27 ? 1.996   8.508   2.020   1.00 0.00 ? 27 ILE A CG1  3  
ATOM 3119  C CG2  . ILE A 1 27 ? 1.604   10.237  0.238   1.00 0.00 ? 27 ILE A CG2  3  
ATOM 3120  C CD1  . ILE A 1 27 ? 2.718   9.388   3.020   1.00 0.00 ? 27 ILE A CD1  3  
ATOM 3121  H H    . ILE A 1 27 ? -0.574  8.076   2.905   1.00 0.00 ? 27 ILE A H    3  
ATOM 3122  H HA   . ILE A 1 27 ? 0.476   10.728  2.672   1.00 0.00 ? 27 ILE A HA   3  
ATOM 3123  H HB   . ILE A 1 27 ? 0.400   8.527   0.595   1.00 0.00 ? 27 ILE A HB   3  
ATOM 3124  H HG12 . ILE A 1 27 ? 1.519   7.723   2.571   1.00 0.00 ? 27 ILE A HG12 3  
ATOM 3125  H HG13 . ILE A 1 27 ? 2.738   8.075   1.362   1.00 0.00 ? 27 ILE A HG13 3  
ATOM 3126  H HG21 . ILE A 1 27 ? 1.999   11.077  0.793   1.00 0.00 ? 27 ILE A HG21 3  
ATOM 3127  H HG22 . ILE A 1 27 ? 0.882   10.591  -0.482  1.00 0.00 ? 27 ILE A HG22 3  
ATOM 3128  H HG23 . ILE A 1 27 ? 2.413   9.749   -0.291  1.00 0.00 ? 27 ILE A HG23 3  
ATOM 3129  H HD11 . ILE A 1 27 ? 3.553   8.842   3.434   1.00 0.00 ? 27 ILE A HD11 3  
ATOM 3130  H HD12 . ILE A 1 27 ? 2.044   9.662   3.817   1.00 0.00 ? 27 ILE A HD12 3  
ATOM 3131  H HD13 . ILE A 1 27 ? 3.083   10.281  2.534   1.00 0.00 ? 27 ILE A HD13 3  
ATOM 3132  N N    . LEU A 1 28 ? -2.166  9.941   0.909   1.00 0.00 ? 28 LEU A N    3  
ATOM 3133  C CA   . LEU A 1 28 ? -3.237  10.497  0.090   1.00 0.00 ? 28 LEU A CA   3  
ATOM 3134  C C    . LEU A 1 28 ? -3.851  11.721  0.760   1.00 0.00 ? 28 LEU A C    3  
ATOM 3135  O O    . LEU A 1 28 ? -4.119  12.730  0.107   1.00 0.00 ? 28 LEU A O    3  
ATOM 3136  C CB   . LEU A 1 28 ? -4.314  9.440   -0.166  1.00 0.00 ? 28 LEU A CB   3  
ATOM 3137  C CG   . LEU A 1 28 ? -5.405  9.849   -1.159  1.00 0.00 ? 28 LEU A CG   3  
ATOM 3138  C CD1  . LEU A 1 28 ? -4.826  10.004  -2.557  1.00 0.00 ? 28 LEU A CD1  3  
ATOM 3139  C CD2  . LEU A 1 28 ? -6.534  8.831   -1.159  1.00 0.00 ? 28 LEU A CD2  3  
ATOM 3140  H H    . LEU A 1 28 ? -2.229  9.000   1.199   1.00 0.00 ? 28 LEU A H    3  
ATOM 3141  H HA   . LEU A 1 28 ? -2.808  10.798  -0.854  1.00 0.00 ? 28 LEU A HA   3  
ATOM 3142  H HB2  . LEU A 1 28 ? -3.828  8.546   -0.536  1.00 0.00 ? 28 LEU A HB2  3  
ATOM 3143  H HB3  . LEU A 1 28 ? -4.783  9.201   0.782   1.00 0.00 ? 28 LEU A HB3  3  
ATOM 3144  H HG   . LEU A 1 28 ? -5.819  10.802  -0.865  1.00 0.00 ? 28 LEU A HG   3  
ATOM 3145  H HD11 . LEU A 1 28 ? -5.614  10.272  -3.249  1.00 0.00 ? 28 LEU A HD11 3  
ATOM 3146  H HD12 . LEU A 1 28 ? -4.376  9.073   -2.872  1.00 0.00 ? 28 LEU A HD12 3  
ATOM 3147  H HD13 . LEU A 1 28 ? -4.078  10.782  -2.557  1.00 0.00 ? 28 LEU A HD13 3  
ATOM 3148  H HD21 . LEU A 1 28 ? -6.952  8.753   -0.164  1.00 0.00 ? 28 LEU A HD21 3  
ATOM 3149  H HD22 . LEU A 1 28 ? -6.156  7.865   -1.465  1.00 0.00 ? 28 LEU A HD22 3  
ATOM 3150  H HD23 . LEU A 1 28 ? -7.308  9.147   -1.845  1.00 0.00 ? 28 LEU A HD23 3  
ATOM 3151  N N    . ILE A 1 29 ? -4.070  11.625  2.068   1.00 0.00 ? 29 ILE A N    3  
ATOM 3152  C CA   . ILE A 1 29 ? -4.649  12.724  2.831   1.00 0.00 ? 29 ILE A CA   3  
ATOM 3153  C C    . ILE A 1 29 ? -3.597  13.785  3.149   1.00 0.00 ? 29 ILE A C    3  
ATOM 3154  O O    . ILE A 1 29 ? -3.888  14.980  3.146   1.00 0.00 ? 29 ILE A O    3  
ATOM 3155  C CB   . ILE A 1 29 ? -5.279  12.224  4.145   1.00 0.00 ? 29 ILE A CB   3  
ATOM 3156  C CG1  . ILE A 1 29 ? -6.333  11.146  3.860   1.00 0.00 ? 29 ILE A CG1  3  
ATOM 3157  C CG2  . ILE A 1 29 ? -5.892  13.384  4.921   1.00 0.00 ? 29 ILE A CG2  3  
ATOM 3158  C CD1  . ILE A 1 29 ? -7.507  11.633  3.033   1.00 0.00 ? 29 ILE A CD1  3  
ATOM 3159  H H    . ILE A 1 29 ? -3.835  10.792  2.542   1.00 0.00 ? 29 ILE A H    3  
ATOM 3160  H HA   . ILE A 1 29 ? -5.425  13.184  2.235   1.00 0.00 ? 29 ILE A HA   3  
ATOM 3161  H HB   . ILE A 1 29 ? -4.497  11.792  4.755   1.00 0.00 ? 29 ILE A HB   3  
ATOM 3162  H HG12 . ILE A 1 29 ? -5.874  10.325  3.329   1.00 0.00 ? 29 ILE A HG12 3  
ATOM 3163  H HG13 . ILE A 1 29 ? -6.723  10.778  4.799   1.00 0.00 ? 29 ILE A HG13 3  
ATOM 3164  H HG21 . ILE A 1 29 ? -6.581  13.920  4.294   1.00 0.00 ? 29 ILE A HG21 3  
ATOM 3165  H HG22 . ILE A 1 29 ? -5.117  14.054  5.259   1.00 0.00 ? 29 ILE A HG22 3  
ATOM 3166  H HG23 . ILE A 1 29 ? -6.422  13.002  5.784   1.00 0.00 ? 29 ILE A HG23 3  
ATOM 3167  H HD11 . ILE A 1 29 ? -8.208  10.821  2.902   1.00 0.00 ? 29 ILE A HD11 3  
ATOM 3168  H HD12 . ILE A 1 29 ? -7.163  11.961  2.065   1.00 0.00 ? 29 ILE A HD12 3  
ATOM 3169  H HD13 . ILE A 1 29 ? -8.001  12.449  3.537   1.00 0.00 ? 29 ILE A HD13 3  
ATOM 3170  N N    . MET A 1 30 ? -2.373  13.339  3.426   1.00 0.00 ? 30 MET A N    3  
ATOM 3171  C CA   . MET A 1 30 ? -1.282  14.253  3.746   1.00 0.00 ? 30 MET A CA   3  
ATOM 3172  C C    . MET A 1 30 ? -1.040  15.228  2.597   1.00 0.00 ? 30 MET A C    3  
ATOM 3173  O O    . MET A 1 30 ? -0.878  16.428  2.813   1.00 0.00 ? 30 MET A O    3  
ATOM 3174  C CB   . MET A 1 30 ? 0.000   13.469  4.045   1.00 0.00 ? 30 MET A CB   3  
ATOM 3175  C CG   . MET A 1 30 ? 1.135   14.335  4.565   1.00 0.00 ? 30 MET A CG   3  
ATOM 3176  S SD   . MET A 1 30 ? 2.664   13.410  4.809   1.00 0.00 ? 30 MET A SD   3  
ATOM 3177  C CE   . MET A 1 30 ? 2.139   12.188  6.010   1.00 0.00 ? 30 MET A CE   3  
ATOM 3178  H H    . MET A 1 30 ? -2.194  12.369  3.421   1.00 0.00 ? 30 MET A H    3  
ATOM 3179  H HA   . MET A 1 30 ? -1.564  14.815  4.627   1.00 0.00 ? 30 MET A HA   3  
ATOM 3180  H HB2  . MET A 1 30 ? -0.226  12.724  4.792   1.00 0.00 ? 30 MET A HB2  3  
ATOM 3181  H HB3  . MET A 1 30 ? 0.329   12.971  3.141   1.00 0.00 ? 30 MET A HB3  3  
ATOM 3182  H HG2  . MET A 1 30 ? 1.311   15.123  3.894   1.00 0.00 ? 30 MET A HG2  3  
ATOM 3183  H HG3  . MET A 1 30 ? 0.836   14.746  5.518   1.00 0.00 ? 30 MET A HG3  3  
ATOM 3184  H HE1  . MET A 1 30 ? 1.564   12.670  6.786   1.00 0.00 ? 30 MET A HE1  3  
ATOM 3185  H HE2  . MET A 1 30 ? 3.007   11.715  6.446   1.00 0.00 ? 30 MET A HE2  3  
ATOM 3186  H HE3  . MET A 1 30 ? 1.530   11.442  5.522   1.00 0.00 ? 30 MET A HE3  3  
ATOM 3187  N N    . LEU A 1 31 ? -1.022  14.699  1.377   1.00 0.00 ? 31 LEU A N    3  
ATOM 3188  C CA   . LEU A 1 31 ? -0.808  15.517  0.188   1.00 0.00 ? 31 LEU A CA   3  
ATOM 3189  C C    . LEU A 1 31 ? -2.069  16.305  -0.150  1.00 0.00 ? 31 LEU A C    3  
ATOM 3190  O O    . LEU A 1 31 ? -2.001  17.406  -0.697  1.00 0.00 ? 31 LEU A O    3  
ATOM 3191  C CB   . LEU A 1 31 ? -0.407  14.635  -0.996  1.00 0.00 ? 31 LEU A CB   3  
ATOM 3192  C CG   . LEU A 1 31 ? -0.002  15.391  -2.265  1.00 0.00 ? 31 LEU A CG   3  
ATOM 3193  C CD1  . LEU A 1 31 ? 1.278   16.179  -2.032  1.00 0.00 ? 31 LEU A CD1  3  
ATOM 3194  C CD2  . LEU A 1 31 ? 0.168   14.423  -3.427  1.00 0.00 ? 31 LEU A CD2  3  
ATOM 3195  H H    . LEU A 1 31 ? -1.161  13.728  1.267   1.00 0.00 ? 31 LEU A H    3  
ATOM 3196  H HA   . LEU A 1 31 ? -0.018  16.208  0.386   1.00 0.00 ? 31 LEU A HA   3  
ATOM 3197  H HB2  . LEU A 1 31 ? 0.422   14.012  -0.686  1.00 0.00 ? 31 LEU A HB2  3  
ATOM 3198  H HB3  . LEU A 1 31 ? -1.244  13.988  -1.233  1.00 0.00 ? 31 LEU A HB3  3  
ATOM 3199  H HG   . LEU A 1 31 ? -0.780  16.092  -2.529  1.00 0.00 ? 31 LEU A HG   3  
ATOM 3200  H HD11 . LEU A 1 31 ? 1.045   17.069  -1.472  1.00 0.00 ? 31 LEU A HD11 3  
ATOM 3201  H HD12 . LEU A 1 31 ? 1.715   16.459  -2.977  1.00 0.00 ? 31 LEU A HD12 3  
ATOM 3202  H HD13 . LEU A 1 31 ? 1.990   15.581  -1.477  1.00 0.00 ? 31 LEU A HD13 3  
ATOM 3203  H HD21 . LEU A 1 31 ? 0.953   13.714  -3.200  1.00 0.00 ? 31 LEU A HD21 3  
ATOM 3204  H HD22 . LEU A 1 31 ? 0.428   14.972  -4.321  1.00 0.00 ? 31 LEU A HD22 3  
ATOM 3205  H HD23 . LEU A 1 31 ? -0.759  13.891  -3.594  1.00 0.00 ? 31 LEU A HD23 3  
ATOM 3206  N N    . TRP A 1 32 ? -3.221  15.729  0.181   1.00 0.00 ? 32 TRP A N    3  
ATOM 3207  C CA   . TRP A 1 32 ? -4.504  16.370  -0.075  1.00 0.00 ? 32 TRP A CA   3  
ATOM 3208  C C    . TRP A 1 32 ? -4.600  17.694  0.679   1.00 0.00 ? 32 TRP A C    3  
ATOM 3209  O O    . TRP A 1 32 ? -5.232  18.642  0.212   1.00 0.00 ? 32 TRP A O    3  
ATOM 3210  C CB   . TRP A 1 32 ? -5.650  15.439  0.339   1.00 0.00 ? 32 TRP A CB   3  
ATOM 3211  C CG   . TRP A 1 32 ? -7.010  16.050  0.189   1.00 0.00 ? 32 TRP A CG   3  
ATOM 3212  C CD1  . TRP A 1 32 ? -7.560  16.562  -0.950  1.00 0.00 ? 32 TRP A CD1  3  
ATOM 3213  C CD2  . TRP A 1 32 ? -7.996  16.206  1.217   1.00 0.00 ? 32 TRP A CD2  3  
ATOM 3214  N NE1  . TRP A 1 32 ? -8.825  17.033  -0.694  1.00 0.00 ? 32 TRP A NE1  3  
ATOM 3215  C CE2  . TRP A 1 32 ? -9.116  16.824  0.629   1.00 0.00 ? 32 TRP A CE2  3  
ATOM 3216  C CE3  . TRP A 1 32 ? -8.039  15.884  2.576   1.00 0.00 ? 32 TRP A CE3  3  
ATOM 3217  C CZ2  . TRP A 1 32 ? -10.267 17.126  1.355   1.00 0.00 ? 32 TRP A CZ2  3  
ATOM 3218  C CZ3  . TRP A 1 32 ? -9.181  16.184  3.295   1.00 0.00 ? 32 TRP A CZ3  3  
ATOM 3219  C CH2  . TRP A 1 32 ? -10.281 16.799  2.684   1.00 0.00 ? 32 TRP A CH2  3  
ATOM 3220  H H    . TRP A 1 32 ? -3.217  14.843  0.612   1.00 0.00 ? 32 TRP A H    3  
ATOM 3221  H HA   . TRP A 1 32 ? -4.579  16.566  -1.136  1.00 0.00 ? 32 TRP A HA   3  
ATOM 3222  H HB2  . TRP A 1 32 ? -5.623  14.556  -0.278  1.00 0.00 ? 32 TRP A HB2  3  
ATOM 3223  H HB3  . TRP A 1 32 ? -5.518  15.157  1.370   1.00 0.00 ? 32 TRP A HB3  3  
ATOM 3224  H HD1  . TRP A 1 32 ? -7.060  16.591  -1.907  1.00 0.00 ? 32 TRP A HD1  3  
ATOM 3225  H HE1  . TRP A 1 32 ? -9.422  17.448  -1.351  1.00 0.00 ? 32 TRP A HE1  3  
ATOM 3226  H HE3  . TRP A 1 32 ? -7.202  15.416  3.061   1.00 0.00 ? 32 TRP A HE3  3  
ATOM 3227  H HZ2  . TRP A 1 32 ? -11.124 17.600  0.899   1.00 0.00 ? 32 TRP A HZ2  3  
ATOM 3228  H HZ3  . TRP A 1 32 ? -9.232  15.943  4.347   1.00 0.00 ? 32 TRP A HZ3  3  
ATOM 3229  H HH2  . TRP A 1 32 ? -11.152 17.015  3.285   1.00 0.00 ? 32 TRP A HH2  3  
ATOM 3230  N N    . GLN A 1 33 ? -3.965  17.747  1.844   1.00 0.00 ? 33 GLN A N    3  
ATOM 3231  C CA   . GLN A 1 33 ? -3.970  18.951  2.667   1.00 0.00 ? 33 GLN A CA   3  
ATOM 3232  C C    . GLN A 1 33 ? -2.622  19.664  2.592   1.00 0.00 ? 33 GLN A C    3  
ATOM 3233  O O    . GLN A 1 33 ? -2.369  20.611  3.334   1.00 0.00 ? 33 GLN A O    3  
ATOM 3234  C CB   . GLN A 1 33 ? -4.291  18.600  4.120   1.00 0.00 ? 33 GLN A CB   3  
ATOM 3235  C CG   . GLN A 1 33 ? -5.679  18.012  4.308   1.00 0.00 ? 33 GLN A CG   3  
ATOM 3236  C CD   . GLN A 1 33 ? -6.779  18.984  3.928   1.00 0.00 ? 33 GLN A CD   3  
ATOM 3237  O OE1  . GLN A 1 33 ? -7.245  19.765  4.757   1.00 0.00 ? 33 GLN A OE1  3  
ATOM 3238  N NE2  . GLN A 1 33 ? -7.199  18.937  2.669   1.00 0.00 ? 33 GLN A NE2  3  
ATOM 3239  H H    . GLN A 1 33 ? -3.472  16.962  2.175   1.00 0.00 ? 33 GLN A H    3  
ATOM 3240  H HA   . GLN A 1 33 ? -4.725  19.634  2.300   1.00 0.00 ? 33 GLN A HA   3  
ATOM 3241  H HB2  . GLN A 1 33 ? -3.570  17.876  4.471   1.00 0.00 ? 33 GLN A HB2  3  
ATOM 3242  H HB3  . GLN A 1 33 ? -4.217  19.493  4.730   1.00 0.00 ? 33 GLN A HB3  3  
ATOM 3243  H HG2  . GLN A 1 33 ? -5.768  17.123  3.699   1.00 0.00 ? 33 GLN A HG2  3  
ATOM 3244  H HG3  . GLN A 1 33 ? -5.801  17.745  5.348   1.00 0.00 ? 33 GLN A HG3  3  
ATOM 3245  H HE21 . GLN A 1 33 ? -6.787  18.304  2.058   1.00 0.00 ? 33 GLN A HE21 3  
ATOM 3246  H HE22 . GLN A 1 33 ? -7.916  19.550  2.404   1.00 0.00 ? 33 GLN A HE22 3  
ATOM 3247  N N    . LYS A 1 34 ? -1.760  19.198  1.695   1.00 0.00 ? 34 LYS A N    3  
ATOM 3248  C CA   . LYS A 1 34 ? -0.441  19.794  1.524   1.00 0.00 ? 34 LYS A CA   3  
ATOM 3249  C C    . LYS A 1 34 ? -0.464  20.855  0.428   1.00 0.00 ? 34 LYS A C    3  
ATOM 3250  O O    . LYS A 1 34 ? 0.137   21.920  0.568   1.00 0.00 ? 34 LYS A O    3  
ATOM 3251  C CB   . LYS A 1 34 ? 0.593   18.717  1.187   1.00 0.00 ? 34 LYS A CB   3  
ATOM 3252  C CG   . LYS A 1 34 ? 2.014   19.249  1.086   1.00 0.00 ? 34 LYS A CG   3  
ATOM 3253  C CD   . LYS A 1 34 ? 3.001   18.162  0.687   1.00 0.00 ? 34 LYS A CD   3  
ATOM 3254  C CE   . LYS A 1 34 ? 3.303   17.219  1.843   1.00 0.00 ? 34 LYS A CE   3  
ATOM 3255  N NZ   . LYS A 1 34 ? 2.182   16.274  2.105   1.00 0.00 ? 34 LYS A NZ   3  
ATOM 3256  H H    . LYS A 1 34 ? -2.002  18.454  1.127   1.00 0.00 ? 34 LYS A H    3  
ATOM 3257  H HA   . LYS A 1 34 ? -0.147  20.269  2.453   1.00 0.00 ? 34 LYS A HA   3  
ATOM 3258  H HB2  . LYS A 1 34 ? 0.557   17.988  1.955   1.00 0.00 ? 34 LYS A HB2  3  
ATOM 3259  H HB3  . LYS A 1 34 ? 0.328   18.260  0.245   1.00 0.00 ? 34 LYS A HB3  3  
ATOM 3260  H HG2  . LYS A 1 34 ? 2.049   20.025  0.336   1.00 0.00 ? 34 LYS A HG2  3  
ATOM 3261  H HG3  . LYS A 1 34 ? 2.303   19.664  2.042   1.00 0.00 ? 34 LYS A HG3  3  
ATOM 3262  H HD2  . LYS A 1 34 ? 2.604   17.593  -0.133  1.00 0.00 ? 34 LYS A HD2  3  
ATOM 3263  H HD3  . LYS A 1 34 ? 3.923   18.633  0.378   1.00 0.00 ? 34 LYS A HD3  3  
ATOM 3264  H HE2  . LYS A 1 34 ? 4.185   16.647  1.595   1.00 0.00 ? 34 LYS A HE2  3  
ATOM 3265  H HE3  . LYS A 1 34 ? 3.495   17.797  2.738   1.00 0.00 ? 34 LYS A HE3  3  
ATOM 3266  H HZ1  . LYS A 1 34 ? 2.570   15.369  2.433   1.00 0.00 ? 34 LYS A HZ1  3  
ATOM 3267  H HZ2  . LYS A 1 34 ? 1.638   16.099  1.246   1.00 0.00 ? 34 LYS A HZ2  3  
ATOM 3268  H HZ3  . LYS A 1 34 ? 1.559   16.658  2.837   1.00 0.00 ? 34 LYS A HZ3  3  
ATOM 3269  N N    . LYS A 1 35 ? -1.165  20.556  -0.662  1.00 0.00 ? 35 LYS A N    3  
ATOM 3270  C CA   . LYS A 1 35 ? -1.273  21.486  -1.781  1.00 0.00 ? 35 LYS A CA   3  
ATOM 3271  C C    . LYS A 1 35 ? -2.613  22.223  -1.746  1.00 0.00 ? 35 LYS A C    3  
ATOM 3272  O O    . LYS A 1 35 ? -3.663  21.599  -1.578  1.00 0.00 ? 35 LYS A O    3  
ATOM 3273  C CB   . LYS A 1 35 ? -1.114  20.736  -3.105  1.00 0.00 ? 35 LYS A CB   3  
ATOM 3274  C CG   . LYS A 1 35 ? 0.260   20.112  -3.284  1.00 0.00 ? 35 LYS A CG   3  
ATOM 3275  C CD   . LYS A 1 35 ? 0.397   19.433  -4.636  1.00 0.00 ? 35 LYS A CD   3  
ATOM 3276  C CE   . LYS A 1 35 ? 1.790   18.852  -4.828  1.00 0.00 ? 35 LYS A CE   3  
ATOM 3277  N NZ   . LYS A 1 35 ? 2.843   19.902  -4.754  1.00 0.00 ? 35 LYS A NZ   3  
ATOM 3278  H H    . LYS A 1 35 ? -1.631  19.689  -0.724  1.00 0.00 ? 35 LYS A H    3  
ATOM 3279  H HA   . LYS A 1 35 ? -0.463  22.190  -1.704  1.00 0.00 ? 35 LYS A HA   3  
ATOM 3280  H HB2  . LYS A 1 35 ? -1.854  19.950  -3.150  1.00 0.00 ? 35 LYS A HB2  3  
ATOM 3281  H HB3  . LYS A 1 35 ? -1.282  21.426  -3.924  1.00 0.00 ? 35 LYS A HB3  3  
ATOM 3282  H HG2  . LYS A 1 35 ? 1.004   20.891  -3.203  1.00 0.00 ? 35 LYS A HG2  3  
ATOM 3283  H HG3  . LYS A 1 35 ? 0.415   19.381  -2.503  1.00 0.00 ? 35 LYS A HG3  3  
ATOM 3284  H HD2  . LYS A 1 35 ? -0.326  18.633  -4.704  1.00 0.00 ? 35 LYS A HD2  3  
ATOM 3285  H HD3  . LYS A 1 35 ? 0.211   20.157  -5.417  1.00 0.00 ? 35 LYS A HD3  3  
ATOM 3286  H HE2  . LYS A 1 35 ? 1.974   18.122  -4.062  1.00 0.00 ? 35 LYS A HE2  3  
ATOM 3287  H HE3  . LYS A 1 35 ? 1.837   18.376  -5.796  1.00 0.00 ? 35 LYS A HE3  3  
ATOM 3288  H HZ1  . LYS A 1 35 ? 3.747   19.517  -5.095  1.00 0.00 ? 35 LYS A HZ1  3  
ATOM 3289  H HZ2  . LYS A 1 35 ? 2.969   20.218  -3.772  1.00 0.00 ? 35 LYS A HZ2  3  
ATOM 3290  H HZ3  . LYS A 1 35 ? 2.589   20.724  -5.343  1.00 0.00 ? 35 LYS A HZ3  3  
ATOM 3291  N N    . PRO A 1 36 ? -2.601  23.563  -1.903  1.00 0.00 ? 36 PRO A N    3  
ATOM 3292  C CA   . PRO A 1 36 ? -3.825  24.375  -1.875  1.00 0.00 ? 36 PRO A CA   3  
ATOM 3293  C C    . PRO A 1 36 ? -4.827  23.968  -2.951  1.00 0.00 ? 36 PRO A C    3  
ATOM 3294  O O    . PRO A 1 36 ? -4.476  23.302  -3.924  1.00 0.00 ? 36 PRO A O    3  
ATOM 3295  C CB   . PRO A 1 36 ? -3.324  25.801  -2.132  1.00 0.00 ? 36 PRO A CB   3  
ATOM 3296  C CG   . PRO A 1 36 ? -1.878  25.771  -1.773  1.00 0.00 ? 36 PRO A CG   3  
ATOM 3297  C CD   . PRO A 1 36 ? -1.400  24.390  -2.117  1.00 0.00 ? 36 PRO A CD   3  
ATOM 3298  H HA   . PRO A 1 36 ? -4.301  24.330  -0.906  1.00 0.00 ? 36 PRO A HA   3  
ATOM 3299  H HB2  . PRO A 1 36 ? -3.459  26.075  -3.172  1.00 0.00 ? 36 PRO A HB2  3  
ATOM 3300  H HB3  . PRO A 1 36 ? -3.866  26.491  -1.503  1.00 0.00 ? 36 PRO A HB3  3  
ATOM 3301  H HG2  . PRO A 1 36 ? -1.340  26.509  -2.350  1.00 0.00 ? 36 PRO A HG2  3  
ATOM 3302  H HG3  . PRO A 1 36 ? -1.757  25.957  -0.716  1.00 0.00 ? 36 PRO A HG3  3  
ATOM 3303  H HD2  . PRO A 1 36 ? -1.073  24.346  -3.146  1.00 0.00 ? 36 PRO A HD2  3  
ATOM 3304  H HD3  . PRO A 1 36 ? -0.603  24.109  -1.449  1.00 0.00 ? 36 PRO A HD3  3  
ATOM 3305  N N    . ARG A 1 37 ? -6.080  24.376  -2.759  1.00 0.00 ? 37 ARG A N    3  
ATOM 3306  C CA   . ARG A 1 37 ? -7.145  24.065  -3.708  1.00 0.00 ? 37 ARG A CA   3  
ATOM 3307  C C    . ARG A 1 37 ? -7.943  25.320  -4.053  1.00 0.00 ? 37 ARG A C    3  
ATOM 3308  O O    . ARG A 1 37 ? -8.132  26.196  -3.210  1.00 0.00 ? 37 ARG A O    3  
ATOM 3309  C CB   . ARG A 1 37 ? -8.072  22.992  -3.133  1.00 0.00 ? 37 ARG A CB   3  
ATOM 3310  C CG   . ARG A 1 37 ? -8.707  23.379  -1.807  1.00 0.00 ? 37 ARG A CG   3  
ATOM 3311  C CD   . ARG A 1 37 ? -9.629  22.286  -1.291  1.00 0.00 ? 37 ARG A CD   3  
ATOM 3312  N NE   . ARG A 1 37 ? -10.192 22.615  0.017   1.00 0.00 ? 37 ARG A NE   3  
ATOM 3313  C CZ   . ARG A 1 37 ? -11.232 21.982  0.553   1.00 0.00 ? 37 ARG A CZ   3  
ATOM 3314  N NH1  . ARG A 1 37 ? -11.825 20.993  -0.103  1.00 0.00 ? 37 ARG A NH1  3  
ATOM 3315  N NH2  . ARG A 1 37 ? -11.680 22.338  1.749   1.00 0.00 ? 37 ARG A NH2  3  
ATOM 3316  H H    . ARG A 1 37 ? -6.302  24.903  -1.956  1.00 0.00 ? 37 ARG A H    3  
ATOM 3317  H HA   . ARG A 1 37 ? -6.704  23.682  -4.622  1.00 0.00 ? 37 ARG A HA   3  
ATOM 3318  H HB2  . ARG A 1 37 ? -8.860  22.788  -3.847  1.00 0.00 ? 37 ARG A HB2  3  
ATOM 3319  H HB3  . ARG A 1 37 ? -7.497  22.089  -2.982  1.00 0.00 ? 37 ARG A HB3  3  
ATOM 3320  H HG2  . ARG A 1 37 ? -7.927  23.548  -1.081  1.00 0.00 ? 37 ARG A HG2  3  
ATOM 3321  H HG3  . ARG A 1 37 ? -9.281  24.284  -1.938  1.00 0.00 ? 37 ARG A HG3  3  
ATOM 3322  H HD2  . ARG A 1 37 ? -10.432 22.160  -2.004  1.00 0.00 ? 37 ARG A HD2  3  
ATOM 3323  H HD3  . ARG A 1 37 ? -9.071  21.362  -1.210  1.00 0.00 ? 37 ARG A HD3  3  
ATOM 3324  H HE   . ARG A 1 37 ? -9.770  23.344  0.530   1.00 0.00 ? 37 ARG A HE   3  
ATOM 3325  H HH11 . ARG A 1 37 ? -11.510 20.700  -1.002  1.00 0.00 ? 37 ARG A HH11 3  
ATOM 3326  H HH12 . ARG A 1 37 ? -12.609 20.526  0.311   1.00 0.00 ? 37 ARG A HH12 3  
ATOM 3327  H HH21 . ARG A 1 37 ? -11.237 23.083  2.251   1.00 0.00 ? 37 ARG A HH21 3  
ATOM 3328  H HH22 . ARG A 1 37 ? -12.464 21.863  2.156   1.00 0.00 ? 37 ARG A HH22 3  
ATOM 3329  N N    . TYR A 1 38 ? -8.407  25.400  -5.297  1.00 0.00 ? 38 TYR A N    3  
ATOM 3330  C CA   . TYR A 1 38 ? -9.180  26.553  -5.748  1.00 0.00 ? 38 TYR A CA   3  
ATOM 3331  C C    . TYR A 1 38 ? -10.511 26.122  -6.357  1.00 0.00 ? 38 TYR A C    3  
ATOM 3332  O O    . TYR A 1 38 ? -10.545 25.458  -7.394  1.00 0.00 ? 38 TYR A O    3  
ATOM 3333  C CB   . TYR A 1 38 ? -8.377  27.360  -6.769  1.00 0.00 ? 38 TYR A CB   3  
ATOM 3334  C CG   . TYR A 1 38 ? -9.073  28.624  -7.227  1.00 0.00 ? 38 TYR A CG   3  
ATOM 3335  C CD1  . TYR A 1 38 ? -9.032  29.781  -6.459  1.00 0.00 ? 38 TYR A CD1  3  
ATOM 3336  C CD2  . TYR A 1 38 ? -9.772  28.657  -8.428  1.00 0.00 ? 38 TYR A CD2  3  
ATOM 3337  C CE1  . TYR A 1 38 ? -9.666  30.936  -6.874  1.00 0.00 ? 38 TYR A CE1  3  
ATOM 3338  C CE2  . TYR A 1 38 ? -10.408 29.810  -8.850  1.00 0.00 ? 38 TYR A CE2  3  
ATOM 3339  C CZ   . TYR A 1 38 ? -10.353 30.945  -8.070  1.00 0.00 ? 38 TYR A CZ   3  
ATOM 3340  O OH   . TYR A 1 38 ? -10.986 32.093  -8.487  1.00 0.00 ? 38 TYR A OH   3  
ATOM 3341  H H    . TYR A 1 38 ? -8.226  24.672  -5.936  1.00 0.00 ? 38 TYR A H    3  
ATOM 3342  H HA   . TYR A 1 38 ? -9.383  27.196  -4.898  1.00 0.00 ? 38 TYR A HA   3  
ATOM 3343  H HB2  . TYR A 1 38 ? -7.431  27.640  -6.323  1.00 0.00 ? 38 TYR A HB2  3  
ATOM 3344  H HB3  . TYR A 1 38 ? -8.181  26.740  -7.636  1.00 0.00 ? 38 TYR A HB3  3  
ATOM 3345  H HD1  . TYR A 1 38 ? -8.493  29.775  -5.522  1.00 0.00 ? 38 TYR A HD1  3  
ATOM 3346  H HD2  . TYR A 1 38 ? -9.816  27.767  -9.040  1.00 0.00 ? 38 TYR A HD2  3  
ATOM 3347  H HE1  . TYR A 1 38 ? -9.622  31.825  -6.263  1.00 0.00 ? 38 TYR A HE1  3  
ATOM 3348  H HE2  . TYR A 1 38 ? -10.946 29.817  -9.786  1.00 0.00 ? 38 TYR A HE2  3  
ATOM 3349  H HH   . TYR A 1 38 ? -10.359 32.655  -8.949  1.00 0.00 ? 38 TYR A HH   3  
ATOM 3350  N N    . GLU A 1 39 ? -11.604 26.505  -5.701  1.00 0.00 ? 39 GLU A N    3  
ATOM 3351  C CA   . GLU A 1 39 ? -12.946 26.172  -6.175  1.00 0.00 ? 39 GLU A CA   3  
ATOM 3352  C C    . GLU A 1 39 ? -13.108 24.667  -6.373  1.00 0.00 ? 39 GLU A C    3  
ATOM 3353  O O    . GLU A 1 39 ? -13.896 24.224  -7.210  1.00 0.00 ? 39 GLU A O    3  
ATOM 3354  C CB   . GLU A 1 39 ? -13.244 26.908  -7.482  1.00 0.00 ? 39 GLU A CB   3  
ATOM 3355  C CG   . GLU A 1 39 ? -13.303 28.419  -7.330  1.00 0.00 ? 39 GLU A CG   3  
ATOM 3356  C CD   . GLU A 1 39 ? -14.404 28.865  -6.390  1.00 0.00 ? 39 GLU A CD   3  
ATOM 3357  O OE1  . GLU A 1 39 ? -15.537 29.089  -6.865  1.00 0.00 ? 39 GLU A OE1  3  
ATOM 3358  O OE2  . GLU A 1 39 ? -14.134 28.991  -5.177  1.00 0.00 ? 39 GLU A OE2  3  
ATOM 3359  O OXT  . GLU A 1 39 ? -12.436 23.906  -5.637  1.00 0.00 ? 39 GLU A OXT  3  
ATOM 3360  H H    . GLU A 1 39 ? -11.521 27.033  -4.876  1.00 0.00 ? 39 GLU A H    3  
ATOM 3361  H HA   . GLU A 1 39 ? -13.648 26.488  -5.419  1.00 0.00 ? 39 GLU A HA   3  
ATOM 3362  H HB2  . GLU A 1 39 ? -12.479 26.673  -8.204  1.00 0.00 ? 39 GLU A HB2  3  
ATOM 3363  H HB3  . GLU A 1 39 ? -14.200 26.576  -7.869  1.00 0.00 ? 39 GLU A HB3  3  
ATOM 3364  H HG2  . GLU A 1 39 ? -12.357 28.768  -6.943  1.00 0.00 ? 39 GLU A HG2  3  
ATOM 3365  H HG3  . GLU A 1 39 ? -13.478 28.859  -8.301  1.00 0.00 ? 39 GLU A HG3  3  
ATOM 3366  N N    . GLY B 1 1  ? -12.165 -23.286 -11.807 1.00 0.00 ? 1  GLY B N    3  
ATOM 3367  C CA   . GLY B 1 1  ? -11.715 -23.798 -10.526 1.00 0.00 ? 1  GLY B CA   3  
ATOM 3368  C C    . GLY B 1 1  ? -11.956 -22.819 -9.394  1.00 0.00 ? 1  GLY B C    3  
ATOM 3369  O O    . GLY B 1 1  ? -12.036 -21.611 -9.616  1.00 0.00 ? 1  GLY B O    3  
ATOM 3370  H H1   . GLY B 1 1  ? -11.659 -22.407 -12.046 1.00 0.00 ? 1  GLY B H1   3  
ATOM 3371  H H2   . GLY B 1 1  ? -13.188 -23.090 -11.782 1.00 0.00 ? 1  GLY B H2   3  
ATOM 3372  H H3   . GLY B 1 1  ? -11.980 -23.987 -12.552 1.00 0.00 ? 1  GLY B H3   3  
ATOM 3373  H HA2  . GLY B 1 1  ? -12.243 -24.717 -10.315 1.00 0.00 ? 1  GLY B HA2  3  
ATOM 3374  H HA3  . GLY B 1 1  ? -10.657 -24.009 -10.587 1.00 0.00 ? 1  GLY B HA3  3  
ATOM 3375  N N    . HIS B 1 2  ? -12.072 -23.339 -8.177  1.00 0.00 ? 2  HIS B N    3  
ATOM 3376  C CA   . HIS B 1 2  ? -12.304 -22.503 -7.006  1.00 0.00 ? 2  HIS B CA   3  
ATOM 3377  C C    . HIS B 1 2  ? -11.075 -22.470 -6.104  1.00 0.00 ? 2  HIS B C    3  
ATOM 3378  O O    . HIS B 1 2  ? -11.000 -21.673 -5.169  1.00 0.00 ? 2  HIS B O    3  
ATOM 3379  C CB   . HIS B 1 2  ? -13.516 -23.013 -6.223  1.00 0.00 ? 2  HIS B CB   3  
ATOM 3380  C CG   . HIS B 1 2  ? -13.430 -24.465 -5.869  1.00 0.00 ? 2  HIS B CG   3  
ATOM 3381  N ND1  . HIS B 1 2  ? -12.900 -24.921 -4.681  1.00 0.00 ? 2  HIS B ND1  3  
ATOM 3382  C CD2  . HIS B 1 2  ? -13.809 -25.568 -6.558  1.00 0.00 ? 2  HIS B CD2  3  
ATOM 3383  C CE1  . HIS B 1 2  ? -12.956 -26.241 -4.654  1.00 0.00 ? 2  HIS B CE1  3  
ATOM 3384  N NE2  . HIS B 1 2  ? -13.505 -26.657 -5.780  1.00 0.00 ? 2  HIS B NE2  3  
ATOM 3385  H H    . HIS B 1 2  ? -11.993 -24.312 -8.066  1.00 0.00 ? 2  HIS B H    3  
ATOM 3386  H HA   . HIS B 1 2  ? -12.512 -21.489 -7.324  1.00 0.00 ? 2  HIS B HA   3  
ATOM 3387  H HB2  . HIS B 1 2  ? -13.621 -22.450 -5.305  1.00 0.00 ? 2  HIS B HB2  3  
ATOM 3388  H HB3  . HIS B 1 2  ? -14.403 -22.872 -6.824  1.00 0.00 ? 2  HIS B HB3  3  
ATOM 3389  H HD1  . HIS B 1 2  ? -12.536 -24.361 -3.964  1.00 0.00 ? 2  HIS B HD1  3  
ATOM 3390  H HD2  . HIS B 1 2  ? -14.266 -25.587 -7.538  1.00 0.00 ? 2  HIS B HD2  3  
ATOM 3391  H HE1  . HIS B 1 2  ? -12.613 -26.872 -3.847  1.00 0.00 ? 2  HIS B HE1  3  
ATOM 3392  H HE2  . HIS B 1 2  ? -13.591 -27.594 -6.054  1.00 0.00 ? 2  HIS B HE2  3  
ATOM 3393  N N    . SER B 1 3  ? -10.111 -23.339 -6.391  1.00 0.00 ? 3  SER B N    3  
ATOM 3394  C CA   . SER B 1 3  ? -8.884  -23.410 -5.606  1.00 0.00 ? 3  SER B CA   3  
ATOM 3395  C C    . SER B 1 3  ? -7.693  -22.898 -6.410  1.00 0.00 ? 3  SER B C    3  
ATOM 3396  O O    . SER B 1 3  ? -7.407  -23.397 -7.499  1.00 0.00 ? 3  SER B O    3  
ATOM 3397  C CB   . SER B 1 3  ? -8.625  -24.845 -5.149  1.00 0.00 ? 3  SER B CB   3  
ATOM 3398  O OG   . SER B 1 3  ? -7.429  -24.933 -4.396  1.00 0.00 ? 3  SER B OG   3  
ATOM 3399  H H    . SER B 1 3  ? -10.202 -23.956 -7.145  1.00 0.00 ? 3  SER B H    3  
ATOM 3400  H HA   . SER B 1 3  ? -8.997  -22.795 -4.719  1.00 0.00 ? 3  SER B HA   3  
ATOM 3401  H HB2  . SER B 1 3  ? -9.447  -25.175 -4.531  1.00 0.00 ? 3  SER B HB2  3  
ATOM 3402  H HB3  . SER B 1 3  ? -8.545  -25.490 -6.013  1.00 0.00 ? 3  SER B HB3  3  
ATOM 3403  H HG   . SER B 1 3  ? -6.681  -25.048 -4.988  1.00 0.00 ? 3  SER B HG   3  
ATOM 3404  N N    . LEU B 1 4  ? -7.003  -21.901 -5.866  1.00 0.00 ? 4  LEU B N    3  
ATOM 3405  C CA   . LEU B 1 4  ? -5.842  -21.323 -6.532  1.00 0.00 ? 4  LEU B CA   3  
ATOM 3406  C C    . LEU B 1 4  ? -4.549  -21.945 -6.002  1.00 0.00 ? 4  LEU B C    3  
ATOM 3407  O O    . LEU B 1 4  ? -4.475  -22.335 -4.838  1.00 0.00 ? 4  LEU B O    3  
ATOM 3408  C CB   . LEU B 1 4  ? -5.811  -19.805 -6.333  1.00 0.00 ? 4  LEU B CB   3  
ATOM 3409  C CG   . LEU B 1 4  ? -7.007  -19.045 -6.915  1.00 0.00 ? 4  LEU B CG   3  
ATOM 3410  C CD1  . LEU B 1 4  ? -6.911  -17.565 -6.581  1.00 0.00 ? 4  LEU B CD1  3  
ATOM 3411  C CD2  . LEU B 1 4  ? -7.087  -19.246 -8.422  1.00 0.00 ? 4  LEU B CD2  3  
ATOM 3412  H H    . LEU B 1 4  ? -7.274  -21.542 -4.988  1.00 0.00 ? 4  LEU B H    3  
ATOM 3413  H HA   . LEU B 1 4  ? -5.922  -21.531 -7.588  1.00 0.00 ? 4  LEU B HA   3  
ATOM 3414  H HB2  . LEU B 1 4  ? -5.769  -19.610 -5.268  1.00 0.00 ? 4  LEU B HB2  3  
ATOM 3415  H HB3  . LEU B 1 4  ? -4.907  -19.415 -6.787  1.00 0.00 ? 4  LEU B HB3  3  
ATOM 3416  H HG   . LEU B 1 4  ? -7.917  -19.428 -6.476  1.00 0.00 ? 4  LEU B HG   3  
ATOM 3417  H HD11 . LEU B 1 4  ? -6.012  -17.149 -7.016  1.00 0.00 ? 4  LEU B HD11 3  
ATOM 3418  H HD12 . LEU B 1 4  ? -6.882  -17.437 -5.508  1.00 0.00 ? 4  LEU B HD12 3  
ATOM 3419  H HD13 . LEU B 1 4  ? -7.774  -17.047 -6.976  1.00 0.00 ? 4  LEU B HD13 3  
ATOM 3420  H HD21 . LEU B 1 4  ? -7.268  -20.287 -8.642  1.00 0.00 ? 4  LEU B HD21 3  
ATOM 3421  H HD22 . LEU B 1 4  ? -6.159  -18.937 -8.882  1.00 0.00 ? 4  LEU B HD22 3  
ATOM 3422  H HD23 . LEU B 1 4  ? -7.899  -18.654 -8.825  1.00 0.00 ? 4  LEU B HD23 3  
ATOM 3423  N N    . PRO B 1 5  ? -3.511  -22.047 -6.855  1.00 0.00 ? 5  PRO B N    3  
ATOM 3424  C CA   . PRO B 1 5  ? -2.222  -22.627 -6.460  1.00 0.00 ? 5  PRO B CA   3  
ATOM 3425  C C    . PRO B 1 5  ? -1.533  -21.817 -5.367  1.00 0.00 ? 5  PRO B C    3  
ATOM 3426  O O    . PRO B 1 5  ? -1.749  -20.613 -5.245  1.00 0.00 ? 5  PRO B O    3  
ATOM 3427  C CB   . PRO B 1 5  ? -1.395  -22.595 -7.749  1.00 0.00 ? 5  PRO B CB   3  
ATOM 3428  C CG   . PRO B 1 5  ? -2.045  -21.559 -8.599  1.00 0.00 ? 5  PRO B CG   3  
ATOM 3429  C CD   . PRO B 1 5  ? -3.507  -21.607 -8.261  1.00 0.00 ? 5  PRO B CD   3  
ATOM 3430  H HA   . PRO B 1 5  ? -2.340  -23.651 -6.132  1.00 0.00 ? 5  PRO B HA   3  
ATOM 3431  H HB2  . PRO B 1 5  ? -0.362  -22.344 -7.540  1.00 0.00 ? 5  PRO B HB2  3  
ATOM 3432  H HB3  . PRO B 1 5  ? -1.438  -23.564 -8.222  1.00 0.00 ? 5  PRO B HB3  3  
ATOM 3433  H HG2  . PRO B 1 5  ? -1.638  -20.586 -8.368  1.00 0.00 ? 5  PRO B HG2  3  
ATOM 3434  H HG3  . PRO B 1 5  ? -1.894  -21.792 -9.643  1.00 0.00 ? 5  PRO B HG3  3  
ATOM 3435  H HD2  . PRO B 1 5  ? -3.946  -20.626 -8.365  1.00 0.00 ? 5  PRO B HD2  3  
ATOM 3436  H HD3  . PRO B 1 5  ? -4.018  -22.321 -8.890  1.00 0.00 ? 5  PRO B HD3  3  
ATOM 3437  N N    . PHE B 1 6  ? -0.712  -22.489 -4.568  1.00 0.00 ? 6  PHE B N    3  
ATOM 3438  C CA   . PHE B 1 6  ? 0.014   -21.835 -3.486  1.00 0.00 ? 6  PHE B CA   3  
ATOM 3439  C C    . PHE B 1 6  ? 1.125   -20.945 -4.038  1.00 0.00 ? 6  PHE B C    3  
ATOM 3440  O O    . PHE B 1 6  ? 1.656   -20.088 -3.331  1.00 0.00 ? 6  PHE B O    3  
ATOM 3441  C CB   . PHE B 1 6  ? 0.597   -22.880 -2.526  1.00 0.00 ? 6  PHE B CB   3  
ATOM 3442  C CG   . PHE B 1 6  ? 1.801   -23.605 -3.059  1.00 0.00 ? 6  PHE B CG   3  
ATOM 3443  C CD1  . PHE B 1 6  ? 1.730   -24.341 -4.231  1.00 0.00 ? 6  PHE B CD1  3  
ATOM 3444  C CD2  . PHE B 1 6  ? 3.008   -23.552 -2.379  1.00 0.00 ? 6  PHE B CD2  3  
ATOM 3445  C CE1  . PHE B 1 6  ? 2.841   -25.010 -4.715  1.00 0.00 ? 6  PHE B CE1  3  
ATOM 3446  C CE2  . PHE B 1 6  ? 4.120   -24.217 -2.857  1.00 0.00 ? 6  PHE B CE2  3  
ATOM 3447  C CZ   . PHE B 1 6  ? 4.037   -24.947 -4.027  1.00 0.00 ? 6  PHE B CZ   3  
ATOM 3448  H H    . PHE B 1 6  ? -0.612  -23.447 -4.710  1.00 0.00 ? 6  PHE B H    3  
ATOM 3449  H HA   . PHE B 1 6  ? -0.683  -21.220 -2.936  1.00 0.00 ? 6  PHE B HA   3  
ATOM 3450  H HB2  . PHE B 1 6  ? 0.869   -22.387 -1.603  1.00 0.00 ? 6  PHE B HB2  3  
ATOM 3451  H HB3  . PHE B 1 6  ? -0.164  -23.618 -2.312  1.00 0.00 ? 6  PHE B HB3  3  
ATOM 3452  H HD1  . PHE B 1 6  ? 0.812   -24.410 -4.774  1.00 0.00 ? 6  PHE B HD1  3  
ATOM 3453  H HD2  . PHE B 1 6  ? 3.080   -22.982 -1.462  1.00 0.00 ? 6  PHE B HD2  3  
ATOM 3454  H HE1  . PHE B 1 6  ? 2.773   -25.581 -5.629  1.00 0.00 ? 6  PHE B HE1  3  
ATOM 3455  H HE2  . PHE B 1 6  ? 5.054   -24.166 -2.317  1.00 0.00 ? 6  PHE B HE2  3  
ATOM 3456  H HZ   . PHE B 1 6  ? 4.905   -25.468 -4.402  1.00 0.00 ? 6  PHE B HZ   3  
ATOM 3457  N N    . LYS B 1 7  ? 1.470   -21.157 -5.306  1.00 0.00 ? 7  LYS B N    3  
ATOM 3458  C CA   . LYS B 1 7  ? 2.523   -20.384 -5.960  1.00 0.00 ? 7  LYS B CA   3  
ATOM 3459  C C    . LYS B 1 7  ? 2.219   -18.888 -5.931  1.00 0.00 ? 7  LYS B C    3  
ATOM 3460  O O    . LYS B 1 7  ? 3.062   -18.084 -5.531  1.00 0.00 ? 7  LYS B O    3  
ATOM 3461  C CB   . LYS B 1 7  ? 2.701   -20.850 -7.406  1.00 0.00 ? 7  LYS B CB   3  
ATOM 3462  C CG   . LYS B 1 7  ? 3.887   -20.210 -8.110  1.00 0.00 ? 7  LYS B CG   3  
ATOM 3463  C CD   . LYS B 1 7  ? 3.913   -20.546 -9.594  1.00 0.00 ? 7  LYS B CD   3  
ATOM 3464  C CE   . LYS B 1 7  ? 4.445   -21.949 -9.851  1.00 0.00 ? 7  LYS B CE   3  
ATOM 3465  N NZ   . LYS B 1 7  ? 3.483   -23.001 -9.424  1.00 0.00 ? 7  LYS B NZ   3  
ATOM 3466  H H    . LYS B 1 7  ? 1.028   -21.860 -5.826  1.00 0.00 ? 7  LYS B H    3  
ATOM 3467  H HA   . LYS B 1 7  ? 3.445   -20.560 -5.422  1.00 0.00 ? 7  LYS B HA   3  
ATOM 3468  H HB2  . LYS B 1 7  ? 2.844   -21.910 -7.385  1.00 0.00 ? 7  LYS B HB2  3  
ATOM 3469  H HB3  . LYS B 1 7  ? 1.799   -20.626 -7.963  1.00 0.00 ? 7  LYS B HB3  3  
ATOM 3470  H HG2  . LYS B 1 7  ? 3.824   -19.136 -8.012  1.00 0.00 ? 7  LYS B HG2  3  
ATOM 3471  H HG3  . LYS B 1 7  ? 4.800   -20.557 -7.646  1.00 0.00 ? 7  LYS B HG3  3  
ATOM 3472  H HD2  . LYS B 1 7  ? 2.914   -20.470 -10.003 1.00 0.00 ? 7  LYS B HD2  3  
ATOM 3473  H HD3  . LYS B 1 7  ? 4.556   -19.836 -10.095 1.00 0.00 ? 7  LYS B HD3  3  
ATOM 3474  H HE2  . LYS B 1 7  ? 4.628   -22.057 -10.910 1.00 0.00 ? 7  LYS B HE2  3  
ATOM 3475  H HE3  . LYS B 1 7  ? 5.376   -22.082 -9.315  1.00 0.00 ? 7  LYS B HE3  3  
ATOM 3476  H HZ1  . LYS B 1 7  ? 3.720   -23.337 -8.470  1.00 0.00 ? 7  LYS B HZ1  3  
ATOM 3477  H HZ2  . LYS B 1 7  ? 3.542   -23.809 -10.076 1.00 0.00 ? 7  LYS B HZ2  3  
ATOM 3478  H HZ3  . LYS B 1 7  ? 2.501   -22.650 -9.430  1.00 0.00 ? 7  LYS B HZ3  3  
ATOM 3479  N N    . VAL B 1 8  ? 1.016   -18.520 -6.359  1.00 0.00 ? 8  VAL B N    3  
ATOM 3480  C CA   . VAL B 1 8  ? 0.612   -17.118 -6.386  1.00 0.00 ? 8  VAL B CA   3  
ATOM 3481  C C    . VAL B 1 8  ? 0.670   -16.498 -4.992  1.00 0.00 ? 8  VAL B C    3  
ATOM 3482  O O    . VAL B 1 8  ? 1.003   -15.324 -4.842  1.00 0.00 ? 8  VAL B O    3  
ATOM 3483  C CB   . VAL B 1 8  ? -0.806  -16.942 -6.965  1.00 0.00 ? 8  VAL B CB   3  
ATOM 3484  C CG1  . VAL B 1 8  ? -0.877  -17.500 -8.378  1.00 0.00 ? 8  VAL B CG1  3  
ATOM 3485  C CG2  . VAL B 1 8  ? -1.843  -17.607 -6.073  1.00 0.00 ? 8  VAL B CG2  3  
ATOM 3486  H H    . VAL B 1 8  ? 0.386   -19.212 -6.665  1.00 0.00 ? 8  VAL B H    3  
ATOM 3487  H HA   . VAL B 1 8  ? 1.305   -16.584 -7.026  1.00 0.00 ? 8  VAL B HA   3  
ATOM 3488  H HB   . VAL B 1 8  ? -1.029  -15.884 -7.014  1.00 0.00 ? 8  VAL B HB   3  
ATOM 3489  H HG11 . VAL B 1 8  ? -1.859  -17.313 -8.791  1.00 0.00 ? 8  VAL B HG11 3  
ATOM 3490  H HG12 . VAL B 1 8  ? -0.692  -18.564 -8.365  1.00 0.00 ? 8  VAL B HG12 3  
ATOM 3491  H HG13 . VAL B 1 8  ? -0.135  -17.015 -8.997  1.00 0.00 ? 8  VAL B HG13 3  
ATOM 3492  H HG21 . VAL B 1 8  ? -1.960  -17.036 -5.165  1.00 0.00 ? 8  VAL B HG21 3  
ATOM 3493  H HG22 . VAL B 1 8  ? -1.527  -18.597 -5.830  1.00 0.00 ? 8  VAL B HG22 3  
ATOM 3494  H HG23 . VAL B 1 8  ? -2.797  -17.651 -6.584  1.00 0.00 ? 8  VAL B HG23 3  
ATOM 3495  N N    . VAL B 1 9  ? 0.338   -17.292 -3.976  1.00 0.00 ? 9  VAL B N    3  
ATOM 3496  C CA   . VAL B 1 9  ? 0.353   -16.814 -2.597  1.00 0.00 ? 9  VAL B CA   3  
ATOM 3497  C C    . VAL B 1 9  ? 1.756   -16.383 -2.183  1.00 0.00 ? 9  VAL B C    3  
ATOM 3498  O O    . VAL B 1 9  ? 1.954   -15.279 -1.677  1.00 0.00 ? 9  VAL B O    3  
ATOM 3499  C CB   . VAL B 1 9  ? -0.139  -17.894 -1.614  1.00 0.00 ? 9  VAL B CB   3  
ATOM 3500  C CG1  . VAL B 1 9  ? -0.434  -17.279 -0.254  1.00 0.00 ? 9  VAL B CG1  3  
ATOM 3501  C CG2  . VAL B 1 9  ? -1.364  -18.609 -2.157  1.00 0.00 ? 9  VAL B CG2  3  
ATOM 3502  H H    . VAL B 1 9  ? 0.089   -18.218 -4.165  1.00 0.00 ? 9  VAL B H    3  
ATOM 3503  H HA   . VAL B 1 9  ? -0.311  -15.959 -2.533  1.00 0.00 ? 9  VAL B HA   3  
ATOM 3504  H HB   . VAL B 1 9  ? 0.643   -18.633 -1.484  1.00 0.00 ? 9  VAL B HB   3  
ATOM 3505  H HG11 . VAL B 1 9  ? -1.195  -16.518 -0.356  1.00 0.00 ? 9  VAL B HG11 3  
ATOM 3506  H HG12 . VAL B 1 9  ? 0.464   -16.837 0.151   1.00 0.00 ? 9  VAL B HG12 3  
ATOM 3507  H HG13 . VAL B 1 9  ? -0.785  -18.046 0.423   1.00 0.00 ? 9  VAL B HG13 3  
ATOM 3508  H HG21 . VAL B 1 9  ? -1.747  -19.292 -1.410  1.00 0.00 ? 9  VAL B HG21 3  
ATOM 3509  H HG22 . VAL B 1 9  ? -1.107  -19.168 -3.037  1.00 0.00 ? 9  VAL B HG22 3  
ATOM 3510  H HG23 . VAL B 1 9  ? -2.130  -17.886 -2.401  1.00 0.00 ? 9  VAL B HG23 3  
ATOM 3511  N N    . VAL B 1 10 ? 2.726   -17.266 -2.400  1.00 0.00 ? 10 VAL B N    3  
ATOM 3512  C CA   . VAL B 1 10 ? 4.114   -16.988 -2.045  1.00 0.00 ? 10 VAL B CA   3  
ATOM 3513  C C    . VAL B 1 10 ? 4.640   -15.751 -2.763  1.00 0.00 ? 10 VAL B C    3  
ATOM 3514  O O    . VAL B 1 10 ? 5.148   -14.827 -2.130  1.00 0.00 ? 10 VAL B O    3  
ATOM 3515  C CB   . VAL B 1 10 ? 5.026   -18.185 -2.375  1.00 0.00 ? 10 VAL B CB   3  
ATOM 3516  C CG1  . VAL B 1 10 ? 6.462   -17.894 -1.965  1.00 0.00 ? 10 VAL B CG1  3  
ATOM 3517  C CG2  . VAL B 1 10 ? 4.515   -19.445 -1.698  1.00 0.00 ? 10 VAL B CG2  3  
ATOM 3518  H H    . VAL B 1 10 ? 2.495   -18.127 -2.816  1.00 0.00 ? 10 VAL B H    3  
ATOM 3519  H HA   . VAL B 1 10 ? 4.157   -16.814 -0.976  1.00 0.00 ? 10 VAL B HA   3  
ATOM 3520  H HB   . VAL B 1 10 ? 5.007   -18.348 -3.445  1.00 0.00 ? 10 VAL B HB   3  
ATOM 3521  H HG11 . VAL B 1 10 ? 6.875   -17.120 -2.594  1.00 0.00 ? 10 VAL B HG11 3  
ATOM 3522  H HG12 . VAL B 1 10 ? 7.061   -18.789 -2.076  1.00 0.00 ? 10 VAL B HG12 3  
ATOM 3523  H HG13 . VAL B 1 10 ? 6.492   -17.573 -0.932  1.00 0.00 ? 10 VAL B HG13 3  
ATOM 3524  H HG21 . VAL B 1 10 ? 4.491   -19.297 -0.627  1.00 0.00 ? 10 VAL B HG21 3  
ATOM 3525  H HG22 . VAL B 1 10 ? 5.174   -20.271 -1.927  1.00 0.00 ? 10 VAL B HG22 3  
ATOM 3526  H HG23 . VAL B 1 10 ? 3.531   -19.681 -2.045  1.00 0.00 ? 10 VAL B HG23 3  
ATOM 3527  N N    . ILE B 1 11 ? 4.523   -15.744 -4.087  1.00 0.00 ? 11 ILE B N    3  
ATOM 3528  C CA   . ILE B 1 11 ? 4.995   -14.621 -4.891  1.00 0.00 ? 11 ILE B CA   3  
ATOM 3529  C C    . ILE B 1 11 ? 4.324   -13.316 -4.470  1.00 0.00 ? 11 ILE B C    3  
ATOM 3530  O O    . ILE B 1 11 ? 4.954   -12.260 -4.459  1.00 0.00 ? 11 ILE B O    3  
ATOM 3531  C CB   . ILE B 1 11 ? 4.739   -14.861 -6.393  1.00 0.00 ? 11 ILE B CB   3  
ATOM 3532  C CG1  . ILE B 1 11 ? 5.353   -16.194 -6.830  1.00 0.00 ? 11 ILE B CG1  3  
ATOM 3533  C CG2  . ILE B 1 11 ? 5.308   -13.713 -7.216  1.00 0.00 ? 11 ILE B CG2  3  
ATOM 3534  C CD1  . ILE B 1 11 ? 5.047   -16.563 -8.266  1.00 0.00 ? 11 ILE B CD1  3  
ATOM 3535  H H    . ILE B 1 11 ? 4.100   -16.516 -4.526  1.00 0.00 ? 11 ILE B H    3  
ATOM 3536  H HA   . ILE B 1 11 ? 6.064   -14.528 -4.738  1.00 0.00 ? 11 ILE B HA   3  
ATOM 3537  H HB   . ILE B 1 11 ? 3.670   -14.896 -6.558  1.00 0.00 ? 11 ILE B HB   3  
ATOM 3538  H HG12 . ILE B 1 11 ? 6.427   -16.138 -6.732  1.00 0.00 ? 11 ILE B HG12 3  
ATOM 3539  H HG13 . ILE B 1 11 ? 4.994   -16.992 -6.213  1.00 0.00 ? 11 ILE B HG13 3  
ATOM 3540  H HG21 . ILE B 1 11 ? 5.131   -13.890 -8.267  1.00 0.00 ? 11 ILE B HG21 3  
ATOM 3541  H HG22 . ILE B 1 11 ? 6.372   -13.633 -7.044  1.00 0.00 ? 11 ILE B HG22 3  
ATOM 3542  H HG23 . ILE B 1 11 ? 4.832   -12.784 -6.938  1.00 0.00 ? 11 ILE B HG23 3  
ATOM 3543  H HD11 . ILE B 1 11 ? 5.587   -15.906 -8.931  1.00 0.00 ? 11 ILE B HD11 3  
ATOM 3544  H HD12 . ILE B 1 11 ? 3.985   -16.471 -8.450  1.00 0.00 ? 11 ILE B HD12 3  
ATOM 3545  H HD13 . ILE B 1 11 ? 5.354   -17.583 -8.446  1.00 0.00 ? 11 ILE B HD13 3  
ATOM 3546  N N    . SER B 1 12 ? 3.043   -13.396 -4.122  1.00 0.00 ? 12 SER B N    3  
ATOM 3547  C CA   . SER B 1 12 ? 2.288   -12.217 -3.704  1.00 0.00 ? 12 SER B CA   3  
ATOM 3548  C C    . SER B 1 12 ? 2.752   -11.721 -2.337  1.00 0.00 ? 12 SER B C    3  
ATOM 3549  O O    . SER B 1 12 ? 2.827   -10.516 -2.097  1.00 0.00 ? 12 SER B O    3  
ATOM 3550  C CB   . SER B 1 12 ? 0.790   -12.528 -3.667  1.00 0.00 ? 12 SER B CB   3  
ATOM 3551  O OG   . SER B 1 12 ? 0.043   -11.396 -3.256  1.00 0.00 ? 12 SER B OG   3  
ATOM 3552  H H    . SER B 1 12 ? 2.584   -14.268 -4.149  1.00 0.00 ? 12 SER B H    3  
ATOM 3553  H HA   . SER B 1 12 ? 2.457   -11.432 -4.430  1.00 0.00 ? 12 SER B HA   3  
ATOM 3554  H HB2  . SER B 1 12 ? 0.462   -12.822 -4.653  1.00 0.00 ? 12 SER B HB2  3  
ATOM 3555  H HB3  . SER B 1 12 ? 0.608   -13.336 -2.973  1.00 0.00 ? 12 SER B HB3  3  
ATOM 3556  H HG   . SER B 1 12 ? -0.072  -10.797 -3.999  1.00 0.00 ? 12 SER B HG   3  
ATOM 3557  N N    . ALA B 1 13 ? 3.058   -12.658 -1.446  1.00 0.00 ? 13 ALA B N    3  
ATOM 3558  C CA   . ALA B 1 13 ? 3.508   -12.320 -0.100  1.00 0.00 ? 13 ALA B CA   3  
ATOM 3559  C C    . ALA B 1 13 ? 4.866   -11.626 -0.120  1.00 0.00 ? 13 ALA B C    3  
ATOM 3560  O O    . ALA B 1 13 ? 5.017   -10.522 0.403   1.00 0.00 ? 13 ALA B O    3  
ATOM 3561  C CB   . ALA B 1 13 ? 3.569   -13.571 0.762   1.00 0.00 ? 13 ALA B CB   3  
ATOM 3562  H H    . ALA B 1 13 ? 2.974   -13.609 -1.693  1.00 0.00 ? 13 ALA B H    3  
ATOM 3563  H HA   . ALA B 1 13 ? 2.781   -11.650 0.343   1.00 0.00 ? 13 ALA B HA   3  
ATOM 3564  H HB1  . ALA B 1 13 ? 3.839   -13.303 1.774   1.00 0.00 ? 13 ALA B HB1  3  
ATOM 3565  H HB2  . ALA B 1 13 ? 4.304   -14.255 0.361   1.00 0.00 ? 13 ALA B HB2  3  
ATOM 3566  H HB3  . ALA B 1 13 ? 2.601   -14.050 0.765   1.00 0.00 ? 13 ALA B HB3  3  
ATOM 3567  N N    . ILE B 1 14 ? 5.852   -12.282 -0.725  1.00 0.00 ? 14 ILE B N    3  
ATOM 3568  C CA   . ILE B 1 14 ? 7.200   -11.730 -0.802  1.00 0.00 ? 14 ILE B CA   3  
ATOM 3569  C C    . ILE B 1 14 ? 7.215   -10.400 -1.552  1.00 0.00 ? 14 ILE B C    3  
ATOM 3570  O O    . ILE B 1 14 ? 7.935   -9.476  -1.172  1.00 0.00 ? 14 ILE B O    3  
ATOM 3571  C CB   . ILE B 1 14 ? 8.173   -12.717 -1.483  1.00 0.00 ? 14 ILE B CB   3  
ATOM 3572  C CG1  . ILE B 1 14 ? 9.596   -12.152 -1.479  1.00 0.00 ? 14 ILE B CG1  3  
ATOM 3573  C CG2  . ILE B 1 14 ? 7.719   -13.022 -2.903  1.00 0.00 ? 14 ILE B CG2  3  
ATOM 3574  C CD1  . ILE B 1 14 ? 10.651  -13.162 -1.873  1.00 0.00 ? 14 ILE B CD1  3  
ATOM 3575  H H    . ILE B 1 14 ? 5.666   -13.167 -1.117  1.00 0.00 ? 14 ILE B H    3  
ATOM 3576  H HA   . ILE B 1 14 ? 7.547   -11.561 0.211   1.00 0.00 ? 14 ILE B HA   3  
ATOM 3577  H HB   . ILE B 1 14 ? 8.155   -13.641 -0.922  1.00 0.00 ? 14 ILE B HB   3  
ATOM 3578  H HG12 . ILE B 1 14 ? 9.666   -11.324 -2.171  1.00 0.00 ? 14 ILE B HG12 3  
ATOM 3579  H HG13 . ILE B 1 14 ? 9.840   -11.802 -0.484  1.00 0.00 ? 14 ILE B HG13 3  
ATOM 3580  H HG21 . ILE B 1 14 ? 6.668   -13.241 -2.931  1.00 0.00 ? 14 ILE B HG21 3  
ATOM 3581  H HG22 . ILE B 1 14 ? 8.265   -13.877 -3.271  1.00 0.00 ? 14 ILE B HG22 3  
ATOM 3582  H HG23 . ILE B 1 14 ? 7.921   -12.174 -3.544  1.00 0.00 ? 14 ILE B HG23 3  
ATOM 3583  H HD11 . ILE B 1 14 ? 11.625  -12.697 -1.837  1.00 0.00 ? 14 ILE B HD11 3  
ATOM 3584  H HD12 . ILE B 1 14 ? 10.456  -13.514 -2.875  1.00 0.00 ? 14 ILE B HD12 3  
ATOM 3585  H HD13 . ILE B 1 14 ? 10.625  -13.996 -1.187  1.00 0.00 ? 14 ILE B HD13 3  
ATOM 3586  N N    . LEU B 1 15 ? 6.414   -10.303 -2.610  1.00 0.00 ? 15 LEU B N    3  
ATOM 3587  C CA   . LEU B 1 15 ? 6.347   -9.081  -3.406  1.00 0.00 ? 15 LEU B CA   3  
ATOM 3588  C C    . LEU B 1 15 ? 5.690   -7.952  -2.619  1.00 0.00 ? 15 LEU B C    3  
ATOM 3589  O O    . LEU B 1 15 ? 6.041   -6.784  -2.785  1.00 0.00 ? 15 LEU B O    3  
ATOM 3590  C CB   . LEU B 1 15 ? 5.572   -9.324  -4.703  1.00 0.00 ? 15 LEU B CB   3  
ATOM 3591  C CG   . LEU B 1 15 ? 5.395   -8.093  -5.593  1.00 0.00 ? 15 LEU B CG   3  
ATOM 3592  C CD1  . LEU B 1 15 ? 6.735   -7.637  -6.149  1.00 0.00 ? 15 LEU B CD1  3  
ATOM 3593  C CD2  . LEU B 1 15 ? 4.417   -8.384  -6.720  1.00 0.00 ? 15 LEU B CD2  3  
ATOM 3594  H H    . LEU B 1 15 ? 5.849   -11.068 -2.868  1.00 0.00 ? 15 LEU B H    3  
ATOM 3595  H HA   . LEU B 1 15 ? 7.358   -8.786  -3.657  1.00 0.00 ? 15 LEU B HA   3  
ATOM 3596  H HB2  . LEU B 1 15 ? 6.087   -10.091 -5.267  1.00 0.00 ? 15 LEU B HB2  3  
ATOM 3597  H HB3  . LEU B 1 15 ? 4.592   -9.699  -4.437  1.00 0.00 ? 15 LEU B HB3  3  
ATOM 3598  H HG   . LEU B 1 15 ? 4.987   -7.279  -5.013  1.00 0.00 ? 15 LEU B HG   3  
ATOM 3599  H HD11 . LEU B 1 15 ? 7.399   -7.385  -5.335  1.00 0.00 ? 15 LEU B HD11 3  
ATOM 3600  H HD12 . LEU B 1 15 ? 6.592   -6.764  -6.771  1.00 0.00 ? 15 LEU B HD12 3  
ATOM 3601  H HD13 . LEU B 1 15 ? 7.174   -8.430  -6.739  1.00 0.00 ? 15 LEU B HD13 3  
ATOM 3602  H HD21 . LEU B 1 15 ? 4.801   -9.183  -7.340  1.00 0.00 ? 15 LEU B HD21 3  
ATOM 3603  H HD22 . LEU B 1 15 ? 4.283   -7.496  -7.322  1.00 0.00 ? 15 LEU B HD22 3  
ATOM 3604  H HD23 . LEU B 1 15 ? 3.463   -8.679  -6.305  1.00 0.00 ? 15 LEU B HD23 3  
ATOM 3605  N N    . ALA B 1 16 ? 4.737   -8.307  -1.765  1.00 0.00 ? 16 ALA B N    3  
ATOM 3606  C CA   . ALA B 1 16 ? 4.035   -7.319  -0.956  1.00 0.00 ? 16 ALA B CA   3  
ATOM 3607  C C    . ALA B 1 16 ? 4.984   -6.649  0.030   1.00 0.00 ? 16 ALA B C    3  
ATOM 3608  O O    . ALA B 1 16 ? 4.815   -5.478  0.372   1.00 0.00 ? 16 ALA B O    3  
ATOM 3609  C CB   . ALA B 1 16 ? 2.870   -7.966  -0.226  1.00 0.00 ? 16 ALA B CB   3  
ATOM 3610  H H    . ALA B 1 16 ? 4.490   -9.257  -1.673  1.00 0.00 ? 16 ALA B H    3  
ATOM 3611  H HA   . ALA B 1 16 ? 3.627   -6.570  -1.619  1.00 0.00 ? 16 ALA B HA   3  
ATOM 3612  H HB1  . ALA B 1 16 ? 2.339   -7.219  0.348   1.00 0.00 ? 16 ALA B HB1  3  
ATOM 3613  H HB2  . ALA B 1 16 ? 3.239   -8.735  0.437   1.00 0.00 ? 16 ALA B HB2  3  
ATOM 3614  H HB3  . ALA B 1 16 ? 2.198   -8.407  -0.946  1.00 0.00 ? 16 ALA B HB3  3  
ATOM 3615  N N    . LEU B 1 17 ? 5.980   -7.399  0.490   1.00 0.00 ? 17 LEU B N    3  
ATOM 3616  C CA   . LEU B 1 17 ? 6.964   -6.871  1.429   1.00 0.00 ? 17 LEU B CA   3  
ATOM 3617  C C    . LEU B 1 17 ? 7.923   -5.920  0.723   1.00 0.00 ? 17 LEU B C    3  
ATOM 3618  O O    . LEU B 1 17 ? 8.394   -4.947  1.311   1.00 0.00 ? 17 LEU B O    3  
ATOM 3619  C CB   . LEU B 1 17 ? 7.747   -8.010  2.088   1.00 0.00 ? 17 LEU B CB   3  
ATOM 3620  C CG   . LEU B 1 17 ? 6.909   -8.986  2.917   1.00 0.00 ? 17 LEU B CG   3  
ATOM 3621  C CD1  . LEU B 1 17 ? 7.798   -10.050 3.540   1.00 0.00 ? 17 LEU B CD1  3  
ATOM 3622  C CD2  . LEU B 1 17 ? 6.129   -8.250  3.996   1.00 0.00 ? 17 LEU B CD2  3  
ATOM 3623  H H    . LEU B 1 17 ? 6.068   -8.334  0.191   1.00 0.00 ? 17 LEU B H    3  
ATOM 3624  H HA   . LEU B 1 17 ? 6.443   -6.312  2.193   1.00 0.00 ? 17 LEU B HA   3  
ATOM 3625  H HB2  . LEU B 1 17 ? 8.248   -8.570  1.308   1.00 0.00 ? 17 LEU B HB2  3  
ATOM 3626  H HB3  . LEU B 1 17 ? 8.500   -7.576  2.736   1.00 0.00 ? 17 LEU B HB3  3  
ATOM 3627  H HG   . LEU B 1 17 ? 6.201   -9.481  2.271   1.00 0.00 ? 17 LEU B HG   3  
ATOM 3628  H HD11 . LEU B 1 17 ? 7.191   -10.748 4.100   1.00 0.00 ? 17 LEU B HD11 3  
ATOM 3629  H HD12 . LEU B 1 17 ? 8.515   -9.586  4.204   1.00 0.00 ? 17 LEU B HD12 3  
ATOM 3630  H HD13 . LEU B 1 17 ? 8.325   -10.584 2.761   1.00 0.00 ? 17 LEU B HD13 3  
ATOM 3631  H HD21 . LEU B 1 17 ? 5.614   -8.964  4.625   1.00 0.00 ? 17 LEU B HD21 3  
ATOM 3632  H HD22 . LEU B 1 17 ? 5.400   -7.599  3.539   1.00 0.00 ? 17 LEU B HD22 3  
ATOM 3633  H HD23 . LEU B 1 17 ? 6.806   -7.664  4.603   1.00 0.00 ? 17 LEU B HD23 3  
ATOM 3634  N N    . VAL B 1 18 ? 8.209   -6.213  -0.543  1.00 0.00 ? 18 VAL B N    3  
ATOM 3635  C CA   . VAL B 1 18 ? 9.111   -5.386  -1.335  1.00 0.00 ? 18 VAL B CA   3  
ATOM 3636  C C    . VAL B 1 18 ? 8.475   -4.039  -1.663  1.00 0.00 ? 18 VAL B C    3  
ATOM 3637  O O    . VAL B 1 18 ? 9.136   -3.003  -1.613  1.00 0.00 ? 18 VAL B O    3  
ATOM 3638  C CB   . VAL B 1 18 ? 9.513   -6.087  -2.647  1.00 0.00 ? 18 VAL B CB   3  
ATOM 3639  C CG1  . VAL B 1 18 ? 10.476  -5.223  -3.446  1.00 0.00 ? 18 VAL B CG1  3  
ATOM 3640  C CG2  . VAL B 1 18 ? 10.124  -7.447  -2.357  1.00 0.00 ? 18 VAL B CG2  3  
ATOM 3641  H H    . VAL B 1 18 ? 7.802   -7.004  -0.963  1.00 0.00 ? 18 VAL B H    3  
ATOM 3642  H HA   . VAL B 1 18 ? 10.011  -5.213  -0.754  1.00 0.00 ? 18 VAL B HA   3  
ATOM 3643  H HB   . VAL B 1 18 ? 8.623   -6.240  -3.243  1.00 0.00 ? 18 VAL B HB   3  
ATOM 3644  H HG11 . VAL B 1 18 ? 10.848  -5.782  -4.296  1.00 0.00 ? 18 VAL B HG11 3  
ATOM 3645  H HG12 . VAL B 1 18 ? 11.310  -4.930  -2.823  1.00 0.00 ? 18 VAL B HG12 3  
ATOM 3646  H HG13 . VAL B 1 18 ? 9.968   -4.341  -3.805  1.00 0.00 ? 18 VAL B HG13 3  
ATOM 3647  H HG21 . VAL B 1 18 ? 9.436   -8.050  -1.809  1.00 0.00 ? 18 VAL B HG21 3  
ATOM 3648  H HG22 . VAL B 1 18 ? 11.027  -7.323  -1.776  1.00 0.00 ? 18 VAL B HG22 3  
ATOM 3649  H HG23 . VAL B 1 18 ? 10.365  -7.940  -3.289  1.00 0.00 ? 18 VAL B HG23 3  
ATOM 3650  N N    . VAL B 1 19 ? 7.188   -4.064  -1.998  1.00 0.00 ? 19 VAL B N    3  
ATOM 3651  C CA   . VAL B 1 19 ? 6.467   -2.844  -2.338  1.00 0.00 ? 19 VAL B CA   3  
ATOM 3652  C C    . VAL B 1 19 ? 6.181   -2.007  -1.097  1.00 0.00 ? 19 VAL B C    3  
ATOM 3653  O O    . VAL B 1 19 ? 6.047   -0.787  -1.183  1.00 0.00 ? 19 VAL B O    3  
ATOM 3654  C CB   . VAL B 1 19 ? 5.140   -3.148  -3.063  1.00 0.00 ? 19 VAL B CB   3  
ATOM 3655  C CG1  . VAL B 1 19 ? 5.398   -3.924  -4.345  1.00 0.00 ? 19 VAL B CG1  3  
ATOM 3656  C CG2  . VAL B 1 19 ? 4.188   -3.910  -2.152  1.00 0.00 ? 19 VAL B CG2  3  
ATOM 3657  H H    . VAL B 1 19 ? 6.713   -4.925  -2.025  1.00 0.00 ? 19 VAL B H    3  
ATOM 3658  H HA   . VAL B 1 19 ? 7.086   -2.258  -3.009  1.00 0.00 ? 19 VAL B HA   3  
ATOM 3659  H HB   . VAL B 1 19 ? 4.672   -2.210  -3.332  1.00 0.00 ? 19 VAL B HB   3  
ATOM 3660  H HG11 . VAL B 1 19 ? 4.459   -4.142  -4.835  1.00 0.00 ? 19 VAL B HG11 3  
ATOM 3661  H HG12 . VAL B 1 19 ? 5.907   -4.845  -4.121  1.00 0.00 ? 19 VAL B HG12 3  
ATOM 3662  H HG13 . VAL B 1 19 ? 6.012   -3.330  -5.007  1.00 0.00 ? 19 VAL B HG13 3  
ATOM 3663  H HG21 . VAL B 1 19 ? 3.962   -3.332  -1.270  1.00 0.00 ? 19 VAL B HG21 3  
ATOM 3664  H HG22 . VAL B 1 19 ? 4.641   -4.830  -1.873  1.00 0.00 ? 19 VAL B HG22 3  
ATOM 3665  H HG23 . VAL B 1 19 ? 3.268   -4.114  -2.683  1.00 0.00 ? 19 VAL B HG23 3  
ATOM 3666  N N    . LEU B 1 20 ? 6.083   -2.663  0.056   1.00 0.00 ? 20 LEU B N    3  
ATOM 3667  C CA   . LEU B 1 20 ? 5.820   -1.959  1.307   1.00 0.00 ? 20 LEU B CA   3  
ATOM 3668  C C    . LEU B 1 20 ? 7.046   -1.162  1.739   1.00 0.00 ? 20 LEU B C    3  
ATOM 3669  O O    . LEU B 1 20 ? 6.930   -0.158  2.440   1.00 0.00 ? 20 LEU B O    3  
ATOM 3670  C CB   . LEU B 1 20 ? 5.413   -2.937  2.412   1.00 0.00 ? 20 LEU B CB   3  
ATOM 3671  C CG   . LEU B 1 20 ? 5.029   -2.282  3.744   1.00 0.00 ? 20 LEU B CG   3  
ATOM 3672  C CD1  . LEU B 1 20 ? 3.811   -1.382  3.576   1.00 0.00 ? 20 LEU B CD1  3  
ATOM 3673  C CD2  . LEU B 1 20 ? 4.770   -3.345  4.801   1.00 0.00 ? 20 LEU B CD2  3  
ATOM 3674  H H    . LEU B 1 20 ? 6.192   -3.641  0.078   1.00 0.00 ? 20 LEU B H    3  
ATOM 3675  H HA   . LEU B 1 20 ? 5.005   -1.276  1.133   1.00 0.00 ? 20 LEU B HA   3  
ATOM 3676  H HB2  . LEU B 1 20 ? 4.570   -3.516  2.055   1.00 0.00 ? 20 LEU B HB2  3  
ATOM 3677  H HB3  . LEU B 1 20 ? 6.241   -3.613  2.587   1.00 0.00 ? 20 LEU B HB3  3  
ATOM 3678  H HG   . LEU B 1 20 ? 5.847   -1.669  4.090   1.00 0.00 ? 20 LEU B HG   3  
ATOM 3679  H HD11 . LEU B 1 20 ? 3.531   -0.966  4.535   1.00 0.00 ? 20 LEU B HD11 3  
ATOM 3680  H HD12 . LEU B 1 20 ? 2.985   -1.956  3.181   1.00 0.00 ? 20 LEU B HD12 3  
ATOM 3681  H HD13 . LEU B 1 20 ? 4.045   -0.576  2.898   1.00 0.00 ? 20 LEU B HD13 3  
ATOM 3682  H HD21 . LEU B 1 20 ? 3.944   -3.972  4.494   1.00 0.00 ? 20 LEU B HD21 3  
ATOM 3683  H HD22 . LEU B 1 20 ? 4.529   -2.870  5.742   1.00 0.00 ? 20 LEU B HD22 3  
ATOM 3684  H HD23 . LEU B 1 20 ? 5.654   -3.954  4.927   1.00 0.00 ? 20 LEU B HD23 3  
ATOM 3685  N N    . THR B 1 21 ? 8.221   -1.618  1.314   1.00 0.00 ? 21 THR B N    3  
ATOM 3686  C CA   . THR B 1 21 ? 9.465   -0.938  1.644   1.00 0.00 ? 21 THR B CA   3  
ATOM 3687  C C    . THR B 1 21 ? 9.715   0.203   0.668   1.00 0.00 ? 21 THR B C    3  
ATOM 3688  O O    . THR B 1 21 ? 10.231  1.255   1.042   1.00 0.00 ? 21 THR B O    3  
ATOM 3689  C CB   . THR B 1 21 ? 10.667  -1.903  1.618   1.00 0.00 ? 21 THR B CB   3  
ATOM 3690  O OG1  . THR B 1 21 ? 10.459  -2.969  2.553   1.00 0.00 ? 21 THR B OG1  3  
ATOM 3691  C CG2  . THR B 1 21 ? 11.958  -1.172  1.957   1.00 0.00 ? 21 THR B CG2  3  
ATOM 3692  H H    . THR B 1 21 ? 8.265   -2.427  0.756   1.00 0.00 ? 21 THR B H    3  
ATOM 3693  H HA   . THR B 1 21 ? 9.383   -0.529  2.646   1.00 0.00 ? 21 THR B HA   3  
ATOM 3694  H HB   . THR B 1 21 ? 10.757  -2.321  0.624   1.00 0.00 ? 21 THR B HB   3  
ATOM 3695  H HG1  . THR B 1 21 ? 10.967  -3.739  2.284   1.00 0.00 ? 21 THR B HG1  3  
ATOM 3696  H HG21 . THR B 1 21 ? 12.271  -0.574  1.114   1.00 0.00 ? 21 THR B HG21 3  
ATOM 3697  H HG22 . THR B 1 21 ? 12.727  -1.897  2.182   1.00 0.00 ? 21 THR B HG22 3  
ATOM 3698  H HG23 . THR B 1 21 ? 11.809  -0.533  2.818   1.00 0.00 ? 21 THR B HG23 3  
ATOM 3699  N N    . ILE B 1 22 ? 9.339   -0.013  -0.588  1.00 0.00 ? 22 ILE B N    3  
ATOM 3700  C CA   . ILE B 1 22 ? 9.508   0.997   -1.624  1.00 0.00 ? 22 ILE B CA   3  
ATOM 3701  C C    . ILE B 1 22 ? 8.497   2.124   -1.448  1.00 0.00 ? 22 ILE B C    3  
ATOM 3702  O O    . ILE B 1 22 ? 8.827   3.298   -1.618  1.00 0.00 ? 22 ILE B O    3  
ATOM 3703  C CB   . ILE B 1 22 ? 9.356   0.385   -3.032  1.00 0.00 ? 22 ILE B CB   3  
ATOM 3704  C CG1  . ILE B 1 22 ? 10.444  -0.666  -3.268  1.00 0.00 ? 22 ILE B CG1  3  
ATOM 3705  C CG2  . ILE B 1 22 ? 9.416   1.471   -4.098  1.00 0.00 ? 22 ILE B CG2  3  
ATOM 3706  C CD1  . ILE B 1 22 ? 10.257  -1.459  -4.543  1.00 0.00 ? 22 ILE B CD1  3  
ATOM 3707  H H    . ILE B 1 22 ? 8.929   -0.875  -0.835  1.00 0.00 ? 22 ILE B H    3  
ATOM 3708  H HA   . ILE B 1 22 ? 10.507  1.414   -1.541  1.00 0.00 ? 22 ILE B HA   3  
ATOM 3709  H HB   . ILE B 1 22 ? 8.386   -0.089  -3.090  1.00 0.00 ? 22 ILE B HB   3  
ATOM 3710  H HG12 . ILE B 1 22 ? 11.406  -0.175  -3.328  1.00 0.00 ? 22 ILE B HG12 3  
ATOM 3711  H HG13 . ILE B 1 22 ? 10.465  -1.362  -2.449  1.00 0.00 ? 22 ILE B HG13 3  
ATOM 3712  H HG21 . ILE B 1 22 ? 8.566   2.128   -4.005  1.00 0.00 ? 22 ILE B HG21 3  
ATOM 3713  H HG22 . ILE B 1 22 ? 9.397   1.026   -5.082  1.00 0.00 ? 22 ILE B HG22 3  
ATOM 3714  H HG23 . ILE B 1 22 ? 10.326  2.044   -3.985  1.00 0.00 ? 22 ILE B HG23 3  
ATOM 3715  H HD11 . ILE B 1 22 ? 10.936  -2.299  -4.544  1.00 0.00 ? 22 ILE B HD11 3  
ATOM 3716  H HD12 . ILE B 1 22 ? 10.467  -0.830  -5.395  1.00 0.00 ? 22 ILE B HD12 3  
ATOM 3717  H HD13 . ILE B 1 22 ? 9.240   -1.822  -4.604  1.00 0.00 ? 22 ILE B HD13 3  
ATOM 3718  N N    . ILE B 1 23 ? 7.267   1.758   -1.100  1.00 0.00 ? 23 ILE B N    3  
ATOM 3719  C CA   . ILE B 1 23 ? 6.207   2.738   -0.897  1.00 0.00 ? 23 ILE B CA   3  
ATOM 3720  C C    . ILE B 1 23 ? 6.566   3.687   0.245   1.00 0.00 ? 23 ILE B C    3  
ATOM 3721  O O    . ILE B 1 23 ? 6.250   4.876   0.201   1.00 0.00 ? 23 ILE B O    3  
ATOM 3722  C CB   . ILE B 1 23 ? 4.854   2.053   -0.604  1.00 0.00 ? 23 ILE B CB   3  
ATOM 3723  C CG1  . ILE B 1 23 ? 3.713   3.069   -0.684  1.00 0.00 ? 23 ILE B CG1  3  
ATOM 3724  C CG2  . ILE B 1 23 ? 4.879   1.377   0.759   1.00 0.00 ? 23 ILE B CG2  3  
ATOM 3725  C CD1  . ILE B 1 23 ? 2.338   2.444   -0.598  1.00 0.00 ? 23 ILE B CD1  3  
ATOM 3726  H H    . ILE B 1 23 ? 7.059   0.802   -0.976  1.00 0.00 ? 23 ILE B H    3  
ATOM 3727  H HA   . ILE B 1 23 ? 6.109   3.314   -1.811  1.00 0.00 ? 23 ILE B HA   3  
ATOM 3728  H HB   . ILE B 1 23 ? 4.699   1.289   -1.352  1.00 0.00 ? 23 ILE B HB   3  
ATOM 3729  H HG12 . ILE B 1 23 ? 3.804   3.780   0.125   1.00 0.00 ? 23 ILE B HG12 3  
ATOM 3730  H HG13 . ILE B 1 23 ? 3.771   3.598   -1.627  1.00 0.00 ? 23 ILE B HG13 3  
ATOM 3731  H HG21 . ILE B 1 23 ? 4.023   0.724   0.849   1.00 0.00 ? 23 ILE B HG21 3  
ATOM 3732  H HG22 . ILE B 1 23 ? 4.852   2.113   1.551   1.00 0.00 ? 23 ILE B HG22 3  
ATOM 3733  H HG23 . ILE B 1 23 ? 5.768   0.803   0.836   1.00 0.00 ? 23 ILE B HG23 3  
ATOM 3734  H HD11 . ILE B 1 23 ? 1.587   3.210   -0.727  1.00 0.00 ? 23 ILE B HD11 3  
ATOM 3735  H HD12 . ILE B 1 23 ? 2.212   1.978   0.368   1.00 0.00 ? 23 ILE B HD12 3  
ATOM 3736  H HD13 . ILE B 1 23 ? 2.229   1.700   -1.374  1.00 0.00 ? 23 ILE B HD13 3  
ATOM 3737  N N    . SER B 1 24 ? 7.227   3.148   1.268   1.00 0.00 ? 24 SER B N    3  
ATOM 3738  C CA   . SER B 1 24 ? 7.644   3.939   2.419   1.00 0.00 ? 24 SER B CA   3  
ATOM 3739  C C    . SER B 1 24 ? 8.830   4.831   2.065   1.00 0.00 ? 24 SER B C    3  
ATOM 3740  O O    . SER B 1 24 ? 8.925   5.968   2.528   1.00 0.00 ? 24 SER B O    3  
ATOM 3741  C CB   . SER B 1 24 ? 8.007   3.026   3.591   1.00 0.00 ? 24 SER B CB   3  
ATOM 3742  O OG   . SER B 1 24 ? 9.083   2.166   3.256   1.00 0.00 ? 24 SER B OG   3  
ATOM 3743  H H    . SER B 1 24 ? 7.453   2.189   1.252   1.00 0.00 ? 24 SER B H    3  
ATOM 3744  H HA   . SER B 1 24 ? 6.817   4.567   2.717   1.00 0.00 ? 24 SER B HA   3  
ATOM 3745  H HB2  . SER B 1 24 ? 8.292   3.625   4.445   1.00 0.00 ? 24 SER B HB2  3  
ATOM 3746  H HB3  . SER B 1 24 ? 7.149   2.422   3.849   1.00 0.00 ? 24 SER B HB3  3  
ATOM 3747  H HG   . SER B 1 24 ? 9.409   1.737   4.050   1.00 0.00 ? 24 SER B HG   3  
ATOM 3748  N N    . LEU B 1 25 ? 9.736   4.305   1.242   1.00 0.00 ? 25 LEU B N    3  
ATOM 3749  C CA   . LEU B 1 25 ? 10.916  5.055   0.824   1.00 0.00 ? 25 LEU B CA   3  
ATOM 3750  C C    . LEU B 1 25 ? 10.519  6.311   0.058   1.00 0.00 ? 25 LEU B C    3  
ATOM 3751  O O    . LEU B 1 25 ? 11.103  7.377   0.254   1.00 0.00 ? 25 LEU B O    3  
ATOM 3752  C CB   . LEU B 1 25 ? 11.831  4.181   -0.039  1.00 0.00 ? 25 LEU B CB   3  
ATOM 3753  C CG   . LEU B 1 25 ? 12.633  3.127   0.726   1.00 0.00 ? 25 LEU B CG   3  
ATOM 3754  C CD1  . LEU B 1 25 ? 13.378  2.218   -0.239  1.00 0.00 ? 25 LEU B CD1  3  
ATOM 3755  C CD2  . LEU B 1 25 ? 13.603  3.793   1.690   1.00 0.00 ? 25 LEU B CD2  3  
ATOM 3756  H H    . LEU B 1 25 ? 9.614   3.386   0.905   1.00 0.00 ? 25 LEU B H    3  
ATOM 3757  H HA   . LEU B 1 25 ? 11.444  5.364   1.711   1.00 0.00 ? 25 LEU B HA   3  
ATOM 3758  H HB2  . LEU B 1 25 ? 11.213  3.678   -0.772  1.00 0.00 ? 25 LEU B HB2  3  
ATOM 3759  H HB3  . LEU B 1 25 ? 12.532  4.819   -0.568  1.00 0.00 ? 25 LEU B HB3  3  
ATOM 3760  H HG   . LEU B 1 25 ? 11.965  2.524   1.306   1.00 0.00 ? 25 LEU B HG   3  
ATOM 3761  H HD11 . LEU B 1 25 ? 12.672  1.734   -0.899  1.00 0.00 ? 25 LEU B HD11 3  
ATOM 3762  H HD12 . LEU B 1 25 ? 13.919  1.464   0.317   1.00 0.00 ? 25 LEU B HD12 3  
ATOM 3763  H HD13 . LEU B 1 25 ? 14.075  2.801   -0.826  1.00 0.00 ? 25 LEU B HD13 3  
ATOM 3764  H HD21 . LEU B 1 25 ? 13.055  4.340   2.440   1.00 0.00 ? 25 LEU B HD21 3  
ATOM 3765  H HD22 . LEU B 1 25 ? 14.249  4.471   1.150   1.00 0.00 ? 25 LEU B HD22 3  
ATOM 3766  H HD23 . LEU B 1 25 ? 14.207  3.038   2.177   1.00 0.00 ? 25 LEU B HD23 3  
ATOM 3767  N N    . ILE B 1 26 ? 9.526   6.178   -0.817  1.00 0.00 ? 26 ILE B N    3  
ATOM 3768  C CA   . ILE B 1 26 ? 9.046   7.311   -1.600  1.00 0.00 ? 26 ILE B CA   3  
ATOM 3769  C C    . ILE B 1 26 ? 8.619   8.446   -0.678  1.00 0.00 ? 26 ILE B C    3  
ATOM 3770  O O    . ILE B 1 26 ? 8.866   9.618   -0.959  1.00 0.00 ? 26 ILE B O    3  
ATOM 3771  C CB   . ILE B 1 26 ? 7.860   6.915   -2.503  1.00 0.00 ? 26 ILE B CB   3  
ATOM 3772  C CG1  . ILE B 1 26 ? 8.284   5.809   -3.474  1.00 0.00 ? 26 ILE B CG1  3  
ATOM 3773  C CG2  . ILE B 1 26 ? 7.343   8.128   -3.264  1.00 0.00 ? 26 ILE B CG2  3  
ATOM 3774  C CD1  . ILE B 1 26 ? 7.142   5.243   -4.293  1.00 0.00 ? 26 ILE B CD1  3  
ATOM 3775  H H    . ILE B 1 26 ? 9.097   5.299   -0.929  1.00 0.00 ? 26 ILE B H    3  
ATOM 3776  H HA   . ILE B 1 26 ? 9.858   7.657   -2.228  1.00 0.00 ? 26 ILE B HA   3  
ATOM 3777  H HB   . ILE B 1 26 ? 7.061   6.546   -1.874  1.00 0.00 ? 26 ILE B HB   3  
ATOM 3778  H HG12 . ILE B 1 26 ? 9.013   6.205   -4.166  1.00 0.00 ? 26 ILE B HG12 3  
ATOM 3779  H HG13 . ILE B 1 26 ? 8.728   5.000   -2.939  1.00 0.00 ? 26 ILE B HG13 3  
ATOM 3780  H HG21 . ILE B 1 26 ? 6.960   8.864   -2.575  1.00 0.00 ? 26 ILE B HG21 3  
ATOM 3781  H HG22 . ILE B 1 26 ? 6.544   7.834   -3.929  1.00 0.00 ? 26 ILE B HG22 3  
ATOM 3782  H HG23 . ILE B 1 26 ? 8.145   8.563   -3.843  1.00 0.00 ? 26 ILE B HG23 3  
ATOM 3783  H HD11 . ILE B 1 26 ? 6.316   4.990   -3.643  1.00 0.00 ? 26 ILE B HD11 3  
ATOM 3784  H HD12 . ILE B 1 26 ? 7.477   4.354   -4.807  1.00 0.00 ? 26 ILE B HD12 3  
ATOM 3785  H HD13 . ILE B 1 26 ? 6.820   5.975   -5.018  1.00 0.00 ? 26 ILE B HD13 3  
ATOM 3786  N N    . ILE B 1 27 ? 7.978   8.081   0.426   1.00 0.00 ? 27 ILE B N    3  
ATOM 3787  C CA   . ILE B 1 27 ? 7.518   9.052   1.410   1.00 0.00 ? 27 ILE B CA   3  
ATOM 3788  C C    . ILE B 1 27 ? 8.701   9.696   2.126   1.00 0.00 ? 27 ILE B C    3  
ATOM 3789  O O    . ILE B 1 27 ? 8.700   10.896  2.397   1.00 0.00 ? 27 ILE B O    3  
ATOM 3790  C CB   . ILE B 1 27 ? 6.605   8.389   2.458   1.00 0.00 ? 27 ILE B CB   3  
ATOM 3791  C CG1  . ILE B 1 27 ? 5.473   7.622   1.772   1.00 0.00 ? 27 ILE B CG1  3  
ATOM 3792  C CG2  . ILE B 1 27 ? 6.049   9.436   3.412   1.00 0.00 ? 27 ILE B CG2  3  
ATOM 3793  C CD1  . ILE B 1 27 ? 4.766   6.643   2.684   1.00 0.00 ? 27 ILE B CD1  3  
ATOM 3794  H H    . ILE B 1 27 ? 7.824   7.124   0.595   1.00 0.00 ? 27 ILE B H    3  
ATOM 3795  H HA   . ILE B 1 27 ? 6.954   9.820   0.898   1.00 0.00 ? 27 ILE B HA   3  
ATOM 3796  H HB   . ILE B 1 27 ? 7.202   7.694   3.037   1.00 0.00 ? 27 ILE B HB   3  
ATOM 3797  H HG12 . ILE B 1 27 ? 4.732   8.321   1.410   1.00 0.00 ? 27 ILE B HG12 3  
ATOM 3798  H HG13 . ILE B 1 27 ? 5.847   7.062   0.937   1.00 0.00 ? 27 ILE B HG13 3  
ATOM 3799  H HG21 . ILE B 1 27 ? 5.340   8.972   4.086   1.00 0.00 ? 27 ILE B HG21 3  
ATOM 3800  H HG22 . ILE B 1 27 ? 5.548   10.213  2.852   1.00 0.00 ? 27 ILE B HG22 3  
ATOM 3801  H HG23 . ILE B 1 27 ? 6.850   9.870   3.991   1.00 0.00 ? 27 ILE B HG23 3  
ATOM 3802  H HD11 . ILE B 1 27 ? 4.063   7.177   3.305   1.00 0.00 ? 27 ILE B HD11 3  
ATOM 3803  H HD12 . ILE B 1 27 ? 5.483   6.134   3.311   1.00 0.00 ? 27 ILE B HD12 3  
ATOM 3804  H HD13 . ILE B 1 27 ? 4.235   5.917   2.087   1.00 0.00 ? 27 ILE B HD13 3  
ATOM 3805  N N    . LEU B 1 28 ? 9.705   8.879   2.431   1.00 0.00 ? 28 LEU B N    3  
ATOM 3806  C CA   . LEU B 1 28 ? 10.901  9.351   3.120   1.00 0.00 ? 28 LEU B CA   3  
ATOM 3807  C C    . LEU B 1 28 ? 11.564  10.484  2.346   1.00 0.00 ? 28 LEU B C    3  
ATOM 3808  O O    . LEU B 1 28 ? 11.775  11.574  2.877   1.00 0.00 ? 28 LEU B O    3  
ATOM 3809  C CB   . LEU B 1 28 ? 11.894  8.196   3.302   1.00 0.00 ? 28 LEU B CB   3  
ATOM 3810  C CG   . LEU B 1 28 ? 12.668  8.190   4.626   1.00 0.00 ? 28 LEU B CG   3  
ATOM 3811  C CD1  . LEU B 1 28 ? 13.374  9.519   4.851   1.00 0.00 ? 28 LEU B CD1  3  
ATOM 3812  C CD2  . LEU B 1 28 ? 11.735  7.876   5.785   1.00 0.00 ? 28 LEU B CD2  3  
ATOM 3813  H H    . LEU B 1 28 ? 9.640   7.925   2.192   1.00 0.00 ? 28 LEU B H    3  
ATOM 3814  H HA   . LEU B 1 28 ? 10.598  9.726   4.086   1.00 0.00 ? 28 LEU B HA   3  
ATOM 3815  H HB2  . LEU B 1 28 ? 11.354  7.259   3.231   1.00 0.00 ? 28 LEU B HB2  3  
ATOM 3816  H HB3  . LEU B 1 28 ? 12.619  8.214   2.499   1.00 0.00 ? 28 LEU B HB3  3  
ATOM 3817  H HG   . LEU B 1 28 ? 13.422  7.417   4.588   1.00 0.00 ? 28 LEU B HG   3  
ATOM 3818  H HD11 . LEU B 1 28 ? 13.980  9.457   5.744   1.00 0.00 ? 28 LEU B HD11 3  
ATOM 3819  H HD12 . LEU B 1 28 ? 12.646  10.310  4.969   1.00 0.00 ? 28 LEU B HD12 3  
ATOM 3820  H HD13 . LEU B 1 28 ? 14.011  9.741   4.005   1.00 0.00 ? 28 LEU B HD13 3  
ATOM 3821  H HD21 . LEU B 1 28 ? 10.990  8.652   5.880   1.00 0.00 ? 28 LEU B HD21 3  
ATOM 3822  H HD22 . LEU B 1 28 ? 12.306  7.815   6.701   1.00 0.00 ? 28 LEU B HD22 3  
ATOM 3823  H HD23 . LEU B 1 28 ? 11.245  6.928   5.610   1.00 0.00 ? 28 LEU B HD23 3  
ATOM 3824  N N    . ILE B 1 29 ? 11.886  10.217  1.084   1.00 0.00 ? 29 ILE B N    3  
ATOM 3825  C CA   . ILE B 1 29 ? 12.530  11.209  0.229   1.00 0.00 ? 29 ILE B CA   3  
ATOM 3826  C C    . ILE B 1 29 ? 11.593  12.381  -0.055  1.00 0.00 ? 29 ILE B C    3  
ATOM 3827  O O    . ILE B 1 29 ? 12.038  13.517  -0.213  1.00 0.00 ? 29 ILE B O    3  
ATOM 3828  C CB   . ILE B 1 29 ? 12.977  10.587  -1.108  1.00 0.00 ? 29 ILE B CB   3  
ATOM 3829  C CG1  . ILE B 1 29 ? 13.852  9.355   -0.857  1.00 0.00 ? 29 ILE B CG1  3  
ATOM 3830  C CG2  . ILE B 1 29 ? 13.725  11.616  -1.947  1.00 0.00 ? 29 ILE B CG2  3  
ATOM 3831  C CD1  . ILE B 1 29 ? 14.195  8.583   -2.114  1.00 0.00 ? 29 ILE B CD1  3  
ATOM 3832  H H    . ILE B 1 29 ? 11.673  9.327   0.719   1.00 0.00 ? 29 ILE B H    3  
ATOM 3833  H HA   . ILE B 1 29 ? 13.409  11.574  0.742   1.00 0.00 ? 29 ILE B HA   3  
ATOM 3834  H HB   . ILE B 1 29 ? 12.094  10.284  -1.657  1.00 0.00 ? 29 ILE B HB   3  
ATOM 3835  H HG12 . ILE B 1 29 ? 14.780  9.661   -0.398  1.00 0.00 ? 29 ILE B HG12 3  
ATOM 3836  H HG13 . ILE B 1 29 ? 13.347  8.669   -0.195  1.00 0.00 ? 29 ILE B HG13 3  
ATOM 3837  H HG21 . ILE B 1 29 ? 13.084  12.453  -2.172  1.00 0.00 ? 29 ILE B HG21 3  
ATOM 3838  H HG22 . ILE B 1 29 ? 14.043  11.169  -2.877  1.00 0.00 ? 29 ILE B HG22 3  
ATOM 3839  H HG23 . ILE B 1 29 ? 14.591  11.963  -1.407  1.00 0.00 ? 29 ILE B HG23 3  
ATOM 3840  H HD11 . ILE B 1 29 ? 14.874  9.163   -2.720  1.00 0.00 ? 29 ILE B HD11 3  
ATOM 3841  H HD12 . ILE B 1 29 ? 13.294  8.379   -2.676  1.00 0.00 ? 29 ILE B HD12 3  
ATOM 3842  H HD13 . ILE B 1 29 ? 14.666  7.650   -1.843  1.00 0.00 ? 29 ILE B HD13 3  
ATOM 3843  N N    . MET B 1 30 ? 10.296  12.095  -0.114  1.00 0.00 ? 30 MET B N    3  
ATOM 3844  C CA   . MET B 1 30 ? 9.298   13.125  -0.386  1.00 0.00 ? 30 MET B CA   3  
ATOM 3845  C C    . MET B 1 30 ? 9.357   14.235  0.659   1.00 0.00 ? 30 MET B C    3  
ATOM 3846  O O    . MET B 1 30 ? 9.355   15.418  0.321   1.00 0.00 ? 30 MET B O    3  
ATOM 3847  C CB   . MET B 1 30 ? 7.895   12.517  -0.408  1.00 0.00 ? 30 MET B CB   3  
ATOM 3848  C CG   . MET B 1 30 ? 6.843   13.445  -0.995  1.00 0.00 ? 30 MET B CG   3  
ATOM 3849  S SD   . MET B 1 30 ? 5.158   12.912  -0.630  1.00 0.00 ? 30 MET B SD   3  
ATOM 3850  C CE   . MET B 1 30 ? 5.192   11.226  -1.235  1.00 0.00 ? 30 MET B CE   3  
ATOM 3851  H H    . MET B 1 30 ? 9.993   11.167  0.018   1.00 0.00 ? 30 MET B H    3  
ATOM 3852  H HA   . MET B 1 30 ? 9.515   13.549  -1.358  1.00 0.00 ? 30 MET B HA   3  
ATOM 3853  H HB2  . MET B 1 30 ? 7.916   11.632  -1.016  1.00 0.00 ? 30 MET B HB2  3  
ATOM 3854  H HB3  . MET B 1 30 ? 7.607   12.247  0.601   1.00 0.00 ? 30 MET B HB3  3  
ATOM 3855  H HG2  . MET B 1 30 ? 6.974   14.440  -0.594  1.00 0.00 ? 30 MET B HG2  3  
ATOM 3856  H HG3  . MET B 1 30 ? 6.969   13.473  -2.067  1.00 0.00 ? 30 MET B HG3  3  
ATOM 3857  H HE1  . MET B 1 30 ? 5.435   10.559  -0.425  1.00 0.00 ? 30 MET B HE1  3  
ATOM 3858  H HE2  . MET B 1 30 ? 5.932   11.128  -2.017  1.00 0.00 ? 30 MET B HE2  3  
ATOM 3859  H HE3  . MET B 1 30 ? 4.220   10.969  -1.630  1.00 0.00 ? 30 MET B HE3  3  
ATOM 3860  N N    . LEU B 1 31 ? 9.408   13.842  1.926   1.00 0.00 ? 31 LEU B N    3  
ATOM 3861  C CA   . LEU B 1 31 ? 9.463   14.803  3.021   1.00 0.00 ? 31 LEU B CA   3  
ATOM 3862  C C    . LEU B 1 31 ? 10.889  15.302  3.238   1.00 0.00 ? 31 LEU B C    3  
ATOM 3863  O O    . LEU B 1 31 ? 11.102  16.387  3.779   1.00 0.00 ? 31 LEU B O    3  
ATOM 3864  C CB   . LEU B 1 31 ? 8.929   14.170  4.307   1.00 0.00 ? 31 LEU B CB   3  
ATOM 3865  C CG   . LEU B 1 31 ? 8.681   15.146  5.459   1.00 0.00 ? 31 LEU B CG   3  
ATOM 3866  C CD1  . LEU B 1 31 ? 7.513   16.067  5.139   1.00 0.00 ? 31 LEU B CD1  3  
ATOM 3867  C CD2  . LEU B 1 31 ? 8.425   14.386  6.752   1.00 0.00 ? 31 LEU B CD2  3  
ATOM 3868  H H    . LEU B 1 31 ? 9.408   12.878  2.137   1.00 0.00 ? 31 LEU B H    3  
ATOM 3869  H HA   . LEU B 1 31 ? 8.839   15.648  2.761   1.00 0.00 ? 31 LEU B HA   3  
ATOM 3870  H HB2  . LEU B 1 31 ? 7.997   13.667  4.075   1.00 0.00 ? 31 LEU B HB2  3  
ATOM 3871  H HB3  . LEU B 1 31 ? 9.641   13.421  4.636   1.00 0.00 ? 31 LEU B HB3  3  
ATOM 3872  H HG   . LEU B 1 31 ? 9.558   15.760  5.604   1.00 0.00 ? 31 LEU B HG   3  
ATOM 3873  H HD11 . LEU B 1 31 ? 7.338   16.734  5.973   1.00 0.00 ? 31 LEU B HD11 3  
ATOM 3874  H HD12 . LEU B 1 31 ? 6.623   15.480  4.959   1.00 0.00 ? 31 LEU B HD12 3  
ATOM 3875  H HD13 . LEU B 1 31 ? 7.740   16.652  4.261   1.00 0.00 ? 31 LEU B HD13 3  
ATOM 3876  H HD21 . LEU B 1 31 ? 9.276   13.757  6.977   1.00 0.00 ? 31 LEU B HD21 3  
ATOM 3877  H HD22 . LEU B 1 31 ? 7.542   13.770  6.646   1.00 0.00 ? 31 LEU B HD22 3  
ATOM 3878  H HD23 . LEU B 1 31 ? 8.277   15.087  7.562   1.00 0.00 ? 31 LEU B HD23 3  
ATOM 3879  N N    . TRP B 1 32 ? 11.862  14.500  2.814   1.00 0.00 ? 32 TRP B N    3  
ATOM 3880  C CA   . TRP B 1 32 ? 13.269  14.860  2.959   1.00 0.00 ? 32 TRP B CA   3  
ATOM 3881  C C    . TRP B 1 32 ? 13.608  16.079  2.106   1.00 0.00 ? 32 TRP B C    3  
ATOM 3882  O O    . TRP B 1 32 ? 14.421  16.916  2.499   1.00 0.00 ? 32 TRP B O    3  
ATOM 3883  C CB   . TRP B 1 32 ? 14.162  13.678  2.571   1.00 0.00 ? 32 TRP B CB   3  
ATOM 3884  C CG   . TRP B 1 32 ? 15.627  13.970  2.694   1.00 0.00 ? 32 TRP B CG   3  
ATOM 3885  C CD1  . TRP B 1 32 ? 16.304  14.307  3.832   1.00 0.00 ? 32 TRP B CD1  3  
ATOM 3886  C CD2  . TRP B 1 32 ? 16.598  13.945  1.641   1.00 0.00 ? 32 TRP B CD2  3  
ATOM 3887  N NE1  . TRP B 1 32 ? 17.636  14.499  3.547   1.00 0.00 ? 32 TRP B NE1  3  
ATOM 3888  C CE2  . TRP B 1 32 ? 17.840  14.280  2.210   1.00 0.00 ? 32 TRP B CE2  3  
ATOM 3889  C CE3  . TRP B 1 32 ? 16.536  13.671  0.271   1.00 0.00 ? 32 TRP B CE3  3  
ATOM 3890  C CZ2  . TRP B 1 32 ? 19.010  14.351  1.457   1.00 0.00 ? 32 TRP B CZ2  3  
ATOM 3891  C CZ3  . TRP B 1 32 ? 17.697  13.741  -0.475  1.00 0.00 ? 32 TRP B CZ3  3  
ATOM 3892  C CH2  . TRP B 1 32 ? 18.920  14.077  0.119   1.00 0.00 ? 32 TRP B CH2  3  
ATOM 3893  H H    . TRP B 1 32 ? 11.639  13.640  2.394   1.00 0.00 ? 32 TRP B H    3  
ATOM 3894  H HA   . TRP B 1 32 ? 13.450  15.104  3.998   1.00 0.00 ? 32 TRP B HA   3  
ATOM 3895  H HB2  . TRP B 1 32 ? 13.935  12.839  3.211   1.00 0.00 ? 32 TRP B HB2  3  
ATOM 3896  H HB3  . TRP B 1 32 ? 13.956  13.409  1.547   1.00 0.00 ? 32 TRP B HB3  3  
ATOM 3897  H HD1  . TRP B 1 32 ? 15.846  14.410  4.805   1.00 0.00 ? 32 TRP B HD1  3  
ATOM 3898  H HE1  . TRP B 1 32 ? 18.327  14.749  4.196   1.00 0.00 ? 32 TRP B HE1  3  
ATOM 3899  H HE3  . TRP B 1 32 ? 15.605  13.411  -0.202  1.00 0.00 ? 32 TRP B HE3  3  
ATOM 3900  H HZ2  . TRP B 1 32 ? 19.961  14.608  1.900   1.00 0.00 ? 32 TRP B HZ2  3  
ATOM 3901  H HZ3  . TRP B 1 32 ? 17.668  13.532  -1.534  1.00 0.00 ? 32 TRP B HZ3  3  
ATOM 3902  H HH2  . TRP B 1 32 ? 19.802  14.120  -0.503  1.00 0.00 ? 32 TRP B HH2  3  
ATOM 3903  N N    . GLN B 1 33 ? 12.979  16.173  0.939   1.00 0.00 ? 33 GLN B N    3  
ATOM 3904  C CA   . GLN B 1 33 ? 13.213  17.292  0.033   1.00 0.00 ? 33 GLN B CA   3  
ATOM 3905  C C    . GLN B 1 33 ? 12.092  18.323  0.141   1.00 0.00 ? 33 GLN B C    3  
ATOM 3906  O O    . GLN B 1 33 ? 12.008  19.248  -0.667  1.00 0.00 ? 33 GLN B O    3  
ATOM 3907  C CB   . GLN B 1 33 ? 13.329  16.797  -1.411  1.00 0.00 ? 33 GLN B CB   3  
ATOM 3908  C CG   . GLN B 1 33 ? 14.500  15.856  -1.643  1.00 0.00 ? 33 GLN B CG   3  
ATOM 3909  C CD   . GLN B 1 33 ? 14.638  15.436  -3.095  1.00 0.00 ? 33 GLN B CD   3  
ATOM 3910  O OE1  . GLN B 1 33 ? 15.741  15.181  -3.576  1.00 0.00 ? 33 GLN B OE1  3  
ATOM 3911  N NE2  . GLN B 1 33 ? 13.515  15.359  -3.802  1.00 0.00 ? 33 GLN B NE2  3  
ATOM 3912  H H    . GLN B 1 33 ? 12.336  15.478  0.668   1.00 0.00 ? 33 GLN B H    3  
ATOM 3913  H HA   . GLN B 1 33 ? 14.145  17.778  0.300   1.00 0.00 ? 33 GLN B HA   3  
ATOM 3914  H HB2  . GLN B 1 33 ? 12.418  16.275  -1.655  1.00 0.00 ? 33 GLN B HB2  3  
ATOM 3915  H HB3  . GLN B 1 33 ? 13.439  17.649  -2.072  1.00 0.00 ? 33 GLN B HB3  3  
ATOM 3916  H HG2  . GLN B 1 33 ? 15.411  16.351  -1.341  1.00 0.00 ? 33 GLN B HG2  3  
ATOM 3917  H HG3  . GLN B 1 33 ? 14.355  14.973  -1.041  1.00 0.00 ? 33 GLN B HG3  3  
ATOM 3918  H HE21 . GLN B 1 33 ? 12.652  15.556  -3.393  1.00 0.00 ? 33 GLN B HE21 3  
ATOM 3919  H HE22 . GLN B 1 33 ? 13.601  15.097  -4.742  1.00 0.00 ? 33 GLN B HE22 3  
ATOM 3920  N N    . LYS B 1 34 ? 11.234  18.159  1.144   1.00 0.00 ? 34 LYS B N    3  
ATOM 3921  C CA   . LYS B 1 34 ? 10.120  19.079  1.356   1.00 0.00 ? 34 LYS B CA   3  
ATOM 3922  C C    . LYS B 1 34 ? 9.942   19.389  2.840   1.00 0.00 ? 34 LYS B C    3  
ATOM 3923  O O    . LYS B 1 34 ? 9.437   18.564  3.602   1.00 0.00 ? 34 LYS B O    3  
ATOM 3924  C CB   . LYS B 1 34 ? 8.828   18.488  0.784   1.00 0.00 ? 34 LYS B CB   3  
ATOM 3925  C CG   . LYS B 1 34 ? 8.854   18.306  -0.727  1.00 0.00 ? 34 LYS B CG   3  
ATOM 3926  C CD   . LYS B 1 34 ? 8.906   19.643  -1.452  1.00 0.00 ? 34 LYS B CD   3  
ATOM 3927  C CE   . LYS B 1 34 ? 9.032   19.458  -2.955  1.00 0.00 ? 34 LYS B CE   3  
ATOM 3928  N NZ   . LYS B 1 34 ? 7.907   18.658  -3.515  1.00 0.00 ? 34 LYS B NZ   3  
ATOM 3929  H H    . LYS B 1 34 ? 11.332  17.418  1.761   1.00 0.00 ? 34 LYS B H    3  
ATOM 3930  H HA   . LYS B 1 34 ? 10.332  20.009  0.846   1.00 0.00 ? 34 LYS B HA   3  
ATOM 3931  H HB2  . LYS B 1 34 ? 8.657   17.526  1.239   1.00 0.00 ? 34 LYS B HB2  3  
ATOM 3932  H HB3  . LYS B 1 34 ? 7.998   19.140  1.031   1.00 0.00 ? 34 LYS B HB3  3  
ATOM 3933  H HG2  . LYS B 1 34 ? 9.717   17.717  -0.999  1.00 0.00 ? 34 LYS B HG2  3  
ATOM 3934  H HG3  . LYS B 1 34 ? 7.956   17.783  -1.025  1.00 0.00 ? 34 LYS B HG3  3  
ATOM 3935  H HD2  . LYS B 1 34 ? 7.999   20.190  -1.245  1.00 0.00 ? 34 LYS B HD2  3  
ATOM 3936  H HD3  . LYS B 1 34 ? 9.756   20.211  -1.107  1.00 0.00 ? 34 LYS B HD3  3  
ATOM 3937  H HE2  . LYS B 1 34 ? 9.037   20.431  -3.424  1.00 0.00 ? 34 LYS B HE2  3  
ATOM 3938  H HE3  . LYS B 1 34 ? 9.963   18.953  -3.168  1.00 0.00 ? 34 LYS B HE3  3  
ATOM 3939  H HZ1  . LYS B 1 34 ? 7.991   17.663  -3.226  1.00 0.00 ? 34 LYS B HZ1  3  
ATOM 3940  H HZ2  . LYS B 1 34 ? 7.927   18.702  -4.554  1.00 0.00 ? 34 LYS B HZ2  3  
ATOM 3941  H HZ3  . LYS B 1 34 ? 6.990   19.030  -3.186  1.00 0.00 ? 34 LYS B HZ3  3  
ATOM 3942  N N    . LYS B 1 35 ? 10.363  20.585  3.241   1.00 0.00 ? 35 LYS B N    3  
ATOM 3943  C CA   . LYS B 1 35 ? 10.258  21.014  4.632   1.00 0.00 ? 35 LYS B CA   3  
ATOM 3944  C C    . LYS B 1 35 ? 9.188   22.098  4.789   1.00 0.00 ? 35 LYS B C    3  
ATOM 3945  O O    . LYS B 1 35 ? 9.308   23.178  4.210   1.00 0.00 ? 35 LYS B O    3  
ATOM 3946  C CB   . LYS B 1 35 ? 11.611  21.544  5.117   1.00 0.00 ? 35 LYS B CB   3  
ATOM 3947  C CG   . LYS B 1 35 ? 11.602  22.027  6.559   1.00 0.00 ? 35 LYS B CG   3  
ATOM 3948  C CD   . LYS B 1 35 ? 12.946  22.617  6.960   1.00 0.00 ? 35 LYS B CD   3  
ATOM 3949  C CE   . LYS B 1 35 ? 13.223  23.926  6.235   1.00 0.00 ? 35 LYS B CE   3  
ATOM 3950  N NZ   . LYS B 1 35 ? 14.555  24.487  6.590   1.00 0.00 ? 35 LYS B NZ   3  
ATOM 3951  H H    . LYS B 1 35 ? 10.759  21.207  2.587   1.00 0.00 ? 35 LYS B H    3  
ATOM 3952  H HA   . LYS B 1 35 ? 10.009  20.157  5.236   1.00 0.00 ? 35 LYS B HA   3  
ATOM 3953  H HB2  . LYS B 1 35 ? 12.342  20.752  5.029   1.00 0.00 ? 35 LYS B HB2  3  
ATOM 3954  H HB3  . LYS B 1 35 ? 11.900  22.359  4.474   1.00 0.00 ? 35 LYS B HB3  3  
ATOM 3955  H HG2  . LYS B 1 35 ? 10.839  22.781  6.687   1.00 0.00 ? 35 LYS B HG2  3  
ATOM 3956  H HG3  . LYS B 1 35 ? 11.387  21.187  7.203   1.00 0.00 ? 35 LYS B HG3  3  
ATOM 3957  H HD2  . LYS B 1 35 ? 12.938  22.806  8.023   1.00 0.00 ? 35 LYS B HD2  3  
ATOM 3958  H HD3  . LYS B 1 35 ? 13.733  21.911  6.727   1.00 0.00 ? 35 LYS B HD3  3  
ATOM 3959  H HE2  . LYS B 1 35 ? 13.201  23.760  5.170   1.00 0.00 ? 35 LYS B HE2  3  
ATOM 3960  H HE3  . LYS B 1 35 ? 12.460  24.643  6.503   1.00 0.00 ? 35 LYS B HE3  3  
ATOM 3961  H HZ1  . LYS B 1 35 ? 15.310  23.818  6.332   1.00 0.00 ? 35 LYS B HZ1  3  
ATOM 3962  H HZ2  . LYS B 1 35 ? 14.608  24.676  7.612   1.00 0.00 ? 35 LYS B HZ2  3  
ATOM 3963  H HZ3  . LYS B 1 35 ? 14.711  25.379  6.079   1.00 0.00 ? 35 LYS B HZ3  3  
ATOM 3964  N N    . PRO B 1 36 ? 8.122   21.830  5.573   1.00 0.00 ? 36 PRO B N    3  
ATOM 3965  C CA   . PRO B 1 36 ? 7.044   22.801  5.786   1.00 0.00 ? 36 PRO B CA   3  
ATOM 3966  C C    . PRO B 1 36 ? 7.475   23.963  6.676   1.00 0.00 ? 36 PRO B C    3  
ATOM 3967  O O    . PRO B 1 36 ? 7.968   23.759  7.786   1.00 0.00 ? 36 PRO B O    3  
ATOM 3968  C CB   . PRO B 1 36 ? 5.954   21.976  6.473   1.00 0.00 ? 36 PRO B CB   3  
ATOM 3969  C CG   . PRO B 1 36 ? 6.688   20.882  7.166   1.00 0.00 ? 36 PRO B CG   3  
ATOM 3970  C CD   . PRO B 1 36 ? 7.880   20.567  6.303   1.00 0.00 ? 36 PRO B CD   3  
ATOM 3971  H HA   . PRO B 1 36 ? 6.665   23.177  4.844   1.00 0.00 ? 36 PRO B HA   3  
ATOM 3972  H HB2  . PRO B 1 36 ? 5.393   22.584  7.172   1.00 0.00 ? 36 PRO B HB2  3  
ATOM 3973  H HB3  . PRO B 1 36 ? 5.284   21.579  5.726   1.00 0.00 ? 36 PRO B HB3  3  
ATOM 3974  H HG2  . PRO B 1 36 ? 7.010   21.216  8.141   1.00 0.00 ? 36 PRO B HG2  3  
ATOM 3975  H HG3  . PRO B 1 36 ? 6.052   20.014  7.257   1.00 0.00 ? 36 PRO B HG3  3  
ATOM 3976  H HD2  . PRO B 1 36 ? 8.727   20.309  6.921   1.00 0.00 ? 36 PRO B HD2  3  
ATOM 3977  H HD3  . PRO B 1 36 ? 7.650   19.763  5.619   1.00 0.00 ? 36 PRO B HD3  3  
ATOM 3978  N N    . ARG B 1 37 ? 7.284   25.182  6.179   1.00 0.00 ? 37 ARG B N    3  
ATOM 3979  C CA   . ARG B 1 37 ? 7.647   26.383  6.926   1.00 0.00 ? 37 ARG B CA   3  
ATOM 3980  C C    . ARG B 1 37 ? 6.963   26.400  8.289   1.00 0.00 ? 37 ARG B C    3  
ATOM 3981  O O    . ARG B 1 37 ? 5.876   25.847  8.457   1.00 0.00 ? 37 ARG B O    3  
ATOM 3982  C CB   . ARG B 1 37 ? 7.279   27.644  6.134   1.00 0.00 ? 37 ARG B CB   3  
ATOM 3983  C CG   . ARG B 1 37 ? 5.781   27.854  5.951   1.00 0.00 ? 37 ARG B CG   3  
ATOM 3984  C CD   . ARG B 1 37 ? 5.196   26.896  4.923   1.00 0.00 ? 37 ARG B CD   3  
ATOM 3985  N NE   . ARG B 1 37 ? 3.759   27.090  4.747   1.00 0.00 ? 37 ARG B NE   3  
ATOM 3986  C CZ   . ARG B 1 37 ? 2.961   26.200  4.165   1.00 0.00 ? 37 ARG B CZ   3  
ATOM 3987  N NH1  . ARG B 1 37 ? 3.458   25.060  3.707   1.00 0.00 ? 37 ARG B NH1  3  
ATOM 3988  N NH2  . ARG B 1 37 ? 1.664   26.451  4.041   1.00 0.00 ? 37 ARG B NH2  3  
ATOM 3989  H H    . ARG B 1 37 ? 6.921   25.264  5.280   1.00 0.00 ? 37 ARG B H    3  
ATOM 3990  H HA   . ARG B 1 37 ? 8.719   26.367  7.073   1.00 0.00 ? 37 ARG B HA   3  
ATOM 3991  H HB2  . ARG B 1 37 ? 7.674   28.504  6.656   1.00 0.00 ? 37 ARG B HB2  3  
ATOM 3992  H HB3  . ARG B 1 37 ? 7.744   27.590  5.158   1.00 0.00 ? 37 ARG B HB3  3  
ATOM 3993  H HG2  . ARG B 1 37 ? 5.266   27.719  6.888   1.00 0.00 ? 37 ARG B HG2  3  
ATOM 3994  H HG3  . ARG B 1 37 ? 5.620   28.865  5.605   1.00 0.00 ? 37 ARG B HG3  3  
ATOM 3995  H HD2  . ARG B 1 37 ? 5.692   27.035  3.975   1.00 0.00 ? 37 ARG B HD2  3  
ATOM 3996  H HD3  . ARG B 1 37 ? 5.347   25.896  5.270   1.00 0.00 ? 37 ARG B HD3  3  
ATOM 3997  H HE   . ARG B 1 37 ? 3.364   27.932  5.075   1.00 0.00 ? 37 ARG B HE   3  
ATOM 3998  H HH11 . ARG B 1 37 ? 4.428   24.844  3.782   1.00 0.00 ? 37 ARG B HH11 3  
ATOM 3999  H HH12 . ARG B 1 37 ? 2.847   24.394  3.273   1.00 0.00 ? 37 ARG B HH12 3  
ATOM 4000  H HH21 . ARG B 1 37 ? 1.282   27.311  4.385   1.00 0.00 ? 37 ARG B HH21 3  
ATOM 4001  H HH22 . ARG B 1 37 ? 1.061   25.782  3.602   1.00 0.00 ? 37 ARG B HH22 3  
ATOM 4002  N N    . TYR B 1 38 ? 7.609   27.036  9.261   1.00 0.00 ? 38 TYR B N    3  
ATOM 4003  C CA   . TYR B 1 38 ? 7.069   27.123  10.615  1.00 0.00 ? 38 TYR B CA   3  
ATOM 4004  C C    . TYR B 1 38 ? 6.645   28.549  10.944  1.00 0.00 ? 38 TYR B C    3  
ATOM 4005  O O    . TYR B 1 38 ? 7.421   29.493  10.780  1.00 0.00 ? 38 TYR B O    3  
ATOM 4006  C CB   . TYR B 1 38 ? 8.113   26.639  11.626  1.00 0.00 ? 38 TYR B CB   3  
ATOM 4007  C CG   . TYR B 1 38 ? 7.611   26.596  13.054  1.00 0.00 ? 38 TYR B CG   3  
ATOM 4008  C CD1  . TYR B 1 38 ? 6.874   25.514  13.520  1.00 0.00 ? 38 TYR B CD1  3  
ATOM 4009  C CD2  . TYR B 1 38 ? 7.881   27.635  13.937  1.00 0.00 ? 38 TYR B CD2  3  
ATOM 4010  C CE1  . TYR B 1 38 ? 6.421   25.469  14.825  1.00 0.00 ? 38 TYR B CE1  3  
ATOM 4011  C CE2  . TYR B 1 38 ? 7.429   27.596  15.244  1.00 0.00 ? 38 TYR B CE2  3  
ATOM 4012  C CZ   . TYR B 1 38 ? 6.701   26.512  15.682  1.00 0.00 ? 38 TYR B CZ   3  
ATOM 4013  O OH   . TYR B 1 38 ? 6.252   26.470  16.982  1.00 0.00 ? 38 TYR B OH   3  
ATOM 4014  H H    . TYR B 1 38 ? 8.477   27.462  9.071   1.00 0.00 ? 38 TYR B H    3  
ATOM 4015  H HA   . TYR B 1 38 ? 6.203   26.474  10.691  1.00 0.00 ? 38 TYR B HA   3  
ATOM 4016  H HB2  . TYR B 1 38 ? 8.424   25.640  11.349  1.00 0.00 ? 38 TYR B HB2  3  
ATOM 4017  H HB3  . TYR B 1 38 ? 8.976   27.293  11.584  1.00 0.00 ? 38 TYR B HB3  3  
ATOM 4018  H HD1  . TYR B 1 38 ? 6.653   24.695  12.849  1.00 0.00 ? 38 TYR B HD1  3  
ATOM 4019  H HD2  . TYR B 1 38 ? 8.452   28.487  13.594  1.00 0.00 ? 38 TYR B HD2  3  
ATOM 4020  H HE1  . TYR B 1 38 ? 5.850   24.619  15.168  1.00 0.00 ? 38 TYR B HE1  3  
ATOM 4021  H HE2  . TYR B 1 38 ? 7.648   28.413  15.915  1.00 0.00 ? 38 TYR B HE2  3  
ATOM 4022  H HH   . TYR B 1 38 ? 6.890   26.003  17.526  1.00 0.00 ? 38 TYR B HH   3  
ATOM 4023  N N    . GLU B 1 39 ? 5.408   28.702  11.406  1.00 0.00 ? 39 GLU B N    3  
ATOM 4024  C CA   . GLU B 1 39 ? 4.879   30.016  11.760  1.00 0.00 ? 39 GLU B CA   3  
ATOM 4025  C C    . GLU B 1 39 ? 4.137   29.962  13.092  1.00 0.00 ? 39 GLU B C    3  
ATOM 4026  O O    . GLU B 1 39 ? 4.441   30.795  13.974  1.00 0.00 ? 39 GLU B O    3  
ATOM 4027  C CB   . GLU B 1 39 ? 3.944   30.527  10.661  1.00 0.00 ? 39 GLU B CB   3  
ATOM 4028  C CG   . GLU B 1 39 ? 4.657   30.858  9.360   1.00 0.00 ? 39 GLU B CG   3  
ATOM 4029  C CD   . GLU B 1 39 ? 3.702   31.308  8.272   1.00 0.00 ? 39 GLU B CD   3  
ATOM 4030  O OE1  . GLU B 1 39 ? 3.026   32.339  8.464   1.00 0.00 ? 39 GLU B OE1  3  
ATOM 4031  O OE2  . GLU B 1 39 ? 3.631   30.628  7.227   1.00 0.00 ? 39 GLU B OE2  3  
ATOM 4032  O OXT  . GLU B 1 39 ? 3.255   29.089  13.246  1.00 0.00 ? 39 GLU B OXT  3  
ATOM 4033  H H    . GLU B 1 39 ? 4.825   27.914  11.513  1.00 0.00 ? 39 GLU B H    3  
ATOM 4034  H HA   . GLU B 1 39 ? 5.702   30.714  11.868  1.00 0.00 ? 39 GLU B HA   3  
ATOM 4035  H HB2  . GLU B 1 39 ? 3.201   29.768  10.460  1.00 0.00 ? 39 GLU B HB2  3  
ATOM 4036  H HB3  . GLU B 1 39 ? 3.444   31.425  11.006  1.00 0.00 ? 39 GLU B HB3  3  
ATOM 4037  H HG2  . GLU B 1 39 ? 5.366   31.651  9.545   1.00 0.00 ? 39 GLU B HG2  3  
ATOM 4038  H HG3  . GLU B 1 39 ? 5.184   29.978  9.018   1.00 0.00 ? 39 GLU B HG3  3  
ATOM 4039  N N    . GLY A 1 1  ? 14.490  -27.202 7.318   1.00 0.00 ? 1  GLY A N    4  
ATOM 4040  C CA   . GLY A 1 1  ? 14.071  -28.626 7.427   1.00 0.00 ? 1  GLY A CA   4  
ATOM 4041  C C    . GLY A 1 1  ? 13.019  -29.002 6.400   1.00 0.00 ? 1  GLY A C    4  
ATOM 4042  O O    . GLY A 1 1  ? 13.165  -29.995 5.687   1.00 0.00 ? 1  GLY A O    4  
ATOM 4043  H H1   . GLY A 1 1  ? 13.705  -26.573 7.576   1.00 0.00 ? 1  GLY A H1   4  
ATOM 4044  H H2   . GLY A 1 1  ? 14.791  -26.982 6.345   1.00 0.00 ? 1  GLY A H2   4  
ATOM 4045  H H3   . GLY A 1 1  ? 15.287  -27.019 7.961   1.00 0.00 ? 1  GLY A H3   4  
ATOM 4046  H HA2  . GLY A 1 1  ? 14.937  -29.256 7.286   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 4047  H HA3  . GLY A 1 1  ? 13.671  -28.797 8.415   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 4048  N N    . HIS A 1 2  ? 11.956  -28.207 6.328   1.00 0.00 ? 2  HIS A N    4  
ATOM 4049  C CA   . HIS A 1 2  ? 10.872  -28.458 5.383   1.00 0.00 ? 2  HIS A CA   4  
ATOM 4050  C C    . HIS A 1 2  ? 10.152  -27.161 5.025   1.00 0.00 ? 2  HIS A C    4  
ATOM 4051  O O    . HIS A 1 2  ? 10.489  -26.093 5.536   1.00 0.00 ? 2  HIS A O    4  
ATOM 4052  C CB   . HIS A 1 2  ? 9.878   -29.463 5.968   1.00 0.00 ? 2  HIS A CB   4  
ATOM 4053  C CG   . HIS A 1 2  ? 9.336   -29.059 7.305   1.00 0.00 ? 2  HIS A CG   4  
ATOM 4054  N ND1  . HIS A 1 2  ? 9.879   -29.490 8.499   1.00 0.00 ? 2  HIS A ND1  4  
ATOM 4055  C CD2  . HIS A 1 2  ? 8.293   -28.262 7.635   1.00 0.00 ? 2  HIS A CD2  4  
ATOM 4056  C CE1  . HIS A 1 2  ? 9.192   -28.975 9.504   1.00 0.00 ? 2  HIS A CE1  4  
ATOM 4057  N NE2  . HIS A 1 2  ? 8.226   -28.225 9.006   1.00 0.00 ? 2  HIS A NE2  4  
ATOM 4058  H H    . HIS A 1 2  ? 11.890  -27.430 6.931   1.00 0.00 ? 2  HIS A H    4  
ATOM 4059  H HA   . HIS A 1 2  ? 11.293  -28.872 4.475   1.00 0.00 ? 2  HIS A HA   4  
ATOM 4060  H HB2  . HIS A 1 2  ? 9.044   -29.594 5.295   1.00 0.00 ? 2  HIS A HB2  4  
ATOM 4061  H HB3  . HIS A 1 2  ? 10.378  -30.412 6.092   1.00 0.00 ? 2  HIS A HB3  4  
ATOM 4062  H HD1  . HIS A 1 2  ? 10.652  -30.085 8.595   1.00 0.00 ? 2  HIS A HD1  4  
ATOM 4063  H HD2  . HIS A 1 2  ? 7.638   -27.756 6.955   1.00 0.00 ? 2  HIS A HD2  4  
ATOM 4064  H HE1  . HIS A 1 2  ? 9.388   -29.138 10.553  1.00 0.00 ? 2  HIS A HE1  4  
ATOM 4065  H HE2  . HIS A 1 2  ? 7.623   -27.659 9.531   1.00 0.00 ? 2  HIS A HE2  4  
ATOM 4066  N N    . SER A 1 3  ? 9.159   -27.259 4.145   1.00 0.00 ? 3  SER A N    4  
ATOM 4067  C CA   . SER A 1 3  ? 8.394   -26.093 3.721   1.00 0.00 ? 3  SER A CA   4  
ATOM 4068  C C    . SER A 1 3  ? 7.191   -25.865 4.633   1.00 0.00 ? 3  SER A C    4  
ATOM 4069  O O    . SER A 1 3  ? 6.616   -26.812 5.167   1.00 0.00 ? 3  SER A O    4  
ATOM 4070  C CB   . SER A 1 3  ? 7.925   -26.261 2.274   1.00 0.00 ? 3  SER A CB   4  
ATOM 4071  O OG   . SER A 1 3  ? 7.113   -27.413 2.131   1.00 0.00 ? 3  SER A OG   4  
ATOM 4072  H H    . SER A 1 3  ? 8.930   -28.139 3.765   1.00 0.00 ? 3  SER A H    4  
ATOM 4073  H HA   . SER A 1 3  ? 9.038   -25.221 3.769   1.00 0.00 ? 3  SER A HA   4  
ATOM 4074  H HB2  . SER A 1 3  ? 7.356   -25.393 1.971   1.00 0.00 ? 3  SER A HB2  4  
ATOM 4075  H HB3  . SER A 1 3  ? 8.787   -26.364 1.632   1.00 0.00 ? 3  SER A HB3  4  
ATOM 4076  H HG   . SER A 1 3  ? 6.753   -27.443 1.241   1.00 0.00 ? 3  SER A HG   4  
ATOM 4077  N N    . LEU A 1 4  ? 6.818   -24.600 4.806   1.00 0.00 ? 4  LEU A N    4  
ATOM 4078  C CA   . LEU A 1 4  ? 5.686   -24.245 5.654   1.00 0.00 ? 4  LEU A CA   4  
ATOM 4079  C C    . LEU A 1 4  ? 4.376   -24.338 4.872   1.00 0.00 ? 4  LEU A C    4  
ATOM 4080  O O    . LEU A 1 4  ? 4.356   -24.127 3.659   1.00 0.00 ? 4  LEU A O    4  
ATOM 4081  C CB   . LEU A 1 4  ? 5.864   -22.829 6.209   1.00 0.00 ? 4  LEU A CB   4  
ATOM 4082  C CG   . LEU A 1 4  ? 7.140   -22.604 7.025   1.00 0.00 ? 4  LEU A CG   4  
ATOM 4083  C CD1  . LEU A 1 4  ? 7.252   -21.149 7.449   1.00 0.00 ? 4  LEU A CD1  4  
ATOM 4084  C CD2  . LEU A 1 4  ? 7.165   -23.517 8.243   1.00 0.00 ? 4  LEU A CD2  4  
ATOM 4085  H H    . LEU A 1 4  ? 7.317   -23.882 4.348   1.00 0.00 ? 4  LEU A H    4  
ATOM 4086  H HA   . LEU A 1 4  ? 5.667   -24.940 6.475   1.00 0.00 ? 4  LEU A HA   4  
ATOM 4087  H HB2  . LEU A 1 4  ? 5.870   -22.139 5.372   1.00 0.00 ? 4  LEU A HB2  4  
ATOM 4088  H HB3  . LEU A 1 4  ? 5.012   -22.597 6.838   1.00 0.00 ? 4  LEU A HB3  4  
ATOM 4089  H HG   . LEU A 1 4  ? 7.998   -22.839 6.412   1.00 0.00 ? 4  LEU A HG   4  
ATOM 4090  H HD11 . LEU A 1 4  ? 7.260   -20.516 6.573   1.00 0.00 ? 4  LEU A HD11 4  
ATOM 4091  H HD12 . LEU A 1 4  ? 8.170   -21.001 8.001   1.00 0.00 ? 4  LEU A HD12 4  
ATOM 4092  H HD13 . LEU A 1 4  ? 6.410   -20.884 8.075   1.00 0.00 ? 4  LEU A HD13 4  
ATOM 4093  H HD21 . LEU A 1 4  ? 8.047   -23.310 8.835   1.00 0.00 ? 4  LEU A HD21 4  
ATOM 4094  H HD22 . LEU A 1 4  ? 7.191   -24.548 7.926   1.00 0.00 ? 4  LEU A HD22 4  
ATOM 4095  H HD23 . LEU A 1 4  ? 6.283   -23.347 8.845   1.00 0.00 ? 4  LEU A HD23 4  
ATOM 4096  N N    . PRO A 1 5  ? 3.259   -24.656 5.555   1.00 0.00 ? 5  PRO A N    4  
ATOM 4097  C CA   . PRO A 1 5  ? 1.944   -24.776 4.912   1.00 0.00 ? 5  PRO A CA   4  
ATOM 4098  C C    . PRO A 1 5  ? 1.494   -23.468 4.267   1.00 0.00 ? 5  PRO A C    4  
ATOM 4099  O O    . PRO A 1 5  ? 2.060   -22.407 4.529   1.00 0.00 ? 5  PRO A O    4  
ATOM 4100  C CB   . PRO A 1 5  ? 1.003   -25.156 6.062   1.00 0.00 ? 5  PRO A CB   4  
ATOM 4101  C CG   . PRO A 1 5  ? 1.892   -25.676 7.139   1.00 0.00 ? 5  PRO A CG   4  
ATOM 4102  C CD   . PRO A 1 5  ? 3.185   -24.924 7.003   1.00 0.00 ? 5  PRO A CD   4  
ATOM 4103  H HA   . PRO A 1 5  ? 1.942   -25.560 4.168   1.00 0.00 ? 5  PRO A HA   4  
ATOM 4104  H HB2  . PRO A 1 5  ? 0.446   -24.292 6.405   1.00 0.00 ? 5  PRO A HB2  4  
ATOM 4105  H HB3  . PRO A 1 5  ? 0.316   -25.917 5.726   1.00 0.00 ? 5  PRO A HB3  4  
ATOM 4106  H HG2  . PRO A 1 5  ? 1.448   -25.488 8.105   1.00 0.00 ? 5  PRO A HG2  4  
ATOM 4107  H HG3  . PRO A 1 5  ? 2.057   -26.734 7.000   1.00 0.00 ? 5  PRO A HG3  4  
ATOM 4108  H HD2  . PRO A 1 5  ? 3.150   -24.004 7.569   1.00 0.00 ? 5  PRO A HD2  4  
ATOM 4109  H HD3  . PRO A 1 5  ? 4.000   -25.545 7.333   1.00 0.00 ? 5  PRO A HD3  4  
ATOM 4110  N N    . PHE A 1 6  ? 0.467   -23.555 3.426   1.00 0.00 ? 6  PHE A N    4  
ATOM 4111  C CA   . PHE A 1 6  ? -0.069  -22.385 2.737   1.00 0.00 ? 6  PHE A CA   4  
ATOM 4112  C C    . PHE A 1 6  ? -0.800  -21.462 3.708   1.00 0.00 ? 6  PHE A C    4  
ATOM 4113  O O    . PHE A 1 6  ? -1.059  -20.300 3.397   1.00 0.00 ? 6  PHE A O    4  
ATOM 4114  C CB   . PHE A 1 6  ? -1.019  -22.817 1.618   1.00 0.00 ? 6  PHE A CB   4  
ATOM 4115  C CG   . PHE A 1 6  ? -2.212  -23.594 2.105   1.00 0.00 ? 6  PHE A CG   4  
ATOM 4116  C CD1  . PHE A 1 6  ? -2.139  -24.967 2.272   1.00 0.00 ? 6  PHE A CD1  4  
ATOM 4117  C CD2  . PHE A 1 6  ? -3.406  -22.949 2.394   1.00 0.00 ? 6  PHE A CD2  4  
ATOM 4118  C CE1  . PHE A 1 6  ? -3.233  -25.684 2.718   1.00 0.00 ? 6  PHE A CE1  4  
ATOM 4119  C CE2  . PHE A 1 6  ? -4.503  -23.663 2.840   1.00 0.00 ? 6  PHE A CE2  4  
ATOM 4120  C CZ   . PHE A 1 6  ? -4.416  -25.032 3.002   1.00 0.00 ? 6  PHE A CZ   4  
ATOM 4121  H H    . PHE A 1 6  ? 0.074   -24.432 3.272   1.00 0.00 ? 6  PHE A H    4  
ATOM 4122  H HA   . PHE A 1 6  ? 0.749   -21.850 2.292   1.00 0.00 ? 6  PHE A HA   4  
ATOM 4123  H HB2  . PHE A 1 6  ? -1.371  -21.937 1.092   1.00 0.00 ? 6  PHE A HB2  4  
ATOM 4124  H HB3  . PHE A 1 6  ? -0.471  -23.438 0.920   1.00 0.00 ? 6  PHE A HB3  4  
ATOM 4125  H HD1  . PHE A 1 6  ? -1.219  -25.487 2.045   1.00 0.00 ? 6  PHE A HD1  4  
ATOM 4126  H HD2  . PHE A 1 6  ? -3.479  -21.877 2.269   1.00 0.00 ? 6  PHE A HD2  4  
ATOM 4127  H HE1  . PHE A 1 6  ? -3.163  -26.754 2.843   1.00 0.00 ? 6  PHE A HE1  4  
ATOM 4128  H HE2  . PHE A 1 6  ? -5.428  -23.150 3.061   1.00 0.00 ? 6  PHE A HE2  4  
ATOM 4129  H HZ   . PHE A 1 6  ? -5.272  -25.591 3.351   1.00 0.00 ? 6  PHE A HZ   4  
ATOM 4130  N N    . LYS A 1 7  ? -1.130  -21.986 4.881   1.00 0.00 ? 7  LYS A N    4  
ATOM 4131  C CA   . LYS A 1 7  ? -1.845  -21.217 5.893   1.00 0.00 ? 7  LYS A CA   4  
ATOM 4132  C C    . LYS A 1 7  ? -1.088  -19.946 6.270   1.00 0.00 ? 7  LYS A C    4  
ATOM 4133  O O    . LYS A 1 7  ? -1.667  -18.860 6.306   1.00 0.00 ? 7  LYS A O    4  
ATOM 4134  C CB   . LYS A 1 7  ? -2.073  -22.074 7.138   1.00 0.00 ? 7  LYS A CB   4  
ATOM 4135  C CG   . LYS A 1 7  ? -2.856  -23.347 6.859   1.00 0.00 ? 7  LYS A CG   4  
ATOM 4136  C CD   . LYS A 1 7  ? -3.028  -24.186 8.115   1.00 0.00 ? 7  LYS A CD   4  
ATOM 4137  C CE   . LYS A 1 7  ? -3.902  -23.487 9.145   1.00 0.00 ? 7  LYS A CE   4  
ATOM 4138  N NZ   . LYS A 1 7  ? -5.267  -23.216 8.619   1.00 0.00 ? 7  LYS A NZ   4  
ATOM 4139  H H    . LYS A 1 7  ? -0.906  -22.916 5.076   1.00 0.00 ? 7  LYS A H    4  
ATOM 4140  H HA   . LYS A 1 7  ? -2.806  -20.939 5.483   1.00 0.00 ? 7  LYS A HA   4  
ATOM 4141  H HB2  . LYS A 1 7  ? -1.112  -22.347 7.556   1.00 0.00 ? 7  LYS A HB2  4  
ATOM 4142  H HB3  . LYS A 1 7  ? -2.618  -21.486 7.861   1.00 0.00 ? 7  LYS A HB3  4  
ATOM 4143  H HG2  . LYS A 1 7  ? -3.826  -23.087 6.465   1.00 0.00 ? 7  LYS A HG2  4  
ATOM 4144  H HG3  . LYS A 1 7  ? -2.324  -23.935 6.128   1.00 0.00 ? 7  LYS A HG3  4  
ATOM 4145  H HD2  . LYS A 1 7  ? -3.494  -25.122 7.845   1.00 0.00 ? 7  LYS A HD2  4  
ATOM 4146  H HD3  . LYS A 1 7  ? -2.057  -24.381 8.550   1.00 0.00 ? 7  LYS A HD3  4  
ATOM 4147  H HE2  . LYS A 1 7  ? -3.988  -24.129 10.010  1.00 0.00 ? 7  LYS A HE2  4  
ATOM 4148  H HE3  . LYS A 1 7  ? -3.443  -22.558 9.440   1.00 0.00 ? 7  LYS A HE3  4  
ATOM 4149  H HZ1  . LYS A 1 7  ? -5.897  -22.942 9.400   1.00 0.00 ? 7  LYS A HZ1  4  
ATOM 4150  H HZ2  . LYS A 1 7  ? -5.662  -24.063 8.158   1.00 0.00 ? 7  LYS A HZ2  4  
ATOM 4151  H HZ3  . LYS A 1 7  ? -5.240  -22.439 7.929   1.00 0.00 ? 7  LYS A HZ3  4  
ATOM 4152  N N    . VAL A 1 8  ? 0.203   -20.084 6.549   1.00 0.00 ? 8  VAL A N    4  
ATOM 4153  C CA   . VAL A 1 8  ? 1.027   -18.943 6.929   1.00 0.00 ? 8  VAL A CA   4  
ATOM 4154  C C    . VAL A 1 8  ? 1.284   -18.018 5.739   1.00 0.00 ? 8  VAL A C    4  
ATOM 4155  O O    . VAL A 1 8  ? 1.345   -16.799 5.894   1.00 0.00 ? 8  VAL A O    4  
ATOM 4156  C CB   . VAL A 1 8  ? 2.379   -19.393 7.514   1.00 0.00 ? 8  VAL A CB   4  
ATOM 4157  C CG1  . VAL A 1 8  ? 3.150   -18.203 8.063   1.00 0.00 ? 8  VAL A CG1  4  
ATOM 4158  C CG2  . VAL A 1 8  ? 2.172   -20.446 8.593   1.00 0.00 ? 8  VAL A CG2  4  
ATOM 4159  H H    . VAL A 1 8  ? 0.611   -20.978 6.490   1.00 0.00 ? 8  VAL A H    4  
ATOM 4160  H HA   . VAL A 1 8  ? 0.497   -18.385 7.695   1.00 0.00 ? 8  VAL A HA   4  
ATOM 4161  H HB   . VAL A 1 8  ? 2.968   -19.840 6.723   1.00 0.00 ? 8  VAL A HB   4  
ATOM 4162  H HG11 . VAL A 1 8  ? 3.389   -17.518 7.264   1.00 0.00 ? 8  VAL A HG11 4  
ATOM 4163  H HG12 . VAL A 1 8  ? 4.070   -18.545 8.518   1.00 0.00 ? 8  VAL A HG12 4  
ATOM 4164  H HG13 . VAL A 1 8  ? 2.553   -17.694 8.807   1.00 0.00 ? 8  VAL A HG13 4  
ATOM 4165  H HG21 . VAL A 1 8  ? 1.749   -21.338 8.161   1.00 0.00 ? 8  VAL A HG21 4  
ATOM 4166  H HG22 . VAL A 1 8  ? 1.505   -20.064 9.353   1.00 0.00 ? 8  VAL A HG22 4  
ATOM 4167  H HG23 . VAL A 1 8  ? 3.123   -20.693 9.047   1.00 0.00 ? 8  VAL A HG23 4  
ATOM 4168  N N    . VAL A 1 9  ? 1.434   -18.606 4.555   1.00 0.00 ? 9  VAL A N    4  
ATOM 4169  C CA   . VAL A 1 9  ? 1.694   -17.833 3.344   1.00 0.00 ? 9  VAL A CA   4  
ATOM 4170  C C    . VAL A 1 9  ? 0.538   -16.888 3.024   1.00 0.00 ? 9  VAL A C    4  
ATOM 4171  O O    . VAL A 1 9  ? 0.748   -15.715 2.720   1.00 0.00 ? 9  VAL A O    4  
ATOM 4172  C CB   . VAL A 1 9  ? 1.932   -18.744 2.124   1.00 0.00 ? 9  VAL A CB   4  
ATOM 4173  C CG1  . VAL A 1 9  ? 2.669   -17.987 1.030   1.00 0.00 ? 9  VAL A CG1  4  
ATOM 4174  C CG2  . VAL A 1 9  ? 2.695   -19.997 2.520   1.00 0.00 ? 9  VAL A CG2  4  
ATOM 4175  H H    . VAL A 1 9  ? 1.362   -19.578 4.505   1.00 0.00 ? 9  VAL A H    4  
ATOM 4176  H HA   . VAL A 1 9  ? 2.589   -17.244 3.515   1.00 0.00 ? 9  VAL A HA   4  
ATOM 4177  H HB   . VAL A 1 9  ? 0.974   -19.057 1.725   1.00 0.00 ? 9  VAL A HB   4  
ATOM 4178  H HG11 . VAL A 1 9  ? 2.093   -17.120 0.738   1.00 0.00 ? 9  VAL A HG11 4  
ATOM 4179  H HG12 . VAL A 1 9  ? 2.803   -18.630 0.171   1.00 0.00 ? 9  VAL A HG12 4  
ATOM 4180  H HG13 . VAL A 1 9  ? 3.636   -17.669 1.395   1.00 0.00 ? 9  VAL A HG13 4  
ATOM 4181  H HG21 . VAL A 1 9  ? 2.076   -20.616 3.127   1.00 0.00 ? 9  VAL A HG21 4  
ATOM 4182  H HG22 . VAL A 1 9  ? 3.586   -19.728 3.070   1.00 0.00 ? 9  VAL A HG22 4  
ATOM 4183  H HG23 . VAL A 1 9  ? 2.979   -20.548 1.632   1.00 0.00 ? 9  VAL A HG23 4  
ATOM 4184  N N    . VAL A 1 10 ? -0.683  -17.412 3.092   1.00 0.00 ? 10 VAL A N    4  
ATOM 4185  C CA   . VAL A 1 10 ? -1.876  -16.625 2.797   1.00 0.00 ? 10 VAL A CA   4  
ATOM 4186  C C    . VAL A 1 10 ? -2.068  -15.482 3.793   1.00 0.00 ? 10 VAL A C    4  
ATOM 4187  O O    . VAL A 1 10 ? -2.238  -14.331 3.396   1.00 0.00 ? 10 VAL A O    4  
ATOM 4188  C CB   . VAL A 1 10 ? -3.140  -17.507 2.791   1.00 0.00 ? 10 VAL A CB   4  
ATOM 4189  C CG1  . VAL A 1 10 ? -4.387  -16.666 2.562   1.00 0.00 ? 10 VAL A CG1  4  
ATOM 4190  C CG2  . VAL A 1 10 ? -3.023  -18.596 1.735   1.00 0.00 ? 10 VAL A CG2  4  
ATOM 4191  H H    . VAL A 1 10 ? -0.786  -18.360 3.342   1.00 0.00 ? 10 VAL A H    4  
ATOM 4192  H HA   . VAL A 1 10 ? -1.760  -16.199 1.807   1.00 0.00 ? 10 VAL A HA   4  
ATOM 4193  H HB   . VAL A 1 10 ? -3.228  -17.984 3.757   1.00 0.00 ? 10 VAL A HB   4  
ATOM 4194  H HG11 . VAL A 1 10 ? -4.239  -16.008 1.716   1.00 0.00 ? 10 VAL A HG11 4  
ATOM 4195  H HG12 . VAL A 1 10 ? -4.600  -16.078 3.442   1.00 0.00 ? 10 VAL A HG12 4  
ATOM 4196  H HG13 . VAL A 1 10 ? -5.233  -17.312 2.364   1.00 0.00 ? 10 VAL A HG13 4  
ATOM 4197  H HG21 . VAL A 1 10 ? -3.808  -19.322 1.885   1.00 0.00 ? 10 VAL A HG21 4  
ATOM 4198  H HG22 . VAL A 1 10 ? -2.071  -19.088 1.796   1.00 0.00 ? 10 VAL A HG22 4  
ATOM 4199  H HG23 . VAL A 1 10 ? -3.129  -18.162 0.750   1.00 0.00 ? 10 VAL A HG23 4  
ATOM 4200  N N    . ILE A 1 11 ? -2.045  -15.806 5.080   1.00 0.00 ? 11 ILE A N    4  
ATOM 4201  C CA   . ILE A 1 11 ? -2.230  -14.802 6.123   1.00 0.00 ? 11 ILE A CA   4  
ATOM 4202  C C    . ILE A 1 11 ? -1.188  -13.691 6.021   1.00 0.00 ? 11 ILE A C    4  
ATOM 4203  O O    . ILE A 1 11 ? -1.507  -12.512 6.179   1.00 0.00 ? 11 ILE A O    4  
ATOM 4204  C CB   . ILE A 1 11 ? -2.159  -15.431 7.529   1.00 0.00 ? 11 ILE A CB   4  
ATOM 4205  C CG1  . ILE A 1 11 ? -3.240  -16.505 7.680   1.00 0.00 ? 11 ILE A CG1  4  
ATOM 4206  C CG2  . ILE A 1 11 ? -2.314  -14.362 8.602   1.00 0.00 ? 11 ILE A CG2  4  
ATOM 4207  C CD1  . ILE A 1 11 ? -3.108  -17.326 8.946   1.00 0.00 ? 11 ILE A CD1  4  
ATOM 4208  H H    . ILE A 1 11 ? -1.900  -16.747 5.331   1.00 0.00 ? 11 ILE A H    4  
ATOM 4209  H HA   . ILE A 1 11 ? -3.213  -14.365 5.996   1.00 0.00 ? 11 ILE A HA   4  
ATOM 4210  H HB   . ILE A 1 11 ? -1.186  -15.888 7.647   1.00 0.00 ? 11 ILE A HB   4  
ATOM 4211  H HG12 . ILE A 1 11 ? -4.212  -16.032 7.700   1.00 0.00 ? 11 ILE A HG12 4  
ATOM 4212  H HG13 . ILE A 1 11 ? -3.209  -17.186 6.850   1.00 0.00 ? 11 ILE A HG13 4  
ATOM 4213  H HG21 . ILE A 1 11 ? -3.235  -13.817 8.443   1.00 0.00 ? 11 ILE A HG21 4  
ATOM 4214  H HG22 . ILE A 1 11 ? -1.481  -13.677 8.566   1.00 0.00 ? 11 ILE A HG22 4  
ATOM 4215  H HG23 . ILE A 1 11 ? -2.338  -14.820 9.580   1.00 0.00 ? 11 ILE A HG23 4  
ATOM 4216  H HD11 . ILE A 1 11 ? -2.093  -17.684 9.047   1.00 0.00 ? 11 ILE A HD11 4  
ATOM 4217  H HD12 . ILE A 1 11 ? -3.781  -18.169 8.896   1.00 0.00 ? 11 ILE A HD12 4  
ATOM 4218  H HD13 . ILE A 1 11 ? -3.362  -16.717 9.800   1.00 0.00 ? 11 ILE A HD13 4  
ATOM 4219  N N    . SER A 1 12 ? 0.056   -14.075 5.755   1.00 0.00 ? 12 SER A N    4  
ATOM 4220  C CA   . SER A 1 12 ? 1.147   -13.112 5.638   1.00 0.00 ? 12 SER A CA   4  
ATOM 4221  C C    . SER A 1 12 ? 0.994   -12.252 4.386   1.00 0.00 ? 12 SER A C    4  
ATOM 4222  O O    . SER A 1 12 ? 1.269   -11.052 4.409   1.00 0.00 ? 12 SER A O    4  
ATOM 4223  C CB   . SER A 1 12 ? 2.493   -13.839 5.608   1.00 0.00 ? 12 SER A CB   4  
ATOM 4224  O OG   . SER A 1 12 ? 3.564   -12.923 5.476   1.00 0.00 ? 12 SER A OG   4  
ATOM 4225  H H    . SER A 1 12 ? 0.254   -15.035 5.638   1.00 0.00 ? 12 SER A H    4  
ATOM 4226  H HA   . SER A 1 12 ? 1.124   -12.466 6.506   1.00 0.00 ? 12 SER A HA   4  
ATOM 4227  H HB2  . SER A 1 12 ? 2.620   -14.394 6.526   1.00 0.00 ? 12 SER A HB2  4  
ATOM 4228  H HB3  . SER A 1 12 ? 2.514   -14.522 4.771   1.00 0.00 ? 12 SER A HB3  4  
ATOM 4229  H HG   . SER A 1 12 ? 3.765   -12.534 6.332   1.00 0.00 ? 12 SER A HG   4  
ATOM 4230  N N    . ALA A 1 13 ? 0.552   -12.871 3.297   1.00 0.00 ? 13 ALA A N    4  
ATOM 4231  C CA   . ALA A 1 13 ? 0.371   -12.164 2.036   1.00 0.00 ? 13 ALA A CA   4  
ATOM 4232  C C    . ALA A 1 13 ? -0.755  -11.136 2.127   1.00 0.00 ? 13 ALA A C    4  
ATOM 4233  O O    . ALA A 1 13 ? -0.541  -9.949  1.884   1.00 0.00 ? 13 ALA A O    4  
ATOM 4234  C CB   . ALA A 1 13 ? 0.092   -13.152 0.913   1.00 0.00 ? 13 ALA A CB   4  
ATOM 4235  H H    . ALA A 1 13 ? 0.347   -13.835 3.335   1.00 0.00 ? 13 ALA A H    4  
ATOM 4236  H HA   . ALA A 1 13 ? 1.294   -11.649 1.800   1.00 0.00 ? 13 ALA A HA   4  
ATOM 4237  H HB1  . ALA A 1 13 ? 0.024   -12.624 -0.028  1.00 0.00 ? 13 ALA A HB1  4  
ATOM 4238  H HB2  . ALA A 1 13 ? -0.838  -13.669 1.105   1.00 0.00 ? 13 ALA A HB2  4  
ATOM 4239  H HB3  . ALA A 1 13 ? 0.896   -13.871 0.862   1.00 0.00 ? 13 ALA A HB3  4  
ATOM 4240  N N    . ILE A 1 14 ? -1.950  -11.602 2.483   1.00 0.00 ? 14 ILE A N    4  
ATOM 4241  C CA   . ILE A 1 14 ? -3.113  -10.728 2.602   1.00 0.00 ? 14 ILE A CA   4  
ATOM 4242  C C    . ILE A 1 14 ? -2.842  -9.562  3.547   1.00 0.00 ? 14 ILE A C    4  
ATOM 4243  O O    . ILE A 1 14 ? -3.143  -8.411  3.226   1.00 0.00 ? 14 ILE A O    4  
ATOM 4244  C CB   . ILE A 1 14 ? -4.349  -11.505 3.101   1.00 0.00 ? 14 ILE A CB   4  
ATOM 4245  C CG1  . ILE A 1 14 ? -4.679  -12.650 2.140   1.00 0.00 ? 14 ILE A CG1  4  
ATOM 4246  C CG2  . ILE A 1 14 ? -5.540  -10.566 3.247   1.00 0.00 ? 14 ILE A CG2  4  
ATOM 4247  C CD1  . ILE A 1 14 ? -5.827  -13.523 2.605   1.00 0.00 ? 14 ILE A CD1  4  
ATOM 4248  H H    . ILE A 1 14 ? -2.044  -12.563 2.674   1.00 0.00 ? 14 ILE A H    4  
ATOM 4249  H HA   . ILE A 1 14 ? -3.334  -10.332 1.619   1.00 0.00 ? 14 ILE A HA   4  
ATOM 4250  H HB   . ILE A 1 14 ? -4.123  -11.916 4.075   1.00 0.00 ? 14 ILE A HB   4  
ATOM 4251  H HG12 . ILE A 1 14 ? -4.953  -12.239 1.179   1.00 0.00 ? 14 ILE A HG12 4  
ATOM 4252  H HG13 . ILE A 1 14 ? -3.823  -13.285 2.011   1.00 0.00 ? 14 ILE A HG13 4  
ATOM 4253  H HG21 . ILE A 1 14 ? -5.752  -10.097 2.296   1.00 0.00 ? 14 ILE A HG21 4  
ATOM 4254  H HG22 . ILE A 1 14 ? -5.328  -9.806  3.982   1.00 0.00 ? 14 ILE A HG22 4  
ATOM 4255  H HG23 . ILE A 1 14 ? -6.409  -11.117 3.571   1.00 0.00 ? 14 ILE A HG23 4  
ATOM 4256  H HD11 . ILE A 1 14 ? -6.753  -12.974 2.527   1.00 0.00 ? 14 ILE A HD11 4  
ATOM 4257  H HD12 . ILE A 1 14 ? -5.668  -13.821 3.632   1.00 0.00 ? 14 ILE A HD12 4  
ATOM 4258  H HD13 . ILE A 1 14 ? -5.881  -14.403 1.982   1.00 0.00 ? 14 ILE A HD13 4  
ATOM 4259  N N    . LEU A 1 15 ? -2.275  -9.864  4.711   1.00 0.00 ? 15 LEU A N    4  
ATOM 4260  C CA   . LEU A 1 15 ? -1.964  -8.840  5.702   1.00 0.00 ? 15 LEU A CA   4  
ATOM 4261  C C    . LEU A 1 15 ? -1.106  -7.737  5.094   1.00 0.00 ? 15 LEU A C    4  
ATOM 4262  O O    . LEU A 1 15 ? -1.279  -6.559  5.405   1.00 0.00 ? 15 LEU A O    4  
ATOM 4263  C CB   . LEU A 1 15 ? -1.242  -9.461  6.900   1.00 0.00 ? 15 LEU A CB   4  
ATOM 4264  C CG   . LEU A 1 15 ? -0.839  -8.475  8.000   1.00 0.00 ? 15 LEU A CG   4  
ATOM 4265  C CD1  . LEU A 1 15 ? -2.070  -7.869  8.657   1.00 0.00 ? 15 LEU A CD1  4  
ATOM 4266  C CD2  . LEU A 1 15 ? 0.033   -9.166  9.038   1.00 0.00 ? 15 LEU A CD2  4  
ATOM 4267  H H    . LEU A 1 15 ? -2.060  -10.806 4.913   1.00 0.00 ? 15 LEU A H    4  
ATOM 4268  H HA   . LEU A 1 15 ? -2.896  -8.411  6.039   1.00 0.00 ? 15 LEU A HA   4  
ATOM 4269  H HB2  . LEU A 1 15 ? -1.888  -10.216 7.330   1.00 0.00 ? 15 LEU A HB2  4  
ATOM 4270  H HB3  . LEU A 1 15 ? -0.348  -9.949  6.532   1.00 0.00 ? 15 LEU A HB3  4  
ATOM 4271  H HG   . LEU A 1 15 ? -0.261  -7.669  7.573   1.00 0.00 ? 15 LEU A HG   4  
ATOM 4272  H HD11 . LEU A 1 15 ? -1.765  -7.182  9.435   1.00 0.00 ? 15 LEU A HD11 4  
ATOM 4273  H HD12 . LEU A 1 15 ? -2.677  -8.653  9.089   1.00 0.00 ? 15 LEU A HD12 4  
ATOM 4274  H HD13 . LEU A 1 15 ? -2.649  -7.333  7.919   1.00 0.00 ? 15 LEU A HD13 4  
ATOM 4275  H HD21 . LEU A 1 15 ? 0.332   -8.453  9.794   1.00 0.00 ? 15 LEU A HD21 4  
ATOM 4276  H HD22 . LEU A 1 15 ? 0.916   -9.567  8.560   1.00 0.00 ? 15 LEU A HD22 4  
ATOM 4277  H HD23 . LEU A 1 15 ? -0.520  -9.971  9.503   1.00 0.00 ? 15 LEU A HD23 4  
ATOM 4278  N N    . ALA A 1 16 ? -0.181  -8.127  4.222   1.00 0.00 ? 16 ALA A N    4  
ATOM 4279  C CA   . ALA A 1 16 ? 0.703   -7.172  3.569   1.00 0.00 ? 16 ALA A CA   4  
ATOM 4280  C C    . ALA A 1 16 ? -0.082  -6.235  2.659   1.00 0.00 ? 16 ALA A C    4  
ATOM 4281  O O    . ALA A 1 16 ? 0.218   -5.044  2.572   1.00 0.00 ? 16 ALA A O    4  
ATOM 4282  C CB   . ALA A 1 16 ? 1.777   -7.906  2.784   1.00 0.00 ? 16 ALA A CB   4  
ATOM 4283  H H    . ALA A 1 16 ? -0.085  -9.085  4.009   1.00 0.00 ? 16 ALA A H    4  
ATOM 4284  H HA   . ALA A 1 16 ? 1.195   -6.584  4.335   1.00 0.00 ? 16 ALA A HA   4  
ATOM 4285  H HB1  . ALA A 1 16 ? 1.337   -8.411  1.937   1.00 0.00 ? 16 ALA A HB1  4  
ATOM 4286  H HB2  . ALA A 1 16 ? 2.255   -8.633  3.424   1.00 0.00 ? 16 ALA A HB2  4  
ATOM 4287  H HB3  . ALA A 1 16 ? 2.514   -7.197  2.436   1.00 0.00 ? 16 ALA A HB3  4  
ATOM 4288  N N    . LEU A 1 17 ? -1.090  -6.780  1.981   1.00 0.00 ? 17 LEU A N    4  
ATOM 4289  C CA   . LEU A 1 17 ? -1.927  -5.986  1.089   1.00 0.00 ? 17 LEU A CA   4  
ATOM 4290  C C    . LEU A 1 17 ? -2.684  -4.924  1.875   1.00 0.00 ? 17 LEU A C    4  
ATOM 4291  O O    . LEU A 1 17 ? -2.913  -3.816  1.389   1.00 0.00 ? 17 LEU A O    4  
ATOM 4292  C CB   . LEU A 1 17 ? -2.915  -6.885  0.337   1.00 0.00 ? 17 LEU A CB   4  
ATOM 4293  C CG   . LEU A 1 17 ? -2.387  -7.504  -0.959  1.00 0.00 ? 17 LEU A CG   4  
ATOM 4294  C CD1  . LEU A 1 17 ? -2.057  -6.417  -1.973  1.00 0.00 ? 17 LEU A CD1  4  
ATOM 4295  C CD2  . LEU A 1 17 ? -1.164  -8.367  -0.684  1.00 0.00 ? 17 LEU A CD2  4  
ATOM 4296  H H    . LEU A 1 17 ? -1.285  -7.741  2.085   1.00 0.00 ? 17 LEU A H    4  
ATOM 4297  H HA   . LEU A 1 17 ? -1.280  -5.483  0.389   1.00 0.00 ? 17 LEU A HA   4  
ATOM 4298  H HB2  . LEU A 1 17 ? -3.219  -7.687  0.989   1.00 0.00 ? 17 LEU A HB2  4  
ATOM 4299  H HB3  . LEU A 1 17 ? -3.799  -6.308  0.087   1.00 0.00 ? 17 LEU A HB3  4  
ATOM 4300  H HG   . LEU A 1 17 ? -3.153  -8.135  -1.386  1.00 0.00 ? 17 LEU A HG   4  
ATOM 4301  H HD11 . LEU A 1 17 ? -2.916  -5.774  -2.112  1.00 0.00 ? 17 LEU A HD11 4  
ATOM 4302  H HD12 . LEU A 1 17 ? -1.804  -6.876  -2.917  1.00 0.00 ? 17 LEU A HD12 4  
ATOM 4303  H HD13 . LEU A 1 17 ? -1.220  -5.829  -1.630  1.00 0.00 ? 17 LEU A HD13 4  
ATOM 4304  H HD21 . LEU A 1 17 ? -0.376  -7.774  -0.246  1.00 0.00 ? 17 LEU A HD21 4  
ATOM 4305  H HD22 . LEU A 1 17 ? -0.811  -8.797  -1.612  1.00 0.00 ? 17 LEU A HD22 4  
ATOM 4306  H HD23 . LEU A 1 17 ? -1.438  -9.160  -0.015  1.00 0.00 ? 17 LEU A HD23 4  
ATOM 4307  N N    . VAL A 1 18 ? -3.072  -5.276  3.097   1.00 0.00 ? 18 VAL A N    4  
ATOM 4308  C CA   . VAL A 1 18 ? -3.794  -4.357  3.964   1.00 0.00 ? 18 VAL A CA   4  
ATOM 4309  C C    . VAL A 1 18 ? -2.894  -3.204  4.389   1.00 0.00 ? 18 VAL A C    4  
ATOM 4310  O O    . VAL A 1 18 ? -3.333  -2.058  4.474   1.00 0.00 ? 18 VAL A O    4  
ATOM 4311  C CB   . VAL A 1 18 ? -4.325  -5.078  5.221   1.00 0.00 ? 18 VAL A CB   4  
ATOM 4312  C CG1  . VAL A 1 18 ? -5.146  -4.130  6.080   1.00 0.00 ? 18 VAL A CG1  4  
ATOM 4313  C CG2  . VAL A 1 18 ? -5.142  -6.299  4.828   1.00 0.00 ? 18 VAL A CG2  4  
ATOM 4314  H H    . VAL A 1 18 ? -2.855  -6.175  3.432   1.00 0.00 ? 18 VAL A H    4  
ATOM 4315  H HA   . VAL A 1 18 ? -4.640  -3.961  3.414   1.00 0.00 ? 18 VAL A HA   4  
ATOM 4316  H HB   . VAL A 1 18 ? -3.481  -5.417  5.807   1.00 0.00 ? 18 VAL A HB   4  
ATOM 4317  H HG11 . VAL A 1 18 ? -4.515  -3.346  6.469   1.00 0.00 ? 18 VAL A HG11 4  
ATOM 4318  H HG12 . VAL A 1 18 ? -5.579  -4.674  6.909   1.00 0.00 ? 18 VAL A HG12 4  
ATOM 4319  H HG13 . VAL A 1 18 ? -5.939  -3.694  5.488   1.00 0.00 ? 18 VAL A HG13 4  
ATOM 4320  H HG21 . VAL A 1 18 ? -5.553  -6.762  5.715   1.00 0.00 ? 18 VAL A HG21 4  
ATOM 4321  H HG22 . VAL A 1 18 ? -4.522  -7.007  4.324   1.00 0.00 ? 18 VAL A HG22 4  
ATOM 4322  H HG23 . VAL A 1 18 ? -5.952  -6.002  4.176   1.00 0.00 ? 18 VAL A HG23 4  
ATOM 4323  N N    . VAL A 1 19 ? -1.629  -3.521  4.647   1.00 0.00 ? 19 VAL A N    4  
ATOM 4324  C CA   . VAL A 1 19 ? -0.656  -2.518  5.060   1.00 0.00 ? 19 VAL A CA   4  
ATOM 4325  C C    . VAL A 1 19 ? -0.366  -1.528  3.937   1.00 0.00 ? 19 VAL A C    4  
ATOM 4326  O O    . VAL A 1 19 ? -0.288  -0.324  4.170   1.00 0.00 ? 19 VAL A O    4  
ATOM 4327  C CB   . VAL A 1 19 ? 0.666   -3.173  5.506   1.00 0.00 ? 19 VAL A CB   4  
ATOM 4328  C CG1  . VAL A 1 19 ? 1.705   -2.115  5.847   1.00 0.00 ? 19 VAL A CG1  4  
ATOM 4329  C CG2  . VAL A 1 19 ? 0.430   -4.095  6.691   1.00 0.00 ? 19 VAL A CG2  4  
ATOM 4330  H H    . VAL A 1 19 ? -1.333  -4.457  4.558   1.00 0.00 ? 19 VAL A H    4  
ATOM 4331  H HA   . VAL A 1 19 ? -1.065  -1.973  5.904   1.00 0.00 ? 19 VAL A HA   4  
ATOM 4332  H HB   . VAL A 1 19 ? 1.046   -3.768  4.687   1.00 0.00 ? 19 VAL A HB   4  
ATOM 4333  H HG11 . VAL A 1 19 ? 1.274   -1.372  6.505   1.00 0.00 ? 19 VAL A HG11 4  
ATOM 4334  H HG12 . VAL A 1 19 ? 2.053   -1.638  4.943   1.00 0.00 ? 19 VAL A HG12 4  
ATOM 4335  H HG13 . VAL A 1 19 ? 2.550   -2.577  6.341   1.00 0.00 ? 19 VAL A HG13 4  
ATOM 4336  H HG21 . VAL A 1 19 ? -0.327  -4.815  6.454   1.00 0.00 ? 19 VAL A HG21 4  
ATOM 4337  H HG22 . VAL A 1 19 ? 0.109   -3.514  7.544   1.00 0.00 ? 19 VAL A HG22 4  
ATOM 4338  H HG23 . VAL A 1 19 ? 1.349   -4.610  6.935   1.00 0.00 ? 19 VAL A HG23 4  
ATOM 4339  N N    . LEU A 1 20 ? -0.204  -2.042  2.720   1.00 0.00 ? 20 LEU A N    4  
ATOM 4340  C CA   . LEU A 1 20 ? 0.080   -1.192  1.567   1.00 0.00 ? 20 LEU A CA   4  
ATOM 4341  C C    . LEU A 1 20 ? -1.023  -0.151  1.386   1.00 0.00 ? 20 LEU A C    4  
ATOM 4342  O O    . LEU A 1 20 ? -0.751  1.002   1.055   1.00 0.00 ? 20 LEU A O    4  
ATOM 4343  C CB   . LEU A 1 20 ? 0.221   -2.046  0.299   1.00 0.00 ? 20 LEU A CB   4  
ATOM 4344  C CG   . LEU A 1 20 ? 1.161   -1.485  -0.781  1.00 0.00 ? 20 LEU A CG   4  
ATOM 4345  C CD1  . LEU A 1 20 ? 0.610   -0.195  -1.372  1.00 0.00 ? 20 LEU A CD1  4  
ATOM 4346  C CD2  . LEU A 1 20 ? 2.559   -1.257  -0.216  1.00 0.00 ? 20 LEU A CD2  4  
ATOM 4347  H H    . LEU A 1 20 ? -0.273  -3.018  2.592   1.00 0.00 ? 20 LEU A H    4  
ATOM 4348  H HA   . LEU A 1 20 ? 1.001   -0.676  1.771   1.00 0.00 ? 20 LEU A HA   4  
ATOM 4349  H HB2  . LEU A 1 20 ? 0.603   -3.018  0.587   1.00 0.00 ? 20 LEU A HB2  4  
ATOM 4350  H HB3  . LEU A 1 20 ? -0.757  -2.194  -0.144  1.00 0.00 ? 20 LEU A HB3  4  
ATOM 4351  H HG   . LEU A 1 20 ? 1.241   -2.206  -1.582  1.00 0.00 ? 20 LEU A HG   4  
ATOM 4352  H HD11 . LEU A 1 20 ? 0.767   0.625   -0.688  1.00 0.00 ? 20 LEU A HD11 4  
ATOM 4353  H HD12 . LEU A 1 20 ? -0.448  -0.300  -1.572  1.00 0.00 ? 20 LEU A HD12 4  
ATOM 4354  H HD13 . LEU A 1 20 ? 1.124   0.015   -2.298  1.00 0.00 ? 20 LEU A HD13 4  
ATOM 4355  H HD21 . LEU A 1 20 ? 2.553   -0.428  0.476   1.00 0.00 ? 20 LEU A HD21 4  
ATOM 4356  H HD22 . LEU A 1 20 ? 3.236   -1.035  -1.027  1.00 0.00 ? 20 LEU A HD22 4  
ATOM 4357  H HD23 . LEU A 1 20 ? 2.899   -2.149  0.294   1.00 0.00 ? 20 LEU A HD23 4  
ATOM 4358  N N    . THR A 1 21 ? -2.265  -0.565  1.615   1.00 0.00 ? 21 THR A N    4  
ATOM 4359  C CA   . THR A 1 21 ? -3.407  0.334   1.482   1.00 0.00 ? 21 THR A CA   4  
ATOM 4360  C C    . THR A 1 21 ? -3.374  1.413   2.559   1.00 0.00 ? 21 THR A C    4  
ATOM 4361  O O    . THR A 1 21 ? -3.774  2.553   2.322   1.00 0.00 ? 21 THR A O    4  
ATOM 4362  C CB   . THR A 1 21 ? -4.741  -0.432  1.577   1.00 0.00 ? 21 THR A CB   4  
ATOM 4363  O OG1  . THR A 1 21 ? -4.781  -1.471  0.593   1.00 0.00 ? 21 THR A OG1  4  
ATOM 4364  C CG2  . THR A 1 21 ? -5.923  0.507   1.375   1.00 0.00 ? 21 THR A CG2  4  
ATOM 4365  H H    . THR A 1 21 ? -2.427  -1.500  1.882   1.00 0.00 ? 21 THR A H    4  
ATOM 4366  H HA   . THR A 1 21 ? -3.356  0.808   0.508   1.00 0.00 ? 21 THR A HA   4  
ATOM 4367  H HB   . THR A 1 21 ? -4.820  -0.879  2.559   1.00 0.00 ? 21 THR A HB   4  
ATOM 4368  H HG1  . THR A 1 21 ? -4.693  -1.108  -0.298  1.00 0.00 ? 21 THR A HG1  4  
ATOM 4369  H HG21 . THR A 1 21 ? -6.818  -0.078  1.221   1.00 0.00 ? 21 THR A HG21 4  
ATOM 4370  H HG22 . THR A 1 21 ? -5.755  1.134   0.509   1.00 0.00 ? 21 THR A HG22 4  
ATOM 4371  H HG23 . THR A 1 21 ? -6.051  1.126   2.250   1.00 0.00 ? 21 THR A HG23 4  
ATOM 4372  N N    . ILE A 1 22 ? -2.895  1.043   3.743   1.00 0.00 ? 22 ILE A N    4  
ATOM 4373  C CA   . ILE A 1 22 ? -2.803  1.977   4.859   1.00 0.00 ? 22 ILE A CA   4  
ATOM 4374  C C    . ILE A 1 22 ? -1.659  2.964   4.651   1.00 0.00 ? 22 ILE A C    4  
ATOM 4375  O O    . ILE A 1 22 ? -1.767  4.137   5.007   1.00 0.00 ? 22 ILE A O    4  
ATOM 4376  C CB   . ILE A 1 22 ? -2.605  1.236   6.197   1.00 0.00 ? 22 ILE A CB   4  
ATOM 4377  C CG1  . ILE A 1 22 ? -3.822  0.354   6.496   1.00 0.00 ? 22 ILE A CG1  4  
ATOM 4378  C CG2  . ILE A 1 22 ? -2.371  2.228   7.330   1.00 0.00 ? 22 ILE A CG2  4  
ATOM 4379  C CD1  . ILE A 1 22 ? -3.646  -0.537  7.706   1.00 0.00 ? 22 ILE A CD1  4  
ATOM 4380  H H    . ILE A 1 22 ? -2.592  0.116   3.880   1.00 0.00 ? 22 ILE A H    4  
ATOM 4381  H HA   . ILE A 1 22 ? -3.732  2.536   4.917   1.00 0.00 ? 22 ILE A HA   4  
ATOM 4382  H HB   . ILE A 1 22 ? -1.727  0.612   6.110   1.00 0.00 ? 22 ILE A HB   4  
ATOM 4383  H HG12 . ILE A 1 22 ? -4.681  0.984   6.678   1.00 0.00 ? 22 ILE A HG12 4  
ATOM 4384  H HG13 . ILE A 1 22 ? -4.030  -0.275  5.652   1.00 0.00 ? 22 ILE A HG13 4  
ATOM 4385  H HG21 . ILE A 1 22 ? -3.180  2.945   7.361   1.00 0.00 ? 22 ILE A HG21 4  
ATOM 4386  H HG22 . ILE A 1 22 ? -1.437  2.747   7.180   1.00 0.00 ? 22 ILE A HG22 4  
ATOM 4387  H HG23 . ILE A 1 22 ? -2.322  1.709   8.275   1.00 0.00 ? 22 ILE A HG23 4  
ATOM 4388  H HD11 . ILE A 1 22 ? -3.686  0.060   8.604   1.00 0.00 ? 22 ILE A HD11 4  
ATOM 4389  H HD12 . ILE A 1 22 ? -2.693  -1.046  7.652   1.00 0.00 ? 22 ILE A HD12 4  
ATOM 4390  H HD13 . ILE A 1 22 ? -4.440  -1.268  7.729   1.00 0.00 ? 22 ILE A HD13 4  
ATOM 4391  N N    . ILE A 1 23 ? -0.562  2.481   4.074   1.00 0.00 ? 23 ILE A N    4  
ATOM 4392  C CA   . ILE A 1 23 ? 0.595   3.327   3.813   1.00 0.00 ? 23 ILE A CA   4  
ATOM 4393  C C    . ILE A 1 23 ? 0.238   4.433   2.823   1.00 0.00 ? 23 ILE A C    4  
ATOM 4394  O O    . ILE A 1 23 ? 0.555   5.601   3.038   1.00 0.00 ? 23 ILE A O    4  
ATOM 4395  C CB   . ILE A 1 23 ? 1.785   2.518   3.260   1.00 0.00 ? 23 ILE A CB   4  
ATOM 4396  C CG1  . ILE A 1 23 ? 2.297   1.534   4.315   1.00 0.00 ? 23 ILE A CG1  4  
ATOM 4397  C CG2  . ILE A 1 23 ? 2.902   3.451   2.808   1.00 0.00 ? 23 ILE A CG2  4  
ATOM 4398  C CD1  . ILE A 1 23 ? 2.800   2.195   5.581   1.00 0.00 ? 23 ILE A CD1  4  
ATOM 4399  H H    . ILE A 1 23 ? -0.523  1.532   3.812   1.00 0.00 ? 23 ILE A H    4  
ATOM 4400  H HA   . ILE A 1 23 ? 0.889   3.798   4.740   1.00 0.00 ? 23 ILE A HA   4  
ATOM 4401  H HB   . ILE A 1 23 ? 1.444   1.964   2.398   1.00 0.00 ? 23 ILE A HB   4  
ATOM 4402  H HG12 . ILE A 1 23 ? 1.507   0.869   4.596   1.00 0.00 ? 23 ILE A HG12 4  
ATOM 4403  H HG13 . ILE A 1 23 ? 3.111   0.957   3.899   1.00 0.00 ? 23 ILE A HG13 4  
ATOM 4404  H HG21 . ILE A 1 23 ? 3.814   2.886   2.660   1.00 0.00 ? 23 ILE A HG21 4  
ATOM 4405  H HG22 . ILE A 1 23 ? 3.077   4.213   3.556   1.00 0.00 ? 23 ILE A HG22 4  
ATOM 4406  H HG23 . ILE A 1 23 ? 2.630   3.920   1.874   1.00 0.00 ? 23 ILE A HG23 4  
ATOM 4407  H HD11 . ILE A 1 23 ? 3.273   1.450   6.204   1.00 0.00 ? 23 ILE A HD11 4  
ATOM 4408  H HD12 . ILE A 1 23 ? 1.972   2.629   6.118   1.00 0.00 ? 23 ILE A HD12 4  
ATOM 4409  H HD13 . ILE A 1 23 ? 3.519   2.964   5.343   1.00 0.00 ? 23 ILE A HD13 4  
ATOM 4410  N N    . SER A 1 24 ? -0.431  4.045   1.740   1.00 0.00 ? 24 SER A N    4  
ATOM 4411  C CA   . SER A 1 24 ? -0.835  4.990   0.703   1.00 0.00 ? 24 SER A CA   4  
ATOM 4412  C C    . SER A 1 24 ? -1.996  5.868   1.163   1.00 0.00 ? 24 SER A C    4  
ATOM 4413  O O    . SER A 1 24 ? -2.188  6.972   0.653   1.00 0.00 ? 24 SER A O    4  
ATOM 4414  C CB   . SER A 1 24 ? -1.231  4.235   -0.569  1.00 0.00 ? 24 SER A CB   4  
ATOM 4415  O OG   . SER A 1 24 ? -1.651  5.130   -1.583  1.00 0.00 ? 24 SER A OG   4  
ATOM 4416  H H    . SER A 1 24 ? -0.659  3.091   1.628   1.00 0.00 ? 24 SER A H    4  
ATOM 4417  H HA   . SER A 1 24 ? 0.010   5.627   0.474   1.00 0.00 ? 24 SER A HA   4  
ATOM 4418  H HB2  . SER A 1 24 ? -0.382  3.675   -0.931  1.00 0.00 ? 24 SER A HB2  4  
ATOM 4419  H HB3  . SER A 1 24 ? -2.041  3.555   -0.347  1.00 0.00 ? 24 SER A HB3  4  
ATOM 4420  H HG   . SER A 1 24 ? -1.758  4.652   -2.408  1.00 0.00 ? 24 SER A HG   4  
ATOM 4421  N N    . LEU A 1 25 ? -2.768  5.375   2.127   1.00 0.00 ? 25 LEU A N    4  
ATOM 4422  C CA   . LEU A 1 25 ? -3.910  6.123   2.645   1.00 0.00 ? 25 LEU A CA   4  
ATOM 4423  C C    . LEU A 1 25 ? -3.460  7.404   3.343   1.00 0.00 ? 25 LEU A C    4  
ATOM 4424  O O    . LEU A 1 25 ? -3.861  8.503   2.961   1.00 0.00 ? 25 LEU A O    4  
ATOM 4425  C CB   . LEU A 1 25 ? -4.713  5.257   3.620   1.00 0.00 ? 25 LEU A CB   4  
ATOM 4426  C CG   . LEU A 1 25 ? -5.918  5.949   4.261   1.00 0.00 ? 25 LEU A CG   4  
ATOM 4427  C CD1  . LEU A 1 25 ? -6.975  6.266   3.215   1.00 0.00 ? 25 LEU A CD1  4  
ATOM 4428  C CD2  . LEU A 1 25 ? -6.504  5.086   5.367   1.00 0.00 ? 25 LEU A CD2  4  
ATOM 4429  H H    . LEU A 1 25 ? -2.577  4.485   2.502   1.00 0.00 ? 25 LEU A H    4  
ATOM 4430  H HA   . LEU A 1 25 ? -4.546  6.387   1.811   1.00 0.00 ? 25 LEU A HA   4  
ATOM 4431  H HB2  . LEU A 1 25 ? -5.064  4.386   3.088   1.00 0.00 ? 25 LEU A HB2  4  
ATOM 4432  H HB3  . LEU A 1 25 ? -4.045  4.931   4.406   1.00 0.00 ? 25 LEU A HB3  4  
ATOM 4433  H HG   . LEU A 1 25 ? -5.608  6.881   4.708   1.00 0.00 ? 25 LEU A HG   4  
ATOM 4434  H HD11 . LEU A 1 25 ? -7.818  6.754   3.686   1.00 0.00 ? 25 LEU A HD11 4  
ATOM 4435  H HD12 . LEU A 1 25 ? -7.309  5.352   2.744   1.00 0.00 ? 25 LEU A HD12 4  
ATOM 4436  H HD13 . LEU A 1 25 ? -6.559  6.924   2.466   1.00 0.00 ? 25 LEU A HD13 4  
ATOM 4437  H HD21 . LEU A 1 25 ? -5.748  4.894   6.116   1.00 0.00 ? 25 LEU A HD21 4  
ATOM 4438  H HD22 . LEU A 1 25 ? -6.847  4.147   4.955   1.00 0.00 ? 25 LEU A HD22 4  
ATOM 4439  H HD23 . LEU A 1 25 ? -7.336  5.601   5.827   1.00 0.00 ? 25 LEU A HD23 4  
ATOM 4440  N N    . ILE A 1 26 ? -2.631  7.249   4.372   1.00 0.00 ? 26 ILE A N    4  
ATOM 4441  C CA   . ILE A 1 26 ? -2.128  8.388   5.131   1.00 0.00 ? 26 ILE A CA   4  
ATOM 4442  C C    . ILE A 1 26 ? -1.466  9.419   4.222   1.00 0.00 ? 26 ILE A C    4  
ATOM 4443  O O    . ILE A 1 26 ? -1.626  10.624  4.417   1.00 0.00 ? 26 ILE A O    4  
ATOM 4444  C CB   . ILE A 1 26 ? -1.119  7.937   6.208   1.00 0.00 ? 26 ILE A CB   4  
ATOM 4445  C CG1  . ILE A 1 26 ? -1.791  6.956   7.173   1.00 0.00 ? 26 ILE A CG1  4  
ATOM 4446  C CG2  . ILE A 1 26 ? -0.563  9.141   6.959   1.00 0.00 ? 26 ILE A CG2  4  
ATOM 4447  C CD1  . ILE A 1 26 ? -0.849  6.363   8.198   1.00 0.00 ? 26 ILE A CD1  4  
ATOM 4448  H H    . ILE A 1 26 ? -2.350  6.339   4.619   1.00 0.00 ? 26 ILE A H    4  
ATOM 4449  H HA   . ILE A 1 26 ? -2.969  8.856   5.627   1.00 0.00 ? 26 ILE A HA   4  
ATOM 4450  H HB   . ILE A 1 26 ? -0.296  7.439   5.716   1.00 0.00 ? 26 ILE A HB   4  
ATOM 4451  H HG12 . ILE A 1 26 ? -2.579  7.465   7.709   1.00 0.00 ? 26 ILE A HG12 4  
ATOM 4452  H HG13 . ILE A 1 26 ? -2.219  6.133   6.622   1.00 0.00 ? 26 ILE A HG13 4  
ATOM 4453  H HG21 . ILE A 1 26 ? 0.112   8.812   7.736   1.00 0.00 ? 26 ILE A HG21 4  
ATOM 4454  H HG22 . ILE A 1 26 ? -1.374  9.697   7.406   1.00 0.00 ? 26 ILE A HG22 4  
ATOM 4455  H HG23 . ILE A 1 26 ? -0.022  9.782   6.282   1.00 0.00 ? 26 ILE A HG23 4  
ATOM 4456  H HD11 . ILE A 1 26 ? -1.343  5.550   8.709   1.00 0.00 ? 26 ILE A HD11 4  
ATOM 4457  H HD12 . ILE A 1 26 ? -0.572  7.120   8.916   1.00 0.00 ? 26 ILE A HD12 4  
ATOM 4458  H HD13 . ILE A 1 26 ? 0.039   5.989   7.707   1.00 0.00 ? 26 ILE A HD13 4  
ATOM 4459  N N    . ILE A 1 27 ? -0.727  8.942   3.228   1.00 0.00 ? 27 ILE A N    4  
ATOM 4460  C CA   . ILE A 1 27 ? -0.040  9.827   2.295   1.00 0.00 ? 27 ILE A CA   4  
ATOM 4461  C C    . ILE A 1 27 ? -1.029  10.536  1.374   1.00 0.00 ? 27 ILE A C    4  
ATOM 4462  O O    . ILE A 1 27 ? -0.841  11.700  1.027   1.00 0.00 ? 27 ILE A O    4  
ATOM 4463  C CB   . ILE A 1 27 ? 0.986   9.057   1.443   1.00 0.00 ? 27 ILE A CB   4  
ATOM 4464  C CG1  . ILE A 1 27 ? 1.990   8.334   2.344   1.00 0.00 ? 27 ILE A CG1  4  
ATOM 4465  C CG2  . ILE A 1 27 ? 1.704   10.003  0.489   1.00 0.00 ? 27 ILE A CG2  4  
ATOM 4466  C CD1  . ILE A 1 27 ? 2.769   9.258   3.259   1.00 0.00 ? 27 ILE A CD1  4  
ATOM 4467  H H    . ILE A 1 27 ? -0.637  7.967   3.114   1.00 0.00 ? 27 ILE A H    4  
ATOM 4468  H HA   . ILE A 1 27 ? 0.485   10.580  2.866   1.00 0.00 ? 27 ILE A HA   4  
ATOM 4469  H HB   . ILE A 1 27 ? 0.457   8.323   0.851   1.00 0.00 ? 27 ILE A HB   4  
ATOM 4470  H HG12 . ILE A 1 27 ? 1.472   7.635   2.968   1.00 0.00 ? 27 ILE A HG12 4  
ATOM 4471  H HG13 . ILE A 1 27 ? 2.702   7.799   1.731   1.00 0.00 ? 27 ILE A HG13 4  
ATOM 4472  H HG21 . ILE A 1 27 ? 2.068   10.867  1.028   1.00 0.00 ? 27 ILE A HG21 4  
ATOM 4473  H HG22 . ILE A 1 27 ? 1.025   10.324  -0.287  1.00 0.00 ? 27 ILE A HG22 4  
ATOM 4474  H HG23 . ILE A 1 27 ? 2.541   9.493   0.029   1.00 0.00 ? 27 ILE A HG23 4  
ATOM 4475  H HD11 . ILE A 1 27 ? 3.529   8.687   3.772   1.00 0.00 ? 27 ILE A HD11 4  
ATOM 4476  H HD12 . ILE A 1 27 ? 2.105   9.696   3.988   1.00 0.00 ? 27 ILE A HD12 4  
ATOM 4477  H HD13 . ILE A 1 27 ? 3.242   10.040  2.685   1.00 0.00 ? 27 ILE A HD13 4  
ATOM 4478  N N    . LEU A 1 28 ? -2.082  9.825   0.980   1.00 0.00 ? 28 LEU A N    4  
ATOM 4479  C CA   . LEU A 1 28 ? -3.096  10.393  0.100   1.00 0.00 ? 28 LEU A CA   4  
ATOM 4480  C C    . LEU A 1 28 ? -3.709  11.643  0.719   1.00 0.00 ? 28 LEU A C    4  
ATOM 4481  O O    . LEU A 1 28 ? -3.867  12.665  0.051   1.00 0.00 ? 28 LEU A O    4  
ATOM 4482  C CB   . LEU A 1 28 ? -4.189  9.360   -0.186  1.00 0.00 ? 28 LEU A CB   4  
ATOM 4483  C CG   . LEU A 1 28 ? -5.266  9.813   -1.176  1.00 0.00 ? 28 LEU A CG   4  
ATOM 4484  C CD1  . LEU A 1 28 ? -4.659  10.080  -2.545  1.00 0.00 ? 28 LEU A CD1  4  
ATOM 4485  C CD2  . LEU A 1 28 ? -6.369  8.770   -1.275  1.00 0.00 ? 28 LEU A CD2  4  
ATOM 4486  H H    . LEU A 1 28 ? -2.183  8.892   1.283   1.00 0.00 ? 28 LEU A H    4  
ATOM 4487  H HA   . LEU A 1 28 ? -2.613  10.664  -0.827  1.00 0.00 ? 28 LEU A HA   4  
ATOM 4488  H HB2  . LEU A 1 28 ? -3.716  8.468   -0.576  1.00 0.00 ? 28 LEU A HB2  4  
ATOM 4489  H HB3  . LEU A 1 28 ? -4.670  9.108   0.749   1.00 0.00 ? 28 LEU A HB3  4  
ATOM 4490  H HG   . LEU A 1 28 ? -5.712  10.732  -0.826  1.00 0.00 ? 28 LEU A HG   4  
ATOM 4491  H HD11 . LEU A 1 28 ? -5.440  10.358  -3.241  1.00 0.00 ? 28 LEU A HD11 4  
ATOM 4492  H HD12 . LEU A 1 28 ? -4.162  9.190   -2.905  1.00 0.00 ? 28 LEU A HD12 4  
ATOM 4493  H HD13 . LEU A 1 28 ? -3.945  10.887  -2.476  1.00 0.00 ? 28 LEU A HD13 4  
ATOM 4494  H HD21 . LEU A 1 28 ? -6.807  8.612   -0.299  1.00 0.00 ? 28 LEU A HD21 4  
ATOM 4495  H HD22 . LEU A 1 28 ? -5.959  7.837   -1.638  1.00 0.00 ? 28 LEU A HD22 4  
ATOM 4496  H HD23 . LEU A 1 28 ? -7.135  9.115   -1.957  1.00 0.00 ? 28 LEU A HD23 4  
ATOM 4497  N N    . ILE A 1 29 ? -4.050  11.555  2.001   1.00 0.00 ? 29 ILE A N    4  
ATOM 4498  C CA   . ILE A 1 29 ? -4.643  12.681  2.714   1.00 0.00 ? 29 ILE A CA   4  
ATOM 4499  C C    . ILE A 1 29 ? -3.576  13.695  3.113   1.00 0.00 ? 29 ILE A C    4  
ATOM 4500  O O    . ILE A 1 29 ? -3.835  14.898  3.150   1.00 0.00 ? 29 ILE A O    4  
ATOM 4501  C CB   . ILE A 1 29 ? -5.402  12.208  3.971   1.00 0.00 ? 29 ILE A CB   4  
ATOM 4502  C CG1  . ILE A 1 29 ? -6.543  11.268  3.570   1.00 0.00 ? 29 ILE A CG1  4  
ATOM 4503  C CG2  . ILE A 1 29 ? -5.937  13.401  4.754   1.00 0.00 ? 29 ILE A CG2  4  
ATOM 4504  C CD1  . ILE A 1 29 ? -7.231  10.605  4.744   1.00 0.00 ? 29 ILE A CD1  4  
ATOM 4505  H H    . ILE A 1 29 ? -3.898  10.711  2.489   1.00 0.00 ? 29 ILE A H    4  
ATOM 4506  H HA   . ILE A 1 29 ? -5.354  13.165  2.056   1.00 0.00 ? 29 ILE A HA   4  
ATOM 4507  H HB   . ILE A 1 29 ? -4.708  11.673  4.604   1.00 0.00 ? 29 ILE A HB   4  
ATOM 4508  H HG12 . ILE A 1 29 ? -7.290  11.822  3.020   1.00 0.00 ? 29 ILE A HG12 4  
ATOM 4509  H HG13 . ILE A 1 29 ? -6.156  10.479  2.938   1.00 0.00 ? 29 ILE A HG13 4  
ATOM 4510  H HG21 . ILE A 1 29 ? -5.125  14.025  5.091   1.00 0.00 ? 29 ILE A HG21 4  
ATOM 4511  H HG22 . ILE A 1 29 ? -6.484  13.054  5.619   1.00 0.00 ? 29 ILE A HG22 4  
ATOM 4512  H HG23 . ILE A 1 29 ? -6.596  13.976  4.129   1.00 0.00 ? 29 ILE A HG23 4  
ATOM 4513  H HD11 . ILE A 1 29 ? -7.905  9.844   4.380   1.00 0.00 ? 29 ILE A HD11 4  
ATOM 4514  H HD12 . ILE A 1 29 ? -7.791  11.343  5.299   1.00 0.00 ? 29 ILE A HD12 4  
ATOM 4515  H HD13 . ILE A 1 29 ? -6.493  10.150  5.391   1.00 0.00 ? 29 ILE A HD13 4  
ATOM 4516  N N    . MET A 1 30 ? -2.373  13.203  3.404   1.00 0.00 ? 30 MET A N    4  
ATOM 4517  C CA   . MET A 1 30 ? -1.267  14.072  3.791   1.00 0.00 ? 30 MET A CA   4  
ATOM 4518  C C    . MET A 1 30 ? -0.974  15.080  2.685   1.00 0.00 ? 30 MET A C    4  
ATOM 4519  O O    . MET A 1 30 ? -0.753  16.263  2.949   1.00 0.00 ? 30 MET A O    4  
ATOM 4520  C CB   . MET A 1 30 ? -0.015  13.244  4.089   1.00 0.00 ? 30 MET A CB   4  
ATOM 4521  C CG   . MET A 1 30 ? 1.174   14.080  4.537   1.00 0.00 ? 30 MET A CG   4  
ATOM 4522  S SD   . MET A 1 30 ? 2.658   13.092  4.804   1.00 0.00 ? 30 MET A SD   4  
ATOM 4523  C CE   . MET A 1 30 ? 2.114   12.005  6.120   1.00 0.00 ? 30 MET A CE   4  
ATOM 4524  H H    . MET A 1 30 ? -2.218  12.231  3.359   1.00 0.00 ? 30 MET A H    4  
ATOM 4525  H HA   . MET A 1 30 ? -1.555  14.608  4.686   1.00 0.00 ? 30 MET A HA   4  
ATOM 4526  H HB2  . MET A 1 30 ? -0.249  12.543  4.873   1.00 0.00 ? 30 MET A HB2  4  
ATOM 4527  H HB3  . MET A 1 30 ? 0.262   12.699  3.198   1.00 0.00 ? 30 MET A HB3  4  
ATOM 4528  H HG2  . MET A 1 30 ? 1.396   14.820  3.783   1.00 0.00 ? 30 MET A HG2  4  
ATOM 4529  H HG3  . MET A 1 30 ? 0.920   14.576  5.462   1.00 0.00 ? 30 MET A HG3  4  
ATOM 4530  H HE1  . MET A 1 30 ? 1.508   12.560  6.821   1.00 0.00 ? 30 MET A HE1  4  
ATOM 4531  H HE2  . MET A 1 30 ? 2.975   11.600  6.631   1.00 0.00 ? 30 MET A HE2  4  
ATOM 4532  H HE3  . MET A 1 30 ? 1.533   11.199  5.701   1.00 0.00 ? 30 MET A HE3  4  
ATOM 4533  N N    . LEU A 1 31 ? -0.980  14.600  1.445   1.00 0.00 ? 31 LEU A N    4  
ATOM 4534  C CA   . LEU A 1 31 ? -0.726  15.454  0.293   1.00 0.00 ? 31 LEU A CA   4  
ATOM 4535  C C    . LEU A 1 31 ? -1.985  16.232  -0.075  1.00 0.00 ? 31 LEU A C    4  
ATOM 4536  O O    . LEU A 1 31 ? -1.911  17.311  -0.664  1.00 0.00 ? 31 LEU A O    4  
ATOM 4537  C CB   . LEU A 1 31 ? -0.264  14.613  -0.899  1.00 0.00 ? 31 LEU A CB   4  
ATOM 4538  C CG   . LEU A 1 31 ? 0.080   15.408  -2.161  1.00 0.00 ? 31 LEU A CG   4  
ATOM 4539  C CD1  . LEU A 1 31 ? 1.334   16.240  -1.944  1.00 0.00 ? 31 LEU A CD1  4  
ATOM 4540  C CD2  . LEU A 1 31 ? 0.256   14.469  -3.345  1.00 0.00 ? 31 LEU A CD2  4  
ATOM 4541  H H    . LEU A 1 31 ? -1.167  13.643  1.293   1.00 0.00 ? 31 LEU A H    4  
ATOM 4542  H HA   . LEU A 1 31 ? 0.057   16.150  0.550   1.00 0.00 ? 31 LEU A HA   4  
ATOM 4543  H HB2  . LEU A 1 31 ? 0.608   14.047  -0.595  1.00 0.00 ? 31 LEU A HB2  4  
ATOM 4544  H HB3  . LEU A 1 31 ? -1.055  13.912  -1.138  1.00 0.00 ? 31 LEU A HB3  4  
ATOM 4545  H HG   . LEU A 1 31 ? -0.727  16.083  -2.400  1.00 0.00 ? 31 LEU A HG   4  
ATOM 4546  H HD11 . LEU A 1 31 ? 1.167   16.942  -1.147  1.00 0.00 ? 31 LEU A HD11 4  
ATOM 4547  H HD12 . LEU A 1 31 ? 1.571   16.783  -2.849  1.00 0.00 ? 31 LEU A HD12 4  
ATOM 4548  H HD13 . LEU A 1 31 ? 2.162   15.594  -1.687  1.00 0.00 ? 31 LEU A HD13 4  
ATOM 4549  H HD21 . LEU A 1 31 ? 1.072   13.786  -3.152  1.00 0.00 ? 31 LEU A HD21 4  
ATOM 4550  H HD22 . LEU A 1 31 ? 0.473   15.044  -4.235  1.00 0.00 ? 31 LEU A HD22 4  
ATOM 4551  H HD23 . LEU A 1 31 ? -0.654  13.906  -3.500  1.00 0.00 ? 31 LEU A HD23 4  
ATOM 4552  N N    . TRP A 1 32 ? -3.138  15.673  0.280   1.00 0.00 ? 32 TRP A N    4  
ATOM 4553  C CA   . TRP A 1 32 ? -4.418  16.308  -0.005  1.00 0.00 ? 32 TRP A CA   4  
ATOM 4554  C C    . TRP A 1 32 ? -4.528  17.646  0.719   1.00 0.00 ? 32 TRP A C    4  
ATOM 4555  O O    . TRP A 1 32 ? -5.179  18.574  0.237   1.00 0.00 ? 32 TRP A O    4  
ATOM 4556  C CB   . TRP A 1 32 ? -5.568  15.386  0.413   1.00 0.00 ? 32 TRP A CB   4  
ATOM 4557  C CG   . TRP A 1 32 ? -6.927  15.973  0.171   1.00 0.00 ? 32 TRP A CG   4  
ATOM 4558  C CD1  . TRP A 1 32 ? -7.444  16.385  -1.025  1.00 0.00 ? 32 TRP A CD1  4  
ATOM 4559  C CD2  . TRP A 1 32 ? -7.946  16.209  1.150   1.00 0.00 ? 32 TRP A CD2  4  
ATOM 4560  N NE1  . TRP A 1 32 ? -8.718  16.865  -0.847  1.00 0.00 ? 32 TRP A NE1  4  
ATOM 4561  C CE2  . TRP A 1 32 ? -9.049  16.767  0.478   1.00 0.00 ? 32 TRP A CE2  4  
ATOM 4562  C CE3  . TRP A 1 32 ? -8.031  16.001  2.530   1.00 0.00 ? 32 TRP A CE3  4  
ATOM 4563  C CZ2  . TRP A 1 32 ? -10.223 17.122  1.139   1.00 0.00 ? 32 TRP A CZ2  4  
ATOM 4564  C CZ3  . TRP A 1 32 ? -9.197  16.354  3.185   1.00 0.00 ? 32 TRP A CZ3  4  
ATOM 4565  C CH2  . TRP A 1 32 ? -10.279 16.908  2.489   1.00 0.00 ? 32 TRP A CH2  4  
ATOM 4566  H H    . TRP A 1 32 ? -3.138  14.808  0.738   1.00 0.00 ? 32 TRP A H    4  
ATOM 4567  H HA   . TRP A 1 32 ? -4.480  16.482  -1.071  1.00 0.00 ? 32 TRP A HA   4  
ATOM 4568  H HB2  . TRP A 1 32 ? -5.504  14.466  -0.146  1.00 0.00 ? 32 TRP A HB2  4  
ATOM 4569  H HB3  . TRP A 1 32 ? -5.480  15.170  1.463   1.00 0.00 ? 32 TRP A HB3  4  
ATOM 4570  H HD1  . TRP A 1 32 ? -6.915  16.337  -1.965  1.00 0.00 ? 32 TRP A HD1  4  
ATOM 4571  H HE1  . TRP A 1 32 ? -9.291  17.213  -1.546  1.00 0.00 ? 32 TRP A HE1  4  
ATOM 4572  H HE3  . TRP A 1 32 ? -7.208  15.583  3.080   1.00 0.00 ? 32 TRP A HE3  4  
ATOM 4573  H HZ2  . TRP A 1 32 ? -11.066 17.550  0.617   1.00 0.00 ? 32 TRP A HZ2  4  
ATOM 4574  H HZ3  . TRP A 1 32 ? -9.282  16.202  4.251   1.00 0.00 ? 32 TRP A HZ3  4  
ATOM 4575  H HH2  . TRP A 1 32 ? -11.169 17.169  3.042   1.00 0.00 ? 32 TRP A HH2  4  
ATOM 4576  N N    . GLN A 1 33 ? -3.885  17.740  1.878   1.00 0.00 ? 33 GLN A N    4  
ATOM 4577  C CA   . GLN A 1 33 ? -3.905  18.965  2.670   1.00 0.00 ? 33 GLN A CA   4  
ATOM 4578  C C    . GLN A 1 33 ? -2.573  19.704  2.563   1.00 0.00 ? 33 GLN A C    4  
ATOM 4579  O O    . GLN A 1 33 ? -2.358  20.715  3.233   1.00 0.00 ? 33 GLN A O    4  
ATOM 4580  C CB   . GLN A 1 33 ? -4.214  18.647  4.134   1.00 0.00 ? 33 GLN A CB   4  
ATOM 4581  C CG   . GLN A 1 33 ? -5.616  18.100  4.358   1.00 0.00 ? 33 GLN A CG   4  
ATOM 4582  C CD   . GLN A 1 33 ? -6.699  19.077  3.939   1.00 0.00 ? 33 GLN A CD   4  
ATOM 4583  O OE1  . GLN A 1 33 ? -7.157  19.894  4.737   1.00 0.00 ? 33 GLN A OE1  4  
ATOM 4584  N NE2  . GLN A 1 33 ? -7.116  18.994  2.680   1.00 0.00 ? 33 GLN A NE2  4  
ATOM 4585  H H    . GLN A 1 33 ? -3.376  16.972  2.225   1.00 0.00 ? 33 GLN A H    4  
ATOM 4586  H HA   . GLN A 1 33 ? -4.671  19.625  2.288   1.00 0.00 ? 33 GLN A HA   4  
ATOM 4587  H HB2  . GLN A 1 33 ? -3.506  17.911  4.486   1.00 0.00 ? 33 GLN A HB2  4  
ATOM 4588  H HB3  . GLN A 1 33 ? -4.107  19.547  4.727   1.00 0.00 ? 33 GLN A HB3  4  
ATOM 4589  H HG2  . GLN A 1 33 ? -5.728  17.187  3.790   1.00 0.00 ? 33 GLN A HG2  4  
ATOM 4590  H HG3  . GLN A 1 33 ? -5.737  17.883  5.409   1.00 0.00 ? 33 GLN A HG3  4  
ATOM 4591  H HE21 . GLN A 1 33 ? -6.712  18.333  2.091   1.00 0.00 ? 33 GLN A HE21 4  
ATOM 4592  H HE22 . GLN A 1 33 ? -7.822  19.609  2.392   1.00 0.00 ? 33 GLN A HE22 4  
ATOM 4593  N N    . LYS A 1 34 ? -1.681  19.192  1.719   1.00 0.00 ? 34 LYS A N    4  
ATOM 4594  C CA   . LYS A 1 34 ? -0.374  19.807  1.519   1.00 0.00 ? 34 LYS A CA   4  
ATOM 4595  C C    . LYS A 1 34 ? -0.410  20.764  0.330   1.00 0.00 ? 34 LYS A C    4  
ATOM 4596  O O    . LYS A 1 34 ? 0.202   21.832  0.360   1.00 0.00 ? 34 LYS A O    4  
ATOM 4597  C CB   . LYS A 1 34 ? 0.694   18.733  1.293   1.00 0.00 ? 34 LYS A CB   4  
ATOM 4598  C CG   . LYS A 1 34 ? 2.100   19.295  1.140   1.00 0.00 ? 34 LYS A CG   4  
ATOM 4599  C CD   . LYS A 1 34 ? 3.128   18.191  0.943   1.00 0.00 ? 34 LYS A CD   4  
ATOM 4600  C CE   . LYS A 1 34 ? 3.275   17.330  2.190   1.00 0.00 ? 34 LYS A CE   4  
ATOM 4601  N NZ   . LYS A 1 34 ? 4.222   16.199  1.976   1.00 0.00 ? 34 LYS A NZ   4  
ATOM 4602  H H    . LYS A 1 34 ? -1.895  18.398  1.208   1.00 0.00 ? 34 LYS A H    4  
ATOM 4603  H HA   . LYS A 1 34 ? -0.109  20.371  2.406   1.00 0.00 ? 34 LYS A HA   4  
ATOM 4604  H HB2  . LYS A 1 34 ? 0.674   18.064  2.134   1.00 0.00 ? 34 LYS A HB2  4  
ATOM 4605  H HB3  . LYS A 1 34 ? 0.446   18.185  0.400   1.00 0.00 ? 34 LYS A HB3  4  
ATOM 4606  H HG2  . LYS A 1 34 ? 2.130   19.944  0.278   1.00 0.00 ? 34 LYS A HG2  4  
ATOM 4607  H HG3  . LYS A 1 34 ? 2.352   19.862  2.026   1.00 0.00 ? 34 LYS A HG3  4  
ATOM 4608  H HD2  . LYS A 1 34 ? 2.828   17.564  0.117   1.00 0.00 ? 34 LYS A HD2  4  
ATOM 4609  H HD3  . LYS A 1 34 ? 4.083   18.644  0.720   1.00 0.00 ? 34 LYS A HD3  4  
ATOM 4610  H HE2  . LYS A 1 34 ? 3.644   17.944  2.997   1.00 0.00 ? 34 LYS A HE2  4  
ATOM 4611  H HE3  . LYS A 1 34 ? 2.316   16.920  2.463   1.00 0.00 ? 34 LYS A HE3  4  
ATOM 4612  H HZ1  . LYS A 1 34 ? 5.167   16.560  1.729   1.00 0.00 ? 34 LYS A HZ1  4  
ATOM 4613  H HZ2  . LYS A 1 34 ? 3.885   15.585  1.206   1.00 0.00 ? 34 LYS A HZ2  4  
ATOM 4614  H HZ3  . LYS A 1 34 ? 4.298   15.632  2.845   1.00 0.00 ? 34 LYS A HZ3  4  
ATOM 4615  N N    . LYS A 1 35 ? -1.133  20.368  -0.713  1.00 0.00 ? 35 LYS A N    4  
ATOM 4616  C CA   . LYS A 1 35 ? -1.261  21.189  -1.911  1.00 0.00 ? 35 LYS A CA   4  
ATOM 4617  C C    . LYS A 1 35 ? -2.714  21.622  -2.117  1.00 0.00 ? 35 LYS A C    4  
ATOM 4618  O O    . LYS A 1 35 ? -3.597  20.779  -2.281  1.00 0.00 ? 35 LYS A O    4  
ATOM 4619  C CB   . LYS A 1 35 ? -0.774  20.416  -3.139  1.00 0.00 ? 35 LYS A CB   4  
ATOM 4620  C CG   . LYS A 1 35 ? 0.724   20.145  -3.139  1.00 0.00 ? 35 LYS A CG   4  
ATOM 4621  C CD   . LYS A 1 35 ? 1.534   21.432  -3.193  1.00 0.00 ? 35 LYS A CD   4  
ATOM 4622  C CE   . LYS A 1 35 ? 1.287   22.199  -4.483  1.00 0.00 ? 35 LYS A CE   4  
ATOM 4623  N NZ   . LYS A 1 35 ? 2.180   23.384  -4.605  1.00 0.00 ? 35 LYS A NZ   4  
ATOM 4624  H H    . LYS A 1 35 ? -1.602  19.504  -0.691  1.00 0.00 ? 35 LYS A H    4  
ATOM 4625  H HA   . LYS A 1 35 ? -0.647  22.058  -1.796  1.00 0.00 ? 35 LYS A HA   4  
ATOM 4626  H HB2  . LYS A 1 35 ? -1.281  19.461  -3.159  1.00 0.00 ? 35 LYS A HB2  4  
ATOM 4627  H HB3  . LYS A 1 35 ? -1.031  20.957  -4.038  1.00 0.00 ? 35 LYS A HB3  4  
ATOM 4628  H HG2  . LYS A 1 35 ? 0.982   19.611  -2.236  1.00 0.00 ? 35 LYS A HG2  4  
ATOM 4629  H HG3  . LYS A 1 35 ? 0.969   19.536  -3.998  1.00 0.00 ? 35 LYS A HG3  4  
ATOM 4630  H HD2  . LYS A 1 35 ? 1.286   22.060  -2.354  1.00 0.00 ? 35 LYS A HD2  4  
ATOM 4631  H HD3  . LYS A 1 35 ? 2.582   21.176  -3.143  1.00 0.00 ? 35 LYS A HD3  4  
ATOM 4632  H HE2  . LYS A 1 35 ? 1.463   21.545  -5.325  1.00 0.00 ? 35 LYS A HE2  4  
ATOM 4633  H HE3  . LYS A 1 35 ? 0.264   22.539  -4.501  1.00 0.00 ? 35 LYS A HE3  4  
ATOM 4634  H HZ1  . LYS A 1 35 ? 3.178   23.087  -4.601  1.00 0.00 ? 35 LYS A HZ1  4  
ATOM 4635  H HZ2  . LYS A 1 35 ? 2.022   24.040  -3.813  1.00 0.00 ? 35 LYS A HZ2  4  
ATOM 4636  H HZ3  . LYS A 1 35 ? 1.984   23.885  -5.496  1.00 0.00 ? 35 LYS A HZ3  4  
ATOM 4637  N N    . PRO A 1 36 ? -2.989  22.941  -2.110  1.00 0.00 ? 36 PRO A N    4  
ATOM 4638  C CA   . PRO A 1 36 ? -4.348  23.462  -2.297  1.00 0.00 ? 36 PRO A CA   4  
ATOM 4639  C C    . PRO A 1 36 ? -4.940  23.052  -3.642  1.00 0.00 ? 36 PRO A C    4  
ATOM 4640  O O    . PRO A 1 36 ? -4.212  22.701  -4.569  1.00 0.00 ? 36 PRO A O    4  
ATOM 4641  C CB   . PRO A 1 36 ? -4.173  24.985  -2.232  1.00 0.00 ? 36 PRO A CB   4  
ATOM 4642  C CG   . PRO A 1 36 ? -2.867  25.197  -1.545  1.00 0.00 ? 36 PRO A CG   4  
ATOM 4643  C CD   . PRO A 1 36 ? -2.009  24.026  -1.923  1.00 0.00 ? 36 PRO A CD   4  
ATOM 4644  H HA   . PRO A 1 36 ? -5.004  23.138  -1.501  1.00 0.00 ? 36 PRO A HA   4  
ATOM 4645  H HB2  . PRO A 1 36 ? -4.160  25.414  -3.227  1.00 0.00 ? 36 PRO A HB2  4  
ATOM 4646  H HB3  . PRO A 1 36 ? -4.984  25.415  -1.664  1.00 0.00 ? 36 PRO A HB3  4  
ATOM 4647  H HG2  . PRO A 1 36 ? -2.417  26.118  -1.887  1.00 0.00 ? 36 PRO A HG2  4  
ATOM 4648  H HG3  . PRO A 1 36 ? -3.014  25.224  -0.475  1.00 0.00 ? 36 PRO A HG3  4  
ATOM 4649  H HD2  . PRO A 1 36 ? -1.471  24.229  -2.838  1.00 0.00 ? 36 PRO A HD2  4  
ATOM 4650  H HD3  . PRO A 1 36 ? -1.326  23.804  -1.118  1.00 0.00 ? 36 PRO A HD3  4  
ATOM 4651  N N    . ARG A 1 37 ? -6.266  23.097  -3.739  1.00 0.00 ? 37 ARG A N    4  
ATOM 4652  C CA   . ARG A 1 37 ? -6.954  22.728  -4.970  1.00 0.00 ? 37 ARG A CA   4  
ATOM 4653  C C    . ARG A 1 37 ? -7.109  23.937  -5.888  1.00 0.00 ? 37 ARG A C    4  
ATOM 4654  O O    . ARG A 1 37 ? -7.341  25.055  -5.425  1.00 0.00 ? 37 ARG A O    4  
ATOM 4655  C CB   . ARG A 1 37 ? -8.328  22.132  -4.654  1.00 0.00 ? 37 ARG A CB   4  
ATOM 4656  C CG   . ARG A 1 37 ? -9.057  21.601  -5.877  1.00 0.00 ? 37 ARG A CG   4  
ATOM 4657  C CD   . ARG A 1 37 ? -10.408 21.007  -5.509  1.00 0.00 ? 37 ARG A CD   4  
ATOM 4658  N NE   . ARG A 1 37 ? -10.281 19.922  -4.540  1.00 0.00 ? 37 ARG A NE   4  
ATOM 4659  C CZ   . ARG A 1 37 ? -11.313 19.227  -4.070  1.00 0.00 ? 37 ARG A CZ   4  
ATOM 4660  N NH1  . ARG A 1 37 ? -12.546 19.502  -4.478  1.00 0.00 ? 37 ARG A NH1  4  
ATOM 4661  N NH2  . ARG A 1 37 ? -11.111 18.255  -3.191  1.00 0.00 ? 37 ARG A NH2  4  
ATOM 4662  H H    . ARG A 1 37 ? -6.800  23.389  -2.961  1.00 0.00 ? 37 ARG A H    4  
ATOM 4663  H HA   . ARG A 1 37 ? -6.364  21.972  -5.480  1.00 0.00 ? 37 ARG A HA   4  
ATOM 4664  H HB2  . ARG A 1 37 ? -8.188  21.324  -3.954  1.00 0.00 ? 37 ARG A HB2  4  
ATOM 4665  H HB3  . ARG A 1 37 ? -8.943  22.893  -4.190  1.00 0.00 ? 37 ARG A HB3  4  
ATOM 4666  H HG2  . ARG A 1 37 ? -9.216  22.408  -6.576  1.00 0.00 ? 37 ARG A HG2  4  
ATOM 4667  H HG3  . ARG A 1 37 ? -8.452  20.835  -6.340  1.00 0.00 ? 37 ARG A HG3  4  
ATOM 4668  H HD2  . ARG A 1 37 ? -11.029 21.785  -5.087  1.00 0.00 ? 37 ARG A HD2  4  
ATOM 4669  H HD3  . ARG A 1 37 ? -10.873 20.625  -6.407  1.00 0.00 ? 37 ARG A HD3  4  
ATOM 4670  H HE   . ARG A 1 37 ? -9.381  19.680  -4.225  1.00 0.00 ? 37 ARG A HE   4  
ATOM 4671  H HH11 . ARG A 1 37 ? -12.724 20.229  -5.140  1.00 0.00 ? 37 ARG A HH11 4  
ATOM 4672  H HH12 . ARG A 1 37 ? -13.317 18.972  -4.118  1.00 0.00 ? 37 ARG A HH12 4  
ATOM 4673  H HH21 . ARG A 1 37 ? -10.188 18.048  -2.890  1.00 0.00 ? 37 ARG A HH21 4  
ATOM 4674  H HH22 . ARG A 1 37 ? -11.884 17.729  -2.829  1.00 0.00 ? 37 ARG A HH22 4  
ATOM 4675  N N    . TYR A 1 38 ? -6.982  23.703  -7.189  1.00 0.00 ? 38 TYR A N    4  
ATOM 4676  C CA   . TYR A 1 38 ? -7.105  24.771  -8.175  1.00 0.00 ? 38 TYR A CA   4  
ATOM 4677  C C    . TYR A 1 38 ? -7.751  24.254  -9.456  1.00 0.00 ? 38 TYR A C    4  
ATOM 4678  O O    . TYR A 1 38 ? -7.465  23.141  -9.898  1.00 0.00 ? 38 TYR A O    4  
ATOM 4679  C CB   . TYR A 1 38 ? -5.731  25.367  -8.486  1.00 0.00 ? 38 TYR A CB   4  
ATOM 4680  C CG   . TYR A 1 38 ? -5.786  26.566  -9.406  1.00 0.00 ? 38 TYR A CG   4  
ATOM 4681  C CD1  . TYR A 1 38 ? -6.113  27.824  -8.918  1.00 0.00 ? 38 TYR A CD1  4  
ATOM 4682  C CD2  . TYR A 1 38 ? -5.511  26.440  -10.762 1.00 0.00 ? 38 TYR A CD2  4  
ATOM 4683  C CE1  . TYR A 1 38 ? -6.166  28.923  -9.754  1.00 0.00 ? 38 TYR A CE1  4  
ATOM 4684  C CE2  . TYR A 1 38 ? -5.561  27.534  -11.605 1.00 0.00 ? 38 TYR A CE2  4  
ATOM 4685  C CZ   . TYR A 1 38 ? -5.889  28.773  -11.095 1.00 0.00 ? 38 TYR A CZ   4  
ATOM 4686  O OH   . TYR A 1 38 ? -5.939  29.866  -11.930 1.00 0.00 ? 38 TYR A OH   4  
ATOM 4687  H H    . TYR A 1 38 ? -6.794  22.785  -7.501  1.00 0.00 ? 38 TYR A H    4  
ATOM 4688  H HA   . TYR A 1 38 ? -7.737  25.551  -7.763  1.00 0.00 ? 38 TYR A HA   4  
ATOM 4689  H HB2  . TYR A 1 38 ? -5.270  25.677  -7.557  1.00 0.00 ? 38 TYR A HB2  4  
ATOM 4690  H HB3  . TYR A 1 38 ? -5.108  24.607  -8.944  1.00 0.00 ? 38 TYR A HB3  4  
ATOM 4691  H HD1  . TYR A 1 38 ? -6.330  27.943  -7.865  1.00 0.00 ? 38 TYR A HD1  4  
ATOM 4692  H HD2  . TYR A 1 38 ? -5.255  25.469  -11.162 1.00 0.00 ? 38 TYR A HD2  4  
ATOM 4693  H HE1  . TYR A 1 38 ? -6.422  29.893  -9.355  1.00 0.00 ? 38 TYR A HE1  4  
ATOM 4694  H HE2  . TYR A 1 38 ? -5.344  27.416  -12.656 1.00 0.00 ? 38 TYR A HE2  4  
ATOM 4695  H HH   . TYR A 1 38 ? -5.059  30.239  -12.022 1.00 0.00 ? 38 TYR A HH   4  
ATOM 4696  N N    . GLU A 1 39 ? -8.621  25.071  -10.046 1.00 0.00 ? 39 GLU A N    4  
ATOM 4697  C CA   . GLU A 1 39 ? -9.314  24.703  -11.278 1.00 0.00 ? 39 GLU A CA   4  
ATOM 4698  C C    . GLU A 1 39 ? -10.099 23.406  -11.100 1.00 0.00 ? 39 GLU A C    4  
ATOM 4699  O O    . GLU A 1 39 ? -9.555  22.312  -11.266 1.00 0.00 ? 39 GLU A O    4  
ATOM 4700  C CB   . GLU A 1 39 ? -8.314  24.555  -12.428 1.00 0.00 ? 39 GLU A CB   4  
ATOM 4701  C CG   . GLU A 1 39 ? -8.968  24.267  -13.769 1.00 0.00 ? 39 GLU A CG   4  
ATOM 4702  C CD   . GLU A 1 39 ? -7.954  24.070  -14.880 1.00 0.00 ? 39 GLU A CD   4  
ATOM 4703  O OE1  . GLU A 1 39 ? -7.556  25.076  -15.503 1.00 0.00 ? 39 GLU A OE1  4  
ATOM 4704  O OE2  . GLU A 1 39 ? -7.561  22.911  -15.125 1.00 0.00 ? 39 GLU A OE2  4  
ATOM 4705  O OXT  . GLU A 1 39 ? -11.302 23.510  -10.781 1.00 0.00 ? 39 GLU A OXT  4  
ATOM 4706  H H    . GLU A 1 39 ? -8.811  25.951  -9.649  1.00 0.00 ? 39 GLU A H    4  
ATOM 4707  H HA   . GLU A 1 39 ? -10.006 25.498  -11.516 1.00 0.00 ? 39 GLU A HA   4  
ATOM 4708  H HB2  . GLU A 1 39 ? -7.753  25.474  -12.517 1.00 0.00 ? 39 GLU A HB2  4  
ATOM 4709  H HB3  . GLU A 1 39 ? -7.630  23.750  -12.203 1.00 0.00 ? 39 GLU A HB3  4  
ATOM 4710  H HG2  . GLU A 1 39 ? -9.561  23.368  -13.692 1.00 0.00 ? 39 GLU A HG2  4  
ATOM 4711  H HG3  . GLU A 1 39 ? -9.607  25.098  -14.029 1.00 0.00 ? 39 GLU A HG3  4  
ATOM 4712  N N    . GLY B 1 1  ? -16.390 -20.848 -7.193  1.00 0.00 ? 1  GLY B N    4  
ATOM 4713  C CA   . GLY B 1 1  ? -15.498 -21.446 -6.215  1.00 0.00 ? 1  GLY B CA   4  
ATOM 4714  C C    . GLY B 1 1  ? -14.180 -21.882 -6.820  1.00 0.00 ? 1  GLY B C    4  
ATOM 4715  O O    . GLY B 1 1  ? -13.921 -23.077 -6.967  1.00 0.00 ? 1  GLY B O    4  
ATOM 4716  H H1   . GLY B 1 1  ? -15.952 -20.003 -7.617  1.00 0.00 ? 1  GLY B H1   4  
ATOM 4717  H H2   . GLY B 1 1  ? -17.279 -20.565 -6.733  1.00 0.00 ? 1  GLY B H2   4  
ATOM 4718  H H3   . GLY B 1 1  ? -16.609 -21.529 -7.950  1.00 0.00 ? 1  GLY B H3   4  
ATOM 4719  H HA2  . GLY B 1 1  ? -15.301 -20.725 -5.436  1.00 0.00 ? 1  GLY B HA2  4  
ATOM 4720  H HA3  . GLY B 1 1  ? -15.985 -22.307 -5.780  1.00 0.00 ? 1  GLY B HA3  4  
ATOM 4721  N N    . HIS B 1 2  ? -13.345 -20.910 -7.176  1.00 0.00 ? 2  HIS B N    4  
ATOM 4722  C CA   . HIS B 1 2  ? -12.045 -21.195 -7.770  1.00 0.00 ? 2  HIS B CA   4  
ATOM 4723  C C    . HIS B 1 2  ? -10.920 -20.863 -6.796  1.00 0.00 ? 2  HIS B C    4  
ATOM 4724  O O    . HIS B 1 2  ? -10.795 -19.726 -6.340  1.00 0.00 ? 2  HIS B O    4  
ATOM 4725  C CB   . HIS B 1 2  ? -11.869 -20.398 -9.065  1.00 0.00 ? 2  HIS B CB   4  
ATOM 4726  C CG   . HIS B 1 2  ? -12.922 -20.682 -10.090 1.00 0.00 ? 2  HIS B CG   4  
ATOM 4727  N ND1  . HIS B 1 2  ? -12.694 -21.458 -11.209 1.00 0.00 ? 2  HIS B ND1  4  
ATOM 4728  C CD2  . HIS B 1 2  ? -14.216 -20.288 -10.166 1.00 0.00 ? 2  HIS B CD2  4  
ATOM 4729  C CE1  . HIS B 1 2  ? -13.802 -21.528 -11.927 1.00 0.00 ? 2  HIS B CE1  4  
ATOM 4730  N NE2  . HIS B 1 2  ? -14.739 -20.827 -11.316 1.00 0.00 ? 2  HIS B NE2  4  
ATOM 4731  H H    . HIS B 1 2  ? -13.604 -19.969 -7.035  1.00 0.00 ? 2  HIS B H    4  
ATOM 4732  H HA   . HIS B 1 2  ? -11.993 -22.250 -8.018  1.00 0.00 ? 2  HIS B HA   4  
ATOM 4733  H HB2  . HIS B 1 2  ? -11.906 -19.341 -8.841  1.00 0.00 ? 2  HIS B HB2  4  
ATOM 4734  H HB3  . HIS B 1 2  ? -10.908 -20.635 -9.503  1.00 0.00 ? 2  HIS B HB3  4  
ATOM 4735  H HD1  . HIS B 1 2  ? -11.847 -21.892 -11.442 1.00 0.00 ? 2  HIS B HD1  4  
ATOM 4736  H HD2  . HIS B 1 2  ? -14.739 -19.665 -9.454  1.00 0.00 ? 2  HIS B HD2  4  
ATOM 4737  H HE1  . HIS B 1 2  ? -13.921 -22.068 -12.855 1.00 0.00 ? 2  HIS B HE1  4  
ATOM 4738  H HE2  . HIS B 1 2  ? -15.632 -20.644 -11.676 1.00 0.00 ? 2  HIS B HE2  4  
ATOM 4739  N N    . SER B 1 3  ? -10.101 -21.864 -6.477  1.00 0.00 ? 3  SER B N    4  
ATOM 4740  C CA   . SER B 1 3  ? -8.984  -21.678 -5.557  1.00 0.00 ? 3  SER B CA   4  
ATOM 4741  C C    . SER B 1 3  ? -7.665  -21.594 -6.317  1.00 0.00 ? 3  SER B C    4  
ATOM 4742  O O    . SER B 1 3  ? -7.422  -22.365 -7.246  1.00 0.00 ? 3  SER B O    4  
ATOM 4743  C CB   . SER B 1 3  ? -8.930  -22.826 -4.545  1.00 0.00 ? 3  SER B CB   4  
ATOM 4744  O OG   . SER B 1 3  ? -7.849  -22.661 -3.641  1.00 0.00 ? 3  SER B OG   4  
ATOM 4745  H H    . SER B 1 3  ? -10.244 -22.756 -6.872  1.00 0.00 ? 3  SER B H    4  
ATOM 4746  H HA   . SER B 1 3  ? -9.131  -20.754 -5.008  1.00 0.00 ? 3  SER B HA   4  
ATOM 4747  H HB2  . SER B 1 3  ? -9.851  -22.848 -3.982  1.00 0.00 ? 3  SER B HB2  4  
ATOM 4748  H HB3  . SER B 1 3  ? -8.807  -23.763 -5.069  1.00 0.00 ? 3  SER B HB3  4  
ATOM 4749  H HG   . SER B 1 3  ? -7.863  -23.369 -2.993  1.00 0.00 ? 3  SER B HG   4  
ATOM 4750  N N    . LEU B 1 4  ? -6.816  -20.653 -5.916  1.00 0.00 ? 4  LEU B N    4  
ATOM 4751  C CA   . LEU B 1 4  ? -5.521  -20.467 -6.561  1.00 0.00 ? 4  LEU B CA   4  
ATOM 4752  C C    . LEU B 1 4  ? -4.440  -21.293 -5.864  1.00 0.00 ? 4  LEU B C    4  
ATOM 4753  O O    . LEU B 1 4  ? -4.553  -21.593 -4.675  1.00 0.00 ? 4  LEU B O    4  
ATOM 4754  C CB   . LEU B 1 4  ? -5.132  -18.986 -6.553  1.00 0.00 ? 4  LEU B CB   4  
ATOM 4755  C CG   . LEU B 1 4  ? -5.630  -18.175 -7.753  1.00 0.00 ? 4  LEU B CG   4  
ATOM 4756  C CD1  . LEU B 1 4  ? -7.149  -18.193 -7.829  1.00 0.00 ? 4  LEU B CD1  4  
ATOM 4757  C CD2  . LEU B 1 4  ? -5.117  -16.746 -7.673  1.00 0.00 ? 4  LEU B CD2  4  
ATOM 4758  H H    . LEU B 1 4  ? -7.062  -20.065 -5.162  1.00 0.00 ? 4  LEU B H    4  
ATOM 4759  H HA   . LEU B 1 4  ? -5.608  -20.800 -7.589  1.00 0.00 ? 4  LEU B HA   4  
ATOM 4760  H HB2  . LEU B 1 4  ? -5.507  -18.531 -5.645  1.00 0.00 ? 4  LEU B HB2  4  
ATOM 4761  H HB3  . LEU B 1 4  ? -4.061  -18.929 -6.542  1.00 0.00 ? 4  LEU B HB3  4  
ATOM 4762  H HG   . LEU B 1 4  ? -5.246  -18.617 -8.661  1.00 0.00 ? 4  LEU B HG   4  
ATOM 4763  H HD11 . LEU B 1 4  ? -7.565  -17.790 -6.916  1.00 0.00 ? 4  LEU B HD11 4  
ATOM 4764  H HD12 . LEU B 1 4  ? -7.495  -19.207 -7.964  1.00 0.00 ? 4  LEU B HD12 4  
ATOM 4765  H HD13 . LEU B 1 4  ? -7.479  -17.594 -8.667  1.00 0.00 ? 4  LEU B HD13 4  
ATOM 4766  H HD21 . LEU B 1 4  ? -5.569  -16.151 -8.456  1.00 0.00 ? 4  LEU B HD21 4  
ATOM 4767  H HD22 . LEU B 1 4  ? -4.049  -16.741 -7.805  1.00 0.00 ? 4  LEU B HD22 4  
ATOM 4768  H HD23 . LEU B 1 4  ? -5.365  -16.317 -6.711  1.00 0.00 ? 4  LEU B HD23 4  
ATOM 4769  N N    . PRO B 1 5  ? -3.374  -21.674 -6.597  1.00 0.00 ? 5  PRO B N    4  
ATOM 4770  C CA   . PRO B 1 5  ? -2.279  -22.470 -6.035  1.00 0.00 ? 5  PRO B CA   4  
ATOM 4771  C C    . PRO B 1 5  ? -1.478  -21.693 -4.994  1.00 0.00 ? 5  PRO B C    4  
ATOM 4772  O O    . PRO B 1 5  ? -1.643  -20.483 -4.848  1.00 0.00 ? 5  PRO B O    4  
ATOM 4773  C CB   . PRO B 1 5  ? -1.408  -22.798 -7.251  1.00 0.00 ? 5  PRO B CB   4  
ATOM 4774  C CG   . PRO B 1 5  ? -1.710  -21.724 -8.237  1.00 0.00 ? 5  PRO B CG   4  
ATOM 4775  C CD   . PRO B 1 5  ? -3.150  -21.354 -8.020  1.00 0.00 ? 5  PRO B CD   4  
ATOM 4776  H HA   . PRO B 1 5  ? -2.644  -23.386 -5.593  1.00 0.00 ? 5  PRO B HA   4  
ATOM 4777  H HB2  . PRO B 1 5  ? -0.359  -22.809 -6.984  1.00 0.00 ? 5  PRO B HB2  4  
ATOM 4778  H HB3  . PRO B 1 5  ? -1.688  -23.766 -7.638  1.00 0.00 ? 5  PRO B HB3  4  
ATOM 4779  H HG2  . PRO B 1 5  ? -1.073  -20.871 -8.057  1.00 0.00 ? 5  PRO B HG2  4  
ATOM 4780  H HG3  . PRO B 1 5  ? -1.566  -22.096 -9.241  1.00 0.00 ? 5  PRO B HG3  4  
ATOM 4781  H HD2  . PRO B 1 5  ? -3.300  -20.301 -8.208  1.00 0.00 ? 5  PRO B HD2  4  
ATOM 4782  H HD3  . PRO B 1 5  ? -3.792  -21.947 -8.654  1.00 0.00 ? 5  PRO B HD3  4  
ATOM 4783  N N    . PHE B 1 6  ? -0.614  -22.398 -4.270  1.00 0.00 ? 6  PHE B N    4  
ATOM 4784  C CA   . PHE B 1 6  ? 0.209   -21.771 -3.242  1.00 0.00 ? 6  PHE B CA   4  
ATOM 4785  C C    . PHE B 1 6  ? 1.293   -20.896 -3.868  1.00 0.00 ? 6  PHE B C    4  
ATOM 4786  O O    . PHE B 1 6  ? 1.876   -20.042 -3.200  1.00 0.00 ? 6  PHE B O    4  
ATOM 4787  C CB   . PHE B 1 6  ? 0.848   -22.840 -2.348  1.00 0.00 ? 6  PHE B CB   4  
ATOM 4788  C CG   . PHE B 1 6  ? 2.020   -23.542 -2.978  1.00 0.00 ? 6  PHE B CG   4  
ATOM 4789  C CD1  . PHE B 1 6  ? 1.855   -24.317 -4.116  1.00 0.00 ? 6  PHE B CD1  4  
ATOM 4790  C CD2  . PHE B 1 6  ? 3.287   -23.428 -2.428  1.00 0.00 ? 6  PHE B CD2  4  
ATOM 4791  C CE1  . PHE B 1 6  ? 2.933   -24.963 -4.693  1.00 0.00 ? 6  PHE B CE1  4  
ATOM 4792  C CE2  . PHE B 1 6  ? 4.367   -24.072 -3.002  1.00 0.00 ? 6  PHE B CE2  4  
ATOM 4793  C CZ   . PHE B 1 6  ? 4.190   -24.840 -4.134  1.00 0.00 ? 6  PHE B CZ   4  
ATOM 4794  H H    . PHE B 1 6  ? -0.548  -23.358 -4.428  1.00 0.00 ? 6  PHE B H    4  
ATOM 4795  H HA   . PHE B 1 6  ? -0.428  -21.151 -2.628  1.00 0.00 ? 6  PHE B HA   4  
ATOM 4796  H HB2  . PHE B 1 6  ? 1.176   -22.372 -1.429  1.00 0.00 ? 6  PHE B HB2  4  
ATOM 4797  H HB3  . PHE B 1 6  ? 0.103   -23.587 -2.108  1.00 0.00 ? 6  PHE B HB3  4  
ATOM 4798  H HD1  . PHE B 1 6  ? 0.885   -24.430 -4.558  1.00 0.00 ? 6  PHE B HD1  4  
ATOM 4799  H HD2  . PHE B 1 6  ? 3.433   -22.827 -1.540  1.00 0.00 ? 6  PHE B HD2  4  
ATOM 4800  H HE1  . PHE B 1 6  ? 2.792   -25.564 -5.579  1.00 0.00 ? 6  PHE B HE1  4  
ATOM 4801  H HE2  . PHE B 1 6  ? 5.349   -23.975 -2.563  1.00 0.00 ? 6  PHE B HE2  4  
ATOM 4802  H HZ   . PHE B 1 6  ? 5.033   -25.344 -4.583  1.00 0.00 ? 6  PHE B HZ   4  
ATOM 4803  N N    . LYS B 1 7  ? 1.551   -21.112 -5.154  1.00 0.00 ? 7  LYS B N    4  
ATOM 4804  C CA   . LYS B 1 7  ? 2.572   -20.352 -5.870  1.00 0.00 ? 7  LYS B CA   4  
ATOM 4805  C C    . LYS B 1 7  ? 2.260   -18.858 -5.870  1.00 0.00 ? 7  LYS B C    4  
ATOM 4806  O O    . LYS B 1 7  ? 3.096   -18.043 -5.482  1.00 0.00 ? 7  LYS B O    4  
ATOM 4807  C CB   . LYS B 1 7  ? 2.696   -20.861 -7.308  1.00 0.00 ? 7  LYS B CB   4  
ATOM 4808  C CG   . LYS B 1 7  ? 3.756   -20.136 -8.122  1.00 0.00 ? 7  LYS B CG   4  
ATOM 4809  C CD   . LYS B 1 7  ? 3.838   -20.677 -9.541  1.00 0.00 ? 7  LYS B CD   4  
ATOM 4810  C CE   . LYS B 1 7  ? 4.409   -22.086 -9.573  1.00 0.00 ? 7  LYS B CE   4  
ATOM 4811  N NZ   . LYS B 1 7  ? 4.521   -22.607 -10.963 1.00 0.00 ? 7  LYS B NZ   4  
ATOM 4812  H H    . LYS B 1 7  ? 1.066   -21.808 -5.644  1.00 0.00 ? 7  LYS B H    4  
ATOM 4813  H HA   . LYS B 1 7  ? 3.517   -20.507 -5.367  1.00 0.00 ? 7  LYS B HA   4  
ATOM 4814  H HB2  . LYS B 1 7  ? 2.944   -21.910 -7.271  1.00 0.00 ? 7  LYS B HB2  4  
ATOM 4815  H HB3  . LYS B 1 7  ? 1.741   -20.743 -7.803  1.00 0.00 ? 7  LYS B HB3  4  
ATOM 4816  H HG2  . LYS B 1 7  ? 3.507   -19.087 -8.176  1.00 0.00 ? 7  LYS B HG2  4  
ATOM 4817  H HG3  . LYS B 1 7  ? 4.716   -20.254 -7.638  1.00 0.00 ? 7  LYS B HG3  4  
ATOM 4818  H HD2  . LYS B 1 7  ? 2.850   -20.688 -9.980  1.00 0.00 ? 7  LYS B HD2  4  
ATOM 4819  H HD3  . LYS B 1 7  ? 4.479   -20.029 -10.121 1.00 0.00 ? 7  LYS B HD3  4  
ATOM 4820  H HE2  . LYS B 1 7  ? 5.392   -22.078 -9.125  1.00 0.00 ? 7  LYS B HE2  4  
ATOM 4821  H HE3  . LYS B 1 7  ? 3.764   -22.743 -9.011  1.00 0.00 ? 7  LYS B HE3  4  
ATOM 4822  H HZ1  . LYS B 1 7  ? 3.583   -22.636 -11.416 1.00 0.00 ? 7  LYS B HZ1  4  
ATOM 4823  H HZ2  . LYS B 1 7  ? 4.914   -23.570 -10.950 1.00 0.00 ? 7  LYS B HZ2  4  
ATOM 4824  H HZ3  . LYS B 1 7  ? 5.150   -21.999 -11.528 1.00 0.00 ? 7  LYS B HZ3  4  
ATOM 4825  N N    . VAL B 1 8  ? 1.053   -18.504 -6.306  1.00 0.00 ? 8  VAL B N    4  
ATOM 4826  C CA   . VAL B 1 8  ? 0.643   -17.105 -6.356  1.00 0.00 ? 8  VAL B CA   4  
ATOM 4827  C C    . VAL B 1 8  ? 0.719   -16.457 -4.976  1.00 0.00 ? 8  VAL B C    4  
ATOM 4828  O O    . VAL B 1 8  ? 1.049   -15.277 -4.855  1.00 0.00 ? 8  VAL B O    4  
ATOM 4829  C CB   . VAL B 1 8  ? -0.787  -16.948 -6.914  1.00 0.00 ? 8  VAL B CB   4  
ATOM 4830  C CG1  . VAL B 1 8  ? -0.870  -17.486 -8.335  1.00 0.00 ? 8  VAL B CG1  4  
ATOM 4831  C CG2  . VAL B 1 8  ? -1.798  -17.644 -6.016  1.00 0.00 ? 8  VAL B CG2  4  
ATOM 4832  H H    . VAL B 1 8  ? 0.426   -19.204 -6.602  1.00 0.00 ? 8  VAL B H    4  
ATOM 4833  H HA   . VAL B 1 8  ? 1.323   -16.581 -7.018  1.00 0.00 ? 8  VAL B HA   4  
ATOM 4834  H HB   . VAL B 1 8  ? -1.032  -15.894 -6.945  1.00 0.00 ? 8  VAL B HB   4  
ATOM 4835  H HG11 . VAL B 1 8  ? -0.653  -18.544 -8.341  1.00 0.00 ? 8  VAL B HG11 4  
ATOM 4836  H HG12 . VAL B 1 8  ? -0.154  -16.970 -8.960  1.00 0.00 ? 8  VAL B HG12 4  
ATOM 4837  H HG13 . VAL B 1 8  ? -1.865  -17.322 -8.726  1.00 0.00 ? 8  VAL B HG13 4  
ATOM 4838  H HG21 . VAL B 1 8  ? -1.592  -18.692 -5.994  1.00 0.00 ? 8  VAL B HG21 4  
ATOM 4839  H HG22 . VAL B 1 8  ? -2.780  -17.484 -6.409  1.00 0.00 ? 8  VAL B HG22 4  
ATOM 4840  H HG23 . VAL B 1 8  ? -1.765  -17.244 -5.019  1.00 0.00 ? 8  VAL B HG23 4  
ATOM 4841  N N    . VAL B 1 9  ? 0.412   -17.232 -3.939  1.00 0.00 ? 9  VAL B N    4  
ATOM 4842  C CA   . VAL B 1 9  ? 0.445   -16.728 -2.569  1.00 0.00 ? 9  VAL B CA   4  
ATOM 4843  C C    . VAL B 1 9  ? 1.857   -16.317 -2.163  1.00 0.00 ? 9  VAL B C    4  
ATOM 4844  O O    . VAL B 1 9  ? 2.064   -15.240 -1.605  1.00 0.00 ? 9  VAL B O    4  
ATOM 4845  C CB   . VAL B 1 9  ? -0.067  -17.779 -1.565  1.00 0.00 ? 9  VAL B CB   4  
ATOM 4846  C CG1  . VAL B 1 9  ? -0.412  -17.126 -0.237  1.00 0.00 ? 9  VAL B CG1  4  
ATOM 4847  C CG2  . VAL B 1 9  ? -1.269  -18.523 -2.125  1.00 0.00 ? 9  VAL B CG2  4  
ATOM 4848  H H    . VAL B 1 9  ? 0.170   -18.164 -4.106  1.00 0.00 ? 9  VAL B H    4  
ATOM 4849  H HA   . VAL B 1 9  ? -0.202  -15.859 -2.519  1.00 0.00 ? 9  VAL B HA   4  
ATOM 4850  H HB   . VAL B 1 9  ? 0.716   -18.507 -1.387  1.00 0.00 ? 9  VAL B HB   4  
ATOM 4851  H HG11 . VAL B 1 9  ? -0.761  -17.878 0.458   1.00 0.00 ? 9  VAL B HG11 4  
ATOM 4852  H HG12 . VAL B 1 9  ? -1.188  -16.388 -0.384  1.00 0.00 ? 9  VAL B HG12 4  
ATOM 4853  H HG13 . VAL B 1 9  ? 0.466   -16.646 0.172   1.00 0.00 ? 9  VAL B HG13 4  
ATOM 4854  H HG21 . VAL B 1 9  ? -2.011  -17.816 -2.471  1.00 0.00 ? 9  VAL B HG21 4  
ATOM 4855  H HG22 . VAL B 1 9  ? -1.705  -19.146 -1.355  1.00 0.00 ? 9  VAL B HG22 4  
ATOM 4856  H HG23 . VAL B 1 9  ? -0.964  -19.147 -2.940  1.00 0.00 ? 9  VAL B HG23 4  
ATOM 4857  N N    . VAL B 1 10 ? 2.825   -17.186 -2.444  1.00 0.00 ? 10 VAL B N    4  
ATOM 4858  C CA   . VAL B 1 10 ? 4.220   -16.921 -2.106  1.00 0.00 ? 10 VAL B CA   4  
ATOM 4859  C C    . VAL B 1 10 ? 4.739   -15.677 -2.823  1.00 0.00 ? 10 VAL B C    4  
ATOM 4860  O O    . VAL B 1 10 ? 5.279   -14.769 -2.192  1.00 0.00 ? 10 VAL B O    4  
ATOM 4861  C CB   . VAL B 1 10 ? 5.120   -18.121 -2.460  1.00 0.00 ? 10 VAL B CB   4  
ATOM 4862  C CG1  . VAL B 1 10 ? 6.582   -17.811 -2.163  1.00 0.00 ? 10 VAL B CG1  4  
ATOM 4863  C CG2  . VAL B 1 10 ? 4.672   -19.363 -1.703  1.00 0.00 ? 10 VAL B CG2  4  
ATOM 4864  H H    . VAL B 1 10 ? 2.593   -18.032 -2.894  1.00 0.00 ? 10 VAL B H    4  
ATOM 4865  H HA   . VAL B 1 10 ? 4.282   -16.754 -1.037  1.00 0.00 ? 10 VAL B HA   4  
ATOM 4866  H HB   . VAL B 1 10 ? 5.025   -18.320 -3.518  1.00 0.00 ? 10 VAL B HB   4  
ATOM 4867  H HG11 . VAL B 1 10 ? 6.955   -17.087 -2.872  1.00 0.00 ? 10 VAL B HG11 4  
ATOM 4868  H HG12 . VAL B 1 10 ? 7.172   -18.715 -2.247  1.00 0.00 ? 10 VAL B HG12 4  
ATOM 4869  H HG13 . VAL B 1 10 ? 6.679   -17.416 -1.160  1.00 0.00 ? 10 VAL B HG13 4  
ATOM 4870  H HG21 . VAL B 1 10 ? 3.637   -19.561 -1.889  1.00 0.00 ? 10 VAL B HG21 4  
ATOM 4871  H HG22 . VAL B 1 10 ? 4.816   -19.212 -0.642  1.00 0.00 ? 10 VAL B HG22 4  
ATOM 4872  H HG23 . VAL B 1 10 ? 5.261   -20.211 -2.025  1.00 0.00 ? 10 VAL B HG23 4  
ATOM 4873  N N    . ILE B 1 11 ? 4.572   -15.644 -4.142  1.00 0.00 ? 11 ILE B N    4  
ATOM 4874  C CA   . ILE B 1 11 ? 5.028   -14.510 -4.940  1.00 0.00 ? 11 ILE B CA   4  
ATOM 4875  C C    . ILE B 1 11 ? 4.354   -13.217 -4.493  1.00 0.00 ? 11 ILE B C    4  
ATOM 4876  O O    . ILE B 1 11 ? 4.977   -12.156 -4.481  1.00 0.00 ? 11 ILE B O    4  
ATOM 4877  C CB   . ILE B 1 11 ? 4.759   -14.732 -6.443  1.00 0.00 ? 11 ILE B CB   4  
ATOM 4878  C CG1  . ILE B 1 11 ? 5.480   -15.992 -6.932  1.00 0.00 ? 11 ILE B CG1  4  
ATOM 4879  C CG2  . ILE B 1 11 ? 5.202   -13.516 -7.244  1.00 0.00 ? 11 ILE B CG2  4  
ATOM 4880  C CD1  . ILE B 1 11 ? 5.189   -16.336 -8.379  1.00 0.00 ? 11 ILE B CD1  4  
ATOM 4881  H H    . ILE B 1 11 ? 4.126   -16.402 -4.587  1.00 0.00 ? 11 ILE B H    4  
ATOM 4882  H HA   . ILE B 1 11 ? 6.098   -14.408 -4.798  1.00 0.00 ? 11 ILE B HA   4  
ATOM 4883  H HB   . ILE B 1 11 ? 3.695   -14.858 -6.584  1.00 0.00 ? 11 ILE B HB   4  
ATOM 4884  H HG12 . ILE B 1 11 ? 6.547   -15.855 -6.835  1.00 0.00 ? 11 ILE B HG12 4  
ATOM 4885  H HG13 . ILE B 1 11 ? 5.179   -16.839 -6.334  1.00 0.00 ? 11 ILE B HG13 4  
ATOM 4886  H HG21 . ILE B 1 11 ? 5.042   -13.689 -8.298  1.00 0.00 ? 11 ILE B HG21 4  
ATOM 4887  H HG22 . ILE B 1 11 ? 6.252   -13.329 -7.072  1.00 0.00 ? 11 ILE B HG22 4  
ATOM 4888  H HG23 . ILE B 1 11 ? 4.632   -12.648 -6.949  1.00 0.00 ? 11 ILE B HG23 4  
ATOM 4889  H HD11 . ILE B 1 11 ? 5.555   -17.330 -8.590  1.00 0.00 ? 11 ILE B HD11 4  
ATOM 4890  H HD12 . ILE B 1 11 ? 5.685   -15.628 -9.026  1.00 0.00 ? 11 ILE B HD12 4  
ATOM 4891  H HD13 . ILE B 1 11 ? 4.123   -16.303 -8.557  1.00 0.00 ? 11 ILE B HD13 4  
ATOM 4892  N N    . SER B 1 12 ? 3.079   -13.310 -4.125  1.00 0.00 ? 12 SER B N    4  
ATOM 4893  C CA   . SER B 1 12 ? 2.326   -12.141 -3.678  1.00 0.00 ? 12 SER B CA   4  
ATOM 4894  C C    . SER B 1 12 ? 2.820   -11.656 -2.321  1.00 0.00 ? 12 SER B C    4  
ATOM 4895  O O    . SER B 1 12 ? 2.899   -10.453 -2.071  1.00 0.00 ? 12 SER B O    4  
ATOM 4896  C CB   . SER B 1 12 ? 0.832   -12.463 -3.600  1.00 0.00 ? 12 SER B CB   4  
ATOM 4897  O OG   . SER B 1 12 ? 0.286   -12.681 -4.889  1.00 0.00 ? 12 SER B OG   4  
ATOM 4898  H H    . SER B 1 12 ? 2.625   -14.185 -4.154  1.00 0.00 ? 12 SER B H    4  
ATOM 4899  H HA   . SER B 1 12 ? 2.470   -11.348 -4.401  1.00 0.00 ? 12 SER B HA   4  
ATOM 4900  H HB2  . SER B 1 12 ? 0.689   -13.354 -3.007  1.00 0.00 ? 12 SER B HB2  4  
ATOM 4901  H HB3  . SER B 1 12 ? 0.302   -11.638 -3.140  1.00 0.00 ? 12 SER B HB3  4  
ATOM 4902  H HG   . SER B 1 12 ? 0.501   -13.567 -5.187  1.00 0.00 ? 12 SER B HG   4  
ATOM 4903  N N    . ALA B 1 13 ? 3.146   -12.600 -1.446  1.00 0.00 ? 13 ALA B N    4  
ATOM 4904  C CA   . ALA B 1 13 ? 3.623   -12.273 -0.108  1.00 0.00 ? 13 ALA B CA   4  
ATOM 4905  C C    . ALA B 1 13 ? 4.964   -11.546 -0.154  1.00 0.00 ? 13 ALA B C    4  
ATOM 4906  O O    . ALA B 1 13 ? 5.106   -10.451 0.390   1.00 0.00 ? 13 ALA B O    4  
ATOM 4907  C CB   . ALA B 1 13 ? 3.738   -13.537 0.732   1.00 0.00 ? 13 ALA B CB   4  
ATOM 4908  H H    . ALA B 1 13 ? 3.056   -13.549 -1.698  1.00 0.00 ? 13 ALA B H    4  
ATOM 4909  H HA   . ALA B 1 13 ? 2.893   -11.628 0.364   1.00 0.00 ? 13 ALA B HA   4  
ATOM 4910  H HB1  . ALA B 1 13 ? 4.478   -14.196 0.299   1.00 0.00 ? 13 ALA B HB1  4  
ATOM 4911  H HB2  . ALA B 1 13 ? 2.782   -14.039 0.754   1.00 0.00 ? 13 ALA B HB2  4  
ATOM 4912  H HB3  . ALA B 1 13 ? 4.030   -13.279 1.740   1.00 0.00 ? 13 ALA B HB3  4  
ATOM 4913  N N    . ILE B 1 14 ? 5.945   -12.161 -0.811  1.00 0.00 ? 14 ILE B N    4  
ATOM 4914  C CA   . ILE B 1 14 ? 7.276   -11.575 -0.920  1.00 0.00 ? 14 ILE B CA   4  
ATOM 4915  C C    . ILE B 1 14 ? 7.247   -10.250 -1.679  1.00 0.00 ? 14 ILE B C    4  
ATOM 4916  O O    . ILE B 1 14 ? 7.915   -9.293  -1.289  1.00 0.00 ? 14 ILE B O    4  
ATOM 4917  C CB   . ILE B 1 14 ? 8.263   -12.539 -1.612  1.00 0.00 ? 14 ILE B CB   4  
ATOM 4918  C CG1  . ILE B 1 14 ? 9.668   -11.931 -1.635  1.00 0.00 ? 14 ILE B CG1  4  
ATOM 4919  C CG2  . ILE B 1 14 ? 7.793   -12.864 -3.024  1.00 0.00 ? 14 ILE B CG2  4  
ATOM 4920  C CD1  . ILE B 1 14 ? 10.749  -12.913 -2.029  1.00 0.00 ? 14 ILE B CD1  4  
ATOM 4921  H H    . ILE B 1 14 ? 5.766   -13.038 -1.221  1.00 0.00 ? 14 ILE B H    4  
ATOM 4922  H HA   . ILE B 1 14 ? 7.639   -11.389 0.085   1.00 0.00 ? 14 ILE B HA   4  
ATOM 4923  H HB   . ILE B 1 14 ? 8.282   -13.459 -1.046  1.00 0.00 ? 14 ILE B HB   4  
ATOM 4924  H HG12 . ILE B 1 14 ? 9.704   -11.111 -2.339  1.00 0.00 ? 14 ILE B HG12 4  
ATOM 4925  H HG13 . ILE B 1 14 ? 9.915   -11.559 -0.648  1.00 0.00 ? 14 ILE B HG13 4  
ATOM 4926  H HG21 . ILE B 1 14 ? 8.348   -13.716 -3.390  1.00 0.00 ? 14 ILE B HG21 4  
ATOM 4927  H HG22 . ILE B 1 14 ? 7.972   -12.022 -3.678  1.00 0.00 ? 14 ILE B HG22 4  
ATOM 4928  H HG23 . ILE B 1 14 ? 6.745   -13.099 -3.034  1.00 0.00 ? 14 ILE B HG23 4  
ATOM 4929  H HD11 . ILE B 1 14 ? 11.708  -12.417 -2.015  1.00 0.00 ? 14 ILE B HD11 4  
ATOM 4930  H HD12 . ILE B 1 14 ? 10.551  -13.286 -3.023  1.00 0.00 ? 14 ILE B HD12 4  
ATOM 4931  H HD13 . ILE B 1 14 ? 10.759  -13.737 -1.331  1.00 0.00 ? 14 ILE B HD13 4  
ATOM 4932  N N    . LEU B 1 15 ? 6.472   -10.196 -2.759  1.00 0.00 ? 15 LEU B N    4  
ATOM 4933  C CA   . LEU B 1 15 ? 6.369   -8.982  -3.562  1.00 0.00 ? 15 LEU B CA   4  
ATOM 4934  C C    . LEU B 1 15 ? 5.713   -7.861  -2.765  1.00 0.00 ? 15 LEU B C    4  
ATOM 4935  O O    . LEU B 1 15 ? 6.044   -6.687  -2.940  1.00 0.00 ? 15 LEU B O    4  
ATOM 4936  C CB   . LEU B 1 15 ? 5.569   -9.252  -4.840  1.00 0.00 ? 15 LEU B CB   4  
ATOM 4937  C CG   . LEU B 1 15 ? 5.390   -8.048  -5.771  1.00 0.00 ? 15 LEU B CG   4  
ATOM 4938  C CD1  . LEU B 1 15 ? 6.724   -7.627  -6.370  1.00 0.00 ? 15 LEU B CD1  4  
ATOM 4939  C CD2  . LEU B 1 15 ? 4.391   -8.374  -6.871  1.00 0.00 ? 15 LEU B CD2  4  
ATOM 4940  H H    . LEU B 1 15 ? 5.948   -10.986 -3.026  1.00 0.00 ? 15 LEU B H    4  
ATOM 4941  H HA   . LEU B 1 15 ? 7.369   -8.674  -3.837  1.00 0.00 ? 15 LEU B HA   4  
ATOM 4942  H HB2  . LEU B 1 15 ? 6.065   -10.043 -5.388  1.00 0.00 ? 15 LEU B HB2  4  
ATOM 4943  H HB3  . LEU B 1 15 ? 4.589   -9.608  -4.547  1.00 0.00 ? 15 LEU B HB3  4  
ATOM 4944  H HG   . LEU B 1 15 ? 5.000   -7.211  -5.212  1.00 0.00 ? 15 LEU B HG   4  
ATOM 4945  H HD11 . LEU B 1 15 ? 7.407   -7.355  -5.579  1.00 0.00 ? 15 LEU B HD11 4  
ATOM 4946  H HD12 . LEU B 1 15 ? 6.578   -6.775  -7.020  1.00 0.00 ? 15 LEU B HD12 4  
ATOM 4947  H HD13 . LEU B 1 15 ? 7.143   -8.445  -6.940  1.00 0.00 ? 15 LEU B HD13 4  
ATOM 4948  H HD21 . LEU B 1 15 ? 4.758   -9.200  -7.466  1.00 0.00 ? 15 LEU B HD21 4  
ATOM 4949  H HD22 . LEU B 1 15 ? 4.254   -7.509  -7.505  1.00 0.00 ? 15 LEU B HD22 4  
ATOM 4950  H HD23 . LEU B 1 15 ? 3.442   -8.645  -6.430  1.00 0.00 ? 15 LEU B HD23 4  
ATOM 4951  N N    . ALA B 1 16 ? 4.785   -8.230  -1.889  1.00 0.00 ? 16 ALA B N    4  
ATOM 4952  C CA   . ALA B 1 16 ? 4.080   -7.258  -1.064  1.00 0.00 ? 16 ALA B CA   4  
ATOM 4953  C C    . ALA B 1 16 ? 5.031   -6.578  -0.083  1.00 0.00 ? 16 ALA B C    4  
ATOM 4954  O O    . ALA B 1 16 ? 4.894   -5.389  0.205   1.00 0.00 ? 16 ALA B O    4  
ATOM 4955  C CB   . ALA B 1 16 ? 2.933   -7.927  -0.323  1.00 0.00 ? 16 ALA B CB   4  
ATOM 4956  H H    . ALA B 1 16 ? 4.558   -9.184  -1.791  1.00 0.00 ? 16 ALA B H    4  
ATOM 4957  H HA   . ALA B 1 16 ? 3.653   -6.509  -1.716  1.00 0.00 ? 16 ALA B HA   4  
ATOM 4958  H HB1  . ALA B 1 16 ? 2.232   -8.330  -1.037  1.00 0.00 ? 16 ALA B HB1  4  
ATOM 4959  H HB2  . ALA B 1 16 ? 2.428   -7.202  0.301   1.00 0.00 ? 16 ALA B HB2  4  
ATOM 4960  H HB3  . ALA B 1 16 ? 3.318   -8.726  0.293   1.00 0.00 ? 16 ALA B HB3  4  
ATOM 4961  N N    . LEU B 1 17 ? 5.990   -7.341  0.436   1.00 0.00 ? 17 LEU B N    4  
ATOM 4962  C CA   . LEU B 1 17 ? 6.967   -6.798  1.374   1.00 0.00 ? 17 LEU B CA   4  
ATOM 4963  C C    . LEU B 1 17 ? 7.955   -5.890  0.652   1.00 0.00 ? 17 LEU B C    4  
ATOM 4964  O O    . LEU B 1 17 ? 8.426   -4.899  1.211   1.00 0.00 ? 17 LEU B O    4  
ATOM 4965  C CB   . LEU B 1 17 ? 7.715   -7.924  2.091   1.00 0.00 ? 17 LEU B CB   4  
ATOM 4966  C CG   . LEU B 1 17 ? 7.112   -8.348  3.432   1.00 0.00 ? 17 LEU B CG   4  
ATOM 4967  C CD1  . LEU B 1 17 ? 5.739   -8.968  3.232   1.00 0.00 ? 17 LEU B CD1  4  
ATOM 4968  C CD2  . LEU B 1 17 ? 8.036   -9.318  4.148   1.00 0.00 ? 17 LEU B CD2  4  
ATOM 4969  H H    . LEU B 1 17 ? 6.052   -8.291  0.180   1.00 0.00 ? 17 LEU B H    4  
ATOM 4970  H HA   . LEU B 1 17 ? 6.436   -6.201  2.108   1.00 0.00 ? 17 LEU B HA   4  
ATOM 4971  H HB2  . LEU B 1 17 ? 7.756   -8.789  1.441   1.00 0.00 ? 17 LEU B HB2  4  
ATOM 4972  H HB3  . LEU B 1 17 ? 8.734   -7.599  2.277   1.00 0.00 ? 17 LEU B HB3  4  
ATOM 4973  H HG   . LEU B 1 17 ? 6.994   -7.475  4.058   1.00 0.00 ? 17 LEU B HG   4  
ATOM 4974  H HD11 . LEU B 1 17 ? 5.090   -8.268  2.726   1.00 0.00 ? 17 LEU B HD11 4  
ATOM 4975  H HD12 . LEU B 1 17 ? 5.311   -9.215  4.194   1.00 0.00 ? 17 LEU B HD12 4  
ATOM 4976  H HD13 . LEU B 1 17 ? 5.829   -9.867  2.641   1.00 0.00 ? 17 LEU B HD13 4  
ATOM 4977  H HD21 . LEU B 1 17 ? 7.610   -9.587  5.105   1.00 0.00 ? 17 LEU B HD21 4  
ATOM 4978  H HD22 . LEU B 1 17 ? 8.998   -8.851  4.307   1.00 0.00 ? 17 LEU B HD22 4  
ATOM 4979  H HD23 . LEU B 1 17 ? 8.165   -10.210 3.550   1.00 0.00 ? 17 LEU B HD23 4  
ATOM 4980  N N    . VAL B 1 18 ? 8.262   -6.236  -0.593  1.00 0.00 ? 18 VAL B N    4  
ATOM 4981  C CA   . VAL B 1 18 ? 9.188   -5.449  -1.396  1.00 0.00 ? 18 VAL B CA   4  
ATOM 4982  C C    . VAL B 1 18 ? 8.599   -4.080  -1.720  1.00 0.00 ? 18 VAL B C    4  
ATOM 4983  O O    . VAL B 1 18 ? 9.276   -3.060  -1.601  1.00 0.00 ? 18 VAL B O    4  
ATOM 4984  C CB   . VAL B 1 18 ? 9.558   -6.170  -2.709  1.00 0.00 ? 18 VAL B CB   4  
ATOM 4985  C CG1  . VAL B 1 18 ? 10.401  -5.272  -3.603  1.00 0.00 ? 18 VAL B CG1  4  
ATOM 4986  C CG2  . VAL B 1 18 ? 10.291  -7.471  -2.412  1.00 0.00 ? 18 VAL B CG2  4  
ATOM 4987  H H    . VAL B 1 18 ? 7.859   -7.041  -0.993  1.00 0.00 ? 18 VAL B H    4  
ATOM 4988  H HA   . VAL B 1 18 ? 10.097  -5.303  -0.822  1.00 0.00 ? 18 VAL B HA   4  
ATOM 4989  H HB   . VAL B 1 18 ? 8.645   -6.409  -3.235  1.00 0.00 ? 18 VAL B HB   4  
ATOM 4990  H HG11 . VAL B 1 18 ? 10.828  -5.855  -4.410  1.00 0.00 ? 18 VAL B HG11 4  
ATOM 4991  H HG12 . VAL B 1 18 ? 11.201  -4.824  -3.029  1.00 0.00 ? 18 VAL B HG12 4  
ATOM 4992  H HG13 . VAL B 1 18 ? 9.783   -4.494  -4.027  1.00 0.00 ? 18 VAL B HG13 4  
ATOM 4993  H HG21 . VAL B 1 18 ? 9.745   -8.047  -1.690  1.00 0.00 ? 18 VAL B HG21 4  
ATOM 4994  H HG22 . VAL B 1 18 ? 11.275  -7.254  -2.018  1.00 0.00 ? 18 VAL B HG22 4  
ATOM 4995  H HG23 . VAL B 1 18 ? 10.390  -8.041  -3.324  1.00 0.00 ? 18 VAL B HG23 4  
ATOM 4996  N N    . VAL B 1 19 ? 7.331   -4.065  -2.126  1.00 0.00 ? 19 VAL B N    4  
ATOM 4997  C CA   . VAL B 1 19 ? 6.656   -2.819  -2.471  1.00 0.00 ? 19 VAL B CA   4  
ATOM 4998  C C    . VAL B 1 19 ? 6.367   -1.979  -1.227  1.00 0.00 ? 19 VAL B C    4  
ATOM 4999  O O    . VAL B 1 19 ? 6.354   -0.752  -1.292  1.00 0.00 ? 19 VAL B O    4  
ATOM 5000  C CB   . VAL B 1 19 ? 5.340   -3.077  -3.233  1.00 0.00 ? 19 VAL B CB   4  
ATOM 5001  C CG1  . VAL B 1 19 ? 4.401   -3.944  -2.410  1.00 0.00 ? 19 VAL B CG1  4  
ATOM 5002  C CG2  . VAL B 1 19 ? 4.668   -1.764  -3.605  1.00 0.00 ? 19 VAL B CG2  4  
ATOM 5003  H H    . VAL B 1 19 ? 6.848   -4.916  -2.203  1.00 0.00 ? 19 VAL B H    4  
ATOM 5004  H HA   . VAL B 1 19 ? 7.312   -2.252  -3.124  1.00 0.00 ? 19 VAL B HA   4  
ATOM 5005  H HB   . VAL B 1 19 ? 5.574   -3.606  -4.145  1.00 0.00 ? 19 VAL B HB   4  
ATOM 5006  H HG11 . VAL B 1 19 ? 4.879   -4.860  -2.164  1.00 0.00 ? 19 VAL B HG11 4  
ATOM 5007  H HG12 . VAL B 1 19 ? 3.513   -4.157  -2.987  1.00 0.00 ? 19 VAL B HG12 4  
ATOM 5008  H HG13 . VAL B 1 19 ? 4.117   -3.430  -1.503  1.00 0.00 ? 19 VAL B HG13 4  
ATOM 5009  H HG21 . VAL B 1 19 ? 5.378   -1.116  -4.102  1.00 0.00 ? 19 VAL B HG21 4  
ATOM 5010  H HG22 . VAL B 1 19 ? 4.289   -1.270  -2.721  1.00 0.00 ? 19 VAL B HG22 4  
ATOM 5011  H HG23 . VAL B 1 19 ? 3.846   -1.966  -4.276  1.00 0.00 ? 19 VAL B HG23 4  
ATOM 5012  N N    . LEU B 1 20 ? 6.136   -2.641  -0.095  1.00 0.00 ? 20 LEU B N    4  
ATOM 5013  C CA   . LEU B 1 20 ? 5.855   -1.932  1.151   1.00 0.00 ? 20 LEU B CA   4  
ATOM 5014  C C    . LEU B 1 20 ? 7.046   -1.071  1.554   1.00 0.00 ? 20 LEU B C    4  
ATOM 5015  O O    . LEU B 1 20 ? 6.883   -0.016  2.168   1.00 0.00 ? 20 LEU B O    4  
ATOM 5016  C CB   . LEU B 1 20 ? 5.516   -2.912  2.274   1.00 0.00 ? 20 LEU B CB   4  
ATOM 5017  C CG   . LEU B 1 20 ? 5.137   -2.256  3.605   1.00 0.00 ? 20 LEU B CG   4  
ATOM 5018  C CD1  . LEU B 1 20 ? 3.970   -1.293  3.421   1.00 0.00 ? 20 LEU B CD1  4  
ATOM 5019  C CD2  . LEU B 1 20 ? 4.797   -3.318  4.640   1.00 0.00 ? 20 LEU B CD2  4  
ATOM 5020  H H    . LEU B 1 20 ? 6.153   -3.626  -0.089  1.00 0.00 ? 20 LEU B H    4  
ATOM 5021  H HA   . LEU B 1 20 ? 5.006   -1.288  0.973   1.00 0.00 ? 20 LEU B HA   4  
ATOM 5022  H HB2  . LEU B 1 20 ? 4.687   -3.525  1.942   1.00 0.00 ? 20 LEU B HB2  4  
ATOM 5023  H HB3  . LEU B 1 20 ? 6.372   -3.554  2.439   1.00 0.00 ? 20 LEU B HB3  4  
ATOM 5024  H HG   . LEU B 1 20 ? 5.979   -1.690  3.976   1.00 0.00 ? 20 LEU B HG   4  
ATOM 5025  H HD11 . LEU B 1 20 ? 3.649   -0.921  4.386   1.00 0.00 ? 20 LEU B HD11 4  
ATOM 5026  H HD12 . LEU B 1 20 ? 3.144   -1.803  2.945   1.00 0.00 ? 20 LEU B HD12 4  
ATOM 5027  H HD13 . LEU B 1 20 ? 4.279   -0.460  2.809   1.00 0.00 ? 20 LEU B HD13 4  
ATOM 5028  H HD21 . LEU B 1 20 ? 5.645   -3.975  4.778   1.00 0.00 ? 20 LEU B HD21 4  
ATOM 5029  H HD22 . LEU B 1 20 ? 3.947   -3.896  4.305   1.00 0.00 ? 20 LEU B HD22 4  
ATOM 5030  H HD23 . LEU B 1 20 ? 4.558   -2.843  5.582   1.00 0.00 ? 20 LEU B HD23 4  
ATOM 5031  N N    . THR B 1 21 ? 8.244   -1.529  1.208   1.00 0.00 ? 21 THR B N    4  
ATOM 5032  C CA   . THR B 1 21 ? 9.463   -0.797  1.524   1.00 0.00 ? 21 THR B CA   4  
ATOM 5033  C C    . THR B 1 21 ? 9.668   0.342   0.532   1.00 0.00 ? 21 THR B C    4  
ATOM 5034  O O    . THR B 1 21 ? 10.145  1.418   0.893   1.00 0.00 ? 21 THR B O    4  
ATOM 5035  C CB   . THR B 1 21 ? 10.696  -1.720  1.504   1.00 0.00 ? 21 THR B CB   4  
ATOM 5036  O OG1  . THR B 1 21 ? 10.514  -2.802  2.426   1.00 0.00 ? 21 THR B OG1  4  
ATOM 5037  C CG2  . THR B 1 21 ? 11.959  -0.953  1.866   1.00 0.00 ? 21 THR B CG2  4  
ATOM 5038  H H    . THR B 1 21 ? 8.323   -2.382  0.721   1.00 0.00 ? 21 THR B H    4  
ATOM 5039  H HA   . THR B 1 21 ? 9.368   -0.380  2.522   1.00 0.00 ? 21 THR B HA   4  
ATOM 5040  H HB   . THR B 1 21 ? 10.813  -2.127  0.508   1.00 0.00 ? 21 THR B HB   4  
ATOM 5041  H HG1  . THR B 1 21 ? 10.384  -2.473  3.325   1.00 0.00 ? 21 THR B HG1  4  
ATOM 5042  H HG21 . THR B 1 21 ? 12.247  -0.316  1.043   1.00 0.00 ? 21 THR B HG21 4  
ATOM 5043  H HG22 . THR B 1 21 ? 12.755  -1.655  2.066   1.00 0.00 ? 21 THR B HG22 4  
ATOM 5044  H HG23 . THR B 1 21 ? 11.787  -0.350  2.748   1.00 0.00 ? 21 THR B HG23 4  
ATOM 5045  N N    . ILE B 1 22 ? 9.299   0.096   -0.720  1.00 0.00 ? 22 ILE B N    4  
ATOM 5046  C CA   . ILE B 1 22 ? 9.430   1.098   -1.771  1.00 0.00 ? 22 ILE B CA   4  
ATOM 5047  C C    . ILE B 1 22 ? 8.490   2.268   -1.513  1.00 0.00 ? 22 ILE B C    4  
ATOM 5048  O O    . ILE B 1 22 ? 8.905   3.427   -1.536  1.00 0.00 ? 22 ILE B O    4  
ATOM 5049  C CB   . ILE B 1 22 ? 9.123   0.499   -3.159  1.00 0.00 ? 22 ILE B CB   4  
ATOM 5050  C CG1  . ILE B 1 22 ? 10.073  -0.664  -3.463  1.00 0.00 ? 22 ILE B CG1  4  
ATOM 5051  C CG2  . ILE B 1 22 ? 9.216   1.568   -4.237  1.00 0.00 ? 22 ILE B CG2  4  
ATOM 5052  C CD1  . ILE B 1 22 ? 11.532  -0.261  -3.548  1.00 0.00 ? 22 ILE B CD1  4  
ATOM 5053  H H    . ILE B 1 22 ? 8.920   -0.783  -0.951  1.00 0.00 ? 22 ILE B H    4  
ATOM 5054  H HA   . ILE B 1 22 ? 10.446  1.470   -1.769  1.00 0.00 ? 22 ILE B HA   4  
ATOM 5055  H HB   . ILE B 1 22 ? 8.109   0.125   -3.149  1.00 0.00 ? 22 ILE B HB   4  
ATOM 5056  H HG12 . ILE B 1 22 ? 9.991   -1.402  -2.698  1.00 0.00 ? 22 ILE B HG12 4  
ATOM 5057  H HG13 . ILE B 1 22 ? 9.799   -1.107  -4.410  1.00 0.00 ? 22 ILE B HG13 4  
ATOM 5058  H HG21 . ILE B 1 22 ? 8.388   2.254   -4.146  1.00 0.00 ? 22 ILE B HG21 4  
ATOM 5059  H HG22 . ILE B 1 22 ? 9.177   1.105   -5.215  1.00 0.00 ? 22 ILE B HG22 4  
ATOM 5060  H HG23 . ILE B 1 22 ? 10.146  2.112   -4.139  1.00 0.00 ? 22 ILE B HG23 4  
ATOM 5061  H HD11 . ILE B 1 22 ? 11.865  0.108   -2.591  1.00 0.00 ? 22 ILE B HD11 4  
ATOM 5062  H HD12 . ILE B 1 22 ? 11.662  0.505   -4.296  1.00 0.00 ? 22 ILE B HD12 4  
ATOM 5063  H HD13 . ILE B 1 22 ? 12.122  -1.124  -3.819  1.00 0.00 ? 22 ILE B HD13 4  
ATOM 5064  N N    . ILE B 1 23 ? 7.221   1.954   -1.265  1.00 0.00 ? 23 ILE B N    4  
ATOM 5065  C CA   . ILE B 1 23 ? 6.220   2.976   -0.996  1.00 0.00 ? 23 ILE B CA   4  
ATOM 5066  C C    . ILE B 1 23 ? 6.631   3.826   0.202   1.00 0.00 ? 23 ILE B C    4  
ATOM 5067  O O    . ILE B 1 23 ? 6.331   5.018   0.266   1.00 0.00 ? 23 ILE B O    4  
ATOM 5068  C CB   . ILE B 1 23 ? 4.834   2.347   -0.740  1.00 0.00 ? 23 ILE B CB   4  
ATOM 5069  C CG1  . ILE B 1 23 ? 3.753   3.429   -0.707  1.00 0.00 ? 23 ILE B CG1  4  
ATOM 5070  C CG2  . ILE B 1 23 ? 4.835   1.552   0.556   1.00 0.00 ? 23 ILE B CG2  4  
ATOM 5071  C CD1  . ILE B 1 23 ? 2.343   2.876   -0.677  1.00 0.00 ? 23 ILE B CD1  4  
ATOM 5072  H H    . ILE B 1 23 ? 6.950   1.005   -1.260  1.00 0.00 ? 23 ILE B H    4  
ATOM 5073  H HA   . ILE B 1 23 ? 6.153   3.612   -1.870  1.00 0.00 ? 23 ILE B HA   4  
ATOM 5074  H HB   . ILE B 1 23 ? 4.625   1.663   -1.550  1.00 0.00 ? 23 ILE B HB   4  
ATOM 5075  H HG12 . ILE B 1 23 ? 3.884   4.048   0.170   1.00 0.00 ? 23 ILE B HG12 4  
ATOM 5076  H HG13 . ILE B 1 23 ? 3.840   4.048   -1.591  1.00 0.00 ? 23 ILE B HG13 4  
ATOM 5077  H HG21 . ILE B 1 23 ? 5.635   0.848   0.523   1.00 0.00 ? 23 ILE B HG21 4  
ATOM 5078  H HG22 . ILE B 1 23 ? 3.901   1.018   0.648   1.00 0.00 ? 23 ILE B HG22 4  
ATOM 5079  H HG23 . ILE B 1 23 ? 4.955   2.205   1.408   1.00 0.00 ? 23 ILE B HG23 4  
ATOM 5080  H HD11 . ILE B 1 23 ? 1.637   3.691   -0.739  1.00 0.00 ? 23 ILE B HD11 4  
ATOM 5081  H HD12 . ILE B 1 23 ? 2.187   2.335   0.244   1.00 0.00 ? 23 ILE B HD12 4  
ATOM 5082  H HD13 . ILE B 1 23 ? 2.196   2.210   -1.515  1.00 0.00 ? 23 ILE B HD13 4  
ATOM 5083  N N    . SER B 1 24 ? 7.327   3.199   1.148   1.00 0.00 ? 24 SER B N    4  
ATOM 5084  C CA   . SER B 1 24 ? 7.795   3.885   2.349   1.00 0.00 ? 24 SER B CA   4  
ATOM 5085  C C    . SER B 1 24 ? 8.961   4.818   2.028   1.00 0.00 ? 24 SER B C    4  
ATOM 5086  O O    . SER B 1 24 ? 9.030   5.937   2.538   1.00 0.00 ? 24 SER B O    4  
ATOM 5087  C CB   . SER B 1 24 ? 8.222   2.865   3.404   1.00 0.00 ? 24 SER B CB   4  
ATOM 5088  O OG   . SER B 1 24 ? 8.763   3.508   4.546   1.00 0.00 ? 24 SER B OG   4  
ATOM 5089  H H    . SER B 1 24 ? 7.538   2.242   1.046   1.00 0.00 ? 24 SER B H    4  
ATOM 5090  H HA   . SER B 1 24 ? 6.980   4.473   2.748   1.00 0.00 ? 24 SER B HA   4  
ATOM 5091  H HB2  . SER B 1 24 ? 7.364   2.283   3.707   1.00 0.00 ? 24 SER B HB2  4  
ATOM 5092  H HB3  . SER B 1 24 ? 8.972   2.210   2.986   1.00 0.00 ? 24 SER B HB3  4  
ATOM 5093  H HG   . SER B 1 24 ? 9.202   2.859   5.101   1.00 0.00 ? 24 SER B HG   4  
ATOM 5094  N N    . LEU B 1 25 ? 9.877   4.348   1.184   1.00 0.00 ? 25 LEU B N    4  
ATOM 5095  C CA   . LEU B 1 25 ? 11.041  5.139   0.799   1.00 0.00 ? 25 LEU B CA   4  
ATOM 5096  C C    . LEU B 1 25 ? 10.625  6.401   0.054   1.00 0.00 ? 25 LEU B C    4  
ATOM 5097  O O    . LEU B 1 25 ? 11.204  7.469   0.250   1.00 0.00 ? 25 LEU B O    4  
ATOM 5098  C CB   . LEU B 1 25 ? 11.987  4.309   -0.070  1.00 0.00 ? 25 LEU B CB   4  
ATOM 5099  C CG   . LEU B 1 25 ? 12.726  3.185   0.662   1.00 0.00 ? 25 LEU B CG   4  
ATOM 5100  C CD1  . LEU B 1 25 ? 13.446  2.287   -0.331  1.00 0.00 ? 25 LEU B CD1  4  
ATOM 5101  C CD2  . LEU B 1 25 ? 13.712  3.762   1.668   1.00 0.00 ? 25 LEU B CD2  4  
ATOM 5102  H H    . LEU B 1 25 ? 9.773   3.441   0.810   1.00 0.00 ? 25 LEU B H    4  
ATOM 5103  H HA   . LEU B 1 25 ? 11.556  5.436   1.700   1.00 0.00 ? 25 LEU B HA   4  
ATOM 5104  H HB2  . LEU B 1 25 ? 11.399  3.872   -0.868  1.00 0.00 ? 25 LEU B HB2  4  
ATOM 5105  H HB3  . LEU B 1 25 ? 12.727  4.966   -0.515  1.00 0.00 ? 25 LEU B HB3  4  
ATOM 5106  H HG   . LEU B 1 25 ? 12.020  2.586   1.204   1.00 0.00 ? 25 LEU B HG   4  
ATOM 5107  H HD11 . LEU B 1 25 ? 12.730  1.865   -1.023  1.00 0.00 ? 25 LEU B HD11 4  
ATOM 5108  H HD12 . LEU B 1 25 ? 13.942  1.485   0.198   1.00 0.00 ? 25 LEU B HD12 4  
ATOM 5109  H HD13 . LEU B 1 25 ? 14.179  2.862   -0.880  1.00 0.00 ? 25 LEU B HD13 4  
ATOM 5110  H HD21 . LEU B 1 25 ? 13.180  4.329   2.416   1.00 0.00 ? 25 LEU B HD21 4  
ATOM 5111  H HD22 . LEU B 1 25 ? 14.417  4.407   1.161   1.00 0.00 ? 25 LEU B HD22 4  
ATOM 5112  H HD23 . LEU B 1 25 ? 14.250  2.957   2.152   1.00 0.00 ? 25 LEU B HD23 4  
ATOM 5113  N N    . ILE B 1 26 ? 9.619   6.270   -0.806  1.00 0.00 ? 26 ILE B N    4  
ATOM 5114  C CA   . ILE B 1 26 ? 9.119   7.401   -1.578  1.00 0.00 ? 26 ILE B CA   4  
ATOM 5115  C C    . ILE B 1 26 ? 8.660   8.521   -0.652  1.00 0.00 ? 26 ILE B C    4  
ATOM 5116  O O    . ILE B 1 26 ? 8.889   9.699   -0.923  1.00 0.00 ? 26 ILE B O    4  
ATOM 5117  C CB   . ILE B 1 26 ? 7.950   6.980   -2.491  1.00 0.00 ? 26 ILE B CB   4  
ATOM 5118  C CG1  . ILE B 1 26 ? 8.414   5.911   -3.482  1.00 0.00 ? 26 ILE B CG1  4  
ATOM 5119  C CG2  . ILE B 1 26 ? 7.388   8.187   -3.231  1.00 0.00 ? 26 ILE B CG2  4  
ATOM 5120  C CD1  . ILE B 1 26 ? 7.282   5.244   -4.235  1.00 0.00 ? 26 ILE B CD1  4  
ATOM 5121  H H    . ILE B 1 26 ? 9.195   5.389   -0.920  1.00 0.00 ? 26 ILE B H    4  
ATOM 5122  H HA   . ILE B 1 26 ? 9.926   7.771   -2.200  1.00 0.00 ? 26 ILE B HA   4  
ATOM 5123  H HB   . ILE B 1 26 ? 7.165   6.571   -1.869  1.00 0.00 ? 26 ILE B HB   4  
ATOM 5124  H HG12 . ILE B 1 26 ? 9.067   6.364   -4.215  1.00 0.00 ? 26 ILE B HG12 4  
ATOM 5125  H HG13 . ILE B 1 26 ? 8.958   5.142   -2.974  1.00 0.00 ? 26 ILE B HG13 4  
ATOM 5126  H HG21 . ILE B 1 26 ? 6.915   8.860   -2.533  1.00 0.00 ? 26 ILE B HG21 4  
ATOM 5127  H HG22 . ILE B 1 26 ? 6.650   7.867   -3.953  1.00 0.00 ? 26 ILE B HG22 4  
ATOM 5128  H HG23 . ILE B 1 26 ? 8.186   8.705   -3.746  1.00 0.00 ? 26 ILE B HG23 4  
ATOM 5129  H HD11 . ILE B 1 26 ? 6.883   5.930   -4.966  1.00 0.00 ? 26 ILE B HD11 4  
ATOM 5130  H HD12 . ILE B 1 26 ? 6.500   4.957   -3.546  1.00 0.00 ? 26 ILE B HD12 4  
ATOM 5131  H HD13 . ILE B 1 26 ? 7.656   4.365   -4.738  1.00 0.00 ? 26 ILE B HD13 4  
ATOM 5132  N N    . ILE B 1 27 ? 8.015   8.139   0.446   1.00 0.00 ? 27 ILE B N    4  
ATOM 5133  C CA   . ILE B 1 27 ? 7.521   9.102   1.424   1.00 0.00 ? 27 ILE B CA   4  
ATOM 5134  C C    . ILE B 1 27 ? 8.674   9.822   2.114   1.00 0.00 ? 27 ILE B C    4  
ATOM 5135  O O    . ILE B 1 27 ? 8.654   11.043  2.269   1.00 0.00 ? 27 ILE B O    4  
ATOM 5136  C CB   . ILE B 1 27 ? 6.660   8.411   2.496   1.00 0.00 ? 27 ILE B CB   4  
ATOM 5137  C CG1  . ILE B 1 27 ? 5.529   7.617   1.841   1.00 0.00 ? 27 ILE B CG1  4  
ATOM 5138  C CG2  . ILE B 1 27 ? 6.099   9.437   3.471   1.00 0.00 ? 27 ILE B CG2  4  
ATOM 5139  C CD1  . ILE B 1 27 ? 4.892   6.602   2.765   1.00 0.00 ? 27 ILE B CD1  4  
ATOM 5140  H H    . ILE B 1 27 ? 7.875   7.179   0.610   1.00 0.00 ? 27 ILE B H    4  
ATOM 5141  H HA   . ILE B 1 27 ? 6.909   9.829   0.908   1.00 0.00 ? 27 ILE B HA   4  
ATOM 5142  H HB   . ILE B 1 27 ? 7.294   7.731   3.053   1.00 0.00 ? 27 ILE B HB   4  
ATOM 5143  H HG12 . ILE B 1 27 ? 4.751   8.298   1.521   1.00 0.00 ? 27 ILE B HG12 4  
ATOM 5144  H HG13 . ILE B 1 27 ? 5.887   7.089   0.983   1.00 0.00 ? 27 ILE B HG13 4  
ATOM 5145  H HG21 . ILE B 1 27 ? 5.404   8.955   4.147   1.00 0.00 ? 27 ILE B HG21 4  
ATOM 5146  H HG22 . ILE B 1 27 ? 5.582   10.216  2.928   1.00 0.00 ? 27 ILE B HG22 4  
ATOM 5147  H HG23 . ILE B 1 27 ? 6.900   9.874   4.048   1.00 0.00 ? 27 ILE B HG23 4  
ATOM 5148  H HD11 . ILE B 1 27 ? 3.819   6.718   2.735   1.00 0.00 ? 27 ILE B HD11 4  
ATOM 5149  H HD12 . ILE B 1 27 ? 5.236   6.741   3.783   1.00 0.00 ? 27 ILE B HD12 4  
ATOM 5150  H HD13 . ILE B 1 27 ? 5.148   5.607   2.435   1.00 0.00 ? 27 ILE B HD13 4  
ATOM 5151  N N    . LEU B 1 28 ? 9.675   9.052   2.529   1.00 0.00 ? 28 LEU B N    4  
ATOM 5152  C CA   . LEU B 1 28 ? 10.840  9.602   3.213   1.00 0.00 ? 28 LEU B CA   4  
ATOM 5153  C C    . LEU B 1 28 ? 11.540  10.658  2.360   1.00 0.00 ? 28 LEU B C    4  
ATOM 5154  O O    . LEU B 1 28 ? 11.696  11.803  2.782   1.00 0.00 ? 28 LEU B O    4  
ATOM 5155  C CB   . LEU B 1 28 ? 11.820  8.481   3.567   1.00 0.00 ? 28 LEU B CB   4  
ATOM 5156  C CG   . LEU B 1 28 ? 13.114  8.932   4.251   1.00 0.00 ? 28 LEU B CG   4  
ATOM 5157  C CD1  . LEU B 1 28 ? 12.813  9.589   5.591   1.00 0.00 ? 28 LEU B CD1  4  
ATOM 5158  C CD2  . LEU B 1 28 ? 14.058  7.753   4.432   1.00 0.00 ? 28 LEU B CD2  4  
ATOM 5159  H H    . LEU B 1 28 ? 9.628   8.077   2.379   1.00 0.00 ? 28 LEU B H    4  
ATOM 5160  H HA   . LEU B 1 28 ? 10.499  10.066  4.127   1.00 0.00 ? 28 LEU B HA   4  
ATOM 5161  H HB2  . LEU B 1 28 ? 11.311  7.781   4.217   1.00 0.00 ? 28 LEU B HB2  4  
ATOM 5162  H HB3  . LEU B 1 28 ? 12.079  7.966   2.651   1.00 0.00 ? 28 LEU B HB3  4  
ATOM 5163  H HG   . LEU B 1 28 ? 13.616  9.660   3.632   1.00 0.00 ? 28 LEU B HG   4  
ATOM 5164  H HD11 . LEU B 1 28 ? 12.289  8.892   6.230   1.00 0.00 ? 28 LEU B HD11 4  
ATOM 5165  H HD12 . LEU B 1 28 ? 12.201  10.466  5.438   1.00 0.00 ? 28 LEU B HD12 4  
ATOM 5166  H HD13 . LEU B 1 28 ? 13.738  9.884   6.067   1.00 0.00 ? 28 LEU B HD13 4  
ATOM 5167  H HD21 . LEU B 1 28 ? 14.282  7.317   3.468   1.00 0.00 ? 28 LEU B HD21 4  
ATOM 5168  H HD22 . LEU B 1 28 ? 13.595  7.008   5.064   1.00 0.00 ? 28 LEU B HD22 4  
ATOM 5169  H HD23 . LEU B 1 28 ? 14.977  8.091   4.891   1.00 0.00 ? 28 LEU B HD23 4  
ATOM 5170  N N    . ILE B 1 29 ? 11.962  10.264  1.161   1.00 0.00 ? 29 ILE B N    4  
ATOM 5171  C CA   . ILE B 1 29 ? 12.649  11.178  0.252   1.00 0.00 ? 29 ILE B CA   4  
ATOM 5172  C C    . ILE B 1 29 ? 11.761  12.363  -0.117  1.00 0.00 ? 29 ILE B C    4  
ATOM 5173  O O    . ILE B 1 29 ? 12.251  13.471  -0.339  1.00 0.00 ? 29 ILE B O    4  
ATOM 5174  C CB   . ILE B 1 29 ? 13.098  10.459  -1.037  1.00 0.00 ? 29 ILE B CB   4  
ATOM 5175  C CG1  . ILE B 1 29 ? 13.972  9.249   -0.692  1.00 0.00 ? 29 ILE B CG1  4  
ATOM 5176  C CG2  . ILE B 1 29 ? 13.849  11.421  -1.948  1.00 0.00 ? 29 ILE B CG2  4  
ATOM 5177  C CD1  . ILE B 1 29 ? 14.332  8.397   -1.891  1.00 0.00 ? 29 ILE B CD1  4  
ATOM 5178  H H    . ILE B 1 29 ? 11.796  9.334   0.883   1.00 0.00 ? 29 ILE B H    4  
ATOM 5179  H HA   . ILE B 1 29 ? 13.532  11.550  0.758   1.00 0.00 ? 29 ILE B HA   4  
ATOM 5180  H HB   . ILE B 1 29 ? 12.216  10.118  -1.563  1.00 0.00 ? 29 ILE B HB   4  
ATOM 5181  H HG12 . ILE B 1 29 ? 14.893  9.588   -0.242  1.00 0.00 ? 29 ILE B HG12 4  
ATOM 5182  H HG13 . ILE B 1 29 ? 13.458  8.609   0.007   1.00 0.00 ? 29 ILE B HG13 4  
ATOM 5183  H HG21 . ILE B 1 29 ? 13.200  12.225  -2.256  1.00 0.00 ? 29 ILE B HG21 4  
ATOM 5184  H HG22 . ILE B 1 29 ? 14.192  10.902  -2.831  1.00 0.00 ? 29 ILE B HG22 4  
ATOM 5185  H HG23 . ILE B 1 29 ? 14.700  11.830  -1.422  1.00 0.00 ? 29 ILE B HG23 4  
ATOM 5186  H HD11 . ILE B 1 29 ? 15.036  8.928   -2.514  1.00 0.00 ? 29 ILE B HD11 4  
ATOM 5187  H HD12 . ILE B 1 29 ? 13.442  8.173   -2.462  1.00 0.00 ? 29 ILE B HD12 4  
ATOM 5188  H HD13 . ILE B 1 29 ? 14.780  7.475   -1.552  1.00 0.00 ? 29 ILE B HD13 4  
ATOM 5189  N N    . MET B 1 30 ? 10.454  12.125  -0.181  1.00 0.00 ? 30 MET B N    4  
ATOM 5190  C CA   . MET B 1 30 ? 9.501   13.176  -0.523  1.00 0.00 ? 30 MET B CA   4  
ATOM 5191  C C    . MET B 1 30 ? 9.487   14.269  0.542   1.00 0.00 ? 30 MET B C    4  
ATOM 5192  O O    . MET B 1 30 ? 9.544   15.456  0.227   1.00 0.00 ? 30 MET B O    4  
ATOM 5193  C CB   . MET B 1 30 ? 8.095   12.589  -0.682  1.00 0.00 ? 30 MET B CB   4  
ATOM 5194  C CG   . MET B 1 30 ? 7.045   13.615  -1.079  1.00 0.00 ? 30 MET B CG   4  
ATOM 5195  S SD   . MET B 1 30 ? 5.429   12.875  -1.381  1.00 0.00 ? 30 MET B SD   4  
ATOM 5196  C CE   . MET B 1 30 ? 5.079   12.149  0.219   1.00 0.00 ? 30 MET B CE   4  
ATOM 5197  H H    . MET B 1 30 ? 10.113  11.219  0.002   1.00 0.00 ? 30 MET B H    4  
ATOM 5198  H HA   . MET B 1 30 ? 9.803   13.613  -1.466  1.00 0.00 ? 30 MET B HA   4  
ATOM 5199  H HB2  . MET B 1 30 ? 8.131   11.836  -1.453  1.00 0.00 ? 30 MET B HB2  4  
ATOM 5200  H HB3  . MET B 1 30 ? 7.797   12.131  0.247   1.00 0.00 ? 30 MET B HB3  4  
ATOM 5201  H HG2  . MET B 1 30 ? 6.941   14.339  -0.285  1.00 0.00 ? 30 MET B HG2  4  
ATOM 5202  H HG3  . MET B 1 30 ? 7.368   14.115  -1.981  1.00 0.00 ? 30 MET B HG3  4  
ATOM 5203  H HE1  . MET B 1 30 ? 5.674   12.627  0.984   1.00 0.00 ? 30 MET B HE1  4  
ATOM 5204  H HE2  . MET B 1 30 ? 5.308   11.096  0.191   1.00 0.00 ? 30 MET B HE2  4  
ATOM 5205  H HE3  . MET B 1 30 ? 4.032   12.280  0.448   1.00 0.00 ? 30 MET B HE3  4  
ATOM 5206  N N    . LEU B 1 31 ? 9.411   13.858  1.803   1.00 0.00 ? 31 LEU B N    4  
ATOM 5207  C CA   . LEU B 1 31 ? 9.388   14.803  2.914   1.00 0.00 ? 31 LEU B CA   4  
ATOM 5208  C C    . LEU B 1 31 ? 10.780  15.378  3.163   1.00 0.00 ? 31 LEU B C    4  
ATOM 5209  O O    . LEU B 1 31 ? 10.921  16.466  3.720   1.00 0.00 ? 31 LEU B O    4  
ATOM 5210  C CB   . LEU B 1 31 ? 8.867   14.118  4.181   1.00 0.00 ? 31 LEU B CB   4  
ATOM 5211  C CG   . LEU B 1 31 ? 8.642   15.049  5.374   1.00 0.00 ? 31 LEU B CG   4  
ATOM 5212  C CD1  . LEU B 1 31 ? 7.479   15.994  5.105   1.00 0.00 ? 31 LEU B CD1  4  
ATOM 5213  C CD2  . LEU B 1 31 ? 8.397   14.241  6.639   1.00 0.00 ? 31 LEU B CD2  4  
ATOM 5214  H H    . LEU B 1 31 ? 9.369   12.891  1.997   1.00 0.00 ? 31 LEU B H    4  
ATOM 5215  H HA   . LEU B 1 31 ? 8.720   15.613  2.656   1.00 0.00 ? 31 LEU B HA   4  
ATOM 5216  H HB2  . LEU B 1 31 ? 7.931   13.629  3.940   1.00 0.00 ? 31 LEU B HB2  4  
ATOM 5217  H HB3  . LEU B 1 31 ? 9.581   13.355  4.468   1.00 0.00 ? 31 LEU B HB3  4  
ATOM 5218  H HG   . LEU B 1 31 ? 9.524   15.649  5.536   1.00 0.00 ? 31 LEU B HG   4  
ATOM 5219  H HD11 . LEU B 1 31 ? 7.325   16.633  5.964   1.00 0.00 ? 31 LEU B HD11 4  
ATOM 5220  H HD12 . LEU B 1 31 ? 6.580   15.423  4.919   1.00 0.00 ? 31 LEU B HD12 4  
ATOM 5221  H HD13 . LEU B 1 31 ? 7.700   16.607  4.244   1.00 0.00 ? 31 LEU B HD13 4  
ATOM 5222  H HD21 . LEU B 1 31 ? 9.245   13.597  6.828   1.00 0.00 ? 31 LEU B HD21 4  
ATOM 5223  H HD22 . LEU B 1 31 ? 7.507   13.638  6.521   1.00 0.00 ? 31 LEU B HD22 4  
ATOM 5224  H HD23 . LEU B 1 31 ? 8.267   14.911  7.478   1.00 0.00 ? 31 LEU B HD23 4  
ATOM 5225  N N    . TRP B 1 32 ? 11.804  14.638  2.747   1.00 0.00 ? 32 TRP B N    4  
ATOM 5226  C CA   . TRP B 1 32 ? 13.188  15.069  2.924   1.00 0.00 ? 32 TRP B CA   4  
ATOM 5227  C C    . TRP B 1 32 ? 13.506  16.277  2.047   1.00 0.00 ? 32 TRP B C    4  
ATOM 5228  O O    . TRP B 1 32 ? 14.271  17.158  2.441   1.00 0.00 ? 32 TRP B O    4  
ATOM 5229  C CB   . TRP B 1 32 ? 14.143  13.916  2.598   1.00 0.00 ? 32 TRP B CB   4  
ATOM 5230  C CG   . TRP B 1 32 ? 15.591  14.299  2.663   1.00 0.00 ? 32 TRP B CG   4  
ATOM 5231  C CD1  . TRP B 1 32 ? 16.273  14.749  3.756   1.00 0.00 ? 32 TRP B CD1  4  
ATOM 5232  C CD2  . TRP B 1 32 ? 16.539  14.260  1.588   1.00 0.00 ? 32 TRP B CD2  4  
ATOM 5233  N NE1  . TRP B 1 32 ? 17.584  14.995  3.427   1.00 0.00 ? 32 TRP B NE1  4  
ATOM 5234  C CE2  . TRP B 1 32 ? 17.772  14.703  2.104   1.00 0.00 ? 32 TRP B CE2  4  
ATOM 5235  C CE3  . TRP B 1 32 ? 16.463  13.893  0.241   1.00 0.00 ? 32 TRP B CE3  4  
ATOM 5236  C CZ2  . TRP B 1 32 ? 18.919  14.789  1.318   1.00 0.00 ? 32 TRP B CZ2  4  
ATOM 5237  C CZ3  . TRP B 1 32 ? 17.602  13.980  -0.537  1.00 0.00 ? 32 TRP B CZ3  4  
ATOM 5238  C CH2  . TRP B 1 32 ? 18.817  14.424  0.004   1.00 0.00 ? 32 TRP B CH2  4  
ATOM 5239  H H    . TRP B 1 32 ? 11.636  13.772  2.310   1.00 0.00 ? 32 TRP B H    4  
ATOM 5240  H HA   . TRP B 1 32 ? 13.326  15.348  3.961   1.00 0.00 ? 32 TRP B HA   4  
ATOM 5241  H HB2  . TRP B 1 32 ? 13.980  13.115  3.305   1.00 0.00 ? 32 TRP B HB2  4  
ATOM 5242  H HB3  . TRP B 1 32 ? 13.930  13.556  1.601   1.00 0.00 ? 32 TRP B HB3  4  
ATOM 5243  H HD1  . TRP B 1 32 ? 15.832  14.889  4.732   1.00 0.00 ? 32 TRP B HD1  4  
ATOM 5244  H HE1  . TRP B 1 32 ? 18.272  15.326  4.041   1.00 0.00 ? 32 TRP B HE1  4  
ATOM 5245  H HE3  . TRP B 1 32 ? 15.536  13.548  -0.193  1.00 0.00 ? 32 TRP B HE3  4  
ATOM 5246  H HZ2  . TRP B 1 32 ? 19.862  15.128  1.719   1.00 0.00 ? 32 TRP B HZ2  4  
ATOM 5247  H HZ3  . TRP B 1 32 ? 17.563  13.702  -1.580  1.00 0.00 ? 32 TRP B HZ3  4  
ATOM 5248  H HH2  . TRP B 1 32 ? 19.681  14.477  -0.641  1.00 0.00 ? 32 TRP B HH2  4  
ATOM 5249  N N    . GLN B 1 33 ? 12.914  16.312  0.857   1.00 0.00 ? 33 GLN B N    4  
ATOM 5250  C CA   . GLN B 1 33 ? 13.138  17.412  -0.076  1.00 0.00 ? 33 GLN B CA   4  
ATOM 5251  C C    . GLN B 1 33 ? 12.057  18.480  0.065   1.00 0.00 ? 33 GLN B C    4  
ATOM 5252  O O    . GLN B 1 33 ? 11.959  19.390  -0.758  1.00 0.00 ? 33 GLN B O    4  
ATOM 5253  C CB   . GLN B 1 33 ? 13.182  16.889  -1.514  1.00 0.00 ? 33 GLN B CB   4  
ATOM 5254  C CG   . GLN B 1 33 ? 14.424  16.066  -1.819  1.00 0.00 ? 33 GLN B CG   4  
ATOM 5255  C CD   . GLN B 1 33 ? 14.441  15.521  -3.235  1.00 0.00 ? 33 GLN B CD   4  
ATOM 5256  O OE1  . GLN B 1 33 ? 15.014  14.464  -3.496  1.00 0.00 ? 33 GLN B OE1  4  
ATOM 5257  N NE2  . GLN B 1 33 ? 13.814  16.240  -4.161  1.00 0.00 ? 33 GLN B NE2  4  
ATOM 5258  H H    . GLN B 1 33 ? 12.309  15.582  0.586   1.00 0.00 ? 33 GLN B H    4  
ATOM 5259  H HA   . GLN B 1 33 ? 14.094  17.874  0.149   1.00 0.00 ? 33 GLN B HA   4  
ATOM 5260  H HB2  . GLN B 1 33 ? 12.309  16.277  -1.692  1.00 0.00 ? 33 GLN B HB2  4  
ATOM 5261  H HB3  . GLN B 1 33 ? 13.164  17.736  -2.183  1.00 0.00 ? 33 GLN B HB3  4  
ATOM 5262  H HG2  . GLN B 1 33 ? 15.295  16.689  -1.681  1.00 0.00 ? 33 GLN B HG2  4  
ATOM 5263  H HG3  . GLN B 1 33 ? 14.465  15.235  -1.131  1.00 0.00 ? 33 GLN B HG3  4  
ATOM 5264  H HE21 . GLN B 1 33 ? 13.376  17.079  -3.931  1.00 0.00 ? 33 GLN B HE21 4  
ATOM 5265  H HE22 . GLN B 1 33 ? 13.816  15.884  -5.074  1.00 0.00 ? 33 GLN B HE22 4  
ATOM 5266  N N    . LYS B 1 34 ? 11.247  18.364  1.114   1.00 0.00 ? 34 LYS B N    4  
ATOM 5267  C CA   . LYS B 1 34 ? 10.175  19.323  1.366   1.00 0.00 ? 34 LYS B CA   4  
ATOM 5268  C C    . LYS B 1 34 ? 10.179  19.778  2.822   1.00 0.00 ? 34 LYS B C    4  
ATOM 5269  O O    . LYS B 1 34 ? 9.915   18.990  3.729   1.00 0.00 ? 34 LYS B O    4  
ATOM 5270  C CB   . LYS B 1 34 ? 8.816   18.709  1.018   1.00 0.00 ? 34 LYS B CB   4  
ATOM 5271  C CG   . LYS B 1 34 ? 8.684   18.301  -0.440  1.00 0.00 ? 34 LYS B CG   4  
ATOM 5272  C CD   . LYS B 1 34 ? 8.719   19.510  -1.363  1.00 0.00 ? 34 LYS B CD   4  
ATOM 5273  C CE   . LYS B 1 34 ? 8.622   19.100  -2.824  1.00 0.00 ? 34 LYS B CE   4  
ATOM 5274  N NZ   . LYS B 1 34 ? 8.643   20.279  -3.734  1.00 0.00 ? 34 LYS B NZ   4  
ATOM 5275  H H    . LYS B 1 34 ? 11.349  17.631  1.744   1.00 0.00 ? 34 LYS B H    4  
ATOM 5276  H HA   . LYS B 1 34 ? 10.328  20.194  0.742   1.00 0.00 ? 34 LYS B HA   4  
ATOM 5277  H HB2  . LYS B 1 34 ? 8.668   17.826  1.625   1.00 0.00 ? 34 LYS B HB2  4  
ATOM 5278  H HB3  . LYS B 1 34 ? 8.033   19.423  1.244   1.00 0.00 ? 34 LYS B HB3  4  
ATOM 5279  H HG2  . LYS B 1 34 ? 9.503   17.646  -0.696  1.00 0.00 ? 34 LYS B HG2  4  
ATOM 5280  H HG3  . LYS B 1 34 ? 7.746   17.781  -0.574  1.00 0.00 ? 34 LYS B HG3  4  
ATOM 5281  H HD2  . LYS B 1 34 ? 7.886   20.156  -1.130  1.00 0.00 ? 34 LYS B HD2  4  
ATOM 5282  H HD3  . LYS B 1 34 ? 9.642   20.048  -1.220  1.00 0.00 ? 34 LYS B HD3  4  
ATOM 5283  H HE2  . LYS B 1 34 ? 9.459   18.460  -3.065  1.00 0.00 ? 34 LYS B HE2  4  
ATOM 5284  H HE3  . LYS B 1 34 ? 7.699   18.558  -2.976  1.00 0.00 ? 34 LYS B HE3  4  
ATOM 5285  H HZ1  . LYS B 1 34 ? 8.576   19.964  -4.723  1.00 0.00 ? 34 LYS B HZ1  4  
ATOM 5286  H HZ2  . LYS B 1 34 ? 9.528   20.814  -3.614  1.00 0.00 ? 34 LYS B HZ2  4  
ATOM 5287  H HZ3  . LYS B 1 34 ? 7.839   20.909  -3.529  1.00 0.00 ? 34 LYS B HZ3  4  
ATOM 5288  N N    . LYS B 1 35 ? 10.482  21.055  3.038   1.00 0.00 ? 35 LYS B N    4  
ATOM 5289  C CA   . LYS B 1 35 ? 10.517  21.617  4.385   1.00 0.00 ? 35 LYS B CA   4  
ATOM 5290  C C    . LYS B 1 35 ? 9.162   22.220  4.754   1.00 0.00 ? 35 LYS B C    4  
ATOM 5291  O O    . LYS B 1 35 ? 8.415   22.656  3.878   1.00 0.00 ? 35 LYS B O    4  
ATOM 5292  C CB   . LYS B 1 35 ? 11.609  22.684  4.485   1.00 0.00 ? 35 LYS B CB   4  
ATOM 5293  C CG   . LYS B 1 35 ? 13.012  22.139  4.272   1.00 0.00 ? 35 LYS B CG   4  
ATOM 5294  C CD   . LYS B 1 35 ? 14.054  23.243  4.350   1.00 0.00 ? 35 LYS B CD   4  
ATOM 5295  C CE   . LYS B 1 35 ? 15.462  22.693  4.197   1.00 0.00 ? 35 LYS B CE   4  
ATOM 5296  N NZ   . LYS B 1 35 ? 15.801  21.725  5.276   1.00 0.00 ? 35 LYS B NZ   4  
ATOM 5297  H H    . LYS B 1 35 ? 10.683  21.644  2.272   1.00 0.00 ? 35 LYS B H    4  
ATOM 5298  H HA   . LYS B 1 35 ? 10.753  20.818  5.078   1.00 0.00 ? 35 LYS B HA   4  
ATOM 5299  H HB2  . LYS B 1 35 ? 11.420  23.440  3.735   1.00 0.00 ? 35 LYS B HB2  4  
ATOM 5300  H HB3  . LYS B 1 35 ? 11.570  23.144  5.464   1.00 0.00 ? 35 LYS B HB3  4  
ATOM 5301  H HG2  . LYS B 1 35 ? 13.214  21.404  5.037   1.00 0.00 ? 35 LYS B HG2  4  
ATOM 5302  H HG3  . LYS B 1 35 ? 13.063  21.672  3.298   1.00 0.00 ? 35 LYS B HG3  4  
ATOM 5303  H HD2  . LYS B 1 35 ? 13.872  23.956  3.559   1.00 0.00 ? 35 LYS B HD2  4  
ATOM 5304  H HD3  . LYS B 1 35 ? 13.976  23.738  5.309   1.00 0.00 ? 35 LYS B HD3  4  
ATOM 5305  H HE2  . LYS B 1 35 ? 15.544  22.197  3.240   1.00 0.00 ? 35 LYS B HE2  4  
ATOM 5306  H HE3  . LYS B 1 35 ? 16.160  23.517  4.234   1.00 0.00 ? 35 LYS B HE3  4  
ATOM 5307  H HZ1  . LYS B 1 35 ? 15.284  20.834  5.137   1.00 0.00 ? 35 LYS B HZ1  4  
ATOM 5308  H HZ2  . LYS B 1 35 ? 15.558  22.114  6.212   1.00 0.00 ? 35 LYS B HZ2  4  
ATOM 5309  H HZ3  . LYS B 1 35 ? 16.821  21.522  5.258   1.00 0.00 ? 35 LYS B HZ3  4  
ATOM 5310  N N    . PRO B 1 36 ? 8.823   22.252  6.057   1.00 0.00 ? 36 PRO B N    4  
ATOM 5311  C CA   . PRO B 1 36 ? 7.549   22.811  6.523   1.00 0.00 ? 36 PRO B CA   4  
ATOM 5312  C C    . PRO B 1 36 ? 7.473   24.317  6.308   1.00 0.00 ? 36 PRO B C    4  
ATOM 5313  O O    . PRO B 1 36 ? 8.496   25.001  6.272   1.00 0.00 ? 36 PRO B O    4  
ATOM 5314  C CB   . PRO B 1 36 ? 7.534   22.482  8.018   1.00 0.00 ? 36 PRO B CB   4  
ATOM 5315  C CG   . PRO B 1 36 ? 8.969   22.329  8.387   1.00 0.00 ? 36 PRO B CG   4  
ATOM 5316  C CD   . PRO B 1 36 ? 9.645   21.752  7.176   1.00 0.00 ? 36 PRO B CD   4  
ATOM 5317  H HA   . PRO B 1 36 ? 6.709   22.332  6.038   1.00 0.00 ? 36 PRO B HA   4  
ATOM 5318  H HB2  . PRO B 1 36 ? 7.060   23.275  8.584   1.00 0.00 ? 36 PRO B HB2  4  
ATOM 5319  H HB3  . PRO B 1 36 ? 6.995   21.560  8.174   1.00 0.00 ? 36 PRO B HB3  4  
ATOM 5320  H HG2  . PRO B 1 36 ? 9.391   23.293  8.629   1.00 0.00 ? 36 PRO B HG2  4  
ATOM 5321  H HG3  . PRO B 1 36 ? 9.063   21.655  9.226   1.00 0.00 ? 36 PRO B HG3  4  
ATOM 5322  H HD2  . PRO B 1 36 ? 10.659  22.112  7.106   1.00 0.00 ? 36 PRO B HD2  4  
ATOM 5323  H HD3  . PRO B 1 36 ? 9.628   20.673  7.213   1.00 0.00 ? 36 PRO B HD3  4  
ATOM 5324  N N    . ARG B 1 37 ? 6.254   24.830  6.164   1.00 0.00 ? 37 ARG B N    4  
ATOM 5325  C CA   . ARG B 1 37 ? 6.050   26.258  5.954   1.00 0.00 ? 37 ARG B CA   4  
ATOM 5326  C C    . ARG B 1 37 ? 5.695   26.949  7.266   1.00 0.00 ? 37 ARG B C    4  
ATOM 5327  O O    . ARG B 1 37 ? 5.018   26.374  8.119   1.00 0.00 ? 37 ARG B O    4  
ATOM 5328  C CB   . ARG B 1 37 ? 4.945   26.494  4.921   1.00 0.00 ? 37 ARG B CB   4  
ATOM 5329  C CG   . ARG B 1 37 ? 4.732   27.961  4.579   1.00 0.00 ? 37 ARG B CG   4  
ATOM 5330  C CD   . ARG B 1 37 ? 3.651   28.136  3.525   1.00 0.00 ? 37 ARG B CD   4  
ATOM 5331  N NE   . ARG B 1 37 ? 2.371   27.583  3.959   1.00 0.00 ? 37 ARG B NE   4  
ATOM 5332  C CZ   . ARG B 1 37 ? 1.250   27.669  3.249   1.00 0.00 ? 37 ARG B CZ   4  
ATOM 5333  N NH1  . ARG B 1 37 ? 1.246   28.290  2.077   1.00 0.00 ? 37 ARG B NH1  4  
ATOM 5334  N NH2  . ARG B 1 37 ? 0.129   27.133  3.712   1.00 0.00 ? 37 ARG B NH2  4  
ATOM 5335  H H    . ARG B 1 37 ? 5.467   24.236  6.204   1.00 0.00 ? 37 ARG B H    4  
ATOM 5336  H HA   . ARG B 1 37 ? 6.969   26.691  5.571   1.00 0.00 ? 37 ARG B HA   4  
ATOM 5337  H HB2  . ARG B 1 37 ? 5.209   25.967  4.014   1.00 0.00 ? 37 ARG B HB2  4  
ATOM 5338  H HB3  . ARG B 1 37 ? 4.022   26.087  5.304   1.00 0.00 ? 37 ARG B HB3  4  
ATOM 5339  H HG2  . ARG B 1 37 ? 4.434   28.495  5.468   1.00 0.00 ? 37 ARG B HG2  4  
ATOM 5340  H HG3  . ARG B 1 37 ? 5.658   28.372  4.203   1.00 0.00 ? 37 ARG B HG3  4  
ATOM 5341  H HD2  . ARG B 1 37 ? 3.530   29.192  3.328   1.00 0.00 ? 37 ARG B HD2  4  
ATOM 5342  H HD3  . ARG B 1 37 ? 3.961   27.636  2.618   1.00 0.00 ? 37 ARG B HD3  4  
ATOM 5343  H HE   . ARG B 1 37 ? 2.330   27.129  4.830   1.00 0.00 ? 37 ARG B HE   4  
ATOM 5344  H HH11 . ARG B 1 37 ? 2.077   28.703  1.706   1.00 0.00 ? 37 ARG B HH11 4  
ATOM 5345  H HH12 . ARG B 1 37 ? 0.396   28.349  1.550   1.00 0.00 ? 37 ARG B HH12 4  
ATOM 5346  H HH21 . ARG B 1 37 ? 0.124   26.662  4.597   1.00 0.00 ? 37 ARG B HH21 4  
ATOM 5347  H HH22 . ARG B 1 37 ? -0.718  27.196  3.179   1.00 0.00 ? 37 ARG B HH22 4  
ATOM 5348  N N    . TYR B 1 38 ? 6.156   28.185  7.422   1.00 0.00 ? 38 TYR B N    4  
ATOM 5349  C CA   . TYR B 1 38 ? 5.887   28.953  8.632   1.00 0.00 ? 38 TYR B CA   4  
ATOM 5350  C C    . TYR B 1 38 ? 5.199   30.273  8.298   1.00 0.00 ? 38 TYR B C    4  
ATOM 5351  O O    . TYR B 1 38 ? 5.703   31.061  7.495   1.00 0.00 ? 38 TYR B O    4  
ATOM 5352  C CB   . TYR B 1 38 ? 7.186   29.218  9.395   1.00 0.00 ? 38 TYR B CB   4  
ATOM 5353  C CG   . TYR B 1 38 ? 7.878   27.957  9.865   1.00 0.00 ? 38 TYR B CG   4  
ATOM 5354  C CD1  . TYR B 1 38 ? 8.753   27.273  9.032   1.00 0.00 ? 38 TYR B CD1  4  
ATOM 5355  C CD2  . TYR B 1 38 ? 7.656   27.453  11.140  1.00 0.00 ? 38 TYR B CD2  4  
ATOM 5356  C CE1  . TYR B 1 38 ? 9.388   26.120  9.456   1.00 0.00 ? 38 TYR B CE1  4  
ATOM 5357  C CE2  . TYR B 1 38 ? 8.288   26.302  11.572  1.00 0.00 ? 38 TYR B CE2  4  
ATOM 5358  C CZ   . TYR B 1 38 ? 9.152   25.640  10.727  1.00 0.00 ? 38 TYR B CZ   4  
ATOM 5359  O OH   . TYR B 1 38 ? 9.783   24.493  11.153  1.00 0.00 ? 38 TYR B OH   4  
ATOM 5360  H H    . TYR B 1 38 ? 6.695   28.600  6.710   1.00 0.00 ? 38 TYR B H    4  
ATOM 5361  H HA   . TYR B 1 38 ? 5.230   28.377  9.277   1.00 0.00 ? 38 TYR B HA   4  
ATOM 5362  H HB2  . TYR B 1 38 ? 7.868   29.759  8.750   1.00 0.00 ? 38 TYR B HB2  4  
ATOM 5363  H HB3  . TYR B 1 38 ? 6.970   29.830  10.264  1.00 0.00 ? 38 TYR B HB3  4  
ATOM 5364  H HD1  . TYR B 1 38 ? 8.939   27.650  8.035   1.00 0.00 ? 38 TYR B HD1  4  
ATOM 5365  H HD2  . TYR B 1 38 ? 6.978   27.972  11.804  1.00 0.00 ? 38 TYR B HD2  4  
ATOM 5366  H HE1  . TYR B 1 38 ? 10.065  25.602  8.793   1.00 0.00 ? 38 TYR B HE1  4  
ATOM 5367  H HE2  . TYR B 1 38 ? 8.102   25.925  12.567  1.00 0.00 ? 38 TYR B HE2  4  
ATOM 5368  H HH   . TYR B 1 38 ? 10.604  24.724  11.593  1.00 0.00 ? 38 TYR B HH   4  
ATOM 5369  N N    . GLU B 1 39 ? 4.048   30.505  8.917   1.00 0.00 ? 39 GLU B N    4  
ATOM 5370  C CA   . GLU B 1 39 ? 3.286   31.728  8.689   1.00 0.00 ? 39 GLU B CA   4  
ATOM 5371  C C    . GLU B 1 39 ? 2.434   32.073  9.906   1.00 0.00 ? 39 GLU B C    4  
ATOM 5372  O O    . GLU B 1 39 ? 2.514   33.229  10.376  1.00 0.00 ? 39 GLU B O    4  
ATOM 5373  C CB   . GLU B 1 39 ? 2.395   31.572  7.454   1.00 0.00 ? 39 GLU B CB   4  
ATOM 5374  C CG   . GLU B 1 39 ? 1.620   32.830  7.098   1.00 0.00 ? 39 GLU B CG   4  
ATOM 5375  C CD   . GLU B 1 39 ? 0.775   32.656  5.852   1.00 0.00 ? 39 GLU B CD   4  
ATOM 5376  O OE1  . GLU B 1 39 ? 1.289   32.914  4.743   1.00 0.00 ? 39 GLU B OE1  4  
ATOM 5377  O OE2  . GLU B 1 39 ? -0.404  32.261  5.984   1.00 0.00 ? 39 GLU B OE2  4  
ATOM 5378  O OXT  . GLU B 1 39 ? 1.691   31.187  10.382  1.00 0.00 ? 39 GLU B OXT  4  
ATOM 5379  H H    . GLU B 1 39 ? 3.691   29.834  9.547   1.00 0.00 ? 39 GLU B H    4  
ATOM 5380  H HA   . GLU B 1 39 ? 3.981   32.542  8.518   1.00 0.00 ? 39 GLU B HA   4  
ATOM 5381  H HB2  . GLU B 1 39 ? 3.020   31.308  6.612   1.00 0.00 ? 39 GLU B HB2  4  
ATOM 5382  H HB3  . GLU B 1 39 ? 1.688   30.772  7.629   1.00 0.00 ? 39 GLU B HB3  4  
ATOM 5383  H HG2  . GLU B 1 39 ? 0.965   33.087  7.916   1.00 0.00 ? 39 GLU B HG2  4  
ATOM 5384  H HG3  . GLU B 1 39 ? 2.320   33.635  6.930   1.00 0.00 ? 39 GLU B HG3  4  
ATOM 5385  N N    . GLY A 1 1  ? 6.152   -33.530 4.000   1.00 0.00 ? 1  GLY A N    5  
ATOM 5386  C CA   . GLY A 1 1  ? 7.398   -33.006 3.378   1.00 0.00 ? 1  GLY A CA   5  
ATOM 5387  C C    . GLY A 1 1  ? 7.497   -31.495 3.461   1.00 0.00 ? 1  GLY A C    5  
ATOM 5388  O O    . GLY A 1 1  ? 8.576   -30.949 3.691   1.00 0.00 ? 1  GLY A O    5  
ATOM 5389  H H1   . GLY A 1 1  ? 6.259   -34.546 4.197   1.00 0.00 ? 1  GLY A H1   5  
ATOM 5390  H H2   . GLY A 1 1  ? 5.347   -33.403 3.355   1.00 0.00 ? 1  GLY A H2   5  
ATOM 5391  H H3   . GLY A 1 1  ? 5.948   -33.038 4.897   1.00 0.00 ? 1  GLY A H3   5  
ATOM 5392  H HA2  . GLY A 1 1  ? 8.249   -33.440 3.882   1.00 0.00 ? 1  GLY A HA2  5  
ATOM 5393  H HA3  . GLY A 1 1  ? 7.420   -33.301 2.339   1.00 0.00 ? 1  GLY A HA3  5  
ATOM 5394  N N    . HIS A 1 2  ? 6.368   -30.821 3.275   1.00 0.00 ? 2  HIS A N    5  
ATOM 5395  C CA   . HIS A 1 2  ? 6.328   -29.364 3.330   1.00 0.00 ? 2  HIS A CA   5  
ATOM 5396  C C    . HIS A 1 2  ? 6.688   -28.862 4.726   1.00 0.00 ? 2  HIS A C    5  
ATOM 5397  O O    . HIS A 1 2  ? 6.372   -29.504 5.727   1.00 0.00 ? 2  HIS A O    5  
ATOM 5398  C CB   . HIS A 1 2  ? 4.940   -28.853 2.939   1.00 0.00 ? 2  HIS A CB   5  
ATOM 5399  C CG   . HIS A 1 2  ? 4.516   -29.261 1.563   1.00 0.00 ? 2  HIS A CG   5  
ATOM 5400  N ND1  . HIS A 1 2  ? 4.447   -28.380 0.506   1.00 0.00 ? 2  HIS A ND1  5  
ATOM 5401  C CD2  . HIS A 1 2  ? 4.130   -30.464 1.074   1.00 0.00 ? 2  HIS A CD2  5  
ATOM 5402  C CE1  . HIS A 1 2  ? 4.036   -29.020 -0.574  1.00 0.00 ? 2  HIS A CE1  5  
ATOM 5403  N NE2  . HIS A 1 2  ? 3.838   -30.286 -0.257  1.00 0.00 ? 2  HIS A NE2  5  
ATOM 5404  H H    . HIS A 1 2  ? 5.540   -31.312 3.107   1.00 0.00 ? 2  HIS A H    5  
ATOM 5405  H HA   . HIS A 1 2  ? 7.052   -28.982 2.619   1.00 0.00 ? 2  HIS A HA   5  
ATOM 5406  H HB2  . HIS A 1 2  ? 4.209   -29.240 3.635   1.00 0.00 ? 2  HIS A HB2  5  
ATOM 5407  H HB3  . HIS A 1 2  ? 4.932   -27.771 2.981   1.00 0.00 ? 2  HIS A HB3  5  
ATOM 5408  H HD1  . HIS A 1 2  ? 4.666   -27.425 0.542   1.00 0.00 ? 2  HIS A HD1  5  
ATOM 5409  H HD2  . HIS A 1 2  ? 4.048   -31.388 1.627   1.00 0.00 ? 2  HIS A HD2  5  
ATOM 5410  H HE1  . HIS A 1 2  ? 3.889   -28.582 -1.550  1.00 0.00 ? 2  HIS A HE1  5  
ATOM 5411  H HE2  . HIS A 1 2  ? 3.619   -31.000 -0.892  1.00 0.00 ? 2  HIS A HE2  5  
ATOM 5412  N N    . SER A 1 3  ? 7.353   -27.711 4.782   1.00 0.00 ? 3  SER A N    5  
ATOM 5413  C CA   . SER A 1 3  ? 7.754   -27.122 6.054   1.00 0.00 ? 3  SER A CA   5  
ATOM 5414  C C    . SER A 1 3  ? 6.815   -25.985 6.448   1.00 0.00 ? 3  SER A C    5  
ATOM 5415  O O    . SER A 1 3  ? 6.405   -25.880 7.604   1.00 0.00 ? 3  SER A O    5  
ATOM 5416  C CB   . SER A 1 3  ? 9.193   -26.609 5.969   1.00 0.00 ? 3  SER A CB   5  
ATOM 5417  O OG   . SER A 1 3  ? 10.099  -27.667 5.702   1.00 0.00 ? 3  SER A OG   5  
ATOM 5418  H H    . SER A 1 3  ? 7.579   -27.238 3.946   1.00 0.00 ? 3  SER A H    5  
ATOM 5419  H HA   . SER A 1 3  ? 7.711   -27.880 6.827   1.00 0.00 ? 3  SER A HA   5  
ATOM 5420  H HB2  . SER A 1 3  ? 9.267   -25.886 5.171   1.00 0.00 ? 3  SER A HB2  5  
ATOM 5421  H HB3  . SER A 1 3  ? 9.471   -26.143 6.906   1.00 0.00 ? 3  SER A HB3  5  
ATOM 5422  H HG   . SER A 1 3  ? 10.287  -28.144 6.514   1.00 0.00 ? 3  SER A HG   5  
ATOM 5423  N N    . LEU A 1 4  ? 6.479   -25.135 5.480   1.00 0.00 ? 4  LEU A N    5  
ATOM 5424  C CA   . LEU A 1 4  ? 5.584   -24.009 5.729   1.00 0.00 ? 4  LEU A CA   5  
ATOM 5425  C C    . LEU A 1 4  ? 4.272   -24.177 4.961   1.00 0.00 ? 4  LEU A C    5  
ATOM 5426  O O    . LEU A 1 4  ? 4.220   -23.924 3.758   1.00 0.00 ? 4  LEU A O    5  
ATOM 5427  C CB   . LEU A 1 4  ? 6.249   -22.686 5.325   1.00 0.00 ? 4  LEU A CB   5  
ATOM 5428  C CG   . LEU A 1 4  ? 7.600   -22.380 5.987   1.00 0.00 ? 4  LEU A CG   5  
ATOM 5429  C CD1  . LEU A 1 4  ? 7.568   -22.703 7.474   1.00 0.00 ? 4  LEU A CD1  5  
ATOM 5430  C CD2  . LEU A 1 4  ? 8.722   -23.140 5.294   1.00 0.00 ? 4  LEU A CD2  5  
ATOM 5431  H H    . LEU A 1 4  ? 6.833   -25.258 4.570   1.00 0.00 ? 4  LEU A H    5  
ATOM 5432  H HA   . LEU A 1 4  ? 5.368   -23.954 6.784   1.00 0.00 ? 4  LEU A HA   5  
ATOM 5433  H HB2  . LEU A 1 4  ? 6.380   -22.679 4.249   1.00 0.00 ? 4  LEU A HB2  5  
ATOM 5434  H HB3  . LEU A 1 4  ? 5.572   -21.882 5.582   1.00 0.00 ? 4  LEU A HB3  5  
ATOM 5435  H HG   . LEU A 1 4  ? 7.804   -21.323 5.886   1.00 0.00 ? 4  LEU A HG   5  
ATOM 5436  H HD11 . LEU A 1 4  ? 6.678   -22.282 7.923   1.00 0.00 ? 4  LEU A HD11 5  
ATOM 5437  H HD12 . LEU A 1 4  ? 8.437   -22.271 7.947   1.00 0.00 ? 4  LEU A HD12 5  
ATOM 5438  H HD13 . LEU A 1 4  ? 7.579   -23.764 7.629   1.00 0.00 ? 4  LEU A HD13 5  
ATOM 5439  H HD21 . LEU A 1 4  ? 9.165   -23.860 5.968   1.00 0.00 ? 4  LEU A HD21 5  
ATOM 5440  H HD22 . LEU A 1 4  ? 9.483   -22.438 4.988   1.00 0.00 ? 4  LEU A HD22 5  
ATOM 5441  H HD23 . LEU A 1 4  ? 8.352   -23.657 4.417   1.00 0.00 ? 4  LEU A HD23 5  
ATOM 5442  N N    . PRO A 1 5  ? 3.193   -24.612 5.641   1.00 0.00 ? 5  PRO A N    5  
ATOM 5443  C CA   . PRO A 1 5  ? 1.885   -24.805 5.002   1.00 0.00 ? 5  PRO A CA   5  
ATOM 5444  C C    . PRO A 1 5  ? 1.309   -23.502 4.462   1.00 0.00 ? 5  PRO A C    5  
ATOM 5445  O O    . PRO A 1 5  ? 1.793   -22.417 4.783   1.00 0.00 ? 5  PRO A O    5  
ATOM 5446  C CB   . PRO A 1 5  ? 0.997   -25.348 6.131   1.00 0.00 ? 5  PRO A CB   5  
ATOM 5447  C CG   . PRO A 1 5  ? 1.942   -25.834 7.175   1.00 0.00 ? 5  PRO A CG   5  
ATOM 5448  C CD   . PRO A 1 5  ? 3.153   -24.952 7.074   1.00 0.00 ? 5  PRO A CD   5  
ATOM 5449  H HA   . PRO A 1 5  ? 1.940   -25.531 4.203   1.00 0.00 ? 5  PRO A HA   5  
ATOM 5450  H HB2  . PRO A 1 5  ? 0.355   -24.569 6.525   1.00 0.00 ? 5  PRO A HB2  5  
ATOM 5451  H HB3  . PRO A 1 5  ? 0.390   -26.156 5.751   1.00 0.00 ? 5  PRO A HB3  5  
ATOM 5452  H HG2  . PRO A 1 5  ? 1.490   -25.741 8.152   1.00 0.00 ? 5  PRO A HG2  5  
ATOM 5453  H HG3  . PRO A 1 5  ? 2.209   -26.862 6.979   1.00 0.00 ? 5  PRO A HG3  5  
ATOM 5454  H HD2  . PRO A 1 5  ? 3.030   -24.067 7.682   1.00 0.00 ? 5  PRO A HD2  5  
ATOM 5455  H HD3  . PRO A 1 5  ? 4.029   -25.502 7.372   1.00 0.00 ? 5  PRO A HD3  5  
ATOM 5456  N N    . PHE A 1 6  ? 0.270   -23.618 3.639   1.00 0.00 ? 6  PHE A N    5  
ATOM 5457  C CA   . PHE A 1 6  ? -0.381  -22.452 3.047   1.00 0.00 ? 6  PHE A CA   5  
ATOM 5458  C C    . PHE A 1 6  ? -0.988  -21.557 4.124   1.00 0.00 ? 6  PHE A C    5  
ATOM 5459  O O    . PHE A 1 6  ? -1.325  -20.402 3.863   1.00 0.00 ? 6  PHE A O    5  
ATOM 5460  C CB   . PHE A 1 6  ? -1.465  -22.887 2.055   1.00 0.00 ? 6  PHE A CB   5  
ATOM 5461  C CG   . PHE A 1 6  ? -2.581  -23.679 2.679   1.00 0.00 ? 6  PHE A CG   5  
ATOM 5462  C CD1  . PHE A 1 6  ? -2.443  -25.039 2.904   1.00 0.00 ? 6  PHE A CD1  5  
ATOM 5463  C CD2  . PHE A 1 6  ? -3.770  -23.062 3.034   1.00 0.00 ? 6  PHE A CD2  5  
ATOM 5464  C CE1  . PHE A 1 6  ? -3.469  -25.770 3.472   1.00 0.00 ? 6  PHE A CE1  5  
ATOM 5465  C CE2  . PHE A 1 6  ? -4.800  -23.787 3.602   1.00 0.00 ? 6  PHE A CE2  5  
ATOM 5466  C CZ   . PHE A 1 6  ? -4.649  -25.143 3.821   1.00 0.00 ? 6  PHE A CZ   5  
ATOM 5467  H H    . PHE A 1 6  ? -0.050  -24.511 3.425   1.00 0.00 ? 6  PHE A H    5  
ATOM 5468  H HA   . PHE A 1 6  ? 0.361   -21.893 2.507   1.00 0.00 ? 6  PHE A HA   5  
ATOM 5469  H HB2  . PHE A 1 6  ? -1.887  -22.006 1.585   1.00 0.00 ? 6  PHE A HB2  5  
ATOM 5470  H HB3  . PHE A 1 6  ? -1.005  -23.498 1.288   1.00 0.00 ? 6  PHE A HB3  5  
ATOM 5471  H HD1  . PHE A 1 6  ? -1.529  -25.540 2.625   1.00 0.00 ? 6  PHE A HD1  5  
ATOM 5472  H HD2  . PHE A 1 6  ? -3.893  -22.001 2.865   1.00 0.00 ? 6  PHE A HD2  5  
ATOM 5473  H HE1  . PHE A 1 6  ? -3.349  -26.830 3.642   1.00 0.00 ? 6  PHE A HE1  5  
ATOM 5474  H HE2  . PHE A 1 6  ? -5.722  -23.295 3.874   1.00 0.00 ? 6  PHE A HE2  5  
ATOM 5475  H HZ   . PHE A 1 6  ? -5.453  -25.712 4.265   1.00 0.00 ? 6  PHE A HZ   5  
ATOM 5476  N N    . LYS A 1 7  ? -1.128  -22.095 5.330   1.00 0.00 ? 7  LYS A N    5  
ATOM 5477  C CA   . LYS A 1 7  ? -1.705  -21.344 6.440   1.00 0.00 ? 7  LYS A CA   5  
ATOM 5478  C C    . LYS A 1 7  ? -0.936  -20.052 6.701   1.00 0.00 ? 7  LYS A C    5  
ATOM 5479  O O    . LYS A 1 7  ? -1.520  -18.971 6.747   1.00 0.00 ? 7  LYS A O    5  
ATOM 5480  C CB   . LYS A 1 7  ? -1.714  -22.201 7.710   1.00 0.00 ? 7  LYS A CB   5  
ATOM 5481  C CG   . LYS A 1 7  ? -2.692  -23.365 7.660   1.00 0.00 ? 7  LYS A CG   5  
ATOM 5482  C CD   . LYS A 1 7  ? -4.133  -22.882 7.676   1.00 0.00 ? 7  LYS A CD   5  
ATOM 5483  C CE   . LYS A 1 7  ? -5.105  -24.038 7.852   1.00 0.00 ? 7  LYS A CE   5  
ATOM 5484  N NZ   . LYS A 1 7  ? -4.896  -24.745 9.146   1.00 0.00 ? 7  LYS A NZ   5  
ATOM 5485  H H    . LYS A 1 7  ? -0.868  -23.023 5.493   1.00 0.00 ? 7  LYS A H    5  
ATOM 5486  H HA   . LYS A 1 7  ? -2.720  -21.086 6.177   1.00 0.00 ? 7  LYS A HA   5  
ATOM 5487  H HB2  . LYS A 1 7  ? -0.723  -22.605 7.858   1.00 0.00 ? 7  LYS A HB2  5  
ATOM 5488  H HB3  . LYS A 1 7  ? -1.968  -21.581 8.564   1.00 0.00 ? 7  LYS A HB3  5  
ATOM 5489  H HG2  . LYS A 1 7  ? -2.521  -23.935 6.757   1.00 0.00 ? 7  LYS A HG2  5  
ATOM 5490  H HG3  . LYS A 1 7  ? -2.512  -23.990 8.521   1.00 0.00 ? 7  LYS A HG3  5  
ATOM 5491  H HD2  . LYS A 1 7  ? -4.271  -22.189 8.495   1.00 0.00 ? 7  LYS A HD2  5  
ATOM 5492  H HD3  . LYS A 1 7  ? -4.348  -22.386 6.742   1.00 0.00 ? 7  LYS A HD3  5  
ATOM 5493  H HE2  . LYS A 1 7  ? -6.112  -23.650 7.825   1.00 0.00 ? 7  LYS A HE2  5  
ATOM 5494  H HE3  . LYS A 1 7  ? -4.970  -24.739 7.040   1.00 0.00 ? 7  LYS A HE3  5  
ATOM 5495  H HZ1  . LYS A 1 7  ? -4.804  -24.064 9.931   1.00 0.00 ? 7  LYS A HZ1  5  
ATOM 5496  H HZ2  . LYS A 1 7  ? -4.037  -25.327 9.104   1.00 0.00 ? 7  LYS A HZ2  5  
ATOM 5497  H HZ3  . LYS A 1 7  ? -5.707  -25.367 9.341   1.00 0.00 ? 7  LYS A HZ3  5  
ATOM 5498  N N    . VAL A 1 8  ? 0.377   -20.169 6.865   1.00 0.00 ? 8  VAL A N    5  
ATOM 5499  C CA   . VAL A 1 8  ? 1.222   -19.009 7.131   1.00 0.00 ? 8  VAL A CA   5  
ATOM 5500  C C    . VAL A 1 8  ? 1.377   -18.127 5.893   1.00 0.00 ? 8  VAL A C    5  
ATOM 5501  O O    . VAL A 1 8  ? 1.451   -16.903 6.001   1.00 0.00 ? 8  VAL A O    5  
ATOM 5502  C CB   . VAL A 1 8  ? 2.621   -19.434 7.619   1.00 0.00 ? 8  VAL A CB   5  
ATOM 5503  C CG1  . VAL A 1 8  ? 3.427   -18.218 8.049   1.00 0.00 ? 8  VAL A CG1  5  
ATOM 5504  C CG2  . VAL A 1 8  ? 2.509   -20.437 8.755   1.00 0.00 ? 8  VAL A CG2  5  
ATOM 5505  H H    . VAL A 1 8  ? 0.787   -21.063 6.798   1.00 0.00 ? 8  VAL A H    5  
ATOM 5506  H HA   . VAL A 1 8  ? 0.754   -18.425 7.917   1.00 0.00 ? 8  VAL A HA   5  
ATOM 5507  H HB   . VAL A 1 8  ? 3.144   -19.914 6.801   1.00 0.00 ? 8  VAL A HB   5  
ATOM 5508  H HG11 . VAL A 1 8  ? 3.602   -17.573 7.202   1.00 0.00 ? 8  VAL A HG11 5  
ATOM 5509  H HG12 . VAL A 1 8  ? 4.381   -18.537 8.448   1.00 0.00 ? 8  VAL A HG12 5  
ATOM 5510  H HG13 . VAL A 1 8  ? 2.887   -17.673 8.811   1.00 0.00 ? 8  VAL A HG13 5  
ATOM 5511  H HG21 . VAL A 1 8  ? 3.496   -20.668 9.134   1.00 0.00 ? 8  VAL A HG21 5  
ATOM 5512  H HG22 . VAL A 1 8  ? 2.051   -21.346 8.400   1.00 0.00 ? 8  VAL A HG22 5  
ATOM 5513  H HG23 . VAL A 1 8  ? 1.911   -20.019 9.553   1.00 0.00 ? 8  VAL A HG23 5  
ATOM 5514  N N    . VAL A 1 9  ? 1.429   -18.753 4.721   1.00 0.00 ? 9  VAL A N    5  
ATOM 5515  C CA   . VAL A 1 9  ? 1.592   -18.018 3.469   1.00 0.00 ? 9  VAL A CA   5  
ATOM 5516  C C    . VAL A 1 9  ? 0.433   -17.053 3.226   1.00 0.00 ? 9  VAL A C    5  
ATOM 5517  O O    . VAL A 1 9  ? 0.645   -15.863 2.992   1.00 0.00 ? 9  VAL A O    5  
ATOM 5518  C CB   . VAL A 1 9  ? 1.696   -18.967 2.259   1.00 0.00 ? 9  VAL A CB   5  
ATOM 5519  C CG1  . VAL A 1 9  ? 2.335   -18.255 1.078   1.00 0.00 ? 9  VAL A CG1  5  
ATOM 5520  C CG2  . VAL A 1 9  ? 2.477   -20.219 2.619   1.00 0.00 ? 9  VAL A CG2  5  
ATOM 5521  H H    . VAL A 1 9  ? 1.356   -19.726 4.709   1.00 0.00 ? 9  VAL A H    5  
ATOM 5522  H HA   . VAL A 1 9  ? 2.512   -17.448 3.540   1.00 0.00 ? 9  VAL A HA   5  
ATOM 5523  H HB   . VAL A 1 9  ? 0.699   -19.275 1.964   1.00 0.00 ? 9  VAL A HB   5  
ATOM 5524  H HG11 . VAL A 1 9  ? 1.745   -17.389 0.813   1.00 0.00 ? 9  VAL A HG11 5  
ATOM 5525  H HG12 . VAL A 1 9  ? 2.380   -18.926 0.231   1.00 0.00 ? 9  VAL A HG12 5  
ATOM 5526  H HG13 . VAL A 1 9  ? 3.336   -17.940 1.340   1.00 0.00 ? 9  VAL A HG13 5  
ATOM 5527  H HG21 . VAL A 1 9  ? 3.404   -19.950 3.108   1.00 0.00 ? 9  VAL A HG21 5  
ATOM 5528  H HG22 . VAL A 1 9  ? 2.699   -20.784 1.723   1.00 0.00 ? 9  VAL A HG22 5  
ATOM 5529  H HG23 . VAL A 1 9  ? 1.895   -20.826 3.269   1.00 0.00 ? 9  VAL A HG23 5  
ATOM 5530  N N    . VAL A 1 10 ? -0.789  -17.575 3.279   1.00 0.00 ? 10 VAL A N    5  
ATOM 5531  C CA   . VAL A 1 10 ? -1.985  -16.767 3.050   1.00 0.00 ? 10 VAL A CA   5  
ATOM 5532  C C    . VAL A 1 10 ? -2.100  -15.617 4.048   1.00 0.00 ? 10 VAL A C    5  
ATOM 5533  O O    . VAL A 1 10 ? -2.243  -14.461 3.656   1.00 0.00 ? 10 VAL A O    5  
ATOM 5534  C CB   . VAL A 1 10 ? -3.262  -17.629 3.120   1.00 0.00 ? 10 VAL A CB   5  
ATOM 5535  C CG1  . VAL A 1 10 ? -4.503  -16.770 2.916   1.00 0.00 ? 10 VAL A CG1  5  
ATOM 5536  C CG2  . VAL A 1 10 ? -3.209  -18.746 2.091   1.00 0.00 ? 10 VAL A CG2  5  
ATOM 5537  H H    . VAL A 1 10 ? -0.885  -18.535 3.477   1.00 0.00 ? 10 VAL A H    5  
ATOM 5538  H HA   . VAL A 1 10 ? -1.917  -16.348 2.053   1.00 0.00 ? 10 VAL A HA   5  
ATOM 5539  H HB   . VAL A 1 10 ? -3.319  -18.078 4.102   1.00 0.00 ? 10 VAL A HB   5  
ATOM 5540  H HG11 . VAL A 1 10 ? -4.385  -16.155 2.034   1.00 0.00 ? 10 VAL A HG11 5  
ATOM 5541  H HG12 . VAL A 1 10 ? -4.658  -16.138 3.777   1.00 0.00 ? 10 VAL A HG12 5  
ATOM 5542  H HG13 . VAL A 1 10 ? -5.371  -17.405 2.792   1.00 0.00 ? 10 VAL A HG13 5  
ATOM 5543  H HG21 . VAL A 1 10 ? -4.030  -19.425 2.262   1.00 0.00 ? 10 VAL A HG21 5  
ATOM 5544  H HG22 . VAL A 1 10 ? -2.285  -19.286 2.157   1.00 0.00 ? 10 VAL A HG22 5  
ATOM 5545  H HG23 . VAL A 1 10 ? -3.299  -18.329 1.097   1.00 0.00 ? 10 VAL A HG23 5  
ATOM 5546  N N    . ILE A 1 11 ? -2.040  -15.938 5.337   1.00 0.00 ? 11 ILE A N    5  
ATOM 5547  C CA   . ILE A 1 11 ? -2.153  -14.927 6.384   1.00 0.00 ? 11 ILE A CA   5  
ATOM 5548  C C    . ILE A 1 11 ? -1.130  -13.807 6.197   1.00 0.00 ? 11 ILE A C    5  
ATOM 5549  O O    . ILE A 1 11 ? -1.446  -12.631 6.380   1.00 0.00 ? 11 ILE A O    5  
ATOM 5550  C CB   . ILE A 1 11 ? -1.975  -15.544 7.785   1.00 0.00 ? 11 ILE A CB   5  
ATOM 5551  C CG1  . ILE A 1 11 ? -3.034  -16.622 8.029   1.00 0.00 ? 11 ILE A CG1  5  
ATOM 5552  C CG2  . ILE A 1 11 ? -2.053  -14.463 8.856   1.00 0.00 ? 11 ILE A CG2  5  
ATOM 5553  C CD1  . ILE A 1 11 ? -2.860  -17.362 9.338   1.00 0.00 ? 11 ILE A CD1  5  
ATOM 5554  H H    . ILE A 1 11 ? -1.918  -16.883 5.585   1.00 0.00 ? 11 ILE A H    5  
ATOM 5555  H HA   . ILE A 1 11 ? -3.146  -14.499 6.326   1.00 0.00 ? 11 ILE A HA   5  
ATOM 5556  H HB   . ILE A 1 11 ? -0.994  -15.996 7.835   1.00 0.00 ? 11 ILE A HB   5  
ATOM 5557  H HG12 . ILE A 1 11 ? -4.010  -16.158 8.048   1.00 0.00 ? 11 ILE A HG12 5  
ATOM 5558  H HG13 . ILE A 1 11 ? -3.017  -17.347 7.239   1.00 0.00 ? 11 ILE A HG13 5  
ATOM 5559  H HG21 . ILE A 1 11 ? -3.000  -13.946 8.782   1.00 0.00 ? 11 ILE A HG21 5  
ATOM 5560  H HG22 . ILE A 1 11 ? -1.248  -13.756 8.731   1.00 0.00 ? 11 ILE A HG22 5  
ATOM 5561  H HG23 . ILE A 1 11 ? -1.967  -14.905 9.837   1.00 0.00 ? 11 ILE A HG23 5  
ATOM 5562  H HD11 . ILE A 1 11 ? -1.833  -17.682 9.445   1.00 0.00 ? 11 ILE A HD11 5  
ATOM 5563  H HD12 . ILE A 1 11 ? -3.506  -18.227 9.347   1.00 0.00 ? 11 ILE A HD12 5  
ATOM 5564  H HD13 . ILE A 1 11 ? -3.123  -16.712 10.159  1.00 0.00 ? 11 ILE A HD13 5  
ATOM 5565  N N    . SER A 1 12 ? 0.093   -14.179 5.838   1.00 0.00 ? 12 SER A N    5  
ATOM 5566  C CA   . SER A 1 12 ? 1.159   -13.204 5.636   1.00 0.00 ? 12 SER A CA   5  
ATOM 5567  C C    . SER A 1 12 ? 0.918   -12.365 4.383   1.00 0.00 ? 12 SER A C    5  
ATOM 5568  O O    . SER A 1 12 ? 1.167   -11.159 4.374   1.00 0.00 ? 12 SER A O    5  
ATOM 5569  C CB   . SER A 1 12 ? 2.512   -13.912 5.533   1.00 0.00 ? 12 SER A CB   5  
ATOM 5570  O OG   . SER A 1 12 ? 3.563   -12.982 5.338   1.00 0.00 ? 12 SER A OG   5  
ATOM 5571  H H    . SER A 1 12 ? 0.292   -15.137 5.709   1.00 0.00 ? 12 SER A H    5  
ATOM 5572  H HA   . SER A 1 12 ? 1.182   -12.544 6.494   1.00 0.00 ? 12 SER A HA   5  
ATOM 5573  H HB2  . SER A 1 12 ? 2.698   -14.461 6.445   1.00 0.00 ? 12 SER A HB2  5  
ATOM 5574  H HB3  . SER A 1 12 ? 2.496   -14.599 4.699   1.00 0.00 ? 12 SER A HB3  5  
ATOM 5575  H HG   . SER A 1 12 ? 3.803   -12.584 6.179   1.00 0.00 ? 12 SER A HG   5  
ATOM 5576  N N    . ALA A 1 13 ? 0.432   -13.012 3.329   1.00 0.00 ? 13 ALA A N    5  
ATOM 5577  C CA   . ALA A 1 13 ? 0.165   -12.331 2.067   1.00 0.00 ? 13 ALA A CA   5  
ATOM 5578  C C    . ALA A 1 13 ? -0.943  -11.292 2.214   1.00 0.00 ? 13 ALA A C    5  
ATOM 5579  O O    . ALA A 1 13 ? -0.753  -10.120 1.889   1.00 0.00 ? 13 ALA A O    5  
ATOM 5580  C CB   . ALA A 1 13 ? -0.207  -13.345 0.995   1.00 0.00 ? 13 ALA A CB   5  
ATOM 5581  H H    . ALA A 1 13 ? 0.253   -13.980 3.393   1.00 0.00 ? 13 ALA A H    5  
ATOM 5582  H HA   . ALA A 1 13 ? 1.072   -11.832 1.751   1.00 0.00 ? 13 ALA A HA   5  
ATOM 5583  H HB1  . ALA A 1 13 ? -0.342  -12.841 0.048   1.00 0.00 ? 13 ALA A HB1  5  
ATOM 5584  H HB2  . ALA A 1 13 ? -1.124  -13.847 1.271   1.00 0.00 ? 13 ALA A HB2  5  
ATOM 5585  H HB3  . ALA A 1 13 ? 0.585   -14.073 0.902   1.00 0.00 ? 13 ALA A HB3  5  
ATOM 5586  N N    . ILE A 1 14 ? -2.095  -11.729 2.709   1.00 0.00 ? 14 ILE A N    5  
ATOM 5587  C CA   . ILE A 1 14 ? -3.237  -10.843 2.895   1.00 0.00 ? 14 ILE A CA   5  
ATOM 5588  C C    . ILE A 1 14 ? -2.868  -9.630  3.742   1.00 0.00 ? 14 ILE A C    5  
ATOM 5589  O O    . ILE A 1 14 ? -3.139  -8.492  3.359   1.00 0.00 ? 14 ILE A O    5  
ATOM 5590  C CB   . ILE A 1 14 ? -4.416  -11.582 3.562   1.00 0.00 ? 14 ILE A CB   5  
ATOM 5591  C CG1  . ILE A 1 14 ? -4.841  -12.780 2.708   1.00 0.00 ? 14 ILE A CG1  5  
ATOM 5592  C CG2  . ILE A 1 14 ? -5.583  -10.629 3.776   1.00 0.00 ? 14 ILE A CG2  5  
ATOM 5593  C CD1  . ILE A 1 14 ? -5.929  -13.623 3.340   1.00 0.00 ? 14 ILE A CD1  5  
ATOM 5594  H H    . ILE A 1 14 ? -2.171  -12.678 2.959   1.00 0.00 ? 14 ILE A H    5  
ATOM 5595  H HA   . ILE A 1 14 ? -3.557  -10.501 1.919   1.00 0.00 ? 14 ILE A HA   5  
ATOM 5596  H HB   . ILE A 1 14 ? -4.091  -11.938 4.530   1.00 0.00 ? 14 ILE A HB   5  
ATOM 5597  H HG12 . ILE A 1 14 ? -5.217  -12.423 1.760   1.00 0.00 ? 14 ILE A HG12 5  
ATOM 5598  H HG13 . ILE A 1 14 ? -4.002  -13.423 2.525   1.00 0.00 ? 14 ILE A HG13 5  
ATOM 5599  H HG21 . ILE A 1 14 ? -5.894  -10.216 2.826   1.00 0.00 ? 14 ILE A HG21 5  
ATOM 5600  H HG22 . ILE A 1 14 ? -5.294  -9.827  4.438   1.00 0.00 ? 14 ILE A HG22 5  
ATOM 5601  H HG23 . ILE A 1 14 ? -6.413  -11.154 4.223   1.00 0.00 ? 14 ILE A HG23 5  
ATOM 5602  H HD11 . ILE A 1 14 ? -6.851  -13.063 3.368   1.00 0.00 ? 14 ILE A HD11 5  
ATOM 5603  H HD12 . ILE A 1 14 ? -5.642  -13.897 4.345   1.00 0.00 ? 14 ILE A HD12 5  
ATOM 5604  H HD13 . ILE A 1 14 ? -6.074  -14.517 2.753   1.00 0.00 ? 14 ILE A HD13 5  
ATOM 5605  N N    . LEU A 1 15 ? -2.249  -9.879  4.891   1.00 0.00 ? 15 LEU A N    5  
ATOM 5606  C CA   . LEU A 1 15 ? -1.846  -8.802  5.790   1.00 0.00 ? 15 LEU A CA   5  
ATOM 5607  C C    . LEU A 1 15 ? -0.962  -7.791  5.068   1.00 0.00 ? 15 LEU A C    5  
ATOM 5608  O O    . LEU A 1 15 ? -1.041  -6.588  5.322   1.00 0.00 ? 15 LEU A O    5  
ATOM 5609  C CB   . LEU A 1 15 ? -1.105  -9.366  7.004   1.00 0.00 ? 15 LEU A CB   5  
ATOM 5610  C CG   . LEU A 1 15 ? -0.649  -8.322  8.027   1.00 0.00 ? 15 LEU A CG   5  
ATOM 5611  C CD1  . LEU A 1 15 ? -1.849  -7.619  8.644   1.00 0.00 ? 15 LEU A CD1  5  
ATOM 5612  C CD2  . LEU A 1 15 ? 0.206   -8.967  9.106   1.00 0.00 ? 15 LEU A CD2  5  
ATOM 5613  H H    . LEU A 1 15 ? -2.059  -10.814 5.144   1.00 0.00 ? 15 LEU A H    5  
ATOM 5614  H HA   . LEU A 1 15 ? -2.742  -8.302  6.126   1.00 0.00 ? 15 LEU A HA   5  
ATOM 5615  H HB2  . LEU A 1 15 ? -1.757  -10.075 7.499   1.00 0.00 ? 15 LEU A HB2  5  
ATOM 5616  H HB3  . LEU A 1 15 ? -0.233  -9.899  6.646   1.00 0.00 ? 15 LEU A HB3  5  
ATOM 5617  H HG   . LEU A 1 15 ? -0.045  -7.574  7.535   1.00 0.00 ? 15 LEU A HG   5  
ATOM 5618  H HD11 . LEU A 1 15 ? -1.511  -6.907  9.386   1.00 0.00 ? 15 LEU A HD11 5  
ATOM 5619  H HD12 . LEU A 1 15 ? -2.496  -8.346  9.116   1.00 0.00 ? 15 LEU A HD12 5  
ATOM 5620  H HD13 . LEU A 1 15 ? -2.398  -7.094  7.877   1.00 0.00 ? 15 LEU A HD13 5  
ATOM 5621  H HD21 . LEU A 1 15 ? 0.541   -8.212  9.804   1.00 0.00 ? 15 LEU A HD21 5  
ATOM 5622  H HD22 . LEU A 1 15 ? 1.067   -9.438  8.652   1.00 0.00 ? 15 LEU A HD22 5  
ATOM 5623  H HD23 . LEU A 1 15 ? -0.373  -9.712  9.634   1.00 0.00 ? 15 LEU A HD23 5  
ATOM 5624  N N    . ALA A 1 16 ? -0.124  -8.285  4.164   1.00 0.00 ? 16 ALA A N    5  
ATOM 5625  C CA   . ALA A 1 16 ? 0.771   -7.425  3.403   1.00 0.00 ? 16 ALA A CA   5  
ATOM 5626  C C    . ALA A 1 16 ? -0.014  -6.505  2.473   1.00 0.00 ? 16 ALA A C    5  
ATOM 5627  O O    . ALA A 1 16 ? 0.400   -5.378  2.203   1.00 0.00 ? 16 ALA A O    5  
ATOM 5628  C CB   . ALA A 1 16 ? 1.759   -8.266  2.615   1.00 0.00 ? 16 ALA A CB   5  
ATOM 5629  H H    . ALA A 1 16 ? -0.101  -9.257  3.999   1.00 0.00 ? 16 ALA A H    5  
ATOM 5630  H HA   . ALA A 1 16 ? 1.336   -6.821  4.101   1.00 0.00 ? 16 ALA A HA   5  
ATOM 5631  H HB1  . ALA A 1 16 ? 1.251   -8.786  1.817   1.00 0.00 ? 16 ALA A HB1  5  
ATOM 5632  H HB2  . ALA A 1 16 ? 2.222   -8.987  3.273   1.00 0.00 ? 16 ALA A HB2  5  
ATOM 5633  H HB3  . ALA A 1 16 ? 2.520   -7.624  2.197   1.00 0.00 ? 16 ALA A HB3  5  
ATOM 5634  N N    . LEU A 1 17 ? -1.146  -6.997  1.981   1.00 0.00 ? 17 LEU A N    5  
ATOM 5635  C CA   . LEU A 1 17 ? -1.996  -6.216  1.092   1.00 0.00 ? 17 LEU A CA   5  
ATOM 5636  C C    . LEU A 1 17 ? -2.722  -5.127  1.871   1.00 0.00 ? 17 LEU A C    5  
ATOM 5637  O O    . LEU A 1 17 ? -3.000  -4.050  1.344   1.00 0.00 ? 17 LEU A O    5  
ATOM 5638  C CB   . LEU A 1 17 ? -3.015  -7.122  0.393   1.00 0.00 ? 17 LEU A CB   5  
ATOM 5639  C CG   . LEU A 1 17 ? -2.567  -7.705  -0.951  1.00 0.00 ? 17 LEU A CG   5  
ATOM 5640  C CD1  . LEU A 1 17 ? -2.328  -6.594  -1.963  1.00 0.00 ? 17 LEU A CD1  5  
ATOM 5641  C CD2  . LEU A 1 17 ? -1.315  -8.552  -0.782  1.00 0.00 ? 17 LEU A CD2  5  
ATOM 5642  H H    . LEU A 1 17 ? -1.425  -7.907  2.221   1.00 0.00 ? 17 LEU A H    5  
ATOM 5643  H HA   . LEU A 1 17 ? -1.365  -5.738  0.360   1.00 0.00 ? 17 LEU A HA   5  
ATOM 5644  H HB2  . LEU A 1 17 ? -3.259  -7.944  1.047   1.00 0.00 ? 17 LEU A HB2  5  
ATOM 5645  H HB3  . LEU A 1 17 ? -3.926  -6.560  0.216   1.00 0.00 ? 17 LEU A HB3  5  
ATOM 5646  H HG   . LEU A 1 17 ? -3.351  -8.341  -1.337  1.00 0.00 ? 17 LEU A HG   5  
ATOM 5647  H HD11 . LEU A 1 17 ? -3.206  -5.965  -2.029  1.00 0.00 ? 17 LEU A HD11 5  
ATOM 5648  H HD12 . LEU A 1 17 ? -2.133  -7.031  -2.932  1.00 0.00 ? 17 LEU A HD12 5  
ATOM 5649  H HD13 . LEU A 1 17 ? -1.479  -5.996  -1.668  1.00 0.00 ? 17 LEU A HD13 5  
ATOM 5650  H HD21 . LEU A 1 17 ? -0.519  -7.963  -0.351  1.00 0.00 ? 17 LEU A HD21 5  
ATOM 5651  H HD22 . LEU A 1 17 ? -0.998  -8.927  -1.747  1.00 0.00 ? 17 LEU A HD22 5  
ATOM 5652  H HD23 . LEU A 1 17 ? -1.537  -9.385  -0.141  1.00 0.00 ? 17 LEU A HD23 5  
ATOM 5653  N N    . VAL A 1 18 ? -3.025  -5.419  3.131   1.00 0.00 ? 18 VAL A N    5  
ATOM 5654  C CA   . VAL A 1 18 ? -3.719  -4.471  3.989   1.00 0.00 ? 18 VAL A CA   5  
ATOM 5655  C C    . VAL A 1 18 ? -2.827  -3.282  4.329   1.00 0.00 ? 18 VAL A C    5  
ATOM 5656  O O    . VAL A 1 18 ? -3.244  -2.130  4.207   1.00 0.00 ? 18 VAL A O    5  
ATOM 5657  C CB   . VAL A 1 18 ? -4.189  -5.138  5.299   1.00 0.00 ? 18 VAL A CB   5  
ATOM 5658  C CG1  . VAL A 1 18 ? -4.938  -4.143  6.171   1.00 0.00 ? 18 VAL A CG1  5  
ATOM 5659  C CG2  . VAL A 1 18 ? -5.057  -6.349  4.995   1.00 0.00 ? 18 VAL A CG2  5  
ATOM 5660  H H    . VAL A 1 18 ? -2.775  -6.295  3.501   1.00 0.00 ? 18 VAL A H    5  
ATOM 5661  H HA   . VAL A 1 18 ? -4.595  -4.110  3.460   1.00 0.00 ? 18 VAL A HA   5  
ATOM 5662  H HB   . VAL A 1 18 ? -3.319  -5.478  5.845   1.00 0.00 ? 18 VAL A HB   5  
ATOM 5663  H HG11 . VAL A 1 18 ? -4.260  -3.385  6.532   1.00 0.00 ? 18 VAL A HG11 5  
ATOM 5664  H HG12 . VAL A 1 18 ? -5.370  -4.656  7.021   1.00 0.00 ? 18 VAL A HG12 5  
ATOM 5665  H HG13 . VAL A 1 18 ? -5.728  -3.676  5.599   1.00 0.00 ? 18 VAL A HG13 5  
ATOM 5666  H HG21 . VAL A 1 18 ? -5.393  -6.795  5.921   1.00 0.00 ? 18 VAL A HG21 5  
ATOM 5667  H HG22 . VAL A 1 18 ? -4.496  -7.073  4.444   1.00 0.00 ? 18 VAL A HG22 5  
ATOM 5668  H HG23 . VAL A 1 18 ? -5.917  -6.044  4.416   1.00 0.00 ? 18 VAL A HG23 5  
ATOM 5669  N N    . VAL A 1 19 ? -1.596  -3.566  4.744   1.00 0.00 ? 19 VAL A N    5  
ATOM 5670  C CA   . VAL A 1 19 ? -0.654  -2.513  5.105   1.00 0.00 ? 19 VAL A CA   5  
ATOM 5671  C C    . VAL A 1 19 ? -0.331  -1.617  3.912   1.00 0.00 ? 19 VAL A C    5  
ATOM 5672  O O    . VAL A 1 19 ? -0.101  -0.422  4.078   1.00 0.00 ? 19 VAL A O    5  
ATOM 5673  C CB   . VAL A 1 19 ? 0.656   -3.087  5.680   1.00 0.00 ? 19 VAL A CB   5  
ATOM 5674  C CG1  . VAL A 1 19 ? 0.386   -3.854  6.965   1.00 0.00 ? 19 VAL A CG1  5  
ATOM 5675  C CG2  . VAL A 1 19 ? 1.351   -3.973  4.657   1.00 0.00 ? 19 VAL A CG2  5  
ATOM 5676  H H    . VAL A 1 19 ? -1.320  -4.508  4.818   1.00 0.00 ? 19 VAL A H    5  
ATOM 5677  H HA   . VAL A 1 19 ? -1.116  -1.900  5.872   1.00 0.00 ? 19 VAL A HA   5  
ATOM 5678  H HB   . VAL A 1 19 ? 1.318   -2.265  5.920   1.00 0.00 ? 19 VAL A HB   5  
ATOM 5679  H HG11 . VAL A 1 19 ? -0.081  -3.198  7.687   1.00 0.00 ? 19 VAL A HG11 5  
ATOM 5680  H HG12 . VAL A 1 19 ? 1.318   -4.222  7.371   1.00 0.00 ? 19 VAL A HG12 5  
ATOM 5681  H HG13 . VAL A 1 19 ? -0.271  -4.688  6.761   1.00 0.00 ? 19 VAL A HG13 5  
ATOM 5682  H HG21 . VAL A 1 19 ? 0.712   -4.793  4.410   1.00 0.00 ? 19 VAL A HG21 5  
ATOM 5683  H HG22 . VAL A 1 19 ? 2.268   -4.357  5.083   1.00 0.00 ? 19 VAL A HG22 5  
ATOM 5684  H HG23 . VAL A 1 19 ? 1.590   -3.414  3.769   1.00 0.00 ? 19 VAL A HG23 5  
ATOM 5685  N N    . LEU A 1 20 ? -0.310  -2.196  2.713   1.00 0.00 ? 20 LEU A N    5  
ATOM 5686  C CA   . LEU A 1 20 ? -0.020  -1.423  1.509   1.00 0.00 ? 20 LEU A CA   5  
ATOM 5687  C C    . LEU A 1 20 ? -1.037  -0.294  1.362   1.00 0.00 ? 20 LEU A C    5  
ATOM 5688  O O    . LEU A 1 20 ? -0.702  0.808   0.928   1.00 0.00 ? 20 LEU A O    5  
ATOM 5689  C CB   . LEU A 1 20 ? -0.036  -2.325  0.269   1.00 0.00 ? 20 LEU A CB   5  
ATOM 5690  C CG   . LEU A 1 20 ? 0.867   -1.878  -0.892  1.00 0.00 ? 20 LEU A CG   5  
ATOM 5691  C CD1  . LEU A 1 20 ? 0.361   -0.585  -1.513  1.00 0.00 ? 20 LEU A CD1  5  
ATOM 5692  C CD2  . LEU A 1 20 ? 2.307   -1.711  -0.423  1.00 0.00 ? 20 LEU A CD2  5  
ATOM 5693  H H    . LEU A 1 20 ? -0.494  -3.161  2.630   1.00 0.00 ? 20 LEU A H    5  
ATOM 5694  H HA   . LEU A 1 20 ? 0.954   -0.985  1.640   1.00 0.00 ? 20 LEU A HA   5  
ATOM 5695  H HB2  . LEU A 1 20 ? 0.289   -3.314  0.570   1.00 0.00 ? 20 LEU A HB2  5  
ATOM 5696  H HB3  . LEU A 1 20 ? -1.051  -2.409  -0.101  1.00 0.00 ? 20 LEU A HB3  5  
ATOM 5697  H HG   . LEU A 1 20 ? 0.854   -2.639  -1.659  1.00 0.00 ? 20 LEU A HG   5  
ATOM 5698  H HD11 . LEU A 1 20 ? 0.639   0.258   -0.899  1.00 0.00 ? 20 LEU A HD11 5  
ATOM 5699  H HD12 . LEU A 1 20 ? -0.716  -0.617  -1.615  1.00 0.00 ? 20 LEU A HD12 5  
ATOM 5700  H HD13 . LEU A 1 20 ? 0.803   -0.469  -2.492  1.00 0.00 ? 20 LEU A HD13 5  
ATOM 5701  H HD21 . LEU A 1 20 ? 2.395   -0.845  0.216   1.00 0.00 ? 20 LEU A HD21 5  
ATOM 5702  H HD22 . LEU A 1 20 ? 2.946   -1.581  -1.284  1.00 0.00 ? 20 LEU A HD22 5  
ATOM 5703  H HD23 . LEU A 1 20 ? 2.622   -2.593  0.120   1.00 0.00 ? 20 LEU A HD23 5  
ATOM 5704  N N    . THR A 1 21 ? -2.281  -0.576  1.741   1.00 0.00 ? 21 THR A N    5  
ATOM 5705  C CA   . THR A 1 21 ? -3.348  0.414   1.667   1.00 0.00 ? 21 THR A CA   5  
ATOM 5706  C C    . THR A 1 21 ? -3.225  1.417   2.808   1.00 0.00 ? 21 THR A C    5  
ATOM 5707  O O    . THR A 1 21 ? -3.540  2.597   2.650   1.00 0.00 ? 21 THR A O    5  
ATOM 5708  C CB   . THR A 1 21 ? -4.740  -0.247  1.723   1.00 0.00 ? 21 THR A CB   5  
ATOM 5709  O OG1  . THR A 1 21 ? -4.872  -1.203  0.666   1.00 0.00 ? 21 THR A OG1  5  
ATOM 5710  C CG2  . THR A 1 21 ? -5.847  0.794   1.608   1.00 0.00 ? 21 THR A CG2  5  
ATOM 5711  H H    . THR A 1 21 ? -2.496  -1.473  2.088   1.00 0.00 ? 21 THR A H    5  
ATOM 5712  H HA   . THR A 1 21 ? -3.262  0.943   0.724   1.00 0.00 ? 21 THR A HA   5  
ATOM 5713  H HB   . THR A 1 21 ? -4.846  -0.759  2.670   1.00 0.00 ? 21 THR A HB   5  
ATOM 5714  H HG1  . THR A 1 21 ? -4.761  -0.783  -0.197  1.00 0.00 ? 21 THR A HG1  5  
ATOM 5715  H HG21 . THR A 1 21 ? -5.923  1.350   2.531   1.00 0.00 ? 21 THR A HG21 5  
ATOM 5716  H HG22 . THR A 1 21 ? -6.785  0.294   1.417   1.00 0.00 ? 21 THR A HG22 5  
ATOM 5717  H HG23 . THR A 1 21 ? -5.634  1.473   0.793   1.00 0.00 ? 21 THR A HG23 5  
ATOM 5718  N N    . ILE A 1 22 ? -2.764  0.938   3.961   1.00 0.00 ? 22 ILE A N    5  
ATOM 5719  C CA   . ILE A 1 22 ? -2.589  1.791   5.130   1.00 0.00 ? 22 ILE A CA   5  
ATOM 5720  C C    . ILE A 1 22 ? -1.501  2.828   4.882   1.00 0.00 ? 22 ILE A C    5  
ATOM 5721  O O    . ILE A 1 22 ? -1.645  3.994   5.252   1.00 0.00 ? 22 ILE A O    5  
ATOM 5722  C CB   . ILE A 1 22 ? -2.220  0.967   6.382   1.00 0.00 ? 22 ILE A CB   5  
ATOM 5723  C CG1  . ILE A 1 22 ? -3.304  -0.073  6.684   1.00 0.00 ? 22 ILE A CG1  5  
ATOM 5724  C CG2  . ILE A 1 22 ? -2.007  1.883   7.580   1.00 0.00 ? 22 ILE A CG2  5  
ATOM 5725  C CD1  . ILE A 1 22 ? -4.667  0.525   6.964   1.00 0.00 ? 22 ILE A CD1  5  
ATOM 5726  H H    . ILE A 1 22 ? -2.531  -0.013  4.033   1.00 0.00 ? 22 ILE A H    5  
ATOM 5727  H HA   . ILE A 1 22 ? -3.518  2.312   5.318   1.00 0.00 ? 22 ILE A HA   5  
ATOM 5728  H HB   . ILE A 1 22 ? -1.289  0.452   6.187   1.00 0.00 ? 22 ILE A HB   5  
ATOM 5729  H HG12 . ILE A 1 22 ? -3.407  -0.731  5.852   1.00 0.00 ? 22 ILE A HG12 5  
ATOM 5730  H HG13 . ILE A 1 22 ? -3.013  -0.648  7.552   1.00 0.00 ? 22 ILE A HG13 5  
ATOM 5731  H HG21 . ILE A 1 22 ? -2.836  2.573   7.671   1.00 0.00 ? 22 ILE A HG21 5  
ATOM 5732  H HG22 . ILE A 1 22 ? -1.089  2.439   7.458   1.00 0.00 ? 22 ILE A HG22 5  
ATOM 5733  H HG23 . ILE A 1 22 ? -1.937  1.292   8.484   1.00 0.00 ? 22 ILE A HG23 5  
ATOM 5734  H HD11 . ILE A 1 22 ? -5.345  -0.263  7.257   1.00 0.00 ? 22 ILE A HD11 5  
ATOM 5735  H HD12 . ILE A 1 22 ? -5.045  1.004   6.074   1.00 0.00 ? 22 ILE A HD12 5  
ATOM 5736  H HD13 . ILE A 1 22 ? -4.599  1.248   7.762   1.00 0.00 ? 22 ILE A HD13 5  
ATOM 5737  N N    . ILE A 1 23 ? -0.413  2.395   4.254   1.00 0.00 ? 23 ILE A N    5  
ATOM 5738  C CA   . ILE A 1 23 ? 0.701   3.284   3.957   1.00 0.00 ? 23 ILE A CA   5  
ATOM 5739  C C    . ILE A 1 23 ? 0.319   4.295   2.879   1.00 0.00 ? 23 ILE A C    5  
ATOM 5740  O O    . ILE A 1 23 ? 0.713   5.459   2.938   1.00 0.00 ? 23 ILE A O    5  
ATOM 5741  C CB   . ILE A 1 23 ? 1.944   2.500   3.501   1.00 0.00 ? 23 ILE A CB   5  
ATOM 5742  C CG1  . ILE A 1 23 ? 2.345   1.471   4.560   1.00 0.00 ? 23 ILE A CG1  5  
ATOM 5743  C CG2  . ILE A 1 23 ? 3.097   3.454   3.226   1.00 0.00 ? 23 ILE A CG2  5  
ATOM 5744  C CD1  . ILE A 1 23 ? 2.824   2.084   5.858   1.00 0.00 ? 23 ILE A CD1  5  
ATOM 5745  H H    . ILE A 1 23 ? -0.355  1.450   3.979   1.00 0.00 ? 23 ILE A H    5  
ATOM 5746  H HA   . ILE A 1 23 ? 0.951   3.829   4.859   1.00 0.00 ? 23 ILE A HA   5  
ATOM 5747  H HB   . ILE A 1 23 ? 1.707   1.983   2.581   1.00 0.00 ? 23 ILE A HB   5  
ATOM 5748  H HG12 . ILE A 1 23 ? 1.517   0.837   4.794   1.00 0.00 ? 23 ILE A HG12 5  
ATOM 5749  H HG13 . ILE A 1 23 ? 3.150   0.865   4.171   1.00 0.00 ? 23 ILE A HG13 5  
ATOM 5750  H HG21 . ILE A 1 23 ? 4.010   2.891   3.080   1.00 0.00 ? 23 ILE A HG21 5  
ATOM 5751  H HG22 . ILE A 1 23 ? 3.228   4.130   4.060   1.00 0.00 ? 23 ILE A HG22 5  
ATOM 5752  H HG23 . ILE A 1 23 ? 2.894   4.024   2.332   1.00 0.00 ? 23 ILE A HG23 5  
ATOM 5753  H HD11 . ILE A 1 23 ? 3.029   1.295   6.566   1.00 0.00 ? 23 ILE A HD11 5  
ATOM 5754  H HD12 . ILE A 1 23 ? 2.064   2.732   6.263   1.00 0.00 ? 23 ILE A HD12 5  
ATOM 5755  H HD13 . ILE A 1 23 ? 3.728   2.648   5.688   1.00 0.00 ? 23 ILE A HD13 5  
ATOM 5756  N N    . SER A 1 24 ? -0.453  3.839   1.894   1.00 0.00 ? 24 SER A N    5  
ATOM 5757  C CA   . SER A 1 24 ? -0.892  4.702   0.800   1.00 0.00 ? 24 SER A CA   5  
ATOM 5758  C C    . SER A 1 24 ? -1.960  5.680   1.276   1.00 0.00 ? 24 SER A C    5  
ATOM 5759  O O    . SER A 1 24 ? -2.103  6.772   0.724   1.00 0.00 ? 24 SER A O    5  
ATOM 5760  C CB   . SER A 1 24 ? -1.437  3.863   -0.358  1.00 0.00 ? 24 SER A CB   5  
ATOM 5761  O OG   . SER A 1 24 ? -0.420  3.062   -0.932  1.00 0.00 ? 24 SER A OG   5  
ATOM 5762  H H    . SER A 1 24 ? -0.739  2.895   1.896   1.00 0.00 ? 24 SER A H    5  
ATOM 5763  H HA   . SER A 1 24 ? -0.038  5.266   0.446   1.00 0.00 ? 24 SER A HA   5  
ATOM 5764  H HB2  . SER A 1 24 ? -2.223  3.219   0.006   1.00 0.00 ? 24 SER A HB2  5  
ATOM 5765  H HB3  . SER A 1 24 ? -1.834  4.515   -1.126  1.00 0.00 ? 24 SER A HB3  5  
ATOM 5766  H HG   . SER A 1 24 ? -0.283  2.278   -0.393  1.00 0.00 ? 24 SER A HG   5  
ATOM 5767  N N    . LEU A 1 25 ? -2.712  5.280   2.296   1.00 0.00 ? 25 LEU A N    5  
ATOM 5768  C CA   . LEU A 1 25 ? -3.767  6.122   2.846   1.00 0.00 ? 25 LEU A CA   5  
ATOM 5769  C C    . LEU A 1 25 ? -3.178  7.371   3.492   1.00 0.00 ? 25 LEU A C    5  
ATOM 5770  O O    . LEU A 1 25 ? -3.751  8.457   3.400   1.00 0.00 ? 25 LEU A O    5  
ATOM 5771  C CB   . LEU A 1 25 ? -4.591  5.340   3.871   1.00 0.00 ? 25 LEU A CB   5  
ATOM 5772  C CG   . LEU A 1 25 ? -5.657  6.151   4.613   1.00 0.00 ? 25 LEU A CG   5  
ATOM 5773  C CD1  . LEU A 1 25 ? -6.642  6.771   3.632   1.00 0.00 ? 25 LEU A CD1  5  
ATOM 5774  C CD2  . LEU A 1 25 ? -6.386  5.274   5.619   1.00 0.00 ? 25 LEU A CD2  5  
ATOM 5775  H H    . LEU A 1 25 ? -2.563  4.392   2.696   1.00 0.00 ? 25 LEU A H    5  
ATOM 5776  H HA   . LEU A 1 25 ? -4.416  6.423   2.034   1.00 0.00 ? 25 LEU A HA   5  
ATOM 5777  H HB2  . LEU A 1 25 ? -5.076  4.521   3.356   1.00 0.00 ? 25 LEU A HB2  5  
ATOM 5778  H HB3  . LEU A 1 25 ? -3.908  4.927   4.601   1.00 0.00 ? 25 LEU A HB3  5  
ATOM 5779  H HG   . LEU A 1 25 ? -5.185  6.953   5.161   1.00 0.00 ? 25 LEU A HG   5  
ATOM 5780  H HD11 . LEU A 1 25 ? -7.406  7.311   4.176   1.00 0.00 ? 25 LEU A HD11 5  
ATOM 5781  H HD12 . LEU A 1 25 ? -7.107  5.994   3.041   1.00 0.00 ? 25 LEU A HD12 5  
ATOM 5782  H HD13 . LEU A 1 25 ? -6.124  7.457   2.978   1.00 0.00 ? 25 LEU A HD13 5  
ATOM 5783  H HD21 . LEU A 1 25 ? -5.676  4.864   6.324   1.00 0.00 ? 25 LEU A HD21 5  
ATOM 5784  H HD22 . LEU A 1 25 ? -6.887  4.466   5.104   1.00 0.00 ? 25 LEU A HD22 5  
ATOM 5785  H HD23 . LEU A 1 25 ? -7.116  5.866   6.154   1.00 0.00 ? 25 LEU A HD23 5  
ATOM 5786  N N    . ILE A 1 26 ? -2.031  7.210   4.145   1.00 0.00 ? 26 ILE A N    5  
ATOM 5787  C CA   . ILE A 1 26 ? -1.366  8.328   4.803   1.00 0.00 ? 26 ILE A CA   5  
ATOM 5788  C C    . ILE A 1 26 ? -0.847  9.331   3.778   1.00 0.00 ? 26 ILE A C    5  
ATOM 5789  O O    . ILE A 1 26 ? -0.942  10.540  3.980   1.00 0.00 ? 26 ILE A O    5  
ATOM 5790  C CB   . ILE A 1 26 ? -0.195  7.848   5.685   1.00 0.00 ? 26 ILE A CB   5  
ATOM 5791  C CG1  . ILE A 1 26 ? -0.685  6.836   6.729   1.00 0.00 ? 26 ILE A CG1  5  
ATOM 5792  C CG2  . ILE A 1 26 ? 0.482   9.033   6.362   1.00 0.00 ? 26 ILE A CG2  5  
ATOM 5793  C CD1  . ILE A 1 26 ? -1.761  7.376   7.650   1.00 0.00 ? 26 ILE A CD1  5  
ATOM 5794  H H    . ILE A 1 26 ? -1.615  6.318   4.186   1.00 0.00 ? 26 ILE A H    5  
ATOM 5795  H HA   . ILE A 1 26 ? -2.088  8.832   5.433   1.00 0.00 ? 26 ILE A HA   5  
ATOM 5796  H HB   . ILE A 1 26 ? 0.535   7.366   5.049   1.00 0.00 ? 26 ILE A HB   5  
ATOM 5797  H HG12 . ILE A 1 26 ? -1.087  5.980   6.230   1.00 0.00 ? 26 ILE A HG12 5  
ATOM 5798  H HG13 . ILE A 1 26 ? 0.149   6.524   7.343   1.00 0.00 ? 26 ILE A HG13 5  
ATOM 5799  H HG21 . ILE A 1 26 ? 1.171   8.678   7.118   1.00 0.00 ? 26 ILE A HG21 5  
ATOM 5800  H HG22 . ILE A 1 26 ? -0.259  9.668   6.828   1.00 0.00 ? 26 ILE A HG22 5  
ATOM 5801  H HG23 . ILE A 1 26 ? 1.032   9.601   5.630   1.00 0.00 ? 26 ILE A HG23 5  
ATOM 5802  H HD11 . ILE A 1 26 ? -2.666  7.550   7.089   1.00 0.00 ? 26 ILE A HD11 5  
ATOM 5803  H HD12 . ILE A 1 26 ? -1.434  8.299   8.103   1.00 0.00 ? 26 ILE A HD12 5  
ATOM 5804  H HD13 . ILE A 1 26 ? -1.959  6.651   8.426   1.00 0.00 ? 26 ILE A HD13 5  
ATOM 5805  N N    . ILE A 1 27 ? -0.297  8.820   2.678   1.00 0.00 ? 27 ILE A N    5  
ATOM 5806  C CA   . ILE A 1 27 ? 0.234   9.675   1.622   1.00 0.00 ? 27 ILE A CA   5  
ATOM 5807  C C    . ILE A 1 27 ? -0.889  10.385  0.876   1.00 0.00 ? 27 ILE A C    5  
ATOM 5808  O O    . ILE A 1 27 ? -0.751  11.543  0.482   1.00 0.00 ? 27 ILE A O    5  
ATOM 5809  C CB   . ILE A 1 27 ? 1.056   8.866   0.600   1.00 0.00 ? 27 ILE A CB   5  
ATOM 5810  C CG1  . ILE A 1 27 ? 2.017   7.915   1.311   1.00 0.00 ? 27 ILE A CG1  5  
ATOM 5811  C CG2  . ILE A 1 27 ? 1.822   9.807   -0.323  1.00 0.00 ? 27 ILE A CG2  5  
ATOM 5812  C CD1  . ILE A 1 27 ? 2.670   6.918   0.379   1.00 0.00 ? 27 ILE A CD1  5  
ATOM 5813  H H    . ILE A 1 27 ? -0.266  7.844   2.571   1.00 0.00 ? 27 ILE A H    5  
ATOM 5814  H HA   . ILE A 1 27 ? 0.882   10.417  2.077   1.00 0.00 ? 27 ILE A HA   5  
ATOM 5815  H HB   . ILE A 1 27 ? 0.373   8.283   -0.009  1.00 0.00 ? 27 ILE A HB   5  
ATOM 5816  H HG12 . ILE A 1 27 ? 2.804   8.484   1.783   1.00 0.00 ? 27 ILE A HG12 5  
ATOM 5817  H HG13 . ILE A 1 27 ? 1.506   7.355   2.060   1.00 0.00 ? 27 ILE A HG13 5  
ATOM 5818  H HG21 . ILE A 1 27 ? 2.503   10.412  0.259   1.00 0.00 ? 27 ILE A HG21 5  
ATOM 5819  H HG22 . ILE A 1 27 ? 1.133   10.451  -0.850  1.00 0.00 ? 27 ILE A HG22 5  
ATOM 5820  H HG23 . ILE A 1 27 ? 2.383   9.234   -1.046  1.00 0.00 ? 27 ILE A HG23 5  
ATOM 5821  H HD11 . ILE A 1 27 ? 1.912   6.401   -0.192  1.00 0.00 ? 27 ILE A HD11 5  
ATOM 5822  H HD12 . ILE A 1 27 ? 3.232   6.201   0.959   1.00 0.00 ? 27 ILE A HD12 5  
ATOM 5823  H HD13 . ILE A 1 27 ? 3.338   7.435   -0.293  1.00 0.00 ? 27 ILE A HD13 5  
ATOM 5824  N N    . LEU A 1 28 ? -1.998  9.678   0.682   1.00 0.00 ? 28 LEU A N    5  
ATOM 5825  C CA   . LEU A 1 28 ? -3.147  10.227  -0.024  1.00 0.00 ? 28 LEU A CA   5  
ATOM 5826  C C    . LEU A 1 28 ? -3.671  11.480  0.670   1.00 0.00 ? 28 LEU A C    5  
ATOM 5827  O O    . LEU A 1 28 ? -3.913  12.500  0.025   1.00 0.00 ? 28 LEU A O    5  
ATOM 5828  C CB   . LEU A 1 28 ? -4.258  9.178   -0.116  1.00 0.00 ? 28 LEU A CB   5  
ATOM 5829  C CG   . LEU A 1 28 ? -5.458  9.572   -0.981  1.00 0.00 ? 28 LEU A CG   5  
ATOM 5830  C CD1  . LEU A 1 28 ? -5.049  9.683   -2.442  1.00 0.00 ? 28 LEU A CD1  5  
ATOM 5831  C CD2  . LEU A 1 28 ? -6.585  8.565   -0.815  1.00 0.00 ? 28 LEU A CD2  5  
ATOM 5832  H H    . LEU A 1 28 ? -2.047  8.751   1.014   1.00 0.00 ? 28 LEU A H    5  
ATOM 5833  H HA   . LEU A 1 28 ? -2.828  10.490  -1.021  1.00 0.00 ? 28 LEU A HA   5  
ATOM 5834  H HB2  . LEU A 1 28 ? -3.829  8.267   -0.515  1.00 0.00 ? 28 LEU A HB2  5  
ATOM 5835  H HB3  . LEU A 1 28 ? -4.610  8.972   0.888   1.00 0.00 ? 28 LEU A HB3  5  
ATOM 5836  H HG   . LEU A 1 28 ? -5.827  10.537  -0.666  1.00 0.00 ? 28 LEU A HG   5  
ATOM 5837  H HD11 . LEU A 1 28 ? -4.301  10.453  -2.553  1.00 0.00 ? 28 LEU A HD11 5  
ATOM 5838  H HD12 . LEU A 1 28 ? -5.912  9.941   -3.042  1.00 0.00 ? 28 LEU A HD12 5  
ATOM 5839  H HD13 . LEU A 1 28 ? -4.646  8.738   -2.782  1.00 0.00 ? 28 LEU A HD13 5  
ATOM 5840  H HD21 . LEU A 1 28 ? -6.880  8.519   0.225   1.00 0.00 ? 28 LEU A HD21 5  
ATOM 5841  H HD22 . LEU A 1 28 ? -6.253  7.587   -1.137  1.00 0.00 ? 28 LEU A HD22 5  
ATOM 5842  H HD23 . LEU A 1 28 ? -7.434  8.869   -1.411  1.00 0.00 ? 28 LEU A HD23 5  
ATOM 5843  N N    . ILE A 1 29 ? -3.841  11.396  1.985   1.00 0.00 ? 29 ILE A N    5  
ATOM 5844  C CA   . ILE A 1 29 ? -4.340  12.522  2.765   1.00 0.00 ? 29 ILE A CA   5  
ATOM 5845  C C    . ILE A 1 29 ? -3.251  13.568  2.990   1.00 0.00 ? 29 ILE A C    5  
ATOM 5846  O O    . ILE A 1 29 ? -3.523  14.768  2.987   1.00 0.00 ? 29 ILE A O    5  
ATOM 5847  C CB   . ILE A 1 29 ? -4.884  12.061  4.130   1.00 0.00 ? 29 ILE A CB   5  
ATOM 5848  C CG1  . ILE A 1 29 ? -5.883  10.911  3.950   1.00 0.00 ? 29 ILE A CG1  5  
ATOM 5849  C CG2  . ILE A 1 29 ? -5.532  13.225  4.867   1.00 0.00 ? 29 ILE A CG2  5  
ATOM 5850  C CD1  . ILE A 1 29 ? -7.095  11.274  3.114   1.00 0.00 ? 29 ILE A CD1  5  
ATOM 5851  H H    . ILE A 1 29 ? -3.620  10.553  2.447   1.00 0.00 ? 29 ILE A H    5  
ATOM 5852  H HA   . ILE A 1 29 ? -5.152  12.981  2.216   1.00 0.00 ? 29 ILE A HA   5  
ATOM 5853  H HB   . ILE A 1 29 ? -4.055  11.708  4.729   1.00 0.00 ? 29 ILE A HB   5  
ATOM 5854  H HG12 . ILE A 1 29 ? -5.402  10.080  3.476   1.00 0.00 ? 29 ILE A HG12 5  
ATOM 5855  H HG13 . ILE A 1 29 ? -6.239  10.598  4.922   1.00 0.00 ? 29 ILE A HG13 5  
ATOM 5856  H HG21 . ILE A 1 29 ? -4.785  13.964  5.116   1.00 0.00 ? 29 ILE A HG21 5  
ATOM 5857  H HG22 . ILE A 1 29 ? -5.988  12.868  5.781   1.00 0.00 ? 29 ILE A HG22 5  
ATOM 5858  H HG23 . ILE A 1 29 ? -6.290  13.676  4.246   1.00 0.00 ? 29 ILE A HG23 5  
ATOM 5859  H HD11 . ILE A 1 29 ? -7.756  10.421  3.060   1.00 0.00 ? 29 ILE A HD11 5  
ATOM 5860  H HD12 . ILE A 1 29 ? -6.786  11.545  2.117   1.00 0.00 ? 29 ILE A HD12 5  
ATOM 5861  H HD13 . ILE A 1 29 ? -7.621  12.100  3.566   1.00 0.00 ? 29 ILE A HD13 5  
ATOM 5862  N N    . MET A 1 30 ? -2.020  13.105  3.183   1.00 0.00 ? 30 MET A N    5  
ATOM 5863  C CA   . MET A 1 30 ? -0.892  14.004  3.409   1.00 0.00 ? 30 MET A CA   5  
ATOM 5864  C C    . MET A 1 30 ? -0.709  14.949  2.225   1.00 0.00 ? 30 MET A C    5  
ATOM 5865  O O    . MET A 1 30 ? -0.463  16.142  2.404   1.00 0.00 ? 30 MET A O    5  
ATOM 5866  C CB   . MET A 1 30 ? 0.392   13.206  3.646   1.00 0.00 ? 30 MET A CB   5  
ATOM 5867  C CG   . MET A 1 30 ? 1.617   14.076  3.883   1.00 0.00 ? 30 MET A CG   5  
ATOM 5868  S SD   . MET A 1 30 ? 3.135   13.114  4.041   1.00 0.00 ? 30 MET A SD   5  
ATOM 5869  C CE   . MET A 1 30 ? 2.788   12.168  5.523   1.00 0.00 ? 30 MET A CE   5  
ATOM 5870  H H    . MET A 1 30 ? -1.858  12.132  3.179   1.00 0.00 ? 30 MET A H    5  
ATOM 5871  H HA   . MET A 1 30 ? -1.104  14.592  4.292   1.00 0.00 ? 30 MET A HA   5  
ATOM 5872  H HB2  . MET A 1 30 ? 0.250   12.583  4.515   1.00 0.00 ? 30 MET A HB2  5  
ATOM 5873  H HB3  . MET A 1 30 ? 0.575   12.577  2.785   1.00 0.00 ? 30 MET A HB3  5  
ATOM 5874  H HG2  . MET A 1 30 ? 1.741   14.758  3.056   1.00 0.00 ? 30 MET A HG2  5  
ATOM 5875  H HG3  . MET A 1 30 ? 1.471   14.639  4.793   1.00 0.00 ? 30 MET A HG3  5  
ATOM 5876  H HE1  . MET A 1 30 ? 2.529   12.841  6.327   1.00 0.00 ? 30 MET A HE1  5  
ATOM 5877  H HE2  . MET A 1 30 ? 3.662   11.597  5.799   1.00 0.00 ? 30 MET A HE2  5  
ATOM 5878  H HE3  . MET A 1 30 ? 1.966   11.498  5.336   1.00 0.00 ? 30 MET A HE3  5  
ATOM 5879  N N    . LEU A 1 31 ? -0.827  14.407  1.018   1.00 0.00 ? 31 LEU A N    5  
ATOM 5880  C CA   . LEU A 1 31 ? -0.678  15.203  -0.192  1.00 0.00 ? 31 LEU A CA   5  
ATOM 5881  C C    . LEU A 1 31 ? -1.967  15.960  -0.495  1.00 0.00 ? 31 LEU A C    5  
ATOM 5882  O O    . LEU A 1 31 ? -1.944  17.026  -1.112  1.00 0.00 ? 31 LEU A O    5  
ATOM 5883  C CB   . LEU A 1 31 ? -0.302  14.308  -1.376  1.00 0.00 ? 31 LEU A CB   5  
ATOM 5884  C CG   . LEU A 1 31 ? -0.036  15.044  -2.692  1.00 0.00 ? 31 LEU A CG   5  
ATOM 5885  C CD1  . LEU A 1 31 ? 1.163   15.971  -2.556  1.00 0.00 ? 31 LEU A CD1  5  
ATOM 5886  C CD2  . LEU A 1 31 ? 0.184   14.049  -3.822  1.00 0.00 ? 31 LEU A CD2  5  
ATOM 5887  H H    . LEU A 1 31 ? -1.023  13.444  0.932   1.00 0.00 ? 31 LEU A H    5  
ATOM 5888  H HA   . LEU A 1 31 ? 0.116   15.913  -0.030  1.00 0.00 ? 31 LEU A HA   5  
ATOM 5889  H HB2  . LEU A 1 31 ? 0.586   13.750  -1.107  1.00 0.00 ? 31 LEU A HB2  5  
ATOM 5890  H HB3  . LEU A 1 31 ? -1.109  13.603  -1.534  1.00 0.00 ? 31 LEU A HB3  5  
ATOM 5891  H HG   . LEU A 1 31 ? -0.895  15.647  -2.946  1.00 0.00 ? 31 LEU A HG   5  
ATOM 5892  H HD11 . LEU A 1 31 ? 2.021   15.415  -2.202  1.00 0.00 ? 31 LEU A HD11 5  
ATOM 5893  H HD12 . LEU A 1 31 ? 0.926   16.751  -1.859  1.00 0.00 ? 31 LEU A HD12 5  
ATOM 5894  H HD13 . LEU A 1 31 ? 1.394   16.415  -3.516  1.00 0.00 ? 31 LEU A HD13 5  
ATOM 5895  H HD21 . LEU A 1 31 ? 1.049   13.436  -3.607  1.00 0.00 ? 31 LEU A HD21 5  
ATOM 5896  H HD22 . LEU A 1 31 ? 0.344   14.582  -4.749  1.00 0.00 ? 31 LEU A HD22 5  
ATOM 5897  H HD23 . LEU A 1 31 ? -0.687  13.416  -3.923  1.00 0.00 ? 31 LEU A HD23 5  
ATOM 5898  N N    . TRP A 1 32 ? -3.090  15.402  -0.051  1.00 0.00 ? 32 TRP A N    5  
ATOM 5899  C CA   . TRP A 1 32 ? -4.393  16.022  -0.263  1.00 0.00 ? 32 TRP A CA   5  
ATOM 5900  C C    . TRP A 1 32 ? -4.470  17.366  0.455   1.00 0.00 ? 32 TRP A C    5  
ATOM 5901  O O    . TRP A 1 32 ? -5.148  18.288  0.001   1.00 0.00 ? 32 TRP A O    5  
ATOM 5902  C CB   . TRP A 1 32 ? -5.507  15.096  0.232   1.00 0.00 ? 32 TRP A CB   5  
ATOM 5903  C CG   . TRP A 1 32 ? -6.879  15.680  0.091   1.00 0.00 ? 32 TRP A CG   5  
ATOM 5904  C CD1  . TRP A 1 32 ? -7.485  16.079  -1.067  1.00 0.00 ? 32 TRP A CD1  5  
ATOM 5905  C CD2  . TRP A 1 32 ? -7.819  15.929  1.141   1.00 0.00 ? 32 TRP A CD2  5  
ATOM 5906  N NE1  . TRP A 1 32 ? -8.742  16.565  -0.799  1.00 0.00 ? 32 TRP A NE1  5  
ATOM 5907  C CE2  . TRP A 1 32 ? -8.970  16.483  0.549   1.00 0.00 ? 32 TRP A CE2  5  
ATOM 5908  C CE3  . TRP A 1 32 ? -7.799  15.739  2.527   1.00 0.00 ? 32 TRP A CE3  5  
ATOM 5909  C CZ2  . TRP A 1 32 ? -10.089 16.845  1.295   1.00 0.00 ? 32 TRP A CZ2  5  
ATOM 5910  C CZ3  . TRP A 1 32 ? -8.911  16.100  3.265   1.00 0.00 ? 32 TRP A CZ3  5  
ATOM 5911  C CH2  . TRP A 1 32 ? -10.042 16.648  2.648   1.00 0.00 ? 32 TRP A CH2  5  
ATOM 5912  H H    . TRP A 1 32 ? -3.052  14.548  0.434   1.00 0.00 ? 32 TRP A H    5  
ATOM 5913  H HA   . TRP A 1 32 ? -4.522  16.186  -1.325  1.00 0.00 ? 32 TRP A HA   5  
ATOM 5914  H HB2  . TRP A 1 32 ? -5.485  14.185  -0.341  1.00 0.00 ? 32 TRP A HB2  5  
ATOM 5915  H HB3  . TRP A 1 32 ? -5.339  14.869  1.273   1.00 0.00 ? 32 TRP A HB3  5  
ATOM 5916  H HD1  . TRP A 1 32 ? -7.029  16.019  -2.044  1.00 0.00 ? 32 TRP A HD1  5  
ATOM 5917  H HE1  . TRP A 1 32 ? -9.372  16.913  -1.464  1.00 0.00 ? 32 TRP A HE1  5  
ATOM 5918  H HE3  . TRP A 1 32 ? -6.936  15.321  3.019   1.00 0.00 ? 32 TRP A HE3  5  
ATOM 5919  H HZ2  . TRP A 1 32 ? -10.969 17.268  0.835   1.00 0.00 ? 32 TRP A HZ2  5  
ATOM 5920  H HZ3  . TRP A 1 32 ? -8.913  15.961  4.336   1.00 0.00 ? 32 TRP A HZ3  5  
ATOM 5921  H HH2  . TRP A 1 32 ? -10.888 16.916  3.264   1.00 0.00 ? 32 TRP A HH2  5  
ATOM 5922  N N    . GLN A 1 33 ? -3.770  17.466  1.579   1.00 0.00 ? 33 GLN A N    5  
ATOM 5923  C CA   . GLN A 1 33 ? -3.749  18.693  2.364   1.00 0.00 ? 33 GLN A CA   5  
ATOM 5924  C C    . GLN A 1 33 ? -2.432  19.438  2.169   1.00 0.00 ? 33 GLN A C    5  
ATOM 5925  O O    . GLN A 1 33 ? -2.132  20.388  2.889   1.00 0.00 ? 33 GLN A O    5  
ATOM 5926  C CB   . GLN A 1 33 ? -3.962  18.380  3.848   1.00 0.00 ? 33 GLN A CB   5  
ATOM 5927  C CG   . GLN A 1 33 ? -5.340  17.819  4.162   1.00 0.00 ? 33 GLN A CG   5  
ATOM 5928  C CD   . GLN A 1 33 ? -6.455  18.800  3.853   1.00 0.00 ? 33 GLN A CD   5  
ATOM 5929  O OE1  . GLN A 1 33 ? -6.845  19.602  4.703   1.00 0.00 ? 33 GLN A OE1  5  
ATOM 5930  N NE2  . GLN A 1 33 ? -6.977  18.739  2.633   1.00 0.00 ? 33 GLN A NE2  5  
ATOM 5931  H H    . GLN A 1 33 ? -3.245  16.700  1.904   1.00 0.00 ? 33 GLN A H    5  
ATOM 5932  H HA   . GLN A 1 33 ? -4.545  19.345  2.030   1.00 0.00 ? 33 GLN A HA   5  
ATOM 5933  H HB2  . GLN A 1 33 ? -3.225  17.654  4.158   1.00 0.00 ? 33 GLN A HB2  5  
ATOM 5934  H HB3  . GLN A 1 33 ? -3.827  19.285  4.429   1.00 0.00 ? 33 GLN A HB3  5  
ATOM 5935  H HG2  . GLN A 1 33 ? -5.492  16.920  3.581   1.00 0.00 ? 33 GLN A HG2  5  
ATOM 5936  H HG3  . GLN A 1 33 ? -5.380  17.574  5.214   1.00 0.00 ? 33 GLN A HG3  5  
ATOM 5937  H HE21 . GLN A 1 33 ? -6.619  18.093  1.997   1.00 0.00 ? 33 GLN A HE21 5  
ATOM 5938  H HE22 . GLN A 1 33 ? -7.710  19.353  2.419   1.00 0.00 ? 33 GLN A HE22 5  
ATOM 5939  N N    . LYS A 1 34 ? -1.648  18.992  1.192   1.00 0.00 ? 34 LYS A N    5  
ATOM 5940  C CA   . LYS A 1 34 ? -0.362  19.616  0.897   1.00 0.00 ? 34 LYS A CA   5  
ATOM 5941  C C    . LYS A 1 34 ? -0.493  20.605  -0.255  1.00 0.00 ? 34 LYS A C    5  
ATOM 5942  O O    . LYS A 1 34 ? -0.154  21.782  -0.119  1.00 0.00 ? 34 LYS A O    5  
ATOM 5943  C CB   . LYS A 1 34 ? 0.682   18.551  0.554   1.00 0.00 ? 34 LYS A CB   5  
ATOM 5944  C CG   . LYS A 1 34 ? 2.028   19.131  0.151   1.00 0.00 ? 34 LYS A CG   5  
ATOM 5945  C CD   . LYS A 1 34 ? 3.048   18.038  -0.120  1.00 0.00 ? 34 LYS A CD   5  
ATOM 5946  C CE   . LYS A 1 34 ? 4.352   18.618  -0.643  1.00 0.00 ? 34 LYS A CE   5  
ATOM 5947  N NZ   . LYS A 1 34 ? 4.918   19.635  0.284   1.00 0.00 ? 34 LYS A NZ   5  
ATOM 5948  H H    . LYS A 1 34 ? -1.925  18.243  0.644   1.00 0.00 ? 34 LYS A H    5  
ATOM 5949  H HA   . LYS A 1 34 ? -0.020  20.156  1.773   1.00 0.00 ? 34 LYS A HA   5  
ATOM 5950  H HB2  . LYS A 1 34 ? 0.827   17.917  1.415   1.00 0.00 ? 34 LYS A HB2  5  
ATOM 5951  H HB3  . LYS A 1 34 ? 0.308   17.961  -0.263  1.00 0.00 ? 34 LYS A HB3  5  
ATOM 5952  H HG2  . LYS A 1 34 ? 1.907   19.719  -0.748  1.00 0.00 ? 34 LYS A HG2  5  
ATOM 5953  H HG3  . LYS A 1 34 ? 2.393   19.761  0.950   1.00 0.00 ? 34 LYS A HG3  5  
ATOM 5954  H HD2  . LYS A 1 34 ? 3.247   17.509  0.799   1.00 0.00 ? 34 LYS A HD2  5  
ATOM 5955  H HD3  . LYS A 1 34 ? 2.659   17.356  -0.849  1.00 0.00 ? 34 LYS A HD3  5  
ATOM 5956  H HE2  . LYS A 1 34 ? 5.066   17.816  -0.761  1.00 0.00 ? 34 LYS A HE2  5  
ATOM 5957  H HE3  . LYS A 1 34 ? 4.168   19.079  -1.603  1.00 0.00 ? 34 LYS A HE3  5  
ATOM 5958  H HZ1  . LYS A 1 34 ? 4.357   20.510  0.249   1.00 0.00 ? 34 LYS A HZ1  5  
ATOM 5959  H HZ2  . LYS A 1 34 ? 5.894   19.859  0.006   1.00 0.00 ? 34 LYS A HZ2  5  
ATOM 5960  H HZ3  . LYS A 1 34 ? 4.928   19.278  1.264   1.00 0.00 ? 34 LYS A HZ3  5  
ATOM 5961  N N    . LYS A 1 35 ? -0.984  20.119  -1.390  1.00 0.00 ? 35 LYS A N    5  
ATOM 5962  C CA   . LYS A 1 35 ? -1.163  20.958  -2.567  1.00 0.00 ? 35 LYS A CA   5  
ATOM 5963  C C    . LYS A 1 35 ? -2.508  21.678  -2.512  1.00 0.00 ? 35 LYS A C    5  
ATOM 5964  O O    . LYS A 1 35 ? -3.433  21.219  -1.844  1.00 0.00 ? 35 LYS A O    5  
ATOM 5965  C CB   . LYS A 1 35 ? -1.071  20.111  -3.839  1.00 0.00 ? 35 LYS A CB   5  
ATOM 5966  C CG   . LYS A 1 35 ? 0.206   19.290  -3.932  1.00 0.00 ? 35 LYS A CG   5  
ATOM 5967  C CD   . LYS A 1 35 ? 0.311   18.573  -5.268  1.00 0.00 ? 35 LYS A CD   5  
ATOM 5968  C CE   . LYS A 1 35 ? 0.580   19.547  -6.403  1.00 0.00 ? 35 LYS A CE   5  
ATOM 5969  N NZ   . LYS A 1 35 ? 1.868   20.270  -6.217  1.00 0.00 ? 35 LYS A NZ   5  
ATOM 5970  H H    . LYS A 1 35 ? -1.240  19.166  -1.438  1.00 0.00 ? 35 LYS A H    5  
ATOM 5971  H HA   . LYS A 1 35 ? -0.366  21.690  -2.582  1.00 0.00 ? 35 LYS A HA   5  
ATOM 5972  H HB2  . LYS A 1 35 ? -1.909  19.425  -3.862  1.00 0.00 ? 35 LYS A HB2  5  
ATOM 5973  H HB3  . LYS A 1 35 ? -1.132  20.760  -4.692  1.00 0.00 ? 35 LYS A HB3  5  
ATOM 5974  H HG2  . LYS A 1 35 ? 1.060   19.936  -3.795  1.00 0.00 ? 35 LYS A HG2  5  
ATOM 5975  H HG3  . LYS A 1 35 ? 0.194   18.550  -3.144  1.00 0.00 ? 35 LYS A HG3  5  
ATOM 5976  H HD2  . LYS A 1 35 ? 1.126   17.867  -5.218  1.00 0.00 ? 35 LYS A HD2  5  
ATOM 5977  H HD3  . LYS A 1 35 ? -0.611  18.043  -5.468  1.00 0.00 ? 35 LYS A HD3  5  
ATOM 5978  H HE2  . LYS A 1 35 ? 0.628   18.989  -7.327  1.00 0.00 ? 35 LYS A HE2  5  
ATOM 5979  H HE3  . LYS A 1 35 ? -0.224  20.263  -6.464  1.00 0.00 ? 35 LYS A HE3  5  
ATOM 5980  H HZ1  . LYS A 1 35 ? 2.629   19.609  -5.949  1.00 0.00 ? 35 LYS A HZ1  5  
ATOM 5981  H HZ2  . LYS A 1 35 ? 1.772   20.992  -5.477  1.00 0.00 ? 35 LYS A HZ2  5  
ATOM 5982  H HZ3  . LYS A 1 35 ? 2.137   20.742  -7.104  1.00 0.00 ? 35 LYS A HZ3  5  
ATOM 5983  N N    . PRO A 1 36 ? -2.641  22.819  -3.217  1.00 0.00 ? 36 PRO A N    5  
ATOM 5984  C CA   . PRO A 1 36 ? -3.887  23.592  -3.235  1.00 0.00 ? 36 PRO A CA   5  
ATOM 5985  C C    . PRO A 1 36 ? -5.073  22.770  -3.728  1.00 0.00 ? 36 PRO A C    5  
ATOM 5986  O O    . PRO A 1 36 ? -4.971  22.050  -4.722  1.00 0.00 ? 36 PRO A O    5  
ATOM 5987  C CB   . PRO A 1 36 ? -3.589  24.743  -4.206  1.00 0.00 ? 36 PRO A CB   5  
ATOM 5988  C CG   . PRO A 1 36 ? -2.397  24.302  -4.984  1.00 0.00 ? 36 PRO A CG   5  
ATOM 5989  C CD   . PRO A 1 36 ? -1.600  23.442  -4.051  1.00 0.00 ? 36 PRO A CD   5  
ATOM 5990  H HA   . PRO A 1 36 ? -4.103  23.997  -2.256  1.00 0.00 ? 36 PRO A HA   5  
ATOM 5991  H HB2  . PRO A 1 36 ? -4.436  24.930  -4.855  1.00 0.00 ? 36 PRO A HB2  5  
ATOM 5992  H HB3  . PRO A 1 36 ? -3.370  25.636  -3.640  1.00 0.00 ? 36 PRO A HB3  5  
ATOM 5993  H HG2  . PRO A 1 36 ? -2.710  23.732  -5.846  1.00 0.00 ? 36 PRO A HG2  5  
ATOM 5994  H HG3  . PRO A 1 36 ? -1.818  25.161  -5.290  1.00 0.00 ? 36 PRO A HG3  5  
ATOM 5995  H HD2  . PRO A 1 36 ? -1.040  22.719  -4.611  1.00 0.00 ? 36 PRO A HD2  5  
ATOM 5996  H HD3  . PRO A 1 36 ? -0.938  24.050  -3.451  1.00 0.00 ? 36 PRO A HD3  5  
ATOM 5997  N N    . ARG A 1 37 ? -6.196  22.881  -3.026  1.00 0.00 ? 37 ARG A N    5  
ATOM 5998  C CA   . ARG A 1 37 ? -7.404  22.151  -3.390  1.00 0.00 ? 37 ARG A CA   5  
ATOM 5999  C C    . ARG A 1 37 ? -8.013  22.711  -4.672  1.00 0.00 ? 37 ARG A C    5  
ATOM 6000  O O    . ARG A 1 37 ? -7.972  23.917  -4.914  1.00 0.00 ? 37 ARG A O    5  
ATOM 6001  C CB   . ARG A 1 37 ? -8.425  22.214  -2.251  1.00 0.00 ? 37 ARG A CB   5  
ATOM 6002  C CG   . ARG A 1 37 ? -8.697  23.624  -1.751  1.00 0.00 ? 37 ARG A CG   5  
ATOM 6003  C CD   . ARG A 1 37 ? -9.547  23.611  -0.491  1.00 0.00 ? 37 ARG A CD   5  
ATOM 6004  N NE   . ARG A 1 37 ? -8.915  22.854  0.587   1.00 0.00 ? 37 ARG A NE   5  
ATOM 6005  C CZ   . ARG A 1 37 ? -9.515  22.569  1.738   1.00 0.00 ? 37 ARG A CZ   5  
ATOM 6006  N NH1  . ARG A 1 37 ? -10.757 22.976  1.961   1.00 0.00 ? 37 ARG A NH1  5  
ATOM 6007  N NH2  . ARG A 1 37 ? -8.872  21.877  2.668   1.00 0.00 ? 37 ARG A NH2  5  
ATOM 6008  H H    . ARG A 1 37 ? -6.196  23.469  -2.243  1.00 0.00 ? 37 ARG A H    5  
ATOM 6009  H HA   . ARG A 1 37 ? -7.134  21.113  -3.552  1.00 0.00 ? 37 ARG A HA   5  
ATOM 6010  H HB2  . ARG A 1 37 ? -9.362  21.783  -2.584  1.00 0.00 ? 37 ARG A HB2  5  
ATOM 6011  H HB3  . ARG A 1 37 ? -8.043  21.621  -1.435  1.00 0.00 ? 37 ARG A HB3  5  
ATOM 6012  H HG2  . ARG A 1 37 ? -7.773  24.124  -1.522  1.00 0.00 ? 37 ARG A HG2  5  
ATOM 6013  H HG3  . ARG A 1 37 ? -9.224  24.171  -2.518  1.00 0.00 ? 37 ARG A HG3  5  
ATOM 6014  H HD2  . ARG A 1 37 ? -9.696  24.630  -0.163  1.00 0.00 ? 37 ARG A HD2  5  
ATOM 6015  H HD3  . ARG A 1 37 ? -10.504 23.165  -0.726  1.00 0.00 ? 37 ARG A HD3  5  
ATOM 6016  H HE   . ARG A 1 37 ? -7.988  22.548  0.457   1.00 0.00 ? 37 ARG A HE   5  
ATOM 6017  H HH11 . ARG A 1 37 ? -11.264 23.500  1.279   1.00 0.00 ? 37 ARG A HH11 5  
ATOM 6018  H HH12 . ARG A 1 37 ? -11.202 22.755  2.832   1.00 0.00 ? 37 ARG A HH12 5  
ATOM 6019  H HH21 . ARG A 1 37 ? -7.933  21.567  2.506   1.00 0.00 ? 37 ARG A HH21 5  
ATOM 6020  H HH22 . ARG A 1 37 ? -9.322  21.661  3.537   1.00 0.00 ? 37 ARG A HH22 5  
ATOM 6021  N N    . TYR A 1 38 ? -8.576  21.825  -5.488  1.00 0.00 ? 38 TYR A N    5  
ATOM 6022  C CA   . TYR A 1 38 ? -9.189  22.227  -6.750  1.00 0.00 ? 38 TYR A CA   5  
ATOM 6023  C C    . TYR A 1 38 ? -10.711 22.251  -6.634  1.00 0.00 ? 38 TYR A C    5  
ATOM 6024  O O    . TYR A 1 38 ? -11.292 21.560  -5.799  1.00 0.00 ? 38 TYR A O    5  
ATOM 6025  C CB   . TYR A 1 38 ? -8.769  21.274  -7.870  1.00 0.00 ? 38 TYR A CB   5  
ATOM 6026  C CG   . TYR A 1 38 ? -7.274  21.222  -8.096  1.00 0.00 ? 38 TYR A CG   5  
ATOM 6027  C CD1  . TYR A 1 38 ? -6.470  20.367  -7.352  1.00 0.00 ? 38 TYR A CD1  5  
ATOM 6028  C CD2  . TYR A 1 38 ? -6.668  22.024  -9.054  1.00 0.00 ? 38 TYR A CD2  5  
ATOM 6029  C CE1  . TYR A 1 38 ? -5.104  20.314  -7.557  1.00 0.00 ? 38 TYR A CE1  5  
ATOM 6030  C CE2  . TYR A 1 38 ? -5.303  21.977  -9.265  1.00 0.00 ? 38 TYR A CE2  5  
ATOM 6031  C CZ   . TYR A 1 38 ? -4.526  21.121  -8.514  1.00 0.00 ? 38 TYR A CZ   5  
ATOM 6032  O OH   . TYR A 1 38 ? -3.166  21.068  -8.721  1.00 0.00 ? 38 TYR A OH   5  
ATOM 6033  H H    . TYR A 1 38 ? -8.582  20.870  -5.240  1.00 0.00 ? 38 TYR A H    5  
ATOM 6034  H HA   . TYR A 1 38 ? -8.848  23.224  -7.009  1.00 0.00 ? 38 TYR A HA   5  
ATOM 6035  H HB2  . TYR A 1 38 ? -9.108  20.274  -7.627  1.00 0.00 ? 38 TYR A HB2  5  
ATOM 6036  H HB3  . TYR A 1 38 ? -9.241  21.585  -8.796  1.00 0.00 ? 38 TYR A HB3  5  
ATOM 6037  H HD1  . TYR A 1 38 ? -6.923  19.734  -6.601  1.00 0.00 ? 38 TYR A HD1  5  
ATOM 6038  H HD2  . TYR A 1 38 ? -7.277  22.696  -9.643  1.00 0.00 ? 38 TYR A HD2  5  
ATOM 6039  H HE1  . TYR A 1 38 ? -4.496  19.643  -6.969  1.00 0.00 ? 38 TYR A HE1  5  
ATOM 6040  H HE2  . TYR A 1 38 ? -4.851  22.609  -10.015 1.00 0.00 ? 38 TYR A HE2  5  
ATOM 6041  H HH   . TYR A 1 38 ? -2.724  21.648  -8.097  1.00 0.00 ? 38 TYR A HH   5  
ATOM 6042  N N    . GLU A 1 39 ? -11.347 23.056  -7.481  1.00 0.00 ? 39 GLU A N    5  
ATOM 6043  C CA   . GLU A 1 39 ? -12.801 23.173  -7.481  1.00 0.00 ? 39 GLU A CA   5  
ATOM 6044  C C    . GLU A 1 39 ? -13.342 23.226  -8.905  1.00 0.00 ? 39 GLU A C    5  
ATOM 6045  O O    . GLU A 1 39 ? -14.554 23.271  -9.119  1.00 0.00 ? 39 GLU A O    5  
ATOM 6046  C CB   . GLU A 1 39 ? -13.232 24.424  -6.713  1.00 0.00 ? 39 GLU A CB   5  
ATOM 6047  C CG   . GLU A 1 39 ? -12.920 24.362  -5.227  1.00 0.00 ? 39 GLU A CG   5  
ATOM 6048  C CD   . GLU A 1 39 ? -13.360 25.608  -4.486  1.00 0.00 ? 39 GLU A CD   5  
ATOM 6049  O OE1  . GLU A 1 39 ? -14.545 25.683  -4.103  1.00 0.00 ? 39 GLU A OE1  5  
ATOM 6050  O OE2  . GLU A 1 39 ? -12.518 26.509  -4.290  1.00 0.00 ? 39 GLU A OE2  5  
ATOM 6051  O OXT  . GLU A 1 39 ? -12.514 23.226  -9.847  1.00 0.00 ? 39 GLU A OXT  5  
ATOM 6052  H H    . GLU A 1 39 ? -10.827 23.591  -8.127  1.00 0.00 ? 39 GLU A H    5  
ATOM 6053  H HA   . GLU A 1 39 ? -13.229 22.302  -6.998  1.00 0.00 ? 39 GLU A HA   5  
ATOM 6054  H HB2  . GLU A 1 39 ? -12.723 25.280  -7.133  1.00 0.00 ? 39 GLU A HB2  5  
ATOM 6055  H HB3  . GLU A 1 39 ? -14.301 24.560  -6.826  1.00 0.00 ? 39 GLU A HB3  5  
ATOM 6056  H HG2  . GLU A 1 39 ? -13.428 23.511  -4.800  1.00 0.00 ? 39 GLU A HG2  5  
ATOM 6057  H HG3  . GLU A 1 39 ? -11.854 24.244  -5.100  1.00 0.00 ? 39 GLU A HG3  5  
ATOM 6058  N N    . GLY B 1 1  ? -10.108 -17.881 -12.066 1.00 0.00 ? 1  GLY B N    5  
ATOM 6059  C CA   . GLY B 1 1  ? -10.404 -18.483 -10.778 1.00 0.00 ? 1  GLY B CA   5  
ATOM 6060  C C    . GLY B 1 1  ? -10.423 -19.998 -10.836 1.00 0.00 ? 1  GLY B C    5  
ATOM 6061  O O    . GLY B 1 1  ? -9.724  -20.604 -11.650 1.00 0.00 ? 1  GLY B O    5  
ATOM 6062  H H1   . GLY B 1 1  ? -9.172  -18.188 -12.405 1.00 0.00 ? 1  GLY B H1   5  
ATOM 6063  H H2   . GLY B 1 1  ? -10.105 -16.844 -11.979 1.00 0.00 ? 1  GLY B H2   5  
ATOM 6064  H H3   . GLY B 1 1  ? -10.827 -18.154 -12.769 1.00 0.00 ? 1  GLY B H3   5  
ATOM 6065  H HA2  . GLY B 1 1  ? -9.663  -18.169 -10.067 1.00 0.00 ? 1  GLY B HA2  5  
ATOM 6066  H HA3  . GLY B 1 1  ? -11.372 -18.129 -10.449 1.00 0.00 ? 1  GLY B HA3  5  
ATOM 6067  N N    . HIS B 1 2  ? -11.227 -20.607 -9.968  1.00 0.00 ? 2  HIS B N    5  
ATOM 6068  C CA   . HIS B 1 2  ? -11.349 -22.062 -9.913  1.00 0.00 ? 2  HIS B CA   5  
ATOM 6069  C C    . HIS B 1 2  ? -10.002 -22.717 -9.615  1.00 0.00 ? 2  HIS B C    5  
ATOM 6070  O O    . HIS B 1 2  ? -9.221  -22.992 -10.526 1.00 0.00 ? 2  HIS B O    5  
ATOM 6071  C CB   . HIS B 1 2  ? -11.914 -22.602 -11.228 1.00 0.00 ? 2  HIS B CB   5  
ATOM 6072  C CG   . HIS B 1 2  ? -13.232 -22.000 -11.604 1.00 0.00 ? 2  HIS B CG   5  
ATOM 6073  N ND1  . HIS B 1 2  ? -14.434 -22.439 -11.091 1.00 0.00 ? 2  HIS B ND1  5  
ATOM 6074  C CD2  . HIS B 1 2  ? -13.532 -20.984 -12.447 1.00 0.00 ? 2  HIS B CD2  5  
ATOM 6075  C CE1  . HIS B 1 2  ? -15.417 -21.720 -11.601 1.00 0.00 ? 2  HIS B CE1  5  
ATOM 6076  N NE2  . HIS B 1 2  ? -14.897 -20.830 -12.426 1.00 0.00 ? 2  HIS B NE2  5  
ATOM 6077  H H    . HIS B 1 2  ? -11.763 -20.070 -9.340  1.00 0.00 ? 2  HIS B H    5  
ATOM 6078  H HA   . HIS B 1 2  ? -12.040 -22.301 -9.116  1.00 0.00 ? 2  HIS B HA   5  
ATOM 6079  H HB2  . HIS B 1 2  ? -11.220 -22.410 -12.031 1.00 0.00 ? 2  HIS B HB2  5  
ATOM 6080  H HB3  . HIS B 1 2  ? -12.058 -23.670 -11.137 1.00 0.00 ? 2  HIS B HB3  5  
ATOM 6081  H HD1  . HIS B 1 2  ? -14.549 -23.170 -10.449 1.00 0.00 ? 2  HIS B HD1  5  
ATOM 6082  H HD2  . HIS B 1 2  ? -12.829 -20.403 -13.027 1.00 0.00 ? 2  HIS B HD2  5  
ATOM 6083  H HE1  . HIS B 1 2  ? -16.467 -21.839 -11.380 1.00 0.00 ? 2  HIS B HE1  5  
ATOM 6084  H HE2  . HIS B 1 2  ? -15.411 -20.227 -13.003 1.00 0.00 ? 2  HIS B HE2  5  
ATOM 6085  N N    . SER B 1 3  ? -9.745  -22.961 -8.331  1.00 0.00 ? 3  SER B N    5  
ATOM 6086  C CA   . SER B 1 3  ? -8.497  -23.585 -7.893  1.00 0.00 ? 3  SER B CA   5  
ATOM 6087  C C    . SER B 1 3  ? -7.290  -22.739 -8.288  1.00 0.00 ? 3  SER B C    5  
ATOM 6088  O O    . SER B 1 3  ? -6.899  -22.700 -9.456  1.00 0.00 ? 3  SER B O    5  
ATOM 6089  C CB   . SER B 1 3  ? -8.365  -24.993 -8.482  1.00 0.00 ? 3  SER B CB   5  
ATOM 6090  O OG   . SER B 1 3  ? -7.157  -25.608 -8.066  1.00 0.00 ? 3  SER B OG   5  
ATOM 6091  H H    . SER B 1 3  ? -10.409 -22.719 -7.647  1.00 0.00 ? 3  SER B H    5  
ATOM 6092  H HA   . SER B 1 3  ? -8.537  -23.667 -6.815  1.00 0.00 ? 3  SER B HA   5  
ATOM 6093  H HB2  . SER B 1 3  ? -9.195  -25.599 -8.149  1.00 0.00 ? 3  SER B HB2  5  
ATOM 6094  H HB3  . SER B 1 3  ? -8.370  -24.944 -9.559  1.00 0.00 ? 3  SER B HB3  5  
ATOM 6095  H HG   . SER B 1 3  ? -7.262  -25.958 -7.177  1.00 0.00 ? 3  SER B HG   5  
ATOM 6096  N N    . LEU B 1 4  ? -6.699  -22.065 -7.305  1.00 0.00 ? 4  LEU B N    5  
ATOM 6097  C CA   . LEU B 1 4  ? -5.537  -21.219 -7.551  1.00 0.00 ? 4  LEU B CA   5  
ATOM 6098  C C    . LEU B 1 4  ? -4.276  -21.833 -6.941  1.00 0.00 ? 4  LEU B C    5  
ATOM 6099  O O    . LEU B 1 4  ? -4.309  -22.344 -5.822  1.00 0.00 ? 4  LEU B O    5  
ATOM 6100  C CB   . LEU B 1 4  ? -5.760  -19.822 -6.967  1.00 0.00 ? 4  LEU B CB   5  
ATOM 6101  C CG   . LEU B 1 4  ? -7.009  -19.095 -7.470  1.00 0.00 ? 4  LEU B CG   5  
ATOM 6102  C CD1  . LEU B 1 4  ? -7.163  -17.759 -6.761  1.00 0.00 ? 4  LEU B CD1  5  
ATOM 6103  C CD2  . LEU B 1 4  ? -6.947  -18.893 -8.978  1.00 0.00 ? 4  LEU B CD2  5  
ATOM 6104  H H    . LEU B 1 4  ? -7.047  -22.134 -6.385  1.00 0.00 ? 4  LEU B H    5  
ATOM 6105  H HA   . LEU B 1 4  ? -5.417  -21.119 -8.612  1.00 0.00 ? 4  LEU B HA   5  
ATOM 6106  H HB2  . LEU B 1 4  ? -5.834  -19.916 -5.889  1.00 0.00 ? 4  LEU B HB2  5  
ATOM 6107  H HB3  . LEU B 1 4  ? -4.895  -19.212 -7.199  1.00 0.00 ? 4  LEU B HB3  5  
ATOM 6108  H HG   . LEU B 1 4  ? -7.880  -19.694 -7.247  1.00 0.00 ? 4  LEU B HG   5  
ATOM 6109  H HD11 . LEU B 1 4  ? -6.308  -17.131 -6.973  1.00 0.00 ? 4  LEU B HD11 5  
ATOM 6110  H HD12 . LEU B 1 4  ? -7.233  -17.921 -5.694  1.00 0.00 ? 4  LEU B HD12 5  
ATOM 6111  H HD13 . LEU B 1 4  ? -8.063  -17.267 -7.105  1.00 0.00 ? 4  LEU B HD13 5  
ATOM 6112  H HD21 . LEU B 1 4  ? -6.986  -19.852 -9.472  1.00 0.00 ? 4  LEU B HD21 5  
ATOM 6113  H HD22 . LEU B 1 4  ? -6.027  -18.390 -9.242  1.00 0.00 ? 4  LEU B HD22 5  
ATOM 6114  H HD23 . LEU B 1 4  ? -7.782  -18.294 -9.300  1.00 0.00 ? 4  LEU B HD23 5  
ATOM 6115  N N    . PRO B 1 5  ? -3.144  -21.792 -7.671  1.00 0.00 ? 5  PRO B N    5  
ATOM 6116  C CA   . PRO B 1 5  ? -1.872  -22.345 -7.188  1.00 0.00 ? 5  PRO B CA   5  
ATOM 6117  C C    . PRO B 1 5  ? -1.373  -21.639 -5.931  1.00 0.00 ? 5  PRO B C    5  
ATOM 6118  O O    . PRO B 1 5  ? -1.644  -20.457 -5.721  1.00 0.00 ? 5  PRO B O    5  
ATOM 6119  C CB   . PRO B 1 5  ? -0.903  -22.103 -8.353  1.00 0.00 ? 5  PRO B CB   5  
ATOM 6120  C CG   . PRO B 1 5  ? -1.773  -21.883 -9.543  1.00 0.00 ? 5  PRO B CG   5  
ATOM 6121  C CD   . PRO B 1 5  ? -3.011  -21.218 -9.022  1.00 0.00 ? 5  PRO B CD   5  
ATOM 6122  H HA   . PRO B 1 5  ? -1.954  -23.407 -7.000  1.00 0.00 ? 5  PRO B HA   5  
ATOM 6123  H HB2  . PRO B 1 5  ? -0.308  -21.228 -8.162  1.00 0.00 ? 5  PRO B HB2  5  
ATOM 6124  H HB3  . PRO B 1 5  ? -0.265  -22.963 -8.485  1.00 0.00 ? 5  PRO B HB3  5  
ATOM 6125  H HG2  . PRO B 1 5  ? -1.271  -21.241 -10.252 1.00 0.00 ? 5  PRO B HG2  5  
ATOM 6126  H HG3  . PRO B 1 5  ? -2.019  -22.830 -9.999  1.00 0.00 ? 5  PRO B HG3  5  
ATOM 6127  H HD2  . PRO B 1 5  ? -2.878  -20.146 -8.982  1.00 0.00 ? 5  PRO B HD2  5  
ATOM 6128  H HD3  . PRO B 1 5  ? -3.847  -21.478 -9.648  1.00 0.00 ? 5  PRO B HD3  5  
ATOM 6129  N N    . PHE B 1 6  ? -0.643  -22.375 -5.097  1.00 0.00 ? 6  PHE B N    5  
ATOM 6130  C CA   . PHE B 1 6  ? -0.100  -21.824 -3.861  1.00 0.00 ? 6  PHE B CA   5  
ATOM 6131  C C    . PHE B 1 6  ? 1.035   -20.848 -4.158  1.00 0.00 ? 6  PHE B C    5  
ATOM 6132  O O    . PHE B 1 6  ? 1.389   -20.019 -3.320  1.00 0.00 ? 6  PHE B O    5  
ATOM 6133  C CB   . PHE B 1 6  ? 0.399   -22.950 -2.951  1.00 0.00 ? 6  PHE B CB   5  
ATOM 6134  C CG   . PHE B 1 6  ? 1.682   -23.585 -3.415  1.00 0.00 ? 6  PHE B CG   5  
ATOM 6135  C CD1  . PHE B 1 6  ? 1.747   -24.243 -4.635  1.00 0.00 ? 6  PHE B CD1  5  
ATOM 6136  C CD2  . PHE B 1 6  ? 2.821   -23.524 -2.629  1.00 0.00 ? 6  PHE B CD2  5  
ATOM 6137  C CE1  . PHE B 1 6  ? 2.926   -24.826 -5.060  1.00 0.00 ? 6  PHE B CE1  5  
ATOM 6138  C CE2  . PHE B 1 6  ? 4.002   -24.107 -3.050  1.00 0.00 ? 6  PHE B CE2  5  
ATOM 6139  C CZ   . PHE B 1 6  ? 4.054   -24.758 -4.268  1.00 0.00 ? 6  PHE B CZ   5  
ATOM 6140  H H    . PHE B 1 6  ? -0.488  -23.308 -5.322  1.00 0.00 ? 6  PHE B H    5  
ATOM 6141  H HA   . PHE B 1 6  ? -0.891  -21.290 -3.349  1.00 0.00 ? 6  PHE B HA   5  
ATOM 6142  H HB2  . PHE B 1 6  ? 0.547   -22.552 -1.956  1.00 0.00 ? 6  PHE B HB2  5  
ATOM 6143  H HB3  . PHE B 1 6  ? -0.356  -23.723 -2.907  1.00 0.00 ? 6  PHE B HB3  5  
ATOM 6144  H HD1  . PHE B 1 6  ? 0.881   -24.318 -5.259  1.00 0.00 ? 6  PHE B HD1  5  
ATOM 6145  H HD2  . PHE B 1 6  ? 2.786   -23.016 -1.675  1.00 0.00 ? 6  PHE B HD2  5  
ATOM 6146  H HE1  . PHE B 1 6  ? 2.964   -25.336 -6.011  1.00 0.00 ? 6  PHE B HE1  5  
ATOM 6147  H HE2  . PHE B 1 6  ? 4.883   -24.052 -2.428  1.00 0.00 ? 6  PHE B HE2  5  
ATOM 6148  H HZ   . PHE B 1 6  ? 4.976   -25.213 -4.599  1.00 0.00 ? 6  PHE B HZ   5  
ATOM 6149  N N    . LYS B 1 7  ? 1.601   -20.955 -5.357  1.00 0.00 ? 7  LYS B N    5  
ATOM 6150  C CA   . LYS B 1 7  ? 2.694   -20.079 -5.764  1.00 0.00 ? 7  LYS B CA   5  
ATOM 6151  C C    . LYS B 1 7  ? 2.211   -18.639 -5.880  1.00 0.00 ? 7  LYS B C    5  
ATOM 6152  O O    . LYS B 1 7  ? 2.994   -17.700 -5.747  1.00 0.00 ? 7  LYS B O    5  
ATOM 6153  C CB   . LYS B 1 7  ? 3.289   -20.544 -7.098  1.00 0.00 ? 7  LYS B CB   5  
ATOM 6154  C CG   . LYS B 1 7  ? 2.320   -20.457 -8.267  1.00 0.00 ? 7  LYS B CG   5  
ATOM 6155  C CD   . LYS B 1 7  ? 2.996   -20.804 -9.585  1.00 0.00 ? 7  LYS B CD   5  
ATOM 6156  C CE   . LYS B 1 7  ? 3.438   -22.259 -9.630  1.00 0.00 ? 7  LYS B CE   5  
ATOM 6157  N NZ   . LYS B 1 7  ? 4.108   -22.598 -10.915 1.00 0.00 ? 7  LYS B NZ   5  
ATOM 6158  H H    . LYS B 1 7  ? 1.293   -21.639 -5.988  1.00 0.00 ? 7  LYS B H    5  
ATOM 6159  H HA   . LYS B 1 7  ? 3.465   -20.126 -5.006  1.00 0.00 ? 7  LYS B HA   5  
ATOM 6160  H HB2  . LYS B 1 7  ? 4.157   -19.937 -7.321  1.00 0.00 ? 7  LYS B HB2  5  
ATOM 6161  H HB3  . LYS B 1 7  ? 3.600   -21.571 -6.986  1.00 0.00 ? 7  LYS B HB3  5  
ATOM 6162  H HG2  . LYS B 1 7  ? 1.532   -21.150 -8.095  1.00 0.00 ? 7  LYS B HG2  5  
ATOM 6163  H HG3  . LYS B 1 7  ? 1.918   -19.458 -8.339  1.00 0.00 ? 7  LYS B HG3  5  
ATOM 6164  H HD2  . LYS B 1 7  ? 2.296   -20.631 -10.389 1.00 0.00 ? 7  LYS B HD2  5  
ATOM 6165  H HD3  . LYS B 1 7  ? 3.861   -20.169 -9.720  1.00 0.00 ? 7  LYS B HD3  5  
ATOM 6166  H HE2  . LYS B 1 7  ? 4.133   -22.447 -8.827  1.00 0.00 ? 7  LYS B HE2  5  
ATOM 6167  H HE3  . LYS B 1 7  ? 2.571   -22.893 -9.511  1.00 0.00 ? 7  LYS B HE3  5  
ATOM 6168  H HZ1  . LYS B 1 7  ? 3.459   -22.442 -11.714 1.00 0.00 ? 7  LYS B HZ1  5  
ATOM 6169  H HZ2  . LYS B 1 7  ? 4.396   -23.597 -10.912 1.00 0.00 ? 7  LYS B HZ2  5  
ATOM 6170  H HZ3  . LYS B 1 7  ? 4.955   -22.007 -11.048 1.00 0.00 ? 7  LYS B HZ3  5  
ATOM 6171  N N    . VAL B 1 8  ? 0.914   -18.472 -6.126  1.00 0.00 ? 8  VAL B N    5  
ATOM 6172  C CA   . VAL B 1 8  ? 0.328   -17.146 -6.256  1.00 0.00 ? 8  VAL B CA   5  
ATOM 6173  C C    . VAL B 1 8  ? 0.404   -16.391 -4.932  1.00 0.00 ? 8  VAL B C    5  
ATOM 6174  O O    . VAL B 1 8  ? 0.596   -15.176 -4.909  1.00 0.00 ? 8  VAL B O    5  
ATOM 6175  C CB   . VAL B 1 8  ? -1.142  -17.219 -6.712  1.00 0.00 ? 8  VAL B CB   5  
ATOM 6176  C CG1  . VAL B 1 8  ? -1.676  -15.830 -7.019  1.00 0.00 ? 8  VAL B CG1  5  
ATOM 6177  C CG2  . VAL B 1 8  ? -1.282  -18.130 -7.922  1.00 0.00 ? 8  VAL B CG2  5  
ATOM 6178  H H    . VAL B 1 8  ? 0.336   -19.256 -6.215  1.00 0.00 ? 8  VAL B H    5  
ATOM 6179  H HA   . VAL B 1 8  ? 0.892   -16.600 -7.005  1.00 0.00 ? 8  VAL B HA   5  
ATOM 6180  H HB   . VAL B 1 8  ? -1.736  -17.639 -5.909  1.00 0.00 ? 8  VAL B HB   5  
ATOM 6181  H HG11 . VAL B 1 8  ? -1.665  -15.225 -6.126  1.00 0.00 ? 8  VAL B HG11 5  
ATOM 6182  H HG12 . VAL B 1 8  ? -2.693  -15.904 -7.380  1.00 0.00 ? 8  VAL B HG12 5  
ATOM 6183  H HG13 . VAL B 1 8  ? -1.062  -15.363 -7.777  1.00 0.00 ? 8  VAL B HG13 5  
ATOM 6184  H HG21 . VAL B 1 8  ? -1.007  -19.137 -7.666  1.00 0.00 ? 8  VAL B HG21 5  
ATOM 6185  H HG22 . VAL B 1 8  ? -0.643  -17.777 -8.719  1.00 0.00 ? 8  VAL B HG22 5  
ATOM 6186  H HG23 . VAL B 1 8  ? -2.310  -18.123 -8.263  1.00 0.00 ? 8  VAL B HG23 5  
ATOM 6187  N N    . VAL B 1 9  ? 0.245   -17.123 -3.831  1.00 0.00 ? 9  VAL B N    5  
ATOM 6188  C CA   . VAL B 1 9  ? 0.300   -16.524 -2.503  1.00 0.00 ? 9  VAL B CA   5  
ATOM 6189  C C    . VAL B 1 9  ? 1.727   -16.119 -2.149  1.00 0.00 ? 9  VAL B C    5  
ATOM 6190  O O    . VAL B 1 9  ? 1.969   -15.010 -1.674  1.00 0.00 ? 9  VAL B O    5  
ATOM 6191  C CB   . VAL B 1 9  ? -0.220  -17.491 -1.422  1.00 0.00 ? 9  VAL B CB   5  
ATOM 6192  C CG1  . VAL B 1 9  ? -0.544  -16.738 -0.142  1.00 0.00 ? 9  VAL B CG1  5  
ATOM 6193  C CG2  . VAL B 1 9  ? -1.435  -18.256 -1.922  1.00 0.00 ? 9  VAL B CG2  5  
ATOM 6194  H H    . VAL B 1 9  ? 0.105   -18.089 -3.919  1.00 0.00 ? 9  VAL B H    5  
ATOM 6195  H HA   . VAL B 1 9  ? -0.327  -15.638 -2.506  1.00 0.00 ? 9  VAL B HA   5  
ATOM 6196  H HB   . VAL B 1 9  ? 0.554   -18.216 -1.196  1.00 0.00 ? 9  VAL B HB   5  
ATOM 6197  H HG11 . VAL B 1 9  ? -1.313  -16.004 -0.336  1.00 0.00 ? 9  VAL B HG11 5  
ATOM 6198  H HG12 . VAL B 1 9  ? 0.343   -16.240 0.222   1.00 0.00 ? 9  VAL B HG12 5  
ATOM 6199  H HG13 . VAL B 1 9  ? -0.894  -17.433 0.609   1.00 0.00 ? 9  VAL B HG13 5  
ATOM 6200  H HG21 . VAL B 1 9  ? -1.912  -18.768 -1.096  1.00 0.00 ? 9  VAL B HG21 5  
ATOM 6201  H HG22 . VAL B 1 9  ? -1.130  -18.989 -2.651  1.00 0.00 ? 9  VAL B HG22 5  
ATOM 6202  H HG23 . VAL B 1 9  ? -2.144  -17.573 -2.371  1.00 0.00 ? 9  VAL B HG23 5  
ATOM 6203  N N    . VAL B 1 10 ? 2.665   -17.033 -2.385  1.00 0.00 ? 10 VAL B N    5  
ATOM 6204  C CA   . VAL B 1 10 ? 4.072   -16.785 -2.092  1.00 0.00 ? 10 VAL B CA   5  
ATOM 6205  C C    . VAL B 1 10 ? 4.584   -15.557 -2.838  1.00 0.00 ? 10 VAL B C    5  
ATOM 6206  O O    . VAL B 1 10 ? 5.143   -14.643 -2.232  1.00 0.00 ? 10 VAL B O    5  
ATOM 6207  C CB   . VAL B 1 10 ? 4.945   -18.003 -2.459  1.00 0.00 ? 10 VAL B CB   5  
ATOM 6208  C CG1  . VAL B 1 10 ? 6.408   -17.733 -2.136  1.00 0.00 ? 10 VAL B CG1  5  
ATOM 6209  C CG2  . VAL B 1 10 ? 4.457   -19.250 -1.735  1.00 0.00 ? 10 VAL B CG2  5  
ATOM 6210  H H    . VAL B 1 10 ? 2.399   -17.897 -2.772  1.00 0.00 ? 10 VAL B H    5  
ATOM 6211  H HA   . VAL B 1 10 ? 4.165   -16.608 -1.027  1.00 0.00 ? 10 VAL B HA   5  
ATOM 6212  H HB   . VAL B 1 10 ? 4.861   -18.178 -3.523  1.00 0.00 ? 10 VAL B HB   5  
ATOM 6213  H HG11 . VAL B 1 10 ? 6.797   -16.975 -2.798  1.00 0.00 ? 10 VAL B HG11 5  
ATOM 6214  H HG12 . VAL B 1 10 ? 6.984   -18.640 -2.269  1.00 0.00 ? 10 VAL B HG12 5  
ATOM 6215  H HG13 . VAL B 1 10 ? 6.503   -17.399 -1.111  1.00 0.00 ? 10 VAL B HG13 5  
ATOM 6216  H HG21 . VAL B 1 10 ? 4.483   -19.084 -0.667  1.00 0.00 ? 10 VAL B HG21 5  
ATOM 6217  H HG22 . VAL B 1 10 ? 5.098   -20.086 -1.981  1.00 0.00 ? 10 VAL B HG22 5  
ATOM 6218  H HG23 . VAL B 1 10 ? 3.449   -19.481 -2.037  1.00 0.00 ? 10 VAL B HG23 5  
ATOM 6219  N N    . ILE B 1 11 ? 4.395   -15.542 -4.155  1.00 0.00 ? 11 ILE B N    5  
ATOM 6220  C CA   . ILE B 1 11 ? 4.836   -14.422 -4.978  1.00 0.00 ? 11 ILE B CA   5  
ATOM 6221  C C    . ILE B 1 11 ? 4.195   -13.118 -4.513  1.00 0.00 ? 11 ILE B C    5  
ATOM 6222  O O    . ILE B 1 11 ? 4.806   -12.052 -4.589  1.00 0.00 ? 11 ILE B O    5  
ATOM 6223  C CB   . ILE B 1 11 ? 4.502   -14.647 -6.466  1.00 0.00 ? 11 ILE B CB   5  
ATOM 6224  C CG1  . ILE B 1 11 ? 5.143   -15.945 -6.965  1.00 0.00 ? 11 ILE B CG1  5  
ATOM 6225  C CG2  . ILE B 1 11 ? 4.973   -13.463 -7.302  1.00 0.00 ? 11 ILE B CG2  5  
ATOM 6226  C CD1  . ILE B 1 11 ? 4.694   -16.349 -8.353  1.00 0.00 ? 11 ILE B CD1  5  
ATOM 6227  H H    . ILE B 1 11 ? 3.935   -16.304 -4.577  1.00 0.00 ? 11 ILE B H    5  
ATOM 6228  H HA   . ILE B 1 11 ? 5.912   -14.336 -4.879  1.00 0.00 ? 11 ILE B HA   5  
ATOM 6229  H HB   . ILE B 1 11 ? 3.427   -14.723 -6.566  1.00 0.00 ? 11 ILE B HB   5  
ATOM 6230  H HG12 . ILE B 1 11 ? 6.216   -15.818 -6.999  1.00 0.00 ? 11 ILE B HG12 5  
ATOM 6231  H HG13 . ILE B 1 11 ? 4.920   -16.757 -6.303  1.00 0.00 ? 11 ILE B HG13 5  
ATOM 6232  H HG21 . ILE B 1 11 ? 4.448   -12.568 -7.008  1.00 0.00 ? 11 ILE B HG21 5  
ATOM 6233  H HG22 . ILE B 1 11 ? 4.775   -13.648 -8.348  1.00 0.00 ? 11 ILE B HG22 5  
ATOM 6234  H HG23 . ILE B 1 11 ? 6.035   -13.318 -7.161  1.00 0.00 ? 11 ILE B HG23 5  
ATOM 6235  H HD11 . ILE B 1 11 ? 5.046   -17.348 -8.566  1.00 0.00 ? 11 ILE B HD11 5  
ATOM 6236  H HD12 . ILE B 1 11 ? 5.104   -15.664 -9.080  1.00 0.00 ? 11 ILE B HD12 5  
ATOM 6237  H HD13 . ILE B 1 11 ? 3.614   -16.331 -8.408  1.00 0.00 ? 11 ILE B HD13 5  
ATOM 6238  N N    . SER B 1 12 ? 2.959   -13.211 -4.029  1.00 0.00 ? 12 SER B N    5  
ATOM 6239  C CA   . SER B 1 12 ? 2.235   -12.039 -3.552  1.00 0.00 ? 12 SER B CA   5  
ATOM 6240  C C    . SER B 1 12 ? 2.828   -11.522 -2.245  1.00 0.00 ? 12 SER B C    5  
ATOM 6241  O O    . SER B 1 12 ? 2.929   -10.316 -2.036  1.00 0.00 ? 12 SER B O    5  
ATOM 6242  C CB   . SER B 1 12 ? 0.755   -12.368 -3.353  1.00 0.00 ? 12 SER B CB   5  
ATOM 6243  O OG   . SER B 1 12 ? 0.112   -12.596 -4.593  1.00 0.00 ? 12 SER B OG   5  
ATOM 6244  H H    . SER B 1 12 ? 2.513   -14.089 -3.991  1.00 0.00 ? 12 SER B H    5  
ATOM 6245  H HA   . SER B 1 12 ? 2.317   -11.261 -4.301  1.00 0.00 ? 12 SER B HA   5  
ATOM 6246  H HB2  . SER B 1 12 ? 0.661   -13.254 -2.748  1.00 0.00 ? 12 SER B HB2  5  
ATOM 6247  H HB3  . SER B 1 12 ? 0.258   -11.542 -2.859  1.00 0.00 ? 12 SER B HB3  5  
ATOM 6248  H HG   . SER B 1 12 ? -0.758  -12.972 -4.439  1.00 0.00 ? 12 SER B HG   5  
ATOM 6249  N N    . ALA B 1 13 ? 3.220   -12.445 -1.372  1.00 0.00 ? 13 ALA B N    5  
ATOM 6250  C CA   . ALA B 1 13 ? 3.801   -12.082 -0.084  1.00 0.00 ? 13 ALA B CA   5  
ATOM 6251  C C    . ALA B 1 13 ? 5.144   -11.380 -0.260  1.00 0.00 ? 13 ALA B C    5  
ATOM 6252  O O    . ALA B 1 13 ? 5.354   -10.284 0.262   1.00 0.00 ? 13 ALA B O    5  
ATOM 6253  C CB   . ALA B 1 13 ? 3.960   -13.318 0.788   1.00 0.00 ? 13 ALA B CB   5  
ATOM 6254  H H    . ALA B 1 13 ? 3.114   -13.401 -1.593  1.00 0.00 ? 13 ALA B H    5  
ATOM 6255  H HA   . ALA B 1 13 ? 3.119   -11.408 0.419   1.00 0.00 ? 13 ALA B HA   5  
ATOM 6256  H HB1  . ALA B 1 13 ? 4.333   -13.032 1.761   1.00 0.00 ? 13 ALA B HB1  5  
ATOM 6257  H HB2  . ALA B 1 13 ? 4.654   -14.005 0.323   1.00 0.00 ? 13 ALA B HB2  5  
ATOM 6258  H HB3  . ALA B 1 13 ? 3.001   -13.801 0.901   1.00 0.00 ? 13 ALA B HB3  5  
ATOM 6259  N N    . ILE B 1 14 ? 6.049   -12.020 -0.993  1.00 0.00 ? 14 ILE B N    5  
ATOM 6260  C CA   . ILE B 1 14 ? 7.373   -11.458 -1.241  1.00 0.00 ? 14 ILE B CA   5  
ATOM 6261  C C    . ILE B 1 14 ? 7.276   -10.090 -1.907  1.00 0.00 ? 14 ILE B C    5  
ATOM 6262  O O    . ILE B 1 14 ? 7.847   -9.113  -1.424  1.00 0.00 ? 14 ILE B O    5  
ATOM 6263  C CB   . ILE B 1 14 ? 8.220   -12.400 -2.129  1.00 0.00 ? 14 ILE B CB   5  
ATOM 6264  C CG1  . ILE B 1 14 ? 8.554   -13.691 -1.373  1.00 0.00 ? 14 ILE B CG1  5  
ATOM 6265  C CG2  . ILE B 1 14 ? 9.493   -11.708 -2.597  1.00 0.00 ? 14 ILE B CG2  5  
ATOM 6266  C CD1  . ILE B 1 14 ? 9.387   -13.478 -0.125  1.00 0.00 ? 14 ILE B CD1  5  
ATOM 6267  H H    . ILE B 1 14 ? 5.820   -12.898 -1.382  1.00 0.00 ? 14 ILE B H    5  
ATOM 6268  H HA   . ILE B 1 14 ? 7.867   -11.328 -0.291  1.00 0.00 ? 14 ILE B HA   5  
ATOM 6269  H HB   . ILE B 1 14 ? 7.637   -12.648 -3.003  1.00 0.00 ? 14 ILE B HB   5  
ATOM 6270  H HG12 . ILE B 1 14 ? 7.635   -14.176 -1.075  1.00 0.00 ? 14 ILE B HG12 5  
ATOM 6271  H HG13 . ILE B 1 14 ? 9.103   -14.354 -2.028  1.00 0.00 ? 14 ILE B HG13 5  
ATOM 6272  H HG21 . ILE B 1 14 ? 10.186  -12.441 -2.991  1.00 0.00 ? 14 ILE B HG21 5  
ATOM 6273  H HG22 . ILE B 1 14 ? 9.960   -11.189 -1.770  1.00 0.00 ? 14 ILE B HG22 5  
ATOM 6274  H HG23 . ILE B 1 14 ? 9.257   -11.000 -3.379  1.00 0.00 ? 14 ILE B HG23 5  
ATOM 6275  H HD11 . ILE B 1 14 ? 8.800   -12.965 0.620   1.00 0.00 ? 14 ILE B HD11 5  
ATOM 6276  H HD12 . ILE B 1 14 ? 10.267  -12.897 -0.356  1.00 0.00 ? 14 ILE B HD12 5  
ATOM 6277  H HD13 . ILE B 1 14 ? 9.691   -14.438 0.265   1.00 0.00 ? 14 ILE B HD13 5  
ATOM 6278  N N    . LEU B 1 15 ? 6.546   -10.029 -3.015  1.00 0.00 ? 15 LEU B N    5  
ATOM 6279  C CA   . LEU B 1 15 ? 6.380   -8.782  -3.756  1.00 0.00 ? 15 LEU B CA   5  
ATOM 6280  C C    . LEU B 1 15 ? 5.724   -7.707  -2.896  1.00 0.00 ? 15 LEU B C    5  
ATOM 6281  O O    . LEU B 1 15 ? 6.042   -6.525  -3.017  1.00 0.00 ? 15 LEU B O    5  
ATOM 6282  C CB   . LEU B 1 15 ? 5.542   -9.023  -5.014  1.00 0.00 ? 15 LEU B CB   5  
ATOM 6283  C CG   . LEU B 1 15 ? 5.338   -7.796  -5.905  1.00 0.00 ? 15 LEU B CG   5  
ATOM 6284  C CD1  . LEU B 1 15 ? 6.663   -7.331  -6.491  1.00 0.00 ? 15 LEU B CD1  5  
ATOM 6285  C CD2  . LEU B 1 15 ? 4.343   -8.106  -7.013  1.00 0.00 ? 15 LEU B CD2  5  
ATOM 6286  H H    . LEU B 1 15 ? 6.109   -10.849 -3.350  1.00 0.00 ? 15 LEU B H    5  
ATOM 6287  H HA   . LEU B 1 15 ? 7.361   -8.439  -4.051  1.00 0.00 ? 15 LEU B HA   5  
ATOM 6288  H HB2  . LEU B 1 15 ? 6.023   -9.798  -5.597  1.00 0.00 ? 15 LEU B HB2  5  
ATOM 6289  H HB3  . LEU B 1 15 ? 4.570   -9.387  -4.703  1.00 0.00 ? 15 LEU B HB3  5  
ATOM 6290  H HG   . LEU B 1 15 ? 4.933   -6.985  -5.318  1.00 0.00 ? 15 LEU B HG   5  
ATOM 6291  H HD11 . LEU B 1 15 ? 7.334   -7.048  -5.694  1.00 0.00 ? 15 LEU B HD11 5  
ATOM 6292  H HD12 . LEU B 1 15 ? 6.496   -6.476  -7.132  1.00 0.00 ? 15 LEU B HD12 5  
ATOM 6293  H HD13 . LEU B 1 15 ? 7.108   -8.130  -7.068  1.00 0.00 ? 15 LEU B HD13 5  
ATOM 6294  H HD21 . LEU B 1 15 ? 4.725   -8.905  -7.634  1.00 0.00 ? 15 LEU B HD21 5  
ATOM 6295  H HD22 . LEU B 1 15 ? 4.188   -7.224  -7.619  1.00 0.00 ? 15 LEU B HD22 5  
ATOM 6296  H HD23 . LEU B 1 15 ? 3.400   -8.409  -6.579  1.00 0.00 ? 15 LEU B HD23 5  
ATOM 6297  N N    . ALA B 1 16 ? 4.809   -8.123  -2.024  1.00 0.00 ? 16 ALA B N    5  
ATOM 6298  C CA   . ALA B 1 16 ? 4.110   -7.185  -1.156  1.00 0.00 ? 16 ALA B CA   5  
ATOM 6299  C C    . ALA B 1 16 ? 5.068   -6.501  -0.185  1.00 0.00 ? 16 ALA B C    5  
ATOM 6300  O O    . ALA B 1 16 ? 4.955   -5.303  0.069   1.00 0.00 ? 16 ALA B O    5  
ATOM 6301  C CB   . ALA B 1 16 ? 2.999   -7.892  -0.396  1.00 0.00 ? 16 ALA B CB   5  
ATOM 6302  H H    . ALA B 1 16 ? 4.588   -9.082  -1.965  1.00 0.00 ? 16 ALA B H    5  
ATOM 6303  H HA   . ALA B 1 16 ? 3.648   -6.431  -1.779  1.00 0.00 ? 16 ALA B HA   5  
ATOM 6304  H HB1  . ALA B 1 16 ? 2.573   -7.225  0.343   1.00 0.00 ? 16 ALA B HB1  5  
ATOM 6305  H HB2  . ALA B 1 16 ? 3.397   -8.766  0.096   1.00 0.00 ? 16 ALA B HB2  5  
ATOM 6306  H HB3  . ALA B 1 16 ? 2.227   -8.190  -1.089  1.00 0.00 ? 16 ALA B HB3  5  
ATOM 6307  N N    . LEU B 1 17 ? 6.009   -7.266  0.359   1.00 0.00 ? 17 LEU B N    5  
ATOM 6308  C CA   . LEU B 1 17 ? 6.985   -6.714  1.292   1.00 0.00 ? 17 LEU B CA   5  
ATOM 6309  C C    . LEU B 1 17 ? 7.984   -5.829  0.556   1.00 0.00 ? 17 LEU B C    5  
ATOM 6310  O O    . LEU B 1 17 ? 8.488   -4.851  1.108   1.00 0.00 ? 17 LEU B O    5  
ATOM 6311  C CB   . LEU B 1 17 ? 7.719   -7.833  2.037   1.00 0.00 ? 17 LEU B CB   5  
ATOM 6312  C CG   . LEU B 1 17 ? 6.834   -8.727  2.914   1.00 0.00 ? 17 LEU B CG   5  
ATOM 6313  C CD1  . LEU B 1 17 ? 7.685   -9.713  3.696   1.00 0.00 ? 17 LEU B CD1  5  
ATOM 6314  C CD2  . LEU B 1 17 ? 5.988   -7.888  3.862   1.00 0.00 ? 17 LEU B CD2  5  
ATOM 6315  H H    . LEU B 1 17 ? 6.057   -8.223  0.126   1.00 0.00 ? 17 LEU B H    5  
ATOM 6316  H HA   . LEU B 1 17 ? 6.462   -6.095  2.007   1.00 0.00 ? 17 LEU B HA   5  
ATOM 6317  H HB2  . LEU B 1 17 ? 8.213   -8.459  1.306   1.00 0.00 ? 17 LEU B HB2  5  
ATOM 6318  H HB3  . LEU B 1 17 ? 8.475   -7.381  2.670   1.00 0.00 ? 17 LEU B HB3  5  
ATOM 6319  H HG   . LEU B 1 17 ? 6.168   -9.292  2.285   1.00 0.00 ? 17 LEU B HG   5  
ATOM 6320  H HD11 . LEU B 1 17 ? 7.046   -10.354 4.289   1.00 0.00 ? 17 LEU B HD11 5  
ATOM 6321  H HD12 . LEU B 1 17 ? 8.360   -9.177  4.349   1.00 0.00 ? 17 LEU B HD12 5  
ATOM 6322  H HD13 . LEU B 1 17 ? 8.259   -10.320 3.009   1.00 0.00 ? 17 LEU B HD13 5  
ATOM 6323  H HD21 . LEU B 1 17 ? 5.463   -8.535  4.553   1.00 0.00 ? 17 LEU B HD21 5  
ATOM 6324  H HD22 . LEU B 1 17 ? 5.263   -7.321  3.298   1.00 0.00 ? 17 LEU B HD22 5  
ATOM 6325  H HD23 . LEU B 1 17 ? 6.622   -7.211  4.419   1.00 0.00 ? 17 LEU B HD23 5  
ATOM 6326  N N    . VAL B 1 18 ? 8.261   -6.179  -0.696  1.00 0.00 ? 18 VAL B N    5  
ATOM 6327  C CA   . VAL B 1 18 ? 9.193   -5.415  -1.515  1.00 0.00 ? 18 VAL B CA   5  
ATOM 6328  C C    . VAL B 1 18 ? 8.620   -4.043  -1.853  1.00 0.00 ? 18 VAL B C    5  
ATOM 6329  O O    . VAL B 1 18 ? 9.332   -3.039  -1.819  1.00 0.00 ? 18 VAL B O    5  
ATOM 6330  C CB   . VAL B 1 18 ? 9.533   -6.160  -2.823  1.00 0.00 ? 18 VAL B CB   5  
ATOM 6331  C CG1  . VAL B 1 18 ? 10.377  -5.285  -3.739  1.00 0.00 ? 18 VAL B CG1  5  
ATOM 6332  C CG2  . VAL B 1 18 ? 10.252  -7.465  -2.520  1.00 0.00 ? 18 VAL B CG2  5  
ATOM 6333  H H    . VAL B 1 18 ? 7.830   -6.972  -1.091  1.00 0.00 ? 18 VAL B H    5  
ATOM 6334  H HA   . VAL B 1 18 ? 10.111  -5.277  -0.953  1.00 0.00 ? 18 VAL B HA   5  
ATOM 6335  H HB   . VAL B 1 18 ? 8.610   -6.392  -3.333  1.00 0.00 ? 18 VAL B HB   5  
ATOM 6336  H HG11 . VAL B 1 18 ? 10.788  -5.885  -4.542  1.00 0.00 ? 18 VAL B HG11 5  
ATOM 6337  H HG12 . VAL B 1 18 ? 11.189  -4.839  -3.181  1.00 0.00 ? 18 VAL B HG12 5  
ATOM 6338  H HG13 . VAL B 1 18 ? 9.764   -4.505  -4.167  1.00 0.00 ? 18 VAL B HG13 5  
ATOM 6339  H HG21 . VAL B 1 18 ? 9.765   -7.984  -1.715  1.00 0.00 ? 18 VAL B HG21 5  
ATOM 6340  H HG22 . VAL B 1 18 ? 11.277  -7.263  -2.235  1.00 0.00 ? 18 VAL B HG22 5  
ATOM 6341  H HG23 . VAL B 1 18 ? 10.245  -8.088  -3.402  1.00 0.00 ? 18 VAL B HG23 5  
ATOM 6342  N N    . VAL B 1 19 ? 7.331   -4.007  -2.176  1.00 0.00 ? 19 VAL B N    5  
ATOM 6343  C CA   . VAL B 1 19 ? 6.670   -2.757  -2.524  1.00 0.00 ? 19 VAL B CA   5  
ATOM 6344  C C    . VAL B 1 19 ? 6.383   -1.915  -1.287  1.00 0.00 ? 19 VAL B C    5  
ATOM 6345  O O    . VAL B 1 19 ? 6.465   -0.691  -1.337  1.00 0.00 ? 19 VAL B O    5  
ATOM 6346  C CB   . VAL B 1 19 ? 5.351   -3.000  -3.286  1.00 0.00 ? 19 VAL B CB   5  
ATOM 6347  C CG1  . VAL B 1 19 ? 5.612   -3.768  -4.573  1.00 0.00 ? 19 VAL B CG1  5  
ATOM 6348  C CG2  . VAL B 1 19 ? 4.348   -3.735  -2.411  1.00 0.00 ? 19 VAL B CG2  5  
ATOM 6349  H H    . VAL B 1 19 ? 6.814   -4.843  -2.189  1.00 0.00 ? 19 VAL B H    5  
ATOM 6350  H HA   . VAL B 1 19 ? 7.328   -2.192  -3.172  1.00 0.00 ? 19 VAL B HA   5  
ATOM 6351  H HB   . VAL B 1 19 ? 4.927   -2.041  -3.554  1.00 0.00 ? 19 VAL B HB   5  
ATOM 6352  H HG11 . VAL B 1 19 ? 4.674   -3.989  -5.065  1.00 0.00 ? 19 VAL B HG11 5  
ATOM 6353  H HG12 . VAL B 1 19 ? 6.128   -4.685  -4.360  1.00 0.00 ? 19 VAL B HG12 5  
ATOM 6354  H HG13 . VAL B 1 19 ? 6.220   -3.163  -5.229  1.00 0.00 ? 19 VAL B HG13 5  
ATOM 6355  H HG21 . VAL B 1 19 ? 4.089   -3.143  -1.550  1.00 0.00 ? 19 VAL B HG21 5  
ATOM 6356  H HG22 . VAL B 1 19 ? 4.762   -4.664  -2.102  1.00 0.00 ? 19 VAL B HG22 5  
ATOM 6357  H HG23 . VAL B 1 19 ? 3.449   -3.926  -2.983  1.00 0.00 ? 19 VAL B HG23 5  
ATOM 6358  N N    . LEU B 1 20 ? 6.062   -2.573  -0.173  1.00 0.00 ? 20 LEU B N    5  
ATOM 6359  C CA   . LEU B 1 20 ? 5.759   -1.862  1.067   1.00 0.00 ? 20 LEU B CA   5  
ATOM 6360  C C    . LEU B 1 20 ? 6.927   -0.973  1.472   1.00 0.00 ? 20 LEU B C    5  
ATOM 6361  O O    . LEU B 1 20 ? 6.730   0.136   1.970   1.00 0.00 ? 20 LEU B O    5  
ATOM 6362  C CB   . LEU B 1 20 ? 5.434   -2.846  2.195   1.00 0.00 ? 20 LEU B CB   5  
ATOM 6363  C CG   . LEU B 1 20 ? 5.077   -2.200  3.537   1.00 0.00 ? 20 LEU B CG   5  
ATOM 6364  C CD1  . LEU B 1 20 ? 3.843   -1.314  3.402   1.00 0.00 ? 20 LEU B CD1  5  
ATOM 6365  C CD2  . LEU B 1 20 ? 4.854   -3.265  4.600   1.00 0.00 ? 20 LEU B CD2  5  
ATOM 6366  H H    . LEU B 1 20 ? 6.016   -3.558  -0.181  1.00 0.00 ? 20 LEU B H    5  
ATOM 6367  H HA   . LEU B 1 20 ? 4.896   -1.239  0.883   1.00 0.00 ? 20 LEU B HA   5  
ATOM 6368  H HB2  . LEU B 1 20 ? 4.602   -3.460  1.875   1.00 0.00 ? 20 LEU B HB2  5  
ATOM 6369  H HB3  . LEU B 1 20 ? 6.294   -3.487  2.341   1.00 0.00 ? 20 LEU B HB3  5  
ATOM 6370  H HG   . LEU B 1 20 ? 5.896   -1.577  3.864   1.00 0.00 ? 20 LEU B HG   5  
ATOM 6371  H HD11 . LEU B 1 20 ? 3.582   -0.904  4.369   1.00 0.00 ? 20 LEU B HD11 5  
ATOM 6372  H HD12 . LEU B 1 20 ? 3.014   -1.897  3.027   1.00 0.00 ? 20 LEU B HD12 5  
ATOM 6373  H HD13 . LEU B 1 20 ? 4.050   -0.503  2.720   1.00 0.00 ? 20 LEU B HD13 5  
ATOM 6374  H HD21 . LEU B 1 20 ? 4.632   -2.792  5.547   1.00 0.00 ? 20 LEU B HD21 5  
ATOM 6375  H HD22 . LEU B 1 20 ? 5.747   -3.865  4.704   1.00 0.00 ? 20 LEU B HD22 5  
ATOM 6376  H HD23 . LEU B 1 20 ? 4.027   -3.900  4.313   1.00 0.00 ? 20 LEU B HD23 5  
ATOM 6377  N N    . THR B 1 21 ? 8.140   -1.465  1.255   1.00 0.00 ? 21 THR B N    5  
ATOM 6378  C CA   . THR B 1 21 ? 9.335   -0.700  1.582   1.00 0.00 ? 21 THR B CA   5  
ATOM 6379  C C    . THR B 1 21 ? 9.501   0.450   0.598   1.00 0.00 ? 21 THR B C    5  
ATOM 6380  O O    . THR B 1 21 ? 10.042  1.501   0.936   1.00 0.00 ? 21 THR B O    5  
ATOM 6381  C CB   . THR B 1 21 ? 10.600  -1.580  1.554   1.00 0.00 ? 21 THR B CB   5  
ATOM 6382  O OG1  . THR B 1 21 ? 10.434  -2.706  2.424   1.00 0.00 ? 21 THR B OG1  5  
ATOM 6383  C CG2  . THR B 1 21 ? 11.823  -0.784  1.984   1.00 0.00 ? 21 THR B CG2  5  
ATOM 6384  H H    . THR B 1 21 ? 8.244   -2.360  0.855   1.00 0.00 ? 21 THR B H    5  
ATOM 6385  H HA   . THR B 1 21 ? 9.221   -0.295  2.583   1.00 0.00 ? 21 THR B HA   5  
ATOM 6386  H HB   . THR B 1 21 ? 10.758  -1.938  0.544   1.00 0.00 ? 21 THR B HB   5  
ATOM 6387  H HG1  . THR B 1 21 ? 11.002  -3.425  2.134   1.00 0.00 ? 21 THR B HG1  5  
ATOM 6388  H HG21 . THR B 1 21 ? 12.087  -0.076  1.213   1.00 0.00 ? 21 THR B HG21 5  
ATOM 6389  H HG22 . THR B 1 21 ? 12.649  -1.461  2.142   1.00 0.00 ? 21 THR B HG22 5  
ATOM 6390  H HG23 . THR B 1 21 ? 11.616  -0.255  2.905   1.00 0.00 ? 21 THR B HG23 5  
ATOM 6391  N N    . ILE B 1 22 ? 9.019   0.238   -0.624  1.00 0.00 ? 22 ILE B N    5  
ATOM 6392  C CA   . ILE B 1 22 ? 9.100   1.252   -1.665  1.00 0.00 ? 22 ILE B CA   5  
ATOM 6393  C C    . ILE B 1 22 ? 8.114   2.383   -1.394  1.00 0.00 ? 22 ILE B C    5  
ATOM 6394  O O    . ILE B 1 22 ? 8.416   3.551   -1.640  1.00 0.00 ? 22 ILE B O    5  
ATOM 6395  C CB   . ILE B 1 22 ? 8.827   0.648   -3.061  1.00 0.00 ? 22 ILE B CB   5  
ATOM 6396  C CG1  . ILE B 1 22 ? 9.914   -0.369  -3.418  1.00 0.00 ? 22 ILE B CG1  5  
ATOM 6397  C CG2  . ILE B 1 22 ? 8.749   1.744   -4.116  1.00 0.00 ? 22 ILE B CG2  5  
ATOM 6398  C CD1  . ILE B 1 22 ? 9.637   -1.138  -4.691  1.00 0.00 ? 22 ILE B CD1  5  
ATOM 6399  H H    . ILE B 1 22 ? 8.603   -0.618  -0.841  1.00 0.00 ? 22 ILE B H    5  
ATOM 6400  H HA   . ILE B 1 22 ? 10.104  1.665   -1.665  1.00 0.00 ? 22 ILE B HA   5  
ATOM 6401  H HB   . ILE B 1 22 ? 7.874   0.150   -3.034  1.00 0.00 ? 22 ILE B HB   5  
ATOM 6402  H HG12 . ILE B 1 22 ? 10.855  0.147   -3.547  1.00 0.00 ? 22 ILE B HG12 5  
ATOM 6403  H HG13 . ILE B 1 22 ? 10.018  -1.078  -2.620  1.00 0.00 ? 22 ILE B HG13 5  
ATOM 6404  H HG21 . ILE B 1 22 ? 7.872   2.351   -3.953  1.00 0.00 ? 22 ILE B HG21 5  
ATOM 6405  H HG22 . ILE B 1 22 ? 8.683   1.308   -5.103  1.00 0.00 ? 22 ILE B HG22 5  
ATOM 6406  H HG23 . ILE B 1 22 ? 9.631   2.368   -4.062  1.00 0.00 ? 22 ILE B HG23 5  
ATOM 6407  H HD11 . ILE B 1 22 ? 9.852   -0.511  -5.543  1.00 0.00 ? 22 ILE B HD11 5  
ATOM 6408  H HD12 . ILE B 1 22 ? 8.602   -1.444  -4.723  1.00 0.00 ? 22 ILE B HD12 5  
ATOM 6409  H HD13 . ILE B 1 22 ? 10.269  -2.013  -4.724  1.00 0.00 ? 22 ILE B HD13 5  
ATOM 6410  N N    . ILE B 1 23 ? 6.935   2.035   -0.881  1.00 0.00 ? 23 ILE B N    5  
ATOM 6411  C CA   . ILE B 1 23 ? 5.920   3.033   -0.575  1.00 0.00 ? 23 ILE B CA   5  
ATOM 6412  C C    . ILE B 1 23 ? 6.427   3.995   0.497   1.00 0.00 ? 23 ILE B C    5  
ATOM 6413  O O    . ILE B 1 23 ? 6.195   5.201   0.423   1.00 0.00 ? 23 ILE B O    5  
ATOM 6414  C CB   . ILE B 1 23 ? 4.605   2.395   -0.082  1.00 0.00 ? 23 ILE B CB   5  
ATOM 6415  C CG1  . ILE B 1 23 ? 4.123   1.315   -1.053  1.00 0.00 ? 23 ILE B CG1  5  
ATOM 6416  C CG2  . ILE B 1 23 ? 3.538   3.467   0.089   1.00 0.00 ? 23 ILE B CG2  5  
ATOM 6417  C CD1  . ILE B 1 23 ? 3.802   1.835   -2.437  1.00 0.00 ? 23 ILE B CD1  5  
ATOM 6418  H H    . ILE B 1 23 ? 6.752   1.088   -0.695  1.00 0.00 ? 23 ILE B H    5  
ATOM 6419  H HA   . ILE B 1 23 ? 5.715   3.595   -1.479  1.00 0.00 ? 23 ILE B HA   5  
ATOM 6420  H HB   . ILE B 1 23 ? 4.781   1.940   0.885   1.00 0.00 ? 23 ILE B HB   5  
ATOM 6421  H HG12 . ILE B 1 23 ? 4.858   0.556   -1.150  1.00 0.00 ? 23 ILE B HG12 5  
ATOM 6422  H HG13 . ILE B 1 23 ? 3.220   0.870   -0.659  1.00 0.00 ? 23 ILE B HG13 5  
ATOM 6423  H HG21 . ILE B 1 23 ? 2.586   3.002   0.312   1.00 0.00 ? 23 ILE B HG21 5  
ATOM 6424  H HG22 . ILE B 1 23 ? 3.446   4.046   -0.819  1.00 0.00 ? 23 ILE B HG22 5  
ATOM 6425  H HG23 . ILE B 1 23 ? 3.806   4.122   0.905   1.00 0.00 ? 23 ILE B HG23 5  
ATOM 6426  H HD11 . ILE B 1 23 ? 3.002   2.557   -2.383  1.00 0.00 ? 23 ILE B HD11 5  
ATOM 6427  H HD12 . ILE B 1 23 ? 3.492   1.010   -3.061  1.00 0.00 ? 23 ILE B HD12 5  
ATOM 6428  H HD13 . ILE B 1 23 ? 4.676   2.296   -2.869  1.00 0.00 ? 23 ILE B HD13 5  
ATOM 6429  N N    . SER B 1 24 ? 7.126   3.444   1.488   1.00 0.00 ? 24 SER B N    5  
ATOM 6430  C CA   . SER B 1 24 ? 7.665   4.240   2.588   1.00 0.00 ? 24 SER B CA   5  
ATOM 6431  C C    . SER B 1 24 ? 8.862   5.074   2.141   1.00 0.00 ? 24 SER B C    5  
ATOM 6432  O O    . SER B 1 24 ? 9.020   6.220   2.565   1.00 0.00 ? 24 SER B O    5  
ATOM 6433  C CB   . SER B 1 24 ? 8.071   3.330   3.751   1.00 0.00 ? 24 SER B CB   5  
ATOM 6434  O OG   . SER B 1 24 ? 9.074   2.410   3.356   1.00 0.00 ? 24 SER B OG   5  
ATOM 6435  H H    . SER B 1 24 ? 7.281   2.470   1.490   1.00 0.00 ? 24 SER B H    5  
ATOM 6436  H HA   . SER B 1 24 ? 6.890   4.909   2.933   1.00 0.00 ? 24 SER B HA   5  
ATOM 6437  H HB2  . SER B 1 24 ? 8.449   3.929   4.568   1.00 0.00 ? 24 SER B HB2  5  
ATOM 6438  H HB3  . SER B 1 24 ? 7.206   2.776   4.086   1.00 0.00 ? 24 SER B HB3  5  
ATOM 6439  H HG   . SER B 1 24 ? 9.445   1.987   4.134   1.00 0.00 ? 24 SER B HG   5  
ATOM 6440  N N    . LEU B 1 25 ? 9.706   4.496   1.288   1.00 0.00 ? 25 LEU B N    5  
ATOM 6441  C CA   . LEU B 1 25 ? 10.887  5.196   0.793   1.00 0.00 ? 25 LEU B CA   5  
ATOM 6442  C C    . LEU B 1 25 ? 10.496  6.477   0.062   1.00 0.00 ? 25 LEU B C    5  
ATOM 6443  O O    . LEU B 1 25 ? 11.162  7.504   0.193   1.00 0.00 ? 25 LEU B O    5  
ATOM 6444  C CB   . LEU B 1 25 ? 11.698  4.290   -0.137  1.00 0.00 ? 25 LEU B CB   5  
ATOM 6445  C CG   . LEU B 1 25 ? 12.523  3.207   0.564   1.00 0.00 ? 25 LEU B CG   5  
ATOM 6446  C CD1  . LEU B 1 25 ? 13.140  2.265   -0.457  1.00 0.00 ? 25 LEU B CD1  5  
ATOM 6447  C CD2  . LEU B 1 25 ? 13.605  3.835   1.432   1.00 0.00 ? 25 LEU B CD2  5  
ATOM 6448  H H    . LEU B 1 25 ? 9.537   3.573   0.985   1.00 0.00 ? 25 LEU B H    5  
ATOM 6449  H HA   . LEU B 1 25 ? 11.488  5.472   1.644   1.00 0.00 ? 25 LEU B HA   5  
ATOM 6450  H HB2  . LEU B 1 25 ? 11.005  3.809   -0.817  1.00 0.00 ? 25 LEU B HB2  5  
ATOM 6451  H HB3  . LEU B 1 25 ? 12.376  4.902   -0.723  1.00 0.00 ? 25 LEU B HB3  5  
ATOM 6452  H HG   . LEU B 1 25 ? 11.886  2.633   1.207   1.00 0.00 ? 25 LEU B HG   5  
ATOM 6453  H HD11 . LEU B 1 25 ? 13.805  2.816   -1.108  1.00 0.00 ? 25 LEU B HD11 5  
ATOM 6454  H HD12 . LEU B 1 25 ? 12.358  1.808   -1.047  1.00 0.00 ? 25 LEU B HD12 5  
ATOM 6455  H HD13 . LEU B 1 25 ? 13.698  1.492   0.053   1.00 0.00 ? 25 LEU B HD13 5  
ATOM 6456  H HD21 . LEU B 1 25 ? 13.151  4.420   2.216   1.00 0.00 ? 25 LEU B HD21 5  
ATOM 6457  H HD22 . LEU B 1 25 ? 14.235  4.472   0.827   1.00 0.00 ? 25 LEU B HD22 5  
ATOM 6458  H HD23 . LEU B 1 25 ? 14.210  3.056   1.879   1.00 0.00 ? 25 LEU B HD23 5  
ATOM 6459  N N    . ILE B 1 26 ? 9.415   6.407   -0.709  1.00 0.00 ? 26 ILE B N    5  
ATOM 6460  C CA   . ILE B 1 26 ? 8.936   7.564   -1.455  1.00 0.00 ? 26 ILE B CA   5  
ATOM 6461  C C    . ILE B 1 26 ? 8.539   8.693   -0.508  1.00 0.00 ? 26 ILE B C    5  
ATOM 6462  O O    . ILE B 1 26 ? 8.814   9.864   -0.773  1.00 0.00 ? 26 ILE B O    5  
ATOM 6463  C CB   . ILE B 1 26 ? 7.735   7.202   -2.354  1.00 0.00 ? 26 ILE B CB   5  
ATOM 6464  C CG1  . ILE B 1 26 ? 8.141   6.132   -3.370  1.00 0.00 ? 26 ILE B CG1  5  
ATOM 6465  C CG2  . ILE B 1 26 ? 7.205   8.442   -3.061  1.00 0.00 ? 26 ILE B CG2  5  
ATOM 6466  C CD1  . ILE B 1 26 ? 6.979   5.589   -4.179  1.00 0.00 ? 26 ILE B CD1  5  
ATOM 6467  H H    . ILE B 1 26 ? 8.921   5.558   -0.778  1.00 0.00 ? 26 ILE B H    5  
ATOM 6468  H HA   . ILE B 1 26 ? 9.743   7.914   -2.090  1.00 0.00 ? 26 ILE B HA   5  
ATOM 6469  H HB   . ILE B 1 26 ? 6.947   6.812   -1.725  1.00 0.00 ? 26 ILE B HB   5  
ATOM 6470  H HG12 . ILE B 1 26 ? 8.851   6.556   -4.067  1.00 0.00 ? 26 ILE B HG12 5  
ATOM 6471  H HG13 . ILE B 1 26 ? 8.605   5.308   -2.872  1.00 0.00 ? 26 ILE B HG13 5  
ATOM 6472  H HG21 . ILE B 1 26 ? 6.819   9.144   -2.340  1.00 0.00 ? 26 ILE B HG21 5  
ATOM 6473  H HG22 . ILE B 1 26 ? 6.406   8.171   -3.735  1.00 0.00 ? 26 ILE B HG22 5  
ATOM 6474  H HG23 . ILE B 1 26 ? 8.001   8.909   -3.624  1.00 0.00 ? 26 ILE B HG23 5  
ATOM 6475  H HD11 . ILE B 1 26 ? 6.168   5.316   -3.518  1.00 0.00 ? 26 ILE B HD11 5  
ATOM 6476  H HD12 . ILE B 1 26 ? 7.302   4.716   -4.727  1.00 0.00 ? 26 ILE B HD12 5  
ATOM 6477  H HD13 . ILE B 1 26 ? 6.640   6.341   -4.875  1.00 0.00 ? 26 ILE B HD13 5  
ATOM 6478  N N    . ILE B 1 27 ? 7.894   8.332   0.598   1.00 0.00 ? 27 ILE B N    5  
ATOM 6479  C CA   . ILE B 1 27 ? 7.466   9.313   1.590   1.00 0.00 ? 27 ILE B CA   5  
ATOM 6480  C C    . ILE B 1 27 ? 8.670   9.973   2.250   1.00 0.00 ? 27 ILE B C    5  
ATOM 6481  O O    . ILE B 1 27 ? 8.693   11.184  2.460   1.00 0.00 ? 27 ILE B O    5  
ATOM 6482  C CB   . ILE B 1 27 ? 6.600   8.668   2.688   1.00 0.00 ? 27 ILE B CB   5  
ATOM 6483  C CG1  . ILE B 1 27 ? 5.491   7.817   2.068   1.00 0.00 ? 27 ILE B CG1  5  
ATOM 6484  C CG2  . ILE B 1 27 ? 6.008   9.738   3.595   1.00 0.00 ? 27 ILE B CG2  5  
ATOM 6485  C CD1  . ILE B 1 27 ? 4.804   6.908   3.063   1.00 0.00 ? 27 ILE B CD1  5  
ATOM 6486  H H    . ILE B 1 27 ? 7.720   7.378   0.757   1.00 0.00 ? 27 ILE B H    5  
ATOM 6487  H HA   . ILE B 1 27 ? 6.877   10.071  1.086   1.00 0.00 ? 27 ILE B HA   5  
ATOM 6488  H HB   . ILE B 1 27 ? 7.234   8.030   3.294   1.00 0.00 ? 27 ILE B HB   5  
ATOM 6489  H HG12 . ILE B 1 27 ? 4.736   8.463   1.642   1.00 0.00 ? 27 ILE B HG12 5  
ATOM 6490  H HG13 . ILE B 1 27 ? 5.882   7.198   1.294   1.00 0.00 ? 27 ILE B HG13 5  
ATOM 6491  H HG21 . ILE B 1 27 ? 5.374   9.275   4.339   1.00 0.00 ? 27 ILE B HG21 5  
ATOM 6492  H HG22 . ILE B 1 27 ? 5.420   10.429  3.008   1.00 0.00 ? 27 ILE B HG22 5  
ATOM 6493  H HG23 . ILE B 1 27 ? 6.799   10.277  4.095   1.00 0.00 ? 27 ILE B HG23 5  
ATOM 6494  H HD11 . ILE B 1 27 ? 4.149   7.494   3.690   1.00 0.00 ? 27 ILE B HD11 5  
ATOM 6495  H HD12 . ILE B 1 27 ? 5.539   6.410   3.679   1.00 0.00 ? 27 ILE B HD12 5  
ATOM 6496  H HD13 . ILE B 1 27 ? 4.223   6.170   2.531   1.00 0.00 ? 27 ILE B HD13 5  
ATOM 6497  N N    . LEU B 1 28 ? 9.666   9.156   2.579   1.00 0.00 ? 28 LEU B N    5  
ATOM 6498  C CA   . LEU B 1 28 ? 10.882  9.638   3.223   1.00 0.00 ? 28 LEU B CA   5  
ATOM 6499  C C    . LEU B 1 28 ? 11.538  10.745  2.403   1.00 0.00 ? 28 LEU B C    5  
ATOM 6500  O O    . LEU B 1 28 ? 11.716  11.865  2.884   1.00 0.00 ? 28 LEU B O    5  
ATOM 6501  C CB   . LEU B 1 28 ? 11.864  8.480   3.417   1.00 0.00 ? 28 LEU B CB   5  
ATOM 6502  C CG   . LEU B 1 28 ? 13.166  8.841   4.134   1.00 0.00 ? 28 LEU B CG   5  
ATOM 6503  C CD1  . LEU B 1 28 ? 12.886  9.296   5.558   1.00 0.00 ? 28 LEU B CD1  5  
ATOM 6504  C CD2  . LEU B 1 28 ? 14.118  7.653   4.128   1.00 0.00 ? 28 LEU B CD2  5  
ATOM 6505  H H    . LEU B 1 28 ? 9.581   8.191   2.392   1.00 0.00 ? 28 LEU B H    5  
ATOM 6506  H HA   . LEU B 1 28 ? 10.609  10.034  4.189   1.00 0.00 ? 28 LEU B HA   5  
ATOM 6507  H HB2  . LEU B 1 28 ? 11.361  7.705   3.983   1.00 0.00 ? 28 LEU B HB2  5  
ATOM 6508  H HB3  . LEU B 1 28 ? 12.109  8.080   2.441   1.00 0.00 ? 28 LEU B HB3  5  
ATOM 6509  H HG   . LEU B 1 28 ? 13.651  9.654   3.615   1.00 0.00 ? 28 LEU B HG   5  
ATOM 6510  H HD11 . LEU B 1 28 ? 13.819  9.518   6.058   1.00 0.00 ? 28 LEU B HD11 5  
ATOM 6511  H HD12 . LEU B 1 28 ? 12.370  8.514   6.097   1.00 0.00 ? 28 LEU B HD12 5  
ATOM 6512  H HD13 . LEU B 1 28 ? 12.274  10.186  5.542   1.00 0.00 ? 28 LEU B HD13 5  
ATOM 6513  H HD21 . LEU B 1 28 ? 14.326  7.360   3.108   1.00 0.00 ? 28 LEU B HD21 5  
ATOM 6514  H HD22 . LEU B 1 28 ? 13.670  6.822   4.655   1.00 0.00 ? 28 LEU B HD22 5  
ATOM 6515  H HD23 . LEU B 1 28 ? 15.044  7.928   4.614   1.00 0.00 ? 28 LEU B HD23 5  
ATOM 6516  N N    . ILE B 1 29 ? 11.894  10.426  1.163   1.00 0.00 ? 29 ILE B N    5  
ATOM 6517  C CA   . ILE B 1 29 ? 12.533  11.392  0.276   1.00 0.00 ? 29 ILE B CA   5  
ATOM 6518  C C    . ILE B 1 29 ? 11.614  12.579  -0.001  1.00 0.00 ? 29 ILE B C    5  
ATOM 6519  O O    . ILE B 1 29 ? 12.077  13.706  -0.176  1.00 0.00 ? 29 ILE B O    5  
ATOM 6520  C CB   . ILE B 1 29 ? 12.937  10.743  -1.062  1.00 0.00 ? 29 ILE B CB   5  
ATOM 6521  C CG1  . ILE B 1 29 ? 13.783  9.491   -0.810  1.00 0.00 ? 29 ILE B CG1  5  
ATOM 6522  C CG2  . ILE B 1 29 ? 13.700  11.739  -1.925  1.00 0.00 ? 29 ILE B CG2  5  
ATOM 6523  C CD1  . ILE B 1 29 ? 14.067  8.690   -2.064  1.00 0.00 ? 29 ILE B CD1  5  
ATOM 6524  H H    . ILE B 1 29 ? 11.706  9.517   0.838   1.00 0.00 ? 29 ILE B H    5  
ATOM 6525  H HA   . ILE B 1 29 ? 13.431  11.749  0.764   1.00 0.00 ? 29 ILE B HA   5  
ATOM 6526  H HB   . ILE B 1 29 ? 12.037  10.459  -1.592  1.00 0.00 ? 29 ILE B HB   5  
ATOM 6527  H HG12 . ILE B 1 29 ? 14.732  9.778   -0.382  1.00 0.00 ? 29 ILE B HG12 5  
ATOM 6528  H HG13 . ILE B 1 29 ? 13.278  8.830   -0.125  1.00 0.00 ? 29 ILE B HG13 5  
ATOM 6529  H HG21 . ILE B 1 29 ? 13.098  12.599  -2.097  1.00 0.00 ? 29 ILE B HG21 5  
ATOM 6530  H HG22 . ILE B 1 29 ? 13.940  11.288  -2.876  1.00 0.00 ? 29 ILE B HG22 5  
ATOM 6531  H HG23 . ILE B 1 29 ? 14.611  12.028  -1.429  1.00 0.00 ? 29 ILE B HG23 5  
ATOM 6532  H HD11 . ILE B 1 29 ? 14.717  9.255   -2.714  1.00 0.00 ? 29 ILE B HD11 5  
ATOM 6533  H HD12 . ILE B 1 29 ? 13.140  8.476   -2.578  1.00 0.00 ? 29 ILE B HD12 5  
ATOM 6534  H HD13 . ILE B 1 29 ? 14.549  7.762   -1.794  1.00 0.00 ? 29 ILE B HD13 5  
ATOM 6535  N N    . MET B 1 30 ? 10.311  12.317  -0.038  1.00 0.00 ? 30 MET B N    5  
ATOM 6536  C CA   . MET B 1 30 ? 9.324   13.360  -0.296  1.00 0.00 ? 30 MET B CA   5  
ATOM 6537  C C    . MET B 1 30 ? 9.411   14.472  0.746   1.00 0.00 ? 30 MET B C    5  
ATOM 6538  O O    . MET B 1 30 ? 9.486   15.652  0.407   1.00 0.00 ? 30 MET B O    5  
ATOM 6539  C CB   . MET B 1 30 ? 7.914   12.764  -0.293  1.00 0.00 ? 30 MET B CB   5  
ATOM 6540  C CG   . MET B 1 30 ? 6.824   13.774  -0.616  1.00 0.00 ? 30 MET B CG   5  
ATOM 6541  S SD   . MET B 1 30 ? 5.184   13.213  -0.118  1.00 0.00 ? 30 MET B SD   5  
ATOM 6542  C CE   . MET B 1 30 ? 5.014   11.727  -1.101  1.00 0.00 ? 30 MET B CE   5  
ATOM 6543  H H    . MET B 1 30 ? 9.995   11.394  0.105   1.00 0.00 ? 30 MET B H    5  
ATOM 6544  H HA   . MET B 1 30 ? 9.524   13.779  -1.272  1.00 0.00 ? 30 MET B HA   5  
ATOM 6545  H HB2  . MET B 1 30 ? 7.869   11.987  -1.037  1.00 0.00 ? 30 MET B HB2  5  
ATOM 6546  H HB3  . MET B 1 30 ? 7.718   12.336  0.676   1.00 0.00 ? 30 MET B HB3  5  
ATOM 6547  H HG2  . MET B 1 30 ? 7.020   14.708  -0.112  1.00 0.00 ? 30 MET B HG2  5  
ATOM 6548  H HG3  . MET B 1 30 ? 6.817   13.941  -1.683  1.00 0.00 ? 30 MET B HG3  5  
ATOM 6549  H HE1  . MET B 1 30 ? 3.995   11.374  -1.047  1.00 0.00 ? 30 MET B HE1  5  
ATOM 6550  H HE2  . MET B 1 30 ? 5.679   10.966  -0.721  1.00 0.00 ? 30 MET B HE2  5  
ATOM 6551  H HE3  . MET B 1 30 ? 5.266   11.944  -2.129  1.00 0.00 ? 30 MET B HE3  5  
ATOM 6552  N N    . LEU B 1 31 ? 9.399   14.082  2.017   1.00 0.00 ? 31 LEU B N    5  
ATOM 6553  C CA   . LEU B 1 31 ? 9.464   15.041  3.115   1.00 0.00 ? 31 LEU B CA   5  
ATOM 6554  C C    . LEU B 1 31 ? 10.883  15.572  3.305   1.00 0.00 ? 31 LEU B C    5  
ATOM 6555  O O    . LEU B 1 31 ? 11.080  16.658  3.851   1.00 0.00 ? 31 LEU B O    5  
ATOM 6556  C CB   . LEU B 1 31 ? 8.966   14.393  4.409   1.00 0.00 ? 31 LEU B CB   5  
ATOM 6557  C CG   . LEU B 1 31 ? 8.847   15.336  5.608   1.00 0.00 ? 31 LEU B CG   5  
ATOM 6558  C CD1  . LEU B 1 31 ? 7.797   16.407  5.345   1.00 0.00 ? 31 LEU B CD1  5  
ATOM 6559  C CD2  . LEU B 1 31 ? 8.509   14.556  6.871   1.00 0.00 ? 31 LEU B CD2  5  
ATOM 6560  H H    . LEU B 1 31 ? 9.339   13.119  2.226   1.00 0.00 ? 31 LEU B H    5  
ATOM 6561  H HA   . LEU B 1 31 ? 8.817   15.871  2.871   1.00 0.00 ? 31 LEU B HA   5  
ATOM 6562  H HB2  . LEU B 1 31 ? 7.994   13.958  4.215   1.00 0.00 ? 31 LEU B HB2  5  
ATOM 6563  H HB3  . LEU B 1 31 ? 9.648   13.592  4.668   1.00 0.00 ? 31 LEU B HB3  5  
ATOM 6564  H HG   . LEU B 1 31 ? 9.792   15.831  5.771   1.00 0.00 ? 31 LEU B HG   5  
ATOM 6565  H HD11 . LEU B 1 31 ? 8.095   17.010  4.502   1.00 0.00 ? 31 LEU B HD11 5  
ATOM 6566  H HD12 . LEU B 1 31 ? 7.700   17.043  6.215   1.00 0.00 ? 31 LEU B HD12 5  
ATOM 6567  H HD13 . LEU B 1 31 ? 6.844   15.941  5.135   1.00 0.00 ? 31 LEU B HD13 5  
ATOM 6568  H HD21 . LEU B 1 31 ? 9.278   13.819  7.058   1.00 0.00 ? 31 LEU B HD21 5  
ATOM 6569  H HD22 . LEU B 1 31 ? 7.557   14.058  6.749   1.00 0.00 ? 31 LEU B HD22 5  
ATOM 6570  H HD23 . LEU B 1 31 ? 8.455   15.233  7.712   1.00 0.00 ? 31 LEU B HD23 5  
ATOM 6571  N N    . TRP B 1 32 ? 11.869  14.802  2.855   1.00 0.00 ? 32 TRP B N    5  
ATOM 6572  C CA   . TRP B 1 32 ? 13.269  15.198  2.980   1.00 0.00 ? 32 TRP B CA   5  
ATOM 6573  C C    . TRP B 1 32 ? 13.590  16.378  2.068   1.00 0.00 ? 32 TRP B C    5  
ATOM 6574  O O    . TRP B 1 32 ? 14.341  17.277  2.444   1.00 0.00 ? 32 TRP B O    5  
ATOM 6575  C CB   . TRP B 1 32 ? 14.184  14.017  2.651   1.00 0.00 ? 32 TRP B CB   5  
ATOM 6576  C CG   . TRP B 1 32 ? 15.644  14.367  2.650   1.00 0.00 ? 32 TRP B CG   5  
ATOM 6577  C CD1  . TRP B 1 32 ? 16.360  14.902  3.681   1.00 0.00 ? 32 TRP B CD1  5  
ATOM 6578  C CD2  . TRP B 1 32 ? 16.564  14.201  1.564   1.00 0.00 ? 32 TRP B CD2  5  
ATOM 6579  N NE1  . TRP B 1 32 ? 17.668  15.082  3.304   1.00 0.00 ? 32 TRP B NE1  5  
ATOM 6580  C CE2  . TRP B 1 32 ? 17.819  14.658  2.009   1.00 0.00 ? 32 TRP B CE2  5  
ATOM 6581  C CE3  . TRP B 1 32 ? 16.449  13.709  0.261   1.00 0.00 ? 32 TRP B CE3  5  
ATOM 6582  C CZ2  . TRP B 1 32 ? 18.948  14.637  1.196   1.00 0.00 ? 32 TRP B CZ2  5  
ATOM 6583  C CZ3  . TRP B 1 32 ? 17.571  13.689  -0.545  1.00 0.00 ? 32 TRP B CZ3  5  
ATOM 6584  C CH2  . TRP B 1 32 ? 18.807  14.151  -0.074  1.00 0.00 ? 32 TRP B CH2  5  
ATOM 6585  H H    . TRP B 1 32 ? 11.662  13.939  2.429   1.00 0.00 ? 32 TRP B H    5  
ATOM 6586  H HA   . TRP B 1 32 ? 13.447  15.496  4.006   1.00 0.00 ? 32 TRP B HA   5  
ATOM 6587  H HB2  . TRP B 1 32 ? 14.030  13.238  3.383   1.00 0.00 ? 32 TRP B HB2  5  
ATOM 6588  H HB3  . TRP B 1 32 ? 13.926  13.640  1.673   1.00 0.00 ? 32 TRP B HB3  5  
ATOM 6589  H HD1  . TRP B 1 32 ? 15.944  15.146  4.647   1.00 0.00 ? 32 TRP B HD1  5  
ATOM 6590  H HE1  . TRP B 1 32 ? 18.378  15.452  3.870   1.00 0.00 ? 32 TRP B HE1  5  
ATOM 6591  H HE3  . TRP B 1 32 ? 15.506  13.353  -0.115  1.00 0.00 ? 32 TRP B HE3  5  
ATOM 6592  H HZ2  . TRP B 1 32 ? 19.908  14.989  1.543   1.00 0.00 ? 32 TRP B HZ2  5  
ATOM 6593  H HZ3  . TRP B 1 32 ? 17.501  13.313  -1.555  1.00 0.00 ? 32 TRP B HZ3  5  
ATOM 6594  H HH2  . TRP B 1 32 ? 19.658  14.118  -0.738  1.00 0.00 ? 32 TRP B HH2  5  
ATOM 6595  N N    . GLN B 1 33 ? 13.019  16.370  0.869   1.00 0.00 ? 33 GLN B N    5  
ATOM 6596  C CA   . GLN B 1 33 ? 13.253  17.442  -0.093  1.00 0.00 ? 33 GLN B CA   5  
ATOM 6597  C C    . GLN B 1 33 ? 12.237  18.567  0.085   1.00 0.00 ? 33 GLN B C    5  
ATOM 6598  O O    . GLN B 1 33 ? 12.146  19.469  -0.746  1.00 0.00 ? 33 GLN B O    5  
ATOM 6599  C CB   . GLN B 1 33 ? 13.195  16.900  -1.522  1.00 0.00 ? 33 GLN B CB   5  
ATOM 6600  C CG   . GLN B 1 33 ? 14.205  15.796  -1.793  1.00 0.00 ? 33 GLN B CG   5  
ATOM 6601  C CD   . GLN B 1 33 ? 14.293  15.433  -3.263  1.00 0.00 ? 33 GLN B CD   5  
ATOM 6602  O OE1  . GLN B 1 33 ? 15.106  15.987  -4.004  1.00 0.00 ? 33 GLN B OE1  5  
ATOM 6603  N NE2  . GLN B 1 33 ? 13.454  14.498  -3.693  1.00 0.00 ? 33 GLN B NE2  5  
ATOM 6604  H H    . GLN B 1 33 ? 12.424  15.626  0.613   1.00 0.00 ? 33 GLN B H    5  
ATOM 6605  H HA   . GLN B 1 33 ? 14.244  17.850  0.074   1.00 0.00 ? 33 GLN B HA   5  
ATOM 6606  H HB2  . GLN B 1 33 ? 12.206  16.504  -1.709  1.00 0.00 ? 33 GLN B HB2  5  
ATOM 6607  H HB3  . GLN B 1 33 ? 13.386  17.714  -2.211  1.00 0.00 ? 33 GLN B HB3  5  
ATOM 6608  H HG2  . GLN B 1 33 ? 15.182  16.129  -1.468  1.00 0.00 ? 33 GLN B HG2  5  
ATOM 6609  H HG3  . GLN B 1 33 ? 13.923  14.919  -1.232  1.00 0.00 ? 33 GLN B HG3  5  
ATOM 6610  H HE21 . GLN B 1 33 ? 12.819  14.103  -3.064  1.00 0.00 ? 33 GLN B HE21 5  
ATOM 6611  H HE22 . GLN B 1 33 ? 13.506  14.238  -4.636  1.00 0.00 ? 33 GLN B HE22 5  
ATOM 6612  N N    . LYS B 1 34 ? 11.473  18.504  1.172   1.00 0.00 ? 34 LYS B N    5  
ATOM 6613  C CA   . LYS B 1 34 ? 10.469  19.524  1.457   1.00 0.00 ? 34 LYS B CA   5  
ATOM 6614  C C    . LYS B 1 34 ? 11.130  20.816  1.924   1.00 0.00 ? 34 LYS B C    5  
ATOM 6615  O O    . LYS B 1 34 ? 10.717  21.910  1.541   1.00 0.00 ? 34 LYS B O    5  
ATOM 6616  C CB   . LYS B 1 34 ? 9.486   19.026  2.519   1.00 0.00 ? 34 LYS B CB   5  
ATOM 6617  C CG   . LYS B 1 34 ? 8.446   20.061  2.923   1.00 0.00 ? 34 LYS B CG   5  
ATOM 6618  C CD   . LYS B 1 34 ? 7.561   20.455  1.749   1.00 0.00 ? 34 LYS B CD   5  
ATOM 6619  C CE   . LYS B 1 34 ? 6.586   21.557  2.128   1.00 0.00 ? 34 LYS B CE   5  
ATOM 6620  N NZ   . LYS B 1 34 ? 7.289   22.798  2.559   1.00 0.00 ? 34 LYS B NZ   5  
ATOM 6621  H H    . LYS B 1 34 ? 11.570  17.774  1.806   1.00 0.00 ? 34 LYS B H    5  
ATOM 6622  H HA   . LYS B 1 34 ? 9.925   19.722  0.543   1.00 0.00 ? 34 LYS B HA   5  
ATOM 6623  H HB2  . LYS B 1 34 ? 8.974   18.152  2.143   1.00 0.00 ? 34 LYS B HB2  5  
ATOM 6624  H HB3  . LYS B 1 34 ? 10.041  18.754  3.402   1.00 0.00 ? 34 LYS B HB3  5  
ATOM 6625  H HG2  . LYS B 1 34 ? 7.822   19.635  3.696   1.00 0.00 ? 34 LYS B HG2  5  
ATOM 6626  H HG3  . LYS B 1 34 ? 8.943   20.935  3.311   1.00 0.00 ? 34 LYS B HG3  5  
ATOM 6627  H HD2  . LYS B 1 34 ? 8.172   20.816  0.937   1.00 0.00 ? 34 LYS B HD2  5  
ATOM 6628  H HD3  . LYS B 1 34 ? 7.001   19.590  1.425   1.00 0.00 ? 34 LYS B HD3  5  
ATOM 6629  H HE2  . LYS B 1 34 ? 5.971   21.784  1.270   1.00 0.00 ? 34 LYS B HE2  5  
ATOM 6630  H HE3  . LYS B 1 34 ? 5.958   21.208  2.936   1.00 0.00 ? 34 LYS B HE3  5  
ATOM 6631  H HZ1  . LYS B 1 34 ? 7.708   22.666  3.501   1.00 0.00 ? 34 LYS B HZ1  5  
ATOM 6632  H HZ2  . LYS B 1 34 ? 6.613   23.587  2.606   1.00 0.00 ? 34 LYS B HZ2  5  
ATOM 6633  H HZ3  . LYS B 1 34 ? 8.044   23.049  1.885   1.00 0.00 ? 34 LYS B HZ3  5  
ATOM 6634  N N    . LYS B 1 35 ? 12.160  20.682  2.758   1.00 0.00 ? 35 LYS B N    5  
ATOM 6635  C CA   . LYS B 1 35 ? 12.879  21.840  3.276   1.00 0.00 ? 35 LYS B CA   5  
ATOM 6636  C C    . LYS B 1 35 ? 13.652  22.539  2.157   1.00 0.00 ? 35 LYS B C    5  
ATOM 6637  O O    . LYS B 1 35 ? 14.095  21.892  1.208   1.00 0.00 ? 35 LYS B O    5  
ATOM 6638  C CB   . LYS B 1 35 ? 13.838  21.416  4.392   1.00 0.00 ? 35 LYS B CB   5  
ATOM 6639  C CG   . LYS B 1 35 ? 13.137  20.939  5.654   1.00 0.00 ? 35 LYS B CG   5  
ATOM 6640  C CD   . LYS B 1 35 ? 12.373  22.067  6.331   1.00 0.00 ? 35 LYS B CD   5  
ATOM 6641  C CE   . LYS B 1 35 ? 11.803  21.631  7.671   1.00 0.00 ? 35 LYS B CE   5  
ATOM 6642  N NZ   . LYS B 1 35 ? 10.870  20.478  7.532   1.00 0.00 ? 35 LYS B NZ   5  
ATOM 6643  H H    . LYS B 1 35 ? 12.447  19.780  3.036   1.00 0.00 ? 35 LYS B H    5  
ATOM 6644  H HA   . LYS B 1 35 ? 12.144  22.521  3.675   1.00 0.00 ? 35 LYS B HA   5  
ATOM 6645  H HB2  . LYS B 1 35 ? 14.455  20.608  4.027   1.00 0.00 ? 35 LYS B HB2  5  
ATOM 6646  H HB3  . LYS B 1 35 ? 14.478  22.251  4.655   1.00 0.00 ? 35 LYS B HB3  5  
ATOM 6647  H HG2  . LYS B 1 35 ? 12.444  20.151  5.396   1.00 0.00 ? 35 LYS B HG2  5  
ATOM 6648  H HG3  . LYS B 1 35 ? 13.883  20.555  6.337   1.00 0.00 ? 35 LYS B HG3  5  
ATOM 6649  H HD2  . LYS B 1 35 ? 13.039  22.902  6.496   1.00 0.00 ? 35 LYS B HD2  5  
ATOM 6650  H HD3  . LYS B 1 35 ? 11.559  22.374  5.693   1.00 0.00 ? 35 LYS B HD3  5  
ATOM 6651  H HE2  . LYS B 1 35 ? 12.617  21.348  8.323   1.00 0.00 ? 35 LYS B HE2  5  
ATOM 6652  H HE3  . LYS B 1 35 ? 11.269  22.463  8.107   1.00 0.00 ? 35 LYS B HE3  5  
ATOM 6653  H HZ1  . LYS B 1 35 ? 11.393  19.619  7.266   1.00 0.00 ? 35 LYS B HZ1  5  
ATOM 6654  H HZ2  . LYS B 1 35 ? 10.150  20.673  6.805   1.00 0.00 ? 35 LYS B HZ2  5  
ATOM 6655  H HZ3  . LYS B 1 35 ? 10.387  20.305  8.437   1.00 0.00 ? 35 LYS B HZ3  5  
ATOM 6656  N N    . PRO B 1 36 ? 13.827  23.870  2.255   1.00 0.00 ? 36 PRO B N    5  
ATOM 6657  C CA   . PRO B 1 36 ? 14.547  24.645  1.241   1.00 0.00 ? 36 PRO B CA   5  
ATOM 6658  C C    . PRO B 1 36 ? 16.052  24.414  1.291   1.00 0.00 ? 36 PRO B C    5  
ATOM 6659  O O    . PRO B 1 36 ? 16.627  24.236  2.364   1.00 0.00 ? 36 PRO B O    5  
ATOM 6660  C CB   . PRO B 1 36 ? 14.215  26.093  1.605   1.00 0.00 ? 36 PRO B CB   5  
ATOM 6661  C CG   . PRO B 1 36 ? 13.963  26.063  3.072   1.00 0.00 ? 36 PRO B CG   5  
ATOM 6662  C CD   . PRO B 1 36 ? 13.340  24.724  3.359   1.00 0.00 ? 36 PRO B CD   5  
ATOM 6663  H HA   . PRO B 1 36 ? 14.177  24.431  0.246   1.00 0.00 ? 36 PRO B HA   5  
ATOM 6664  H HB2  . PRO B 1 36 ? 15.038  26.752  1.355   1.00 0.00 ? 36 PRO B HB2  5  
ATOM 6665  H HB3  . PRO B 1 36 ? 13.331  26.402  1.067   1.00 0.00 ? 36 PRO B HB3  5  
ATOM 6666  H HG2  . PRO B 1 36 ? 14.896  26.165  3.607   1.00 0.00 ? 36 PRO B HG2  5  
ATOM 6667  H HG3  . PRO B 1 36 ? 13.284  26.858  3.344   1.00 0.00 ? 36 PRO B HG3  5  
ATOM 6668  H HD2  . PRO B 1 36 ? 13.678  24.348  4.314   1.00 0.00 ? 36 PRO B HD2  5  
ATOM 6669  H HD3  . PRO B 1 36 ? 12.263  24.798  3.341   1.00 0.00 ? 36 PRO B HD3  5  
ATOM 6670  N N    . ARG B 1 37 ? 16.684  24.419  0.122   1.00 0.00 ? 37 ARG B N    5  
ATOM 6671  C CA   . ARG B 1 37 ? 18.123  24.210  0.027   1.00 0.00 ? 37 ARG B CA   5  
ATOM 6672  C C    . ARG B 1 37 ? 18.865  25.542  0.077   1.00 0.00 ? 37 ARG B C    5  
ATOM 6673  O O    . ARG B 1 37 ? 18.474  26.504  -0.585  1.00 0.00 ? 37 ARG B O    5  
ATOM 6674  C CB   . ARG B 1 37 ? 18.469  23.469  -1.267  1.00 0.00 ? 37 ARG B CB   5  
ATOM 6675  C CG   . ARG B 1 37 ? 19.942  23.117  -1.392  1.00 0.00 ? 37 ARG B CG   5  
ATOM 6676  C CD   . ARG B 1 37 ? 20.241  22.445  -2.720  1.00 0.00 ? 37 ARG B CD   5  
ATOM 6677  N NE   . ARG B 1 37 ? 19.464  21.221  -2.901  1.00 0.00 ? 37 ARG B NE   5  
ATOM 6678  C CZ   . ARG B 1 37 ? 19.679  20.347  -3.879  1.00 0.00 ? 37 ARG B CZ   5  
ATOM 6679  N NH1  . ARG B 1 37 ? 20.644  20.559  -4.764  1.00 0.00 ? 37 ARG B NH1  5  
ATOM 6680  N NH2  . ARG B 1 37 ? 18.928  19.258  -3.972  1.00 0.00 ? 37 ARG B NH2  5  
ATOM 6681  H H    . ARG B 1 37 ? 16.169  24.572  -0.706  1.00 0.00 ? 37 ARG B H    5  
ATOM 6682  H HA   . ARG B 1 37 ? 18.439  23.596  0.865   1.00 0.00 ? 37 ARG B HA   5  
ATOM 6683  H HB2  . ARG B 1 37 ? 17.892  22.559  -1.295  1.00 0.00 ? 37 ARG B HB2  5  
ATOM 6684  H HB3  . ARG B 1 37 ? 18.188  24.087  -2.111  1.00 0.00 ? 37 ARG B HB3  5  
ATOM 6685  H HG2  . ARG B 1 37 ? 20.535  24.016  -1.323  1.00 0.00 ? 37 ARG B HG2  5  
ATOM 6686  H HG3  . ARG B 1 37 ? 20.210  22.444  -0.591  1.00 0.00 ? 37 ARG B HG3  5  
ATOM 6687  H HD2  . ARG B 1 37 ? 20.009  23.132  -3.522  1.00 0.00 ? 37 ARG B HD2  5  
ATOM 6688  H HD3  . ARG B 1 37 ? 21.295  22.204  -2.746  1.00 0.00 ? 37 ARG B HD3  5  
ATOM 6689  H HE   . ARG B 1 37 ? 18.747  21.023  -2.261  1.00 0.00 ? 37 ARG B HE   5  
ATOM 6690  H HH11 . ARG B 1 37 ? 21.224  21.370  -4.719  1.00 0.00 ? 37 ARG B HH11 5  
ATOM 6691  H HH12 . ARG B 1 37 ? 20.799  19.892  -5.496  1.00 0.00 ? 37 ARG B HH12 5  
ATOM 6692  H HH21 . ARG B 1 37 ? 18.198  19.091  -3.306  1.00 0.00 ? 37 ARG B HH21 5  
ATOM 6693  H HH22 . ARG B 1 37 ? 19.087  18.597  -4.708  1.00 0.00 ? 37 ARG B HH22 5  
ATOM 6694  N N    . TYR B 1 38 ? 19.933  25.593  0.864   1.00 0.00 ? 38 TYR B N    5  
ATOM 6695  C CA   . TYR B 1 38 ? 20.725  26.810  0.997   1.00 0.00 ? 38 TYR B CA   5  
ATOM 6696  C C    . TYR B 1 38 ? 22.177  26.485  1.333   1.00 0.00 ? 38 TYR B C    5  
ATOM 6697  O O    . TYR B 1 38 ? 22.457  25.548  2.082   1.00 0.00 ? 38 TYR B O    5  
ATOM 6698  C CB   . TYR B 1 38 ? 20.129  27.715  2.077   1.00 0.00 ? 38 TYR B CB   5  
ATOM 6699  C CG   . TYR B 1 38 ? 20.831  29.049  2.204   1.00 0.00 ? 38 TYR B CG   5  
ATOM 6700  C CD1  . TYR B 1 38 ? 20.603  30.066  1.284   1.00 0.00 ? 38 TYR B CD1  5  
ATOM 6701  C CD2  . TYR B 1 38 ? 21.723  29.290  3.240   1.00 0.00 ? 38 TYR B CD2  5  
ATOM 6702  C CE1  . TYR B 1 38 ? 21.244  31.285  1.395   1.00 0.00 ? 38 TYR B CE1  5  
ATOM 6703  C CE2  . TYR B 1 38 ? 22.367  30.507  3.359   1.00 0.00 ? 38 TYR B CE2  5  
ATOM 6704  C CZ   . TYR B 1 38 ? 22.124  31.501  2.434   1.00 0.00 ? 38 TYR B CZ   5  
ATOM 6705  O OH   . TYR B 1 38 ? 22.764  32.713  2.548   1.00 0.00 ? 38 TYR B OH   5  
ATOM 6706  H H    . TYR B 1 38 ? 20.198  24.792  1.376   1.00 0.00 ? 38 TYR B H    5  
ATOM 6707  H HA   . TYR B 1 38 ? 20.702  27.339  0.049   1.00 0.00 ? 38 TYR B HA   5  
ATOM 6708  H HB2  . TYR B 1 38 ? 19.091  27.905  1.836   1.00 0.00 ? 38 TYR B HB2  5  
ATOM 6709  H HB3  . TYR B 1 38 ? 20.175  27.206  3.033   1.00 0.00 ? 38 TYR B HB3  5  
ATOM 6710  H HD1  . TYR B 1 38 ? 19.912  29.898  0.469   1.00 0.00 ? 38 TYR B HD1  5  
ATOM 6711  H HD2  . TYR B 1 38 ? 21.914  28.511  3.966   1.00 0.00 ? 38 TYR B HD2  5  
ATOM 6712  H HE1  . TYR B 1 38 ? 21.053  32.063  0.671   1.00 0.00 ? 38 TYR B HE1  5  
ATOM 6713  H HE2  . TYR B 1 38 ? 23.058  30.675  4.172   1.00 0.00 ? 38 TYR B HE2  5  
ATOM 6714  H HH   . TYR B 1 38 ? 23.555  32.710  2.004   1.00 0.00 ? 38 TYR B HH   5  
ATOM 6715  N N    . GLU B 1 39 ? 23.096  27.267  0.775   1.00 0.00 ? 39 GLU B N    5  
ATOM 6716  C CA   . GLU B 1 39 ? 24.520  27.067  1.015   1.00 0.00 ? 39 GLU B CA   5  
ATOM 6717  C C    . GLU B 1 39 ? 24.987  27.881  2.218   1.00 0.00 ? 39 GLU B C    5  
ATOM 6718  O O    . GLU B 1 39 ? 24.795  29.116  2.212   1.00 0.00 ? 39 GLU B O    5  
ATOM 6719  C CB   . GLU B 1 39 ? 25.325  27.454  -0.227  1.00 0.00 ? 39 GLU B CB   5  
ATOM 6720  C CG   . GLU B 1 39 ? 26.825  27.265  -0.064  1.00 0.00 ? 39 GLU B CG   5  
ATOM 6721  C CD   . GLU B 1 39 ? 27.203  25.827  0.234   1.00 0.00 ? 39 GLU B CD   5  
ATOM 6722  O OE1  . GLU B 1 39 ? 27.378  25.049  -0.726  1.00 0.00 ? 39 GLU B OE1  5  
ATOM 6723  O OE2  . GLU B 1 39 ? 27.325  25.480  1.427   1.00 0.00 ? 39 GLU B OE2  5  
ATOM 6724  O OXT  . GLU B 1 39 ? 25.543  27.277  3.161   1.00 0.00 ? 39 GLU B OXT  5  
ATOM 6725  H H    . GLU B 1 39 ? 22.810  28.007  0.187   1.00 0.00 ? 39 GLU B H    5  
ATOM 6726  H HA   . GLU B 1 39 ? 24.691  26.017  1.221   1.00 0.00 ? 39 GLU B HA   5  
ATOM 6727  H HB2  . GLU B 1 39 ? 24.994  26.848  -1.058  1.00 0.00 ? 39 GLU B HB2  5  
ATOM 6728  H HB3  . GLU B 1 39 ? 25.138  28.493  -0.457  1.00 0.00 ? 39 GLU B HB3  5  
ATOM 6729  H HG2  . GLU B 1 39 ? 27.308  27.558  -0.985  1.00 0.00 ? 39 GLU B HG2  5  
ATOM 6730  H HG3  . GLU B 1 39 ? 27.183  27.893  0.738   1.00 0.00 ? 39 GLU B HG3  5  
ATOM 6731  N N    . GLY A 1 1  ? 13.942  -22.080 1.612   1.00 0.00 ? 1  GLY A N    6  
ATOM 6732  C CA   . GLY A 1 1  ? 13.097  -22.996 0.797   1.00 0.00 ? 1  GLY A CA   6  
ATOM 6733  C C    . GLY A 1 1  ? 11.683  -23.112 1.332   1.00 0.00 ? 1  GLY A C    6  
ATOM 6734  O O    . GLY A 1 1  ? 11.172  -22.183 1.959   1.00 0.00 ? 1  GLY A O    6  
ATOM 6735  H H1   . GLY A 1 1  ? 14.008  -22.426 2.592   1.00 0.00 ? 1  GLY A H1   6  
ATOM 6736  H H2   . GLY A 1 1  ? 13.534  -21.122 1.620   1.00 0.00 ? 1  GLY A H2   6  
ATOM 6737  H H3   . GLY A 1 1  ? 14.900  -22.030 1.210   1.00 0.00 ? 1  GLY A H3   6  
ATOM 6738  H HA2  . GLY A 1 1  ? 13.057  -22.623 -0.216  1.00 0.00 ? 1  GLY A HA2  6  
ATOM 6739  H HA3  . GLY A 1 1  ? 13.555  -23.975 0.790   1.00 0.00 ? 1  GLY A HA3  6  
ATOM 6740  N N    . HIS A 1 2  ? 11.053  -24.256 1.087   1.00 0.00 ? 2  HIS A N    6  
ATOM 6741  C CA   . HIS A 1 2  ? 9.688   -24.494 1.544   1.00 0.00 ? 2  HIS A CA   6  
ATOM 6742  C C    . HIS A 1 2  ? 9.666   -25.482 2.706   1.00 0.00 ? 2  HIS A C    6  
ATOM 6743  O O    . HIS A 1 2  ? 10.037  -26.646 2.551   1.00 0.00 ? 2  HIS A O    6  
ATOM 6744  C CB   . HIS A 1 2  ? 8.832   -25.023 0.395   1.00 0.00 ? 2  HIS A CB   6  
ATOM 6745  C CG   . HIS A 1 2  ? 8.742   -24.081 -0.765  1.00 0.00 ? 2  HIS A CG   6  
ATOM 6746  N ND1  . HIS A 1 2  ? 9.606   -24.125 -1.840  1.00 0.00 ? 2  HIS A ND1  6  
ATOM 6747  C CD2  . HIS A 1 2  ? 7.882   -23.067 -1.019  1.00 0.00 ? 2  HIS A CD2  6  
ATOM 6748  C CE1  . HIS A 1 2  ? 9.283   -23.180 -2.702  1.00 0.00 ? 2  HIS A CE1  6  
ATOM 6749  N NE2  . HIS A 1 2  ? 8.239   -22.524 -2.229  1.00 0.00 ? 2  HIS A NE2  6  
ATOM 6750  H H    . HIS A 1 2  ? 11.514  -24.968 0.584   1.00 0.00 ? 2  HIS A H    6  
ATOM 6751  H HA   . HIS A 1 2  ? 9.258   -23.554 1.876   1.00 0.00 ? 2  HIS A HA   6  
ATOM 6752  H HB2  . HIS A 1 2  ? 9.254   -25.950 0.034   1.00 0.00 ? 2  HIS A HB2  6  
ATOM 6753  H HB3  . HIS A 1 2  ? 7.826   -25.205 0.751   1.00 0.00 ? 2  HIS A HB3  6  
ATOM 6754  H HD1  . HIS A 1 2  ? 10.347  -24.756 -1.953  1.00 0.00 ? 2  HIS A HD1  6  
ATOM 6755  H HD2  . HIS A 1 2  ? 7.066   -22.745 -0.387  1.00 0.00 ? 2  HIS A HD2  6  
ATOM 6756  H HE1  . HIS A 1 2  ? 9.786   -22.978 -3.636  1.00 0.00 ? 2  HIS A HE1  6  
ATOM 6757  H HE2  . HIS A 1 2  ? 7.852   -21.717 -2.627  1.00 0.00 ? 2  HIS A HE2  6  
ATOM 6758  N N    . SER A 1 3  ? 9.230   -25.011 3.871   1.00 0.00 ? 3  SER A N    6  
ATOM 6759  C CA   . SER A 1 3  ? 9.160   -25.855 5.059   1.00 0.00 ? 3  SER A CA   6  
ATOM 6760  C C    . SER A 1 3  ? 7.946   -25.500 5.914   1.00 0.00 ? 3  SER A C    6  
ATOM 6761  O O    . SER A 1 3  ? 7.584   -26.241 6.829   1.00 0.00 ? 3  SER A O    6  
ATOM 6762  C CB   . SER A 1 3  ? 10.437  -25.713 5.889   1.00 0.00 ? 3  SER A CB   6  
ATOM 6763  O OG   . SER A 1 3  ? 11.575  -26.113 5.146   1.00 0.00 ? 3  SER A OG   6  
ATOM 6764  H H    . SER A 1 3  ? 8.974   -24.067 3.929   1.00 0.00 ? 3  SER A H    6  
ATOM 6765  H HA   . SER A 1 3  ? 9.060   -26.889 4.752   1.00 0.00 ? 3  SER A HA   6  
ATOM 6766  H HB2  . SER A 1 3  ? 10.563  -24.681 6.183   1.00 0.00 ? 3  SER A HB2  6  
ATOM 6767  H HB3  . SER A 1 3  ? 10.368  -26.334 6.773   1.00 0.00 ? 3  SER A HB3  6  
ATOM 6768  H HG   . SER A 1 3  ? 12.332  -26.183 5.732   1.00 0.00 ? 3  SER A HG   6  
ATOM 6769  N N    . LEU A 1 4  ? 7.323   -24.366 5.611   1.00 0.00 ? 4  LEU A N    6  
ATOM 6770  C CA   . LEU A 1 4  ? 6.152   -23.914 6.357   1.00 0.00 ? 4  LEU A CA   6  
ATOM 6771  C C    . LEU A 1 4  ? 4.872   -24.118 5.546   1.00 0.00 ? 4  LEU A C    6  
ATOM 6772  O O    . LEU A 1 4  ? 4.898   -24.077 4.316   1.00 0.00 ? 4  LEU A O    6  
ATOM 6773  C CB   . LEU A 1 4  ? 6.298   -22.438 6.737   1.00 0.00 ? 4  LEU A CB   6  
ATOM 6774  C CG   . LEU A 1 4  ? 7.344   -22.141 7.816   1.00 0.00 ? 4  LEU A CG   6  
ATOM 6775  C CD1  . LEU A 1 4  ? 8.752   -22.289 7.259   1.00 0.00 ? 4  LEU A CD1  6  
ATOM 6776  C CD2  . LEU A 1 4  ? 7.138   -20.745 8.383   1.00 0.00 ? 4  LEU A CD2  6  
ATOM 6777  H H    . LEU A 1 4  ? 7.633   -23.802 4.880   1.00 0.00 ? 4  LEU A H    6  
ATOM 6778  H HA   . LEU A 1 4  ? 6.086   -24.494 7.269   1.00 0.00 ? 4  LEU A HA   6  
ATOM 6779  H HB2  . LEU A 1 4  ? 6.548   -21.881 5.843   1.00 0.00 ? 4  LEU A HB2  6  
ATOM 6780  H HB3  . LEU A 1 4  ? 5.336   -22.086 7.095   1.00 0.00 ? 4  LEU A HB3  6  
ATOM 6781  H HG   . LEU A 1 4  ? 7.231   -22.848 8.626   1.00 0.00 ? 4  LEU A HG   6  
ATOM 6782  H HD11 . LEU A 1 4  ? 8.821   -21.816 6.288   1.00 0.00 ? 4  LEU A HD11 6  
ATOM 6783  H HD12 . LEU A 1 4  ? 8.995   -23.333 7.168   1.00 0.00 ? 4  LEU A HD12 6  
ATOM 6784  H HD13 . LEU A 1 4  ? 9.465   -21.826 7.930   1.00 0.00 ? 4  LEU A HD13 6  
ATOM 6785  H HD21 . LEU A 1 4  ? 6.143   -20.666 8.800   1.00 0.00 ? 4  LEU A HD21 6  
ATOM 6786  H HD22 . LEU A 1 4  ? 7.257   -20.010 7.598   1.00 0.00 ? 4  LEU A HD22 6  
ATOM 6787  H HD23 . LEU A 1 4  ? 7.865   -20.559 9.162   1.00 0.00 ? 4  LEU A HD23 6  
ATOM 6788  N N    . PRO A 1 5  ? 3.730   -24.339 6.227   1.00 0.00 ? 5  PRO A N    6  
ATOM 6789  C CA   . PRO A 1 5  ? 2.440   -24.546 5.560   1.00 0.00 ? 5  PRO A CA   6  
ATOM 6790  C C    . PRO A 1 5  ? 1.971   -23.303 4.813   1.00 0.00 ? 5  PRO A C    6  
ATOM 6791  O O    . PRO A 1 5  ? 2.499   -22.209 5.015   1.00 0.00 ? 5  PRO A O    6  
ATOM 6792  C CB   . PRO A 1 5  ? 1.482   -24.869 6.710   1.00 0.00 ? 5  PRO A CB   6  
ATOM 6793  C CG   . PRO A 1 5  ? 2.123   -24.281 7.919   1.00 0.00 ? 5  PRO A CG   6  
ATOM 6794  C CD   . PRO A 1 5  ? 3.603   -24.402 7.697   1.00 0.00 ? 5  PRO A CD   6  
ATOM 6795  H HA   . PRO A 1 5  ? 2.480   -25.382 4.876   1.00 0.00 ? 5  PRO A HA   6  
ATOM 6796  H HB2  . PRO A 1 5  ? 0.504   -24.441 6.532   1.00 0.00 ? 5  PRO A HB2  6  
ATOM 6797  H HB3  . PRO A 1 5  ? 1.391   -25.941 6.805   1.00 0.00 ? 5  PRO A HB3  6  
ATOM 6798  H HG2  . PRO A 1 5  ? 1.841   -23.243 8.017   1.00 0.00 ? 5  PRO A HG2  6  
ATOM 6799  H HG3  . PRO A 1 5  ? 1.829   -24.835 8.798   1.00 0.00 ? 5  PRO A HG3  6  
ATOM 6800  H HD2  . PRO A 1 5  ? 4.120   -23.580 8.169   1.00 0.00 ? 5  PRO A HD2  6  
ATOM 6801  H HD3  . PRO A 1 5  ? 3.966   -25.346 8.075   1.00 0.00 ? 5  PRO A HD3  6  
ATOM 6802  N N    . PHE A 1 6  ? 0.976   -23.478 3.950   1.00 0.00 ? 6  PHE A N    6  
ATOM 6803  C CA   . PHE A 1 6  ? 0.435   -22.371 3.169   1.00 0.00 ? 6  PHE A CA   6  
ATOM 6804  C C    . PHE A 1 6  ? -0.360  -21.416 4.053   1.00 0.00 ? 6  PHE A C    6  
ATOM 6805  O O    . PHE A 1 6  ? -0.627  -20.279 3.669   1.00 0.00 ? 6  PHE A O    6  
ATOM 6806  C CB   . PHE A 1 6  ? -0.455  -22.898 2.040   1.00 0.00 ? 6  PHE A CB   6  
ATOM 6807  C CG   . PHE A 1 6  ? -1.677  -23.628 2.523   1.00 0.00 ? 6  PHE A CG   6  
ATOM 6808  C CD1  . PHE A 1 6  ? -1.608  -24.968 2.869   1.00 0.00 ? 6  PHE A CD1  6  
ATOM 6809  C CD2  . PHE A 1 6  ? -2.895  -22.975 2.631   1.00 0.00 ? 6  PHE A CD2  6  
ATOM 6810  C CE1  . PHE A 1 6  ? -2.730  -25.644 3.312   1.00 0.00 ? 6  PHE A CE1  6  
ATOM 6811  C CE2  . PHE A 1 6  ? -4.021  -23.645 3.072   1.00 0.00 ? 6  PHE A CE2  6  
ATOM 6812  C CZ   . PHE A 1 6  ? -3.937  -24.980 3.414   1.00 0.00 ? 6  PHE A CZ   6  
ATOM 6813  H H    . PHE A 1 6  ? 0.612   -24.373 3.842   1.00 0.00 ? 6  PHE A H    6  
ATOM 6814  H HA   . PHE A 1 6  ? 1.263   -21.828 2.730   1.00 0.00 ? 6  PHE A HA   6  
ATOM 6815  H HB2  . PHE A 1 6  ? -0.771  -22.065 1.423   1.00 0.00 ? 6  PHE A HB2  6  
ATOM 6816  H HB3  . PHE A 1 6  ? 0.127   -23.577 1.429   1.00 0.00 ? 6  PHE A HB3  6  
ATOM 6817  H HD1  . PHE A 1 6  ? -0.671  -25.498 2.783   1.00 0.00 ? 6  PHE A HD1  6  
ATOM 6818  H HD2  . PHE A 1 6  ? -2.966  -21.929 2.364   1.00 0.00 ? 6  PHE A HD2  6  
ATOM 6819  H HE1  . PHE A 1 6  ? -2.663  -26.689 3.578   1.00 0.00 ? 6  PHE A HE1  6  
ATOM 6820  H HE2  . PHE A 1 6  ? -4.964  -23.125 3.151   1.00 0.00 ? 6  PHE A HE2  6  
ATOM 6821  H HZ   . PHE A 1 6  ? -4.815  -25.505 3.760   1.00 0.00 ? 6  PHE A HZ   6  
ATOM 6822  N N    . LYS A 1 7  ? -0.738  -21.888 5.235   1.00 0.00 ? 7  LYS A N    6  
ATOM 6823  C CA   . LYS A 1 7  ? -1.512  -21.078 6.171   1.00 0.00 ? 7  LYS A CA   6  
ATOM 6824  C C    . LYS A 1 7  ? -0.765  -19.802 6.546   1.00 0.00 ? 7  LYS A C    6  
ATOM 6825  O O    . LYS A 1 7  ? -1.332  -18.710 6.518   1.00 0.00 ? 7  LYS A O    6  
ATOM 6826  C CB   . LYS A 1 7  ? -1.834  -21.891 7.427   1.00 0.00 ? 7  LYS A CB   6  
ATOM 6827  C CG   . LYS A 1 7  ? -2.521  -23.214 7.129   1.00 0.00 ? 7  LYS A CG   6  
ATOM 6828  C CD   . LYS A 1 7  ? -3.001  -23.897 8.399   1.00 0.00 ? 7  LYS A CD   6  
ATOM 6829  C CE   . LYS A 1 7  ? -4.174  -23.157 9.023   1.00 0.00 ? 7  LYS A CE   6  
ATOM 6830  N NZ   . LYS A 1 7  ? -4.614  -23.792 10.297  1.00 0.00 ? 7  LYS A NZ   6  
ATOM 6831  H H    . LYS A 1 7  ? -0.505  -22.800 5.488   1.00 0.00 ? 7  LYS A H    6  
ATOM 6832  H HA   . LYS A 1 7  ? -2.441  -20.805 5.688   1.00 0.00 ? 7  LYS A HA   6  
ATOM 6833  H HB2  . LYS A 1 7  ? -0.913  -22.102 7.957   1.00 0.00 ? 7  LYS A HB2  6  
ATOM 6834  H HB3  . LYS A 1 7  ? -2.474  -21.295 8.057   1.00 0.00 ? 7  LYS A HB3  6  
ATOM 6835  H HG2  . LYS A 1 7  ? -3.368  -23.040 6.478   1.00 0.00 ? 7  LYS A HG2  6  
ATOM 6836  H HG3  . LYS A 1 7  ? -1.821  -23.869 6.634   1.00 0.00 ? 7  LYS A HG3  6  
ATOM 6837  H HD2  . LYS A 1 7  ? -3.316  -24.900 8.154   1.00 0.00 ? 7  LYS A HD2  6  
ATOM 6838  H HD3  . LYS A 1 7  ? -2.190  -23.941 9.114   1.00 0.00 ? 7  LYS A HD3  6  
ATOM 6839  H HE2  . LYS A 1 7  ? -3.888  -22.139 9.234   1.00 0.00 ? 7  LYS A HE2  6  
ATOM 6840  H HE3  . LYS A 1 7  ? -5.001  -23.162 8.327   1.00 0.00 ? 7  LYS A HE3  6  
ATOM 6841  H HZ1  . LYS A 1 7  ? -3.836  -23.792 10.989  1.00 0.00 ? 7  LYS A HZ1  6  
ATOM 6842  H HZ2  . LYS A 1 7  ? -4.914  -24.775 10.128  1.00 0.00 ? 7  LYS A HZ2  6  
ATOM 6843  H HZ3  . LYS A 1 7  ? -5.416  -23.264 10.697  1.00 0.00 ? 7  LYS A HZ3  6  
ATOM 6844  N N    . VAL A 1 8  ? 0.509   -19.946 6.894   1.00 0.00 ? 8  VAL A N    6  
ATOM 6845  C CA   . VAL A 1 8  ? 1.333   -18.804 7.275   1.00 0.00 ? 8  VAL A CA   6  
ATOM 6846  C C    . VAL A 1 8  ? 1.613   -17.903 6.074   1.00 0.00 ? 8  VAL A C    6  
ATOM 6847  O O    . VAL A 1 8  ? 1.674   -16.680 6.203   1.00 0.00 ? 8  VAL A O    6  
ATOM 6848  C CB   . VAL A 1 8  ? 2.672   -19.258 7.884   1.00 0.00 ? 8  VAL A CB   6  
ATOM 6849  C CG1  . VAL A 1 8  ? 3.492   -18.061 8.343   1.00 0.00 ? 8  VAL A CG1  6  
ATOM 6850  C CG2  . VAL A 1 8  ? 2.434   -20.222 9.036   1.00 0.00 ? 8  VAL A CG2  6  
ATOM 6851  H H    . VAL A 1 8  ? 0.908   -20.847 6.886   1.00 0.00 ? 8  VAL A H    6  
ATOM 6852  H HA   . VAL A 1 8  ? 0.796   -18.232 8.024   1.00 0.00 ? 8  VAL A HA   6  
ATOM 6853  H HB   . VAL A 1 8  ? 3.237   -19.781 7.124   1.00 0.00 ? 8  VAL A HB   6  
ATOM 6854  H HG11 . VAL A 1 8  ? 3.793   -17.472 7.491   1.00 0.00 ? 8  VAL A HG11 6  
ATOM 6855  H HG12 . VAL A 1 8  ? 4.379   -18.404 8.860   1.00 0.00 ? 8  VAL A HG12 6  
ATOM 6856  H HG13 . VAL A 1 8  ? 2.903   -17.450 9.014   1.00 0.00 ? 8  VAL A HG13 6  
ATOM 6857  H HG21 . VAL A 1 8  ? 3.381   -20.502 9.476   1.00 0.00 ? 8  VAL A HG21 6  
ATOM 6858  H HG22 . VAL A 1 8  ? 1.939   -21.110 8.678   1.00 0.00 ? 8  VAL A HG22 6  
ATOM 6859  H HG23 . VAL A 1 8  ? 1.820   -19.746 9.788   1.00 0.00 ? 8  VAL A HG23 6  
ATOM 6860  N N    . VAL A 1 9  ? 1.780   -18.519 4.908   1.00 0.00 ? 9  VAL A N    6  
ATOM 6861  C CA   . VAL A 1 9  ? 2.062   -17.779 3.682   1.00 0.00 ? 9  VAL A CA   6  
ATOM 6862  C C    . VAL A 1 9  ? 0.899   -16.867 3.296   1.00 0.00 ? 9  VAL A C    6  
ATOM 6863  O O    . VAL A 1 9  ? 1.095   -15.685 3.019   1.00 0.00 ? 9  VAL A O    6  
ATOM 6864  C CB   . VAL A 1 9  ? 2.361   -18.734 2.510   1.00 0.00 ? 9  VAL A CB   6  
ATOM 6865  C CG1  . VAL A 1 9  ? 2.899   -17.963 1.315   1.00 0.00 ? 9  VAL A CG1  6  
ATOM 6866  C CG2  . VAL A 1 9  ? 3.338   -19.818 2.937   1.00 0.00 ? 9  VAL A CG2  6  
ATOM 6867  H H    . VAL A 1 9  ? 1.706   -19.496 4.874   1.00 0.00 ? 9  VAL A H    6  
ATOM 6868  H HA   . VAL A 1 9  ? 2.941   -17.169 3.857   1.00 0.00 ? 9  VAL A HA   6  
ATOM 6869  H HB   . VAL A 1 9  ? 1.439   -19.218 2.210   1.00 0.00 ? 9  VAL A HB   6  
ATOM 6870  H HG11 . VAL A 1 9  ? 2.159   -17.258 0.968   1.00 0.00 ? 9  VAL A HG11 6  
ATOM 6871  H HG12 . VAL A 1 9  ? 3.132   -18.652 0.514   1.00 0.00 ? 9  VAL A HG12 6  
ATOM 6872  H HG13 . VAL A 1 9  ? 3.796   -17.431 1.599   1.00 0.00 ? 9  VAL A HG13 6  
ATOM 6873  H HG21 . VAL A 1 9  ? 4.193   -19.373 3.430   1.00 0.00 ? 9  VAL A HG21 6  
ATOM 6874  H HG22 . VAL A 1 9  ? 3.675   -20.371 2.069   1.00 0.00 ? 9  VAL A HG22 6  
ATOM 6875  H HG23 . VAL A 1 9  ? 2.852   -20.493 3.605   1.00 0.00 ? 9  VAL A HG23 6  
ATOM 6876  N N    . VAL A 1 10 ? -0.310  -17.423 3.277   1.00 0.00 ? 10 VAL A N    6  
ATOM 6877  C CA   . VAL A 1 10 ? -1.501  -16.659 2.918   1.00 0.00 ? 10 VAL A CA   6  
ATOM 6878  C C    . VAL A 1 10 ? -1.730  -15.499 3.882   1.00 0.00 ? 10 VAL A C    6  
ATOM 6879  O O    . VAL A 1 10 ? -1.846  -14.348 3.463   1.00 0.00 ? 10 VAL A O    6  
ATOM 6880  C CB   . VAL A 1 10 ? -2.761  -17.549 2.897   1.00 0.00 ? 10 VAL A CB   6  
ATOM 6881  C CG1  . VAL A 1 10 ? -3.999  -16.718 2.592   1.00 0.00 ? 10 VAL A CG1  6  
ATOM 6882  C CG2  . VAL A 1 10 ? -2.607  -18.670 1.882   1.00 0.00 ? 10 VAL A CG2  6  
ATOM 6883  H H    . VAL A 1 10 ? -0.402  -18.376 3.512   1.00 0.00 ? 10 VAL A H    6  
ATOM 6884  H HA   . VAL A 1 10 ? -1.355  -16.256 1.923   1.00 0.00 ? 10 VAL A HA   6  
ATOM 6885  H HB   . VAL A 1 10 ? -2.884  -17.993 3.875   1.00 0.00 ? 10 VAL A HB   6  
ATOM 6886  H HG11 . VAL A 1 10 ? -3.821  -16.094 1.726   1.00 0.00 ? 10 VAL A HG11 6  
ATOM 6887  H HG12 . VAL A 1 10 ? -4.242  -16.096 3.440   1.00 0.00 ? 10 VAL A HG12 6  
ATOM 6888  H HG13 . VAL A 1 10 ? -4.838  -17.372 2.391   1.00 0.00 ? 10 VAL A HG13 6  
ATOM 6889  H HG21 . VAL A 1 10 ? -3.419  -19.371 2.000   1.00 0.00 ? 10 VAL A HG21 6  
ATOM 6890  H HG22 . VAL A 1 10 ? -1.675  -19.183 2.020   1.00 0.00 ? 10 VAL A HG22 6  
ATOM 6891  H HG23 . VAL A 1 10 ? -2.637  -18.261 0.881   1.00 0.00 ? 10 VAL A HG23 6  
ATOM 6892  N N    . ILE A 1 11 ? -1.798  -15.812 5.172   1.00 0.00 ? 11 ILE A N    6  
ATOM 6893  C CA   . ILE A 1 11 ? -2.020  -14.796 6.195   1.00 0.00 ? 11 ILE A CA   6  
ATOM 6894  C C    . ILE A 1 11 ? -0.996  -13.669 6.088   1.00 0.00 ? 11 ILE A C    6  
ATOM 6895  O O    . ILE A 1 11 ? -1.316  -12.505 6.328   1.00 0.00 ? 11 ILE A O    6  
ATOM 6896  C CB   . ILE A 1 11 ? -1.965  -15.410 7.609   1.00 0.00 ? 11 ILE A CB   6  
ATOM 6897  C CG1  . ILE A 1 11 ? -3.042  -16.488 7.756   1.00 0.00 ? 11 ILE A CG1  6  
ATOM 6898  C CG2  . ILE A 1 11 ? -2.139  -14.329 8.667   1.00 0.00 ? 11 ILE A CG2  6  
ATOM 6899  C CD1  . ILE A 1 11 ? -2.952  -17.271 9.048   1.00 0.00 ? 11 ILE A CD1  6  
ATOM 6900  H H    . ILE A 1 11 ? -1.691  -16.754 5.437   1.00 0.00 ? 11 ILE A H    6  
ATOM 6901  H HA   . ILE A 1 11 ? -3.008  -14.379 6.042   1.00 0.00 ? 11 ILE A HA   6  
ATOM 6902  H HB   . ILE A 1 11 ? -0.992  -15.861 7.745   1.00 0.00 ? 11 ILE A HB   6  
ATOM 6903  H HG12 . ILE A 1 11 ? -4.016  -16.019 7.731   1.00 0.00 ? 11 ILE A HG12 6  
ATOM 6904  H HG13 . ILE A 1 11 ? -2.983  -17.190 6.947   1.00 0.00 ? 11 ILE A HG13 6  
ATOM 6905  H HG21 . ILE A 1 11 ? -3.066  -13.798 8.497   1.00 0.00 ? 11 ILE A HG21 6  
ATOM 6906  H HG22 . ILE A 1 11 ? -1.315  -13.634 8.626   1.00 0.00 ? 11 ILE A HG22 6  
ATOM 6907  H HG23 . ILE A 1 11 ? -2.162  -14.774 9.650   1.00 0.00 ? 11 ILE A HG23 6  
ATOM 6908  H HD11 . ILE A 1 11 ? -1.938  -17.614 9.199   1.00 0.00 ? 11 ILE A HD11 6  
ATOM 6909  H HD12 . ILE A 1 11 ? -3.614  -18.123 8.996   1.00 0.00 ? 11 ILE A HD12 6  
ATOM 6910  H HD13 . ILE A 1 11 ? -3.246  -16.641 9.874   1.00 0.00 ? 11 ILE A HD13 6  
ATOM 6911  N N    . SER A 1 12 ? 0.234   -14.020 5.727   1.00 0.00 ? 12 SER A N    6  
ATOM 6912  C CA   . SER A 1 12 ? 1.301   -13.034 5.588   1.00 0.00 ? 12 SER A CA   6  
ATOM 6913  C C    . SER A 1 12 ? 1.092   -12.172 4.344   1.00 0.00 ? 12 SER A C    6  
ATOM 6914  O O    . SER A 1 12 ? 1.318   -10.963 4.371   1.00 0.00 ? 12 SER A O    6  
ATOM 6915  C CB   . SER A 1 12 ? 2.663   -13.728 5.521   1.00 0.00 ? 12 SER A CB   6  
ATOM 6916  O OG   . SER A 1 12 ? 3.712   -12.784 5.397   1.00 0.00 ? 12 SER A OG   6  
ATOM 6917  H H    . SER A 1 12 ? 0.439   -14.968 5.548   1.00 0.00 ? 12 SER A H    6  
ATOM 6918  H HA   . SER A 1 12 ? 1.285   -12.391 6.460   1.00 0.00 ? 12 SER A HA   6  
ATOM 6919  H HB2  . SER A 1 12 ? 2.816   -14.301 6.424   1.00 0.00 ? 12 SER A HB2  6  
ATOM 6920  H HB3  . SER A 1 12 ? 2.688   -14.391 4.667   1.00 0.00 ? 12 SER A HB3  6  
ATOM 6921  H HG   . SER A 1 12 ? 3.914   -12.410 6.259   1.00 0.00 ? 12 SER A HG   6  
ATOM 6922  N N    . ALA A 1 13 ? 0.659   -12.803 3.258   1.00 0.00 ? 13 ALA A N    6  
ATOM 6923  C CA   . ALA A 1 13 ? 0.421   -12.098 2.003   1.00 0.00 ? 13 ALA A CA   6  
ATOM 6924  C C    . ALA A 1 13 ? -0.706  -11.081 2.141   1.00 0.00 ? 13 ALA A C    6  
ATOM 6925  O O    . ALA A 1 13 ? -0.518  -9.894  1.873   1.00 0.00 ? 13 ALA A O    6  
ATOM 6926  C CB   . ALA A 1 13 ? 0.106   -13.090 0.893   1.00 0.00 ? 13 ALA A CB   6  
ATOM 6927  H H    . ALA A 1 13 ? 0.496   -13.775 3.294   1.00 0.00 ? 13 ALA A H    6  
ATOM 6928  H HA   . ALA A 1 13 ? 1.329   -11.575 1.731   1.00 0.00 ? 13 ALA A HA   6  
ATOM 6929  H HB1  . ALA A 1 13 ? -0.005  -12.564 -0.045  1.00 0.00 ? 13 ALA A HB1  6  
ATOM 6930  H HB2  . ALA A 1 13 ? -0.811  -13.615 1.123   1.00 0.00 ? 13 ALA A HB2  6  
ATOM 6931  H HB3  . ALA A 1 13 ? 0.914   -13.802 0.810   1.00 0.00 ? 13 ALA A HB3  6  
ATOM 6932  N N    . ILE A 1 14 ? -1.876  -11.555 2.557   1.00 0.00 ? 14 ILE A N    6  
ATOM 6933  C CA   . ILE A 1 14 ? -3.038  -10.691 2.728   1.00 0.00 ? 14 ILE A CA   6  
ATOM 6934  C C    . ILE A 1 14 ? -2.724  -9.526  3.662   1.00 0.00 ? 14 ILE A C    6  
ATOM 6935  O O    . ILE A 1 14 ? -3.071  -8.381  3.377   1.00 0.00 ? 14 ILE A O    6  
ATOM 6936  C CB   . ILE A 1 14 ? -4.244  -11.474 3.284   1.00 0.00 ? 14 ILE A CB   6  
ATOM 6937  C CG1  . ILE A 1 14 ? -4.565  -12.664 2.376   1.00 0.00 ? 14 ILE A CG1  6  
ATOM 6938  C CG2  . ILE A 1 14 ? -5.452  -10.557 3.419   1.00 0.00 ? 14 ILE A CG2  6  
ATOM 6939  C CD1  . ILE A 1 14 ? -5.642  -13.578 2.922   1.00 0.00 ? 14 ILE A CD1  6  
ATOM 6940  H H    . ILE A 1 14 ? -1.948  -12.514 2.760   1.00 0.00 ? 14 ILE A H    6  
ATOM 6941  H HA   . ILE A 1 14 ? -3.305  -10.296 1.755   1.00 0.00 ? 14 ILE A HA   6  
ATOM 6942  H HB   . ILE A 1 14 ? -3.989  -11.841 4.269   1.00 0.00 ? 14 ILE A HB   6  
ATOM 6943  H HG12 . ILE A 1 14 ? -4.901  -12.301 1.416   1.00 0.00 ? 14 ILE A HG12 6  
ATOM 6944  H HG13 . ILE A 1 14 ? -3.685  -13.267 2.229   1.00 0.00 ? 14 ILE A HG13 6  
ATOM 6945  H HG21 . ILE A 1 14 ? -5.693  -10.128 2.456   1.00 0.00 ? 14 ILE A HG21 6  
ATOM 6946  H HG22 . ILE A 1 14 ? -5.242  -9.765  4.121   1.00 0.00 ? 14 ILE A HG22 6  
ATOM 6947  H HG23 . ILE A 1 14 ? -6.302  -11.117 3.779   1.00 0.00 ? 14 ILE A HG23 6  
ATOM 6948  H HD11 . ILE A 1 14 ? -6.597  -13.076 2.882   1.00 0.00 ? 14 ILE A HD11 6  
ATOM 6949  H HD12 . ILE A 1 14 ? -5.415  -13.841 3.946   1.00 0.00 ? 14 ILE A HD12 6  
ATOM 6950  H HD13 . ILE A 1 14 ? -5.685  -14.476 2.324   1.00 0.00 ? 14 ILE A HD13 6  
ATOM 6951  N N    . LEU A 1 15 ? -2.064  -9.827  4.777   1.00 0.00 ? 15 LEU A N    6  
ATOM 6952  C CA   . LEU A 1 15 ? -1.704  -8.805  5.753   1.00 0.00 ? 15 LEU A CA   6  
ATOM 6953  C C    . LEU A 1 15 ? -0.873  -7.703  5.106   1.00 0.00 ? 15 LEU A C    6  
ATOM 6954  O O    . LEU A 1 15 ? -1.163  -6.517  5.266   1.00 0.00 ? 15 LEU A O    6  
ATOM 6955  C CB   . LEU A 1 15 ? -0.923  -9.432  6.911   1.00 0.00 ? 15 LEU A CB   6  
ATOM 6956  C CG   . LEU A 1 15 ? -0.523  -8.464  8.026   1.00 0.00 ? 15 LEU A CG   6  
ATOM 6957  C CD1  . LEU A 1 15 ? -1.756  -7.925  8.736   1.00 0.00 ? 15 LEU A CD1  6  
ATOM 6958  C CD2  . LEU A 1 15 ? 0.410   -9.148  9.014   1.00 0.00 ? 15 LEU A CD2  6  
ATOM 6959  H H    . LEU A 1 15 ? -1.813  -10.765 4.953   1.00 0.00 ? 15 LEU A H    6  
ATOM 6960  H HA   . LEU A 1 15 ? -2.617  -8.375  6.137   1.00 0.00 ? 15 LEU A HA   6  
ATOM 6961  H HB2  . LEU A 1 15 ? -1.528  -10.221 7.338   1.00 0.00 ? 15 LEU A HB2  6  
ATOM 6962  H HB3  . LEU A 1 15 ? -0.024  -9.878  6.504   1.00 0.00 ? 15 LEU A HB3  6  
ATOM 6963  H HG   . LEU A 1 15 ? 0.007   -7.624  7.603   1.00 0.00 ? 15 LEU A HG   6  
ATOM 6964  H HD11 . LEU A 1 15 ? -1.454  -7.257  9.531   1.00 0.00 ? 15 LEU A HD11 6  
ATOM 6965  H HD12 . LEU A 1 15 ? -2.324  -8.744  9.155   1.00 0.00 ? 15 LEU A HD12 6  
ATOM 6966  H HD13 . LEU A 1 15 ? -2.372  -7.383  8.034   1.00 0.00 ? 15 LEU A HD13 6  
ATOM 6967  H HD21 . LEU A 1 15 ? 0.705   -8.445  9.780   1.00 0.00 ? 15 LEU A HD21 6  
ATOM 6968  H HD22 . LEU A 1 15 ? 1.292   -9.500  8.496   1.00 0.00 ? 15 LEU A HD22 6  
ATOM 6969  H HD23 . LEU A 1 15 ? -0.095  -9.987  9.473   1.00 0.00 ? 15 LEU A HD23 6  
ATOM 6970  N N    . ALA A 1 16 ? 0.158   -8.104  4.371   1.00 0.00 ? 16 ALA A N    6  
ATOM 6971  C CA   . ALA A 1 16 ? 1.033   -7.156  3.694   1.00 0.00 ? 16 ALA A CA   6  
ATOM 6972  C C    . ALA A 1 16 ? 0.265   -6.345  2.657   1.00 0.00 ? 16 ALA A C    6  
ATOM 6973  O O    . ALA A 1 16 ? 0.605   -5.197  2.371   1.00 0.00 ? 16 ALA A O    6  
ATOM 6974  C CB   . ALA A 1 16 ? 2.199   -7.882  3.046   1.00 0.00 ? 16 ALA A CB   6  
ATOM 6975  H H    . ALA A 1 16 ? 0.337   -9.071  4.278   1.00 0.00 ? 16 ALA A H    6  
ATOM 6976  H HA   . ALA A 1 16 ? 1.440   -6.490  4.437   1.00 0.00 ? 16 ALA A HA   6  
ATOM 6977  H HB1  . ALA A 1 16 ? 1.831   -8.554  2.283   1.00 0.00 ? 16 ALA A HB1  6  
ATOM 6978  H HB2  . ALA A 1 16 ? 2.728   -8.449  3.797   1.00 0.00 ? 16 ALA A HB2  6  
ATOM 6979  H HB3  . ALA A 1 16 ? 2.873   -7.164  2.599   1.00 0.00 ? 16 ALA A HB3  6  
ATOM 6980  N N    . LEU A 1 17 ? -0.769  -6.953  2.087   1.00 0.00 ? 17 LEU A N    6  
ATOM 6981  C CA   . LEU A 1 17 ? -1.584  -6.292  1.077   1.00 0.00 ? 17 LEU A CA   6  
ATOM 6982  C C    . LEU A 1 17 ? -2.471  -5.219  1.707   1.00 0.00 ? 17 LEU A C    6  
ATOM 6983  O O    . LEU A 1 17 ? -2.773  -4.203  1.081   1.00 0.00 ? 17 LEU A O    6  
ATOM 6984  C CB   . LEU A 1 17 ? -2.441  -7.319  0.335   1.00 0.00 ? 17 LEU A CB   6  
ATOM 6985  C CG   . LEU A 1 17 ? -3.163  -6.796  -0.907  1.00 0.00 ? 17 LEU A CG   6  
ATOM 6986  C CD1  . LEU A 1 17 ? -2.165  -6.291  -1.937  1.00 0.00 ? 17 LEU A CD1  6  
ATOM 6987  C CD2  . LEU A 1 17 ? -4.041  -7.886  -1.504  1.00 0.00 ? 17 LEU A CD2  6  
ATOM 6988  H H    . LEU A 1 17 ? -0.993  -7.876  2.340   1.00 0.00 ? 17 LEU A H    6  
ATOM 6989  H HA   . LEU A 1 17 ? -0.915  -5.816  0.376   1.00 0.00 ? 17 LEU A HA   6  
ATOM 6990  H HB2  . LEU A 1 17 ? -1.798  -8.138  0.037   1.00 0.00 ? 17 LEU A HB2  6  
ATOM 6991  H HB3  . LEU A 1 17 ? -3.182  -7.706  1.023   1.00 0.00 ? 17 LEU A HB3  6  
ATOM 6992  H HG   . LEU A 1 17 ? -3.799  -5.970  -0.625  1.00 0.00 ? 17 LEU A HG   6  
ATOM 6993  H HD11 . LEU A 1 17 ? -2.689  -5.996  -2.837  1.00 0.00 ? 17 LEU A HD11 6  
ATOM 6994  H HD12 . LEU A 1 17 ? -1.458  -7.073  -2.177  1.00 0.00 ? 17 LEU A HD12 6  
ATOM 6995  H HD13 . LEU A 1 17 ? -1.637  -5.437  -1.544  1.00 0.00 ? 17 LEU A HD13 6  
ATOM 6996  H HD21 . LEU A 1 17 ? -3.429  -8.725  -1.806  1.00 0.00 ? 17 LEU A HD21 6  
ATOM 6997  H HD22 . LEU A 1 17 ? -4.567  -7.497  -2.365  1.00 0.00 ? 17 LEU A HD22 6  
ATOM 6998  H HD23 . LEU A 1 17 ? -4.762  -8.215  -0.768  1.00 0.00 ? 17 LEU A HD23 6  
ATOM 6999  N N    . VAL A 1 18 ? -2.888  -5.453  2.950   1.00 0.00 ? 18 VAL A N    6  
ATOM 7000  C CA   . VAL A 1 18 ? -3.739  -4.503  3.662   1.00 0.00 ? 18 VAL A CA   6  
ATOM 7001  C C    . VAL A 1 18 ? -2.949  -3.270  4.093   1.00 0.00 ? 18 VAL A C    6  
ATOM 7002  O O    . VAL A 1 18 ? -3.404  -2.140  3.918   1.00 0.00 ? 18 VAL A O    6  
ATOM 7003  C CB   . VAL A 1 18 ? -4.393  -5.146  4.901   1.00 0.00 ? 18 VAL A CB   6  
ATOM 7004  C CG1  . VAL A 1 18 ? -5.197  -4.117  5.684   1.00 0.00 ? 18 VAL A CG1  6  
ATOM 7005  C CG2  . VAL A 1 18 ? -5.276  -6.314  4.490   1.00 0.00 ? 18 VAL A CG2  6  
ATOM 7006  H H    . VAL A 1 18 ? -2.623  -6.283  3.409   1.00 0.00 ? 18 VAL A H    6  
ATOM 7007  H HA   . VAL A 1 18 ? -4.531  -4.184  2.991   1.00 0.00 ? 18 VAL A HA   6  
ATOM 7008  H HB   . VAL A 1 18 ? -3.611  -5.524  5.544   1.00 0.00 ? 18 VAL A HB   6  
ATOM 7009  H HG11 . VAL A 1 18 ? -4.529  -3.431  6.182   1.00 0.00 ? 18 VAL A HG11 6  
ATOM 7010  H HG12 . VAL A 1 18 ? -5.801  -4.616  6.431   1.00 0.00 ? 18 VAL A HG12 6  
ATOM 7011  H HG13 . VAL A 1 18 ? -5.845  -3.567  5.014   1.00 0.00 ? 18 VAL A HG13 6  
ATOM 7012  H HG21 . VAL A 1 18 ? -6.110  -5.950  3.904   1.00 0.00 ? 18 VAL A HG21 6  
ATOM 7013  H HG22 . VAL A 1 18 ? -5.650  -6.811  5.373   1.00 0.00 ? 18 VAL A HG22 6  
ATOM 7014  H HG23 . VAL A 1 18 ? -4.714  -7.012  3.905   1.00 0.00 ? 18 VAL A HG23 6  
ATOM 7015  N N    . VAL A 1 19 ? -1.765  -3.494  4.659   1.00 0.00 ? 19 VAL A N    6  
ATOM 7016  C CA   . VAL A 1 19 ? -0.919  -2.397  5.115   1.00 0.00 ? 19 VAL A CA   6  
ATOM 7017  C C    . VAL A 1 19 ? -0.503  -1.504  3.949   1.00 0.00 ? 19 VAL A C    6  
ATOM 7018  O O    . VAL A 1 19 ? -0.302  -0.302  4.120   1.00 0.00 ? 19 VAL A O    6  
ATOM 7019  C CB   . VAL A 1 19 ? 0.340   -2.916  5.841   1.00 0.00 ? 19 VAL A CB   6  
ATOM 7020  C CG1  . VAL A 1 19 ? 1.145   -3.833  4.939   1.00 0.00 ? 19 VAL A CG1  6  
ATOM 7021  C CG2  . VAL A 1 19 ? 1.194   -1.756  6.331   1.00 0.00 ? 19 VAL A CG2  6  
ATOM 7022  H H    . VAL A 1 19 ? -1.463  -4.422  4.781   1.00 0.00 ? 19 VAL A H    6  
ATOM 7023  H HA   . VAL A 1 19 ? -1.492  -1.804  5.819   1.00 0.00 ? 19 VAL A HA   6  
ATOM 7024  H HB   . VAL A 1 19 ? 0.023   -3.487  6.701   1.00 0.00 ? 19 VAL A HB   6  
ATOM 7025  H HG11 . VAL A 1 19 ? 0.540   -4.667  4.674   1.00 0.00 ? 19 VAL A HG11 6  
ATOM 7026  H HG12 . VAL A 1 19 ? 2.017   -4.188  5.471   1.00 0.00 ? 19 VAL A HG12 6  
ATOM 7027  H HG13 . VAL A 1 19 ? 1.461   -3.311  4.050   1.00 0.00 ? 19 VAL A HG13 6  
ATOM 7028  H HG21 . VAL A 1 19 ? 1.645   -1.240  5.494   1.00 0.00 ? 19 VAL A HG21 6  
ATOM 7029  H HG22 . VAL A 1 19 ? 1.974   -2.138  6.973   1.00 0.00 ? 19 VAL A HG22 6  
ATOM 7030  H HG23 . VAL A 1 19 ? 0.583   -1.063  6.893   1.00 0.00 ? 19 VAL A HG23 6  
ATOM 7031  N N    . LEU A 1 20 ? -0.378  -2.095  2.762   1.00 0.00 ? 20 LEU A N    6  
ATOM 7032  C CA   . LEU A 1 20 ? 0.008   -1.341  1.574   1.00 0.00 ? 20 LEU A CA   6  
ATOM 7033  C C    . LEU A 1 20 ? -1.007  -0.235  1.300   1.00 0.00 ? 20 LEU A C    6  
ATOM 7034  O O    . LEU A 1 20 ? -0.647  0.865   0.882   1.00 0.00 ? 20 LEU A O    6  
ATOM 7035  C CB   . LEU A 1 20 ? 0.114   -2.267  0.360   1.00 0.00 ? 20 LEU A CB   6  
ATOM 7036  C CG   . LEU A 1 20 ? 1.266   -1.953  -0.604  1.00 0.00 ? 20 LEU A CG   6  
ATOM 7037  C CD1  . LEU A 1 20 ? 1.124   -0.556  -1.191  1.00 0.00 ? 20 LEU A CD1  6  
ATOM 7038  C CD2  . LEU A 1 20 ? 2.604   -2.096  0.104   1.00 0.00 ? 20 LEU A CD2  6  
ATOM 7039  H H    . LEU A 1 20 ? -0.549  -3.061  2.678   1.00 0.00 ? 20 LEU A H    6  
ATOM 7040  H HA   . LEU A 1 20 ? 0.960   -0.879  1.777   1.00 0.00 ? 20 LEU A HA   6  
ATOM 7041  H HB2  . LEU A 1 20 ? 0.248   -3.284  0.711   1.00 0.00 ? 20 LEU A HB2  6  
ATOM 7042  H HB3  . LEU A 1 20 ? -0.811  -2.233  -0.202  1.00 0.00 ? 20 LEU A HB3  6  
ATOM 7043  H HG   . LEU A 1 20 ? 1.244   -2.660  -1.421  1.00 0.00 ? 20 LEU A HG   6  
ATOM 7044  H HD11 . LEU A 1 20 ? 1.265   0.184   -0.417  1.00 0.00 ? 20 LEU A HD11 6  
ATOM 7045  H HD12 . LEU A 1 20 ? 0.140   -0.439  -1.626  1.00 0.00 ? 20 LEU A HD12 6  
ATOM 7046  H HD13 . LEU A 1 20 ? 1.870   -0.414  -1.959  1.00 0.00 ? 20 LEU A HD13 6  
ATOM 7047  H HD21 . LEU A 1 20 ? 2.713   -1.331  0.858   1.00 0.00 ? 20 LEU A HD21 6  
ATOM 7048  H HD22 . LEU A 1 20 ? 3.401   -1.997  -0.618  1.00 0.00 ? 20 LEU A HD22 6  
ATOM 7049  H HD23 . LEU A 1 20 ? 2.669   -3.071  0.569   1.00 0.00 ? 20 LEU A HD23 6  
ATOM 7050  N N    . THR A 1 21 ? -2.279  -0.538  1.546   1.00 0.00 ? 21 THR A N    6  
ATOM 7051  C CA   . THR A 1 21 ? -3.351  0.428   1.337   1.00 0.00 ? 21 THR A CA   6  
ATOM 7052  C C    . THR A 1 21 ? -3.365  1.463   2.455   1.00 0.00 ? 21 THR A C    6  
ATOM 7053  O O    . THR A 1 21 ? -3.753  2.613   2.250   1.00 0.00 ? 21 THR A O    6  
ATOM 7054  C CB   . THR A 1 21 ? -4.727  -0.262  1.265   1.00 0.00 ? 21 THR A CB   6  
ATOM 7055  O OG1  . THR A 1 21 ? -4.712  -1.288  0.265   1.00 0.00 ? 21 THR A OG1  6  
ATOM 7056  C CG2  . THR A 1 21 ? -5.824  0.745   0.943   1.00 0.00 ? 21 THR A CG2  6  
ATOM 7057  H H    . THR A 1 21 ? -2.513  -1.435  1.882   1.00 0.00 ? 21 THR A H    6  
ATOM 7058  H HA   . THR A 1 21 ? -3.176  0.935   0.393   1.00 0.00 ? 21 THR A HA   6  
ATOM 7059  H HB   . THR A 1 21 ? -4.944  -0.714  2.224   1.00 0.00 ? 21 THR A HB   6  
ATOM 7060  H HG1  . THR A 1 21 ? -4.498  -0.922  -0.604  1.00 0.00 ? 21 THR A HG1  6  
ATOM 7061  H HG21 . THR A 1 21 ? -5.995  1.384   1.796   1.00 0.00 ? 21 THR A HG21 6  
ATOM 7062  H HG22 . THR A 1 21 ? -6.735  0.214   0.709   1.00 0.00 ? 21 THR A HG22 6  
ATOM 7063  H HG23 . THR A 1 21 ? -5.535  1.347   0.092   1.00 0.00 ? 21 THR A HG23 6  
ATOM 7064  N N    . ILE A 1 22 ? -2.937  1.044   3.643   1.00 0.00 ? 22 ILE A N    6  
ATOM 7065  C CA   . ILE A 1 22 ? -2.891  1.932   4.798   1.00 0.00 ? 22 ILE A CA   6  
ATOM 7066  C C    . ILE A 1 22 ? -1.816  2.997   4.621   1.00 0.00 ? 22 ILE A C    6  
ATOM 7067  O O    . ILE A 1 22 ? -2.045  4.176   4.896   1.00 0.00 ? 22 ILE A O    6  
ATOM 7068  C CB   . ILE A 1 22 ? -2.619  1.150   6.100   1.00 0.00 ? 22 ILE A CB   6  
ATOM 7069  C CG1  . ILE A 1 22 ? -3.752  0.156   6.378   1.00 0.00 ? 22 ILE A CG1  6  
ATOM 7070  C CG2  . ILE A 1 22 ? -2.443  2.104   7.275   1.00 0.00 ? 22 ILE A CG2  6  
ATOM 7071  C CD1  . ILE A 1 22 ? -5.101  0.810   6.597   1.00 0.00 ? 22 ILE A CD1  6  
ATOM 7072  H H    . ILE A 1 22 ? -2.646  0.115   3.757   1.00 0.00 ? 22 ILE A H    6  
ATOM 7073  H HA   . ILE A 1 22 ? -3.846  2.431   4.884   1.00 0.00 ? 22 ILE A HA   6  
ATOM 7074  H HB   . ILE A 1 22 ? -1.697  0.602   5.977   1.00 0.00 ? 22 ILE A HB   6  
ATOM 7075  H HG12 . ILE A 1 22 ? -3.847  -0.515  5.544   1.00 0.00 ? 22 ILE A HG12 6  
ATOM 7076  H HG13 . ILE A 1 22 ? -3.513  -0.416  7.264   1.00 0.00 ? 22 ILE A HG13 6  
ATOM 7077  H HG21 . ILE A 1 22 ? -3.215  2.862   7.260   1.00 0.00 ? 22 ILE A HG21 6  
ATOM 7078  H HG22 . ILE A 1 22 ? -1.474  2.578   7.217   1.00 0.00 ? 22 ILE A HG22 6  
ATOM 7079  H HG23 . ILE A 1 22 ? -2.504  1.555   8.207   1.00 0.00 ? 22 ILE A HG23 6  
ATOM 7080  H HD11 . ILE A 1 22 ? -5.785  0.477   5.831   1.00 0.00 ? 22 ILE A HD11 6  
ATOM 7081  H HD12 . ILE A 1 22 ? -5.029  1.888   6.562   1.00 0.00 ? 22 ILE A HD12 6  
ATOM 7082  H HD13 . ILE A 1 22 ? -5.486  0.514   7.561   1.00 0.00 ? 22 ILE A HD13 6  
ATOM 7083  N N    . ILE A 1 23 ? -0.642  2.575   4.160   1.00 0.00 ? 23 ILE A N    6  
ATOM 7084  C CA   . ILE A 1 23 ? 0.469   3.495   3.950   1.00 0.00 ? 23 ILE A CA   6  
ATOM 7085  C C    . ILE A 1 23 ? 0.143   4.517   2.864   1.00 0.00 ? 23 ILE A C    6  
ATOM 7086  O O    . ILE A 1 23 ? 0.427   5.706   3.013   1.00 0.00 ? 23 ILE A O    6  
ATOM 7087  C CB   . ILE A 1 23 ? 1.757   2.747   3.569   1.00 0.00 ? 23 ILE A CB   6  
ATOM 7088  C CG1  . ILE A 1 23 ? 2.138   1.746   4.662   1.00 0.00 ? 23 ILE A CG1  6  
ATOM 7089  C CG2  . ILE A 1 23 ? 2.891   3.736   3.334   1.00 0.00 ? 23 ILE A CG2  6  
ATOM 7090  C CD1  . ILE A 1 23 ? 2.423   2.385   6.004   1.00 0.00 ? 23 ILE A CD1  6  
ATOM 7091  H H    . ILE A 1 23 ? -0.518  1.619   3.954   1.00 0.00 ? 23 ILE A H    6  
ATOM 7092  H HA   . ILE A 1 23 ? 0.641   4.033   4.873   1.00 0.00 ? 23 ILE A HA   6  
ATOM 7093  H HB   . ILE A 1 23 ? 1.582   2.211   2.647   1.00 0.00 ? 23 ILE A HB   6  
ATOM 7094  H HG12 . ILE A 1 23 ? 1.344   1.044   4.804   1.00 0.00 ? 23 ILE A HG12 6  
ATOM 7095  H HG13 . ILE A 1 23 ? 3.027   1.212   4.358   1.00 0.00 ? 23 ILE A HG13 6  
ATOM 7096  H HG21 . ILE A 1 23 ? 3.832   3.204   3.266   1.00 0.00 ? 23 ILE A HG21 6  
ATOM 7097  H HG22 . ILE A 1 23 ? 2.943   4.443   4.151   1.00 0.00 ? 23 ILE A HG22 6  
ATOM 7098  H HG23 . ILE A 1 23 ? 2.726   4.268   2.409   1.00 0.00 ? 23 ILE A HG23 6  
ATOM 7099  H HD11 . ILE A 1 23 ? 2.761   1.624   6.692   1.00 0.00 ? 23 ILE A HD11 6  
ATOM 7100  H HD12 . ILE A 1 23 ? 1.524   2.837   6.393   1.00 0.00 ? 23 ILE A HD12 6  
ATOM 7101  H HD13 . ILE A 1 23 ? 3.191   3.136   5.905   1.00 0.00 ? 23 ILE A HD13 6  
ATOM 7102  N N    . SER A 1 24 ? -0.459  4.047   1.774   1.00 0.00 ? 24 SER A N    6  
ATOM 7103  C CA   . SER A 1 24 ? -0.822  4.920   0.661   1.00 0.00 ? 24 SER A CA   6  
ATOM 7104  C C    . SER A 1 24 ? -2.011  5.806   1.020   1.00 0.00 ? 24 SER A C    6  
ATOM 7105  O O    . SER A 1 24 ? -2.196  6.876   0.440   1.00 0.00 ? 24 SER A O    6  
ATOM 7106  C CB   . SER A 1 24 ? -1.147  4.092   -0.583  1.00 0.00 ? 24 SER A CB   6  
ATOM 7107  O OG   . SER A 1 24 ? -2.298  3.293   -0.380  1.00 0.00 ? 24 SER A OG   6  
ATOM 7108  H H    . SER A 1 24 ? -0.666  3.084   1.710   1.00 0.00 ? 24 SER A H    6  
ATOM 7109  H HA   . SER A 1 24 ? 0.026   5.556   0.438   1.00 0.00 ? 24 SER A HA   6  
ATOM 7110  H HB2  . SER A 1 24 ? -1.325  4.752   -1.420  1.00 0.00 ? 24 SER A HB2  6  
ATOM 7111  H HB3  . SER A 1 24 ? -0.312  3.445   -0.808  1.00 0.00 ? 24 SER A HB3  6  
ATOM 7112  H HG   . SER A 1 24 ? -2.396  2.680   -1.112  1.00 0.00 ? 24 SER A HG   6  
ATOM 7113  N N    . LEU A 1 25 ? -2.818  5.352   1.976   1.00 0.00 ? 25 LEU A N    6  
ATOM 7114  C CA   . LEU A 1 25 ? -3.988  6.109   2.408   1.00 0.00 ? 25 LEU A CA   6  
ATOM 7115  C C    . LEU A 1 25 ? -3.576  7.390   3.124   1.00 0.00 ? 25 LEU A C    6  
ATOM 7116  O O    . LEU A 1 25 ? -4.018  8.483   2.768   1.00 0.00 ? 25 LEU A O    6  
ATOM 7117  C CB   . LEU A 1 25 ? -4.867  5.260   3.331   1.00 0.00 ? 25 LEU A CB   6  
ATOM 7118  C CG   . LEU A 1 25 ? -6.107  5.970   3.881   1.00 0.00 ? 25 LEU A CG   6  
ATOM 7119  C CD1  . LEU A 1 25 ? -7.088  6.282   2.762   1.00 0.00 ? 25 LEU A CD1  6  
ATOM 7120  C CD2  . LEU A 1 25 ? -6.771  5.124   4.957   1.00 0.00 ? 25 LEU A CD2  6  
ATOM 7121  H H    . LEU A 1 25 ? -2.632  4.486   2.406   1.00 0.00 ? 25 LEU A H    6  
ATOM 7122  H HA   . LEU A 1 25 ? -4.562  6.373   1.530   1.00 0.00 ? 25 LEU A HA   6  
ATOM 7123  H HB2  . LEU A 1 25 ? -5.191  4.389   2.782   1.00 0.00 ? 25 LEU A HB2  6  
ATOM 7124  H HB3  . LEU A 1 25 ? -4.260  4.934   4.163   1.00 0.00 ? 25 LEU A HB3  6  
ATOM 7125  H HG   . LEU A 1 25 ? -5.819  6.905   4.336   1.00 0.00 ? 25 LEU A HG   6  
ATOM 7126  H HD11 . LEU A 1 25 ? -7.955  6.785   3.169   1.00 0.00 ? 25 LEU A HD11 6  
ATOM 7127  H HD12 . LEU A 1 25 ? -7.399  5.364   2.282   1.00 0.00 ? 25 LEU A HD12 6  
ATOM 7128  H HD13 . LEU A 1 25 ? -6.615  6.925   2.033   1.00 0.00 ? 25 LEU A HD13 6  
ATOM 7129  H HD21 . LEU A 1 25 ? -6.067  4.936   5.756   1.00 0.00 ? 25 LEU A HD21 6  
ATOM 7130  H HD22 . LEU A 1 25 ? -7.093  4.182   4.535   1.00 0.00 ? 25 LEU A HD22 6  
ATOM 7131  H HD23 . LEU A 1 25 ? -7.628  5.650   5.355   1.00 0.00 ? 25 LEU A HD23 6  
ATOM 7132  N N    . ILE A 1 26 ? -2.732  7.247   4.140   1.00 0.00 ? 26 ILE A N    6  
ATOM 7133  C CA   . ILE A 1 26 ? -2.258  8.391   4.910   1.00 0.00 ? 26 ILE A CA   6  
ATOM 7134  C C    . ILE A 1 26 ? -1.600  9.424   4.002   1.00 0.00 ? 26 ILE A C    6  
ATOM 7135  O O    . ILE A 1 26 ? -1.781  10.628  4.183   1.00 0.00 ? 26 ILE A O    6  
ATOM 7136  C CB   . ILE A 1 26 ? -1.255  7.956   5.996   1.00 0.00 ? 26 ILE A CB   6  
ATOM 7137  C CG1  . ILE A 1 26 ? -1.850  6.824   6.836   1.00 0.00 ? 26 ILE A CG1  6  
ATOM 7138  C CG2  . ILE A 1 26 ? -0.879  9.141   6.876   1.00 0.00 ? 26 ILE A CG2  6  
ATOM 7139  C CD1  . ILE A 1 26 ? -0.880  6.234   7.837   1.00 0.00 ? 26 ILE A CD1  6  
ATOM 7140  H H    . ILE A 1 26 ? -2.416  6.344   4.359   1.00 0.00 ? 26 ILE A H    6  
ATOM 7141  H HA   . ILE A 1 26 ? -3.114  8.844   5.395   1.00 0.00 ? 26 ILE A HA   6  
ATOM 7142  H HB   . ILE A 1 26 ? -0.356  7.598   5.511   1.00 0.00 ? 26 ILE A HB   6  
ATOM 7143  H HG12 . ILE A 1 26 ? -2.698  7.199   7.389   1.00 0.00 ? 26 ILE A HG12 6  
ATOM 7144  H HG13 . ILE A 1 26 ? -2.177  6.024   6.209   1.00 0.00 ? 26 ILE A HG13 6  
ATOM 7145  H HG21 . ILE A 1 26 ? -0.175  8.827   7.633   1.00 0.00 ? 26 ILE A HG21 6  
ATOM 7146  H HG22 . ILE A 1 26 ? -1.764  9.534   7.355   1.00 0.00 ? 26 ILE A HG22 6  
ATOM 7147  H HG23 . ILE A 1 26 ? -0.423  9.917   6.279   1.00 0.00 ? 26 ILE A HG23 6  
ATOM 7148  H HD11 . ILE A 1 26 ? -1.312  5.345   8.272   1.00 0.00 ? 26 ILE A HD11 6  
ATOM 7149  H HD12 . ILE A 1 26 ? -0.683  6.954   8.617   1.00 0.00 ? 26 ILE A HD12 6  
ATOM 7150  H HD13 . ILE A 1 26 ? 0.046   5.976   7.341   1.00 0.00 ? 26 ILE A HD13 6  
ATOM 7151  N N    . ILE A 1 27 ? -0.839  8.943   3.023   1.00 0.00 ? 27 ILE A N    6  
ATOM 7152  C CA   . ILE A 1 27 ? -0.158  9.823   2.081   1.00 0.00 ? 27 ILE A CA   6  
ATOM 7153  C C    . ILE A 1 27 ? -1.152  10.505  1.152   1.00 0.00 ? 27 ILE A C    6  
ATOM 7154  O O    . ILE A 1 27 ? -0.980  11.667  0.788   1.00 0.00 ? 27 ILE A O    6  
ATOM 7155  C CB   . ILE A 1 27 ? 0.878   9.049   1.242   1.00 0.00 ? 27 ILE A CB   6  
ATOM 7156  C CG1  . ILE A 1 27 ? 1.956   8.461   2.153   1.00 0.00 ? 27 ILE A CG1  6  
ATOM 7157  C CG2  . ILE A 1 27 ? 1.500   9.955   0.186   1.00 0.00 ? 27 ILE A CG2  6  
ATOM 7158  C CD1  . ILE A 1 27 ? 2.708   9.502   2.956   1.00 0.00 ? 27 ILE A CD1  6  
ATOM 7159  H H    . ILE A 1 27 ? -0.729  7.968   2.924   1.00 0.00 ? 27 ILE A H    6  
ATOM 7160  H HA   . ILE A 1 27 ? 0.352   10.595  2.639   1.00 0.00 ? 27 ILE A HA   6  
ATOM 7161  H HB   . ILE A 1 27 ? 0.369   8.243   0.734   1.00 0.00 ? 27 ILE A HB   6  
ATOM 7162  H HG12 . ILE A 1 27 ? 1.497   7.786   2.853   1.00 0.00 ? 27 ILE A HG12 6  
ATOM 7163  H HG13 . ILE A 1 27 ? 2.675   7.918   1.556   1.00 0.00 ? 27 ILE A HG13 6  
ATOM 7164  H HG21 . ILE A 1 27 ? 1.787   10.900  0.629   1.00 0.00 ? 27 ILE A HG21 6  
ATOM 7165  H HG22 . ILE A 1 27 ? 0.789   10.132  -0.607  1.00 0.00 ? 27 ILE A HG22 6  
ATOM 7166  H HG23 . ILE A 1 27 ? 2.377   9.479   -0.235  1.00 0.00 ? 27 ILE A HG23 6  
ATOM 7167  H HD11 . ILE A 1 27 ? 3.551   9.031   3.440   1.00 0.00 ? 27 ILE A HD11 6  
ATOM 7168  H HD12 . ILE A 1 27 ? 2.059   9.919   3.710   1.00 0.00 ? 27 ILE A HD12 6  
ATOM 7169  H HD13 . ILE A 1 27 ? 3.066   10.290  2.311   1.00 0.00 ? 27 ILE A HD13 6  
ATOM 7170  N N    . LEU A 1 28 ? -2.193  9.772   0.770   1.00 0.00 ? 28 LEU A N    6  
ATOM 7171  C CA   . LEU A 1 28 ? -3.218  10.307  -0.116  1.00 0.00 ? 28 LEU A CA   6  
ATOM 7172  C C    . LEU A 1 28 ? -3.881  11.534  0.503   1.00 0.00 ? 28 LEU A C    6  
ATOM 7173  O O    . LEU A 1 28 ? -4.007  12.574  -0.141  1.00 0.00 ? 28 LEU A O    6  
ATOM 7174  C CB   . LEU A 1 28 ? -4.274  9.240   -0.414  1.00 0.00 ? 28 LEU A CB   6  
ATOM 7175  C CG   . LEU A 1 28 ? -5.360  9.662   -1.403  1.00 0.00 ? 28 LEU A CG   6  
ATOM 7176  C CD1  . LEU A 1 28 ? -4.764  9.895   -2.783  1.00 0.00 ? 28 LEU A CD1  6  
ATOM 7177  C CD2  . LEU A 1 28 ? -6.460  8.613   -1.463  1.00 0.00 ? 28 LEU A CD2  6  
ATOM 7178  H H    . LEU A 1 28 ? -2.279  8.842   1.088   1.00 0.00 ? 28 LEU A H    6  
ATOM 7179  H HA   . LEU A 1 28 ? -2.740  10.597  -1.040  1.00 0.00 ? 28 LEU A HA   6  
ATOM 7180  H HB2  . LEU A 1 28 ? -3.770  8.365   -0.804  1.00 0.00 ? 28 LEU A HB2  6  
ATOM 7181  H HB3  . LEU A 1 28 ? -4.749  8.968   0.518   1.00 0.00 ? 28 LEU A HB3  6  
ATOM 7182  H HG   . LEU A 1 28 ? -5.807  10.589  -1.075  1.00 0.00 ? 28 LEU A HG   6  
ATOM 7183  H HD11 . LEU A 1 28 ? -5.549  10.170  -3.475  1.00 0.00 ? 28 LEU A HD11 6  
ATOM 7184  H HD12 . LEU A 1 28 ? -4.282  8.992   -3.131  1.00 0.00 ? 28 LEU A HD12 6  
ATOM 7185  H HD13 . LEU A 1 28 ? -4.039  10.694  -2.736  1.00 0.00 ? 28 LEU A HD13 6  
ATOM 7186  H HD21 . LEU A 1 28 ? -6.889  8.480   -0.479  1.00 0.00 ? 28 LEU A HD21 6  
ATOM 7187  H HD22 . LEU A 1 28 ? -6.050  7.672   -1.805  1.00 0.00 ? 28 LEU A HD22 6  
ATOM 7188  H HD23 . LEU A 1 28 ? -7.233  8.937   -2.146  1.00 0.00 ? 28 LEU A HD23 6  
ATOM 7189  N N    . ILE A 1 29 ? -4.297  11.401  1.758   1.00 0.00 ? 29 ILE A N    6  
ATOM 7190  C CA   . ILE A 1 29 ? -4.945  12.497  2.469   1.00 0.00 ? 29 ILE A CA   6  
ATOM 7191  C C    . ILE A 1 29 ? -3.934  13.583  2.826   1.00 0.00 ? 29 ILE A C    6  
ATOM 7192  O O    . ILE A 1 29 ? -4.270  14.766  2.874   1.00 0.00 ? 29 ILE A O    6  
ATOM 7193  C CB   . ILE A 1 29 ? -5.639  12.001  3.755   1.00 0.00 ? 29 ILE A CB   6  
ATOM 7194  C CG1  . ILE A 1 29 ? -6.523  10.785  3.456   1.00 0.00 ? 29 ILE A CG1  6  
ATOM 7195  C CG2  . ILE A 1 29 ? -6.459  13.119  4.383   1.00 0.00 ? 29 ILE A CG2  6  
ATOM 7196  C CD1  . ILE A 1 29 ? -7.591  11.045  2.412   1.00 0.00 ? 29 ILE A CD1  6  
ATOM 7197  H H    . ILE A 1 29 ? -4.151  10.544  2.222   1.00 0.00 ? 29 ILE A H    6  
ATOM 7198  H HA   . ILE A 1 29 ? -5.698  12.925  1.818   1.00 0.00 ? 29 ILE A HA   6  
ATOM 7199  H HB   . ILE A 1 29 ? -4.877  11.708  4.466   1.00 0.00 ? 29 ILE A HB   6  
ATOM 7200  H HG12 . ILE A 1 29 ? -5.916  9.970   3.108   1.00 0.00 ? 29 ILE A HG12 6  
ATOM 7201  H HG13 . ILE A 1 29 ? -7.023  10.479  4.365   1.00 0.00 ? 29 ILE A HG13 6  
ATOM 7202  H HG21 . ILE A 1 29 ? -7.195  13.472  3.682   1.00 0.00 ? 29 ILE A HG21 6  
ATOM 7203  H HG22 . ILE A 1 29 ? -5.813  13.936  4.667   1.00 0.00 ? 29 ILE A HG22 6  
ATOM 7204  H HG23 . ILE A 1 29 ? -6.960  12.746  5.266   1.00 0.00 ? 29 ILE A HG23 6  
ATOM 7205  H HD11 . ILE A 1 29 ? -8.196  10.158  2.297   1.00 0.00 ? 29 ILE A HD11 6  
ATOM 7206  H HD12 . ILE A 1 29 ? -7.130  11.284  1.466   1.00 0.00 ? 29 ILE A HD12 6  
ATOM 7207  H HD13 . ILE A 1 29 ? -8.220  11.863  2.724   1.00 0.00 ? 29 ILE A HD13 6  
ATOM 7208  N N    . MET A 1 30 ? -2.696  13.169  3.073   1.00 0.00 ? 30 MET A N    6  
ATOM 7209  C CA   . MET A 1 30 ? -1.628  14.101  3.425   1.00 0.00 ? 30 MET A CA   6  
ATOM 7210  C C    . MET A 1 30 ? -1.369  15.083  2.287   1.00 0.00 ? 30 MET A C    6  
ATOM 7211  O O    . MET A 1 30 ? -1.276  16.292  2.505   1.00 0.00 ? 30 MET A O    6  
ATOM 7212  C CB   . MET A 1 30 ? -0.345  13.335  3.752   1.00 0.00 ? 30 MET A CB   6  
ATOM 7213  C CG   . MET A 1 30 ? 0.796   14.228  4.215   1.00 0.00 ? 30 MET A CG   6  
ATOM 7214  S SD   . MET A 1 30 ? 2.292   13.299  4.600   1.00 0.00 ? 30 MET A SD   6  
ATOM 7215  C CE   . MET A 1 30 ? 1.723   12.298  5.972   1.00 0.00 ? 30 MET A CE   6  
ATOM 7216  H H    . MET A 1 30 ? -2.484  12.208  3.023   1.00 0.00 ? 30 MET A H    6  
ATOM 7217  H HA   . MET A 1 30 ? -1.938  14.655  4.301   1.00 0.00 ? 30 MET A HA   6  
ATOM 7218  H HB2  . MET A 1 30 ? -0.564  12.634  4.541   1.00 0.00 ? 30 MET A HB2  6  
ATOM 7219  H HB3  . MET A 1 30 ? -0.024  12.790  2.874   1.00 0.00 ? 30 MET A HB3  6  
ATOM 7220  H HG2  . MET A 1 30 ? 1.030   14.937  3.436   1.00 0.00 ? 30 MET A HG2  6  
ATOM 7221  H HG3  . MET A 1 30 ? 0.483   14.760  5.101   1.00 0.00 ? 30 MET A HG3  6  
ATOM 7222  H HE1  . MET A 1 30 ? 1.189   12.921  6.675   1.00 0.00 ? 30 MET A HE1  6  
ATOM 7223  H HE2  . MET A 1 30 ? 2.571   11.846  6.464   1.00 0.00 ? 30 MET A HE2  6  
ATOM 7224  H HE3  . MET A 1 30 ? 1.065   11.524  5.605   1.00 0.00 ? 30 MET A HE3  6  
ATOM 7225  N N    . LEU A 1 31 ? -1.254  14.554  1.073   1.00 0.00 ? 31 LEU A N    6  
ATOM 7226  C CA   . LEU A 1 31 ? -1.005  15.382  -0.102  1.00 0.00 ? 31 LEU A CA   6  
ATOM 7227  C C    . LEU A 1 31 ? -2.267  16.134  -0.509  1.00 0.00 ? 31 LEU A C    6  
ATOM 7228  O O    . LEU A 1 31 ? -2.201  17.272  -0.975  1.00 0.00 ? 31 LEU A O    6  
ATOM 7229  C CB   . LEU A 1 31 ? -0.510  14.518  -1.264  1.00 0.00 ? 31 LEU A CB   6  
ATOM 7230  C CG   . LEU A 1 31 ? -0.145  15.286  -2.536  1.00 0.00 ? 31 LEU A CG   6  
ATOM 7231  C CD1  . LEU A 1 31 ? 1.023   16.227  -2.278  1.00 0.00 ? 31 LEU A CD1  6  
ATOM 7232  C CD2  . LEU A 1 31 ? 0.185   14.319  -3.663  1.00 0.00 ? 31 LEU A CD2  6  
ATOM 7233  H H    . LEU A 1 31 ? -1.339  13.577  0.960   1.00 0.00 ? 31 LEU A H    6  
ATOM 7234  H HA   . LEU A 1 31 ? -0.238  16.102  0.150   1.00 0.00 ? 31 LEU A HA   6  
ATOM 7235  H HB2  . LEU A 1 31 ? 0.362   13.970  -0.928  1.00 0.00 ? 31 LEU A HB2  6  
ATOM 7236  H HB3  . LEU A 1 31 ? -1.287  13.803  -1.505  1.00 0.00 ? 31 LEU A HB3  6  
ATOM 7237  H HG   . LEU A 1 31 ? -0.988  15.883  -2.851  1.00 0.00 ? 31 LEU A HG   6  
ATOM 7238  H HD11 . LEU A 1 31 ? 0.742   16.962  -1.540  1.00 0.00 ? 31 LEU A HD11 6  
ATOM 7239  H HD12 . LEU A 1 31 ? 1.291   16.734  -3.196  1.00 0.00 ? 31 LEU A HD12 6  
ATOM 7240  H HD13 . LEU A 1 31 ? 1.874   15.664  -1.920  1.00 0.00 ? 31 LEU A HD13 6  
ATOM 7241  H HD21 . LEU A 1 31 ? 1.038   13.714  -3.387  1.00 0.00 ? 31 LEU A HD21 6  
ATOM 7242  H HD22 . LEU A 1 31 ? 0.415   14.874  -4.562  1.00 0.00 ? 31 LEU A HD22 6  
ATOM 7243  H HD23 . LEU A 1 31 ? -0.665  13.677  -3.850  1.00 0.00 ? 31 LEU A HD23 6  
ATOM 7244  N N    . TRP A 1 32 ? -3.415  15.489  -0.330  1.00 0.00 ? 32 TRP A N    6  
ATOM 7245  C CA   . TRP A 1 32 ? -4.696  16.096  -0.670  1.00 0.00 ? 32 TRP A CA   6  
ATOM 7246  C C    . TRP A 1 32 ? -4.934  17.341  0.176   1.00 0.00 ? 32 TRP A C    6  
ATOM 7247  O O    . TRP A 1 32 ? -5.590  18.288  -0.261  1.00 0.00 ? 32 TRP A O    6  
ATOM 7248  C CB   . TRP A 1 32 ? -5.830  15.088  -0.460  1.00 0.00 ? 32 TRP A CB   6  
ATOM 7249  C CG   . TRP A 1 32 ? -7.199  15.690  -0.578  1.00 0.00 ? 32 TRP A CG   6  
ATOM 7250  C CD1  . TRP A 1 32 ? -7.773  16.213  -1.701  1.00 0.00 ? 32 TRP A CD1  6  
ATOM 7251  C CD2  . TRP A 1 32 ? -8.166  15.827  0.470   1.00 0.00 ? 32 TRP A CD2  6  
ATOM 7252  N NE1  . TRP A 1 32 ? -9.038  16.669  -1.413  1.00 0.00 ? 32 TRP A NE1  6  
ATOM 7253  C CE2  . TRP A 1 32 ? -9.302  16.443  -0.087  1.00 0.00 ? 32 TRP A CE2  6  
ATOM 7254  C CE3  . TRP A 1 32 ? -8.179  15.487  1.826   1.00 0.00 ? 32 TRP A CE3  6  
ATOM 7255  C CZ2  . TRP A 1 32 ? -10.441 16.725  0.665   1.00 0.00 ? 32 TRP A CZ2  6  
ATOM 7256  C CZ3  . TRP A 1 32 ? -9.308  15.768  2.571   1.00 0.00 ? 32 TRP A CZ3  6  
ATOM 7257  C CH2  . TRP A 1 32 ? -10.426 16.381  1.989   1.00 0.00 ? 32 TRP A CH2  6  
ATOM 7258  H H    . TRP A 1 32 ? -3.409  14.576  0.043   1.00 0.00 ? 32 TRP A H    6  
ATOM 7259  H HA   . TRP A 1 32 ? -4.670  16.382  -1.713  1.00 0.00 ? 32 TRP A HA   6  
ATOM 7260  H HB2  . TRP A 1 32 ? -5.747  14.306  -1.201  1.00 0.00 ? 32 TRP A HB2  6  
ATOM 7261  H HB3  . TRP A 1 32 ? -5.734  14.655  0.524   1.00 0.00 ? 32 TRP A HB3  6  
ATOM 7262  H HD1  . TRP A 1 32 ? -7.292  16.258  -2.667  1.00 0.00 ? 32 TRP A HD1  6  
ATOM 7263  H HE1  . TRP A 1 32 ? -9.651  17.087  -2.053  1.00 0.00 ? 32 TRP A HE1  6  
ATOM 7264  H HE3  . TRP A 1 32 ? -7.326  15.019  2.288   1.00 0.00 ? 32 TRP A HE3  6  
ATOM 7265  H HZ2  . TRP A 1 32 ? -11.311 17.196  0.231   1.00 0.00 ? 32 TRP A HZ2  6  
ATOM 7266  H HZ3  . TRP A 1 32 ? -9.336  15.513  3.620   1.00 0.00 ? 32 TRP A HZ3  6  
ATOM 7267  H HH2  . TRP A 1 32 ? -11.286 16.582  2.610   1.00 0.00 ? 32 TRP A HH2  6  
ATOM 7268  N N    . GLN A 1 33 ? -4.389  17.332  1.386   1.00 0.00 ? 33 GLN A N    6  
ATOM 7269  C CA   . GLN A 1 33 ? -4.536  18.457  2.300   1.00 0.00 ? 33 GLN A CA   6  
ATOM 7270  C C    . GLN A 1 33 ? -3.262  19.294  2.332   1.00 0.00 ? 33 GLN A C    6  
ATOM 7271  O O    . GLN A 1 33 ? -3.184  20.295  3.046   1.00 0.00 ? 33 GLN A O    6  
ATOM 7272  C CB   . GLN A 1 33 ? -4.870  17.952  3.704   1.00 0.00 ? 33 GLN A CB   6  
ATOM 7273  C CG   . GLN A 1 33 ? -5.655  18.949  4.541   1.00 0.00 ? 33 GLN A CG   6  
ATOM 7274  C CD   . GLN A 1 33 ? -6.987  19.318  3.912   1.00 0.00 ? 33 GLN A CD   6  
ATOM 7275  O OE1  . GLN A 1 33 ? -7.486  20.428  4.097   1.00 0.00 ? 33 GLN A OE1  6  
ATOM 7276  N NE2  . GLN A 1 33 ? -7.572  18.387  3.163   1.00 0.00 ? 33 GLN A NE2  6  
ATOM 7277  H H    . GLN A 1 33 ? -3.871  16.553  1.691   1.00 0.00 ? 33 GLN A H    6  
ATOM 7278  H HA   . GLN A 1 33 ? -5.338  19.088  1.943   1.00 0.00 ? 33 GLN A HA   6  
ATOM 7279  H HB2  . GLN A 1 33 ? -5.438  17.038  3.634   1.00 0.00 ? 33 GLN A HB2  6  
ATOM 7280  H HB3  . GLN A 1 33 ? -3.951  17.731  4.233   1.00 0.00 ? 33 GLN A HB3  6  
ATOM 7281  H HG2  . GLN A 1 33 ? -5.841  18.516  5.513   1.00 0.00 ? 33 GLN A HG2  6  
ATOM 7282  H HG3  . GLN A 1 33 ? -5.066  19.847  4.654   1.00 0.00 ? 33 GLN A HG3  6  
ATOM 7283  H HE21 . GLN A 1 33 ? -7.155  17.522  3.046   1.00 0.00 ? 33 GLN A HE21 6  
ATOM 7284  H HE22 . GLN A 1 33 ? -8.428  18.621  2.747   1.00 0.00 ? 33 GLN A HE22 6  
ATOM 7285  N N    . LYS A 1 34 ? -2.268  18.871  1.555   1.00 0.00 ? 34 LYS A N    6  
ATOM 7286  C CA   . LYS A 1 34 ? -0.988  19.573  1.478   1.00 0.00 ? 34 LYS A CA   6  
ATOM 7287  C C    . LYS A 1 34 ? -0.296  19.615  2.838   1.00 0.00 ? 34 LYS A C    6  
ATOM 7288  O O    . LYS A 1 34 ? 0.537   18.763  3.146   1.00 0.00 ? 34 LYS A O    6  
ATOM 7289  C CB   . LYS A 1 34 ? -1.188  20.993  0.941   1.00 0.00 ? 34 LYS A CB   6  
ATOM 7290  C CG   . LYS A 1 34 ? 0.105   21.780  0.806   1.00 0.00 ? 34 LYS A CG   6  
ATOM 7291  C CD   . LYS A 1 34 ? 1.027   21.165  -0.234  1.00 0.00 ? 34 LYS A CD   6  
ATOM 7292  C CE   . LYS A 1 34 ? 2.332   21.936  -0.345  1.00 0.00 ? 34 LYS A CE   6  
ATOM 7293  N NZ   . LYS A 1 34 ? 2.101   23.366  -0.686  1.00 0.00 ? 34 LYS A NZ   6  
ATOM 7294  H H    . LYS A 1 34 ? -2.374  18.080  1.015   1.00 0.00 ? 34 LYS A H    6  
ATOM 7295  H HA   . LYS A 1 34 ? -0.364  19.023  0.792   1.00 0.00 ? 34 LYS A HA   6  
ATOM 7296  H HB2  . LYS A 1 34 ? -1.643  20.924  -0.038  1.00 0.00 ? 34 LYS A HB2  6  
ATOM 7297  H HB3  . LYS A 1 34 ? -1.853  21.543  1.580   1.00 0.00 ? 34 LYS A HB3  6  
ATOM 7298  H HG2  . LYS A 1 34 ? -0.143  22.785  0.497   1.00 0.00 ? 34 LYS A HG2  6  
ATOM 7299  H HG3  . LYS A 1 34 ? 0.613   21.818  1.757   1.00 0.00 ? 34 LYS A HG3  6  
ATOM 7300  H HD2  . LYS A 1 34 ? 1.258   20.149  0.044   1.00 0.00 ? 34 LYS A HD2  6  
ATOM 7301  H HD3  . LYS A 1 34 ? 0.533   21.175  -1.195  1.00 0.00 ? 34 LYS A HD3  6  
ATOM 7302  H HE2  . LYS A 1 34 ? 2.854   21.879  0.599   1.00 0.00 ? 34 LYS A HE2  6  
ATOM 7303  H HE3  . LYS A 1 34 ? 2.937   21.484  -1.117  1.00 0.00 ? 34 LYS A HE3  6  
ATOM 7304  H HZ1  . LYS A 1 34 ? 1.432   23.454  -1.481  1.00 0.00 ? 34 LYS A HZ1  6  
ATOM 7305  H HZ2  . LYS A 1 34 ? 3.000   23.811  -0.961  1.00 0.00 ? 34 LYS A HZ2  6  
ATOM 7306  H HZ3  . LYS A 1 34 ? 1.718   23.876  0.135   1.00 0.00 ? 34 LYS A HZ3  6  
ATOM 7307  N N    . LYS A 1 35 ? -0.645  20.610  3.648   1.00 0.00 ? 35 LYS A N    6  
ATOM 7308  C CA   . LYS A 1 35 ? -0.055  20.763  4.973   1.00 0.00 ? 35 LYS A CA   6  
ATOM 7309  C C    . LYS A 1 35 ? -0.396  19.572  5.865   1.00 0.00 ? 35 LYS A C    6  
ATOM 7310  O O    . LYS A 1 35 ? -1.405  18.900  5.650   1.00 0.00 ? 35 LYS A O    6  
ATOM 7311  C CB   . LYS A 1 35 ? -0.545  22.057  5.625   1.00 0.00 ? 35 LYS A CB   6  
ATOM 7312  C CG   . LYS A 1 35 ? -0.078  23.316  4.910   1.00 0.00 ? 35 LYS A CG   6  
ATOM 7313  C CD   . LYS A 1 35 ? -0.605  24.574  5.588   1.00 0.00 ? 35 LYS A CD   6  
ATOM 7314  C CE   . LYS A 1 35 ? -0.023  24.746  6.983   1.00 0.00 ? 35 LYS A CE   6  
ATOM 7315  N NZ   . LYS A 1 35 ? -0.560  25.955  7.666   1.00 0.00 ? 35 LYS A NZ   6  
ATOM 7316  H H    . LYS A 1 35 ? -1.322  21.260  3.370   1.00 0.00 ? 35 LYS A H    6  
ATOM 7317  H HA   . LYS A 1 35 ? 1.014   20.821  4.839   1.00 0.00 ? 35 LYS A HA   6  
ATOM 7318  H HB2  . LYS A 1 35 ? -1.627  22.050  5.638   1.00 0.00 ? 35 LYS A HB2  6  
ATOM 7319  H HB3  . LYS A 1 35 ? -0.181  22.084  6.641   1.00 0.00 ? 35 LYS A HB3  6  
ATOM 7320  H HG2  . LYS A 1 35 ? 1.003   23.339  4.907   1.00 0.00 ? 35 LYS A HG2  6  
ATOM 7321  H HG3  . LYS A 1 35 ? -0.439  23.291  3.892   1.00 0.00 ? 35 LYS A HG3  6  
ATOM 7322  H HD2  . LYS A 1 35 ? -0.331  25.431  4.991   1.00 0.00 ? 35 LYS A HD2  6  
ATOM 7323  H HD3  . LYS A 1 35 ? -1.683  24.516  5.660   1.00 0.00 ? 35 LYS A HD3  6  
ATOM 7324  H HE2  . LYS A 1 35 ? -0.268  23.886  7.585   1.00 0.00 ? 35 LYS A HE2  6  
ATOM 7325  H HE3  . LYS A 1 35 ? 1.051   24.838  6.906   1.00 0.00 ? 35 LYS A HE3  6  
ATOM 7326  H HZ1  . LYS A 1 35 ? -0.143  26.041  8.615   1.00 0.00 ? 35 LYS A HZ1  6  
ATOM 7327  H HZ2  . LYS A 1 35 ? -1.594  25.887  7.763   1.00 0.00 ? 35 LYS A HZ2  6  
ATOM 7328  H HZ3  . LYS A 1 35 ? -0.329  26.812  7.121   1.00 0.00 ? 35 LYS A HZ3  6  
ATOM 7329  N N    . PRO A 1 36 ? 0.444   19.293  6.880   1.00 0.00 ? 36 PRO A N    6  
ATOM 7330  C CA   . PRO A 1 36 ? 0.217   18.175  7.804   1.00 0.00 ? 36 PRO A CA   6  
ATOM 7331  C C    . PRO A 1 36 ? -1.156  18.243  8.461   1.00 0.00 ? 36 PRO A C    6  
ATOM 7332  O O    . PRO A 1 36 ? -1.807  19.287  8.456   1.00 0.00 ? 36 PRO A O    6  
ATOM 7333  C CB   . PRO A 1 36 ? 1.320   18.345  8.854   1.00 0.00 ? 36 PRO A CB   6  
ATOM 7334  C CG   . PRO A 1 36 ? 2.386   19.126  8.166   1.00 0.00 ? 36 PRO A CG   6  
ATOM 7335  C CD   . PRO A 1 36 ? 1.677   20.036  7.206   1.00 0.00 ? 36 PRO A CD   6  
ATOM 7336  H HA   . PRO A 1 36 ? 0.333   17.223  7.306   1.00 0.00 ? 36 PRO A HA   6  
ATOM 7337  H HB2  . PRO A 1 36 ? 0.947   18.879  9.720   1.00 0.00 ? 36 PRO A HB2  6  
ATOM 7338  H HB3  . PRO A 1 36 ? 1.683   17.374  9.155   1.00 0.00 ? 36 PRO A HB3  6  
ATOM 7339  H HG2  . PRO A 1 36 ? 2.943   19.704  8.889   1.00 0.00 ? 36 PRO A HG2  6  
ATOM 7340  H HG3  . PRO A 1 36 ? 3.044   18.457  7.632   1.00 0.00 ? 36 PRO A HG3  6  
ATOM 7341  H HD2  . PRO A 1 36 ? 1.447   20.980  7.679   1.00 0.00 ? 36 PRO A HD2  6  
ATOM 7342  H HD3  . PRO A 1 36 ? 2.284   20.188  6.328   1.00 0.00 ? 36 PRO A HD3  6  
ATOM 7343  N N    . ARG A 1 37 ? -1.591  17.122  9.025   1.00 0.00 ? 37 ARG A N    6  
ATOM 7344  C CA   . ARG A 1 37 ? -2.891  17.054  9.683   1.00 0.00 ? 37 ARG A CA   6  
ATOM 7345  C C    . ARG A 1 37 ? -2.784  17.480  11.143  1.00 0.00 ? 37 ARG A C    6  
ATOM 7346  O O    . ARG A 1 37 ? -1.935  16.982  11.885  1.00 0.00 ? 37 ARG A O    6  
ATOM 7347  C CB   . ARG A 1 37 ? -3.453  15.633  9.591   1.00 0.00 ? 37 ARG A CB   6  
ATOM 7348  C CG   . ARG A 1 37 ? -4.915  15.530  9.987   1.00 0.00 ? 37 ARG A CG   6  
ATOM 7349  C CD   . ARG A 1 37 ? -5.421  14.100  9.875   1.00 0.00 ? 37 ARG A CD   6  
ATOM 7350  N NE   . ARG A 1 37 ? -6.866  14.016  10.068  1.00 0.00 ? 37 ARG A NE   6  
ATOM 7351  C CZ   . ARG A 1 37 ? -7.544  12.871  10.089  1.00 0.00 ? 37 ARG A CZ   6  
ATOM 7352  N NH1  . ARG A 1 37 ? -6.908  11.716  9.941   1.00 0.00 ? 37 ARG A NH1  6  
ATOM 7353  N NH2  . ARG A 1 37 ? -8.858  12.881  10.260  1.00 0.00 ? 37 ARG A NH2  6  
ATOM 7354  H H    . ARG A 1 37 ? -1.023  16.315  9.001   1.00 0.00 ? 37 ARG A H    6  
ATOM 7355  H HA   . ARG A 1 37 ? -3.570  17.725  9.163   1.00 0.00 ? 37 ARG A HA   6  
ATOM 7356  H HB2  . ARG A 1 37 ? -3.356  15.293  8.568   1.00 0.00 ? 37 ARG A HB2  6  
ATOM 7357  H HB3  . ARG A 1 37 ? -2.875  14.978  10.232  1.00 0.00 ? 37 ARG A HB3  6  
ATOM 7358  H HG2  . ARG A 1 37 ? -5.027  15.861  11.009  1.00 0.00 ? 37 ARG A HG2  6  
ATOM 7359  H HG3  . ARG A 1 37 ? -5.500  16.162  9.335   1.00 0.00 ? 37 ARG A HG3  6  
ATOM 7360  H HD2  . ARG A 1 37 ? -5.181  13.714  8.892   1.00 0.00 ? 37 ARG A HD2  6  
ATOM 7361  H HD3  . ARG A 1 37 ? -4.929  13.500  10.627  1.00 0.00 ? 37 ARG A HD3  6  
ATOM 7362  H HE   . ARG A 1 37 ? -7.365  14.858  10.184  1.00 0.00 ? 37 ARG A HE   6  
ATOM 7363  H HH11 . ARG A 1 37 ? -5.918  11.681  9.812   1.00 0.00 ? 37 ARG A HH11 6  
ATOM 7364  H HH12 . ARG A 1 37 ? -7.427  10.858  9.958   1.00 0.00 ? 37 ARG A HH12 6  
ATOM 7365  H HH21 . ARG A 1 37 ? -9.345  13.750  10.374  1.00 0.00 ? 37 ARG A HH21 6  
ATOM 7366  H HH22 . ARG A 1 37 ? -9.371  12.020  10.276  1.00 0.00 ? 37 ARG A HH22 6  
ATOM 7367  N N    . TYR A 1 38 ? -3.648  18.404  11.550  1.00 0.00 ? 38 TYR A N    6  
ATOM 7368  C CA   . TYR A 1 38 ? -3.653  18.898  12.923  1.00 0.00 ? 38 TYR A CA   6  
ATOM 7369  C C    . TYR A 1 38 ? -5.040  19.403  13.311  1.00 0.00 ? 38 TYR A C    6  
ATOM 7370  O O    . TYR A 1 38 ? -5.580  20.309  12.678  1.00 0.00 ? 38 TYR A O    6  
ATOM 7371  C CB   . TYR A 1 38 ? -2.623  20.019  13.090  1.00 0.00 ? 38 TYR A CB   6  
ATOM 7372  C CG   . TYR A 1 38 ? -2.504  20.536  14.509  1.00 0.00 ? 38 TYR A CG   6  
ATOM 7373  C CD1  . TYR A 1 38 ? -3.297  21.586  14.957  1.00 0.00 ? 38 TYR A CD1  6  
ATOM 7374  C CD2  . TYR A 1 38 ? -1.597  19.975  15.399  1.00 0.00 ? 38 TYR A CD2  6  
ATOM 7375  C CE1  . TYR A 1 38 ? -3.187  22.062  16.249  1.00 0.00 ? 38 TYR A CE1  6  
ATOM 7376  C CE2  . TYR A 1 38 ? -1.481  20.446  16.693  1.00 0.00 ? 38 TYR A CE2  6  
ATOM 7377  C CZ   . TYR A 1 38 ? -2.280  21.489  17.113  1.00 0.00 ? 38 TYR A CZ   6  
ATOM 7378  O OH   . TYR A 1 38 ? -2.169  21.962  18.400  1.00 0.00 ? 38 TYR A OH   6  
ATOM 7379  H H    . TYR A 1 38 ? -4.304  18.771  10.910  1.00 0.00 ? 38 TYR A H    6  
ATOM 7380  H HA   . TYR A 1 38 ? -3.380  18.078  13.580  1.00 0.00 ? 38 TYR A HA   6  
ATOM 7381  H HB2  . TYR A 1 38 ? -1.654  19.647  12.782  1.00 0.00 ? 38 TYR A HB2  6  
ATOM 7382  H HB3  . TYR A 1 38 ? -2.894  20.847  12.446  1.00 0.00 ? 38 TYR A HB3  6  
ATOM 7383  H HD1  . TYR A 1 38 ? -4.010  22.036  14.280  1.00 0.00 ? 38 TYR A HD1  6  
ATOM 7384  H HD2  . TYR A 1 38 ? -0.971  19.157  15.070  1.00 0.00 ? 38 TYR A HD2  6  
ATOM 7385  H HE1  . TYR A 1 38 ? -3.813  22.879  16.578  1.00 0.00 ? 38 TYR A HE1  6  
ATOM 7386  H HE2  . TYR A 1 38 ? -0.769  19.996  17.370  1.00 0.00 ? 38 TYR A HE2  6  
ATOM 7387  H HH   . TYR A 1 38 ? -1.481  22.630  18.438  1.00 0.00 ? 38 TYR A HH   6  
ATOM 7388  N N    . GLU A 1 39 ? -5.607  18.811  14.358  1.00 0.00 ? 39 GLU A N    6  
ATOM 7389  C CA   . GLU A 1 39 ? -6.929  19.201  14.834  1.00 0.00 ? 39 GLU A CA   6  
ATOM 7390  C C    . GLU A 1 39 ? -6.944  19.319  16.353  1.00 0.00 ? 39 GLU A C    6  
ATOM 7391  O O    . GLU A 1 39 ? -7.313  20.358  16.902  1.00 0.00 ? 39 GLU A O    6  
ATOM 7392  C CB   . GLU A 1 39 ? -7.979  18.186  14.377  1.00 0.00 ? 39 GLU A CB   6  
ATOM 7393  C CG   . GLU A 1 39 ? -8.064  18.037  12.866  1.00 0.00 ? 39 GLU A CG   6  
ATOM 7394  C CD   . GLU A 1 39 ? -9.148  17.069  12.436  1.00 0.00 ? 39 GLU A CD   6  
ATOM 7395  O OE1  . GLU A 1 39 ? -8.912  15.845  12.497  1.00 0.00 ? 39 GLU A OE1  6  
ATOM 7396  O OE2  . GLU A 1 39 ? -10.235 17.535  12.032  1.00 0.00 ? 39 GLU A OE2  6  
ATOM 7397  O OXT  . GLU A 1 39 ? -6.559  18.324  17.009  1.00 0.00 ? 39 GLU A OXT  6  
ATOM 7398  H H    . GLU A 1 39 ? -5.129  18.088  14.829  1.00 0.00 ? 39 GLU A H    6  
ATOM 7399  H HA   . GLU A 1 39 ? -7.185  20.170  14.424  1.00 0.00 ? 39 GLU A HA   6  
ATOM 7400  H HB2  . GLU A 1 39 ? -7.739  17.219  14.798  1.00 0.00 ? 39 GLU A HB2  6  
ATOM 7401  H HB3  . GLU A 1 39 ? -8.950  18.498  14.741  1.00 0.00 ? 39 GLU A HB3  6  
ATOM 7402  H HG2  . GLU A 1 39 ? -8.273  19.004  12.431  1.00 0.00 ? 39 GLU A HG2  6  
ATOM 7403  H HG3  . GLU A 1 39 ? -7.114  17.677  12.499  1.00 0.00 ? 39 GLU A HG3  6  
ATOM 7404  N N    . GLY B 1 1  ? -14.347 -16.269 -0.704  1.00 0.00 ? 1  GLY B N    6  
ATOM 7405  C CA   . GLY B 1 1  ? -14.625 -16.084 -2.116  1.00 0.00 ? 1  GLY B CA   6  
ATOM 7406  C C    . GLY B 1 1  ? -13.497 -16.578 -3.000  1.00 0.00 ? 1  GLY B C    6  
ATOM 7407  O O    . GLY B 1 1  ? -13.317 -17.783 -3.171  1.00 0.00 ? 1  GLY B O    6  
ATOM 7408  H H1   . GLY B 1 1  ? -14.207 -17.279 -0.489  1.00 0.00 ? 1  GLY B H1   6  
ATOM 7409  H H2   . GLY B 1 1  ? -15.146 -15.917 -0.138  1.00 0.00 ? 1  GLY B H2   6  
ATOM 7410  H H3   . GLY B 1 1  ? -13.489 -15.745 -0.430  1.00 0.00 ? 1  GLY B H3   6  
ATOM 7411  H HA2  . GLY B 1 1  ? -15.523 -16.630 -2.365  1.00 0.00 ? 1  GLY B HA2  6  
ATOM 7412  H HA3  . GLY B 1 1  ? -14.798 -15.033 -2.302  1.00 0.00 ? 1  GLY B HA3  6  
ATOM 7413  N N    . HIS B 1 2  ? -12.738 -15.643 -3.564  1.00 0.00 ? 2  HIS B N    6  
ATOM 7414  C CA   . HIS B 1 2  ? -11.622 -15.988 -4.436  1.00 0.00 ? 2  HIS B CA   6  
ATOM 7415  C C    . HIS B 1 2  ? -10.355 -16.245 -3.626  1.00 0.00 ? 2  HIS B C    6  
ATOM 7416  O O    . HIS B 1 2  ? -9.727  -15.313 -3.124  1.00 0.00 ? 2  HIS B O    6  
ATOM 7417  C CB   . HIS B 1 2  ? -11.376 -14.870 -5.451  1.00 0.00 ? 2  HIS B CB   6  
ATOM 7418  C CG   . HIS B 1 2  ? -12.538 -14.625 -6.363  1.00 0.00 ? 2  HIS B CG   6  
ATOM 7419  N ND1  . HIS B 1 2  ? -13.408 -13.566 -6.210  1.00 0.00 ? 2  HIS B ND1  6  
ATOM 7420  C CD2  . HIS B 1 2  ? -12.971 -15.311 -7.448  1.00 0.00 ? 2  HIS B CD2  6  
ATOM 7421  C CE1  . HIS B 1 2  ? -14.327 -13.612 -7.158  1.00 0.00 ? 2  HIS B CE1  6  
ATOM 7422  N NE2  . HIS B 1 2  ? -14.083 -14.660 -7.922  1.00 0.00 ? 2  HIS B NE2  6  
ATOM 7423  H H    . HIS B 1 2  ? -12.930 -14.691 -3.387  1.00 0.00 ? 2  HIS B H    6  
ATOM 7424  H HA   . HIS B 1 2  ? -11.881 -16.891 -4.983  1.00 0.00 ? 2  HIS B HA   6  
ATOM 7425  H HB2  . HIS B 1 2  ? -11.171 -13.950 -4.923  1.00 0.00 ? 2  HIS B HB2  6  
ATOM 7426  H HB3  . HIS B 1 2  ? -10.523 -15.125 -6.067  1.00 0.00 ? 2  HIS B HB3  6  
ATOM 7427  H HD1  . HIS B 1 2  ? -13.360 -12.882 -5.510  1.00 0.00 ? 2  HIS B HD1  6  
ATOM 7428  H HD2  . HIS B 1 2  ? -12.524 -16.204 -7.863  1.00 0.00 ? 2  HIS B HD2  6  
ATOM 7429  H HE1  . HIS B 1 2  ? -15.138 -12.911 -7.287  1.00 0.00 ? 2  HIS B HE1  6  
ATOM 7430  H HE2  . HIS B 1 2  ? -14.656 -14.971 -8.654  1.00 0.00 ? 2  HIS B HE2  6  
ATOM 7431  N N    . SER B 1 3  ? -9.986  -17.516 -3.504  1.00 0.00 ? 3  SER B N    6  
ATOM 7432  C CA   . SER B 1 3  ? -8.794  -17.898 -2.753  1.00 0.00 ? 3  SER B CA   6  
ATOM 7433  C C    . SER B 1 3  ? -7.526  -17.554 -3.525  1.00 0.00 ? 3  SER B C    6  
ATOM 7434  O O    . SER B 1 3  ? -7.586  -17.073 -4.656  1.00 0.00 ? 3  SER B O    6  
ATOM 7435  C CB   . SER B 1 3  ? -8.822  -19.397 -2.440  1.00 0.00 ? 3  SER B CB   6  
ATOM 7436  O OG   . SER B 1 3  ? -8.851  -20.165 -3.630  1.00 0.00 ? 3  SER B OG   6  
ATOM 7437  H H    . SER B 1 3  ? -10.529 -18.221 -3.932  1.00 0.00 ? 3  SER B H    6  
ATOM 7438  H HA   . SER B 1 3  ? -8.789  -17.351 -1.818  1.00 0.00 ? 3  SER B HA   6  
ATOM 7439  H HB2  . SER B 1 3  ? -7.947  -19.671 -1.869  1.00 0.00 ? 3  SER B HB2  6  
ATOM 7440  H HB3  . SER B 1 3  ? -9.708  -19.622 -1.864  1.00 0.00 ? 3  SER B HB3  6  
ATOM 7441  H HG   . SER B 1 3  ? -9.060  -21.077 -3.417  1.00 0.00 ? 3  SER B HG   6  
ATOM 7442  N N    . LEU B 1 4  ? -6.378  -17.804 -2.902  1.00 0.00 ? 4  LEU B N    6  
ATOM 7443  C CA   . LEU B 1 4  ? -5.090  -17.523 -3.522  1.00 0.00 ? 4  LEU B CA   6  
ATOM 7444  C C    . LEU B 1 4  ? -4.307  -18.818 -3.747  1.00 0.00 ? 4  LEU B C    6  
ATOM 7445  O O    . LEU B 1 4  ? -3.959  -19.506 -2.788  1.00 0.00 ? 4  LEU B O    6  
ATOM 7446  C CB   . LEU B 1 4  ? -4.279  -16.571 -2.640  1.00 0.00 ? 4  LEU B CB   6  
ATOM 7447  C CG   . LEU B 1 4  ? -4.987  -15.264 -2.278  1.00 0.00 ? 4  LEU B CG   6  
ATOM 7448  C CD1  . LEU B 1 4  ? -4.153  -14.459 -1.294  1.00 0.00 ? 4  LEU B CD1  6  
ATOM 7449  C CD2  . LEU B 1 4  ? -5.272  -14.449 -3.531  1.00 0.00 ? 4  LEU B CD2  6  
ATOM 7450  H H    . LEU B 1 4  ? -6.386  -18.188 -1.995  1.00 0.00 ? 4  LEU B H    6  
ATOM 7451  H HA   . LEU B 1 4  ? -5.258  -17.031 -4.463  1.00 0.00 ? 4  LEU B HA   6  
ATOM 7452  H HB2  . LEU B 1 4  ? -4.034  -17.091 -1.719  1.00 0.00 ? 4  LEU B HB2  6  
ATOM 7453  H HB3  . LEU B 1 4  ? -3.356  -16.330 -3.152  1.00 0.00 ? 4  LEU B HB3  6  
ATOM 7454  H HG   . LEU B 1 4  ? -5.931  -15.492 -1.805  1.00 0.00 ? 4  LEU B HG   6  
ATOM 7455  H HD11 . LEU B 1 4  ? -3.202  -14.205 -1.743  1.00 0.00 ? 4  LEU B HD11 6  
ATOM 7456  H HD12 . LEU B 1 4  ? -3.983  -15.043 -0.400  1.00 0.00 ? 4  LEU B HD12 6  
ATOM 7457  H HD13 . LEU B 1 4  ? -4.679  -13.552 -1.030  1.00 0.00 ? 4  LEU B HD13 6  
ATOM 7458  H HD21 . LEU B 1 4  ? -5.938  -14.998 -4.180  1.00 0.00 ? 4  LEU B HD21 6  
ATOM 7459  H HD22 . LEU B 1 4  ? -4.347  -14.245 -4.053  1.00 0.00 ? 4  LEU B HD22 6  
ATOM 7460  H HD23 . LEU B 1 4  ? -5.740  -13.513 -3.256  1.00 0.00 ? 4  LEU B HD23 6  
ATOM 7461  N N    . PRO B 1 5  ? -4.019  -19.170 -5.017  1.00 0.00 ? 5  PRO B N    6  
ATOM 7462  C CA   . PRO B 1 5  ? -3.275  -20.393 -5.342  1.00 0.00 ? 5  PRO B CA   6  
ATOM 7463  C C    . PRO B 1 5  ? -1.945  -20.483 -4.604  1.00 0.00 ? 5  PRO B C    6  
ATOM 7464  O O    . PRO B 1 5  ? -1.489  -19.512 -4.002  1.00 0.00 ? 5  PRO B O    6  
ATOM 7465  C CB   . PRO B 1 5  ? -3.043  -20.284 -6.852  1.00 0.00 ? 5  PRO B CB   6  
ATOM 7466  C CG   . PRO B 1 5  ? -4.143  -19.405 -7.336  1.00 0.00 ? 5  PRO B CG   6  
ATOM 7467  C CD   . PRO B 1 5  ? -4.395  -18.420 -6.231  1.00 0.00 ? 5  PRO B CD   6  
ATOM 7468  H HA   . PRO B 1 5  ? -3.861  -21.276 -5.130  1.00 0.00 ? 5  PRO B HA   6  
ATOM 7469  H HB2  . PRO B 1 5  ? -2.078  -19.860 -7.051  1.00 0.00 ? 5  PRO B HB2  6  
ATOM 7470  H HB3  . PRO B 1 5  ? -3.105  -21.266 -7.297  1.00 0.00 ? 5  PRO B HB3  6  
ATOM 7471  H HG2  . PRO B 1 5  ? -3.850  -18.901 -8.238  1.00 0.00 ? 5  PRO B HG2  6  
ATOM 7472  H HG3  . PRO B 1 5  ? -5.029  -19.997 -7.513  1.00 0.00 ? 5  PRO B HG3  6  
ATOM 7473  H HD2  . PRO B 1 5  ? -3.792  -17.539 -6.354  1.00 0.00 ? 5  PRO B HD2  6  
ATOM 7474  H HD3  . PRO B 1 5  ? -5.442  -18.158 -6.209  1.00 0.00 ? 5  PRO B HD3  6  
ATOM 7475  N N    . PHE B 1 6  ? -1.330  -21.660 -4.660  1.00 0.00 ? 6  PHE B N    6  
ATOM 7476  C CA   . PHE B 1 6  ? -0.054  -21.904 -3.995  1.00 0.00 ? 6  PHE B CA   6  
ATOM 7477  C C    . PHE B 1 6  ? 1.062   -21.042 -4.586  1.00 0.00 ? 6  PHE B C    6  
ATOM 7478  O O    . PHE B 1 6  ? 1.764   -20.338 -3.862  1.00 0.00 ? 6  PHE B O    6  
ATOM 7479  C CB   . PHE B 1 6  ? 0.305   -23.390 -4.103  1.00 0.00 ? 6  PHE B CB   6  
ATOM 7480  C CG   . PHE B 1 6  ? 1.766   -23.691 -3.917  1.00 0.00 ? 6  PHE B CG   6  
ATOM 7481  C CD1  . PHE B 1 6  ? 2.331   -23.714 -2.651  1.00 0.00 ? 6  PHE B CD1  6  
ATOM 7482  C CD2  . PHE B 1 6  ? 2.574   -23.952 -5.012  1.00 0.00 ? 6  PHE B CD2  6  
ATOM 7483  C CE1  . PHE B 1 6  ? 3.675   -23.992 -2.484  1.00 0.00 ? 6  PHE B CE1  6  
ATOM 7484  C CE2  . PHE B 1 6  ? 3.916   -24.230 -4.851  1.00 0.00 ? 6  PHE B CE2  6  
ATOM 7485  C CZ   . PHE B 1 6  ? 4.468   -24.250 -3.585  1.00 0.00 ? 6  PHE B CZ   6  
ATOM 7486  H H    . PHE B 1 6  ? -1.754  -22.396 -5.165  1.00 0.00 ? 6  PHE B H    6  
ATOM 7487  H HA   . PHE B 1 6  ? -0.167  -21.653 -2.949  1.00 0.00 ? 6  PHE B HA   6  
ATOM 7488  H HB2  . PHE B 1 6  ? -0.246  -23.933 -3.347  1.00 0.00 ? 6  PHE B HB2  6  
ATOM 7489  H HB3  . PHE B 1 6  ? 0.002   -23.756 -5.078  1.00 0.00 ? 6  PHE B HB3  6  
ATOM 7490  H HD1  . PHE B 1 6  ? 1.714   -23.513 -1.786  1.00 0.00 ? 6  PHE B HD1  6  
ATOM 7491  H HD2  . PHE B 1 6  ? 2.148   -23.937 -6.006  1.00 0.00 ? 6  PHE B HD2  6  
ATOM 7492  H HE1  . PHE B 1 6  ? 4.105   -24.007 -1.493  1.00 0.00 ? 6  PHE B HE1  6  
ATOM 7493  H HE2  . PHE B 1 6  ? 4.534   -24.432 -5.714  1.00 0.00 ? 6  PHE B HE2  6  
ATOM 7494  H HZ   . PHE B 1 6  ? 5.518   -24.467 -3.456  1.00 0.00 ? 6  PHE B HZ   6  
ATOM 7495  N N    . LYS B 1 7  ? 1.222   -21.108 -5.901  1.00 0.00 ? 7  LYS B N    6  
ATOM 7496  C CA   . LYS B 1 7  ? 2.263   -20.345 -6.583  1.00 0.00 ? 7  LYS B CA   6  
ATOM 7497  C C    . LYS B 1 7  ? 1.962   -18.847 -6.579  1.00 0.00 ? 7  LYS B C    6  
ATOM 7498  O O    . LYS B 1 7  ? 2.873   -18.025 -6.504  1.00 0.00 ? 7  LYS B O    6  
ATOM 7499  C CB   . LYS B 1 7  ? 2.415   -20.843 -8.021  1.00 0.00 ? 7  LYS B CB   6  
ATOM 7500  C CG   . LYS B 1 7  ? 3.592   -20.230 -8.763  1.00 0.00 ? 7  LYS B CG   6  
ATOM 7501  C CD   . LYS B 1 7  ? 3.731   -20.805 -10.164 1.00 0.00 ? 7  LYS B CD   6  
ATOM 7502  C CE   . LYS B 1 7  ? 4.099   -22.281 -10.128 1.00 0.00 ? 7  LYS B CE   6  
ATOM 7503  N NZ   . LYS B 1 7  ? 4.180   -22.867 -11.494 1.00 0.00 ? 7  LYS B NZ   6  
ATOM 7504  H H    . LYS B 1 7  ? 0.628   -21.693 -6.430  1.00 0.00 ? 7  LYS B H    6  
ATOM 7505  H HA   . LYS B 1 7  ? 3.198   -20.510 -6.061  1.00 0.00 ? 7  LYS B HA   6  
ATOM 7506  H HB2  . LYS B 1 7  ? 2.544   -21.911 -7.982  1.00 0.00 ? 7  LYS B HB2  6  
ATOM 7507  H HB3  . LYS B 1 7  ? 1.508   -20.621 -8.570  1.00 0.00 ? 7  LYS B HB3  6  
ATOM 7508  H HG2  . LYS B 1 7  ? 3.439   -19.164 -8.844  1.00 0.00 ? 7  LYS B HG2  6  
ATOM 7509  H HG3  . LYS B 1 7  ? 4.500   -20.422 -8.207  1.00 0.00 ? 7  LYS B HG3  6  
ATOM 7510  H HD2  . LYS B 1 7  ? 2.796   -20.689 -10.694 1.00 0.00 ? 7  LYS B HD2  6  
ATOM 7511  H HD3  . LYS B 1 7  ? 4.508   -20.265 -10.685 1.00 0.00 ? 7  LYS B HD3  6  
ATOM 7512  H HE2  . LYS B 1 7  ? 5.058   -22.391 -9.646  1.00 0.00 ? 7  LYS B HE2  6  
ATOM 7513  H HE3  . LYS B 1 7  ? 3.355   -22.828 -9.572  1.00 0.00 ? 7  LYS B HE3  6  
ATOM 7514  H HZ1  . LYS B 1 7  ? 3.262   -22.783 -11.979 1.00 0.00 ? 7  LYS B HZ1  6  
ATOM 7515  H HZ2  . LYS B 1 7  ? 4.433   -23.874 -11.434 1.00 0.00 ? 7  LYS B HZ2  6  
ATOM 7516  H HZ3  . LYS B 1 7  ? 4.905   -22.375 -12.057 1.00 0.00 ? 7  LYS B HZ3  6  
ATOM 7517  N N    . VAL B 1 8  ? 0.681   -18.501 -6.658  1.00 0.00 ? 8  VAL B N    6  
ATOM 7518  C CA   . VAL B 1 8  ? 0.265   -17.102 -6.684  1.00 0.00 ? 8  VAL B CA   6  
ATOM 7519  C C    . VAL B 1 8  ? 0.431   -16.421 -5.323  1.00 0.00 ? 8  VAL B C    6  
ATOM 7520  O O    . VAL B 1 8  ? 0.848   -15.265 -5.251  1.00 0.00 ? 8  VAL B O    6  
ATOM 7521  C CB   . VAL B 1 8  ? -1.203  -16.966 -7.136  1.00 0.00 ? 8  VAL B CB   6  
ATOM 7522  C CG1  . VAL B 1 8  ? -1.602  -15.500 -7.236  1.00 0.00 ? 8  VAL B CG1  6  
ATOM 7523  C CG2  . VAL B 1 8  ? -1.419  -17.671 -8.464  1.00 0.00 ? 8  VAL B CG2  6  
ATOM 7524  H H    . VAL B 1 8  ? -0.007  -19.202 -6.709  1.00 0.00 ? 8  VAL B H    6  
ATOM 7525  H HA   . VAL B 1 8  ? 0.885   -16.581 -7.406  1.00 0.00 ? 8  VAL B HA   6  
ATOM 7526  H HB   . VAL B 1 8  ? -1.825  -17.440 -6.397  1.00 0.00 ? 8  VAL B HB   6  
ATOM 7527  H HG11 . VAL B 1 8  ? -2.592  -15.420 -7.669  1.00 0.00 ? 8  VAL B HG11 6  
ATOM 7528  H HG12 . VAL B 1 8  ? -0.898  -14.970 -7.862  1.00 0.00 ? 8  VAL B HG12 6  
ATOM 7529  H HG13 . VAL B 1 8  ? -1.614  -15.054 -6.253  1.00 0.00 ? 8  VAL B HG13 6  
ATOM 7530  H HG21 . VAL B 1 8  ? -0.763  -17.240 -9.209  1.00 0.00 ? 8  VAL B HG21 6  
ATOM 7531  H HG22 . VAL B 1 8  ? -2.441  -17.541 -8.782  1.00 0.00 ? 8  VAL B HG22 6  
ATOM 7532  H HG23 . VAL B 1 8  ? -1.206  -18.720 -8.373  1.00 0.00 ? 8  VAL B HG23 6  
ATOM 7533  N N    . VAL B 1 9  ? 0.104   -17.137 -4.251  1.00 0.00 ? 9  VAL B N    6  
ATOM 7534  C CA   . VAL B 1 9  ? 0.201   -16.577 -2.905  1.00 0.00 ? 9  VAL B CA   6  
ATOM 7535  C C    . VAL B 1 9  ? 1.651   -16.322 -2.495  1.00 0.00 ? 9  VAL B C    6  
ATOM 7536  O O    . VAL B 1 9  ? 1.948   -15.328 -1.830  1.00 0.00 ? 9  VAL B O    6  
ATOM 7537  C CB   . VAL B 1 9  ? -0.474  -17.489 -1.858  1.00 0.00 ? 9  VAL B CB   6  
ATOM 7538  C CG1  . VAL B 1 9  ? 0.287   -18.794 -1.691  1.00 0.00 ? 9  VAL B CG1  6  
ATOM 7539  C CG2  . VAL B 1 9  ? -0.601  -16.764 -0.528  1.00 0.00 ? 9  VAL B CG2  6  
ATOM 7540  H H    . VAL B 1 9  ? -0.228  -18.058 -4.363  1.00 0.00 ? 9  VAL B H    6  
ATOM 7541  H HA   . VAL B 1 9  ? -0.324  -15.627 -2.908  1.00 0.00 ? 9  VAL B HA   6  
ATOM 7542  H HB   . VAL B 1 9  ? -1.469  -17.724 -2.207  1.00 0.00 ? 9  VAL B HB   6  
ATOM 7543  H HG11 . VAL B 1 9  ? -0.308  -19.476 -1.101  1.00 0.00 ? 9  VAL B HG11 6  
ATOM 7544  H HG12 . VAL B 1 9  ? 1.229   -18.623 -1.189  1.00 0.00 ? 9  VAL B HG12 6  
ATOM 7545  H HG13 . VAL B 1 9  ? 0.466   -19.225 -2.647  1.00 0.00 ? 9  VAL B HG13 6  
ATOM 7546  H HG21 . VAL B 1 9  ? -1.129  -15.831 -0.671  1.00 0.00 ? 9  VAL B HG21 6  
ATOM 7547  H HG22 . VAL B 1 9  ? 0.379   -16.563 -0.120  1.00 0.00 ? 9  VAL B HG22 6  
ATOM 7548  H HG23 . VAL B 1 9  ? -1.155  -17.381 0.165   1.00 0.00 ? 9  VAL B HG23 6  
ATOM 7549  N N    . VAL B 1 10 ? 2.552   -17.217 -2.890  1.00 0.00 ? 10 VAL B N    6  
ATOM 7550  C CA   . VAL B 1 10 ? 3.965   -17.074 -2.553  1.00 0.00 ? 10 VAL B CA   6  
ATOM 7551  C C    . VAL B 1 10 ? 4.572   -15.855 -3.239  1.00 0.00 ? 10 VAL B C    6  
ATOM 7552  O O    . VAL B 1 10 ? 5.332   -15.101 -2.629  1.00 0.00 ? 10 VAL B O    6  
ATOM 7553  C CB   . VAL B 1 10 ? 4.768   -18.332 -2.945  1.00 0.00 ? 10 VAL B CB   6  
ATOM 7554  C CG1  . VAL B 1 10 ? 6.256   -18.125 -2.695  1.00 0.00 ? 10 VAL B CG1  6  
ATOM 7555  C CG2  . VAL B 1 10 ? 4.261   -19.545 -2.178  1.00 0.00 ? 10 VAL B CG2  6  
ATOM 7556  H H    . VAL B 1 10 ? 2.266   -17.996 -3.422  1.00 0.00 ? 10 VAL B H    6  
ATOM 7557  H HA   . VAL B 1 10 ? 4.047   -16.941 -1.480  1.00 0.00 ? 10 VAL B HA   6  
ATOM 7558  H HB   . VAL B 1 10 ? 4.624   -18.515 -4.000  1.00 0.00 ? 10 VAL B HB   6  
ATOM 7559  H HG11 . VAL B 1 10 ? 6.659   -17.438 -3.424  1.00 0.00 ? 10 VAL B HG11 6  
ATOM 7560  H HG12 . VAL B 1 10 ? 6.777   -19.070 -2.784  1.00 0.00 ? 10 VAL B HG12 6  
ATOM 7561  H HG13 . VAL B 1 10 ? 6.412   -17.727 -1.701  1.00 0.00 ? 10 VAL B HG13 6  
ATOM 7562  H HG21 . VAL B 1 10 ? 4.563   -19.474 -1.141  1.00 0.00 ? 10 VAL B HG21 6  
ATOM 7563  H HG22 . VAL B 1 10 ? 4.680   -20.441 -2.609  1.00 0.00 ? 10 VAL B HG22 6  
ATOM 7564  H HG23 . VAL B 1 10 ? 3.188   -19.598 -2.227  1.00 0.00 ? 10 VAL B HG23 6  
ATOM 7565  N N    . ILE B 1 11 ? 4.234   -15.667 -4.510  1.00 0.00 ? 11 ILE B N    6  
ATOM 7566  C CA   . ILE B 1 11 ? 4.742   -14.538 -5.279  1.00 0.00 ? 11 ILE B CA   6  
ATOM 7567  C C    . ILE B 1 11 ? 4.129   -13.226 -4.798  1.00 0.00 ? 11 ILE B C    6  
ATOM 7568  O O    . ILE B 1 11 ? 4.772   -12.178 -4.837  1.00 0.00 ? 11 ILE B O    6  
ATOM 7569  C CB   . ILE B 1 11 ? 4.460   -14.718 -6.784  1.00 0.00 ? 11 ILE B CB   6  
ATOM 7570  C CG1  . ILE B 1 11 ? 5.113   -16.008 -7.289  1.00 0.00 ? 11 ILE B CG1  6  
ATOM 7571  C CG2  . ILE B 1 11 ? 4.963   -13.516 -7.573  1.00 0.00 ? 11 ILE B CG2  6  
ATOM 7572  C CD1  . ILE B 1 11 ? 4.750   -16.359 -8.716  1.00 0.00 ? 11 ILE B CD1  6  
ATOM 7573  H H    . ILE B 1 11 ? 3.621   -16.303 -4.948  1.00 0.00 ? 11 ILE B H    6  
ATOM 7574  H HA   . ILE B 1 11 ? 5.817   -14.487 -5.140  1.00 0.00 ? 11 ILE B HA   6  
ATOM 7575  H HB   . ILE B 1 11 ? 3.390   -14.787 -6.923  1.00 0.00 ? 11 ILE B HB   6  
ATOM 7576  H HG12 . ILE B 1 11 ? 6.188   -15.901 -7.245  1.00 0.00 ? 11 ILE B HG12 6  
ATOM 7577  H HG13 . ILE B 1 11 ? 4.826   -16.836 -6.667  1.00 0.00 ? 11 ILE B HG13 6  
ATOM 7578  H HG21 . ILE B 1 11 ? 4.800   -13.674 -8.629  1.00 0.00 ? 11 ILE B HG21 6  
ATOM 7579  H HG22 . ILE B 1 11 ? 6.019   -13.380 -7.394  1.00 0.00 ? 11 ILE B HG22 6  
ATOM 7580  H HG23 . ILE B 1 11 ? 4.432   -12.626 -7.271  1.00 0.00 ? 11 ILE B HG23 6  
ATOM 7581  H HD11 . ILE B 1 11 ? 5.224   -15.663 -9.391  1.00 0.00 ? 11 ILE B HD11 6  
ATOM 7582  H HD12 . ILE B 1 11 ? 3.677   -16.312 -8.843  1.00 0.00 ? 11 ILE B HD12 6  
ATOM 7583  H HD13 . ILE B 1 11 ? 5.092   -17.360 -8.936  1.00 0.00 ? 11 ILE B HD13 6  
ATOM 7584  N N    . SER B 1 12 ? 2.883   -13.294 -4.341  1.00 0.00 ? 12 SER B N    6  
ATOM 7585  C CA   . SER B 1 12 ? 2.181   -12.112 -3.849  1.00 0.00 ? 12 SER B CA   6  
ATOM 7586  C C    . SER B 1 12 ? 2.753   -11.652 -2.512  1.00 0.00 ? 12 SER B C    6  
ATOM 7587  O O    . SER B 1 12 ? 2.867   -10.454 -2.254  1.00 0.00 ? 12 SER B O    6  
ATOM 7588  C CB   . SER B 1 12 ? 0.686   -12.401 -3.705  1.00 0.00 ? 12 SER B CB   6  
ATOM 7589  O OG   . SER B 1 12 ? 0.084   -12.619 -4.967  1.00 0.00 ? 12 SER B OG   6  
ATOM 7590  H H    . SER B 1 12 ? 2.412   -14.160 -4.331  1.00 0.00 ? 12 SER B H    6  
ATOM 7591  H HA   . SER B 1 12 ? 2.309   -11.315 -4.572  1.00 0.00 ? 12 SER B HA   6  
ATOM 7592  H HB2  . SER B 1 12 ? 0.550   -13.285 -3.101  1.00 0.00 ? 12 SER B HB2  6  
ATOM 7593  H HB3  . SER B 1 12 ? 0.194   -11.561 -3.229  1.00 0.00 ? 12 SER B HB3  6  
ATOM 7594  H HG   . SER B 1 12 ? -0.093  -11.775 -5.391  1.00 0.00 ? 12 SER B HG   6  
ATOM 7595  N N    . ALA B 1 13 ? 3.106   -12.613 -1.664  1.00 0.00 ? 13 ALA B N    6  
ATOM 7596  C CA   . ALA B 1 13 ? 3.663   -12.309 -0.351  1.00 0.00 ? 13 ALA B CA   6  
ATOM 7597  C C    . ALA B 1 13 ? 5.037   -11.656 -0.468  1.00 0.00 ? 13 ALA B C    6  
ATOM 7598  O O    . ALA B 1 13 ? 5.256   -10.559 0.044   1.00 0.00 ? 13 ALA B O    6  
ATOM 7599  C CB   . ALA B 1 13 ? 3.748   -13.576 0.488   1.00 0.00 ? 13 ALA B CB   6  
ATOM 7600  H H    . ALA B 1 13 ? 2.986   -13.558 -1.921  1.00 0.00 ? 13 ALA B H    6  
ATOM 7601  H HA   . ALA B 1 13 ? 2.993   -11.623 0.153   1.00 0.00 ? 13 ALA B HA   6  
ATOM 7602  H HB1  . ALA B 1 13 ? 4.103   -13.333 1.480   1.00 0.00 ? 13 ALA B HB1  6  
ATOM 7603  H HB2  . ALA B 1 13 ? 4.428   -14.276 0.023   1.00 0.00 ? 13 ALA B HB2  6  
ATOM 7604  H HB3  . ALA B 1 13 ? 2.768   -14.024 0.559   1.00 0.00 ? 13 ALA B HB3  6  
ATOM 7605  N N    . ILE B 1 14 ? 5.958   -12.337 -1.144  1.00 0.00 ? 14 ILE B N    6  
ATOM 7606  C CA   . ILE B 1 14 ? 7.313   -11.826 -1.320  1.00 0.00 ? 14 ILE B CA   6  
ATOM 7607  C C    . ILE B 1 14 ? 7.310   -10.444 -1.969  1.00 0.00 ? 14 ILE B C    6  
ATOM 7608  O O    . ILE B 1 14 ? 8.082   -9.569  -1.581  1.00 0.00 ? 14 ILE B O    6  
ATOM 7609  C CB   . ILE B 1 14 ? 8.172   -12.784 -2.175  1.00 0.00 ? 14 ILE B CB   6  
ATOM 7610  C CG1  . ILE B 1 14 ? 9.598   -12.246 -2.319  1.00 0.00 ? 14 ILE B CG1  6  
ATOM 7611  C CG2  . ILE B 1 14 ? 7.539   -12.990 -3.544  1.00 0.00 ? 14 ILE B CG2  6  
ATOM 7612  C CD1  . ILE B 1 14 ? 10.353  -12.162 -1.009  1.00 0.00 ? 14 ILE B CD1  6  
ATOM 7613  H H    . ILE B 1 14 ? 5.719   -13.215 -1.523  1.00 0.00 ? 14 ILE B H    6  
ATOM 7614  H HA   . ILE B 1 14 ? 7.761   -11.749 -0.339  1.00 0.00 ? 14 ILE B HA   6  
ATOM 7615  H HB   . ILE B 1 14 ? 8.204   -13.742 -1.677  1.00 0.00 ? 14 ILE B HB   6  
ATOM 7616  H HG12 . ILE B 1 14 ? 10.159  -12.912 -2.962  1.00 0.00 ? 14 ILE B HG12 6  
ATOM 7617  H HG13 . ILE B 1 14 ? 9.588   -11.264 -2.765  1.00 0.00 ? 14 ILE B HG13 6  
ATOM 7618  H HG21 . ILE B 1 14 ? 6.496   -13.213 -3.448  1.00 0.00 ? 14 ILE B HG21 6  
ATOM 7619  H HG22 . ILE B 1 14 ? 8.028   -13.817 -4.036  1.00 0.00 ? 14 ILE B HG22 6  
ATOM 7620  H HG23 . ILE B 1 14 ? 7.661   -12.102 -4.148  1.00 0.00 ? 14 ILE B HG23 6  
ATOM 7621  H HD11 . ILE B 1 14 ? 10.304  -13.113 -0.498  1.00 0.00 ? 14 ILE B HD11 6  
ATOM 7622  H HD12 . ILE B 1 14 ? 9.914   -11.396 -0.388  1.00 0.00 ? 14 ILE B HD12 6  
ATOM 7623  H HD13 . ILE B 1 14 ? 11.386  -11.915 -1.206  1.00 0.00 ? 14 ILE B HD13 6  
ATOM 7624  N N    . LEU B 1 15 ? 6.440   -10.256 -2.955  1.00 0.00 ? 15 LEU B N    6  
ATOM 7625  C CA   . LEU B 1 15 ? 6.346   -8.982  -3.654  1.00 0.00 ? 15 LEU B CA   6  
ATOM 7626  C C    . LEU B 1 15 ? 5.767   -7.899  -2.750  1.00 0.00 ? 15 LEU B C    6  
ATOM 7627  O O    . LEU B 1 15 ? 6.225   -6.758  -2.765  1.00 0.00 ? 15 LEU B O    6  
ATOM 7628  C CB   . LEU B 1 15 ? 5.486   -9.127  -4.913  1.00 0.00 ? 15 LEU B CB   6  
ATOM 7629  C CG   . LEU B 1 15 ? 5.332   -7.852  -5.745  1.00 0.00 ? 15 LEU B CG   6  
ATOM 7630  C CD1  . LEU B 1 15 ? 6.666   -7.443  -6.349  1.00 0.00 ? 15 LEU B CD1  6  
ATOM 7631  C CD2  . LEU B 1 15 ? 4.289   -8.052  -6.836  1.00 0.00 ? 15 LEU B CD2  6  
ATOM 7632  H H    . LEU B 1 15 ? 5.838   -10.988 -3.224  1.00 0.00 ? 15 LEU B H    6  
ATOM 7633  H HA   . LEU B 1 15 ? 7.344   -8.687  -3.950  1.00 0.00 ? 15 LEU B HA   6  
ATOM 7634  H HB2  . LEU B 1 15 ? 5.924   -9.898  -5.535  1.00 0.00 ? 15 LEU B HB2  6  
ATOM 7635  H HB3  . LEU B 1 15 ? 4.502   -9.458  -4.606  1.00 0.00 ? 15 LEU B HB3  6  
ATOM 7636  H HG   . LEU B 1 15 ? 4.994   -7.044  -5.114  1.00 0.00 ? 15 LEU B HG   6  
ATOM 7637  H HD11 . LEU B 1 15 ? 7.377   -7.246  -5.561  1.00 0.00 ? 15 LEU B HD11 6  
ATOM 7638  H HD12 . LEU B 1 15 ? 6.537   -6.547  -6.941  1.00 0.00 ? 15 LEU B HD12 6  
ATOM 7639  H HD13 . LEU B 1 15 ? 7.041   -8.237  -6.980  1.00 0.00 ? 15 LEU B HD13 6  
ATOM 7640  H HD21 . LEU B 1 15 ? 4.604   -8.844  -7.502  1.00 0.00 ? 15 LEU B HD21 6  
ATOM 7641  H HD22 . LEU B 1 15 ? 4.172   -7.136  -7.399  1.00 0.00 ? 15 LEU B HD22 6  
ATOM 7642  H HD23 . LEU B 1 15 ? 3.341   -8.316  -6.387  1.00 0.00 ? 15 LEU B HD23 6  
ATOM 7643  N N    . ALA B 1 16 ? 4.762   -8.267  -1.962  1.00 0.00 ? 16 ALA B N    6  
ATOM 7644  C CA   . ALA B 1 16 ? 4.109   -7.326  -1.058  1.00 0.00 ? 16 ALA B CA   6  
ATOM 7645  C C    . ALA B 1 16 ? 5.110   -6.661  -0.117  1.00 0.00 ? 16 ALA B C    6  
ATOM 7646  O O    . ALA B 1 16 ? 5.106   -5.443  0.044   1.00 0.00 ? 16 ALA B O    6  
ATOM 7647  C CB   . ALA B 1 16 ? 3.020   -8.029  -0.263  1.00 0.00 ? 16 ALA B CB   6  
ATOM 7648  H H    . ALA B 1 16 ? 4.436   -9.198  -1.994  1.00 0.00 ? 16 ALA B H    6  
ATOM 7649  H HA   . ALA B 1 16 ? 3.638   -6.560  -1.659  1.00 0.00 ? 16 ALA B HA   6  
ATOM 7650  H HB1  . ALA B 1 16 ? 2.532   -7.322  0.395   1.00 0.00 ? 16 ALA B HB1  6  
ATOM 7651  H HB2  . ALA B 1 16 ? 3.456   -8.825  0.323   1.00 0.00 ? 16 ALA B HB2  6  
ATOM 7652  H HB3  . ALA B 1 16 ? 2.291   -8.443  -0.943  1.00 0.00 ? 16 ALA B HB3  6  
ATOM 7653  N N    . LEU B 1 17 ? 5.969   -7.467  0.503   1.00 0.00 ? 17 LEU B N    6  
ATOM 7654  C CA   . LEU B 1 17 ? 6.972   -6.944  1.430   1.00 0.00 ? 17 LEU B CA   6  
ATOM 7655  C C    . LEU B 1 17 ? 7.916   -5.976  0.722   1.00 0.00 ? 17 LEU B C    6  
ATOM 7656  O O    . LEU B 1 17 ? 8.340   -4.976  1.300   1.00 0.00 ? 17 LEU B O    6  
ATOM 7657  C CB   . LEU B 1 17 ? 7.772   -8.087  2.063   1.00 0.00 ? 17 LEU B CB   6  
ATOM 7658  C CG   . LEU B 1 17 ? 7.106   -8.770  3.266   1.00 0.00 ? 17 LEU B CG   6  
ATOM 7659  C CD1  . LEU B 1 17 ? 6.891   -7.776  4.397   1.00 0.00 ? 17 LEU B CD1  6  
ATOM 7660  C CD2  . LEU B 1 17 ? 5.788   -9.414  2.861   1.00 0.00 ? 17 LEU B CD2  6  
ATOM 7661  H H    . LEU B 1 17 ? 5.929   -8.438  0.332   1.00 0.00 ? 17 LEU B H    6  
ATOM 7662  H HA   . LEU B 1 17 ? 6.453   -6.393  2.197   1.00 0.00 ? 17 LEU B HA   6  
ATOM 7663  H HB2  . LEU B 1 17 ? 7.955   -8.837  1.305   1.00 0.00 ? 17 LEU B HB2  6  
ATOM 7664  H HB3  . LEU B 1 17 ? 8.732   -7.706  2.393   1.00 0.00 ? 17 LEU B HB3  6  
ATOM 7665  H HG   . LEU B 1 17 ? 7.759   -9.549  3.632   1.00 0.00 ? 17 LEU B HG   6  
ATOM 7666  H HD11 . LEU B 1 17 ? 6.145   -7.048  4.117   1.00 0.00 ? 17 LEU B HD11 6  
ATOM 7667  H HD12 . LEU B 1 17 ? 7.820   -7.270  4.622   1.00 0.00 ? 17 LEU B HD12 6  
ATOM 7668  H HD13 . LEU B 1 17 ? 6.556   -8.307  5.277   1.00 0.00 ? 17 LEU B HD13 6  
ATOM 7669  H HD21 . LEU B 1 17 ? 5.350   -9.905  3.720   1.00 0.00 ? 17 LEU B HD21 6  
ATOM 7670  H HD22 . LEU B 1 17 ? 5.973   -10.147 2.100   1.00 0.00 ? 17 LEU B HD22 6  
ATOM 7671  H HD23 . LEU B 1 17 ? 5.103   -8.666  2.493   1.00 0.00 ? 17 LEU B HD23 6  
ATOM 7672  N N    . VAL B 1 18 ? 8.240   -6.280  -0.531  1.00 0.00 ? 18 VAL B N    6  
ATOM 7673  C CA   . VAL B 1 18 ? 9.131   -5.430  -1.313  1.00 0.00 ? 18 VAL B CA   6  
ATOM 7674  C C    . VAL B 1 18 ? 8.456   -4.105  -1.659  1.00 0.00 ? 18 VAL B C    6  
ATOM 7675  O O    . VAL B 1 18 ? 9.095   -3.054  -1.648  1.00 0.00 ? 18 VAL B O    6  
ATOM 7676  C CB   . VAL B 1 18 ? 9.582   -6.126  -2.615  1.00 0.00 ? 18 VAL B CB   6  
ATOM 7677  C CG1  . VAL B 1 18 ? 10.460  -5.201  -3.443  1.00 0.00 ? 18 VAL B CG1  6  
ATOM 7678  C CG2  . VAL B 1 18 ? 10.315  -7.422  -2.301  1.00 0.00 ? 18 VAL B CG2  6  
ATOM 7679  H H    . VAL B 1 18 ? 7.874   -7.094  -0.948  1.00 0.00 ? 18 VAL B H    6  
ATOM 7680  H HA   . VAL B 1 18 ? 10.014  -5.222  -0.717  1.00 0.00 ? 18 VAL B HA   6  
ATOM 7681  H HB   . VAL B 1 18 ? 8.703   -6.368  -3.197  1.00 0.00 ? 18 VAL B HB   6  
ATOM 7682  H HG11 . VAL B 1 18 ? 10.907  -5.755  -4.259  1.00 0.00 ? 18 VAL B HG11 6  
ATOM 7683  H HG12 . VAL B 1 18 ? 11.245  -4.787  -2.826  1.00 0.00 ? 18 VAL B HG12 6  
ATOM 7684  H HG13 . VAL B 1 18 ? 9.864   -4.399  -3.853  1.00 0.00 ? 18 VAL B HG13 6  
ATOM 7685  H HG21 . VAL B 1 18 ? 9.736   -8.023  -1.627  1.00 0.00 ? 18 VAL B HG21 6  
ATOM 7686  H HG22 . VAL B 1 18 ? 11.269  -7.200  -1.842  1.00 0.00 ? 18 VAL B HG22 6  
ATOM 7687  H HG23 . VAL B 1 18 ? 10.480  -7.970  -3.217  1.00 0.00 ? 18 VAL B HG23 6  
ATOM 7688  N N    . VAL B 1 19 ? 7.162   -4.163  -1.958  1.00 0.00 ? 19 VAL B N    6  
ATOM 7689  C CA   . VAL B 1 19 ? 6.405   -2.967  -2.310  1.00 0.00 ? 19 VAL B CA   6  
ATOM 7690  C C    . VAL B 1 19 ? 6.275   -2.024  -1.120  1.00 0.00 ? 19 VAL B C    6  
ATOM 7691  O O    . VAL B 1 19 ? 6.481   -0.821  -1.254  1.00 0.00 ? 19 VAL B O    6  
ATOM 7692  C CB   . VAL B 1 19 ? 4.996   -3.317  -2.829  1.00 0.00 ? 19 VAL B CB   6  
ATOM 7693  C CG1  . VAL B 1 19 ? 4.180   -2.055  -3.080  1.00 0.00 ? 19 VAL B CG1  6  
ATOM 7694  C CG2  . VAL B 1 19 ? 5.088   -4.155  -4.095  1.00 0.00 ? 19 VAL B CG2  6  
ATOM 7695  H H    . VAL B 1 19 ? 6.697   -5.032  -1.949  1.00 0.00 ? 19 VAL B H    6  
ATOM 7696  H HA   . VAL B 1 19 ? 6.936   -2.449  -3.101  1.00 0.00 ? 19 VAL B HA   6  
ATOM 7697  H HB   . VAL B 1 19 ? 4.490   -3.902  -2.074  1.00 0.00 ? 19 VAL B HB   6  
ATOM 7698  H HG11 . VAL B 1 19 ? 3.284   -2.302  -3.637  1.00 0.00 ? 19 VAL B HG11 6  
ATOM 7699  H HG12 . VAL B 1 19 ? 4.764   -1.343  -3.648  1.00 0.00 ? 19 VAL B HG12 6  
ATOM 7700  H HG13 . VAL B 1 19 ? 3.891   -1.612  -2.138  1.00 0.00 ? 19 VAL B HG13 6  
ATOM 7701  H HG21 . VAL B 1 19 ? 4.109   -4.537  -4.342  1.00 0.00 ? 19 VAL B HG21 6  
ATOM 7702  H HG22 . VAL B 1 19 ? 5.763   -4.975  -3.953  1.00 0.00 ? 19 VAL B HG22 6  
ATOM 7703  H HG23 . VAL B 1 19 ? 5.446   -3.544  -4.912  1.00 0.00 ? 19 VAL B HG23 6  
ATOM 7704  N N    . LEU B 1 20 ? 5.933   -2.575  0.040   1.00 0.00 ? 20 LEU B N    6  
ATOM 7705  C CA   . LEU B 1 20 ? 5.772   -1.767  1.244   1.00 0.00 ? 20 LEU B CA   6  
ATOM 7706  C C    . LEU B 1 20 ? 7.052   -1.004  1.560   1.00 0.00 ? 20 LEU B C    6  
ATOM 7707  O O    . LEU B 1 20 ? 7.005   0.140   2.013   1.00 0.00 ? 20 LEU B O    6  
ATOM 7708  C CB   . LEU B 1 20 ? 5.371   -2.642  2.434   1.00 0.00 ? 20 LEU B CB   6  
ATOM 7709  C CG   . LEU B 1 20 ? 4.978   -1.878  3.702   1.00 0.00 ? 20 LEU B CG   6  
ATOM 7710  C CD1  . LEU B 1 20 ? 3.732   -1.033  3.461   1.00 0.00 ? 20 LEU B CD1  6  
ATOM 7711  C CD2  . LEU B 1 20 ? 4.750   -2.844  4.854   1.00 0.00 ? 20 LEU B CD2  6  
ATOM 7712  H H    . LEU B 1 20 ? 5.777   -3.549  0.089   1.00 0.00 ? 20 LEU B H    6  
ATOM 7713  H HA   . LEU B 1 20 ? 4.986   -1.053  1.051   1.00 0.00 ? 20 LEU B HA   6  
ATOM 7714  H HB2  . LEU B 1 20 ? 4.534   -3.258  2.130   1.00 0.00 ? 20 LEU B HB2  6  
ATOM 7715  H HB3  . LEU B 1 20 ? 6.203   -3.295  2.670   1.00 0.00 ? 20 LEU B HB3  6  
ATOM 7716  H HG   . LEU B 1 20 ? 5.782   -1.212  3.980   1.00 0.00 ? 20 LEU B HG   6  
ATOM 7717  H HD11 . LEU B 1 20 ? 3.447   -0.535  4.379   1.00 0.00 ? 20 LEU B HD11 6  
ATOM 7718  H HD12 . LEU B 1 20 ? 2.920   -1.665  3.131   1.00 0.00 ? 20 LEU B HD12 6  
ATOM 7719  H HD13 . LEU B 1 20 ? 3.937   -0.290  2.706   1.00 0.00 ? 20 LEU B HD13 6  
ATOM 7720  H HD21 . LEU B 1 20 ? 4.500   -2.290  5.748   1.00 0.00 ? 20 LEU B HD21 6  
ATOM 7721  H HD22 . LEU B 1 20 ? 5.650   -3.416  5.031   1.00 0.00 ? 20 LEU B HD22 6  
ATOM 7722  H HD23 . LEU B 1 20 ? 3.939   -3.518  4.611   1.00 0.00 ? 20 LEU B HD23 6  
ATOM 7723  N N    . THR B 1 21 ? 8.194   -1.639  1.319   1.00 0.00 ? 21 THR B N    6  
ATOM 7724  C CA   . THR B 1 21 ? 9.479   -1.002  1.568   1.00 0.00 ? 21 THR B CA   6  
ATOM 7725  C C    . THR B 1 21 ? 9.672   0.182   0.628   1.00 0.00 ? 21 THR B C    6  
ATOM 7726  O O    . THR B 1 21 ? 10.136  1.243   1.039   1.00 0.00 ? 21 THR B O    6  
ATOM 7727  C CB   . THR B 1 21 ? 10.651  -1.989  1.397   1.00 0.00 ? 21 THR B CB   6  
ATOM 7728  O OG1  . THR B 1 21 ? 10.481  -3.107  2.278   1.00 0.00 ? 21 THR B OG1  6  
ATOM 7729  C CG2  . THR B 1 21 ? 11.981  -1.310  1.693   1.00 0.00 ? 21 THR B CG2  6  
ATOM 7730  H H    . THR B 1 21 ? 8.180   -2.556  0.958   1.00 0.00 ? 21 THR B H    6  
ATOM 7731  H HA   . THR B 1 21 ? 9.486   -0.641  2.591   1.00 0.00 ? 21 THR B HA   6  
ATOM 7732  H HB   . THR B 1 21 ? 10.663  -2.344  0.375   1.00 0.00 ? 21 THR B HB   6  
ATOM 7733  H HG1  . THR B 1 21 ? 10.947  -3.870  1.926   1.00 0.00 ? 21 THR B HG1  6  
ATOM 7734  H HG21 . THR B 1 21 ? 12.240  -0.646  0.882   1.00 0.00 ? 21 THR B HG21 6  
ATOM 7735  H HG22 . THR B 1 21 ? 12.749  -2.063  1.793   1.00 0.00 ? 21 THR B HG22 6  
ATOM 7736  H HG23 . THR B 1 21 ? 11.914  -0.747  2.615   1.00 0.00 ? 21 THR B HG23 6  
ATOM 7737  N N    . ILE B 1 22 ? 9.306   -0.010  -0.637  1.00 0.00 ? 22 ILE B N    6  
ATOM 7738  C CA   . ILE B 1 22 ? 9.428   1.046   -1.633  1.00 0.00 ? 22 ILE B CA   6  
ATOM 7739  C C    . ILE B 1 22 ? 8.488   2.201   -1.303  1.00 0.00 ? 22 ILE B C    6  
ATOM 7740  O O    . ILE B 1 22 ? 8.872   3.367   -1.375  1.00 0.00 ? 22 ILE B O    6  
ATOM 7741  C CB   . ILE B 1 22 ? 9.113   0.527   -3.051  1.00 0.00 ? 22 ILE B CB   6  
ATOM 7742  C CG1  . ILE B 1 22 ? 10.075  -0.603  -3.435  1.00 0.00 ? 22 ILE B CG1  6  
ATOM 7743  C CG2  . ILE B 1 22 ? 9.187   1.663   -4.062  1.00 0.00 ? 22 ILE B CG2  6  
ATOM 7744  C CD1  . ILE B 1 22 ? 11.526  -0.172  -3.510  1.00 0.00 ? 22 ILE B CD1  6  
ATOM 7745  H H    . ILE B 1 22 ? 8.936   -0.882  -0.910  1.00 0.00 ? 22 ILE B H    6  
ATOM 7746  H HA   . ILE B 1 22 ? 10.443  1.418   -1.614  1.00 0.00 ? 22 ILE B HA   6  
ATOM 7747  H HB   . ILE B 1 22 ? 8.103   0.142   -3.055  1.00 0.00 ? 22 ILE B HB   6  
ATOM 7748  H HG12 . ILE B 1 22 ? 10.011  -1.388  -2.713  1.00 0.00 ? 22 ILE B HG12 6  
ATOM 7749  H HG13 . ILE B 1 22 ? 9.796   -0.992  -4.404  1.00 0.00 ? 22 ILE B HG13 6  
ATOM 7750  H HG21 . ILE B 1 22 ? 8.330   2.310   -3.946  1.00 0.00 ? 22 ILE B HG21 6  
ATOM 7751  H HG22 . ILE B 1 22 ? 9.184   1.260   -5.067  1.00 0.00 ? 22 ILE B HG22 6  
ATOM 7752  H HG23 . ILE B 1 22 ? 10.092  2.237   -3.913  1.00 0.00 ? 22 ILE B HG23 6  
ATOM 7753  H HD11 . ILE B 1 22 ? 12.109  -0.769  -2.825  1.00 0.00 ? 22 ILE B HD11 6  
ATOM 7754  H HD12 . ILE B 1 22 ? 11.644  0.871   -3.257  1.00 0.00 ? 22 ILE B HD12 6  
ATOM 7755  H HD13 . ILE B 1 22 ? 11.892  -0.334  -4.513  1.00 0.00 ? 22 ILE B HD13 6  
ATOM 7756  N N    . ILE B 1 23 ? 7.253   1.861   -0.942  1.00 0.00 ? 23 ILE B N    6  
ATOM 7757  C CA   . ILE B 1 23 ? 6.253   2.859   -0.590  1.00 0.00 ? 23 ILE B CA   6  
ATOM 7758  C C    . ILE B 1 23 ? 6.757   3.744   0.547   1.00 0.00 ? 23 ILE B C    6  
ATOM 7759  O O    . ILE B 1 23 ? 6.516   4.951   0.568   1.00 0.00 ? 23 ILE B O    6  
ATOM 7760  C CB   . ILE B 1 23 ? 4.927   2.198   -0.166  1.00 0.00 ? 23 ILE B CB   6  
ATOM 7761  C CG1  . ILE B 1 23 ? 4.335   1.392   -1.328  1.00 0.00 ? 23 ILE B CG1  6  
ATOM 7762  C CG2  . ILE B 1 23 ? 3.938   3.250   0.316   1.00 0.00 ? 23 ILE B CG2  6  
ATOM 7763  C CD1  . ILE B 1 23 ? 3.824   2.247   -2.469  1.00 0.00 ? 23 ILE B CD1  6  
ATOM 7764  H H    . ILE B 1 23 ? 7.009   0.908   -0.904  1.00 0.00 ? 23 ILE B H    6  
ATOM 7765  H HA   . ILE B 1 23 ? 6.074   3.481   -1.454  1.00 0.00 ? 23 ILE B HA   6  
ATOM 7766  H HB   . ILE B 1 23 ? 5.130   1.528   0.657   1.00 0.00 ? 23 ILE B HB   6  
ATOM 7767  H HG12 . ILE B 1 23 ? 5.071   0.731   -1.734  1.00 0.00 ? 23 ILE B HG12 6  
ATOM 7768  H HG13 . ILE B 1 23 ? 3.504   0.809   -0.960  1.00 0.00 ? 23 ILE B HG13 6  
ATOM 7769  H HG21 . ILE B 1 23 ? 2.950   2.813   0.399   1.00 0.00 ? 23 ILE B HG21 6  
ATOM 7770  H HG22 . ILE B 1 23 ? 3.901   4.074   -0.383  1.00 0.00 ? 23 ILE B HG22 6  
ATOM 7771  H HG23 . ILE B 1 23 ? 4.238   3.616   1.287   1.00 0.00 ? 23 ILE B HG23 6  
ATOM 7772  H HD11 . ILE B 1 23 ? 2.954   2.801   -2.150  1.00 0.00 ? 23 ILE B HD11 6  
ATOM 7773  H HD12 . ILE B 1 23 ? 3.552   1.607   -3.295  1.00 0.00 ? 23 ILE B HD12 6  
ATOM 7774  H HD13 . ILE B 1 23 ? 4.590   2.933   -2.792  1.00 0.00 ? 23 ILE B HD13 6  
ATOM 7775  N N    . SER B 1 24 ? 7.466   3.128   1.489   1.00 0.00 ? 24 SER B N    6  
ATOM 7776  C CA   . SER B 1 24 ? 8.010   3.844   2.636   1.00 0.00 ? 24 SER B CA   6  
ATOM 7777  C C    . SER B 1 24 ? 9.167   4.751   2.224   1.00 0.00 ? 24 SER B C    6  
ATOM 7778  O O    . SER B 1 24 ? 9.278   5.882   2.697   1.00 0.00 ? 24 SER B O    6  
ATOM 7779  C CB   . SER B 1 24 ? 8.483   2.850   3.699   1.00 0.00 ? 24 SER B CB   6  
ATOM 7780  O OG   . SER B 1 24 ? 9.102   3.518   4.783   1.00 0.00 ? 24 SER B OG   6  
ATOM 7781  H H    . SER B 1 24 ? 7.629   2.158   1.419   1.00 0.00 ? 24 SER B H    6  
ATOM 7782  H HA   . SER B 1 24 ? 7.224   4.455   3.061   1.00 0.00 ? 24 SER B HA   6  
ATOM 7783  H HB2  . SER B 1 24 ? 7.636   2.293   4.071   1.00 0.00 ? 24 SER B HB2  6  
ATOM 7784  H HB3  . SER B 1 24 ? 9.196   2.168   3.258   1.00 0.00 ? 24 SER B HB3  6  
ATOM 7785  H HG   . SER B 1 24 ? 8.430   3.868   5.373   1.00 0.00 ? 24 SER B HG   6  
ATOM 7786  N N    . LEU B 1 25 ? 10.027  4.247   1.345   1.00 0.00 ? 25 LEU B N    6  
ATOM 7787  C CA   . LEU B 1 25 ? 11.177  5.013   0.873   1.00 0.00 ? 25 LEU B CA   6  
ATOM 7788  C C    . LEU B 1 25 ? 10.737  6.284   0.157   1.00 0.00 ? 25 LEU B C    6  
ATOM 7789  O O    . LEU B 1 25 ? 11.357  7.338   0.308   1.00 0.00 ? 25 LEU B O    6  
ATOM 7790  C CB   . LEU B 1 25 ? 12.038  4.162   -0.062  1.00 0.00 ? 25 LEU B CB   6  
ATOM 7791  C CG   . LEU B 1 25 ? 12.724  2.960   0.592   1.00 0.00 ? 25 LEU B CG   6  
ATOM 7792  C CD1  . LEU B 1 25 ? 13.413  2.107   -0.459  1.00 0.00 ? 25 LEU B CD1  6  
ATOM 7793  C CD2  . LEU B 1 25 ? 13.725  3.422   1.642   1.00 0.00 ? 25 LEU B CD2  6  
ATOM 7794  H H    . LEU B 1 25 ? 9.892   3.331   1.003   1.00 0.00 ? 25 LEU B H    6  
ATOM 7795  H HA   . LEU B 1 25 ? 11.764  5.298   1.732   1.00 0.00 ? 25 LEU B HA   6  
ATOM 7796  H HB2  . LEU B 1 25 ? 11.399  3.800   -0.858  1.00 0.00 ? 25 LEU B HB2  6  
ATOM 7797  H HB3  . LEU B 1 25 ? 12.805  4.792   -0.501  1.00 0.00 ? 25 LEU B HB3  6  
ATOM 7798  H HG   . LEU B 1 25 ? 11.991  2.356   1.084   1.00 0.00 ? 25 LEU B HG   6  
ATOM 7799  H HD11 . LEU B 1 25 ? 14.174  2.689   -0.962  1.00 0.00 ? 25 LEU B HD11 6  
ATOM 7800  H HD12 . LEU B 1 25 ? 12.685  1.766   -1.183  1.00 0.00 ? 25 LEU B HD12 6  
ATOM 7801  H HD13 . LEU B 1 25 ? 13.872  1.249   0.013   1.00 0.00 ? 25 LEU B HD13 6  
ATOM 7802  H HD21 . LEU B 1 25 ? 13.209  3.947   2.431   1.00 0.00 ? 25 LEU B HD21 6  
ATOM 7803  H HD22 . LEU B 1 25 ? 14.453  4.080   1.189   1.00 0.00 ? 25 LEU B HD22 6  
ATOM 7804  H HD23 . LEU B 1 25 ? 14.233  2.564   2.063   1.00 0.00 ? 25 LEU B HD23 6  
ATOM 7805  N N    . ILE B 1 26 ? 9.666   6.183   -0.624  1.00 0.00 ? 26 ILE B N    6  
ATOM 7806  C CA   . ILE B 1 26 ? 9.146   7.327   -1.361  1.00 0.00 ? 26 ILE B CA   6  
ATOM 7807  C C    . ILE B 1 26 ? 8.755   8.457   -0.413  1.00 0.00 ? 26 ILE B C    6  
ATOM 7808  O O    . ILE B 1 26 ? 9.084   9.618   -0.646  1.00 0.00 ? 26 ILE B O    6  
ATOM 7809  C CB   . ILE B 1 26 ? 7.920   6.941   -2.213  1.00 0.00 ? 26 ILE B CB   6  
ATOM 7810  C CG1  . ILE B 1 26 ? 8.290   5.843   -3.212  1.00 0.00 ? 26 ILE B CG1  6  
ATOM 7811  C CG2  . ILE B 1 26 ? 7.369   8.160   -2.941  1.00 0.00 ? 26 ILE B CG2  6  
ATOM 7812  C CD1  . ILE B 1 26 ? 7.095   5.235   -3.913  1.00 0.00 ? 26 ILE B CD1  6  
ATOM 7813  H H    . ILE B 1 26 ? 9.209   5.315   -0.704  1.00 0.00 ? 26 ILE B H    6  
ATOM 7814  H HA   . ILE B 1 26 ? 9.925   7.683   -2.025  1.00 0.00 ? 26 ILE B HA   6  
ATOM 7815  H HB   . ILE B 1 26 ? 7.150   6.570   -1.549  1.00 0.00 ? 26 ILE B HB   6  
ATOM 7816  H HG12 . ILE B 1 26 ? 8.936   6.257   -3.974  1.00 0.00 ? 26 ILE B HG12 6  
ATOM 7817  H HG13 . ILE B 1 26 ? 8.812   5.052   -2.720  1.00 0.00 ? 26 ILE B HG13 6  
ATOM 7818  H HG21 . ILE B 1 26 ? 6.995   8.879   -2.230  1.00 0.00 ? 26 ILE B HG21 6  
ATOM 7819  H HG22 . ILE B 1 26 ? 6.557   7.867   -3.590  1.00 0.00 ? 26 ILE B HG22 6  
ATOM 7820  H HG23 . ILE B 1 26 ? 8.151   8.615   -3.534  1.00 0.00 ? 26 ILE B HG23 6  
ATOM 7821  H HD11 . ILE B 1 26 ? 6.349   4.948   -3.184  1.00 0.00 ? 26 ILE B HD11 6  
ATOM 7822  H HD12 . ILE B 1 26 ? 7.411   4.361   -4.463  1.00 0.00 ? 26 ILE B HD12 6  
ATOM 7823  H HD13 . ILE B 1 26 ? 6.672   5.954   -4.598  1.00 0.00 ? 26 ILE B HD13 6  
ATOM 7824  N N    . ILE B 1 27 ? 8.053   8.102   0.660   1.00 0.00 ? 27 ILE B N    6  
ATOM 7825  C CA   . ILE B 1 27 ? 7.610   9.080   1.648   1.00 0.00 ? 27 ILE B CA   6  
ATOM 7826  C C    . ILE B 1 27 ? 8.793   9.704   2.379   1.00 0.00 ? 27 ILE B C    6  
ATOM 7827  O O    . ILE B 1 27 ? 8.805   10.905  2.651   1.00 0.00 ? 27 ILE B O    6  
ATOM 7828  C CB   . ILE B 1 27 ? 6.671   8.436   2.685   1.00 0.00 ? 27 ILE B CB   6  
ATOM 7829  C CG1  . ILE B 1 27 ? 5.555   7.661   1.982   1.00 0.00 ? 27 ILE B CG1  6  
ATOM 7830  C CG2  . ILE B 1 27 ? 6.090   9.503   3.604   1.00 0.00 ? 27 ILE B CG2  6  
ATOM 7831  C CD1  . ILE B 1 27 ? 4.734   6.800   2.918   1.00 0.00 ? 27 ILE B CD1  6  
ATOM 7832  H H    . ILE B 1 27 ? 7.840   7.151   0.792   1.00 0.00 ? 27 ILE B H    6  
ATOM 7833  H HA   . ILE B 1 27 ? 7.066   9.858   1.130   1.00 0.00 ? 27 ILE B HA   6  
ATOM 7834  H HB   . ILE B 1 27 ? 7.249   7.748   3.292   1.00 0.00 ? 27 ILE B HB   6  
ATOM 7835  H HG12 . ILE B 1 27 ? 4.880   8.358   1.507   1.00 0.00 ? 27 ILE B HG12 6  
ATOM 7836  H HG13 . ILE B 1 27 ? 5.959   7.017   1.233   1.00 0.00 ? 27 ILE B HG13 6  
ATOM 7837  H HG21 . ILE B 1 27 ? 5.417   9.046   4.315   1.00 0.00 ? 27 ILE B HG21 6  
ATOM 7838  H HG22 . ILE B 1 27 ? 5.547   10.231  3.019   1.00 0.00 ? 27 ILE B HG22 6  
ATOM 7839  H HG23 . ILE B 1 27 ? 6.883   9.999   4.145   1.00 0.00 ? 27 ILE B HG23 6  
ATOM 7840  H HD11 . ILE B 1 27 ? 4.063   6.182   2.339   1.00 0.00 ? 27 ILE B HD11 6  
ATOM 7841  H HD12 . ILE B 1 27 ? 4.159   7.431   3.579   1.00 0.00 ? 27 ILE B HD12 6  
ATOM 7842  H HD13 . ILE B 1 27 ? 5.389   6.168   3.501   1.00 0.00 ? 27 ILE B HD13 6  
ATOM 7843  N N    . LEU B 1 28 ? 9.786   8.878   2.694   1.00 0.00 ? 28 LEU B N    6  
ATOM 7844  C CA   . LEU B 1 28 ? 10.975  9.340   3.402   1.00 0.00 ? 28 LEU B CA   6  
ATOM 7845  C C    . LEU B 1 28 ? 11.695  10.436  2.621   1.00 0.00 ? 28 LEU B C    6  
ATOM 7846  O O    . LEU B 1 28 ? 11.891  11.543  3.123   1.00 0.00 ? 28 LEU B O    6  
ATOM 7847  C CB   . LEU B 1 28 ? 11.926  8.169   3.658   1.00 0.00 ? 28 LEU B CB   6  
ATOM 7848  C CG   . LEU B 1 28 ? 13.224  8.529   4.385   1.00 0.00 ? 28 LEU B CG   6  
ATOM 7849  C CD1  . LEU B 1 28 ? 12.932  9.011   5.797   1.00 0.00 ? 28 LEU B CD1  6  
ATOM 7850  C CD2  . LEU B 1 28 ? 14.168  7.336   4.413   1.00 0.00 ? 28 LEU B CD2  6  
ATOM 7851  H H    . LEU B 1 28 ? 9.719   7.924   2.453   1.00 0.00 ? 28 LEU B H    6  
ATOM 7852  H HA   . LEU B 1 28 ? 10.658  9.744   4.353   1.00 0.00 ? 28 LEU B HA   6  
ATOM 7853  H HB2  . LEU B 1 28 ? 11.397  7.425   4.240   1.00 0.00 ? 28 LEU B HB2  6  
ATOM 7854  H HB3  . LEU B 1 28 ? 12.179  7.733   2.700   1.00 0.00 ? 28 LEU B HB3  6  
ATOM 7855  H HG   . LEU B 1 28 ? 13.725  9.328   3.860   1.00 0.00 ? 28 LEU B HG   6  
ATOM 7856  H HD11 . LEU B 1 28 ? 13.860  9.251   6.298   1.00 0.00 ? 28 LEU B HD11 6  
ATOM 7857  H HD12 . LEU B 1 28 ? 12.418  8.236   6.349   1.00 0.00 ? 28 LEU B HD12 6  
ATOM 7858  H HD13 . LEU B 1 28 ? 12.313  9.895   5.759   1.00 0.00 ? 28 LEU B HD13 6  
ATOM 7859  H HD21 . LEU B 1 28 ? 14.387  7.023   3.401   1.00 0.00 ? 28 LEU B HD21 6  
ATOM 7860  H HD22 . LEU B 1 28 ? 13.707  6.517   4.949   1.00 0.00 ? 28 LEU B HD22 6  
ATOM 7861  H HD23 . LEU B 1 28 ? 15.090  7.614   4.906   1.00 0.00 ? 28 LEU B HD23 6  
ATOM 7862  N N    . ILE B 1 29 ? 12.084  10.122  1.389   1.00 0.00 ? 29 ILE B N    6  
ATOM 7863  C CA   . ILE B 1 29 ? 12.788  11.079  0.541   1.00 0.00 ? 29 ILE B CA   6  
ATOM 7864  C C    . ILE B 1 29 ? 11.901  12.271  0.197   1.00 0.00 ? 29 ILE B C    6  
ATOM 7865  O O    . ILE B 1 29 ? 12.386  13.392  0.038   1.00 0.00 ? 29 ILE B O    6  
ATOM 7866  C CB   . ILE B 1 29 ? 13.279  10.419  -0.763  1.00 0.00 ? 29 ILE B CB   6  
ATOM 7867  C CG1  . ILE B 1 29 ? 14.062  9.142   -0.445  1.00 0.00 ? 29 ILE B CG1  6  
ATOM 7868  C CG2  . ILE B 1 29 ? 14.139  11.391  -1.559  1.00 0.00 ? 29 ILE B CG2  6  
ATOM 7869  C CD1  . ILE B 1 29 ? 14.463  8.350   -1.673  1.00 0.00 ? 29 ILE B CD1  6  
ATOM 7870  H H    . ILE B 1 29 ? 11.878  9.224   1.044   1.00 0.00 ? 29 ILE B H    6  
ATOM 7871  H HA   . ILE B 1 29 ? 13.654  11.432  1.087   1.00 0.00 ? 29 ILE B HA   6  
ATOM 7872  H HB   . ILE B 1 29 ? 12.417  10.161  -1.365  1.00 0.00 ? 29 ILE B HB   6  
ATOM 7873  H HG12 . ILE B 1 29 ? 14.967  9.401   0.085   1.00 0.00 ? 29 ILE B HG12 6  
ATOM 7874  H HG13 . ILE B 1 29 ? 13.476  8.487   0.173   1.00 0.00 ? 29 ILE B HG13 6  
ATOM 7875  H HG21 . ILE B 1 29 ? 13.574  12.276  -1.805  1.00 0.00 ? 29 ILE B HG21 6  
ATOM 7876  H HG22 . ILE B 1 29 ? 14.463  10.924  -2.477  1.00 0.00 ? 29 ILE B HG22 6  
ATOM 7877  H HG23 . ILE B 1 29 ? 15.005  11.669  -0.978  1.00 0.00 ? 29 ILE B HG23 6  
ATOM 7878  H HD11 . ILE B 1 29 ? 15.215  8.894   -2.224  1.00 0.00 ? 29 ILE B HD11 6  
ATOM 7879  H HD12 . ILE B 1 29 ? 13.599  8.189   -2.303  1.00 0.00 ? 29 ILE B HD12 6  
ATOM 7880  H HD13 . ILE B 1 29 ? 14.865  7.395   -1.367  1.00 0.00 ? 29 ILE B HD13 6  
ATOM 7881  N N    . MET B 1 30 ? 10.601  12.024  0.083   1.00 0.00 ? 30 MET B N    6  
ATOM 7882  C CA   . MET B 1 30 ? 9.649   13.080  -0.244  1.00 0.00 ? 30 MET B CA   6  
ATOM 7883  C C    . MET B 1 30 ? 9.641   14.161  0.831   1.00 0.00 ? 30 MET B C    6  
ATOM 7884  O O    . MET B 1 30 ? 9.688   15.353  0.527   1.00 0.00 ? 30 MET B O    6  
ATOM 7885  C CB   . MET B 1 30 ? 8.244   12.497  -0.408  1.00 0.00 ? 30 MET B CB   6  
ATOM 7886  C CG   . MET B 1 30 ? 7.211   13.516  -0.859  1.00 0.00 ? 30 MET B CG   6  
ATOM 7887  S SD   . MET B 1 30 ? 5.567   12.803  -1.047  1.00 0.00 ? 30 MET B SD   6  
ATOM 7888  C CE   . MET B 1 30 ? 5.226   12.287  0.634   1.00 0.00 ? 30 MET B CE   6  
ATOM 7889  H H    . MET B 1 30 ? 10.264  11.108  0.216   1.00 0.00 ? 30 MET B H    6  
ATOM 7890  H HA   . MET B 1 30 ? 9.952   13.526  -1.182  1.00 0.00 ? 30 MET B HA   6  
ATOM 7891  H HB2  . MET B 1 30 ? 8.286   11.720  -1.154  1.00 0.00 ? 30 MET B HB2  6  
ATOM 7892  H HB3  . MET B 1 30 ? 7.928   12.069  0.533   1.00 0.00 ? 30 MET B HB3  6  
ATOM 7893  H HG2  . MET B 1 30 ? 7.154   14.309  -0.129  1.00 0.00 ? 30 MET B HG2  6  
ATOM 7894  H HG3  . MET B 1 30 ? 7.520   13.925  -1.810  1.00 0.00 ? 30 MET B HG3  6  
ATOM 7895  H HE1  . MET B 1 30 ? 5.814   12.870  1.328   1.00 0.00 ? 30 MET B HE1  6  
ATOM 7896  H HE2  . MET B 1 30 ? 5.469   11.243  0.745   1.00 0.00 ? 30 MET B HE2  6  
ATOM 7897  H HE3  . MET B 1 30 ? 4.177   12.433  0.845   1.00 0.00 ? 30 MET B HE3  6  
ATOM 7898  N N    . LEU B 1 31 ? 9.582   13.735  2.089   1.00 0.00 ? 31 LEU B N    6  
ATOM 7899  C CA   . LEU B 1 31 ? 9.563   14.664  3.213   1.00 0.00 ? 31 LEU B CA   6  
ATOM 7900  C C    . LEU B 1 31 ? 10.964  15.183  3.519   1.00 0.00 ? 31 LEU B C    6  
ATOM 7901  O O    . LEU B 1 31 ? 11.125  16.256  4.101   1.00 0.00 ? 31 LEU B O    6  
ATOM 7902  C CB   . LEU B 1 31 ? 8.974   13.979  4.449   1.00 0.00 ? 31 LEU B CB   6  
ATOM 7903  C CG   . LEU B 1 31 ? 8.758   14.886  5.662   1.00 0.00 ? 31 LEU B CG   6  
ATOM 7904  C CD1  . LEU B 1 31 ? 7.758   15.986  5.339   1.00 0.00 ? 31 LEU B CD1  6  
ATOM 7905  C CD2  . LEU B 1 31 ? 8.282   14.070  6.855   1.00 0.00 ? 31 LEU B CD2  6  
ATOM 7906  H H    . LEU B 1 31 ? 9.548   12.765  2.272   1.00 0.00 ? 31 LEU B H    6  
ATOM 7907  H HA   . LEU B 1 31 ? 8.935   15.497  2.945   1.00 0.00 ? 31 LEU B HA   6  
ATOM 7908  H HB2  . LEU B 1 31 ? 8.021   13.546  4.169   1.00 0.00 ? 31 LEU B HB2  6  
ATOM 7909  H HB3  . LEU B 1 31 ? 9.639   13.173  4.737   1.00 0.00 ? 31 LEU B HB3  6  
ATOM 7910  H HG   . LEU B 1 31 ? 9.693   15.354  5.931   1.00 0.00 ? 31 LEU B HG   6  
ATOM 7911  H HD11 . LEU B 1 31 ? 8.151   16.618  4.558   1.00 0.00 ? 31 LEU B HD11 6  
ATOM 7912  H HD12 . LEU B 1 31 ? 7.581   16.587  6.221   1.00 0.00 ? 31 LEU B HD12 6  
ATOM 7913  H HD13 . LEU B 1 31 ? 6.825   15.548  5.012   1.00 0.00 ? 31 LEU B HD13 6  
ATOM 7914  H HD21 . LEU B 1 31 ? 9.014   13.309  7.089   1.00 0.00 ? 31 LEU B HD21 6  
ATOM 7915  H HD22 . LEU B 1 31 ? 7.337   13.598  6.622   1.00 0.00 ? 31 LEU B HD22 6  
ATOM 7916  H HD23 . LEU B 1 31 ? 8.158   14.718  7.712   1.00 0.00 ? 31 LEU B HD23 6  
ATOM 7917  N N    . TRP B 1 32 ? 11.976  14.416  3.122   1.00 0.00 ? 32 TRP B N    6  
ATOM 7918  C CA   . TRP B 1 32 ? 13.366  14.799  3.354   1.00 0.00 ? 32 TRP B CA   6  
ATOM 7919  C C    . TRP B 1 32 ? 13.738  16.030  2.531   1.00 0.00 ? 32 TRP B C    6  
ATOM 7920  O O    . TRP B 1 32 ? 14.524  16.867  2.973   1.00 0.00 ? 32 TRP B O    6  
ATOM 7921  C CB   . TRP B 1 32 ? 14.301  13.636  3.012   1.00 0.00 ? 32 TRP B CB   6  
ATOM 7922  C CG   . TRP B 1 32 ? 15.758  13.985  3.107   1.00 0.00 ? 32 TRP B CG   6  
ATOM 7923  C CD1  . TRP B 1 32 ? 16.431  14.408  4.218   1.00 0.00 ? 32 TRP B CD1  6  
ATOM 7924  C CD2  . TRP B 1 32 ? 16.722  13.938  2.049   1.00 0.00 ? 32 TRP B CD2  6  
ATOM 7925  N NE1  . TRP B 1 32 ? 17.753  14.628  3.914   1.00 0.00 ? 32 TRP B NE1  6  
ATOM 7926  C CE2  . TRP B 1 32 ? 17.956  14.346  2.588   1.00 0.00 ? 32 TRP B CE2  6  
ATOM 7927  C CE3  . TRP B 1 32 ? 16.660  13.589  0.698   1.00 0.00 ? 32 TRP B CE3  6  
ATOM 7928  C CZ2  . TRP B 1 32 ? 19.117  14.416  1.823   1.00 0.00 ? 32 TRP B CZ2  6  
ATOM 7929  C CZ3  . TRP B 1 32 ? 17.813  13.658  -0.061  1.00 0.00 ? 32 TRP B CZ3  6  
ATOM 7930  C CH2  . TRP B 1 32 ? 19.027  14.069  0.502   1.00 0.00 ? 32 TRP B CH2  6  
ATOM 7931  H H    . TRP B 1 32 ? 11.795  13.565  2.662   1.00 0.00 ? 32 TRP B H    6  
ATOM 7932  H HA   . TRP B 1 32 ? 13.481  15.037  4.404   1.00 0.00 ? 32 TRP B HA   6  
ATOM 7933  H HB2  . TRP B 1 32 ? 14.110  12.819  3.692   1.00 0.00 ? 32 TRP B HB2  6  
ATOM 7934  H HB3  . TRP B 1 32 ? 14.096  13.312  2.003   1.00 0.00 ? 32 TRP B HB3  6  
ATOM 7935  H HD1  . TRP B 1 32 ? 15.977  14.547  5.188   1.00 0.00 ? 32 TRP B HD1  6  
ATOM 7936  H HE1  . TRP B 1 32 ? 18.438  14.936  4.543   1.00 0.00 ? 32 TRP B HE1  6  
ATOM 7937  H HE3  . TRP B 1 32 ? 15.734  13.271  0.248   1.00 0.00 ? 32 TRP B HE3  6  
ATOM 7938  H HZ2  . TRP B 1 32 ? 20.061  14.731  2.243   1.00 0.00 ? 32 TRP B HZ2  6  
ATOM 7939  H HZ3  . TRP B 1 32 ? 17.784  13.393  -1.108  1.00 0.00 ? 32 TRP B HZ3  6  
ATOM 7940  H HH2  . TRP B 1 32 ? 19.902  14.109  -0.129  1.00 0.00 ? 32 TRP B HH2  6  
ATOM 7941  N N    . GLN B 1 33 ? 13.169  16.132  1.333   1.00 0.00 ? 33 GLN B N    6  
ATOM 7942  C CA   . GLN B 1 33 ? 13.448  17.258  0.449   1.00 0.00 ? 33 GLN B CA   6  
ATOM 7943  C C    . GLN B 1 33 ? 12.352  18.313  0.546   1.00 0.00 ? 33 GLN B C    6  
ATOM 7944  O O    . GLN B 1 33 ? 12.477  19.402  -0.013  1.00 0.00 ? 33 GLN B O    6  
ATOM 7945  C CB   . GLN B 1 33 ? 13.584  16.782  -0.996  1.00 0.00 ? 33 GLN B CB   6  
ATOM 7946  C CG   . GLN B 1 33 ? 14.763  15.847  -1.221  1.00 0.00 ? 33 GLN B CG   6  
ATOM 7947  C CD   . GLN B 1 33 ? 14.894  15.406  -2.667  1.00 0.00 ? 33 GLN B CD   6  
ATOM 7948  O OE1  . GLN B 1 33 ? 15.996  15.140  -3.148  1.00 0.00 ? 33 GLN B OE1  6  
ATOM 7949  N NE2  . GLN B 1 33 ? 13.769  15.325  -3.369  1.00 0.00 ? 33 GLN B NE2  6  
ATOM 7950  H H    . GLN B 1 33 ? 12.546  15.435  1.022   1.00 0.00 ? 33 GLN B H    6  
ATOM 7951  H HA   . GLN B 1 33 ? 14.385  17.718  0.745   1.00 0.00 ? 33 GLN B HA   6  
ATOM 7952  H HB2  . GLN B 1 33 ? 12.677  16.261  -1.255  1.00 0.00 ? 33 GLN B HB2  6  
ATOM 7953  H HB3  . GLN B 1 33 ? 13.700  17.641  -1.647  1.00 0.00 ? 33 GLN B HB3  6  
ATOM 7954  H HG2  . GLN B 1 33 ? 15.671  16.356  -0.933  1.00 0.00 ? 33 GLN B HG2  6  
ATOM 7955  H HG3  . GLN B 1 33 ? 14.631  14.971  -0.604  1.00 0.00 ? 33 GLN B HG3  6  
ATOM 7956  H HE21 . GLN B 1 33 ? 12.909  15.532  -2.962  1.00 0.00 ? 33 GLN B HE21 6  
ATOM 7957  H HE22 . GLN B 1 33 ? 13.851  15.050  -4.306  1.00 0.00 ? 33 GLN B HE22 6  
ATOM 7958  N N    . LYS B 1 34 ? 11.276  17.984  1.251   1.00 0.00 ? 34 LYS B N    6  
ATOM 7959  C CA   . LYS B 1 34 ? 10.163  18.911  1.417   1.00 0.00 ? 34 LYS B CA   6  
ATOM 7960  C C    . LYS B 1 34 ? 10.423  19.855  2.585   1.00 0.00 ? 34 LYS B C    6  
ATOM 7961  O O    . LYS B 1 34 ? 10.181  19.510  3.743   1.00 0.00 ? 34 LYS B O    6  
ATOM 7962  C CB   . LYS B 1 34 ? 8.858   18.148  1.642   1.00 0.00 ? 34 LYS B CB   6  
ATOM 7963  C CG   . LYS B 1 34 ? 7.640   19.050  1.763   1.00 0.00 ? 34 LYS B CG   6  
ATOM 7964  C CD   . LYS B 1 34 ? 6.368   18.243  1.964   1.00 0.00 ? 34 LYS B CD   6  
ATOM 7965  C CE   . LYS B 1 34 ? 5.151   19.144  2.099   1.00 0.00 ? 34 LYS B CE   6  
ATOM 7966  N NZ   . LYS B 1 34 ? 4.959   20.005  0.898   1.00 0.00 ? 34 LYS B NZ   6  
ATOM 7967  H H    . LYS B 1 34 ? 11.215  17.106  1.675   1.00 0.00 ? 34 LYS B H    6  
ATOM 7968  H HA   . LYS B 1 34 ? 10.062  19.495  0.506   1.00 0.00 ? 34 LYS B HA   6  
ATOM 7969  H HB2  . LYS B 1 34 ? 8.701   17.485  0.807   1.00 0.00 ? 34 LYS B HB2  6  
ATOM 7970  H HB3  . LYS B 1 34 ? 8.944   17.566  2.547   1.00 0.00 ? 34 LYS B HB3  6  
ATOM 7971  H HG2  . LYS B 1 34 ? 7.768   19.710  2.608   1.00 0.00 ? 34 LYS B HG2  6  
ATOM 7972  H HG3  . LYS B 1 34 ? 7.549   19.632  0.857   1.00 0.00 ? 34 LYS B HG3  6  
ATOM 7973  H HD2  . LYS B 1 34 ? 6.225   17.592  1.114   1.00 0.00 ? 34 LYS B HD2  6  
ATOM 7974  H HD3  . LYS B 1 34 ? 6.464   17.650  2.863   1.00 0.00 ? 34 LYS B HD3  6  
ATOM 7975  H HE2  . LYS B 1 34 ? 4.275   18.525  2.229   1.00 0.00 ? 34 LYS B HE2  6  
ATOM 7976  H HE3  . LYS B 1 34 ? 5.276   19.774  2.968   1.00 0.00 ? 34 LYS B HE3  6  
ATOM 7977  H HZ1  . LYS B 1 34 ? 5.020   19.439  0.024   1.00 0.00 ? 34 LYS B HZ1  6  
ATOM 7978  H HZ2  . LYS B 1 34 ? 5.683   20.750  0.868   1.00 0.00 ? 34 LYS B HZ2  6  
ATOM 7979  H HZ3  . LYS B 1 34 ? 4.023   20.457  0.936   1.00 0.00 ? 34 LYS B HZ3  6  
ATOM 7980  N N    . LYS B 1 35 ? 10.924  21.046  2.273   1.00 0.00 ? 35 LYS B N    6  
ATOM 7981  C CA   . LYS B 1 35 ? 11.223  22.040  3.293   1.00 0.00 ? 35 LYS B CA   6  
ATOM 7982  C C    . LYS B 1 35 ? 10.095  23.067  3.403   1.00 0.00 ? 35 LYS B C    6  
ATOM 7983  O O    . LYS B 1 35 ? 9.592   23.552  2.388   1.00 0.00 ? 35 LYS B O    6  
ATOM 7984  C CB   . LYS B 1 35 ? 12.544  22.741  2.967   1.00 0.00 ? 35 LYS B CB   6  
ATOM 7985  C CG   . LYS B 1 35 ? 12.955  23.781  3.998   1.00 0.00 ? 35 LYS B CG   6  
ATOM 7986  C CD   . LYS B 1 35 ? 14.322  24.368  3.683   1.00 0.00 ? 35 LYS B CD   6  
ATOM 7987  C CE   . LYS B 1 35 ? 14.757  25.362  4.746   1.00 0.00 ? 35 LYS B CE   6  
ATOM 7988  N NZ   . LYS B 1 35 ? 14.745  24.759  6.107   1.00 0.00 ? 35 LYS B NZ   6  
ATOM 7989  H H    . LYS B 1 35 ? 11.099  21.267  1.327   1.00 0.00 ? 35 LYS B H    6  
ATOM 7990  H HA   . LYS B 1 35 ? 11.345  21.527  4.235   1.00 0.00 ? 35 LYS B HA   6  
ATOM 7991  H HB2  . LYS B 1 35 ? 13.322  21.992  2.907   1.00 0.00 ? 35 LYS B HB2  6  
ATOM 7992  H HB3  . LYS B 1 35 ? 12.454  23.229  2.006   1.00 0.00 ? 35 LYS B HB3  6  
ATOM 7993  H HG2  . LYS B 1 35 ? 12.228  24.579  4.014   1.00 0.00 ? 35 LYS B HG2  6  
ATOM 7994  H HG3  . LYS B 1 35 ? 12.997  23.303  4.963   1.00 0.00 ? 35 LYS B HG3  6  
ATOM 7995  H HD2  . LYS B 1 35 ? 15.050  23.570  3.637   1.00 0.00 ? 35 LYS B HD2  6  
ATOM 7996  H HD3  . LYS B 1 35 ? 14.277  24.873  2.729   1.00 0.00 ? 35 LYS B HD3  6  
ATOM 7997  H HE2  . LYS B 1 35 ? 15.758  25.696  4.520   1.00 0.00 ? 35 LYS B HE2  6  
ATOM 7998  H HE3  . LYS B 1 35 ? 14.084  26.207  4.729   1.00 0.00 ? 35 LYS B HE3  6  
ATOM 7999  H HZ1  . LYS B 1 35 ? 13.769  24.679  6.457   1.00 0.00 ? 35 LYS B HZ1  6  
ATOM 8000  H HZ2  . LYS B 1 35 ? 15.281  25.362  6.763   1.00 0.00 ? 35 LYS B HZ2  6  
ATOM 8001  H HZ3  . LYS B 1 35 ? 15.181  23.812  6.098   1.00 0.00 ? 35 LYS B HZ3  6  
ATOM 8002  N N    . PRO B 1 36 ? 9.677   23.414  4.637   1.00 0.00 ? 36 PRO B N    6  
ATOM 8003  C CA   . PRO B 1 36 ? 8.602   24.386  4.859   1.00 0.00 ? 36 PRO B CA   6  
ATOM 8004  C C    . PRO B 1 36 ? 9.017   25.802  4.476   1.00 0.00 ? 36 PRO B C    6  
ATOM 8005  O O    . PRO B 1 36 ? 9.997   26.335  4.995   1.00 0.00 ? 36 PRO B O    6  
ATOM 8006  C CB   . PRO B 1 36 ? 8.341   24.298  6.365   1.00 0.00 ? 36 PRO B CB   6  
ATOM 8007  C CG   . PRO B 1 36 ? 9.626   23.813  6.939   1.00 0.00 ? 36 PRO B CG   6  
ATOM 8008  C CD   . PRO B 1 36 ? 10.216  22.892  5.910   1.00 0.00 ? 36 PRO B CD   6  
ATOM 8009  H HA   . PRO B 1 36 ? 7.704   24.105  4.323   1.00 0.00 ? 36 PRO B HA   6  
ATOM 8010  H HB2  . PRO B 1 36 ? 8.065   25.265  6.767   1.00 0.00 ? 36 PRO B HB2  6  
ATOM 8011  H HB3  . PRO B 1 36 ? 7.545   23.592  6.548   1.00 0.00 ? 36 PRO B HB3  6  
ATOM 8012  H HG2  . PRO B 1 36 ? 10.287  24.648  7.118   1.00 0.00 ? 36 PRO B HG2  6  
ATOM 8013  H HG3  . PRO B 1 36 ? 9.439   23.277  7.858   1.00 0.00 ? 36 PRO B HG3  6  
ATOM 8014  H HD2  . PRO B 1 36 ? 11.285  22.944  5.938   1.00 0.00 ? 36 PRO B HD2  6  
ATOM 8015  H HD3  . PRO B 1 36 ? 9.884   21.878  6.079   1.00 0.00 ? 36 PRO B HD3  6  
ATOM 8016  N N    . ARG B 1 37 ? 8.264   26.407  3.562   1.00 0.00 ? 37 ARG B N    6  
ATOM 8017  C CA   . ARG B 1 37 ? 8.550   27.762  3.109   1.00 0.00 ? 37 ARG B CA   6  
ATOM 8018  C C    . ARG B 1 37 ? 7.407   28.708  3.463   1.00 0.00 ? 37 ARG B C    6  
ATOM 8019  O O    . ARG B 1 37 ? 6.241   28.418  3.192   1.00 0.00 ? 37 ARG B O    6  
ATOM 8020  C CB   . ARG B 1 37 ? 8.795   27.775  1.597   1.00 0.00 ? 37 ARG B CB   6  
ATOM 8021  C CG   . ARG B 1 37 ? 7.697   27.094  0.796   1.00 0.00 ? 37 ARG B CG   6  
ATOM 8022  C CD   . ARG B 1 37 ? 7.981   27.150  -0.697  1.00 0.00 ? 37 ARG B CD   6  
ATOM 8023  N NE   . ARG B 1 37 ? 8.090   28.525  -1.179  1.00 0.00 ? 37 ARG B NE   6  
ATOM 8024  C CZ   . ARG B 1 37 ? 8.541   28.848  -2.387  1.00 0.00 ? 37 ARG B CZ   6  
ATOM 8025  N NH1  . ARG B 1 37 ? 8.934   27.903  -3.232  1.00 0.00 ? 37 ARG B NH1  6  
ATOM 8026  N NH2  . ARG B 1 37 ? 8.600   30.121  -2.755  1.00 0.00 ? 37 ARG B NH2  6  
ATOM 8027  H H    . ARG B 1 37 ? 7.487   25.937  3.188   1.00 0.00 ? 37 ARG B H    6  
ATOM 8028  H HA   . ARG B 1 37 ? 9.453   28.114  3.596   1.00 0.00 ? 37 ARG B HA   6  
ATOM 8029  H HB2  . ARG B 1 37 ? 8.889   28.800  1.262   1.00 0.00 ? 37 ARG B HB2  6  
ATOM 8030  H HB3  . ARG B 1 37 ? 9.725   27.260  1.400   1.00 0.00 ? 37 ARG B HB3  6  
ATOM 8031  H HG2  . ARG B 1 37 ? 7.631   26.059  1.091   1.00 0.00 ? 37 ARG B HG2  6  
ATOM 8032  H HG3  . ARG B 1 37 ? 6.758   27.588  0.989   1.00 0.00 ? 37 ARG B HG3  6  
ATOM 8033  H HD2  . ARG B 1 37 ? 8.909   26.627  -0.888  1.00 0.00 ? 37 ARG B HD2  6  
ATOM 8034  H HD3  . ARG B 1 37 ? 7.176   26.656  -1.222  1.00 0.00 ? 37 ARG B HD3  6  
ATOM 8035  H HE   . ARG B 1 37 ? 7.803   29.250  -0.576  1.00 0.00 ? 37 ARG B HE   6  
ATOM 8036  H HH11 . ARG B 1 37 ? 8.900   26.937  -2.986  1.00 0.00 ? 37 ARG B HH11 6  
ATOM 8037  H HH12 . ARG B 1 37 ? 9.274   28.161  -4.139  1.00 0.00 ? 37 ARG B HH12 6  
ATOM 8038  H HH21 . ARG B 1 37 ? 8.305   30.842  -2.124  1.00 0.00 ? 37 ARG B HH21 6  
ATOM 8039  H HH22 . ARG B 1 37 ? 8.940   30.368  -3.665  1.00 0.00 ? 37 ARG B HH22 6  
ATOM 8040  N N    . TYR B 1 38 ? 7.750   29.840  4.070   1.00 0.00 ? 38 TYR B N    6  
ATOM 8041  C CA   . TYR B 1 38 ? 6.751   30.829  4.461   1.00 0.00 ? 38 TYR B CA   6  
ATOM 8042  C C    . TYR B 1 38 ? 6.949   32.132  3.694   1.00 0.00 ? 38 TYR B C    6  
ATOM 8043  O O    . TYR B 1 38 ? 8.079   32.547  3.435   1.00 0.00 ? 38 TYR B O    6  
ATOM 8044  C CB   . TYR B 1 38 ? 6.829   31.090  5.968   1.00 0.00 ? 38 TYR B CB   6  
ATOM 8045  C CG   . TYR B 1 38 ? 5.777   32.051  6.472   1.00 0.00 ? 38 TYR B CG   6  
ATOM 8046  C CD1  . TYR B 1 38 ? 4.477   31.622  6.716   1.00 0.00 ? 38 TYR B CD1  6  
ATOM 8047  C CD2  . TYR B 1 38 ? 6.081   33.386  6.709   1.00 0.00 ? 38 TYR B CD2  6  
ATOM 8048  C CE1  . TYR B 1 38 ? 3.512   32.497  7.178   1.00 0.00 ? 38 TYR B CE1  6  
ATOM 8049  C CE2  . TYR B 1 38 ? 5.122   34.266  7.170   1.00 0.00 ? 38 TYR B CE2  6  
ATOM 8050  C CZ   . TYR B 1 38 ? 3.840   33.818  7.405   1.00 0.00 ? 38 TYR B CZ   6  
ATOM 8051  O OH   . TYR B 1 38 ? 2.882   34.693  7.865   1.00 0.00 ? 38 TYR B OH   6  
ATOM 8052  H H    . TYR B 1 38 ? 8.697   30.027  4.264   1.00 0.00 ? 38 TYR B H    6  
ATOM 8053  H HA   . TYR B 1 38 ? 5.762   30.444  4.235   1.00 0.00 ? 38 TYR B HA   6  
ATOM 8054  H HB2  . TYR B 1 38 ? 6.703   30.150  6.489   1.00 0.00 ? 38 TYR B HB2  6  
ATOM 8055  H HB3  . TYR B 1 38 ? 7.807   31.491  6.208   1.00 0.00 ? 38 TYR B HB3  6  
ATOM 8056  H HD1  . TYR B 1 38 ? 4.219   30.587  6.538   1.00 0.00 ? 38 TYR B HD1  6  
ATOM 8057  H HD2  . TYR B 1 38 ? 7.086   33.740  6.525   1.00 0.00 ? 38 TYR B HD2  6  
ATOM 8058  H HE1  . TYR B 1 38 ? 2.508   32.145  7.362   1.00 0.00 ? 38 TYR B HE1  6  
ATOM 8059  H HE2  . TYR B 1 38 ? 5.380   35.300  7.347   1.00 0.00 ? 38 TYR B HE2  6  
ATOM 8060  H HH   . TYR B 1 38 ? 2.846   34.654  8.824   1.00 0.00 ? 38 TYR B HH   6  
ATOM 8061  N N    . GLU B 1 39 ? 5.842   32.773  3.332   1.00 0.00 ? 39 GLU B N    6  
ATOM 8062  C CA   . GLU B 1 39 ? 5.891   34.030  2.592   1.00 0.00 ? 39 GLU B CA   6  
ATOM 8063  C C    . GLU B 1 39 ? 5.479   35.200  3.479   1.00 0.00 ? 39 GLU B C    6  
ATOM 8064  O O    . GLU B 1 39 ? 6.234   36.195  3.536   1.00 0.00 ? 39 GLU B O    6  
ATOM 8065  C CB   . GLU B 1 39 ? 4.982   33.958  1.364   1.00 0.00 ? 39 GLU B CB   6  
ATOM 8066  C CG   . GLU B 1 39 ? 5.309   32.804  0.429   1.00 0.00 ? 39 GLU B CG   6  
ATOM 8067  C CD   . GLU B 1 39 ? 6.718   32.883  -0.125  1.00 0.00 ? 39 GLU B CD   6  
ATOM 8068  O OE1  . GLU B 1 39 ? 6.910   33.545  -1.167  1.00 0.00 ? 39 GLU B OE1  6  
ATOM 8069  O OE2  . GLU B 1 39 ? 7.628   32.281  0.480   1.00 0.00 ? 39 GLU B OE2  6  
ATOM 8070  O OXT  . GLU B 1 39 ? 4.403   35.117  4.111   1.00 0.00 ? 39 GLU B OXT  6  
ATOM 8071  H H    . GLU B 1 39 ? 4.961   32.397  3.567   1.00 0.00 ? 39 GLU B H    6  
ATOM 8072  H HA   . GLU B 1 39 ? 6.905   34.207  2.254   1.00 0.00 ? 39 GLU B HA   6  
ATOM 8073  H HB2  . GLU B 1 39 ? 3.957   33.842  1.691   1.00 0.00 ? 39 GLU B HB2  6  
ATOM 8074  H HB3  . GLU B 1 39 ? 5.069   34.880  0.805   1.00 0.00 ? 39 GLU B HB3  6  
ATOM 8075  H HG2  . GLU B 1 39 ? 5.204   31.876  0.971   1.00 0.00 ? 39 GLU B HG2  6  
ATOM 8076  H HG3  . GLU B 1 39 ? 4.612   32.818  -0.396  1.00 0.00 ? 39 GLU B HG3  6  
ATOM 8077  N N    . GLY A 1 1  ? 11.570  -32.685 8.098   1.00 0.00 ? 1  GLY A N    7  
ATOM 8078  C CA   . GLY A 1 1  ? 10.115  -32.914 7.875   1.00 0.00 ? 1  GLY A CA   7  
ATOM 8079  C C    . GLY A 1 1  ? 9.258   -31.808 8.457   1.00 0.00 ? 1  GLY A C    7  
ATOM 8080  O O    . GLY A 1 1  ? 8.378   -32.064 9.280   1.00 0.00 ? 1  GLY A O    7  
ATOM 8081  H H1   . GLY A 1 1  ? 11.772  -32.600 9.116   1.00 0.00 ? 1  GLY A H1   7  
ATOM 8082  H H2   . GLY A 1 1  ? 11.877  -31.814 7.621   1.00 0.00 ? 1  GLY A H2   7  
ATOM 8083  H H3   . GLY A 1 1  ? 12.117  -33.483 7.716   1.00 0.00 ? 1  GLY A H3   7  
ATOM 8084  H HA2  . GLY A 1 1  ? 9.930   -32.976 6.813   1.00 0.00 ? 1  GLY A HA2  7  
ATOM 8085  H HA3  . GLY A 1 1  ? 9.835   -33.851 8.333   1.00 0.00 ? 1  GLY A HA3  7  
ATOM 8086  N N    . HIS A 1 2  ? 9.512   -30.576 8.028   1.00 0.00 ? 2  HIS A N    7  
ATOM 8087  C CA   . HIS A 1 2  ? 8.758   -29.426 8.514   1.00 0.00 ? 2  HIS A CA   7  
ATOM 8088  C C    . HIS A 1 2  ? 7.600   -29.096 7.578   1.00 0.00 ? 2  HIS A C    7  
ATOM 8089  O O    . HIS A 1 2  ? 6.433   -29.219 7.954   1.00 0.00 ? 2  HIS A O    7  
ATOM 8090  C CB   . HIS A 1 2  ? 9.674   -28.211 8.655   1.00 0.00 ? 2  HIS A CB   7  
ATOM 8091  C CG   . HIS A 1 2  ? 10.792  -28.420 9.629   1.00 0.00 ? 2  HIS A CG   7  
ATOM 8092  N ND1  . HIS A 1 2  ? 12.121  -28.410 9.261   1.00 0.00 ? 2  HIS A ND1  7  
ATOM 8093  C CD2  . HIS A 1 2  ? 10.774  -28.645 10.963  1.00 0.00 ? 2  HIS A CD2  7  
ATOM 8094  C CE1  . HIS A 1 2  ? 12.872  -28.620 10.329  1.00 0.00 ? 2  HIS A CE1  7  
ATOM 8095  N NE2  . HIS A 1 2  ? 12.078  -28.764 11.373  1.00 0.00 ? 2  HIS A NE2  7  
ATOM 8096  H H    . HIS A 1 2  ? 10.224  -30.430 7.361   1.00 0.00 ? 2  HIS A H    7  
ATOM 8097  H HA   . HIS A 1 2  ? 8.349   -29.659 9.491   1.00 0.00 ? 2  HIS A HA   7  
ATOM 8098  H HB2  . HIS A 1 2  ? 10.113  -27.978 7.697   1.00 0.00 ? 2  HIS A HB2  7  
ATOM 8099  H HB3  . HIS A 1 2  ? 9.095   -27.363 8.997   1.00 0.00 ? 2  HIS A HB3  7  
ATOM 8100  H HD1  . HIS A 1 2  ? 12.463  -28.271 8.353   1.00 0.00 ? 2  HIS A HD1  7  
ATOM 8101  H HD2  . HIS A 1 2  ? 9.896   -28.717 11.589  1.00 0.00 ? 2  HIS A HD2  7  
ATOM 8102  H HE1  . HIS A 1 2  ? 13.951  -28.664 10.344  1.00 0.00 ? 2  HIS A HE1  7  
ATOM 8103  H HE2  . HIS A 1 2  ? 12.377  -28.849 12.302  1.00 0.00 ? 2  HIS A HE2  7  
ATOM 8104  N N    . SER A 1 3  ? 7.932   -28.679 6.360   1.00 0.00 ? 3  SER A N    7  
ATOM 8105  C CA   . SER A 1 3  ? 6.925   -28.327 5.363   1.00 0.00 ? 3  SER A CA   7  
ATOM 8106  C C    . SER A 1 3  ? 6.007   -27.222 5.878   1.00 0.00 ? 3  SER A C    7  
ATOM 8107  O O    . SER A 1 3  ? 5.000   -27.494 6.534   1.00 0.00 ? 3  SER A O    7  
ATOM 8108  C CB   . SER A 1 3  ? 6.101   -29.558 4.981   1.00 0.00 ? 3  SER A CB   7  
ATOM 8109  O OG   . SER A 1 3  ? 5.133   -29.240 3.995   1.00 0.00 ? 3  SER A OG   7  
ATOM 8110  H H    . SER A 1 3  ? 8.878   -28.604 6.105   1.00 0.00 ? 3  SER A H    7  
ATOM 8111  H HA   . SER A 1 3  ? 7.445   -27.972 4.484   1.00 0.00 ? 3  SER A HA   7  
ATOM 8112  H HB2  . SER A 1 3  ? 6.758   -30.317 4.585   1.00 0.00 ? 3  SER A HB2  7  
ATOM 8113  H HB3  . SER A 1 3  ? 5.593   -29.944 5.851   1.00 0.00 ? 3  SER A HB3  7  
ATOM 8114  H HG   . SER A 1 3  ? 4.518   -29.972 3.902   1.00 0.00 ? 3  SER A HG   7  
ATOM 8115  N N    . LEU A 1 4  ? 6.361   -25.977 5.577   1.00 0.00 ? 4  LEU A N    7  
ATOM 8116  C CA   . LEU A 1 4  ? 5.567   -24.832 6.010   1.00 0.00 ? 4  LEU A CA   7  
ATOM 8117  C C    . LEU A 1 4  ? 4.170   -24.885 5.391   1.00 0.00 ? 4  LEU A C    7  
ATOM 8118  O O    . LEU A 1 4  ? 4.033   -24.939 4.169   1.00 0.00 ? 4  LEU A O    7  
ATOM 8119  C CB   . LEU A 1 4  ? 6.262   -23.522 5.625   1.00 0.00 ? 4  LEU A CB   7  
ATOM 8120  C CG   . LEU A 1 4  ? 7.601   -23.263 6.321   1.00 0.00 ? 4  LEU A CG   7  
ATOM 8121  C CD1  . LEU A 1 4  ? 8.718   -24.055 5.659   1.00 0.00 ? 4  LEU A CD1  7  
ATOM 8122  C CD2  . LEU A 1 4  ? 7.923   -21.776 6.318   1.00 0.00 ? 4  LEU A CD2  7  
ATOM 8123  H H    . LEU A 1 4  ? 7.160   -25.837 5.033   1.00 0.00 ? 4  LEU A H    7  
ATOM 8124  H HA   . LEU A 1 4  ? 5.508   -24.881 7.084   1.00 0.00 ? 4  LEU A HA   7  
ATOM 8125  H HB2  . LEU A 1 4  ? 6.415   -23.519 4.552   1.00 0.00 ? 4  LEU A HB2  7  
ATOM 8126  H HB3  . LEU A 1 4  ? 5.589   -22.707 5.871   1.00 0.00 ? 4  LEU A HB3  7  
ATOM 8127  H HG   . LEU A 1 4  ? 7.536   -23.583 7.353   1.00 0.00 ? 4  LEU A HG   7  
ATOM 8128  H HD11 . LEU A 1 4  ? 8.564   -24.103 4.588   1.00 0.00 ? 4  LEU A HD11 7  
ATOM 8129  H HD12 . LEU A 1 4  ? 8.735   -25.054 6.065   1.00 0.00 ? 4  LEU A HD12 7  
ATOM 8130  H HD13 . LEU A 1 4  ? 9.675   -23.588 5.859   1.00 0.00 ? 4  LEU A HD13 7  
ATOM 8131  H HD21 . LEU A 1 4  ? 7.133   -21.233 6.819   1.00 0.00 ? 4  LEU A HD21 7  
ATOM 8132  H HD22 . LEU A 1 4  ? 8.011   -21.423 5.300   1.00 0.00 ? 4  LEU A HD22 7  
ATOM 8133  H HD23 . LEU A 1 4  ? 8.856   -21.606 6.838   1.00 0.00 ? 4  LEU A HD23 7  
ATOM 8134  N N    . PRO A 1 5  ? 3.109   -24.871 6.225   1.00 0.00 ? 5  PRO A N    7  
ATOM 8135  C CA   . PRO A 1 5  ? 1.725   -24.925 5.737   1.00 0.00 ? 5  PRO A CA   7  
ATOM 8136  C C    . PRO A 1 5  ? 1.372   -23.722 4.869   1.00 0.00 ? 5  PRO A C    7  
ATOM 8137  O O    . PRO A 1 5  ? 1.945   -22.643 5.023   1.00 0.00 ? 5  PRO A O    7  
ATOM 8138  C CB   . PRO A 1 5  ? 0.885   -24.926 7.019   1.00 0.00 ? 5  PRO A CB   7  
ATOM 8139  C CG   . PRO A 1 5  ? 1.781   -24.364 8.069   1.00 0.00 ? 5  PRO A CG   7  
ATOM 8140  C CD   . PRO A 1 5  ? 3.169   -24.796 7.695   1.00 0.00 ? 5  PRO A CD   7  
ATOM 8141  H HA   . PRO A 1 5  ? 1.542   -25.836 5.184   1.00 0.00 ? 5  PRO A HA   7  
ATOM 8142  H HB2  . PRO A 1 5  ? -0.008  -24.324 6.897   1.00 0.00 ? 5  PRO A HB2  7  
ATOM 8143  H HB3  . PRO A 1 5  ? 0.602   -25.940 7.257   1.00 0.00 ? 5  PRO A HB3  7  
ATOM 8144  H HG2  . PRO A 1 5  ? 1.712   -23.294 8.071   1.00 0.00 ? 5  PRO A HG2  7  
ATOM 8145  H HG3  . PRO A 1 5  ? 1.512   -24.762 9.036   1.00 0.00 ? 5  PRO A HG3  7  
ATOM 8146  H HD2  . PRO A 1 5  ? 3.882   -24.054 8.023   1.00 0.00 ? 5  PRO A HD2  7  
ATOM 8147  H HD3  . PRO A 1 5  ? 3.396   -25.761 8.125   1.00 0.00 ? 5  PRO A HD3  7  
ATOM 8148  N N    . PHE A 1 6  ? 0.423   -23.916 3.957   1.00 0.00 ? 6  PHE A N    7  
ATOM 8149  C CA   . PHE A 1 6  ? -0.006  -22.849 3.062   1.00 0.00 ? 6  PHE A CA   7  
ATOM 8150  C C    . PHE A 1 6  ? -0.747  -21.757 3.830   1.00 0.00 ? 6  PHE A C    7  
ATOM 8151  O O    . PHE A 1 6  ? -0.867  -20.628 3.358   1.00 0.00 ? 6  PHE A O    7  
ATOM 8152  C CB   . PHE A 1 6  ? -0.903  -23.410 1.954   1.00 0.00 ? 6  PHE A CB   7  
ATOM 8153  C CG   . PHE A 1 6  ? -2.204  -23.972 2.454   1.00 0.00 ? 6  PHE A CG   7  
ATOM 8154  C CD1  . PHE A 1 6  ? -2.275  -25.273 2.925   1.00 0.00 ? 6  PHE A CD1  7  
ATOM 8155  C CD2  . PHE A 1 6  ? -3.357  -23.201 2.452   1.00 0.00 ? 6  PHE A CD2  7  
ATOM 8156  C CE1  . PHE A 1 6  ? -3.470  -25.795 3.383   1.00 0.00 ? 6  PHE A CE1  7  
ATOM 8157  C CE2  . PHE A 1 6  ? -4.554  -23.717 2.909   1.00 0.00 ? 6  PHE A CE2  7  
ATOM 8158  C CZ   . PHE A 1 6  ? -4.611  -25.016 3.375   1.00 0.00 ? 6  PHE A CZ   7  
ATOM 8159  H H    . PHE A 1 6  ? 0.016   -24.799 3.890   1.00 0.00 ? 6  PHE A H    7  
ATOM 8160  H HA   . PHE A 1 6  ? 0.871   -22.422 2.603   1.00 0.00 ? 6  PHE A HA   7  
ATOM 8161  H HB2  . PHE A 1 6  ? -1.118  -22.621 1.244   1.00 0.00 ? 6  PHE A HB2  7  
ATOM 8162  H HB3  . PHE A 1 6  ? -0.367  -24.198 1.440   1.00 0.00 ? 6  PHE A HB3  7  
ATOM 8163  H HD1  . PHE A 1 6  ? -1.391  -25.893 2.927   1.00 0.00 ? 6  PHE A HD1  7  
ATOM 8164  H HD2  . PHE A 1 6  ? -3.318  -22.183 2.088   1.00 0.00 ? 6  PHE A HD2  7  
ATOM 8165  H HE1  . PHE A 1 6  ? -3.512  -26.811 3.747   1.00 0.00 ? 6  PHE A HE1  7  
ATOM 8166  H HE2  . PHE A 1 6  ? -5.444  -23.106 2.901   1.00 0.00 ? 6  PHE A HE2  7  
ATOM 8167  H HZ   . PHE A 1 6  ? -5.546  -25.422 3.732   1.00 0.00 ? 6  PHE A HZ   7  
ATOM 8168  N N    . LYS A 1 7  ? -1.238  -22.103 5.016   1.00 0.00 ? 7  LYS A N    7  
ATOM 8169  C CA   . LYS A 1 7  ? -1.970  -21.152 5.842   1.00 0.00 ? 7  LYS A CA   7  
ATOM 8170  C C    . LYS A 1 7  ? -1.107  -19.945 6.187   1.00 0.00 ? 7  LYS A C    7  
ATOM 8171  O O    . LYS A 1 7  ? -1.560  -18.804 6.095   1.00 0.00 ? 7  LYS A O    7  
ATOM 8172  C CB   . LYS A 1 7  ? -2.471  -21.829 7.118   1.00 0.00 ? 7  LYS A CB   7  
ATOM 8173  C CG   . LYS A 1 7  ? -3.384  -23.015 6.850   1.00 0.00 ? 7  LYS A CG   7  
ATOM 8174  C CD   . LYS A 1 7  ? -4.216  -23.374 8.070   1.00 0.00 ? 7  LYS A CD   7  
ATOM 8175  C CE   . LYS A 1 7  ? -3.356  -23.923 9.196   1.00 0.00 ? 7  LYS A CE   7  
ATOM 8176  N NZ   . LYS A 1 7  ? -4.163  -24.229 10.409  1.00 0.00 ? 7  LYS A NZ   7  
ATOM 8177  H H    . LYS A 1 7  ? -1.123  -23.019 5.349   1.00 0.00 ? 7  LYS A H    7  
ATOM 8178  H HA   . LYS A 1 7  ? -2.826  -20.809 5.275   1.00 0.00 ? 7  LYS A HA   7  
ATOM 8179  H HB2  . LYS A 1 7  ? -1.620  -22.179 7.687   1.00 0.00 ? 7  LYS A HB2  7  
ATOM 8180  H HB3  . LYS A 1 7  ? -3.015  -21.099 7.707   1.00 0.00 ? 7  LYS A HB3  7  
ATOM 8181  H HG2  . LYS A 1 7  ? -4.059  -22.769 6.040   1.00 0.00 ? 7  LYS A HG2  7  
ATOM 8182  H HG3  . LYS A 1 7  ? -2.780  -23.866 6.567   1.00 0.00 ? 7  LYS A HG3  7  
ATOM 8183  H HD2  . LYS A 1 7  ? -4.735  -22.493 8.422   1.00 0.00 ? 7  LYS A HD2  7  
ATOM 8184  H HD3  . LYS A 1 7  ? -4.939  -24.125 7.787   1.00 0.00 ? 7  LYS A HD3  7  
ATOM 8185  H HE2  . LYS A 1 7  ? -2.876  -24.830 8.859   1.00 0.00 ? 7  LYS A HE2  7  
ATOM 8186  H HE3  . LYS A 1 7  ? -2.602  -23.194 9.458   1.00 0.00 ? 7  LYS A HE3  7  
ATOM 8187  H HZ1  . LYS A 1 7  ? -3.547  -24.603 11.159  1.00 0.00 ? 7  LYS A HZ1  7  
ATOM 8188  H HZ2  . LYS A 1 7  ? -4.890  -24.941 10.191  1.00 0.00 ? 7  LYS A HZ2  7  
ATOM 8189  H HZ3  . LYS A 1 7  ? -4.631  -23.367 10.760  1.00 0.00 ? 7  LYS A HZ3  7  
ATOM 8190  N N    . VAL A 1 8  ? 0.138   -20.196 6.579   1.00 0.00 ? 8  VAL A N    7  
ATOM 8191  C CA   . VAL A 1 8  ? 1.055   -19.117 6.927   1.00 0.00 ? 8  VAL A CA   7  
ATOM 8192  C C    . VAL A 1 8  ? 1.307   -18.215 5.723   1.00 0.00 ? 8  VAL A C    7  
ATOM 8193  O O    . VAL A 1 8  ? 1.445   -17.000 5.863   1.00 0.00 ? 8  VAL A O    7  
ATOM 8194  C CB   . VAL A 1 8  ? 2.404   -19.660 7.441   1.00 0.00 ? 8  VAL A CB   7  
ATOM 8195  C CG1  . VAL A 1 8  ? 3.333   -18.517 7.821   1.00 0.00 ? 8  VAL A CG1  7  
ATOM 8196  C CG2  . VAL A 1 8  ? 2.187   -20.592 8.623   1.00 0.00 ? 8  VAL A CG2  7  
ATOM 8197  H H    . VAL A 1 8  ? 0.449   -21.129 6.623   1.00 0.00 ? 8  VAL A H    7  
ATOM 8198  H HA   . VAL A 1 8  ? 0.601   -18.528 7.716   1.00 0.00 ? 8  VAL A HA   7  
ATOM 8199  H HB   . VAL A 1 8  ? 2.873   -20.228 6.648   1.00 0.00 ? 8  VAL A HB   7  
ATOM 8200  H HG11 . VAL A 1 8  ? 3.625   -17.970 6.938   1.00 0.00 ? 8  VAL A HG11 7  
ATOM 8201  H HG12 . VAL A 1 8  ? 4.222   -18.912 8.296   1.00 0.00 ? 8  VAL A HG12 7  
ATOM 8202  H HG13 . VAL A 1 8  ? 2.831   -17.849 8.508   1.00 0.00 ? 8  VAL A HG13 7  
ATOM 8203  H HG21 . VAL A 1 8  ? 3.130   -21.035 8.910   1.00 0.00 ? 8  VAL A HG21 7  
ATOM 8204  H HG22 . VAL A 1 8  ? 1.496   -21.370 8.362   1.00 0.00 ? 8  VAL A HG22 7  
ATOM 8205  H HG23 . VAL A 1 8  ? 1.790   -20.032 9.458   1.00 0.00 ? 8  VAL A HG23 7  
ATOM 8206  N N    . VAL A 1 9  ? 1.359   -18.820 4.541   1.00 0.00 ? 9  VAL A N    7  
ATOM 8207  C CA   . VAL A 1 9  ? 1.592   -18.074 3.308   1.00 0.00 ? 9  VAL A CA   7  
ATOM 8208  C C    . VAL A 1 9  ? 0.433   -17.124 3.022   1.00 0.00 ? 9  VAL A C    7  
ATOM 8209  O O    . VAL A 1 9  ? 0.641   -15.977 2.628   1.00 0.00 ? 9  VAL A O    7  
ATOM 8210  C CB   . VAL A 1 9  ? 1.759   -19.014 2.097   1.00 0.00 ? 9  VAL A CB   7  
ATOM 8211  C CG1  . VAL A 1 9  ? 2.410   -18.277 0.936   1.00 0.00 ? 9  VAL A CG1  7  
ATOM 8212  C CG2  . VAL A 1 9  ? 2.565   -20.248 2.472   1.00 0.00 ? 9  VAL A CG2  7  
ATOM 8213  H H    . VAL A 1 9  ? 1.223   -19.787 4.503   1.00 0.00 ? 9  VAL A H    7  
ATOM 8214  H HA   . VAL A 1 9  ? 2.502   -17.497 3.430   1.00 0.00 ? 9  VAL A HA   7  
ATOM 8215  H HB   . VAL A 1 9  ? 0.780   -19.348 1.773   1.00 0.00 ? 9  VAL A HB   7  
ATOM 8216  H HG11 . VAL A 1 9  ? 1.800   -17.431 0.654   1.00 0.00 ? 9  VAL A HG11 7  
ATOM 8217  H HG12 . VAL A 1 9  ? 2.504   -18.944 0.090   1.00 0.00 ? 9  VAL A HG12 7  
ATOM 8218  H HG13 . VAL A 1 9  ? 3.391   -17.930 1.229   1.00 0.00 ? 9  VAL A HG13 7  
ATOM 8219  H HG21 . VAL A 1 9  ? 3.511   -19.948 2.901   1.00 0.00 ? 9  VAL A HG21 7  
ATOM 8220  H HG22 . VAL A 1 9  ? 2.750   -20.844 1.588   1.00 0.00 ? 9  VAL A HG22 7  
ATOM 8221  H HG23 . VAL A 1 9  ? 2.025   -20.844 3.182   1.00 0.00 ? 9  VAL A HG23 7  
ATOM 8222  N N    . VAL A 1 10 ? -0.785  -17.614 3.224   1.00 0.00 ? 10 VAL A N    7  
ATOM 8223  C CA   . VAL A 1 10 ? -1.985  -16.823 2.982   1.00 0.00 ? 10 VAL A CA   7  
ATOM 8224  C C    . VAL A 1 10 ? -2.097  -15.658 3.961   1.00 0.00 ? 10 VAL A C    7  
ATOM 8225  O O    . VAL A 1 10 ? -2.297  -14.514 3.556   1.00 0.00 ? 10 VAL A O    7  
ATOM 8226  C CB   . VAL A 1 10 ? -3.253  -17.694 3.077   1.00 0.00 ? 10 VAL A CB   7  
ATOM 8227  C CG1  . VAL A 1 10 ? -4.504  -16.853 2.877   1.00 0.00 ? 10 VAL A CG1  7  
ATOM 8228  C CG2  . VAL A 1 10 ? -3.197  -18.823 2.059   1.00 0.00 ? 10 VAL A CG2  7  
ATOM 8229  H H    . VAL A 1 10 ? -0.885  -18.541 3.543   1.00 0.00 ? 10 VAL A H    7  
ATOM 8230  H HA   . VAL A 1 10 ? -1.928  -16.421 1.976   1.00 0.00 ? 10 VAL A HA   7  
ATOM 8231  H HB   . VAL A 1 10 ? -3.295  -18.133 4.064   1.00 0.00 ? 10 VAL A HB   7  
ATOM 8232  H HG11 . VAL A 1 10 ? -4.404  -16.251 1.984   1.00 0.00 ? 10 VAL A HG11 7  
ATOM 8233  H HG12 . VAL A 1 10 ? -4.654  -16.209 3.730   1.00 0.00 ? 10 VAL A HG12 7  
ATOM 8234  H HG13 . VAL A 1 10 ? -5.367  -17.499 2.774   1.00 0.00 ? 10 VAL A HG13 7  
ATOM 8235  H HG21 . VAL A 1 10 ? -2.300  -19.393 2.182   1.00 0.00 ? 10 VAL A HG21 7  
ATOM 8236  H HG22 . VAL A 1 10 ? -3.218  -18.411 1.060   1.00 0.00 ? 10 VAL A HG22 7  
ATOM 8237  H HG23 . VAL A 1 10 ? -4.052  -19.471 2.195   1.00 0.00 ? 10 VAL A HG23 7  
ATOM 8238  N N    . ILE A 1 11 ? -1.970  -15.955 5.252   1.00 0.00 ? 11 ILE A N    7  
ATOM 8239  C CA   . ILE A 1 11 ? -2.061  -14.930 6.288   1.00 0.00 ? 11 ILE A CA   7  
ATOM 8240  C C    . ILE A 1 11 ? -1.026  -13.830 6.070   1.00 0.00 ? 11 ILE A C    7  
ATOM 8241  O O    . ILE A 1 11 ? -1.298  -12.653 6.302   1.00 0.00 ? 11 ILE A O    7  
ATOM 8242  C CB   . ILE A 1 11 ? -1.866  -15.535 7.691   1.00 0.00 ? 11 ILE A CB   7  
ATOM 8243  C CG1  . ILE A 1 11 ? -2.894  -16.642 7.936   1.00 0.00 ? 11 ILE A CG1  7  
ATOM 8244  C CG2  . ILE A 1 11 ? -1.981  -14.453 8.759   1.00 0.00 ? 11 ILE A CG2  7  
ATOM 8245  C CD1  . ILE A 1 11 ? -2.668  -17.412 9.221   1.00 0.00 ? 11 ILE A CD1  7  
ATOM 8246  H H    . ILE A 1 11 ? -1.803  -16.891 5.507   1.00 0.00 ? 11 ILE A H    7  
ATOM 8247  H HA   . ILE A 1 11 ? -3.051  -14.492 6.239   1.00 0.00 ? 11 ILE A HA   7  
ATOM 8248  H HB   . ILE A 1 11 ? -0.872  -15.958 7.746   1.00 0.00 ? 11 ILE A HB   7  
ATOM 8249  H HG12 . ILE A 1 11 ? -3.880  -16.202 7.994   1.00 0.00 ? 11 ILE A HG12 7  
ATOM 8250  H HG13 . ILE A 1 11 ? -2.886  -17.349 7.133   1.00 0.00 ? 11 ILE A HG13 7  
ATOM 8251  H HG21 . ILE A 1 11 ? -2.945  -13.969 8.684   1.00 0.00 ? 11 ILE A HG21 7  
ATOM 8252  H HG22 . ILE A 1 11 ? -1.201  -13.719 8.630   1.00 0.00 ? 11 ILE A HG22 7  
ATOM 8253  H HG23 . ILE A 1 11 ? -1.880  -14.891 9.741   1.00 0.00 ? 11 ILE A HG23 7  
ATOM 8254  H HD11 . ILE A 1 11 ? -1.636  -17.731 9.280   1.00 0.00 ? 11 ILE A HD11 7  
ATOM 8255  H HD12 . ILE A 1 11 ? -3.311  -18.279 9.235   1.00 0.00 ? 11 ILE A HD12 7  
ATOM 8256  H HD13 . ILE A 1 11 ? -2.900  -16.782 10.066  1.00 0.00 ? 11 ILE A HD13 7  
ATOM 8257  N N    . SER A 1 12 ? 0.162   -14.224 5.622   1.00 0.00 ? 12 SER A N    7  
ATOM 8258  C CA   . SER A 1 12 ? 1.239   -13.273 5.375   1.00 0.00 ? 12 SER A CA   7  
ATOM 8259  C C    . SER A 1 12 ? 0.956   -12.431 4.134   1.00 0.00 ? 12 SER A C    7  
ATOM 8260  O O    . SER A 1 12 ? 1.242   -11.233 4.108   1.00 0.00 ? 12 SER A O    7  
ATOM 8261  C CB   . SER A 1 12 ? 2.570   -14.010 5.214   1.00 0.00 ? 12 SER A CB   7  
ATOM 8262  O OG   . SER A 1 12 ? 3.625   -13.104 4.932   1.00 0.00 ? 12 SER A OG   7  
ATOM 8263  H H    . SER A 1 12 ? 0.327   -15.182 5.454   1.00 0.00 ? 12 SER A H    7  
ATOM 8264  H HA   . SER A 1 12 ? 1.313   -12.613 6.230   1.00 0.00 ? 12 SER A HA   7  
ATOM 8265  H HB2  . SER A 1 12 ? 2.799   -14.538 6.128   1.00 0.00 ? 12 SER A HB2  7  
ATOM 8266  H HB3  . SER A 1 12 ? 2.492   -14.717 4.401   1.00 0.00 ? 12 SER A HB3  7  
ATOM 8267  H HG   . SER A 1 12 ? 3.922   -12.690 5.747   1.00 0.00 ? 12 SER A HG   7  
ATOM 8268  N N    . ALA A 1 13 ? 0.393   -13.063 3.109   1.00 0.00 ? 13 ALA A N    7  
ATOM 8269  C CA   . ALA A 1 13 ? 0.076   -12.373 1.864   1.00 0.00 ? 13 ALA A CA   7  
ATOM 8270  C C    . ALA A 1 13 ? -1.022  -11.333 2.070   1.00 0.00 ? 13 ALA A C    7  
ATOM 8271  O O    . ALA A 1 13 ? -0.841  -10.155 1.758   1.00 0.00 ? 13 ALA A O    7  
ATOM 8272  C CB   . ALA A 1 13 ? -0.339  -13.375 0.797   1.00 0.00 ? 13 ALA A CB   7  
ATOM 8273  H H    . ALA A 1 13 ? 0.187   -14.025 3.184   1.00 0.00 ? 13 ALA A H    7  
ATOM 8274  H HA   . ALA A 1 13 ? 0.970   -11.871 1.516   1.00 0.00 ? 13 ALA A HA   7  
ATOM 8275  H HB1  . ALA A 1 13 ? -0.512  -12.861 -0.138  1.00 0.00 ? 13 ALA A HB1  7  
ATOM 8276  H HB2  . ALA A 1 13 ? -1.244  -13.880 1.104   1.00 0.00 ? 13 ALA A HB2  7  
ATOM 8277  H HB3  . ALA A 1 13 ? 0.448   -14.102 0.665   1.00 0.00 ? 13 ALA A HB3  7  
ATOM 8278  N N    . ILE A 1 14 ? -2.160  -11.778 2.597   1.00 0.00 ? 14 ILE A N    7  
ATOM 8279  C CA   . ILE A 1 14 ? -3.290  -10.890 2.846   1.00 0.00 ? 14 ILE A CA   7  
ATOM 8280  C C    . ILE A 1 14 ? -2.881  -9.704  3.712   1.00 0.00 ? 14 ILE A C    7  
ATOM 8281  O O    . ILE A 1 14 ? -3.188  -8.555  3.390   1.00 0.00 ? 14 ILE A O    7  
ATOM 8282  C CB   . ILE A 1 14 ? -4.448  -11.639 3.535   1.00 0.00 ? 14 ILE A CB   7  
ATOM 8283  C CG1  . ILE A 1 14 ? -4.891  -12.829 2.680   1.00 0.00 ? 14 ILE A CG1  7  
ATOM 8284  C CG2  . ILE A 1 14 ? -5.616  -10.695 3.790   1.00 0.00 ? 14 ILE A CG2  7  
ATOM 8285  C CD1  . ILE A 1 14 ? -5.926  -13.706 3.350   1.00 0.00 ? 14 ILE A CD1  7  
ATOM 8286  H H    . ILE A 1 14 ? -2.229  -12.731 2.831   1.00 0.00 ? 14 ILE A H    7  
ATOM 8287  H HA   . ILE A 1 14 ? -3.642  -10.520 1.891   1.00 0.00 ? 14 ILE A HA   7  
ATOM 8288  H HB   . ILE A 1 14 ? -4.097  -12.004 4.491   1.00 0.00 ? 14 ILE A HB   7  
ATOM 8289  H HG12 . ILE A 1 14 ? -5.323  -12.463 1.760   1.00 0.00 ? 14 ILE A HG12 7  
ATOM 8290  H HG13 . ILE A 1 14 ? -4.051  -13.452 2.440   1.00 0.00 ? 14 ILE A HG13 7  
ATOM 8291  H HG21 . ILE A 1 14 ? -5.954  -10.274 2.853   1.00 0.00 ? 14 ILE A HG21 7  
ATOM 8292  H HG22 . ILE A 1 14 ? -5.314  -9.899  4.452   1.00 0.00 ? 14 ILE A HG22 7  
ATOM 8293  H HG23 . ILE A 1 14 ? -6.431  -11.231 4.252   1.00 0.00 ? 14 ILE A HG23 7  
ATOM 8294  H HD11 . ILE A 1 14 ? -6.856  -13.166 3.438   1.00 0.00 ? 14 ILE A HD11 7  
ATOM 8295  H HD12 . ILE A 1 14 ? -5.580  -13.994 4.333   1.00 0.00 ? 14 ILE A HD12 7  
ATOM 8296  H HD13 . ILE A 1 14 ? -6.084  -14.591 2.753   1.00 0.00 ? 14 ILE A HD13 7  
ATOM 8297  N N    . LEU A 1 15 ? -2.189  -9.989  4.811   1.00 0.00 ? 15 LEU A N    7  
ATOM 8298  C CA   . LEU A 1 15 ? -1.738  -8.942  5.722   1.00 0.00 ? 15 LEU A CA   7  
ATOM 8299  C C    . LEU A 1 15 ? -0.878  -7.922  4.986   1.00 0.00 ? 15 LEU A C    7  
ATOM 8300  O O    . LEU A 1 15 ? -0.907  -6.730  5.296   1.00 0.00 ? 15 LEU A O    7  
ATOM 8301  C CB   . LEU A 1 15 ? -0.945  -9.554  6.880   1.00 0.00 ? 15 LEU A CB   7  
ATOM 8302  C CG   . LEU A 1 15 ? -0.394  -8.547  7.894   1.00 0.00 ? 15 LEU A CG   7  
ATOM 8303  C CD1  . LEU A 1 15 ? -1.528  -7.847  8.625   1.00 0.00 ? 15 LEU A CD1  7  
ATOM 8304  C CD2  . LEU A 1 15 ? 0.534   -9.239  8.880   1.00 0.00 ? 15 LEU A CD2  7  
ATOM 8305  H H    . LEU A 1 15 ? -1.975  -10.931 5.017   1.00 0.00 ? 15 LEU A H    7  
ATOM 8306  H HA   . LEU A 1 15 ? -2.611  -8.444  6.118   1.00 0.00 ? 15 LEU A HA   7  
ATOM 8307  H HB2  . LEU A 1 15 ? -1.588  -10.253 7.399   1.00 0.00 ? 15 LEU A HB2  7  
ATOM 8308  H HB3  . LEU A 1 15 ? -0.114  -10.106 6.458   1.00 0.00 ? 15 LEU A HB3  7  
ATOM 8309  H HG   . LEU A 1 15 ? 0.182   -7.793  7.380   1.00 0.00 ? 15 LEU A HG   7  
ATOM 8310  H HD11 . LEU A 1 15 ? -1.120  -7.148  9.343   1.00 0.00 ? 15 LEU A HD11 7  
ATOM 8311  H HD12 . LEU A 1 15 ? -2.135  -8.577  9.143   1.00 0.00 ? 15 LEU A HD12 7  
ATOM 8312  H HD13 . LEU A 1 15 ? -2.140  -7.309  7.916   1.00 0.00 ? 15 LEU A HD13 7  
ATOM 8313  H HD21 . LEU A 1 15 ? 0.936   -8.512  9.572   1.00 0.00 ? 15 LEU A HD21 7  
ATOM 8314  H HD22 . LEU A 1 15 ? 1.349   -9.707  8.344   1.00 0.00 ? 15 LEU A HD22 7  
ATOM 8315  H HD23 . LEU A 1 15 ? -0.013  -9.993  9.430   1.00 0.00 ? 15 LEU A HD23 7  
ATOM 8316  N N    . ALA A 1 16 ? -0.114  -8.399  4.010   1.00 0.00 ? 16 ALA A N    7  
ATOM 8317  C CA   . ALA A 1 16 ? 0.756   -7.533  3.227   1.00 0.00 ? 16 ALA A CA   7  
ATOM 8318  C C    . ALA A 1 16 ? -0.056  -6.557  2.378   1.00 0.00 ? 16 ALA A C    7  
ATOM 8319  O O    . ALA A 1 16 ? 0.375   -5.431  2.128   1.00 0.00 ? 16 ALA A O    7  
ATOM 8320  C CB   . ALA A 1 16 ? 1.677   -8.369  2.354   1.00 0.00 ? 16 ALA A CB   7  
ATOM 8321  H H    . ALA A 1 16 ? -0.127  -9.363  3.806   1.00 0.00 ? 16 ALA A H    7  
ATOM 8322  H HA   . ALA A 1 16 ? 1.376   -6.967  3.911   1.00 0.00 ? 16 ALA A HA   7  
ATOM 8323  H HB1  . ALA A 1 16 ? 1.123   -8.802  1.534   1.00 0.00 ? 16 ALA A HB1  7  
ATOM 8324  H HB2  . ALA A 1 16 ? 2.115   -9.159  2.946   1.00 0.00 ? 16 ALA A HB2  7  
ATOM 8325  H HB3  . ALA A 1 16 ? 2.463   -7.741  1.962   1.00 0.00 ? 16 ALA A HB3  7  
ATOM 8326  N N    . LEU A 1 17 ? -1.230  -6.997  1.931   1.00 0.00 ? 17 LEU A N    7  
ATOM 8327  C CA   . LEU A 1 17 ? -2.103  -6.154  1.120   1.00 0.00 ? 17 LEU A CA   7  
ATOM 8328  C C    . LEU A 1 17 ? -2.741  -5.061  1.971   1.00 0.00 ? 17 LEU A C    7  
ATOM 8329  O O    . LEU A 1 17 ? -3.009  -3.962  1.489   1.00 0.00 ? 17 LEU A O    7  
ATOM 8330  C CB   . LEU A 1 17 ? -3.195  -6.995  0.449   1.00 0.00 ? 17 LEU A CB   7  
ATOM 8331  C CG   . LEU A 1 17 ? -2.823  -7.602  -0.908  1.00 0.00 ? 17 LEU A CG   7  
ATOM 8332  C CD1  . LEU A 1 17 ? -2.553  -6.509  -1.932  1.00 0.00 ? 17 LEU A CD1  7  
ATOM 8333  C CD2  . LEU A 1 17 ? -1.617  -8.520  -0.776  1.00 0.00 ? 17 LEU A CD2  7  
ATOM 8334  H H    . LEU A 1 17 ? -1.525  -7.908  2.151   1.00 0.00 ? 17 LEU A H    7  
ATOM 8335  H HA   . LEU A 1 17 ? -1.497  -5.675  0.367   1.00 0.00 ? 17 LEU A HA   7  
ATOM 8336  H HB2  . LEU A 1 17 ? -3.467  -7.802  1.112   1.00 0.00 ? 17 LEU A HB2  7  
ATOM 8337  H HB3  . LEU A 1 17 ? -4.075  -6.379  0.300   1.00 0.00 ? 17 LEU A HB3  7  
ATOM 8338  H HG   . LEU A 1 17 ? -3.654  -8.193  -1.267  1.00 0.00 ? 17 LEU A HG   7  
ATOM 8339  H HD11 . LEU A 1 17 ? -3.395  -5.831  -1.973  1.00 0.00 ? 17 LEU A HD11 7  
ATOM 8340  H HD12 . LEU A 1 17 ? -2.414  -6.958  -2.905  1.00 0.00 ? 17 LEU A HD12 7  
ATOM 8341  H HD13 . LEU A 1 17 ? -1.663  -5.960  -1.665  1.00 0.00 ? 17 LEU A HD13 7  
ATOM 8342  H HD21 . LEU A 1 17 ? -1.859  -9.324  -0.106  1.00 0.00 ? 17 LEU A HD21 7  
ATOM 8343  H HD22 . LEU A 1 17 ? -0.768  -7.971  -0.397  1.00 0.00 ? 17 LEU A HD22 7  
ATOM 8344  H HD23 . LEU A 1 17 ? -1.370  -8.933  -1.745  1.00 0.00 ? 17 LEU A HD23 7  
ATOM 8345  N N    . VAL A 1 18 ? -2.982  -5.376  3.240   1.00 0.00 ? 18 VAL A N    7  
ATOM 8346  C CA   . VAL A 1 18 ? -3.591  -4.426  4.162   1.00 0.00 ? 18 VAL A CA   7  
ATOM 8347  C C    . VAL A 1 18 ? -2.643  -3.271  4.475   1.00 0.00 ? 18 VAL A C    7  
ATOM 8348  O O    . VAL A 1 18 ? -3.031  -2.106  4.412   1.00 0.00 ? 18 VAL A O    7  
ATOM 8349  C CB   . VAL A 1 18 ? -4.002  -5.108  5.481   1.00 0.00 ? 18 VAL A CB   7  
ATOM 8350  C CG1  . VAL A 1 18 ? -4.698  -4.121  6.407   1.00 0.00 ? 18 VAL A CG1  7  
ATOM 8351  C CG2  . VAL A 1 18 ? -4.893  -6.310  5.208   1.00 0.00 ? 18 VAL A CG2  7  
ATOM 8352  H H    . VAL A 1 18 ? -2.742  -6.270  3.571   1.00 0.00 ? 18 VAL A H    7  
ATOM 8353  H HA   . VAL A 1 18 ? -4.485  -4.027  3.695   1.00 0.00 ? 18 VAL A HA   7  
ATOM 8354  H HB   . VAL A 1 18 ? -3.108  -5.463  5.978   1.00 0.00 ? 18 VAL A HB   7  
ATOM 8355  H HG11 . VAL A 1 18 ? -4.000  -3.364  6.730   1.00 0.00 ? 18 VAL A HG11 7  
ATOM 8356  H HG12 . VAL A 1 18 ? -5.075  -4.642  7.278   1.00 0.00 ? 18 VAL A HG12 7  
ATOM 8357  H HG13 . VAL A 1 18 ? -5.523  -3.652  5.889   1.00 0.00 ? 18 VAL A HG13 7  
ATOM 8358  H HG21 . VAL A 1 18 ? -5.203  -6.753  6.145   1.00 0.00 ? 18 VAL A HG21 7  
ATOM 8359  H HG22 . VAL A 1 18 ? -4.358  -7.040  4.639   1.00 0.00 ? 18 VAL A HG22 7  
ATOM 8360  H HG23 . VAL A 1 18 ? -5.769  -5.996  4.658   1.00 0.00 ? 18 VAL A HG23 7  
ATOM 8361  N N    . VAL A 1 19 ? -1.400  -3.604  4.808   1.00 0.00 ? 19 VAL A N    7  
ATOM 8362  C CA   . VAL A 1 19 ? -0.401  -2.593  5.142   1.00 0.00 ? 19 VAL A CA   7  
ATOM 8363  C C    . VAL A 1 19 ? -0.088  -1.694  3.952   1.00 0.00 ? 19 VAL A C    7  
ATOM 8364  O O    . VAL A 1 19 ? 0.227   -0.517  4.122   1.00 0.00 ? 19 VAL A O    7  
ATOM 8365  C CB   . VAL A 1 19 ? 0.904   -3.236  5.654   1.00 0.00 ? 19 VAL A CB   7  
ATOM 8366  C CG1  . VAL A 1 19 ? 0.632   -4.078  6.890   1.00 0.00 ? 19 VAL A CG1  7  
ATOM 8367  C CG2  . VAL A 1 19 ? 1.557   -4.074  4.563   1.00 0.00 ? 19 VAL A CG2  7  
ATOM 8368  H H    . VAL A 1 19 ? -1.151  -4.556  4.837   1.00 0.00 ? 19 VAL A H    7  
ATOM 8369  H HA   . VAL A 1 19 ? -0.803  -1.975  5.938   1.00 0.00 ? 19 VAL A HA   7  
ATOM 8370  H HB   . VAL A 1 19 ? 1.591   -2.448  5.933   1.00 0.00 ? 19 VAL A HB   7  
ATOM 8371  H HG11 . VAL A 1 19 ? 0.195   -3.458  7.661   1.00 0.00 ? 19 VAL A HG11 7  
ATOM 8372  H HG12 . VAL A 1 19 ? 1.560   -4.495  7.255   1.00 0.00 ? 19 VAL A HG12 7  
ATOM 8373  H HG13 . VAL A 1 19 ? -0.048  -4.879  6.649   1.00 0.00 ? 19 VAL A HG13 7  
ATOM 8374  H HG21 . VAL A 1 19 ? 0.887   -4.855  4.268   1.00 0.00 ? 19 VAL A HG21 7  
ATOM 8375  H HG22 . VAL A 1 19 ? 2.465   -4.518  4.950   1.00 0.00 ? 19 VAL A HG22 7  
ATOM 8376  H HG23 . VAL A 1 19 ? 1.807   -3.464  3.712   1.00 0.00 ? 19 VAL A HG23 7  
ATOM 8377  N N    . LEU A 1 20 ? -0.170  -2.248  2.744   1.00 0.00 ? 20 LEU A N    7  
ATOM 8378  C CA   . LEU A 1 20 ? 0.102   -1.478  1.535   1.00 0.00 ? 20 LEU A CA   7  
ATOM 8379  C C    . LEU A 1 20 ? -0.984  -0.426  1.332   1.00 0.00 ? 20 LEU A C    7  
ATOM 8380  O O    . LEU A 1 20 ? -0.724  0.663   0.822   1.00 0.00 ? 20 LEU A O    7  
ATOM 8381  C CB   . LEU A 1 20 ? 0.194   -2.405  0.315   1.00 0.00 ? 20 LEU A CB   7  
ATOM 8382  C CG   . LEU A 1 20 ? 1.052   -1.892  -0.855  1.00 0.00 ? 20 LEU A CG   7  
ATOM 8383  C CD1  . LEU A 1 20 ? 0.369   -0.739  -1.573  1.00 0.00 ? 20 LEU A CD1  7  
ATOM 8384  C CD2  . LEU A 1 20 ? 2.435   -1.468  -0.372  1.00 0.00 ? 20 LEU A CD2  7  
ATOM 8385  H H    . LEU A 1 20 ? -0.421  -3.197  2.656   1.00 0.00 ? 20 LEU A H    7  
ATOM 8386  H HA   . LEU A 1 20 ? 1.040   -0.974  1.685   1.00 0.00 ? 20 LEU A HA   7  
ATOM 8387  H HB2  . LEU A 1 20 ? 0.625   -3.343  0.643   1.00 0.00 ? 20 LEU A HB2  7  
ATOM 8388  H HB3  . LEU A 1 20 ? -0.804  -2.610  -0.054  1.00 0.00 ? 20 LEU A HB3  7  
ATOM 8389  H HG   . LEU A 1 20 ? 1.182   -2.693  -1.569  1.00 0.00 ? 20 LEU A HG   7  
ATOM 8390  H HD11 . LEU A 1 20 ? 0.554   0.190   -1.055  1.00 0.00 ? 20 LEU A HD11 7  
ATOM 8391  H HD12 . LEU A 1 20 ? -0.698  -0.912  -1.630  1.00 0.00 ? 20 LEU A HD12 7  
ATOM 8392  H HD13 . LEU A 1 20 ? 0.765   -0.667  -2.575  1.00 0.00 ? 20 LEU A HD13 7  
ATOM 8393  H HD21 . LEU A 1 20 ? 2.862   -2.244  0.250   1.00 0.00 ? 20 LEU A HD21 7  
ATOM 8394  H HD22 . LEU A 1 20 ? 2.369   -0.549  0.193   1.00 0.00 ? 20 LEU A HD22 7  
ATOM 8395  H HD23 . LEU A 1 20 ? 3.075   -1.310  -1.228  1.00 0.00 ? 20 LEU A HD23 7  
ATOM 8396  N N    . THR A 1 21 ? -2.205  -0.756  1.745   1.00 0.00 ? 21 THR A N    7  
ATOM 8397  C CA   . THR A 1 21 ? -3.328  0.163   1.618   1.00 0.00 ? 21 THR A CA   7  
ATOM 8398  C C    . THR A 1 21 ? -3.277  1.224   2.713   1.00 0.00 ? 21 THR A C    7  
ATOM 8399  O O    . THR A 1 21 ? -3.644  2.379   2.492   1.00 0.00 ? 21 THR A O    7  
ATOM 8400  C CB   . THR A 1 21 ? -4.678  -0.578  1.692   1.00 0.00 ? 21 THR A CB   7  
ATOM 8401  O OG1  . THR A 1 21 ? -4.723  -1.613  0.702   1.00 0.00 ? 21 THR A OG1  7  
ATOM 8402  C CG2  . THR A 1 21 ? -5.837  0.384   1.475   1.00 0.00 ? 21 THR A CG2  7  
ATOM 8403  H H    . THR A 1 21 ? -2.365  -1.639  2.152   1.00 0.00 ? 21 THR A H    7  
ATOM 8404  H HA   . THR A 1 21 ? -3.263  0.654   0.652   1.00 0.00 ? 21 THR A HA   7  
ATOM 8405  H HB   . THR A 1 21 ? -4.780  -1.027  2.671   1.00 0.00 ? 21 THR A HB   7  
ATOM 8406  H HG1  . THR A 1 21 ? -4.614  -1.248  -0.186  1.00 0.00 ? 21 THR A HG1  7  
ATOM 8407  H HG21 . THR A 1 21 ? -5.953  1.017   2.342   1.00 0.00 ? 21 THR A HG21 7  
ATOM 8408  H HG22 . THR A 1 21 ? -6.744  -0.182  1.325   1.00 0.00 ? 21 THR A HG22 7  
ATOM 8409  H HG23 . THR A 1 21 ? -5.652  0.996   0.602   1.00 0.00 ? 21 THR A HG23 7  
ATOM 8410  N N    . ILE A 1 22 ? -2.817  0.823   3.895   1.00 0.00 ? 22 ILE A N    7  
ATOM 8411  C CA   . ILE A 1 22 ? -2.703  1.738   5.024   1.00 0.00 ? 22 ILE A CA   7  
ATOM 8412  C C    . ILE A 1 22 ? -1.594  2.755   4.779   1.00 0.00 ? 22 ILE A C    7  
ATOM 8413  O O    . ILE A 1 22 ? -1.766  3.950   5.020   1.00 0.00 ? 22 ILE A O    7  
ATOM 8414  C CB   . ILE A 1 22 ? -2.411  0.984   6.340   1.00 0.00 ? 22 ILE A CB   7  
ATOM 8415  C CG1  . ILE A 1 22 ? -3.557  0.023   6.679   1.00 0.00 ? 22 ILE A CG1  7  
ATOM 8416  C CG2  . ILE A 1 22 ? -2.176  1.965   7.481   1.00 0.00 ? 22 ILE A CG2  7  
ATOM 8417  C CD1  . ILE A 1 22 ? -4.889  0.710   6.907   1.00 0.00 ? 22 ILE A CD1  7  
ATOM 8418  H H    . ILE A 1 22 ? -2.538  -0.114  4.019   1.00 0.00 ? 22 ILE A H    7  
ATOM 8419  H HA   . ILE A 1 22 ? -3.637  2.274   5.128   1.00 0.00 ? 22 ILE A HA   7  
ATOM 8420  H HB   . ILE A 1 22 ? -1.505  0.411   6.205   1.00 0.00 ? 22 ILE A HB   7  
ATOM 8421  H HG12 . ILE A 1 22 ? -3.689  -0.668  5.874   1.00 0.00 ? 22 ILE A HG12 7  
ATOM 8422  H HG13 . ILE A 1 22 ? -3.308  -0.525  7.577   1.00 0.00 ? 22 ILE A HG13 7  
ATOM 8423  H HG21 . ILE A 1 22 ? -2.932  2.739   7.470   1.00 0.00 ? 22 ILE A HG21 7  
ATOM 8424  H HG22 . ILE A 1 22 ? -1.201  2.417   7.377   1.00 0.00 ? 22 ILE A HG22 7  
ATOM 8425  H HG23 . ILE A 1 22 ? -2.216  1.443   8.429   1.00 0.00 ? 22 ILE A HG23 7  
ATOM 8426  H HD11 . ILE A 1 22 ? -5.591  0.383   6.154   1.00 0.00 ? 22 ILE A HD11 7  
ATOM 8427  H HD12 . ILE A 1 22 ? -4.792  1.785   6.857   1.00 0.00 ? 22 ILE A HD12 7  
ATOM 8428  H HD13 . ILE A 1 22 ? -5.267  0.435   7.880   1.00 0.00 ? 22 ILE A HD13 7  
ATOM 8429  N N    . ILE A 1 23 ? -0.455  2.268   4.295   1.00 0.00 ? 23 ILE A N    7  
ATOM 8430  C CA   . ILE A 1 23 ? 0.686   3.130   4.018   1.00 0.00 ? 23 ILE A CA   7  
ATOM 8431  C C    . ILE A 1 23 ? 0.360   4.122   2.902   1.00 0.00 ? 23 ILE A C    7  
ATOM 8432  O O    . ILE A 1 23 ? 0.790   5.274   2.936   1.00 0.00 ? 23 ILE A O    7  
ATOM 8433  C CB   . ILE A 1 23 ? 1.934   2.308   3.636   1.00 0.00 ? 23 ILE A CB   7  
ATOM 8434  C CG1  . ILE A 1 23 ? 3.171   3.208   3.625   1.00 0.00 ? 23 ILE A CG1  7  
ATOM 8435  C CG2  . ILE A 1 23 ? 1.742   1.633   2.287   1.00 0.00 ? 23 ILE A CG2  7  
ATOM 8436  C CD1  . ILE A 1 23 ? 4.468   2.457   3.404   1.00 0.00 ? 23 ILE A CD1  7  
ATOM 8437  H H    . ILE A 1 23 ? -0.374  1.300   4.123   1.00 0.00 ? 23 ILE A H    7  
ATOM 8438  H HA   . ILE A 1 23 ? 0.908   3.687   4.923   1.00 0.00 ? 23 ILE A HA   7  
ATOM 8439  H HB   . ILE A 1 23 ? 2.066   1.536   4.379   1.00 0.00 ? 23 ILE A HB   7  
ATOM 8440  H HG12 . ILE A 1 23 ? 3.080   3.941   2.837   1.00 0.00 ? 23 ILE A HG12 7  
ATOM 8441  H HG13 . ILE A 1 23 ? 3.249   3.719   4.576   1.00 0.00 ? 23 ILE A HG13 7  
ATOM 8442  H HG21 . ILE A 1 23 ? 1.742   2.361   1.489   1.00 0.00 ? 23 ILE A HG21 7  
ATOM 8443  H HG22 . ILE A 1 23 ? 0.821   1.108   2.297   1.00 0.00 ? 23 ILE A HG22 7  
ATOM 8444  H HG23 . ILE A 1 23 ? 2.546   0.930   2.125   1.00 0.00 ? 23 ILE A HG23 7  
ATOM 8445  H HD11 . ILE A 1 23 ? 4.470   2.021   2.416   1.00 0.00 ? 23 ILE A HD11 7  
ATOM 8446  H HD12 . ILE A 1 23 ? 4.565   1.675   4.143   1.00 0.00 ? 23 ILE A HD12 7  
ATOM 8447  H HD13 . ILE A 1 23 ? 5.298   3.141   3.495   1.00 0.00 ? 23 ILE A HD13 7  
ATOM 8448  N N    . SER A 1 24 ? -0.408  3.663   1.915   1.00 0.00 ? 24 SER A N    7  
ATOM 8449  C CA   . SER A 1 24 ? -0.801  4.504   0.790   1.00 0.00 ? 24 SER A CA   7  
ATOM 8450  C C    . SER A 1 24 ? -1.857  5.519   1.217   1.00 0.00 ? 24 SER A C    7  
ATOM 8451  O O    . SER A 1 24 ? -1.916  6.629   0.687   1.00 0.00 ? 24 SER A O    7  
ATOM 8452  C CB   . SER A 1 24 ? -1.338  3.644   -0.356  1.00 0.00 ? 24 SER A CB   7  
ATOM 8453  O OG   . SER A 1 24 ? -1.756  4.446   -1.446  1.00 0.00 ? 24 SER A OG   7  
ATOM 8454  H H    . SER A 1 24 ? -0.730  2.732   1.940   1.00 0.00 ? 24 SER A H    7  
ATOM 8455  H HA   . SER A 1 24 ? 0.073   5.039   0.441   1.00 0.00 ? 24 SER A HA   7  
ATOM 8456  H HB2  . SER A 1 24 ? -0.560  2.977   -0.696  1.00 0.00 ? 24 SER A HB2  7  
ATOM 8457  H HB3  . SER A 1 24 ? -2.181  3.065   -0.006  1.00 0.00 ? 24 SER A HB3  7  
ATOM 8458  H HG   . SER A 1 24 ? -2.089  3.883   -2.149  1.00 0.00 ? 24 SER A HG   7  
ATOM 8459  N N    . LEU A 1 25 ? -2.692  5.125   2.175   1.00 0.00 ? 25 LEU A N    7  
ATOM 8460  C CA   . LEU A 1 25 ? -3.749  5.995   2.677   1.00 0.00 ? 25 LEU A CA   7  
ATOM 8461  C C    . LEU A 1 25 ? -3.163  7.241   3.335   1.00 0.00 ? 25 LEU A C    7  
ATOM 8462  O O    . LEU A 1 25 ? -3.711  8.336   3.209   1.00 0.00 ? 25 LEU A O    7  
ATOM 8463  C CB   . LEU A 1 25 ? -4.625  5.233   3.679   1.00 0.00 ? 25 LEU A CB   7  
ATOM 8464  C CG   . LEU A 1 25 ? -5.803  6.026   4.252   1.00 0.00 ? 25 LEU A CG   7  
ATOM 8465  C CD1  . LEU A 1 25 ? -6.760  6.445   3.144   1.00 0.00 ? 25 LEU A CD1  7  
ATOM 8466  C CD2  . LEU A 1 25 ? -6.532  5.204   5.304   1.00 0.00 ? 25 LEU A CD2  7  
ATOM 8467  H H    . LEU A 1 25 ? -2.604  4.221   2.558   1.00 0.00 ? 25 LEU A H    7  
ATOM 8468  H HA   . LEU A 1 25 ? -4.357  6.297   1.837   1.00 0.00 ? 25 LEU A HA   7  
ATOM 8469  H HB2  . LEU A 1 25 ? -5.011  4.351   3.184   1.00 0.00 ? 25 LEU A HB2  7  
ATOM 8470  H HB3  . LEU A 1 25 ? -3.996  4.914   4.500   1.00 0.00 ? 25 LEU A HB3  7  
ATOM 8471  H HG   . LEU A 1 25 ? -5.436  6.922   4.730   1.00 0.00 ? 25 LEU A HG   7  
ATOM 8472  H HD11 . LEU A 1 25 ? -7.606  6.967   3.572   1.00 0.00 ? 25 LEU A HD11 7  
ATOM 8473  H HD12 . LEU A 1 25 ? -7.112  5.571   2.615   1.00 0.00 ? 25 LEU A HD12 7  
ATOM 8474  H HD13 . LEU A 1 25 ? -6.253  7.103   2.454   1.00 0.00 ? 25 LEU A HD13 7  
ATOM 8475  H HD21 . LEU A 1 25 ? -5.845  4.938   6.096   1.00 0.00 ? 25 LEU A HD21 7  
ATOM 8476  H HD22 . LEU A 1 25 ? -6.928  4.303   4.855   1.00 0.00 ? 25 LEU A HD22 7  
ATOM 8477  H HD23 . LEU A 1 25 ? -7.345  5.785   5.719   1.00 0.00 ? 25 LEU A HD23 7  
ATOM 8478  N N    . ILE A 1 26 ? -2.047  7.065   4.035   1.00 0.00 ? 26 ILE A N    7  
ATOM 8479  C CA   . ILE A 1 26 ? -1.385  8.176   4.713   1.00 0.00 ? 26 ILE A CA   7  
ATOM 8480  C C    . ILE A 1 26 ? -0.856  9.197   3.708   1.00 0.00 ? 26 ILE A C    7  
ATOM 8481  O O    . ILE A 1 26 ? -0.959  10.404  3.926   1.00 0.00 ? 26 ILE A O    7  
ATOM 8482  C CB   . ILE A 1 26 ? -0.216  7.682   5.593   1.00 0.00 ? 26 ILE A CB   7  
ATOM 8483  C CG1  . ILE A 1 26 ? -0.724  6.698   6.654   1.00 0.00 ? 26 ILE A CG1  7  
ATOM 8484  C CG2  . ILE A 1 26 ? 0.499   8.857   6.246   1.00 0.00 ? 26 ILE A CG2  7  
ATOM 8485  C CD1  . ILE A 1 26 ? -1.742  7.292   7.608   1.00 0.00 ? 26 ILE A CD1  7  
ATOM 8486  H H    . ILE A 1 26 ? -1.651  6.166   4.101   1.00 0.00 ? 26 ILE A H    7  
ATOM 8487  H HA   . ILE A 1 26 ? -2.109  8.671   5.345   1.00 0.00 ? 26 ILE A HA   7  
ATOM 8488  H HB   . ILE A 1 26 ? 0.494   7.172   4.957   1.00 0.00 ? 26 ILE A HB   7  
ATOM 8489  H HG12 . ILE A 1 26 ? -1.184  5.860   6.172   1.00 0.00 ? 26 ILE A HG12 7  
ATOM 8490  H HG13 . ILE A 1 26 ? 0.113   6.348   7.242   1.00 0.00 ? 26 ILE A HG13 7  
ATOM 8491  H HG21 . ILE A 1 26 ? 1.164   8.497   7.021   1.00 0.00 ? 26 ILE A HG21 7  
ATOM 8492  H HG22 . ILE A 1 26 ? -0.222  9.534   6.684   1.00 0.00 ? 26 ILE A HG22 7  
ATOM 8493  H HG23 . ILE A 1 26 ? 1.081   9.381   5.505   1.00 0.00 ? 26 ILE A HG23 7  
ATOM 8494  H HD11 . ILE A 1 26 ? -2.652  7.519   7.074   1.00 0.00 ? 26 ILE A HD11 7  
ATOM 8495  H HD12 . ILE A 1 26 ? -1.352  8.193   8.056   1.00 0.00 ? 26 ILE A HD12 7  
ATOM 8496  H HD13 . ILE A 1 26 ? -1.958  6.575   8.386   1.00 0.00 ? 26 ILE A HD13 7  
ATOM 8497  N N    . ILE A 1 27 ? -0.292  8.704   2.610   1.00 0.00 ? 27 ILE A N    7  
ATOM 8498  C CA   . ILE A 1 27 ? 0.254   9.574   1.573   1.00 0.00 ? 27 ILE A CA   7  
ATOM 8499  C C    . ILE A 1 27 ? -0.857  10.315  0.839   1.00 0.00 ? 27 ILE A C    7  
ATOM 8500  O O    . ILE A 1 27 ? -0.698  11.474  0.458   1.00 0.00 ? 27 ILE A O    7  
ATOM 8501  C CB   . ILE A 1 27 ? 1.079   8.778   0.544   1.00 0.00 ? 27 ILE A CB   7  
ATOM 8502  C CG1  . ILE A 1 27 ? 2.104   7.894   1.256   1.00 0.00 ? 27 ILE A CG1  7  
ATOM 8503  C CG2  . ILE A 1 27 ? 1.771   9.727   -0.426  1.00 0.00 ? 27 ILE A CG2  7  
ATOM 8504  C CD1  . ILE A 1 27 ? 2.821   6.936   0.330   1.00 0.00 ? 27 ILE A CD1  7  
ATOM 8505  H H    . ILE A 1 27 ? -0.252  7.729   2.489   1.00 0.00 ? 27 ILE A H    7  
ATOM 8506  H HA   . ILE A 1 27 ? 0.907   10.299  2.048   1.00 0.00 ? 27 ILE A HA   7  
ATOM 8507  H HB   . ILE A 1 27 ? 0.406   8.147   -0.025  1.00 0.00 ? 27 ILE A HB   7  
ATOM 8508  H HG12 . ILE A 1 27 ? 2.852   8.517   1.725   1.00 0.00 ? 27 ILE A HG12 7  
ATOM 8509  H HG13 . ILE A 1 27 ? 1.626   7.302   2.012   1.00 0.00 ? 27 ILE A HG13 7  
ATOM 8510  H HG21 . ILE A 1 27 ? 2.428   10.390  0.120   1.00 0.00 ? 27 ILE A HG21 7  
ATOM 8511  H HG22 . ILE A 1 27 ? 1.038   10.311  -0.961  1.00 0.00 ? 27 ILE A HG22 7  
ATOM 8512  H HG23 . ILE A 1 27 ? 2.350   9.163   -1.141  1.00 0.00 ? 27 ILE A HG23 7  
ATOM 8513  H HD11 . ILE A 1 27 ? 2.099   6.383   -0.255  1.00 0.00 ? 27 ILE A HD11 7  
ATOM 8514  H HD12 . ILE A 1 27 ? 3.409   6.246   0.916   1.00 0.00 ? 27 ILE A HD12 7  
ATOM 8515  H HD13 . ILE A 1 27 ? 3.472   7.489   -0.330  1.00 0.00 ? 27 ILE A HD13 7  
ATOM 8516  N N    . LEU A 1 28 ? -1.980  9.633   0.638   1.00 0.00 ? 28 LEU A N    7  
ATOM 8517  C CA   . LEU A 1 28 ? -3.120  10.217  -0.056  1.00 0.00 ? 28 LEU A CA   7  
ATOM 8518  C C    . LEU A 1 28 ? -3.623  11.464  0.664   1.00 0.00 ? 28 LEU A C    7  
ATOM 8519  O O    . LEU A 1 28 ? -3.714  12.538  0.073   1.00 0.00 ? 28 LEU A O    7  
ATOM 8520  C CB   . LEU A 1 28 ? -4.251  9.190   -0.167  1.00 0.00 ? 28 LEU A CB   7  
ATOM 8521  C CG   . LEU A 1 28 ? -5.497  9.668   -0.918  1.00 0.00 ? 28 LEU A CG   7  
ATOM 8522  C CD1  . LEU A 1 28 ? -5.150  10.033  -2.355  1.00 0.00 ? 28 LEU A CD1  7  
ATOM 8523  C CD2  . LEU A 1 28 ? -6.577  8.599   -0.885  1.00 0.00 ? 28 LEU A CD2  7  
ATOM 8524  H H    . LEU A 1 28 ? -2.048  8.702   0.957   1.00 0.00 ? 28 LEU A H    7  
ATOM 8525  H HA   . LEU A 1 28 ? -2.796  10.493  -1.048  1.00 0.00 ? 28 LEU A HA   7  
ATOM 8526  H HB2  . LEU A 1 28 ? -3.860  8.314   -0.670  1.00 0.00 ? 28 LEU A HB2  7  
ATOM 8527  H HB3  . LEU A 1 28 ? -4.544  8.903   0.835   1.00 0.00 ? 28 LEU A HB3  7  
ATOM 8528  H HG   . LEU A 1 28 ? -5.892  10.551  -0.437  1.00 0.00 ? 28 LEU A HG   7  
ATOM 8529  H HD11 . LEU A 1 28 ? -4.455  10.859  -2.364  1.00 0.00 ? 28 LEU A HD11 7  
ATOM 8530  H HD12 . LEU A 1 28 ? -6.048  10.324  -2.883  1.00 0.00 ? 28 LEU A HD12 7  
ATOM 8531  H HD13 . LEU A 1 28 ? -4.704  9.182   -2.851  1.00 0.00 ? 28 LEU A HD13 7  
ATOM 8532  H HD21 . LEU A 1 28 ? -6.830  8.371   0.141   1.00 0.00 ? 28 LEU A HD21 7  
ATOM 8533  H HD22 . LEU A 1 28 ? -6.220  7.703   -1.374  1.00 0.00 ? 28 LEU A HD22 7  
ATOM 8534  H HD23 . LEU A 1 28 ? -7.459  8.959   -1.396  1.00 0.00 ? 28 LEU A HD23 7  
ATOM 8535  N N    . ILE A 1 29 ? -3.943  11.310  1.944   1.00 0.00 ? 29 ILE A N    7  
ATOM 8536  C CA   . ILE A 1 29 ? -4.444  12.419  2.747   1.00 0.00 ? 29 ILE A CA   7  
ATOM 8537  C C    . ILE A 1 29 ? -3.361  13.464  2.995   1.00 0.00 ? 29 ILE A C    7  
ATOM 8538  O O    . ILE A 1 29 ? -3.634  14.664  2.988   1.00 0.00 ? 29 ILE A O    7  
ATOM 8539  C CB   . ILE A 1 29 ? -4.999  11.920  4.093   1.00 0.00 ? 29 ILE A CB   7  
ATOM 8540  C CG1  . ILE A 1 29 ? -6.115  10.899  3.850   1.00 0.00 ? 29 ILE A CG1  7  
ATOM 8541  C CG2  . ILE A 1 29 ? -5.507  13.088  4.927   1.00 0.00 ? 29 ILE A CG2  7  
ATOM 8542  C CD1  . ILE A 1 29 ? -6.632  10.247  5.114   1.00 0.00 ? 29 ILE A CD1  7  
ATOM 8543  H H    . ILE A 1 29 ? -3.837  10.422  2.361   1.00 0.00 ? 29 ILE A H    7  
ATOM 8544  H HA   . ILE A 1 29 ? -5.257  12.885  2.204   1.00 0.00 ? 29 ILE A HA   7  
ATOM 8545  H HB   . ILE A 1 29 ? -4.196  11.442  4.637   1.00 0.00 ? 29 ILE A HB   7  
ATOM 8546  H HG12 . ILE A 1 29 ? -6.949  11.388  3.368   1.00 0.00 ? 29 ILE A HG12 7  
ATOM 8547  H HG13 . ILE A 1 29 ? -5.755  10.108  3.208   1.00 0.00 ? 29 ILE A HG13 7  
ATOM 8548  H HG21 . ILE A 1 29 ? -6.302  13.589  4.403   1.00 0.00 ? 29 ILE A HG21 7  
ATOM 8549  H HG22 . ILE A 1 29 ? -4.709  13.787  5.123   1.00 0.00 ? 29 ILE A HG22 7  
ATOM 8550  H HG23 . ILE A 1 29 ? -5.882  12.725  5.872   1.00 0.00 ? 29 ILE A HG23 7  
ATOM 8551  H HD11 . ILE A 1 29 ? -7.296  9.436   4.852   1.00 0.00 ? 29 ILE A HD11 7  
ATOM 8552  H HD12 . ILE A 1 29 ? -7.171  10.975  5.702   1.00 0.00 ? 29 ILE A HD12 7  
ATOM 8553  H HD13 . ILE A 1 29 ? -5.804  9.859   5.690   1.00 0.00 ? 29 ILE A HD13 7  
ATOM 8554  N N    . MET A 1 30 ? -2.131  13.004  3.216   1.00 0.00 ? 30 MET A N    7  
ATOM 8555  C CA   . MET A 1 30 ? -1.013  13.910  3.461   1.00 0.00 ? 30 MET A CA   7  
ATOM 8556  C C    . MET A 1 30 ? -0.844  14.878  2.297   1.00 0.00 ? 30 MET A C    7  
ATOM 8557  O O    . MET A 1 30 ? -0.777  16.092  2.489   1.00 0.00 ? 30 MET A O    7  
ATOM 8558  C CB   . MET A 1 30 ? 0.281   13.119  3.674   1.00 0.00 ? 30 MET A CB   7  
ATOM 8559  C CG   . MET A 1 30 ? 1.490   13.997  3.953   1.00 0.00 ? 30 MET A CG   7  
ATOM 8560  S SD   . MET A 1 30 ? 3.007   13.046  4.169   1.00 0.00 ? 30 MET A SD   7  
ATOM 8561  C CE   . MET A 1 30 ? 2.601   12.089  5.627   1.00 0.00 ? 30 MET A CE   7  
ATOM 8562  H H    . MET A 1 30 ? -1.966  12.032  3.216   1.00 0.00 ? 30 MET A H    7  
ATOM 8563  H HA   . MET A 1 30 ? -1.229  14.476  4.357   1.00 0.00 ? 30 MET A HA   7  
ATOM 8564  H HB2  . MET A 1 30 ? 0.138   12.463  4.517   1.00 0.00 ? 30 MET A HB2  7  
ATOM 8565  H HB3  . MET A 1 30 ? 0.480   12.525  2.792   1.00 0.00 ? 30 MET A HB3  7  
ATOM 8566  H HG2  . MET A 1 30 ? 1.637   14.669  3.126   1.00 0.00 ? 30 MET A HG2  7  
ATOM 8567  H HG3  . MET A 1 30 ? 1.308   14.566  4.852   1.00 0.00 ? 30 MET A HG3  7  
ATOM 8568  H HE1  . MET A 1 30 ? 2.257   12.751  6.408   1.00 0.00 ? 30 MET A HE1  7  
ATOM 8569  H HE2  . MET A 1 30 ? 3.479   11.558  5.966   1.00 0.00 ? 30 MET A HE2  7  
ATOM 8570  H HE3  . MET A 1 30 ? 1.825   11.382  5.387   1.00 0.00 ? 30 MET A HE3  7  
ATOM 8571  N N    . LEU A 1 31 ? -0.777  14.330  1.086   1.00 0.00 ? 31 LEU A N    7  
ATOM 8572  C CA   . LEU A 1 31 ? -0.622  15.140  -0.115  1.00 0.00 ? 31 LEU A CA   7  
ATOM 8573  C C    . LEU A 1 31 ? -1.903  15.914  -0.412  1.00 0.00 ? 31 LEU A C    7  
ATOM 8574  O O    . LEU A 1 31 ? -1.870  16.970  -1.043  1.00 0.00 ? 31 LEU A O    7  
ATOM 8575  C CB   . LEU A 1 31 ? -0.255  14.255  -1.309  1.00 0.00 ? 31 LEU A CB   7  
ATOM 8576  C CG   . LEU A 1 31 ? 0.008   15.004  -2.617  1.00 0.00 ? 31 LEU A CG   7  
ATOM 8577  C CD1  . LEU A 1 31 ? 1.305   15.795  -2.532  1.00 0.00 ? 31 LEU A CD1  7  
ATOM 8578  C CD2  . LEU A 1 31 ? 0.048   14.033  -3.788  1.00 0.00 ? 31 LEU A CD2  7  
ATOM 8579  H H    . LEU A 1 31 ? -0.840  13.348  0.997   1.00 0.00 ? 31 LEU A H    7  
ATOM 8580  H HA   . LEU A 1 31 ? 0.181   15.822  0.052   1.00 0.00 ? 31 LEU A HA   7  
ATOM 8581  H HB2  . LEU A 1 31 ? 0.629   13.686  -1.049  1.00 0.00 ? 31 LEU A HB2  7  
ATOM 8582  H HB3  . LEU A 1 31 ? -1.069  13.558  -1.468  1.00 0.00 ? 31 LEU A HB3  7  
ATOM 8583  H HG   . LEU A 1 31 ? -0.791  15.702  -2.805  1.00 0.00 ? 31 LEU A HG   7  
ATOM 8584  H HD11 . LEU A 1 31 ? 1.254   16.487  -1.714  1.00 0.00 ? 31 LEU A HD11 7  
ATOM 8585  H HD12 . LEU A 1 31 ? 1.456   16.344  -3.451  1.00 0.00 ? 31 LEU A HD12 7  
ATOM 8586  H HD13 . LEU A 1 31 ? 2.135   15.118  -2.379  1.00 0.00 ? 31 LEU A HD13 7  
ATOM 8587  H HD21 . LEU A 1 31 ? 0.853   13.325  -3.648  1.00 0.00 ? 31 LEU A HD21 7  
ATOM 8588  H HD22 . LEU A 1 31 ? 0.207   14.580  -4.707  1.00 0.00 ? 31 LEU A HD22 7  
ATOM 8589  H HD23 . LEU A 1 31 ? -0.891  13.501  -3.850  1.00 0.00 ? 31 LEU A HD23 7  
ATOM 8590  N N    . TRP A 1 32 ? -3.030  15.380  0.048   1.00 0.00 ? 32 TRP A N    7  
ATOM 8591  C CA   . TRP A 1 32 ? -4.327  16.014  -0.165  1.00 0.00 ? 32 TRP A CA   7  
ATOM 8592  C C    . TRP A 1 32 ? -4.436  17.312  0.631   1.00 0.00 ? 32 TRP A C    7  
ATOM 8593  O O    . TRP A 1 32 ? -5.274  18.165  0.335   1.00 0.00 ? 32 TRP A O    7  
ATOM 8594  C CB   . TRP A 1 32 ? -5.453  15.053  0.233   1.00 0.00 ? 32 TRP A CB   7  
ATOM 8595  C CG   . TRP A 1 32 ? -6.825  15.648  0.115   1.00 0.00 ? 32 TRP A CG   7  
ATOM 8596  C CD1  . TRP A 1 32 ? -7.385  16.205  -0.998  1.00 0.00 ? 32 TRP A CD1  7  
ATOM 8597  C CD2  . TRP A 1 32 ? -7.812  15.738  1.151   1.00 0.00 ? 32 TRP A CD2  7  
ATOM 8598  N NE1  . TRP A 1 32 ? -8.659  16.640  -0.718  1.00 0.00 ? 32 TRP A NE1  7  
ATOM 8599  C CE2  . TRP A 1 32 ? -8.943  16.364  0.595   1.00 0.00 ? 32 TRP A CE2  7  
ATOM 8600  C CE3  . TRP A 1 32 ? -7.849  15.351  2.494   1.00 0.00 ? 32 TRP A CE3  7  
ATOM 8601  C CZ2  . TRP A 1 32 ? -10.098 16.610  1.334   1.00 0.00 ? 32 TRP A CZ2  7  
ATOM 8602  C CZ3  . TRP A 1 32 ? -8.995  15.597  3.227   1.00 0.00 ? 32 TRP A CZ3  7  
ATOM 8603  C CH2  . TRP A 1 32 ? -10.106 16.220  2.645   1.00 0.00 ? 32 TRP A CH2  7  
ATOM 8604  H H    . TRP A 1 32 ? -3.001  14.532  0.539   1.00 0.00 ? 32 TRP A H    7  
ATOM 8605  H HA   . TRP A 1 32 ? -4.424  16.244  -1.219  1.00 0.00 ? 32 TRP A HA   7  
ATOM 8606  H HB2  . TRP A 1 32 ? -5.418  14.186  -0.407  1.00 0.00 ? 32 TRP A HB2  7  
ATOM 8607  H HB3  . TRP A 1 32 ? -5.306  14.747  1.253   1.00 0.00 ? 32 TRP A HB3  7  
ATOM 8608  H HD1  . TRP A 1 32 ? -6.887  16.288  -1.953  1.00 0.00 ? 32 TRP A HD1  7  
ATOM 8609  H HE1  . TRP A 1 32 ? -9.265  17.076  -1.354  1.00 0.00 ? 32 TRP A HE1  7  
ATOM 8610  H HE3  . TRP A 1 32 ? -7.003  14.874  2.956   1.00 0.00 ? 32 TRP A HE3  7  
ATOM 8611  H HZ2  . TRP A 1 32 ? -10.963 17.089  0.900   1.00 0.00 ? 32 TRP A HZ2  7  
ATOM 8612  H HZ3  . TRP A 1 32 ? -9.042  15.305  4.266   1.00 0.00 ? 32 TRP A HZ3  7  
ATOM 8613  H HH2  . TRP A 1 32 ? -10.980 16.393  3.256   1.00 0.00 ? 32 TRP A HH2  7  
ATOM 8614  N N    . GLN A 1 33 ? -3.580  17.458  1.637   1.00 0.00 ? 33 GLN A N    7  
ATOM 8615  C CA   . GLN A 1 33 ? -3.584  18.650  2.478   1.00 0.00 ? 33 GLN A CA   7  
ATOM 8616  C C    . GLN A 1 33 ? -2.460  19.608  2.090   1.00 0.00 ? 33 GLN A C    7  
ATOM 8617  O O    . GLN A 1 33 ? -2.180  20.567  2.808   1.00 0.00 ? 33 GLN A O    7  
ATOM 8618  C CB   . GLN A 1 33 ? -3.458  18.261  3.952   1.00 0.00 ? 33 GLN A CB   7  
ATOM 8619  C CG   . GLN A 1 33 ? -4.713  17.611  4.514   1.00 0.00 ? 33 GLN A CG   7  
ATOM 8620  C CD   . GLN A 1 33 ? -5.923  18.524  4.442   1.00 0.00 ? 33 GLN A CD   7  
ATOM 8621  O OE1  . GLN A 1 33 ? -5.799  19.746  4.532   1.00 0.00 ? 33 GLN A OE1  7  
ATOM 8622  N NE2  . GLN A 1 33 ? -7.100  17.936  4.276   1.00 0.00 ? 33 GLN A NE2  7  
ATOM 8623  H H    . GLN A 1 33 ? -2.929  16.755  1.845   1.00 0.00 ? 33 GLN A H    7  
ATOM 8624  H HA   . GLN A 1 33 ? -4.517  19.178  2.335   1.00 0.00 ? 33 GLN A HA   7  
ATOM 8625  H HB2  . GLN A 1 33 ? -2.640  17.564  4.060   1.00 0.00 ? 33 GLN A HB2  7  
ATOM 8626  H HB3  . GLN A 1 33 ? -3.246  19.144  4.544   1.00 0.00 ? 33 GLN A HB3  7  
ATOM 8627  H HG2  . GLN A 1 33 ? -4.917  16.711  3.951   1.00 0.00 ? 33 GLN A HG2  7  
ATOM 8628  H HG3  . GLN A 1 33 ? -4.536  17.353  5.548   1.00 0.00 ? 33 GLN A HG3  7  
ATOM 8629  H HE21 . GLN A 1 33 ? -7.123  16.972  4.231   1.00 0.00 ? 33 GLN A HE21 7  
ATOM 8630  H HE22 . GLN A 1 33 ? -7.896  18.503  4.206   1.00 0.00 ? 33 GLN A HE22 7  
ATOM 8631  N N    . LYS A 1 34 ? -1.817  19.341  0.957   1.00 0.00 ? 34 LYS A N    7  
ATOM 8632  C CA   . LYS A 1 34 ? -0.730  20.191  0.484   1.00 0.00 ? 34 LYS A CA   7  
ATOM 8633  C C    . LYS A 1 34 ? -0.772  20.344  -1.037  1.00 0.00 ? 34 LYS A C    7  
ATOM 8634  O O    . LYS A 1 34 ? 0.038   21.067  -1.617  1.00 0.00 ? 34 LYS A O    7  
ATOM 8635  C CB   . LYS A 1 34 ? 0.624   19.619  0.913   1.00 0.00 ? 34 LYS A CB   7  
ATOM 8636  C CG   . LYS A 1 34 ? 0.955   18.284  0.268   1.00 0.00 ? 34 LYS A CG   7  
ATOM 8637  C CD   . LYS A 1 34 ? 2.283   17.732  0.765   1.00 0.00 ? 34 LYS A CD   7  
ATOM 8638  C CE   . LYS A 1 34 ? 2.208   17.317  2.226   1.00 0.00 ? 34 LYS A CE   7  
ATOM 8639  N NZ   . LYS A 1 34 ? 3.482   16.706  2.696   1.00 0.00 ? 34 LYS A NZ   7  
ATOM 8640  H H    . LYS A 1 34 ? -2.055  18.552  0.438   1.00 0.00 ? 34 LYS A H    7  
ATOM 8641  H HA   . LYS A 1 34 ? -0.839  21.178  0.917   1.00 0.00 ? 34 LYS A HA   7  
ATOM 8642  H HB2  . LYS A 1 34 ? 1.400   20.327  0.654   1.00 0.00 ? 34 LYS A HB2  7  
ATOM 8643  H HB3  . LYS A 1 34 ? 0.607   19.494  1.984   1.00 0.00 ? 34 LYS A HB3  7  
ATOM 8644  H HG2  . LYS A 1 34 ? 0.169   17.599  0.507   1.00 0.00 ? 34 LYS A HG2  7  
ATOM 8645  H HG3  . LYS A 1 34 ? 1.012   18.412  -0.802  1.00 0.00 ? 34 LYS A HG3  7  
ATOM 8646  H HD2  . LYS A 1 34 ? 2.541   16.867  0.173   1.00 0.00 ? 34 LYS A HD2  7  
ATOM 8647  H HD3  . LYS A 1 34 ? 3.051   18.486  0.651   1.00 0.00 ? 34 LYS A HD3  7  
ATOM 8648  H HE2  . LYS A 1 34 ? 2.001   18.184  2.831   1.00 0.00 ? 34 LYS A HE2  7  
ATOM 8649  H HE3  . LYS A 1 34 ? 1.421   16.602  2.344   1.00 0.00 ? 34 LYS A HE3  7  
ATOM 8650  H HZ1  . LYS A 1 34 ? 4.266   17.385  2.601   1.00 0.00 ? 34 LYS A HZ1  7  
ATOM 8651  H HZ2  . LYS A 1 34 ? 3.704   15.856  2.138   1.00 0.00 ? 34 LYS A HZ2  7  
ATOM 8652  H HZ3  . LYS A 1 34 ? 3.396   16.433  3.696   1.00 0.00 ? 34 LYS A HZ3  7  
ATOM 8653  N N    . LYS A 1 35 ? -1.722  19.663  -1.673  1.00 0.00 ? 35 LYS A N    7  
ATOM 8654  C CA   . LYS A 1 35 ? -1.867  19.728  -3.124  1.00 0.00 ? 35 LYS A CA   7  
ATOM 8655  C C    . LYS A 1 35 ? -2.818  20.859  -3.521  1.00 0.00 ? 35 LYS A C    7  
ATOM 8656  O O    . LYS A 1 35 ? -3.891  21.003  -2.936  1.00 0.00 ? 35 LYS A O    7  
ATOM 8657  C CB   . LYS A 1 35 ? -2.388  18.395  -3.668  1.00 0.00 ? 35 LYS A CB   7  
ATOM 8658  C CG   . LYS A 1 35 ? -2.451  18.337  -5.188  1.00 0.00 ? 35 LYS A CG   7  
ATOM 8659  C CD   . LYS A 1 35 ? -2.886  16.963  -5.675  1.00 0.00 ? 35 LYS A CD   7  
ATOM 8660  C CE   . LYS A 1 35 ? -2.954  16.906  -7.193  1.00 0.00 ? 35 LYS A CE   7  
ATOM 8661  N NZ   . LYS A 1 35 ? -3.954  17.862  -7.742  1.00 0.00 ? 35 LYS A NZ   7  
ATOM 8662  H H    . LYS A 1 35 ? -2.355  19.108  -1.180  1.00 0.00 ? 35 LYS A H    7  
ATOM 8663  H HA   . LYS A 1 35 ? -0.888  19.895  -3.541  1.00 0.00 ? 35 LYS A HA   7  
ATOM 8664  H HB2  . LYS A 1 35 ? -1.727  17.612  -3.332  1.00 0.00 ? 35 LYS A HB2  7  
ATOM 8665  H HB3  . LYS A 1 35 ? -3.379  18.212  -3.275  1.00 0.00 ? 35 LYS A HB3  7  
ATOM 8666  H HG2  . LYS A 1 35 ? -3.161  19.072  -5.535  1.00 0.00 ? 35 LYS A HG2  7  
ATOM 8667  H HG3  . LYS A 1 35 ? -1.471  18.560  -5.588  1.00 0.00 ? 35 LYS A HG3  7  
ATOM 8668  H HD2  . LYS A 1 35 ? -2.176  16.225  -5.331  1.00 0.00 ? 35 LYS A HD2  7  
ATOM 8669  H HD3  . LYS A 1 35 ? -3.865  16.739  -5.273  1.00 0.00 ? 35 LYS A HD3  7  
ATOM 8670  H HE2  . LYS A 1 35 ? -1.981  17.143  -7.599  1.00 0.00 ? 35 LYS A HE2  7  
ATOM 8671  H HE3  . LYS A 1 35 ? -3.229  15.904  -7.488  1.00 0.00 ? 35 LYS A HE3  7  
ATOM 8672  H HZ1  . LYS A 1 35 ? -3.617  18.839  -7.632  1.00 0.00 ? 35 LYS A HZ1  7  
ATOM 8673  H HZ2  . LYS A 1 35 ? -4.868  17.763  -7.251  1.00 0.00 ? 35 LYS A HZ2  7  
ATOM 8674  H HZ3  . LYS A 1 35 ? -4.101  17.674  -8.754  1.00 0.00 ? 35 LYS A HZ3  7  
ATOM 8675  N N    . PRO A 1 36 ? -2.438  21.680  -4.522  1.00 0.00 ? 36 PRO A N    7  
ATOM 8676  C CA   . PRO A 1 36 ? -3.273  22.796  -4.981  1.00 0.00 ? 36 PRO A CA   7  
ATOM 8677  C C    . PRO A 1 36 ? -4.654  22.338  -5.435  1.00 0.00 ? 36 PRO A C    7  
ATOM 8678  O O    . PRO A 1 36 ? -4.784  21.363  -6.178  1.00 0.00 ? 36 PRO A O    7  
ATOM 8679  C CB   . PRO A 1 36 ? -2.492  23.376  -6.165  1.00 0.00 ? 36 PRO A CB   7  
ATOM 8680  C CG   . PRO A 1 36 ? -1.086  22.927  -5.959  1.00 0.00 ? 36 PRO A CG   7  
ATOM 8681  C CD   . PRO A 1 36 ? -1.176  21.591  -5.279  1.00 0.00 ? 36 PRO A CD   7  
ATOM 8682  H HA   . PRO A 1 36 ? -3.369  23.550  -4.211  1.00 0.00 ? 36 PRO A HA   7  
ATOM 8683  H HB2  . PRO A 1 36 ? -2.883  23.002  -7.104  1.00 0.00 ? 36 PRO A HB2  7  
ATOM 8684  H HB3  . PRO A 1 36 ? -2.562  24.453  -6.148  1.00 0.00 ? 36 PRO A HB3  7  
ATOM 8685  H HG2  . PRO A 1 36 ? -0.588  22.830  -6.912  1.00 0.00 ? 36 PRO A HG2  7  
ATOM 8686  H HG3  . PRO A 1 36 ? -0.563  23.633  -5.331  1.00 0.00 ? 36 PRO A HG3  7  
ATOM 8687  H HD2  . PRO A 1 36 ? -1.215  20.795  -6.009  1.00 0.00 ? 36 PRO A HD2  7  
ATOM 8688  H HD3  . PRO A 1 36 ? -0.333  21.462  -4.620  1.00 0.00 ? 36 PRO A HD3  7  
ATOM 8689  N N    . ARG A 1 37 ? -5.684  23.046  -4.985  1.00 0.00 ? 37 ARG A N    7  
ATOM 8690  C CA   . ARG A 1 37 ? -7.058  22.717  -5.344  1.00 0.00 ? 37 ARG A CA   7  
ATOM 8691  C C    . ARG A 1 37 ? -7.443  23.373  -6.666  1.00 0.00 ? 37 ARG A C    7  
ATOM 8692  O O    . ARG A 1 37 ? -7.074  24.517  -6.934  1.00 0.00 ? 37 ARG A O    7  
ATOM 8693  C CB   . ARG A 1 37 ? -8.018  23.165  -4.239  1.00 0.00 ? 37 ARG A CB   7  
ATOM 8694  C CG   . ARG A 1 37 ? -7.936  24.649  -3.924  1.00 0.00 ? 37 ARG A CG   7  
ATOM 8695  C CD   . ARG A 1 37 ? -8.974  25.054  -2.890  1.00 0.00 ? 37 ARG A CD   7  
ATOM 8696  N NE   . ARG A 1 37 ? -8.915  26.480  -2.580  1.00 0.00 ? 37 ARG A NE   7  
ATOM 8697  C CZ   . ARG A 1 37 ? -9.615  27.051  -1.604  1.00 0.00 ? 37 ARG A CZ   7  
ATOM 8698  N NH1  . ARG A 1 37 ? -10.418 26.318  -0.845  1.00 0.00 ? 37 ARG A NH1  7  
ATOM 8699  N NH2  . ARG A 1 37 ? -9.513  28.356  -1.387  1.00 0.00 ? 37 ARG A NH2  7  
ATOM 8700  H H    . ARG A 1 37 ? -5.506  23.814  -4.401  1.00 0.00 ? 37 ARG A H    7  
ATOM 8701  H HA   . ARG A 1 37 ? -7.137  21.639  -5.448  1.00 0.00 ? 37 ARG A HA   7  
ATOM 8702  H HB2  . ARG A 1 37 ? -9.033  22.929  -4.537  1.00 0.00 ? 37 ARG A HB2  7  
ATOM 8703  H HB3  . ARG A 1 37 ? -7.784  22.615  -3.338  1.00 0.00 ? 37 ARG A HB3  7  
ATOM 8704  H HG2  . ARG A 1 37 ? -6.960  24.878  -3.532  1.00 0.00 ? 37 ARG A HG2  7  
ATOM 8705  H HG3  . ARG A 1 37 ? -8.108  25.219  -4.823  1.00 0.00 ? 37 ARG A HG3  7  
ATOM 8706  H HD2  . ARG A 1 37 ? -9.959  24.822  -3.271  1.00 0.00 ? 37 ARG A HD2  7  
ATOM 8707  H HD3  . ARG A 1 37 ? -8.795  24.489  -1.984  1.00 0.00 ? 37 ARG A HD3  7  
ATOM 8708  H HE   . ARG A 1 37 ? -8.326  27.048  -3.130  1.00 0.00 ? 37 ARG A HE   7  
ATOM 8709  H HH11 . ARG A 1 37 ? -10.515 25.335  -0.987  1.00 0.00 ? 37 ARG A HH11 7  
ATOM 8710  H HH12 . ARG A 1 37 ? -10.941 26.756  -0.110  1.00 0.00 ? 37 ARG A HH12 7  
ATOM 8711  H HH21 . ARG A 1 37 ? -8.908  28.916  -1.958  1.00 0.00 ? 37 ARG A HH21 7  
ATOM 8712  H HH22 . ARG A 1 37 ? -10.040 28.788  -0.652  1.00 0.00 ? 37 ARG A HH22 7  
ATOM 8713  N N    . TYR A 1 38 ? -8.186  22.641  -7.490  1.00 0.00 ? 38 TYR A N    7  
ATOM 8714  C CA   . TYR A 1 38 ? -8.622  23.153  -8.782  1.00 0.00 ? 38 TYR A CA   7  
ATOM 8715  C C    . TYR A 1 38 ? -10.100 22.856  -9.017  1.00 0.00 ? 38 TYR A C    7  
ATOM 8716  O O    . TYR A 1 38 ? -10.525 21.703  -8.976  1.00 0.00 ? 38 TYR A O    7  
ATOM 8717  C CB   . TYR A 1 38 ? -7.783  22.539  -9.905  1.00 0.00 ? 38 TYR A CB   7  
ATOM 8718  C CG   . TYR A 1 38 ? -8.180  23.007  -11.289 1.00 0.00 ? 38 TYR A CG   7  
ATOM 8719  C CD1  . TYR A 1 38 ? -7.858  24.285  -11.730 1.00 0.00 ? 38 TYR A CD1  7  
ATOM 8720  C CD2  . TYR A 1 38 ? -8.878  22.171  -12.153 1.00 0.00 ? 38 TYR A CD2  7  
ATOM 8721  C CE1  . TYR A 1 38 ? -8.219  24.716  -12.991 1.00 0.00 ? 38 TYR A CE1  7  
ATOM 8722  C CE2  . TYR A 1 38 ? -9.243  22.596  -13.417 1.00 0.00 ? 38 TYR A CE2  7  
ATOM 8723  C CZ   . TYR A 1 38 ? -8.912  23.869  -13.830 1.00 0.00 ? 38 TYR A CZ   7  
ATOM 8724  O OH   . TYR A 1 38 ? -9.275  24.294  -15.088 1.00 0.00 ? 38 TYR A OH   7  
ATOM 8725  H H    . TYR A 1 38 ? -8.451  21.728  -7.227  1.00 0.00 ? 38 TYR A H    7  
ATOM 8726  H HA   . TYR A 1 38 ? -8.477  24.228  -8.801  1.00 0.00 ? 38 TYR A HA   7  
ATOM 8727  H HB2  . TYR A 1 38 ? -6.746  22.804  -9.748  1.00 0.00 ? 38 TYR A HB2  7  
ATOM 8728  H HB3  . TYR A 1 38 ? -7.876  21.461  -9.864  1.00 0.00 ? 38 TYR A HB3  7  
ATOM 8729  H HD1  . TYR A 1 38 ? -7.315  24.950  -11.073 1.00 0.00 ? 38 TYR A HD1  7  
ATOM 8730  H HD2  . TYR A 1 38 ? -9.138  21.173  -11.829 1.00 0.00 ? 38 TYR A HD2  7  
ATOM 8731  H HE1  . TYR A 1 38 ? -7.959  25.713  -13.315 1.00 0.00 ? 38 TYR A HE1  7  
ATOM 8732  H HE2  . TYR A 1 38 ? -9.786  21.933  -14.074 1.00 0.00 ? 38 TYR A HE2  7  
ATOM 8733  H HH   . TYR A 1 38 ? -8.556  24.128  -15.702 1.00 0.00 ? 38 TYR A HH   7  
ATOM 8734  N N    . GLU A 1 39 ? -10.876 23.907  -9.259  1.00 0.00 ? 39 GLU A N    7  
ATOM 8735  C CA   . GLU A 1 39 ? -12.305 23.762  -9.502  1.00 0.00 ? 39 GLU A CA   7  
ATOM 8736  C C    . GLU A 1 39 ? -12.567 23.297  -10.930 1.00 0.00 ? 39 GLU A C    7  
ATOM 8737  O O    . GLU A 1 39 ? -11.847 23.671  -11.857 1.00 0.00 ? 39 GLU A O    7  
ATOM 8738  C CB   . GLU A 1 39 ? -13.024 25.089  -9.248  1.00 0.00 ? 39 GLU A CB   7  
ATOM 8739  C CG   . GLU A 1 39 ? -12.563 26.212  -10.162 1.00 0.00 ? 39 GLU A CG   7  
ATOM 8740  C CD   . GLU A 1 39 ? -13.248 27.530  -9.858  1.00 0.00 ? 39 GLU A CD   7  
ATOM 8741  O OE1  . GLU A 1 39 ? -14.386 27.731  -10.330 1.00 0.00 ? 39 GLU A OE1  7  
ATOM 8742  O OE2  . GLU A 1 39 ? -12.644 28.361  -9.146  1.00 0.00 ? 39 GLU A OE2  7  
ATOM 8743  O OXT  . GLU A 1 39 ? -13.536 22.528  -11.107 1.00 0.00 ? 39 GLU A OXT  7  
ATOM 8744  H H    . GLU A 1 39 ? -10.471 24.802  -9.274  1.00 0.00 ? 39 GLU A H    7  
ATOM 8745  H HA   . GLU A 1 39 ? -12.698 23.020  -8.817  1.00 0.00 ? 39 GLU A HA   7  
ATOM 8746  H HB2  . GLU A 1 39 ? -14.088 24.947  -9.388  1.00 0.00 ? 39 GLU A HB2  7  
ATOM 8747  H HB3  . GLU A 1 39 ? -12.843 25.387  -8.225  1.00 0.00 ? 39 GLU A HB3  7  
ATOM 8748  H HG2  . GLU A 1 39 ? -11.501 26.351  -10.049 1.00 0.00 ? 39 GLU A HG2  7  
ATOM 8749  H HG3  . GLU A 1 39 ? -12.782 25.947  -11.185 1.00 0.00 ? 39 GLU A HG3  7  
ATOM 8750  N N    . GLY B 1 1  ? -10.296 -23.118 -12.854 1.00 0.00 ? 1  GLY B N    7  
ATOM 8751  C CA   . GLY B 1 1  ? -10.608 -23.465 -11.480 1.00 0.00 ? 1  GLY B CA   7  
ATOM 8752  C C    . GLY B 1 1  ? -11.017 -22.259 -10.656 1.00 0.00 ? 1  GLY B C    7  
ATOM 8753  O O    . GLY B 1 1  ? -11.047 -21.136 -11.160 1.00 0.00 ? 1  GLY B O    7  
ATOM 8754  H H1   . GLY B 1 1  ? -10.022 -23.972 -13.381 1.00 0.00 ? 1  GLY B H1   7  
ATOM 8755  H H2   . GLY B 1 1  ? -9.506  -22.439 -12.888 1.00 0.00 ? 1  GLY B H2   7  
ATOM 8756  H H3   . GLY B 1 1  ? -11.125 -22.693 -13.320 1.00 0.00 ? 1  GLY B H3   7  
ATOM 8757  H HA2  . GLY B 1 1  ? -11.417 -24.180 -11.475 1.00 0.00 ? 1  GLY B HA2  7  
ATOM 8758  H HA3  . GLY B 1 1  ? -9.738  -23.919 -11.028 1.00 0.00 ? 1  GLY B HA3  7  
ATOM 8759  N N    . HIS B 1 2  ? -11.329 -22.491 -9.384  1.00 0.00 ? 2  HIS B N    7  
ATOM 8760  C CA   . HIS B 1 2  ? -11.738 -21.415 -8.489  1.00 0.00 ? 2  HIS B CA   7  
ATOM 8761  C C    . HIS B 1 2  ? -10.604 -21.035 -7.541  1.00 0.00 ? 2  HIS B C    7  
ATOM 8762  O O    . HIS B 1 2  ? -10.159 -19.888 -7.519  1.00 0.00 ? 2  HIS B O    7  
ATOM 8763  C CB   . HIS B 1 2  ? -12.974 -21.829 -7.688  1.00 0.00 ? 2  HIS B CB   7  
ATOM 8764  C CG   . HIS B 1 2  ? -13.510 -20.740 -6.811  1.00 0.00 ? 2  HIS B CG   7  
ATOM 8765  N ND1  . HIS B 1 2  ? -14.392 -19.779 -7.259  1.00 0.00 ? 2  HIS B ND1  7  
ATOM 8766  C CD2  . HIS B 1 2  ? -13.283 -20.460 -5.505  1.00 0.00 ? 2  HIS B CD2  7  
ATOM 8767  C CE1  . HIS B 1 2  ? -14.683 -18.955 -6.269  1.00 0.00 ? 2  HIS B CE1  7  
ATOM 8768  N NE2  . HIS B 1 2  ? -14.024 -19.347 -5.194  1.00 0.00 ? 2  HIS B NE2  7  
ATOM 8769  H H    . HIS B 1 2  ? -11.282 -23.411 -9.030  1.00 0.00 ? 2  HIS B H    7  
ATOM 8770  H HA   . HIS B 1 2  ? -11.993 -20.541 -9.078  1.00 0.00 ? 2  HIS B HA   7  
ATOM 8771  H HB2  . HIS B 1 2  ? -13.757 -22.114 -8.375  1.00 0.00 ? 2  HIS B HB2  7  
ATOM 8772  H HB3  . HIS B 1 2  ? -12.729 -22.676 -7.061  1.00 0.00 ? 2  HIS B HB3  7  
ATOM 8773  H HD1  . HIS B 1 2  ? -14.751 -19.711 -8.168  1.00 0.00 ? 2  HIS B HD1  7  
ATOM 8774  H HD2  . HIS B 1 2  ? -12.639 -21.010 -4.834  1.00 0.00 ? 2  HIS B HD2  7  
ATOM 8775  H HE1  . HIS B 1 2  ? -15.348 -18.106 -6.328  1.00 0.00 ? 2  HIS B HE1  7  
ATOM 8776  H HE2  . HIS B 1 2  ? -13.995 -18.864 -4.342  1.00 0.00 ? 2  HIS B HE2  7  
ATOM 8777  N N    . SER B 1 3  ? -10.141 -22.005 -6.759  1.00 0.00 ? 3  SER B N    7  
ATOM 8778  C CA   . SER B 1 3  ? -9.059  -21.773 -5.808  1.00 0.00 ? 3  SER B CA   7  
ATOM 8779  C C    . SER B 1 3  ? -7.731  -21.577 -6.532  1.00 0.00 ? 3  SER B C    7  
ATOM 8780  O O    . SER B 1 3  ? -7.434  -22.274 -7.502  1.00 0.00 ? 3  SER B O    7  
ATOM 8781  C CB   . SER B 1 3  ? -8.952  -22.942 -4.829  1.00 0.00 ? 3  SER B CB   7  
ATOM 8782  O OG   . SER B 1 3  ? -7.900  -22.735 -3.899  1.00 0.00 ? 3  SER B OG   7  
ATOM 8783  H H    . SER B 1 3  ? -10.538 -22.907 -6.824  1.00 0.00 ? 3  SER B H    7  
ATOM 8784  H HA   . SER B 1 3  ? -9.293  -20.875 -5.246  1.00 0.00 ? 3  SER B HA   7  
ATOM 8785  H HB2  . SER B 1 3  ? -9.880  -23.038 -4.286  1.00 0.00 ? 3  SER B HB2  7  
ATOM 8786  H HB3  . SER B 1 3  ? -8.760  -23.854 -5.376  1.00 0.00 ? 3  SER B HB3  7  
ATOM 8787  H HG   . SER B 1 3  ? -7.723  -23.553 -3.428  1.00 0.00 ? 3  SER B HG   7  
ATOM 8788  N N    . LEU B 1 4  ? -6.936  -20.623 -6.054  1.00 0.00 ? 4  LEU B N    7  
ATOM 8789  C CA   . LEU B 1 4  ? -5.638  -20.335 -6.656  1.00 0.00 ? 4  LEU B CA   7  
ATOM 8790  C C    . LEU B 1 4  ? -4.527  -21.136 -5.974  1.00 0.00 ? 4  LEU B C    7  
ATOM 8791  O O    . LEU B 1 4  ? -4.606  -21.420 -4.778  1.00 0.00 ? 4  LEU B O    7  
ATOM 8792  C CB   . LEU B 1 4  ? -5.331  -18.837 -6.564  1.00 0.00 ? 4  LEU B CB   7  
ATOM 8793  C CG   . LEU B 1 4  ? -6.341  -17.919 -7.255  1.00 0.00 ? 4  LEU B CG   7  
ATOM 8794  C CD1  . LEU B 1 4  ? -6.061  -16.465 -6.909  1.00 0.00 ? 4  LEU B CD1  7  
ATOM 8795  C CD2  . LEU B 1 4  ? -6.305  -18.123 -8.764  1.00 0.00 ? 4  LEU B CD2  7  
ATOM 8796  H H    . LEU B 1 4  ? -7.225  -20.098 -5.270  1.00 0.00 ? 4  LEU B H    7  
ATOM 8797  H HA   . LEU B 1 4  ? -5.687  -20.609 -7.700  1.00 0.00 ? 4  LEU B HA   7  
ATOM 8798  H HB2  . LEU B 1 4  ? -5.288  -18.570 -5.514  1.00 0.00 ? 4  LEU B HB2  7  
ATOM 8799  H HB3  . LEU B 1 4  ? -4.358  -18.660 -7.001  1.00 0.00 ? 4  LEU B HB3  7  
ATOM 8800  H HG   . LEU B 1 4  ? -7.335  -18.159 -6.907  1.00 0.00 ? 4  LEU B HG   7  
ATOM 8801  H HD11 . LEU B 1 4  ? -5.074  -16.190 -7.255  1.00 0.00 ? 4  LEU B HD11 7  
ATOM 8802  H HD12 . LEU B 1 4  ? -6.115  -16.331 -5.837  1.00 0.00 ? 4  LEU B HD12 7  
ATOM 8803  H HD13 . LEU B 1 4  ? -6.797  -15.831 -7.384  1.00 0.00 ? 4  LEU B HD13 7  
ATOM 8804  H HD21 . LEU B 1 4  ? -6.568  -19.144 -8.999  1.00 0.00 ? 4  LEU B HD21 7  
ATOM 8805  H HD22 . LEU B 1 4  ? -5.313  -17.913 -9.138  1.00 0.00 ? 4  LEU B HD22 7  
ATOM 8806  H HD23 . LEU B 1 4  ? -7.014  -17.457 -9.238  1.00 0.00 ? 4  LEU B HD23 7  
ATOM 8807  N N    . PRO B 1 5  ? -3.475  -21.510 -6.728  1.00 0.00 ? 5  PRO B N    7  
ATOM 8808  C CA   . PRO B 1 5  ? -2.346  -22.278 -6.185  1.00 0.00 ? 5  PRO B CA   7  
ATOM 8809  C C    . PRO B 1 5  ? -1.549  -21.484 -5.154  1.00 0.00 ? 5  PRO B C    7  
ATOM 8810  O O    . PRO B 1 5  ? -1.726  -20.276 -5.016  1.00 0.00 ? 5  PRO B O    7  
ATOM 8811  C CB   . PRO B 1 5  ? -1.485  -22.570 -7.419  1.00 0.00 ? 5  PRO B CB   7  
ATOM 8812  C CG   . PRO B 1 5  ? -1.843  -21.500 -8.390  1.00 0.00 ? 5  PRO B CG   7  
ATOM 8813  C CD   . PRO B 1 5  ? -3.301  -21.219 -8.163  1.00 0.00 ? 5  PRO B CD   7  
ATOM 8814  H HA   . PRO B 1 5  ? -2.676  -23.207 -5.744  1.00 0.00 ? 5  PRO B HA   7  
ATOM 8815  H HB2  . PRO B 1 5  ? -0.432  -22.547 -7.172  1.00 0.00 ? 5  PRO B HB2  7  
ATOM 8816  H HB3  . PRO B 1 5  ? -1.740  -23.544 -7.808  1.00 0.00 ? 5  PRO B HB3  7  
ATOM 8817  H HG2  . PRO B 1 5  ? -1.254  -20.615 -8.197  1.00 0.00 ? 5  PRO B HG2  7  
ATOM 8818  H HG3  . PRO B 1 5  ? -1.681  -21.848 -9.399  1.00 0.00 ? 5  PRO B HG3  7  
ATOM 8819  H HD2  . PRO B 1 5  ? -3.521  -20.184 -8.381  1.00 0.00 ? 5  PRO B HD2  7  
ATOM 8820  H HD3  . PRO B 1 5  ? -3.912  -21.874 -8.767  1.00 0.00 ? 5  PRO B HD3  7  
ATOM 8821  N N    . PHE B 1 6  ? -0.674  -22.173 -4.428  1.00 0.00 ? 6  PHE B N    7  
ATOM 8822  C CA   . PHE B 1 6  ? 0.151   -21.531 -3.410  1.00 0.00 ? 6  PHE B CA   7  
ATOM 8823  C C    . PHE B 1 6  ? 1.225   -20.656 -4.051  1.00 0.00 ? 6  PHE B C    7  
ATOM 8824  O O    . PHE B 1 6  ? 1.824   -19.806 -3.390  1.00 0.00 ? 6  PHE B O    7  
ATOM 8825  C CB   . PHE B 1 6  ? 0.800   -22.588 -2.511  1.00 0.00 ? 6  PHE B CB   7  
ATOM 8826  C CG   . PHE B 1 6  ? 1.980   -23.278 -3.137  1.00 0.00 ? 6  PHE B CG   7  
ATOM 8827  C CD1  . PHE B 1 6  ? 1.827   -24.041 -4.284  1.00 0.00 ? 6  PHE B CD1  7  
ATOM 8828  C CD2  . PHE B 1 6  ? 3.240   -23.163 -2.576  1.00 0.00 ? 6  PHE B CD2  7  
ATOM 8829  C CE1  . PHE B 1 6  ? 2.911   -24.674 -4.858  1.00 0.00 ? 6  PHE B CE1  7  
ATOM 8830  C CE2  . PHE B 1 6  ? 4.328   -23.795 -3.147  1.00 0.00 ? 6  PHE B CE2  7  
ATOM 8831  C CZ   . PHE B 1 6  ? 4.163   -24.551 -4.290  1.00 0.00 ? 6  PHE B CZ   7  
ATOM 8832  H H    . PHE B 1 6  ? -0.599  -23.134 -4.579  1.00 0.00 ? 6  PHE B H    7  
ATOM 8833  H HA   . PHE B 1 6  ? -0.486  -20.920 -2.799  1.00 0.00 ? 6  PHE B HA   7  
ATOM 8834  H HB2  . PHE B 1 6  ? 1.121   -22.112 -1.594  1.00 0.00 ? 6  PHE B HB2  7  
ATOM 8835  H HB3  . PHE B 1 6  ? 0.064   -23.343 -2.269  1.00 0.00 ? 6  PHE B HB3  7  
ATOM 8836  H HD1  . PHE B 1 6  ? 0.862   -24.155 -4.735  1.00 0.00 ? 6  PHE B HD1  7  
ATOM 8837  H HD2  . PHE B 1 6  ? 3.375   -22.572 -1.680  1.00 0.00 ? 6  PHE B HD2  7  
ATOM 8838  H HE1  . PHE B 1 6  ? 2.779   -25.266 -5.752  1.00 0.00 ? 6  PHE B HE1  7  
ATOM 8839  H HE2  . PHE B 1 6  ? 5.306   -23.697 -2.700  1.00 0.00 ? 6  PHE B HE2  7  
ATOM 8840  H HZ   . PHE B 1 6  ? 5.012   -25.046 -4.738  1.00 0.00 ? 6  PHE B HZ   7  
ATOM 8841  N N    . LYS B 1 7  ? 1.466   -20.876 -5.339  1.00 0.00 ? 7  LYS B N    7  
ATOM 8842  C CA   . LYS B 1 7  ? 2.472   -20.120 -6.078  1.00 0.00 ? 7  LYS B CA   7  
ATOM 8843  C C    . LYS B 1 7  ? 2.181   -18.622 -6.033  1.00 0.00 ? 7  LYS B C    7  
ATOM 8844  O O    . LYS B 1 7  ? 3.055   -17.822 -5.695  1.00 0.00 ? 7  LYS B O    7  
ATOM 8845  C CB   . LYS B 1 7  ? 2.522   -20.594 -7.532  1.00 0.00 ? 7  LYS B CB   7  
ATOM 8846  C CG   . LYS B 1 7  ? 3.675   -20.005 -8.330  1.00 0.00 ? 7  LYS B CG   7  
ATOM 8847  C CD   . LYS B 1 7  ? 3.598   -20.402 -9.797  1.00 0.00 ? 7  LYS B CD   7  
ATOM 8848  C CE   . LYS B 1 7  ? 3.784   -21.900 -9.984  1.00 0.00 ? 7  LYS B CE   7  
ATOM 8849  N NZ   . LYS B 1 7  ? 5.143   -22.346 -9.569  1.00 0.00 ? 7  LYS B NZ   7  
ATOM 8850  H H    . LYS B 1 7  ? 0.976   -21.575 -5.818  1.00 0.00 ? 7  LYS B H    7  
ATOM 8851  H HA   . LYS B 1 7  ? 3.433   -20.303 -5.616  1.00 0.00 ? 7  LYS B HA   7  
ATOM 8852  H HB2  . LYS B 1 7  ? 2.624   -21.668 -7.527  1.00 0.00 ? 7  LYS B HB2  7  
ATOM 8853  H HB3  . LYS B 1 7  ? 1.591   -20.333 -8.021  1.00 0.00 ? 7  LYS B HB3  7  
ATOM 8854  H HG2  . LYS B 1 7  ? 3.634   -18.927 -8.269  1.00 0.00 ? 7  LYS B HG2  7  
ATOM 8855  H HG3  . LYS B 1 7  ? 4.608   -20.351 -7.913  1.00 0.00 ? 7  LYS B HG3  7  
ATOM 8856  H HD2  . LYS B 1 7  ? 2.634   -20.116 -10.195 1.00 0.00 ? 7  LYS B HD2  7  
ATOM 8857  H HD3  . LYS B 1 7  ? 4.377   -19.884 -10.337 1.00 0.00 ? 7  LYS B HD3  7  
ATOM 8858  H HE2  . LYS B 1 7  ? 3.043   -22.438 -9.416  1.00 0.00 ? 7  LYS B HE2  7  
ATOM 8859  H HE3  . LYS B 1 7  ? 3.654   -22.128 -11.032 1.00 0.00 ? 7  LYS B HE3  7  
ATOM 8860  H HZ1  . LYS B 1 7  ? 5.292   -23.335 -9.855  1.00 0.00 ? 7  LYS B HZ1  7  
ATOM 8861  H HZ2  . LYS B 1 7  ? 5.244   -22.283 -8.537  1.00 0.00 ? 7  LYS B HZ2  7  
ATOM 8862  H HZ3  . LYS B 1 7  ? 5.877   -21.757 -10.017 1.00 0.00 ? 7  LYS B HZ3  7  
ATOM 8863  N N    . VAL B 1 8  ? 0.951   -18.249 -6.374  1.00 0.00 ? 8  VAL B N    7  
ATOM 8864  C CA   . VAL B 1 8  ? 0.548   -16.847 -6.377  1.00 0.00 ? 8  VAL B CA   7  
ATOM 8865  C C    . VAL B 1 8  ? 0.624   -16.241 -4.979  1.00 0.00 ? 8  VAL B C    7  
ATOM 8866  O O    . VAL B 1 8  ? 0.945   -15.063 -4.823  1.00 0.00 ? 8  VAL B O    7  
ATOM 8867  C CB   . VAL B 1 8  ? -0.875  -16.660 -6.937  1.00 0.00 ? 8  VAL B CB   7  
ATOM 8868  C CG1  . VAL B 1 8  ? -0.937  -17.085 -8.395  1.00 0.00 ? 8  VAL B CG1  7  
ATOM 8869  C CG2  . VAL B 1 8  ? -1.886  -17.437 -6.108  1.00 0.00 ? 8  VAL B CG2  7  
ATOM 8870  H H    . VAL B 1 8  ? 0.301   -18.940 -6.639  1.00 0.00 ? 8  VAL B H    7  
ATOM 8871  H HA   . VAL B 1 8  ? 1.235   -16.304 -7.018  1.00 0.00 ? 8  VAL B HA   7  
ATOM 8872  H HB   . VAL B 1 8  ? -1.133  -15.610 -6.888  1.00 0.00 ? 8  VAL B HB   7  
ATOM 8873  H HG11 . VAL B 1 8  ? -0.233  -16.501 -8.972  1.00 0.00 ? 8  VAL B HG11 7  
ATOM 8874  H HG12 . VAL B 1 8  ? -1.934  -16.921 -8.779  1.00 0.00 ? 8  VAL B HG12 7  
ATOM 8875  H HG13 . VAL B 1 8  ? -0.688  -18.134 -8.480  1.00 0.00 ? 8  VAL B HG13 7  
ATOM 8876  H HG21 . VAL B 1 8  ? -1.856  -17.127 -5.078  1.00 0.00 ? 8  VAL B HG21 7  
ATOM 8877  H HG22 . VAL B 1 8  ? -1.679  -18.482 -6.179  1.00 0.00 ? 8  VAL B HG22 7  
ATOM 8878  H HG23 . VAL B 1 8  ? -2.875  -17.247 -6.497  1.00 0.00 ? 8  VAL B HG23 7  
ATOM 8879  N N    . VAL B 1 9  ? 0.315   -17.045 -3.965  1.00 0.00 ? 9  VAL B N    7  
ATOM 8880  C CA   . VAL B 1 9  ? 0.344   -16.576 -2.584  1.00 0.00 ? 9  VAL B CA   7  
ATOM 8881  C C    . VAL B 1 9  ? 1.749   -16.144 -2.175  1.00 0.00 ? 9  VAL B C    7  
ATOM 8882  O O    . VAL B 1 9  ? 1.944   -15.045 -1.656  1.00 0.00 ? 9  VAL B O    7  
ATOM 8883  C CB   . VAL B 1 9  ? -0.140  -17.658 -1.600  1.00 0.00 ? 9  VAL B CB   7  
ATOM 8884  C CG1  . VAL B 1 9  ? -0.537  -17.028 -0.274  1.00 0.00 ? 9  VAL B CG1  7  
ATOM 8885  C CG2  . VAL B 1 9  ? -1.296  -18.451 -2.188  1.00 0.00 ? 9  VAL B CG2  7  
ATOM 8886  H H    . VAL B 1 9  ? 0.071   -17.970 -4.160  1.00 0.00 ? 9  VAL B H    7  
ATOM 8887  H HA   . VAL B 1 9  ? -0.320  -15.721 -2.512  1.00 0.00 ? 9  VAL B HA   7  
ATOM 8888  H HB   . VAL B 1 9  ? 0.671   -18.352 -1.411  1.00 0.00 ? 9  VAL B HB   7  
ATOM 8889  H HG11 . VAL B 1 9  ? -1.348  -16.330 -0.430  1.00 0.00 ? 9  VAL B HG11 7  
ATOM 8890  H HG12 . VAL B 1 9  ? 0.310   -16.505 0.149   1.00 0.00 ? 9  VAL B HG12 7  
ATOM 8891  H HG13 . VAL B 1 9  ? -0.856  -17.799 0.413   1.00 0.00 ? 9  VAL B HG13 7  
ATOM 8892  H HG21 . VAL B 1 9  ? -1.676  -19.143 -1.448  1.00 0.00 ? 9  VAL B HG21 7  
ATOM 8893  H HG22 . VAL B 1 9  ? -0.966  -19.006 -3.043  1.00 0.00 ? 9  VAL B HG22 7  
ATOM 8894  H HG23 . VAL B 1 9  ? -2.089  -17.777 -2.481  1.00 0.00 ? 9  VAL B HG23 7  
ATOM 8895  N N    . VAL B 1 10 ? 2.726   -17.018 -2.409  1.00 0.00 ? 10 VAL B N    7  
ATOM 8896  C CA   . VAL B 1 10 ? 4.114   -16.734 -2.058  1.00 0.00 ? 10 VAL B CA   7  
ATOM 8897  C C    . VAL B 1 10 ? 4.641   -15.513 -2.807  1.00 0.00 ? 10 VAL B C    7  
ATOM 8898  O O    . VAL B 1 10 ? 5.239   -14.620 -2.207  1.00 0.00 ? 10 VAL B O    7  
ATOM 8899  C CB   . VAL B 1 10 ? 5.029   -17.937 -2.359  1.00 0.00 ? 10 VAL B CB   7  
ATOM 8900  C CG1  . VAL B 1 10 ? 6.465   -17.636 -1.955  1.00 0.00 ? 10 VAL B CG1  7  
ATOM 8901  C CG2  . VAL B 1 10 ? 4.524   -19.187 -1.654  1.00 0.00 ? 10 VAL B CG2  7  
ATOM 8902  H H    . VAL B 1 10 ? 2.500   -17.877 -2.834  1.00 0.00 ? 10 VAL B H    7  
ATOM 8903  H HA   . VAL B 1 10 ? 4.156   -16.534 -0.994  1.00 0.00 ? 10 VAL B HA   7  
ATOM 8904  H HB   . VAL B 1 10 ? 5.012   -18.125 -3.425  1.00 0.00 ? 10 VAL B HB   7  
ATOM 8905  H HG11 . VAL B 1 10 ? 6.877   -16.875 -2.599  1.00 0.00 ? 10 VAL B HG11 7  
ATOM 8906  H HG12 . VAL B 1 10 ? 7.065   -18.532 -2.048  1.00 0.00 ? 10 VAL B HG12 7  
ATOM 8907  H HG13 . VAL B 1 10 ? 6.494   -17.294 -0.929  1.00 0.00 ? 10 VAL B HG13 7  
ATOM 8908  H HG21 . VAL B 1 10 ? 4.544   -19.031 -0.584  1.00 0.00 ? 10 VAL B HG21 7  
ATOM 8909  H HG22 . VAL B 1 10 ? 5.162   -20.024 -1.902  1.00 0.00 ? 10 VAL B HG22 7  
ATOM 8910  H HG23 . VAL B 1 10 ? 3.524   -19.411 -1.959  1.00 0.00 ? 10 VAL B HG23 7  
ATOM 8911  N N    . ILE B 1 11 ? 4.418   -15.484 -4.116  1.00 0.00 ? 11 ILE B N    7  
ATOM 8912  C CA   . ILE B 1 11 ? 4.880   -14.376 -4.946  1.00 0.00 ? 11 ILE B CA   7  
ATOM 8913  C C    . ILE B 1 11 ? 4.236   -13.059 -4.527  1.00 0.00 ? 11 ILE B C    7  
ATOM 8914  O O    . ILE B 1 11 ? 4.881   -12.012 -4.535  1.00 0.00 ? 11 ILE B O    7  
ATOM 8915  C CB   . ILE B 1 11 ? 4.586   -14.633 -6.438  1.00 0.00 ? 11 ILE B CB   7  
ATOM 8916  C CG1  . ILE B 1 11 ? 5.253   -15.933 -6.894  1.00 0.00 ? 11 ILE B CG1  7  
ATOM 8917  C CG2  . ILE B 1 11 ? 5.063   -13.460 -7.285  1.00 0.00 ? 11 ILE B CG2  7  
ATOM 8918  C CD1  . ILE B 1 11 ? 4.857   -16.363 -8.290  1.00 0.00 ? 11 ILE B CD1  7  
ATOM 8919  H H    . ILE B 1 11 ? 3.928   -16.229 -4.534  1.00 0.00 ? 11 ILE B H    7  
ATOM 8920  H HA   . ILE B 1 11 ? 5.954   -14.290 -4.823  1.00 0.00 ? 11 ILE B HA   7  
ATOM 8921  H HB   . ILE B 1 11 ? 3.515   -14.723 -6.562  1.00 0.00 ? 11 ILE B HB   7  
ATOM 8922  H HG12 . ILE B 1 11 ? 6.326   -15.802 -6.888  1.00 0.00 ? 11 ILE B HG12 7  
ATOM 8923  H HG13 . ILE B 1 11 ? 5.005   -16.736 -6.226  1.00 0.00 ? 11 ILE B HG13 7  
ATOM 8924  H HG21 . ILE B 1 11 ? 4.900   -13.671 -8.332  1.00 0.00 ? 11 ILE B HG21 7  
ATOM 8925  H HG22 . ILE B 1 11 ? 6.117   -13.295 -7.118  1.00 0.00 ? 11 ILE B HG22 7  
ATOM 8926  H HG23 . ILE B 1 11 ? 4.516   -12.567 -7.024  1.00 0.00 ? 11 ILE B HG23 7  
ATOM 8927  H HD11 . ILE B 1 11 ? 5.295   -15.692 -9.013  1.00 0.00 ? 11 ILE B HD11 7  
ATOM 8928  H HD12 . ILE B 1 11 ? 3.780   -16.346 -8.387  1.00 0.00 ? 11 ILE B HD12 7  
ATOM 8929  H HD13 . ILE B 1 11 ? 5.216   -17.365 -8.470  1.00 0.00 ? 11 ILE B HD13 7  
ATOM 8930  N N    . SER B 1 12 ? 2.961   -13.119 -4.157  1.00 0.00 ? 12 SER B N    7  
ATOM 8931  C CA   . SER B 1 12 ? 2.228   -11.929 -3.738  1.00 0.00 ? 12 SER B CA   7  
ATOM 8932  C C    . SER B 1 12 ? 2.706   -11.438 -2.376  1.00 0.00 ? 12 SER B C    7  
ATOM 8933  O O    . SER B 1 12 ? 2.803   -10.236 -2.139  1.00 0.00 ? 12 SER B O    7  
ATOM 8934  C CB   . SER B 1 12 ? 0.727   -12.221 -3.691  1.00 0.00 ? 12 SER B CB   7  
ATOM 8935  O OG   . SER B 1 12 ? 0.004   -11.097 -3.220  1.00 0.00 ? 12 SER B OG   7  
ATOM 8936  H H    . SER B 1 12 ? 2.491   -13.986 -4.168  1.00 0.00 ? 12 SER B H    7  
ATOM 8937  H HA   . SER B 1 12 ? 2.403   -11.148 -4.467  1.00 0.00 ? 12 SER B HA   7  
ATOM 8938  H HB2  . SER B 1 12 ? 0.380   -12.465 -4.684  1.00 0.00 ? 12 SER B HB2  7  
ATOM 8939  H HB3  . SER B 1 12 ? 0.545   -13.058 -3.031  1.00 0.00 ? 12 SER B HB3  7  
ATOM 8940  H HG   . SER B 1 12 ? -0.043  -11.119 -2.261  1.00 0.00 ? 12 SER B HG   7  
ATOM 8941  N N    . ALA B 1 13 ? 2.998   -12.377 -1.484  1.00 0.00 ? 13 ALA B N    7  
ATOM 8942  C CA   . ALA B 1 13 ? 3.457   -12.040 -0.140  1.00 0.00 ? 13 ALA B CA   7  
ATOM 8943  C C    . ALA B 1 13 ? 4.835   -11.387 -0.163  1.00 0.00 ? 13 ALA B C    7  
ATOM 8944  O O    . ALA B 1 13 ? 5.057   -10.371 0.498   1.00 0.00 ? 13 ALA B O    7  
ATOM 8945  C CB   . ALA B 1 13 ? 3.480   -13.285 0.735   1.00 0.00 ? 13 ALA B CB   7  
ATOM 8946  H H    . ALA B 1 13 ? 2.896   -13.328 -1.726  1.00 0.00 ? 13 ALA B H    7  
ATOM 8947  H HA   . ALA B 1 13 ? 2.750   -11.345 0.296   1.00 0.00 ? 13 ALA B HA   7  
ATOM 8948  H HB1  . ALA B 1 13 ? 3.756   -13.016 1.745   1.00 0.00 ? 13 ALA B HB1  7  
ATOM 8949  H HB2  . ALA B 1 13 ? 4.196   -13.994 0.342   1.00 0.00 ? 13 ALA B HB2  7  
ATOM 8950  H HB3  . ALA B 1 13 ? 2.498   -13.735 0.741   1.00 0.00 ? 13 ALA B HB3  7  
ATOM 8951  N N    . ILE B 1 14 ? 5.757   -11.966 -0.924  1.00 0.00 ? 14 ILE B N    7  
ATOM 8952  C CA   . ILE B 1 14 ? 7.112   -11.434 -1.010  1.00 0.00 ? 14 ILE B CA   7  
ATOM 8953  C C    . ILE B 1 14 ? 7.152   -10.121 -1.789  1.00 0.00 ? 14 ILE B C    7  
ATOM 8954  O O    . ILE B 1 14 ? 7.895   -9.206  -1.437  1.00 0.00 ? 14 ILE B O    7  
ATOM 8955  C CB   . ILE B 1 14 ? 8.080   -12.447 -1.661  1.00 0.00 ? 14 ILE B CB   7  
ATOM 8956  C CG1  . ILE B 1 14 ? 9.515   -11.915 -1.607  1.00 0.00 ? 14 ILE B CG1  7  
ATOM 8957  C CG2  . ILE B 1 14 ? 7.668   -12.737 -3.098  1.00 0.00 ? 14 ILE B CG2  7  
ATOM 8958  C CD1  . ILE B 1 14 ? 10.559  -12.946 -1.982  1.00 0.00 ? 14 ILE B CD1  7  
ATOM 8959  H H    . ILE B 1 14 ? 5.522   -12.778 -1.428  1.00 0.00 ? 14 ILE B H    7  
ATOM 8960  H HA   . ILE B 1 14 ? 7.460   -11.244 0.001   1.00 0.00 ? 14 ILE B HA   7  
ATOM 8961  H HB   . ILE B 1 14 ? 8.021   -13.370 -1.103  1.00 0.00 ? 14 ILE B HB   7  
ATOM 8962  H HG12 . ILE B 1 14 ? 9.624   -11.081 -2.286  1.00 0.00 ? 14 ILE B HG12 7  
ATOM 8963  H HG13 . ILE B 1 14 ? 9.737   -11.582 -0.601  1.00 0.00 ? 14 ILE B HG13 7  
ATOM 8964  H HG21 . ILE B 1 14 ? 6.622   -12.961 -3.150  1.00 0.00 ? 14 ILE B HG21 7  
ATOM 8965  H HG22 . ILE B 1 14 ? 8.226   -13.587 -3.458  1.00 0.00 ? 14 ILE B HG22 7  
ATOM 8966  H HG23 . ILE B 1 14 ? 7.884   -11.884 -3.728  1.00 0.00 ? 14 ILE B HG23 7  
ATOM 8967  H HD11 . ILE B 1 14 ? 11.543  -12.507 -1.903  1.00 0.00 ? 14 ILE B HD11 7  
ATOM 8968  H HD12 . ILE B 1 14 ? 10.392  -13.275 -2.997  1.00 0.00 ? 14 ILE B HD12 7  
ATOM 8969  H HD13 . ILE B 1 14 ? 10.487  -13.791 -1.314  1.00 0.00 ? 14 ILE B HD13 7  
ATOM 8970  N N    . LEU B 1 15 ? 6.347   -10.031 -2.844  1.00 0.00 ? 15 LEU B N    7  
ATOM 8971  C CA   . LEU B 1 15 ? 6.299   -8.825  -3.666  1.00 0.00 ? 15 LEU B CA   7  
ATOM 8972  C C    . LEU B 1 15 ? 5.692   -7.661  -2.891  1.00 0.00 ? 15 LEU B C    7  
ATOM 8973  O O    . LEU B 1 15 ? 6.140   -6.521  -3.013  1.00 0.00 ? 15 LEU B O    7  
ATOM 8974  C CB   . LEU B 1 15 ? 5.489   -9.080  -4.938  1.00 0.00 ? 15 LEU B CB   7  
ATOM 8975  C CG   . LEU B 1 15 ? 5.388   -7.888  -5.896  1.00 0.00 ? 15 LEU B CG   7  
ATOM 8976  C CD1  . LEU B 1 15 ? 6.754   -7.545  -6.474  1.00 0.00 ? 15 LEU B CD1  7  
ATOM 8977  C CD2  . LEU B 1 15 ? 4.395   -8.185  -7.010  1.00 0.00 ? 15 LEU B CD2  7  
ATOM 8978  H H    . LEU B 1 15 ? 5.766   -10.791 -3.082  1.00 0.00 ? 15 LEU B H    7  
ATOM 8979  H HA   . LEU B 1 15 ? 7.312   -8.566  -3.945  1.00 0.00 ? 15 LEU B HA   7  
ATOM 8980  H HB2  . LEU B 1 15 ? 5.940   -9.911  -5.465  1.00 0.00 ? 15 LEU B HB2  7  
ATOM 8981  H HB3  . LEU B 1 15 ? 4.488   -9.370  -4.643  1.00 0.00 ? 15 LEU B HB3  7  
ATOM 8982  H HG   . LEU B 1 15 ? 5.029   -7.022  -5.361  1.00 0.00 ? 15 LEU B HG   7  
ATOM 8983  H HD11 . LEU B 1 15 ? 7.429   -7.277  -5.675  1.00 0.00 ? 15 LEU B HD11 7  
ATOM 8984  H HD12 . LEU B 1 15 ? 6.661   -6.709  -7.154  1.00 0.00 ? 15 LEU B HD12 7  
ATOM 8985  H HD13 . LEU B 1 15 ? 7.149   -8.398  -7.008  1.00 0.00 ? 15 LEU B HD13 7  
ATOM 8986  H HD21 . LEU B 1 15 ? 4.732   -9.039  -7.582  1.00 0.00 ? 15 LEU B HD21 7  
ATOM 8987  H HD22 . LEU B 1 15 ? 4.314   -7.326  -7.662  1.00 0.00 ? 15 LEU B HD22 7  
ATOM 8988  H HD23 . LEU B 1 15 ? 3.425   -8.399  -6.583  1.00 0.00 ? 15 LEU B HD23 7  
ATOM 8989  N N    . ALA B 1 16 ? 4.673   -7.958  -2.094  1.00 0.00 ? 16 ALA B N    7  
ATOM 8990  C CA   . ALA B 1 16 ? 4.000   -6.936  -1.300  1.00 0.00 ? 16 ALA B CA   7  
ATOM 8991  C C    . ALA B 1 16 ? 4.943   -6.319  -0.273  1.00 0.00 ? 16 ALA B C    7  
ATOM 8992  O O    . ALA B 1 16 ? 4.865   -5.125  0.015   1.00 0.00 ? 16 ALA B O    7  
ATOM 8993  C CB   . ALA B 1 16 ? 2.776   -7.523  -0.618  1.00 0.00 ? 16 ALA B CB   7  
ATOM 8994  H H    . ALA B 1 16 ? 4.354   -8.890  -2.037  1.00 0.00 ? 16 ALA B H    7  
ATOM 8995  H HA   . ALA B 1 16 ? 3.656   -6.163  -1.972  1.00 0.00 ? 16 ALA B HA   7  
ATOM 8996  H HB1  . ALA B 1 16 ? 3.081   -8.292  0.078   1.00 0.00 ? 16 ALA B HB1  7  
ATOM 8997  H HB2  . ALA B 1 16 ? 2.124   -7.954  -1.363  1.00 0.00 ? 16 ALA B HB2  7  
ATOM 8998  H HB3  . ALA B 1 16 ? 2.247   -6.744  -0.086  1.00 0.00 ? 16 ALA B HB3  7  
ATOM 8999  N N    . LEU B 1 17 ? 5.830   -7.137  0.284   1.00 0.00 ? 17 LEU B N    7  
ATOM 9000  C CA   . LEU B 1 17 ? 6.793   -6.659  1.269   1.00 0.00 ? 17 LEU B CA   7  
ATOM 9001  C C    . LEU B 1 17 ? 7.856   -5.797  0.600   1.00 0.00 ? 17 LEU B C    7  
ATOM 9002  O O    . LEU B 1 17 ? 8.378   -4.857  1.199   1.00 0.00 ? 17 LEU B O    7  
ATOM 9003  C CB   . LEU B 1 17 ? 7.445   -7.835  2.001   1.00 0.00 ? 17 LEU B CB   7  
ATOM 9004  C CG   . LEU B 1 17 ? 6.796   -8.212  3.336   1.00 0.00 ? 17 LEU B CG   7  
ATOM 9005  C CD1  . LEU B 1 17 ? 5.315   -8.511  3.154   1.00 0.00 ? 17 LEU B CD1  7  
ATOM 9006  C CD2  . LEU B 1 17 ? 7.507   -9.406  3.952   1.00 0.00 ? 17 LEU B CD2  7  
ATOM 9007  H H    . LEU B 1 17 ? 5.847   -8.087  0.024   1.00 0.00 ? 17 LEU B H    7  
ATOM 9008  H HA   . LEU B 1 17 ? 6.263   -6.042  1.988   1.00 0.00 ? 17 LEU B HA   7  
ATOM 9009  H HB2  . LEU B 1 17 ? 7.423   -8.702  1.353   1.00 0.00 ? 17 LEU B HB2  7  
ATOM 9010  H HB3  . LEU B 1 17 ? 8.484   -7.593  2.200   1.00 0.00 ? 17 LEU B HB3  7  
ATOM 9011  H HG   . LEU B 1 17 ? 6.886   -7.380  4.019   1.00 0.00 ? 17 LEU B HG   7  
ATOM 9012  H HD11 . LEU B 1 17 ? 4.812   -7.658  2.723   1.00 0.00 ? 17 LEU B HD11 7  
ATOM 9013  H HD12 . LEU B 1 17 ? 4.873   -8.727  4.117   1.00 0.00 ? 17 LEU B HD12 7  
ATOM 9014  H HD13 . LEU B 1 17 ? 5.193   -9.362  2.513   1.00 0.00 ? 17 LEU B HD13 7  
ATOM 9015  H HD21 . LEU B 1 17 ? 7.425   -10.260 3.294   1.00 0.00 ? 17 LEU B HD21 7  
ATOM 9016  H HD22 . LEU B 1 17 ? 7.057   -9.644  4.906   1.00 0.00 ? 17 LEU B HD22 7  
ATOM 9017  H HD23 . LEU B 1 17 ? 8.551   -9.168  4.102   1.00 0.00 ? 17 LEU B HD23 7  
ATOM 9018  N N    . VAL B 1 18 ? 8.170   -6.126  -0.648  1.00 0.00 ? 18 VAL B N    7  
ATOM 9019  C CA   . VAL B 1 18 ? 9.163   -5.377  -1.407  1.00 0.00 ? 18 VAL B CA   7  
ATOM 9020  C C    . VAL B 1 18 ? 8.643   -3.985  -1.748  1.00 0.00 ? 18 VAL B C    7  
ATOM 9021  O O    . VAL B 1 18 ? 9.368   -2.997  -1.636  1.00 0.00 ? 18 VAL B O    7  
ATOM 9022  C CB   . VAL B 1 18 ? 9.546   -6.112  -2.709  1.00 0.00 ? 18 VAL B CB   7  
ATOM 9023  C CG1  . VAL B 1 18 ? 10.409  -5.227  -3.598  1.00 0.00 ? 18 VAL B CG1  7  
ATOM 9024  C CG2  . VAL B 1 18 ? 10.267  -7.413  -2.393  1.00 0.00 ? 18 VAL B CG2  7  
ATOM 9025  H H    . VAL B 1 18 ? 7.725   -6.890  -1.082  1.00 0.00 ? 18 VAL B H    7  
ATOM 9026  H HA   . VAL B 1 18 ? 10.055  -5.272  -0.798  1.00 0.00 ? 18 VAL B HA   7  
ATOM 9027  H HB   . VAL B 1 18 ? 8.639   -6.349  -3.246  1.00 0.00 ? 18 VAL B HB   7  
ATOM 9028  H HG11 . VAL B 1 18 ? 10.862  -5.823  -4.381  1.00 0.00 ? 18 VAL B HG11 7  
ATOM 9029  H HG12 . VAL B 1 18 ? 11.190  -4.761  -3.012  1.00 0.00 ? 18 VAL B HG12 7  
ATOM 9030  H HG13 . VAL B 1 18 ? 9.798   -4.462  -4.055  1.00 0.00 ? 18 VAL B HG13 7  
ATOM 9031  H HG21 . VAL B 1 18 ? 9.768   -7.931  -1.593  1.00 0.00 ? 18 VAL B HG21 7  
ATOM 9032  H HG22 . VAL B 1 18 ? 11.286  -7.206  -2.093  1.00 0.00 ? 18 VAL B HG22 7  
ATOM 9033  H HG23 . VAL B 1 18 ? 10.275  -8.039  -3.273  1.00 0.00 ? 18 VAL B HG23 7  
ATOM 9034  N N    . VAL B 1 19 ? 7.380   -3.914  -2.161  1.00 0.00 ? 19 VAL B N    7  
ATOM 9035  C CA   . VAL B 1 19 ? 6.767   -2.639  -2.517  1.00 0.00 ? 19 VAL B CA   7  
ATOM 9036  C C    . VAL B 1 19 ? 6.467   -1.801  -1.278  1.00 0.00 ? 19 VAL B C    7  
ATOM 9037  O O    . VAL B 1 19 ? 6.520   -0.577  -1.330  1.00 0.00 ? 19 VAL B O    7  
ATOM 9038  C CB   . VAL B 1 19 ? 5.464   -2.834  -3.322  1.00 0.00 ? 19 VAL B CB   7  
ATOM 9039  C CG1  . VAL B 1 19 ? 5.737   -3.612  -4.599  1.00 0.00 ? 19 VAL B CG1  7  
ATOM 9040  C CG2  . VAL B 1 19 ? 4.405   -3.530  -2.481  1.00 0.00 ? 19 VAL B CG2  7  
ATOM 9041  H H    . VAL B 1 19 ? 6.848   -4.739  -2.233  1.00 0.00 ? 19 VAL B H    7  
ATOM 9042  H HA   . VAL B 1 19 ? 7.464   -2.088  -3.140  1.00 0.00 ? 19 VAL B HA   7  
ATOM 9043  H HB   . VAL B 1 19 ? 5.085   -1.860  -3.603  1.00 0.00 ? 19 VAL B HB   7  
ATOM 9044  H HG11 . VAL B 1 19 ? 4.815   -3.747  -5.148  1.00 0.00 ? 19 VAL B HG11 7  
ATOM 9045  H HG12 . VAL B 1 19 ? 6.155   -4.574  -4.360  1.00 0.00 ? 19 VAL B HG12 7  
ATOM 9046  H HG13 . VAL B 1 19 ? 6.437   -3.062  -5.212  1.00 0.00 ? 19 VAL B HG13 7  
ATOM 9047  H HG21 . VAL B 1 19 ? 4.154   -2.937  -1.617  1.00 0.00 ? 19 VAL B HG21 7  
ATOM 9048  H HG22 . VAL B 1 19 ? 4.776   -4.476  -2.176  1.00 0.00 ? 19 VAL B HG22 7  
ATOM 9049  H HG23 . VAL B 1 19 ? 3.513   -3.676  -3.076  1.00 0.00 ? 19 VAL B HG23 7  
ATOM 9050  N N    . LEU B 1 20 ? 6.160   -2.465  -0.165  1.00 0.00 ? 20 LEU B N    7  
ATOM 9051  C CA   . LEU B 1 20 ? 5.855   -1.762  1.078   1.00 0.00 ? 20 LEU B CA   7  
ATOM 9052  C C    . LEU B 1 20 ? 7.020   -0.865  1.483   1.00 0.00 ? 20 LEU B C    7  
ATOM 9053  O O    . LEU B 1 20 ? 6.821   0.269   1.917   1.00 0.00 ? 20 LEU B O    7  
ATOM 9054  C CB   . LEU B 1 20 ? 5.539   -2.754  2.202   1.00 0.00 ? 20 LEU B CB   7  
ATOM 9055  C CG   . LEU B 1 20 ? 5.193   -2.118  3.553   1.00 0.00 ? 20 LEU B CG   7  
ATOM 9056  C CD1  . LEU B 1 20 ? 3.893   -1.329  3.463   1.00 0.00 ? 20 LEU B CD1  7  
ATOM 9057  C CD2  . LEU B 1 20 ? 5.098   -3.186  4.632   1.00 0.00 ? 20 LEU B CD2  7  
ATOM 9058  H H    . LEU B 1 20 ? 6.131   -3.450  -0.173  1.00 0.00 ? 20 LEU B H    7  
ATOM 9059  H HA   . LEU B 1 20 ? 4.986   -1.143  0.904   1.00 0.00 ? 20 LEU B HA   7  
ATOM 9060  H HB2  . LEU B 1 20 ? 4.707   -3.370  1.886   1.00 0.00 ? 20 LEU B HB2  7  
ATOM 9061  H HB3  . LEU B 1 20 ? 6.403   -3.393  2.334   1.00 0.00 ? 20 LEU B HB3  7  
ATOM 9062  H HG   . LEU B 1 20 ? 5.975   -1.432  3.841   1.00 0.00 ? 20 LEU B HG   7  
ATOM 9063  H HD11 . LEU B 1 20 ? 3.663   -0.896  4.428   1.00 0.00 ? 20 LEU B HD11 7  
ATOM 9064  H HD12 . LEU B 1 20 ? 3.088   -1.985  3.164   1.00 0.00 ? 20 LEU B HD12 7  
ATOM 9065  H HD13 . LEU B 1 20 ? 3.999   -0.537  2.736   1.00 0.00 ? 20 LEU B HD13 7  
ATOM 9066  H HD21 . LEU B 1 20 ? 4.882   -2.722  5.584   1.00 0.00 ? 20 LEU B HD21 7  
ATOM 9067  H HD22 . LEU B 1 20 ? 6.038   -3.716  4.701   1.00 0.00 ? 20 LEU B HD22 7  
ATOM 9068  H HD23 . LEU B 1 20 ? 4.310   -3.885  4.386   1.00 0.00 ? 20 LEU B HD23 7  
ATOM 9069  N N    . THR B 1 21 ? 8.236   -1.383  1.341   1.00 0.00 ? 21 THR B N    7  
ATOM 9070  C CA   . THR B 1 21 ? 9.430   -0.622  1.679   1.00 0.00 ? 21 THR B CA   7  
ATOM 9071  C C    . THR B 1 21 ? 9.614   0.533   0.702   1.00 0.00 ? 21 THR B C    7  
ATOM 9072  O O    . THR B 1 21 ? 10.150  1.584   1.056   1.00 0.00 ? 21 THR B O    7  
ATOM 9073  C CB   . THR B 1 21 ? 10.693  -1.507  1.665   1.00 0.00 ? 21 THR B CB   7  
ATOM 9074  O OG1  . THR B 1 21 ? 10.524  -2.617  2.556   1.00 0.00 ? 21 THR B OG1  7  
ATOM 9075  C CG2  . THR B 1 21 ? 11.924  -0.710  2.075   1.00 0.00 ? 21 THR B CG2  7  
ATOM 9076  H H    . THR B 1 21 ? 8.339   -2.300  0.993   1.00 0.00 ? 21 THR B H    7  
ATOM 9077  H HA   . THR B 1 21 ? 9.307   -0.220  2.679   1.00 0.00 ? 21 THR B HA   7  
ATOM 9078  H HB   . THR B 1 21 ? 10.845  -1.884  0.662   1.00 0.00 ? 21 THR B HB   7  
ATOM 9079  H HG1  . THR B 1 21 ? 10.002  -3.299  2.126   1.00 0.00 ? 21 THR B HG1  7  
ATOM 9080  H HG21 . THR B 1 21 ? 12.203  -0.034  1.280   1.00 0.00 ? 21 THR B HG21 7  
ATOM 9081  H HG22 . THR B 1 21 ? 12.741  -1.391  2.264   1.00 0.00 ? 21 THR B HG22 7  
ATOM 9082  H HG23 . THR B 1 21 ? 11.717  -0.145  2.974   1.00 0.00 ? 21 THR B HG23 7  
ATOM 9083  N N    . ILE B 1 22 ? 9.156   0.332   -0.531  1.00 0.00 ? 22 ILE B N    7  
ATOM 9084  C CA   . ILE B 1 22 ? 9.263   1.353   -1.564  1.00 0.00 ? 22 ILE B CA   7  
ATOM 9085  C C    . ILE B 1 22 ? 8.264   2.480   -1.316  1.00 0.00 ? 22 ILE B C    7  
ATOM 9086  O O    . ILE B 1 22 ? 8.581   3.652   -1.508  1.00 0.00 ? 22 ILE B O    7  
ATOM 9087  C CB   . ILE B 1 22 ? 9.027   0.762   -2.970  1.00 0.00 ? 22 ILE B CB   7  
ATOM 9088  C CG1  . ILE B 1 22 ? 10.087  -0.298  -3.276  1.00 0.00 ? 22 ILE B CG1  7  
ATOM 9089  C CG2  . ILE B 1 22 ? 9.046   1.863   -4.024  1.00 0.00 ? 22 ILE B CG2  7  
ATOM 9090  C CD1  . ILE B 1 22 ? 9.876   -1.010  -4.597  1.00 0.00 ? 22 ILE B CD1  7  
ATOM 9091  H H    . ILE B 1 22 ? 8.740   -0.523  -0.763  1.00 0.00 ? 22 ILE B H    7  
ATOM 9092  H HA   . ILE B 1 22 ? 10.265  1.769   -1.535  1.00 0.00 ? 22 ILE B HA   7  
ATOM 9093  H HB   . ILE B 1 22 ? 8.053   0.301   -2.988  1.00 0.00 ? 22 ILE B HB   7  
ATOM 9094  H HG12 . ILE B 1 22 ? 11.060  0.172   -3.310  1.00 0.00 ? 22 ILE B HG12 7  
ATOM 9095  H HG13 . ILE B 1 22 ? 10.088  -1.039  -2.500  1.00 0.00 ? 22 ILE B HG13 7  
ATOM 9096  H HG21 . ILE B 1 22 ? 8.237   2.554   -3.854  1.00 0.00 ? 22 ILE B HG21 7  
ATOM 9097  H HG22 . ILE B 1 22 ? 8.927   1.436   -5.009  1.00 0.00 ? 22 ILE B HG22 7  
ATOM 9098  H HG23 . ILE B 1 22 ? 9.986   2.394   -3.978  1.00 0.00 ? 22 ILE B HG23 7  
ATOM 9099  H HD11 . ILE B 1 22 ? 10.119  -0.342  -5.410  1.00 0.00 ? 22 ILE B HD11 7  
ATOM 9100  H HD12 . ILE B 1 22 ? 8.845   -1.325  -4.685  1.00 0.00 ? 22 ILE B HD12 7  
ATOM 9101  H HD13 . ILE B 1 22 ? 10.519  -1.876  -4.642  1.00 0.00 ? 22 ILE B HD13 7  
ATOM 9102  N N    . ILE B 1 23 ? 7.060   2.118   -0.885  1.00 0.00 ? 23 ILE B N    7  
ATOM 9103  C CA   . ILE B 1 23 ? 6.027   3.106   -0.608  1.00 0.00 ? 23 ILE B CA   7  
ATOM 9104  C C    . ILE B 1 23 ? 6.478   4.051   0.502   1.00 0.00 ? 23 ILE B C    7  
ATOM 9105  O O    . ILE B 1 23 ? 6.234   5.255   0.443   1.00 0.00 ? 23 ILE B O    7  
ATOM 9106  C CB   . ILE B 1 23 ? 4.692   2.447   -0.206  1.00 0.00 ? 23 ILE B CB   7  
ATOM 9107  C CG1  . ILE B 1 23 ? 4.189   1.526   -1.324  1.00 0.00 ? 23 ILE B CG1  7  
ATOM 9108  C CG2  . ILE B 1 23 ? 3.652   3.513   0.111   1.00 0.00 ? 23 ILE B CG2  7  
ATOM 9109  C CD1  . ILE B 1 23 ? 3.906   2.241   -2.629  1.00 0.00 ? 23 ILE B CD1  7  
ATOM 9110  H H    . ILE B 1 23 ? 6.860   1.164   -0.744  1.00 0.00 ? 23 ILE B H    7  
ATOM 9111  H HA   . ILE B 1 23 ? 5.870   3.692   -1.504  1.00 0.00 ? 23 ILE B HA   7  
ATOM 9112  H HB   . ILE B 1 23 ? 4.855   1.860   0.687   1.00 0.00 ? 23 ILE B HB   7  
ATOM 9113  H HG12 . ILE B 1 23 ? 4.914   0.772   -1.523  1.00 0.00 ? 23 ILE B HG12 7  
ATOM 9114  H HG13 . ILE B 1 23 ? 3.271   1.052   -1.005  1.00 0.00 ? 23 ILE B HG13 7  
ATOM 9115  H HG21 . ILE B 1 23 ? 2.675   3.055   0.203   1.00 0.00 ? 23 ILE B HG21 7  
ATOM 9116  H HG22 . ILE B 1 23 ? 3.624   4.251   -0.679  1.00 0.00 ? 23 ILE B HG22 7  
ATOM 9117  H HG23 . ILE B 1 23 ? 3.898   3.997   1.045   1.00 0.00 ? 23 ILE B HG23 7  
ATOM 9118  H HD11 . ILE B 1 23 ? 3.200   3.041   -2.470  1.00 0.00 ? 23 ILE B HD11 7  
ATOM 9119  H HD12 . ILE B 1 23 ? 3.489   1.537   -3.334  1.00 0.00 ? 23 ILE B HD12 7  
ATOM 9120  H HD13 . ILE B 1 23 ? 4.822   2.642   -3.032  1.00 0.00 ? 23 ILE B HD13 7  
ATOM 9121  N N    . SER B 1 24 ? 7.145   3.492   1.510   1.00 0.00 ? 24 SER B N    7  
ATOM 9122  C CA   . SER B 1 24 ? 7.640   4.274   2.637   1.00 0.00 ? 24 SER B CA   7  
ATOM 9123  C C    . SER B 1 24 ? 8.842   5.121   2.228   1.00 0.00 ? 24 SER B C    7  
ATOM 9124  O O    . SER B 1 24 ? 8.988   6.262   2.670   1.00 0.00 ? 24 SER B O    7  
ATOM 9125  C CB   . SER B 1 24 ? 8.022   3.352   3.797   1.00 0.00 ? 24 SER B CB   7  
ATOM 9126  O OG   . SER B 1 24 ? 9.060   2.463   3.420   1.00 0.00 ? 24 SER B OG   7  
ATOM 9127  H H    . SER B 1 24 ? 7.314   2.520   1.501   1.00 0.00 ? 24 SER B H    7  
ATOM 9128  H HA   . SER B 1 24 ? 6.849   4.933   2.967   1.00 0.00 ? 24 SER B HA   7  
ATOM 9129  H HB2  . SER B 1 24 ? 8.357   3.944   4.637   1.00 0.00 ? 24 SER B HB2  7  
ATOM 9130  H HB3  . SER B 1 24 ? 7.159   2.772   4.089   1.00 0.00 ? 24 SER B HB3  7  
ATOM 9131  H HG   . SER B 1 24 ? 9.388   2.005   4.197   1.00 0.00 ? 24 SER B HG   7  
ATOM 9132  N N    . LEU B 1 25 ? 9.700   4.555   1.384   1.00 0.00 ? 25 LEU B N    7  
ATOM 9133  C CA   . LEU B 1 25 ? 10.890  5.261   0.916   1.00 0.00 ? 25 LEU B CA   7  
ATOM 9134  C C    . LEU B 1 25 ? 10.512  6.535   0.172   1.00 0.00 ? 25 LEU B C    7  
ATOM 9135  O O    . LEU B 1 25 ? 11.163  7.569   0.321   1.00 0.00 ? 25 LEU B O    7  
ATOM 9136  C CB   . LEU B 1 25 ? 11.727  4.354   0.012   1.00 0.00 ? 25 LEU B CB   7  
ATOM 9137  C CG   . LEU B 1 25 ? 12.611  3.344   0.746   1.00 0.00 ? 25 LEU B CG   7  
ATOM 9138  C CD1  . LEU B 1 25 ? 13.140  2.297   -0.224  1.00 0.00 ? 25 LEU B CD1  7  
ATOM 9139  C CD2  . LEU B 1 25 ? 13.762  4.054   1.444   1.00 0.00 ? 25 LEU B CD2  7  
ATOM 9140  H H    . LEU B 1 25 ? 9.537   3.636   1.065   1.00 0.00 ? 25 LEU B H    7  
ATOM 9141  H HA   . LEU B 1 25 ? 11.472  5.539   1.782   1.00 0.00 ? 25 LEU B HA   7  
ATOM 9142  H HB2  . LEU B 1 25 ? 11.045  3.812   -0.633  1.00 0.00 ? 25 LEU B HB2  7  
ATOM 9143  H HB3  . LEU B 1 25 ? 12.366  4.967   -0.616  1.00 0.00 ? 25 LEU B HB3  7  
ATOM 9144  H HG   . LEU B 1 25 ? 12.032  2.839   1.501   1.00 0.00 ? 25 LEU B HG   7  
ATOM 9145  H HD11 . LEU B 1 25 ? 13.741  2.775   -0.986  1.00 0.00 ? 25 LEU B HD11 7  
ATOM 9146  H HD12 . LEU B 1 25 ? 12.311  1.784   -0.691  1.00 0.00 ? 25 LEU B HD12 7  
ATOM 9147  H HD13 . LEU B 1 25 ? 13.745  1.579   0.312   1.00 0.00 ? 25 LEU B HD13 7  
ATOM 9148  H HD21 . LEU B 1 25 ? 13.375  4.747   2.175   1.00 0.00 ? 25 LEU B HD21 7  
ATOM 9149  H HD22 . LEU B 1 25 ? 14.354  4.593   0.717   1.00 0.00 ? 25 LEU B HD22 7  
ATOM 9150  H HD23 . LEU B 1 25 ? 14.387  3.326   1.944   1.00 0.00 ? 25 LEU B HD23 7  
ATOM 9151  N N    . ILE B 1 26 ? 9.457   6.453   -0.634  1.00 0.00 ? 26 ILE B N    7  
ATOM 9152  C CA   . ILE B 1 26 ? 8.990   7.602   -1.400  1.00 0.00 ? 26 ILE B CA   7  
ATOM 9153  C C    . ILE B 1 26 ? 8.582   8.744   -0.473  1.00 0.00 ? 26 ILE B C    7  
ATOM 9154  O O    . ILE B 1 26 ? 8.851   9.912   -0.758  1.00 0.00 ? 26 ILE B O    7  
ATOM 9155  C CB   . ILE B 1 26 ? 7.803   7.226   -2.310  1.00 0.00 ? 26 ILE B CB   7  
ATOM 9156  C CG1  . ILE B 1 26 ? 8.227   6.147   -3.310  1.00 0.00 ? 26 ILE B CG1  7  
ATOM 9157  C CG2  . ILE B 1 26 ? 7.279   8.456   -3.039  1.00 0.00 ? 26 ILE B CG2  7  
ATOM 9158  C CD1  . ILE B 1 26 ? 7.075   5.553   -4.094  1.00 0.00 ? 26 ILE B CD1  7  
ATOM 9159  H H    . ILE B 1 26 ? 8.975   5.598   -0.715  1.00 0.00 ? 26 ILE B H    7  
ATOM 9160  H HA   . ILE B 1 26 ? 9.806   7.943   -2.028  1.00 0.00 ? 26 ILE B HA   7  
ATOM 9161  H HB   . ILE B 1 26 ? 7.008   6.840   -1.687  1.00 0.00 ? 26 ILE B HB   7  
ATOM 9162  H HG12 . ILE B 1 26 ? 8.916   6.577   -4.024  1.00 0.00 ? 26 ILE B HG12 7  
ATOM 9163  H HG13 . ILE B 1 26 ? 8.722   5.347   -2.804  1.00 0.00 ? 26 ILE B HG13 7  
ATOM 9164  H HG21 . ILE B 1 26 ? 6.858   9.154   -2.333  1.00 0.00 ? 26 ILE B HG21 7  
ATOM 9165  H HG22 . ILE B 1 26 ? 6.507   8.170   -3.739  1.00 0.00 ? 26 ILE B HG22 7  
ATOM 9166  H HG23 . ILE B 1 26 ? 8.086   8.934   -3.577  1.00 0.00 ? 26 ILE B HG23 7  
ATOM 9167  H HD11 . ILE B 1 26 ? 6.284   5.260   -3.417  1.00 0.00 ? 26 ILE B HD11 7  
ATOM 9168  H HD12 . ILE B 1 26 ? 7.422   4.685   -4.636  1.00 0.00 ? 26 ILE B HD12 7  
ATOM 9169  H HD13 . ILE B 1 26 ? 6.698   6.284   -4.793  1.00 0.00 ? 26 ILE B HD13 7  
ATOM 9170  N N    . ILE B 1 27 ? 7.935   8.400   0.636   1.00 0.00 ? 27 ILE B N    7  
ATOM 9171  C CA   . ILE B 1 27 ? 7.496   9.398   1.608   1.00 0.00 ? 27 ILE B CA   7  
ATOM 9172  C C    . ILE B 1 27 ? 8.689   10.078  2.265   1.00 0.00 ? 27 ILE B C    7  
ATOM 9173  O O    . ILE B 1 27 ? 8.676   11.286  2.505   1.00 0.00 ? 27 ILE B O    7  
ATOM 9174  C CB   . ILE B 1 27 ? 6.623   8.770   2.712   1.00 0.00 ? 27 ILE B CB   7  
ATOM 9175  C CG1  . ILE B 1 27 ? 5.559   7.858   2.101   1.00 0.00 ? 27 ILE B CG1  7  
ATOM 9176  C CG2  . ILE B 1 27 ? 5.974   9.858   3.554   1.00 0.00 ? 27 ILE B CG2  7  
ATOM 9177  C CD1  . ILE B 1 27 ? 4.850   6.993   3.121   1.00 0.00 ? 27 ILE B CD1  7  
ATOM 9178  H H    . ILE B 1 27 ? 7.767   7.449   0.811   1.00 0.00 ? 27 ILE B H    7  
ATOM 9179  H HA   . ILE B 1 27 ? 6.907   10.144  1.084   1.00 0.00 ? 27 ILE B HA   7  
ATOM 9180  H HB   . ILE B 1 27 ? 7.260   8.180   3.361   1.00 0.00 ? 27 ILE B HB   7  
ATOM 9181  H HG12 . ILE B 1 27 ? 4.810   8.458   1.605   1.00 0.00 ? 27 ILE B HG12 7  
ATOM 9182  H HG13 . ILE B 1 27 ? 5.997   7.202   1.387   1.00 0.00 ? 27 ILE B HG13 7  
ATOM 9183  H HG21 . ILE B 1 27 ? 5.352   9.408   4.316   1.00 0.00 ? 27 ILE B HG21 7  
ATOM 9184  H HG22 . ILE B 1 27 ? 5.364   10.491  2.925   1.00 0.00 ? 27 ILE B HG22 7  
ATOM 9185  H HG23 . ILE B 1 27 ? 6.735   10.457  4.032   1.00 0.00 ? 27 ILE B HG23 7  
ATOM 9186  H HD11 . ILE B 1 27 ? 4.198   7.609   3.723   1.00 0.00 ? 27 ILE B HD11 7  
ATOM 9187  H HD12 . ILE B 1 27 ? 5.575   6.507   3.759   1.00 0.00 ? 27 ILE B HD12 7  
ATOM 9188  H HD13 . ILE B 1 27 ? 4.263   6.244   2.610   1.00 0.00 ? 27 ILE B HD13 7  
ATOM 9189  N N    . LEU B 1 28 ? 9.717   9.289   2.558   1.00 0.00 ? 28 LEU B N    7  
ATOM 9190  C CA   . LEU B 1 28 ? 10.925  9.799   3.198   1.00 0.00 ? 28 LEU B CA   7  
ATOM 9191  C C    . LEU B 1 28 ? 11.580  10.886  2.353   1.00 0.00 ? 28 LEU B C    7  
ATOM 9192  O O    . LEU B 1 28 ? 11.765  12.013  2.811   1.00 0.00 ? 28 LEU B O    7  
ATOM 9193  C CB   . LEU B 1 28 ? 11.917  8.657   3.438   1.00 0.00 ? 28 LEU B CB   7  
ATOM 9194  C CG   . LEU B 1 28 ? 13.172  9.037   4.226   1.00 0.00 ? 28 LEU B CG   7  
ATOM 9195  C CD1  . LEU B 1 28 ? 12.810  9.449   5.646   1.00 0.00 ? 28 LEU B CD1  7  
ATOM 9196  C CD2  . LEU B 1 28 ? 14.160  7.880   4.239   1.00 0.00 ? 28 LEU B CD2  7  
ATOM 9197  H H    . LEU B 1 28 ? 9.665   8.326   2.349   1.00 0.00 ? 28 LEU B H    7  
ATOM 9198  H HA   . LEU B 1 28 ? 10.640  10.223  4.149   1.00 0.00 ? 28 LEU B HA   7  
ATOM 9199  H HB2  . LEU B 1 28 ? 11.400  7.870   3.972   1.00 0.00 ? 28 LEU B HB2  7  
ATOM 9200  H HB3  . LEU B 1 28 ? 12.221  8.266   2.475   1.00 0.00 ? 28 LEU B HB3  7  
ATOM 9201  H HG   . LEU B 1 28 ? 13.654  9.878   3.750   1.00 0.00 ? 28 LEU B HG   7  
ATOM 9202  H HD11 . LEU B 1 28 ? 13.711  9.686   6.196   1.00 0.00 ? 28 LEU B HD11 7  
ATOM 9203  H HD12 . LEU B 1 28 ? 12.293  8.639   6.141   1.00 0.00 ? 28 LEU B HD12 7  
ATOM 9204  H HD13 . LEU B 1 28 ? 12.173  10.320  5.621   1.00 0.00 ? 28 LEU B HD13 7  
ATOM 9205  H HD21 . LEU B 1 28 ? 13.713  7.023   4.724   1.00 0.00 ? 28 LEU B HD21 7  
ATOM 9206  H HD22 . LEU B 1 28 ? 15.052  8.171   4.776   1.00 0.00 ? 28 LEU B HD22 7  
ATOM 9207  H HD23 . LEU B 1 28 ? 14.426  7.619   3.224   1.00 0.00 ? 28 LEU B HD23 7  
ATOM 9208  N N    . ILE B 1 29 ? 11.931  10.538  1.117   1.00 0.00 ? 29 ILE B N    7  
ATOM 9209  C CA   . ILE B 1 29 ? 12.571  11.482  0.208   1.00 0.00 ? 29 ILE B CA   7  
ATOM 9210  C C    . ILE B 1 29 ? 11.676  12.687  -0.062  1.00 0.00 ? 29 ILE B C    7  
ATOM 9211  O O    . ILE B 1 29 ? 12.157  13.817  -0.168  1.00 0.00 ? 29 ILE B O    7  
ATOM 9212  C CB   . ILE B 1 29 ? 12.924  10.816  -1.137  1.00 0.00 ? 29 ILE B CB   7  
ATOM 9213  C CG1  . ILE B 1 29 ? 13.597  9.457   -0.907  1.00 0.00 ? 29 ILE B CG1  7  
ATOM 9214  C CG2  . ILE B 1 29 ? 13.823  11.730  -1.960  1.00 0.00 ? 29 ILE B CG2  7  
ATOM 9215  C CD1  . ILE B 1 29 ? 14.900  9.538   -0.137  1.00 0.00 ? 29 ILE B CD1  7  
ATOM 9216  H H    . ILE B 1 29 ? 11.736  9.625   0.819   1.00 0.00 ? 29 ILE B H    7  
ATOM 9217  H HA   . ILE B 1 29 ? 13.488  11.822  0.674   1.00 0.00 ? 29 ILE B HA   7  
ATOM 9218  H HB   . ILE B 1 29 ? 12.010  10.657  -1.696  1.00 0.00 ? 29 ILE B HB   7  
ATOM 9219  H HG12 . ILE B 1 29 ? 12.944  8.802   -0.378  1.00 0.00 ? 29 ILE B HG12 7  
ATOM 9220  H HG13 . ILE B 1 29 ? 13.820  9.014   -1.868  1.00 0.00 ? 29 ILE B HG13 7  
ATOM 9221  H HG21 . ILE B 1 29 ? 13.280  12.617  -2.227  1.00 0.00 ? 29 ILE B HG21 7  
ATOM 9222  H HG22 . ILE B 1 29 ? 14.133  11.221  -2.863  1.00 0.00 ? 29 ILE B HG22 7  
ATOM 9223  H HG23 . ILE B 1 29 ? 14.697  12.003  -1.385  1.00 0.00 ? 29 ILE B HG23 7  
ATOM 9224  H HD11 . ILE B 1 29 ? 15.616  10.127  -0.690  1.00 0.00 ? 29 ILE B HD11 7  
ATOM 9225  H HD12 . ILE B 1 29 ? 15.293  8.542   0.002   1.00 0.00 ? 29 ILE B HD12 7  
ATOM 9226  H HD13 . ILE B 1 29 ? 14.729  9.990   0.828   1.00 0.00 ? 29 ILE B HD13 7  
ATOM 9227  N N    . MET B 1 30 ? 10.374  12.439  -0.171  1.00 0.00 ? 30 MET B N    7  
ATOM 9228  C CA   . MET B 1 30 ? 9.409   13.504  -0.431  1.00 0.00 ? 30 MET B CA   7  
ATOM 9229  C C    . MET B 1 30 ? 9.479   14.581  0.646   1.00 0.00 ? 30 MET B C    7  
ATOM 9230  O O    . MET B 1 30 ? 9.594   15.769  0.344   1.00 0.00 ? 30 MET B O    7  
ATOM 9231  C CB   . MET B 1 30 ? 7.991   12.930  -0.496  1.00 0.00 ? 30 MET B CB   7  
ATOM 9232  C CG   . MET B 1 30 ? 6.949   13.940  -0.947  1.00 0.00 ? 30 MET B CG   7  
ATOM 9233  S SD   . MET B 1 30 ? 5.258   13.357  -0.705  1.00 0.00 ? 30 MET B SD   7  
ATOM 9234  C CE   . MET B 1 30 ? 5.296   11.805  -1.602  1.00 0.00 ? 30 MET B CE   7  
ATOM 9235  H H    . MET B 1 30 ? 10.046  11.513  -0.081  1.00 0.00 ? 30 MET B H    7  
ATOM 9236  H HA   . MET B 1 30 ? 9.652   13.949  -1.386  1.00 0.00 ? 30 MET B HA   7  
ATOM 9237  H HB2  . MET B 1 30 ? 7.988   12.113  -1.200  1.00 0.00 ? 30 MET B HB2  7  
ATOM 9238  H HB3  . MET B 1 30 ? 7.718   12.554  0.483   1.00 0.00 ? 30 MET B HB3  7  
ATOM 9239  H HG2  . MET B 1 30 ? 7.068   14.858  -0.390  1.00 0.00 ? 30 MET B HG2  7  
ATOM 9240  H HG3  . MET B 1 30 ? 7.095   14.139  -1.998  1.00 0.00 ? 30 MET B HG3  7  
ATOM 9241  H HE1  . MET B 1 30 ? 4.296   11.403  -1.668  1.00 0.00 ? 30 MET B HE1  7  
ATOM 9242  H HE2  . MET B 1 30 ? 5.933   11.104  -1.082  1.00 0.00 ? 30 MET B HE2  7  
ATOM 9243  H HE3  . MET B 1 30 ? 5.682   11.973  -2.596  1.00 0.00 ? 30 MET B HE3  7  
ATOM 9244  N N    . LEU B 1 31 ? 9.410   14.156  1.904   1.00 0.00 ? 31 LEU B N    7  
ATOM 9245  C CA   . LEU B 1 31 ? 9.460   15.080  3.031   1.00 0.00 ? 31 LEU B CA   7  
ATOM 9246  C C    . LEU B 1 31 ? 10.879  15.592  3.258   1.00 0.00 ? 31 LEU B C    7  
ATOM 9247  O O    . LEU B 1 31 ? 11.079  16.659  3.838   1.00 0.00 ? 31 LEU B O    7  
ATOM 9248  C CB   . LEU B 1 31 ? 8.943   14.395  4.300   1.00 0.00 ? 31 LEU B CB   7  
ATOM 9249  C CG   . LEU B 1 31 ? 8.798   15.309  5.519   1.00 0.00 ? 31 LEU B CG   7  
ATOM 9250  C CD1  . LEU B 1 31 ? 7.690   16.327  5.296   1.00 0.00 ? 31 LEU B CD1  7  
ATOM 9251  C CD2  . LEU B 1 31 ? 8.525   14.487  6.768   1.00 0.00 ? 31 LEU B CD2  7  
ATOM 9252  H H    . LEU B 1 31 ? 9.322   13.189  2.082   1.00 0.00 ? 31 LEU B H    7  
ATOM 9253  H HA   . LEU B 1 31 ? 8.821   15.922  2.806   1.00 0.00 ? 31 LEU B HA   7  
ATOM 9254  H HB2  . LEU B 1 31 ? 7.977   13.958  4.078   1.00 0.00 ? 31 LEU B HB2  7  
ATOM 9255  H HB3  . LEU B 1 31 ? 9.627   13.592  4.550   1.00 0.00 ? 31 LEU B HB3  7  
ATOM 9256  H HG   . LEU B 1 31 ? 9.717   15.850  5.678   1.00 0.00 ? 31 LEU B HG   7  
ATOM 9257  H HD11 . LEU B 1 31 ? 7.588   16.951  6.174   1.00 0.00 ? 31 LEU B HD11 7  
ATOM 9258  H HD12 . LEU B 1 31 ? 6.755   15.816  5.111   1.00 0.00 ? 31 LEU B HD12 7  
ATOM 9259  H HD13 . LEU B 1 31 ? 7.933   16.949  4.447   1.00 0.00 ? 31 LEU B HD13 7  
ATOM 9260  H HD21 . LEU B 1 31 ? 9.335   13.787  6.926   1.00 0.00 ? 31 LEU B HD21 7  
ATOM 9261  H HD22 . LEU B 1 31 ? 7.598   13.942  6.652   1.00 0.00 ? 31 LEU B HD22 7  
ATOM 9262  H HD23 . LEU B 1 31 ? 8.451   15.143  7.625   1.00 0.00 ? 31 LEU B HD23 7  
ATOM 9263  N N    . TRP B 1 32 ? 11.862  14.825  2.795   1.00 0.00 ? 32 TRP B N    7  
ATOM 9264  C CA   . TRP B 1 32 ? 13.263  15.200  2.952   1.00 0.00 ? 32 TRP B CA   7  
ATOM 9265  C C    . TRP B 1 32 ? 13.595  16.453  2.146   1.00 0.00 ? 32 TRP B C    7  
ATOM 9266  O O    . TRP B 1 32 ? 14.346  17.315  2.604   1.00 0.00 ? 32 TRP B O    7  
ATOM 9267  C CB   . TRP B 1 32 ? 14.173  14.049  2.518   1.00 0.00 ? 32 TRP B CB   7  
ATOM 9268  C CG   . TRP B 1 32 ? 15.633  14.354  2.676   1.00 0.00 ? 32 TRP B CG   7  
ATOM 9269  C CD1  . TRP B 1 32 ? 16.276  14.698  3.828   1.00 0.00 ? 32 TRP B CD1  7  
ATOM 9270  C CD2  . TRP B 1 32 ? 16.629  14.341  1.647   1.00 0.00 ? 32 TRP B CD2  7  
ATOM 9271  N NE1  . TRP B 1 32 ? 17.613  14.904  3.579   1.00 0.00 ? 32 TRP B NE1  7  
ATOM 9272  C CE2  . TRP B 1 32 ? 17.855  14.691  2.249   1.00 0.00 ? 32 TRP B CE2  7  
ATOM 9273  C CE3  . TRP B 1 32 ? 16.607  14.070  0.276   1.00 0.00 ? 32 TRP B CE3  7  
ATOM 9274  C CZ2  . TRP B 1 32 ? 19.041  14.775  1.527   1.00 0.00 ? 32 TRP B CZ2  7  
ATOM 9275  C CZ3  . TRP B 1 32 ? 17.788  14.153  -0.439  1.00 0.00 ? 32 TRP B CZ3  7  
ATOM 9276  C CH2  . TRP B 1 32 ? 18.990  14.503  0.188   1.00 0.00 ? 32 TRP B CH2  7  
ATOM 9277  H H    . TRP B 1 32 ? 11.651  13.980  2.343   1.00 0.00 ? 32 TRP B H    7  
ATOM 9278  H HA   . TRP B 1 32 ? 13.442  15.405  4.000   1.00 0.00 ? 32 TRP B HA   7  
ATOM 9279  H HB2  . TRP B 1 32 ? 13.950  13.180  3.119   1.00 0.00 ? 32 TRP B HB2  7  
ATOM 9280  H HB3  . TRP B 1 32 ? 13.984  13.818  1.480   1.00 0.00 ? 32 TRP B HB3  7  
ATOM 9281  H HD1  . TRP B 1 32 ? 15.793  14.794  4.789   1.00 0.00 ? 32 TRP B HD1  7  
ATOM 9282  H HE1  . TRP B 1 32 ? 18.283  15.161  4.247   1.00 0.00 ? 32 TRP B HE1  7  
ATOM 9283  H HE3  . TRP B 1 32 ? 15.690  13.798  -0.225  1.00 0.00 ? 32 TRP B HE3  7  
ATOM 9284  H HZ2  . TRP B 1 32 ? 19.977  15.043  1.995   1.00 0.00 ? 32 TRP B HZ2  7  
ATOM 9285  H HZ3  . TRP B 1 32 ? 17.790  13.946  -1.499  1.00 0.00 ? 32 TRP B HZ3  7  
ATOM 9286  H HH2  . TRP B 1 32 ? 19.888  14.556  -0.410  1.00 0.00 ? 32 TRP B HH2  7  
ATOM 9287  N N    . GLN B 1 33 ? 13.030  16.548  0.947   1.00 0.00 ? 33 GLN B N    7  
ATOM 9288  C CA   . GLN B 1 33 ? 13.277  17.694  0.080   1.00 0.00 ? 33 GLN B CA   7  
ATOM 9289  C C    . GLN B 1 33 ? 12.166  18.734  0.206   1.00 0.00 ? 33 GLN B C    7  
ATOM 9290  O O    . GLN B 1 33 ? 12.180  19.752  -0.488  1.00 0.00 ? 33 GLN B O    7  
ATOM 9291  C CB   . GLN B 1 33 ? 13.398  17.243  -1.376  1.00 0.00 ? 33 GLN B CB   7  
ATOM 9292  C CG   . GLN B 1 33 ? 14.451  16.170  -1.598  1.00 0.00 ? 33 GLN B CG   7  
ATOM 9293  C CD   . GLN B 1 33 ? 14.643  15.841  -3.065  1.00 0.00 ? 33 GLN B CD   7  
ATOM 9294  O OE1  . GLN B 1 33 ? 15.495  16.422  -3.738  1.00 0.00 ? 33 GLN B OE1  7  
ATOM 9295  N NE2  . GLN B 1 33 ? 13.846  14.908  -3.570  1.00 0.00 ? 33 GLN B NE2  7  
ATOM 9296  H H    . GLN B 1 33 ? 12.434  15.832  0.625   1.00 0.00 ? 33 GLN B H    7  
ATOM 9297  H HA   . GLN B 1 33 ? 14.213  18.160  0.366   1.00 0.00 ? 33 GLN B HA   7  
ATOM 9298  H HB2  . GLN B 1 33 ? 12.445  16.849  -1.704  1.00 0.00 ? 33 GLN B HB2  7  
ATOM 9299  H HB3  . GLN B 1 33 ? 13.653  18.101  -1.985  1.00 0.00 ? 33 GLN B HB3  7  
ATOM 9300  H HG2  . GLN B 1 33 ? 15.394  16.519  -1.201  1.00 0.00 ? 33 GLN B HG2  7  
ATOM 9301  H HG3  . GLN B 1 33 ? 14.151  15.274  -1.073  1.00 0.00 ? 33 GLN B HG3  7  
ATOM 9302  H HE21 . GLN B 1 33 ? 13.178  14.488  -2.989  1.00 0.00 ? 33 GLN B HE21 7  
ATOM 9303  H HE22 . GLN B 1 33 ? 13.959  14.674  -4.515  1.00 0.00 ? 33 GLN B HE22 7  
ATOM 9304  N N    . LYS B 1 34 ? 11.206  18.476  1.088   1.00 0.00 ? 34 LYS B N    7  
ATOM 9305  C CA   . LYS B 1 34 ? 10.097  19.405  1.292   1.00 0.00 ? 34 LYS B CA   7  
ATOM 9306  C C    . LYS B 1 34 ? 10.463  20.460  2.329   1.00 0.00 ? 34 LYS B C    7  
ATOM 9307  O O    . LYS B 1 34 ? 10.301  21.658  2.095   1.00 0.00 ? 34 LYS B O    7  
ATOM 9308  C CB   . LYS B 1 34 ? 8.837   18.655  1.730   1.00 0.00 ? 34 LYS B CB   7  
ATOM 9309  C CG   . LYS B 1 34 ? 7.633   19.564  1.937   1.00 0.00 ? 34 LYS B CG   7  
ATOM 9310  C CD   . LYS B 1 34 ? 6.379   18.771  2.264   1.00 0.00 ? 34 LYS B CD   7  
ATOM 9311  C CE   . LYS B 1 34 ? 5.200   19.689  2.549   1.00 0.00 ? 34 LYS B CE   7  
ATOM 9312  N NZ   . LYS B 1 34 ? 4.895   20.579  1.394   1.00 0.00 ? 34 LYS B NZ   7  
ATOM 9313  H H    . LYS B 1 34 ? 11.229  17.661  1.620   1.00 0.00 ? 34 LYS B H    7  
ATOM 9314  H HA   . LYS B 1 34 ? 9.886   19.906  0.354   1.00 0.00 ? 34 LYS B HA   7  
ATOM 9315  H HB2  . LYS B 1 34 ? 8.590   17.929  0.969   1.00 0.00 ? 34 LYS B HB2  7  
ATOM 9316  H HB3  . LYS B 1 34 ? 9.039   18.138  2.658   1.00 0.00 ? 34 LYS B HB3  7  
ATOM 9317  H HG2  . LYS B 1 34 ? 7.838   20.240  2.755   1.00 0.00 ? 34 LYS B HG2  7  
ATOM 9318  H HG3  . LYS B 1 34 ? 7.464   20.131  1.032   1.00 0.00 ? 34 LYS B HG3  7  
ATOM 9319  H HD2  . LYS B 1 34 ? 6.134   18.139  1.424   1.00 0.00 ? 34 LYS B HD2  7  
ATOM 9320  H HD3  . LYS B 1 34 ? 6.563   18.159  3.137   1.00 0.00 ? 34 LYS B HD3  7  
ATOM 9321  H HE2  . LYS B 1 34 ? 4.332   19.082  2.761   1.00 0.00 ? 34 LYS B HE2  7  
ATOM 9322  H HE3  . LYS B 1 34 ? 5.430   20.298  3.412   1.00 0.00 ? 34 LYS B HE3  7  
ATOM 9323  H HZ1  . LYS B 1 34 ? 4.838   20.029  0.510   1.00 0.00 ? 34 LYS B HZ1  7  
ATOM 9324  H HZ2  . LYS B 1 34 ? 5.632   21.305  1.292   1.00 0.00 ? 34 LYS B HZ2  7  
ATOM 9325  H HZ3  . LYS B 1 34 ? 3.983   21.055  1.548   1.00 0.00 ? 34 LYS B HZ3  7  
ATOM 9326  N N    . LYS B 1 35 ? 10.957  20.008  3.477   1.00 0.00 ? 35 LYS B N    7  
ATOM 9327  C CA   . LYS B 1 35 ? 11.350  20.913  4.550   1.00 0.00 ? 35 LYS B CA   7  
ATOM 9328  C C    . LYS B 1 35 ? 12.765  21.448  4.317   1.00 0.00 ? 35 LYS B C    7  
ATOM 9329  O O    . LYS B 1 35 ? 13.724  20.678  4.298   1.00 0.00 ? 35 LYS B O    7  
ATOM 9330  C CB   . LYS B 1 35 ? 11.282  20.196  5.900   1.00 0.00 ? 35 LYS B CB   7  
ATOM 9331  C CG   . LYS B 1 35 ? 11.588  21.098  7.087   1.00 0.00 ? 35 LYS B CG   7  
ATOM 9332  C CD   . LYS B 1 35 ? 10.508  22.151  7.284   1.00 0.00 ? 35 LYS B CD   7  
ATOM 9333  C CE   . LYS B 1 35 ? 10.826  23.061  8.460   1.00 0.00 ? 35 LYS B CE   7  
ATOM 9334  N NZ   . LYS B 1 35 ? 12.110  23.788  8.271   1.00 0.00 ? 35 LYS B NZ   7  
ATOM 9335  H H    . LYS B 1 35 ? 11.067  19.035  3.608   1.00 0.00 ? 35 LYS B H    7  
ATOM 9336  H HA   . LYS B 1 35 ? 10.639  21.722  4.564   1.00 0.00 ? 35 LYS B HA   7  
ATOM 9337  H HB2  . LYS B 1 35 ? 10.289  19.785  6.026   1.00 0.00 ? 35 LYS B HB2  7  
ATOM 9338  H HB3  . LYS B 1 35 ? 11.995  19.382  5.902   1.00 0.00 ? 35 LYS B HB3  7  
ATOM 9339  H HG2  . LYS B 1 35 ? 11.640  20.485  7.976   1.00 0.00 ? 35 LYS B HG2  7  
ATOM 9340  H HG3  . LYS B 1 35 ? 12.539  21.585  6.935   1.00 0.00 ? 35 LYS B HG3  7  
ATOM 9341  H HD2  . LYS B 1 35 ? 10.418  22.749  6.401   1.00 0.00 ? 35 LYS B HD2  7  
ATOM 9342  H HD3  . LYS B 1 35 ? 9.568   21.654  7.478   1.00 0.00 ? 35 LYS B HD3  7  
ATOM 9343  H HE2  . LYS B 1 35 ? 10.029  23.782  8.564   1.00 0.00 ? 35 LYS B HE2  7  
ATOM 9344  H HE3  . LYS B 1 35 ? 10.888  22.464  9.359   1.00 0.00 ? 35 LYS B HE3  7  
ATOM 9345  H HZ1  . LYS B 1 35 ? 12.195  24.543  8.982   1.00 0.00 ? 35 LYS B HZ1  7  
ATOM 9346  H HZ2  . LYS B 1 35 ? 12.155  24.220  7.324   1.00 0.00 ? 35 LYS B HZ2  7  
ATOM 9347  H HZ3  . LYS B 1 35 ? 12.913  23.137  8.383   1.00 0.00 ? 35 LYS B HZ3  7  
ATOM 9348  N N    . PRO B 1 36 ? 12.918  22.777  4.135   1.00 0.00 ? 36 PRO B N    7  
ATOM 9349  C CA   . PRO B 1 36 ? 14.229  23.390  3.904   1.00 0.00 ? 36 PRO B CA   7  
ATOM 9350  C C    . PRO B 1 36 ? 15.081  23.427  5.167   1.00 0.00 ? 36 PRO B C    7  
ATOM 9351  O O    . PRO B 1 36 ? 14.564  23.309  6.280   1.00 0.00 ? 36 PRO B O    7  
ATOM 9352  C CB   . PRO B 1 36 ? 13.883  24.810  3.455   1.00 0.00 ? 36 PRO B CB   7  
ATOM 9353  C CG   . PRO B 1 36 ? 12.567  25.094  4.090   1.00 0.00 ? 36 PRO B CG   7  
ATOM 9354  C CD   . PRO B 1 36 ? 11.834  23.779  4.140   1.00 0.00 ? 36 PRO B CD   7  
ATOM 9355  H HA   . PRO B 1 36 ? 14.771  22.884  3.117   1.00 0.00 ? 36 PRO B HA   7  
ATOM 9356  H HB2  . PRO B 1 36 ? 14.642  25.513  3.778   1.00 0.00 ? 36 PRO B HB2  7  
ATOM 9357  H HB3  . PRO B 1 36 ? 13.806  24.835  2.378   1.00 0.00 ? 36 PRO B HB3  7  
ATOM 9358  H HG2  . PRO B 1 36 ? 12.717  25.478  5.089   1.00 0.00 ? 36 PRO B HG2  7  
ATOM 9359  H HG3  . PRO B 1 36 ? 12.017  25.806  3.492   1.00 0.00 ? 36 PRO B HG3  7  
ATOM 9360  H HD2  . PRO B 1 36 ? 11.256  23.722  5.039   1.00 0.00 ? 36 PRO B HD2  7  
ATOM 9361  H HD3  . PRO B 1 36 ? 11.200  23.666  3.273   1.00 0.00 ? 36 PRO B HD3  7  
ATOM 9362  N N    . ARG B 1 37 ? 16.389  23.593  4.991   1.00 0.00 ? 37 ARG B N    7  
ATOM 9363  C CA   . ARG B 1 37 ? 17.312  23.648  6.119   1.00 0.00 ? 37 ARG B CA   7  
ATOM 9364  C C    . ARG B 1 37 ? 17.824  25.069  6.334   1.00 0.00 ? 37 ARG B C    7  
ATOM 9365  O O    . ARG B 1 37 ? 18.392  25.680  5.428   1.00 0.00 ? 37 ARG B O    7  
ATOM 9366  C CB   . ARG B 1 37 ? 18.489  22.698  5.893   1.00 0.00 ? 37 ARG B CB   7  
ATOM 9367  C CG   . ARG B 1 37 ? 19.395  22.552  7.105   1.00 0.00 ? 37 ARG B CG   7  
ATOM 9368  C CD   . ARG B 1 37 ? 20.564  21.624  6.822   1.00 0.00 ? 37 ARG B CD   7  
ATOM 9369  N NE   . ARG B 1 37 ? 21.375  21.387  8.014   1.00 0.00 ? 37 ARG B NE   7  
ATOM 9370  C CZ   . ARG B 1 37 ? 22.576  20.815  7.989   1.00 0.00 ? 37 ARG B CZ   7  
ATOM 9371  N NH1  . ARG B 1 37 ? 23.107  20.429  6.837   1.00 0.00 ? 37 ARG B NH1  7  
ATOM 9372  N NH2  . ARG B 1 37 ? 23.246  20.631  9.118   1.00 0.00 ? 37 ARG B NH2  7  
ATOM 9373  H H    . ARG B 1 37 ? 16.750  23.686  4.078   1.00 0.00 ? 37 ARG B H    7  
ATOM 9374  H HA   . ARG B 1 37 ? 16.788  23.325  7.014   1.00 0.00 ? 37 ARG B HA   7  
ATOM 9375  H HB2  . ARG B 1 37 ? 18.097  21.722  5.644   1.00 0.00 ? 37 ARG B HB2  7  
ATOM 9376  H HB3  . ARG B 1 37 ? 19.081  23.059  5.061   1.00 0.00 ? 37 ARG B HB3  7  
ATOM 9377  H HG2  . ARG B 1 37 ? 19.784  23.521  7.378   1.00 0.00 ? 37 ARG B HG2  7  
ATOM 9378  H HG3  . ARG B 1 37 ? 18.819  22.149  7.925   1.00 0.00 ? 37 ARG B HG3  7  
ATOM 9379  H HD2  . ARG B 1 37 ? 20.185  20.675  6.464   1.00 0.00 ? 37 ARG B HD2  7  
ATOM 9380  H HD3  . ARG B 1 37 ? 21.178  22.080  6.057   1.00 0.00 ? 37 ARG B HD3  7  
ATOM 9381  H HE   . ARG B 1 37 ? 21.005  21.663  8.885   1.00 0.00 ? 37 ARG B HE   7  
ATOM 9382  H HH11 . ARG B 1 37 ? 22.626  20.554  5.972   1.00 0.00 ? 37 ARG B HH11 7  
ATOM 9383  H HH12 . ARG B 1 37 ? 24.014  20.001  6.829   1.00 0.00 ? 37 ARG B HH12 7  
ATOM 9384  H HH21 . ARG B 1 37 ? 22.850  20.922  9.992   1.00 0.00 ? 37 ARG B HH21 7  
ATOM 9385  H HH22 . ARG B 1 37 ? 24.151  20.200  9.103   1.00 0.00 ? 37 ARG B HH22 7  
ATOM 9386  N N    . TYR B 1 38 ? 17.621  25.590  7.541   1.00 0.00 ? 38 TYR B N    7  
ATOM 9387  C CA   . TYR B 1 38 ? 18.059  26.939  7.879   1.00 0.00 ? 38 TYR B CA   7  
ATOM 9388  C C    . TYR B 1 38 ? 19.438  26.916  8.533   1.00 0.00 ? 38 TYR B C    7  
ATOM 9389  O O    . TYR B 1 38 ? 19.738  26.035  9.340   1.00 0.00 ? 38 TYR B O    7  
ATOM 9390  C CB   . TYR B 1 38 ? 17.044  27.606  8.812   1.00 0.00 ? 38 TYR B CB   7  
ATOM 9391  C CG   . TYR B 1 38 ? 17.468  28.972  9.304   1.00 0.00 ? 38 TYR B CG   7  
ATOM 9392  C CD1  . TYR B 1 38 ? 17.379  30.087  8.479   1.00 0.00 ? 38 TYR B CD1  7  
ATOM 9393  C CD2  . TYR B 1 38 ? 17.958  29.147  10.593  1.00 0.00 ? 38 TYR B CD2  7  
ATOM 9394  C CE1  . TYR B 1 38 ? 17.764  31.336  8.925   1.00 0.00 ? 38 TYR B CE1  7  
ATOM 9395  C CE2  . TYR B 1 38 ? 18.346  30.394  11.045  1.00 0.00 ? 38 TYR B CE2  7  
ATOM 9396  C CZ   . TYR B 1 38 ? 18.248  31.485  10.208  1.00 0.00 ? 38 TYR B CZ   7  
ATOM 9397  O OH   . TYR B 1 38 ? 18.631  32.727  10.656  1.00 0.00 ? 38 TYR B OH   7  
ATOM 9398  H H    . TYR B 1 38 ? 17.165  25.053  8.232   1.00 0.00 ? 38 TYR B H    7  
ATOM 9399  H HA   . TYR B 1 38 ? 18.114  27.525  6.967   1.00 0.00 ? 38 TYR B HA   7  
ATOM 9400  H HB2  . TYR B 1 38 ? 16.106  27.717  8.283   1.00 0.00 ? 38 TYR B HB2  7  
ATOM 9401  H HB3  . TYR B 1 38 ? 16.886  26.964  9.669   1.00 0.00 ? 38 TYR B HB3  7  
ATOM 9402  H HD1  . TYR B 1 38 ? 17.000  29.972  7.473   1.00 0.00 ? 38 TYR B HD1  7  
ATOM 9403  H HD2  . TYR B 1 38 ? 18.036  28.292  11.250  1.00 0.00 ? 38 TYR B HD2  7  
ATOM 9404  H HE1  . TYR B 1 38 ? 17.687  32.190  8.269   1.00 0.00 ? 38 TYR B HE1  7  
ATOM 9405  H HE2  . TYR B 1 38 ? 18.725  30.510  12.050  1.00 0.00 ? 38 TYR B HE2  7  
ATOM 9406  H HH   . TYR B 1 38 ? 19.554  32.875  10.439  1.00 0.00 ? 38 TYR B HH   7  
ATOM 9407  N N    . GLU B 1 39 ? 20.270  27.891  8.183   1.00 0.00 ? 39 GLU B N    7  
ATOM 9408  C CA   . GLU B 1 39 ? 21.617  27.982  8.736   1.00 0.00 ? 39 GLU B CA   7  
ATOM 9409  C C    . GLU B 1 39 ? 21.667  28.993  9.878   1.00 0.00 ? 39 GLU B C    7  
ATOM 9410  O O    . GLU B 1 39 ? 21.210  30.140  9.678   1.00 0.00 ? 39 GLU B O    7  
ATOM 9411  C CB   . GLU B 1 39 ? 22.617  28.375  7.646   1.00 0.00 ? 39 GLU B CB   7  
ATOM 9412  C CG   . GLU B 1 39 ? 24.064  28.346  8.112   1.00 0.00 ? 39 GLU B CG   7  
ATOM 9413  C CD   . GLU B 1 39 ? 24.511  26.959  8.534   1.00 0.00 ? 39 GLU B CD   7  
ATOM 9414  O OE1  . GLU B 1 39 ? 24.894  26.164  7.652   1.00 0.00 ? 39 GLU B OE1  7  
ATOM 9415  O OE2  . GLU B 1 39 ? 24.475  26.669  9.750   1.00 0.00 ? 39 GLU B OE2  7  
ATOM 9416  O OXT  . GLU B 1 39 ? 22.163  28.632  10.967  1.00 0.00 ? 39 GLU B OXT  7  
ATOM 9417  H H    . GLU B 1 39 ? 19.974  28.575  7.537   1.00 0.00 ? 39 GLU B H    7  
ATOM 9418  H HA   . GLU B 1 39 ? 21.897  27.011  9.127   1.00 0.00 ? 39 GLU B HA   7  
ATOM 9419  H HB2  . GLU B 1 39 ? 22.513  27.690  6.816   1.00 0.00 ? 39 GLU B HB2  7  
ATOM 9420  H HB3  . GLU B 1 39 ? 22.392  29.375  7.301   1.00 0.00 ? 39 GLU B HB3  7  
ATOM 9421  H HG2  . GLU B 1 39 ? 24.693  28.674  7.298   1.00 0.00 ? 39 GLU B HG2  7  
ATOM 9422  H HG3  . GLU B 1 39 ? 24.185  29.019  8.947   1.00 0.00 ? 39 GLU B HG3  7  
ATOM 9423  N N    . GLY A 1 1  ? 15.000  -29.001 8.558   1.00 0.00 ? 1  GLY A N    8  
ATOM 9424  C CA   . GLY A 1 1  ? 14.368  -28.325 7.393   1.00 0.00 ? 1  GLY A CA   8  
ATOM 9425  C C    . GLY A 1 1  ? 12.913  -28.712 7.215   1.00 0.00 ? 1  GLY A C    8  
ATOM 9426  O O    . GLY A 1 1  ? 12.607  -29.747 6.623   1.00 0.00 ? 1  GLY A O    8  
ATOM 9427  H H1   . GLY A 1 1  ? 14.967  -30.035 8.438   1.00 0.00 ? 1  GLY A H1   8  
ATOM 9428  H H2   . GLY A 1 1  ? 14.502  -28.748 9.437   1.00 0.00 ? 1  GLY A H2   8  
ATOM 9429  H H3   . GLY A 1 1  ? 15.994  -28.707 8.642   1.00 0.00 ? 1  GLY A H3   8  
ATOM 9430  H HA2  . GLY A 1 1  ? 14.438  -27.255 7.530   1.00 0.00 ? 1  GLY A HA2  8  
ATOM 9431  H HA3  . GLY A 1 1  ? 14.911  -28.597 6.499   1.00 0.00 ? 1  GLY A HA3  8  
ATOM 9432  N N    . HIS A 1 2  ? 12.014  -27.876 7.727   1.00 0.00 ? 2  HIS A N    8  
ATOM 9433  C CA   . HIS A 1 2  ? 10.582  -28.134 7.622   1.00 0.00 ? 2  HIS A CA   8  
ATOM 9434  C C    . HIS A 1 2  ? 9.883   -27.018 6.854   1.00 0.00 ? 2  HIS A C    8  
ATOM 9435  O O    . HIS A 1 2  ? 10.302  -25.861 6.899   1.00 0.00 ? 2  HIS A O    8  
ATOM 9436  C CB   . HIS A 1 2  ? 9.965   -28.278 9.016   1.00 0.00 ? 2  HIS A CB   8  
ATOM 9437  C CG   . HIS A 1 2  ? 10.496  -29.447 9.787   1.00 0.00 ? 2  HIS A CG   8  
ATOM 9438  N ND1  . HIS A 1 2  ? 11.514  -29.341 10.712  1.00 0.00 ? 2  HIS A ND1  8  
ATOM 9439  C CD2  . HIS A 1 2  ? 10.140  -30.754 9.771   1.00 0.00 ? 2  HIS A CD2  8  
ATOM 9440  C CE1  . HIS A 1 2  ? 11.761  -30.530 11.230  1.00 0.00 ? 2  HIS A CE1  8  
ATOM 9441  N NE2  . HIS A 1 2  ? 10.942  -31.404 10.678  1.00 0.00 ? 2  HIS A NE2  8  
ATOM 9442  H H    . HIS A 1 2  ? 12.312  -27.060 8.190   1.00 0.00 ? 2  HIS A H    8  
ATOM 9443  H HA   . HIS A 1 2  ? 10.425  -29.063 7.082   1.00 0.00 ? 2  HIS A HA   8  
ATOM 9444  H HB2  . HIS A 1 2  ? 10.169  -27.385 9.587   1.00 0.00 ? 2  HIS A HB2  8  
ATOM 9445  H HB3  . HIS A 1 2  ? 8.894   -28.404 8.925   1.00 0.00 ? 2  HIS A HB3  8  
ATOM 9446  H HD1  . HIS A 1 2  ? 11.986  -28.516 10.952  1.00 0.00 ? 2  HIS A HD1  8  
ATOM 9447  H HD2  . HIS A 1 2  ? 9.369   -31.201 9.159   1.00 0.00 ? 2  HIS A HD2  8  
ATOM 9448  H HE1  . HIS A 1 2  ? 12.507  -30.749 11.980  1.00 0.00 ? 2  HIS A HE1  8  
ATOM 9449  H HE2  . HIS A 1 2  ? 10.854  -32.343 10.946  1.00 0.00 ? 2  HIS A HE2  8  
ATOM 9450  N N    . SER A 1 3  ? 8.815   -27.373 6.144   1.00 0.00 ? 3  SER A N    8  
ATOM 9451  C CA   . SER A 1 3  ? 8.057   -26.403 5.361   1.00 0.00 ? 3  SER A CA   8  
ATOM 9452  C C    . SER A 1 3  ? 6.769   -26.010 6.079   1.00 0.00 ? 3  SER A C    8  
ATOM 9453  O O    . SER A 1 3  ? 6.090   -26.855 6.662   1.00 0.00 ? 3  SER A O    8  
ATOM 9454  C CB   . SER A 1 3  ? 7.732   -26.977 3.980   1.00 0.00 ? 3  SER A CB   8  
ATOM 9455  O OG   . SER A 1 3  ? 7.003   -26.045 3.200   1.00 0.00 ? 3  SER A OG   8  
ATOM 9456  H H    . SER A 1 3  ? 8.522   -28.315 6.144   1.00 0.00 ? 3  SER A H    8  
ATOM 9457  H HA   . SER A 1 3  ? 8.663   -25.514 5.220   1.00 0.00 ? 3  SER A HA   8  
ATOM 9458  H HB2  . SER A 1 3  ? 8.652   -27.216 3.467   1.00 0.00 ? 3  SER A HB2  8  
ATOM 9459  H HB3  . SER A 1 3  ? 7.141   -27.875 4.093   1.00 0.00 ? 3  SER A HB3  8  
ATOM 9460  H HG   . SER A 1 3  ? 7.605   -25.401 2.819   1.00 0.00 ? 3  SER A HG   8  
ATOM 9461  N N    . LEU A 1 4  ? 6.440   -24.722 6.033   1.00 0.00 ? 4  LEU A N    8  
ATOM 9462  C CA   . LEU A 1 4  ? 5.234   -24.218 6.679   1.00 0.00 ? 4  LEU A CA   8  
ATOM 9463  C C    . LEU A 1 4  ? 4.010   -24.426 5.787   1.00 0.00 ? 4  LEU A C    8  
ATOM 9464  O O    . LEU A 1 4  ? 4.107   -24.349 4.563   1.00 0.00 ? 4  LEU A O    8  
ATOM 9465  C CB   . LEU A 1 4  ? 5.383   -22.730 7.018   1.00 0.00 ? 4  LEU A CB   8  
ATOM 9466  C CG   . LEU A 1 4  ? 6.185   -22.418 8.288   1.00 0.00 ? 4  LEU A CG   8  
ATOM 9467  C CD1  . LEU A 1 4  ? 5.512   -23.024 9.512   1.00 0.00 ? 4  LEU A CD1  8  
ATOM 9468  C CD2  . LEU A 1 4  ? 7.616   -22.922 8.159   1.00 0.00 ? 4  LEU A CD2  8  
ATOM 9469  H H    . LEU A 1 4  ? 7.022   -24.090 5.547   1.00 0.00 ? 4  LEU A H    8  
ATOM 9470  H HA   . LEU A 1 4  ? 5.112   -24.778 7.584   1.00 0.00 ? 4  LEU A HA   8  
ATOM 9471  H HB2  . LEU A 1 4  ? 5.864   -22.237 6.183   1.00 0.00 ? 4  LEU A HB2  8  
ATOM 9472  H HB3  . LEU A 1 4  ? 4.396   -22.296 7.139   1.00 0.00 ? 4  LEU A HB3  8  
ATOM 9473  H HG   . LEU A 1 4  ? 6.220   -21.347 8.426   1.00 0.00 ? 4  LEU A HG   8  
ATOM 9474  H HD11 . LEU A 1 4  ? 5.567   -24.102 9.473   1.00 0.00 ? 4  LEU A HD11 8  
ATOM 9475  H HD12 . LEU A 1 4  ? 4.475   -22.718 9.549   1.00 0.00 ? 4  LEU A HD12 8  
ATOM 9476  H HD13 . LEU A 1 4  ? 6.015   -22.675 10.403  1.00 0.00 ? 4  LEU A HD13 8  
ATOM 9477  H HD21 . LEU A 1 4  ? 8.194   -22.571 9.002   1.00 0.00 ? 4  LEU A HD21 8  
ATOM 9478  H HD22 . LEU A 1 4  ? 8.057   -22.546 7.246   1.00 0.00 ? 4  LEU A HD22 8  
ATOM 9479  H HD23 . LEU A 1 4  ? 7.628   -24.002 8.145   1.00 0.00 ? 4  LEU A HD23 8  
ATOM 9480  N N    . PRO A 1 5  ? 2.838   -24.694 6.392   1.00 0.00 ? 5  PRO A N    8  
ATOM 9481  C CA   . PRO A 1 5  ? 1.593   -24.912 5.646   1.00 0.00 ? 5  PRO A CA   8  
ATOM 9482  C C    . PRO A 1 5  ? 1.181   -23.683 4.840   1.00 0.00 ? 5  PRO A C    8  
ATOM 9483  O O    . PRO A 1 5  ? 1.703   -22.590 5.050   1.00 0.00 ? 5  PRO A O    8  
ATOM 9484  C CB   . PRO A 1 5  ? 0.556   -25.206 6.737   1.00 0.00 ? 5  PRO A CB   8  
ATOM 9485  C CG   . PRO A 1 5  ? 1.352   -25.583 7.941   1.00 0.00 ? 5  PRO A CG   8  
ATOM 9486  C CD   . PRO A 1 5  ? 2.631   -24.806 7.845   1.00 0.00 ? 5  PRO A CD   8  
ATOM 9487  H HA   . PRO A 1 5  ? 1.675   -25.763 4.985   1.00 0.00 ? 5  PRO A HA   8  
ATOM 9488  H HB2  . PRO A 1 5  ? -0.053  -24.332 6.935   1.00 0.00 ? 5  PRO A HB2  8  
ATOM 9489  H HB3  . PRO A 1 5  ? -0.076  -26.021 6.420   1.00 0.00 ? 5  PRO A HB3  8  
ATOM 9490  H HG2  . PRO A 1 5  ? 0.814   -25.312 8.837   1.00 0.00 ? 5  PRO A HG2  8  
ATOM 9491  H HG3  . PRO A 1 5  ? 1.556   -26.644 7.930   1.00 0.00 ? 5  PRO A HG3  8  
ATOM 9492  H HD2  . PRO A 1 5  ? 2.518   -23.832 8.301   1.00 0.00 ? 5  PRO A HD2  8  
ATOM 9493  H HD3  . PRO A 1 5  ? 3.423   -25.360 8.319   1.00 0.00 ? 5  PRO A HD3  8  
ATOM 9494  N N    . PHE A 1 6  ? 0.240   -23.872 3.919   1.00 0.00 ? 6  PHE A N    8  
ATOM 9495  C CA   . PHE A 1 6  ? -0.244  -22.778 3.083   1.00 0.00 ? 6  PHE A CA   8  
ATOM 9496  C C    . PHE A 1 6  ? -0.960  -21.729 3.928   1.00 0.00 ? 6  PHE A C    8  
ATOM 9497  O O    . PHE A 1 6  ? -1.160  -20.595 3.493   1.00 0.00 ? 6  PHE A O    8  
ATOM 9498  C CB   . PHE A 1 6  ? -1.190  -23.311 2.002   1.00 0.00 ? 6  PHE A CB   8  
ATOM 9499  C CG   . PHE A 1 6  ? -2.463  -23.895 2.547   1.00 0.00 ? 6  PHE A CG   8  
ATOM 9500  C CD1  . PHE A 1 6  ? -2.492  -25.189 3.041   1.00 0.00 ? 6  PHE A CD1  8  
ATOM 9501  C CD2  . PHE A 1 6  ? -3.632  -23.150 2.562   1.00 0.00 ? 6  PHE A CD2  8  
ATOM 9502  C CE1  . PHE A 1 6  ? -3.661  -25.729 3.542   1.00 0.00 ? 6  PHE A CE1  8  
ATOM 9503  C CE2  . PHE A 1 6  ? -4.806  -23.685 3.063   1.00 0.00 ? 6  PHE A CE2  8  
ATOM 9504  C CZ   . PHE A 1 6  ? -4.819  -24.976 3.552   1.00 0.00 ? 6  PHE A CZ   8  
ATOM 9505  H H    . PHE A 1 6  ? -0.122  -24.768 3.804   1.00 0.00 ? 6  PHE A H    8  
ATOM 9506  H HA   . PHE A 1 6  ? 0.600   -22.328 2.597   1.00 0.00 ? 6  PHE A HA   8  
ATOM 9507  H HB2  . PHE A 1 6  ? -1.441  -22.502 1.326   1.00 0.00 ? 6  PHE A HB2  8  
ATOM 9508  H HB3  . PHE A 1 6  ? -0.676  -24.082 1.441   1.00 0.00 ? 6  PHE A HB3  8  
ATOM 9509  H HD1  . PHE A 1 6  ? -1.596  -25.790 3.029   1.00 0.00 ? 6  PHE A HD1  8  
ATOM 9510  H HD2  . PHE A 1 6  ? -3.626  -22.138 2.180   1.00 0.00 ? 6  PHE A HD2  8  
ATOM 9511  H HE1  . PHE A 1 6  ? -3.670  -26.739 3.924   1.00 0.00 ? 6  PHE A HE1  8  
ATOM 9512  H HE2  . PHE A 1 6  ? -5.710  -23.095 3.070   1.00 0.00 ? 6  PHE A HE2  8  
ATOM 9513  H HZ   . PHE A 1 6  ? -5.734  -25.397 3.943   1.00 0.00 ? 6  PHE A HZ   8  
ATOM 9514  N N    . LYS A 1 7  ? -1.339  -22.119 5.140   1.00 0.00 ? 7  LYS A N    8  
ATOM 9515  C CA   . LYS A 1 7  ? -2.036  -21.225 6.055   1.00 0.00 ? 7  LYS A CA   8  
ATOM 9516  C C    . LYS A 1 7  ? -1.199  -19.985 6.361   1.00 0.00 ? 7  LYS A C    8  
ATOM 9517  O O    . LYS A 1 7  ? -1.689  -18.861 6.282   1.00 0.00 ? 7  LYS A O    8  
ATOM 9518  C CB   . LYS A 1 7  ? -2.379  -21.965 7.348   1.00 0.00 ? 7  LYS A CB   8  
ATOM 9519  C CG   . LYS A 1 7  ? -3.068  -23.301 7.111   1.00 0.00 ? 7  LYS A CG   8  
ATOM 9520  C CD   . LYS A 1 7  ? -3.429  -23.992 8.418   1.00 0.00 ? 7  LYS A CD   8  
ATOM 9521  C CE   . LYS A 1 7  ? -4.758  -23.499 8.969   1.00 0.00 ? 7  LYS A CE   8  
ATOM 9522  N NZ   . LYS A 1 7  ? -4.708  -22.063 9.359   1.00 0.00 ? 7  LYS A NZ   8  
ATOM 9523  H H    . LYS A 1 7  ? -1.155  -23.028 5.429   1.00 0.00 ? 7  LYS A H    8  
ATOM 9524  H HA   . LYS A 1 7  ? -2.956  -20.912 5.581   1.00 0.00 ? 7  LYS A HA   8  
ATOM 9525  H HB2  . LYS A 1 7  ? -1.465  -22.150 7.902   1.00 0.00 ? 7  LYS A HB2  8  
ATOM 9526  H HB3  . LYS A 1 7  ? -3.012  -21.334 7.925   1.00 0.00 ? 7  LYS A HB3  8  
ATOM 9527  H HG2  . LYS A 1 7  ? -3.963  -23.140 6.527   1.00 0.00 ? 7  LYS A HG2  8  
ATOM 9528  H HG3  . LYS A 1 7  ? -2.404  -23.950 6.564   1.00 0.00 ? 7  LYS A HG3  8  
ATOM 9529  H HD2  . LYS A 1 7  ? -3.508  -25.053 8.234   1.00 0.00 ? 7  LYS A HD2  8  
ATOM 9530  H HD3  . LYS A 1 7  ? -2.654  -23.815 9.154   1.00 0.00 ? 7  LYS A HD3  8  
ATOM 9531  H HE2  . LYS A 1 7  ? -5.524  -23.632 8.218   1.00 0.00 ? 7  LYS A HE2  8  
ATOM 9532  H HE3  . LYS A 1 7  ? -5.008  -24.088 9.839   1.00 0.00 ? 7  LYS A HE3  8  
ATOM 9533  H HZ1  . LYS A 1 7  ? -5.458  -21.866 10.053  1.00 0.00 ? 7  LYS A HZ1  8  
ATOM 9534  H HZ2  . LYS A 1 7  ? -4.869  -21.460 8.529   1.00 0.00 ? 7  LYS A HZ2  8  
ATOM 9535  H HZ3  . LYS A 1 7  ? -3.789  -21.821 9.791   1.00 0.00 ? 7  LYS A HZ3  8  
ATOM 9536  N N    . VAL A 1 8  ? 0.068   -20.200 6.704   1.00 0.00 ? 8  VAL A N    8  
ATOM 9537  C CA   . VAL A 1 8  ? 0.969   -19.096 7.022   1.00 0.00 ? 8  VAL A CA   8  
ATOM 9538  C C    . VAL A 1 8  ? 1.236   -18.230 5.793   1.00 0.00 ? 8  VAL A C    8  
ATOM 9539  O O    . VAL A 1 8  ? 1.374   -17.011 5.902   1.00 0.00 ? 8  VAL A O    8  
ATOM 9540  C CB   . VAL A 1 8  ? 2.313   -19.609 7.579   1.00 0.00 ? 8  VAL A CB   8  
ATOM 9541  C CG1  . VAL A 1 8  ? 3.233   -18.446 7.925   1.00 0.00 ? 8  VAL A CG1  8  
ATOM 9542  C CG2  . VAL A 1 8  ? 2.084   -20.495 8.794   1.00 0.00 ? 8  VAL A CG2  8  
ATOM 9543  H H    . VAL A 1 8  ? 0.406   -21.125 6.738   1.00 0.00 ? 8  VAL A H    8  
ATOM 9544  H HA   . VAL A 1 8  ? 0.499   -18.483 7.784   1.00 0.00 ? 8  VAL A HA   8  
ATOM 9545  H HB   . VAL A 1 8  ? 2.796   -20.205 6.816   1.00 0.00 ? 8  VAL A HB   8  
ATOM 9546  H HG11 . VAL A 1 8  ? 3.544   -17.941 7.023   1.00 0.00 ? 8  VAL A HG11 8  
ATOM 9547  H HG12 . VAL A 1 8  ? 4.112   -18.816 8.437   1.00 0.00 ? 8  VAL A HG12 8  
ATOM 9548  H HG13 . VAL A 1 8  ? 2.715   -17.747 8.568   1.00 0.00 ? 8  VAL A HG13 8  
ATOM 9549  H HG21 . VAL A 1 8  ? 1.562   -19.936 9.558   1.00 0.00 ? 8  VAL A HG21 8  
ATOM 9550  H HG22 . VAL A 1 8  ? 3.036   -20.829 9.184   1.00 0.00 ? 8  VAL A HG22 8  
ATOM 9551  H HG23 . VAL A 1 8  ? 1.497   -21.356 8.516   1.00 0.00 ? 8  VAL A HG23 8  
ATOM 9552  N N    . VAL A 1 9  ? 1.308   -18.865 4.626   1.00 0.00 ? 9  VAL A N    8  
ATOM 9553  C CA   . VAL A 1 9  ? 1.563   -18.148 3.380   1.00 0.00 ? 9  VAL A CA   8  
ATOM 9554  C C    . VAL A 1 9  ? 0.437   -17.170 3.065   1.00 0.00 ? 9  VAL A C    8  
ATOM 9555  O O    . VAL A 1 9  ? 0.683   -16.024 2.689   1.00 0.00 ? 9  VAL A O    8  
ATOM 9556  C CB   . VAL A 1 9  ? 1.724   -19.113 2.190   1.00 0.00 ? 9  VAL A CB   8  
ATOM 9557  C CG1  . VAL A 1 9  ? 2.464   -18.433 1.048   1.00 0.00 ? 9  VAL A CG1  8  
ATOM 9558  C CG2  . VAL A 1 9  ? 2.439   -20.385 2.613   1.00 0.00 ? 9  VAL A CG2  8  
ATOM 9559  H H    . VAL A 1 9  ? 1.176   -19.832 4.612   1.00 0.00 ? 9  VAL A H    8  
ATOM 9560  H HA   . VAL A 1 9  ? 2.486   -17.591 3.502   1.00 0.00 ? 9  VAL A HA   8  
ATOM 9561  H HB   . VAL A 1 9  ? 0.741   -19.395 1.829   1.00 0.00 ? 9  VAL A HB   8  
ATOM 9562  H HG11 . VAL A 1 9  ? 1.922   -17.549 0.740   1.00 0.00 ? 9  VAL A HG11 8  
ATOM 9563  H HG12 . VAL A 1 9  ? 2.541   -19.112 0.210   1.00 0.00 ? 9  VAL A HG12 8  
ATOM 9564  H HG13 . VAL A 1 9  ? 3.456   -18.150 1.373   1.00 0.00 ? 9  VAL A HG13 8  
ATOM 9565  H HG21 . VAL A 1 9  ? 1.827   -20.941 3.290   1.00 0.00 ? 9  VAL A HG21 8  
ATOM 9566  H HG22 . VAL A 1 9  ? 3.374   -20.137 3.096   1.00 0.00 ? 9  VAL A HG22 8  
ATOM 9567  H HG23 . VAL A 1 9  ? 2.642   -20.995 1.742   1.00 0.00 ? 9  VAL A HG23 8  
ATOM 9568  N N    . VAL A 1 10 ? -0.801  -17.630 3.222   1.00 0.00 ? 10 VAL A N    8  
ATOM 9569  C CA   . VAL A 1 10 ? -1.967  -16.801 2.949   1.00 0.00 ? 10 VAL A CA   8  
ATOM 9570  C C    . VAL A 1 10 ? -2.090  -15.654 3.949   1.00 0.00 ? 10 VAL A C    8  
ATOM 9571  O O    . VAL A 1 10 ? -2.172  -14.490 3.560   1.00 0.00 ? 10 VAL A O    8  
ATOM 9572  C CB   . VAL A 1 10 ? -3.264  -17.634 2.971   1.00 0.00 ? 10 VAL A CB   8  
ATOM 9573  C CG1  . VAL A 1 10 ? -4.478  -16.749 2.732   1.00 0.00 ? 10 VAL A CG1  8  
ATOM 9574  C CG2  . VAL A 1 10 ? -3.201  -18.749 1.937   1.00 0.00 ? 10 VAL A CG2  8  
ATOM 9575  H H    . VAL A 1 10 ? -0.937  -18.557 3.529   1.00 0.00 ? 10 VAL A H    8  
ATOM 9576  H HA   . VAL A 1 10 ? -1.856  -16.379 1.956   1.00 0.00 ? 10 VAL A HA   8  
ATOM 9577  H HB   . VAL A 1 10 ? -3.364  -18.087 3.948   1.00 0.00 ? 10 VAL A HB   8  
ATOM 9578  H HG11 . VAL A 1 10 ? -4.318  -16.132 1.858   1.00 0.00 ? 10 VAL A HG11 8  
ATOM 9579  H HG12 . VAL A 1 10 ? -4.648  -16.118 3.592   1.00 0.00 ? 10 VAL A HG12 8  
ATOM 9580  H HG13 . VAL A 1 10 ? -5.355  -17.365 2.576   1.00 0.00 ? 10 VAL A HG13 8  
ATOM 9581  H HG21 . VAL A 1 10 ? -2.300  -19.318 2.049   1.00 0.00 ? 10 VAL A HG21 8  
ATOM 9582  H HG22 . VAL A 1 10 ? -3.225  -18.324 0.943   1.00 0.00 ? 10 VAL A HG22 8  
ATOM 9583  H HG23 . VAL A 1 10 ? -4.052  -19.402 2.065   1.00 0.00 ? 10 VAL A HG23 8  
ATOM 9584  N N    . ILE A 1 11 ? -2.105  -15.988 5.238   1.00 0.00 ? 11 ILE A N    8  
ATOM 9585  C CA   . ILE A 1 11 ? -2.227  -14.982 6.289   1.00 0.00 ? 11 ILE A CA   8  
ATOM 9586  C C    . ILE A 1 11 ? -1.172  -13.890 6.139   1.00 0.00 ? 11 ILE A C    8  
ATOM 9587  O O    . ILE A 1 11 ? -1.448  -12.712 6.371   1.00 0.00 ? 11 ILE A O    8  
ATOM 9588  C CB   . ILE A 1 11 ? -2.102  -15.613 7.692   1.00 0.00 ? 11 ILE A CB   8  
ATOM 9589  C CG1  . ILE A 1 11 ? -3.173  -16.689 7.888   1.00 0.00 ? 11 ILE A CG1  8  
ATOM 9590  C CG2  . ILE A 1 11 ? -2.216  -14.544 8.772   1.00 0.00 ? 11 ILE A CG2  8  
ATOM 9591  C CD1  . ILE A 1 11 ? -3.013  -17.479 9.169   1.00 0.00 ? 11 ILE A CD1  8  
ATOM 9592  H H    . ILE A 1 11 ? -2.029  -16.938 5.480   1.00 0.00 ? 11 ILE A H    8  
ATOM 9593  H HA   . ILE A 1 11 ? -3.207  -14.530 6.204   1.00 0.00 ? 11 ILE A HA   8  
ATOM 9594  H HB   . ILE A 1 11 ? -1.125  -16.069 7.773   1.00 0.00 ? 11 ILE A HB   8  
ATOM 9595  H HG12 . ILE A 1 11 ? -4.145  -16.217 7.920   1.00 0.00 ? 11 ILE A HG12 8  
ATOM 9596  H HG13 . ILE A 1 11 ? -3.161  -17.385 7.075   1.00 0.00 ? 11 ILE A HG13 8  
ATOM 9597  H HG21 . ILE A 1 11 ? -2.169  -15.000 9.750   1.00 0.00 ? 11 ILE A HG21 8  
ATOM 9598  H HG22 . ILE A 1 11 ? -3.156  -14.023 8.670   1.00 0.00 ? 11 ILE A HG22 8  
ATOM 9599  H HG23 . ILE A 1 11 ? -1.405  -13.838 8.682   1.00 0.00 ? 11 ILE A HG23 8  
ATOM 9600  H HD11 . ILE A 1 11 ? -1.992  -17.823 9.263   1.00 0.00 ? 11 ILE A HD11 8  
ATOM 9601  H HD12 . ILE A 1 11 ? -3.676  -18.331 9.148   1.00 0.00 ? 11 ILE A HD12 8  
ATOM 9602  H HD13 . ILE A 1 11 ? -3.262  -16.854 10.013  1.00 0.00 ? 11 ILE A HD13 8  
ATOM 9603  N N    . SER A 1 12 ? 0.035   -14.284 5.747   1.00 0.00 ? 12 SER A N    8  
ATOM 9604  C CA   . SER A 1 12 ? 1.128   -13.335 5.568   1.00 0.00 ? 12 SER A CA   8  
ATOM 9605  C C    . SER A 1 12 ? 0.902   -12.465 4.336   1.00 0.00 ? 12 SER A C    8  
ATOM 9606  O O    . SER A 1 12 ? 1.154   -11.259 4.363   1.00 0.00 ? 12 SER A O    8  
ATOM 9607  C CB   . SER A 1 12 ? 2.459   -14.079 5.447   1.00 0.00 ? 12 SER A CB   8  
ATOM 9608  O OG   . SER A 1 12 ? 3.533   -13.175 5.255   1.00 0.00 ? 12 SER A OG   8  
ATOM 9609  H H    . SER A 1 12 ? 0.203   -15.240 5.573   1.00 0.00 ? 12 SER A H    8  
ATOM 9610  H HA   . SER A 1 12 ? 1.170   -12.695 6.441   1.00 0.00 ? 12 SER A HA   8  
ATOM 9611  H HB2  . SER A 1 12 ? 2.637   -14.641 6.351   1.00 0.00 ? 12 SER A HB2  8  
ATOM 9612  H HB3  . SER A 1 12 ? 2.418   -14.756 4.605   1.00 0.00 ? 12 SER A HB3  8  
ATOM 9613  H HG   . SER A 1 12 ? 4.318   -13.661 4.991   1.00 0.00 ? 12 SER A HG   8  
ATOM 9614  N N    . ALA A 1 13 ? 0.427   -13.083 3.260   1.00 0.00 ? 13 ALA A N    8  
ATOM 9615  C CA   . ALA A 1 13 ? 0.172   -12.367 2.016   1.00 0.00 ? 13 ALA A CA   8  
ATOM 9616  C C    . ALA A 1 13 ? -0.920  -11.316 2.190   1.00 0.00 ? 13 ALA A C    8  
ATOM 9617  O O    . ALA A 1 13 ? -0.701  -10.133 1.929   1.00 0.00 ? 13 ALA A O    8  
ATOM 9618  C CB   . ALA A 1 13 ? -0.206  -13.344 0.914   1.00 0.00 ? 13 ALA A CB   8  
ATOM 9619  H H    . ALA A 1 13 ? 0.246   -14.052 3.297   1.00 0.00 ? 13 ALA A H    8  
ATOM 9620  H HA   . ALA A 1 13 ? 1.087   -11.871 1.718   1.00 0.00 ? 13 ALA A HA   8  
ATOM 9621  H HB1  . ALA A 1 13 ? -0.329  -12.811 -0.019  1.00 0.00 ? 13 ALA A HB1  8  
ATOM 9622  H HB2  . ALA A 1 13 ? -1.131  -13.842 1.170   1.00 0.00 ? 13 ALA A HB2  8  
ATOM 9623  H HB3  . ALA A 1 13 ? 0.577   -14.080 0.805   1.00 0.00 ? 13 ALA A HB3  8  
ATOM 9624  N N    . ILE A 1 14 ? -2.096  -11.754 2.631   1.00 0.00 ? 14 ILE A N    8  
ATOM 9625  C CA   . ILE A 1 14 ? -3.224  -10.852 2.838   1.00 0.00 ? 14 ILE A CA   8  
ATOM 9626  C C    . ILE A 1 14 ? -2.846  -9.708  3.773   1.00 0.00 ? 14 ILE A C    8  
ATOM 9627  O O    . ILE A 1 14 ? -3.149  -8.547  3.499   1.00 0.00 ? 14 ILE A O    8  
ATOM 9628  C CB   . ILE A 1 14 ? -4.443  -11.599 3.418   1.00 0.00 ? 14 ILE A CB   8  
ATOM 9629  C CG1  . ILE A 1 14 ? -4.851  -12.749 2.495   1.00 0.00 ? 14 ILE A CG1  8  
ATOM 9630  C CG2  . ILE A 1 14 ? -5.606  -10.637 3.623   1.00 0.00 ? 14 ILE A CG2  8  
ATOM 9631  C CD1  . ILE A 1 14 ? -5.978  -13.598 3.044   1.00 0.00 ? 14 ILE A CD1  8  
ATOM 9632  H H    . ILE A 1 14 ? -2.198  -12.713 2.828   1.00 0.00 ? 14 ILE A H    8  
ATOM 9633  H HA   . ILE A 1 14 ? -3.502  -10.439 1.876   1.00 0.00 ? 14 ILE A HA   8  
ATOM 9634  H HB   . ILE A 1 14 ? -4.168  -12.003 4.383   1.00 0.00 ? 14 ILE A HB   8  
ATOM 9635  H HG12 . ILE A 1 14 ? -5.176  -12.348 1.546   1.00 0.00 ? 14 ILE A HG12 8  
ATOM 9636  H HG13 . ILE A 1 14 ? -4.012  -13.403 2.328   1.00 0.00 ? 14 ILE A HG13 8  
ATOM 9637  H HG21 . ILE A 1 14 ? -5.871  -10.181 2.679   1.00 0.00 ? 14 ILE A HG21 8  
ATOM 9638  H HG22 . ILE A 1 14 ? -5.333  -9.868  4.328   1.00 0.00 ? 14 ILE A HG22 8  
ATOM 9639  H HG23 . ILE A 1 14 ? -6.461  -11.167 4.013   1.00 0.00 ? 14 ILE A HG23 8  
ATOM 9640  H HD11 . ILE A 1 14 ? -6.901  -13.040 3.009   1.00 0.00 ? 14 ILE A HD11 8  
ATOM 9641  H HD12 . ILE A 1 14 ? -5.763  -13.877 4.066   1.00 0.00 ? 14 ILE A HD12 8  
ATOM 9642  H HD13 . ILE A 1 14 ? -6.077  -14.490 2.444   1.00 0.00 ? 14 ILE A HD13 8  
ATOM 9643  N N    . LEU A 1 15 ? -2.186  -10.046 4.877   1.00 0.00 ? 15 LEU A N    8  
ATOM 9644  C CA   . LEU A 1 15 ? -1.766  -9.045  5.852   1.00 0.00 ? 15 LEU A CA   8  
ATOM 9645  C C    . LEU A 1 15 ? -0.928  -7.959  5.186   1.00 0.00 ? 15 LEU A C    8  
ATOM 9646  O O    . LEU A 1 15 ? -1.062  -6.777  5.500   1.00 0.00 ? 15 LEU A O    8  
ATOM 9647  C CB   . LEU A 1 15 ? -0.965  -9.704  6.978   1.00 0.00 ? 15 LEU A CB   8  
ATOM 9648  C CG   . LEU A 1 15 ? -0.478  -8.756  8.077   1.00 0.00 ? 15 LEU A CG   8  
ATOM 9649  C CD1  . LEU A 1 15 ? -1.655  -8.169  8.842   1.00 0.00 ? 15 LEU A CD1  8  
ATOM 9650  C CD2  . LEU A 1 15 ? 0.464   -9.482  9.023   1.00 0.00 ? 15 LEU A CD2  8  
ATOM 9651  H H    . LEU A 1 15 ? -1.976  -10.996 5.045   1.00 0.00 ? 15 LEU A H    8  
ATOM 9652  H HA   . LEU A 1 15 ? -2.654  -8.594  6.270   1.00 0.00 ? 15 LEU A HA   8  
ATOM 9653  H HB2  . LEU A 1 15 ? -1.585  -10.467 7.430   1.00 0.00 ? 15 LEU A HB2  8  
ATOM 9654  H HB3  . LEU A 1 15 ? -0.103  -10.187 6.534   1.00 0.00 ? 15 LEU A HB3  8  
ATOM 9655  H HG   . LEU A 1 15 ? 0.069   -7.938  7.634   1.00 0.00 ? 15 LEU A HG   8  
ATOM 9656  H HD11 . LEU A 1 15 ? -1.291  -7.510  9.619   1.00 0.00 ? 15 LEU A HD11 8  
ATOM 9657  H HD12 . LEU A 1 15 ? -2.233  -8.965  9.291   1.00 0.00 ? 15 LEU A HD12 8  
ATOM 9658  H HD13 . LEU A 1 15 ? -2.283  -7.607  8.166   1.00 0.00 ? 15 LEU A HD13 8  
ATOM 9659  H HD21 . LEU A 1 15 ? 0.821   -8.795  9.778   1.00 0.00 ? 15 LEU A HD21 8  
ATOM 9660  H HD22 . LEU A 1 15 ? 1.308   -9.869  8.468   1.00 0.00 ? 15 LEU A HD22 8  
ATOM 9661  H HD23 . LEU A 1 15 ? -0.057  -10.301 9.501   1.00 0.00 ? 15 LEU A HD23 8  
ATOM 9662  N N    . ALA A 1 16 ? -0.070  -8.372  4.261   1.00 0.00 ? 16 ALA A N    8  
ATOM 9663  C CA   . ALA A 1 16 ? 0.791   -7.437  3.549   1.00 0.00 ? 16 ALA A CA   8  
ATOM 9664  C C    . ALA A 1 16 ? -0.026  -6.480  2.687   1.00 0.00 ? 16 ALA A C    8  
ATOM 9665  O O    . ALA A 1 16 ? 0.261   -5.284  2.632   1.00 0.00 ? 16 ALA A O    8  
ATOM 9666  C CB   . ALA A 1 16 ? 1.796   -8.194  2.698   1.00 0.00 ? 16 ALA A CB   8  
ATOM 9667  H H    . ALA A 1 16 ? -0.006  -9.333  4.048   1.00 0.00 ? 16 ALA A H    8  
ATOM 9668  H HA   . ALA A 1 16 ? 1.344   -6.861  4.280   1.00 0.00 ? 16 ALA A HA   8  
ATOM 9669  H HB1  . ALA A 1 16 ? 2.510   -7.499  2.281   1.00 0.00 ? 16 ALA A HB1  8  
ATOM 9670  H HB2  . ALA A 1 16 ? 1.287   -8.710  1.897   1.00 0.00 ? 16 ALA A HB2  8  
ATOM 9671  H HB3  . ALA A 1 16 ? 2.315   -8.913  3.313   1.00 0.00 ? 16 ALA A HB3  8  
ATOM 9672  N N    . LEU A 1 17 ? -1.041  -7.012  2.014   1.00 0.00 ? 17 LEU A N    8  
ATOM 9673  C CA   . LEU A 1 17 ? -1.900  -6.200  1.159   1.00 0.00 ? 17 LEU A CA   8  
ATOM 9674  C C    . LEU A 1 17 ? -2.618  -5.135  1.977   1.00 0.00 ? 17 LEU A C    8  
ATOM 9675  O O    . LEU A 1 17 ? -2.816  -4.011  1.514   1.00 0.00 ? 17 LEU A O    8  
ATOM 9676  C CB   . LEU A 1 17 ? -2.921  -7.079  0.429   1.00 0.00 ? 17 LEU A CB   8  
ATOM 9677  C CG   . LEU A 1 17 ? -2.449  -7.663  -0.906  1.00 0.00 ? 17 LEU A CG   8  
ATOM 9678  C CD1  . LEU A 1 17 ? -2.149  -6.550  -1.899  1.00 0.00 ? 17 LEU A CD1  8  
ATOM 9679  C CD2  . LEU A 1 17 ? -1.225  -8.545  -0.707  1.00 0.00 ? 17 LEU A CD2  8  
ATOM 9680  H H    . LEU A 1 17 ? -1.222  -7.979  2.092   1.00 0.00 ? 17 LEU A H    8  
ATOM 9681  H HA   . LEU A 1 17 ? -1.269  -5.697  0.444   1.00 0.00 ? 17 LEU A HA   8  
ATOM 9682  H HB2  . LEU A 1 17 ? -3.195  -7.900  1.079   1.00 0.00 ? 17 LEU A HB2  8  
ATOM 9683  H HB3  . LEU A 1 17 ? -3.816  -6.497  0.234   1.00 0.00 ? 17 LEU A HB3  8  
ATOM 9684  H HG   . LEU A 1 17 ? -3.238  -8.274  -1.321  1.00 0.00 ? 17 LEU A HG   8  
ATOM 9685  H HD11 . LEU A 1 17 ? -3.004  -5.891  -1.980  1.00 0.00 ? 17 LEU A HD11 8  
ATOM 9686  H HD12 . LEU A 1 17 ? -1.945  -6.983  -2.868  1.00 0.00 ? 17 LEU A HD12 8  
ATOM 9687  H HD13 . LEU A 1 17 ? -1.288  -5.983  -1.577  1.00 0.00 ? 17 LEU A HD13 8  
ATOM 9688  H HD21 . LEU A 1 17 ? -0.419  -7.975  -0.271  1.00 0.00 ? 17 LEU A HD21 8  
ATOM 9689  H HD22 . LEU A 1 17 ? -0.905  -8.939  -1.663  1.00 0.00 ? 17 LEU A HD22 8  
ATOM 9690  H HD23 . LEU A 1 17 ? -1.482  -9.364  -0.062  1.00 0.00 ? 17 LEU A HD23 8  
ATOM 9691  N N    . VAL A 1 18 ? -3.004  -5.495  3.196   1.00 0.00 ? 18 VAL A N    8  
ATOM 9692  C CA   . VAL A 1 18 ? -3.692  -4.567  4.082   1.00 0.00 ? 18 VAL A CA   8  
ATOM 9693  C C    . VAL A 1 18 ? -2.778  -3.408  4.464   1.00 0.00 ? 18 VAL A C    8  
ATOM 9694  O O    . VAL A 1 18 ? -3.197  -2.251  4.470   1.00 0.00 ? 18 VAL A O    8  
ATOM 9695  C CB   . VAL A 1 18 ? -4.181  -5.273  5.364   1.00 0.00 ? 18 VAL A CB   8  
ATOM 9696  C CG1  . VAL A 1 18 ? -4.895  -4.292  6.283   1.00 0.00 ? 18 VAL A CG1  8  
ATOM 9697  C CG2  . VAL A 1 18 ? -5.087  -6.443  5.017   1.00 0.00 ? 18 VAL A CG2  8  
ATOM 9698  H H    . VAL A 1 18 ? -2.814  -6.406  3.515   1.00 0.00 ? 18 VAL A H    8  
ATOM 9699  H HA   . VAL A 1 18 ? -4.556  -4.173  3.559   1.00 0.00 ? 18 VAL A HA   8  
ATOM 9700  H HB   . VAL A 1 18 ? -3.320  -5.662  5.891   1.00 0.00 ? 18 VAL A HB   8  
ATOM 9701  H HG11 . VAL A 1 18 ? -5.349  -4.828  7.107   1.00 0.00 ? 18 VAL A HG11 8  
ATOM 9702  H HG12 . VAL A 1 18 ? -5.666  -3.769  5.734   1.00 0.00 ? 18 VAL A HG12 8  
ATOM 9703  H HG13 . VAL A 1 18 ? -4.188  -3.578  6.679   1.00 0.00 ? 18 VAL A HG13 8  
ATOM 9704  H HG21 . VAL A 1 18 ? -5.963  -6.080  4.496   1.00 0.00 ? 18 VAL A HG21 8  
ATOM 9705  H HG22 . VAL A 1 18 ? -5.394  -6.943  5.924   1.00 0.00 ? 18 VAL A HG22 8  
ATOM 9706  H HG23 . VAL A 1 18 ? -4.571  -7.139  4.395   1.00 0.00 ? 18 VAL A HG23 8  
ATOM 9707  N N    . VAL A 1 19 ? -1.524  -3.730  4.771   1.00 0.00 ? 19 VAL A N    8  
ATOM 9708  C CA   . VAL A 1 19 ? -0.545  -2.720  5.155   1.00 0.00 ? 19 VAL A CA   8  
ATOM 9709  C C    . VAL A 1 19 ? -0.283  -1.735  4.020   1.00 0.00 ? 19 VAL A C    8  
ATOM 9710  O O    . VAL A 1 19 ? -0.187  -0.532  4.248   1.00 0.00 ? 19 VAL A O    8  
ATOM 9711  C CB   . VAL A 1 19 ? 0.789   -3.360  5.584   1.00 0.00 ? 19 VAL A CB   8  
ATOM 9712  C CG1  . VAL A 1 19 ? 1.803   -2.290  5.960   1.00 0.00 ? 19 VAL A CG1  8  
ATOM 9713  C CG2  . VAL A 1 19 ? 0.573   -4.321  6.741   1.00 0.00 ? 19 VAL A CG2  8  
ATOM 9714  H H    . VAL A 1 19 ? -1.247  -4.674  4.735   1.00 0.00 ? 19 VAL A H    8  
ATOM 9715  H HA   . VAL A 1 19 ? -0.943  -2.172  6.001   1.00 0.00 ? 19 VAL A HA   8  
ATOM 9716  H HB   . VAL A 1 19 ? 1.185   -3.922  4.749   1.00 0.00 ? 19 VAL A HB   8  
ATOM 9717  H HG11 . VAL A 1 19 ? 1.363   -1.597  6.666   1.00 0.00 ? 19 VAL A HG11 8  
ATOM 9718  H HG12 . VAL A 1 19 ? 2.116   -1.754  5.077   1.00 0.00 ? 19 VAL A HG12 8  
ATOM 9719  H HG13 . VAL A 1 19 ? 2.672   -2.752  6.411   1.00 0.00 ? 19 VAL A HG13 8  
ATOM 9720  H HG21 . VAL A 1 19 ? -0.156  -5.056  6.483   1.00 0.00 ? 19 VAL A HG21 8  
ATOM 9721  H HG22 . VAL A 1 19 ? 0.229   -3.773  7.607   1.00 0.00 ? 19 VAL A HG22 8  
ATOM 9722  H HG23 . VAL A 1 19 ? 1.506   -4.813  6.978   1.00 0.00 ? 19 VAL A HG23 8  
ATOM 9723  N N    . LEU A 1 20 ? -0.175  -2.250  2.797   1.00 0.00 ? 20 LEU A N    8  
ATOM 9724  C CA   . LEU A 1 20 ? 0.081   -1.401  1.637   1.00 0.00 ? 20 LEU A CA   8  
ATOM 9725  C C    . LEU A 1 20 ? -1.004  -0.336  1.510   1.00 0.00 ? 20 LEU A C    8  
ATOM 9726  O O    . LEU A 1 20 ? -0.715  0.824   1.220   1.00 0.00 ? 20 LEU A O    8  
ATOM 9727  C CB   . LEU A 1 20 ? 0.156   -2.248  0.359   1.00 0.00 ? 20 LEU A CB   8  
ATOM 9728  C CG   . LEU A 1 20 ? 0.916   -1.620  -0.824  1.00 0.00 ? 20 LEU A CG   8  
ATOM 9729  C CD1  . LEU A 1 20 ? 0.140   -0.454  -1.418  1.00 0.00 ? 20 LEU A CD1  8  
ATOM 9730  C CD2  . LEU A 1 20 ? 2.310   -1.170  -0.401  1.00 0.00 ? 20 LEU A CD2  8  
ATOM 9731  H H    . LEU A 1 20 ? -0.262  -3.224  2.669   1.00 0.00 ? 20 LEU A H    8  
ATOM 9732  H HA   . LEU A 1 20 ? 1.023   -0.910  1.808   1.00 0.00 ? 20 LEU A HA   8  
ATOM 9733  H HB2  . LEU A 1 20 ? 0.655   -3.176  0.606   1.00 0.00 ? 20 LEU A HB2  8  
ATOM 9734  H HB3  . LEU A 1 20 ? -0.849  -2.489  0.033   1.00 0.00 ? 20 LEU A HB3  8  
ATOM 9735  H HG   . LEU A 1 20 ? 1.030   -2.365  -1.598  1.00 0.00 ? 20 LEU A HG   8  
ATOM 9736  H HD11 . LEU A 1 20 ? -0.916  -0.689  -1.456  1.00 0.00 ? 20 LEU A HD11 8  
ATOM 9737  H HD12 . LEU A 1 20 ? 0.494   -0.272  -2.421  1.00 0.00 ? 20 LEU A HD12 8  
ATOM 9738  H HD13 . LEU A 1 20 ? 0.289   0.436   -0.827  1.00 0.00 ? 20 LEU A HD13 8  
ATOM 9739  H HD21 . LEU A 1 20 ? 2.243   -0.312  0.252   1.00 0.00 ? 20 LEU A HD21 8  
ATOM 9740  H HD22 . LEU A 1 20 ? 2.877   -0.902  -1.280  1.00 0.00 ? 20 LEU A HD22 8  
ATOM 9741  H HD23 . LEU A 1 20 ? 2.816   -1.976  0.114   1.00 0.00 ? 20 LEU A HD23 8  
ATOM 9742  N N    . THR A 1 21 ? -2.252  -0.735  1.737   1.00 0.00 ? 21 THR A N    8  
ATOM 9743  C CA   . THR A 1 21 ? -3.372  0.194   1.654   1.00 0.00 ? 21 THR A CA   8  
ATOM 9744  C C    . THR A 1 21 ? -3.254  1.269   2.730   1.00 0.00 ? 21 THR A C    8  
ATOM 9745  O O    . THR A 1 21 ? -3.648  2.416   2.522   1.00 0.00 ? 21 THR A O    8  
ATOM 9746  C CB   . THR A 1 21 ? -4.723  -0.531  1.813   1.00 0.00 ? 21 THR A CB   8  
ATOM 9747  O OG1  . THR A 1 21 ? -4.820  -1.599  0.862   1.00 0.00 ? 21 THR A OG1  8  
ATOM 9748  C CG2  . THR A 1 21 ? -5.883  0.433   1.614   1.00 0.00 ? 21 THR A CG2  8  
ATOM 9749  H H    . THR A 1 21 ? -2.430  -1.677  1.970   1.00 0.00 ? 21 THR A H    8  
ATOM 9750  H HA   . THR A 1 21 ? -3.349  0.667   0.678   1.00 0.00 ? 21 THR A HA   8  
ATOM 9751  H HB   . THR A 1 21 ? -4.785  -0.946  2.811   1.00 0.00 ? 21 THR A HB   8  
ATOM 9752  H HG1  . THR A 1 21 ? -4.747  -1.266  -0.042  1.00 0.00 ? 21 THR A HG1  8  
ATOM 9753  H HG21 . THR A 1 21 ? -5.740  1.001   0.704   1.00 0.00 ? 21 THR A HG21 8  
ATOM 9754  H HG22 . THR A 1 21 ? -5.946  1.108   2.455   1.00 0.00 ? 21 THR A HG22 8  
ATOM 9755  H HG23 . THR A 1 21 ? -6.802  -0.129  1.541   1.00 0.00 ? 21 THR A HG23 8  
ATOM 9756  N N    . ILE A 1 22 ? -2.707  0.884   3.878   1.00 0.00 ? 22 ILE A N    8  
ATOM 9757  C CA   . ILE A 1 22 ? -2.527  1.810   4.989   1.00 0.00 ? 22 ILE A CA   8  
ATOM 9758  C C    . ILE A 1 22 ? -1.439  2.830   4.674   1.00 0.00 ? 22 ILE A C    8  
ATOM 9759  O O    . ILE A 1 22 ? -1.609  4.026   4.912   1.00 0.00 ? 22 ILE A O    8  
ATOM 9760  C CB   . ILE A 1 22 ? -2.162  1.066   6.290   1.00 0.00 ? 22 ILE A CB   8  
ATOM 9761  C CG1  . ILE A 1 22 ? -3.267  0.075   6.673   1.00 0.00 ? 22 ILE A CG1  8  
ATOM 9762  C CG2  . ILE A 1 22 ? -1.908  2.055   7.421   1.00 0.00 ? 22 ILE A CG2  8  
ATOM 9763  C CD1  . ILE A 1 22 ? -4.613  0.723   6.925   1.00 0.00 ? 22 ILE A CD1  8  
ATOM 9764  H H    . ILE A 1 22 ? -2.414  -0.046  3.991   1.00 0.00 ? 22 ILE A H    8  
ATOM 9765  H HA   . ILE A 1 22 ? -3.454  2.346   5.145   1.00 0.00 ? 22 ILE A HA   8  
ATOM 9766  H HB   . ILE A 1 22 ? -1.248  0.519   6.124   1.00 0.00 ? 22 ILE A HB   8  
ATOM 9767  H HG12 . ILE A 1 22 ? -3.395  -0.631  5.882   1.00 0.00 ? 22 ILE A HG12 8  
ATOM 9768  H HG13 . ILE A 1 22 ? -2.979  -0.451  7.573   1.00 0.00 ? 22 ILE A HG13 8  
ATOM 9769  H HG21 . ILE A 1 22 ? -0.973  2.569   7.255   1.00 0.00 ? 22 ILE A HG21 8  
ATOM 9770  H HG22 . ILE A 1 22 ? -1.850  1.526   8.364   1.00 0.00 ? 22 ILE A HG22 8  
ATOM 9771  H HG23 . ILE A 1 22 ? -2.712  2.777   7.469   1.00 0.00 ? 22 ILE A HG23 8  
ATOM 9772  H HD11 . ILE A 1 22 ? -4.998  1.133   6.004   1.00 0.00 ? 22 ILE A HD11 8  
ATOM 9773  H HD12 . ILE A 1 22 ? -4.517  1.509   7.658   1.00 0.00 ? 22 ILE A HD12 8  
ATOM 9774  H HD13 . ILE A 1 22 ? -5.301  -0.023  7.295   1.00 0.00 ? 22 ILE A HD13 8  
ATOM 9775  N N    . ILE A 1 23 ? -0.321  2.350   4.136   1.00 0.00 ? 23 ILE A N    8  
ATOM 9776  C CA   . ILE A 1 23 ? 0.791   3.224   3.788   1.00 0.00 ? 23 ILE A CA   8  
ATOM 9777  C C    . ILE A 1 23 ? 0.370   4.243   2.732   1.00 0.00 ? 23 ILE A C    8  
ATOM 9778  O O    . ILE A 1 23 ? 0.652   5.434   2.857   1.00 0.00 ? 23 ILE A O    8  
ATOM 9779  C CB   . ILE A 1 23 ? 2.000   2.429   3.258   1.00 0.00 ? 23 ILE A CB   8  
ATOM 9780  C CG1  . ILE A 1 23 ? 2.423   1.353   4.264   1.00 0.00 ? 23 ILE A CG1  8  
ATOM 9781  C CG2  . ILE A 1 23 ? 3.157   3.372   2.959   1.00 0.00 ? 23 ILE A CG2  8  
ATOM 9782  C CD1  . ILE A 1 23 ? 2.896   1.905   5.593   1.00 0.00 ? 23 ILE A CD1  8  
ATOM 9783  H H    . ILE A 1 23 ? -0.249  1.384   3.962   1.00 0.00 ? 23 ILE A H    8  
ATOM 9784  H HA   . ILE A 1 23 ? 1.093   3.758   4.680   1.00 0.00 ? 23 ILE A HA   8  
ATOM 9785  H HB   . ILE A 1 23 ? 1.714   1.947   2.332   1.00 0.00 ? 23 ILE A HB   8  
ATOM 9786  H HG12 . ILE A 1 23 ? 1.610   0.693   4.461   1.00 0.00 ? 23 ILE A HG12 8  
ATOM 9787  H HG13 . ILE A 1 23 ? 3.238   0.782   3.842   1.00 0.00 ? 23 ILE A HG13 8  
ATOM 9788  H HG21 . ILE A 1 23 ? 4.046   2.797   2.731   1.00 0.00 ? 23 ILE A HG21 8  
ATOM 9789  H HG22 . ILE A 1 23 ? 3.353   4.000   3.817   1.00 0.00 ? 23 ILE A HG22 8  
ATOM 9790  H HG23 . ILE A 1 23 ? 2.915   3.992   2.108   1.00 0.00 ? 23 ILE A HG23 8  
ATOM 9791  H HD11 . ILE A 1 23 ? 3.746   2.553   5.443   1.00 0.00 ? 23 ILE A HD11 8  
ATOM 9792  H HD12 . ILE A 1 23 ? 3.186   1.085   6.234   1.00 0.00 ? 23 ILE A HD12 8  
ATOM 9793  H HD13 . ILE A 1 23 ? 2.099   2.458   6.065   1.00 0.00 ? 23 ILE A HD13 8  
ATOM 9794  N N    . SER A 1 24 ? -0.314  3.762   1.697   1.00 0.00 ? 24 SER A N    8  
ATOM 9795  C CA   . SER A 1 24 ? -0.771  4.620   0.607   1.00 0.00 ? 24 SER A CA   8  
ATOM 9796  C C    . SER A 1 24 ? -1.851  5.591   1.078   1.00 0.00 ? 24 SER A C    8  
ATOM 9797  O O    . SER A 1 24 ? -1.954  6.708   0.568   1.00 0.00 ? 24 SER A O    8  
ATOM 9798  C CB   . SER A 1 24 ? -1.307  3.769   -0.545  1.00 0.00 ? 24 SER A CB   8  
ATOM 9799  O OG   . SER A 1 24 ? -1.780  4.584   -1.605  1.00 0.00 ? 24 SER A OG   8  
ATOM 9800  H H    . SER A 1 24 ? -0.513  2.796   1.657   1.00 0.00 ? 24 SER A H    8  
ATOM 9801  H HA   . SER A 1 24 ? 0.073   5.190   0.249   1.00 0.00 ? 24 SER A HA   8  
ATOM 9802  H HB2  . SER A 1 24 ? -0.514  3.139   -0.921  1.00 0.00 ? 24 SER A HB2  8  
ATOM 9803  H HB3  . SER A 1 24 ? -2.119  3.150   -0.188  1.00 0.00 ? 24 SER A HB3  8  
ATOM 9804  H HG   . SER A 1 24 ? -2.697  4.824   -1.446  1.00 0.00 ? 24 SER A HG   8  
ATOM 9805  N N    . LEU A 1 25 ? -2.653  5.164   2.049   1.00 0.00 ? 25 LEU A N    8  
ATOM 9806  C CA   . LEU A 1 25 ? -3.726  6.003   2.576   1.00 0.00 ? 25 LEU A CA   8  
ATOM 9807  C C    . LEU A 1 25 ? -3.165  7.263   3.225   1.00 0.00 ? 25 LEU A C    8  
ATOM 9808  O O    . LEU A 1 25 ? -3.648  8.369   2.979   1.00 0.00 ? 25 LEU A O    8  
ATOM 9809  C CB   . LEU A 1 25 ? -4.566  5.225   3.593   1.00 0.00 ? 25 LEU A CB   8  
ATOM 9810  C CG   . LEU A 1 25 ? -5.757  5.991   4.176   1.00 0.00 ? 25 LEU A CG   8  
ATOM 9811  C CD1  . LEU A 1 25 ? -6.772  6.313   3.087   1.00 0.00 ? 25 LEU A CD1  8  
ATOM 9812  C CD2  . LEU A 1 25 ? -6.408  5.193   5.296   1.00 0.00 ? 25 LEU A CD2  8  
ATOM 9813  H H    . LEU A 1 25 ? -2.532  4.260   2.421   1.00 0.00 ? 25 LEU A H    8  
ATOM 9814  H HA   . LEU A 1 25 ? -4.358  6.291   1.748   1.00 0.00 ? 25 LEU A HA   8  
ATOM 9815  H HB2  . LEU A 1 25 ? -4.940  4.334   3.109   1.00 0.00 ? 25 LEU A HB2  8  
ATOM 9816  H HB3  . LEU A 1 25 ? -3.917  4.925   4.406   1.00 0.00 ? 25 LEU A HB3  8  
ATOM 9817  H HG   . LEU A 1 25 ? -5.415  6.925   4.595   1.00 0.00 ? 25 LEU A HG   8  
ATOM 9818  H HD11 . LEU A 1 25 ? -7.617  6.831   3.520   1.00 0.00 ? 25 LEU A HD11 8  
ATOM 9819  H HD12 . LEU A 1 25 ? -7.114  5.398   2.624   1.00 0.00 ? 25 LEU A HD12 8  
ATOM 9820  H HD13 . LEU A 1 25 ? -6.316  6.945   2.340   1.00 0.00 ? 25 LEU A HD13 8  
ATOM 9821  H HD21 . LEU A 1 25 ? -5.680  4.997   6.072   1.00 0.00 ? 25 LEU A HD21 8  
ATOM 9822  H HD22 . LEU A 1 25 ? -6.779  4.254   4.908   1.00 0.00 ? 25 LEU A HD22 8  
ATOM 9823  H HD23 . LEU A 1 25 ? -7.230  5.758   5.714   1.00 0.00 ? 25 LEU A HD23 8  
ATOM 9824  N N    . ILE A 1 26 ? -2.140  7.090   4.054   1.00 0.00 ? 26 ILE A N    8  
ATOM 9825  C CA   . ILE A 1 26 ? -1.512  8.213   4.737   1.00 0.00 ? 26 ILE A CA   8  
ATOM 9826  C C    . ILE A 1 26 ? -0.922  9.199   3.734   1.00 0.00 ? 26 ILE A C    8  
ATOM 9827  O O    . ILE A 1 26 ? -0.996  10.413  3.925   1.00 0.00 ? 26 ILE A O    8  
ATOM 9828  C CB   . ILE A 1 26 ? -0.407  7.741   5.702   1.00 0.00 ? 26 ILE A CB   8  
ATOM 9829  C CG1  . ILE A 1 26 ? -0.983  6.735   6.703   1.00 0.00 ? 26 ILE A CG1  8  
ATOM 9830  C CG2  . ILE A 1 26 ? 0.211   8.933   6.424   1.00 0.00 ? 26 ILE A CG2  8  
ATOM 9831  C CD1  . ILE A 1 26 ? 0.044   6.168   7.660   1.00 0.00 ? 26 ILE A CD1  8  
ATOM 9832  H H    . ILE A 1 26 ? -1.793  6.181   4.201   1.00 0.00 ? 26 ILE A H    8  
ATOM 9833  H HA   . ILE A 1 26 ? -2.275  8.722   5.316   1.00 0.00 ? 26 ILE A HA   8  
ATOM 9834  H HB   . ILE A 1 26 ? 0.369   7.257   5.125   1.00 0.00 ? 26 ILE A HB   8  
ATOM 9835  H HG12 . ILE A 1 26 ? -1.744  7.221   7.296   1.00 0.00 ? 26 ILE A HG12 8  
ATOM 9836  H HG13 . ILE A 1 26 ? -1.425  5.911   6.183   1.00 0.00 ? 26 ILE A HG13 8  
ATOM 9837  H HG21 . ILE A 1 26 ? 0.659   9.609   5.713   1.00 0.00 ? 26 ILE A HG21 8  
ATOM 9838  H HG22 . ILE A 1 26 ? 0.979   8.595   7.103   1.00 0.00 ? 26 ILE A HG22 8  
ATOM 9839  H HG23 . ILE A 1 26 ? -0.553  9.456   6.982   1.00 0.00 ? 26 ILE A HG23 8  
ATOM 9840  H HD11 . ILE A 1 26 ? -0.391  5.342   8.202   1.00 0.00 ? 26 ILE A HD11 8  
ATOM 9841  H HD12 . ILE A 1 26 ? 0.348   6.933   8.358   1.00 0.00 ? 26 ILE A HD12 8  
ATOM 9842  H HD13 . ILE A 1 26 ? 0.906   5.819   7.108   1.00 0.00 ? 26 ILE A HD13 8  
ATOM 9843  N N    . ILE A 1 27 ? -0.330  8.670   2.667   1.00 0.00 ? 27 ILE A N    8  
ATOM 9844  C CA   . ILE A 1 27 ? 0.266   9.506   1.630   1.00 0.00 ? 27 ILE A CA   8  
ATOM 9845  C C    . ILE A 1 27 ? -0.801  10.293  0.883   1.00 0.00 ? 27 ILE A C    8  
ATOM 9846  O O    . ILE A 1 27 ? -0.603  11.459  0.540   1.00 0.00 ? 27 ILE A O    8  
ATOM 9847  C CB   . ILE A 1 27 ? 1.057   8.664   0.612   1.00 0.00 ? 27 ILE A CB   8  
ATOM 9848  C CG1  . ILE A 1 27 ? 2.054   7.758   1.329   1.00 0.00 ? 27 ILE A CG1  8  
ATOM 9849  C CG2  . ILE A 1 27 ? 1.777   9.571   -0.377  1.00 0.00 ? 27 ILE A CG2  8  
ATOM 9850  C CD1  . ILE A 1 27 ? 2.685   6.725   0.423   1.00 0.00 ? 27 ILE A CD1  8  
ATOM 9851  H H    . ILE A 1 27 ? -0.308  7.692   2.567   1.00 0.00 ? 27 ILE A H    8  
ATOM 9852  H HA   . ILE A 1 27 ? 0.950   10.201  2.105   1.00 0.00 ? 27 ILE A HA   8  
ATOM 9853  H HB   . ILE A 1 27 ? 0.357   8.050   0.057   1.00 0.00 ? 27 ILE A HB   8  
ATOM 9854  H HG12 . ILE A 1 27 ? 2.853   8.360   1.741   1.00 0.00 ? 27 ILE A HG12 8  
ATOM 9855  H HG13 . ILE A 1 27 ? 1.579   7.235   2.127   1.00 0.00 ? 27 ILE A HG13 8  
ATOM 9856  H HG21 . ILE A 1 27 ? 2.359   8.974   -1.066  1.00 0.00 ? 27 ILE A HG21 8  
ATOM 9857  H HG22 . ILE A 1 27 ? 2.437   10.240  0.156   1.00 0.00 ? 27 ILE A HG22 8  
ATOM 9858  H HG23 . ILE A 1 27 ? 1.060   10.150  -0.939  1.00 0.00 ? 27 ILE A HG23 8  
ATOM 9859  H HD11 . ILE A 1 27 ? 3.387   7.209   -0.239  1.00 0.00 ? 27 ILE A HD11 8  
ATOM 9860  H HD12 . ILE A 1 27 ? 1.923   6.230   -0.161  1.00 0.00 ? 27 ILE A HD12 8  
ATOM 9861  H HD13 . ILE A 1 27 ? 3.206   5.994   1.023   1.00 0.00 ? 27 ILE A HD13 8  
ATOM 9862  N N    . LEU A 1 28 ? -1.935  9.645   0.629   1.00 0.00 ? 28 LEU A N    8  
ATOM 9863  C CA   . LEU A 1 28 ? -3.037  10.276  -0.086  1.00 0.00 ? 28 LEU A CA   8  
ATOM 9864  C C    . LEU A 1 28 ? -3.551  11.500  0.664   1.00 0.00 ? 28 LEU A C    8  
ATOM 9865  O O    . LEU A 1 28 ? -3.775  12.554  0.069   1.00 0.00 ? 28 LEU A O    8  
ATOM 9866  C CB   . LEU A 1 28 ? -4.178  9.275   -0.290  1.00 0.00 ? 28 LEU A CB   8  
ATOM 9867  C CG   . LEU A 1 28 ? -5.360  9.799   -1.108  1.00 0.00 ? 28 LEU A CG   8  
ATOM 9868  C CD1  . LEU A 1 28 ? -4.944  10.054  -2.550  1.00 0.00 ? 28 LEU A CD1  8  
ATOM 9869  C CD2  . LEU A 1 28 ? -6.521  8.818   -1.055  1.00 0.00 ? 28 LEU A CD2  8  
ATOM 9870  H H    . LEU A 1 28 ? -2.035  8.708   0.922   1.00 0.00 ? 28 LEU A H    8  
ATOM 9871  H HA   . LEU A 1 28 ? -2.670  10.589  -1.052  1.00 0.00 ? 28 LEU A HA   8  
ATOM 9872  H HB2  . LEU A 1 28 ? -3.775  8.399   -0.783  1.00 0.00 ? 28 LEU A HB2  8  
ATOM 9873  H HB3  . LEU A 1 28 ? -4.540  8.976   0.687   1.00 0.00 ? 28 LEU A HB3  8  
ATOM 9874  H HG   . LEU A 1 28 ? -5.702  10.735  -0.692  1.00 0.00 ? 28 LEU A HG   8  
ATOM 9875  H HD11 . LEU A 1 28 ? -5.795  10.410  -3.116  1.00 0.00 ? 28 LEU A HD11 8  
ATOM 9876  H HD12 . LEU A 1 28 ? -4.579  9.138   -2.993  1.00 0.00 ? 28 LEU A HD12 8  
ATOM 9877  H HD13 . LEU A 1 28 ? -4.164  10.801  -2.576  1.00 0.00 ? 28 LEU A HD13 8  
ATOM 9878  H HD21 . LEU A 1 28 ? -6.822  8.668   -0.027  1.00 0.00 ? 28 LEU A HD21 8  
ATOM 9879  H HD22 . LEU A 1 28 ? -6.220  7.871   -1.482  1.00 0.00 ? 28 LEU A HD22 8  
ATOM 9880  H HD23 . LEU A 1 28 ? -7.357  9.214   -1.616  1.00 0.00 ? 28 LEU A HD23 8  
ATOM 9881  N N    . ILE A 1 29 ? -3.735  11.353  1.970   1.00 0.00 ? 29 ILE A N    8  
ATOM 9882  C CA   . ILE A 1 29 ? -4.229  12.445  2.804   1.00 0.00 ? 29 ILE A CA   8  
ATOM 9883  C C    . ILE A 1 29 ? -3.149  13.496  3.041   1.00 0.00 ? 29 ILE A C    8  
ATOM 9884  O O    . ILE A 1 29 ? -3.414  14.697  2.978   1.00 0.00 ? 29 ILE A O    8  
ATOM 9885  C CB   . ILE A 1 29 ? -4.736  11.926  4.164   1.00 0.00 ? 29 ILE A CB   8  
ATOM 9886  C CG1  . ILE A 1 29 ? -5.712  10.760  3.963   1.00 0.00 ? 29 ILE A CG1  8  
ATOM 9887  C CG2  . ILE A 1 29 ? -5.400  13.050  4.947   1.00 0.00 ? 29 ILE A CG2  8  
ATOM 9888  C CD1  . ILE A 1 29 ? -6.934  11.118  3.142   1.00 0.00 ? 29 ILE A CD1  8  
ATOM 9889  H H    . ILE A 1 29 ? -3.528  10.486  2.389   1.00 0.00 ? 29 ILE A H    8  
ATOM 9890  H HA   . ILE A 1 29 ? -5.059  12.917  2.289   1.00 0.00 ? 29 ILE A HA   8  
ATOM 9891  H HB   . ILE A 1 29 ? -3.888  11.573  4.734   1.00 0.00 ? 29 ILE A HB   8  
ATOM 9892  H HG12 . ILE A 1 29 ? -5.217  9.950   3.471   1.00 0.00 ? 29 ILE A HG12 8  
ATOM 9893  H HG13 . ILE A 1 29 ? -6.058  10.418  4.929   1.00 0.00 ? 29 ILE A HG13 8  
ATOM 9894  H HG21 . ILE A 1 29 ? -4.659  13.780  5.236   1.00 0.00 ? 29 ILE A HG21 8  
ATOM 9895  H HG22 . ILE A 1 29 ? -5.864  12.650  5.839   1.00 0.00 ? 29 ILE A HG22 8  
ATOM 9896  H HG23 . ILE A 1 29 ? -6.155  13.528  4.338   1.00 0.00 ? 29 ILE A HG23 8  
ATOM 9897  H HD11 . ILE A 1 29 ? -6.636  11.394  2.142   1.00 0.00 ? 29 ILE A HD11 8  
ATOM 9898  H HD12 . ILE A 1 29 ? -7.460  11.940  3.602   1.00 0.00 ? 29 ILE A HD12 8  
ATOM 9899  H HD13 . ILE A 1 29 ? -7.590  10.262  3.092   1.00 0.00 ? 29 ILE A HD13 8  
ATOM 9900  N N    . MET A 1 30 ? -1.932  13.038  3.318   1.00 0.00 ? 30 MET A N    8  
ATOM 9901  C CA   . MET A 1 30 ? -0.811  13.938  3.568   1.00 0.00 ? 30 MET A CA   8  
ATOM 9902  C C    . MET A 1 30 ? -0.568  14.851  2.369   1.00 0.00 ? 30 MET A C    8  
ATOM 9903  O O    . MET A 1 30 ? -0.259  16.032  2.528   1.00 0.00 ? 30 MET A O    8  
ATOM 9904  C CB   . MET A 1 30 ? 0.454   13.137  3.882   1.00 0.00 ? 30 MET A CB   8  
ATOM 9905  C CG   . MET A 1 30 ? 1.678   14.003  4.142   1.00 0.00 ? 30 MET A CG   8  
ATOM 9906  S SD   . MET A 1 30 ? 3.154   13.032  4.503   1.00 0.00 ? 30 MET A SD   8  
ATOM 9907  C CE   . MET A 1 30 ? 2.677   12.234  6.034   1.00 0.00 ? 30 MET A CE   8  
ATOM 9908  H H    . MET A 1 30 ? -1.779  12.064  3.361   1.00 0.00 ? 30 MET A H    8  
ATOM 9909  H HA   . MET A 1 30 ? -1.057  14.550  4.425   1.00 0.00 ? 30 MET A HA   8  
ATOM 9910  H HB2  . MET A 1 30 ? 0.267   12.535  4.759   1.00 0.00 ? 30 MET A HB2  8  
ATOM 9911  H HB3  . MET A 1 30 ? 0.667   12.483  3.047   1.00 0.00 ? 30 MET A HB3  8  
ATOM 9912  H HG2  . MET A 1 30 ? 1.880   14.607  3.271   1.00 0.00 ? 30 MET A HG2  8  
ATOM 9913  H HG3  . MET A 1 30 ? 1.474   14.645  4.985   1.00 0.00 ? 30 MET A HG3  8  
ATOM 9914  H HE1  . MET A 1 30 ? 1.969   11.446  5.824   1.00 0.00 ? 30 MET A HE1  8  
ATOM 9915  H HE2  . MET A 1 30 ? 2.222   12.960  6.692   1.00 0.00 ? 30 MET A HE2  8  
ATOM 9916  H HE3  . MET A 1 30 ? 3.552   11.815  6.509   1.00 0.00 ? 30 MET A HE3  8  
ATOM 9917  N N    . LEU A 1 31 ? -0.707  14.295  1.172   1.00 0.00 ? 31 LEU A N    8  
ATOM 9918  C CA   . LEU A 1 31 ? -0.509  15.063  -0.053  1.00 0.00 ? 31 LEU A CA   8  
ATOM 9919  C C    . LEU A 1 31 ? -1.758  15.871  -0.385  1.00 0.00 ? 31 LEU A C    8  
ATOM 9920  O O    . LEU A 1 31 ? -1.678  16.936  -0.996  1.00 0.00 ? 31 LEU A O    8  
ATOM 9921  C CB   . LEU A 1 31 ? -0.161  14.129  -1.216  1.00 0.00 ? 31 LEU A CB   8  
ATOM 9922  C CG   . LEU A 1 31 ? 0.107   14.826  -2.552  1.00 0.00 ? 31 LEU A CG   8  
ATOM 9923  C CD1  . LEU A 1 31 ? 1.368   15.672  -2.472  1.00 0.00 ? 31 LEU A CD1  8  
ATOM 9924  C CD2  . LEU A 1 31 ? 0.219   13.801  -3.671  1.00 0.00 ? 31 LEU A CD2  8  
ATOM 9925  H H    . LEU A 1 31 ? -0.954  13.343  1.100   1.00 0.00 ? 31 LEU A H    8  
ATOM 9926  H HA   . LEU A 1 31 ? 0.316   15.748  0.101   1.00 0.00 ? 31 LEU A HA   8  
ATOM 9927  H HB2  . LEU A 1 31 ? 0.716   13.558  -0.940  1.00 0.00 ? 31 LEU A HB2  8  
ATOM 9928  H HB3  . LEU A 1 31 ? -0.986  13.439  -1.347  1.00 0.00 ? 31 LEU A HB3  8  
ATOM 9929  H HG   . LEU A 1 31 ? -0.717  15.482  -2.790  1.00 0.00 ? 31 LEU A HG   8  
ATOM 9930  H HD11 . LEU A 1 31 ? 1.248   16.433  -1.716  1.00 0.00 ? 31 LEU A HD11 8  
ATOM 9931  H HD12 . LEU A 1 31 ? 1.547   16.148  -3.427  1.00 0.00 ? 31 LEU A HD12 8  
ATOM 9932  H HD13 . LEU A 1 31 ? 2.213   15.046  -2.220  1.00 0.00 ? 31 LEU A HD13 8  
ATOM 9933  H HD21 . LEU A 1 31 ? 0.382   14.308  -4.612  1.00 0.00 ? 31 LEU A HD21 8  
ATOM 9934  H HD22 . LEU A 1 31 ? -0.696  13.228  -3.730  1.00 0.00 ? 31 LEU A HD22 8  
ATOM 9935  H HD23 . LEU A 1 31 ? 1.048   13.134  -3.475  1.00 0.00 ? 31 LEU A HD23 8  
ATOM 9936  N N    . TRP A 1 32 ? -2.915  15.355  0.023   1.00 0.00 ? 32 TRP A N    8  
ATOM 9937  C CA   . TRP A 1 32 ? -4.185  16.028  -0.223  1.00 0.00 ? 32 TRP A CA   8  
ATOM 9938  C C    . TRP A 1 32 ? -4.222  17.375  0.492   1.00 0.00 ? 32 TRP A C    8  
ATOM 9939  O O    . TRP A 1 32 ? -4.841  18.326  0.015   1.00 0.00 ? 32 TRP A O    8  
ATOM 9940  C CB   . TRP A 1 32 ? -5.349  15.148  0.244   1.00 0.00 ? 32 TRP A CB   8  
ATOM 9941  C CG   . TRP A 1 32 ? -6.693  15.791  0.082   1.00 0.00 ? 32 TRP A CG   8  
ATOM 9942  C CD1  . TRP A 1 32 ? -7.236  16.283  -1.069  1.00 0.00 ? 32 TRP A CD1  8  
ATOM 9943  C CD2  . TRP A 1 32 ? -7.669  16.006  1.109   1.00 0.00 ? 32 TRP A CD2  8  
ATOM 9944  N NE1  . TRP A 1 32 ? -8.487  16.793  -0.821  1.00 0.00 ? 32 TRP A NE1  8  
ATOM 9945  C CE2  . TRP A 1 32 ? -8.776  16.633  0.508   1.00 0.00 ? 32 TRP A CE2  8  
ATOM 9946  C CE3  . TRP A 1 32 ? -7.714  15.727  2.479   1.00 0.00 ? 32 TRP A CE3  8  
ATOM 9947  C CZ2  . TRP A 1 32 ? -9.913  16.988  1.231   1.00 0.00 ? 32 TRP A CZ2  8  
ATOM 9948  C CZ3  . TRP A 1 32 ? -8.843  16.080  3.195   1.00 0.00 ? 32 TRP A CZ3  8  
ATOM 9949  C CH2  . TRP A 1 32 ? -9.929  16.704  2.568   1.00 0.00 ? 32 TRP A CH2  8  
ATOM 9950  H H    . TRP A 1 32 ? -2.924  14.496  0.502   1.00 0.00 ? 32 TRP A H    8  
ATOM 9951  H HA   . TRP A 1 32 ? -4.279  16.196  -1.288  1.00 0.00 ? 32 TRP A HA   8  
ATOM 9952  H HB2  . TRP A 1 32 ? -5.356  14.242  -0.339  1.00 0.00 ? 32 TRP A HB2  8  
ATOM 9953  H HB3  . TRP A 1 32 ? -5.211  14.901  1.286   1.00 0.00 ? 32 TRP A HB3  8  
ATOM 9954  H HD1  . TRP A 1 32 ? -6.741  16.270  -2.029  1.00 0.00 ? 32 TRP A HD1  8  
ATOM 9955  H HE1  . TRP A 1 32 ? -9.077  17.202  -1.488  1.00 0.00 ? 32 TRP A HE1  8  
ATOM 9956  H HE3  . TRP A 1 32 ? -6.886  15.246  2.978   1.00 0.00 ? 32 TRP A HE3  8  
ATOM 9957  H HZ2  . TRP A 1 32 ? -10.760 17.469  0.764   1.00 0.00 ? 32 TRP A HZ2  8  
ATOM 9958  H HZ3  . TRP A 1 32 ? -8.895  15.874  4.254   1.00 0.00 ? 32 TRP A HZ3  8  
ATOM 9959  H HH2  . TRP A 1 32 ? -10.791 16.963  3.165   1.00 0.00 ? 32 TRP A HH2  8  
ATOM 9960  N N    . GLN A 1 33 ? -3.555  17.445  1.640   1.00 0.00 ? 33 GLN A N    8  
ATOM 9961  C CA   . GLN A 1 33 ? -3.501  18.675  2.421   1.00 0.00 ? 33 GLN A CA   8  
ATOM 9962  C C    . GLN A 1 33 ? -2.135  19.340  2.289   1.00 0.00 ? 33 GLN A C    8  
ATOM 9963  O O    . GLN A 1 33 ? -1.957  20.493  2.685   1.00 0.00 ? 33 GLN A O    8  
ATOM 9964  C CB   . GLN A 1 33 ? -3.798  18.384  3.893   1.00 0.00 ? 33 GLN A CB   8  
ATOM 9965  C CG   . GLN A 1 33 ? -5.199  17.849  4.138   1.00 0.00 ? 33 GLN A CG   8  
ATOM 9966  C CD   . GLN A 1 33 ? -6.277  18.857  3.790   1.00 0.00 ? 33 GLN A CD   8  
ATOM 9967  O OE1  . GLN A 1 33 ? -6.703  19.642  4.634   1.00 0.00 ? 33 GLN A OE1  8  
ATOM 9968  N NE2  . GLN A 1 33 ? -6.720  18.843  2.537   1.00 0.00 ? 33 GLN A NE2  8  
ATOM 9969  H H    . GLN A 1 33 ? -3.083  16.653  1.986   1.00 0.00 ? 33 GLN A H    8  
ATOM 9970  H HA   . GLN A 1 33 ? -4.243  19.369  2.050   1.00 0.00 ? 33 GLN A HA   8  
ATOM 9971  H HB2  . GLN A 1 33 ? -3.092  17.648  4.251   1.00 0.00 ? 33 GLN A HB2  8  
ATOM 9972  H HB3  . GLN A 1 33 ? -3.678  19.294  4.470   1.00 0.00 ? 33 GLN A HB3  8  
ATOM 9973  H HG2  . GLN A 1 33 ? -5.344  16.959  3.541   1.00 0.00 ? 33 GLN A HG2  8  
ATOM 9974  H HG3  . GLN A 1 33 ? -5.292  17.595  5.184   1.00 0.00 ? 33 GLN A HG3  8  
ATOM 9975  H HE21 . GLN A 1 33 ? -6.341  18.202  1.906   1.00 0.00 ? 33 GLN A HE21 8  
ATOM 9976  H HE22 . GLN A 1 33 ? -7.419  19.486  2.293   1.00 0.00 ? 33 GLN A HE22 8  
ATOM 9977  N N    . LYS A 1 34 ? -1.174  18.604  1.739   1.00 0.00 ? 34 LYS A N    8  
ATOM 9978  C CA   . LYS A 1 34 ? 0.181   19.118  1.552   1.00 0.00 ? 34 LYS A CA   8  
ATOM 9979  C C    . LYS A 1 34 ? 0.812   19.487  2.895   1.00 0.00 ? 34 LYS A C    8  
ATOM 9980  O O    . LYS A 1 34 ? 1.842   20.158  2.947   1.00 0.00 ? 34 LYS A O    8  
ATOM 9981  C CB   . LYS A 1 34 ? 0.164   20.337  0.623   1.00 0.00 ? 34 LYS A CB   8  
ATOM 9982  C CG   . LYS A 1 34 ? 1.530   20.698  0.056   1.00 0.00 ? 34 LYS A CG   8  
ATOM 9983  C CD   . LYS A 1 34 ? 1.468   21.955  -0.799  1.00 0.00 ? 34 LYS A CD   8  
ATOM 9984  C CE   . LYS A 1 34 ? 0.648   21.737  -2.061  1.00 0.00 ? 34 LYS A CE   8  
ATOM 9985  N NZ   . LYS A 1 34 ? 0.579   22.969  -2.897  1.00 0.00 ? 34 LYS A NZ   8  
ATOM 9986  H H    . LYS A 1 34 ? -1.349  17.695  1.452   1.00 0.00 ? 34 LYS A H    8  
ATOM 9987  H HA   . LYS A 1 34 ? 0.767   18.332  1.097   1.00 0.00 ? 34 LYS A HA   8  
ATOM 9988  H HB2  . LYS A 1 34 ? -0.497  20.118  -0.201  1.00 0.00 ? 34 LYS A HB2  8  
ATOM 9989  H HB3  . LYS A 1 34 ? -0.222  21.195  1.160   1.00 0.00 ? 34 LYS A HB3  8  
ATOM 9990  H HG2  . LYS A 1 34 ? 2.218   20.873  0.863   1.00 0.00 ? 34 LYS A HG2  8  
ATOM 9991  H HG3  . LYS A 1 34 ? 1.888   19.876  -0.548  1.00 0.00 ? 34 LYS A HG3  8  
ATOM 9992  H HD2  . LYS A 1 34 ? 1.023   22.757  -0.226  1.00 0.00 ? 34 LYS A HD2  8  
ATOM 9993  H HD3  . LYS A 1 34 ? 2.474   22.232  -1.081  1.00 0.00 ? 34 LYS A HD3  8  
ATOM 9994  H HE2  . LYS A 1 34 ? 1.101   20.947  -2.642  1.00 0.00 ? 34 LYS A HE2  8  
ATOM 9995  H HE3  . LYS A 1 34 ? -0.357  21.453  -1.791  1.00 0.00 ? 34 LYS A HE3  8  
ATOM 9996  H HZ1  . LYS A 1 34 ? 0.013   22.787  -3.751  1.00 0.00 ? 34 LYS A HZ1  8  
ATOM 9997  H HZ2  . LYS A 1 34 ? 1.534   23.264  -3.188  1.00 0.00 ? 34 LYS A HZ2  8  
ATOM 9998  H HZ3  . LYS A 1 34 ? 0.136   23.745  -2.362  1.00 0.00 ? 34 LYS A HZ3  8  
ATOM 9999  N N    . LYS A 1 35 ? 0.188   19.036  3.981   1.00 0.00 ? 35 LYS A N    8  
ATOM 10000 C CA   . LYS A 1 35 ? 0.687   19.319  5.324   1.00 0.00 ? 35 LYS A CA   8  
ATOM 10001 C C    . LYS A 1 35 ? 1.248   18.053  5.976   1.00 0.00 ? 35 LYS A C    8  
ATOM 10002 O O    . LYS A 1 35 ? 0.821   16.944  5.653   1.00 0.00 ? 35 LYS A O    8  
ATOM 10003 C CB   . LYS A 1 35 ? -0.429  19.900  6.195   1.00 0.00 ? 35 LYS A CB   8  
ATOM 10004 C CG   . LYS A 1 35 ? -0.950  21.241  5.703   1.00 0.00 ? 35 LYS A CG   8  
ATOM 10005 C CD   . LYS A 1 35 ? -2.089  21.748  6.573   1.00 0.00 ? 35 LYS A CD   8  
ATOM 10006 C CE   . LYS A 1 35 ? -2.612  23.089  6.085   1.00 0.00 ? 35 LYS A CE   8  
ATOM 10007 N NZ   . LYS A 1 35 ? -3.135  23.008  4.694   1.00 0.00 ? 35 LYS A NZ   8  
ATOM 10008 H H    . LYS A 1 35 ? -0.611  18.482  3.910   1.00 0.00 ? 35 LYS A H    8  
ATOM 10009 H HA   . LYS A 1 35 ? 1.478   20.054  5.249   1.00 0.00 ? 35 LYS A HA   8  
ATOM 10010 H HB2  . LYS A 1 35 ? -1.253  19.199  6.210   1.00 0.00 ? 35 LYS A HB2  8  
ATOM 10011 H HB3  . LYS A 1 35 ? -0.063  20.031  7.205   1.00 0.00 ? 35 LYS A HB3  8  
ATOM 10012 H HG2  . LYS A 1 35 ? -0.142  21.958  5.728   1.00 0.00 ? 35 LYS A HG2  8  
ATOM 10013 H HG3  . LYS A 1 35 ? -1.298  21.129  4.698   1.00 0.00 ? 35 LYS A HG3  8  
ATOM 10014 H HD2  . LYS A 1 35 ? -2.898  21.032  6.549   1.00 0.00 ? 35 LYS A HD2  8  
ATOM 10015 H HD3  . LYS A 1 35 ? -1.735  21.861  7.588   1.00 0.00 ? 35 LYS A HD3  8  
ATOM 10016 H HE2  . LYS A 1 35 ? -3.409  23.408  6.740   1.00 0.00 ? 35 LYS A HE2  8  
ATOM 10017 H HE3  . LYS A 1 35 ? -1.810  23.813  6.119   1.00 0.00 ? 35 LYS A HE3  8  
ATOM 10018 H HZ1  . LYS A 1 35 ? -2.352  22.898  4.020   1.00 0.00 ? 35 LYS A HZ1  8  
ATOM 10019 H HZ2  . LYS A 1 35 ? -3.651  23.880  4.461   1.00 0.00 ? 35 LYS A HZ2  8  
ATOM 10020 H HZ3  . LYS A 1 35 ? -3.787  22.201  4.591   1.00 0.00 ? 35 LYS A HZ3  8  
ATOM 10021 N N    . PRO A 1 36 ? 2.213   18.201  6.904   1.00 0.00 ? 36 PRO A N    8  
ATOM 10022 C CA   . PRO A 1 36 ? 2.821   17.061  7.597   1.00 0.00 ? 36 PRO A CA   8  
ATOM 10023 C C    . PRO A 1 36 ? 1.906   16.482  8.673   1.00 0.00 ? 36 PRO A C    8  
ATOM 10024 O O    . PRO A 1 36 ? 1.193   17.216  9.355   1.00 0.00 ? 36 PRO A O    8  
ATOM 10025 C CB   . PRO A 1 36 ? 4.072   17.664  8.231   1.00 0.00 ? 36 PRO A CB   8  
ATOM 10026 C CG   . PRO A 1 36 ? 3.725   19.095  8.462   1.00 0.00 ? 36 PRO A CG   8  
ATOM 10027 C CD   . PRO A 1 36 ? 2.788   19.487  7.350   1.00 0.00 ? 36 PRO A CD   8  
ATOM 10028 H HA   . PRO A 1 36 ? 3.109   16.282  6.901   1.00 0.00 ? 36 PRO A HA   8  
ATOM 10029 H HB2  . PRO A 1 36 ? 4.317   17.158  9.158   1.00 0.00 ? 36 PRO A HB2  8  
ATOM 10030 H HB3  . PRO A 1 36 ? 4.899   17.573  7.543   1.00 0.00 ? 36 PRO A HB3  8  
ATOM 10031 H HG2  . PRO A 1 36 ? 3.236   19.203  9.419   1.00 0.00 ? 36 PRO A HG2  8  
ATOM 10032 H HG3  . PRO A 1 36 ? 4.620   19.699  8.427   1.00 0.00 ? 36 PRO A HG3  8  
ATOM 10033 H HD2  . PRO A 1 36 ? 2.020   20.145  7.724   1.00 0.00 ? 36 PRO A HD2  8  
ATOM 10034 H HD3  . PRO A 1 36 ? 3.334   19.962  6.548   1.00 0.00 ? 36 PRO A HD3  8  
ATOM 10035 N N    . ARG A 1 37 ? 1.932   15.160  8.815   1.00 0.00 ? 37 ARG A N    8  
ATOM 10036 C CA   . ARG A 1 37 ? 1.107   14.482  9.808   1.00 0.00 ? 37 ARG A CA   8  
ATOM 10037 C C    . ARG A 1 37 ? 1.962   13.590  10.703  1.00 0.00 ? 37 ARG A C    8  
ATOM 10038 O O    . ARG A 1 37 ? 2.883   12.922  10.231  1.00 0.00 ? 37 ARG A O    8  
ATOM 10039 C CB   . ARG A 1 37 ? 0.019   13.651  9.124   1.00 0.00 ? 37 ARG A CB   8  
ATOM 10040 C CG   . ARG A 1 37 ? -0.849  14.452  8.169   1.00 0.00 ? 37 ARG A CG   8  
ATOM 10041 C CD   . ARG A 1 37 ? -2.062  13.656  7.716   1.00 0.00 ? 37 ARG A CD   8  
ATOM 10042 N NE   . ARG A 1 37 ? -2.977  13.383  8.822   1.00 0.00 ? 37 ARG A NE   8  
ATOM 10043 C CZ   . ARG A 1 37 ? -3.978  12.508  8.759   1.00 0.00 ? 37 ARG A CZ   8  
ATOM 10044 N NH1  . ARG A 1 37 ? -4.190  11.812  7.648   1.00 0.00 ? 37 ARG A NH1  8  
ATOM 10045 N NH2  . ARG A 1 37 ? -4.767  12.326  9.811   1.00 0.00 ? 37 ARG A NH2  8  
ATOM 10046 H H    . ARG A 1 37 ? 2.519   14.617  8.239   1.00 0.00 ? 37 ARG A H    8  
ATOM 10047 H HA   . ARG A 1 37 ? 0.623   15.225  10.433  1.00 0.00 ? 37 ARG A HA   8  
ATOM 10048 H HB2  . ARG A 1 37 ? 0.485   12.852  8.562   1.00 0.00 ? 37 ARG A HB2  8  
ATOM 10049 H HB3  . ARG A 1 37 ? -0.616  13.220  9.888   1.00 0.00 ? 37 ARG A HB3  8  
ATOM 10050 H HG2  . ARG A 1 37 ? -1.191  15.350  8.666   1.00 0.00 ? 37 ARG A HG2  8  
ATOM 10051 H HG3  . ARG A 1 37 ? -0.262  14.719  7.303   1.00 0.00 ? 37 ARG A HG3  8  
ATOM 10052 H HD2  . ARG A 1 37 ? -2.586  14.225  6.961   1.00 0.00 ? 37 ARG A HD2  8  
ATOM 10053 H HD3  . ARG A 1 37 ? -1.722  12.720  7.290   1.00 0.00 ? 37 ARG A HD3  8  
ATOM 10054 H HE   . ARG A 1 37 ? -2.845  13.883  9.661   1.00 0.00 ? 37 ARG A HE   8  
ATOM 10055 H HH11 . ARG A 1 37 ? -3.613  11.928  6.845   1.00 0.00 ? 37 ARG A HH11 8  
ATOM 10056 H HH12 . ARG A 1 37 ? -4.946  11.155  7.612   1.00 0.00 ? 37 ARG A HH12 8  
ATOM 10057 H HH21 . ARG A 1 37 ? -4.611  12.846  10.653  1.00 0.00 ? 37 ARG A HH21 8  
ATOM 10058 H HH22 . ARG A 1 37 ? -5.522  11.668  9.767   1.00 0.00 ? 37 ARG A HH22 8  
ATOM 10059 N N    . TYR A 1 38 ? 1.654   13.584  11.997  1.00 0.00 ? 38 TYR A N    8  
ATOM 10060 C CA   . TYR A 1 38 ? 2.400   12.776  12.956  1.00 0.00 ? 38 TYR A CA   8  
ATOM 10061 C C    . TYR A 1 38 ? 1.462   11.908  13.792  1.00 0.00 ? 38 TYR A C    8  
ATOM 10062 O O    . TYR A 1 38 ? 0.293   12.243  13.981  1.00 0.00 ? 38 TYR A O    8  
ATOM 10063 C CB   . TYR A 1 38 ? 3.233   13.673  13.873  1.00 0.00 ? 38 TYR A CB   8  
ATOM 10064 C CG   . TYR A 1 38 ? 2.415   14.680  14.648  1.00 0.00 ? 38 TYR A CG   8  
ATOM 10065 C CD1  . TYR A 1 38 ? 2.030   15.882  14.069  1.00 0.00 ? 38 TYR A CD1  8  
ATOM 10066 C CD2  . TYR A 1 38 ? 2.028   14.430  15.959  1.00 0.00 ? 38 TYR A CD2  8  
ATOM 10067 C CE1  . TYR A 1 38 ? 1.283   16.807  14.773  1.00 0.00 ? 38 TYR A CE1  8  
ATOM 10068 C CE2  . TYR A 1 38 ? 1.280   15.350  16.670  1.00 0.00 ? 38 TYR A CE2  8  
ATOM 10069 C CZ   . TYR A 1 38 ? 0.911   16.536  16.073  1.00 0.00 ? 38 TYR A CZ   8  
ATOM 10070 O OH   . TYR A 1 38 ? 0.165   17.454  16.776  1.00 0.00 ? 38 TYR A OH   8  
ATOM 10071 H H    . TYR A 1 38 ? 0.906   14.135  12.323  1.00 0.00 ? 38 TYR A H    8  
ATOM 10072 H HA   . TYR A 1 38 ? 3.075   12.119  12.419  1.00 0.00 ? 38 TYR A HA   8  
ATOM 10073 H HB2  . TYR A 1 38 ? 3.778   13.055  14.577  1.00 0.00 ? 38 TYR A HB2  8  
ATOM 10074 H HB3  . TYR A 1 38 ? 3.948   14.215  13.268  1.00 0.00 ? 38 TYR A HB3  8  
ATOM 10075 H HD1  . TYR A 1 38 ? 2.321   16.095  13.049  1.00 0.00 ? 38 TYR A HD1  8  
ATOM 10076 H HD2  . TYR A 1 38 ? 2.318   13.500  16.428  1.00 0.00 ? 38 TYR A HD2  8  
ATOM 10077 H HE1  . TYR A 1 38 ? 0.994   17.736  14.305  1.00 0.00 ? 38 TYR A HE1  8  
ATOM 10078 H HE2  . TYR A 1 38 ? 0.989   15.138  17.688  1.00 0.00 ? 38 TYR A HE2  8  
ATOM 10079 H HH   . TYR A 1 38 ? 0.750   18.096  17.185  1.00 0.00 ? 38 TYR A HH   8  
ATOM 10080 N N    . GLU A 1 39 ? 1.985   10.792  14.289  1.00 0.00 ? 39 GLU A N    8  
ATOM 10081 C CA   . GLU A 1 39 ? 1.199   9.873   15.104  1.00 0.00 ? 39 GLU A CA   8  
ATOM 10082 C C    . GLU A 1 39 ? 1.793   9.743   16.504  1.00 0.00 ? 39 GLU A C    8  
ATOM 10083 O O    . GLU A 1 39 ? 1.140   10.056  17.499  1.00 0.00 ? 39 GLU A O    8  
ATOM 10084 C CB   . GLU A 1 39 ? 1.134   8.498   14.434  1.00 0.00 ? 39 GLU A CB   8  
ATOM 10085 C CG   . GLU A 1 39 ? 0.284   7.490   15.190  1.00 0.00 ? 39 GLU A CG   8  
ATOM 10086 C CD   . GLU A 1 39 ? 0.247   6.134   14.512  1.00 0.00 ? 39 GLU A CD   8  
ATOM 10087 O OE1  . GLU A 1 39 ? -0.585  5.951   13.598  1.00 0.00 ? 39 GLU A OE1  8  
ATOM 10088 O OE2  . GLU A 1 39 ? 1.049   5.257   14.893  1.00 0.00 ? 39 GLU A OE2  8  
ATOM 10089 O OXT  . GLU A 1 39 ? 2.972   9.329   16.591  1.00 0.00 ? 39 GLU A OXT  8  
ATOM 10090 H H    . GLU A 1 39 ? 2.927   10.571  14.108  1.00 0.00 ? 39 GLU A H    8  
ATOM 10091 H HA   . GLU A 1 39 ? 0.189   10.252  15.203  1.00 0.00 ? 39 GLU A HA   8  
ATOM 10092 H HB2  . GLU A 1 39 ? 0.718   8.618   13.444  1.00 0.00 ? 39 GLU A HB2  8  
ATOM 10093 H HB3  . GLU A 1 39 ? 2.138   8.103   14.346  1.00 0.00 ? 39 GLU A HB3  8  
ATOM 10094 H HG2  . GLU A 1 39 ? 0.686   7.358   16.183  1.00 0.00 ? 39 GLU A HG2  8  
ATOM 10095 H HG3  . GLU A 1 39 ? -0.725  7.868   15.258  1.00 0.00 ? 39 GLU A HG3  8  
ATOM 10096 N N    . GLY B 1 1  ? -3.761  -30.584 -4.383  1.00 0.00 ? 1  GLY B N    8  
ATOM 10097 C CA   . GLY B 1 1  ? -4.695  -30.444 -5.486  1.00 0.00 ? 1  GLY B CA   8  
ATOM 10098 C C    . GLY B 1 1  ? -5.862  -29.542 -5.142  1.00 0.00 ? 1  GLY B C    8  
ATOM 10099 O O    . GLY B 1 1  ? -6.107  -29.256 -3.969  1.00 0.00 ? 1  GLY B O    8  
ATOM 10100 H H1   . GLY B 1 1  ? -4.236  -30.997 -3.553  1.00 0.00 ? 1  GLY B H1   8  
ATOM 10101 H H2   . GLY B 1 1  ? -3.367  -29.656 -4.119  1.00 0.00 ? 1  GLY B H2   8  
ATOM 10102 H H3   . GLY B 1 1  ? -2.978  -31.210 -4.660  1.00 0.00 ? 1  GLY B H3   8  
ATOM 10103 H HA2  . GLY B 1 1  ? -4.172  -30.030 -6.335  1.00 0.00 ? 1  GLY B HA2  8  
ATOM 10104 H HA3  . GLY B 1 1  ? -5.073  -31.421 -5.749  1.00 0.00 ? 1  GLY B HA3  8  
ATOM 10105 N N    . HIS B 1 2  ? -6.583  -29.091 -6.166  1.00 0.00 ? 2  HIS B N    8  
ATOM 10106 C CA   . HIS B 1 2  ? -7.731  -28.210 -5.968  1.00 0.00 ? 2  HIS B CA   8  
ATOM 10107 C C    . HIS B 1 2  ? -7.325  -26.944 -5.220  1.00 0.00 ? 2  HIS B C    8  
ATOM 10108 O O    . HIS B 1 2  ? -6.137  -26.664 -5.055  1.00 0.00 ? 2  HIS B O    8  
ATOM 10109 C CB   . HIS B 1 2  ? -8.838  -28.940 -5.201  1.00 0.00 ? 2  HIS B CB   8  
ATOM 10110 C CG   . HIS B 1 2  ? -9.449  -30.075 -5.962  1.00 0.00 ? 2  HIS B CG   8  
ATOM 10111 N ND1  . HIS B 1 2  ? -8.887  -31.333 -6.020  1.00 0.00 ? 2  HIS B ND1  8  
ATOM 10112 C CD2  . HIS B 1 2  ? -10.583 -30.138 -6.700  1.00 0.00 ? 2  HIS B CD2  8  
ATOM 10113 C CE1  . HIS B 1 2  ? -9.650  -32.120 -6.760  1.00 0.00 ? 2  HIS B CE1  8  
ATOM 10114 N NE2  . HIS B 1 2  ? -10.684 -31.419 -7.183  1.00 0.00 ? 2  HIS B NE2  8  
ATOM 10115 H H    . HIS B 1 2  ? -6.343  -29.349 -7.085  1.00 0.00 ? 2  HIS B H    8  
ATOM 10116 H HA   . HIS B 1 2  ? -8.103  -27.928 -6.943  1.00 0.00 ? 2  HIS B HA   8  
ATOM 10117 H HB2  . HIS B 1 2  ? -8.444  -29.339 -4.283  1.00 0.00 ? 2  HIS B HB2  8  
ATOM 10118 H HB3  . HIS B 1 2  ? -9.640  -28.259 -4.964  1.00 0.00 ? 2  HIS B HB3  8  
ATOM 10119 H HD1  . HIS B 1 2  ? -8.053  -31.608 -5.585  1.00 0.00 ? 2  HIS B HD1  8  
ATOM 10120 H HD2  . HIS B 1 2  ? -11.279 -29.330 -6.876  1.00 0.00 ? 2  HIS B HD2  8  
ATOM 10121 H HE1  . HIS B 1 2  ? -9.460  -33.160 -6.979  1.00 0.00 ? 2  HIS B HE1  8  
ATOM 10122 H HE2  . HIS B 1 2  ? -11.360 -31.736 -7.818  1.00 0.00 ? 2  HIS B HE2  8  
ATOM 10123 N N    . SER B 1 3  ? -8.320  -26.181 -4.770  1.00 0.00 ? 3  SER B N    8  
ATOM 10124 C CA   . SER B 1 3  ? -8.068  -24.944 -4.036  1.00 0.00 ? 3  SER B CA   8  
ATOM 10125 C C    . SER B 1 3  ? -7.254  -23.968 -4.882  1.00 0.00 ? 3  SER B C    8  
ATOM 10126 O O    . SER B 1 3  ? -7.026  -24.201 -6.068  1.00 0.00 ? 3  SER B O    8  
ATOM 10127 C CB   . SER B 1 3  ? -7.339  -25.246 -2.724  1.00 0.00 ? 3  SER B CB   8  
ATOM 10128 O OG   . SER B 1 3  ? -7.240  -24.088 -1.913  1.00 0.00 ? 3  SER B OG   8  
ATOM 10129 H H    . SER B 1 3  ? -9.252  -26.426 -4.932  1.00 0.00 ? 3  SER B H    8  
ATOM 10130 H HA   . SER B 1 3  ? -9.023  -24.494 -3.811  1.00 0.00 ? 3  SER B HA   8  
ATOM 10131 H HB2  . SER B 1 3  ? -7.887  -26.000 -2.179  1.00 0.00 ? 3  SER B HB2  8  
ATOM 10132 H HB3  . SER B 1 3  ? -6.343  -25.609 -2.929  1.00 0.00 ? 3  SER B HB3  8  
ATOM 10133 H HG   . SER B 1 3  ? -6.656  -24.265 -1.172  1.00 0.00 ? 3  SER B HG   8  
ATOM 10134 N N    . LEU B 1 4  ? -6.821  -22.871 -4.266  1.00 0.00 ? 4  LEU B N    8  
ATOM 10135 C CA   . LEU B 1 4  ? -6.034  -21.864 -4.968  1.00 0.00 ? 4  LEU B CA   8  
ATOM 10136 C C    . LEU B 1 4  ? -4.547  -22.226 -4.953  1.00 0.00 ? 4  LEU B C    8  
ATOM 10137 O O    . LEU B 1 4  ? -4.043  -22.740 -3.954  1.00 0.00 ? 4  LEU B O    8  
ATOM 10138 C CB   . LEU B 1 4  ? -6.241  -20.485 -4.333  1.00 0.00 ? 4  LEU B CB   8  
ATOM 10139 C CG   . LEU B 1 4  ? -7.661  -19.922 -4.439  1.00 0.00 ? 4  LEU B CG   8  
ATOM 10140 C CD1  . LEU B 1 4  ? -8.586  -20.596 -3.437  1.00 0.00 ? 4  LEU B CD1  8  
ATOM 10141 C CD2  . LEU B 1 4  ? -7.651  -18.416 -4.227  1.00 0.00 ? 4  LEU B CD2  8  
ATOM 10142 H H    . LEU B 1 4  ? -7.026  -22.733 -3.313  1.00 0.00 ? 4  LEU B H    8  
ATOM 10143 H HA   . LEU B 1 4  ? -6.397  -21.824 -5.981  1.00 0.00 ? 4  LEU B HA   8  
ATOM 10144 H HB2  . LEU B 1 4  ? -5.963  -20.545 -3.287  1.00 0.00 ? 4  LEU B HB2  8  
ATOM 10145 H HB3  . LEU B 1 4  ? -5.564  -19.791 -4.822  1.00 0.00 ? 4  LEU B HB3  8  
ATOM 10146 H HG   . LEU B 1 4  ? -8.049  -20.114 -5.430  1.00 0.00 ? 4  LEU B HG   8  
ATOM 10147 H HD11 . LEU B 1 4  ? -9.494  -20.015 -3.325  1.00 0.00 ? 4  LEU B HD11 8  
ATOM 10148 H HD12 . LEU B 1 4  ? -8.099  -20.678 -2.474  1.00 0.00 ? 4  LEU B HD12 8  
ATOM 10149 H HD13 . LEU B 1 4  ? -8.848  -21.579 -3.792  1.00 0.00 ? 4  LEU B HD13 8  
ATOM 10150 H HD21 . LEU B 1 4  ? -8.655  -18.028 -4.332  1.00 0.00 ? 4  LEU B HD21 8  
ATOM 10151 H HD22 . LEU B 1 4  ? -7.012  -17.950 -4.965  1.00 0.00 ? 4  LEU B HD22 8  
ATOM 10152 H HD23 . LEU B 1 4  ? -7.280  -18.188 -3.237  1.00 0.00 ? 4  LEU B HD23 8  
ATOM 10153 N N    . PRO B 1 5  ? -3.826  -21.965 -6.060  1.00 0.00 ? 5  PRO B N    8  
ATOM 10154 C CA   . PRO B 1 5  ? -2.392  -22.270 -6.163  1.00 0.00 ? 5  PRO B CA   8  
ATOM 10155 C C    . PRO B 1 5  ? -1.560  -21.493 -5.148  1.00 0.00 ? 5  PRO B C    8  
ATOM 10156 O O    . PRO B 1 5  ? -1.734  -20.287 -4.981  1.00 0.00 ? 5  PRO B O    8  
ATOM 10157 C CB   . PRO B 1 5  ? -2.024  -21.845 -7.590  1.00 0.00 ? 5  PRO B CB   8  
ATOM 10158 C CG   . PRO B 1 5  ? -3.321  -21.760 -8.321  1.00 0.00 ? 5  PRO B CG   8  
ATOM 10159 C CD   . PRO B 1 5  ? -4.343  -21.358 -7.298  1.00 0.00 ? 5  PRO B CD   8  
ATOM 10160 H HA   . PRO B 1 5  ? -2.214  -23.331 -6.048  1.00 0.00 ? 5  PRO B HA   8  
ATOM 10161 H HB2  . PRO B 1 5  ? -1.519  -20.886 -7.588  1.00 0.00 ? 5  PRO B HB2  8  
ATOM 10162 H HB3  . PRO B 1 5  ? -1.379  -22.591 -8.030  1.00 0.00 ? 5  PRO B HB3  8  
ATOM 10163 H HG2  . PRO B 1 5  ? -3.256  -21.014 -9.100  1.00 0.00 ? 5  PRO B HG2  8  
ATOM 10164 H HG3  . PRO B 1 5  ? -3.570  -22.723 -8.741  1.00 0.00 ? 5  PRO B HG3  8  
ATOM 10165 H HD2  . PRO B 1 5  ? -4.393  -20.281 -7.214  1.00 0.00 ? 5  PRO B HD2  8  
ATOM 10166 H HD3  . PRO B 1 5  ? -5.302  -21.765 -7.570  1.00 0.00 ? 5  PRO B HD3  8  
ATOM 10167 N N    . PHE B 1 6  ? -0.658  -22.192 -4.464  1.00 0.00 ? 6  PHE B N    8  
ATOM 10168 C CA   . PHE B 1 6  ? 0.201   -21.563 -3.467  1.00 0.00 ? 6  PHE B CA   8  
ATOM 10169 C C    . PHE B 1 6  ? 1.252   -20.675 -4.129  1.00 0.00 ? 6  PHE B C    8  
ATOM 10170 O O    . PHE B 1 6  ? 1.833   -19.799 -3.486  1.00 0.00 ? 6  PHE B O    8  
ATOM 10171 C CB   . PHE B 1 6  ? 0.882   -22.630 -2.603  1.00 0.00 ? 6  PHE B CB   8  
ATOM 10172 C CG   . PHE B 1 6  ? 2.030   -23.324 -3.280  1.00 0.00 ? 6  PHE B CG   8  
ATOM 10173 C CD1  . PHE B 1 6  ? 1.806   -24.311 -4.227  1.00 0.00 ? 6  PHE B CD1  8  
ATOM 10174 C CD2  . PHE B 1 6  ? 3.338   -22.992 -2.962  1.00 0.00 ? 6  PHE B CD2  8  
ATOM 10175 C CE1  . PHE B 1 6  ? 2.863   -24.950 -4.846  1.00 0.00 ? 6  PHE B CE1  8  
ATOM 10176 C CE2  . PHE B 1 6  ? 4.399   -23.628 -3.578  1.00 0.00 ? 6  PHE B CE2  8  
ATOM 10177 C CZ   . PHE B 1 6  ? 4.161   -24.609 -4.521  1.00 0.00 ? 6  PHE B CZ   8  
ATOM 10178 H H    . PHE B 1 6  ? -0.574  -23.152 -4.636  1.00 0.00 ? 6  PHE B H    8  
ATOM 10179 H HA   . PHE B 1 6  ? -0.417  -20.952 -2.825  1.00 0.00 ? 6  PHE B HA   8  
ATOM 10180 H HB2  . PHE B 1 6  ? 1.248   -22.160 -1.699  1.00 0.00 ? 6  PHE B HB2  8  
ATOM 10181 H HB3  . PHE B 1 6  ? 0.149   -23.379 -2.328  1.00 0.00 ? 6  PHE B HB3  8  
ATOM 10182 H HD1  . PHE B 1 6  ? 0.797   -24.590 -4.484  1.00 0.00 ? 6  PHE B HD1  8  
ATOM 10183 H HD2  . PHE B 1 6  ? 3.531   -22.225 -2.224  1.00 0.00 ? 6  PHE B HD2  8  
ATOM 10184 H HE1  . PHE B 1 6  ? 2.674   -25.718 -5.582  1.00 0.00 ? 6  PHE B HE1  8  
ATOM 10185 H HE2  . PHE B 1 6  ? 5.413   -23.359 -3.322  1.00 0.00 ? 6  PHE B HE2  8  
ATOM 10186 H HZ   . PHE B 1 6  ? 4.988   -25.108 -5.004  1.00 0.00 ? 6  PHE B HZ   8  
ATOM 10187 N N    . LYS B 1 7  ? 1.489   -20.904 -5.417  1.00 0.00 ? 7  LYS B N    8  
ATOM 10188 C CA   . LYS B 1 7  ? 2.475   -20.132 -6.169  1.00 0.00 ? 7  LYS B CA   8  
ATOM 10189 C C    . LYS B 1 7  ? 2.156   -18.639 -6.133  1.00 0.00 ? 7  LYS B C    8  
ATOM 10190 O O    . LYS B 1 7  ? 3.022   -17.820 -5.822  1.00 0.00 ? 7  LYS B O    8  
ATOM 10191 C CB   . LYS B 1 7  ? 2.529   -20.619 -7.620  1.00 0.00 ? 7  LYS B CB   8  
ATOM 10192 C CG   . LYS B 1 7  ? 3.623   -19.962 -8.450  1.00 0.00 ? 7  LYS B CG   8  
ATOM 10193 C CD   . LYS B 1 7  ? 3.519   -20.349 -9.920  1.00 0.00 ? 7  LYS B CD   8  
ATOM 10194 C CE   . LYS B 1 7  ? 3.835   -21.822 -10.140 1.00 0.00 ? 7  LYS B CE   8  
ATOM 10195 N NZ   . LYS B 1 7  ? 5.257   -22.139 -9.834  1.00 0.00 ? 7  LYS B NZ   8  
ATOM 10196 H H    . LYS B 1 7  ? 1.006   -21.619 -5.886  1.00 0.00 ? 7  LYS B H    8  
ATOM 10197 H HA   . LYS B 1 7  ? 3.442   -20.291 -5.712  1.00 0.00 ? 7  LYS B HA   8  
ATOM 10198 H HB2  . LYS B 1 7  ? 2.704   -21.684 -7.612  1.00 0.00 ? 7  LYS B HB2  8  
ATOM 10199 H HB3  . LYS B 1 7  ? 1.572   -20.425 -8.090  1.00 0.00 ? 7  LYS B HB3  8  
ATOM 10200 H HG2  . LYS B 1 7  ? 3.529   -18.888 -8.379  1.00 0.00 ? 7  LYS B HG2  8  
ATOM 10201 H HG3  . LYS B 1 7  ? 4.586   -20.261 -8.066  1.00 0.00 ? 7  LYS B HG3  8  
ATOM 10202 H HD2  . LYS B 1 7  ? 2.517   -20.149 -10.274 1.00 0.00 ? 7  LYS B HD2  8  
ATOM 10203 H HD3  . LYS B 1 7  ? 4.223   -19.755 -10.484 1.00 0.00 ? 7  LYS B HD3  8  
ATOM 10204 H HE2  . LYS B 1 7  ? 3.195   -22.431 -9.522  1.00 0.00 ? 7  LYS B HE2  8  
ATOM 10205 H HE3  . LYS B 1 7  ? 3.647   -22.057 -11.177 1.00 0.00 ? 7  LYS B HE3  8  
ATOM 10206 H HZ1  . LYS B 1 7  ? 5.471   -23.115 -10.123 1.00 0.00 ? 7  LYS B HZ1  8  
ATOM 10207 H HZ2  . LYS B 1 7  ? 5.435   -22.051 -8.815  1.00 0.00 ? 7  LYS B HZ2  8  
ATOM 10208 H HZ3  . LYS B 1 7  ? 5.896   -21.493 -10.346 1.00 0.00 ? 7  LYS B HZ3  8  
ATOM 10209 N N    . VAL B 1 8  ? 0.913   -18.289 -6.452  1.00 0.00 ? 8  VAL B N    8  
ATOM 10210 C CA   . VAL B 1 8  ? 0.491   -16.892 -6.459  1.00 0.00 ? 8  VAL B CA   8  
ATOM 10211 C C    . VAL B 1 8  ? 0.617   -16.262 -5.074  1.00 0.00 ? 8  VAL B C    8  
ATOM 10212 O O    . VAL B 1 8  ? 0.938   -15.080 -4.952  1.00 0.00 ? 8  VAL B O    8  
ATOM 10213 C CB   . VAL B 1 8  ? -0.959  -16.732 -6.960  1.00 0.00 ? 8  VAL B CB   8  
ATOM 10214 C CG1  . VAL B 1 8  ? -1.096  -17.268 -8.377  1.00 0.00 ? 8  VAL B CG1  8  
ATOM 10215 C CG2  . VAL B 1 8  ? -1.935  -17.428 -6.024  1.00 0.00 ? 8  VAL B CG2  8  
ATOM 10216 H H    . VAL B 1 8  ? 0.265   -18.991 -6.692  1.00 0.00 ? 8  VAL B H    8  
ATOM 10217 H HA   . VAL B 1 8  ? 1.141   -16.351 -7.138  1.00 0.00 ? 8  VAL B HA   8  
ATOM 10218 H HB   . VAL B 1 8  ? -1.203  -15.678 -6.980  1.00 0.00 ? 8  VAL B HB   8  
ATOM 10219 H HG11 . VAL B 1 8  ? -2.105  -17.104 -8.730  1.00 0.00 ? 8  VAL B HG11 8  
ATOM 10220 H HG12 . VAL B 1 8  ? -0.880  -18.326 -8.393  1.00 0.00 ? 8  VAL B HG12 8  
ATOM 10221 H HG13 . VAL B 1 8  ? -0.405  -16.751 -9.028  1.00 0.00 ? 8  VAL B HG13 8  
ATOM 10222 H HG21 . VAL B 1 8  ? -1.966  -16.917 -5.075  1.00 0.00 ? 8  VAL B HG21 8  
ATOM 10223 H HG22 . VAL B 1 8  ? -1.629  -18.438 -5.877  1.00 0.00 ? 8  VAL B HG22 8  
ATOM 10224 H HG23 . VAL B 1 8  ? -2.927  -17.418 -6.458  1.00 0.00 ? 8  VAL B HG23 8  
ATOM 10225 N N    . VAL B 1 9  ? 0.357   -17.051 -4.034  1.00 0.00 ? 9  VAL B N    8  
ATOM 10226 C CA   . VAL B 1 9  ? 0.441   -16.552 -2.665  1.00 0.00 ? 9  VAL B CA   8  
ATOM 10227 C C    . VAL B 1 9  ? 1.868   -16.139 -2.318  1.00 0.00 ? 9  VAL B C    8  
ATOM 10228 O O    . VAL B 1 9  ? 2.101   -15.040 -1.815  1.00 0.00 ? 9  VAL B O    8  
ATOM 10229 C CB   . VAL B 1 9  ? -0.023  -17.605 -1.640  1.00 0.00 ? 9  VAL B CB   8  
ATOM 10230 C CG1  . VAL B 1 9  ? -0.318  -16.946 -0.302  1.00 0.00 ? 9  VAL B CG1  8  
ATOM 10231 C CG2  . VAL B 1 9  ? -1.236  -18.368 -2.147  1.00 0.00 ? 9  VAL B CG2  8  
ATOM 10232 H H    . VAL B 1 9  ? 0.114   -17.983 -4.199  1.00 0.00 ? 9  VAL B H    8  
ATOM 10233 H HA   . VAL B 1 9  ? -0.205  -15.684 -2.587  1.00 0.00 ? 9  VAL B HA   8  
ATOM 10234 H HB   . VAL B 1 9  ? 0.776   -18.323 -1.488  1.00 0.00 ? 9  VAL B HB   8  
ATOM 10235 H HG11 . VAL B 1 9  ? -1.106  -16.215 -0.422  1.00 0.00 ? 9  VAL B HG11 8  
ATOM 10236 H HG12 . VAL B 1 9  ? 0.572   -16.457 0.069   1.00 0.00 ? 9  VAL B HG12 8  
ATOM 10237 H HG13 . VAL B 1 9  ? -0.632  -17.696 0.411   1.00 0.00 ? 9  VAL B HG13 8  
ATOM 10238 H HG21 . VAL B 1 9  ? -2.015  -17.671 -2.424  1.00 0.00 ? 9  VAL B HG21 8  
ATOM 10239 H HG22 . VAL B 1 9  ? -1.606  -19.022 -1.368  1.00 0.00 ? 9  VAL B HG22 8  
ATOM 10240 H HG23 . VAL B 1 9  ? -0.970  -18.963 -3.000  1.00 0.00 ? 9  VAL B HG23 8  
ATOM 10241 N N    . VAL B 1 10 ? 2.818   -17.031 -2.588  1.00 0.00 ? 10 VAL B N    8  
ATOM 10242 C CA   . VAL B 1 10 ? 4.225   -16.770 -2.299  1.00 0.00 ? 10 VAL B CA   8  
ATOM 10243 C C    . VAL B 1 10 ? 4.729   -15.532 -3.039  1.00 0.00 ? 10 VAL B C    8  
ATOM 10244 O O    . VAL B 1 10 ? 5.368   -14.663 -2.447  1.00 0.00 ? 10 VAL B O    8  
ATOM 10245 C CB   . VAL B 1 10 ? 5.107   -17.977 -2.678  1.00 0.00 ? 10 VAL B CB   8  
ATOM 10246 C CG1  . VAL B 1 10 ? 6.569   -17.696 -2.368  1.00 0.00 ? 10 VAL B CG1  8  
ATOM 10247 C CG2  . VAL B 1 10 ? 4.635   -19.231 -1.956  1.00 0.00 ? 10 VAL B CG2  8  
ATOM 10248 H H    . VAL B 1 10 ? 2.560   -17.888 -2.997  1.00 0.00 ? 10 VAL B H    8  
ATOM 10249 H HA   . VAL B 1 10 ? 4.322   -16.600 -1.233  1.00 0.00 ? 10 VAL B HA   8  
ATOM 10250 H HB   . VAL B 1 10 ? 5.015   -18.149 -3.742  1.00 0.00 ? 10 VAL B HB   8  
ATOM 10251 H HG11 . VAL B 1 10 ? 6.948   -16.938 -3.036  1.00 0.00 ? 10 VAL B HG11 8  
ATOM 10252 H HG12 . VAL B 1 10 ? 7.151   -18.599 -2.502  1.00 0.00 ? 10 VAL B HG12 8  
ATOM 10253 H HG13 . VAL B 1 10 ? 6.670   -17.357 -1.346  1.00 0.00 ? 10 VAL B HG13 8  
ATOM 10254 H HG21 . VAL B 1 10 ? 3.611   -19.432 -2.183  1.00 0.00 ? 10 VAL B HG21 8  
ATOM 10255 H HG22 . VAL B 1 10 ? 4.739   -19.095 -0.889  1.00 0.00 ? 10 VAL B HG22 8  
ATOM 10256 H HG23 . VAL B 1 10 ? 5.239   -20.073 -2.267  1.00 0.00 ? 10 VAL B HG23 8  
ATOM 10257 N N    . ILE B 1 11 ? 4.437   -15.460 -4.334  1.00 0.00 ? 11 ILE B N    8  
ATOM 10258 C CA   . ILE B 1 11 ? 4.866   -14.332 -5.155  1.00 0.00 ? 11 ILE B CA   8  
ATOM 10259 C C    . ILE B 1 11 ? 4.210   -13.031 -4.697  1.00 0.00 ? 11 ILE B C    8  
ATOM 10260 O O    . ILE B 1 11 ? 4.832   -11.968 -4.732  1.00 0.00 ? 11 ILE B O    8  
ATOM 10261 C CB   . ILE B 1 11 ? 4.540   -14.572 -6.642  1.00 0.00 ? 11 ILE B CB   8  
ATOM 10262 C CG1  . ILE B 1 11 ? 5.211   -15.859 -7.127  1.00 0.00 ? 11 ILE B CG1  8  
ATOM 10263 C CG2  . ILE B 1 11 ? 4.987   -13.383 -7.484  1.00 0.00 ? 11 ILE B CG2  8  
ATOM 10264 C CD1  . ILE B 1 11 ? 4.762   -16.300 -8.505  1.00 0.00 ? 11 ILE B CD1  8  
ATOM 10265 H H    . ILE B 1 11 ? 3.914   -16.186 -4.748  1.00 0.00 ? 11 ILE B H    8  
ATOM 10266 H HA   . ILE B 1 11 ? 5.941   -14.232 -5.056  1.00 0.00 ? 11 ILE B HA   8  
ATOM 10267 H HB   . ILE B 1 11 ? 3.467   -14.672 -6.743  1.00 0.00 ? 11 ILE B HB   8  
ATOM 10268 H HG12 . ILE B 1 11 ? 6.281   -15.711 -7.166  1.00 0.00 ? 11 ILE B HG12 8  
ATOM 10269 H HG13 . ILE B 1 11 ? 5.003   -16.668 -6.450  1.00 0.00 ? 11 ILE B HG13 8  
ATOM 10270 H HG21 . ILE B 1 11 ? 4.815   -13.588 -8.531  1.00 0.00 ? 11 ILE B HG21 8  
ATOM 10271 H HG22 . ILE B 1 11 ? 6.040   -13.201 -7.328  1.00 0.00 ? 11 ILE B HG22 8  
ATOM 10272 H HG23 . ILE B 1 11 ? 4.427   -12.503 -7.208  1.00 0.00 ? 11 ILE B HG23 8  
ATOM 10273 H HD11 . ILE B 1 11 ? 5.142   -15.613 -9.246  1.00 0.00 ? 11 ILE B HD11 8  
ATOM 10274 H HD12 . ILE B 1 11 ? 3.682   -16.318 -8.549  1.00 0.00 ? 11 ILE B HD12 8  
ATOM 10275 H HD13 . ILE B 1 11 ? 5.144   -17.290 -8.706  1.00 0.00 ? 11 ILE B HD13 8  
ATOM 10276 N N    . SER B 1 12 ? 2.956   -13.121 -4.269  1.00 0.00 ? 12 SER B N    8  
ATOM 10277 C CA   . SER B 1 12 ? 2.219   -11.949 -3.807  1.00 0.00 ? 12 SER B CA   8  
ATOM 10278 C C    . SER B 1 12 ? 2.780   -11.440 -2.484  1.00 0.00 ? 12 SER B C    8  
ATOM 10279 O O    . SER B 1 12 ? 2.872   -10.231 -2.262  1.00 0.00 ? 12 SER B O    8  
ATOM 10280 C CB   . SER B 1 12 ? 0.735   -12.286 -3.647  1.00 0.00 ? 12 SER B CB   8  
ATOM 10281 O OG   . SER B 1 12 ? 0.008   -11.171 -3.160  1.00 0.00 ? 12 SER B OG   8  
ATOM 10282 H H    . SER B 1 12 ? 2.504   -13.997 -4.264  1.00 0.00 ? 12 SER B H    8  
ATOM 10283 H HA   . SER B 1 12 ? 2.319   -11.168 -4.550  1.00 0.00 ? 12 SER B HA   8  
ATOM 10284 H HB2  . SER B 1 12 ? 0.329   -12.575 -4.605  1.00 0.00 ? 12 SER B HB2  8  
ATOM 10285 H HB3  . SER B 1 12 ? 0.626   -13.104 -2.950  1.00 0.00 ? 12 SER B HB3  8  
ATOM 10286 H HG   . SER B 1 12 ? -0.180  -10.567 -3.883  1.00 0.00 ? 12 SER B HG   8  
ATOM 10287 N N    . ALA B 1 13 ? 3.151   -12.369 -1.610  1.00 0.00 ? 13 ALA B N    8  
ATOM 10288 C CA   . ALA B 1 13 ? 3.698   -12.020 -0.305  1.00 0.00 ? 13 ALA B CA   8  
ATOM 10289 C C    . ALA B 1 13 ? 5.058   -11.342 -0.437  1.00 0.00 ? 13 ALA B C    8  
ATOM 10290 O O    . ALA B 1 13 ? 5.254   -10.227 0.046   1.00 0.00 ? 13 ALA B O    8  
ATOM 10291 C CB   . ALA B 1 13 ? 3.809   -13.262 0.565   1.00 0.00 ? 13 ALA B CB   8  
ATOM 10292 H H    . ALA B 1 13 ? 3.050   -13.323 -1.842  1.00 0.00 ? 13 ALA B H    8  
ATOM 10293 H HA   . ALA B 1 13 ? 3.013   -11.336 0.180   1.00 0.00 ? 13 ALA B HA   8  
ATOM 10294 H HB1  . ALA B 1 13 ? 4.504   -13.959 0.118   1.00 0.00 ? 13 ALA B HB1  8  
ATOM 10295 H HB2  . ALA B 1 13 ? 2.838   -13.728 0.647   1.00 0.00 ? 13 ALA B HB2  8  
ATOM 10296 H HB3  . ALA B 1 13 ? 4.158   -12.987 1.551   1.00 0.00 ? 13 ALA B HB3  8  
ATOM 10297 N N    . ILE B 1 14 ? 5.994   -12.020 -1.097  1.00 0.00 ? 14 ILE B N    8  
ATOM 10298 C CA   . ILE B 1 14 ? 7.339   -11.486 -1.286  1.00 0.00 ? 14 ILE B CA   8  
ATOM 10299 C C    . ILE B 1 14 ? 7.306   -10.124 -1.975  1.00 0.00 ? 14 ILE B C    8  
ATOM 10300 O O    . ILE B 1 14 ? 8.044   -9.215  -1.601  1.00 0.00 ? 14 ILE B O    8  
ATOM 10301 C CB   . ILE B 1 14 ? 8.222   -12.452 -2.107  1.00 0.00 ? 14 ILE B CB   8  
ATOM 10302 C CG1  . ILE B 1 14 ? 9.650   -11.912 -2.222  1.00 0.00 ? 14 ILE B CG1  8  
ATOM 10303 C CG2  . ILE B 1 14 ? 7.628   -12.683 -3.490  1.00 0.00 ? 14 ILE B CG2  8  
ATOM 10304 C CD1  . ILE B 1 14 ? 10.406  -11.911 -0.910  1.00 0.00 ? 14 ILE B CD1  8  
ATOM 10305 H H    . ILE B 1 14 ? 5.774   -12.911 -1.458  1.00 0.00 ? 14 ILE B H    8  
ATOM 10306 H HA   . ILE B 1 14 ? 7.783   -11.369 -0.307  1.00 0.00 ? 14 ILE B HA   8  
ATOM 10307 H HB   . ILE B 1 14 ? 8.243   -13.404 -1.595  1.00 0.00 ? 14 ILE B HB   8  
ATOM 10308 H HG12 . ILE B 1 14 ? 10.209  -12.541 -2.904  1.00 0.00 ? 14 ILE B HG12 8  
ATOM 10309 H HG13 . ILE B 1 14 ? 9.647   -10.905 -2.608  1.00 0.00 ? 14 ILE B HG13 8  
ATOM 10310 H HG21 . ILE B 1 14 ? 6.587   -12.908 -3.412  1.00 0.00 ? 14 ILE B HG21 8  
ATOM 10311 H HG22 . ILE B 1 14 ? 8.132   -13.517 -3.954  1.00 0.00 ? 14 ILE B HG22 8  
ATOM 10312 H HG23 . ILE B 1 14 ? 7.762   -11.805 -4.107  1.00 0.00 ? 14 ILE B HG23 8  
ATOM 10313 H HD11 . ILE B 1 14 ? 10.371  -12.897 -0.468  1.00 0.00 ? 14 ILE B HD11 8  
ATOM 10314 H HD12 . ILE B 1 14 ? 9.958   -11.198 -0.235  1.00 0.00 ? 14 ILE B HD12 8  
ATOM 10315 H HD13 . ILE B 1 14 ? 11.435  -11.636 -1.090  1.00 0.00 ? 14 ILE B HD13 8  
ATOM 10316 N N    . LEU B 1 15 ? 6.441   -9.988  -2.976  1.00 0.00 ? 15 LEU B N    8  
ATOM 10317 C CA   . LEU B 1 15 ? 6.318   -8.737  -3.719  1.00 0.00 ? 15 LEU B CA   8  
ATOM 10318 C C    . LEU B 1 15 ? 5.706   -7.640  -2.855  1.00 0.00 ? 15 LEU B C    8  
ATOM 10319 O O    . LEU B 1 15 ? 6.079   -6.472  -2.965  1.00 0.00 ? 15 LEU B O    8  
ATOM 10320 C CB   . LEU B 1 15 ? 5.465   -8.952  -4.973  1.00 0.00 ? 15 LEU B CB   8  
ATOM 10321 C CG   . LEU B 1 15 ? 5.238   -7.704  -5.831  1.00 0.00 ? 15 LEU B CG   8  
ATOM 10322 C CD1  . LEU B 1 15 ? 6.550   -7.208  -6.419  1.00 0.00 ? 15 LEU B CD1  8  
ATOM 10323 C CD2  . LEU B 1 15 ? 4.237   -7.999  -6.939  1.00 0.00 ? 15 LEU B CD2  8  
ATOM 10324 H H    . LEU B 1 15 ? 5.862   -10.744 -3.227  1.00 0.00 ? 15 LEU B H    8  
ATOM 10325 H HA   . LEU B 1 15 ? 7.309   -8.426  -4.024  1.00 0.00 ? 15 LEU B HA   8  
ATOM 10326 H HB2  . LEU B 1 15 ? 5.944   -9.709  -5.582  1.00 0.00 ? 15 LEU B HB2  8  
ATOM 10327 H HB3  . LEU B 1 15 ? 4.501   -9.331  -4.657  1.00 0.00 ? 15 LEU B HB3  8  
ATOM 10328 H HG   . LEU B 1 15 ? 4.827   -6.913  -5.222  1.00 0.00 ? 15 LEU B HG   8  
ATOM 10329 H HD11 . LEU B 1 15 ? 7.230   -6.947  -5.622  1.00 0.00 ? 15 LEU B HD11 8  
ATOM 10330 H HD12 . LEU B 1 15 ? 6.367   -6.333  -7.028  1.00 0.00 ? 15 LEU B HD12 8  
ATOM 10331 H HD13 . LEU B 1 15 ? 6.993   -7.983  -7.029  1.00 0.00 ? 15 LEU B HD13 8  
ATOM 10332 H HD21 . LEU B 1 15 ? 4.623   -8.777  -7.583  1.00 0.00 ? 15 LEU B HD21 8  
ATOM 10333 H HD22 . LEU B 1 15 ? 4.065   -7.104  -7.521  1.00 0.00 ? 15 LEU B HD22 8  
ATOM 10334 H HD23 . LEU B 1 15 ? 3.301   -8.324  -6.505  1.00 0.00 ? 15 LEU B HD23 8  
ATOM 10335 N N    . ALA B 1 16 ? 4.769   -8.023  -1.997  1.00 0.00 ? 16 ALA B N    8  
ATOM 10336 C CA   . ALA B 1 16 ? 4.100   -7.070  -1.120  1.00 0.00 ? 16 ALA B CA   8  
ATOM 10337 C C    . ALA B 1 16 ? 5.084   -6.422  -0.151  1.00 0.00 ? 16 ALA B C    8  
ATOM 10338 O O    . ALA B 1 16 ? 4.970   -5.236  0.160   1.00 0.00 ? 16 ALA B O    8  
ATOM 10339 C CB   . ALA B 1 16 ? 2.977   -7.754  -0.360  1.00 0.00 ? 16 ALA B CB   8  
ATOM 10340 H H    . ALA B 1 16 ? 4.507   -8.973  -1.952  1.00 0.00 ? 16 ALA B H    8  
ATOM 10341 H HA   . ALA B 1 16 ? 3.655   -6.302  -1.736  1.00 0.00 ? 16 ALA B HA   8  
ATOM 10342 H HB1  . ALA B 1 16 ? 2.264   -8.158  -1.062  1.00 0.00 ? 16 ALA B HB1  8  
ATOM 10343 H HB2  . ALA B 1 16 ? 2.480   -7.038  0.281   1.00 0.00 ? 16 ALA B HB2  8  
ATOM 10344 H HB3  . ALA B 1 16 ? 3.382   -8.555  0.241   1.00 0.00 ? 16 ALA B HB3  8  
ATOM 10345 N N    . LEU B 1 17 ? 6.046   -7.202  0.329   1.00 0.00 ? 17 LEU B N    8  
ATOM 10346 C CA   . LEU B 1 17 ? 7.047   -6.689  1.257   1.00 0.00 ? 17 LEU B CA   8  
ATOM 10347 C C    . LEU B 1 17 ? 8.006   -5.737  0.549   1.00 0.00 ? 17 LEU B C    8  
ATOM 10348 O O    . LEU B 1 17 ? 8.501   -4.782  1.149   1.00 0.00 ? 17 LEU B O    8  
ATOM 10349 C CB   . LEU B 1 17 ? 7.828   -7.842  1.901   1.00 0.00 ? 17 LEU B CB   8  
ATOM 10350 C CG   . LEU B 1 17 ? 7.194   -8.435  3.164   1.00 0.00 ? 17 LEU B CG   8  
ATOM 10351 C CD1  . LEU B 1 17 ? 7.161   -7.404  4.282   1.00 0.00 ? 17 LEU B CD1  8  
ATOM 10352 C CD2  . LEU B 1 17 ? 5.794   -8.953  2.873   1.00 0.00 ? 17 LEU B CD2  8  
ATOM 10353 H H    . LEU B 1 17 ? 6.092   -8.148  0.054   1.00 0.00 ? 17 LEU B H    8  
ATOM 10354 H HA   . LEU B 1 17 ? 6.532   -6.128  2.022   1.00 0.00 ? 17 LEU B HA   8  
ATOM 10355 H HB2  . LEU B 1 17 ? 7.933   -8.635  1.172   1.00 0.00 ? 17 LEU B HB2  8  
ATOM 10356 H HB3  . LEU B 1 17 ? 8.823   -7.497  2.162   1.00 0.00 ? 17 LEU B HB3  8  
ATOM 10357 H HG   . LEU B 1 17 ? 7.795   -9.268  3.500   1.00 0.00 ? 17 LEU B HG   8  
ATOM 10358 H HD11 . LEU B 1 17 ? 6.491   -6.598  4.026   1.00 0.00 ? 17 LEU B HD11 8  
ATOM 10359 H HD12 . LEU B 1 17 ? 8.154   -7.007  4.443   1.00 0.00 ? 17 LEU B HD12 8  
ATOM 10360 H HD13 . LEU B 1 17 ? 6.818   -7.876  5.192   1.00 0.00 ? 17 LEU B HD13 8  
ATOM 10361 H HD21 . LEU B 1 17 ? 5.371   -9.372  3.776   1.00 0.00 ? 17 LEU B HD21 8  
ATOM 10362 H HD22 . LEU B 1 17 ? 5.849   -9.722  2.129   1.00 0.00 ? 17 LEU B HD22 8  
ATOM 10363 H HD23 . LEU B 1 17 ? 5.161   -8.151  2.525   1.00 0.00 ? 17 LEU B HD23 8  
ATOM 10364 N N    . VAL B 1 18 ? 8.262   -6.002  -0.729  1.00 0.00 ? 18 VAL B N    8  
ATOM 10365 C CA   . VAL B 1 18 ? 9.157   -5.163  -1.517  1.00 0.00 ? 18 VAL B CA   8  
ATOM 10366 C C    . VAL B 1 18 ? 8.546   -3.790  -1.765  1.00 0.00 ? 18 VAL B C    8  
ATOM 10367 O O    . VAL B 1 18 ? 9.224   -2.770  -1.650  1.00 0.00 ? 18 VAL B O    8  
ATOM 10368 C CB   . VAL B 1 18 ? 9.496   -5.816  -2.874  1.00 0.00 ? 18 VAL B CB   8  
ATOM 10369 C CG1  . VAL B 1 18 ? 10.354  -4.884  -3.722  1.00 0.00 ? 18 VAL B CG1  8  
ATOM 10370 C CG2  . VAL B 1 18 ? 10.199  -7.147  -2.666  1.00 0.00 ? 18 VAL B CG2  8  
ATOM 10371 H H    . VAL B 1 18 ? 7.841   -6.780  -1.163  1.00 0.00 ? 18 VAL B H    8  
ATOM 10372 H HA   . VAL B 1 18 ? 10.081  -5.035  -0.964  1.00 0.00 ? 18 VAL B HA   8  
ATOM 10373 H HB   . VAL B 1 18 ? 8.573   -6.001  -3.405  1.00 0.00 ? 18 VAL B HB   8  
ATOM 10374 H HG11 . VAL B 1 18 ? 10.746  -5.423  -4.576  1.00 0.00 ? 18 VAL B HG11 8  
ATOM 10375 H HG12 . VAL B 1 18 ? 11.179  -4.505  -3.135  1.00 0.00 ? 18 VAL B HG12 8  
ATOM 10376 H HG13 . VAL B 1 18 ? 9.756   -4.058  -4.078  1.00 0.00 ? 18 VAL B HG13 8  
ATOM 10377 H HG21 . VAL B 1 18 ? 9.652   -7.750  -1.970  1.00 0.00 ? 18 VAL B HG21 8  
ATOM 10378 H HG22 . VAL B 1 18 ? 11.194  -6.978  -2.277  1.00 0.00 ? 18 VAL B HG22 8  
ATOM 10379 H HG23 . VAL B 1 18 ? 10.269  -7.665  -3.611  1.00 0.00 ? 18 VAL B HG23 8  
ATOM 10380 N N    . VAL B 1 19 ? 7.259   -3.768  -2.101  1.00 0.00 ? 19 VAL B N    8  
ATOM 10381 C CA   . VAL B 1 19 ? 6.563   -2.516  -2.370  1.00 0.00 ? 19 VAL B CA   8  
ATOM 10382 C C    . VAL B 1 19 ? 6.288   -1.739  -1.086  1.00 0.00 ? 19 VAL B C    8  
ATOM 10383 O O    . VAL B 1 19 ? 6.077   -0.529  -1.125  1.00 0.00 ? 19 VAL B O    8  
ATOM 10384 C CB   . VAL B 1 19 ? 5.235   -2.749  -3.118  1.00 0.00 ? 19 VAL B CB   8  
ATOM 10385 C CG1  . VAL B 1 19 ? 5.489   -3.418  -4.461  1.00 0.00 ? 19 VAL B CG1  8  
ATOM 10386 C CG2  . VAL B 1 19 ? 4.278   -3.575  -2.273  1.00 0.00 ? 19 VAL B CG2  8  
ATOM 10387 H H    . VAL B 1 19 ? 6.769   -4.617  -2.178  1.00 0.00 ? 19 VAL B H    8  
ATOM 10388 H HA   . VAL B 1 19 ? 7.198   -1.905  -3.004  1.00 0.00 ? 19 VAL B HA   8  
ATOM 10389 H HB   . VAL B 1 19 ? 4.774   -1.789  -3.310  1.00 0.00 ? 19 VAL B HB   8  
ATOM 10390 H HG11 . VAL B 1 19 ? 5.954   -4.381  -4.306  1.00 0.00 ? 19 VAL B HG11 8  
ATOM 10391 H HG12 . VAL B 1 19 ? 6.143   -2.796  -5.057  1.00 0.00 ? 19 VAL B HG12 8  
ATOM 10392 H HG13 . VAL B 1 19 ? 4.552   -3.551  -4.983  1.00 0.00 ? 19 VAL B HG13 8  
ATOM 10393 H HG21 . VAL B 1 19 ? 3.340   -3.684  -2.800  1.00 0.00 ? 19 VAL B HG21 8  
ATOM 10394 H HG22 . VAL B 1 19 ? 4.092   -3.092  -1.326  1.00 0.00 ? 19 VAL B HG22 8  
ATOM 10395 H HG23 . VAL B 1 19 ? 4.699   -4.546  -2.106  1.00 0.00 ? 19 VAL B HG23 8  
ATOM 10396 N N    . LEU B 1 20 ? 6.280   -2.434  0.050   1.00 0.00 ? 20 LEU B N    8  
ATOM 10397 C CA   . LEU B 1 20 ? 6.034   -1.785  1.335   1.00 0.00 ? 20 LEU B CA   8  
ATOM 10398 C C    . LEU B 1 20 ? 7.202   -0.876  1.706   1.00 0.00 ? 20 LEU B C    8  
ATOM 10399 O O    . LEU B 1 20 ? 7.017   0.170   2.326   1.00 0.00 ? 20 LEU B O    8  
ATOM 10400 C CB   . LEU B 1 20 ? 5.812   -2.825  2.439   1.00 0.00 ? 20 LEU B CB   8  
ATOM 10401 C CG   . LEU B 1 20 ? 4.723   -2.473  3.461   1.00 0.00 ? 20 LEU B CG   8  
ATOM 10402 C CD1  . LEU B 1 20 ? 5.035   -1.160  4.166   1.00 0.00 ? 20 LEU B CD1  8  
ATOM 10403 C CD2  . LEU B 1 20 ? 3.365   -2.399  2.783   1.00 0.00 ? 20 LEU B CD2  8  
ATOM 10404 H H    . LEU B 1 20 ? 6.445   -3.404  0.034   1.00 0.00 ? 20 LEU B H    8  
ATOM 10405 H HA   . LEU B 1 20 ? 5.154   -1.171  1.228   1.00 0.00 ? 20 LEU B HA   8  
ATOM 10406 H HB2  . LEU B 1 20 ? 5.542   -3.765  1.980   1.00 0.00 ? 20 LEU B HB2  8  
ATOM 10407 H HB3  . LEU B 1 20 ? 6.738   -2.978  2.980   1.00 0.00 ? 20 LEU B HB3  8  
ATOM 10408 H HG   . LEU B 1 20 ? 4.679   -3.250  4.210   1.00 0.00 ? 20 LEU B HG   8  
ATOM 10409 H HD11 . LEU B 1 20 ? 4.958   -0.340  3.467   1.00 0.00 ? 20 LEU B HD11 8  
ATOM 10410 H HD12 . LEU B 1 20 ? 6.036   -1.192  4.574   1.00 0.00 ? 20 LEU B HD12 8  
ATOM 10411 H HD13 . LEU B 1 20 ? 4.329   -1.010  4.970   1.00 0.00 ? 20 LEU B HD13 8  
ATOM 10412 H HD21 . LEU B 1 20 ? 2.599   -2.254  3.532   1.00 0.00 ? 20 LEU B HD21 8  
ATOM 10413 H HD22 . LEU B 1 20 ? 3.170   -3.322  2.254   1.00 0.00 ? 20 LEU B HD22 8  
ATOM 10414 H HD23 . LEU B 1 20 ? 3.340   -1.575  2.086   1.00 0.00 ? 20 LEU B HD23 8  
ATOM 10415 N N    . THR B 1 21 ? 8.407   -1.285  1.323   1.00 0.00 ? 21 THR B N    8  
ATOM 10416 C CA   . THR B 1 21 ? 9.602   -0.503  1.610   1.00 0.00 ? 21 THR B CA   8  
ATOM 10417 C C    . THR B 1 21 ? 9.756   0.627   0.600   1.00 0.00 ? 21 THR B C    8  
ATOM 10418 O O    . THR B 1 21 ? 10.185  1.727   0.946   1.00 0.00 ? 21 THR B O    8  
ATOM 10419 C CB   . THR B 1 21 ? 10.871  -1.378  1.587   1.00 0.00 ? 21 THR B CB   8  
ATOM 10420 O OG1  . THR B 1 21 ? 10.720  -2.486  2.481   1.00 0.00 ? 21 THR B OG1  8  
ATOM 10421 C CG2  . THR B 1 21 ? 12.096  -0.566  1.984   1.00 0.00 ? 21 THR B CG2  8  
ATOM 10422 H H    . THR B 1 21 ? 8.506   -2.133  0.831   1.00 0.00 ? 21 THR B H    8  
ATOM 10423 H HA   . THR B 1 21 ? 9.504   -0.074  2.603   1.00 0.00 ? 21 THR B HA   8  
ATOM 10424 H HB   . THR B 1 21 ? 11.019  -1.758  0.584   1.00 0.00 ? 21 THR B HB   8  
ATOM 10425 H HG1  . THR B 1 21 ? 10.565  -2.183  3.386   1.00 0.00 ? 21 THR B HG1  8  
ATOM 10426 H HG21 . THR B 1 21 ? 12.352  0.121   1.191   1.00 0.00 ? 21 THR B HG21 8  
ATOM 10427 H HG22 . THR B 1 21 ? 12.926  -1.236  2.154   1.00 0.00 ? 21 THR B HG22 8  
ATOM 10428 H HG23 . THR B 1 21 ? 11.895  -0.012  2.891   1.00 0.00 ? 21 THR B HG23 8  
ATOM 10429 N N    . ILE B 1 22 ? 9.401   0.347   -0.649  1.00 0.00 ? 22 ILE B N    8  
ATOM 10430 C CA   . ILE B 1 22 ? 9.494   1.340   -1.712  1.00 0.00 ? 22 ILE B CA   8  
ATOM 10431 C C    . ILE B 1 22 ? 8.440   2.427   -1.534  1.00 0.00 ? 22 ILE B C    8  
ATOM 10432 O O    . ILE B 1 22 ? 8.709   3.607   -1.751  1.00 0.00 ? 22 ILE B O    8  
ATOM 10433 C CB   . ILE B 1 22 ? 9.329   0.692   -3.101  1.00 0.00 ? 22 ILE B CB   8  
ATOM 10434 C CG1  . ILE B 1 22 ? 10.424  -0.355  -3.325  1.00 0.00 ? 22 ILE B CG1  8  
ATOM 10435 C CG2  . ILE B 1 22 ? 9.363   1.753   -4.193  1.00 0.00 ? 22 ILE B CG2  8  
ATOM 10436 C CD1  . ILE B 1 22 ? 10.274  -1.127  -4.618  1.00 0.00 ? 22 ILE B CD1  8  
ATOM 10437 H H    . ILE B 1 22 ? 9.064   -0.552  -0.871  1.00 0.00 ? 22 ILE B H    8  
ATOM 10438 H HA   . ILE B 1 22 ? 10.476  1.800   -1.667  1.00 0.00 ? 22 ILE B HA   8  
ATOM 10439 H HB   . ILE B 1 22 ? 8.364   0.205   -3.136  1.00 0.00 ? 22 ILE B HB   8  
ATOM 10440 H HG12 . ILE B 1 22 ? 11.385  0.139   -3.352  1.00 0.00 ? 22 ILE B HG12 8  
ATOM 10441 H HG13 . ILE B 1 22 ? 10.424  -1.063  -2.518  1.00 0.00 ? 22 ILE B HG13 8  
ATOM 10442 H HG21 . ILE B 1 22 ? 8.536   2.435   -4.076  1.00 0.00 ? 22 ILE B HG21 8  
ATOM 10443 H HG22 . ILE B 1 22 ? 9.285   1.287   -5.164  1.00 0.00 ? 22 ILE B HG22 8  
ATOM 10444 H HG23 . ILE B 1 22 ? 10.291  2.304   -4.136  1.00 0.00 ? 22 ILE B HG23 8  
ATOM 10445 H HD11 . ILE B 1 22 ? 9.260   -1.489  -4.714  1.00 0.00 ? 22 ILE B HD11 8  
ATOM 10446 H HD12 . ILE B 1 22 ? 10.954  -1.966  -4.613  1.00 0.00 ? 22 ILE B HD12 8  
ATOM 10447 H HD13 . ILE B 1 22 ? 10.507  -0.483  -5.453  1.00 0.00 ? 22 ILE B HD13 8  
ATOM 10448 N N    . ILE B 1 23 ? 7.241   2.020   -1.129  1.00 0.00 ? 23 ILE B N    8  
ATOM 10449 C CA   . ILE B 1 23 ? 6.149   2.959   -0.920  1.00 0.00 ? 23 ILE B CA   8  
ATOM 10450 C C    . ILE B 1 23 ? 6.469   3.909   0.233   1.00 0.00 ? 23 ILE B C    8  
ATOM 10451 O O    . ILE B 1 23 ? 6.122   5.090   0.193   1.00 0.00 ? 23 ILE B O    8  
ATOM 10452 C CB   . ILE B 1 23 ? 4.819   2.226   -0.643  1.00 0.00 ? 23 ILE B CB   8  
ATOM 10453 C CG1  . ILE B 1 23 ? 3.646   3.207   -0.682  1.00 0.00 ? 23 ILE B CG1  8  
ATOM 10454 C CG2  . ILE B 1 23 ? 4.871   1.508   0.696   1.00 0.00 ? 23 ILE B CG2  8  
ATOM 10455 C CD1  . ILE B 1 23 ? 2.293   2.534   -0.612  1.00 0.00 ? 23 ILE B CD1  8  
ATOM 10456 H H    . ILE B 1 23 ? 7.081   1.061   -0.969  1.00 0.00 ? 23 ILE B H    8  
ATOM 10457 H HA   . ILE B 1 23 ? 6.034   3.542   -1.828  1.00 0.00 ? 23 ILE B HA   8  
ATOM 10458 H HB   . ILE B 1 23 ? 4.682   1.483   -1.415  1.00 0.00 ? 23 ILE B HB   8  
ATOM 10459 H HG12 . ILE B 1 23 ? 3.717   3.892   0.151   1.00 0.00 ? 23 ILE B HG12 8  
ATOM 10460 H HG13 . ILE B 1 23 ? 3.681   3.770   -1.606  1.00 0.00 ? 23 ILE B HG13 8  
ATOM 10461 H HG21 . ILE B 1 23 ? 4.036   0.827   0.768   1.00 0.00 ? 23 ILE B HG21 8  
ATOM 10462 H HG22 . ILE B 1 23 ? 4.823   2.218   1.511   1.00 0.00 ? 23 ILE B HG22 8  
ATOM 10463 H HG23 . ILE B 1 23 ? 5.774   0.961   0.757   1.00 0.00 ? 23 ILE B HG23 8  
ATOM 10464 H HD11 . ILE B 1 23 ? 1.517   3.278   -0.715  1.00 0.00 ? 23 ILE B HD11 8  
ATOM 10465 H HD12 . ILE B 1 23 ? 2.186   2.034   0.339   1.00 0.00 ? 23 ILE B HD12 8  
ATOM 10466 H HD13 . ILE B 1 23 ? 2.206   1.812   -1.411  1.00 0.00 ? 23 ILE B HD13 8  
ATOM 10467 N N    . SER B 1 24 ? 7.138   3.382   1.258   1.00 0.00 ? 24 SER B N    8  
ATOM 10468 C CA   . SER B 1 24 ? 7.517   4.178   2.419   1.00 0.00 ? 24 SER B CA   8  
ATOM 10469 C C    . SER B 1 24 ? 8.676   5.113   2.082   1.00 0.00 ? 24 SER B C    8  
ATOM 10470 O O    . SER B 1 24 ? 8.706   6.264   2.519   1.00 0.00 ? 24 SER B O    8  
ATOM 10471 C CB   . SER B 1 24 ? 7.900   3.270   3.591   1.00 0.00 ? 24 SER B CB   8  
ATOM 10472 O OG   . SER B 1 24 ? 8.984   2.423   3.248   1.00 0.00 ? 24 SER B OG   8  
ATOM 10473 H H    . SER B 1 24 ? 7.395   2.431   1.237   1.00 0.00 ? 24 SER B H    8  
ATOM 10474 H HA   . SER B 1 24 ? 6.664   4.778   2.713   1.00 0.00 ? 24 SER B HA   8  
ATOM 10475 H HB2  . SER B 1 24 ? 8.184   3.873   4.443   1.00 0.00 ? 24 SER B HB2  8  
ATOM 10476 H HB3  . SER B 1 24 ? 7.052   2.655   3.856   1.00 0.00 ? 24 SER B HB3  8  
ATOM 10477 H HG   . SER B 1 24 ? 9.276   1.945   4.027   1.00 0.00 ? 24 SER B HG   8  
ATOM 10478 N N    . LEU B 1 25 ? 9.628   4.608   1.300   1.00 0.00 ? 25 LEU B N    8  
ATOM 10479 C CA   . LEU B 1 25 ? 10.790  5.397   0.902   1.00 0.00 ? 25 LEU B CA   8  
ATOM 10480 C C    . LEU B 1 25 ? 10.362  6.656   0.158   1.00 0.00 ? 25 LEU B C    8  
ATOM 10481 O O    . LEU B 1 25 ? 10.975  7.714   0.307   1.00 0.00 ? 25 LEU B O    8  
ATOM 10482 C CB   . LEU B 1 25 ? 11.734  4.566   0.031   1.00 0.00 ? 25 LEU B CB   8  
ATOM 10483 C CG   . LEU B 1 25 ? 12.597  3.554   0.788   1.00 0.00 ? 25 LEU B CG   8  
ATOM 10484 C CD1  . LEU B 1 25 ? 13.284  2.608   -0.184  1.00 0.00 ? 25 LEU B CD1  8  
ATOM 10485 C CD2  . LEU B 1 25 ? 13.625  4.270   1.649   1.00 0.00 ? 25 LEU B CD2  8  
ATOM 10486 H H    . LEU B 1 25 ? 9.554   3.678   0.981   1.00 0.00 ? 25 LEU B H    8  
ATOM 10487 H HA   . LEU B 1 25 ? 11.305  5.701   1.800   1.00 0.00 ? 25 LEU B HA   8  
ATOM 10488 H HB2  . LEU B 1 25 ? 11.129  4.031   -0.692  1.00 0.00 ? 25 LEU B HB2  8  
ATOM 10489 H HB3  . LEU B 1 25 ? 12.396  5.233   -0.513  1.00 0.00 ? 25 LEU B HB3  8  
ATOM 10490 H HG   . LEU B 1 25 ? 11.976  2.970   1.442   1.00 0.00 ? 25 LEU B HG   8  
ATOM 10491 H HD11 . LEU B 1 25 ? 12.539  2.088   -0.771  1.00 0.00 ? 25 LEU B HD11 8  
ATOM 10492 H HD12 . LEU B 1 25 ? 13.870  1.884   0.366   1.00 0.00 ? 25 LEU B HD12 8  
ATOM 10493 H HD13 . LEU B 1 25 ? 13.933  3.168   -0.843  1.00 0.00 ? 25 LEU B HD13 8  
ATOM 10494 H HD21 . LEU B 1 25 ? 13.125  4.878   2.387   1.00 0.00 ? 25 LEU B HD21 8  
ATOM 10495 H HD22 . LEU B 1 25 ? 14.248  4.899   1.028   1.00 0.00 ? 25 LEU B HD22 8  
ATOM 10496 H HD23 . LEU B 1 25 ? 14.246  3.542   2.154   1.00 0.00 ? 25 LEU B HD23 8  
ATOM 10497 N N    . ILE B 1 26 ? 9.309   6.536   -0.649  1.00 0.00 ? 26 ILE B N    8  
ATOM 10498 C CA   . ILE B 1 26 ? 8.799   7.673   -1.404  1.00 0.00 ? 26 ILE B CA   8  
ATOM 10499 C C    . ILE B 1 26 ? 8.392   8.798   -0.459  1.00 0.00 ? 26 ILE B C    8  
ATOM 10500 O O    . ILE B 1 26 ? 8.626   9.973   -0.738  1.00 0.00 ? 26 ILE B O    8  
ATOM 10501 C CB   . ILE B 1 26 ? 7.593   7.277   -2.282  1.00 0.00 ? 26 ILE B CB   8  
ATOM 10502 C CG1  . ILE B 1 26 ? 8.027   6.282   -3.362  1.00 0.00 ? 26 ILE B CG1  8  
ATOM 10503 C CG2  . ILE B 1 26 ? 6.964   8.513   -2.913  1.00 0.00 ? 26 ILE B CG2  8  
ATOM 10504 C CD1  . ILE B 1 26 ? 6.869   5.674   -4.126  1.00 0.00 ? 26 ILE B CD1  8  
ATOM 10505 H H    . ILE B 1 26 ? 8.858   5.665   -0.739  1.00 0.00 ? 26 ILE B H    8  
ATOM 10506 H HA   . ILE B 1 26 ? 9.591   8.034   -2.050  1.00 0.00 ? 26 ILE B HA   8  
ATOM 10507 H HB   . ILE B 1 26 ? 6.854   6.812   -1.646  1.00 0.00 ? 26 ILE B HB   8  
ATOM 10508 H HG12 . ILE B 1 26 ? 8.663   6.785   -4.078  1.00 0.00 ? 26 ILE B HG12 8  
ATOM 10509 H HG13 . ILE B 1 26 ? 8.581   5.481   -2.915  1.00 0.00 ? 26 ILE B HG13 8  
ATOM 10510 H HG21 . ILE B 1 26 ? 6.501   9.121   -2.152  1.00 0.00 ? 26 ILE B HG21 8  
ATOM 10511 H HG22 . ILE B 1 26 ? 6.205   8.223   -3.625  1.00 0.00 ? 26 ILE B HG22 8  
ATOM 10512 H HG23 . ILE B 1 26 ? 7.723   9.092   -3.421  1.00 0.00 ? 26 ILE B HG23 8  
ATOM 10513 H HD11 . ILE B 1 26 ? 7.227   4.842   -4.714  1.00 0.00 ? 26 ILE B HD11 8  
ATOM 10514 H HD12 . ILE B 1 26 ? 6.439   6.415   -4.782  1.00 0.00 ? 26 ILE B HD12 8  
ATOM 10515 H HD13 . ILE B 1 26 ? 6.115   5.324   -3.434  1.00 0.00 ? 26 ILE B HD13 8  
ATOM 10516 N N    . ILE B 1 27 ? 7.781   8.425   0.663   1.00 0.00 ? 27 ILE B N    8  
ATOM 10517 C CA   . ILE B 1 27 ? 7.341   9.397   1.657   1.00 0.00 ? 27 ILE B CA   8  
ATOM 10518 C C    . ILE B 1 27 ? 8.535   10.087  2.306   1.00 0.00 ? 27 ILE B C    8  
ATOM 10519 O O    . ILE B 1 27 ? 8.535   11.302  2.494   1.00 0.00 ? 27 ILE B O    8  
ATOM 10520 C CB   . ILE B 1 27 ? 6.502   8.731   2.763   1.00 0.00 ? 27 ILE B CB   8  
ATOM 10521 C CG1  . ILE B 1 27 ? 5.458   7.794   2.155   1.00 0.00 ? 27 ILE B CG1  8  
ATOM 10522 C CG2  . ILE B 1 27 ? 5.832   9.789   3.628   1.00 0.00 ? 27 ILE B CG2  8  
ATOM 10523 C CD1  . ILE B 1 27 ? 4.762   6.921   3.178   1.00 0.00 ? 27 ILE B CD1  8  
ATOM 10524 H H    . ILE B 1 27 ? 7.641   7.469   0.829   1.00 0.00 ? 27 ILE B H    8  
ATOM 10525 H HA   . ILE B 1 27 ? 6.730   10.140  1.157   1.00 0.00 ? 27 ILE B HA   8  
ATOM 10526 H HB   . ILE B 1 27 ? 7.164   8.152   3.397   1.00 0.00 ? 27 ILE B HB   8  
ATOM 10527 H HG12 . ILE B 1 27 ? 4.700   8.375   1.650   1.00 0.00 ? 27 ILE B HG12 8  
ATOM 10528 H HG13 . ILE B 1 27 ? 5.914   7.132   1.446   1.00 0.00 ? 27 ILE B HG13 8  
ATOM 10529 H HG21 . ILE B 1 27 ? 5.257   9.312   4.409   1.00 0.00 ? 27 ILE B HG21 8  
ATOM 10530 H HG22 . ILE B 1 27 ? 5.174   10.393  3.020   1.00 0.00 ? 27 ILE B HG22 8  
ATOM 10531 H HG23 . ILE B 1 27 ? 6.580   10.423  4.082   1.00 0.00 ? 27 ILE B HG23 8  
ATOM 10532 H HD11 . ILE B 1 27 ? 4.148   7.535   3.819   1.00 0.00 ? 27 ILE B HD11 8  
ATOM 10533 H HD12 . ILE B 1 27 ? 5.498   6.400   3.774   1.00 0.00 ? 27 ILE B HD12 8  
ATOM 10534 H HD13 . ILE B 1 27 ? 4.139   6.200   2.669   1.00 0.00 ? 27 ILE B HD13 8  
ATOM 10535 N N    . LEU B 1 28 ? 9.545   9.293   2.647   1.00 0.00 ? 28 LEU B N    8  
ATOM 10536 C CA   . LEU B 1 28 ? 10.750  9.808   3.285   1.00 0.00 ? 28 LEU B CA   8  
ATOM 10537 C C    . LEU B 1 28 ? 11.403  10.896  2.439   1.00 0.00 ? 28 LEU B C    8  
ATOM 10538 O O    . LEU B 1 28 ? 11.585  12.024  2.897   1.00 0.00 ? 28 LEU B O    8  
ATOM 10539 C CB   . LEU B 1 28 ? 11.743  8.668   3.523   1.00 0.00 ? 28 LEU B CB   8  
ATOM 10540 C CG   . LEU B 1 28 ? 13.011  9.055   4.284   1.00 0.00 ? 28 LEU B CG   8  
ATOM 10541 C CD1  . LEU B 1 28 ? 12.682  9.432   5.720   1.00 0.00 ? 28 LEU B CD1  8  
ATOM 10542 C CD2  . LEU B 1 28 ? 14.019  7.917   4.246   1.00 0.00 ? 28 LEU B CD2  8  
ATOM 10543 H H    . LEU B 1 28 ? 9.478   8.324   2.474   1.00 0.00 ? 28 LEU B H    8  
ATOM 10544 H HA   . LEU B 1 28 ? 10.467  10.230  4.237   1.00 0.00 ? 28 LEU B HA   8  
ATOM 10545 H HB2  . LEU B 1 28 ? 11.233  7.887   4.074   1.00 0.00 ? 28 LEU B HB2  8  
ATOM 10546 H HB3  . LEU B 1 28 ? 12.029  8.266   2.558   1.00 0.00 ? 28 LEU B HB3  8  
ATOM 10547 H HG   . LEU B 1 28 ? 13.467  9.913   3.814   1.00 0.00 ? 28 LEU B HG   8  
ATOM 10548 H HD11 . LEU B 1 28 ? 12.208  8.597   6.218   1.00 0.00 ? 28 LEU B HD11 8  
ATOM 10549 H HD12 . LEU B 1 28 ? 12.015  10.281  5.729   1.00 0.00 ? 28 LEU B HD12 8  
ATOM 10550 H HD13 . LEU B 1 28 ? 13.591  9.692   6.245   1.00 0.00 ? 28 LEU B HD13 8  
ATOM 10551 H HD21 . LEU B 1 28 ? 13.601  7.042   4.726   1.00 0.00 ? 28 LEU B HD21 8  
ATOM 10552 H HD22 . LEU B 1 28 ? 14.921  8.214   4.764   1.00 0.00 ? 28 LEU B HD22 8  
ATOM 10553 H HD23 . LEU B 1 28 ? 14.261  7.681   3.219   1.00 0.00 ? 28 LEU B HD23 8  
ATOM 10554 N N    . ILE B 1 29 ? 11.754  10.551  1.203   1.00 0.00 ? 29 ILE B N    8  
ATOM 10555 C CA   . ILE B 1 29 ? 12.393  11.497  0.296   1.00 0.00 ? 29 ILE B CA   8  
ATOM 10556 C C    . ILE B 1 29 ? 11.482  12.687  0.003   1.00 0.00 ? 29 ILE B C    8  
ATOM 10557 O O    . ILE B 1 29 ? 11.948  13.820  -0.116  1.00 0.00 ? 29 ILE B O    8  
ATOM 10558 C CB   . ILE B 1 29 ? 12.788  10.823  -1.034  1.00 0.00 ? 29 ILE B CB   8  
ATOM 10559 C CG1  . ILE B 1 29 ? 13.666  9.596   -0.766  1.00 0.00 ? 29 ILE B CG1  8  
ATOM 10560 C CG2  . ILE B 1 29 ? 13.511  11.815  -1.937  1.00 0.00 ? 29 ILE B CG2  8  
ATOM 10561 C CD1  . ILE B 1 29 ? 14.023  8.816   -2.014  1.00 0.00 ? 29 ILE B CD1  8  
ATOM 10562 H H    . ILE B 1 29 ? 11.567  9.635   0.897   1.00 0.00 ? 29 ILE B H    8  
ATOM 10563 H HA   . ILE B 1 29 ? 13.296  11.860  0.773   1.00 0.00 ? 29 ILE B HA   8  
ATOM 10564 H HB   . ILE B 1 29 ? 11.886  10.505  -1.539  1.00 0.00 ? 29 ILE B HB   8  
ATOM 10565 H HG12 . ILE B 1 29 ? 14.589  9.911   -0.302  1.00 0.00 ? 29 ILE B HG12 8  
ATOM 10566 H HG13 . ILE B 1 29 ? 13.156  8.916   -0.103  1.00 0.00 ? 29 ILE B HG13 8  
ATOM 10567 H HG21 . ILE B 1 29 ? 12.867  12.650  -2.165  1.00 0.00 ? 29 ILE B HG21 8  
ATOM 10568 H HG22 . ILE B 1 29 ? 13.789  11.336  -2.863  1.00 0.00 ? 29 ILE B HG22 8  
ATOM 10569 H HG23 . ILE B 1 29 ? 14.401  12.176  -1.441  1.00 0.00 ? 29 ILE B HG23 8  
ATOM 10570 H HD11 . ILE B 1 29 ? 14.720  9.386   -2.609  1.00 0.00 ? 29 ILE B HD11 8  
ATOM 10571 H HD12 . ILE B 1 29 ? 13.130  8.620   -2.592  1.00 0.00 ? 29 ILE B HD12 8  
ATOM 10572 H HD13 . ILE B 1 29 ? 14.478  7.878   -1.731  1.00 0.00 ? 29 ILE B HD13 8  
ATOM 10573 N N    . MET B 1 30 ? 10.184  12.423  -0.115  1.00 0.00 ? 30 MET B N    8  
ATOM 10574 C CA   . MET B 1 30 ? 9.213   13.477  -0.393  1.00 0.00 ? 30 MET B CA   8  
ATOM 10575 C C    . MET B 1 30 ? 9.202   14.511  0.727   1.00 0.00 ? 30 MET B C    8  
ATOM 10576 O O    . MET B 1 30 ? 9.116   15.714  0.475   1.00 0.00 ? 30 MET B O    8  
ATOM 10577 C CB   . MET B 1 30 ? 7.815   12.883  -0.571  1.00 0.00 ? 30 MET B CB   8  
ATOM 10578 C CG   . MET B 1 30 ? 6.774   13.899  -1.017  1.00 0.00 ? 30 MET B CG   8  
ATOM 10579 S SD   . MET B 1 30 ? 5.168   13.151  -1.355  1.00 0.00 ? 30 MET B SD   8  
ATOM 10580 C CE   . MET B 1 30 ? 4.728   12.537  0.270   1.00 0.00 ? 30 MET B CE   8  
ATOM 10581 H H    . MET B 1 30 ? 9.864   11.496  -0.016  1.00 0.00 ? 30 MET B H    8  
ATOM 10582 H HA   . MET B 1 30 ? 9.505   13.966  -1.314  1.00 0.00 ? 30 MET B HA   8  
ATOM 10583 H HB2  . MET B 1 30 ? 7.871   12.113  -1.325  1.00 0.00 ? 30 MET B HB2  8  
ATOM 10584 H HB3  . MET B 1 30 ? 7.491   12.442  0.362   1.00 0.00 ? 30 MET B HB3  8  
ATOM 10585 H HG2  . MET B 1 30 ? 6.649   14.636  -0.238  1.00 0.00 ? 30 MET B HG2  8  
ATOM 10586 H HG3  . MET B 1 30 ? 7.123   14.385  -1.918  1.00 0.00 ? 30 MET B HG3  8  
ATOM 10587 H HE1  . MET B 1 30 ? 5.005   13.265  1.018   1.00 0.00 ? 30 MET B HE1  8  
ATOM 10588 H HE2  . MET B 1 30 ? 5.250   11.611  0.458   1.00 0.00 ? 30 MET B HE2  8  
ATOM 10589 H HE3  . MET B 1 30 ? 3.663   12.364  0.313   1.00 0.00 ? 30 MET B HE3  8  
ATOM 10590 N N    . LEU B 1 31 ? 9.292   14.035  1.965   1.00 0.00 ? 31 LEU B N    8  
ATOM 10591 C CA   . LEU B 1 31 ? 9.291   14.915  3.127   1.00 0.00 ? 31 LEU B CA   8  
ATOM 10592 C C    . LEU B 1 31 ? 10.683  15.490  3.372   1.00 0.00 ? 31 LEU B C    8  
ATOM 10593 O O    . LEU B 1 31 ? 10.831  16.539  3.999   1.00 0.00 ? 31 LEU B O    8  
ATOM 10594 C CB   . LEU B 1 31 ? 8.809   14.163  4.368   1.00 0.00 ? 31 LEU B CB   8  
ATOM 10595 C CG   . LEU B 1 31 ? 8.584   15.035  5.607   1.00 0.00 ? 31 LEU B CG   8  
ATOM 10596 C CD1  . LEU B 1 31 ? 7.383   15.946  5.406   1.00 0.00 ? 31 LEU B CD1  8  
ATOM 10597 C CD2  . LEU B 1 31 ? 8.396   14.169  6.841   1.00 0.00 ? 31 LEU B CD2  8  
ATOM 10598 H H    . LEU B 1 31 ? 9.360   13.062  2.110   1.00 0.00 ? 31 LEU B H    8  
ATOM 10599 H HA   . LEU B 1 31 ? 8.609   15.725  2.931   1.00 0.00 ? 31 LEU B HA   8  
ATOM 10600 H HB2  . LEU B 1 31 ? 7.880   13.663  4.121   1.00 0.00 ? 31 LEU B HB2  8  
ATOM 10601 H HB3  . LEU B 1 31 ? 9.545   13.404  4.609   1.00 0.00 ? 31 LEU B HB3  8  
ATOM 10602 H HG   . LEU B 1 31 ? 9.448   15.659  5.774   1.00 0.00 ? 31 LEU B HG   8  
ATOM 10603 H HD11 . LEU B 1 31 ? 7.228   16.544  6.295   1.00 0.00 ? 31 LEU B HD11 8  
ATOM 10604 H HD12 . LEU B 1 31 ? 6.500   15.351  5.217   1.00 0.00 ? 31 LEU B HD12 8  
ATOM 10605 H HD13 . LEU B 1 31 ? 7.560   16.601  4.567   1.00 0.00 ? 31 LEU B HD13 8  
ATOM 10606 H HD21 . LEU B 1 31 ? 9.269   13.547  6.983   1.00 0.00 ? 31 LEU B HD21 8  
ATOM 10607 H HD22 . LEU B 1 31 ? 7.525   13.540  6.718   1.00 0.00 ? 31 LEU B HD22 8  
ATOM 10608 H HD23 . LEU B 1 31 ? 8.263   14.799  7.710   1.00 0.00 ? 31 LEU B HD23 8  
ATOM 10609 N N    . TRP B 1 32 ? 11.702  14.790  2.880   1.00 0.00 ? 32 TRP B N    8  
ATOM 10610 C CA   . TRP B 1 32 ? 13.082  15.229  3.047   1.00 0.00 ? 32 TRP B CA   8  
ATOM 10611 C C    . TRP B 1 32 ? 13.348  16.486  2.224   1.00 0.00 ? 32 TRP B C    8  
ATOM 10612 O O    . TRP B 1 32 ? 14.156  17.332  2.605   1.00 0.00 ? 32 TRP B O    8  
ATOM 10613 C CB   . TRP B 1 32 ? 14.046  14.112  2.640   1.00 0.00 ? 32 TRP B CB   8  
ATOM 10614 C CG   . TRP B 1 32 ? 15.491  14.480  2.795   1.00 0.00 ? 32 TRP B CG   8  
ATOM 10615 C CD1  . TRP B 1 32 ? 16.098  14.959  3.918   1.00 0.00 ? 32 TRP B CD1  8  
ATOM 10616 C CD2  . TRP B 1 32 ? 16.508  14.390  1.793   1.00 0.00 ? 32 TRP B CD2  8  
ATOM 10617 N NE1  . TRP B 1 32 ? 17.433  15.179  3.675   1.00 0.00 ? 32 TRP B NE1  8  
ATOM 10618 C CE2  . TRP B 1 32 ? 17.708  14.837  2.377   1.00 0.00 ? 32 TRP B CE2  8  
ATOM 10619 C CE3  . TRP B 1 32 ? 16.521  13.976  0.458   1.00 0.00 ? 32 TRP B CE3  8  
ATOM 10620 C CZ2  . TRP B 1 32 ? 18.909  14.881  1.670   1.00 0.00 ? 32 TRP B CZ2  8  
ATOM 10621 C CZ3  . TRP B 1 32 ? 17.712  14.021  -0.242  1.00 0.00 ? 32 TRP B CZ3  8  
ATOM 10622 C CH2  . TRP B 1 32 ? 18.892  14.469  0.365   1.00 0.00 ? 32 TRP B CH2  8  
ATOM 10623 H H    . TRP B 1 32 ? 11.533  13.953  2.398   1.00 0.00 ? 32 TRP B H    8  
ATOM 10624 H HA   . TRP B 1 32 ? 13.241  15.460  4.093   1.00 0.00 ? 32 TRP B HA   8  
ATOM 10625 H HB2  . TRP B 1 32 ? 13.858  13.246  3.258   1.00 0.00 ? 32 TRP B HB2  8  
ATOM 10626 H HB3  . TRP B 1 32 ? 13.869  13.852  1.605   1.00 0.00 ? 32 TRP B HB3  8  
ATOM 10627 H HD1  . TRP B 1 32 ? 15.591  15.138  4.854   1.00 0.00 ? 32 TRP B HD1  8  
ATOM 10628 H HE1  . TRP B 1 32 ? 18.081  15.524  4.324   1.00 0.00 ? 32 TRP B HE1  8  
ATOM 10629 H HE3  . TRP B 1 32 ? 15.621  13.627  -0.027  1.00 0.00 ? 32 TRP B HE3  8  
ATOM 10630 H HZ2  . TRP B 1 32 ? 19.827  15.223  2.124   1.00 0.00 ? 32 TRP B HZ2  8  
ATOM 10631 H HZ3  . TRP B 1 32 ? 17.741  13.705  -1.274  1.00 0.00 ? 32 TRP B HZ3  8  
ATOM 10632 H HH2  . TRP B 1 32 ? 19.799  14.488  -0.221  1.00 0.00 ? 32 TRP B HH2  8  
ATOM 10633 N N    . GLN B 1 33 ? 12.659  16.597  1.092   1.00 0.00 ? 33 GLN B N    8  
ATOM 10634 C CA   . GLN B 1 33 ? 12.807  17.750  0.212   1.00 0.00 ? 33 GLN B CA   8  
ATOM 10635 C C    . GLN B 1 33 ? 11.655  18.728  0.415   1.00 0.00 ? 33 GLN B C    8  
ATOM 10636 O O    . GLN B 1 33 ? 11.486  19.676  -0.351  1.00 0.00 ? 33 GLN B O    8  
ATOM 10637 C CB   . GLN B 1 33 ? 12.870  17.299  -1.250  1.00 0.00 ? 33 GLN B CB   8  
ATOM 10638 C CG   . GLN B 1 33 ? 14.096  16.458  -1.566  1.00 0.00 ? 33 GLN B CG   8  
ATOM 10639 C CD   . GLN B 1 33 ? 14.162  16.030  -3.022  1.00 0.00 ? 33 GLN B CD   8  
ATOM 10640 O OE1  . GLN B 1 33 ? 14.707  14.975  -3.344  1.00 0.00 ? 33 GLN B OE1  8  
ATOM 10641 N NE2  . GLN B 1 33 ? 13.609  16.851  -3.909  1.00 0.00 ? 33 GLN B NE2  8  
ATOM 10642 H H    . GLN B 1 33 ? 12.025  15.891  0.829   1.00 0.00 ? 33 GLN B H    8  
ATOM 10643 H HA   . GLN B 1 33 ? 13.731  18.265  0.451   1.00 0.00 ? 33 GLN B HA   8  
ATOM 10644 H HB2  . GLN B 1 33 ? 11.985  16.722  -1.479  1.00 0.00 ? 33 GLN B HB2  8  
ATOM 10645 H HB3  . GLN B 1 33 ? 12.891  18.182  -1.870  1.00 0.00 ? 33 GLN B HB3  8  
ATOM 10646 H HG2  . GLN B 1 33 ? 14.981  17.034  -1.339  1.00 0.00 ? 33 GLN B HG2  8  
ATOM 10647 H HG3  . GLN B 1 33 ? 14.077  15.572  -0.947  1.00 0.00 ? 33 GLN B HG3  8  
ATOM 10648 H HE21 . GLN B 1 33 ? 13.194  17.686  -3.628  1.00 0.00 ? 33 GLN B HE21 8  
ATOM 10649 H HE22 . GLN B 1 33 ? 13.641  16.573  -4.848  1.00 0.00 ? 33 GLN B HE22 8  
ATOM 10650 N N    . LYS B 1 34 ? 10.866  18.485  1.459   1.00 0.00 ? 34 LYS B N    8  
ATOM 10651 C CA   . LYS B 1 34 ? 9.728   19.339  1.780   1.00 0.00 ? 34 LYS B CA   8  
ATOM 10652 C C    . LYS B 1 34 ? 10.192  20.742  2.161   1.00 0.00 ? 34 LYS B C    8  
ATOM 10653 O O    . LYS B 1 34 ? 9.861   21.720  1.491   1.00 0.00 ? 34 LYS B O    8  
ATOM 10654 C CB   . LYS B 1 34 ? 8.918   18.730  2.928   1.00 0.00 ? 34 LYS B CB   8  
ATOM 10655 C CG   . LYS B 1 34 ? 7.621   19.468  3.222   1.00 0.00 ? 34 LYS B CG   8  
ATOM 10656 C CD   . LYS B 1 34 ? 6.552   19.156  2.186   1.00 0.00 ? 34 LYS B CD   8  
ATOM 10657 C CE   . LYS B 1 34 ? 5.254   19.887  2.487   1.00 0.00 ? 34 LYS B CE   8  
ATOM 10658 N NZ   . LYS B 1 34 ? 5.406   21.363  2.361   1.00 0.00 ? 34 LYS B NZ   8  
ATOM 10659 H H    . LYS B 1 34 ? 11.042  17.727  2.038   1.00 0.00 ? 34 LYS B H    8  
ATOM 10660 H HA   . LYS B 1 34 ? 9.097   19.406  0.903   1.00 0.00 ? 34 LYS B HA   8  
ATOM 10661 H HB2  . LYS B 1 34 ? 8.683   17.712  2.674   1.00 0.00 ? 34 LYS B HB2  8  
ATOM 10662 H HB3  . LYS B 1 34 ? 9.516   18.728  3.828   1.00 0.00 ? 34 LYS B HB3  8  
ATOM 10663 H HG2  . LYS B 1 34 ? 7.264   19.153  4.192   1.00 0.00 ? 34 LYS B HG2  8  
ATOM 10664 H HG3  . LYS B 1 34 ? 7.801   20.532  3.240   1.00 0.00 ? 34 LYS B HG3  8  
ATOM 10665 H HD2  . LYS B 1 34 ? 6.904   19.462  1.211   1.00 0.00 ? 34 LYS B HD2  8  
ATOM 10666 H HD3  . LYS B 1 34 ? 6.361   18.092  2.185   1.00 0.00 ? 34 LYS B HD3  8  
ATOM 10667 H HE2  . LYS B 1 34 ? 4.501   19.554  1.788   1.00 0.00 ? 34 LYS B HE2  8  
ATOM 10668 H HE3  . LYS B 1 34 ? 4.937   19.649  3.493   1.00 0.00 ? 34 LYS B HE3  8  
ATOM 10669 H HZ1  . LYS B 1 34 ? 5.811   21.613  1.433   1.00 0.00 ? 34 LYS B HZ1  8  
ATOM 10670 H HZ2  . LYS B 1 34 ? 6.028   21.727  3.108   1.00 0.00 ? 34 LYS B HZ2  8  
ATOM 10671 H HZ3  . LYS B 1 34 ? 4.477   21.822  2.452   1.00 0.00 ? 34 LYS B HZ3  8  
ATOM 10672 N N    . LYS B 1 35 ? 10.962  20.830  3.243   1.00 0.00 ? 35 LYS B N    8  
ATOM 10673 C CA   . LYS B 1 35 ? 11.473  22.113  3.716   1.00 0.00 ? 35 LYS B CA   8  
ATOM 10674 C C    . LYS B 1 35 ? 12.947  22.285  3.342   1.00 0.00 ? 35 LYS B C    8  
ATOM 10675 O O    . LYS B 1 35 ? 13.805  21.564  3.851   1.00 0.00 ? 35 LYS B O    8  
ATOM 10676 C CB   . LYS B 1 35 ? 11.318  22.219  5.235   1.00 0.00 ? 35 LYS B CB   8  
ATOM 10677 C CG   . LYS B 1 35 ? 9.918   21.903  5.733   1.00 0.00 ? 35 LYS B CG   8  
ATOM 10678 C CD   . LYS B 1 35 ? 9.832   22.015  7.248   1.00 0.00 ? 35 LYS B CD   8  
ATOM 10679 C CE   . LYS B 1 35 ? 8.480   21.554  7.766   1.00 0.00 ? 35 LYS B CE   8  
ATOM 10680 N NZ   . LYS B 1 35 ? 8.223   20.122  7.450   1.00 0.00 ? 35 LYS B NZ   8  
ATOM 10681 H H    . LYS B 1 35 ? 11.205  20.014  3.739   1.00 0.00 ? 35 LYS B H    8  
ATOM 10682 H HA   . LYS B 1 35 ? 10.884  22.902  3.275   1.00 0.00 ? 35 LYS B HA   8  
ATOM 10683 H HB2  . LYS B 1 35 ? 12.007  21.528  5.709   1.00 0.00 ? 35 LYS B HB2  8  
ATOM 10684 H HB3  . LYS B 1 35 ? 11.568  23.227  5.538   1.00 0.00 ? 35 LYS B HB3  8  
ATOM 10685 H HG2  . LYS B 1 35 ? 9.221   22.599  5.289   1.00 0.00 ? 35 LYS B HG2  8  
ATOM 10686 H HG3  . LYS B 1 35 ? 9.666   20.896  5.436   1.00 0.00 ? 35 LYS B HG3  8  
ATOM 10687 H HD2  . LYS B 1 35 ? 10.600  21.399  7.696   1.00 0.00 ? 35 LYS B HD2  8  
ATOM 10688 H HD3  . LYS B 1 35 ? 9.983   23.046  7.532   1.00 0.00 ? 35 LYS B HD3  8  
ATOM 10689 H HE2  . LYS B 1 35 ? 8.458   21.684  8.838   1.00 0.00 ? 35 LYS B HE2  8  
ATOM 10690 H HE3  . LYS B 1 35 ? 7.705   22.159  7.316   1.00 0.00 ? 35 LYS B HE3  8  
ATOM 10691 H HZ1  . LYS B 1 35 ? 9.048   19.534  7.697   1.00 0.00 ? 35 LYS B HZ1  8  
ATOM 10692 H HZ2  . LYS B 1 35 ? 8.019   20.007  6.438   1.00 0.00 ? 35 LYS B HZ2  8  
ATOM 10693 H HZ3  . LYS B 1 35 ? 7.402   19.784  7.992   1.00 0.00 ? 35 LYS B HZ3  8  
ATOM 10694 N N    . PRO B 1 36 ? 13.266  23.241  2.446   1.00 0.00 ? 36 PRO B N    8  
ATOM 10695 C CA   . PRO B 1 36 ? 14.645  23.492  2.024   1.00 0.00 ? 36 PRO B CA   8  
ATOM 10696 C C    . PRO B 1 36 ? 15.439  24.277  3.064   1.00 0.00 ? 36 PRO B C    8  
ATOM 10697 O O    . PRO B 1 36 ? 15.059  25.387  3.442   1.00 0.00 ? 36 PRO B O    8  
ATOM 10698 C CB   . PRO B 1 36 ? 14.474  24.312  0.746   1.00 0.00 ? 36 PRO B CB   8  
ATOM 10699 C CG   . PRO B 1 36 ? 13.188  25.041  0.935   1.00 0.00 ? 36 PRO B CG   8  
ATOM 10700 C CD   . PRO B 1 36 ? 12.311  24.146  1.772   1.00 0.00 ? 36 PRO B CD   8  
ATOM 10701 H HA   . PRO B 1 36 ? 15.159  22.568  1.787   1.00 0.00 ? 36 PRO B HA   8  
ATOM 10702 H HB2  . PRO B 1 36 ? 15.304  24.996  0.613   1.00 0.00 ? 36 PRO B HB2  8  
ATOM 10703 H HB3  . PRO B 1 36 ? 14.419  23.645  -0.101  1.00 0.00 ? 36 PRO B HB3  8  
ATOM 10704 H HG2  . PRO B 1 36 ? 13.368  25.974  1.449   1.00 0.00 ? 36 PRO B HG2  8  
ATOM 10705 H HG3  . PRO B 1 36 ? 12.727  25.225  -0.024  1.00 0.00 ? 36 PRO B HG3  8  
ATOM 10706 H HD2  . PRO B 1 36 ? 11.762  24.732  2.494   1.00 0.00 ? 36 PRO B HD2  8  
ATOM 10707 H HD3  . PRO B 1 36 ? 11.632  23.589  1.143   1.00 0.00 ? 36 PRO B HD3  8  
ATOM 10708 N N    . ARG B 1 37 ? 16.544  23.694  3.525   1.00 0.00 ? 37 ARG B N    8  
ATOM 10709 C CA   . ARG B 1 37 ? 17.391  24.338  4.523   1.00 0.00 ? 37 ARG B CA   8  
ATOM 10710 C C    . ARG B 1 37 ? 18.374  25.301  3.868   1.00 0.00 ? 37 ARG B C    8  
ATOM 10711 O O    . ARG B 1 37 ? 18.940  25.007  2.815   1.00 0.00 ? 37 ARG B O    8  
ATOM 10712 C CB   . ARG B 1 37 ? 18.155  23.288  5.338   1.00 0.00 ? 37 ARG B CB   8  
ATOM 10713 C CG   . ARG B 1 37 ? 17.286  22.530  6.330   1.00 0.00 ? 37 ARG B CG   8  
ATOM 10714 C CD   . ARG B 1 37 ? 16.388  21.517  5.637   1.00 0.00 ? 37 ARG B CD   8  
ATOM 10715 N NE   . ARG B 1 37 ? 15.456  20.886  6.569   1.00 0.00 ? 37 ARG B NE   8  
ATOM 10716 C CZ   . ARG B 1 37 ? 14.958  19.665  6.403   1.00 0.00 ? 37 ARG B CZ   8  
ATOM 10717 N NH1  . ARG B 1 37 ? 15.311  18.938  5.351   1.00 0.00 ? 37 ARG B NH1  8  
ATOM 10718 N NH2  . ARG B 1 37 ? 14.111  19.168  7.293   1.00 0.00 ? 37 ARG B NH2  8  
ATOM 10719 H H    . ARG B 1 37 ? 16.804  22.807  3.179   1.00 0.00 ? 37 ARG B H    8  
ATOM 10720 H HA   . ARG B 1 37 ? 16.751  24.900  5.198   1.00 0.00 ? 37 ARG B HA   8  
ATOM 10721 H HB2  . ARG B 1 37 ? 18.609  22.579  4.659   1.00 0.00 ? 37 ARG B HB2  8  
ATOM 10722 H HB3  . ARG B 1 37 ? 18.941  23.778  5.901   1.00 0.00 ? 37 ARG B HB3  8  
ATOM 10723 H HG2  . ARG B 1 37 ? 17.928  22.006  7.022   1.00 0.00 ? 37 ARG B HG2  8  
ATOM 10724 H HG3  . ARG B 1 37 ? 16.670  23.232  6.875   1.00 0.00 ? 37 ARG B HG3  8  
ATOM 10725 H HD2  . ARG B 1 37 ? 15.817  22.011  4.882   1.00 0.00 ? 37 ARG B HD2  8  
ATOM 10726 H HD3  . ARG B 1 37 ? 17.024  20.772  5.187   1.00 0.00 ? 37 ARG B HD3  8  
ATOM 10727 H HE   . ARG B 1 37 ? 15.178  21.404  7.360   1.00 0.00 ? 37 ARG B HE   8  
ATOM 10728 H HH11 . ARG B 1 37 ? 15.945  19.280  4.665   1.00 0.00 ? 37 ARG B HH11 8  
ATOM 10729 H HH12 . ARG B 1 37 ? 14.931  18.017  5.240   1.00 0.00 ? 37 ARG B HH12 8  
ATOM 10730 H HH21 . ARG B 1 37 ? 13.844  19.711  8.092   1.00 0.00 ? 37 ARG B HH21 8  
ATOM 10731 H HH22 . ARG B 1 37 ? 13.733  18.248  7.171   1.00 0.00 ? 37 ARG B HH22 8  
ATOM 10732 N N    . TYR B 1 38 ? 18.569  26.456  4.498   1.00 0.00 ? 38 TYR B N    8  
ATOM 10733 C CA   . TYR B 1 38 ? 19.485  27.466  3.980   1.00 0.00 ? 38 TYR B CA   8  
ATOM 10734 C C    . TYR B 1 38 ? 20.901  27.219  4.487   1.00 0.00 ? 38 TYR B C    8  
ATOM 10735 O O    . TYR B 1 38 ? 21.098  26.830  5.639   1.00 0.00 ? 38 TYR B O    8  
ATOM 10736 C CB   . TYR B 1 38 ? 19.018  28.865  4.388   1.00 0.00 ? 38 TYR B CB   8  
ATOM 10737 C CG   . TYR B 1 38 ? 19.891  29.977  3.849   1.00 0.00 ? 38 TYR B CG   8  
ATOM 10738 C CD1  . TYR B 1 38 ? 19.792  30.384  2.525   1.00 0.00 ? 38 TYR B CD1  8  
ATOM 10739 C CD2  . TYR B 1 38 ? 20.815  30.616  4.666   1.00 0.00 ? 38 TYR B CD2  8  
ATOM 10740 C CE1  . TYR B 1 38 ? 20.589  31.400  2.030   1.00 0.00 ? 38 TYR B CE1  8  
ATOM 10741 C CE2  . TYR B 1 38 ? 21.614  31.633  4.179   1.00 0.00 ? 38 TYR B CE2  8  
ATOM 10742 C CZ   . TYR B 1 38 ? 21.499  32.020  2.861   1.00 0.00 ? 38 TYR B CZ   8  
ATOM 10743 O OH   . TYR B 1 38 ? 22.293  33.031  2.372   1.00 0.00 ? 38 TYR B OH   8  
ATOM 10744 H H    . TYR B 1 38 ? 18.088  26.636  5.341   1.00 0.00 ? 38 TYR B H    8  
ATOM 10745 H HA   . TYR B 1 38 ? 19.483  27.409  2.896   1.00 0.00 ? 38 TYR B HA   8  
ATOM 10746 H HB2  . TYR B 1 38 ? 18.013  29.017  4.016   1.00 0.00 ? 38 TYR B HB2  8  
ATOM 10747 H HB3  . TYR B 1 38 ? 19.001  28.931  5.469   1.00 0.00 ? 38 TYR B HB3  8  
ATOM 10748 H HD1  . TYR B 1 38 ? 19.078  29.899  1.874   1.00 0.00 ? 38 TYR B HD1  8  
ATOM 10749 H HD2  . TYR B 1 38 ? 20.907  30.313  5.700   1.00 0.00 ? 38 TYR B HD2  8  
ATOM 10750 H HE1  . TYR B 1 38 ? 20.498  31.703  0.997   1.00 0.00 ? 38 TYR B HE1  8  
ATOM 10751 H HE2  . TYR B 1 38 ? 22.327  32.118  4.830   1.00 0.00 ? 38 TYR B HE2  8  
ATOM 10752 H HH   . TYR B 1 38 ? 23.130  32.666  2.076   1.00 0.00 ? 38 TYR B HH   8  
ATOM 10753 N N    . GLU B 1 39 ? 21.882  27.446  3.621   1.00 0.00 ? 39 GLU B N    8  
ATOM 10754 C CA   . GLU B 1 39 ? 23.281  27.245  3.981   1.00 0.00 ? 39 GLU B CA   8  
ATOM 10755 C C    . GLU B 1 39 ? 23.923  28.559  4.421   1.00 0.00 ? 39 GLU B C    8  
ATOM 10756 O O    . GLU B 1 39 ? 23.818  29.553  3.669   1.00 0.00 ? 39 GLU B O    8  
ATOM 10757 C CB   . GLU B 1 39 ? 24.052  26.651  2.800   1.00 0.00 ? 39 GLU B CB   8  
ATOM 10758 C CG   . GLU B 1 39 ? 25.529  26.434  3.083   1.00 0.00 ? 39 GLU B CG   8  
ATOM 10759 C CD   . GLU B 1 39 ? 25.770  25.486  4.240   1.00 0.00 ? 39 GLU B CD   8  
ATOM 10760 O OE1  . GLU B 1 39 ? 25.863  24.264  3.997   1.00 0.00 ? 39 GLU B OE1  8  
ATOM 10761 O OE2  . GLU B 1 39 ? 25.864  25.964  5.391   1.00 0.00 ? 39 GLU B OE2  8  
ATOM 10762 O OXT  . GLU B 1 39 ? 24.527  28.585  5.515   1.00 0.00 ? 39 GLU B OXT  8  
ATOM 10763 H H    . GLU B 1 39 ? 21.664  27.761  2.711   1.00 0.00 ? 39 GLU B H    8  
ATOM 10764 H HA   . GLU B 1 39 ? 23.331  26.546  4.807   1.00 0.00 ? 39 GLU B HA   8  
ATOM 10765 H HB2  . GLU B 1 39 ? 23.612  25.699  2.540   1.00 0.00 ? 39 GLU B HB2  8  
ATOM 10766 H HB3  . GLU B 1 39 ? 23.964  27.318  1.955   1.00 0.00 ? 39 GLU B HB3  8  
ATOM 10767 H HG2  . GLU B 1 39 ? 25.986  26.012  2.200   1.00 0.00 ? 39 GLU B HG2  8  
ATOM 10768 H HG3  . GLU B 1 39 ? 25.998  27.380  3.304   1.00 0.00 ? 39 GLU B HG3  8  
ATOM 10769 N N    . GLY A 1 1  ? 3.903   -35.451 5.058   1.00 0.00 ? 1  GLY A N    9  
ATOM 10770 C CA   . GLY A 1 1  ? 4.591   -34.425 5.890   1.00 0.00 ? 1  GLY A CA   9  
ATOM 10771 C C    . GLY A 1 1  ? 4.549   -33.045 5.265   1.00 0.00 ? 1  GLY A C    9  
ATOM 10772 O O    . GLY A 1 1  ? 4.751   -32.894 4.060   1.00 0.00 ? 1  GLY A O    9  
ATOM 10773 H H1   . GLY A 1 1  ? 3.957   -36.380 5.523   1.00 0.00 ? 1  GLY A H1   9  
ATOM 10774 H H2   . GLY A 1 1  ? 4.355   -35.521 4.123   1.00 0.00 ? 1  GLY A H2   9  
ATOM 10775 H H3   . GLY A 1 1  ? 2.901   -35.199 4.930   1.00 0.00 ? 1  GLY A H3   9  
ATOM 10776 H HA2  . GLY A 1 1  ? 4.116   -34.394 6.861   1.00 0.00 ? 1  GLY A HA2  9  
ATOM 10777 H HA3  . GLY A 1 1  ? 5.623   -34.718 6.017   1.00 0.00 ? 1  GLY A HA3  9  
ATOM 10778 N N    . HIS A 1 2  ? 4.282   -32.034 6.089   1.00 0.00 ? 2  HIS A N    9  
ATOM 10779 C CA   . HIS A 1 2  ? 4.213   -30.656 5.616   1.00 0.00 ? 2  HIS A CA   9  
ATOM 10780 C C    . HIS A 1 2  ? 5.346   -29.822 6.202   1.00 0.00 ? 2  HIS A C    9  
ATOM 10781 O O    . HIS A 1 2  ? 5.516   -29.756 7.420   1.00 0.00 ? 2  HIS A O    9  
ATOM 10782 C CB   . HIS A 1 2  ? 2.866   -30.035 5.986   1.00 0.00 ? 2  HIS A CB   9  
ATOM 10783 C CG   . HIS A 1 2  ? 1.696   -30.727 5.358   1.00 0.00 ? 2  HIS A CG   9  
ATOM 10784 N ND1  . HIS A 1 2  ? 0.927   -30.157 4.365   1.00 0.00 ? 2  HIS A ND1  9  
ATOM 10785 C CD2  . HIS A 1 2  ? 1.161   -31.951 5.590   1.00 0.00 ? 2  HIS A CD2  9  
ATOM 10786 C CE1  . HIS A 1 2  ? -0.029  -31.000 4.013   1.00 0.00 ? 2  HIS A CE1  9  
ATOM 10787 N NE2  . HIS A 1 2  ? 0.091   -32.094 4.742   1.00 0.00 ? 2  HIS A NE2  9  
ATOM 10788 H H    . HIS A 1 2  ? 4.128   -32.211 7.046   1.00 0.00 ? 2  HIS A H    9  
ATOM 10789 H HA   . HIS A 1 2  ? 4.301   -30.649 4.534   1.00 0.00 ? 2  HIS A HA   9  
ATOM 10790 H HB2  . HIS A 1 2  ? 2.738   -30.079 7.058   1.00 0.00 ? 2  HIS A HB2  9  
ATOM 10791 H HB3  . HIS A 1 2  ? 2.847   -29.000 5.668   1.00 0.00 ? 2  HIS A HB3  9  
ATOM 10792 H HD1  . HIS A 1 2  ? 1.061   -29.267 3.977   1.00 0.00 ? 2  HIS A HD1  9  
ATOM 10793 H HD2  . HIS A 1 2  ? 1.512   -32.678 6.309   1.00 0.00 ? 2  HIS A HD2  9  
ATOM 10794 H HE1  . HIS A 1 2  ? -0.779  -30.824 3.257   1.00 0.00 ? 2  HIS A HE1  9  
ATOM 10795 H HE2  . HIS A 1 2  ? -0.540  -32.844 4.743   1.00 0.00 ? 2  HIS A HE2  9  
ATOM 10796 N N    . SER A 1 3  ? 6.120   -29.186 5.327   1.00 0.00 ? 3  SER A N    9  
ATOM 10797 C CA   . SER A 1 3  ? 7.236   -28.353 5.758   1.00 0.00 ? 3  SER A CA   9  
ATOM 10798 C C    . SER A 1 3  ? 6.817   -26.889 5.845   1.00 0.00 ? 3  SER A C    9  
ATOM 10799 O O    . SER A 1 3  ? 6.958   -26.254 6.891   1.00 0.00 ? 3  SER A O    9  
ATOM 10800 C CB   . SER A 1 3  ? 8.413   -28.504 4.793   1.00 0.00 ? 3  SER A CB   9  
ATOM 10801 O OG   . SER A 1 3  ? 8.857   -29.848 4.733   1.00 0.00 ? 3  SER A OG   9  
ATOM 10802 H H    . SER A 1 3  ? 5.936   -29.271 4.361   1.00 0.00 ? 3  SER A H    9  
ATOM 10803 H HA   . SER A 1 3  ? 7.560   -28.675 6.741   1.00 0.00 ? 3  SER A HA   9  
ATOM 10804 H HB2  . SER A 1 3  ? 8.107   -28.199 3.803   1.00 0.00 ? 3  SER A HB2  9  
ATOM 10805 H HB3  . SER A 1 3  ? 9.235   -27.882 5.123   1.00 0.00 ? 3  SER A HB3  9  
ATOM 10806 H HG   . SER A 1 3  ? 9.418   -30.037 5.490   1.00 0.00 ? 3  SER A HG   9  
ATOM 10807 N N    . LEU A 1 4  ? 6.300   -26.358 4.740   1.00 0.00 ? 4  LEU A N    9  
ATOM 10808 C CA   . LEU A 1 4  ? 5.855   -24.971 4.692   1.00 0.00 ? 4  LEU A CA   9  
ATOM 10809 C C    . LEU A 1 4  ? 4.337   -24.893 4.511   1.00 0.00 ? 4  LEU A C    9  
ATOM 10810 O O    . LEU A 1 4  ? 3.839   -24.977 3.388   1.00 0.00 ? 4  LEU A O    9  
ATOM 10811 C CB   . LEU A 1 4  ? 6.554   -24.223 3.553   1.00 0.00 ? 4  LEU A CB   9  
ATOM 10812 C CG   . LEU A 1 4  ? 6.169   -22.748 3.414   1.00 0.00 ? 4  LEU A CG   9  
ATOM 10813 C CD1  . LEU A 1 4  ? 6.611   -21.959 4.636   1.00 0.00 ? 4  LEU A CD1  9  
ATOM 10814 C CD2  . LEU A 1 4  ? 6.772   -22.158 2.148   1.00 0.00 ? 4  LEU A CD2  9  
ATOM 10815 H H    . LEU A 1 4  ? 6.207   -26.911 3.930   1.00 0.00 ? 4  LEU A H    9  
ATOM 10816 H HA   . LEU A 1 4  ? 6.136   -24.487 5.610   1.00 0.00 ? 4  LEU A HA   9  
ATOM 10817 H HB2  . LEU A 1 4  ? 7.623   -24.289 3.710   1.00 0.00 ? 4  LEU A HB2  9  
ATOM 10818 H HB3  . LEU A 1 4  ? 6.315   -24.729 2.626   1.00 0.00 ? 4  LEU A HB3  9  
ATOM 10819 H HG   . LEU A 1 4  ? 5.096   -22.660 3.335   1.00 0.00 ? 4  LEU A HG   9  
ATOM 10820 H HD11 . LEU A 1 4  ? 6.351   -20.916 4.509   1.00 0.00 ? 4  LEU A HD11 9  
ATOM 10821 H HD12 . LEU A 1 4  ? 7.681   -22.048 4.761   1.00 0.00 ? 4  LEU A HD12 9  
ATOM 10822 H HD13 . LEU A 1 4  ? 6.114   -22.341 5.515   1.00 0.00 ? 4  LEU A HD13 9  
ATOM 10823 H HD21 . LEU A 1 4  ? 6.469   -21.125 2.049   1.00 0.00 ? 4  LEU A HD21 9  
ATOM 10824 H HD22 . LEU A 1 4  ? 6.424   -22.714 1.288   1.00 0.00 ? 4  LEU A HD22 9  
ATOM 10825 H HD23 . LEU A 1 4  ? 7.851   -22.212 2.198   1.00 0.00 ? 4  LEU A HD23 9  
ATOM 10826 N N    . PRO A 1 5  ? 3.581   -24.732 5.614   1.00 0.00 ? 5  PRO A N    9  
ATOM 10827 C CA   . PRO A 1 5  ? 2.117   -24.648 5.558   1.00 0.00 ? 5  PRO A CA   9  
ATOM 10828 C C    . PRO A 1 5  ? 1.638   -23.395 4.832   1.00 0.00 ? 5  PRO A C    9  
ATOM 10829 O O    . PRO A 1 5  ? 2.122   -22.293 5.090   1.00 0.00 ? 5  PRO A O    9  
ATOM 10830 C CB   . PRO A 1 5  ? 1.697   -24.607 7.029   1.00 0.00 ? 5  PRO A CB   9  
ATOM 10831 C CG   . PRO A 1 5  ? 2.897   -24.108 7.758   1.00 0.00 ? 5  PRO A CG   9  
ATOM 10832 C CD   . PRO A 1 5  ? 4.086   -24.620 6.995   1.00 0.00 ? 5  PRO A CD   9  
ATOM 10833 H HA   . PRO A 1 5  ? 1.697   -25.528 5.090   1.00 0.00 ? 5  PRO A HA   9  
ATOM 10834 H HB2  . PRO A 1 5  ? 0.846   -23.951 7.170   1.00 0.00 ? 5  PRO A HB2  9  
ATOM 10835 H HB3  . PRO A 1 5  ? 1.437   -25.604 7.352   1.00 0.00 ? 5  PRO A HB3  9  
ATOM 10836 H HG2  . PRO A 1 5  ? 2.896   -23.028 7.771   1.00 0.00 ? 5  PRO A HG2  9  
ATOM 10837 H HG3  . PRO A 1 5  ? 2.903   -24.497 8.766   1.00 0.00 ? 5  PRO A HG3  9  
ATOM 10838 H HD2  . PRO A 1 5  ? 4.894   -23.909 7.060   1.00 0.00 ? 5  PRO A HD2  9  
ATOM 10839 H HD3  . PRO A 1 5  ? 4.394   -25.583 7.375   1.00 0.00 ? 5  PRO A HD3  9  
ATOM 10840 N N    . PHE A 1 6  ? 0.684   -23.574 3.923   1.00 0.00 ? 6  PHE A N    9  
ATOM 10841 C CA   . PHE A 1 6  ? 0.138   -22.459 3.159   1.00 0.00 ? 6  PHE A CA   9  
ATOM 10842 C C    . PHE A 1 6  ? -0.646  -21.516 4.065   1.00 0.00 ? 6  PHE A C    9  
ATOM 10843 O O    . PHE A 1 6  ? -0.940  -20.382 3.693   1.00 0.00 ? 6  PHE A O    9  
ATOM 10844 C CB   . PHE A 1 6  ? -0.762  -22.971 2.030   1.00 0.00 ? 6  PHE A CB   9  
ATOM 10845 C CG   . PHE A 1 6  ? -1.979  -23.713 2.507   1.00 0.00 ? 6  PHE A CG   9  
ATOM 10846 C CD1  . PHE A 1 6  ? -1.910  -25.063 2.814   1.00 0.00 ? 6  PHE A CD1  9  
ATOM 10847 C CD2  . PHE A 1 6  ? -3.194  -23.062 2.644   1.00 0.00 ? 6  PHE A CD2  9  
ATOM 10848 C CE1  . PHE A 1 6  ? -3.029  -25.749 3.248   1.00 0.00 ? 6  PHE A CE1  9  
ATOM 10849 C CE2  . PHE A 1 6  ? -4.317  -23.742 3.078   1.00 0.00 ? 6  PHE A CE2  9  
ATOM 10850 C CZ   . PHE A 1 6  ? -4.234  -25.086 3.379   1.00 0.00 ? 6  PHE A CZ   9  
ATOM 10851 H H    . PHE A 1 6  ? 0.352   -24.476 3.768   1.00 0.00 ? 6  PHE A H    9  
ATOM 10852 H HA   . PHE A 1 6  ? 0.964   -21.912 2.721   1.00 0.00 ? 6  PHE A HA   9  
ATOM 10853 H HB2  . PHE A 1 6  ? -1.085  -22.129 1.429   1.00 0.00 ? 6  PHE A HB2  9  
ATOM 10854 H HB3  . PHE A 1 6  ? -0.183  -23.637 1.403   1.00 0.00 ? 6  PHE A HB3  9  
ATOM 10855 H HD1  . PHE A 1 6  ? -0.974  -25.591 2.706   1.00 0.00 ? 6  PHE A HD1  9  
ATOM 10856 H HD2  . PHE A 1 6  ? -3.265  -22.009 2.409   1.00 0.00 ? 6  PHE A HD2  9  
ATOM 10857 H HE1  . PHE A 1 6  ? -2.962  -26.801 3.483   1.00 0.00 ? 6  PHE A HE1  9  
ATOM 10858 H HE2  . PHE A 1 6  ? -5.258  -23.222 3.180   1.00 0.00 ? 6  PHE A HE2  9  
ATOM 10859 H HZ   . PHE A 1 6  ? -5.110  -25.619 3.718   1.00 0.00 ? 6  PHE A HZ   9  
ATOM 10860 N N    . LYS A 1 7  ? -0.983  -21.998 5.257   1.00 0.00 ? 7  LYS A N    9  
ATOM 10861 C CA   . LYS A 1 7  ? -1.739  -21.205 6.221   1.00 0.00 ? 7  LYS A CA   9  
ATOM 10862 C C    . LYS A 1 7  ? -1.016  -19.902 6.552   1.00 0.00 ? 7  LYS A C    9  
ATOM 10863 O O    . LYS A 1 7  ? -1.595  -18.820 6.457   1.00 0.00 ? 7  LYS A O    9  
ATOM 10864 C CB   . LYS A 1 7  ? -1.973  -22.016 7.496   1.00 0.00 ? 7  LYS A CB   9  
ATOM 10865 C CG   . LYS A 1 7  ? -2.738  -23.309 7.255   1.00 0.00 ? 7  LYS A CG   9  
ATOM 10866 C CD   . LYS A 1 7  ? -2.911  -24.109 8.535   1.00 0.00 ? 7  LYS A CD   9  
ATOM 10867 C CE   . LYS A 1 7  ? -3.823  -23.401 9.522   1.00 0.00 ? 7  LYS A CE   9  
ATOM 10868 N NZ   . LYS A 1 7  ? -5.185  -23.181 8.963   1.00 0.00 ? 7  LYS A NZ   9  
ATOM 10869 H H    . LYS A 1 7  ? -0.735  -22.909 5.502   1.00 0.00 ? 7  LYS A H    9  
ATOM 10870 H HA   . LYS A 1 7  ? -2.697  -20.967 5.780   1.00 0.00 ? 7  LYS A HA   9  
ATOM 10871 H HB2  . LYS A 1 7  ? -1.014  -22.261 7.936   1.00 0.00 ? 7  LYS A HB2  9  
ATOM 10872 H HB3  . LYS A 1 7  ? -2.535  -21.409 8.190   1.00 0.00 ? 7  LYS A HB3  9  
ATOM 10873 H HG2  . LYS A 1 7  ? -3.707  -23.075 6.842   1.00 0.00 ? 7  LYS A HG2  9  
ATOM 10874 H HG3  . LYS A 1 7  ? -2.191  -23.913 6.548   1.00 0.00 ? 7  LYS A HG3  9  
ATOM 10875 H HD2  . LYS A 1 7  ? -3.345  -25.066 8.289   1.00 0.00 ? 7  LYS A HD2  9  
ATOM 10876 H HD3  . LYS A 1 7  ? -1.944  -24.262 8.995   1.00 0.00 ? 7  LYS A HD3  9  
ATOM 10877 H HE2  . LYS A 1 7  ? -3.909  -24.015 10.406  1.00 0.00 ? 7  LYS A HE2  9  
ATOM 10878 H HE3  . LYS A 1 7  ? -3.392  -22.451 9.794   1.00 0.00 ? 7  LYS A HE3  9  
ATOM 10879 H HZ1  . LYS A 1 7  ? -5.837  -22.905 9.725   1.00 0.00 ? 7  LYS A HZ1  9  
ATOM 10880 H HZ2  . LYS A 1 7  ? -5.548  -24.050 8.517   1.00 0.00 ? 7  LYS A HZ2  9  
ATOM 10881 H HZ3  . LYS A 1 7  ? -5.165  -22.421 8.254   1.00 0.00 ? 7  LYS A HZ3  9  
ATOM 10882 N N    . VAL A 1 8  ? 0.251   -20.009 6.938   1.00 0.00 ? 8  VAL A N    9  
ATOM 10883 C CA   . VAL A 1 8  ? 1.047   -18.835 7.284   1.00 0.00 ? 8  VAL A CA   9  
ATOM 10884 C C    . VAL A 1 8  ? 1.336   -17.978 6.055   1.00 0.00 ? 8  VAL A C    9  
ATOM 10885 O O    . VAL A 1 8  ? 1.376   -16.750 6.139   1.00 0.00 ? 8  VAL A O    9  
ATOM 10886 C CB   . VAL A 1 8  ? 2.381   -19.237 7.942   1.00 0.00 ? 8  VAL A CB   9  
ATOM 10887 C CG1  . VAL A 1 8  ? 3.169   -18.003 8.356   1.00 0.00 ? 8  VAL A CG1  9  
ATOM 10888 C CG2  . VAL A 1 8  ? 2.136   -20.147 9.136   1.00 0.00 ? 8  VAL A CG2  9  
ATOM 10889 H H    . VAL A 1 8  ? 0.662   -20.904 6.983   1.00 0.00 ? 8  VAL A H    9  
ATOM 10890 H HA   . VAL A 1 8  ? 0.484   -18.243 7.997   1.00 0.00 ? 8  VAL A HA   9  
ATOM 10891 H HB   . VAL A 1 8  ? 2.971   -19.786 7.219   1.00 0.00 ? 8  VAL A HB   9  
ATOM 10892 H HG11 . VAL A 1 8  ? 3.485   -17.457 7.481   1.00 0.00 ? 8  VAL A HG11 9  
ATOM 10893 H HG12 . VAL A 1 8  ? 4.046   -18.302 8.916   1.00 0.00 ? 8  VAL A HG12 9  
ATOM 10894 H HG13 . VAL A 1 8  ? 2.553   -17.365 8.975   1.00 0.00 ? 8  VAL A HG13 9  
ATOM 10895 H HG21 . VAL A 1 8  ? 1.659   -21.059 8.813   1.00 0.00 ? 8  VAL A HG21 9  
ATOM 10896 H HG22 . VAL A 1 8  ? 1.502   -19.645 9.852   1.00 0.00 ? 8  VAL A HG22 9  
ATOM 10897 H HG23 . VAL A 1 8  ? 3.080   -20.391 9.606   1.00 0.00 ? 8  VAL A HG23 9  
ATOM 10898 N N    . VAL A 1 9  ? 1.539   -18.630 4.914   1.00 0.00 ? 9  VAL A N    9  
ATOM 10899 C CA   . VAL A 1 9  ? 1.830   -17.927 3.668   1.00 0.00 ? 9  VAL A CA   9  
ATOM 10900 C C    . VAL A 1 9  ? 0.696   -16.984 3.276   1.00 0.00 ? 9  VAL A C    9  
ATOM 10901 O O    . VAL A 1 9  ? 0.922   -15.802 3.011   1.00 0.00 ? 9  VAL A O    9  
ATOM 10902 C CB   . VAL A 1 9  ? 2.080   -18.918 2.513   1.00 0.00 ? 9  VAL A CB   9  
ATOM 10903 C CG1  . VAL A 1 9  ? 2.419   -18.176 1.228   1.00 0.00 ? 9  VAL A CG1  9  
ATOM 10904 C CG2  . VAL A 1 9  ? 3.185   -19.898 2.878   1.00 0.00 ? 9  VAL A CG2  9  
ATOM 10905 H H    . VAL A 1 9  ? 1.489   -19.611 4.909   1.00 0.00 ? 9  VAL A H    9  
ATOM 10906 H HA   . VAL A 1 9  ? 2.732   -17.344 3.815   1.00 0.00 ? 9  VAL A HA   9  
ATOM 10907 H HB   . VAL A 1 9  ? 1.174   -19.485 2.344   1.00 0.00 ? 9  VAL A HB   9  
ATOM 10908 H HG11 . VAL A 1 9  ? 1.554   -17.635 0.876   1.00 0.00 ? 9  VAL A HG11 9  
ATOM 10909 H HG12 . VAL A 1 9  ? 2.720   -18.884 0.466   1.00 0.00 ? 9  VAL A HG12 9  
ATOM 10910 H HG13 . VAL A 1 9  ? 3.229   -17.482 1.408   1.00 0.00 ? 9  VAL A HG13 9  
ATOM 10911 H HG21 . VAL A 1 9  ? 4.097   -19.355 3.086   1.00 0.00 ? 9  VAL A HG21 9  
ATOM 10912 H HG22 . VAL A 1 9  ? 3.355   -20.576 2.053   1.00 0.00 ? 9  VAL A HG22 9  
ATOM 10913 H HG23 . VAL A 1 9  ? 2.904   -20.467 3.743   1.00 0.00 ? 9  VAL A HG23 9  
ATOM 10914 N N    . VAL A 1 10 ? -0.524  -17.513 3.241   1.00 0.00 ? 10 VAL A N    9  
ATOM 10915 C CA   . VAL A 1 10 ? -1.695  -16.724 2.871   1.00 0.00 ? 10 VAL A CA   9  
ATOM 10916 C C    . VAL A 1 10 ? -1.951  -15.590 3.860   1.00 0.00 ? 10 VAL A C    9  
ATOM 10917 O O    . VAL A 1 10 ? -2.153  -14.444 3.461   1.00 0.00 ? 10 VAL A O    9  
ATOM 10918 C CB   . VAL A 1 10 ? -2.958  -17.604 2.775   1.00 0.00 ? 10 VAL A CB   9  
ATOM 10919 C CG1  . VAL A 1 10 ? -4.174  -16.767 2.405   1.00 0.00 ? 10 VAL A CG1  9  
ATOM 10920 C CG2  . VAL A 1 10 ? -2.750  -18.725 1.767   1.00 0.00 ? 10 VAL A CG2  9  
ATOM 10921 H H    . VAL A 1 10 ? -0.639  -18.467 3.468   1.00 0.00 ? 10 VAL A H    9  
ATOM 10922 H HA   . VAL A 1 10 ? -1.512  -16.292 1.894   1.00 0.00 ? 10 VAL A HA   9  
ATOM 10923 H HB   . VAL A 1 10 ? -3.139  -18.051 3.743   1.00 0.00 ? 10 VAL A HB   9  
ATOM 10924 H HG11 . VAL A 1 10 ? -3.954  -16.161 1.536   1.00 0.00 ? 10 VAL A HG11 9  
ATOM 10925 H HG12 . VAL A 1 10 ? -4.445  -16.127 3.231   1.00 0.00 ? 10 VAL A HG12 9  
ATOM 10926 H HG13 . VAL A 1 10 ? -5.011  -17.417 2.181   1.00 0.00 ? 10 VAL A HG13 9  
ATOM 10927 H HG21 . VAL A 1 10 ? -2.835  -19.673 2.276   1.00 0.00 ? 10 VAL A HG21 9  
ATOM 10928 H HG22 . VAL A 1 10 ? -1.770  -18.658 1.311   1.00 0.00 ? 10 VAL A HG22 9  
ATOM 10929 H HG23 . VAL A 1 10 ? -3.500  -18.681 0.987   1.00 0.00 ? 10 VAL A HG23 9  
ATOM 10930 N N    . ILE A 1 11 ? -1.942  -15.914 5.149   1.00 0.00 ? 11 ILE A N    9  
ATOM 10931 C CA   . ILE A 1 11 ? -2.180  -14.917 6.189   1.00 0.00 ? 11 ILE A CA   9  
ATOM 10932 C C    . ILE A 1 11 ? -1.159  -13.783 6.119   1.00 0.00 ? 11 ILE A C    9  
ATOM 10933 O O    . ILE A 1 11 ? -1.497  -12.619 6.335   1.00 0.00 ? 11 ILE A O    9  
ATOM 10934 C CB   . ILE A 1 11 ? -2.142  -15.549 7.596   1.00 0.00 ? 11 ILE A CB   9  
ATOM 10935 C CG1  . ILE A 1 11 ? -3.235  -16.611 7.729   1.00 0.00 ? 11 ILE A CG1  9  
ATOM 10936 C CG2  . ILE A 1 11 ? -2.306  -14.476 8.666   1.00 0.00 ? 11 ILE A CG2  9  
ATOM 10937 C CD1  . ILE A 1 11 ? -3.148  -17.416 9.010   1.00 0.00 ? 11 ILE A CD1  9  
ATOM 10938 H H    . ILE A 1 11 ? -1.770  -16.850 5.408   1.00 0.00 ? 11 ILE A H    9  
ATOM 10939 H HA   . ILE A 1 11 ? -3.168  -14.499 6.032   1.00 0.00 ? 11 ILE A HA   9  
ATOM 10940 H HB   . ILE A 1 11 ? -1.176  -16.015 7.732   1.00 0.00 ? 11 ILE A HB   9  
ATOM 10941 H HG12 . ILE A 1 11 ? -4.202  -16.127 7.717   1.00 0.00 ? 11 ILE A HG12 9  
ATOM 10942 H HG13 . ILE A 1 11 ? -3.189  -17.299 6.906   1.00 0.00 ? 11 ILE A HG13 9  
ATOM 10943 H HG21 . ILE A 1 11 ? -3.212  -13.914 8.483   1.00 0.00 ? 11 ILE A HG21 9  
ATOM 10944 H HG22 . ILE A 1 11 ? -1.460  -13.807 8.652   1.00 0.00 ? 11 ILE A HG22 9  
ATOM 10945 H HG23 . ILE A 1 11 ? -2.363  -14.931 9.643   1.00 0.00 ? 11 ILE A HG23 9  
ATOM 10946 H HD11 . ILE A 1 11 ? -2.135  -17.766 9.156   1.00 0.00 ? 11 ILE A HD11 9  
ATOM 10947 H HD12 . ILE A 1 11 ? -3.813  -18.264 8.944   1.00 0.00 ? 11 ILE A HD12 9  
ATOM 10948 H HD13 . ILE A 1 11 ? -3.440  -16.799 9.846   1.00 0.00 ? 11 ILE A HD13 9  
ATOM 10949 N N    . SER A 1 12 ? 0.087   -14.129 5.813   1.00 0.00 ? 12 SER A N    9  
ATOM 10950 C CA   . SER A 1 12 ? 1.154   -13.138 5.720   1.00 0.00 ? 12 SER A CA   9  
ATOM 10951 C C    . SER A 1 12 ? 0.983   -12.263 4.481   1.00 0.00 ? 12 SER A C    9  
ATOM 10952 O O    . SER A 1 12 ? 1.234   -11.057 4.521   1.00 0.00 ? 12 SER A O    9  
ATOM 10953 C CB   . SER A 1 12 ? 2.519   -13.825 5.685   1.00 0.00 ? 12 SER A CB   9  
ATOM 10954 O OG   . SER A 1 12 ? 3.568   -12.876 5.592   1.00 0.00 ? 12 SER A OG   9  
ATOM 10955 H H    . SER A 1 12 ? 0.304   -15.077 5.648   1.00 0.00 ? 12 SER A H    9  
ATOM 10956 H HA   . SER A 1 12 ? 1.109   -12.506 6.598   1.00 0.00 ? 12 SER A HA   9  
ATOM 10957 H HB2  . SER A 1 12 ? 2.651   -14.402 6.589   1.00 0.00 ? 12 SER A HB2  9  
ATOM 10958 H HB3  . SER A 1 12 ? 2.569   -14.484 4.830   1.00 0.00 ? 12 SER A HB3  9  
ATOM 10959 H HG   . SER A 1 12 ? 3.747   -12.505 6.460   1.00 0.00 ? 12 SER A HG   9  
ATOM 10960 N N    . ALA A 1 13 ? 0.558   -12.879 3.383   1.00 0.00 ? 13 ALA A N    9  
ATOM 10961 C CA   . ALA A 1 13 ? 0.360   -12.163 2.129   1.00 0.00 ? 13 ALA A CA   9  
ATOM 10962 C C    . ALA A 1 13 ? -0.775  -11.151 2.238   1.00 0.00 ? 13 ALA A C    9  
ATOM 10963 O O    . ALA A 1 13 ? -0.580  -9.957  2.002   1.00 0.00 ? 13 ALA A O    9  
ATOM 10964 C CB   . ALA A 1 13 ? 0.077   -13.143 1.002   1.00 0.00 ? 13 ALA A CB   9  
ATOM 10965 H H    . ALA A 1 13 ? 0.377   -13.848 3.408   1.00 0.00 ? 13 ALA A H    9  
ATOM 10966 H HA   . ALA A 1 13 ? 1.275   -11.637 1.888   1.00 0.00 ? 13 ALA A HA   9  
ATOM 10967 H HB1  . ALA A 1 13 ? -0.007  -12.608 0.066   1.00 0.00 ? 13 ALA A HB1  9  
ATOM 10968 H HB2  . ALA A 1 13 ? -0.846  -13.671 1.200   1.00 0.00 ? 13 ALA A HB2  9  
ATOM 10969 H HB3  . ALA A 1 13 ? 0.887   -13.854 0.935   1.00 0.00 ? 13 ALA A HB3  9  
ATOM 10970 N N    . ILE A 1 14 ? -1.960  -11.637 2.596   1.00 0.00 ? 14 ILE A N    9  
ATOM 10971 C CA   . ILE A 1 14 ? -3.135  -10.783 2.733   1.00 0.00 ? 14 ILE A CA   9  
ATOM 10972 C C    . ILE A 1 14 ? -2.865  -9.622  3.687   1.00 0.00 ? 14 ILE A C    9  
ATOM 10973 O O    . ILE A 1 14 ? -3.263  -8.489  3.426   1.00 0.00 ? 14 ILE A O    9  
ATOM 10974 C CB   . ILE A 1 14 ? -4.353  -11.582 3.242   1.00 0.00 ? 14 ILE A CB   9  
ATOM 10975 C CG1  . ILE A 1 14 ? -4.673  -12.731 2.284   1.00 0.00 ? 14 ILE A CG1  9  
ATOM 10976 C CG2  . ILE A 1 14 ? -5.560  -10.667 3.403   1.00 0.00 ? 14 ILE A CG2  9  
ATOM 10977 C CD1  . ILE A 1 14 ? -5.749  -13.665 2.795   1.00 0.00 ? 14 ILE A CD1  9  
ATOM 10978 H H    . ILE A 1 14 ? -2.038  -12.601 2.777   1.00 0.00 ? 14 ILE A H    9  
ATOM 10979 H HA   . ILE A 1 14 ? -3.373  -10.382 1.756   1.00 0.00 ? 14 ILE A HA   9  
ATOM 10980 H HB   . ILE A 1 14 ? -4.109  -11.990 4.214   1.00 0.00 ? 14 ILE A HB   9  
ATOM 10981 H HG12 . ILE A 1 14 ? -5.013  -12.326 1.342   1.00 0.00 ? 14 ILE A HG12 9  
ATOM 10982 H HG13 . ILE A 1 14 ? -3.794  -13.324 2.106   1.00 0.00 ? 14 ILE A HG13 9  
ATOM 10983 H HG21 . ILE A 1 14 ? -5.784  -10.191 2.458   1.00 0.00 ? 14 ILE A HG21 9  
ATOM 10984 H HG22 . ILE A 1 14 ? -5.357  -9.911  4.146   1.00 0.00 ? 14 ILE A HG22 9  
ATOM 10985 H HG23 . ILE A 1 14 ? -6.418  -11.238 3.724   1.00 0.00 ? 14 ILE A HG23 9  
ATOM 10986 H HD11 . ILE A 1 14 ? -6.702  -13.159 2.785   1.00 0.00 ? 14 ILE A HD11 9  
ATOM 10987 H HD12 . ILE A 1 14 ? -5.515  -13.976 3.804   1.00 0.00 ? 14 ILE A HD12 9  
ATOM 10988 H HD13 . ILE A 1 14 ? -5.800  -14.534 2.156   1.00 0.00 ? 14 ILE A HD13 9  
ATOM 10989 N N    . LEU A 1 15 ? -2.185  -9.918  4.791   1.00 0.00 ? 15 LEU A N    9  
ATOM 10990 C CA   . LEU A 1 15 ? -1.865  -8.900  5.784   1.00 0.00 ? 15 LEU A CA   9  
ATOM 10991 C C    . LEU A 1 15 ? -1.016  -7.787  5.175   1.00 0.00 ? 15 LEU A C    9  
ATOM 10992 O O    . LEU A 1 15 ? -1.191  -6.614  5.502   1.00 0.00 ? 15 LEU A O    9  
ATOM 10993 C CB   . LEU A 1 15 ? -1.126  -9.526  6.969   1.00 0.00 ? 15 LEU A CB   9  
ATOM 10994 C CG   . LEU A 1 15 ? -0.730  -8.550  8.077   1.00 0.00 ? 15 LEU A CG   9  
ATOM 10995 C CD1  . LEU A 1 15 ? -1.965  -7.915  8.698   1.00 0.00 ? 15 LEU A CD1  9  
ATOM 10996 C CD2  . LEU A 1 15 ? 0.101   -9.258  9.136   1.00 0.00 ? 15 LEU A CD2  9  
ATOM 10997 H H    . LEU A 1 15 ? -1.893  -10.847 4.949   1.00 0.00 ? 15 LEU A H    9  
ATOM 10998 H HA   . LEU A 1 15 ? -2.795  -8.476  6.135   1.00 0.00 ? 15 LEU A HA   9  
ATOM 10999 H HB2  . LEU A 1 15 ? -1.761  -10.294 7.394   1.00 0.00 ? 15 LEU A HB2  9  
ATOM 11000 H HB3  . LEU A 1 15 ? -0.228  -9.998  6.591   1.00 0.00 ? 15 LEU A HB3  9  
ATOM 11001 H HG   . LEU A 1 15 ? -0.124  -7.758  7.662   1.00 0.00 ? 15 LEU A HG   9  
ATOM 11002 H HD11 . LEU A 1 15 ? -1.668  -7.256  9.503   1.00 0.00 ? 15 LEU A HD11 9  
ATOM 11003 H HD12 . LEU A 1 15 ? -2.615  -8.685  9.089   1.00 0.00 ? 15 LEU A HD12 9  
ATOM 11004 H HD13 . LEU A 1 15 ? -2.495  -7.343  7.952   1.00 0.00 ? 15 LEU A HD13 9  
ATOM 11005 H HD21 . LEU A 1 15 ? 0.396   -8.550  9.898   1.00 0.00 ? 15 LEU A HD21 9  
ATOM 11006 H HD22 . LEU A 1 15 ? 0.987   -9.679  8.680   1.00 0.00 ? 15 LEU A HD22 9  
ATOM 11007 H HD23 . LEU A 1 15 ? -0.481  -10.050 9.588   1.00 0.00 ? 15 LEU A HD23 9  
ATOM 11008 N N    . ALA A 1 16 ? -0.099  -8.164  4.291   1.00 0.00 ? 16 ALA A N    9  
ATOM 11009 C CA   . ALA A 1 16 ? 0.774   -7.195  3.641   1.00 0.00 ? 16 ALA A CA   9  
ATOM 11010 C C    . ALA A 1 16 ? -0.021  -6.264  2.733   1.00 0.00 ? 16 ALA A C    9  
ATOM 11011 O O    . ALA A 1 16 ? 0.275   -5.072  2.640   1.00 0.00 ? 16 ALA A O    9  
ATOM 11012 C CB   . ALA A 1 16 ? 1.862   -7.909  2.856   1.00 0.00 ? 16 ALA A CB   9  
ATOM 11013 H H    . ALA A 1 16 ? 0.001   -9.120  4.068   1.00 0.00 ? 16 ALA A H    9  
ATOM 11014 H HA   . ALA A 1 16 ? 1.256   -6.603  4.410   1.00 0.00 ? 16 ALA A HA   9  
ATOM 11015 H HB1  . ALA A 1 16 ? 1.418   -8.481  2.054   1.00 0.00 ? 16 ALA A HB1  9  
ATOM 11016 H HB2  . ALA A 1 16 ? 2.400   -8.575  3.515   1.00 0.00 ? 16 ALA A HB2  9  
ATOM 11017 H HB3  . ALA A 1 16 ? 2.548   -7.183  2.444   1.00 0.00 ? 16 ALA A HB3  9  
ATOM 11018 N N    . LEU A 1 17 ? -1.029  -6.815  2.064   1.00 0.00 ? 17 LEU A N    9  
ATOM 11019 C CA   . LEU A 1 17 ? -1.873  -6.029  1.171   1.00 0.00 ? 17 LEU A CA   9  
ATOM 11020 C C    . LEU A 1 17 ? -2.627  -4.960  1.950   1.00 0.00 ? 17 LEU A C    9  
ATOM 11021 O O    . LEU A 1 17 ? -2.774  -3.829  1.489   1.00 0.00 ? 17 LEU A O    9  
ATOM 11022 C CB   . LEU A 1 17 ? -2.858  -6.937  0.430   1.00 0.00 ? 17 LEU A CB   9  
ATOM 11023 C CG   . LEU A 1 17 ? -2.348  -7.513  -0.895  1.00 0.00 ? 17 LEU A CG   9  
ATOM 11024 C CD1  . LEU A 1 17 ? -2.133  -6.402  -1.911  1.00 0.00 ? 17 LEU A CD1  9  
ATOM 11025 C CD2  . LEU A 1 17 ? -1.061  -8.300  -0.681  1.00 0.00 ? 17 LEU A CD2  9  
ATOM 11026 H H    . LEU A 1 17 ? -1.218  -7.777  2.173   1.00 0.00 ? 17 LEU A H    9  
ATOM 11027 H HA   . LEU A 1 17 ? -1.229  -5.532  0.462   1.00 0.00 ? 17 LEU A HA   9  
ATOM 11028 H HB2  . LEU A 1 17 ? -3.119  -7.764  1.076   1.00 0.00 ? 17 LEU A HB2  9  
ATOM 11029 H HB3  . LEU A 1 17 ? -3.766  -6.382  0.220   1.00 0.00 ? 17 LEU A HB3  9  
ATOM 11030 H HG   . LEU A 1 17 ? -3.091  -8.189  -1.294  1.00 0.00 ? 17 LEU A HG   9  
ATOM 11031 H HD11 . LEU A 1 17 ? -3.044  -5.829  -2.023  1.00 0.00 ? 17 LEU A HD11 9  
ATOM 11032 H HD12 . LEU A 1 17 ? -1.870  -6.836  -2.865  1.00 0.00 ? 17 LEU A HD12 9  
ATOM 11033 H HD13 . LEU A 1 17 ? -1.337  -5.750  -1.586  1.00 0.00 ? 17 LEU A HD13 9  
ATOM 11034 H HD21 . LEU A 1 17 ? -0.294  -7.661  -0.270  1.00 0.00 ? 17 LEU A HD21 9  
ATOM 11035 H HD22 . LEU A 1 17 ? -0.721  -8.699  -1.627  1.00 0.00 ? 17 LEU A HD22 9  
ATOM 11036 H HD23 . LEU A 1 17 ? -1.253  -9.115  -0.009  1.00 0.00 ? 17 LEU A HD23 9  
ATOM 11037 N N    . VAL A 1 18 ? -3.102  -5.327  3.136   1.00 0.00 ? 18 VAL A N    9  
ATOM 11038 C CA   . VAL A 1 18 ? -3.832  -4.398  3.986   1.00 0.00 ? 18 VAL A CA   9  
ATOM 11039 C C    . VAL A 1 18 ? -2.934  -3.236  4.401   1.00 0.00 ? 18 VAL A C    9  
ATOM 11040 O O    . VAL A 1 18 ? -3.392  -2.101  4.534   1.00 0.00 ? 18 VAL A O    9  
ATOM 11041 C CB   . VAL A 1 18 ? -4.372  -5.097  5.250   1.00 0.00 ? 18 VAL A CB   9  
ATOM 11042 C CG1  . VAL A 1 18 ? -5.145  -4.117  6.119   1.00 0.00 ? 18 VAL A CG1  9  
ATOM 11043 C CG2  . VAL A 1 18 ? -5.241  -6.288  4.873   1.00 0.00 ? 18 VAL A CG2  9  
ATOM 11044 H H    . VAL A 1 18 ? -2.947  -6.245  3.453   1.00 0.00 ? 18 VAL A H    9  
ATOM 11045 H HA   . VAL A 1 18 ? -4.673  -4.009  3.423   1.00 0.00 ? 18 VAL A HA   9  
ATOM 11046 H HB   . VAL A 1 18 ? -3.532  -5.465  5.824   1.00 0.00 ? 18 VAL A HB   9  
ATOM 11047 H HG11 . VAL A 1 18 ? -4.473  -3.380  6.531   1.00 0.00 ? 18 VAL A HG11 9  
ATOM 11048 H HG12 . VAL A 1 18 ? -5.620  -4.649  6.934   1.00 0.00 ? 18 VAL A HG12 9  
ATOM 11049 H HG13 . VAL A 1 18 ? -5.904  -3.622  5.528   1.00 0.00 ? 18 VAL A HG13 9  
ATOM 11050 H HG21 . VAL A 1 18 ? -6.082  -5.950  4.282   1.00 0.00 ? 18 VAL A HG21 9  
ATOM 11051 H HG22 . VAL A 1 18 ? -5.606  -6.768  5.770   1.00 0.00 ? 18 VAL A HG22 9  
ATOM 11052 H HG23 . VAL A 1 18 ? -4.674  -6.995  4.309   1.00 0.00 ? 18 VAL A HG23 9  
ATOM 11053 N N    . VAL A 1 19 ? -1.653  -3.532  4.596   1.00 0.00 ? 19 VAL A N    9  
ATOM 11054 C CA   . VAL A 1 19 ? -0.682  -2.520  4.998   1.00 0.00 ? 19 VAL A CA   9  
ATOM 11055 C C    . VAL A 1 19 ? -0.367  -1.564  3.851   1.00 0.00 ? 19 VAL A C    9  
ATOM 11056 O O    . VAL A 1 19 ? -0.229  -0.361  4.060   1.00 0.00 ? 19 VAL A O    9  
ATOM 11057 C CB   . VAL A 1 19 ? 0.629   -3.163  5.488   1.00 0.00 ? 19 VAL A CB   9  
ATOM 11058 C CG1  . VAL A 1 19 ? 1.665   -2.097  5.806   1.00 0.00 ? 19 VAL A CG1  9  
ATOM 11059 C CG2  . VAL A 1 19 ? 0.368   -4.044  6.700   1.00 0.00 ? 19 VAL A CG2  9  
ATOM 11060 H H    . VAL A 1 19 ? -1.341  -4.458  4.473   1.00 0.00 ? 19 VAL A H    9  
ATOM 11061 H HA   . VAL A 1 19 ? -1.104  -1.947  5.817   1.00 0.00 ? 19 VAL A HA   9  
ATOM 11062 H HB   . VAL A 1 19 ? 1.020   -3.787  4.697   1.00 0.00 ? 19 VAL A HB   9  
ATOM 11063 H HG11 . VAL A 1 19 ? 1.223   -1.323  6.420   1.00 0.00 ? 19 VAL A HG11 9  
ATOM 11064 H HG12 . VAL A 1 19 ? 2.037   -1.662  4.890   1.00 0.00 ? 19 VAL A HG12 9  
ATOM 11065 H HG13 . VAL A 1 19 ? 2.495   -2.541  6.340   1.00 0.00 ? 19 VAL A HG13 9  
ATOM 11066 H HG21 . VAL A 1 19 ? -0.414  -4.746  6.485   1.00 0.00 ? 19 VAL A HG21 9  
ATOM 11067 H HG22 . VAL A 1 19 ? 0.070   -3.430  7.539   1.00 0.00 ? 19 VAL A HG22 9  
ATOM 11068 H HG23 . VAL A 1 19 ? 1.271   -4.581  6.954   1.00 0.00 ? 19 VAL A HG23 9  
ATOM 11069 N N    . LEU A 1 20 ? -0.253  -2.106  2.643   1.00 0.00 ? 20 LEU A N    9  
ATOM 11070 C CA   . LEU A 1 20 ? 0.049   -1.292  1.470   1.00 0.00 ? 20 LEU A CA   9  
ATOM 11071 C C    . LEU A 1 20 ? -1.006  -0.202  1.302   1.00 0.00 ? 20 LEU A C    9  
ATOM 11072 O O    . LEU A 1 20 ? -0.691  0.931   0.937   1.00 0.00 ? 20 LEU A O    9  
ATOM 11073 C CB   . LEU A 1 20 ? 0.114   -2.174  0.217   1.00 0.00 ? 20 LEU A CB   9  
ATOM 11074 C CG   . LEU A 1 20 ? 1.012   -1.655  -0.918  1.00 0.00 ? 20 LEU A CG   9  
ATOM 11075 C CD1  . LEU A 1 20 ? 0.450   -0.375  -1.519  1.00 0.00 ? 20 LEU A CD1  9  
ATOM 11076 C CD2  . LEU A 1 20 ? 2.433   -1.429  -0.420  1.00 0.00 ? 20 LEU A CD2  9  
ATOM 11077 H H    . LEU A 1 20 ? -0.369  -3.079  2.533   1.00 0.00 ? 20 LEU A H    9  
ATOM 11078 H HA   . LEU A 1 20 ? 1.000   -0.821  1.644   1.00 0.00 ? 20 LEU A HA   9  
ATOM 11079 H HB2  . LEU A 1 20 ? 0.491   -3.147  0.510   1.00 0.00 ? 20 LEU A HB2  9  
ATOM 11080 H HB3  . LEU A 1 20 ? -0.887  -2.312  -0.176  1.00 0.00 ? 20 LEU A HB3  9  
ATOM 11081 H HG   . LEU A 1 20 ? 1.049   -2.398  -1.702  1.00 0.00 ? 20 LEU A HG   9  
ATOM 11082 H HD11 . LEU A 1 20 ? 0.684   0.468   -0.888  1.00 0.00 ? 20 LEU A HD11 9  
ATOM 11083 H HD12 . LEU A 1 20 ? -0.624  -0.455  -1.630  1.00 0.00 ? 20 LEU A HD12 9  
ATOM 11084 H HD13 . LEU A 1 20 ? 0.893   -0.220  -2.492  1.00 0.00 ? 20 LEU A HD13 9  
ATOM 11085 H HD21 . LEU A 1 20 ? 2.465   -0.581  0.248   1.00 0.00 ? 20 LEU A HD21 9  
ATOM 11086 H HD22 . LEU A 1 20 ? 3.077   -1.237  -1.265  1.00 0.00 ? 20 LEU A HD22 9  
ATOM 11087 H HD23 . LEU A 1 20 ? 2.785   -2.310  0.100   1.00 0.00 ? 20 LEU A HD23 9  
ATOM 11088 N N    . THR A 1 21 ? -2.256  -0.549  1.586   1.00 0.00 ? 21 THR A N    9  
ATOM 11089 C CA   . THR A 1 21 ? -3.360  0.397   1.471   1.00 0.00 ? 21 THR A CA   9  
ATOM 11090 C C    . THR A 1 21 ? -3.292  1.452   2.571   1.00 0.00 ? 21 THR A C    9  
ATOM 11091 O O    . THR A 1 21 ? -3.473  2.642   2.313   1.00 0.00 ? 21 THR A O    9  
ATOM 11092 C CB   . THR A 1 21 ? -4.723  -0.318  1.541   1.00 0.00 ? 21 THR A CB   9  
ATOM 11093 O OG1  . THR A 1 21 ? -4.814  -1.300  0.501   1.00 0.00 ? 21 THR A OG1  9  
ATOM 11094 C CG2  . THR A 1 21 ? -5.867  0.675   1.405   1.00 0.00 ? 21 THR A CG2  9  
ATOM 11095 H H    . THR A 1 21 ? -2.452  -1.468  1.883   1.00 0.00 ? 21 THR A H    9  
ATOM 11096 H HA   . THR A 1 21 ? -3.287  0.891   0.508   1.00 0.00 ? 21 THR A HA   9  
ATOM 11097 H HB   . THR A 1 21 ? -4.808  -0.814  2.498   1.00 0.00 ? 21 THR A HB   9  
ATOM 11098 H HG1  . THR A 1 21 ? -4.721  -0.892  -0.370  1.00 0.00 ? 21 THR A HG1  9  
ATOM 11099 H HG21 . THR A 1 21 ? -5.980  1.230   2.325   1.00 0.00 ? 21 THR A HG21 9  
ATOM 11100 H HG22 . THR A 1 21 ? -6.781  0.137   1.202   1.00 0.00 ? 21 THR A HG22 9  
ATOM 11101 H HG23 . THR A 1 21 ? -5.670  1.361   0.591   1.00 0.00 ? 21 THR A HG23 9  
ATOM 11102 N N    . ILE A 1 22 ? -3.034  1.008   3.798   1.00 0.00 ? 22 ILE A N    9  
ATOM 11103 C CA   . ILE A 1 22 ? -2.943  1.916   4.937   1.00 0.00 ? 22 ILE A CA   9  
ATOM 11104 C C    . ILE A 1 22 ? -1.821  2.930   4.739   1.00 0.00 ? 22 ILE A C    9  
ATOM 11105 O O    . ILE A 1 22 ? -1.983  4.114   5.031   1.00 0.00 ? 22 ILE A O    9  
ATOM 11106 C CB   . ILE A 1 22 ? -2.715  1.146   6.254   1.00 0.00 ? 22 ILE A CB   9  
ATOM 11107 C CG1  . ILE A 1 22 ? -3.921  0.253   6.553   1.00 0.00 ? 22 ILE A CG1  9  
ATOM 11108 C CG2  . ILE A 1 22 ? -2.462  2.114   7.403   1.00 0.00 ? 22 ILE A CG2  9  
ATOM 11109 C CD1  . ILE A 1 22 ? -3.739  -0.630  7.769   1.00 0.00 ? 22 ILE A CD1  9  
ATOM 11110 H H    . ILE A 1 22 ? -2.901  0.042   3.946   1.00 0.00 ? 22 ILE A H    9  
ATOM 11111 H HA   . ILE A 1 22 ? -3.881  2.455   5.015   1.00 0.00 ? 22 ILE A HA   9  
ATOM 11112 H HB   . ILE A 1 22 ? -1.837  0.528   6.136   1.00 0.00 ? 22 ILE A HB   9  
ATOM 11113 H HG12 . ILE A 1 22 ? -4.786  0.876   6.731   1.00 0.00 ? 22 ILE A HG12 9  
ATOM 11114 H HG13 . ILE A 1 22 ? -4.122  -0.380  5.712   1.00 0.00 ? 22 ILE A HG13 9  
ATOM 11115 H HG21 . ILE A 1 22 ? -3.278  2.821   7.471   1.00 0.00 ? 22 ILE A HG21 9  
ATOM 11116 H HG22 . ILE A 1 22 ? -1.538  2.647   7.242   1.00 0.00 ? 22 ILE A HG22 9  
ATOM 11117 H HG23 . ILE A 1 22 ? -2.383  1.575   8.334   1.00 0.00 ? 22 ILE A HG23 9  
ATOM 11118 H HD11 . ILE A 1 22 ? -3.798  -0.030  8.664   1.00 0.00 ? 22 ILE A HD11 9  
ATOM 11119 H HD12 . ILE A 1 22 ? -2.776  -1.121  7.726   1.00 0.00 ? 22 ILE A HD12 9  
ATOM 11120 H HD13 . ILE A 1 22 ? -4.520  -1.376  7.788   1.00 0.00 ? 22 ILE A HD13 9  
ATOM 11121 N N    . ILE A 1 23 ? -0.684  2.457   4.241   1.00 0.00 ? 23 ILE A N    9  
ATOM 11122 C CA   . ILE A 1 23 ? 0.461   3.323   4.001   1.00 0.00 ? 23 ILE A CA   9  
ATOM 11123 C C    . ILE A 1 23 ? 0.146   4.341   2.908   1.00 0.00 ? 23 ILE A C    9  
ATOM 11124 O O    . ILE A 1 23 ? 0.479   5.519   3.026   1.00 0.00 ? 23 ILE A O    9  
ATOM 11125 C CB   . ILE A 1 23 ? 1.708   2.511   3.602   1.00 0.00 ? 23 ILE A CB   9  
ATOM 11126 C CG1  . ILE A 1 23 ? 2.127   1.588   4.748   1.00 0.00 ? 23 ILE A CG1  9  
ATOM 11127 C CG2  . ILE A 1 23 ? 2.850   3.443   3.222   1.00 0.00 ? 23 ILE A CG2  9  
ATOM 11128 C CD1  . ILE A 1 23 ? 2.580   2.322   5.991   1.00 0.00 ? 23 ILE A CD1  9  
ATOM 11129 H H    . ILE A 1 23 ? -0.608  1.497   4.026   1.00 0.00 ? 23 ILE A H    9  
ATOM 11130 H HA   . ILE A 1 23 ? 0.674   3.868   4.910   1.00 0.00 ? 23 ILE A HA   9  
ATOM 11131 H HB   . ILE A 1 23 ? 1.461   1.912   2.738   1.00 0.00 ? 23 ILE A HB   9  
ATOM 11132 H HG12 . ILE A 1 23 ? 1.301   0.964   5.031   1.00 0.00 ? 23 ILE A HG12 9  
ATOM 11133 H HG13 . ILE A 1 23 ? 2.944   0.963   4.418   1.00 0.00 ? 23 ILE A HG13 9  
ATOM 11134 H HG21 . ILE A 1 23 ? 3.774   2.881   3.155   1.00 0.00 ? 23 ILE A HG21 9  
ATOM 11135 H HG22 . ILE A 1 23 ? 2.961   4.218   3.969   1.00 0.00 ? 23 ILE A HG22 9  
ATOM 11136 H HG23 . ILE A 1 23 ? 2.649   3.895   2.262   1.00 0.00 ? 23 ILE A HG23 9  
ATOM 11137 H HD11 . ILE A 1 23 ? 3.405   2.977   5.757   1.00 0.00 ? 23 ILE A HD11 9  
ATOM 11138 H HD12 . ILE A 1 23 ? 2.901   1.601   6.728   1.00 0.00 ? 23 ILE A HD12 9  
ATOM 11139 H HD13 . ILE A 1 23 ? 1.764   2.899   6.395   1.00 0.00 ? 23 ILE A HD13 9  
ATOM 11140 N N    . SER A 1 24 ? -0.502  3.871   1.845   1.00 0.00 ? 24 SER A N    9  
ATOM 11141 C CA   . SER A 1 24 ? -0.868  4.729   0.722   1.00 0.00 ? 24 SER A CA   9  
ATOM 11142 C C    . SER A 1 24 ? -2.031  5.652   1.084   1.00 0.00 ? 24 SER A C    9  
ATOM 11143 O O    . SER A 1 24 ? -2.252  6.670   0.427   1.00 0.00 ? 24 SER A O    9  
ATOM 11144 C CB   . SER A 1 24 ? -1.241  3.877   -0.494  1.00 0.00 ? 24 SER A CB   9  
ATOM 11145 O OG   . SER A 1 24 ? -1.552  4.690   -1.613  1.00 0.00 ? 24 SER A OG   9  
ATOM 11146 H H    . SER A 1 24 ? -0.743  2.915   1.808   1.00 0.00 ? 24 SER A H    9  
ATOM 11147 H HA   . SER A 1 24 ? -0.010  5.328   0.463   1.00 0.00 ? 24 SER A HA   9  
ATOM 11148 H HB2  . SER A 1 24 ? -0.408  3.238   -0.750  1.00 0.00 ? 24 SER A HB2  9  
ATOM 11149 H HB3  . SER A 1 24 ? -2.101  3.266   -0.257  1.00 0.00 ? 24 SER A HB3  9  
ATOM 11150 H HG   . SER A 1 24 ? -0.740  4.987   -2.033  1.00 0.00 ? 24 SER A HG   9  
ATOM 11151 N N    . LEU A 1 25 ? -2.771  5.292   2.128   1.00 0.00 ? 25 LEU A N    9  
ATOM 11152 C CA   . LEU A 1 25 ? -3.916  6.086   2.567   1.00 0.00 ? 25 LEU A CA   9  
ATOM 11153 C C    . LEU A 1 25 ? -3.473  7.332   3.329   1.00 0.00 ? 25 LEU A C    9  
ATOM 11154 O O    . LEU A 1 25 ? -3.855  8.449   2.980   1.00 0.00 ? 25 LEU A O    9  
ATOM 11155 C CB   . LEU A 1 25 ? -4.841  5.239   3.444   1.00 0.00 ? 25 LEU A CB   9  
ATOM 11156 C CG   . LEU A 1 25 ? -6.052  5.979   4.021   1.00 0.00 ? 25 LEU A CG   9  
ATOM 11157 C CD1  . LEU A 1 25 ? -6.979  6.446   2.909   1.00 0.00 ? 25 LEU A CD1  9  
ATOM 11158 C CD2  . LEU A 1 25 ? -6.800  5.091   5.002   1.00 0.00 ? 25 LEU A CD2  9  
ATOM 11159 H H    . LEU A 1 25 ? -2.562  4.469   2.617   1.00 0.00 ? 25 LEU A H    9  
ATOM 11160 H HA   . LEU A 1 25 ? -4.468  6.398   1.689   1.00 0.00 ? 25 LEU A HA   9  
ATOM 11161 H HB2  . LEU A 1 25 ? -5.194  4.403   2.854   1.00 0.00 ? 25 LEU A HB2  9  
ATOM 11162 H HB3  . LEU A 1 25 ? -4.253  4.851   4.266   1.00 0.00 ? 25 LEU A HB3  9  
ATOM 11163 H HG   . LEU A 1 25 ? -5.720  6.852   4.562   1.00 0.00 ? 25 LEU A HG   9  
ATOM 11164 H HD11 . LEU A 1 25 ? -7.832  6.956   3.337   1.00 0.00 ? 25 LEU A HD11 9  
ATOM 11165 H HD12 . LEU A 1 25 ? -7.322  5.595   2.337   1.00 0.00 ? 25 LEU A HD12 9  
ATOM 11166 H HD13 . LEU A 1 25 ? -6.451  7.126   2.257   1.00 0.00 ? 25 LEU A HD13 9  
ATOM 11167 H HD21 . LEU A 1 25 ? -6.134  4.792   5.800   1.00 0.00 ? 25 LEU A HD21 9  
ATOM 11168 H HD22 . LEU A 1 25 ? -7.166  4.210   4.492   1.00 0.00 ? 25 LEU A HD22 9  
ATOM 11169 H HD23 . LEU A 1 25 ? -7.635  5.636   5.421   1.00 0.00 ? 25 LEU A HD23 9  
ATOM 11170 N N    . ILE A 1 26 ? -2.669  7.135   4.368   1.00 0.00 ? 26 ILE A N    9  
ATOM 11171 C CA   . ILE A 1 26 ? -2.185  8.245   5.182   1.00 0.00 ? 26 ILE A CA   9  
ATOM 11172 C C    . ILE A 1 26 ? -1.442  9.273   4.334   1.00 0.00 ? 26 ILE A C    9  
ATOM 11173 O O    . ILE A 1 26 ? -1.580  10.479  4.543   1.00 0.00 ? 26 ILE A O    9  
ATOM 11174 C CB   . ILE A 1 26 ? -1.258  7.755   6.310   1.00 0.00 ? 26 ILE A CB   9  
ATOM 11175 C CG1  . ILE A 1 26 ? -1.939  6.637   7.102   1.00 0.00 ? 26 ILE A CG1  9  
ATOM 11176 C CG2  . ILE A 1 26 ? -0.881  8.912   7.227   1.00 0.00 ? 26 ILE A CG2  9  
ATOM 11177 C CD1  . ILE A 1 26 ? -1.065  6.029   8.176   1.00 0.00 ? 26 ILE A CD1  9  
ATOM 11178 H H    . ILE A 1 26 ? -2.395  6.216   4.579   1.00 0.00 ? 26 ILE A H    9  
ATOM 11179 H HA   . ILE A 1 26 ? -3.046  8.723   5.633   1.00 0.00 ? 26 ILE A HA   9  
ATOM 11180 H HB   . ILE A 1 26 ? -0.350  7.367   5.867   1.00 0.00 ? 26 ILE A HB   9  
ATOM 11181 H HG12 . ILE A 1 26 ? -2.820  7.031   7.587   1.00 0.00 ? 26 ILE A HG12 9  
ATOM 11182 H HG13 . ILE A 1 26 ? -2.233  5.844   6.451   1.00 0.00 ? 26 ILE A HG13 9  
ATOM 11183 H HG21 . ILE A 1 26 ? -0.223  8.562   8.009   1.00 0.00 ? 26 ILE A HG21 9  
ATOM 11184 H HG22 . ILE A 1 26 ? -1.772  9.328   7.673   1.00 0.00 ? 26 ILE A HG22 9  
ATOM 11185 H HG23 . ILE A 1 26 ? -0.372  9.681   6.665   1.00 0.00 ? 26 ILE A HG23 9  
ATOM 11186 H HD11 . ILE A 1 26 ? -1.544  5.144   8.568   1.00 0.00 ? 26 ILE A HD11 9  
ATOM 11187 H HD12 . ILE A 1 26 ? -0.924  6.742   8.974   1.00 0.00 ? 26 ILE A HD12 9  
ATOM 11188 H HD13 . ILE A 1 26 ? -0.105  5.760   7.758   1.00 0.00 ? 26 ILE A HD13 9  
ATOM 11189 N N    . ILE A 1 27 ? -0.652  8.792   3.379   1.00 0.00 ? 27 ILE A N    9  
ATOM 11190 C CA   . ILE A 1 27 ? 0.110   9.676   2.508   1.00 0.00 ? 27 ILE A CA   9  
ATOM 11191 C C    . ILE A 1 27 ? -0.810  10.398  1.526   1.00 0.00 ? 27 ILE A C    9  
ATOM 11192 O O    . ILE A 1 27 ? -0.586  11.562  1.193   1.00 0.00 ? 27 ILE A O    9  
ATOM 11193 C CB   . ILE A 1 27 ? 1.201   8.912   1.728   1.00 0.00 ? 27 ILE A CB   9  
ATOM 11194 C CG1  . ILE A 1 27 ? 2.110   9.893   0.987   1.00 0.00 ? 27 ILE A CG1  9  
ATOM 11195 C CG2  . ILE A 1 27 ? 0.578   7.923   0.756   1.00 0.00 ? 27 ILE A CG2  9  
ATOM 11196 C CD1  . ILE A 1 27 ? 2.854   10.838  1.905   1.00 0.00 ? 27 ILE A CD1  9  
ATOM 11197 H H    . ILE A 1 27 ? -0.573  7.818   3.260   1.00 0.00 ? 27 ILE A H    9  
ATOM 11198 H HA   . ILE A 1 27 ? 0.588   10.415  3.138   1.00 0.00 ? 27 ILE A HA   9  
ATOM 11199 H HB   . ILE A 1 27 ? 1.792   8.352   2.438   1.00 0.00 ? 27 ILE A HB   9  
ATOM 11200 H HG12 . ILE A 1 27 ? 2.853   9.335   0.433   1.00 0.00 ? 27 ILE A HG12 9  
ATOM 11201 H HG13 . ILE A 1 27 ? 1.531   10.486  0.295   1.00 0.00 ? 27 ILE A HG13 9  
ATOM 11202 H HG21 . ILE A 1 27 ? 1.355   7.299   0.340   1.00 0.00 ? 27 ILE A HG21 9  
ATOM 11203 H HG22 . ILE A 1 27 ? 0.073   8.441   -0.047  1.00 0.00 ? 27 ILE A HG22 9  
ATOM 11204 H HG23 . ILE A 1 27 ? -0.115  7.311   1.283   1.00 0.00 ? 27 ILE A HG23 9  
ATOM 11205 H HD11 . ILE A 1 27 ? 3.673   11.290  1.365   1.00 0.00 ? 27 ILE A HD11 9  
ATOM 11206 H HD12 . ILE A 1 27 ? 3.243   10.299  2.759   1.00 0.00 ? 27 ILE A HD12 9  
ATOM 11207 H HD13 . ILE A 1 27 ? 2.181   11.610  2.241   1.00 0.00 ? 27 ILE A HD13 9  
ATOM 11208 N N    . LEU A 1 28 ? -1.842  9.696   1.067   1.00 0.00 ? 28 LEU A N    9  
ATOM 11209 C CA   . LEU A 1 28 ? -2.804  10.266  0.130   1.00 0.00 ? 28 LEU A CA   9  
ATOM 11210 C C    . LEU A 1 28 ? -3.454  11.512  0.720   1.00 0.00 ? 28 LEU A C    9  
ATOM 11211 O O    . LEU A 1 28 ? -3.543  12.550  0.063   1.00 0.00 ? 28 LEU A O    9  
ATOM 11212 C CB   . LEU A 1 28 ? -3.877  9.232   -0.218  1.00 0.00 ? 28 LEU A CB   9  
ATOM 11213 C CG   . LEU A 1 28 ? -4.991  9.733   -1.138  1.00 0.00 ? 28 LEU A CG   9  
ATOM 11214 C CD1  . LEU A 1 28 ? -4.433  10.103  -2.504  1.00 0.00 ? 28 LEU A CD1  9  
ATOM 11215 C CD2  . LEU A 1 28 ? -6.080  8.680   -1.273  1.00 0.00 ? 28 LEU A CD2  9  
ATOM 11216 H H    . LEU A 1 28 ? -1.969  8.765   1.365   1.00 0.00 ? 28 LEU A H    9  
ATOM 11217 H HA   . LEU A 1 28 ? -2.274  10.540  -0.771  1.00 0.00 ? 28 LEU A HA   9  
ATOM 11218 H HB2  . LEU A 1 28 ? -3.393  8.395   -0.697  1.00 0.00 ? 28 LEU A HB2  9  
ATOM 11219 H HB3  . LEU A 1 28 ? -4.323  8.889   0.701   1.00 0.00 ? 28 LEU A HB3  9  
ATOM 11220 H HG   . LEU A 1 28 ? -5.443  10.617  -0.715  1.00 0.00 ? 28 LEU A HG   9  
ATOM 11221 H HD11 . LEU A 1 28 ? -3.963  9.239   -2.953  1.00 0.00 ? 28 LEU A HD11 9  
ATOM 11222 H HD12 . LEU A 1 28 ? -3.704  10.893  -2.398  1.00 0.00 ? 28 LEU A HD12 9  
ATOM 11223 H HD13 . LEU A 1 28 ? -5.235  10.446  -3.143  1.00 0.00 ? 28 LEU A HD13 9  
ATOM 11224 H HD21 . LEU A 1 28 ? -6.483  8.448   -0.297  1.00 0.00 ? 28 LEU A HD21 9  
ATOM 11225 H HD22 . LEU A 1 28 ? -5.668  7.782   -1.713  1.00 0.00 ? 28 LEU A HD22 9  
ATOM 11226 H HD23 . LEU A 1 28 ? -6.873  9.057   -1.904  1.00 0.00 ? 28 LEU A HD23 9  
ATOM 11227 N N    . ILE A 1 29 ? -3.907  11.401  1.965   1.00 0.00 ? 29 ILE A N    9  
ATOM 11228 C CA   . ILE A 1 29 ? -4.544  12.521  2.647   1.00 0.00 ? 29 ILE A CA   9  
ATOM 11229 C C    . ILE A 1 29 ? -3.521  13.592  2.999   1.00 0.00 ? 29 ILE A C    9  
ATOM 11230 O O    . ILE A 1 29 ? -3.835  14.784  3.015   1.00 0.00 ? 29 ILE A O    9  
ATOM 11231 C CB   . ILE A 1 29 ? -5.261  12.060  3.932   1.00 0.00 ? 29 ILE A CB   9  
ATOM 11232 C CG1  . ILE A 1 29 ? -6.232  10.914  3.623   1.00 0.00 ? 29 ILE A CG1  9  
ATOM 11233 C CG2  . ILE A 1 29 ? -5.995  13.227  4.579   1.00 0.00 ? 29 ILE A CG2  9  
ATOM 11234 C CD1  . ILE A 1 29 ? -7.319  11.280  2.633   1.00 0.00 ? 29 ILE A CD1  9  
ATOM 11235 H H    . ILE A 1 29 ? -3.800  10.545  2.442   1.00 0.00 ? 29 ILE A H    9  
ATOM 11236 H HA   . ILE A 1 29 ? -5.279  12.951  1.981   1.00 0.00 ? 29 ILE A HA   9  
ATOM 11237 H HB   . ILE A 1 29 ? -4.516  11.705  4.632   1.00 0.00 ? 29 ILE A HB   9  
ATOM 11238 H HG12 . ILE A 1 29 ? -5.690  10.076  3.220   1.00 0.00 ? 29 ILE A HG12 9  
ATOM 11239 H HG13 . ILE A 1 29 ? -6.716  10.605  4.540   1.00 0.00 ? 29 ILE A HG13 9  
ATOM 11240 H HG21 . ILE A 1 29 ? -5.288  13.976  4.900   1.00 0.00 ? 29 ILE A HG21 9  
ATOM 11241 H HG22 . ILE A 1 29 ? -6.545  12.874  5.441   1.00 0.00 ? 29 ILE A HG22 9  
ATOM 11242 H HG23 . ILE A 1 29 ? -6.683  13.661  3.876   1.00 0.00 ? 29 ILE A HG23 9  
ATOM 11243 H HD11 . ILE A 1 29 ? -7.977  10.433  2.503   1.00 0.00 ? 29 ILE A HD11 9  
ATOM 11244 H HD12 . ILE A 1 29 ? -6.880  11.534  1.681   1.00 0.00 ? 29 ILE A HD12 9  
ATOM 11245 H HD13 . ILE A 1 29 ? -7.890  12.116  3.003   1.00 0.00 ? 29 ILE A HD13 9  
ATOM 11246 N N    . MET A 1 30 ? -2.294  13.163  3.276   1.00 0.00 ? 30 MET A N    9  
ATOM 11247 C CA   . MET A 1 30 ? -1.220  14.084  3.623   1.00 0.00 ? 30 MET A CA   9  
ATOM 11248 C C    . MET A 1 30 ? -0.961  15.061  2.479   1.00 0.00 ? 30 MET A C    9  
ATOM 11249 O O    . MET A 1 30 ? -0.839  16.265  2.696   1.00 0.00 ? 30 MET A O    9  
ATOM 11250 C CB   . MET A 1 30 ? 0.058   13.309  3.949   1.00 0.00 ? 30 MET A CB   9  
ATOM 11251 C CG   . MET A 1 30 ? 1.220   14.195  4.367   1.00 0.00 ? 30 MET A CG   9  
ATOM 11252 S SD   . MET A 1 30 ? 2.756   13.276  4.583   1.00 0.00 ? 30 MET A SD   9  
ATOM 11253 C CE   . MET A 1 30 ? 2.288   12.119  5.868   1.00 0.00 ? 30 MET A CE   9  
ATOM 11254 H H    . MET A 1 30 ? -2.097  12.198  3.250   1.00 0.00 ? 30 MET A H    9  
ATOM 11255 H HA   . MET A 1 30 ? -1.523  14.643  4.498   1.00 0.00 ? 30 MET A HA   9  
ATOM 11256 H HB2  . MET A 1 30 ? -0.154  12.624  4.756   1.00 0.00 ? 30 MET A HB2  9  
ATOM 11257 H HB3  . MET A 1 30 ? 0.354   12.743  3.078   1.00 0.00 ? 30 MET A HB3  9  
ATOM 11258 H HG2  . MET A 1 30 ? 1.387   14.950  3.614   1.00 0.00 ? 30 MET A HG2  9  
ATOM 11259 H HG3  . MET A 1 30 ? 0.971   14.672  5.303   1.00 0.00 ? 30 MET A HG3  9  
ATOM 11260 H HE1  . MET A 1 30 ? 1.844   12.657  6.693   1.00 0.00 ? 30 MET A HE1  9  
ATOM 11261 H HE2  . MET A 1 30 ? 3.164   11.590  6.213   1.00 0.00 ? 30 MET A HE2  9  
ATOM 11262 H HE3  . MET A 1 30 ? 1.573   11.412  5.473   1.00 0.00 ? 30 MET A HE3  9  
ATOM 11263 N N    . LEU A 1 31 ? -0.882  14.532  1.261   1.00 0.00 ? 31 LEU A N    9  
ATOM 11264 C CA   . LEU A 1 31 ? -0.643  15.357  0.082   1.00 0.00 ? 31 LEU A CA   9  
ATOM 11265 C C    . LEU A 1 31 ? -1.918  16.091  -0.329  1.00 0.00 ? 31 LEU A C    9  
ATOM 11266 O O    . LEU A 1 31 ? -1.863  17.162  -0.933  1.00 0.00 ? 31 LEU A O    9  
ATOM 11267 C CB   . LEU A 1 31 ? -0.138  14.495  -1.079  1.00 0.00 ? 31 LEU A CB   9  
ATOM 11268 C CG   . LEU A 1 31 ? 0.151   15.254  -2.378  1.00 0.00 ? 31 LEU A CG   9  
ATOM 11269 C CD1  . LEU A 1 31 ? 1.292   16.241  -2.181  1.00 0.00 ? 31 LEU A CD1  9  
ATOM 11270 C CD2  . LEU A 1 31 ? 0.476   14.282  -3.503  1.00 0.00 ? 31 LEU A CD2  9  
ATOM 11271 H H    . LEU A 1 31 ? -0.991  13.558  1.147   1.00 0.00 ? 31 LEU A H    9  
ATOM 11272 H HA   . LEU A 1 31 ? 0.116   16.087  0.327   1.00 0.00 ? 31 LEU A HA   9  
ATOM 11273 H HB2  . LEU A 1 31 ? 0.769   13.996  -0.760  1.00 0.00 ? 31 LEU A HB2  9  
ATOM 11274 H HB3  . LEU A 1 31 ? -0.887  13.740  -1.283  1.00 0.00 ? 31 LEU A HB3  9  
ATOM 11275 H HG   . LEU A 1 31 ? -0.723  15.814  -2.673  1.00 0.00 ? 31 LEU A HG   9  
ATOM 11276 H HD11 . LEU A 1 31 ? 1.019   16.967  -1.430  1.00 0.00 ? 31 LEU A HD11 9  
ATOM 11277 H HD12 . LEU A 1 31 ? 1.493   16.754  -3.112  1.00 0.00 ? 31 LEU A HD12 9  
ATOM 11278 H HD13 . LEU A 1 31 ? 2.181   15.713  -1.864  1.00 0.00 ? 31 LEU A HD13 9  
ATOM 11279 H HD21 . LEU A 1 31 ? 1.361   13.713  -3.251  1.00 0.00 ? 31 LEU A HD21 9  
ATOM 11280 H HD22 . LEU A 1 31 ? 0.651   14.831  -4.418  1.00 0.00 ? 31 LEU A HD22 9  
ATOM 11281 H HD23 . LEU A 1 31 ? -0.355  13.606  -3.649  1.00 0.00 ? 31 LEU A HD23 9  
ATOM 11282 N N    . TRP A 1 32 ? -3.064  15.504  0.005   1.00 0.00 ? 32 TRP A N    9  
ATOM 11283 C CA   . TRP A 1 32 ? -4.355  16.098  -0.323  1.00 0.00 ? 32 TRP A CA   9  
ATOM 11284 C C    . TRP A 1 32 ? -4.542  17.427  0.402   1.00 0.00 ? 32 TRP A C    9  
ATOM 11285 O O    . TRP A 1 32 ? -5.245  18.315  -0.081  1.00 0.00 ? 32 TRP A O    9  
ATOM 11286 C CB   . TRP A 1 32 ? -5.486  15.133  0.042   1.00 0.00 ? 32 TRP A CB   9  
ATOM 11287 C CG   . TRP A 1 32 ? -6.858  15.696  -0.183  1.00 0.00 ? 32 TRP A CG   9  
ATOM 11288 C CD1  . TRP A 1 32 ? -7.390  16.113  -1.370  1.00 0.00 ? 32 TRP A CD1  9  
ATOM 11289 C CD2  . TRP A 1 32 ? -7.872  15.900  0.806   1.00 0.00 ? 32 TRP A CD2  9  
ATOM 11290 N NE1  . TRP A 1 32 ? -8.673  16.567  -1.177  1.00 0.00 ? 32 TRP A NE1  9  
ATOM 11291 C CE2  . TRP A 1 32 ? -8.991  16.445  0.150   1.00 0.00 ? 32 TRP A CE2  9  
ATOM 11292 C CE3  . TRP A 1 32 ? -7.942  15.675  2.183   1.00 0.00 ? 32 TRP A CE3  9  
ATOM 11293 C CZ2  . TRP A 1 32 ? -10.166 16.766  0.825   1.00 0.00 ? 32 TRP A CZ2  9  
ATOM 11294 C CZ3  . TRP A 1 32 ? -9.108  15.993  2.852   1.00 0.00 ? 32 TRP A CZ3  9  
ATOM 11295 C CH2  . TRP A 1 32 ? -10.207 16.534  2.173   1.00 0.00 ? 32 TRP A CH2  9  
ATOM 11296 H H    . TRP A 1 32 ? -3.052  14.645  0.484   1.00 0.00 ? 32 TRP A H    9  
ATOM 11297 H HA   . TRP A 1 32 ? -4.383  16.278  -1.390  1.00 0.00 ? 32 TRP A HA   9  
ATOM 11298 H HB2  . TRP A 1 32 ? -5.392  14.239  -0.556  1.00 0.00 ? 32 TRP A HB2  9  
ATOM 11299 H HB3  . TRP A 1 32 ? -5.395  14.873  1.085   1.00 0.00 ? 32 TRP A HB3  9  
ATOM 11300 H HD1  . TRP A 1 32 ? -6.866  16.087  -2.314  1.00 0.00 ? 32 TRP A HD1  9  
ATOM 11301 H HE1  . TRP A 1 32 ? -9.264  16.919  -1.875  1.00 0.00 ? 32 TRP A HE1  9  
ATOM 11302 H HE3  . TRP A 1 32 ? -7.105  15.267  2.720   1.00 0.00 ? 32 TRP A HE3  9  
ATOM 11303 H HZ2  . TRP A 1 32 ? -11.022 17.183  0.316   1.00 0.00 ? 32 TRP A HZ2  9  
ATOM 11304 H HZ3  . TRP A 1 32 ? -9.180  15.825  3.917   1.00 0.00 ? 32 TRP A HZ3  9  
ATOM 11305 H HH2  . TRP A 1 32 ? -11.098 16.768  2.736   1.00 0.00 ? 32 TRP A HH2  9  
ATOM 11306 N N    . GLN A 1 33 ? -3.906  17.555  1.561   1.00 0.00 ? 33 GLN A N    9  
ATOM 11307 C CA   . GLN A 1 33 ? -4.003  18.774  2.356   1.00 0.00 ? 33 GLN A CA   9  
ATOM 11308 C C    . GLN A 1 33 ? -2.749  19.632  2.208   1.00 0.00 ? 33 GLN A C    9  
ATOM 11309 O O    . GLN A 1 33 ? -2.558  20.597  2.945   1.00 0.00 ? 33 GLN A O    9  
ATOM 11310 C CB   . GLN A 1 33 ? -4.233  18.433  3.827   1.00 0.00 ? 33 GLN A CB   9  
ATOM 11311 C CG   . GLN A 1 33 ? -5.592  17.807  4.096   1.00 0.00 ? 33 GLN A CG   9  
ATOM 11312 C CD   . GLN A 1 33 ? -6.738  18.743  3.769   1.00 0.00 ? 33 GLN A CD   9  
ATOM 11313 O OE1  . GLN A 1 33 ? -7.200  19.501  4.623   1.00 0.00 ? 33 GLN A OE1  9  
ATOM 11314 N NE2  . GLN A 1 33 ? -7.205  18.698  2.526   1.00 0.00 ? 33 GLN A NE2  9  
ATOM 11315 H H    . GLN A 1 33 ? -3.355  16.818  1.909   1.00 0.00 ? 33 GLN A H    9  
ATOM 11316 H HA   . GLN A 1 33 ? -4.835  19.364  2.001   1.00 0.00 ? 33 GLN A HA   9  
ATOM 11317 H HB2  . GLN A 1 33 ? -3.472  17.735  4.144   1.00 0.00 ? 33 GLN A HB2  9  
ATOM 11318 H HB3  . GLN A 1 33 ? -4.153  19.334  4.424   1.00 0.00 ? 33 GLN A HB3  9  
ATOM 11319 H HG2  . GLN A 1 33 ? -5.689  16.910  3.500   1.00 0.00 ? 33 GLN A HG2  9  
ATOM 11320 H HG3  . GLN A 1 33 ? -5.649  17.546  5.143   1.00 0.00 ? 33 GLN A HG3  9  
ATOM 11321 H HE21 . GLN A 1 33 ? -6.790  18.087  1.885   1.00 0.00 ? 33 GLN A HE21 9  
ATOM 11322 H HE22 . GLN A 1 33 ? -7.956  19.286  2.299   1.00 0.00 ? 33 GLN A HE22 9  
ATOM 11323 N N    . LYS A 1 34 ? -1.894  19.270  1.255   1.00 0.00 ? 34 LYS A N    9  
ATOM 11324 C CA   . LYS A 1 34 ? -0.665  20.015  1.010   1.00 0.00 ? 34 LYS A CA   9  
ATOM 11325 C C    . LYS A 1 34 ? -0.632  20.548  -0.420  1.00 0.00 ? 34 LYS A C    9  
ATOM 11326 O O    . LYS A 1 34 ? -1.371  20.076  -1.283  1.00 0.00 ? 34 LYS A O    9  
ATOM 11327 C CB   . LYS A 1 34 ? 0.561   19.138  1.273   1.00 0.00 ? 34 LYS A CB   9  
ATOM 11328 C CG   . LYS A 1 34 ? 0.796   18.835  2.746   1.00 0.00 ? 34 LYS A CG   9  
ATOM 11329 C CD   . LYS A 1 34 ? 1.081   20.098  3.547   1.00 0.00 ? 34 LYS A CD   9  
ATOM 11330 C CE   . LYS A 1 34 ? 2.396   20.742  3.133   1.00 0.00 ? 34 LYS A CE   9  
ATOM 11331 N NZ   . LYS A 1 34 ? 2.698   21.959  3.938   1.00 0.00 ? 34 LYS A NZ   9  
ATOM 11332 H H    . LYS A 1 34 ? -2.075  18.502  0.691   1.00 0.00 ? 34 LYS A H    9  
ATOM 11333 H HA   . LYS A 1 34 ? -0.635  20.873  1.663   1.00 0.00 ? 34 LYS A HA   9  
ATOM 11334 H HB2  . LYS A 1 34 ? 0.420   18.198  0.762   1.00 0.00 ? 34 LYS A HB2  9  
ATOM 11335 H HB3  . LYS A 1 34 ? 1.444   19.614  0.873   1.00 0.00 ? 34 LYS A HB3  9  
ATOM 11336 H HG2  . LYS A 1 34 ? -0.089  18.377  3.151   1.00 0.00 ? 34 LYS A HG2  9  
ATOM 11337 H HG3  . LYS A 1 34 ? 1.632   18.156  2.840   1.00 0.00 ? 34 LYS A HG3  9  
ATOM 11338 H HD2  . LYS A 1 34 ? 0.283   20.809  3.421   1.00 0.00 ? 34 LYS A HD2  9  
ATOM 11339 H HD3  . LYS A 1 34 ? 1.148   19.829  4.591   1.00 0.00 ? 34 LYS A HD3  9  
ATOM 11340 H HE2  . LYS A 1 34 ? 3.196   20.029  3.269   1.00 0.00 ? 34 LYS A HE2  9  
ATOM 11341 H HE3  . LYS A 1 34 ? 2.342   21.026  2.094   1.00 0.00 ? 34 LYS A HE3  9  
ATOM 11342 H HZ1  . LYS A 1 34 ? 2.771   21.716  4.948   1.00 0.00 ? 34 LYS A HZ1  9  
ATOM 11343 H HZ2  . LYS A 1 34 ? 1.947   22.670  3.816   1.00 0.00 ? 34 LYS A HZ2  9  
ATOM 11344 H HZ3  . LYS A 1 34 ? 3.601   22.373  3.629   1.00 0.00 ? 34 LYS A HZ3  9  
ATOM 11345 N N    . LYS A 1 35 ? 0.228   21.533  -0.659  1.00 0.00 ? 35 LYS A N    9  
ATOM 11346 C CA   . LYS A 1 35 ? 0.357   22.132  -1.983  1.00 0.00 ? 35 LYS A CA   9  
ATOM 11347 C C    . LYS A 1 35 ? 1.214   21.253  -2.899  1.00 0.00 ? 35 LYS A C    9  
ATOM 11348 O O    . LYS A 1 35 ? 2.412   21.092  -2.664  1.00 0.00 ? 35 LYS A O    9  
ATOM 11349 C CB   . LYS A 1 35 ? 0.974   23.529  -1.870  1.00 0.00 ? 35 LYS A CB   9  
ATOM 11350 C CG   . LYS A 1 35 ? 1.032   24.280  -3.191  1.00 0.00 ? 35 LYS A CG   9  
ATOM 11351 C CD   . LYS A 1 35 ? 1.606   25.677  -3.016  1.00 0.00 ? 35 LYS A CD   9  
ATOM 11352 C CE   . LYS A 1 35 ? 3.083   25.637  -2.655  1.00 0.00 ? 35 LYS A CE   9  
ATOM 11353 N NZ   . LYS A 1 35 ? 3.892   24.977  -3.715  1.00 0.00 ? 35 LYS A NZ   9  
ATOM 11354 H H    . LYS A 1 35 ? 0.796   21.867  0.076   1.00 0.00 ? 35 LYS A H    9  
ATOM 11355 H HA   . LYS A 1 35 ? -0.637  22.243  -2.385  1.00 0.00 ? 35 LYS A HA   9  
ATOM 11356 H HB2  . LYS A 1 35 ? 0.383   24.108  -1.173  1.00 0.00 ? 35 LYS A HB2  9  
ATOM 11357 H HB3  . LYS A 1 35 ? 1.976   23.431  -1.480  1.00 0.00 ? 35 LYS A HB3  9  
ATOM 11358 H HG2  . LYS A 1 35 ? 1.636   23.729  -3.894  1.00 0.00 ? 35 LYS A HG2  9  
ATOM 11359 H HG3  . LYS A 1 35 ? 0.027   24.367  -3.580  1.00 0.00 ? 35 LYS A HG3  9  
ATOM 11360 H HD2  . LYS A 1 35 ? 1.492   26.217  -3.944  1.00 0.00 ? 35 LYS A HD2  9  
ATOM 11361 H HD3  . LYS A 1 35 ? 1.065   26.192  -2.233  1.00 0.00 ? 35 LYS A HD3  9  
ATOM 11362 H HE2  . LYS A 1 35 ? 3.433   26.652  -2.535  1.00 0.00 ? 35 LYS A HE2  9  
ATOM 11363 H HE3  . LYS A 1 35 ? 3.214   25.106  -1.725  1.00 0.00 ? 35 LYS A HE3  9  
ATOM 11364 H HZ1  . LYS A 1 35 ? 3.739   23.949  -3.698  1.00 0.00 ? 35 LYS A HZ1  9  
ATOM 11365 H HZ2  . LYS A 1 35 ? 4.902   25.162  -3.553  1.00 0.00 ? 35 LYS A HZ2  9  
ATOM 11366 H HZ3  . LYS A 1 35 ? 3.637   25.342  -4.658  1.00 0.00 ? 35 LYS A HZ3  9  
ATOM 11367 N N    . PRO A 1 36 ? 0.611   20.671  -3.957  1.00 0.00 ? 36 PRO A N    9  
ATOM 11368 C CA   . PRO A 1 36 ? 1.334   19.806  -4.896  1.00 0.00 ? 36 PRO A CA   9  
ATOM 11369 C C    . PRO A 1 36 ? 2.345   20.572  -5.746  1.00 0.00 ? 36 PRO A C    9  
ATOM 11370 O O    . PRO A 1 36 ? 2.151   21.749  -6.051  1.00 0.00 ? 36 PRO A O    9  
ATOM 11371 C CB   . PRO A 1 36 ? 0.226   19.233  -5.783  1.00 0.00 ? 36 PRO A CB   9  
ATOM 11372 C CG   . PRO A 1 36 ? -0.875  20.234  -5.708  1.00 0.00 ? 36 PRO A CG   9  
ATOM 11373 C CD   . PRO A 1 36 ? -0.815  20.804  -4.319  1.00 0.00 ? 36 PRO A CD   9  
ATOM 11374 H HA   . PRO A 1 36 ? 1.833   18.998  -4.378  1.00 0.00 ? 36 PRO A HA   9  
ATOM 11375 H HB2  . PRO A 1 36 ? 0.574   19.100  -6.801  1.00 0.00 ? 36 PRO A HB2  9  
ATOM 11376 H HB3  . PRO A 1 36 ? -0.091  18.280  -5.386  1.00 0.00 ? 36 PRO A HB3  9  
ATOM 11377 H HG2  . PRO A 1 36 ? -0.716  21.012  -6.441  1.00 0.00 ? 36 PRO A HG2  9  
ATOM 11378 H HG3  . PRO A 1 36 ? -1.825  19.749  -5.874  1.00 0.00 ? 36 PRO A HG3  9  
ATOM 11379 H HD2  . PRO A 1 36 ? -1.119  21.840  -4.334  1.00 0.00 ? 36 PRO A HD2  9  
ATOM 11380 H HD3  . PRO A 1 36 ? -1.441  20.233  -3.655  1.00 0.00 ? 36 PRO A HD3  9  
ATOM 11381 N N    . ARG A 1 37 ? 3.423   19.890  -6.126  1.00 0.00 ? 37 ARG A N    9  
ATOM 11382 C CA   . ARG A 1 37 ? 4.466   20.496  -6.946  1.00 0.00 ? 37 ARG A CA   9  
ATOM 11383 C C    . ARG A 1 37 ? 4.286   20.116  -8.413  1.00 0.00 ? 37 ARG A C    9  
ATOM 11384 O O    . ARG A 1 37 ? 4.341   18.939  -8.769  1.00 0.00 ? 37 ARG A O    9  
ATOM 11385 C CB   . ARG A 1 37 ? 5.847   20.055  -6.454  1.00 0.00 ? 37 ARG A CB   9  
ATOM 11386 C CG   . ARG A 1 37 ? 6.999   20.695  -7.212  1.00 0.00 ? 37 ARG A CG   9  
ATOM 11387 C CD   . ARG A 1 37 ? 8.344   20.255  -6.652  1.00 0.00 ? 37 ARG A CD   9  
ATOM 11388 N NE   . ARG A 1 37 ? 9.462   20.856  -7.374  1.00 0.00 ? 37 ARG A NE   9  
ATOM 11389 C CZ   . ARG A 1 37 ? 10.724  20.457  -7.243  1.00 0.00 ? 37 ARG A CZ   9  
ATOM 11390 N NH1  . ARG A 1 37 ? 11.026  19.456  -6.427  1.00 0.00 ? 37 ARG A NH1  9  
ATOM 11391 N NH2  . ARG A 1 37 ? 11.685  21.058  -7.929  1.00 0.00 ? 37 ARG A NH2  9  
ATOM 11392 H H    . ARG A 1 37 ? 3.520   18.946  -5.855  1.00 0.00 ? 37 ARG A H    9  
ATOM 11393 H HA   . ARG A 1 37 ? 4.404   21.576  -6.848  1.00 0.00 ? 37 ARG A HA   9  
ATOM 11394 H HB2  . ARG A 1 37 ? 5.937   20.319  -5.409  1.00 0.00 ? 37 ARG A HB2  9  
ATOM 11395 H HB3  . ARG A 1 37 ? 5.927   18.980  -6.551  1.00 0.00 ? 37 ARG A HB3  9  
ATOM 11396 H HG2  . ARG A 1 37 ? 6.948   20.406  -8.251  1.00 0.00 ? 37 ARG A HG2  9  
ATOM 11397 H HG3  . ARG A 1 37 ? 6.920   21.769  -7.130  1.00 0.00 ? 37 ARG A HG3  9  
ATOM 11398 H HD2  . ARG A 1 37 ? 8.404   20.545  -5.612  1.00 0.00 ? 37 ARG A HD2  9  
ATOM 11399 H HD3  . ARG A 1 37 ? 8.408   19.177  -6.731  1.00 0.00 ? 37 ARG A HD3  9  
ATOM 11400 H HE   . ARG A 1 37 ? 9.267   21.603  -7.987  1.00 0.00 ? 37 ARG A HE   9  
ATOM 11401 H HH11 . ARG A 1 37 ? 10.325  18.985  -5.896  1.00 0.00 ? 37 ARG A HH11 9  
ATOM 11402 H HH12 . ARG A 1 37 ? 11.980  19.162  -6.338  1.00 0.00 ? 37 ARG A HH12 9  
ATOM 11403 H HH21 . ARG A 1 37 ? 11.464  21.814  -8.548  1.00 0.00 ? 37 ARG A HH21 9  
ATOM 11404 H HH22 . ARG A 1 37 ? 12.637  20.759  -7.832  1.00 0.00 ? 37 ARG A HH22 9  
ATOM 11405 N N    . TYR A 1 38 ? 4.069   21.119  -9.260  1.00 0.00 ? 38 TYR A N    9  
ATOM 11406 C CA   . TYR A 1 38 ? 3.879   20.888  -10.688 1.00 0.00 ? 38 TYR A CA   9  
ATOM 11407 C C    . TYR A 1 38 ? 5.200   21.003  -11.443 1.00 0.00 ? 38 TYR A C    9  
ATOM 11408 O O    . TYR A 1 38 ? 5.841   22.054  -11.433 1.00 0.00 ? 38 TYR A O    9  
ATOM 11409 C CB   . TYR A 1 38 ? 2.862   21.881  -11.254 1.00 0.00 ? 38 TYR A CB   9  
ATOM 11410 C CG   . TYR A 1 38 ? 2.563   21.672  -12.722 1.00 0.00 ? 38 TYR A CG   9  
ATOM 11411 C CD1  . TYR A 1 38 ? 1.788   20.597  -13.143 1.00 0.00 ? 38 TYR A CD1  9  
ATOM 11412 C CD2  . TYR A 1 38 ? 3.053   22.546  -13.683 1.00 0.00 ? 38 TYR A CD2  9  
ATOM 11413 C CE1  . TYR A 1 38 ? 1.514   20.399  -14.483 1.00 0.00 ? 38 TYR A CE1  9  
ATOM 11414 C CE2  . TYR A 1 38 ? 2.781   22.354  -15.025 1.00 0.00 ? 38 TYR A CE2  9  
ATOM 11415 C CZ   . TYR A 1 38 ? 2.013   21.281  -15.420 1.00 0.00 ? 38 TYR A CZ   9  
ATOM 11416 O OH   . TYR A 1 38 ? 1.742   21.087  -16.755 1.00 0.00 ? 38 TYR A OH   9  
ATOM 11417 H H    . TYR A 1 38 ? 4.038   22.045  -8.920  1.00 0.00 ? 38 TYR A H    9  
ATOM 11418 H HA   . TYR A 1 38 ? 3.479   19.887  -10.824 1.00 0.00 ? 38 TYR A HA   9  
ATOM 11419 H HB2  . TYR A 1 38 ? 1.934   21.777  -10.706 1.00 0.00 ? 38 TYR A HB2  9  
ATOM 11420 H HB3  . TYR A 1 38 ? 3.237   22.888  -11.116 1.00 0.00 ? 38 TYR A HB3  9  
ATOM 11421 H HD1  . TYR A 1 38 ? 1.397   19.905  -12.409 1.00 0.00 ? 38 TYR A HD1  9  
ATOM 11422 H HD2  . TYR A 1 38 ? 3.657   23.388  -13.374 1.00 0.00 ? 38 TYR A HD2  9  
ATOM 11423 H HE1  . TYR A 1 38 ? 0.910   19.559  -14.792 1.00 0.00 ? 38 TYR A HE1  9  
ATOM 11424 H HE2  . TYR A 1 38 ? 3.172   23.044  -15.758 1.00 0.00 ? 38 TYR A HE2  9  
ATOM 11425 H HH   . TYR A 1 38 ? 2.459   20.593  -17.159 1.00 0.00 ? 38 TYR A HH   9  
ATOM 11426 N N    . GLU A 1 39 ? 5.598   19.917  -12.099 1.00 0.00 ? 39 GLU A N    9  
ATOM 11427 C CA   . GLU A 1 39 ? 6.841   19.895  -12.861 1.00 0.00 ? 39 GLU A CA   9  
ATOM 11428 C C    . GLU A 1 39 ? 6.592   20.249  -14.324 1.00 0.00 ? 39 GLU A C    9  
ATOM 11429 O O    . GLU A 1 39 ? 7.214   21.162  -14.866 1.00 0.00 ? 39 GLU A O    9  
ATOM 11430 C CB   . GLU A 1 39 ? 7.501   18.517  -12.758 1.00 0.00 ? 39 GLU A CB   9  
ATOM 11431 C CG   . GLU A 1 39 ? 8.802   18.401  -13.536 1.00 0.00 ? 39 GLU A CG   9  
ATOM 11432 C CD   . GLU A 1 39 ? 9.841   19.412  -13.093 1.00 0.00 ? 39 GLU A CD   9  
ATOM 11433 O OE1  . GLU A 1 39 ? 10.586  19.117  -12.135 1.00 0.00 ? 39 GLU A OE1  9  
ATOM 11434 O OE2  . GLU A 1 39 ? 9.912   20.499  -13.705 1.00 0.00 ? 39 GLU A OE2  9  
ATOM 11435 O OXT  . GLU A 1 39 ? 5.730   19.579  -14.937 1.00 0.00 ? 39 GLU A OXT  9  
ATOM 11436 H H    . GLU A 1 39 ? 5.040   19.103  -12.078 1.00 0.00 ? 39 GLU A H    9  
ATOM 11437 H HA   . GLU A 1 39 ? 7.517   20.630  -12.442 1.00 0.00 ? 39 GLU A HA   9  
ATOM 11438 H HB2  . GLU A 1 39 ? 7.709   18.308  -11.719 1.00 0.00 ? 39 GLU A HB2  9  
ATOM 11439 H HB3  . GLU A 1 39 ? 6.815   17.772  -13.133 1.00 0.00 ? 39 GLU A HB3  9  
ATOM 11440 H HG2  . GLU A 1 39 ? 9.205   17.411  -13.380 1.00 0.00 ? 39 GLU A HG2  9  
ATOM 11441 H HG3  . GLU A 1 39 ? 8.606   18.541  -14.588 1.00 0.00 ? 39 GLU A HG3  9  
ATOM 11442 N N    . GLY B 1 1  ? -1.559  -26.676 -5.815  1.00 0.00 ? 1  GLY B N    9  
ATOM 11443 C CA   . GLY B 1 1  ? -2.162  -27.439 -4.738  1.00 0.00 ? 1  GLY B CA   9  
ATOM 11444 C C    . GLY B 1 1  ? -3.347  -28.264 -5.201  1.00 0.00 ? 1  GLY B C    9  
ATOM 11445 O O    . GLY B 1 1  ? -3.237  -29.036 -6.154  1.00 0.00 ? 1  GLY B O    9  
ATOM 11446 H H1   . GLY B 1 1  ? -0.753  -26.128 -5.452  1.00 0.00 ? 1  GLY B H1   9  
ATOM 11447 H H2   . GLY B 1 1  ? -2.252  -26.015 -6.225  1.00 0.00 ? 1  GLY B H2   9  
ATOM 11448 H H3   . GLY B 1 1  ? -1.216  -27.313 -6.565  1.00 0.00 ? 1  GLY B H3   9  
ATOM 11449 H HA2  . GLY B 1 1  ? -1.417  -28.104 -4.327  1.00 0.00 ? 1  GLY B HA2  9  
ATOM 11450 H HA3  . GLY B 1 1  ? -2.477  -26.753 -3.964  1.00 0.00 ? 1  GLY B HA3  9  
ATOM 11451 N N    . HIS B 1 2  ? -4.482  -28.099 -4.526  1.00 0.00 ? 2  HIS B N    9  
ATOM 11452 C CA   . HIS B 1 2  ? -5.692  -28.835 -4.873  1.00 0.00 ? 2  HIS B CA   9  
ATOM 11453 C C    . HIS B 1 2  ? -6.795  -27.888 -5.334  1.00 0.00 ? 2  HIS B C    9  
ATOM 11454 O O    . HIS B 1 2  ? -7.481  -28.153 -6.321  1.00 0.00 ? 2  HIS B O    9  
ATOM 11455 C CB   . HIS B 1 2  ? -6.175  -29.657 -3.677  1.00 0.00 ? 2  HIS B CB   9  
ATOM 11456 C CG   . HIS B 1 2  ? -5.165  -30.645 -3.182  1.00 0.00 ? 2  HIS B CG   9  
ATOM 11457 N ND1  . HIS B 1 2  ? -5.002  -31.898 -3.735  1.00 0.00 ? 2  HIS B ND1  9  
ATOM 11458 C CD2  . HIS B 1 2  ? -4.259  -30.560 -2.177  1.00 0.00 ? 2  HIS B CD2  9  
ATOM 11459 C CE1  . HIS B 1 2  ? -4.042  -32.541 -3.092  1.00 0.00 ? 2  HIS B CE1  9  
ATOM 11460 N NE2  . HIS B 1 2  ? -3.576  -31.750 -2.145  1.00 0.00 ? 2  HIS B NE2  9  
ATOM 11461 H H    . HIS B 1 2  ? -4.512  -27.470 -3.771  1.00 0.00 ? 2  HIS B H    9  
ATOM 11462 H HA   . HIS B 1 2  ? -5.478  -29.516 -5.688  1.00 0.00 ? 2  HIS B HA   9  
ATOM 11463 H HB2  . HIS B 1 2  ? -6.414  -28.991 -2.860  1.00 0.00 ? 2  HIS B HB2  9  
ATOM 11464 H HB3  . HIS B 1 2  ? -7.063  -30.207 -3.958  1.00 0.00 ? 2  HIS B HB3  9  
ATOM 11465 H HD1  . HIS B 1 2  ? -5.514  -32.263 -4.487  1.00 0.00 ? 2  HIS B HD1  9  
ATOM 11466 H HD2  . HIS B 1 2  ? -4.104  -29.713 -1.523  1.00 0.00 ? 2  HIS B HD2  9  
ATOM 11467 H HE1  . HIS B 1 2  ? -3.697  -33.542 -3.307  1.00 0.00 ? 2  HIS B HE1  9  
ATOM 11468 H HE2  . HIS B 1 2  ? -2.813  -31.953 -1.564  1.00 0.00 ? 2  HIS B HE2  9  
ATOM 11469 N N    . SER B 1 3  ? -6.962  -26.784 -4.613  1.00 0.00 ? 3  SER B N    9  
ATOM 11470 C CA   . SER B 1 3  ? -7.983  -25.798 -4.950  1.00 0.00 ? 3  SER B CA   9  
ATOM 11471 C C    . SER B 1 3  ? -7.394  -24.670 -5.792  1.00 0.00 ? 3  SER B C    9  
ATOM 11472 O O    . SER B 1 3  ? -7.691  -24.551 -6.981  1.00 0.00 ? 3  SER B O    9  
ATOM 11473 C CB   . SER B 1 3  ? -8.612  -25.228 -3.676  1.00 0.00 ? 3  SER B CB   9  
ATOM 11474 O OG   . SER B 1 3  ? -9.212  -26.252 -2.903  1.00 0.00 ? 3  SER B OG   9  
ATOM 11475 H H    . SER B 1 3  ? -6.390  -26.617 -3.830  1.00 0.00 ? 3  SER B H    9  
ATOM 11476 H HA   . SER B 1 3  ? -8.764  -26.280 -5.526  1.00 0.00 ? 3  SER B HA   9  
ATOM 11477 H HB2  . SER B 1 3  ? -7.854  -24.751 -3.075  1.00 0.00 ? 3  SER B HB2  9  
ATOM 11478 H HB3  . SER B 1 3  ? -9.372  -24.505 -3.938  1.00 0.00 ? 3  SER B HB3  9  
ATOM 11479 H HG   . SER B 1 3  ? -9.751  -25.858 -2.213  1.00 0.00 ? 3  SER B HG   9  
ATOM 11480 N N    . LEU B 1 4  ? -6.559  -23.845 -5.168  1.00 0.00 ? 4  LEU B N    9  
ATOM 11481 C CA   . LEU B 1 4  ? -5.926  -22.727 -5.859  1.00 0.00 ? 4  LEU B CA   9  
ATOM 11482 C C    . LEU B 1 4  ? -4.405  -22.858 -5.822  1.00 0.00 ? 4  LEU B C    9  
ATOM 11483 O O    . LEU B 1 4  ? -3.852  -23.456 -4.898  1.00 0.00 ? 4  LEU B O    9  
ATOM 11484 C CB   . LEU B 1 4  ? -6.352  -21.401 -5.226  1.00 0.00 ? 4  LEU B CB   9  
ATOM 11485 C CG   . LEU B 1 4  ? -7.855  -21.114 -5.262  1.00 0.00 ? 4  LEU B CG   9  
ATOM 11486 C CD1  . LEU B 1 4  ? -8.161  -19.802 -4.556  1.00 0.00 ? 4  LEU B CD1  9  
ATOM 11487 C CD2  . LEU B 1 4  ? -8.360  -21.077 -6.698  1.00 0.00 ? 4  LEU B CD2  9  
ATOM 11488 H H    . LEU B 1 4  ? -6.343  -23.981 -4.220  1.00 0.00 ? 4  LEU B H    9  
ATOM 11489 H HA   . LEU B 1 4  ? -6.242  -22.737 -6.890  1.00 0.00 ? 4  LEU B HA   9  
ATOM 11490 H HB2  . LEU B 1 4  ? -6.035  -21.410 -4.190  1.00 0.00 ? 4  LEU B HB2  9  
ATOM 11491 H HB3  . LEU B 1 4  ? -5.840  -20.593 -5.730  1.00 0.00 ? 4  LEU B HB3  9  
ATOM 11492 H HG   . LEU B 1 4  ? -8.379  -21.903 -4.742  1.00 0.00 ? 4  LEU B HG   9  
ATOM 11493 H HD11 . LEU B 1 4  ? -7.657  -18.989 -5.061  1.00 0.00 ? 4  LEU B HD11 9  
ATOM 11494 H HD12 . LEU B 1 4  ? -7.820  -19.854 -3.531  1.00 0.00 ? 4  LEU B HD12 9  
ATOM 11495 H HD13 . LEU B 1 4  ? -9.228  -19.624 -4.566  1.00 0.00 ? 4  LEU B HD13 9  
ATOM 11496 H HD21 . LEU B 1 4  ? -8.243  -22.049 -7.151  1.00 0.00 ? 4  LEU B HD21 9  
ATOM 11497 H HD22 . LEU B 1 4  ? -7.800  -20.346 -7.265  1.00 0.00 ? 4  LEU B HD22 9  
ATOM 11498 H HD23 . LEU B 1 4  ? -9.409  -20.808 -6.708  1.00 0.00 ? 4  LEU B HD23 9  
ATOM 11499 N N    . PRO B 1 5  ? -3.703  -22.295 -6.826  1.00 0.00 ? 5  PRO B N    9  
ATOM 11500 C CA   . PRO B 1 5  ? -2.238  -22.359 -6.894  1.00 0.00 ? 5  PRO B CA   9  
ATOM 11501 C C    . PRO B 1 5  ? -1.566  -21.576 -5.771  1.00 0.00 ? 5  PRO B C    9  
ATOM 11502 O O    . PRO B 1 5  ? -1.730  -20.359 -5.663  1.00 0.00 ? 5  PRO B O    9  
ATOM 11503 C CB   . PRO B 1 5  ? -1.911  -21.731 -8.252  1.00 0.00 ? 5  PRO B CB   9  
ATOM 11504 C CG   . PRO B 1 5  ? -3.087  -20.875 -8.575  1.00 0.00 ? 5  PRO B CG   9  
ATOM 11505 C CD   . PRO B 1 5  ? -4.278  -21.561 -7.969  1.00 0.00 ? 5  PRO B CD   9  
ATOM 11506 H HA   . PRO B 1 5  ? -1.894  -23.385 -6.885  1.00 0.00 ? 5  PRO B HA   9  
ATOM 11507 H HB2  . PRO B 1 5  ? -0.998  -21.153 -8.200  1.00 0.00 ? 5  PRO B HB2  9  
ATOM 11508 H HB3  . PRO B 1 5  ? -1.794  -22.515 -8.985  1.00 0.00 ? 5  PRO B HB3  9  
ATOM 11509 H HG2  . PRO B 1 5  ? -2.962  -19.898 -8.138  1.00 0.00 ? 5  PRO B HG2  9  
ATOM 11510 H HG3  . PRO B 1 5  ? -3.204  -20.798 -9.646  1.00 0.00 ? 5  PRO B HG3  9  
ATOM 11511 H HD2  . PRO B 1 5  ? -5.001  -20.832 -7.643  1.00 0.00 ? 5  PRO B HD2  9  
ATOM 11512 H HD3  . PRO B 1 5  ? -4.722  -22.242 -8.680  1.00 0.00 ? 5  PRO B HD3  9  
ATOM 11513 N N    . PHE B 1 6  ? -0.807  -22.282 -4.937  1.00 0.00 ? 6  PHE B N    9  
ATOM 11514 C CA   . PHE B 1 6  ? -0.103  -21.661 -3.821  1.00 0.00 ? 6  PHE B CA   9  
ATOM 11515 C C    . PHE B 1 6  ? 1.068   -20.818 -4.320  1.00 0.00 ? 6  PHE B C    9  
ATOM 11516 O O    . PHE B 1 6  ? 1.605   -19.985 -3.593  1.00 0.00 ? 6  PHE B O    9  
ATOM 11517 C CB   . PHE B 1 6  ? 0.401   -22.733 -2.850  1.00 0.00 ? 6  PHE B CB   9  
ATOM 11518 C CG   . PHE B 1 6  ? 1.631   -23.458 -3.325  1.00 0.00 ? 6  PHE B CG   9  
ATOM 11519 C CD1  . PHE B 1 6  ? 1.618   -24.178 -4.510  1.00 0.00 ? 6  PHE B CD1  9  
ATOM 11520 C CD2  . PHE B 1 6  ? 2.799   -23.421 -2.581  1.00 0.00 ? 6  PHE B CD2  9  
ATOM 11521 C CE1  . PHE B 1 6  ? 2.748   -24.845 -4.943  1.00 0.00 ? 6  PHE B CE1  9  
ATOM 11522 C CE2  . PHE B 1 6  ? 3.931   -24.085 -3.009  1.00 0.00 ? 6  PHE B CE2  9  
ATOM 11523 C CZ   . PHE B 1 6  ? 3.907   -24.799 -4.192  1.00 0.00 ? 6  PHE B CZ   9  
ATOM 11524 H H    . PHE B 1 6  ? -0.736  -23.245 -5.075  1.00 0.00 ? 6  PHE B H    9  
ATOM 11525 H HA   . PHE B 1 6  ? -0.799  -21.020 -3.297  1.00 0.00 ? 6  PHE B HA   9  
ATOM 11526 H HB2  . PHE B 1 6  ? 0.619   -22.264 -1.900  1.00 0.00 ? 6  PHE B HB2  9  
ATOM 11527 H HB3  . PHE B 1 6  ? -0.380  -23.467 -2.703  1.00 0.00 ? 6  PHE B HB3  9  
ATOM 11528 H HD1  . PHE B 1 6  ? 0.728   -24.232 -5.102  1.00 0.00 ? 6  PHE B HD1  9  
ATOM 11529 H HD2  . PHE B 1 6  ? 2.825   -22.864 -1.654  1.00 0.00 ? 6  PHE B HD2  9  
ATOM 11530 H HE1  . PHE B 1 6  ? 2.725   -25.403 -5.868  1.00 0.00 ? 6  PHE B HE1  9  
ATOM 11531 H HE2  . PHE B 1 6  ? 4.835   -24.047 -2.419  1.00 0.00 ? 6  PHE B HE2  9  
ATOM 11532 H HZ   . PHE B 1 6  ? 4.791   -25.320 -4.528  1.00 0.00 ? 6  PHE B HZ   9  
ATOM 11533 N N    . LYS B 1 7  ? 1.462   -21.048 -5.565  1.00 0.00 ? 7  LYS B N    9  
ATOM 11534 C CA   . LYS B 1 7  ? 2.572   -20.318 -6.167  1.00 0.00 ? 7  LYS B CA   9  
ATOM 11535 C C    . LYS B 1 7  ? 2.237   -18.836 -6.320  1.00 0.00 ? 7  LYS B C    9  
ATOM 11536 O O    . LYS B 1 7  ? 3.121   -17.982 -6.268  1.00 0.00 ? 7  LYS B O    9  
ATOM 11537 C CB   . LYS B 1 7  ? 2.919   -20.923 -7.529  1.00 0.00 ? 7  LYS B CB   9  
ATOM 11538 C CG   . LYS B 1 7  ? 4.068   -20.225 -8.236  1.00 0.00 ? 7  LYS B CG   9  
ATOM 11539 C CD   . LYS B 1 7  ? 4.368   -20.865 -9.583  1.00 0.00 ? 7  LYS B CD   9  
ATOM 11540 C CE   . LYS B 1 7  ? 4.928   -22.271 -9.425  1.00 0.00 ? 7  LYS B CE   9  
ATOM 11541 N NZ   . LYS B 1 7  ? 5.186   -22.916 -10.742 1.00 0.00 ? 7  LYS B NZ   9  
ATOM 11542 H H    . LYS B 1 7  ? 1.016   -21.734 -6.106  1.00 0.00 ? 7  LYS B H    9  
ATOM 11543 H HA   . LYS B 1 7  ? 3.432   -20.414 -5.517  1.00 0.00 ? 7  LYS B HA   9  
ATOM 11544 H HB2  . LYS B 1 7  ? 3.181   -21.956 -7.374  1.00 0.00 ? 7  LYS B HB2  9  
ATOM 11545 H HB3  . LYS B 1 7  ? 2.044   -20.875 -8.164  1.00 0.00 ? 7  LYS B HB3  9  
ATOM 11546 H HG2  . LYS B 1 7  ? 3.807   -19.191 -8.405  1.00 0.00 ? 7  LYS B HG2  9  
ATOM 11547 H HG3  . LYS B 1 7  ? 4.950   -20.276 -7.612  1.00 0.00 ? 7  LYS B HG3  9  
ATOM 11548 H HD2  . LYS B 1 7  ? 3.460   -20.912 -10.168 1.00 0.00 ? 7  LYS B HD2  9  
ATOM 11549 H HD3  . LYS B 1 7  ? 5.096   -20.257 -10.100 1.00 0.00 ? 7  LYS B HD3  9  
ATOM 11550 H HE2  . LYS B 1 7  ? 5.856   -22.219 -8.876  1.00 0.00 ? 7  LYS B HE2  9  
ATOM 11551 H HE3  . LYS B 1 7  ? 4.224   -22.880 -8.881  1.00 0.00 ? 7  LYS B HE3  9  
ATOM 11552 H HZ1  . LYS B 1 7  ? 4.303   -22.988 -11.289 1.00 0.00 ? 7  LYS B HZ1  9  
ATOM 11553 H HZ2  . LYS B 1 7  ? 5.567   -23.873 -10.600 1.00 0.00 ? 7  LYS B HZ2  9  
ATOM 11554 H HZ3  . LYS B 1 7  ? 5.877   -22.360 -11.288 1.00 0.00 ? 7  LYS B HZ3  9  
ATOM 11555 N N    . VAL B 1 8  ? 0.956   -18.540 -6.508  1.00 0.00 ? 8  VAL B N    9  
ATOM 11556 C CA   . VAL B 1 8  ? 0.503   -17.164 -6.680  1.00 0.00 ? 8  VAL B CA   9  
ATOM 11557 C C    . VAL B 1 8  ? 0.557   -16.381 -5.369  1.00 0.00 ? 8  VAL B C    9  
ATOM 11558 O O    . VAL B 1 8  ? 0.987   -15.227 -5.343  1.00 0.00 ? 8  VAL B O    9  
ATOM 11559 C CB   . VAL B 1 8  ? -0.933  -17.114 -7.236  1.00 0.00 ? 8  VAL B CB   9  
ATOM 11560 C CG1  . VAL B 1 8  ? -1.339  -15.683 -7.548  1.00 0.00 ? 8  VAL B CG1  9  
ATOM 11561 C CG2  . VAL B 1 8  ? -1.057  -17.991 -8.472  1.00 0.00 ? 8  VAL B CG2  9  
ATOM 11562 H H    . VAL B 1 8  ? 0.292   -19.264 -6.532  1.00 0.00 ? 8  VAL B H    9  
ATOM 11563 H HA   . VAL B 1 8  ? 1.158   -16.682 -7.399  1.00 0.00 ? 8  VAL B HA   9  
ATOM 11564 H HB   . VAL B 1 8  ? -1.610  -17.500 -6.484  1.00 0.00 ? 8  VAL B HB   9  
ATOM 11565 H HG11 . VAL B 1 8  ? -1.371  -15.102 -6.639  1.00 0.00 ? 8  VAL B HG11 9  
ATOM 11566 H HG12 . VAL B 1 8  ? -2.321  -15.675 -8.003  1.00 0.00 ? 8  VAL B HG12 9  
ATOM 11567 H HG13 . VAL B 1 8  ? -0.626  -15.242 -8.232  1.00 0.00 ? 8  VAL B HG13 9  
ATOM 11568 H HG21 . VAL B 1 8  ? -0.874  -19.018 -8.214  1.00 0.00 ? 8  VAL B HG21 9  
ATOM 11569 H HG22 . VAL B 1 8  ? -0.341  -17.675 -9.217  1.00 0.00 ? 8  VAL B HG22 9  
ATOM 11570 H HG23 . VAL B 1 8  ? -2.056  -17.903 -8.880  1.00 0.00 ? 8  VAL B HG23 9  
ATOM 11571 N N    . VAL B 1 9  ? 0.122   -17.013 -4.282  1.00 0.00 ? 9  VAL B N    9  
ATOM 11572 C CA   . VAL B 1 9  ? 0.112   -16.365 -2.974  1.00 0.00 ? 9  VAL B CA   9  
ATOM 11573 C C    . VAL B 1 9  ? 1.527   -16.154 -2.435  1.00 0.00 ? 9  VAL B C    9  
ATOM 11574 O O    . VAL B 1 9  ? 1.794   -15.164 -1.753  1.00 0.00 ? 9  VAL B O    9  
ATOM 11575 C CB   . VAL B 1 9  ? -0.716  -17.171 -1.952  1.00 0.00 ? 9  VAL B CB   9  
ATOM 11576 C CG1  . VAL B 1 9  ? -0.124  -18.554 -1.742  1.00 0.00 ? 9  VAL B CG1  9  
ATOM 11577 C CG2  . VAL B 1 9  ? -0.817  -16.425 -0.631  1.00 0.00 ? 9  VAL B CG2  9  
ATOM 11578 H H    . VAL B 1 9  ? -0.213  -17.933 -4.367  1.00 0.00 ? 9  VAL B H    9  
ATOM 11579 H HA   . VAL B 1 9  ? -0.358  -15.394 -3.089  1.00 0.00 ? 9  VAL B HA   9  
ATOM 11580 H HB   . VAL B 1 9  ? -1.714  -17.291 -2.347  1.00 0.00 ? 9  VAL B HB   9  
ATOM 11581 H HG11 . VAL B 1 9  ? -0.711  -19.085 -1.004  1.00 0.00 ? 9  VAL B HG11 9  
ATOM 11582 H HG12 . VAL B 1 9  ? 0.893   -18.491 -1.397  1.00 0.00 ? 9  VAL B HG12 9  
ATOM 11583 H HG13 . VAL B 1 9  ? -0.167  -19.090 -2.661  1.00 0.00 ? 9  VAL B HG13 9  
ATOM 11584 H HG21 . VAL B 1 9  ? -1.177  -15.420 -0.805  1.00 0.00 ? 9  VAL B HG21 9  
ATOM 11585 H HG22 . VAL B 1 9  ? 0.150   -16.381 -0.150  1.00 0.00 ? 9  VAL B HG22 9  
ATOM 11586 H HG23 . VAL B 1 9  ? -1.511  -16.941 0.017   1.00 0.00 ? 9  VAL B HG23 9  
ATOM 11587 N N    . VAL B 1 10 ? 2.431   -17.082 -2.741  1.00 0.00 ? 10 VAL B N    9  
ATOM 11588 C CA   . VAL B 1 10 ? 3.813   -16.980 -2.277  1.00 0.00 ? 10 VAL B CA   9  
ATOM 11589 C C    . VAL B 1 10 ? 4.526   -15.794 -2.924  1.00 0.00 ? 10 VAL B C    9  
ATOM 11590 O O    . VAL B 1 10 ? 5.122   -14.966 -2.235  1.00 0.00 ? 10 VAL B O    9  
ATOM 11591 C CB   . VAL B 1 10 ? 4.610   -18.268 -2.570  1.00 0.00 ? 10 VAL B CB   9  
ATOM 11592 C CG1  . VAL B 1 10 ? 6.081   -18.085 -2.221  1.00 0.00 ? 10 VAL B CG1  9  
ATOM 11593 C CG2  . VAL B 1 10 ? 4.026   -19.445 -1.802  1.00 0.00 ? 10 VAL B CG2  9  
ATOM 11594 H H    . VAL B 1 10 ? 2.170   -17.859 -3.288  1.00 0.00 ? 10 VAL B H    9  
ATOM 11595 H HA   . VAL B 1 10 ? 3.800   -16.827 -1.203  1.00 0.00 ? 10 VAL B HA   9  
ATOM 11596 H HB   . VAL B 1 10 ? 4.537   -18.482 -3.626  1.00 0.00 ? 10 VAL B HB   9  
ATOM 11597 H HG11 . VAL B 1 10 ? 6.556   -17.452 -2.955  1.00 0.00 ? 10 VAL B HG11 9  
ATOM 11598 H HG12 . VAL B 1 10 ? 6.580   -19.046 -2.219  1.00 0.00 ? 10 VAL B HG12 9  
ATOM 11599 H HG13 . VAL B 1 10 ? 6.176   -17.635 -1.242  1.00 0.00 ? 10 VAL B HG13 9  
ATOM 11600 H HG21 . VAL B 1 10 ? 4.340   -19.401 -0.766  1.00 0.00 ? 10 VAL B HG21 9  
ATOM 11601 H HG22 . VAL B 1 10 ? 4.378   -20.366 -2.240  1.00 0.00 ? 10 VAL B HG22 9  
ATOM 11602 H HG23 . VAL B 1 10 ? 2.950   -19.423 -1.842  1.00 0.00 ? 10 VAL B HG23 9  
ATOM 11603 N N    . ILE B 1 11 ? 4.461   -15.720 -4.251  1.00 0.00 ? 11 ILE B N    9  
ATOM 11604 C CA   . ILE B 1 11 ? 5.100   -14.636 -4.988  1.00 0.00 ? 11 ILE B CA   9  
ATOM 11605 C C    . ILE B 1 11 ? 4.479   -13.291 -4.630  1.00 0.00 ? 11 ILE B C    9  
ATOM 11606 O O    . ILE B 1 11 ? 5.162   -12.267 -4.597  1.00 0.00 ? 11 ILE B O    9  
ATOM 11607 C CB   . ILE B 1 11 ? 4.994   -14.852 -6.511  1.00 0.00 ? 11 ILE B CB   9  
ATOM 11608 C CG1  . ILE B 1 11 ? 5.565   -16.218 -6.895  1.00 0.00 ? 11 ILE B CG1  9  
ATOM 11609 C CG2  . ILE B 1 11 ? 5.721   -13.740 -7.256  1.00 0.00 ? 11 ILE B CG2  9  
ATOM 11610 C CD1  . ILE B 1 11 ? 5.315   -16.598 -8.339  1.00 0.00 ? 11 ILE B CD1  9  
ATOM 11611 H H    . ILE B 1 11 ? 3.958   -16.411 -4.741  1.00 0.00 ? 11 ILE B H    9  
ATOM 11612 H HA   . ILE B 1 11 ? 6.150   -14.619 -4.719  1.00 0.00 ? 11 ILE B HA   9  
ATOM 11613 H HB   . ILE B 1 11 ? 3.948   -14.816 -6.789  1.00 0.00 ? 11 ILE B HB   9  
ATOM 11614 H HG12 . ILE B 1 11 ? 6.636   -16.209 -6.745  1.00 0.00 ? 11 ILE B HG12 9  
ATOM 11615 H HG13 . ILE B 1 11 ? 5.144   -16.989 -6.281  1.00 0.00 ? 11 ILE B HG13 9  
ATOM 11616 H HG21 . ILE B 1 11 ? 5.263   -12.787 -7.042  1.00 0.00 ? 11 ILE B HG21 9  
ATOM 11617 H HG22 . ILE B 1 11 ? 5.668   -13.915 -8.321  1.00 0.00 ? 11 ILE B HG22 9  
ATOM 11618 H HG23 . ILE B 1 11 ? 6.758   -13.715 -6.951  1.00 0.00 ? 11 ILE B HG23 9  
ATOM 11619 H HD11 . ILE B 1 11 ? 5.907   -15.969 -8.986  1.00 0.00 ? 11 ILE B HD11 9  
ATOM 11620 H HD12 . ILE B 1 11 ? 4.267   -16.474 -8.574  1.00 0.00 ? 11 ILE B HD12 9  
ATOM 11621 H HD13 . ILE B 1 11 ? 5.595   -17.630 -8.491  1.00 0.00 ? 11 ILE B HD13 9  
ATOM 11622 N N    . SER B 1 12 ? 3.177   -13.302 -4.363  1.00 0.00 ? 12 SER B N    9  
ATOM 11623 C CA   . SER B 1 12 ? 2.459   -12.085 -4.006  1.00 0.00 ? 12 SER B CA   9  
ATOM 11624 C C    . SER B 1 12 ? 2.870   -11.598 -2.620  1.00 0.00 ? 12 SER B C    9  
ATOM 11625 O O    . SER B 1 12 ? 2.999   -10.396 -2.385  1.00 0.00 ? 12 SER B O    9  
ATOM 11626 C CB   . SER B 1 12 ? 0.948   -12.329 -4.044  1.00 0.00 ? 12 SER B CB   9  
ATOM 11627 O OG   . SER B 1 12 ? 0.232   -11.157 -3.692  1.00 0.00 ? 12 SER B OG   9  
ATOM 11628 H H    . SER B 1 12 ? 2.676   -14.150 -4.407  1.00 0.00 ? 12 SER B H    9  
ATOM 11629 H HA   . SER B 1 12 ? 2.704   -11.319 -4.731  1.00 0.00 ? 12 SER B HA   9  
ATOM 11630 H HB2  . SER B 1 12 ? 0.659   -12.626 -5.042  1.00 0.00 ? 12 SER B HB2  9  
ATOM 11631 H HB3  . SER B 1 12 ? 0.693   -13.116 -3.348  1.00 0.00 ? 12 SER B HB3  9  
ATOM 11632 H HG   . SER B 1 12 ? 0.185   -10.567 -4.449  1.00 0.00 ? 12 SER B HG   9  
ATOM 11633 N N    . ALA B 1 13 ? 3.076   -12.542 -1.708  1.00 0.00 ? 13 ALA B N    9  
ATOM 11634 C CA   . ALA B 1 13 ? 3.468   -12.219 -0.341  1.00 0.00 ? 13 ALA B CA   9  
ATOM 11635 C C    . ALA B 1 13 ? 4.813   -11.500 -0.299  1.00 0.00 ? 13 ALA B C    9  
ATOM 11636 O O    . ALA B 1 13 ? 4.915   -10.390 0.225   1.00 0.00 ? 13 ALA B O    9  
ATOM 11637 C CB   . ALA B 1 13 ? 3.518   -13.484 0.502   1.00 0.00 ? 13 ALA B CB   9  
ATOM 11638 H H    . ALA B 1 13 ? 2.955   -13.490 -1.954  1.00 0.00 ? 13 ALA B H    9  
ATOM 11639 H HA   . ALA B 1 13 ? 2.713   -11.569 0.082   1.00 0.00 ? 13 ALA B HA   9  
ATOM 11640 H HB1  . ALA B 1 13 ? 3.745   -13.229 1.528   1.00 0.00 ? 13 ALA B HB1  9  
ATOM 11641 H HB2  . ALA B 1 13 ? 4.280   -14.148 0.118   1.00 0.00 ? 13 ALA B HB2  9  
ATOM 11642 H HB3  . ALA B 1 13 ? 2.559   -13.979 0.460   1.00 0.00 ? 13 ALA B HB3  9  
ATOM 11643 N N    . ILE B 1 14 ? 5.842   -12.134 -0.855  1.00 0.00 ? 14 ILE B N    9  
ATOM 11644 C CA   . ILE B 1 14 ? 7.180   -11.551 -0.868  1.00 0.00 ? 14 ILE B CA   9  
ATOM 11645 C C    . ILE B 1 14 ? 7.198   -10.210 -1.597  1.00 0.00 ? 14 ILE B C    9  
ATOM 11646 O O    . ILE B 1 14 ? 7.832   -9.258  -1.144  1.00 0.00 ? 14 ILE B O    9  
ATOM 11647 C CB   . ILE B 1 14 ? 8.209   -12.503 -1.515  1.00 0.00 ? 14 ILE B CB   9  
ATOM 11648 C CG1  . ILE B 1 14 ? 9.603   -11.867 -1.497  1.00 0.00 ? 14 ILE B CG1  9  
ATOM 11649 C CG2  . ILE B 1 14 ? 7.792   -12.855 -2.937  1.00 0.00 ? 14 ILE B CG2  9  
ATOM 11650 C CD1  . ILE B 1 14 ? 10.711  -12.810 -1.912  1.00 0.00 ? 14 ILE B CD1  9  
ATOM 11651 H H    . ILE B 1 14 ? 5.694   -13.023 -1.252  1.00 0.00 ? 14 ILE B H    9  
ATOM 11652 H HA   . ILE B 1 14 ? 7.478   -11.387 0.161   1.00 0.00 ? 14 ILE B HA   9  
ATOM 11653 H HB   . ILE B 1 14 ? 8.228   -13.416 -0.937  1.00 0.00 ? 14 ILE B HB   9  
ATOM 11654 H HG12 . ILE B 1 14 ? 9.632   -11.024 -2.173  1.00 0.00 ? 14 ILE B HG12 9  
ATOM 11655 H HG13 . ILE B 1 14 ? 9.828   -11.525 -0.495  1.00 0.00 ? 14 ILE B HG13 9  
ATOM 11656 H HG21 . ILE B 1 14 ? 6.774   -13.210 -2.959  1.00 0.00 ? 14 ILE B HG21 9  
ATOM 11657 H HG22 . ILE B 1 14 ? 8.439   -13.636 -3.307  1.00 0.00 ? 14 ILE B HG22 9  
ATOM 11658 H HG23 . ILE B 1 14 ? 7.887   -11.992 -3.578  1.00 0.00 ? 14 ILE B HG23 9  
ATOM 11659 H HD11 . ILE B 1 14 ? 11.663  -12.307 -1.824  1.00 0.00 ? 14 ILE B HD11 9  
ATOM 11660 H HD12 . ILE B 1 14 ? 10.559  -13.115 -2.937  1.00 0.00 ? 14 ILE B HD12 9  
ATOM 11661 H HD13 . ILE B 1 14 ? 10.704  -13.680 -1.272  1.00 0.00 ? 14 ILE B HD13 9  
ATOM 11662 N N    . LEU B 1 15 ? 6.499   -10.135 -2.726  1.00 0.00 ? 15 LEU B N    9  
ATOM 11663 C CA   . LEU B 1 15 ? 6.442   -8.905  -3.509  1.00 0.00 ? 15 LEU B CA   9  
ATOM 11664 C C    . LEU B 1 15 ? 5.720   -7.805  -2.739  1.00 0.00 ? 15 LEU B C    9  
ATOM 11665 O O    . LEU B 1 15 ? 5.994   -6.620  -2.925  1.00 0.00 ? 15 LEU B O    9  
ATOM 11666 C CB   . LEU B 1 15 ? 5.739   -9.157  -4.847  1.00 0.00 ? 15 LEU B CB   9  
ATOM 11667 C CG   . LEU B 1 15 ? 5.687   -7.953  -5.792  1.00 0.00 ? 15 LEU B CG   9  
ATOM 11668 C CD1  . LEU B 1 15 ? 7.089   -7.547  -6.221  1.00 0.00 ? 15 LEU B CD1  9  
ATOM 11669 C CD2  . LEU B 1 15 ? 4.824   -8.268  -7.006  1.00 0.00 ? 15 LEU B CD2  9  
ATOM 11670 H H    . LEU B 1 15 ? 5.999   -10.922 -3.044  1.00 0.00 ? 15 LEU B H    9  
ATOM 11671 H HA   . LEU B 1 15 ? 7.456   -8.586  -3.701  1.00 0.00 ? 15 LEU B HA   9  
ATOM 11672 H HB2  . LEU B 1 15 ? 6.251   -9.969  -5.349  1.00 0.00 ? 15 LEU B HB2  9  
ATOM 11673 H HB3  . LEU B 1 15 ? 4.724   -9.474  -4.638  1.00 0.00 ? 15 LEU B HB3  9  
ATOM 11674 H HG   . LEU B 1 15 ? 5.241   -7.113  -5.281  1.00 0.00 ? 15 LEU B HG   9  
ATOM 11675 H HD11 . LEU B 1 15 ? 7.662   -7.248  -5.357  1.00 0.00 ? 15 LEU B HD11 9  
ATOM 11676 H HD12 . LEU B 1 15 ? 7.031   -6.715  -6.910  1.00 0.00 ? 15 LEU B HD12 9  
ATOM 11677 H HD13 . LEU B 1 15 ? 7.578   -8.380  -6.707  1.00 0.00 ? 15 LEU B HD13 9  
ATOM 11678 H HD21 . LEU B 1 15 ? 5.251   -9.098  -7.553  1.00 0.00 ? 15 LEU B HD21 9  
ATOM 11679 H HD22 . LEU B 1 15 ? 4.774   -7.401  -7.651  1.00 0.00 ? 15 LEU B HD22 9  
ATOM 11680 H HD23 . LEU B 1 15 ? 3.825   -8.528  -6.683  1.00 0.00 ? 15 LEU B HD23 9  
ATOM 11681 N N    . ALA B 1 16 ? 4.798   -8.207  -1.869  1.00 0.00 ? 16 ALA B N    9  
ATOM 11682 C CA   . ALA B 1 16 ? 4.035   -7.258  -1.067  1.00 0.00 ? 16 ALA B CA   9  
ATOM 11683 C C    . ALA B 1 16 ? 4.933   -6.518  -0.081  1.00 0.00 ? 16 ALA B C    9  
ATOM 11684 O O    . ALA B 1 16 ? 4.758   -5.324  0.157   1.00 0.00 ? 16 ALA B O    9  
ATOM 11685 C CB   . ALA B 1 16 ? 2.917   -7.975  -0.330  1.00 0.00 ? 16 ALA B CB   9  
ATOM 11686 H H    . ALA B 1 16 ? 4.616   -9.168  -1.759  1.00 0.00 ? 16 ALA B H    9  
ATOM 11687 H HA   . ALA B 1 16 ? 3.581   -6.536  -1.735  1.00 0.00 ? 16 ALA B HA   9  
ATOM 11688 H HB1  . ALA B 1 16 ? 2.297   -7.248  0.176   1.00 0.00 ? 16 ALA B HB1  9  
ATOM 11689 H HB2  . ALA B 1 16 ? 3.329   -8.656  0.396   1.00 0.00 ? 16 ALA B HB2  9  
ATOM 11690 H HB3  . ALA B 1 16 ? 2.314   -8.522  -1.036  1.00 0.00 ? 16 ALA B HB3  9  
ATOM 11691 N N    . LEU B 1 17 ? 5.892   -7.237  0.497   1.00 0.00 ? 17 LEU B N    9  
ATOM 11692 C CA   . LEU B 1 17 ? 6.819   -6.643  1.456   1.00 0.00 ? 17 LEU B CA   9  
ATOM 11693 C C    . LEU B 1 17 ? 7.836   -5.753  0.749   1.00 0.00 ? 17 LEU B C    9  
ATOM 11694 O O    . LEU B 1 17 ? 8.284   -4.749  1.302   1.00 0.00 ? 17 LEU B O    9  
ATOM 11695 C CB   . LEU B 1 17 ? 7.539   -7.733  2.257   1.00 0.00 ? 17 LEU B CB   9  
ATOM 11696 C CG   . LEU B 1 17 ? 6.744   -8.323  3.429   1.00 0.00 ? 17 LEU B CG   9  
ATOM 11697 C CD1  . LEU B 1 17 ? 6.421   -7.246  4.455   1.00 0.00 ? 17 LEU B CD1  9  
ATOM 11698 C CD2  . LEU B 1 17 ? 5.469   -8.988  2.934   1.00 0.00 ? 17 LEU B CD2  9  
ATOM 11699 H H    . LEU B 1 17 ? 5.986   -8.194  0.276   1.00 0.00 ? 17 LEU B H    9  
ATOM 11700 H HA   . LEU B 1 17 ? 6.250   -6.018  2.126   1.00 0.00 ? 17 LEU B HA   9  
ATOM 11701 H HB2  . LEU B 1 17 ? 7.797   -8.538  1.582   1.00 0.00 ? 17 LEU B HB2  9  
ATOM 11702 H HB3  . LEU B 1 17 ? 8.461   -7.325  2.658   1.00 0.00 ? 17 LEU B HB3  9  
ATOM 11703 H HG   . LEU B 1 17 ? 7.346   -9.076  3.918   1.00 0.00 ? 17 LEU B HG   9  
ATOM 11704 H HD11 . LEU B 1 17 ? 7.328   -6.730  4.742   1.00 0.00 ? 17 LEU B HD11 9  
ATOM 11705 H HD12 . LEU B 1 17 ? 5.986   -7.707  5.330   1.00 0.00 ? 17 LEU B HD12 9  
ATOM 11706 H HD13 . LEU B 1 17 ? 5.719   -6.537  4.043   1.00 0.00 ? 17 LEU B HD13 9  
ATOM 11707 H HD21 . LEU B 1 17 ? 5.723   -9.752  2.223   1.00 0.00 ? 17 LEU B HD21 9  
ATOM 11708 H HD22 . LEU B 1 17 ? 4.821   -8.259  2.474   1.00 0.00 ? 17 LEU B HD22 9  
ATOM 11709 H HD23 . LEU B 1 17 ? 4.954   -9.442  3.770   1.00 0.00 ? 17 LEU B HD23 9  
ATOM 11710 N N    . VAL B 1 18 ? 8.199   -6.128  -0.475  1.00 0.00 ? 18 VAL B N    9  
ATOM 11711 C CA   . VAL B 1 18 ? 9.163   -5.360  -1.252  1.00 0.00 ? 18 VAL B CA   9  
ATOM 11712 C C    . VAL B 1 18 ? 8.595   -3.998  -1.635  1.00 0.00 ? 18 VAL B C    9  
ATOM 11713 O O    . VAL B 1 18 ? 9.286   -2.982  -1.547  1.00 0.00 ? 18 VAL B O    9  
ATOM 11714 C CB   . VAL B 1 18 ? 9.588   -6.109  -2.533  1.00 0.00 ? 18 VAL B CB   9  
ATOM 11715 C CG1  . VAL B 1 18 ? 10.537  -5.259  -3.364  1.00 0.00 ? 18 VAL B CG1  9  
ATOM 11716 C CG2  . VAL B 1 18 ? 10.233  -7.441  -2.184  1.00 0.00 ? 18 VAL B CG2  9  
ATOM 11717 H H    . VAL B 1 18 ? 7.814   -6.942  -0.872  1.00 0.00 ? 18 VAL B H    9  
ATOM 11718 H HA   . VAL B 1 18 ? 10.047  -5.206  -0.642  1.00 0.00 ? 18 VAL B HA   9  
ATOM 11719 H HB   . VAL B 1 18 ? 8.705   -6.307  -3.124  1.00 0.00 ? 18 VAL B HB   9  
ATOM 11720 H HG11 . VAL B 1 18 ? 10.966  -5.859  -4.157  1.00 0.00 ? 18 VAL B HG11 9  
ATOM 11721 H HG12 . VAL B 1 18 ? 11.333  -4.877  -2.740  1.00 0.00 ? 18 VAL B HG12 9  
ATOM 11722 H HG13 . VAL B 1 18 ? 9.999   -4.433  -3.806  1.00 0.00 ? 18 VAL B HG13 9  
ATOM 11723 H HG21 . VAL B 1 18 ? 11.188  -7.268  -1.705  1.00 0.00 ? 18 VAL B HG21 9  
ATOM 11724 H HG22 . VAL B 1 18 ? 10.386  -8.012  -3.087  1.00 0.00 ? 18 VAL B HG22 9  
ATOM 11725 H HG23 . VAL B 1 18 ? 9.603   -7.996  -1.519  1.00 0.00 ? 18 VAL B HG23 9  
ATOM 11726 N N    . VAL B 1 19 ? 7.332   -3.977  -2.054  1.00 0.00 ? 19 VAL B N    9  
ATOM 11727 C CA   . VAL B 1 19 ? 6.684   -2.733  -2.451  1.00 0.00 ? 19 VAL B CA   9  
ATOM 11728 C C    . VAL B 1 19 ? 6.385   -1.854  -1.242  1.00 0.00 ? 19 VAL B C    9  
ATOM 11729 O O    . VAL B 1 19 ? 6.449   -0.630  -1.330  1.00 0.00 ? 19 VAL B O    9  
ATOM 11730 C CB   . VAL B 1 19 ? 5.376   -2.986  -3.228  1.00 0.00 ? 19 VAL B CB   9  
ATOM 11731 C CG1  . VAL B 1 19 ? 5.648   -3.811  -4.476  1.00 0.00 ? 19 VAL B CG1  9  
ATOM 11732 C CG2  . VAL B 1 19 ? 4.343   -3.668  -2.344  1.00 0.00 ? 19 VAL B CG2  9  
ATOM 11733 H H    . VAL B 1 19 ? 6.825   -4.819  -2.104  1.00 0.00 ? 19 VAL B H    9  
ATOM 11734 H HA   . VAL B 1 19 ? 7.360   -2.192  -3.106  1.00 0.00 ? 19 VAL B HA   9  
ATOM 11735 H HB   . VAL B 1 19 ? 4.974   -2.032  -3.544  1.00 0.00 ? 19 VAL B HB   9  
ATOM 11736 H HG11 . VAL B 1 19 ? 4.717   -4.027  -4.983  1.00 0.00 ? 19 VAL B HG11 9  
ATOM 11737 H HG12 . VAL B 1 19 ? 6.134   -4.732  -4.213  1.00 0.00 ? 19 VAL B HG12 9  
ATOM 11738 H HG13 . VAL B 1 19 ? 6.288   -3.250  -5.141  1.00 0.00 ? 19 VAL B HG13 9  
ATOM 11739 H HG21 . VAL B 1 19 ? 4.092   -3.047  -1.502  1.00 0.00 ? 19 VAL B HG21 9  
ATOM 11740 H HG22 . VAL B 1 19 ? 4.727   -4.607  -2.004  1.00 0.00 ? 19 VAL B HG22 9  
ATOM 11741 H HG23 . VAL B 1 19 ? 3.445   -3.848  -2.921  1.00 0.00 ? 19 VAL B HG23 9  
ATOM 11742 N N    . LEU B 1 20 ? 6.058   -2.479  -0.112  1.00 0.00 ? 20 LEU B N    9  
ATOM 11743 C CA   . LEU B 1 20 ? 5.760   -1.737  1.109   1.00 0.00 ? 20 LEU B CA   9  
ATOM 11744 C C    . LEU B 1 20 ? 6.944   -0.865  1.505   1.00 0.00 ? 20 LEU B C    9  
ATOM 11745 O O    . LEU B 1 20 ? 6.775   0.282   1.919   1.00 0.00 ? 20 LEU B O    9  
ATOM 11746 C CB   . LEU B 1 20 ? 5.411   -2.690  2.253   1.00 0.00 ? 20 LEU B CB   9  
ATOM 11747 C CG   . LEU B 1 20 ? 5.098   -2.008  3.589   1.00 0.00 ? 20 LEU B CG   9  
ATOM 11748 C CD1  . LEU B 1 20 ? 3.935   -1.036  3.436   1.00 0.00 ? 20 LEU B CD1  9  
ATOM 11749 C CD2  . LEU B 1 20 ? 4.788   -3.047  4.654   1.00 0.00 ? 20 LEU B CD2  9  
ATOM 11750 H H    . LEU B 1 20 ? 6.016   -3.464  -0.092  1.00 0.00 ? 20 LEU B H    9  
ATOM 11751 H HA   . LEU B 1 20 ? 4.911   -1.101  0.906   1.00 0.00 ? 20 LEU B HA   9  
ATOM 11752 H HB2  . LEU B 1 20 ? 4.550   -3.273  1.952   1.00 0.00 ? 20 LEU B HB2  9  
ATOM 11753 H HB3  . LEU B 1 20 ? 6.246   -3.363  2.399   1.00 0.00 ? 20 LEU B HB3  9  
ATOM 11754 H HG   . LEU B 1 20 ? 5.960   -1.446  3.918   1.00 0.00 ? 20 LEU B HG   9  
ATOM 11755 H HD11 . LEU B 1 20 ? 3.686   -0.612  4.400   1.00 0.00 ? 20 LEU B HD11 9  
ATOM 11756 H HD12 . LEU B 1 20 ? 3.073   -1.556  3.042   1.00 0.00 ? 20 LEU B HD12 9  
ATOM 11757 H HD13 . LEU B 1 20 ? 4.212   -0.239  2.763   1.00 0.00 ? 20 LEU B HD13 9  
ATOM 11758 H HD21 . LEU B 1 20 ? 3.918   -3.620  4.364   1.00 0.00 ? 20 LEU B HD21 9  
ATOM 11759 H HD22 . LEU B 1 20 ? 4.595   -2.554  5.597   1.00 0.00 ? 20 LEU B HD22 9  
ATOM 11760 H HD23 . LEU B 1 20 ? 5.633   -3.712  4.769   1.00 0.00 ? 20 LEU B HD23 9  
ATOM 11761 N N    . THR B 1 21 ? 8.143   -1.421  1.372   1.00 0.00 ? 21 THR B N    9  
ATOM 11762 C CA   . THR B 1 21 ? 9.362   -0.698  1.706   1.00 0.00 ? 21 THR B CA   9  
ATOM 11763 C C    . THR B 1 21 ? 9.595   0.448   0.725   1.00 0.00 ? 21 THR B C    9  
ATOM 11764 O O    . THR B 1 21 ? 10.083  1.512   1.103   1.00 0.00 ? 21 THR B O    9  
ATOM 11765 C CB   . THR B 1 21 ? 10.588  -1.630  1.700   1.00 0.00 ? 21 THR B CB   9  
ATOM 11766 O OG1  . THR B 1 21 ? 10.391  -2.702  2.630   1.00 0.00 ? 21 THR B OG1  9  
ATOM 11767 C CG2  . THR B 1 21 ? 11.855  -0.868  2.061   1.00 0.00 ? 21 THR B CG2  9  
ATOM 11768 H H    . THR B 1 21 ? 8.218   -2.345  1.037   1.00 0.00 ? 21 THR B H    9  
ATOM 11769 H HA   . THR B 1 21 ? 9.253   -0.289  2.704   1.00 0.00 ? 21 THR B HA   9  
ATOM 11770 H HB   . THR B 1 21 ? 10.706  -2.044  0.707   1.00 0.00 ? 21 THR B HB   9  
ATOM 11771 H HG1  . THR B 1 21 ? 10.923  -3.459  2.369   1.00 0.00 ? 21 THR B HG1  9  
ATOM 11772 H HG21 . THR B 1 21 ? 12.163  -0.256  1.226   1.00 0.00 ? 21 THR B HG21 9  
ATOM 11773 H HG22 . THR B 1 21 ? 12.639  -1.574  2.291   1.00 0.00 ? 21 THR B HG22 9  
ATOM 11774 H HG23 . THR B 1 21 ? 11.678  -0.240  2.924   1.00 0.00 ? 21 THR B HG23 9  
ATOM 11775 N N    . ILE B 1 22 ? 9.239   0.222   -0.538  1.00 0.00 ? 22 ILE B N    9  
ATOM 11776 C CA   . ILE B 1 22 ? 9.405   1.240   -1.568  1.00 0.00 ? 22 ILE B CA   9  
ATOM 11777 C C    . ILE B 1 22 ? 8.411   2.379   -1.361  1.00 0.00 ? 22 ILE B C    9  
ATOM 11778 O O    . ILE B 1 22 ? 8.739   3.544   -1.571  1.00 0.00 ? 22 ILE B O    9  
ATOM 11779 C CB   . ILE B 1 22 ? 9.227   0.651   -2.983  1.00 0.00 ? 22 ILE B CB   9  
ATOM 11780 C CG1  . ILE B 1 22 ? 10.306  -0.402  -3.254  1.00 0.00 ? 22 ILE B CG1  9  
ATOM 11781 C CG2  . ILE B 1 22 ? 9.281   1.757   -4.031  1.00 0.00 ? 22 ILE B CG2  9  
ATOM 11782 C CD1  . ILE B 1 22 ? 10.155  -1.103  -4.588  1.00 0.00 ? 22 ILE B CD1  9  
ATOM 11783 H H    . ILE B 1 22 ? 8.853   -0.649  -0.791  1.00 0.00 ? 22 ILE B H    9  
ATOM 11784 H HA   . ILE B 1 22 ? 10.410  1.644   -1.492  1.00 0.00 ? 22 ILE B HA   9  
ATOM 11785 H HB   . ILE B 1 22 ? 8.255   0.184   -3.037  1.00 0.00 ? 22 ILE B HB   9  
ATOM 11786 H HG12 . ILE B 1 22 ? 11.277  0.074   -3.244  1.00 0.00 ? 22 ILE B HG12 9  
ATOM 11787 H HG13 . ILE B 1 22 ? 10.279  -1.150  -2.484  1.00 0.00 ? 22 ILE B HG13 9  
ATOM 11788 H HG21 . ILE B 1 22 ? 8.461   2.443   -3.891  1.00 0.00 ? 22 ILE B HG21 9  
ATOM 11789 H HG22 . ILE B 1 22 ? 9.203   1.334   -5.021  1.00 0.00 ? 22 ILE B HG22 9  
ATOM 11790 H HG23 . ILE B 1 22 ? 10.215  2.294   -3.946  1.00 0.00 ? 22 ILE B HG23 9  
ATOM 11791 H HD11 . ILE B 1 22 ? 10.810  -1.961  -4.616  1.00 0.00 ? 22 ILE B HD11 9  
ATOM 11792 H HD12 . ILE B 1 22 ? 10.421  -0.425  -5.385  1.00 0.00 ? 22 ILE B HD12 9  
ATOM 11793 H HD13 . ILE B 1 22 ? 9.132   -1.429  -4.718  1.00 0.00 ? 22 ILE B HD13 9  
ATOM 11794 N N    . ILE B 1 23 ? 7.197   2.031   -0.942  1.00 0.00 ? 23 ILE B N    9  
ATOM 11795 C CA   . ILE B 1 23 ? 6.164   3.026   -0.693  1.00 0.00 ? 23 ILE B CA   9  
ATOM 11796 C C    . ILE B 1 23 ? 6.606   3.980   0.413   1.00 0.00 ? 23 ILE B C    9  
ATOM 11797 O O    . ILE B 1 23 ? 6.363   5.185   0.347   1.00 0.00 ? 23 ILE B O    9  
ATOM 11798 C CB   . ILE B 1 23 ? 4.824   2.368   -0.293  1.00 0.00 ? 23 ILE B CB   9  
ATOM 11799 C CG1  . ILE B 1 23 ? 4.262   1.543   -1.456  1.00 0.00 ? 23 ILE B CG1  9  
ATOM 11800 C CG2  . ILE B 1 23 ? 3.817   3.423   0.144   1.00 0.00 ? 23 ILE B CG2  9  
ATOM 11801 C CD1  . ILE B 1 23 ? 3.850   2.372   -2.655  1.00 0.00 ? 23 ILE B CD1  9  
ATOM 11802 H H    . ILE B 1 23 ? 6.986   1.081   -0.789  1.00 0.00 ? 23 ILE B H    9  
ATOM 11803 H HA   . ILE B 1 23 ? 6.020   3.599   -1.597  1.00 0.00 ? 23 ILE B HA   9  
ATOM 11804 H HB   . ILE B 1 23 ? 5.007   1.714   0.546   1.00 0.00 ? 23 ILE B HB   9  
ATOM 11805 H HG12 . ILE B 1 23 ? 5.000   0.845   -1.791  1.00 0.00 ? 23 ILE B HG12 9  
ATOM 11806 H HG13 . ILE B 1 23 ? 3.392   1.001   -1.115  1.00 0.00 ? 23 ILE B HG13 9  
ATOM 11807 H HG21 . ILE B 1 23 ? 2.826   2.987   0.192   1.00 0.00 ? 23 ILE B HG21 9  
ATOM 11808 H HG22 . ILE B 1 23 ? 3.808   4.244   -0.560  1.00 0.00 ? 23 ILE B HG22 9  
ATOM 11809 H HG23 . ILE B 1 23 ? 4.079   3.794   1.124   1.00 0.00 ? 23 ILE B HG23 9  
ATOM 11810 H HD11 . ILE B 1 23 ? 2.773   2.362   -2.738  1.00 0.00 ? 23 ILE B HD11 9  
ATOM 11811 H HD12 . ILE B 1 23 ? 4.275   1.940   -3.549  1.00 0.00 ? 23 ILE B HD12 9  
ATOM 11812 H HD13 . ILE B 1 23 ? 4.188   3.394   -2.564  1.00 0.00 ? 23 ILE B HD13 9  
ATOM 11813 N N    . SER B 1 24 ? 7.263   3.423   1.427   1.00 0.00 ? 24 SER B N    9  
ATOM 11814 C CA   . SER B 1 24 ? 7.751   4.209   2.557   1.00 0.00 ? 24 SER B CA   9  
ATOM 11815 C C    . SER B 1 24 ? 8.962   5.051   2.164   1.00 0.00 ? 24 SER B C    9  
ATOM 11816 O O    . SER B 1 24 ? 9.113   6.184   2.618   1.00 0.00 ? 24 SER B O    9  
ATOM 11817 C CB   . SER B 1 24 ? 8.114   3.286   3.721   1.00 0.00 ? 24 SER B CB   9  
ATOM 11818 O OG   . SER B 1 24 ? 8.687   4.016   4.791   1.00 0.00 ? 24 SER B OG   9  
ATOM 11819 H H    . SER B 1 24 ? 7.429   2.451   1.423   1.00 0.00 ? 24 SER B H    9  
ATOM 11820 H HA   . SER B 1 24 ? 6.958   4.873   2.879   1.00 0.00 ? 24 SER B HA   9  
ATOM 11821 H HB2  . SER B 1 24 ? 7.223   2.789   4.075   1.00 0.00 ? 24 SER B HB2  9  
ATOM 11822 H HB3  . SER B 1 24 ? 8.827   2.548   3.383   1.00 0.00 ? 24 SER B HB3  9  
ATOM 11823 H HG   . SER B 1 24 ? 7.992   4.433   5.307   1.00 0.00 ? 24 SER B HG   9  
ATOM 11824 N N    . LEU B 1 25 ? 9.824   4.489   1.322   1.00 0.00 ? 25 LEU B N    9  
ATOM 11825 C CA   . LEU B 1 25 ? 11.023  5.189   0.874   1.00 0.00 ? 25 LEU B CA   9  
ATOM 11826 C C    . LEU B 1 25 ? 10.669  6.422   0.050   1.00 0.00 ? 25 LEU B C    9  
ATOM 11827 O O    . LEU B 1 25 ? 11.275  7.481   0.211   1.00 0.00 ? 25 LEU B O    9  
ATOM 11828 C CB   . LEU B 1 25 ? 11.916  4.253   0.055   1.00 0.00 ? 25 LEU B CB   9  
ATOM 11829 C CG   . LEU B 1 25 ? 12.662  3.190   0.866   1.00 0.00 ? 25 LEU B CG   9  
ATOM 11830 C CD1  . LEU B 1 25 ? 13.316  2.174   -0.059  1.00 0.00 ? 25 LEU B CD1  9  
ATOM 11831 C CD2  . LEU B 1 25 ? 13.704  3.840   1.765   1.00 0.00 ? 25 LEU B CD2  9  
ATOM 11832 H H    . LEU B 1 25 ? 9.658   3.574   0.993   1.00 0.00 ? 25 LEU B H    9  
ATOM 11833 H HA   . LEU B 1 25 ? 11.562  5.518   1.749   1.00 0.00 ? 25 LEU B HA   9  
ATOM 11834 H HB2  . LEU B 1 25 ? 11.288  3.753   -0.672  1.00 0.00 ? 25 LEU B HB2  9  
ATOM 11835 H HB3  . LEU B 1 25 ? 12.651  4.844   -0.483  1.00 0.00 ? 25 LEU B HB3  9  
ATOM 11836 H HG   . LEU B 1 25 ? 11.967  2.669   1.498   1.00 0.00 ? 25 LEU B HG   9  
ATOM 11837 H HD11 . LEU B 1 25 ? 14.037  2.670   -0.695  1.00 0.00 ? 25 LEU B HD11 9  
ATOM 11838 H HD12 . LEU B 1 25 ? 12.560  1.703   -0.672  1.00 0.00 ? 25 LEU B HD12 9  
ATOM 11839 H HD13 . LEU B 1 25 ? 13.817  1.417   0.529   1.00 0.00 ? 25 LEU B HD13 9  
ATOM 11840 H HD21 . LEU B 1 25 ? 13.219  4.493   2.473   1.00 0.00 ? 25 LEU B HD21 9  
ATOM 11841 H HD22 . LEU B 1 25 ? 14.398  4.412   1.166   1.00 0.00 ? 25 LEU B HD22 9  
ATOM 11842 H HD23 . LEU B 1 25 ? 14.246  3.074   2.305   1.00 0.00 ? 25 LEU B HD23 9  
ATOM 11843 N N    . ILE B 1 26 ? 9.685   6.281   -0.834  1.00 0.00 ? 26 ILE B N    9  
ATOM 11844 C CA   . ILE B 1 26 ? 9.254   7.390   -1.680  1.00 0.00 ? 26 ILE B CA   9  
ATOM 11845 C C    . ILE B 1 26 ? 8.752   8.557   -0.837  1.00 0.00 ? 26 ILE B C    9  
ATOM 11846 O O    . ILE B 1 26 ? 9.012   9.719   -1.148  1.00 0.00 ? 26 ILE B O    9  
ATOM 11847 C CB   . ILE B 1 26 ? 8.147   6.950   -2.663  1.00 0.00 ? 26 ILE B CB   9  
ATOM 11848 C CG1  . ILE B 1 26 ? 8.682   5.879   -3.617  1.00 0.00 ? 26 ILE B CG1  9  
ATOM 11849 C CG2  . ILE B 1 26 ? 7.619   8.147   -3.446  1.00 0.00 ? 26 ILE B CG2  9  
ATOM 11850 C CD1  . ILE B 1 26 ? 7.612   5.241   -4.476  1.00 0.00 ? 26 ILE B CD1  9  
ATOM 11851 H H    . ILE B 1 26 ? 9.233   5.409   -0.923  1.00 0.00 ? 26 ILE B H    9  
ATOM 11852 H HA   . ILE B 1 26 ? 10.108  7.726   -2.257  1.00 0.00 ? 26 ILE B HA   9  
ATOM 11853 H HB   . ILE B 1 26 ? 7.330   6.538   -2.088  1.00 0.00 ? 26 ILE B HB   9  
ATOM 11854 H HG12 . ILE B 1 26 ? 9.407   6.327   -4.283  1.00 0.00 ? 26 ILE B HG12 9  
ATOM 11855 H HG13 . ILE B 1 26 ? 9.165   5.099   -3.063  1.00 0.00 ? 26 ILE B HG13 9  
ATOM 11856 H HG21 . ILE B 1 26 ? 7.112   8.829   -2.782  1.00 0.00 ? 26 ILE B HG21 9  
ATOM 11857 H HG22 . ILE B 1 26 ? 6.917   7.819   -4.198  1.00 0.00 ? 26 ILE B HG22 9  
ATOM 11858 H HG23 . ILE B 1 26 ? 8.440   8.660   -3.927  1.00 0.00 ? 26 ILE B HG23 9  
ATOM 11859 H HD11 . ILE B 1 26 ? 6.775   4.942   -3.859  1.00 0.00 ? 26 ILE B HD11 9  
ATOM 11860 H HD12 . ILE B 1 26 ? 8.021   4.371   -4.968  1.00 0.00 ? 26 ILE B HD12 9  
ATOM 11861 H HD13 . ILE B 1 26 ? 7.277   5.947   -5.221  1.00 0.00 ? 26 ILE B HD13 9  
ATOM 11862 N N    . ILE B 1 27 ? 8.030   8.239   0.234   1.00 0.00 ? 27 ILE B N    9  
ATOM 11863 C CA   . ILE B 1 27 ? 7.490   9.260   1.125   1.00 0.00 ? 27 ILE B CA   9  
ATOM 11864 C C    . ILE B 1 27 ? 8.590   9.893   1.975   1.00 0.00 ? 27 ILE B C    9  
ATOM 11865 O O    . ILE B 1 27 ? 8.565   11.094